5DDJ1

Crystal structure of recombinant foot-and-mouth-disease virus o1m-s2093y empty capsid
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
208
structure length
184
Chain Sequence
TTSAGESADPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHTLVGALLRTATYYFADLEVAVKHEGNLTWVPNGAPEAALDNTTNPTAYHKAPLTRLALPYTAPHRVLATVYNGRALPTSFNYGAIKATRVTELLYRMKRAETYCPRPLLAIHPDQARHKQKIVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Foot and mouth disease virus, VP1
publication title Structure-based energetics of protein interfaces guides foot-and-mouth disease virus vaccine design.
pubmed doi rcsb
source organism Foot-and-mouth disease virus - type o
molecule tags Virus
total genus 21
structure length 184
sequence length 208
ec nomenclature
pdb deposition date 2015-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ddj100
2RS11 3VDDA 5AC93 1HRI1 4QPGC 1ND3A 4Y5Z0 5CFCA 1QJZA 3DPRA 3JD73 5K0UC 1HXS1 1BEV2 1QJX3 2BBVA 3M8LA 4Q4V2 1ZBA2 4YVSA 1AR81 3VBUC 1BMV2 4N43B 5D8AA 1PO22 1RB8G 4QPGB 1R093 2RMU1 1RUH1 1PGW2 2RS52 1H8TC 1NA1C 3VBRA 5C4WA 3JB4C 2MEV3 3VBUB 1VBC3 2ZAHA 1V9U2 1AR62 1HRV1 5ACA1 3VDDC 1AYM1 4CEYA 1VBB2 1AR73 3DPRC 1BBT3 1H8TB 1NA1B 4PDWC 1RVF2 4GB31 1PO13 5DDJ1 3VDDB 2X5IA 1QJU3 3DPRB 1VBC2 1MEC3 1Z7S1 4Q4X3 1RHI3 1VBD2 4PDWB 3TN92 5FMOS 3J8F1 4QPIB 4NWVA 1QJY1 1NCRA 1AR93 2R063 4AEDA 4CEYC 1RUE1 1F2NA 2XBO2 3NAPA 1R083 5L7OA 1QQP2 1EV12 1TME2 1D4M1 1PIV1 1FOD2 2R072 1ASJ3 1PGL2 1PVC1 2DF7A 1VAKA 2HWC3 1ZBA1 2RS12 1AL23 1HQNA 1FPN3 1HXS2 4AEDC 2RS51 3ZFEB 1AR82 2WFF3 3NAPC 5L7OC 1OOPA 1V9U1 1VRH2 3JD71 1RUF3 1AR61 4IV1A 4FTSA 2HWF2 4N53A 1RUH2 1VBB1 4NWWA 1RMU3 3IDEA 1R091 1FMD3 5CFDB 4IV3A 2ZTNA 4YVWA 4CEWA 1X36A 5ACA2 1F8VA 1AYM2 4SBVA 2WFF2 2MEV1 1VBC1 1RUG3 3LOBA 3JBG2 1C8M3 1RUI3 4GB32 1OOPC 1AR71 4CDXA 2RS33 4GH4B 4IV1C 1C8NA 2PLV3 2IZWA 1Z7S2 3VBSB 4RS5A 2BPA2 2WZR3 3ZXAC 1QQP1 1QJU1 1TME1 1OOPB 1MEC1 4JGZB 4YVWC 4IV1B 1ND2C 1C8M2 1RHI1 4Q4X1 1VBA2 2R071 1PGL1 4RR3B 5C9AC 5FMOL 4WM7A 2HWE3 3ZFFC 5BNOB 1PIV2 4YVWB 1ND2B 1B35A 1PVC2 1R081 5C9AB 1AYN3 4WM8A 3ZFFB 4CDWC 1VRH1 2HWE2 5FOJB 2HWF1 5K0UB 4FTEA 2HWC1 1RUD3 2HWB3 2BUKA 4GMP3 5AC92 1FPN1 2GH8A 3JD72 4CDQC 1QJX2 3ZFGA 4CDWB 4BCUA 1EAH3 1RUJ3 1ND3C 5CFCC 2WFF1 2FZ2A 2GSYA 1RUF1 3JBG1 1R092 4YVSC 1TMF3 4Q4Y3 4WM8C 5JZGA 4CDQB 4CDUA 5ABJA 5D8AC 1NOVA 1NY71 1RMU1 1ND3B 5CFCB 2MEV2 1CD3G 1FMD1 3VBRC 5C4WC 4YVSB 4WM8B 4RHV3 1AR72 3VBOA 5D8AB 1BBT2 1C8M1 1VBA1 1PO12 2VQ0A 3VBRB 5C4WB 2RS31 5BNNA 3JB8A 1RUC3 1QJU2 1MEC2 4CDUC 2PLV1 3VBHA 4Q4X2 1RHI2 1VBE3 2X5IC 4CEYB 1W39A 1MQTA 5A33A 4Q4W3 4JGYA 1AR92 2R062 1ZBE3 4Y4YA 3VBOC 4CDUB 2X5IB 2HWE1 1HRI3 1R082 1NCRC 2WWSA 5AC91 1ASJ2 4RFT0 4RQPA 3VBOB 1X33A 1QJX1 3VBHC 1AYN1 2HWC2 1NCRB 2RMU3 2WS93 4Q4W2 4AEDB 1AL22 4LLFA 1FPN2 3CJIA 1SMVA 1POV3 3NAPB 5L7OB 4JGYC 3VBHB 1HRV3 2HWB1 1RUF2 1K5MA 5A33B 4RQPC 1NY72 1RMU2 1BBT1 5J96B 4N53C 1NCQA 5A32A 1TMF1 1FMD2 1PO11 2HWD3 2QQPA 1WCDJ 2RM23 4RQPB 1RUG2 4IV3C 4CEWC 3J8F3 1RUI2 2R043 4N53B 4RHV1 1R1A3 1RUE3 2RS32 4N43A 1K5MC 1E57A 4QPGA 2PLV2 2RR13 1AR91 1COV3 2R061 4IV3B 4CEWB 4CDXC 5J98B 2WZR2 1NCQC 2WLPA 3VBUA 4RS5C 1BEV3 3FBMA 1K5MB 1VBE1 4Q4V3 1ZBA3 1VB4A 1ASJ1 1R1A2 4CDXB 4EJRA 1PO23 1NA1A 1OHFA 4Q4W1 2RR12 1AL21 1ZBE1 2RS53 4RS5B 4WM7C 1DDLA 1AYN2 1HX6A 1V9U3 1AR63 1A6CA 1B35C 4PDWA 4FTBA 1VBB3 2XPJA 4WM7B 4QPIA 1RVF3 1RUD2 2WS91 2HWB2 3VBFA 1B35B 1POV1 2Y26A 1EAH2 1RUJ2 1VBD3 3TN93 1M06G 3ZFGC 1AUYA 1RUG1 1RUI1 1TMF2 4Q4Y2 5LK7B 4QPIC 5JZGC 1AL0G 1VB2A 2XBO3 5C8CA 5ABJC 1POV0 1QQP3 3ZFGB 1EV13 1TME3 2HWD1 2BFUL 3ZFEA 3VBFC 4RHV2 2WZR1 1FOD3 2R073 2RM21 5JZGB 2R041 5BNPA 5ABJB 1R1A1 2RS13 3VBFB 1RUC2 1HXS3 2RR11 1COV1 5CFDA 4FSJA 1VBE2 5BNNC 1AR83 5C8CC 1CJDA 1VRH3 2ZZQA 4Z92B 1BEV1 3ZFEC 1MQTC 2HWF3 1RUH3 1ZBE2 4Q4V1 1BMV1 5BNNB 4GH4A 1HRI2 1PO21 3S6PA 5BNPC 5C8CB 1RUD1 3VBSA 1PGW1 4GMP1 5ACA3 1AYM3 1GFF2 1MQTB 5CFDC 1EAH1 1RUJ1 3JBG3 4JGZA 4GB33 2RMU2 2WS92 4JGYB 5BNPB 5GKAC 4RR3A 5DDJ3 4Q4Y1 2BFUS 1RVF1 1Z7S3 5BNOA 3CJIC 1HRV2 3HAGA 4GMP0 4GH4C 1ND2A 1NG0A 5C9AA 3VBSC 1QJY3 1VBD1 3ZFFA 3TN91 1VBA3 3CJIB 5DDJ2 1IHMA 4JGZC 5K0UA 1D4M3 2HWD2 1PIV3 4RR3C 2RM22 1RUC1 1PVC3 2XBO1 3J8F2 1EV11 4CDWA 5BNOC 2R042 2TBVA 1QJY2 1FOD1 1RUE2 1H8TA 1OPOA 2FZ1A 1NCQB 5A32B 1COV2 1D4M2 4CDQA 4N43C
chains in the Genus database with same CATH superfamily
3T2QA 2RS11 5KBFA 4HKLA 3LIHA 3VGIA 2XJUA 5AC93 2GC0A 1W8FA 3SEPA 1ND3A 1Y9QA 3AKPA 3M3IA 1QJZA 5CFCA 3DPRA 2E51A 3ZSKA 2VD7A 4DNYA 5JSRA 5K0UC 4YG6A 4KWKA 4AEKA 2YV8A 2BBVA 3GZAA 5FO7B 1J59A 4WVWA 2VW2A 5IAXA 2BW8A 5JXJA 1S55A 1XE7A 1PO22 3MW2A 5T54A 2C26A 1RB8G 4G9SB 2JDYA 1YQCA 1R093 2LM3A 2W68A 1W90A 2GAUA 3C8XA 1UXZA 2WABA 1O5UA 1PGW2 4LBKA 2RS52 2XUMA 2VOTA 1NA1C 3VBRA 1LAJA 3E5UA 3DYOA 3LDBA 2PHRA 3T09A 2F4LA 1W8ZA 4QXCA 2W95A 4ZZ8A 3ZXJA 1HRV1 1ZZ7A 3MW4A 3I59A 1X8MA 2IXCA 3E6DA 3JQXA 4IEXA 1AYM1 1G6NA 2W08A 5FXZA 4UYBA 1UY2A 2XONA 5A1FA 2P1BA 1XRUA 2WBKA 3BN6A 4H7LA 4K8FA 5EPAA 4EYUA 5FZ3A 1H1AA 5CG8A 5C5UA 4DQAA 2BRTA 5IJRA 3IM0A 2D44A 2B5HA 1RJ7A 5FY1A 3I3MA 4NRMA 4LIUA 2NQYA 5FYHA 1SLIA 3AVRA 1UKGA 4EWDA 5HXVA 5FUIA 2I07B 2DDUA 3IT8A 3DPRB 1VBC2 5LBBA 2TEPA 1YI7A 1Z7S1 3H42B 5DAWA 4Q29A 2FHRA 4PDWB 3DECA 1VP6A 4LEJA 4CDQA 1A78A 3J8F1 4QPIB 1C1FA 3EMRA 5FYTA 2P17A 2FDIA 4GKXA 2GC1A 1LECA 1AR93 2R063 3AM2A 4Q0QA 4LNVA 4CEYC 3MLLA 2G9ZA 1LU1A 2EIGA 2UURA 3V56A 3NAPA 5F3CA 3PTYA 1CWPA 1QQP2 2JDUA 2A6XA 3ST7A 3K4DA 3VKMA 4NHYA 4Y20B 1NQDA 2J1TA 4BH9A 3EO6A 3K46A 2B4KA 1FOD2 1L7LA 1PGL2 4IL7A 1SCRA 2QQWA 4QM9A 3IDCB 5J7MA 3DKWA 3N7MA 3KV5A 4CUBA 3RI9A 3MIEA 2RS12 4HT1T 4XJWA 3S7EA 3VKNA 4LBOA 4M4RA 3WVJA 3OGVA 3RPQA 3ZXGA 1QXPA 5IHRA 4DRVA 2CV6A 3ACGA 4H55A 1XYOA 3E5XA 4XFIA 5DPNA 3IIAA 5ACA1 3ZFEB 2Z69A 2P3JA 4FAGA 3MICA 3WSOA 1UN1A 4PIZA 2GP5A 3JD71 1VRH2 1RUF3 2PHXA 1J1LA 1UPIA 1AR61 4XJ8A 2HWF2 4N53A 4NAOA 1CONA 3TBDA 4H7MA 4OUEA 4NWWA 4YW1A 1Q43A 2C1FA 2YBPA 1BQPA 1WCQA 2VUJA 1NXD1 3H3LA 4P9LA 1FMD3 2J1RA 2ZEYA 5CFDB 2D6NA 1F4AA 2A6VA 4YZ3A 5ACA2 4WVMA 1ST8A 5IYYA 3I2HA 1AYM2 1WW4A 4SBVA 5EJ1B 3VZMA 4O61A 5CISA 3PLQA 2OQ6A 1N1SA 1RUG3 3LPFA 3NNMA 3H1MA 4OQ8A 3LOBA 2Q8EA 3T1MA 3NJVA 3BYWA 4FO9A 3C7GA 1QOOA 4IEYA 4M0NA 3ZN6A 4QX5A 4NPLA 4QMAA 5EWSA 1JTZX 5BYNA 2JX9A 5J48A 1LOFA 1YYNA 2D43A 3WOGA 2RS33 5JOWA 2YGMA 2WQ4A 3BODA 3LF7A 4A3XA 2VZ1A 3I7DA 1Z7S2 2WWUA 4C1WA 4QGLA 2SBAA 2WZR3 2ETEA 1MS9A 1F5FA 3I49A 4IESA 2VXJA 4BPZA 5FDBA 2FCUA 3J7HA 4CU7A 1Y43B 4QB1A 1MZEA 2BYVE 2IVIB 3J9SA 5FMOL 3D6EA 3KV4A 4MGYE 3H7JA 4K40A 4NN0A 4QX2A 2ZGOA 2FBEA 2XDVA 4B7EA 1W06A 2SLIA 3ZFFC 4DIQA 3B69A 4E2GA 1OPMA 5BNOB 2Q30A 2CHHA 4WVMB 4TTGA 4M3CB 2ZGRA 4I3GA 2E7AA 3OTFA 4YGDA 3ZN6B 1IS3A 1Y3TA 4FVVA 1O8PA 4LMFA 2DTYA 3HNMA 3V0AA 1O4ZA 2ZMNA 2HWE2 1TZOA 4YW7A 1Z0HA 1LEMA 5GLTA 2BUKA 4XEZA 4XFGA 4ZS2A 3PU3A 3NMBA 4Z2WA 3JD72 4YG0A 2WO2A 4XYXA 2Z2SB 4JV4A 4CUAA 4BCUA 3NWKA 4LUMA 2UWAA 1YNAA 1QJEA 1NZCA 3WHUA 4Q1PA 5A3NA 5LEKA 4R52A 3V65A 4QGNA 3LA7A 2DCYA 4LPLA 2P4EA 3JBG1 4LHLA 2D97A 4JAAA 2ZX3A 1V6IA 2W46A 2PELA 5DUXA 4WM8C 4YVSC 5JZGA 5K8SA 3O1UA 2MHFA 3VD3A 3BKZA 1DG6A 3WDWA 5C6CA 1RMU1 2YY1A 4HONA 3C7OA 2DFCA 3OBZA 2JWPA 2CGOA 1PM4A 2GDFA 1WW5A 4NIAA 4XQWA 3D82A 3PIGA 1OLQA 3U11A 2ZMLA 3I3QA 3RZLA 2ZGPA 4PQ9A 4RHV3 4IEZA 5D8AB 3J7NA 1BBT2 2Q1MA 3P6BA 2IXIA 3M2MA 2OPWA 1VBA1 1PO12 2JG9A 3ZXDA 2ET1A 4LBQD 5DAQA 2D5FA 4FP2A 1WZXA 3SMHA 4D6RA 2ADEA 5BNNA 4XF0A 4C91A 1GQPA 1S0CA 3LPGA 4LE4A 3VL8A 3I2IA 4CDUC 3UNPA 3TB0A 3VBSB 4E4DX 4ZXKA 1W39A 2YYOA 4N9IA 4QX3A 1TE1B 3POYA 4UFHA 4E4ZA 4AFCA 4LK6A 4UBHA 2I74A 3RYKA 3VBOC 2EVXA 3BPZA 1DU3D 4PJYA 1JOBA 2B46X 2WAOA 1NCRC 1J1TA 1VRBA 3ZM8A 4CPBD 2WWSA 1YQ5A 4HFSA 4GQ7A 2D3SA 3FC0A 5AC91 1CESA 5FUPA 3CQOA 4K1ZA 4RQPA 3LKJA 3W59A 4AI1A 3BI3A 3WQBA 4NAMA 1SZBA 3IMNA 4OCTA 4R9BA 3VBHC 3OG2A 1SHWB 3IN9A 5H9QA 2H6CA 5DZGA 2RMU3 3AMHA 3AP4A 4Q4W2 2YB7A 1EPZA 4XJAA 1HJGA 2JIGA 4KNCA 2Q1ZB 2P37A 3N7LA 1LRHA 1S2KA 4JGYC 3TWIA 3TYJA 4EROA 4FAHA 1DQ0A 2LS6A 2PMWB 3DUIA 1W2NA 3WG3A 5CKMA 3MZHA 2HWB1 2B9UA 4AZZA 3BIEA 1DYOA 4JDOA 4WZFA 5HBAA 1QDOA 4EN8B 1PMIA 3PTRB 4JVAA 2IXJA 1RGSA 1UOJA 3OD4A 1RMU2 2IXLA 1C5HA 1S0DA 1CAXB 3O1RA 4MGTA 3LZZA 5KXCA 5CAZA 1NCQA 1UYXA 1HQWA 4IW3A 4NE9A 1ULFA 2DURA 4UXAA 4P08A 3POWA 4B7KA 5IFPA 4NRPA 4H3WA 5FQ0B 1SPPA 4RQPB 3DYMA 4CEWC 1IG3A 1HN1A 2VNRA 1RUI2 5K4LA 2R043 5BV6A 5EV7A 5DQ0A 3AYCA 3FFZA 3OGGA 1C28A 3P5BA 1W03A 2BNOA 3PNAA 4N43A 4HK8A 1WGPA 2W9XA 4U2AA 4XFHA 5FMBA 3WX5A 4XDPA 2XLFA 3ZMNA 2RR13 1AR91 2R061 1LULA 4GKYA 4IV3B 3N9OA 4L8QA 2BNNA 5J98B 4CDXC 5JR2A 4E8CA 3ROUA 3BGAA 2DVBA 5JIUA 4IE5A 1CX1A 2FDFA 4KWUA 5IFTA 4ZHNA 4XFAA 4PBPA 4LOTA 1VB4A 2FMDA 2YC4A 2E9QA 3LEMA 5HCAA 1PO23 1H1MA 1NA1A 4L11A 5CB7A 1GYKA 3AMNA 2ARCA 2E26A 4FQZA 2RS53 1H9PA 4RS5B 3MIHA 5F39A 2D3PA 4G4FA 4O7XA 4AAPA 1DDLA 1V6LA 3K77A 1N3QA 2ZGTA 1YI9A 4UFJA 3WNPA 3G7DA 2KXLA 3QACA 4KGQA 1FT9A 4P9YA 4JDNA 1LNSA 2E33A 2CU5A 2VZQA 2EAAA 2ZX1A 3D0JA 1RUD2 2P6CA 2PTMA 2WS91 2HWB2 1Q8SA 5FPUA 4AVVA 3C7EA 1B35B 4NPRA 3GALA 1YFWA 2QQMA 2VCMA 2ZHMA 5LBEA 5J3UA 2W87A 3BU7A 1JZ4A 2BGCA 3SKJE 4QGMA 1OH3A 1I5ZA 4LTAA 4OQ9A 5CBLA 1P8JA 2TUNA 1M06G 3ZFGC 1RUG1 1J58A 4Y3OA 2YDEA 5CYYA 1ULOA 1GP6A 2AUYA 2PHFA 4YRDA 4D94A 4RA0A 5SV5A 1V00A 4QPIC 1S0JA 3H50A 3I8TA 4SLIA 1IG0A 3MUZ1 3PVNA 1W2OA 1ACCA 2AYHA 5ABJC 1KFXL 1DQ4A 4YFZA 2VGDA 1QQP3 4AF9A 4K7JA 4XF4A 2HWD1 2BFUL 3WNNA 4D69A 4Q0SA 4UW6A 3RZMA 4LXLA 4UI9L 2IXHA 5A80A 3VBFC 2WZR1 1FOD3 1AXYA 1O7FA 4BQ3A 5H9PA 5FBJA 1S2EA 5LRRA 4BE3A 2RDRA 2OA2A 3AC0A 5FZAA 3GYDA 2F4PA 1W04A 2UY8A 2Q8DA 4COZA 5F7UA 2R16A 2WWJA 1R1A1 1JS9A 2RS13 4ZU5A 2BU9A 5FYBA 3MV01 2JJ6A 2R0FA 3FL7A 1FX5A 1DQ6A 1S0BA 3FN9A 1WKYA 4LA2A 3TNPB 3WP6A 4FSJA 5T5JA 2D6KA 4DEVA 1JU4A 1CAWB 2B39A 4YW4A 2XR4A 4N7IA 1VRH3 3B00A 3M70A 3ZFEC 1Q3EA 2DVAA 4IEWA 1QJFA 2HWF3 1ULCA 3GXUA 4Q4V1 2B45X 4QHZA 1BMV1 4AAXA 4ATEA 1CX4A 1W6MB 2GP3A 1IKPA 4BLIA 4RYDA 1VIWB 4P5YA 1FV2A 2JICA 1QU0A 5KHKA 1UL9A 3IIIA 1Z78A 1ULGA 1XNAA 2BJSA 4NR1A 1WLCA 1AYM3 1GFF2 2WNUC 1MQTB 4RN5A 1IS6A 1FV3A 2DV9A 3PVEA 3AYAA 4XVHA 3C7HA 5CFDC 4CCOA 2BWCA 3POJA 4JGZA 2HJIA 3RWNA 3RZHA 2WS92 3GZTB 5JXGA 4MG2A 4NRQA 5JCTA 2D6OX 1QKQA 4OHVA 2OW4A 4RR3A 1O4YA 1PK6B 3P1IA 1DGWX 4Z07A 5FY9A 1GWKA 2K46A 4F3JA 4FBFA 4IGQA 3D4KA 2LTNA 1RVF1 3OPWA 5JI9A 4XACA 4XZUG 1Z7S3 2W1UA 4QD2A 1OKQA 2ZGNA 3HAGA 3ZPYA 2XWJB 2VCBA 4IEPA 1JYIA 4AGGA 3KT7A 1WBLA 4COVA 4A41A 3WDVA 3ACFA 3BTZA 3AP9A 3ZFFA 3TN91 1W2TA 1UW8A 4FI9A 4CCCA 2AEYA 1NQJA 4AHXA 2HWD2 3CHXA 3ORJA 3RS6A 4NHXA 4I3PA 2YPJA 2VW0A 2CDPA 4I0BA 4D6QA 1HB3A 1EV11 4D7SA 5BNOC 2BTVC 1DQ1A 3AMMA 4FOVA 4CP9A 2Y38A 2ZKLA 3HVDA 4XILA 1JU3A 1OLME 3ABZA 5LASA 5FZOA 3EB7A 4URTA 4W50A 1U5IA 1OC1A 1ODMA 2ZKNA 3K3OA 2ES3A 5EYYA 1D4M2 2HH9A 4S2GA 1MACA 4DS0A 3KQ4B 1MS8A 3B9IA 4BQYA 5FY4A 3VDDA 5FZ6A 5JDBA 1DZTA 2WO1A 3HWJA 2VOWA 4Y5TA 4AFBA 3JD73 1WD3A 5A6QA 5FYUA 2EIEA 2NM1A 5A6XA 2ZA9A 2JDZA 3M8LA 5I8YA 1UY0A 1UZ0A 2JB4A 4Q4V2 4YVSA 5EYXA 1AR81 2W1SA 5FP3A 3VBUC 3MEPA 1BMV2 1X82A 1G9FA 3SCHA 1T2XA 4QPGB 2RMU1 3RDIA 2Z4FA 1RUH1 1LEDA 3G6JB 1W8HA 1H8TC 4IXLA 1REFA 2QDNA 1J84A 2Y6FA 1WMFA 3ELNA 3JB4C 4QX1A 4CCMA 2GC2A 4ARXA 3CLPA 4ASLA 1BYHA 4YGEA 3K51A 2KM2A 5LBCA 2A3XA 1CN1A 1OUXA 1KEXA 2W94A 5BPXA 4A6SA 1BBT3 5IVEA 4NOTA 3J7MA 3FUOA 1DQ5A 4RSUA 5F6KA 1RVF2 1UIKA 1BLZA 1PO13 5FPVA 5FYSA 2XB6C 3AZWA 5E89A 5DDJ1 3VDDB 5LA1A 2VUCA 5L9VA 5C3OA 1CPMA 2CYFA 3K4AA 1W9TA 3KT1A 3N7KA 4QQLA 1LENA 5EZWA 3TN92 4P5HA 3ITQA 3WP3A 3S5QA 1YLLA 4C8DA 1GQHA 1ZX5A 4NWVA 4AXOA 4J6GA 3V0BA 1QJY1 4UT5A 1NCRA 1F35A 3O1OA 4AEDA 3HT1A 4DFSA 2GH2A 1UIJA 2NMOA 3IDAA 1NAEA 1K3IA 5KXEA 3HQUA 2C5DA 4HN0A 1JODA 5L7OA 1EV12 1BK1A 3WF4A 1PIV1 1FNZA 2VMEA 4DPNA 2R072 4XF1A 4AI8A 1LJ7A 2UWCA 1PVC1 2VUDA 2WNVC 3B9CA 4JQTA 1VAKA 3BCWA 4ATFA 1DGLA 4XCBA 5H9SA 4XUOA 3I54A 1G9DA 3KCXA 4HZFA 3FHAA 2Q0AA 1MS4A 1CAVB 1LCLA 4MHRA 1CIYA 2XVGA 2VZUA 2QBXA 2RS51 5C71A 3AKSA 2DCJA 1OF4A 4GJZA 1AR82 4LKFA 2VTFA 5JIAA 3AZXA 4YFWA 1GNZA 3NV4A 2J1EA 3ASIA 3DN7A 2BV4A 4IV1A 1QIQA 1UO9A 5FXXA 4EWAA 3V0BB 1RUH2 2ZGLA 5CU1A 1GNHA 1HJFA 3T0DA 4HG6B 4XJ9A 1RMU3 5JOZA 3T0AA 5FPBA 2ZEWA 4CE8A 3KCYA 3PDQA 2Y34A 1F31A 4YVWA 1UD1A 1X36A 2C9KA 3D8CA 1QNWA 4CEWA 5B2GB 2OX0A 3PJYA 1D2SA 2WFF2 4Q8LA 2MEV1 2VUAA 1VBC1 1DIWA 1UZYA 5FPLA 2YU2A 5FY8A 4CCEA 1RUI3 1GICA 3UGHA 1VE0A 2RDNA 3AL6A 3URFA 1XNCA 5GZGA 1ZREA 1YQ8A 5F9TA 1OOPC 1AR71 3EXUA 4CDXA 4GWMA 5DABA 3VZNA 3ZDSA 2IFWA 5KHIA 5HCFA 2A1XA 1L3JA 3LB9A 4V1PA 4ISRA 3CEWA 3GHNA 2BPA2 2JE8A 4TXWA 5IAVA 3ZXAC 3MUY1 3OJBA 4XUNA 1QQP1 1QJU1 1C3HA 2XGXA 3NV3A 1MEC1 1ZYBA 2JG8A 3BPSA 4IV1B 1ND2C 3ZOIA 1C8M2 1RHI1 1SLAA 4FXGB 4NIIA 3T0BA 1XSQA 1PGL1 1UYPA 5C9AC 2XL7A 5F5QA 4DEQA 3RWKX 3A22A 3ZIXA 4K20A 2NPIA 1PIV2 2RG4A 1DCSA 5FP8A 4EN7B 4YVWB 3NKGA 3MLJA 3ZX7A 2YBKA 3E97A 3MW3A 1PVC2 5GLWA 1R081 1SG3A 1PX4A 2QVSB 4MSVA 5I0UA 3KGZA 4AWDA 2VAUA 5IK7A 3ILNA 3O7OA 4W8JA 5CZKA 3AJZA 3N9MA 3NNLA 4LO8A 1YQ2A 2ZGKA 3VLBB 4IUGA 1VRH1 2W1QA 4CDWC 2WC2A 1NT0A 4NHLA 5GZFA 3EYPA 1BJQA 2HWF1 3HQRA 2VULA 4FTEA 2HWC1 1RUD3 2ID4A 2ADDA 2ZMKA 2W3JA 2G4IA 2CAUA 3EHKA 3QOPA 5FMCA 2HWB3 1YIFA 4GMP3 4HBNA 4JKMA 5AFEA 1FPN1 2R7EB 4AYUA 4XJZA 1LOAA 1D7PM 1KQRA 4AEMA 3ZFGA 4W6YA 2VMIA 5I0TA 3THTA 1N3OA 5C70A 4XMIA 5J37A 1MS3A 3FLRA 4XUPA 3NJXA 3JUUA 2GSYA 5JSPA 3FJSA 2WO7A 3THCA 3VHOA 3WG1A 1YC61 3W58A 3WDYA 4CDQB 5ABJA 5HXMA 3A0KA 3U75A 1NOVA 3ES4A 3U78A 2VQAA 1ND3B 5CFCB 4HSJA 2MEV2 1KJLA 2WO3A 1CD3G 3VHRA 3DL3A 4OI0A 3A4UA 4XTPA 1LGCA 5C4WC 1XBFA 5FYYA 3UK9A 3LQCA 1GZWA 3NNGA 1AR72 3NJZA 4R9AA 2JXAA 4COYA 4LO4B 4FXKB 5FZ4A 3PVOA 1E5IA 4AFAA 4A44A 1VAVA 1H0BA 2D6MA 2VZSA 4L0PA 4BXSV 3GZUC 3VBRB 3OUHA 3M3CA 4YM0A 1QJU2 1K45A 3OOXA 2G1MA 1LOBA 5F32A 4QXKA 1MEC2 2KR2A 2MPFA 1FYUA 3WQ1A 1NYWA 2OXBA 3ZMOA 1RHI2 4B8EA 3I59B 1K42A 2X5IC 2FDHA 2QQJA 4D7TA 1D0HA 3A0NA 1C4RA 3GHMA 4YLZA 3B94A 3VD5A 3A21A 4J25A 4KWJA 5A33A 5FBZA 3VHPA 4KBZA 3WCSA 5FOBB 5JWPA 1H6YA 2GMPA 2NP0A 5FZ8A 3PMEA 5T5OA 3PUSA 2VTXJ 2BVBA 2ARBA 2ZAAA 2HWE1 4YW5A 1R082 3TAYA 2HBTA 1APNA 1YXWA 4HVOA 2OKXA 3TEWA 1I5PA 4LORA 1I9RA 1N1VA 5IK4A 2VCAA 3K48A 4OMDA 3IZOA 3BTXA 1GZWB 3GCXA 2FDGA 4ES8A 2RDQA 2WUHA 2YBSA 1W9YA 2B42B 2HWC2 4HLTA 1DBNA 4GALA 2WS93 4AGVA 1AL22 2QQLA 2XHKA 5FP9A 1T6GC 1FPN2 2Y8KA 2YC0A 4LK7A 1SMVA 3NAPB 1SLLA 4Q1RA 4CCLA 4OI2A 1DGWA 3N4MA 2WZPP 4JHTA 3TRSB 3BUCA 1LOGA 1OT5A 1IS5A 2XH6A 1OFNA 1OQEA 4HETA 2WLQA 5A33B 1XC6A 3LCPA 2UU8A 1F4HA 5FLHA 3PHMA 2ORXA 1BBT1 3DV8A 4P02B 2W1WA 3UV9A 3FHQA 3OEAA 2VQUA 1L7RA 2XVLA 3WR0A 3WQ7A 4A6OA 5J96B 2A7AA 1JHJA 1EYBA 1WUVA 3SITA 3T3YA 1PO11 2HWD3 2WYSA 5F5AA 2QQPA 2R0HA 5G05L 4YGBA 5C7GA 2F17A 2GZWA 1O6UA 4QX0A 4UFKA 1O3RA 2W39A 1A34A 1H9WA 3FUQA 4S2FA 4JX0A 5KHJA 3H3UA 2V72A 2VVFA 3RZGA 2ZEXA 4N53B 3J26N 3UJQA 5KC5A 2PAEA 2WSUA 2J1SA 1R1A3 2D98A 1EY2A 3LEKA 4MV2A 5I0RA 1UWWA 3H3ZA 1K5MC 1O3SA 3FX3A 1E57A 5LY1A 2PAMA 1W6PA 4WVVA 2WZ8A 2GC3A 5A1AA 5IVCA 1IPKA 3ZXLA 2WR9A 3OUIA 2RJ2A 4PQQA 2WLPA 3QBQA 3T2TA 3VBUA 1MS5A 1SACA 3M4FA 3OPZA 4LUKA 4X6RB 1WCKA 2XJQA 4MYEA 1LR5A 2J1UA 1VBE1 4Q4V3 1G9BA 1W6QA 1BVVA 2GNMA 1FNYA 4RL7A 1JMUB 2HKXA 4BM8A 1O5LA 4Q4W1 3I2OA 1LTEA 4A4AA 1GUIA 3SLIA 4MGIE 3H1YA 1H2KA 4WM7C 1J3QA 5L19A 1REEA 2AH2A 1WCUA 1Q8PA 1ZVFA 3LWCA 3ZIWA 5LW9A 2W5FA 4XFBA 1G9CA 4GZ9A 2FDJA 1WW6A 3AMQA 3WW3A 4EN9B 4IEOA 3ZKYA 2OPKA 4OI4A 5FXWA 5FIXA 1HB2A 4ITCA 5FZMA 1HV0A 4J1WA 5GZCA 4XC9A 1RVF3 1ULEA 1W6PB 1Y9MA 2WNEA 2IFRA 2VH9A 1XQNA 1KS4A 3CKHA 1N3PA 3MF6A 1POV1 3RMXA 4QPYA 5DAVA 3ZSJA 5I93A 1ALYA 2QCSB 1RUJ2 4XHBA 3BIWE 1XNKA 5A7SA 1YUDA 3TN93 3H8OA 1AF9A 3V0AB 1UPSA 2UYBA 1QNYA 2D6PA 1V70A 1RUI1 2VMGA 1OBNA 2RE9A 3K75B 1Q5OA 4PLMA 4Q4Y2 1SFYA 1MZFA 2VZRA 2Y0OA 2C4XA 3QH6A 5LK7B 3AMPA 3OUJA 2ZJCA 3U14A 2WT2A 4IE0A 5DMYA 5C8CA 5E8AA 1EV13 4AVTA 2E53A 2HEWF 2AREA 3CJXA 2TNFA 4CUCA 2Y60A 4JTOA 2OVUA 1DHKB 3AP5A 4O9GA 2R073 5FPAA 2RM21 4ORFA 3UGFA 3ZXFA 4Y5SA 3Q9OA 3LA3A 4J1XA 3MDPA 4L92A 1RYYA 5FJKA 3VUOA 4DMIA 3OGJA 5JZGB 2DCTA 2R32A 4H2AA 5BNPA 1UX6A 5FKBA 3ZKUA 3O12A 3MI8A 2QJVA 2C24A 1DP0A 2WKKA 4FOYA 4OUSA 4BYYA 1XU2A 1X7NA 5I8TA 5IATA 1ENQA 4ASKA 3OD0A 1COV1 4XZPA 1VALA 5FYIA 1VBE2 2ZX2A 2P2KA 1LGNA 3JXSA 1AR83 4M3CE 4BWOA 3R0RA 1DZQA 1GQGA 1WMDA 1GANA 3IBMA 3T2PA 4AQSA 1GOGA 2VVEA 4FPJA 2ZZQA 1SFPA 5I0DA 4LIVA 1BEV1 3A23A 4YYOA 3OPTA 4G3YC 1UOFA 2JG9B 3R4DB 1AX2A 1RUH3 1QGLA 4BQXA 4EZHA 5IVJA 3B93A 2EALA 4HKWA 3AYEA 5BNNB 1JHNA 4GH4A 5A3OA 3ZPOA 1HRI2 3S6PA 1C57A 2JD4A 2AEZA 4XQ4A 1OURA 5C8CB 1RUD1 3NNJA 4XPVA 5FY0A 4TN7A 3VBSA 3R05A 4I01A 4GMP1 4H14A 3LDRA 3ILRA 4PIXA 1ZRIA 2BVVA 5LEJA 1JZ7A 5FZHA 3K4ZA 4XF3A 1YWKA 4BJ0A 5FZDA 4XBNA 3OEBA 1OD5A 3I2DA 1RJ8A 5FYCA 1DGRA 5FZ0A 3E1F1 5BNPB 1GMMA 3I2JA 3L9JT 5DDJ3 1MVEA 5I8SA 2O14A 5JVVA 5JOYA 3CJIC 1SCSA 4MGSA 1GBGA 1ND2A 4CUGA 4W6XA 5DAPA 3EQEA 5FXVA 1UMHA 5C9AA 3AFGA 2Y6LA 3O14A 5A7NA 2JENA 3LD8A 4Q8KA 1QJY3 1MS0A 1XOYA 4PF5A 5IVBA 4HKOA 5A3MA 5B4XA 5FR3A 1VMFA 1W2UA 2QQUA 1IOAA 1IHMA 2LUWA 2XLAA 4QWNA 4FFIA 5K0UA 4CP0A 2PQSA 1PIV3 4COWA 1OVPA 3RJ2X 1CZSA 2DUPA 3TOJA 1O3QA 2DBNA 1OXCA 1VMJA 2RM22 4DINB 1YHFA 3H8XA 4EN0A 1PVC3 2XBO1 3U37A 3B01A 2JECA 1NXMA 1QH6A 4BLJA 4CDWA 4D3WA 2O1QA 1YO8A 1XU1A 3FLTA 4NJ4A 1E5SA 4DXZA 1RUE2 1BVP1 1RXGA 2PYTA 4QKNA 5CKQA 2XXZA 4AL9A 3BTYA 1XXNA 5FUNA 2FZ1A 3RJRA 3WNOA 1NCQB 4CYDA 2XUEA 4IDZA 4BK5A 1COV2 4A42A 2Y6KA 2WFPA 4AVAA 4RGGA 3CDZB 4A2UA 5CKNA 4XXPA 4IERA 5DUUA 4YM1A 1IZ3A 1SPPB 4Y5Z0 5T52A 5IT6A 2EICA 2W92A 1HXS1 2I45A 2ORZA 3RG0A 1BEV2 3UL2A 1XNTA 4JKLA 1ZBA2 5EIYB 1SBFA 1MVQA 1QXJA 1O8SA 2QUOA 1O3TA 3KV6A 3FWEA 3NV2A 4N43B 3H1WA 1PZ8A 3TNQA 4DY5A 3LEIA 2P3IA 3DCQA 1CAUA 4QHOA 2X53S 1WBFA 1GU3A 2R1BA 4HVQA 2QQIA 3E5QA 2VG9A 1GZCA 1W0NA 5C4WA 1L7QA 2ZCWA 4OFGA 4KU8A 2MEV3 1VBC3 4U36A 3RYPA 1V9U2 2J42A 1LESA 3M7AA 1FATA 4XOGA 3U07A 1H2NA 3CZUA 4CEYA 1N1TA 1VBB2 1AR73 3DPRC 4FFFA 4BB3A 2V5DA 3F95A 2JDMA 2GN7A 2GN3A 1GWLA 1NA1B 1OLMA 2HLEA 4LBQA 4LO5B 4C0HA 4HOOA 2VMCA 3BTAA 4PDWC 3VZJA 4LBJA 5JMOA 2E7QA 2JKBA 4OZOA 4ASMB 5CADA 2X5IA 3KVAA 1QJU3 3AX4A 3RI8A 2YGLA 1MEC3 3FHIB 2FD8A 4AI9A 3HJRA 1RHI3 1QXRA 3GJBA 3ZLIA 1ZRDA 3S5AA 4RGKA 3MV11 5FMOS 3TEXA 3BOWA 4OYUA 4XXAA 3WLUA 4HK9A 2DVFA 4AI0A 1XPWA 3M3QA 1HB1A 2BQPA 1K12A 4NROA 4CPBA 4QX7A 1F2NA 4FP3A 3VDBA 3THDA 2J1AA 2XBO2 3SHRA 3UKVA 5CEHA 1R083 3WNMA 1TME2 3KHBA 1D4M1 5IVYA 1TNFA 4A45A 4MGZE 3ZYRA 4HPKA 3C7FA 2OS2A 4M01A 1W6OA 1XE8A 1TVGA 2DF7A 4QDSA 3OY8A 4B3NA 1IS4A 4LBQB 1TQ5A 2NMNA 4XDQA 3NNFA 2HWC3 1DQ2A 2JE9A 4C1XA 3UYJA 1AL23 3W5NA 1FPN3 3ZYBA 4A7ZA 1HB4A 5A3LA 1HXS2 4KWLA 1PVXA 4CP2A 3VL9A 1G86A 3W20A 4PT6A 2DCKA 2Q1FA 1UU5A 2AGSA 4N9HA 5FTTC 2YG0A 3NAPC 5L9RA 2VM9A 4KL1A 3S0MA 3AKRA 4Q0PA 5A6ZA 4XBLA 2BP6A 1KDMA 3O1PA 1UXXX 3GCWA 1ENSA 4I30A 5C5TA 2ERFA 5JUVA 2B8MA 4N7UA 3AP7A 3JZVA 4UAPA 3BALA 1LKNA 3IDEA 4LO6B 4V2VA 1C1LA 3RZKA 4JDMA 1VPHA 1W9FA 3FE5A 2RJLA 3LOIA 4OI1A 3UGGA 4GAZA 2LW8A 1JZ2A 2ZTNA 1F8VA 4MZUA 4C90A 2V5YA 5BNQA 4B1LA 5FZFA 3U0ZA 2K9ZA 1JZ3A 3GBGA 1VAMA 2OUHA 1PX3A 4MX3A 4UW3A 5F2WA 3FZ3A 3H7YA 1W8NA 1YCIA 4FPOB 1OA2A 3DKQA 5E88A 3VB9A 1LB2A 3ACLA 4AG4A 3VD9A 2DUQA 4D8MA 5FP4A 5A7PA 4PCRA 5A3TA 3C3VA 5FPXA 4IE7A 3RFRA 1UKRA 3UETA 2P6HA 4TSVA 1Y9GA 3CIHA 4JKKA 3WF3A 2DBIA 3AKTA 2B7YA 2VPVA 1WLWA 2QDRA 4HVRA 1NLSA 2VL4A 2GMEA 3AZYA 3LDKA 4HANA 4JGZB 3ZO0B 4Q4X1 1CGPA 4NUBA 5L73A 2R071 4L99A 4RR3B 4QQ2A 2OYZA 4AVSA 2C0ZA 4W4ZA 4WM7A 4LBMA 2HWE3 2WNOA 3GM8A 3MPBA 5LY2A 3WF2A 1WLTA 4BHPA 1XE0A 4EZ4A 4HSLA 4BOWA 5C33A 4N8MA 2R6QA 1N47A 5AVAA 3O1TA 1G8WA 4XABA 3ZR5A 3PIJA 1GSLA 4EE2A 5LZ6A 4MXWA 5DAXA 3GDBA 4WM8A 5IUQA 3W21A 1ONAA 3ZFFB 4B4QA 3USSA 1JZ6A 2IWGB 5EJ3A 3RQ0A 3SC7X 4P14A 4P9JA 2E63A 4P9XA 2J7MA 3WF1A 1A8DA 1SBDA 2PAKA 5M0TA 4PI2A 4QB2A 1H8VA 1H2LA 5FOJB 1H4HA 3RZZA 3ZYFA 2CGPA 3H8UA 5A3UA 3HN1A 3RNSA 1US2A 1UNBA 1HV1A 5FY7A 1GOFA 2GH8A 3KCCA 1S0IA 2EXIA 3PUAA 2BWAA 3O5SA 2ATFA 2P3YA 1QJX2 3LSEA 3HPNA 2G9GA 1SQ4A 1W6NA 1RUJ3 4IGOA 4LBLA 4CP9B 5HCHA 5LK5A 3SH3A 3F2ZA 2WFF1 2FZ2A 1UYYA 5FZOB 1UU4A 3N9LA 3AFKA 5JI7A 2NZ9A 4Q4Y3 1KS5A 4CDUA 5D8AC 1RL3A 4CXXA 5FZ9A 3ZN5A 3WD5A 4NIHA 5F3GA 2FMYA 3N9PA 3GJAA 4YVSB 1R64A 3I3EA 4WM8B 3WEZA 3Q8FA 2RDSA 4Y1UA 1OD3A 2XJPA 2R49A 1SLTA 2D5HA 5T55A 2V09A 3RYRA 3VKOA 5IVFA 2YMZA 2ZEZA 2CWSA 2Y64A 1AX1A 1C8M1 2Y6JA 2VNGA 5A7WA 1RUNA 1UU6A 4HMZA 1ZM1A 5FMDA 3BOPA 1PMHX 2Y6GA 3KT4A 3WW1A 2RHPA 1JYVA 3KLSA 4KI5M 4PF1A 3ZN4A 2BBAA 2PLV1 4XETA 3VBHA 1C5IA 1WLDA 4Q4X2 1FI2A 1W6NB 3NSTA 1VBE3 1EUTA 3VN4A 5LCWL 2GNBA 2O8QA 4AVBA 2A6YA 2VMHA 3I4IA 4Q4W3 1PZ9A 4FPEA 2BDRA 4JGYA 5C3PA 4Y4YA 4CDUB 3AP6A 1S2BA 2BEOA 1LHWA 1ULDA 3WNXA 1HRI3 2VQTA 5KWRA 2JB8A 2Q5TA 4AQTA 5JMCA 4YW3A 4BMEA 4E4HA 3GBFA 3M1HA 4XIOA 2JE7A 4XQDA 1PNGA 3OSDA 4K9SA 5FO9B 1ASJ2 3VBOB 3CO2A 1X33A 3FBYA 5FLIA 1AYN1 2YUEA 3ZYHA 5D2AA 5KC6A 4P00B 1NCRB 2LALA 5A7WB 4AEDB 2JD9A 3KVBA 3R4SA 4LLFA 1BHGA 3U4XA 3CJIA 4ZU4A 1JZ8A 1POV3 2JDPA 4ARYA 3MLKA 1UY3A 4BK4A 3MPPG 5L7OB 1X50A 2Y33A 5AVPA 4QDRA 3VBHB 2QE3A 3TEYA 2ZGMA 4GA9A 1PNFA 1ZZ6A 4Y22A 4M4PA 1W28A 4URAA 5E6HA 3KF5A 3MIBA 1DLLA 1JW6A 3POFA 3WQ0A 2FCTA 5IVVA 4N90A 1BZWA 1NLRA 2WDBA 3OBTA 4RQPC 3WG4A 2Q4SA 3O0XA 5FK7A 5FWEA 2CGNA 5A32A 2A70A 1TMF1 2EXHA 3IPVA 2BGOA 4R4ZA 3OGSA 2EIDA 4UOJA 5C3RA 5DUWA 5FZKA 5ISLA 1E5HA 3E6BA 2RM23 5GZEA 1V6KA 2QQOA 4IV3C 4OVEA 4ZY9A 5BY5A 1ZA4A 1OF3A 4XCAA 1XYNA 3ES1A 4YW6A 3U4SA 4ET7A 1UOGA 1U0AA 3E6CC 2WQZC 2W47A 1ZNPA 1RUE3 3ZVXA 4PI0A 4V2WA 3WHTA 4QHBA 2ILMA 3ALQA 1H30A 3TEZA 3MHZA 4Z1VA 2PLV2 1COV3 1B09A 2XQXA 4CEWB 2VR4A 3AKQA 4RGAA 3FFQA 2NLRA 2GMMA 1YFXA 4DRRA 1ZZBA 3D0SA 2FDKA 5FKCA 4YARA 1NCQC 1V6NA 1WWYA 5CA6A 4RS5C 1BEV3 3FBMA 3EJKA 1OA4A 4UFMA 3UESA 4IQPA 1DFQA 3PUIA 1ZBA3 3KHCA 3SXWA 1CPNA 1SEFA 1W9SA 1REDA 4TLFA 4CDXB 1OHFA 4DY3A 5GALA 5L36A 2HYXA 2ZOEB 2ENRA 2RR12 4WVZA 1AL21 1ZBE1 3BVCA 1LGBA 1PM7A 1VLNA 1W3VA 4K3UA 5FPZA 1FXZA 3M3OA 3SISA 2EA7A 2YZ4A 4LHNA 4EQVA 4B1MA 1AYN2 3OB8A 1HX6A 1V9U3 2JG8B 2QFEA 2UWBA 4K21A 2ZACA 4X8PA 3HBZA 1B35C 4PDWA 2DYCA 4Y1XA 2NN8A 4FTBA 4YGCA 1VBB3 2XPJA 3LFIA 3RMYA 4CCKA 1QOSA 1QH7A 4QPIA 5FWJA 1MS1A 1W0OA 3GNEA 3J7LA 2F6BA 4CSWA 4JTNA 4ZKTB 1BKZA 4LITA 4CVUA 1S0GA 3VBFA 2ZPXA 2VCCA 3T4HB 5KHGA 2PA7A 4TWTA 4FPLA 1JBCA 1EAH2 4N43C 4Y20A 1JI6A 2EAKA 5DXDA 4Q5OA 5EJZB 4GULA 5IWFA 2Z79A 2E7TA 2V4VA 4FPCA 4F83A 1UZVA 4ZU7A 1TMF2 5ACA3 3IAPA 1WA6X 1RXFA 5E16A 2UY9A 2O8OA 4JRAA 1IKQA 5J36A 1G7YA 4OLLA 5FYVA 4AEJA 2C9AA 1AL0G 2XBO3 3H0OA 2W0XA 3NRUA 1UF2C 4YG3A 1TME3 3ZFGB 4F8AA 4P9IA 4Y24A 3JCIA 2A3WA 3ZFEA 3T1LA 1YJKA 1YEWA 4MO3M 3I2GA 3CF6E 2A6WA 1OQDA 2VOVA 3HOBA 1OFSA 3OBAA 5FK8A 2D93A 4KU7A 2LRPA 5FFOC 5ABJB 3A7QA 4BXFA 2WNUA 2WSVA 4ZONA 3VBFB 1RUC2 4HN1A 1HXS3 2ZZJA 2VBDA 5CFDA 4COUA 1D2QA 3WINE 4ONUA 1OUSA 4OZXA 3RGBA 1UZZA 3L2YA 5FZIA 3MO4A 1LHUA 1WW7A 4Z92B 3S7IA 1IQDC 3P3PA 5ANNA 4JCKA 3WUCA 1MQTC 4META 2ZABA 1ZBE2 2DUOA 5HV4A 1KXGA 1A3KA 4IEQA 3IDBB 2CSGA 2P5BA 2WT1A 3POBA 1W99A 4FPFA 4R8HA 4XJUA 4NMIA 1NKGA 4CCJA 3B7MA 1PK6C 5DZFA 2FCVA 2HEYF 1IPSA 5FZGA 4R9DA 3HN3A 1WMXA 2Y6HA 1HN0A 4LR4A 1ZRRA 1RUJ1 2W91A 1AXKA 4A3ZA 2V4AA 5I91A 1LODA 1V0AA 1JUHA 2DTWA 4OHYA 3KF3A 3I3DA 5LRSA 2BOIA 3UT0A 2CWMA 1J3RA 4E8DA 3VV1A 2WNUB 4IEUA 2XJVA 1OSGA 3ZXEA 5D21A 4Q4Y1 3V64A 1XSRA 5IW0A 3O1SA 4PHZA 4YPJA 3KD4A 5BNOA 1HRV2 3ZR6A 3I3BA 5EP9A 3MFCA 3UJOA 1NG0A 4M3CA 3B5LB 3U10A 4QPWA 1CJPA 1MR5A 1VBD1 1OVSA 4DXSA 3H8RA 4JQRA 2VBPA 1BCXA 3WUDA 1SLCA 4Z82A 1PMJX 4JGZC 4MH0E 1MZ6A 4XF9A 1D4M3 5FAXA 1NUKA 4Q26A 1WD4A 4FPHA 3POEA 3UKTA 2XJTA 4RR3C 4BIFA 4Q0UA 1CR7A 4DB5A 3VZOA 2ZXQA 4UW4A 2WN3A 3MGUA 3N9QA 2YROA 4UFLA 3ZDVA 4YZ1A 3BU0A 2CY6A 2VJXA 3J8F2 3ECQA 2QQNA 5A3WA 5L9BA 1O4TA 2XL9A 2TBVA 1TG7A 5A1LA 3CNAA 4DOUA 1UCXA 3ETPA 4XIKA 3PUQA 1KGYA 2AENA 2G9FA 4DUWA 1H8TA 4A7KA 4CRQA 1U12A 1OPOA 4E2QA 2CDOA 3KB5A 4BQ1A 4D0QA 3ATGA 2PHTA 4UW5A 2JEMA 3OCPA 5SV8A 4RFRB 4I0WB 4FPKA 1VR3A 1HRI1 4QPGC 3I97A 2CNAA 2WQ8A 4W65A 1JYNA 2WA4A 4LT5A 4QB6A 4Y1YA 4KG8A 4XMAA 5A3PA 1GLHA 1QJX3 4GD4A 2XJRA 3ENRA 1ZZ9A 5DG2A 3VKLA 4BQ2A 1OMIA 1MPXA 5K9YA 3EBRA 2E6VA 1I3HA 4LOSA 1GNYA 5D8AA 2J22A 1PHMA 3HD8B 3N9NA 2GALA 4MVTA 5FV3A 5FLJA 4JRLA 5GLZA 3R6SA 1EP0A 1SDWA 2O0OA 4FQ4A 3WP5A 3OF1A 3CBNA 2ZGSA 4B4RA 1AJKA 3KSCA 2YPDA 2VTXA 3WDUA 3ZYGA 3ON7A 4I02A 1YIPA 3VBUB 2KA3A 2OIIA 2ZAHA 5FZCA 1SDDB 1AR62 1S0FA 3VDDC 1IGOA 1W6QB 4A7YA 2JDHA 3ETQA 2X29A 2Q8CA 1H8TB 3PUHA 4MUVA 5EXOA 2GNTA 4DZGA 4P9WA 3N36A 4DXRA 5KR7A 1JYXA 1HDKA 1DF0A 2IUWA 4GB31 4EN6B 1I6XA 5JAXA 2MNGA 2K0GA 5DG1A 2A75A 2PXJA 2RJKA 4YNIA 4BIOA 2WNVA 4GXLA 2QQVA 3X29B 2W52A 2YC2A 4Q4X3 1VBD2 3VHNA 4KQ7A 5FCCA 1H2MA 3LFMA 1GP4A 2BNMA 3N3HA 4FFHA 4QXBA 4CCDA 1YRZA 5B4NA 4NIDA 5CVRA 4FT8A 2C6SA 3INAA 2VC9A 2XG3A 2XQRA 3AK0A 2EIBA 4MGQA 4BA6A 1RUE1 2OT7A 1GWMA 4GWIA 4NIGA 5FZEA 2KD7A 3GF6A 2X10A 2X05A 3Q8AA 2BZDA 1AX0A 1NE6A 4JHZA 1ENRA 4QQHA 2DCZA 3NO8A 5F8PA 3GBWA 3WG2A 3HNBM 1S0EA 2PHDA 4FPYA 1BK0A 1ASJ3 4AI2A 4Q27A 1XB9A 3VD7A 3ZXKA 3AVSA 3DF0A 3IAQA 1RC6A 2ZGQA 3AL5A 4AQ6A 5A7QA 1HQLA 1ZBA1 4LKDA 1W8UA 3WCRA 4UWDA 1HQNA 3M3EA 2QQKA 3KMHA 3BB6A 1CAXA 4GWNA 5APAA 3MYXA 3WDTA 5CNAA 1H1IA 4ES9A 3B3QE 1LHNA 2WNVB 4AEDC 1T6BX 4UFIA 1XJAA 2WFF3 5BXXA 5FQ0A 4M00A 4TYSA 1OOPA 5L7OC 1V9U1 2Z42A 4JC1A 3P3NA 4Z2AA 2DU0A 2VZ3A 1HLCA 2WA3A 3Q8BA 2WZEA 5F3EA 3U1XA 4AVCA 4FTSA 5JPNB 4LJHA 5LWBA 1VBB1 3ZYJB 3DXTA 4AR2A 1AHSA 1ZZ8A 2VZPA 1V6JA 3Q8CA 3ZSEA 4ISQA 5F5IA 1R091 1IQAA 2WN2A 4IV3A 4WZCA 4OULA 1X9TA 2QKDA 5T5PA 2VZOA 5ANQA 4IEVA 4BU2A 1YFYA 3JBG2 3PMSA 1C8M3 1O91A 4GB32 1Q8VA 4YSFA 2ZHNA 1DLCA 1QMJA 3AXDA 2EXKA 4IETA 3VZKA 4TZDA 3RZJA 3DEMA 3HQXA 2VXRA 1EPWA 4GH4B 1EUUA 4KG0A 5GZDA 1AJOA 1CQ9A 4IV1C 4Y33A 4QKBA 4E4SA 1FAYA 3QH7A 4LHKA 4MLOA 1C8NA 4CU8A 5JSOA 2OZJA 1JOJA 2IZWA 1W05A 2PHUA 2PLV3 1XYPA 2ARAA 2B9VA 3AYDA 3MIGA 3NW4A 5DUVA 1DGRN 2JKXA 1VJ2A 4RS5A 3WY6A 1JYWA 3POIA 1TME1 1OOPB 1ZRCA 1D0GA 5E1RA 4YVWC 1WA4A 3SKVA 1OA3A 5H9RA 1VBA2 4PIYA 3WW2A 2CAVA 2ET7A 2W2IA 1IPJA 5C3QA 3C2UA 3S57A 4BQWA 1U5ZA 5ERLA 4LKEA 3WNLA 2VE1A 3NV1A 2WJSA 3NQHA 4GIQA 2A73B 2WYFA 1ND2B 3DXUA 4CP1A 1QY4A 2A6ZA 3VD4A 3RSJA 1B35A 4AE2A 1SLBA 1GZ9A 1RIRA 4R9CA 4XFFA 5C9AB 1AYN3 4QU1A 4AGRA 2XMLA 4XHXA 4CTEA 1AXZA 2HYKA 5F5CA 1S1AA 2JG8C 2VMDA 5K0UB 5EQUA 4I2OA 5GJ6A 2LROA 1W0PA 2VBBA 4X8NA 1ENXA 1J3PA 1WMEA 2QTWB 2XJSA 5FREA 1GKBA 2AACA 4C0BA 5AC92 1UY4A 4OHXA 1RUOA 1W8TA 4P9GA 4AW7A 1GV9A 5F2SA 4CDQC 5CIRA 4CDWB 1JYCA 3MBWA 1EAH3 3WNKA 1JXNA 1ND3C 5CFCC 3ZYPA 5T3NA 1F15A 1SBEA 4NVPA 2XOMA 4IE4A 1RUF1 1Y7BA 4BQ5A 1R092 1W8OA 1TMF3 1Q8OA 1UQXA 2G19A 1CVNA 4XTMA 5KXBA 3PVBB 4QKDA 5HI0A 3PURA 5GLUA 1NY71 4BQ4A 2A71A 2JDNA 4XFCA 3WP4A 4TLGA 5JOXA 2ZX0A 3HNYM 4BZ4A 1TNRA 2DWRA 3ACIA 4LO7A 4CXYA 1H6XA 1FMD1 1W8WA 2VNOA 4MADA 3VBRC 4FPGA 1H4GA 1UZWA 2P34A 5KHHA 4ZS3A 2VU9A 1CAWA 3O0WA 4FOWA 1GZTA 1NZIA 3GGLA 5J09A 3VDCA 4XUQA 1KITA 1N1YA 3JU9A 1CAUB 4AHWA 1Q8QA 5TSWA 3L2HA 2VQ0A 2R30A 5F3IA 3KS7A 1STMA 3POGA 1ODNA 2H0BA 2RS31 4X6QB 5C4WB 3IMMA 1W6MA 3JB8A 1RUC3 2AR6A 5T50A 1RITA 2YFUA 2DVGA 3O0VA 2VW1A 3SCFA 5A6YA 1CZVA 4LBNA 4MOAA 4AFMA 2FQPA 4GJYA 4S2DA 4NHMA 4YZ2A 4M0HA 4CEYB 1MQTA 5LB6A 4K6BA 2DU1A 1VMHA 4E9KA 2PHLA 5J1XA 1F5JA 2ZHKA 2Q8OA 4YZ5A 4ZPIA 1AR92 2R062 1BXHA 1ZBE3 5FYZA 4E27A 3PL0A 2X8KA 3S30A 3IKWA 3HMYA 1PK6A 2X5IB 1LOEA 3I2KA 1MZ5A 2A3YA 4KMQA 5LA9A 3OBRA 5A70A 3ACHA 5A7OA 2VOKA 4OHWA 4DUXA 2Y0IA 3VDAA 3ME2A 3IWZA 1OH4A 3POSA 2PQQA 3LGRA 4KH9A 4NPMA 4ZZ5A 4RFT0 3K3NA 1CIWA 2E31A 3AXEA 5C3SA 1YJLA 1QJX1 2JDKA 4YM3A 4PLNA 4AOCA 3HBKA 2ARXA 1S4CA 3AZVA 3D3AA 5GLVA 5JXIA 5FO8B 3QD6A 4BMBA 4M3CF 2BERA 4DO0A 1Y4WA 3WXPA 3LE0A 3UKNA 2E32A 4MHUA 1RTVA 1QDCA 1HRV3 1KD7A 1AZDA 3OYWA 4HPKB 4S2HA 1M4WA 1URXA 1W6OB 4I0AA 4NO4A 4UBGA 2WRAA 3RRDA 3OY8B 5KXDA 1RUF2 1K5MA 2BOJA 3WDXA 3HIFA 3CL1A 1NX9A 2QNKA 1NY72 3LAGA 5FZLA 1X8EA 2WINB 3SH5A 4CU9A 2VOXA 1YFUA 2L9LA 3CZJA 4N53C 1HW5A 4D6SA 1FMD2 5F37A 4L2NA 1TEIA 1WCDJ 4QQPA 4YM2A 5K7PA 2IVJA 5HPOA 2XKPA 1RUG2 5FP7A 4QT6A 3J8F3 5LBFA 2K2SA 5FYMA 3CU7A 3VKFC 1KFUL 3R4UA 2VZVA 4RHV1 1JUIA 2RS32 3AJYA 3SQOA 4NHKA 2VO5A 5IK5A 4QPGA 1QF3A 3J4UH 1ZRFA 1LOFC 1PGSA 4I09A 5FJHA 3SEEA 2PFWA 2HBUA 2PHWA 3OYWB 2WZR2 1JYTA 1DYPA 2JIJA 4OHZA 2JDAA 4YWAA 1HKDA 1K5JA 1UY1A 1K5MB 3QCWA 3W5MA 4OUMA 1QOTA 1US3A 4QXHA 3I2FA 1O59A 3LIGA 1ASJ1 5D1IA 4YW2A 3WF0A 2IC1A 1R1A2 2V73A 4XURA 5IK8A 2QZ3A 2H6BA 4EJRA 1OQ1A 3KM5A 4QM8A 5EHDA 2OZ6A 5JPMB 4DUVA 5I0SA 4LULA 1JH5A 5BUVA 2XKOA 4DXTA 1LHVA 4XAAA 4Y1ZA 1JZ5A 1G9AA 2ZBJA 4XE9A 5FY5A 2VNVA 2XVKA 4IE6A 2IXKA 1Q56A 5F6LB 1AR63 1ZZCA 4FFGA 3T30A 2VMFA 1A6CA 2R1DA 3N35A 5G04L 4CA9A 2P3KA 3LSDA 4YZ4A 4F7ZA 4E2SA 4L97A 4WM7B 1RINA 3KQRA 2I2SA 1LHOA 4CU6A 4PLOA 2YFZA 5FZBA 2GU9A 4BDVB 1POQA 1E5RA 1OI6A 1ULPA 2UYAA 1D4VB 4QQOA 4AFDA 1UOBA 1J83A 3DGTA 3B02A 3RVHA 4R4XA 2YHJA 2Y26A 3HT2A 1UYZA 2J1VA 4MXWB 1VBD3 2ZS6B 2GNDA 4JZRA 4AHYA 1AUYA 4Z8BA 3N7JA 3LEGA 4O65A 2AZ5A 4AI3A 4LHSA 4LE3A 4CXWA 1V6OA 2YU1A 4AQ2A 4B4PA 4W6WA 1U5XA 4Y1VA 4LA3A 3FLPA 3KV9A 4XBQA 1CAVA 5HV0A 5JZGC 1OKOA 4L9BA 1VB2A 5DZEA 3D5OA 2XHNA 1POV0 2VVDA 4UF0A 2DVDA 2CL2A 2EXJA 1KJRA 3SNMA 3APBA 4RHV2 5LA0A 3PJQA 2OQ7A 4XUTA 3PU8A 3WT3A 4MGKE 3USUA 2D6LX 2QZ2A 4EWEA 5FRAA 2R041 3AZZA 3K2OA 4D7YA 4FOQA 1KDKA 4ZXEA 4HL0A 4KGGA 4AK3A 3ZYIB 4OMCA 5DN2A 3W9AA 1QEXA 4QU2A 4LKSA 1QHDA 2JG9C 2RR11 2OUJA 3KZ4C 2PN5A 1HIXA 1ZA7A 2CTVA 2HEVF 3KWVA 4CZSA 5BNNC 1UMIA 3OGRA 3NL1A 1SFNA 4KBBA 3THPA 5C8CC 1CJDA 5JLVA 1I1EA 2H0VA 5CG9A 3Q8EA 4XDOA 3IB3A 1LU2A 1CZTA 4LLOA 3MIFA 3LA2A 3MF9A 1GOHA 2N7GA 3VBOA 3GZEA 4WBBA 4Q0VA 3SH4A 3NKTA 3O1MA 3WV6A 1PO21 3AB0A 4O9EA 5GM0A 4WV8A 1W3XA 5BNPC 4Q2FA 4UF0B 5LA2A 2RV9A 1V6MA 1PGW1 2YXSA 1R1ZA 4RD7A 4HXCA 5JR7B 3T2OA 2BGPA 3CMGA 1JN2P 1NLQA 2VY0A 3USUB 2VECA 1EAH1 3JBG3 3DYPA 4K8RB 4QAWA 2DFBA 2RMU2 4GB33 4JGYB 5HCBA 1GR3A 3HR9A 3JQWA 4XAEA 3T4VA 3T08A 1QWRA 5GKAC 3ZSMA 4BISA 2XLGA 3KGLA 5F1RA 3NVCA 1JOPA 1U5YA 1DZRA 1PZ7A 4QKFA 2BFUS 1LOCA 1WCSA 3MFAA 1UX7A 4K1YA 4QX8A 4GMP0 1DYKA 4GH4C 4PBOA 2VZTA 2D7FA 2ZHLA 1UMZA 5FZ1A 2WIIB 2Z5WA 3VBSC 2WL1A 1GP5A 5FZ7A 1VBA3 1OLRA 3CJIB 1XNDA 2WT0A 4GWJA 5DDJ2 1AVBA 2XWBB 2AC1A 2ZX4A 5EFUA 3WZ1A 1NE4A 1KRIA 4CCNA 4Y26A 4IGPA 3NJYA 4MXVA 1X9PA 4QDQA 2NYYA 4Y22B 2D3RA 4Y4RA 3MIDA 3VZLA 2D40A 1RUC1 2X09A 4B29A 5JXHA 3HEIA 4LQRA 5C8WA 4FCAA 2WAAA 2R042 3H9AA 3ILFA 1QJY2 3FMGA 4AHZA 1YQ6A 1FOD1 1F9KA 5T5LA 2ZGUA 4XW3A 5AFBA 1UAIA 3O1VA 1W9WA 3SCGA 3ZSLA 1XNBA 5A32B 1A8MA 3WW4A 4EV0A 5LATA 2RVAA 3IPVB 3QLQA 2EF6A 1W2AX 2A5ZA 4INDA
chains in the Genus database with same CATH topology
2RS11 5KBFA 4HKLA 3VGIA 5AC93 2XJUA 2GC0A 1ND3A 1Y9QA 3AKPA 3M3IA 1QJZA 5CFCA 3DPRA 2E51A 3ZSKA 4DNYA 5JSRA 5K0UC 4YG6A 4KWKA 4AEKA 2YV8A 2BBVA 3GZAA 5FO7B 1J59A 4WVWA 2VW2A 2BW8A 1S55A 1XE7A 1PO22 3MW2A 5T54A 1RB8G 4G9SB 2LM3A 1R093 2W68A 2GAUA 1O5UA 1PGW2 4LBKA 2RS52 2XUMA 1NA1C 3VBRA 3E5UA 2PHRA 3ZXJA 1HRV1 1ZZ7A 3MW4A 3I59A 1X8MA 2IXCA 3E6DA 3JQXA 4IEXA 1AYM1 1G6NA 2W08A 5ACA1 1XRUA 5CG8A 4H7LA 4K8FA 1H1AA 4DQAA 3IM0A 2D44A 2B5HA 1RJ7A 2NQYA 1SLIA 1UKGA 4EWDA 5HXVA 2I07B 3IT8A 3DPRB 1VBC2 2TEPA 1YI7A 1Z7S1 4Q29A 2FHRA 4PDWB 1VP6A 4LEJA 4CDQA 1A78A 3J8F1 4QPIB 1C1FA 2P17A 4GKXA 2GC1A 1LECA 1AR93 2R063 3AM2A 4Q0QA 4LNVA 4CEYC 3MLLA 1LU1A 2EIGA 2UURA 3V56A 3NAPA 3PTYA 1QQP2 2A6XA 3ST7A 3VKMA 4Y20B 1NQDA 4BH9A 3EO6A 1FOD2 1PGL2 4IL7A 1SCRA 4QM9A 3IDCB 5J7MA 3DKWA 3N7MA 3RI9A 3MIEA 2RS12 4HT1T 4XJWA 3S7EA 3VKNA 4LBOA 3WVJA 3ZXGA 3RPQA 1ZRDA 1QXPA 4DRVA 2CV6A 4H55A 1XYOA 3E5XA 4XFIA 3IIAA 3ZFEB 2Z69A 2P3JA 4FAGA 3MICA 1UN1A 4PIZA 3JD71 1VRH2 1RUF3 2PHXA 1J1LA 1UPIA 1AR61 4XJ8A 2HWF2 4N53A 1CONA 3TBDA 4H7MA 4NWWA 4YW1A 1Q43A 2C1FA 1BQPA 2VUJA 1NXD1 4P9LA 1FMD3 5CFDB 2D6NA 4YZ3A 2A6VA 5ACA2 4WVMA 1AYM2 1WW4A 4SBVA 3VZMA 3PLQA 1N1SA 1RUG3 3H1MA 3LOBA 3T1MA 4FO9A 4IEYA 1QOOA 3ZN6A 4M0NA 5BYNA 4QX5A 4QMAA 5EWSA 5J48A 1JTZX 2JX9A 1LOFA 1YYNA 2D43A 3WOGA 2RS33 5JOWA 2YGMA 2WQ4A 3BODA 4A3XA 3I7DA 1Z7S2 4C1WA 4QGLA 2SBAA 2WZR3 2ETEA 1MS9A 1F5FA 4IESA 4BPZA 5FDBA 1Y43B 1MZEA 2BYVE 3J9SA 5FMOL 3D6EA 4MGYE 3H7JA 4K40A 4NN0A 1G9DA 2ZGOA 2FBEA 4B7EA 4E2GA 2SLIA 3ZFFC 3B69A 1OPMA 5BNOB 2Q30A 4WVMB 4M3CB 2ZGRA 4I3GA 2E7AA 3OTFA 4YGDA 3ZN6B 1IS3A 1Y3TA 4FVVA 2DTYA 3V0AA 1O4ZA 2ZMNA 2HWE2 1Z0HA 1LEMA 5GLTA 2BUKA 4XEZA 4XFGA 4Z2WA 3JD72 4YG0A 4XYXA 2Z2SB 4JV4A 4BCUA 3NWKA 4LUMA 2UWAA 1YNAA 3WHUA 1NZCA 4Q1PA 5LEKA 4R52A 3V65A 4QGNA 3LA7A 2DCYA 3JBG1 4LHLA 2D97A 4JAAA 2ZX3A 1V6IA 5DUXA 2PELA 4YVSC 4WM8C 5JZGA 5K8SA 2MHFA 1DG6A 3WDWA 5C6CA 1RMU1 2YY1A 2DFCA 2CGOA 2GDFA 1WW5A 4XQWA 3D82A 1OLQA 3U11A 2ZMLA 2ZGPA 4PQ9A 4RHV3 4IEZA 5D8AB 1BBT2 2Q1MA 2IXIA 3M2MA 1VBA1 1PO12 2JG9A 3ZXDA 2ET1A 4LBQD 2D5FA 4FP2A 3SMHA 5BNNA 4XF0A 4C91A 1S0CA 4LE4A 3VL8A 4CDUC 3TB0A 4E4DX 4ZXKA 1W39A 2YYOA 4N9IA 1TE1B 3POYA 4E4ZA 4AFCA 4UBHA 2I74A 3RYKA 3VBOC 2EVXA 3BPZA 1DU3D 4PJYA 2B46X 1NCRC 1J1TA 2WWSA 4HFSA 4GQ7A 2D3SA 3FC0A 5AC91 1CESA 4K1ZA 4RQPA 3LKJA 3W59A 4AI1A 4R9BA 3IMNA 3VBHC 5H9QA 3IN9A 2H6CA 5DZGA 2RMU3 3AMHA 3AP4A 4Q4W2 1EPZA 4XJAA 4KNCA 2Q1ZB 2P37A 3N7LA 1LRHA 1S2KA 4JGYC 3TWIA 3TYJA 4EROA 4FAHA 1DQ0A 3DUIA 3WG3A 3MZHA 2HWB1 2B9UA 4JDOA 4WZFA 5HBAA 1QDOA 4EN8B 1PMIA 4JVAA 2IXJA 1RGSA 3OD4A 1RMU2 2IXLA 1C5HA 1S0DA 1CAXB 3LZZA 5KXCA 5CAZA 1NCQA 1HQWA 1ULFA 2DURA 4UXAA 4B7KA 3POWA 4H3WA 5FQ0B 4RQPB 4CEWC 2VNRA 1RUI2 2R043 5BV6A 5EV7A 3AYCA 3FFZA 3OGGA 1C28A 3PNAA 2BNOA 4N43A 3WX5A 4HK8A 1WGPA 4U2AA 4XFHA 2XLFA 3ZMNA 2RR13 1AR91 2R061 1LULA 4GKYA 4IV3B 4L8QA 4CDXC 2BNNA 5J98B 3ROUA 2DVBA 5JIUA 4XFAA 4PBPA 1VB4A 2FMDA 2E9QA 5HCAA 1PO23 1H1MA 1NA1A 4L11A 5CB7A 1GYKA 3AMNA 4FQZA 2RS53 1H9PA 4RS5B 3MIHA 2D3PA 4G4FA 1DDLA 1V6LA 1N3QA 2ZGTA 1YI9A 3G7DA 2KXLA 3QACA 4KGQA 1FT9A 4P9YA 4JDNA 2EAAA 2ZX1A 3D0JA 1RUD2 2WS91 2PTMA 2HWB2 1Q8SA 4AVVA 1B35B 4NPRA 3GALA 1YFWA 5J3UA 2ZHMA 3BU7A 2BGCA 4QGMA 1I5ZA 4LTAA 5CBLA 2TUNA 1M06G 3ZFGC 1RUG1 1J58A 2YDEA 2AUYA 2PHFA 4YRDA 4D94A 4RA0A 5SV5A 1V00A 4QPIC 1S0JA 3H50A 3I8TA 4SLIA 3PVNA 2AYHA 5ABJC 1KFXL 1DQ4A 4YFZA 2VGDA 1QQP3 4AF9A 4K7JA 4XF4A 2HWD1 2BFUL 4D69A 4Q0SA 4UW6A 2IXHA 3VBFC 2WZR1 1FOD3 1AXYA 1O7FA 5H9PA 4BE3A 5LRRA 2OA2A 3GYDA 2F4PA 2UY8A 4COZA 2R16A 1R1A1 2RS13 4ZU5A 2JJ6A 2R0FA 1FX5A 1DQ6A 1S0BA 4LA2A 3TNPB 3WP6A 4FSJA 5T5JA 2D6KA 1CAWB 2B39A 4YW4A 4N7IA 1VRH3 3B00A 3M70A 3ZFEC 1Q3EA 2DVAA 4IEWA 2HWF3 1ULCA 4Q4V1 2B45X 1BMV1 4ATEA 1CX4A 1W6MB 1IKPA 4BLIA 1VIWB 1FV2A 2JICA 1QU0A 5KHKA 1UL9A 1ZRFA 1Z78A 1ULGA 4NR1A 5ACA3 1WLCA 1AYM3 1GFF2 2WNUC 1MQTB 1IS6A 1FV3A 2DV9A 3PVEA 3AYAA 5CFDC 2BWCA 4JGZA 2HJIA 3RWNA 2WS92 3GZTB 5JCTA 2D6OX 1QKQA 4OHVA 2OW4A 4RR3A 1O4YA 1PK6B 1DGWX 4Z07A 4F3JA 4FBFA 3D4KA 2LTNA 1RVF1 5JI9A 1Z7S3 4QD2A 1OKQA 2ZGNA 3HAGA 3ZPYA 2XWJB 4IEPA 1JYIA 4AGGA 3KT7A 1WBLA 4COVA 3WDVA 3AP9A 3ZFFA 3TN91 1UW8A 1NQJA 4AHXA 2HWD2 3RS6A 4I3PA 2YPJA 2VW0A 4I0BA 1EV11 4D7SA 5BNOC 2BTVC 1DQ1A 3AMMA 4FOVA 2Y38A 2ZKLA 4XILA 4URTA 1U5IA 2ZKNA 5EYYA 2ES3A 1D4M2 4DS0A 4S2GA 1MACA 1MS8A 3B9IA 3VDDA 5JDBA 1DZTA 3HWJA 2VOWA 4AFBA 3JD73 1WD3A 2NM1A 2ZA9A 2JDZA 3M8LA 5I8YA 4Q4V2 4YVSA 5EYXA 1AR81 3VBUC 3MEPA 1BMV2 1X82A 1G9FA 3SCHA 4QPGB 2RMU1 3RDIA 1RUH1 1LEDA 3G6JB 1H8TC 4IXLA 1REFA 2QDNA 1WMFA 3ELNA 3JB4C 2GC2A 3CLPA 4ASLA 1BYHA 4YGEA 3K51A 2KM2A 2A3XA 1CN1A 5BPXA 1BBT3 4NOTA 4RSUA 3FUOA 1DQ5A 5F6KA 1RVF2 1UIKA 1PO13 2XB6C 3AZWA 5E89A 5DDJ1 3VDDB 1CPMA 2CYFA 3KT1A 3N7KA 4QQLA 1LENA 5EZWA 3TN92 4P5HA 3WP3A 1YLLA 1GQHA 1ZX5A 4NWVA 4AXOA 4J6GA 3V0BA 1QJY1 1NCRA 4AEDA 3HT1A 4DFSA 2GH2A 1UIJA 2NMOA 5KXEA 4HN0A 2C5DA 5L7OA 1EV12 1BK1A 1PIV1 1FNZA 4DPNA 2R072 4XF1A 4AI8A 1LJ7A 2UWCA 1PVC1 2WNVC 3B9CA 1VAKA 3BCWA 4ATFA 1DGLA 5H9SA 3I54A 3KCXA 4HZFA 2Q0AA 1MS4A 1CAVB 1LCLA 2XVGA 2RS51 3AKSA 2DCJA 1AR82 5JIAA 3AZXA 4YFWA 1GNZA 3NV4A 3ASIA 3DN7A 4IV1A 4EWAA 3V0BB 1RUH2 2ZGLA 5CU1A 1GNHA 4XJ9A 1RMU3 5JOZA 3KCYA 1F31A 4YVWA 1UD1A 1X36A 3D8CA 4CEWA 1QNWA 5B2GB 3PJYA 1D2SA 2WFF2 4Q8LA 2MEV1 2VUAA 1VBC1 1DIWA 1UZYA 1RUI3 1GICA 5GZGA 3URFA 1XNCA 1ZREA 5F9TA 1OOPC 1AR71 3EXUA 4CDXA 4GWMA 3VZNA 3ZDSA 2IFWA 5KHIA 5HCFA 1L3JA 3LB9A 4V1PA 4ISRA 3CEWA 3GHNA 2BPA2 3ZXAC 3OJBA 1QQP1 1QJU1 1C3HA 2XGXA 3NV3A 1MEC1 1ZYBA 2JG8A 4IV1B 1ND2C 1C8M2 1RHI1 1SLAA 4FXGB 1PGL1 5C9AC 2XL7A 5F5QA 3ZIXA 4K20A 2NPIA 1PIV2 4EN7B 4YVWB 3NKGA 3MLJA 3ZX7A 3E97A 3MW3A 1PVC2 5GLWA 1R081 2QVSB 4MSVA 5I0UA 3KGZA 4AWDA 5IK7A 3ILNA 3O7OA 3AJZA 4LO8A 2ZGKA 3VLBB 4CDWC 1VRH1 2WC2A 4NHLA 5GZFA 1BJQA 2HWF1 2VULA 4FTEA 2HWC1 1RUD3 3EHKA 2ZMKA 2G4IA 2CAUA 3QOPA 5AFEA 2HWB3 1YIFA 4GMP3 4HBNA 1FPN1 4AYUA 4XJZA 1LOAA 1KQRA 4AEMA 3ZFGA 4W6YA 2VMIA 5I0TA 3THTA 1N3OA 4XMIA 5J37A 1MS3A 3FLRA 3JUUA 2GSYA 5JSPA 3FJSA 3VHOA 3WG1A 3W58A 3WDYA 4CDQB 5ABJA 3A0KA 1NOVA 3ES4A 2VQAA 1ND3B 5CFCB 4HSJA 2MEV2 1KJLA 1CD3G 3VHRA 3DL3A 4OI0A 3A4UA 4XTPA 1LGCA 5C4WC 3UK9A 1GZWA 1AR72 3NJZA 4R9AA 2JXAA 4COYA 4LO4B 4FXKB 3PVOA 4AFAA 1VAVA 1H0BA 2D6MA 3GZUC 3VBRB 3M3CA 4YM0A 1QJU2 1LOBA 4QXKA 1MEC2 2MPFA 1FYUA 3WQ1A 1NYWA 3ZMOA 1RHI2 3I59B 2X5IC 4D7TA 1D0HA 3A0NA 1C4RA 3GHMA 4YLZA 3B94A 4KWJA 5A33A 5FBZA 3VHPA 5FOBB 3WCSA 5JWPA 2GMPA 2NP0A 3PMEA 5T5OA 2BVBA 2ARBA 2ZAAA 2HWE1 4YW5A 1R082 3TAYA 1APNA 1YXWA 4HVOA 1I9RA 1N1VA 5IK4A 3K48A 1GZWB 4ES8A 2B42B 2HWC2 4HLTA 1DBNA 4GALA 2WS93 4AGVA 1AL22 2XHKA 1T6GC 1FPN2 2YC0A 1SMVA 3NAPB 1SLLA 4Q1RA 4OI2A 1DGWA 3N4MA 2WZPP 3TRSB 1LOGA 1IS5A 2XH6A 1OFNA 1OQEA 4HETA 2WLQA 5A33B 3LCPA 2UU8A 5FLHA 3PHMA 1BBT1 3DV8A 3UV9A 2XVLA 3WR0A 5J96B 3WQ7A 2A7AA 1EYBA 1WUVA 3SITA 1PO11 2HWD3 2QQPA 2R0HA 4YGBA 2GZWA 1O3RA 2W39A 1H9WA 3FUQA 4S2FA 5KHJA 3H3UA 2VVFA 3UJQA 4N53B 3J26N 5KC5A 2PAEA 2WSUA 1R1A3 2D98A 1EY2A 4MV2A 5I0RA 3H3ZA 1K5MC 1O3SA 3FX3A 1E57A 2PAMA 1W6PA 4WVVA 2GC3A 1IPKA 3ZXLA 2WLPA 3QBQA 3T2TA 3VBUA 1MS5A 1SACA 3M4FA 3OPZA 4LUKA 4X6RB 1WCKA 2XJQA 4MYEA 1LR5A 1VBE1 4Q4V3 1G9BA 1W6QA 1BVVA 2GNMA 1FNYA 4RL7A 2HKXA 4BM8A 1O5LA 4Q4W1 1LTEA 3SLIA 4MGIE 3H1YA 1H2KA 4WM7C 1J3QA 5L19A 1REEA 2AH2A 1Q8PA 1ZVFA 3LWCA 3ZIWA 4XFBA 1G9CA 1WW6A 3AMQA 3WW3A 4EN9B 4IEOA 2OPKA 4OI4A 4ITCA 5GZCA 1HV0A 4J1WA 1RVF3 1ULEA 1W6PB 2WNEA 2IFRA 2VH9A 1XQNA 1KS4A 1N3PA 3MF6A 1POV1 3RMXA 4QPYA 3ZSJA 5I93A 1ALYA 2QCSB 1RUJ2 4XHBA 3BIWE 1XNKA 1YUDA 3TN93 1AF9A 3V0AB 1UPSA 2UYBA 1QNYA 2D6PA 1V70A 1RUI1 2VMGA 2RE9A 4PLMA 4Q4Y2 1Q5OA 1SFYA 1MZFA 2Y0OA 3QH6A 5LK7B 3AMPA 2ZJCA 2WT2A 5C8CA 5E8AA 1EV13 4AVTA 2E53A 2HEWF 2AREA 3CJXA 2TNFA 4JTOA 2OVUA 1DHKB 3AP5A 4O9GA 2R073 3ZXFA 2RM21 4ORFA 3VUOA 3Q9OA 3LA3A 4J1XA 3MDPA 4L92A 4DMIA 3OGJA 5JZGB 2DCTA 2R32A 5BNPA 1UX6A 3O12A 3MI8A 2QJVA 2WKKA 4FOYA 4OUSA 4BYYA 1XU2A 1X7NA 5I8TA 1ENQA 3OD0A 1COV1 4XZPA 1VALA 1VBE2 2ZX2A 2P2KA 1LGNA 1AR83 4M3CE 4BWOA 3R0RA 1DZQA 1GQGA 1WMDA 1GANA 3IBMA 4AQSA 2VVEA 4FPJA 2ZZQA 1BEV1 4YYOA 4G3YC 2JG9B 3R4DB 1AX2A 1RUH3 1QGLA 3B93A 2EALA 4HKWA 3AYEA 5BNNB 1JHNA 4GH4A 1HRI2 3S6PA 1C57A 2JD4A 4XQ4A 5C8CB 1RUD1 4XPVA 3VBSA 3R05A 4I01A 4GMP1 4H14A 4PIXA 3ILRA 2BVVA 5LEJA 4XF3A 1YWKA 4XBNA 1OD5A 3I2DA 1RJ8A 1DGRA 5BNPB 3L9JT 5DDJ3 1MVEA 5I8SA 5JVVA 5JOYA 3CJIC 1SCSA 1GBGA 1ND2A 4W6XA 3EQEA 5C9AA 3AFGA 3O14A 4Q8KA 2JENA 1QJY3 1MS0A 4PF5A 4HKOA 5A3MA 1W2UA 1IOAA 1IHMA 2LUWA 2XLAA 5K0UA 4CP0A 1PIV3 4COWA 3RJ2X 2DUPA 3TOJA 1O3QA 2RM22 4DINB 1YHFA 4EN0A 1PVC3 2XBO1 3B01A 2JECA 1NXMA 1QH6A 4BLJA 4CDWA 4D3WA 2O1QA 1YO8A 1XU1A 3FLTA 4DXZA 1RUE2 1BVP1 2PYTA 1XXNA 3RJRA 2FZ1A 4CYDA 1NCQB 1COV2 2WFPA 4AVAA 4RGGA 4A2UA 4XXPA 4IERA 5DUUA 4YM1A 1IZ3A 4Y5Z0 5T52A 5IT6A 3RG0A 1HXS1 2I45A 1BEV2 3UL2A 1ZBA2 1SBFA 1MVQA 1QXJA 2QUOA 1O3TA 3NV2A 3FWEA 4N43B 3H1WA 1PZ8A 3TNQA 4DY5A 2P3IA 1CAUA 2X53S 1WBFA 2R1BA 4HVQA 3E5QA 2VG9A 1GZCA 5C4WA 2ZCWA 4OFGA 4KU8A 2MEV3 1VBC3 4U36A 3RYPA 1V9U2 1LESA 3M7AA 1FATA 4XOGA 3U07A 1H2NA 4CEYA 1N1TA 1VBB2 1AR73 3DPRC 4C0HA 2GN7A 2GN3A 1NA1B 4LBQA 4LO5B 3VZJA 4PDWC 3BTAA 4LBJA 2E7QA 2JKBA 4ASMB 5CADA 2X5IA 1QJU3 3AX4A 3RI8A 2YGLA 1MEC3 3FHIB 1RHI3 1QXRA 5FMOS 3BOWA 4XXAA 3WLUA 4HK9A 2DVFA 4AI0A 3M3QA 2BQPA 1F2NA 4FP3A 2XBO2 3UKVA 3SHRA 1R083 1TME2 1D4M1 1TNFA 4MGZE 3ZYRA 4HPKA 4M01A 1W6OA 1XE8A 2DF7A 3OY8A 4B3NA 1IS4A 4LBQB 1TQ5A 2NMNA 4XDQA 2HWC3 1DQ2A 2JE9A 4C1XA 1AL23 1FPN3 4A7ZA 5A3LA 1HXS2 4KWLA 1PVXA 4CP2A 3VL9A 1G86A 2DCKA 1UU5A 2AGSA 4N9HA 5FTTC 3NAPC 4KL1A 3S0MA 3AKRA 4Q0PA 4XBLA 1KDMA 1ENSA 4I30A 2ERFA 2B8MA 4N7UA 3AP7A 3JZVA 3BALA 1LKNA 3IDEA 4LO6B 1C1LA 4JDMA 3FE5A 2RJLA 3LOIA 4OI1A 2ZTNA 1F8VA 4MZUA 4C90A 2V5YA 5BNQA 3U0ZA 2K9ZA 3GBGA 1VAMA 2OUHA 4MX3A 4UW3A 3FZ3A 3H7YA 1YCIA 5E88A 4FPOB 1OA2A 1LB2A 3ACLA 4AG4A 2DUQA 5FPXA 4PCRA 3C3VA 1UKRA 4TSVA 3AKTA 2B7YA 2VPVA 1WLWA 2QDRA 4HVRA 1NLSA 3AZYA 2GMEA 4HANA 4JGZB 3ZO0B 4Q4X1 1CGPA 5L73A 2R071 4L99A 4RR3B 4QQ2A 2OYZA 4AVSA 2C0ZA 4WM7A 4LBMA 2HWE3 3MPBA 1WLTA 4BHPA 4HSLA 4BOWA 5C33A 2R6QA 1N47A 5AVAA 1G8WA 1GSLA 4MXWA 4WM8A 3ZFFB 5IUQA 1ONAA 4B4QA 3USSA 2IWGB 5EJ3A 3RQ0A 4P14A 4P9JA 2E63A 4P9XA 1A8DA 1SBDA 2PAKA 1H8VA 1H2LA 5FOJB 1H4HA 3RZZA 2CGPA 3H8UA 3HN1A 3RNSA 1HV1A 3KCCA 2GH8A 1S0IA 2EXIA 2BWAA 3O5SA 2ATFA 1QJX2 3LSEA 2G9GA