5DDJ1

Crystal structure of recombinant foot-and-mouth-disease virus o1m-s2093y empty capsid
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
208
structure length
184
Chain Sequence
TTSAGESADPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHTLVGALLRTATYYFADLEVAVKHEGNLTWVPNGAPEAALDNTTNPTAYHKAPLTRLALPYTAPHRVLATVYNGRALPTSFNYGAIKATRVTELLYRMKRAETYCPRPLLAIHPDQARHKQKIVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Foot and mouth disease virus, VP1
publication title Structure-based energetics of protein interfaces guides foot-and-mouth disease virus vaccine design.
pubmed doi rcsb
source organism Foot-and-mouth disease virus - type o
total genus 21
structure length 184
sequence length 208
ec nomenclature
pdb deposition date 2015-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ddj100
1TME2 2R041 5ABJA 1RUH2 2RR11 1BEV1 4QPIA 5GKAC 1TMF2 1PGW2 4FTBA 3HAGA 4N43C 1AR63 1NOVA 1F8VA 4JGYA 1PO12 4GMP0 2RMU2 1QJZA 2R043 1OOPA 1ASJ1 1AR82 1RUH1 2RR13 5JZGA 4N43B 1BEV3 1NCRC 4BCUA 4CDQC 2BBVA 1PGW1 1ZBE1 1W39A 3VDDA 1RUC2 1MEC1 1RUI2 2ZZQA 5AC92 4AEDC 4CDQB 3J8F2 5BNOC 3TN91 5D8AA 1ASJ3 1AR81 1R082 4GMP1 5C8CA 1ND2B 1ZBE3 4Y4YA 4WM8A 2RS52 1QJX2 2PLV1 3ZFFA 1RUF2 1RUC1 1MEC3 1RUI1 4CDWA 3J8F1 1FPN2 3TN93 1AR72 1VBC2 4CEWC 1AR83 4FTEA 1R081 2R072 1VBE3 5A33A 1R092 1ZBA2 4WM7B 2PLV3 1QJX1 3CJIC 2RS12 1RUI3 3J8F3 4FSJA 1FPN1 1AR71 1VBC1 5L7OA 2HWB2 4JGYC 3CJIB 5ABJB 1R091 1ZBA1 4QPIB 2XBO3 4CDUC 2HWD2 3ZXAC 3VBRA 5DDJ2 3VBHC 1C8NA 2RS11 4JGYB 1PIV1 3ZFGA 2HWB1 3VDDC 1AYM3 4CDUB 1R093 1NCRA 1ZBA3 3FBMA 4CDQA 4Z92B 5D8AC 5DDJ1 4Q4X2 3VDDB 4YVWC 2WZR1 1OPOA 5J98B 4CEYC 1PIV3 5BNNA 4AEDA 5BNOA 5D8AB 1ND3A 4GB31 1AR62 4Y5Z0 5DDJ3 5A32A 4Q4X1 1B35C 2WZR3 1EAH1 4N53C 3ZFFB 2WLPA 1BEV2 4CDWB 1VRH1 4CEWA 4GB33 2BFUS 1HRI3 1RUD1 1AR91 5L7OC 4IV1C 1EAH3 3CJIA 1ASJ2 1PO21 1VRH3 1ZBE2 3VBRC 5L7OB 1RVF2 4IV1B 4SBVA 1VBB1 3VBOA 1MEC2 5FMOL 1RUD3 4RHV2 1AR93 3ZFGC 4CDUA 3TN92 3VBRB 3VBHA 5C9AA 1PO23 2GSYA 4CDXA 1VBE2 1AL21 1H8TC 3ZFGB 2PLV2 1RVF1 1VBB3 1NCRB 5BNNC 4RHV1 1FMD1 1HRV2 1H8TB 1ND3C 4YVWA 4JGZA 5ACA2 4CEYA 1VBE1 1AL23 3VBFC 5BNNB 4AEDB 2HWF1 4YVSA 5BNOB 2XBO2 1RVF3 2WS93 3S6PA 1Z7S3 1ND3B 4RHV3 1FMD3 4RR3C 1HRV1 1AUYA 3JD72 3VBFB 2MEV2 1B35A 5A32B 1AYM2 4N53A 5ACA1 3JB4C 2HWF3 4RR3B 2XBO1 1D4M2 4CEWB 1V9U2 2VQ0A 2QQPA 1HRV3 1PIV2 3JD71 2MEV1 4IV1A 2HWE2 1AYM1 5ACA3 1M06G 3VBOC 5LK7B 5CFCA 1VAKA 1NA1A 2FZ1A 1D4M1 5BNPA 1V9U1 3DPRA 2FZ2A 1HXS3 5C9AC 2WZR2 1CJDA 3VBOB 2WFF2 4CDXC 5C4WC 4RS5C 3JD73 1F2NA 2MEV3 1AYN1 2HWE1 4IV3C 1QJU1 1OHFA 4GB32 3VBHB 5C9AB 1HRI2 2R061 4CDXB 2X5IA 1PVC3 4RS5B 1H8TA 2RS31 1D4M3 1V9U3 4IV3B 1HX6A 1EAH2 1E57A 1EV13 4JGZC 2WFF1 1VBD1 1AYN3 2HWE3 4YVSC 1RUE3 1QJU3 1VRH2 4YVWB 1HRI1 2R063 4JGZB 1RMU2 1K5MA 4CEYB 2RS33 3VBFA 5CFDA 1RUD2 1AR92 3VBSA 4YVSB 4LLFA 2WFF3 1NG0A 1VBD3 2Y26A 1PO22 4QPGA 3VBUA 4RR3A 4GH4C 2HWC1 1R1A1 1B35B 1VBB2 4N53B 1RMU1 1QJY2 2RM23 2IZWA 4GH4B 1GFF2 1POV1 1RHI1 1WCDJ 2ZAHA 1IHMA 1BBT3 5CFCC 2XPJA 4RQPC 2BUKA 2HWC3 1AL22 1RUG1 1NA1C 5BNPC 1R1A3 3DPRC 2WS92 2BPA2 1VBA2 1RMU3 5FMOS 1QJY1 1Z7S2 4EJRA 5CFCB 1FMD2 1POV3 1RHI3 1NA1B 1COV3 5BNPB 4RFT0 3DPRB 1SMVA 5K0UC 5C4WA 4RS5A 2X5IC 4PDWA 1RUG3 2HWF2 4IV3A 2WS91 1VBA1 1QJY3 1MQTC 1Z7S1 1FOD1 3NAPC 4Q4Y1 5K0UB 3IDEA 2X5IB 4Q4V2 1PGL2 1TME1 1MQTB 1K5MC 3NAPB 1VB4A 5CFDC 3VBSC 1VBA3 1CD3G 1QQP2 1TMF1 1FOD3 1HXS2 4Q4Y3 1NCQC 4QPGC 3VBUC 1PO11 1K5MB 1RUJ2 4Q4V1 5CFDB 1ND2C 4Q4W2 4NWVA 2RMU1 3VBSB 3M8LA 1PGL1 1TME3 4FTSA 3ZFEA 1RUH3 4NWWA 1NCQB 4QPGB 4GH4A 3VBUB 1PVC2 1QQP1 1TMF3 1HXS1 1EV12 5J96B 1PO13 4Q4V3 1RUJ1 4Q4W1 1AYN2 2RMU3 5AC91 4WM7C 1RUE2 1QJU2 1C8M2 2R062 4RQPA 1PVC1 2RS32 4GMP3 1QQP3 1HQNA 2RS51 1EV11 1RUC3 1RUF1 1VBD2 1RUJ3 4PDWC 5ABJC 1AL0G 4Q4W3 5AC93 3LOBA 4QPIC 1RUE1 1C8M1 5K0UA 1R083 5C4WB 2R071 4PDWB 1BMV2 2RM22 2RS53 1QJX3 1MQTA 1RUF3 1OOPC 3NAPA 1BBT2 4N43A 5JZGC 1POV0 2HWC2 2GH8A 1FPN3 2ZTNA 1AR73 1VBC3 1C8M3 1R1A2 5FOJB 3JBG2 2R073 1OOPB 1VB2A 1BMV1 2RM21 5JZGB 1NY72 1RHI2 1X33A 1COV2 2HWD1 3ZFEC 1BBT1 1NCQA 2RS13 1RUG2 1ND2A 5C8CC 2TBVA 2HWB3 4WM8C 3ZFEB 3JBG1 3ZFFC 3JB8A 1NY71 4CDWC 1COV1 2DF7A 2HWD3 5C8CB 1A6CA 4WM8B 2R042 1X36A 2RR12 4WM7A 1RB8G 2WWSA 3JBG3 1FOD2 4Q4Y2 1AR61 4RQPB 2BFUL 1DDLA 5A33B 4Q4X3
chains in the Genus database with same CATH superfamily
2WAOA 3WDWA 1GU3A 2BOJA 3HBZA 1UYYA 2PQQA 4LKFA 5ABJA 5KHJA 1BEV1 1Y4WA 3ZYPA 1SCRA 2YC4A 1WMXA 4QB6A 5CZKA 2VVDA 3Q8AA 4BXSV 3AYCA 4AZZA 4K7JA 4BMEA 2CGOA 2IC1A 2R0FA 2BGOA 4FVVA 4UT5A 4XJZA 1AR63 2WSUA 4XCAA 2OZJA 4JGYA 1H4HA 2YROA 4GMP0 2XKPA 3IDBB 3DGTA 4EN9B 3ZXKA 2ZGSA 1U5XA 1I5PA 1X8EA 4A3ZA 4AR2A 5FOBB 1G8WA 2R043 1JUHA 1OOPA 2X10A 1VRBA 2XHNA 1N1TA 3MV11 1VPHA 2RR13 1AX1A 3KHBA 3KLSA 5H9PA 4A7ZA 1UPSA 5IVCA 5FWEA 4CDQC 3C7HA 5LA0A 5EJ1B 2BWCA 2ADDA 1ZBE1 4Z8BA 1IS5A 2W2IA 3VDDA 2HEYF 4QB1A 1BK1A 3U0ZA 1JBCA 4GJZA 2VOTA 2VGDA 4BXFA 4E4ZA 2D98A 2YUEA 3E6DA 5AC92 4AEDC 1GQPA 2UYBA 3TN91 2XWJB 5KXDA 3OGVA 4BZ4A 5A7OA 4CA9A 5FP9A 3BTZA 1XE8A 1YQ5A 3LKJA 1ND2B 1HN1A 4Y4YA 1LGBA 4A7YA 4EROA 1QJX2 2PLV1 2GALA 1XYNA 2VZVA 3ZFFA 3HIFA 4AEKA 4LHSA 4MO3M 2ZEYA 2VC9A 5DUXA 2LM3A 4EQVA 3T0AA 1WUVA 3A22A 5C71A 2QQMA 4FOVA 5F5AA 4OI2A 1W9WA 1AR83 3JCIA 2J1AA 1UY1A 3ENRA 2PHFA 1JZ4A 1YFYA 1PK6B 1PMHX 4Y20A 1G7YA 4YW6A 4GWNA 1SFPA 4YW7A 2VD7A 3PNAA 1JHNA 4HN1A 1ZRDA 3MYXA 3CZUA 1UX6A 4TSVA 2BU9A 4R52A 1CPNA 1H1IA 1RL3A 5KHHA 2MNGA 3LEGA 4P9YA 1K3IA 4FSJA 4R9AA 3KCXA 1AX0A 3H0OA 3DECA 2Y8KA 3BCWA 3ES4A 3U4XA 3CHXA 4AE2A 3FMGA 2WUHA 4JGYC 3S30A 3ACLA 3BODA 4XQDA 1JHJA 2DWRA 4CCJA 1JMUB 1R091 4OUEA 4BIFA 1QOTA 5F5IA 3POGA 5GZEA 1XNDA 4N90A 3ZXAC 2GMMA 3AP4A 2ZGLA 2VO5A 5EIYB 4HPKB 1OF4A 4MVTA 4QX3A 5FZBA 2FCTA 1PIV1 2D6MA 1CZTA 4LE3A 5FRAA 3WW1A 2W68A 1YRZA 3VDDC 1AYM3 3W9AA 3AL5A 4S2FA 3WT3A 5IFTA 2QDRA 3OGRA 3GBFA 2B45X 4K3UA 3CBNA 4BK5A 1ZBA3 1CPMA 1JXNA 1UOJA 2A3WA 2A6VA 3H1MA 3QD6A 5FYZA 4AVSA 3J7LA 5FO9B 3LAGA 1QDOA 4S2DA 1S55A 2JG9B 5D8AC 1ST8A 3POSA 5DDJ1 5FKCA 4Q4X2 4AAPA 4E2SA 2ZX4A 4CP2A 4RFRB 2O1QA 1PZ7A 5BNOA 1YNAA 1YLLA 1OXCA 2D6OX 3A7QA 1SG3A 3AKRA 3OEAA 1XE0A 4FP2A 4LIVA 4MHRA 5LY2A 4GB31 3MBWA 4O9GA 2FMYA 1OD3A 3OYWB 3J9SA 3R4SA 4Y5TA 3I3BA 4Y5Z0 5DAVA 4YZ1A 4BQYA 3LDRA 5LW9A 1LOCA 4TXWA 5A32A 3VHPA 3L9JT 2BVVA 2WZR3 2QQVA 3WXPA 4F8AA 4C0BA 2DVBA 5E16A 3FFQA 3T2OA 3UESA 4LBQD 2XDVA 1CAVA 2BJSA 4UYBA 2PN5A 3AMQA 2WNUB 4D3WA 3AVSA 4I01A 4ZU4A 5I0TA 2IXKA 5FIXA 4IESA 1EP0A 5FYSA 1D7PM 3BKZA 1W8UA 2ZX2A 1G9FA 2DCJA 2FBEA 1WCUA 1TEIA 2BERA 2Y6GA 5FCCA 3B9CA 1UIJA 3RG0A 2DVAA 2WN3A 2P2KA 3C7OA 1OUSA 2A5ZA 2F4LA 3GZUC 3IMNA 4I3GA 4AYUA 2A6YA 2WRAA 1PHMA 1VRH3 1W9TA 4Y22B 4NN0A 1O8SA 2DDUA 2DVDA 4Q29A 2JB4A 1RVF2 1W9YA 4IV1B 3ZYIB 4B4QA 3LQCA 2E51A 1XU1A 3FJSA 1MEC2 5IAXA 1W8WA 1WLWA 5FZ7A 5LEKA 1RUD3 4PLMA 3HNMA 3D0SA 3POJA 5IWFA 2EAAA 3VBRB 1S2BA 4M00A 2JX9A 2GSYA 4CDXA 2JICA 3PMSA 2GC2A 4Z07A 4N7IA 4JDNA 2ZX1A 1QGLA 1V6IA 5GJ6A 3U11A 2JDPA 2ZHKA 3JQXA 3ZFGB 1ULCA 1VBB3 2FDFA 1ZRCA 1EUTA 1S0GA 3RSJA 4FFFA 5DMYA 1GZTA 3SKJE 4PLOA 1D0HA 3ZDVA 1J59A 4YGEA 1HRV2 5IVBA 1W90A 1D0GA 1QDCA 3KHCA 3M4FA 1GWLA 4Q8LA 5SV8A 1Y43B 2ENRA 5ACA2 5CA6A 3QH6A 5FR3A 5JXJA 5E1RA 5ISLA 2Y6HA 1AL23 5E6HA 5BNNB 4AEDB 1NAEA 1BJQA 2D7FA 4YVSA 2XBO2 3AFKA 5JMOA 3O0XA 3SCHA 1Z7S3 2AREA 1ND3B 1E5RA 4XAAA 5L9BA 5EYXA 3S0MA 4CP0A 4RHV3 3TEYA 5FXWA 5FXZA 1FMD3 1J1LA 1AUYA 1P8JA 2XG3A 2ZMKA 3JD72 3D8CA 4KWLA 1XYPA 4P02B 3VBFB 2G9ZA 2NMNA 3MW2A 5JR7B 3OG2A 3WNOA 2XVGA 4N53A 5IVFA 4LUKA 5FUNA 2XLFA 2HJIA 1JZ6A 2BW8A 3UGHA 3JB4C 2EVXA 3K4DA 4AI2A 1WWYA 3MZHA 2ARCA 4XHXA 3ZR5A 1J84A 5FP3A 2VQ0A 5CYYA 2R0HA 3SC7X 1VLNA 3TNPB 4B4RA 2CDOA 2VW0A 1MZEA 4XJAA 1AYM1 5FYBA 4META 1HJGA 3C8XA 3B93A 4XIKA 4ZONA 2WFPA 3UKVA 1MS1A 4XFGA 2UYAA 2NZ9A 1VAKA 3PU8A 1NA1A 5FY5A 3N9MA 2GNDA 2AYHA 1HXS3 1V6JA 1V6KA 3ACHA 1CAUB 4BWOA 4CDXC 5C4WC 1ENQA 4RS5C 1ALYA 4BQXA 1JYTA 1AXYA 3FFZA 2VOWA 1E5IA 4JX0A 4NHMA 3KF3A 1YJKA 4CUGA 4C91A 1VAMA 5B4NA 4Q0UA 4ZS3A 5C3QA 4QGMA 5FLHA 1GKBA 4HG6B 5C9AB 4GULA 3H50A 3ZSEA 4BQ4A 3FHIB 4WZFA 1QH6A 4Y1VA 1PVC3 2A75A 3PVEA 4PIYA 2CGNA 5HXVA 2HLEA 1V9U3 2W91A 1UZVA 5JXHA 2XQRA 4P5YA 1WW6A 3CZJA 3VB9A 3BIWE 5FUIA 4MYEA 5FY8A 5EP9A 3RFRA 3APBA 1PMIA 3WG3A 5J48A 3LEKA 1UYXA 3DKQA 3GJBA 5LBBA 1AYN3 4YM3A 4AAXA 2HWE3 4QQLA 1QXJA 1R1ZA 3LZZA 4YVSC 2VM9A 2XJRA 3HQXA 4YSFA 4PF5A 5L19A 5DPNA 1CX4A 1K5MA 1URXA 4UFHA 4XFCA 5CFDA 3VBSA 2D44A 5LRSA 4P14A 1YUDA 3UKTA 1Q8OA 2D3SA 2WAAA 1L7QA 1YFXA 2VZTA 2D93A 3DV8A 5FPVA 2ZA9A 2BGPA 5E8AA 4HSJA 4UFMA 2JE9A 1J3RA 3ZXEA 4GAZA 2GN7A 4K1YA 2WYSA 2YBKA 4UFLA 4AVCA 3THPA 1NX9A 5FZHA 4Q0PA 5FMCA 4NAMA 2E7AA 2Z69A 3ELNA 1Q8QA 4FPCA 2R49A 1RINA 4EE2A 3B02A 2X09A 4A45A 4CU9A 4FFIA 1FV2A 3N7KA 1OA4A 1XB9A 2HKXA 1ZZ9A 2BUKA 1NQDA 3WW2A 2BZDA 1RUG1 1NA1C 3B69A 3MIGA 4LITA 3P3NA 4WVZA 2FDKA 2WS92 1RMU3 5A7QA 5FMOS 1OKOA 2VCCA 3MIFA 5ANNA 4EJRA 3HT2A 1UZZA 2VNVA 2WLQA 1RHI3 4IGPA 4L2NA 4RFT0 1RJ7A 4LO6B 4M0NA 3WG2A 5K0UC 3B01A 1CZVA 3ILFA 4QHBA 5JI9A 3OPWA 2W0XA 1VR3A 3IKWA 5HCAA 4TZDA 4IV3A 2JG8B 2VL4A 2XGXA 1VBA1 3NNJA 4CP1A 2AENA 1QJY3 2OZ6A 1Z7S1 3VV1A 3NAPC 1Y9GA 3TNQA 3VZLA 1YCIA 5H9QA 2X5IB 3T08A 4DRVA 1IQAA 1RITA 4XUQA 4MGTA 4NIHA 3K46A 2EXJA 1BCXA 4GZ9A 4Y26A 4MLOA 3UV9A 1LEDA 5FBZA 1DGWX 2RV9A 1K5MC 3LPGA 5CFDC 3TEZA 3BOWA 1XYOA 3VBSC 2ZJCA 2XVLA 3GDBA 1SFNA 2DUOA 2PTMA 2VBBA 1QQP2 4J6GA 4OMCA 3DF0A 4Q4Y3 3H7JA 3NNGA 4KWKA 4FPKA 4NJ4A 2ZACA 3N3HA 2CL2A 3M3OA 4NOTA 4W6WA 3OD4A 3J26N 3VLBB 2DV9A 4AI1A 3HR9A 1ZRIA 1TME3 3D82A 3RWKX 3ZFEA 1PGL1 3E6BA 4DEQA 1HDKA 3K51A 2DVFA 1RUH3 1XSQA 1LESA 2P3JA 3WP4A 3OEBA 4QPGB 4GH4A 3WF1A 3WW4A 3ZKYA 1W8HA 4R9CA 5JDBA 3RGBA 3CMGA 1TMF3 1YXWA 3UL2A 1Q56A 2BP6A 1HXS1 1JU3A 1AXKA 1EV12 2HBTA 1PO13 4ZS2A 5J96B 1MVQA 1RUJ1 2HYXA 5F6KA 1WLTA 1LCLA 4ARXA 1SHWB 5FY4A 1C1LA 5IK8A 5AC91 4MGZE 1QJU2 5I8TA 3N7JA 4XF1A 3RDIA 1L7RA 2K2SA 4E4SA 2GC3A 2R062 2Y6LA 1PVC1 3N4MA 2ET1A 4GMP3 4PLNA 1NE6A 2WNVC 5A3NA 1HQNA 5EHDA 2HYKA 2XR4A 5I93A 4LORA 4UFJA 3GM8A 1GBGA 3NKGA 5KWRA 3URFA 1DZRA 4ZU7A 3AYDA 2OX0A 1LHWA 2XB6C 4QPIC 5EV7A 1DYOA 4KU8A 3E1F1 4DEVA 3LOBA 1H30A 2BOIA 3TYJA 1SEFA 2NYYA 4XAEA 1N1YA 1NKGA 4P5HA 3TRSB 1R083 2D6NA 5C4WB 4KQ7A 1WGPA 5CADA 2VTFA 2ORZA 3ZLIA 1CX1A 3H8XA 1SDWA 3QLQA 3DXUA 3K3NA 4CCNA 4WZCA 5F3EA 2RJ2A 1MQTA 1VMHA 1JTZX 3VN4A 1RC6A 1OLME 5GZGA 3VD4A 4LBMA 4JRAA 1AZDA 5IUQA 2O8QA 5LEJA 5FZCA 2HBUA 2WNOA 2R32A 2ZTNA 3LPFA 2Y38A 1C8M3 4B29A 2V4VA 1R1A2 3M2MA 4IGQA 3JBG2 1O3QA 3QCWA 1O3SA 1LAJA 2ERFA 4QMAA 5DUVA 4WVMA 2VQTA 4XUOA 3QOPA 2YBPA 4R9DA 4LNVA 4TLFA 5FMDA 1COV2 1RTVA 3W20A 3ZFEC 4P08A 5C70A 4BLIA 2RS13 3INAA 3WD5A 3FHAA 5DQ0A 5FY7A 1ND2A 4PT6A 3T4HB 1QMJA 1NT0A 2WSVA 1G86A 2DUPA 1CGPA 1LJ7A 2QQIA 4PBPA 4OHYA 2WDBA 2XL9A 5KXCA 2RE9A 1WLCA 3GZAA 3GF6A 2W1QA 4K8RB 5JSPA 3GXUA 4Q0QA 2FCVA 1B09A 5FZDA 1A6CA 4DXRA 3MIDA 4XQ4A 3FLTA 2R042 1X36A 1JOBA 4LLOA 4B8EA 3IDCB 1OQDA 4WVWA 2RR12 4BM8A 5TSWA 5C33A 2ZGNA 5FZEA 2XHKA 2NN8A 1IGOA 1KD7A 4KI5M 4W6XA 2C26A 2PHTA 4ZHNA 1FOD2 1NXD1 1UPIA 1UX7A 2DYCA 4K6BA 4BLJA 4HFSA 2VVEA 5F1RA 3RMXA 1OH3A 5FPUA 3GBWA 5FO7B 1H4GA 2BGCA 1LKNA 4FBFA 5A33B 4Q27A 3OF1A 1V70A 3N9PA 1U5YA 1DQ1A 2RDSA 3OBZA 2K0GA 1YQ2A 2VVFA 2LROA 5J3UA 2EXHA 5DG2A 5JOZA 1ZVFA 1S2KA 1U5IA 3AZVA 2C9AA 3NQHA 4R8HA 3T2QA 4AOCA 4JKMA 4CZSA 1C3HA 1X9PA 3AVRA 3IAPA 2ARXA 4Y1YA 4UFIA 5A80A 1HV0A 2CDPA 2OVUA 1K5JA 4YW1A 2WO7A 2ZAAA 5FYVA 5FYMA 2N7GA 3LA7A 2MPFA 3NRUA 3M70A 1XE7A 1AR82 1RUH1 3ZSMA 5JZGA 4N43B 5KBFA 2VMDA 1BEV3 2DCZA 1NCRC 2ZX0A 4OVEA 1SACA 4BQ1A 3H1WA 2VZPA 3HVDA 1ZRFA 1PGW1 4X8PA 5BXXA 4FFGA 4NIAA 3KQ4B 5CBLA 2VUCA 3D3AA 1CONA 4NPRA 1RUC2 1FAYA 3FHQA 1MEC1 2YBSA 3OB8A 4GWJA 2L9LA 2PAKA 4ISRA 3OPTA 4PIXA 5IVVA 1GQHA 1WMEA 1XOYA 4OHXA 2GNTA 4L11A 4OUMA 5LB6A 3TEWA 5F3GA 3IIAA 3VDBA 2KA3A 3P3PA 3MUZ1 4UW3A 4YZ5A 4YG6A 3LIHA 1SLTA 3OYWA 2WZPP 4BE3A 2VZQA 1A3KA 4GMP1 5C8CA 1ZBE3 2CU5A 2OIIA 4WM8A 2RS52 1LOFA 5ANQA 1PK6C 1RUF2 3GALA 2BQPA 2IXHA 2VJXA 3BGAA 1WBFA 2P37A 1RUI1 4IGOA 1DP0A 1YJLA 4AVTA 3J8F1 1FPN2 3TN93 1AR72 1VBC2 2E7QA 3KV6A 4CEWC 2DCTA 3IT8A 5LZ6A 3I7DA 1R081 3NL1A 4IEPA 4EN7B 2Z79A 1ZBA2 4MUVA 5HI0A 3U14A 2PLV3 2YDEA 2OT7A 1G9AA 2WN2A 3RZJA 1GWKA 3ST7A 4IEYA 1VP6A 5FP4A 2Q8DA 1SBEA 4Q1PA 4XVHA 4Y22A 1UWWA 5HBAA 2HWB2 1LHVA 2ZHLA 1UD1A 4H7LA 3CJIB 2D6LX 2XJPA 4JKKA 4HBNA 4CUAA 4QPIB 3UJOA 5EQUA 2A70A 4I0WB 4QAWA 1BZWA 4QHZA 1A78A 3VBRA 1J3QA 2NMOA 3F95A 2QQUA 2ZKNA 2RS11 1WD4A 2UY8A 4EYUA 5DN2A 4ES9A 1CQ9A 1J58A 1KGYA 1SBFA 2JG9C 2ZMLA 5CVRA 3SEPA 3USSA 3ZFGA 1JYXA 4CDUB 1YYNA 3AP7A 2A3YA 1MZ6A 5F8PA 4E8CA 1F5JA 3T2PA 3SITA 2ARBA 1R093 3BPZA 2ZGTA 3FBMA 3GGLA 4W8JA 4CDQA 1Y9MA 5A3TA 4Z92B 1W6PA 1SLLA 3AK0A 1XSRA 2W87A 2B39A 2OKXA 3T0BA 2B7YA 3A21A 3ZYGA 2E9QA 4KMQA 1YI9A 1PIV3 4CEYC 1UY0A 2DVGA 2GDFA 3R05A 4AEDA 3OY8B 4G3YC 3LB9A 4IEZA 4M3CE 3VD3A 5BNNA 4IUGA 5K9YA 3WDUA 4DPNA 1O6UA 2Y60A 3BALA 1ND3A 4IXLA 5D8AB 1BXHA 4AWDA 4DQAA 3MPPG 3MICA 1G9CA 1FNYA 4QT6A 2WNUC 2WIIB 1XU2A 4M0HA 5DDJ3 4RGKA 2J1UA 3SLIA 1VALA 1US3A 2DCKA 3WDXA 5JIAA 5KR7A 2VAUA 2FDGA 5JI7A 4I0BA 4INDA 3T4VA 4XBQA 5FPLA 3D6EA 1KJRA 4GB33 1GOHA 1S0BA 2QQKA 2WZEA 4YM1A 2YFUA 4LHKA 4BOWA 1DGRN 1WKYA 1UW8A 2EIGA 3VZJA 5J7MA 2VZRA 4JHTA 2QBXA 2W92A 1SPPA 4LBJA 4AEJA 4IV1C 1BYHA 1MPXA 1ASJ2 1S0CA 4AHZA 3T0DA 5FYIA 3PJYA 1H2LA 1BQPA 2JDZA 4Z1VA 3OUIA 4AFAA 2KM2A 4S2GA 3VBRC 3AYEA 3WHUA 1CAUA 4SBVA 4XJ8A 3VHOA 2LS6A 3D0JA 5GZCA 5IVYA 5HCBA 4RHV2 3ZFGC 2ZABA 1UU6A 3QH7A 5FYYA 2WYFA 5IATA 3LGRA 1HN0A 5C9AA 3BTAA 3I2FA 4L9BA 1DZQA 1VBE2 4QPWA 4AQTA 3MLJA 1H2KA 3AZYA 4LPLA 2XXZA 2EIDA 5GZFA 4EN8B 4AHWA 2JDUA 3NV3A 5EJZB 2AGSA 3CO2A 1J3PA 3EO6A 1CIWA 1VAVA 4XCBA 1NCRB 3CLPA 5F2WA 3E5XA 5BNNC 5CG8A 4P00B 2JIJA 2BEOA 1BK0A 1H8TB 2TUNA 2ETEA 2QE3A 2Y6FA 2YGMA 4QPYA 1ND3C 5A7NA 5DXDA 2ATFA 5BY5A 2RVAA 4LR4A 3VBFC 1CN1A 1DYPA 1F5FA 3K4ZA 1CR7A 2YYOA 3ZMNA 1ULDA 5HV4A 2OYZA 2V5DA 4AQSA 4Y1ZA 1OC1A 3SMHA 2WWUA 2DURA 2XH6A 4UF0B 2R6QA 1H2NA 3H3LA 3I59B 4FOWA 3B5LB 4ZPIA 3WQBA 4ZZ8A 1J83A 2XJTA 4RR3B 3AC0A 1US2A 1O5LA 4C0HA 1V9U2 4CEWB 4XOGA 3CKHA 3G7DA 4HN0A 4L8QA 3POFA 1QNYA 1XNTA 2MEV1 5FK7A 2HWE2 4QDQA 4Y33A 2WO2A 5DAWA 3HN3A 2JENA 1QHDA 5FZ1A 1DLCA 4LOTA 3K2OA 5BYNA 2QQWA 2FZ1A 1D4M1 1UL9A 5C9AC 1CWPA 1C1FA 5JMCA 1XJAA 1XBFA 2ZOEB 5FXXA 1VJ2A 4KWJA 4FP3A 1HW5A 4NHLA 3UGFA 3IN9A 4EN0A 1FI2A 1T2XA 2CSGA 3RYRA 2B9UA 1QJU1 1DQ0A 4N9IA 1KEXA 4DOUA 4Q5OA 1DG6A 5DZFA 1LULA 2W3JA 1HRI2 3U75A 2R061 2VOVA 2X5IA 5A3OA 5GM0A 3KV9A 4W6YA 4XFHA 4XMAA 1XC6A 3MIEA 2C6SA 2K9ZA 1HX6A 1EAH2 2WFF1 3Q9OA 2A6XA 2BDRA 3NVCA 4AHXA 3O1UA 4I3PA 3B3QE 2IXIA 4QXBA 4K8FA 4Y5SA 2ZGUA 4Z2WA 3W21A 3VDCA 4JZRA 3LOIA 1LNSA 4QXHA 1RMU2 4CEYB 2X8KA 1AR92 5LCWL 2JE7A 1UMHA 4D6QA 1W6QB 3LDKA 3HWJA 1E5SA 3M7AA 4D69A 2Y26A 5HXMA 4KG8A 1PO22 4B3NA 4QPGA 3DYMA 3GBGA 5FP7A 5IVEA 1Q8VA 4LHNA 4AGGA 2IUWA 5I8YA 1F31A 1R1A1 5FZOB 5ERLA 3RVHA 1QJY2 3H8UA 3LE0A 3OD0A 5JLVA 1DGLA 4B4PA 1POV1 4H14A 4TN7A 5DG1A 5BNQA 4NHXA 2ZAHA 5FZMA 2DBIA 3ZXDA 1KJLA 1BBT3 2Q1FA 2A7AA 2E32A 2BNMA 2XPJA 3ZYBA 1PZ9A 4CE8A 3AXEA 5EWSA 3SH4A 3RZZA 4JHZA 3O1TA 4PHZA 1LOBA 4RL7A 3OSDA 3QBQA 3DCQA 1UOGA 4JTNA 1GP5A 5CFCB 1ZA4A 1REDA 1W9FA 2JG8C 3PUHA 1UAIA 5FY1A 1ODMA 2GU9A 2JD9A 4XW3A 3DPRB 4CCOA 1POQA 1UF2C 1SMVA 1MZ5A 5C4WA 4RS5A 2X5IC 3ON7A 1H9PA 4NRQA 4IETA 4A44A 1RUG3 2PHRA 3M1HA 3WCSA 3RZGA 1WCKA 4XUPA 2HWF2 3UETA 3ZSLA 3OBTA 1ZZCA 1W8OA 3AM2A 1HV1A 2G19A 1DQ2A 2YGLA 1L7LA 1FOD1 3JZVA 1QOSA 4X8NA 3RRDA 4OI0A 4FPGA 2OW4A 4AFCA 3AMPA 1S0EA 1STMA 3KSCA 3L2YA 4CCKA 1GP6A 1SZBA 4ASMB 1JOJA 3A0KA 5A3LA 1FATA 5FBJA 3GCWA 2HEWF 2W46A 3MUY1 1VB4A 2GN3A 3I2OA 3HMYA 5I91A 1XNKA 1QU0A 2OXBA 4BDVB 1VBA3 1CD3G 3O1RA 4ATFA 3SKVA 1V00A 2PFWA 5APAA 3IZOA 5FZ6A 4QPGC 2E53A 3Q8FA 2CGPA 4MGQA 5GLWA 5L36A 4PI2A 4Q4V1 5FWJA 3UGGA 4LO5B 1TVGA 4A6OA 4MGSA 5KHGA 4ATEA 3TOJA 3ABZA 2GZWA 3H8RA 3LD8A 1QJFA 2XL7A 1JZ3A 1NCQB 5JOWA 2FDJA 1YIFA 5FKBA 1SBDA 2JEMA 2ORXA 2JE8A 3LEIA 2QKDA 2QZ3A 2J1TA 5FDBA 4OHVA 2B42B 3EHKA 1GP4A 3RS6A 4XMIA 2D5FA 4Q4W1 5IJRA 3VKFC 1ENSA 4NR1A 2YU1A 1RUE2 5F32A 3K4AA 2OQ7A 4WBBA 1C8M2 2JIGA 2RHPA 2W1UA 5T55A 4K20A 3FL7A 5A7WA 4OLLA 2JD4A 2P17A 1JYWA 5IFPA 5LBFA 2D6PA 2NQYA 2RS32 1UKGA 3PUQA 1W6MA 1X8MA 3IIIA 1E5HA 2AEZA 5AFEA 3WEZA 3O12A 5CIRA 2RS51 1AF9A 3MHZA 4AFMA 2JDNA 1MVEA 1RUF1 1VBD2 1RUJ3 4IDZA 4GKYA 4DO0A 4ZKTB 3T3YA 1HQLA 3IB3A 5AC93 5EPAA 3WNNA 5T5OA 1PX3A 3ASIA 2R7EB 4MHUA 3AX4A 5K0UA 4HSLA 1IPSA 2G1MA 3W5MA 4TTGA 1W0NA 2VUAA 4PDWB 1RYYA 1UY3A 2RM22 5HPOA 5FK8A 1JN2P 3C7GA 1OLQA 5C3RA 4XE9A 4QHOA 1N1SA 5JXIA 1QJX3 3ETPA 2BV4A 1W6NB 3NAPA 1W9SA 4N43A 3UT0A 1POV0 2Q30A 3FN9A 2HWC2 1O91A 4LMFA 4KNCA 4XIOA 2VCMA 3ROUA 2E31A 2VCAA 5B4XA 2AH2A 4HONA 1OOPB 3DYOA 4ZXEA 2Y34A 4A4AA 3VDAA 1BMV1 1UN1A 4GKXA 1RGSA 4QGNA 4XXAA 1NY72 2VNOA 2ZZJA 2C0ZA 1JODA 4DMIA 1FYUA 4UW4A 3ZYRA 2A3XA 1LRHA 1BBT1 3P1IA 1U12A 4XJUA 1IG3A 2WA3A 2ZEWA 4URAA 1F4HA 4QX5A 5LK5A 4NVPA 3AMMA 5DZGA 1Z0HA 4JCKA 4IE5A 4LBQA 4UXAA 3CL1A 1Y9QA 2GNMA 3OPZA 2GNBA 1W8FA 5KXBA 1O3TA 4I2OA 4YWAA 2ILMA 4W4ZA 1QNWA 2MHFA 4FCAA 5FPZA 5L73A 1FXZA 4CDWC 4MG2A 2IXCA 2VZ3A 3GHNA 3I2IA 2C4XA 4H7MA 4CSWA 2LUWA 2DUQA 2AZ5A 1BVP1 4XDPA 2FD8A 3H42B 3IAQA 4IL7A 1G9DA 1UKRA 1YEWA 4FOQA 1RB8G 2OUHA 1AJOA 3G6JB 5FLJA 4DUWA 2VZSA 4HKOA 5FJHA 4FQ4A 3ZO0B 4F3JA 4ORFA 2VG9A 1YI7A 2BFUL 4J1XA 5JXGA 4Y20B 2F6BA 2WNVA 3PURA 4BB3A 2ZGMA 4Q4X3 1BLZA 4PQ9A 4UW5A 2DBNA 4OZXA 4Y24A 2JDYA 2RG4A 1V0AA 3ZYJB 3PL0A 4AEMA 4IQPA 5A70A 1W8TA 4QPIA 4B7EA 1QJEA 1D4VB 2E33A 2F4PA 2UWAA 3JU9A 4FTBA 3K3OA 3Q8CA 2UURA 1ZM1A 1NOVA 1XQNA 1F4AA 1ONAA 2QJVA 4N43C 1APNA 2W08A 4DXSA 5AFBA 1SQ4A 3D5OA 2D97A 4P9IA 3IWZA 5T54A 5JCTA 2RMU2 3NV2A 3HNYM 4EN6B 5JOXA 1QJZA 2ZBJA 1ASJ1 2IVIB 3KGZA 2R1BA 3KVBA 2CHHA 2IXJA 3ITQA 4COZA 1W99A 3ZN5A 4HL0A 4BCUA 1REEA 2ID4A 3O7OA 1G6NA 3CDZB 1O4YA 3V0BA 5GALA 1W03A 1WW5A 3ES1A 4JDMA 3OY8A 2ZZQA 3ZXGA 1ACCA 4YM2A 5C3SA 1SLBA 5D8AA 4YARA 2ARAA 3H7YA 2UWCA 3VZMA 4MADA 3S7EA 5FPAA 5LY1A 3TAYA 2Y6KA 3SHRA 5LWBA 3VKNA 1XNCA 4Y4RA 1HB4A 2JKXA 4IEWA 5KC6A 1MEC3 3FBYA 1VMJA 4GQ7A 3RPQA 2AEYA 4HVRA 1X82A 2NPIA 4QQPA 1IS3A 1KDKA 5JPMB 5K8SA 2J42A 1C4RA 1W2UA 2Y33A 3ZR6A 4QX2A 2R072 1UXXX 1O59A 1R092 4FXGB 4ONUA 1CAVB 2YC2A 1QJX1 5FFOC 2IWGB 2SLIA 3C7FA 2P5BA 3CJIC 4BH9A 4BA6A 4IE6A 2RDNA 3P5BA 1RUI3 1XNBA 2Q4SA 4IEVA 5FZ4A 3WNKA 4CU6A 3J8F3 4LK7A 4XJWA 2O8OA 1CJPA 5SV5A 4LXLA 4BYYA 5F3CA 4B1MA 1TQ5A 5FZLA 3DN7A 3PVOA 5AVAA 4CCMA 4AI9A 3IMMA 4M3CB 1JZ8A 2XBO3 4QQHA 4CDUC 2QQNA 5H9SA 5F5CA 2HWD2 3BU0A 5FLIA 1WMDA 2BNOA 4QM8A 5DDJ2 3VBHC 2WWJA 3TB0A 3FLPA 4CXYA 3RJRA 3M3CA 5FZFA 2XQXA 3RYKA 1R64A 1REFA 3MFCA 2PYTA 4LQRA 4QKNA 4B1LA 2P3KA 3VKLA 2VOXA 2ADEA 1LGCA 2J7MA 3O0WA 1K42A 3VD9A 3KS7A 1NCRA 3WINE 2ZEZA 3M3EA 3AZXA 3F2ZA 1Q8SA 1UMIA 1QIQA 3ECQA 2WNEA 5D21A 1OVPA 1UOBA 3DL3A 4FXKB 2AUYA 2ES3A 4YVWC 3WUDA 1OPOA 4J25A 4PQQA 2CAUA 2G9FA 3ZX7A 1PM7A 2VU9A 4XEZA 5BUVA 3USUB 4K1ZA 5FY0A 4NPLA 1JYVA 2PHLA 3ZN4A 1AR62 3AKPA 1N1VA 4XJ9A 1GICA 2GP5A 3ZIXA 3ME2A 4EWDA 4CCDA 3OUHA 4Q4X1 4DXTA 1B35C 1PK6A 4IEOA 1EAH1 3I59A 1OPMA 1DLLA 1MS4A 3O1MA 3CQOA 5E89A 5IHRA 2KR2A 2P3IA 1UNBA 3LCPA 4I02A 4CDWB 2UY9A 4CEWA 3AXDA 3WZ1A 3LSEA 4NE9A 4D7TA 2DTYA 4V2WA 3NJXA 4BQ2A 1AR91 1IPKA 4LE4A 4HVOA 4V1PA 4XACA 4XTMA 5FZ9A 2GC1A 4CP9B 2DFBA 2D43A 2FCUA 3VL9A 3OGGA 4BU2A 3WQ7A 1YC61 2H6BA 1PO21 4O7XA 1ZRRA 1AHSA 2B5HA 2WQZC 4Q0VA 3SCGA 3NV1A 1OF3A 1EY2A 4XURA 1I5ZA 2BRTA 1GWMA 5L7OB 1OQ1A 2Z5WA 4FPFA 4HPKA 5DABA 2Q8CA 3VKMA 4PF1A 2P3YA 5L9RA 1CAWB 1UU5A 3M3IA 4HKLA 4AG4A 1MS5A 1W8NA 4CCCA 5FO8B 1H0BA 2WZ8A 2ZHNA 1Q3EA 2YPJA 5T50A 3RZMA 4HZFA 4IE4A 1WBLA 3PUAA 1BHGA 1C5IA 3AKTA 4COYA 4P9LA 2YMZA 4EZHA 5JPNB 2AACA 1DFQA 1H8TC 2JG9A 4QQ2A 4DUVA 3KM5A 3BU7A 4HMZA 4XBLA 1RVF1 1FX5A 1CESA 2GH2A 1H2MA 4P9GA 1ZZ6A 3WVJA 4FPYA 2QVSB 3J4UH 4LKEA 3S57A 4U2AA 3T09A 3NJZA 4X6QB 2JJ6A 1GYKA 4QDRA 3PTYA 1DHKB 3OCPA 4MSVA 1NUKA 5A6ZA 3NMBA 4CEYA 1W05A 3NO8A 4YGBA 3RJ2X 2VTXJ 1T6GC 2HWF1 3IM0A 2ZEXA 3I2GA 5G05L 2WS93 3S6PA 1W6QA 1YIPA 1QXRA 1ZZ8A 1GZ9A 4QX0A 3KV4A 1KFXL 5IW0A 1K12A 1MR5A 3HPNA 4RR3C 1HRV1 1K45A 2WNUA 3GYDA 3KT7A 3MF9A 3MIBA 3P6BA 2W5FA 3LA3A 4IEUA 4LA2A 1AYM2 1UZ0A 5FZOA 5ACA1 3I2DA 4JDOA 4O61A 2BNNA 4K9SA 4V2VA 3C2UA 5J09A 4M4PA 3FLRA 4ZXKA 3V0AB 4FFHA 5GLVA 2XBO1 3HN1A 4P9XA 1VIWB 5FP8A 3C7EA 3N7MA 1LHUA 2QTWB 1AJKA 5FV3A 5CKQA 1UYPA 4GALA 3RQ0A 5T5PA 3JD71 4ASLA 4YFZA 3MO4A 4L92A 3I49A 3AP5A 2V72A 2EA7A 4IV1A 3KWVA 4OYUA 1SLIA 3K48A 5IK5A 2B4KA 1YWKA 5CFCA 4OUSA 4IERA 4XC9A 3POBA 3LFMA 3W5NA 3DPRA 2F17A 3A0NA 1SLCA 2PAMA 4MX3A 5I0DA 3GZTB 2LTNA 2WZR2 4RA0A 1FT9A 3HEIA 3ZSJA 3VBOB 1GV9A 2YC0A 1XRUA 2BWAA 3CF6E 1GUIA 4N7UA 4RYDA 1F2NA 4IEQA 2MEV3 2VZUA 3WR0A 2ZCWA 2PAEA 4AF9A 3WQ1A 3PVBB 1OHFA 4D7SA 4XUNA 2J22A 3VBHB 2J1SA 1Q5OA 2VMEA 4LOSA 2RDRA 2V09A 2RS31 1D4M3 3HNBM 4UBGA 1OBNA 3N36A 4G4FA 1HB1A 1UIKA 2JDHA 3LF7A 4Z82A 1PMJX 4IV3B 5C5UA 2YZ4A 1CAXB 4QDSA 1E57A 1EV13 2EF6A 4LBNA 4QQOA 4OULA 3ZN6B 1VBD1 4XZPA 3LDBA 2RJKA 3LA2A 1J1TA 5FY9A 1VRH2 1QJU3 4FPEA 4I09A 2V73A 1N3OA 2JDKA 3HT1A 4YVWB 5C8WA 2R063 2W52A 4JGZB 4KBBA 2QDNA 2ZXQA 3MV01 4ITCA 3VBFA 1JW6A 4HETA 3VD5A 3WP3A 1RUD2 2RJLA 5C3PA 2FDIA 4DNYA 4LLFA 4WV8A 1GOFA 2WFF3 1NG0A 3FZ3A 1XNAA 4D8MA 1T6BX 4NRPA 5F6LB 2FHRA 3WCRA 3AYAA 2I07B 2HWC1 5KHKA 2LW8A 4M3CF 1ENRA 2P6CA 5JAXA 4XF4A 3SH3A 1B35B 3J7MA 1W8ZA 1VBB2 3S5AA 1H9WA 1NQJA 3I3EA 5DAPA 3PHMA 2VMCA 4DRRA 2IZWA 2PA7A 2W1WA 1OI6A 1UYZA 3Q8BA 2Z42A 4GH4B 1ZA7A 1GFF2 5M0TA 1ZZ7A 1IHMA 2CAVA 1OVSA 3VUOA 1OLMA 1DIWA 2VNGA 4Z2AA 4M4RA 1KRIA 1N47A 3D4KA 5K4LA 5CFCC 1HB3A 4JRLA 1O3RA 4DY3A 4RQPC 4YW4A 5FZ8A 5LA2A 4DIQA 1AL22 1HJFA 1LOGA 1Q8PA 4AGRA 1LHOA 1R1A3 1WW7A 3A23A 3DPRC 3GHMA 2KD7A 4JTOA 1VBA2 2BPA2 4AK3A 1Z7S2 3VGIA 2IXLA 5LA1A 1PVXA 3H3ZA 1KXGA 4FAHA 5LATA 5IT6A 4DS0A 1FMD2 1POV3 3WQ0A 3VL8A 4R9BA 4MXWB 1I1EA 1COV3 4YRDA 2QQJA 5BNPB 3ORJA 1OA3A 4JVAA 4XDQA 5KXEA 2X29A 3I2JA 4PDWA 3NNMA 3OBRA 1W0PA 3ATGA 1LOEA 1EYBA 3KT4A 1M4WA 2A6ZA 2WS91 1UU4A 2VMGA 3LSDA 4L97A 4IW3A 3U78A 1W6NA 3I2HA 1LGNA 3FE5A 4FI9A 2TNFA 4KGQA 4D6SA 4Q2FA 4PCRA 2ZKLA 4K21A 2VQUA 4E2GA 1HKDA 1MS9A 1S2EA 1V6NA 2W47A 3AB0A 3MGUA 4NO4A 2WO3A 1PGL2 5FYHA 4E8DA 2XUMA 1MQTB 4NAOA 1VMFA 1PX4A 2PHXA 3MW3A 4J1WA 3VKOA 1RXFA 2XJVA 2R30A 4YG0A 5D2AA 4AFBA 2QNKA 2XLGA 1KQRA 1FOD3 1HXS2 2EICA 4HLTA 3WW3A 1NCQC 3MEPA 1LR5A 3RI8A 2QQOA 4CRQA 4UOJA 2EIBA 4OCTA 4XABA 5IK4A 1RUJ2 4D94A 3CNAA 5JWPA 3SH5A 4NWVA 2RMU1 1A34A 4WVMB 5FYTA 5FZIA 5T52A 1OH4A 4RGAA 4QU1A 3U10A 1GNZA 5J1XA 4FTSA 4MZUA 3Q8EA 4DB5A 3B94A 3VBUB 5FQ0B 3GZEA 1PVC2 4QB2A 5EFUA 1UZYA 3K77A 3KB5A 3KT1A 1DQ6A 3LWCA 1QQP1 2JKBA 3NNFA 1LTEA 3KVAA 1IS4A 4A7KA 4A42A 1DQ5A 4YGCA 4NUBA 2PELA 4UFKA 4NHKA 5HCFA 2YV8A 4Q4V3 4HXCA 1GR3A 4XZUG 1AYN2 3U37A 4WM7C 4O9EA 1NLRA 4YZ3A 1QY4A 1ULPA 4QKDA 3T1LA 5BV6A 1DZTA 3POYA 5C7GA 1I3HA 1G9BA 3N7LA 3O1VA 3AFGA 1JU4A 5FTTC 4XTPA 3EQEA 5A3WA 3PUSA 1LU2A 4DY5A 4FPHA 1NLSA 2WT2A 3I3QA 4FPJA 3ILRA 2JECA 5J37A 1EV11 3EYPA 1IQDC 1RUC3 4YLZA 4PDWC 3ZSKA 5ABJC 4XBNA 4URTA 1AL0G 4Q4W3 2JG8A 5JR2A 2JWPA 1JS9A 3ZDSA 3BTYA 4XYXA 3TEXA 1S4CA 2OPKA 4C1XA 2QQLA 4KBZA 3HJRA 2DTWA 3OBAA 2ZS6B 3NV4A 3V56A 2ZGPA 3RI9A 2R071 2WR9A 4GWIA 2R1DA 1OD5A 4IE7A 2CWSA 5F39A 1DCSA 2RS53 3KD4A 4HOOA 1RUF3 1S1AA 4UBHA 1OOPC 5A3MA 3IBMA 2XJSA 3ILNA 4E4DX 2YG0A 1FPN3 5CAZA 1AR73 1VBC3 5I0SA 2FQPA 3EJKA 1H8VA 3HD8B 5FOJB 5AVPA 3E6CC 2GMPA 4LK6A 1VB2A 3KF5A 5JZGB 2IFRA 2P34A 3A4UA 4U36A 4BK4A 5K7PA 1RHI2 1X33A 5IK7A 1UY2A 4CVUA 4C8DA 1MS3A 2HWD1 4LO4B 4LBLA 3BN6A 2D6KA 4GIQA 2J1EA 1MZFA 1DBNA 5DUUA 1NYWA 2Q8OA 2X53S 3R6SA 2DU1A 3PLQA 2TBVA 1O4ZA 3GCXA 2HWB3 2YPDA 3POIA 3PTRB 4Q0SA 4CU8A 3MFAA 1PM4A 2Y0IA 4COUA 2VECA 3JBG1 5A1AA 3OGSA 3ZFFC 2PHWA 5A6QA 1LODA 3WF0A 4YNIA 3SEEA 2LRPA 4LO7A 1COV1 4KG0A 5C8CB 4AXOA 2OS2A 5GLTA 4WM8B 4CYDA 4OHZA 2G4IA 2YY1A 2Q1ZB 3WP6A 1O4TA 4H3WA 3I8TA 4ZU5A 2D3RA 5GLZA 3VZOA 1ULOA 4TYSA 3RWNA 3SISA 1S0DA 3WNMA 4LT5A 1QWRA 5FYCA 1N3PA 4HK8A 2Y6JA 4KU7A 4Q4Y2 5B2GB 2XJUA 4IEXA 1AR61 2P4EA 4JKLA 1WCSA 4LTAA 4RQPB 4NROA 5LA9A 4JV4A 4LHLA 3PMEA 3WG4A 5A1LA 4YZ4A 1S0JA 2VY0A 4XF0A 4QX1A 1C57A 3FUQA 1TME2 4SLIA 3BPSA 2R041 2I45A 4UWDA 1JYCA 1RUH2 1Y7BA 2RR11 3WF3A 4XDOA 1HLCA 2HH9A 1V6LA 4M3CA 2P6HA 3HQUA 5GKAC 4AVBA 4KL1A 4XQWA 3BI3A 1YFWA 1TMF2 1PGW2 3WDTA 4MGKE 1QXPA 2A71A 3HAGA 1F8VA 1PO12 3DYPA 3PIJA 2XOMA 2WABA 2PHDA 3C3VA 2V4AA 4QD2A 4N9HA 2XJQA 1UY4A 2Q0AA 2ET7A 4JC1A 5FUPA 4AI0A 1L3JA 4DFSA 1W3XA 4AQ6A 3ACGA 4CXXA 1UOFA 2BBVA 1TZOA 4A41A 3IPVB 2VBDA 3WUCA 3BOPA 2ZGOA 4PIZA 1W39A 1WA6X 1CVNA 1NZIA 1NZCA 4LBOA 4O65A 4AL9A 3H8OA 2JDMA 1GZWB 1RUI2 3SNMA 3USUA 4CDQB 3J8F2 5BNOC 1DGRA 5C6CA 2Y0OA 4OI4A 1ULFA 2D5HA 1W6PB 1ASJ3 3ZXLA 1I6XA 1AR81 4ZY9A 3LIGA 1S0IA 1MACA 1R082 4UAPA 3U4SA 4EV0A 2R16A 3U07A 3V65A 4KGGA 5I8SA 2VMIA 3CU7A 4A3XA 1RUC1 1YO8A 5A7PA 3EXUA 1Y3TA 4CDWA 5JOYA 3L2HA 4QU2A 5FZ3A 5JUVA 4FTEA 3J7NA 4KH9A 5A1FA 3UK9A 1YHFA 2W94A 2KXLA 1VBE3 5H9RA 1GANA 1W6OB 3MLLA 2H0BA 1SFYA 4GJYA 2ZX3A 4HK9A 4WM7B 1W2AX 5A33A 1LB2A 4ZZ5A 1QH7A 5FYUA 1AVBA 4CP9A 2PQSA 5EXOA 4DZGA 1O5UA 3ZXFA 2RS12 3RNSA 4XILA 2VMHA 3H9AA 3AKSA 3ZYHA 1FPN1 1KFUL 1OSGA 1AR71 1VBC1 4LUMA 3VD7A 3JQWA 3PDQA 4YM0A 4FAGA 5L7OA 1SPPB 3JXSA 2VMFA 4JAAA 4E2QA 3PIGA 5ABJB 1CAWA 3PUIA 1GNHA 5A6YA 1WZXA 1ZBA1 1RUNA 1U0AA 3RZLA 4E27A 3ZMOA 1WLDA 4MGYE 4KWUA 2BBAA 2WC2A 1C8NA 2OA2A 1I9RA 5GZDA 3HBKA 5A7SA 3RYPA 4JQTA 4JGYB 2VUDA 2WQ4A 4LKSA 5FZGA 4TWTA 3E5QA 4NIIA 4XPVA 2NM1A 2HWB1 3WF4A 4AQ2A 4BHPA 2WBKA 2W1SA 5FPBA 2Q1MA 3MF6A 1N3QA 5L9VA 2O0OA 3I3DA 4P9WA 4MGIE 5LRRA 3RMYA 3O1SA 2YFZA 5FREA 4D7YA 3VDDB 2WZR1 3WG1A 4ASKA 3DEMA 1X50A 4F83A 3S7IA 5J98B 1YFUA 1LEMA 2GC0A 4MH0E 3R4UA 3T2TA 2W9XA 3BIEA 1ULEA 4CUBA 5F5QA 4Y1UA 3VHNA 1U5ZA 1MS8A 1W2NA 1H6YA 4E4HA 1ZREA 4EZ4A 3UYJA 2J1VA 1GMMA 1TNRA 4LO8A 4OQ9A 1VE0A 4N53C 3ZFFB 2WLPA 3WX5A 1SLAA 3R0RA 3V0AA 1BEV2 1OUXA 3X29B 4DINB 3FX3A 1WCQA 2VW2A 4MXVA 1VRH1 4R4XA 1IOAA 4NIDA 4LKDA 1IS6A 2VH9A 2BFUS 1GLHA 1HRI3 1LECA 1ZNPA 4RD7A 5KC5A 2CV6A 2H6CA 3PVNA 4QX8A 4BQWA 5A3UA 1OKQA 1RUD1 5CEHA 5L7OC 1O7FA 1F15A 1UCXA 1C5HA 1W04A 1EAH3 1EUUA 3ALQA 3CJIA 3DXTA 1ODNA 3QACA 3THDA 3CEWA 3BB6A 3POEA 2W95A 3BVCA 2AC1A 3EB7A 4D0QA 3KCYA 1GQGA 1YQCA 1W06A 3AZWA 4HANA 5LBCA 2CYFA 1ZBE2 3H1YA 2LALA 3TWIA 1LENA 1IG0A 3LFIA 1VBB1 1LOAA 4YYOA 3VBOA 4YW3A 1ULGA 3WLUA 1HB2A 5FMOL 4AFDA 4AI3A 1AR93 4CDUA 1LU1A 4CU7A 3TN92 5D1IA 4XFIA 5CB7A 3VBHA 3I4IA 1PO23 4BISA 1IZ3A 5FMBA 3NW4A 4AI8A 2VXRA 2UWBA 4G9SB 2YXSA 1AL21 2ZPXA 3WNPA 4XUTA 5I0UA 2PLV2 1CAXA 2G9GA 4QM9A 3ZKUA 4Q1RA 1KITA 2OPWA 3ZN6A 4X6RB 1ZX5A 2Z4FA 5FZAA 4Y3OA 4RHV1 3KCCA 1EPWA 4W50A 4LIUA 1FMD1 2A73B 5CNAA 2YHJA 4BMBA 4COWA 4YVWA 1FNZA 4M01A 2CNAA 4JGZA 2B8MA 1VBE1 1W3VA 1WD3A 2E6VA 4R4ZA 1AX2A 1JYIA 5CKNA 5BNOB 3ZOIA 1RVF3 2I2SA 1JZ2A 1NLQA 3W58A 3I97A 4YPJA 3ZYFA 4AGVA 4E9KA 2QFEA 1NXMA 3JUUA 2C1FA 4COVA 4AHYA 2MEV2 3N9NA 1B35A 5A32B 3ZPYA 1GZCA 2H0VA 3GNEA 3ACIA 1WA4A 4EWEA 4F7ZA 1UMZA 4EWAA 2HWF3 5EJ3A 2VW1A 2OUJA 1OMIA 2YB7A 1JZ5A 3WY6A 1D4M2 3VZKA 5A6XA 1JYNA 3O14A 1F35A 5JSOA 4BPZA 2QQPA 2SBAA 1HRV3 3BUCA 4UI9L 1PIV2 5HV0A 5FAXA 4QX7A 1FV3A 4NRMA 5F2SA 5JIUA 3THTA 5ACA3 4P9JA 1M06G 4K40A 3VBOC 5IYYA 5LK7B 5BPXA 2C24A 1DYKA 1V6MA 1DF0A 1W2OA 2WL1A 3CIHA 1H1MA 3HOBA 2VE1A 3PJQA 1JUIA 2EAKA 2XMLA 2CWMA 1TG7A 1UO9A 4MXWA 1V9U1 4OZOA 3U1XA 3WP5A 5BNPA 2CTVA 2QCSB 2FZ2A 2WO1A 4OHWA 1CJDA 2WFF2 3OOXA 5G04L 1NE4A 3JD73 1GSLA 1ZZBA 1AYN1 4YFWA 2HWE1 2FMDA 4IV3C 3DUIA 5EYYA 1DU3D 4GB32 3ZXJA 1BVVA 5DZEA 1C28A 2WT1A 4AVAA 4CDXB 2XWBB 4RS5B 1H8TA 2VXJA 2EXIA 4FPOB 1KS4A 4QXCA 1Q43A 1YQ8A 1A8MA 4DUXA 1JZ7A 4NIGA 3WSOA 1MS0A 2IFWA 4JGZC 1PZ8A 5IAVA 2C5DA 4PJYA 4BIOA 3SQOA 1RUE3 2JDAA 3O1PA 2UU8A 4QWNA 5GLUA 1HRI1 5F37A 2RS33 3AJZA 3POWA 4XHBA 3FWEA 1X9TA 5DAQA 4UF0A 4Y1XA 4YVSB 2IVJA 3KZ4C 2A6WA 3VHRA 2JB8A 1F9KA 4BQ5A 3O1OA 1VBD3 4MOAA 1DQ4A 2W39A 4RSUA 5CKMA 3WF2A 3ZIWA 4CPBD 4D6RA 3VBUA 5JSRA 4RR3A 4GH4C 4UW6A 5FQ0A 3MDPA 2B9VA 3WNLA 3IDAA 2VBPA 1GNYA 4XF9A 3N9QA 1RJ8A 4N53B 1RMU1 4LEJA 2Z2SB 4CCEA 5HCHA 5CG9A 5E88A 3WDVA 2RM23 4FO9A 3THCA 1KS5A 3UNPA 1RHI1 2ZGRA 1WCDJ 4CUCA 1XXNA 3N9OA 3I2KA 2TEPA 5EZWA 4I30A 1CIYA 2VZ1A 2VOKA 5JVVA 2HWC3 2VR4A 3RZHA 4ISQA 3NJYA 1TE1B 5BNPC 3N35A 3SCFA 1UQXA 1QKQA 3AP9A 2WJSA 3KV5A 4L99A 3W59A 1PNFA 2O14A 4FQZA 4BJ0A 4FPLA 1QJY1 1WMFA 4S2HA 4WVVA 5CU1A 1A8DA 3KQRA 5DUWA 4NHYA 5A7WB 5T5LA 4NPMA 1Z78A 3OGJA 1KDMA 3B9IA 2OQ6A 1NA1B 1W6MB 1GOGA 2ZMNA 5FJKA 1BKZA 2JXAA 1RXGA 4GA9A 2XUEA 3WHTA 2D40A 4OI1A 3OTFA 3E97A 5LASA 2P1BA 3AL6A 4GD4A 3BYWA 5IVJA 4YG3A 2VUJA 3MW4A 3CJXA 1QF3A 4QKFA 1MQTC 1X7NA 2EALA 4H2AA 4Q4Y1 5K0UB 2HEVF 3IDEA 2ZHMA 4DXZA 2AR6A 4Q4V2 2PMWB 2WINB 2BVBA 4FOYA 1W2TA 2QUOA 2Y64A 4GWMA 1TME1 2J1RA 4IE0A 3DKWA 3AP6A 2Q5TA 4H55A 2I74A 3NAPB 4AW7A 1W28A 5KHIA 1WW4A 5A3PA 3AMHA 1TMF1 2YU2A 3MLKA 1HIXA 4C1WA 1SCSA 1JI6A 3PU3A 3VBUC 3N9LA 1PO11 1K5MB 3J7HA 3RZKA 4XXPA 5CFDB 4RN5A 1ND2C 4Q4W2 2VNRA 3R4DB 3VBSB 1S0FA 3WNXA 3M8LA 3MPBA 1D2SA 3TBDA 3T1MA 3H3UA 3KGLA 4NWWA 4LJHA 3UJQA 4C90A 4YW5A 2VQAA 1PNGA 2GMEA 1UZWA 4LBQB 4OMDA 4YGDA 1V6OA 2WA4A 1OFNA 3GJAA 2VZOA 3NJVA 1TNFA 3V64A 1ENXA 4FT8A 4ARYA 4HVQA 2RMU3 3BTXA 2EIEA 1SDDB 2DU0A 1IKQA 1RIRA 3B00A 3T30A 5DAXA 5FXVA 4AVVA 5T5JA 4JQRA 1AXZA 2VTXA 4RQPA 2X05A 4BQ3A 2VCBA 2A1XA 4CTEA 3FUOA 2BTVC 1PGSA 1QEXA 1QQP3 5F9TA 3OUJA 1YQ6A 3EBRA 3ZPOA 5F3IA 3M3QA 3S5QA 1CZSA 5FPXA 3O5SA 3WDYA 4L0PA 4PBOA 2XLAA 1RUE1 4I0AA 2WNVB 3AJYA 1C8M1 5LBEA 2FDHA 5C3OA 2WT0A 5I0RA 4MV2A 2VPVA 2E26A 4Q8KA 1W0OA 4LULA 1BMV2 3B7MA 4HKWA 4RGGA 4XETA 2EXKA 3I54A 2E7TA 3WV6A 4PI0A 1OT5A 1O8PA 5J36A 3AZZA 1OQEA 3O0VA 1IKPA 1BBT2 3NWKA 1DGWA 5JZGC 1IPJA 2PXJA 4ET7A 3AKQA 2WKKA 3UKNA 1XPWA 3IPVA 2GH8A 3OJBA 1HQWA 3WOGA 5F7UA 1H1AA 1OFSA 1H6XA 2QZ2A 4A2UA 2E63A 2DFCA 2ZGQA 2ZGKA 4A6SA 2XVKA 4W65A 2CY6A 1D2QA 2R073 4HT1T 4QKBA 2XKOA 5FZKA 3LEMA 3EMRA 2XONA 1GZWA 1OLRA 2RM21 3E5UA 4LBKA 4YZ2A 2PHUA 4GXLA 3NNLA 3ETQA 1JOPA 2VULA 1UXZA 4OQ8A 3I3MA 1NCQA 4XFAA 4ES8A 3V0BB 4XFFA 2GP3A 1RUG2 4CPBA 5C8CC 2D3PA 5CISA 4LA3A 1RUOA 3KMHA 4WM8C 2NP0A 1LOFC 4XF3A 3ZFEB 2GAUA 4QGLA 4TLGA 2DCYA 3JB8A 3ZVXA 2NLRA 4YW2A 5T3NA 1NY71 2V5YA 3VZNA 2DF7A 1ZYBA 2HWD3 4N8MA 3NSTA 1QOOA 2B46X 1LHNA 2BYVE 1W6OA 3MIHA 5FZ0A 4WM7A 2WWSA 4CXWA 4CCLA 4XFBA 1OURA 2C9KA 3HQRA 2Q8EA 3JBG3 3SXWA 3AMNA 1JH5A 3K75B 2RDQA 4Q26A 4QXKA 3ACFA 3FC0A 4NMIA 5C5TA 1EPZA 3ZM8A 3MI8A 1OA2A 3NKTA 4B7KA 1DDLA 2WQ8A 2K46A 4OFGA
chains in the Genus database with same CATH topology
3HBZA 2PQQA 5ABJA 5KHJA 1BEV1 3ZYPA 1SCRA 2VVDA 3AYCA 4K7JA 4BMEA 2CGOA 2IC1A 2R0FA 4FVVA 4XJZA 1AR63 2WSUA 2OZJA 4JGYA 1H4HA 2YROA 4GMP0 2XKPA 3IDBB 3DGTA 4EN9B 3ZXKA 2ZGSA 1U5XA 1X8EA 5FOBB 1G8WA 2R043 1JUHA 1OOPA 5H9PA 1N1TA 4A7ZA 2RR13 1AX1A 3KLSA 1UPSA 4CDQC 2BWCA 1ZBE1 4Z8BA 1IS5A 3VDDA 2HEYF 1BK1A 3U0ZA 1JBCA 2VGDA 4E4ZA 2D98A 2YUEA 3E6DA 5AC92 4AEDC 2UYBA 3TN91 2XWJB 5KXDA 4BZ4A 1XE8A 3LKJA 1ND2B 4A7YA 4Y4YA 1LGBA 4EROA 1QJX2 2PLV1 2GALA 1XYNA 3ZFFA 3HIFA 4AEKA 5DUXA 2LM3A 1WUVA 4FOVA 4OI2A 1AR83 3JCIA 3ENRA 2PHFA 1YFYA 1PK6B 4Y20A 1G7YA 4GWNA 3PNAA 1JHNA 4HN1A 1ZRDA 3MYXA 1UX6A 4TSVA 4R52A 1CPNA 1H1IA 1RL3A 5KHHA 2MNGA 4P9YA 4FSJA 4R9AA 3KCXA 1AX0A 3H0OA 3ES4A 3BCWA 3U4XA 4AE2A 3FMGA 4JGYC 3S30A 3ACLA 3BODA 4XQDA 2DWRA 1R091 4BIFA 1QOTA 5GZEA 1XNDA 4N90A 3ZXAC 2GMMA 3AP4A 2ZGLA 4HPKB 4MVTA 1PIV1 2D6MA 4LE3A 5FRAA 3WW1A 2W68A 1YRZA 3VDDC 1AYM3 3W9AA 4S2FA 3WT3A 2QDRA 3GBFA 2B45X 4K3UA 1ZBA3 1CPMA 1JXNA 2A3WA 2A6VA 3QD6A 3H1MA 4AVSA 5FO9B 3LAGA 1QDOA 4S2DA 1S55A 2JG9B 3POSA 5DDJ1 4E2SA 4Q4X2 2ZX4A 4CP2A 2O1QA 1PZ7A 5BNOA 1YNAA 1YLLA 2D6OX 4FP2A 3AKRA 4GB31 4O9GA 2FMYA 4Y5Z0 3OYWB 3J9SA 3R4SA 4YZ1A 1LOCA 5A32A 3VHPA 3L9JT 2BVVA 2WZR3 3WXPA 4F8AA 4C0BA 2DVBA 5E16A 3FFQA 4LBQD 1CAVA 2PN5A 3AMQA 2WNUB 4D3WA 4I01A 4ZU4A 5I0TA 2IXKA 4IESA 1EP0A 2ZX2A 1G9FA 2DCJA 2FBEA 1TEIA 5FCCA 3B9CA 1UIJA 3RG0A 2DVAA 2P2KA 2A5ZA 3GZUC 3IMNA 4I3GA 4AYUA 2A6YA 1PHMA 1VRH3 4Y22B 4NN0A 2DVDA 4Q29A 1RVF2 4IV1B 4B4QA 3ZYIB 2E51A 1XU1A 3FJSA 1MEC2 5LEKA 1WLWA 1RUD3 4PLMA 3D0SA 2EAAA 3VBRB 1S2BA 4M00A 2JX9A 2GSYA 4CDXA 2JICA 3PMSA 2GC2A 4Z07A 4N7IA 4JDNA 2ZX1A 1QGLA 1V6IA 5GJ6A 3U11A 3JQXA 2ZHKA 3ZFGB 1ULCA 1VBB3 1ZRCA 1S0GA 3RSJA 4PLOA 1D0HA 1J59A 4YGEA 1HRV2 1D0GA 1QDCA 3M4FA 4Q8LA 5CA6A 5SV8A 1Y43B 2ENRA 5ACA2 3QH6A 5E1RA 1AL23 5BNNB 4AEDB 1BJQA 2D7FA 4YVSA 2XBO2 3AFKA 3O0XA 3SCHA 1Z7S3 2AREA 1ND3B 3S0MA 5EYXA 4CP0A 4RHV3 1FMD3 1J1LA 1AUYA 2XG3A 2ZMKA 3JD72 4KWLA 3D8CA 3VBFB 1XYPA 5JSRA 2NMNA 5JR7B 3MW2A 2XVGA 4N53A 4LUKA 2XLFA 2HJIA 2BW8A 3JB4C 2EVXA 4AI2A 3MZHA 4XHXA 2VQ0A 2R0HA 1VLNA 3TNPB 4B4RA 2VW0A 1MZEA 4XJAA 1AYM1 4META 3B93A 4XIKA 2WFPA 3UKVA 1MS1A 4XFGA 2UYAA 2NZ9A 1VAKA 1NA1A 2GNDA 2AYHA 1HXS3 1V6JA 1V6KA 1CAUB 4BWOA 4CDXC 5C4WC 1ENQA 4RS5C 1ALYA 1AXYA 3FFZA 2VOWA 4NHMA 1YJKA 4C91A 1VAMA 4Q0UA 4QGMA 5FLHA 1GKBA 5C9AB 4GULA 3H50A 3ZSEA 3FHIB 4WZFA 1QH6A 4Y1VA 1PVC3 2A75A 3PVEA 4PIYA 2CGNA 5HXVA 1V9U3 1WW6A 3BIWE 4MYEA 5J48A 3WG3A 3APBA 1PMIA 1AYN3 4YM3A 2HWE3 4QQLA 1QXJA 1R1ZA 3LZZA 4YVSC 2XJRA 3HQXA 4YSFA 4PF5A 5L19A 1CX4A 1K5MA 1URXA 4XFCA 5CFDA 3VBSA 2D44A 5LRSA 4P14A 1YUDA 3UKTA 1Q8OA 2D3SA 3DV8A 1YFXA 2D93A 2ZA9A 5E8AA 4HSJA 2JE9A 1J3RA 3ZXEA 2GN7A 4K1YA 4AVCA 3THPA 4Q0PA 2E7AA 2Z69A 3ELNA 1Q8QA 4FPCA 2R49A 1RINA 3B02A 1FV2A 3N7KA 1OA4A 2HKXA 1ZZ9A 2BUKA 1NQDA 3WW2A 1RUG1 1NA1C 3B69A 3MIGA 3P3NA 4WVZA 2WS92 1RMU3 5FMOS 3MIFA 4EJRA 3HT2A 1UZZA 2WLQA 1RHI3 4L2NA 4RFT0 1RJ7A 4LO6B 4M0NA 3WG2A 5K0UC 3B01A 3ILFA 4QHBA 5JI9A 2W0XA 1VR3A 3IKWA 5HCAA 4TZDA 4IV3A 2JG8B 2XGXA 1VBA1 4CP1A 1QJY3 2AENA 2OZ6A 1Z7S1 3VV1A 3NAPC 3TNQA 3VZLA 1YCIA 5H9QA 2X5IB 4DRVA 1IQAA 1RITA 2EXJA 1BCXA 4Y26A 4MLOA 3UV9A 1LEDA 5FBZA 1DGWX 1K5MC 5CFDC 3BOWA 1XYOA 3VBSC 2ZJCA 2XVLA 1SFNA 2DUOA 2PTMA 4J6GA 1QQP2 3DF0A 4Q4Y3 3H7JA 4KWKA 4FPKA 2ZACA 3N3HA 2CL2A 3M3OA 4NOTA 4W6WA 3OD4A 3J26N 3VLBB 2DV9A 4AI1A 3HR9A 1PGL1 1TME3 3D82A 3ZFEA 3E6BA 1HDKA 3K51A 2DVFA 1RUH3 3WP4A 1LESA 2P3JA 3WW4A 4QPGB 4GH4A 5JDBA 4R9CA 1TMF3 1YXWA 3UL2A 1Q56A 1HXS1 1AXKA 1EV12 5J96B 1PO13 1MVQA 1RUJ1 5F6KA 1WLTA 1LCLA 1C1LA 5IK8A 5AC91 4MGZE 1QJU2 5I8TA 3N7JA 4XF1A 3RDIA 2K2SA 4E4SA 2GC3A 2R062 1PVC1 3N4MA 2ET1A 4GMP3 4PLNA 1NE6A 2WNVC 1HQNA 2HYKA 5I93A 1GBGA 3NKGA 5KWRA 3URFA 1DZRA 4ZU7A 3AYDA 2XB6C 1LHWA 4QPIC 5EV7A 3LOBA 4KU8A 1H30A 3TYJA 1SEFA 2NYYA 1N1YA 4P5HA 3TRSB 1R083 2D6NA 5C4WB 4KQ7A 1WGPA 5CADA 1SDWA 3QLQA 4WZCA 1MQTA 3VN4A 1JTZX 1RC6A 5GZGA 4LBMA 4JRAA 1AZDA 5IUQA 2O8QA 5LEJA 2ZTNA 2R32A 2Y38A 1C8M3 4B29A 1R1A2 3M2MA 3JBG2 1O3QA 3QCWA 1O3SA 2ERFA 4QMAA 5DUVA 4WVMA 3QOPA 4TLFA 4R9DA 4LNVA 1COV2 1RTVA 3ZFEC 4BLIA 2RS13 3INAA 3WD5A 1ND2A 1QMJA 2WSVA 1G86A 2DUPA 1CGPA 1LJ7A 4PBPA 4OHYA 5KXCA 2XL9A 2RE9A 1WLCA 3GZAA 3GF6A 5JSPA 4Q0QA 1B09A 1A6CA 3MIDA 4XQ4A 3FLTA 2R042 1X36A 4LLOA 4B8EA 3IDCB 1OQDA 4WVWA 2RR12 4BM8A 5TSWA 5C33A 2ZGNA 2XHKA 2NN8A 1IGOA 1KD7A 4W6XA 2PHTA 1FOD2 1NXD1 1UPIA 4K6BA 2DYCA 4BLJA 5F1RA 4HFSA 2VVEA 3RMXA 3GBWA 5FO7B 1H4GA 2BGCA 1LKNA 4FBFA 5A33B 4Q27A 3OF1A 1V70A 1U5YA 1DQ1A 2K0GA 2VVFA 5J3UA 2EXHA 5DG2A 5JOZA 1ZVFA 1S2KA 1U5IA 3AZVA 2C9AA 4R8HA 4CZSA 1C3HA 2ARXA 4Y1YA 1HV0A 2OVUA 4YW1A 2ZAAA 3WDWA 2N7GA 3LA7A 2MPFA 3ZSMA 3M70A 1XE7A 1AR82 1RUH1 5JZGA 4N43B 5KBFA 1BEV3 2DCZA 1NCRC 2ZX0A 4OVEA 1SACA 4BQ1A 3H1WA 1ZRFA 1PGW1 4X8PA 5BXXA 5CBLA 1CONA 4NPRA 1RUC2 1FAYA 1MEC1 4ISRA 2PAKA 4PIXA 1GQHA 1WMEA 4OHXA 4OUMA 2GNTA 4L11A 3IIAA 2KA3A 3P3PA 4UW3A 4YZ5A 4YG6A 1SLTA 3OYWA 2WZPP 4BE3A 1A3KA 4GMP1 5C8CA 1ZBE3 2OIIA 4WM8A 2RS52 1LOFA 1PK6C 1RUF2 3GALA 2BQPA 2IXHA 1WBFA 2P37A 1RUI1 1YJLA 4AVTA 3J8F1 1FPN2 3TN93 1AR72 1VBC2 2E7QA 4CEWC 2DCTA 3IT8A 3I7DA 1R081 3NL1A 4IEPA 4EN7B 2Z79A 1ZBA2 4MUVA 5HI0A 2PLV3 2YDEA 1G9AA 3ST7A 4IEYA 1VP6A 1SBEA 4Q1PA 4Y22A 5HBAA 2HWB2 1LHVA 2ZHLA 1UD1A 4H7LA 3CJIB 2D6LX 2XJPA 4HBNA 4QPIB 3UJOA 2A70A 4I0WB 1BZWA 1A78A 3VBRA 1J3QA 2NMOA 2ZKNA 2RS11 1WD4A 2UY8A 4ES9A 1CQ9A 1J58A 1SBFA 2JG9C 2ZMLA 5CVRA 3ZFGA 3USSA 4CDUB 1YYNA 3AP7A 2A3YA 1MZ6A 1F5JA 3SITA 2ARBA 1R093 3BPZA 2ZGTA 3FBMA 4CDQA 4Z92B 1W6PA 1SLLA 3AK0A 2B39A 2B7YA 3ZYGA 2E9QA 1YI9A 1PIV3 4CEYC 2DVGA 2GDFA 3R05A 5BNNA 4AEDA 3OY8B 4G3YC 3LB9A 4IEZA 4M3CE 5K9YA 3WDUA 4DPNA 3BALA 5D8AB 4DQAA 1ND3A 4IXLA 1BXHA 3MPPG 3MICA 1G9CA 1FNYA 4QT6A 2WNUC 2WIIB 1XU2A 4M0HA 5DDJ3 3SLIA 1VALA 2DCKA 3WDXA 5JI7A 4I0BA 4INDA 4XBQA 3D6EA 1KJRA 4GB33 1S0BA 4YM1A 4LHKA 4BOWA 1DGRN 5J7MA 1UW8A 2EIGA 3VZJA 4LBJA 4AEJA 4IV1C 1BYHA 1ASJ2 1S0CA 4AHZA 3PJYA 1H2LA 1BQPA 2JDZA 4Z1VA 4AFAA 2KM2A 4S2GA 3VBRC 3AYEA 3WHUA 1CAUA 4SBVA 4XJ8A 3VHOA 3D0JA 5GZCA 5HCBA 4RHV2 3ZFGC 2ZABA 1UU6A 3QH7A 3LGRA 5C9AA 3BTAA 4L9BA 1DZQA 1VBE2 4AQTA 3MLJA 1H2KA 3AZYA 5GZFA 4EN8B 4AHWA 3NV3A 2AGSA 3CO2A 1J3PA 3EO6A 1CIWA 1VAVA 1NCRB 3CLPA 5BNNC 3E5XA 5CG8A 5JIAA 2BEOA 1H8TB 2TUNA 2YGMA 2ETEA 2QE3A 4QPYA 1ND3C 5DXDA 2ATFA 5BY5A 4LR4A 3VBFC 1CN1A 1DYPA 1F5FA 1CR7A 2YYOA 3ZMNA 1ULDA 2OYZA 4AQSA 4Y1ZA 3SMHA 2DURA 2XH6A 2R6QA 1H2NA 3I59B 4FOWA 3B5LB 2XJTA 4RR3B 4C0HA 1O5LA 4CEWB 1V9U2 4XOGA 3G7DA 4HN0A 4L8QA 1QNYA 2MEV1 2HWE2 2JENA 1QHDA 5BYNA 2FZ1A 1D4M1 1UL9A 5C9AC 1C1FA 5JMCA 2ZOEB 1VJ2A 4KWJA 4FP3A 1HW5A 4NHLA 3IN9A 4EN0A 1FI2A 3RYRA 2B9UA 1QJU1 1DQ0A 4N9IA 4DOUA 1DG6A 5DZFA 1LULA 1HRI2 2R061 2VOVA 2X5IA 5GM0A 4W6YA 4XFHA 4XMAA 3MIEA 2K9ZA 1HX6A 1EAH2 2WFF1 3Q9OA 2A6XA 3NVCA 4AHXA 4I3PA 3B3QE 2IXIA 4K8FA 2ZGUA 4Z2WA 3LOIA 1RMU2 4CEYB 2X8KA 1AR92 2JE7A 1W6QB 3HWJA 3M7AA 4D69A 2Y26A 4KG8A 1PO22 4B3NA 4QPGA 3GBGA 1Q8VA 4LHNA 4AGGA 5I8YA 1F31A 1R1A1 1QJY2 3H8UA 3OD0A 5JLVA 1DGLA 4B4PA 1POV1 4H14A 5DG1A 5BNQA 2ZAHA 3ZXDA 1KJLA 1BBT3 2A7AA 2BNMA 2XPJA 1PZ9A 3AXEA 5EWSA 3SH4A 3RZZA 1LOBA 4RL7A 3QBQA 4JTNA 5CFCB 1ZA4A 1REDA 2JG8C 1UAIA 4XW3A 2GU9A 3DPRB 1UF2C 1SMVA 1MZ5A 5C4WA 4RS5A 2X5IC 1H9PA 4IETA 1RUG3 2PHRA 3M1HA 3WCSA 1WCKA 2HWF2 3ZSLA 3OBTA 1ZZCA 3AM2A 1HV1A 2YGLA 1DQ2A 1FOD1 3JZVA 1QOSA 4X8NA 3RRDA 4OI0A 4FPGA 2OW4A 4AFCA 3AMPA 1S0EA 3KSCA 3L2YA 4ASMB 1JOJA 3A0KA 5A3LA 1FATA 2HEWF 1VB4A 2GN3A 3HMYA 5I91A 1XNKA 1QU0A 1VBA3 1CD3G 4ATFA 1V00A 2PFWA 2CGPA 4QPGC 2E53A 5GLWA 5L36A 4Q4V1 4LO5B 5KHGA 4ATEA 3TOJA 2GZWA 2XL7A 1NCQB 5JOWA 1YIFA 1SBDA 2JEMA 2QKDA 2QZ3A 5FDBA 4OHVA 2B42B 3EHKA 3RS6A 4XMIA 2D5FA 4Q4W1 3VKFC 1ENSA 4NR1A 1RUE2 4WBBA 1C8M2 2RHPA 5T55A 4K20A 4OLLA 2JD4A 2P17A 2D6PA 2NQYA 2RS32 1UKGA 1W6MA 1X8MA 5AFEA 3O12A 5CIRA 2RS51 1AF9A 4AFMA 4ZKTB 1MVEA 1RUF1 1VBD2 1RUJ3 4GKYA 1HQLA 5AC93 5T5OA 3ASIA 3AX4A 5K0UA 4HSLA 2VUAA 4PDWB 2RM22 1JN2P 1OLQA 4XE9A 1N1SA 1QJX3 1W6NB 3NAPA 4N43A 1POV0 2Q30A 2HWC2 1O91A 4KNCA 4XIOA 3ROUA 2AH2A 1OOPB 1BMV1 1UN1A 4GKXA 1RGSA 4QGNA 4XXAA 1NY72 2VNOA 2ZZJA 2C0ZA 4DMIA 1FYUA 4UW4A 3ZYRA 2A3XA 1LRHA 1BBT1 4XJUA 1U12A 2WA3A 4QX5A 5LK5A 4NVPA 3AMMA 5DZGA 1Z0HA 4JCKA 4LBQA 4UXAA 3CL1A 1Y9QA 2GNMA 3OPZA 2GNBA 5KXBA 1O3TA 4I2OA 2ILMA 1QNWA 2MHFA 4FCAA 5FPZA 5L73A 1FXZA 4CDWC 2IXCA 3GHNA 4H7MA 2LUWA 2DUQA 2AZ5A 1BVP1 4IL7A 1G9DA 1UKRA 4FOQA 1RB8G 2OUHA 1AJOA 3G6JB 5FLJA 4HKOA 4FQ4A 3ZO0B 4F3JA 4ORFA 2VG9A 1YI7A 2BFUL 4J1XA 4Y20B 2F6BA 2WNVA 2ZGMA 4Q4X3 4PQ9A 4UW5A 4Y24A 4OZXA 3ZYJB 4AEMA 4IQPA 4QPIA 4B7EA 1D4VB 2F4PA 2UWAA 3JU9A 4FTBA 2UURA 1ZM1A 1NOVA 1XQNA 1ONAA 4N43C 2QJVA 1APNA 2W08A 5AFBA 1SQ4A 3D5OA 2D97A 4P9IA 3IWZA 5T54A 5JCTA 2RMU2 3NV2A 4EN6B 5JOXA 1QJZA 2ZBJA 1ASJ1 3KGZA 2R1BA 2IXJA 4COZA 3ZN5A 4HL0A 4BCUA 1REEA 3O7OA 1G6NA 1O4YA 3V0BA 5GALA 1WW5A 3ES1A 4JDMA 3OY8A 2ZZQA 3ZXGA 4YM2A 1SLBA 5D8AA 4YARA 3H7YA 2UWCA 3VZMA 3S7EA 3TAYA 3SHRA 3VKNA 1XNCA 4IEWA 5KC6A 1MEC3 3FBYA 4GQ7A 3RPQA 4HVRA 1X82A 2NPIA 4QQPA 1IS3A 1KDKA 5JPMB 5K8SA 1C4RA 1W2UA 2R072 1R092 4FXGB 4ONUA 1CAVB 5FFOC 1QJX1 2IWGB 2SLIA 3CJIC 4BA6A 4IEVA 1RUI3 1XNBA 2Q4SA 3J8F3 4XJWA 2O8OA 1CJPA 5SV5A 4BYYA 1TQ5A 3DN7A 3PVOA 5AVAA 4M3CB 2XBO3 4QQHA 4CDUC 5H9SA 2HWD2 5FLIA 1WMDA 2BNOA 4QM8A 5DDJ2 3VBHC 3TB0A 3FLPA 3RJRA 3M3CA 3RYKA 1REFA 3MFCA 2PYTA 2P3KA 3VKLA 2VOXA 1LGCA 3O0WA 3KS7A 1NCRA 3WINE 3M3EA 3AZXA 1Q8SA 5D8AC 3ECQA 5FREA 2WNEA 3WUDA 3DL3A 4FXKB 2AUYA 2ES3A 4YVWC 1OPOA 2CAUA 2G9FA 3ZX7A 1PM7A 2VU9A 4XEZA 5BUVA 3USUB 4K1ZA 2PHLA 3ZN4A 1AR62 3AKPA 1N1VA 4XJ9A 1GICA 3ZIXA 3ME2A 4EWDA 4Q4X1 1B35C 1PK6A 4IEOA 1EAH1 3I59A 1OPMA 1DLLA 1MS4A 5E89A 2P3IA 3LCPA 4CDWB 4I02A 2UY9A 4CEWA 3AXDA 3WZ1A 3LSEA 4D7TA 2DTYA 1AR91 1IPKA 4LE4A 4HVOA 4V1PA 4XTMA 2GC1A 2DFBA 2D43A 3VL9A 3OGGA 3WQ7A 2H6BA 1PO21 1ZRRA 1AHSA 2B5HA 2WQZC 4Q0VA 3SCGA 3NV1A 1EY2A 1I5ZA 5L7OB 1OQ1A 2Z5WA 4FPFA 4HPKA 3VKMA 4AG4A 1CAWB 1UU5A 3M3IA 4HKLA 1MS5A 5FO8B 1H0BA 2ZHNA 1Q3EA 2YPJA 5T50A 4HZFA 1WBLA 1C5IA 3AKTA 4COYA 4P9LA 2YMZA 5JPNB 1DFQA 1H8TC 2JG9A 4QQ2A 3KM5A 3BU7A 4HMZA 4XBLA 1RVF1 1FX5A 1CESA 2GH2A 1H2MA 4P9GA 1ZZ6A 3WVJA 4FPYA 2QVSB 3J4UH 4U2AA 3NJZA 4X6QB 2JJ6A 1GYKA 3PTYA 1DHKB 3OCPA 4MSVA 4CEYA 3NO8A 4YGBA 3RJ2X 1T6GC 2HWF1 3IM0A 3S6PA 2WS93 1W6QA 1YIPA 1QXRA 1ZZ8A 1GZ9A 1KFXL 1MR5A 4RR3C 1HRV1 2WNUA 3GYDA 3KT7A 3MF9A 3MIBA </