2WO1A

Crystal structure of the epha4 ligand binding domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
183
structure length
180
Chain Sequence
ETGEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKRTKHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPHRIN TYPE-A RECEPTOR
publication title Structural Plasticity of Eph-Receptor A4 Facilitates Cross-Class Ephrin Signalling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 34
structure length 180
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wo1A00
3GM8A 1LNSA 3OEAA 3VD7A 4OZOA 5JXIA 4XUOA 3E1F1 3DECA 3DYPA 4BK4A 1JHJA 5DQ0A 4XZUG 3F2ZA 2W1WA 1SG3A 1IQDC 5IFTA 4KMQA 1GUIA 3NJXA 2J1AA 4DEQA 3WNLA 1PMHX 2XOMA 4OMDA 2WQ8A 1UY4A 2HLEA 4A41A 5HXMA 5DPNA 2YFZA 3ECQA 3T08A 3VDCA 1JU3A 5G05L 3MUZ1 1JZ6A 3LPGA 3ETPA 3WNOA 2EICA 2W95A 2VMFA 3MUY1 1L7RA 5DMYA 5IFPA 3WF2A 3EYPA 3C7OA 1UX7A 3C7HA 2ORXA 2VZTA 4UI9L 1OF3A 5JXGA 4QB1A 2WABA 3K77A 4XUPA 1DYOA 4QPWA 1UWWA 1UY2A 3ACHA 3PUIA 4QX2A 4ET7A 3ABZA 2WO1A 4CVUA 1HN1A 5DN2A 1W99A 3NRUA 4A6OA 1GU3A 1SDDB 3THDA 3W5MA 2W94A 3FHQA 1US2A 2W5FA 5IJRA 3A7QA 3I3DA 3I2GA 4PQQA 3GDBA 4CU8A 3MV01 1WCQA 2YG0A 4AAXA 4L0PA 1TVGA 4LKSA 1H6XA 4GWJA 2W92A 4P00B 3VD5A 4W50A 4JKLA 4RYDA 2L9LA 2Y6GA 1KGYA 1GOFA 2YC2A 1JYNA 3I3BA 4BDVB 1JZ7A 2ZXQA 1JZ5A 4JKMA 3K4DA 4A4AA 4MO3M 5G04L 2ZEZA 2VR4A 1DP0A 2E31A 1JYWA 2BGPA 2CDPA 5LA0A 3P1IA 1UY1A 4PT6A 3CZJA 2J1TA 3A21A 3OGVA 1XNAA 4QX3A 5F7UA 4LPLA 3FL7A 3GXUA 3WNMA 4OYUA 2B4KA 2V4VA 3WF3A 4ZZ5A 1PMJX 4BXSV 1I5PA 5JXHA 3OGSA 4KWUA 1MPXA 4M4RA 2WUHA 1NKGA 1R64A 4MGSA 2J1EA 2XQXA 4Z2AA 3CQOA 1NX9A 1XNTA 4IUGA 2VMEA 4OUEA 3MO4A 1NAEA 3UETA 3ACFA 2EIDA 4QDRA 2QQNA 3CKHA 2WO2A 4CUCA 3WNPA 3WNKA 2DCJA 3I2JA 2VZPA 3WF0A 5B4NA 3I3EA 3CMGA 2QQIA 4D8MA 3NJVA 2E32A 2RV9A 1W8OA 1TG7A 3LPFA 4YPJA 3HNYM 2RVAA 2W3JA 1OD3A 4TXWA 2VJXA 4UAPA 3W5NA 4XUTA 2BZDA 4P02B 1CZSA 3VD4A 2YC4A 3K4ZA 4XUNA 3T0BA 1UZ0A 1T2XA 2VMDA 1WKYA 3A23A 2X10A 3DYMA 4OMCA 4HG6B 4DEVA 4A45A 1W9SA 2WN2A 1UXXX 2V72A 2BGOA 2WAOA 3I2HA 1BHGA 2WO3A 3HNBM 3A22A 4FI9A 3LEGA 5CYYA 2WZ8A 3IAQA 3T0DA 5B4XA 4CU9A 3I2IA 1GMMA 1PX3A 4DUXA 2EIEA 1GOGA 3VD3A 1J84A 1EUTA 2J1SA 3U37A 3C7FA 2JDAA 1KEXA 3WF1A 1RYYA 2WN3A 3HPNA 1YQ2A 4CU6A 2VZ1A 4ARXA 1JYXA 4ZY9A 3LQCA 1GQPA 4ZXEA 5HPOA 3SKVA 4LQRA 1K42A 3CDZB 3WEZA 4A44A 2VZUA 2EIBA 1L7QA 2LW8A 2W87A 4DXTA 3WF4A 2JD9A 3HN3A 2VTFA 2WYSA 3UNPA 2W46A 2Y6LA 2VMCA 1OH4A 4W4ZA 3OEBA 3VDBA 3UESA 2HYXA 3EB7A 3ZM8A 1JYVA 1UMHA 3IAPA 5EJZB 5EJ1B 3LE0A 3I2KA 2ZEXA 4A42A 2ID4A 2VQTA 2ZEWA 3C8XA 3NNGA 3NQHA 4LHSA 4P5YA 5JUVA 2XONA 1UMIA 2WBKA 3T0AA 4AG4A 5JXJA 3C7EA 5JMOA 5LCWL 4DUVA 4JX0A 5I0DA 5EIYB 2Y8KA 2VZOA 2VL4A 2WZEA 2ZEYA 3C7GA 2VZVA 1JZ8A 3OB8A 1UYYA 3T2PA 1CZTA 2W47A 3SKJE 3BN6A 1JZ2A 2C9KA 1F4HA 4MOAA 5LA1A 1GOHA 5LA2A 3HOBA 4ZZ8A 1D7PM 2Y6HA 2ORZA 1UY0A 1UYXA 4XVHA 3I97A 2VCAA 4MGQA 2J1UA 2W1QA 2E33A 3P6BA 1JI6A 3OG2A 1OT5A 2DCKA 3IDAA 2X05A 2Y6JA 4A3ZA 1K45A 2J7MA 3J7HA 4RN5A 2VZ3A 4CUAA 2VM9A 5C70A 4BJ0A 3OBAA 4M4PA 1GNYA 2VZRA 2QQOA 3THCA 4E8DA 2B9VA 2QQLA 4QDQA 3CZUA 3SEPA 2KD7A 4GWIA 2OKXA 1CX1A 2Y64A 5A1AA 1JZ3A 2JE8A 3FHAA 1P8JA 1UXZA 3DYOA 4QDSA 3VDAA 2X09A 4UOJA 3VD9A 3WNNA 2WAAA 2E26A 5JR2A 2VZQA 4GZ9A 2C4XA 2QQKA 3IB3A 4KI5M 2QQJA 1F4AA 2VOTA 5FUIA 3WSOA 2QBXA 5C7GA 1UYZA 4TTGA 4XURA 3MV11 4CUBA 1W9WA 2RJ2A 4ARYA 4DXSA 3SEEA 4QB2A 3JXSA 2VCCA 2J1VA 4MADA 2BBAA 2V5DA 3K46A 1W8NA 2CDOA 2VO5A 3HEIA 1O8SA 2YB7A 3T2OA 4JHZA 3BGAA 2J1RA 3T09A 2W1SA 1J83A 3CIHA 4E8CA 4DUWA 2VCBA 2W9XA 3LEIA 1XC6A 1CIYA 1JU4A 3FN9A 4D0QA 3GGLA 2WDBA 2LS6A 4QAWA 3HJRA 3OGRA 3AC0A 3ACGA 1JZ4A 3T2QA 4QX0A 1O8PA 2XHNA 5IHRA 1XPWA 2W1UA 2J22A 3MBWA 1PX4A 4QX1A 4P08A 3K75B 3PUHA 1CZVA 2C26A 3LEKA 4QB6A 2W91A 1ULOA 2Y6KA 2VQUA 4XUQA 2BERA 1W0NA 2R7EB 1UY3A 2PQSA 3HNMA 1H6YA 3WQBA 4JKKA 4PF1A 1O59A 2VC9A 4W8JA 1SHWB 2YFUA 1US3A 5C71A 1NUKA 2DDUA 1OF4A 5J1XA 4DXRA 1ULPA 3D3AA 3I2FA 2Z4FA 4CU7A 2JKXA 1DLCA 5IYYA 1K3IA 1W9TA 3ACIA 3K4AA 5CZKA 1K12A 3IIIA 4BK5A 1EUUA 2VZSA 2QQMA
chains in the Genus database with same CATH superfamily
5FDBA 1ZRIA 2BJSA 1LNSA 4XQDA 4NN0A 1CIWA 2VCMA 4HPKB 3OEAA 3SCHA 3VD7A 3NSTA 3I49A 2LTNA 2P1BA 1LU1A 2BBVA 4LBJA 4EROA 3LB9A 1IS3A 2UU8A 4CCMA 2QDRA 2ZGOA 1OUXA 4BM8A 5GZCA 3N9QA 2UWCA 4BK4A 1UCXA 4NR1A 3NWKA 2YC0A 4PLNA 1C8NA 1VBD2 1VPHA 4XXAA 5ACA2 1HQWA 2YBSA 3SLIA 4BIFA 5F3GA 4KWJA 1XQNA 3WP6A 4PIZA 4DMIA 2JIJA 2BWCA 5EWSA 1PMHX 2V4AA 5FMCA 3WP4A 4M01A 2WQ8A 1TMF3 1B09A 4OLLA 4Q4X2 2HLEA 1J59A 4YVSB 1MQTB 1TME3 4RR3A 5DPNA 4CPBD 5IVEA 2NMOA 4FPJA 3BPZA 4PDWB 2Q30A 1CAWA 5G05L 4WM7B 3S5AA 3FLPA 3MUZ1 1RUH1 1QJX2 1RUI3 4OUSA 4LUMA 4N7IA 3ETPA 4YW4A 3WDUA 1JZ6A 4UBGA 5D1IA 4FOYA 5C8WA 2EICA 2W95A 1XU1A 5F5CA 3VKLA 3BTXA 1CJPA 3WF2A 1W90A 2ILMA 5IVJA 2GMEA 4I30A 1UX7A 3CNAA 2CNAA 1E5IA 3FLTA 2ORXA 4LULA 1HXS3 1OF3A 5JXGA 4YGDA 1YQCA 3MLKA 1H2NA 5F6KA 1K5JA 2WABA 3TWIA 3VBUA 4YM3A 5FMOS 3S5QA 2DCTA 5D8AB 3OY8A 2JDHA 3UKNA 1A6CA 1DYOA 2AZ5A 5ANQA 1HRV1 3LSDA 1UY2A 3AP9A 3PUIA 4GH4B 4ET7A 3RZKA 5L73A 2OVUA 4BMBA 3ZXFA 3LAGA 3U1XA 3DPRC 2WO1A 2R30A 2RMU3 5H9SA 3EBRA 4FFHA 4IV1B 5DN2A 3BUCA 2ZGKA 3NRUA 1QJU1 3B02A 4ORFA 1SBFA 1JYCA 1O3SA 1STMA 1PO12 1XBFA 3JBG3 4EWDA 3W5MA 2FCTA 1RUF1 4AQ2A 1GANA 5FP9A 4OI4A 3FHQA 2C6SA 1US2A 5JZGA 3MW3A 1SCSA 3RZHA 4IESA 3P3NA 3SXWA 3M3EA 3N36A 4Y4YA 1PNFA 2UURA 1BKZA 2Z69A 3I2GA 4QHOA 5LK5A 1UIKA 3N7MA 2QUOA 2XUMA 4NPLA 4XAEA 4CCKA 1QJY1 4HETA 4AAXA 1OLRA 2XXZA 3CBNA 3WQ7A 1LJ7A 4L0PA 1HB2A 1QXPA 4K20A 4XBQA 5T55A 1N1YA 1FMD1 2HWB3 1FOD2 2HWC3 2VOWA 5LBFA 4DO0A 3RZJA 2W92A 2D97A 3BYWA 1SBDA 5EJ3A 3EMRA 2OPKA 5DAQA 4AEDB 3RPQA 2BVVA 3ZPYA 1GNZA 2OQ6A 2JE9A 5HI0A 4Q27A 4Q8KA 4XZPA 1ULDA 4BQ4A 3I3BA 1AL22 4A6SA 3GALA 4AVCA 4EN9B 1YO8A 1OFSA 1AXYA 3K4DA 5BNNC 3ZFGB 4D7TA 4LO6B 4NHKA 4Y1ZA 1WA6X 3PLQA 3ZLIA 4A4AA 2Q5TA 3NJZA 1Z7S1 1EYBA 4AGRA 5EV7A 4FPLA 1C8M3 1OPOA 2ZEZA 4YFZA 1U12A 2DFCA 2HEYF 3BALA 4MXWA 1VB4A 3KV4A 5CU1A 1CN1A 3AMMA 2D3SA 2CDPA 5AVPA 2WS93 2BNMA 3B94A 3TNQA 3P1IA 1Z0HA 3DXUA 4NIHA 5CFDA 2C0ZA 1NCRB 1RHI3 5F9TA 4LBMA 5L19A 4Q26A 4XXPA 4Q0SA 1ZBA1 3N9OA 5FZ1A 2Y0IA 1GZ9A 4RL7A 4R8HA 1Y9QA 1AR62 2R063 3PURA 4YZ1A 5A7SA 4XEZA 4NWVA 1GR3A 4BXSV 1H0BA 4DFSA 4C1XA 3ATGA 3MFCA 1S0BA 2NZ9A 3OD4A 4KWUA 1YLLA 4DOUA 5C9AC 3M7AA 3ZYJB 2WUHA 2YGMA 4PCRA 1R64A 4Y5SA 1V6NA 2DYCA 2QZ2A 3ZXEA 5LY1A 3L9JT 4HT1T 4MVTA 4QGNA 2PA7A 4OUEA 1CESA 2ZZQA 2Z5WA 3ACFA 3BCWA 1URXA 3NAPA 4M0HA 5KXBA 2DCZA 2PAKA 1MS9A 4IEQA 1ULFA 4BQWA 2WO2A 5DUUA 3LIHA 1GP6A 4QPGC 3NO8A 2A6XA 2DCJA 1YI9A 3N9MA 1UIJA 1UU5A 5IVYA 4ZU4A 2VZPA 3IN9A 2XMLA 3VBHC 4QM8A 1EV13 2RS31 1W04A 1BBT2 4OHZA 4MHUA 3UV9A 1FYUA 1Q8OA 2BVBA 3GZEA 1DGRN 2F4PA 3M3OA 3MEPA 3T30A 2D6OX 2XUEA 1X8MA 4KNCA 3R05A 3ILFA 3TN92 5FZBA 4NRQA 5A32A 2RE9A 2E32A 2EA7A 2GH2A 2RV9A 4RS5A 3SMHA 1W8OA 4YPJA 2AEZA 2JG9C 3HNYM 3W21A 3WY6A 5BV6A 5FR3A 1X9TA 1QNWA 3WDVA 1OD3A 5FZMA 4TXWA 5GALA 2ARBA 2VJXA 2KXLA 4UAPA 1IS6A 4XUTA 3VBUB 2C24A 2ZX0A 3GCXA 4COWA 4C1WA 4Z82A 1QJY3 4JDOA 3T0BA 2WFF1 1BXHA 1UZ0A 5CVRA 4XQWA 1CAVA 1HIXA 3TB0A 1FMD3 3H7YA 1POV1 3ZSLA 4YM2A 1Y43B 3HWJA 1V6IA 4XQ4A 3O14A 3J7LA 2GMPA 3DYMA 4N43A 4RSUA 4A45A 1W9SA 1OI6A 2WN2A 3J9SA 2XBO2 4ITCA 3WD5A 3U4XA 1J1LA 2ENRA 4BZ4A 1UXXX 2WAOA 4YZ3A 1V9U1 2IXHA 4TZDA 4LKFA 1R091 3OUJA 4RA0A 2HEVF 1CX4A 3LEGA 5IK5A 2HWF3 1OA4A 2WZ8A 5EXOA 1Y3TA 2D98A 5CISA 1ODMA 1DYKA 1RC6A 1ZZ9A 2UYBA 3AKSA 4FOQA 4HOOA 1IPJA 3NV4A 1J84A 1NE4A 1OBNA 5A3UA 3C7FA 3PVEA 1KEXA 5BNOC 3PUAA 1BJQA 4XJZA 1AR71 4UW3A 2VZ1A 1KQRA 1D4M2 1W9YA 2XJTA 2VTXA 5JIAA 4CU6A 1JYXA 3WR0A 4CRQA 2RR13 2W08A 2IXJA 4B3NA 3ZO0B 3ZXKA 3BTZA 1AX1A 4OCTA 1ZREA 3MPBA 3E5QA 3NNFA 5FLJA 1UZVA 3E97A 5HXVA 3LA3A 3CDZB 2YBPA 1ZBA3 5GLUA 2P3IA 3WEZA 1AR83 1LHWA 1UOBA 2LW8A 1QNYA 2W87A 4DXTA 3WF4A 5FUNA 4OVEA 2VTFA 2WYSA 3PVOA 3M8LA 3UNPA 2Y6LA 5FUPA 4MXWB 2P37A 2UY8A 2D6LX 4W4ZA 3OEBA 5H9RA 1H8TC 2Z2SB 1YUDA 1JXNA 3AP4A 3BOWA 3EB7A 3OYWB 2CV6A 1OQDA 3IAPA 4GB31 5E1RA 4B8EA 1O5UA 2YROA 2GP3A 2ZEWA 3T1MA 1DBNA 3NQHA 5JUVA 2YZ4A 4HSJA 4RQPA 5FTTC 2XBO1 4FCAA 4OUMA 2CL2A 4AI2A 1X33A 3U75A 2MPFA 2WRAA 2QVSB 2VXJA 5M0TA 2WBKA 1HJFA 3WDYA 2AREA 5JXJA 4GULA 4JX0A 1S0DA 3I59B 3BPSA 5EIYB 3O1RA 4EN6B 2VVFA 3CF6E 1Y9MA 4W6XA 2HJIA 5ABJC 1VB2A 3C7GA 4E27A 1QJEA 1JZ8A 1ACCA 1NOVA 2SBAA 3APBA 1UYYA 2IXLA 1ASJ3 1W6QA 2JDPA 2P6CA 4M3CA 4LNVA 1HW5A 4NRMA 3BN6A 4GWNA 1DZQA 1DQ2A 4MOAA 5LA1A 1YJLA 3WT3A 1UNBA 3BVCA 3WCRA 4H14A 4D94A 4IE4A 5CB7A 4ZZ8A 1D7PM 2FD8A 2XL7A 2Y6HA 5B2GB 5DAVA 3POSA 3WXPA 2VU9A 4DZGA 4BMEA 3GHMA 2R072 2VCAA 1VBE2 4I0BA 4CDWA 4S2FA 1FNYA 2RJLA 4LA2A 3BODA 4CXYA 1WD3A 3KD4A 1OT5A 3FZ3A 2QNKA 3MW4A 4HK9A 2DU0A 2DCKA 4KWLA 5IATA 1XYPA 2J7MA 3S0MA 2QQPA 1WMDA 5K0UC 4IQPA 2JG8A 4LT5A 2VNVA 1X82A 4LBQA 2WNVB 1JW6A 3NNLA 5FFOC 2QQOA 1PGW2 5A32B 1VBA3 3ENRA 3E6BA 4RS5B 5CAZA 3H3LA 1MZ6A 2B9VA 5F32A 3CZUA 3EJKA 3PUQA 4AWDA 1NG0A 1NCQB 4JQRA 3WOGA 1YFXA 4AVAA 1F5JA 3GZAA 1HQNA 1VBC1 4ZU7A 5C8CA 2Y64A 2A5ZA 4BH9A 5A1AA 2BEOA 1RMU2 3M2MA 1R093 3U11A 1OURA 3ZFEB 1G9AA 4QDSA 4LE3A 4LO8A 3THTA 1BLZA 2X09A 2I45A 3M3IA 2WT2A 1UZWA 2WIIB 3OOXA 4Z07A 4K7JA 2DUQA 3ZMNA 2Y60A 2LM3A 1C5HA 2E26A 3IM0A 2VZQA 1L7LA 1UX6A 5CFCB 1K5MA 2QQKA 2VW1A 1O5LA 1D0HA 3VBFA 5FUIA 1R081 2AC1A 4IGOA 3I7DA 1JHNA 4NPRA 1UN1A 4OI2A 3KMHA 4CP2A 3MV11 3NV2A 2XVKA 1J3QA 2JEMA 4I01A 5I0RA 4CZSA 4FPEA 1LKNA 1HLCA 1J58A 4GJYA 4FT8A 1JTZX 3JXSA 4QB2A 3TRSB 4MADA 1W8TA 1DQ0A 4IEPA 3TAYA 1BQPA 4YZ2A 3ZPOA 3HEIA 1PK6B 2FZ2A 4GB33 1DGLA 3KV6A 5FPAA 1IS4A 4BLJA 5FZOB 3OSDA 3PIJA 3O0VA 4YZ5A 2CU5A 1L3JA 3PU8A 2A6WA 5FYUA 1S1AA 2G9GA 4AVBA 1AR91 1JU4A 3FN9A 4UW5A 2AH2A 3GGLA 4IEVA 5A3PA 3RJRA 1YHFA 3OGRA 1A34A 5FY1A 3KT1A 2QZ3A 1DIWA 4A2UA 1GZWA 1O3TA 1O8PA 2B39A 2XHNA 5FPXA 1SFNA 3E6DA 5JOWA 2WQ4A 4B1LA 4P9WA 2J22A 5GLVA 4NIIA 1RB8G 4IEYA 1W6PA 1LENA 4NUBA 2RDQA 3T2TA 4FPFA 1XNCA 4I02A 4LIVA 4OZXA 3RSJA 3WW2A 4AI0A 5F5AA 3PUHA 1EAH2 1Q8PA 1FPN2 1OMIA 2YV8A 3N3HA 1G86A 4I3PA 4RQPB 3VBOB 2ZMLA 2VAUA 3LEKA 3VZOA 4B1MA 2LUWA 2Y6KA 3KVAA 4QPIA 2NMNA 3KT7A 2PLV1 5IAVA 1IPKA 4GWMA 3J8F2 4RR3C 1CR7A 4XC9A 5KHIA 4XDQA 5JI9A 2DVGA 2ZHNA 4G9SB 1LOCA 3HVDA 3AYEA 1S2EA 1UYPA 3NVCA 3PJYA 3RZMA 3IT8A 4D69A 5A3WA 2WKKA 3C2UA 3KT4A 4JKKA 5JCTA 2WT0A 3GHNA 1SHWB 2XVGA 1UF2C 2CGOA 1NUKA 4LUKA 1TEIA 4M0NA 5J1XA 1C1FA 1ULPA 3D3AA 3U4SA 3I2FA 4AI8A 5A7OA 1RUC2 4CCOA 1DLCA 2A6VA 4META 3VL9A 3UGGA 1PM7A 1LOFA 3B69A 2ZGMA 1W6OB 1ZBE1 5DXDA 4JDNA 1TMF2 4QPYA 1OA3A 1W9TA 4CP9B 2R041 4BQ1A 3POGA 3H1MA 3K4AA 4OQ9A 4U36A 5FXVA 3BIWE 2HKXA 5A3LA 3SCFA 4YSFA 1NA1C 2JG8B 1OFNA 3B01A 4HPKA 2R16A 2G9FA 4R9BA 4JQTA 5HCBA 1AYM3 2F4LA 3AL6A 1DU3D 4WM8B 4LBNA 5JZGC 3KCXA 3DYPA 1MZFA 5FK7A 1TE1B 3ILRA 4XZUG 3F2ZA 1SG3A 4LO4B 5DABA 5JIUA 1RVF1 4AR2A 1HXS2 3AP7A 1GUIA 1KS5A 3RMYA 1JOPA 3RNSA 1YEWA 2JDYA 3ZXLA 5F6LB 3VHOA 1SLIA 4GJZA 1NXMA 5C8CB 3J8F1 2RS12 5L7OC 3ZSJA 1ZVFA 1ENQA 5FV3A 3WZ1A 4KBZA 4YVSA 1MQTA 3ITQA 4FOWA 5LRSA 3ECQA 4YG3A 4L92A 2BV4A 3VDCA 3ZSKA 4LBQD 1GWLA 1HJGA 3PMEA 4K1ZA 4PDWA 3JBG2 2VBPA 4WM7A 1VRBA 2VVEA 4AAPA 1PMIA 1YWKA 4Q4Y3 1XNBA 4HKOA 3ZYFA 3MUY1 5C3RA 1L7RA 4XJWA 5DMYA 3DEMA 1DG6A 3WDWA 3VBRA 3M3QA 3Q8EA 4Q4V3 5EPAA 3KVBA 5GZEA 3C7HA 1CAUA 1BMV1 1OLMA 5FZ9A 2NP0A 1LRHA 5CG9A 1TMF1 4IGQA 3VBFB 5J96B 5F2WA 2HWB2 5E6HA 5FMOL 3KB5A 1TME1 1VALA 5D8AA 2HWC2 4QPWA 4XCBA 1UWWA 4QX2A 1J1TA 3ACHA 3VB9A 5CFDC 4GH4A 1AXZA 3RGBA 1RUI1 1SEFA 4CVUA 1PVC1 4JTNA 3V56A 2G19A 4BQXA 3ZR6A 2FCUA 4WV8A 4IV1A 1AXKA 2BGCA 4XIKA 5FYHA 5JI7A 4BPZA 2BOIA 3SQOA 3VZKA 1MS4A 1RL3A 2XGXA 4N8MA 1ENSA 2W5FA 1XE7A 5IUQA 4UFJA 1HB3A 5IJRA 2WNUB 4CYDA 4ASLA 3V64A 1VRH2 4KH9A 1C8M2 2C5DA 2ZACA 4BXFA 4PQQA 1IQAA 4PI0A 4E4HA 3GDBA 4CU8A 1AL0G 3MV01 4QMAA 1WMXA 1S55A 3AP5A 4AEKA 2WS92 1TVGA 4LO7A 4MGZE 1GZWB 5GZGA 3RG0A 2PHXA 1H6XA 2RMU1 1ALYA 1RHI2 4FBFA 1KFUL 2Q8EA 4GWJA 2FMYA 3IDBB 2HWD1 3NAPC 4JKLA 4W50A 4RYDA 3WHUA 1LODA 1W6PB 3V0BA 2L9LA 5DG1A 4AHZA 4F7ZA 1KGYA 1GOFA 2VBBA 1O3RA 2YC2A 1LECA 1ULGA 2A6ZA 2B7YA 3MYXA 4X6QB 4X6RB 5FO7B 3ZXAC 1EY2A 1GQGA 1KRIA 5FXZA 3WQ0A 2BTVC 3M4FA 4RHV3 4XBLA 4JKMA 1Z78A 2JB4A 4TWTA 1IOAA 4CCLA 1JOBA 4LO5B 2RDNA 2PHLA 3TEWA 2HYKA 1MEC3 4RS5C 1OKQA 3WCSA 1PGL1 1DP0A 1PZ9A 2E31A 3EQEA 1GKBA 1FNZA 2BGPA 4BE3A 1RUH2 2XQRA 3H8UA 4JHTA 1ZZCA 4ISQA 1OSGA 1NCRA 3ZN6A 4ES9A 1SLAA 3OGGA 4QXCA 1XNAA 3D5OA 4L11A 2WQZC 5F7UA 4LPLA 3GXUA 2D40A 3NW4A 3O1SA 1ODNA 2OUJA 3PVNA 4GMP0 2B4KA 1U0AA 3FUQA 1LAJA 4ZZ5A 1W2NA 3NV3A 5FKBA 5JXHA 3HQUA 4B29A 1GSLA 1MPXA 1HRV2 5JOZA 5T50A 5F2SA 2IXIA 1REDA 4M4RA 4JZRA 4N43C 1YJKA 5LA9A 3WLUA 3VHPA 4DPNA 4MGSA 4K9SA 4XE9A 1RHI1 2ZAHA 2BU9A 1G6NA 3AJZA 3PTYA 1QJU2 5A33B 4HKWA 1XNTA 4IUGA 4Y5Z0 3O0XA 4ZXKA 1T6GC 3K48A 2A71A 1RUF2 3MO4A 4R9DA 1HKDA 1QHDA 2EIDA 2R061 1C3HA 2YPJA 4YVWA 5FKCA 5CA6A 5SV8A 1R1A1 4CCDA 3SH4A 2YBKA 3GZUC 1QJY2 4NIDA 3AZZA 5I8SA 3ZYRA 5FYSA 1UZZA 4NHMA 4LKEA 1FMD2 2DUPA 5B4NA 1VMHA 2ZHLA 3I3EA 4UF0B 3F95A 4FPOB 2GC2A 4N53C 5LK7B 2EXIA 3CO2A 3ILNA 3ZDVA 3LCPA 4NRPA 1BK0A 4RFRB 1PM4A 4FFFA 1POQA 3NJVA 4Q1PA 3ZFFB 2BNNA 1WCUA 2SLIA 4C91A 1PVC3 3LPFA 5D21A 4BISA 4FAGA 5JAXA 3VBRB 1ZRRA 5E88A 2GZWA 2WC2A 2ZX1A 4AI3A 2OZJA 4DRVA 1CAUB 4COYA 2R0HA 3NJYA 5FP4A 3VBSB 5I0SA 3VZNA 1O6UA 2VW0A 3W5NA 2Y33A 1EV11 1Y7BA 4QX8A 1Z7S2 2D5FA 4Z1VA 3VD4A 4Y20A 3N9NA 1H2LA 4QGLA 4UWDA 1I9RA 1T2XA 4KL1A 5A6QA 1GP4A 5HCHA 4RQPC 2CTVA 2X10A 1VE0A 4M3CE 4OMCA 4DEVA 3ZYIB 4QXHA 1OA2A 4XYXA 5J48A 4Y1VA 2HWD3 1JMUB 4COVA 1ZBA2 3TNPB 2X8KA 2BGOA 4MSVA 3A0NA 1YCIA 2PAMA 1TNFA 1G8WA 3BU7A 3AZYA 4QD2A 4F3JA 3PTRB 2P6HA 1W3XA 3SH5A 5JOXA 5F37A 1IZ3A 1CQ9A 5ANNA 5FIXA 3VZJA 4B4QA 3T0DA 1GP5A 4IL7A 4XOGA 3LGRA 3I2IA 2WZR3 3O5SA 4FXKB 1PX3A 3P3PA 1S0GA 1GWKA 3WDXA 2PHWA 1GOGA 3VD3A 1UPSA 3CJIB 3R4SA 1JYIA 3GJBA 3WP5A 1N3PA 2J1SA 3LA7A 3IMNA 1QY4A 3UKTA 1ULCA 4P9IA 3HPNA 2WN3A 3KV5A 4Q0VA 3V0BB 2ZZJA 3RZZA 4CDWC 1OVPA 1YIFA 2O14A 2XWBB 2PHUA 2ZX2A 3GCWA 3JZVA 1VJ2A 4QX7A 4K21A 4MGKE 2B45X 3SC7X 3SKVA 2HWF1 3PJQA 1NT0A 1RUG3 3LD8A 3GYDA 3KGZA 4A44A 2EIBA 2JX9A 1FX5A 4YZ4A 5JPNB 1H1AA 4PI2A 1GICA 2B42B 1ASJ2 1QXRA 3D8CA 4O7XA 2Q4SA 3AFKA 5DDJ3 3RFRA 2RS32 2W46A 4LLFA 3T1LA 1AVBA 5FPUA 2ADEA 2HYXA 1PO23 4HN0A 1PZ8A 4LXLA 1CONA 2GSYA 1V0AA 3ZM8A 3OYWA 4UT5A 4IW3A 4EWEA 3I2KA 1W39A 1CJDA 2RR11 2VQTA 3AL5A 3ZN6B 3C8XA 3RDIA 3B9CA 5KR7A 4LHKA 2XONA 3FJSA 5FY0A 2WT1A 1UMIA 1AR81 2XB6C 5FZGA 4LK6A 2YUEA 4IEXA 3C7EA 2YY1A 5LCWL 1DGWX 4D7SA 4D6QA 3JU9A 4QQ2A 5FYTA 4E9KA 4Q4W1 2Y8KA 3I59A 1RINA 2VZOA 1R1A3 1A8DA 4H3WA 4QKBA 2QQVA 2VL4A 4QU2A 4TYSA 5ISLA 1O7FA 1H8VA 1HN0A 2VZVA 4AQTA 4P9JA 2WFF2 5LBBA 4D6RA 4XTPA 2XJQA 1VBA2 2I74A 2VW2A 4UI9L 3SKJE 3H9AA 5KHKA 1ENXA 3G6JB 5IW0A 1FV3A 3K3OA 4MGIE 3UJQA 5A3NA 3VKMA 4AFBA 3POYA 4V2VA 2RS51 1K5MC 1LGBA 3NMBA 3KM5A 4LHNA 3VBFC 1PGSA 4QXBA 1DHKB 1V9U2 1TQ5A 2WWJA 3POFA 4LKDA 5DUXA 1NE6A 1UY0A 3J7MA 4GA9A 1UYXA 4XVHA 4YVWB 2EIGA 4RFT0 1R092 3USSA 3BB6A 1D2SA 4NIAA 1AX2A 2B5HA 3AVSA 3W58A 3ALQA 5CKQA 2E33A 4FXGB 4PQ9A 3NL1A 1VBB1 1KDKA 2Y38A 4URAA 2D3RA 1ASJ1 2K46A 2Y6JA 3KF3A 3MDPA 4NHXA 5FXWA 1NQJA 2X05A 1F31A 1LOGA 4FP2A 4IEWA 4RN5A 4CUAA 5LB6A 5F8PA 2O0OA 1Q43A 4R4XA 4RGKA 2WNVA 2XLAA 3I8TA 4AFDA 3K3NA 1COV3 3CLPA 4NE9A 1W03A 1OQEA 2BOJA 2FQPA 1RIRA 2ZGNA 1AR72 3IDCB 4LBKA 1EPZA 1W2TA 4FAHA 1FV2A 2WSVA 5HBAA 1WD4A 2Z79A 4YM0A 2O8QA 3LFMA 1WBFA 1ZYBA 3L2YA 1FT9A 2A6YA 3HR9A 4K6BA 1B35B 1QMJA 1NCQA 2DU1A 2OKXA 5J3UA 4UBHA 3ZN5A 2UWAA 1W8FA 4SLIA 1LESA 3WVJA 2JE8A 4JGYB 3B3QE 3SITA 3OCPA 5DAXA 3A0KA 5FZFA 5JVVA 4DY5A 4Y20B 4XPVA 4XFGA 4Y22A 4BHPA 1P8JA 3AKRA 2K9ZA 1LCLA 3ZFEA 5HCFA 4V1PA 2BNOA 3AKQA 1NLSA 1VBA1 4UW6A 3VDAA 5FQ0A 1WUVA 5LBCA 4GB32 1DQ1A 1UOGA 4P14A 4QPIC 3RI9A 2VUDA 1QGLA 3H3ZA 4EZ4A 5FP3A 4Y33A 1AZDA 1GBGA 4FTEA 2JKBA 2VOXA 2C4XA 1GLHA 5CFCA 1VBD3 3IB3A 3NNMA 1V6KA 1HRI1 2QQJA 2VOTA 4KI5M 4YW5A 5ACA3 3WSOA 5C7GA 1UYZA 2GC1A 4Z92B 4AFCA 5FZDA 5KHJA 4B7EA 2IZWA 4PBOA 5DZEA 2LRPA 1AYN3 3ORJA 5JR7B 4ARYA 2N7GA 2DTWA 1RUJ1 3UGFA 4Q4X3 1QXJA 4C0HA 2J1VA 3ON7A 3WW3A 3ZYGA 2BBAA 4CEYB 3DUIA 4LLOA 5FY8A 3SNMA 1WMFA 2CWSA 4R52A 4QQPA 1LOFC 2CDOA 2GN7A 5SV5A 1V6JA 2CYFA 3QLQA 4JHZA 2BUKA 1QJX3 3PUSA 2CY6A 1PK6A 2J1RA 4AI9A 5AC91 2OIIA 1J83A 5C5UA 1DLLA 5FZOA 4KU8A 3VHNA 4UW4A 2VCBA 1XU2A 3O1TA 1XC6A 1CIYA 5FZKA 5T52A 2CAUA 5J98B 1JOJA 4HLTA 3LKJA 1MZ5A 4URTA 5A1FA 2DVAA 2ZHKA 1DZRA 1ZRDA 4NMIA 4OI1A 2QQUA 1YQ8A 3ACGA 4Q4W3 4QHZA 4QX0A 3VDDB 3AMNA 1N3QA 3EHKA 4AFMA 4IE6A 1ZRFA 4I3GA 1IKPA 4XDPA 1RTVA 2JDMA 1Q8QA 2I2SA 4WZFA 5H9QA 3I2DA 1PX4A 2XH6A 4QX1A 2OPWA 4P08A 1J3RA 4K1YA 3ZXJA 4YFWA 4LE4A 1ND2A 4B7KA 1CZVA 4JGZB 2C26A 4QKDA 5FP7A 5DG2A 4QB6A 3VBOA 4AGGA 1PO13 2RS53 2RDRA 1ULOA 2VECA 2NM1A 5GJ6A 4BYYA 4DIQA 4ZKTB 5FLIA 3D4KA 1VBC2 4YVSC 1MQTC 1NYWA 1S2KA 1E5RA 1E5SA 1S0CA 4XJ9A 1UY3A 4PDWC 3KSCA 5F1RA 1TNRA 2JWPA 4NHLA 4WM7C 5DZFA 5A6ZA 2PXJA 1H6YA 1O59A 2NLRA 1VBB3 2A3WA 4UFHA 2MEV1 2JDZA 2VC9A 5FYMA 2FBEA 3MPPG 4CDUB 1VP6A 3ES4A 4Q5OA 2JENA 1FATA 1SQ4A 5C71A 2PQQA 3Q8CA 2DDUA 4IETA 3HMYA 4DXRA 5EQUA 2DBNA 1QF3A 4CU7A 1X36A 3G7DA 5IYYA 5D8AC 1K3IA 2PFWA 1W6OA 2ZTNA 2AUYA 1AL23 2XJPA 4CP9A 1R082 1XSQA 4GH4C 5FZCA 4DNYA 2E63A 4PF5A 5LW9A 2EXJA 2V73A 2GAUA 2ZKLA 3AVRA 2WINB 3FHIB 3FWEA 3JD73 1G9CA 2VZSA 2OXBA 2OQ7A 4IV1C 3RYKA 2OT7A 4INDA 3QH7A 4HANA 4OZOA 4GQ7A 4XUOA 1SACA 3E1F1 1CWPA 3MW2A 2XDVA 2IFRA 3AM2A 4IERA 1I6XA 1VLNA 4MGYE 3AP6A 5LRRA 3DECA 4Q4V2 4QT6A 4JRAA 4IV3A 4WM8A 5FXXA 3BI3A 4XHBA 4NIGA 4RGGA 1IQDC 5A7WB 5IFTA 4FTSA 3I2OA 3OUHA 4KMQA 4YNIA 3VZMA 1S2BA 2ARCA 1OXCA 3NJXA 2D6KA 4C0BA 2TNFA 1H4GA 3D0JA 1C5IA 1XB9A 2J1AA 1AR92 4AZZA 2A73B 1NZCA 4FVVA 3VKNA 2DURA 3WNLA 1RJ7A 4OMDA 1AR63 4NAOA 5FZLA 4D3WA 1UY4A 1HRI3 1HV1A 4E2QA 4Y22B 4A41A 5HXMA 5L9VA 4BLIA 5L36A 1AYM1 1F35A 4R4ZA 3J26N 2YFZA 4AEDC 4IGPA 3T08A 2LROA 1QJFA 5FQ0B 3WG3A 3LDRA 2OS2A 3DXTA 1LOEA 3NV1A 1RUJ3 3E5UA 4Q0UA 4CDQB 1YFYA 3LPGA 3RQ0A 5JMCA 2UY9A 2VMFA 5FZ6A 5IFPA 4CUGA 2D6MA 2P2KA 3C7OA 3EYPA 5F5IA 3HIFA 2OA2A 3ROUA 4W6YA 3ZFGC 3N7KA 5FZHA 5FYCA 5AC93 2PLV2 2ZGRA 1GQHA 4QB1A 2C9AA 4QU1A 4K3UA 2A75A 4QQOA 4ASMB 1Q8SA 1W28A 1XOYA 1NCRC 3H0OA 5EYXA 4BQ2A 4Q4Y1 1AJKA 1BBT3 1UO9A 3J4UH 3R4DB 5J37A 3R6SA 4A6OA 1GU3A 5FPVA 4Q4V1 1XYNA 1N47A 4RHV2 5JSRA 3TN93 3V65A 1VAVA 1AX0A 1ZBE2 3A7QA 3I3DA 2WNUA 1LOBA 3USUB 4CDXA 2R042 1ZRCA 1ZZ8A 2R1DA 4BQ3A 4PIYA 3UKVA 2YG0A 4IEZA 4Z2WA 2GN3A 1YQ5A 1JODA 1RGSA 4MYEA 2ZOEB 2ZX4A 4KQ7A 4HVQA 5F3CA 2BWAA 2R1BA 1YYNA 3AMQA 1LOAA 4YVWC 2MEV3 2VBDA 2Y6GA 1H9PA 1SFPA 2Q1MA 3N9LA 5IK8A 1RVF2 1QU0A 1TZOA 2ZGUA 1ND2B 3U07A 3QH6A 1PIV1 1YQ6A 4XAAA 4BDVB 4F8AA 3E6CC 2BQPA 1CD3G 2GNDA 1JZ5A 2JECA 4ZS3A 2W52A 5GZFA 2QFEA 4DB5A 4YW7A 2AENA 3SHRA 3ZN4A 1DCSA 3FE5A 4MO3M 1IHMA 2R32A 5G04L 3Q8FA 1QWRA 4IXLA 4NVPA 1OOPA 2VR4A 1JUHA 5FY5A 5LA0A 1XYOA 4Y24A 1XXNA 3GNEA 4PT6A 3CZJA 1NLQA 3RVHA 2J1TA 3A21A 3OGVA 4FFIA 4ZU5A 4AVTA 1NY71 2ZPXA 2P3YA 4RHV1 3VBUC 3WNMA 1D4M3 4JAAA 1MR5A 4OYUA 1BMV2 3ASIA 2V4VA 1PMJX 4MHRA 1MVQA 1I5PA 1IG3A 1G9DA 1TME2 2ES3A 3EO6A 4LK7A 4PLMA 4XETA 1KITA 2RM21 4XTMA 4YG6A 3WUDA 1MEC1 1LGCA 1HV0A 2WJSA 3OPZA 3W20A 2HWE1 2ADDA 1NKGA 2QQWA 5KHHA 3ZYHA 5C5TA 1KDMA 1RUI2 4P9GA 4R9CA 5FZAA 1PVC2 2XQXA 3KCYA 1FAYA 4Z2AA 1NX9A 4LEJA 1OKOA 4IV3B 5A33A 3MLLA 3QCWA 4QM9A 5BNOA 1F5FA 3I4IA 1BEV1 2FHRA 2QQNA 4EYUA 4O9GA 3KWVA 5FYYA 4TN7A 3POJA 4K8RB 4GMP1 3IPVA 5JPMB 5C3PA 3I2JA 3M3CA 3WF0A 1GFF2 4BU2A 1VMJA 3CL1A 4W6WA 1RITA 4UFLA 2RMU2 5EFUA 4XJUA 4XILA 5FRAA 4UF0A 2QE3A 1C57A 1GYKA 2HWD2 2QQIA 2H0BA 3B9IA 4J1WA 3S6PA 3WV6A 4D8MA 3AMPA 4YRDA 2MHFA 1H8TA 3DV8A 4OHWA 2ATFA 2D44A 3WG1A 3ZFFA 1TG7A 4YM1A 5KBFA 2EXKA 2D43A 1OH3A 2PN5A 1EPWA 1DQ5A 2W3JA 4NAMA 3W59A 2DUOA 4M3CF 2ZGLA 2A3XA 3VBSA 4AYUA 3O1OA 1RXFA 2R073 1VBE3 4B4RA 5K4LA 3HN1A 4FTBA 4OHYA 2E53A 1QOOA 1CAXB 4XUNA 1PGL2 4CE8A 5C9AB 3O1MA 2G1MA 5FJHA 2HBUA 3HAGA 5FZ8A 1WKYA 1W6NB 3A23A 5IVFA 3RYRA 4E4ZA 1XJAA 2UWBA 4GD4A 4HG6B 4XFAA 1Q5OA 2ZMNA 3H1YA 4YW1A 3HQRA 1DF0A 2XPJA 4I0WB 1YC61 3MI8A 4E4SA 4Q29A 3I2HA 1I1EA 2IVJA 4J6GA 1S0IA 4Y1XA 1U5XA 3NKGA 3POEA 5T3NA 4BB3A 1VMFA 1HDKA 2G9ZA 2ZABA 4CDXB 4ES8A 2JE7A 1G9FA 1PIV3 3ME2A 3OGJA 3IAQA 2PHDA 5B4XA 4CU9A 4FFGA 4Q1RA 2WL1A 2C1FA 4MXVA 4Q8LA 2GH8A 4QPGB 4DUXA 1RMU3 4NPMA 2EIEA 3OPTA 5LEKA 5IT6A 3N4MA 1M06G 2ZCWA 3GBWA 3JQWA 5D2AA 2OW4A 4WZCA 3RYPA 1UQXA 3VBHB 3CJIA 5KXDA 5I93A 3U37A 5F5QA 4KG8A 2JDAA 2DVFA 5FJKA 3O1PA 3MIFA 4HVRA 4Q0PA 1RYYA 2Q8OA 4E2GA 2W68A 1KFXL 2VULA 4XF3A 1SPPB 4FSJA 4KU7A 5KHGA 1GQPA 1ZZ6A 1YIPA 2R062 1YI7A 2GNBA 1UW8A 1W06A 5FK8A 1K42A 4YGBA 4MG2A 3POWA 1R1A2 3Q8AA 2JG9B 2P34A 3VKOA 1Q8VA 1A78A 1L7QA 2JDNA 2WZR1 3NNJA 2O1QA 3ZYBA 2IUWA 1O91A 1JS9A 2JD9A 2WNVC 2RJKA 4PHZA 4XFCA 5A3TA 4L97A 4O9EA 2VMCA 1LB2A 1ONAA 1N3OA 1OOPB 2RM23 1W6MB 1S0EA 5F3IA 3UESA 4U2AA 5A7PA 3AKTA 2HWE3 3OF1A 1GV9A 1UMHA 4WVMB 4CP0A 3LE0A 3KCCA 2ZEXA 2ID4A 4A3XA 4EQVA 5AFEA 1NCQC 2DVDA 4AE2A 3A4UA 1OLQA 2VQ0A 3LOBA 4HN1A 3ZXGA 1RUG1 3MZHA 5FMBA 2WNEA 3OD0A 4BWOA 4UFKA 4AG4A 4D7YA 1LEDA 3PL0A 1Y4WA 5JMOA 5TSWA 4DUVA 1BEV3 2WO7A 2CWMA 1EV12 2ET7A 5DDJ1 3ZFEC 3H7JA 2JB8A 1VAMA 2WZEA 4I2OA 1UL9A 2ZEYA 4QX5A 4YG0A 1OVSA 4GMP3 3OB8A 5FYVA 1ND3A 4DY3A 2YXSA 1PO21 2YHJA 4UYBA 5I8YA 2W47A 4HVOA 4IE7A 4XDOA 3AYDA 2R49A 3KQRA 3VN4A 5FPBA 4QKNA 2VNRA 2C9KA 2P17A 3FLRA 2QTWB 1E57A 1QOSA 5LA2A 5CFCC 2VNOA 1OQ1A 2PHTA 5BNOB 1ZA7A 2W39A 3ZKUA 1EAH3 5DUWA 1FPN3 3I97A 3S30A 4N9IA 1RUE1 3DN7A 4CCCA 4MGTA 5C4WA 4DXZA 3IPVB 3OG2A 4QXKA 3WG4A 5HCAA 5J09A 3ZYPA 3PMSA 4A3ZA 2JDKA 1XRUA 1N1VA 4XMAA 1NLRA 4RD7A 1RUD3 2VM9A 1BVVA 1PK6C 3OBAA 3RZLA 3DCQA 4O61A 1XSRA 4CEWA 2PAEA 2VZRA 4WVZA 1QKQA 1ZNPA 1H8TB 1ZM1A 2WA3A 4CCEA 1QOTA 1W0OA 4YW3A 5K8SA 3M70A 2AGSA 2RDSA 4QDQA 1UKRA 4AQ6A 5LY2A 2KD7A 2HWF2 4GWIA 1NXD1 1RUC3 1SLBA 1B35A 2ZA9A 4LR4A 3M1HA 3T4HB 1AYN2 3VHRA 1I3HA 3GBGA 4FPHA 4XBNA 2XJRA 1GNHA 1JZ3A 4AFAA 2VVDA 5GKAC 1CPMA 5FZ7A 4JGYA 3FHAA 4LOSA 4N7UA 1UXZA 3DYOA 5I91A 1COV1 4NO4A 5ABJB 3JB4C 2GDFA 3IKWA 3ZMOA 2FDGA 1F2NA 1ND2C 1W8HA 3VBOC 4UOJA 2XJVA 1W8ZA 2RR12 3VD9A 5CEHA 1W2UA 5T5LA 5FY4A 3WNNA 2DTYA 5GZDA 1QQP1 2WAAA 1AR82 1W2AX 4LBLA 4GZ9A 3Q8BA 3FFZA 3R4UA 5T5OA 3ZSEA 3VV1A 4NHYA 5F39A 4AVSA 4CXWA 1LGNA 5ERLA 4Q4W2 4E4DX 1OHFA 2R6QA 2VE1A 4TTGA 4JDMA 2X5IA 2XKPA 1QDOA 5CKMA 2PHFA 4CUBA 2P4EA 2RS13 2AYHA 3OPWA 2QKDA 2B9UA 3ACLA 4J25A 2VCCA 1AF9A 1DYPA 4H7LA 3GBFA 4BOWA 4CEYA 1NA1A 5K0UB 3H8RA 2O8OA 5GM0A 3IWZA 2VO5A 3MF6A 2RS52 4J1XA 1O8SA 2YB7A 5FMDA 3FX3A 2BW8A 3RRDA 4QGMA 3T2OA 2QJVA 2W1SA 2X53S 3CIHA 3KHBA 1LTEA 3PHMA 1REFA 4ONUA 1VBD1 1W0PA 5DAWA 2VNGA 4FOVA 5FYIA 5ACA1 4YLZA 4DUWA 2JXAA 1V00A 2EALA 1BVP1 3LEIA 3UK9A 4YARA 3Q9OA 5LZ6A 5C33A 2FCVA 1AYN1 2F6BA 2JG8C 2Y6FA 1LR5A 5JOYA 2WDBA 1VBB2 3AFGA 4FO9A 2XWJB 4Q4X1 4EN7B 1JZ4A 4O65A 3T2QA 5BNPA 4WM8C 3VDDA 3IBMA 4IV3C 5IHRA 5BYNA 5L7OA 1XPWA 4NOTA 5A6XA 2PYTA 1QJX1 2XKOA 3MF9A 3DGTA 2ARXA 4AI1A 3AZVA 3IDEA 1IPSA 4EN8B 2FDKA 2VOKA 5C8CC 2OX0A 4JGZA 4MX3A 2EAAA 2IFWA 4AVVA 5FZ3A 2GC0A 3JD72 2Y26A 3TEZA 1S0JA 1VRH3 2VUJA 2VTXJ 1RUE3 2WLQA 5A3OA 2ZS6B 5FY9A 4OULA 4EWAA 2AEYA 1X50A 2DBIA 1ND3B 2ZGQA 3H1WA 3HNMA 4KGGA 3WQBA 4PF1A 1JBCA 5CBLA 1DZTA 4WVWA 4L8QA 2DCYA 4CDUA 5FWEA 4Y1UA 5FZIA 3LA2A 1PNGA 3I3QA 3TBDA 1PO11 5J7MA 1MS8A 5CG8A 2JKXA 3ELNA 2VMHA 2XHKA 4DS0A 4CCNA 1HX6A 1RJ8A 1UU6A 4ZONA 4HK8A 4LORA 3GZTB 1HRI2 2PMWB 3ACIA 4SBVA 2ZGTA 1X9PA 5C4WB 3IIIA 4AGVA 4BK5A 1EUUA 4W65A 4DRRA 3C3VA 3MFAA 2BFUS 5A7NA 1BYHA 5E16A 4S2HA 3MIHA 4EV0A 3AYCA 3GM8A 3MICA 1MZEA 2ARAA 4XJAA 3MIBA 1RUJ2 4JC1A 5JDBA 2AACA 4QHBA 3RWNA 5JXIA 5HV4A 1FOD1 2CAVA 2XLFA 3MHZA 5H9PA 5EHDA 4CEWB 1N1TA 2FDJA 4GKXA 5I0UA 1JHJA 1KJRA 1RUH3 1A3KA 2WNUC 5DQ0A 2W1WA 2VD7A 4CDXC 2IXCA 3BOPA 5AC92 5JSOA 1MVEA 3K51A 3KGLA 2GC3A 5A7WA 5A70A 1FI2A 2J42A 1AL21 2W2IA 4FP3A 3U0ZA 3LDBA 3ZOIA 1QQP3 1HB4A 1T6BX 3HBKA 3O7OA 4DEQA 1APNA 2ERFA 5FBZA 3P5BA 3JD71 2XOMA 3BTAA 4S2DA 5LATA 1WBLA 1HQLA 3DKQA 4GKYA 2ZX3A 4AF9A 4FPKA 5BUVA 4RR3B 4YYOA 3JQXA 2ZGPA 3H3UA 3KF5A 5FZ0A 3POIA 1HRV3 4C8DA 1UKGA 1CAWB 5FWJA 1W9FA 1JU3A 1WA4A 2XJSA 3UJOA 1YFUA 3VGIA 1U5ZA 5FO9B 2E7TA 2YDEA 5CIRA 1F15A 3WNOA 4CDQA 3RJ2X 1QJU3 1U5YA 2OYZA 1WW4A 1SZBA 5JLVA 2ZKNA 1ZZ7A 2GU9A 1RUF3 1NZIA 1XNDA 1AR61 2A7AA 1KS4A 2Q0AA 2V5YA 2VZTA 3D6EA 4G3YC 4H2AA 4MV2A 4WVVA 3K77A 1OOPC 4XUPA 2H0VA 4H7MA 3LF7A 3OY8B 4Z8BA 3VUOA 2X5IB 1EP0A 2F17A 1QDCA 3LWCA 4X8PA 4PJYA 3RMXA 2A1XA 3OBRA 2MEV2 2JIGA 2JDUA 3ABZA 1GWMA 5EP9A 1C4RA 1HN1A 5CNAA 1NA1B 1M4WA 4AEMA 5FLHA 1QH6A 1W99A 3FC0A 1SDDB 3THDA 4A7ZA 1W05A 1WZXA 4I09A 3AMHA 3R0RA 4QQLA 4HSLA 2ZMKA 3RZGA 5GLZA 5EYYA 4E2SA 2W94A 4GAZA 5JZGB 2BDRA 1QJZA 1JUIA 2ETEA 4G4FA 4HKLA 5IK4A 1WMEA 4P9YA 1SLCA 3USUA 5LASA 3B7MA 3D82A 1WCQA 3AB0A 1X7NA 3VKFC 3IIAA 5IK7A 4XHXA 5IVVA 1MS5A 1WW5A 3LDKA 4FQZA 4LKSA 5BNPB 1Z7S3 1JYTA 1BBT1 2WSUA 4GALA 2XG3A 5L7OB 2VMIA 1C28A 5DZGA 4C90A 4P00B 3VD5A 2P3JA 1V6MA 4MZUA 4YW2A 5KXEA 4EE2A 2RG4A 1RUNA 3PDQA 4XFBA 2Q8DA 3TN91 1ST8A 3ES1A 4N53A 1JYNA 3KLSA 2WLPA 2JD4A 5FOBB 1JZ7A 2A70A 2ZXQA 4XIOA 5IVBA 3HD8B 3BTYA 4BQYA 5BPXA 1OD5A 4AQSA 4LHLA 4ATFA 1OLME 2VQAA 2WYFA 2CGNA 4AHWA 1H4HA 2GP5A 1AYM2 4Y26A 3ZFFC 1H1IA 4LIUA 2VOVA 1JYWA 3B5LB 1UPIA 5HV0A 2B8MA 1LHOA 1VR3A 2CHHA 3INAA 1WGPA 2NPIA 5CFDB 1UY1A 3VBRC 4MH0E 1DQ4A 1ZA4A 1O4ZA 1FOD3 5AVAA 1AUYA 3DPRA 3VBSC 4L99A 2WA4A 4QX3A 3BIEA 3FL7A 1D2QA 5APAA 3IMMA 1WW7A 3OJBA 2PTMA 2IC1A 4OFGA 3WF3A 3ZDSA 3KQ4B 3N9PA 3HQXA 3OGSA 1JN2P 2DWRA 5KXCA 1PVXA 4XACA 2TEPA 2PELA 5BNNA 2VUCA 2IXKA 5IWFA 1UD1A 4YGCA 4S2GA 3CJXA 2RS33 1LHVA 4Q4Y2 2J1EA 2WNOA 4XF4A 4UXAA 3WG2A 3CQOA 3ZIXA 1Q3EA 5L9RA 5A80A 1KD7A 1D4M1 2VMEA 5FZ4A 4CXXA 1NAEA 3NAPB 2WZPP 3UETA 1Q56A 3UYJA 2WWSA 1XE8A 3K2OA 3VLBB 4BQ5A 2AR6A 1W8UA 1UU4A 1H9WA 4QDRA 3CKHA 3WW1A 4QKFA 1PZ7A 4CUCA 3WNPA 3WNKA 3JCIA 3V0AA 1SLTA 2E9QA 4F83A 5AFBA 3I54A 3CJIC 1BCXA 2Q8CA 1CGPA 4X8NA 4QWNA 4NWWA 3CEWA 3LIGA 2EVXA 3ETQA 1WLDA 2XLGA 4PBPA 1POV0 5T54A 3CMGA 2ZJCA 2VGDA 1UOJA 1KJLA 2EAKA 4JTOA 4TLGA 4OHXA 5EZWA 5A1LA 2WFF3 3BKZA 3AYAA 2CGPA 2FZ1A 3AZWA 3KHCA 1POV3 3OUIA 1GZTA 2X29A 4Y3OA 4IE0A 3T4VA 3O12A 1X8EA 1SFYA 1YXWA 1J3PA 1PIV2 4NROA 5FO8B 4XW3A 4XMIA 2RVAA 3MLJA 3RWKX 4HMZA 1F8VA 4PIXA 3AXEA 1V9U3 2FDIA 3AK0A 2RHPA 2Q1FA 1LU2A 4OHVA 2YPDA 1IS5A 2VXRA 4FPGA 4M00A 5FZEA 2BZDA 4P02B 1CZSA 2D5HA 5BXXA 5C3OA 5K9YA 2YC4A 3K4ZA 1SCRA 4LOTA 4XABA 5DAPA 5C3QA 1CAXA 1DFQA 1CAVB 4IEUA 2VMDA 4ZHNA 5C9AA 5FP8A 2ZAAA 4N43B 4LJHA 4JCKA 3GJAA 1W6NA 4MLOA 2BPA2 3PIGA 5K7PA 4XF1A 4AK3A 1NY72 2PHRA 3DF0A 4FQ4A 1W3VA 2XR4A 2V72A 1AR73 4AEJA 1YFWA 1DQ6A 2VUAA 1ULEA 3O0WA 4A7YA 3ZSMA 2D93A 1BHGA 3FFQA 4P5HA 5A3MA 2BP6A 2R071 2WO3A 1VBE1 3A22A 1HB1A 1ND3C 3HNBM 4FI9A 3EXUA 3KZ4C 5FPZA 5CYYA 4EJRA 3T3YA 4RGAA 2RM22 5FYBA 2K2SA 2I07B 4ISRA 1MEC2 1YNAA 4WBBA 1GMMA 3J7NA 2KM2A 3AJYA 3FMGA 4QPGA 2HWE2 1VAKA 3ZVXA 1G9BA 3U14A 4CA9A 5LEJA 1WCDJ 2E6VA 1EUTA 3AKPA 3O1VA 1WWYA 4GIQA 4XF0A 1WLWA 2LALA 5A7QA 4K8FA 2ZHMA 3VBHA 3RI8A 2YMZA 4HZFA 4HONA 2VMGA 3WF1A 1UMZA 4JV4A 1KXGA 1PGW1 4MUVA 1R1ZA 1SBEA 2P5BA 1YQ2A 4AXOA 3BU0A 4LMFA 4ARXA 4N53B 1DDLA 3VL8A 4AW7A 2IVIB 4ZY9A 3LQCA 3UT0A 5J36A 1SPPA 4ZXEA 5C4WC 4Y5TA 3DKWA 2ET1A 1BEV2 5I8TA 3CU7A 5HPOA 1ENRA 4LQRA 1D4VB 2XBO3 2GNMA 2FDFA 5FREA 3WNXA 1UZYA 2VPVA 2E7QA 2VZUA 2JG9A 3HBZA 1NQDA 3WX5A 3TYJA 1RMU1 1CPNA 2GNTA 3H42B 3N7LA 3W9AA 3HN3A 2TUNA 4V2WA 4CEWC 1IGOA 4BCUA 1QH7A 1OH4A 3VDBA 5T5JA 4COUA 3LZZA 1W6MA 4DINB 1VIWB 3H50A 1JYVA 1U5IA 3ZKYA 5EJZB 2G4IA 3B93A 4ZS2A 4WVMA 5EJ1B 4YGEA 1LULA 4A42A 5C6CA 3KV9A 2VG9A 4Q2FA 1H1MA 1H2MA 1B35C 3NNGA 4LHSA 3RS6A 3DPRB 2MNGA 2D3PA 4P5YA 5GLTA 2WWUA 3B00A 1OUSA 2ZBJA 3WW4A 1N1SA 1S4CA 4JGYC 1WLCA 3MIGA 3T0AA 2YGLA 3SH3A 1IG0A 2D7FA 4XFIA 5I0DA 2YU1A 3WQ1A 1RUD2 1F9KA 5BNQA 1RXGA 5BNNB 1W6QB 4YWAA 1DGRA 1SDWA 4M3CB 5FY7A 3T2PA 3GF6A 1CZTA 1LEMA 1AJOA 2YYOA 2B46X 4Y1YA 4CCJA 2QCSB 3LOIA 3JUUA 5I0TA 3X29B 2P3KA 1Y9GA 4KG0A 1JZ2A 5E8AA 1F4HA 1S0FA 5KC5A 3O1UA 1GOHA 4BIOA 1IKQA 3HOBA 4LTAA 3S7IA 4D6SA 3WP3A 3MGUA 4N90A 1I5ZA 2GMMA 2ORZA 3SCGA 2X5IC 1WCKA 2UYAA 3LSEA 4BA6A 4CDWB 2K0GA 3FUOA 4QQHA 3V0AB 4MGQA 5FCCA 2J1UA 3ST7A 4FPCA 4CTEA 2W1QA 4TSVA 2YU2A 3P6BA 5A6YA 1JI6A 2DVBA 5E89A 4OI0A 3ZR5A 4UFIA 1VBC3 1W2OA 4DQAA 2NN8A 3IDAA 4CEYC 2JJ6A 1K45A 3LEMA 4CPBA 3J7HA 2FDHA 4LBQB 2VZ3A 3AZXA 2V09A 5C70A 2BYVE 3UGHA 4BJ0A 4Q0QA 4HXCA 3POBA 1MS3A 4M4PA 1GNYA 4HBNA 3CHXA 3MIEA 3THCA 4E8DA 2H6CA 1OPMA 2VY0A 5FYZA 5LBEA 3I3MA 5F3EA 2QQLA 3FBYA 1EAH1 1H2KA 1FPN1 3H8XA 3SEPA 5CKNA 3WHTA 2NYYA 4AL9A 3WDTA 1V6OA 2Y0OA 4XFHA 4JRLA 1CX1A 1A8MA 1V6LA 5BNPC 2FMDA 2WZR2 1ZX5A 3AXDA 1D0GA 3VDDC 5L9BA 5BY5A 4HL0A 4XFFA 1R083 1RUD1 5LWBA 2BRTA 2XL9A 4XCAA 1O3QA 4R9AA 1QIQA 4IE5A 4ASKA 1REEA 5ABJA 1QEXA 4JGZC 2TBVA 1MS1A 3LFIA 1C1LA 1UAIA 4UFMA 5C3SA 2H6BA 1RUG2 1RUC1 2XJUA 3S57A 4AHYA 5JR2A 3PNAA 1UOFA 2KR2A 1K5MB 5FAXA 1H30A 3KS7A 4N9HA 5IAXA 2WR9A 1F4AA 4YW6A 5DDJ2 4AOCA 1ZZBA 2QBXA 4EN0A 1AR93 2WFPA 3AX4A 1WLTA 3DL3A 4XURA 4CDUC 1G7YA 1W9WA 2HH9A 1DGWA 1PO22 2RJ2A 4DXSA 3HT2A 2ZGSA 3UL2A 4LA3A 3SEEA 3ZX7A 3U10A 4B4PA 3OBZA 3SISA 2V5DA 3PVBB 1V70A 1LHUA 3N7JA 3K46A 5K0UA 1SMVA 1W8NA 5JWPA 1O4YA 4CSWA 4HFSA 3BGAA 2E7AA 2GALA 5CADA 4PLOA 3T09A 1CVNA 2HBTA 1MACA 3OBTA 1HXS1 4AHXA 4K40A 4E8CA 3FBMA 2A3YA 2W9XA 1RUE2 2R0FA 1AHSA 5FPLA 1JH5A 1OC1A 4XJ8A 3TOJA 2OUHA 4ATEA 4D0QA 1YRZA 5JSPA 2PLV3 2RS11 2KA3A 2LS6A 4CP1A 4QAWA 3HJRA 3AC0A 2D6NA 1WCSA 4IDZA 5KWRA 3ZXDA 4H55A 2IWGB 4TLFA 1PHMA 2DV9A 3E5XA 4COZA 2W1UA 3THPA 2JICA 3JBG1 4KGQA 3MBWA 3WUCA 3U78A 2HEWF 1GZCA 2CSGA 4IEOA 2VH9A 4AEDA 3K75B 2D6PA 2OZ6A 2XVLA 2Z42A 3QD6A 4I0AA 4EZHA 4LITA 1LHNA 3N35A 2W91A 4QPIB 3VZLA 2VQUA 2Q1ZB 3OTFA 3NKTA 4XUQA 4GXLA 4ZPIA 5IVCA 3JB8A 3MIDA 4L9BA 4L2NA 4LBOA 1XE0A 1ZBE3 2DF7A 3ZFGA 2BERA 2HWB1 1W0NA 2R7EB 3IZOA 3WINE 2PQSA 2R043 3HT1A 4JVAA 1WW6A 2HWC1 3QACA 2Y34A 4OQ8A 5DUVA 3PU3A 4CDQC 1COV2 4NJ4A 3ZIWA 3URFA 1E5HA 1BZWA 1XNKA 2DFBA 1FXZA 4W8JA 1BK1A 2YFUA 3H8OA 1US3A 2QDNA 4FPYA 3S7EA 1SLLA 1OF4A 4P9XA 1O4TA 4Y4RA 1QQP2 3D0SA 3L2HA 5T5PA 3TEXA 5FOJB 5KC6A 2Z4FA 4A7KA 4KWKA 3TEYA 2W0XA 1RVF3 2NQYA 5GLWA 1W8WA 5FBJA 4XF9A 1VRH1 1MS0A 4KBBA 1C8M1 3QBQA 3QOPA 4P9LA 1K12A 2EF6A 5CZKA 2EXHA 2E51A 1RUOA 2BFUL 3J8F3 2QQMA 2WS91
chains in the Genus database with same CATH topology
3GM8A 1LNSA 3OEAA 3VD7A 4OZOA 5JXIA 4XUOA 3E1F1 3DECA 3DYPA 4BK4A 1JHJA 5DQ0A 4XZUG 3F2ZA 2W1WA 1SG3A 1IQDC 5IFTA 4KMQA 1GUIA 3NJXA 2J1AA 4DEQA 3WNLA 1PMHX 2XOMA 4OMDA 2WQ8A 1UY4A 2HLEA 4A41A 5HXMA 5DPNA 2YFZA 3ECQA 3T08A 3VDCA 1JU3A 5G05L 3MUZ1 1JZ6A 3LPGA 3ETPA 3WNOA 2EICA 2W95A 2VMFA 3MUY1 1L7RA 5DMYA 5IFPA 3WF2A 3EYPA 3C7OA 1UX7A 3C7HA 2ORXA 2VZTA 4UI9L 1OF3A 5JXGA 4QB1A 2WABA 3K77A 4XUPA 1DYOA 4QPWA 1UWWA 1UY2A 3ACHA 3PUIA 4QX2A 4ET7A 3ABZA 2WO1A 4CVUA 1HN1A 5DN2A 1W99A 3NRUA 4A6OA 1GU3A 1SDDB 3THDA 3W5MA 2W94A 3FHQA 1US2A 2W5FA 5IJRA 3A7QA 3I3DA 3I2GA 4PQQA 3GDBA 4CU8A 3MV01 1WCQA 2YG0A 4AAXA 4L0PA 1TVGA 4LKSA 1H6XA 4GWJA 2W92A 4P00B 3VD5A 4W50A 4JKLA 4RYDA 2L9LA 2Y6GA 1KGYA 1GOFA 2YC2A 1JYNA 3I3BA 4BDVB 1JZ7A 2ZXQA 1JZ5A 4JKMA 3K4DA 4A4AA 4MO3M 5G04L 2ZEZA 2VR4A 1DP0A 2E31A 1JYWA 2BGPA 2CDPA 5LA0A 3P1IA 1UY1A 4PT6A 3CZJA 2J1TA 3A21A 3OGVA 1XNAA 4QX3A 5F7UA 4LPLA 3FL7A 3GXUA 3WNMA 4OYUA 2B4KA 2V4VA 3WF3A 4ZZ5A 1PMJX 4BXSV 1I5PA 5JXHA 3OGSA 4KWUA 1MPXA 4M4RA 2WUHA 1NKGA 1R64A 4MGSA 2J1EA 2XQXA 4Z2AA 3CQOA 1NX9A 1XNTA 4IUGA 2VMEA 4OUEA 3MO4A 1NAEA 3UETA 3ACFA 2EIDA 4QDRA 2QQNA 3CKHA 2WO2A 4CUCA 3WNPA 3WNKA 2DCJA 3I2JA 2VZPA 3WF0A 5B4NA 3I3EA 3CMGA 2QQIA 4D8MA 3NJVA 2E32A 2RV9A 1W8OA 1TG7A 3LPFA 4YPJA 3HNYM 2RVAA 2W3JA 1OD3A 4TXWA 2VJXA 4UAPA 3W5NA 4XUTA 2BZDA 4P02B 1CZSA 3VD4A 2YC4A 3K4ZA 4XUNA 3T0BA 1UZ0A 1T2XA 2VMDA 1WKYA 3A23A 2X10A 3DYMA 4OMCA 4HG6B 4DEVA 4A45A 1W9SA 2WN2A 1UXXX 2V72A 2BGOA 2WAOA 3I2HA 1BHGA 2WO3A 3HNBM 3A22A 4FI9A 3LEGA 5CYYA 2WZ8A 3IAQA 3T0DA 5B4XA 4CU9A 3I2IA 1GMMA 1PX3A 4DUXA 2EIEA 1GOGA 3VD3A 1J84A 1EUTA 2J1SA 3U37A 3C7FA 2JDAA 1KEXA 3WF1A 1RYYA 2WN3A 3HPNA 1YQ2A 4CU6A 2VZ1A 4ARXA 1JYXA 4ZY9A 3LQCA 1GQPA 4ZXEA 5HPOA 3SKVA 4LQRA 1K42A 3CDZB 3WEZA 4A44A 2VZUA 2EIBA 1L7QA 2LW8A 2W87A 4DXTA 3WF4A 2JD9A 3HN3A 2VTFA 2WYSA 3UNPA 2W46A 2Y6LA 2VMCA 1OH4A 4W4ZA 3OEBA 3VDBA 3UESA 2HYXA 3EB7A 3ZM8A 1JYVA 1UMHA 3IAPA 5EJZB 5EJ1B 3LE0A 3I2KA 2ZEXA 4A42A 2ID4A 2VQTA 2ZEWA 3C8XA 3NNGA 3NQHA 4LHSA 4P5YA 5JUVA 2XONA 1UMIA 2WBKA 3T0AA 4AG4A 5JXJA 3C7EA 5JMOA 5LCWL 4DUVA 4JX0A 5I0DA 5EIYB 2Y8KA 2VZOA 2VL4A 2WZEA 2ZEYA 3C7GA 2VZVA 1JZ8A 3OB8A 1UYYA 3T2PA 1CZTA 2W47A 3SKJE 3BN6A 1JZ2A 2C9KA 1F4HA 4MOAA 5LA1A 1GOHA 5LA2A 3HOBA 4ZZ8A 1D7PM 2Y6HA 2ORZA 1UY0A 1UYXA 4XVHA 3I97A 2VCAA 4MGQA 2J1UA 2W1QA 2E33A 3P6BA 1JI6A 3OG2A 1OT5A 2DCKA 3IDAA 2X05A 2Y6JA 4A3ZA 1K45A 2J7MA 3J7HA 4RN5A 2VZ3A 4CUAA 2VM9A 5C70A 4BJ0A 3OBAA 4M4PA 1GNYA 2VZRA 2QQOA 3THCA 4E8DA 2B9VA 2QQLA 4QDQA 3CZUA 3SEPA 2KD7A 4GWIA 2OKXA 1CX1A 2Y64A 5A1AA 1JZ3A 2JE8A 3FHAA 1P8JA 1UXZA 3DYOA 4QDSA 3VDAA 2X09A 4UOJA 3VD9A 3WNNA 2WAAA 2E26A 5JR2A 2VZQA 4GZ9A 2C4XA 2QQKA 3IB3A 4KI5M 2QQJA 1F4AA 2VOTA 5FUIA 3WSOA 2QBXA 5C7GA 1UYZA 4TTGA 4XURA 3MV11 4CUBA 1W9WA 2RJ2A 4ARYA 4DXSA 3SEEA 4QB2A 3JXSA 2VCCA 2J1VA 4MADA 2BBAA 2V5DA 3K46A 1W8NA 2CDOA 2VO5A 3HEIA 1O8SA 2YB7A 3T2OA 4JHZA 3BGAA 2J1RA 3T09A 2W1SA 1J83A 3CIHA 4E8CA 4DUWA 2VCBA 2W9XA 3LEIA 1XC6A 1CIYA 1JU4A 3FN9A 4D0QA 3GGLA 2WDBA 2LS6A 4QAWA 3HJRA 3OGRA 3AC0A 3ACGA 1JZ4A 3T2QA 4QX0A 1O8PA 2XHNA 5IHRA 1XPWA 2W1UA 2J22A 3MBWA 1PX4A 4QX1A 4P08A 3K75B 3PUHA 1CZVA 2C26A 3LEKA 4QB6A 2W91A 1ULOA 2Y6KA 2VQUA 4XUQA 2BERA 1W0NA 2R7EB 1UY3A 2PQSA 3HNMA 1H6YA 3WQBA 4JKKA 4PF1A 1O59A 2VC9A 4W8JA 1SHWB 2YFUA 1US3A 5C71A 1NUKA 2DDUA 1OF4A 5J1XA 4DXRA 1ULPA 3D3AA 3I2FA 2Z4FA 4CU7A 2JKXA 1DLCA 5IYYA 1K3IA 1W9TA 3ACIA 3K4AA 5CZKA 1K12A 3IIIA 4BK5A 1EUUA 2VZSA 2QQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GM8 A;  1LNS A;  3OEA A;  3VD7 A;  4OZO A;  5JXI A;  4XUO A;  3E1F 1;  3DEC A;  3DYP A;  4BK4 A;  1JHJ A;  5DQ0 A;  4XZU G;  3F2Z A;  2W1W A;  1SG3 A;  1IQD C;  5IFT A;  4KMQ A;  1GUI A;  3NJX A;  2J1A A;  4DEQ A;  3WNL A;  1PMH X;  2XOM A;  4OMD A;  2WQ8 A;  1UY4 A;  2HLE A;  4A41 A;  5HXM A;  5DPN A;  2YFZ A;  3ECQ A;  3T08 A;  3VDC A;  1JU3 A;  5G05 L;  3MUZ 1;  1JZ6 A;  3LPG A;  3ETP A;  3WNO A;  2EIC A;  2W95 A;  2VMF A;  3MUY 1;  1L7R A;  5DMY A;  5IFP A;  3WF2 A;  3EYP A;  3C7O A;  1UX7 A;  3C7H A;  2ORX A;  2VZT A;  4UI9 L;  1OF3 A;  5JXG A;  4QB1 A;  2WAB A;  3K77 A;  4XUP A;  1DYO A;  4QPW A;  1UWW A;  1UY2 A;  3ACH A;  3PUI A;  4QX2 A;  4ET7 A;  3ABZ A;  2WO1 A;  4CVU A;  1HN1 A;  5DN2 A;  1W99 A;  3NRU A;  4A6O A;  1GU3 A;  1SDD B;  3THD A;  3W5M A;  2W94 A;  3FHQ A;  1US2 A;  2W5F A;  5IJR A;  3A7Q A;  3I3D A;  3I2G A;  4PQQ A;  3GDB A;  4CU8 A;  3MV0 1;  1WCQ A;  2YG0 A;  4AAX A;  4L0P A;  1TVG A;  4LKS A;  1H6X A;  4GWJ A;  2W92 A;  4P00 B;  3VD5 A;  4W50 A;  4JKL A;  4RYD A;  2L9L A;  2Y6G A;  1KGY A;  1GOF A;  2YC2 A;  1JYN A;  3I3B A;  4BDV B;  1JZ7 A;  2ZXQ A;  1JZ5 A;  4JKM A;  3K4D A;  4A4A A;  4MO3 M;  5G04 L;  2ZEZ A;  2VR4 A;  1DP0 A;  2E31 A;  1JYW A;  2BGP A;  2CDP A;  5LA0 A;  3P1I A;  1UY1 A;  4PT6 A;  3CZJ A;  2J1T A;  3A21 A;  3OGV A;  1XNA A;  4QX3 A;  5F7U A;  4LPL A;  3FL7 A;  3GXU A;  3WNM A;  4OYU A;  2B4K A;  2V4V A;  3WF3 A;  4ZZ5 A;  1PMJ X;  4BXS V;  1I5P A;  5JXH A;  3OGS A;  4KWU A;  1MPX A;  4M4R A;  2WUH A;  1NKG A;  1R64 A;  4MGS A;  2J1E A;  2XQX A;  4Z2A A;  3CQO A;  1NX9 A;  1XNT A;  4IUG A;  2VME A;  4OUE A;  3MO4 A;  1NAE A;  3UET A;  3ACF A;  2EID A;  4QDR A;  2QQN A;  3CKH A;  2WO2 A;  4CUC A;  3WNP A;  3WNK A;  2DCJ A;  3I2J A;  2VZP A;  3WF0 A;  5B4N A;  3I3E A;  3CMG A;  2QQI A;  4D8M A;  3NJV A;  2E32 A;  2RV9 A;  1W8O A;  1TG7 A;  3LPF A;  4YPJ A;  3HNY M;  2RVA A;  2W3J A;  1OD3 A;  4TXW A;  2VJX A;  4UAP A;  3W5N A;  4XUT A;  2BZD A;  4P02 B;  1CZS A;  3VD4 A;  2YC4 A;  3K4Z A;  4XUN A;  3T0B A;  1UZ0 A;  1T2X A;  2VMD A;  1WKY A;  3A23 A;  2X10 A;  3DYM A;  4OMC A;  4HG6 B;  4DEV A;  4A45 A;  1W9S A;  2WN2 A;  1UXX X;  2V72 A;  2BGO A;  2WAO A;  3I2H A;  1BHG A;  2WO3 A;  3HNB M;  3A22 A;  4FI9 A;  3LEG A;  5CYY A;  2WZ8 A;  3IAQ A;  3T0D A;  5B4X A;  4CU9 A;  3I2I A;  1GMM A;  1PX3 A;  4DUX A;  2EIE A;  1GOG A;  3VD3 A;  1J84 A;  1EUT A;  2J1S A;  3U37 A;  3C7F A;  2JDA A;  1KEX A;  3WF1 A;  1RYY A;  2WN3 A;  3HPN A;  1YQ2 A;  4CU6 A;  2VZ1 A;  4ARX A;  1JYX A;  4ZY9 A;  3LQC A;  1GQP A;  4ZXE A;  5HPO A;  3SKV A;  4LQR A;  1K42 A;  3CDZ B;  3WEZ A;  4A44 A;  2VZU A;  2EIB A;  1L7Q A;  2LW8 A;  2W87 A;  4DXT A;  3WF4 A;  2JD9 A;  3HN3 A;  2VTF A;  2WYS A;  3UNP A;  2W46 A;  2Y6L A;  2VMC A;  1OH4 A;  4W4Z A;  3OEB A;  3VDB A;  3UES A;  2HYX A;  3EB7 A;  3ZM8 A;  1JYV A;  1UMH A;  3IAP A;  5EJZ B;  5EJ1 B;  3LE0 A;  3I2K A;  2ZEX A;  4A42 A;  2ID4 A;  2VQT A;  2ZEW A;  3C8X A;  3NNG A;  3NQH A;  4LHS A;  4P5Y A;  5JUV A;  2XON A;  1UMI A;  2WBK A;  3T0A A;  4AG4 A;  5JXJ A;  3C7E A;  5JMO A;  5LCW L;  4DUV A;  4JX0 A;  5I0D A;  5EIY B;  2Y8K A;  2VZO A;  2VL4 A;  2WZE A;  2ZEY A;  3C7G A;  2VZV A;  1JZ8 A;  3OB8 A;  1UYY A;  3T2P A;  1CZT A;  2W47 A;  3SKJ E;  3BN6 A;  1JZ2 A;  2C9K A;  1F4H A;  4MOA A;  5LA1 A;  1GOH A;  5LA2 A;  3HOB A;  4ZZ8 A;  1D7P M;  2Y6H A;  2ORZ A;  1UY0 A;  1UYX A;  4XVH A;  3I97 A;  2VCA A;  4MGQ A;  2J1U A;  2W1Q A;  2E33 A;  3P6B A;  1JI6 A;  3OG2 A;  1OT5 A;  2DCK A;  3IDA A;  2X05 A;  2Y6J A;  4A3Z A;  1K45 A;  2J7M A;  3J7H A;  4RN5 A;  2VZ3 A;  4CUA A;  2VM9 A;  5C70 A;  4BJ0 A;  3OBA A;  4M4P A;  1GNY A;  2VZR A;  2QQO A;  3THC A;  4E8D A;  2B9V A;  2QQL A;  4QDQ A;  3CZU A;  3SEP A;  2KD7 A;  4GWI A;  2OKX A;  1CX1 A;  2Y64 A;  5A1A A;  1JZ3 A;  2JE8 A;  3FHA A;  1P8J A;  1UXZ A;  3DYO A;  4QDS A;  3VDA A;  2X09 A;  4UOJ A;  3VD9 A;  3WNN A;  2WAA A;  2E26 A;  5JR2 A;  2VZQ A;  4GZ9 A;  2C4X A;  2QQK A;  3IB3 A;  4KI5 M;  2QQJ A;  1F4A A;  2VOT A;  5FUI A;  3WSO A;  2QBX A;  5C7G A;  1UYZ A;  4TTG A;  4XUR A;  3MV1 1;  4CUB A;  1W9W A;  2RJ2 A;  4ARY A;  4DXS A;  3SEE A;  4QB2 A;  3JXS A;  2VCC A;  2J1V A;  4MAD A;  2BBA A;  2V5D A;  3K46 A;  1W8N A;  2CDO A;  2VO5 A;  3HEI A;  1O8S A;  2YB7 A;  3T2O A;  4JHZ A;  3BGA A;  2J1R A;  3T09 A;  2W1S A;  1J83 A;  3CIH A;  4E8C A;  4DUW A;  2VCB A;  2W9X A;  3LEI A;  1XC6 A;  1CIY A;  1JU4 A;  3FN9 A;  4D0Q A;  3GGL A;  2WDB A;  2LS6 A;  4QAW A;  3HJR A;  3OGR A;  3AC0 A;  3ACG A;  1JZ4 A;  3T2Q A;  4QX0 A;  1O8P A;  2XHN A;  5IHR A;  1XPW A;  2W1U A;  2J22 A;  3MBW A;  1PX4 A;  4QX1 A;  4P08 A;  3K75 B;  3PUH A;  1CZV A;  2C26 A;  3LEK A;  4QB6 A;  2W91 A;  1ULO A;  2Y6K A;  2VQU A;  4XUQ A;  2BER A;  1W0N A;  2R7E B;  1UY3 A;  2PQS A;  3HNM A;  1H6Y A;  3WQB A;  4JKK A;  4PF1 A;  1O59 A;  2VC9 A;  4W8J A;  1SHW B;  2YFU A;  1US3 A;  5C71 A;  1NUK A;  2DDU A;  1OF4 A;  5J1X A;  4DXR A;  1ULP A;  3D3A A;  3I2F A;  2Z4F A;  4CU7 A;  2JKX A;  1DLC A;  5IYY A;  1K3I A;  1W9T A;  3ACI A;  3K4A A;  5CZK A;  1K12 A;  3III A;  4BK5 A;  1EUU A;  2VZS A;  2QQM A; 
#chains in the Genus database with same CATH topology
 5FDB A;  1ZRI A;  2BJS A;  1LNS A;  4XQD A;  4NN0 A;  1CIW A;  2VCM A;  4HPK B;  3OEA A;  3SCH A;  3VD7 A;  3NST A;  3I49 A;  2LTN A;  2P1B A;  1LU1 A;  2BBV A;  4LBJ A;  4ERO A;  3LB9 A;  1IS3 A;  2UU8 A;  4CCM A;  2QDR A;  2ZGO A;  1OUX A;  4BM8 A;  5GZC A;  3N9Q A;  2UWC A;  4BK4 A;  1UCX A;  4NR1 A;  3NWK A;  2YC0 A;  4PLN A;  1C8N A;  1VBD 2;  1VPH A;  4XXA A;  5ACA 2;  1HQW A;  2YBS A;  3SLI A;  4BIF A;  5F3G A;  4KWJ A;  1XQN A;  3WP6 A;  4PIZ A;  4DMI A;  2JIJ A;  2BWC A;  5EWS A;  1PMH X;  2V4A A;  5FMC A;  3WP4 A;  4M01 A;  2WQ8 A;  1TMF 3;  1B09 A;  4OLL A;  4Q4X 2;  2HLE A;  1J59 A;  4YVS B;  1MQT B;  1TME 3;  4RR3 A;  5DPN A;  4CPB D;  5IVE A;  2NMO A;  4FPJ A;  3BPZ A;  4PDW B;  2Q30 A;  1CAW A;  5G05 L;  4WM7 B;  3S5A A;  3FLP A;  3MUZ 1;  1RUH 1;  1QJX 2;  1RUI 3;  4OUS A;  4LUM A;  4N7I A;  3ETP A;  4YW4 A;  3WDU A;  1JZ6 A;  4UBG A;  5D1I A;  4FOY A;  5C8W A;  2EIC A;  2W95 A;  1XU1 A;  5F5C A;  3VKL A;  3BTX A;  1CJP A;  3WF2 A;  1W90 A;  2ILM A;  5IVJ A;  2GME A;  4I30 A;  1UX7 A;  3CNA A;  2CNA A;  1E5I A;  3FLT A;  2ORX A;  4LUL A;  1HXS 3;  1OF3 A;  5JXG A;  4YGD A;  1YQC A;  3MLK A;  1H2N A;  5F6K A;  1K5J A;  2WAB A;  3TWI A;  3VBU A;  4YM3 A;  5FMO S;  3S5Q A;  2DCT A;  5D8A B;  3OY8 A;  2JDH A;  3UKN A;  1A6C A;  1DYO A;  2AZ5 A;  5ANQ A;  1HRV 1;  3LSD A;  1UY2 A;  3AP9 A;  3PUI A;  4GH4 B;  4ET7 A;  3RZK A;  5L73 A;  2OVU A;  4BMB A;  3ZXF A;  3LAG A;  3U1X A;  3DPR C;  2WO1 A;  2R30 A;  2RMU 3;  5H9S A;  3EBR A;  4FFH A;  4IV1 B;  5DN2 A;  3BUC A;  2ZGK A;  3NRU A;  1QJU 1;  3B02 A;  4ORF A;  1SBF A;  1JYC A;  1O3S A;  1STM A;  1PO1 2;  1XBF A;  3JBG 3;  4EWD A;  3W5M A;  2FCT A;  1RUF 1;  4AQ2 A;  1GAN A;  5FP9 A;  4OI4 A;  3FHQ A;  2C6S A;  1US2 A;  5JZG A;  3MW3 A;  1SCS A;  3RZH A;  4IES A;  3P3N A;  3SXW A;  3M3E A;  3N36 A;  4Y4Y A;  1PNF A;  2UUR A;  1BKZ A;  2Z69 A;  3I2G A;  4QHO A;  5LK5 A;  1UIK A;  3N7M A;  2QUO A;  2XUM A;  4NPL A;  4XAE A;  4CCK A;  1QJY 1;  4HET A;  4AAX A;  1OLR A;  2XXZ A;  3CBN A;  3WQ7 A;  1LJ7 A;  4L0P A;  1HB2 A;  1QXP A;  4K20 A;  4XBQ A;  5T55 A;  1N1Y A;  1FMD 1;  2HWB 3;  1FOD 2;  2HWC 3;  2VOW A;  5LBF A;  4DO0 A;  3RZJ A;  2W92 A;  2D97 A;  3BYW A;  1SBD A;  5EJ3 A;  3EMR A;  2OPK A;  5DAQ A;  4AED B;  3RPQ A;  2BVV A;  3ZPY A;  1GNZ A;  2OQ6 A;  2JE9 A;  5HI0 A;  4Q27 A;  4Q8K A;  4XZP A;  1ULD A;  4BQ4 A;  3I3B A;  1AL2 2;  4A6S A;  3GAL A;  4AVC A;  4EN9 B;  1YO8 A;  1OFS A;  1AXY A;  3K4D A;  5BNN C;  3ZFG B;  4D7T A;  4LO6 B;  4NHK A;  4Y1Z A;  1WA6 X;  3PLQ A;  3ZLI A;  4A4A A;  2Q5T A;  3NJZ A;  1Z7S 1;  1EYB A;  4AGR A;  5EV7 A;  4FPL A;  1C8M 3;  1OPO A;  2ZEZ A;  4YFZ A;  1U12 A;  2DFC A;  2HEY F;  3BAL A;  4MXW A;  1VB4 A;  3KV4 A;  5CU1 A;  1CN1 A;  3AMM A;  2D3S A;  2CDP A;  5AVP A;  2WS9 3;  2BNM A;  3B94 A;  3TNQ A;  3P1I A;  1Z0H A;  3DXU A;  4NIH A;  5CFD A;  2C0Z A;  1NCR B;  1RHI 3;  5F9T A;  4LBM A;  5L19 A;  4Q26 A;  4XXP A;  4Q0S A;  1ZBA 1;  3N9O A;  5FZ1 A;  2Y0I A;  1GZ9 A;  4RL7 A;  4R8H A;  1Y9Q A;  1AR6 2;  2R06 3;  3PUR A;  4YZ1 A;  5A7S A;  4XEZ A;  4NWV A;  1GR3 A;  4BXS V;  1H0B A;  4DFS A;  4C1X A;  3ATG A;  3MFC A;  1S0B A;  2NZ9 A;  3OD4 A;  4KWU A;  1YLL A;  4DOU A;  5C9A C;  3M7A A;  3ZYJ B;  2WUH A;  2YGM A;  4PCR A;  1R64 A;  4Y5S A;  1V6N A;  2DYC A;  2QZ2 A;  3ZXE A;  5LY1 A;  3L9J T;  4HT1 T;  4MVT A;  4QGN A;  2PA7 A;  4OUE A;  1CES A;  2ZZQ A;  2Z5W A;  3ACF A;  3BCW A;  1URX A;  3NAP A;  4M0H A;  5KXB A;  2DCZ A;  2PAK A;  1MS9 A;  4IEQ A;  1ULF A;  4BQW A;  2WO2 A;  5DUU A;  3LIH A;  1GP6 A;  4QPG C;  3NO8 A;  2A6X A;  2DCJ A;  1YI9 A;  3N9M A;  1UIJ A;  1UU5 A;  5IVY A;  4ZU4 A;  2VZP A;  3IN9 A;  2XML A;  3VBH C;  4QM8 A;  1EV1 3;  2RS3 1;  1W04 A;  1BBT 2;  4OHZ A;  4MHU A;  3UV9 A;  1FYU A;  1Q8O A;  2BVB A;  3GZE A;  1DGR N;  2F4P A;  3M3O A;  3MEP A;  3T30 A;  2D6O X;  2XUE A;  1X8M A;  4KNC A;  3R05 A;  3ILF A;  3TN9 2;  5FZB A;  4NRQ A;  5A32 A;  2RE9 A;  2E32 A;  2EA7 A;  2GH2 A;  2RV9 A;  4RS5 A;  3SMH A;  1W8O A;  4YPJ A;  2AEZ A;  2JG9 C;  3HNY M;  3W21 A;  3WY6 A;  5BV6 A;  5FR3 A;  1X9T A;  1QNW A;  3WDV A;  1OD3 A;  5FZM A;  4TXW A;  5GAL A;  2ARB A;  2VJX A;  2KXL A;  4UAP A;  1IS6 A;  4XUT A;  3VBU B;  2C24 A;  2ZX0 A;  3GCX A;  4COW A;  4C1W A;  4Z82 A;  1QJY 3;  4JDO A;  3T0B A;  2WFF 1;  1BXH A;  1UZ0 A;  5CVR A;  4XQW A;  1CAV A;  1HIX A;  3TB0 A;  1FMD 3;  3H7Y A;  1POV 1;  3ZSL A;  4YM2 A;  1Y43 B;  3HWJ A;  1V6I A;  4XQ4 A;  3O14 A;  3J7L A;  2GMP A;  3DYM A;  4N43 A;  4RSU A;  4A45 A;  1W9S A;  1OI6 A;  2WN2 A;  3J9S A;  2XBO 2;  4ITC A;  3WD5 A;  3U4X A;  1J1L A;  2ENR A;  4BZ4 A;  1UXX X;  2WAO A;  4YZ3 A;  1V9U 1;  2IXH A;  4TZD A;  4LKF A;  1R09 1;  3OUJ A;  4RA0 A;  2HEV F;  1CX4 A;  3LEG A;  5IK5 A;  2HWF 3;  1OA4 A;  2WZ8 A;  5EXO A;  1Y3T A;  2D98 A;  5CIS A;  1ODM A;  1DYK A;  1RC6 A;  1ZZ9 A;  2UYB A;  3AKS A;  4FOQ A;  4HOO A;  1IPJ A;  3NV4 A;  1J84 A;  1NE4 A;  1OBN A;  5A3U A;  3C7F A;  3PVE A;  1KEX A;  5BNO C;  3PUA A;  1BJQ A;  4XJZ A;  1AR7 1;  4UW3 A;  2VZ1 A;  1KQR A;  1D4M 2;  1W9Y A;  2XJT A;  2VTX A;  5JIA A;  4CU6 A;  1JYX A;  3WR0 A;  4CRQ A;  2RR1 3;  2W08 A;  2IXJ A;  4B3N A;  3ZO0 B;  3ZXK A;  3BTZ A;  1AX1 A;  4OCT A;  1ZRE A;  3MPB A;  3E5Q A;  3NNF A;  5FLJ A;  1UZV A;  3E97 A;  5HXV A;  3LA3 A;  3CDZ B;  2YBP A;  1ZBA 3;  5GLU A;  2P3I A;  3WEZ A;  1AR8 3;  1LHW A;  1UOB A;  2LW8 A;  1QNY A;  2W87 A;  4DXT A;  3WF4 A;  5FUN A;  4OVE A;  2VTF A;  2WYS A;  3PVO A;  3M8L A;  3UNP A;  2Y6L A;  5FUP A;  4MXW B;  2P37 A;  2UY8 A;  2D6L X;  4W4Z A;  3OEB A;  5H9R A;  1H8T C;  2Z2S B;  1YUD A;  1JXN A;  3AP4 A;  3BOW A;  3EB7 A;  3OYW B;  2CV6 A;  1OQD A;  3IAP A;  4GB3 1;  5E1R A;  4B8E A;  1O5U A;  2YRO A;  2GP3 A;  2ZEW A;  3T1M A;  1DBN A;  3NQH A;  5JUV A;  2YZ4 A;  4HSJ A;  4RQP A;  5FTT C;  2XBO 1;  4FCA A;  4OUM A;  2CL2 A;  4AI2 A;  1X33 A;  3U75 A;  2MPF A;  2WRA A;  2QVS B;  2VXJ A;  5M0T A;  2WBK A;  1HJF A;  3WDY A;  2ARE A;  5JXJ A;  4GUL A;  4JX0 A;  1S0D A;  3I59 B;  3BPS A;  5EIY B;  3O1R A;  4EN6 B;  2VVF A;  3CF6 E;  1Y9M A;  4W6X A;  2HJI A;  5ABJ C;  1VB2 A;  3C7G A;  4E27 A;  1QJE A;  1JZ8 A;  1ACC A;  1NOV A;  2SBA A;  3APB A;  1UYY A;  2IXL A;  1ASJ 3;  1W6Q A;  2JDP A;  2P6C A;  4M3C A;  4LNV A;  1HW5 A;  4NRM A;  3BN6 A;  4GWN A;  1DZQ A;  1DQ2 A;  4MOA A;  5LA1 A;  1YJL A;  3WT3 A;  1UNB A;  3BVC A;  3WCR A;  4H14 A;  4D94 A;  4IE4 A;  5CB7 A;  4ZZ8 A;  1D7P M;  2FD8 A;  2XL7 A;  2Y6H A;  5B2G B;  5DAV A;  3POS A;  3WXP A;  2VU9 A;  4DZG A;  4BME A;  3GHM A;  2R07 2;  2VCA A;  1VBE 2;  4I0B A;  4CDW A;  4S2F A;  1FNY A;  2RJL A;  4LA2 A;  3BOD A;  4CXY A;  1WD3 A;  3KD4 A;  1OT5 A;  3FZ3 A;  2QNK A;  3MW4 A;  4HK9 A;  2DU0 A;  2DCK A;  4KWL A;  5IAT A;  1XYP A;  2J7M A;  3S0M A;  2QQP A;  1WMD A;  5K0U C;  4IQP A;  2JG8 A;  4LT5 A;  2VNV A;  1X82 A;  4LBQ A;  2WNV B;  1JW6 A;  3NNL A;  5FFO C;  2QQO A;  1PGW 2;  5A32 B;  1VBA 3;  3ENR A;  3E6B A;  4RS5 B;  5CAZ A;  3H3L A;  1MZ6 A;  2B9V A;  5F32 A;  3CZU A;  3EJK A;  3PUQ A;  4AWD A;  1NG0 A;  1NCQ B;  4JQR A;  3WOG A;  1YFX A;  4AVA A;  1F5J A;  3GZA A;  1HQN A;  1VBC 1;  4ZU7 A;  5C8C A;  2Y64 A;  2A5Z A;  4BH9 A;  5A1A A;  2BEO A;  1RMU 2;  3M2M A;  1R09 3;  3U11 A;  1OUR A;  3ZFE B;  1G9A A;  4QDS A;  4LE3 A;  4LO8 A;  3THT A;  1BLZ A;  2X09 A;  2I45 A;  3M3I A;  2WT2 A;  1UZW A;  2WII B;  3OOX A;  4Z07 A;  4K7J A;  2DUQ A;  3ZMN A;  2Y60 A;  2LM3 A;  1C5H A;  2E26 A;  3IM0 A;  2VZQ A;  1L7L A;  1UX6 A;  5CFC B;  1K5M A;  2QQK A;  2VW1 A;  1O5L A;  1D0H A;  3VBF A;  5FUI A;  1R08 1;  2AC1 A;  4IGO A;  3I7D A;  1JHN A;  4NPR A;  1UN1 A;  4OI2 A;  3KMH A;  4CP2 A;  3MV1 1;  3NV2 A;  2XVK A;  1J3Q A;  2JEM A;  4I01 A;  5I0R A;  4CZS A;  4FPE A;  1LKN A;  1HLC A;  1J58 A;  4GJY A;  4FT8 A;  1JTZ X;  3JXS A;  4QB2 A;  3TRS B;  4MAD A;  1W8T A;  1DQ0 A;  4IEP A;  3TAY A;  1BQP A;  4YZ2 A;  3ZPO A;  3HEI A;  1PK6 B;  2FZ2 A;  4GB3 3;  1DGL A;  3KV6 A;  5FPA A;  1IS4 A;  4BLJ A;  5FZO B;  3OSD A;  3PIJ A;  3O0V A;  4YZ5 A;  2CU5 A;  1L3J A;  3PU8 A;  2A6W A;  5FYU A;  1S1A A;  2G9G A;  4AVB A;  1AR9 1;  1JU4 A;  3FN9 A;  4UW5 A;  2AH2 A;  3GGL A;  4IEV A;  5A3P A;  3RJR A;  1YHF A;  3OGR A;  1A34 A;  5FY1 A;  3KT1 A;  2QZ3 A;  1DIW A;  4A2U A;  1GZW A;  1O3T A;  1O8P A;  2B39 A;  2XHN A;  5FPX A;  1SFN A;  3E6D A;  5JOW A;  2WQ4 A;  4B1L A;  4P9W A;  2J22 A;  5GLV A;  4NII A;  1RB8 G;  4IEY A;  1W6P A;  1LEN A;  4NUB A;  2RDQ A;  3T2T A;  4FPF A;  1XNC A;  4I02 A;  4LIV A;  4OZX A;  3RSJ A;  3WW2 A;  4AI0 A;  5F5A A;  3PUH A;  1EAH 2;  1Q8P A;  1FPN 2;  1OMI A;  2YV8 A;  3N3H A;  1G86 A;  4I3P A;  4RQP B;  3VBO B;  2ZML A;  2VAU A;  3LEK A;  3VZO A;  4B1M A;  2LUW A;  2Y6K A;  3KVA A;  4QPI A;  2NMN A;  3KT7 A;  2PLV 1;  5IAV A;  1IPK A;  4GWM A;  3J8F 2;  4RR3 C;  1CR7 A;  4XC9 A;  5KHI A;  4XDQ A;  5JI9 A;  2DVG A;  2ZHN A;  4G9S B;  1LOC A;  3HVD A;  3AYE A;  1S2E A;  1UYP A;  3NVC A;  3PJY A;  3RZM A;  3IT8 A;  4D69 A;  5A3W A;  2WKK A;  3C2U A;  3KT4 A;  4JKK A;  5JCT A;  2WT0 A;  3GHN A;  1SHW B;  2XVG A;  1UF2 C;  2CGO A;  1NUK A;  4LUK A;  1TEI A;  4M0N A;  5J1X A;  1C1F A;  1ULP A;  3D3A A;  3U4S A;  3I2F A;  4AI8 A;  5A7O A;  1RUC 2;  4CCO A;  1DLC A;  2A6V A;  4MET A;  3VL9 A;  3UGG A;  1PM7 A;  1LOF A;  3B69 A;  2ZGM A;  1W6O B;  1ZBE 1;  5DXD A;  4JDN A;  1TMF 2;  4QPY A;  1OA3 A;  1W9T A;  4CP9 B;  2R04 1;  4BQ1 A;  3POG A;  3H1M A;  3K4A A;  4OQ9 A;  4U36 A;  5FXV A;  3BIW E;  2HKX A;  5A3L A;  3SCF A;  4YSF A;  1NA1 C;  2JG8 B;  1OFN A;  3B01 A;  4HPK A;  2R16 A;  2G9F A;  4R9B A;  4JQT A;  5HCB A;  1AYM 3;  2F4L A;  3AL6 A;  1DU3 D;  4WM8 B;  4LBN A;  5JZG C;  3KCX A;  3DYP A;  1MZF A;  5FK7 A;  1TE1 B;  3ILR A;  4XZU G;  3F2Z A;  1SG3 A;  4LO4 B;  5DAB A;  5JIU A;  1RVF 1;  4AR2 A;  1HXS 2;  3AP7 A;  1GUI A;  1KS5 A;  3RMY A;  1JOP A;  3RNS A;  1YEW A;  2JDY A;  3ZXL A;  5F6L B;  3VHO A;  1SLI A;  4GJZ A;  1NXM A;  5C8C B;  3J8F 1;  2RS1 2;  5L7O C;  3ZSJ A;  1ZVF A;  1ENQ A;  5FV3 A;  3WZ1 A;  4KBZ A;  4YVS A;  1MQT A;  3ITQ A;  4FOW A;  5LRS A;  3ECQ A;  4YG3 A;  4L92 A;  2BV4 A;  3VDC A;  3ZSK A;  4LBQ D;  1GWL A;  1HJG A;  3PME A;  4K1Z A;  4PDW A;  3JBG 2;  2VBP A;  4WM7 A;  1VRB A;  2VVE A;  4AAP A;  1PMI A;  1YWK A;  4Q4Y 3;  1XNB A;  4HKO A;  3ZYF A;  3MUY 1;  5C3R A;  1L7R A;  4XJW A;  5DMY A;  3DEM A;  1DG6 A;  3WDW A;  3VBR A;  3M3Q A;  3Q8E A;  4Q4V 3;  5EPA A;  3KVB A;  5GZE A;  3C7H A;  1CAU A;  1BMV 1;  1OLM A;  5FZ9 A;  2NP0 A;  1LRH A;  5CG9 A;  1TMF 1;  4IGQ A;  3VBF B;  5J96 B;  5F2W A;  2HWB 2;  5E6H A;  5FMO L;  3KB5 A;  1TME 1;  1VAL A;  5D8A A;  2HWC 2;  4QPW A;  4XCB A;  1UWW A;  4QX2 A;  1J1T A;  3ACH A;  3VB9 A;  5CFD C;  4GH4 A;  1AXZ A;  3RGB A;  1RUI 1;  1SEF A;  4CVU A;  1PVC 1;  4JTN A;  3V56 A;  2G19 A;  4BQX A;  3ZR6 A;  2FCU A;  4WV8 A;  4IV1 A;  1AXK A;  2BGC A;  4XIK A;  5FYH A;  5JI7 A;  4BPZ A;  2BOI A;  3SQO A;  3VZK A;  1MS4 A;  1RL3 A;  2XGX A;  4N8M A;  1ENS A;  2W5F A;  1XE7 A;  5IUQ A;  4UFJ A;  1HB3 A;  5IJR A;  2WNU B;  4CYD A;  4ASL A;  3V64 A;  1VRH 2;  4KH9 A;  1C8M 2;  2C5D A;  2ZAC A;  4BXF A;  4PQQ A;  1IQA A;  4PI0 A;  4E4H A;  3GDB A;  4CU8 A;  1AL0 G;  3MV0 1;  4QMA A;  1WMX A;  1S55 A;  3AP5 A;  4AEK A;  2WS9 2;  1TVG A;  4LO7 A;  4MGZ E;  1GZW B;  5GZG A;  3RG0 A;  2PHX A;  1H6X A;  2RMU 1;  1ALY A;  1RHI 2;  4FBF A;  1KFU L;  2Q8E A;  4GWJ A;  2FMY A;  3IDB B;  2HWD 1;  3NAP C;  4JKL A;  4W50 A;  4RYD A;  3WHU A;  1LOD A;  1W6P B;  3V0B A;  2L9L A;  5DG1 A;  4AHZ A;  4F7Z A;  1KGY A;  1GOF A;  2VBB A;  1O3R A;  2YC2 A;  1LEC A;  1ULG A;  2A6Z A;  2B7Y A;  3MYX A;  4X6Q B;  4X6R B;  5FO7 B;  3ZXA C;  1EY2 A;  1GQG A;  1KRI A;  5FXZ A;  3WQ0 A;  2BTV C;  3M4F A;  4RHV 3;  4XBL A;  4JKM A;  1Z78 A;  2JB4 A;  4TWT A;  1IOA A;  4CCL A;  1JOB A;  4LO5 B;  2RDN A;  2PHL A;  3TEW A;  2HYK A;  1MEC 3;  4RS5 C;  1OKQ A;  3WCS A;  1PGL 1;  1DP0 A;  1PZ9 A;  2E31 A;  3EQE A;  1GKB A;  1FNZ A;  2BGP A;  4BE3 A;  1RUH 2;  2XQR A;  3H8U A;  4JHT A;  1ZZC A;  4ISQ A;  1OSG A;  1NCR A;  3ZN6 A;  4ES9 A;  1SLA A;  3OGG A;  4QXC A;  1XNA A;  3D5O A;  4L11 A;  2WQZ C;  5F7U A;  4LPL A;  3GXU A;  2D40 A;  3NW4 A;  3O1S A;  1ODN A;  2OUJ A;  3PVN A;  4GMP 0;  2B4K A;  1U0A A;  3FUQ A;  1LAJ A;  4ZZ5 A;  1W2N A;  3NV3 A;  5FKB A;  5JXH A;  3HQU A;  4B29 A;  1GSL A;  1MPX A;  1HRV 2;  5JOZ A;  5T50 A;  5F2S A;  2IXI A;  1RED A;  4M4R A;  4JZR A;  4N43 C;  1YJK A;  5LA9 A;  3WLU A;  3VHP A;  4DPN A;  4MGS A;  4K9S A;  4XE9 A;  1RHI 1;  2ZAH A;  2BU9 A;  1G6N A;  3AJZ A;  3PTY A;  1QJU 2;  5A33 B;  4HKW A;  1XNT A;  4IUG A;  4Y5Z 0;  3O0X A;  4ZXK A;  1T6G C;  3K48 A;  2A71 A;  1RUF 2;  3MO4 A;  4R9D A;  1HKD A;  1QHD A;  2EID A;  2R06 1;  1C3H A;  2YPJ A;  4YVW A;  5FKC A;  5CA6 A;  5SV8 A;  1R1A 1;  4CCD A;  3SH4 A;  2YBK A;  3GZU C;  1QJY 2;  4NID A;  3AZZ A;  5I8S A;  3ZYR A;  5FYS A;  1UZZ A;  4NHM A;  4LKE A;  1FMD 2;  2DUP A;  5B4N A;  1VMH A;  2ZHL A;  3I3E A;  4UF0 B;  3F95 A;  4FPO B;  2GC2 A;  4N53 C;  5LK7 B;  2EXI A;  3CO2 A;  3ILN A;  3ZDV A;  3LCP A;  4NRP A;  1BK0 A;  4RFR B;  1PM4 A;  4FFF A;  1POQ A;  3NJV A;  4Q1P A;  3ZFF B;  2BNN A;  1WCU A;  2SLI A;  4C91 A;  1PVC 3;  3LPF A;  5D21 A;  4BIS A;  4FAG A;  5JAX A;  3VBR B;  1ZRR A;  5E88 A;  2GZW A;  2WC2 A;  2ZX1 A;  4AI3 A;  2OZJ A;  4DRV A;  1CAU B;  4COY A;  2R0H A;  3NJY A;  5FP4 A;  3VBS B;  5I0S A;  3VZN A;  1O6U A;  2VW0 A;  3W5N A;  2Y33 A;  1EV1 1;  1Y7B A;  4QX8 A;  1Z7S 2;  2D5F A;  4Z1V A;  3VD4 A;  4Y20 A;  3N9N A;  1H2L A;  4QGL A;  4UWD A;  1I9R A;  1T2X A;  4KL1 A;  5A6Q A;  1GP4 A;  5HCH A;  4RQP C;  2CTV A;  2X10 A;  1VE0 A;  4M3C E;  4OMC A;  4DEV A;  3ZYI B;  4QXH A;  1OA2 A;  4XYX A;  5J48 A;  4Y1V A;  2HWD 3;  1JMU B;  4COV A;  1ZBA 2;  3TNP B;  2X8K A;  2BGO A;  4MSV A;  3A0N A;  1YCI A;  2PAM A;  1TNF A;  1G8W A;  3BU7 A;  3AZY A;  4QD2 A;  4F3J A;  3PTR B;  2P6H A;  1W3X A;  3SH5 A;  5JOX A;  5F37 A;  1IZ3 A;  1CQ9 A;  5ANN A;  5FIX A;  3VZJ A;  4B4Q A;  3T0D A;  1GP5 A;  4IL7 A;  4XOG A;  3LGR A;  3I2I A;  2WZR 3;  3O5S A;  4FXK B;  1PX3 A;  3P3P A;  1S0G A;  1GWK A;  3WDX A;  2PHW A;  1GOG A;  3VD3 A;  1UPS A;  3CJI B;  3R4S A;  1JYI A;  3GJB A;  3WP5 A;  1N3P A;  2J1S A;  3LA7 A;  3IMN A;  1QY4 A;  3UKT A;  1ULC A;  4P9I A;  3HPN A;  2WN3 A;  3KV5 A;  4Q0V A;  3V0B B;  2ZZJ A;  3RZZ A;  4CDW C;  1OVP A;  1YIF A;  2O14 A;  2XWB B;  2PHU A;  2ZX2 A;  3GCW A;  3JZV A;  1VJ2 A;  4QX7 A;  4K21 A;  4MGK E;  2B45 X;  3SC7 X;  3SKV A;  2HWF 1;  3PJQ A;  1NT0 A;  1RUG 3;  3LD8 A;  3GYD A;  3KGZ A;  4A44 A;  2EIB A;  2JX9 A;  1FX5 A;  4YZ4 A;  5JPN B;  1H1A A;  4PI2 A;  1GIC A;  2B42 B;  1ASJ 2;  1QXR A;  3D8C A;  4O7X A;  2Q4S A;  3AFK A;  5DDJ 3;  3RFR A;  2RS3 2;  2W46 A;  4LLF A;  3T1L A;  1AVB A;  5FPU A;  2ADE A;  2HYX A;  1PO2 3;  4HN0 A;  1PZ8 A;  4LXL A;  1CON A;  2GSY A;  1V0A A;  3ZM8 A;  3OYW A;  4UT5 A;  4IW3 A;  4EWE A;  3I2K A;  1W39 A;  1CJD A;  2RR1 1;  2VQT A;  3AL5 A;  3ZN6 B;  3C8X A;  3RDI A;  3B9C A;  5KR7 A;  4LHK A;  2XON A;  3FJS A;  5FY0 A;  2WT1 A;  1UMI A;  1AR8 1;  2XB6 C;  5FZG A;  4LK6 A;  2YUE A;  4IEX A;  3C7E A;  2YY1 A;  5LCW L;  1DGW X;  4D7S A;  4D6Q A;  3JU9 A;  4QQ2 A;  5FYT A;  4E9K A;  4Q4W 1;  2Y8K A;  3I59 A;  1RIN A;  2VZO A;  1R1A 3;  1A8D A;  4H3W A;  4QKB A;  2QQV A;  2VL4 A;  4QU2 A;  4TYS A;  5ISL A;  1O7F A;  1H8V A;  1HN0 A;  2VZV A;  4AQT A;  4P9J A;  2WFF 2;  5LBB A;  4D6R A;  4XTP A;  2XJQ A;  1VBA 2;  2I74 A;  2VW2 A;  4UI9 L;  3SKJ E;  3H9A A;  5KHK A;  1ENX A;  3G6J B;  5IW0 A;  1FV3 A;  3K3O A;  4MGI E;  3UJQ A;  5A3N A;  3VKM A;  4AFB A;  3POY A;  4V2V A;  2RS5 1;  1K5M C;  1LGB A;  3NMB A;  3KM5 A;  4LHN A;  3VBF C;  1PGS A;  4QXB A;  1DHK B;  1V9U 2;  1TQ5 A;  2WWJ A;  3POF A;  4LKD A;  5DUX A;  1NE6 A;  1UY0 A;  3J7M A;  4GA9 A;  1UYX A;  4XVH A;  4YVW B;  2EIG A;  4RFT 0;  1R09 2;  3USS A;  3BB6 A;  1D2S A;  4NIA A;  1AX2 A;  2B5H A;  3AVS A;  3W58 A;  3ALQ A;  5CKQ A;  2E33 A;  4FXG B;  4PQ9 A;  3NL1 A;  1VBB 1;  1KDK A;  2Y38 A;  4URA A;  2D3R A;  1ASJ 1;  2K46 A;  2Y6J A;  3KF3 A;  3MDP A;  4NHX A;  5FXW A;  1NQJ A;  2X05 A;  1F31 A;  1LOG A;  4FP2 A;  4IEW A;  4RN5 A;  4CUA A;  5LB6 A;  5F8P A;  2O0O A;  1Q43 A;  4R4X A;  4RGK A;  2WNV A;  2XLA A;  3I8T A;  4AFD A;  3K3N A;  1COV 3;  3CLP A;  4NE9 A;  1W03 A;  1OQE A;  2BOJ A;  2FQP A;  1RIR A;  2ZGN A;  1AR7 2;  3IDC B;  4LBK A;  1EPZ A;  1W2T A;  4FAH A;  1FV2 A;  2WSV A;  5HBA A;  1WD4 A;  2Z79 A;  4YM0 A;  2O8Q A;  3LFM A;  1WBF A;  1ZYB A;  3L2Y A;  1FT9 A;  2A6Y A;  3HR9 A;  4K6B A;  1B35 B;  1QMJ A;  1NCQ A;  2DU1 A;  2OKX A;  5J3U A;  4UBH A;  3ZN5 A;  2UWA A;  1W8F A;  4SLI A;  1LES A;  3WVJ A;  2JE8 A;  4JGY B;  3B3Q E;  3SIT A;  3OCP A;  5DAX A;  3A0K A;  5FZF A;  5JVV A;  4DY5 A;  4Y20 B;  4XPV A;  4XFG A;  4Y22 A;  4BHP A;  1P8J A;  3AKR A;  2K9Z A;  1LCL A;  3ZFE A;  5HCF A;  4V1P A;  2BNO A;  3AKQ A;  1NLS A;  1VBA 1;  4UW6 A;  3VDA A;  5FQ0 A;  1WUV A;  5LBC A;  4GB3 2;  1DQ1 A;  1UOG A;  4P14 A;  4QPI C;  3RI9 A;  2VUD A;  1QGL A;  3H3Z A;  4EZ4 A;  5FP3 A;  4Y33 A;  1AZD A;  1GBG A;  4FTE A;  2JKB A;  2VOX A;  2C4X A;  1GLH A;  5CFC A;  1VBD 3;  3IB3 A;  3NNM A;  1V6K A;  1HRI 1;  2QQJ A;  2VOT A;  4KI5 M;  4YW5 A;  5ACA 3;  3WSO A;  5C7G A;  1UYZ A;  2GC1 A;  4Z92 B;  4AFC A;  5FZD A;  5KHJ A;  4B7E A;  2IZW A;  4PBO A;  5DZE A;  2LRP A;  1AYN 3;  3ORJ A;  5JR7 B;  4ARY A;  2N7G A;  2DTW A;  1RUJ 1;  3UGF A;  4Q4X 3;  1QXJ A;  4C0H A;  2J1V A;  3ON7 A;  3WW3 A;  3ZYG A;  2BBA A;  4CEY B;  3DUI A;  4LLO A;  5FY8 A;  3SNM A;  1WMF A;  2CWS A;  4R52 A;  4QQP A;  1LOF C;  2CDO A;  2GN7 A;  5SV5 A;  1V6J A;  2CYF A;  3QLQ A;  4JHZ A;  2BUK A;  1QJX 3;  3PUS A;  2CY6 A;  1PK6 A;  2J1R A;  4AI9 A;  5AC9 1;  2OII A;  1J83 A;  5C5U A;  1DLL A;  5FZO A;  4KU8 A;  3VHN A;  4UW4 A;  2VCB A;  1XU2 A;  3O1T A;  1XC6 A;  1CIY A;  5FZK A;  5T52 A;  2CAU A;  5J98 B;  1JOJ A;  4HLT A;  3LKJ A;  1MZ5 A;  4URT A;  5A1F A;  2DVA A;  2ZHK A;  1DZR A;  1ZRD A;  4NMI A;  4OI1 A;  2QQU A;  1YQ8 A;  3ACG A;  4Q4W 3;  4QHZ A;  4QX0 A;  3VDD B;  3AMN A;  1N3Q A;  3EHK A;  4AFM A;  4IE6 A;  1ZRF A;  4I3G A;  1IKP A;  4XDP A;  1RTV A;  2JDM A;  1Q8Q A;  2I2S A;  4WZF A;  5H9Q A;  3I2D A;  1PX4 A;  2XH6 A;  4QX1 A;  2OPW A;  4P08 A;  1J3R A;  4K1Y A;  3ZXJ A;  4YFW A;  4LE4 A;  1ND2 A;  4B7K A;  1CZV A;  4JGZ B;  2C26 A;  4QKD A;  5FP7 A;  5DG2 A;  4QB6 A;  3VBO A;  4AGG A;  1PO1 3;  2RS5 3;  2RDR A;  1ULO A;  2VEC A;  2NM1 A;  5GJ6 A;  4BYY A;  4DIQ A;  4ZKT B;  5FLI A;  3D4K A;  1VBC 2;  4YVS C;  1MQT C;  1NYW A;  1S2K A;  1E5R A;  1E5S A;  1S0C A;  4XJ9 A;  1UY3 A;  4PDW C;  3KSC A;  5F1R A;  1TNR A;  2JWP A;  4NHL A;  4WM7 C;  5DZF A;  5A6Z A;  2PXJ A;  1H6Y A;  1O59 A;  2NLR A;  1VBB 3;  2A3W A;  4UFH A;  2MEV 1;  2JDZ A;  2VC9 A;  5FYM A;  2FBE A;  3MPP G;  4CDU B;  1VP6 A;  3ES4 A;  4Q5O A;  2JEN A;  1FAT A;  1SQ4 A;  5C71 A;  2PQQ A;  3Q8C A;  2DDU A;  4IET A;  3HMY A;  4DXR A;  5EQU A;  2DBN A;  1QF3 A;  4CU7 A;  1X36 A;  3G7D A;  5IYY A;  5D8A C;  1K3I A;  2PFW A;  1W6O A;  2ZTN A;  2AUY A;  1AL2 3;  2XJP A;  4CP9 A;  1R08 2;  1XSQ A;  4GH4 C;  5FZC A;  4DNY A;  2E63 A;  4PF5 A;  5LW9 A;  2EXJ A;  2V73 A;  2GAU A;  2ZKL A;  3AVR A;  2WIN B;  3FHI B;  3FWE A;  3JD7 3;  1G9C A;  2VZS A;  2OXB A;  2OQ7 A;  4IV1 C;  3RYK A;  2OT7 A;  4IND A;  3QH7 A;  4HAN A;  4OZO A;  4GQ7 A;  4XUO A;  1SAC A;  3E1F 1;  1CWP A;  3MW2 A;  2XDV A;  2IFR A;  3AM2 A;  4IER A;  1I6X A;  1VLN A;  4MGY E;  3AP6 A;  5LRR A;  3DEC A;  4Q4V 2;  4QT6 A;  4JRA A;  4IV3 A;  4WM8 A;  5FXX A;  3BI3 A;  4XHB A;  4NIG A;  4RGG A;  1IQD C;  5A7W B;  5IFT A;  4FTS A;  3I2O A;  3OUH A;  4KMQ A;  4YNI A;  3VZM A;  1S2B A;  2ARC A;  1OXC A;  3NJX A;  2D6K A;  4C0B A;  2TNF A;  1H4G A;  3D0J A;  1C5I A;  1XB9 A;  2J1A A;  1AR9 2;  4AZZ A;  2A73 B;  1NZC A;  4FVV A;  3VKN A;  2DUR A;  3WNL A;  1RJ7 A;  4OMD A;  1AR6 3;  4NAO A;  5FZL A;  4D3W A;  1UY4 A;  1HRI 3;  1HV1 A;  4E2Q A;  4Y22 B;  4A41 A;  5HXM A;  5L9V A;  4BLI A;  5L36 A;  1AYM 1;  1F35 A;  4R4Z A;  3J26 N;  2YFZ A;  4AED C;  4IGP A;  3T08 A;  2LRO A;  1QJF A;  5FQ0 B;  3WG3 A;  3LDR A;  2OS2 A;  3DXT A;  1LOE A;  3NV1 A;  1RUJ 3;  3E5U A;  4Q0U A;  4CDQ B;  1YFY A;  3LPG A;  3RQ0 A;  5JMC A;  2UY9 A;  2VMF A;  5FZ6 A;  5IFP A;  4CUG A;  2D6M A;  2P2K A;  3C7O A;  3EYP A;  5F5I A;  3HIF A;  2OA2 A;  3ROU A;  4W6Y A;  3ZFG C;  3N7K A;  5FZH A;  5FYC A;  5AC9 3;  2PLV 2;  2ZGR A;  1GQH A;  4QB1 A;  2C9A A;  4QU1 A;  4K3U A;  2A75 A;  4QQO A;  4ASM B;  1Q8S A;  1W28 A;  1XOY A;  1NCR C;  3H0O A;  5EYX A;  4BQ2 A;  4Q4Y 1;  1AJK A;  1BBT 3;  1UO9 A;  3J4U H;  3R4D B;  5J37 A;  3R6S A;  4A6O A;  1GU3 A;  5FPV A;  4Q4V 1;  1XYN A;  1N47 A;  4RHV 2;  5JSR A;  3TN9 3;  3V65 A;  1VAV A;  1AX0 A;  1ZBE 2;  3A7Q A;  3I3D A;  2WNU A;  1LOB A;  3USU B;  4CDX A;  2R04 2;  1ZRC A;  1ZZ8 A;  2R1D A;  4BQ3 A;  4PIY A;  3UKV A;  2YG0 A;  4IEZ A;  4Z2W A;  2GN3 A;  1YQ5 A;  1JOD A;  1RGS A;  4MYE A;  2ZOE B;  2ZX4 A;  4KQ7 A;  4HVQ A;  5F3C A;  2BWA A;  2R1B A;  1YYN A;  3AMQ A;  1LOA A;  4YVW C;  2MEV 3;  2VBD A;  2Y6G A;  1H9P A;  1SFP A;  2Q1M A;  3N9L A;  5IK8 A;  1RVF 2;  1QU0 A;  1TZO A;  2ZGU A;  1ND2 B;  3U07 A;  3QH6 A;  1PIV 1;  1YQ6 A;  4XAA A;  4BDV B;  4F8A A;  3E6C C;  2BQP A;  1CD3 G;  2GND A;  1JZ5 A;  2JEC A;  4ZS3 A;  2W52 A;  5GZF A;  2QFE A;  4DB5 A;  4YW7 A;  2AEN A;  3SHR A;  3ZN4 A;  1DCS A;  3FE5 A;  4MO3 M;  1IHM A;  2R32 A;  5G04 L;  3Q8F A;  1QWR A;  4IXL A;  4NVP A;  1OOP A;  2VR4 A;  1JUH A;  5FY5 A;  5LA0 A;  1XYO A;  4Y24 A;  1XXN A;  3GNE A;  4PT6 A;  3CZJ A;  1NLQ A;  3RVH A;  2J1T A;  3A21 A;  3OGV A;  4FFI A;  4ZU5 A;  4AVT A;  1NY7 1;  2ZPX A;  2P3Y A;  4RHV 1;  3VBU C;  3WNM A;  1D4M 3;  4JAA A;  1MR5 A;  4OYU A;  1BMV 2;  3ASI A;  2V4V A;  1PMJ X;  4MHR A;  1MVQ A;  1I5P A;  1IG3 A;  1G9D A;  1TME 2;  2ES3 A;  3EO6 A;  4LK7 A;  4PLM A;  4XET A;  1KIT A;  2RM2 1;  4XTM A;  4YG6 A;  3WUD A;  1MEC 1;  1LGC A;  1HV0 A;  2WJS A;  3OPZ A;  3W20 A;  2HWE 1;  2ADD A;  1NKG A;  2QQW A;  5KHH A;  3ZYH A;  5C5T A;  1KDM A;  1RUI 2;  4P9G A;  4R9C A;  5FZA A;  1PVC 2;  2XQX A;  3KCY A;  1FAY A;  4Z2A A;  1NX9 A;  4LEJ A;  1OKO A;  4IV3 B;  5A33 A;  3MLL A;  3QCW A;  4QM9 A;  5BNO A;  1F5F A;  3I4I A;  1BEV 1;  2FHR A;  2QQN A;  4EYU A;  4O9G A;  3KWV A;  5FYY A;  4TN7 A;  3POJ A;  4K8R B;  4GMP 1;  3IPV A;  5JPM B;  5C3P A;  3I2J A;  3M3C A;  3WF0 A;  1GFF 2;  4BU2 A;  1VMJ A;  3CL1 A;  4W6W A;  1RIT A;  4UFL A;  2RMU 2;  5EFU A;  4XJU A;  4XIL A;  5FRA A;  4UF0 A;  2QE3 A;  1C57 A;  1GYK A;  2HWD 2;  2QQI A;  2H0B A;  3B9I A;  4J1W A;  3S6P A;  3WV6 A;  4D8M A;  3AMP A;  4YRD A;  2MHF A;  1H8T A;  3DV8 A;  4OHW A;  2ATF A;  2D44 A;  3WG1 A;  3ZFF A;  1TG7 A;  4YM1 A;  5KBF A;  2EXK A;  2D43 A;  1OH3 A;  2PN5 A;  1EPW A;  1DQ5 A;  2W3J A;  4NAM A;  3W59 A;  2DUO A;  4M3C F;  2ZGL A;  2A3X A;  3VBS A;  4AYU A;  3O1O A;  1RXF A;  2R07 3;  1VBE 3;  4B4R A;  5K4L A;  3HN1 A;  4FTB A;  4OHY A;  2E53 A;  1QOO A;  1CAX B;  4XUN A;  1PGL 2;  4CE8 A;  5C9A B;  3O1M A;  2G1M A;  5FJH A;  2HBU A;  3HAG A;  5FZ8 A;  1WKY A;  1W6N B;  3A23 A;  5IVF A;  3RYR A;  4E4Z A;  1XJA A;  2UWB A;  4GD4 A;  4HG6 B;  4XFA A;  1Q5O A;  2ZMN A;  3H1Y A;  4YW1 A;  3HQR A;  1DF0 A;  2XPJ A;  4I0W B;  1YC6 1;  3MI8 A;  4E4S A;  4Q29 A;  3I2H A;  1I1E A;  2IVJ A;  4J6G A;  1S0I A;  4Y1X A;  1U5X A;  3NKG A;  3POE A;  5T3N A;  4BB3 A;  1VMF A;  1HDK A;  2G9Z A;  2ZAB A;  4CDX B;  4ES8 A;  2JE7 A;  1G9F A;  1PIV 3;  3ME2 A;  3OGJ A;  3IAQ A;  2PHD A;  5B4X A;  4CU9 A;  4FFG A;  4Q1R A;  2WL1 A;  2C1F A;  4MXV A;  4Q8L A;  2GH8 A;  4QPG B;  4DUX A;  1RMU 3;  4NPM A;  2EIE A;  3OPT A;  5LEK A;  5IT6 A;  3N4M A;  1M06 G;  2ZCW A;  3GBW A;  3JQW A;  5D2A A;  2OW4 A;  4WZC A;  3RYP A;  1UQX A;  3VBH B;  3CJI A;  5KXD A;  5I93 A;  3U37 A;  5F5Q A;  4KG8 A;  2JDA A;  2DVF A;  5FJK A;  3O1P A;  3MIF A;  4HVR A;  4Q0P A;  1RYY A;  2Q8O A;  4E2G A;  2W68 A;  1KFX L;  2VUL A;  4XF3 A;  1SPP B;  4FSJ A;  4KU7 A;  5KHG A;  1GQP A;  1ZZ6 A;  1YIP A;  2R06 2;  1YI7 A;  2GNB A;  1UW8 A;  1W06 A;  5FK8 A;  1K42 A;  4YGB A;  4MG2 A;  3POW A;  1R1A 2;  3Q8A A;  2JG9 B;  2P34 A;  3VKO A;  1Q8V A;  1A78 A;  1L7Q A;  2JDN A;  2WZR 1;  3NNJ A;  2O1Q A;  3ZYB A;  2IUW A;  1O91 A;  1JS9 A;  2JD9 A;  2WNV C;  2RJK A;  4PHZ A;  4XFC A;  5A3T A;  4L97 A;  4O9E A;  2VMC A;  1LB2 A;  1ONA A;  1N3O A;  1OOP B;  2RM2 3;  1W6M B;  1S0E A;  5F3I A;  3UES A;  4U2A A;  5A7P A;  3AKT A;  2HWE 3;  3OF1 A;  1GV9 A;  1UMH A;  4WVM B;  4CP0 A;  3LE0 A;  3KCC A;  2ZEX A;  2ID4 A;  4A3X A;  4EQV A;  5AFE A;  1NCQ C;  2DVD A;  4AE2 A;  3A4U A;  1OLQ A;  2VQ0 A;  3LOB A;  4HN1 A;  3ZXG A;  1RUG 1;  3MZH A;  5FMB A;  2WNE A;  3OD0 A;  4BWO A;  4UFK A;  4AG4 A;  4D7Y A;  1LED A;  3PL0 A;  1Y4W A;  5JMO A;  5TSW A;  4DUV A;  1BEV 3;  2WO7 A;  2CWM A;  1EV1 2;  2ET7 A;  5DDJ 1;  3ZFE C;  3H7J A;  2JB8 A;  1VAM A;  2WZE A;  4I2O A;  1UL9 A;  2ZEY A;  4QX5 A;  4YG0 A;  1OVS A;  4GMP 3;  3OB8 A;  5FYV A;  1ND3 A;  4DY3 A;  2YXS A;  1PO2 1;  2YHJ A;  4UYB A;  5I8Y A;  2W47 A;  4HVO A;  4IE7 A;  4XDO A;  3AYD A;  2R49 A;  3KQR A;  3VN4 A;  5FPB A;  4QKN A;  2VNR A;  2C9K A;  2P17 A;  3FLR A;  2QTW B;  1E57 A;  1QOS A;  5LA2 A;  5CFC C;  2VNO A;  1OQ1 A;  2PHT A;  5BNO B;  1ZA7 A;  2W39 A;  3ZKU A;  1EAH 3;  5DUW A;  1FPN 3;  3I97 A;  3S30 A;  4N9I A;  1RUE 1;  3DN7 A;  4CCC A;  4MGT A;  5C4W A;  4DXZ A;  3IPV B;  3OG2 A;  4QXK A;  3WG4 A;  5HCA A;  5J09 A;  3ZYP A;  3PMS A;  4A3Z A;  2JDK A;  1XRU A;  1N1V A;  4XMA A;  1NLR A;  4RD7 A;  1RUD 3;  2VM9 A;  1BVV A;  1PK6 C;  3OBA A;  3RZL A;  3DCQ A;  4O61 A;  1XSR A;  4CEW A;  2PAE A;  2VZR A;  4WVZ A;  1QKQ A;  1ZNP A;  1H8T B;  1ZM1 A;  2WA3 A;  4CCE A;  1QOT A;  1W0O A;  4YW3 A;  5K8S A;  3M70 A;  2AGS A;  2RDS A;  4QDQ A;  1UKR A;  4AQ6 A;  5LY2 A;  2KD7 A;  2HWF 2;  4GWI A;  1NXD 1;  1RUC 3;  1SLB A;  1B35 A;  2ZA9 A;  4LR4 A;  3M1H A;  3T4H B;  1AYN 2;  3VHR A;  1I3H A;  3GBG A;  4FPH A;  4XBN A;  2XJR A;  1GNH A;  1JZ3 A;  4AFA A;  2VVD A;  5GKA C;  1CPM A;  5FZ7 A;  4JGY A;  3FHA A;  4LOS A;  4N7U A;  1UXZ A;  3DYO A;  5I91 A;  1COV 1;  4NO4 A;  5ABJ B;  3JB4 C;  2GDF A;  3IKW A;  3ZMO A;  2FDG A;  1F2N A;  1ND2 C;  1W8H A;  3VBO C;  4UOJ A;  2XJV A;  1W8Z A;  2RR1 2;  3VD9 A;  5CEH A;  1W2U A;  5T5L A;  5FY4 A;  3WNN A;  2DTY A;  5GZD A;  1QQP 1;  2WAA A;  1AR8 2;  1W2A X;  4LBL A;  4GZ9 A;  3Q8B A;  3FFZ A;  3R4U A;  5T5O A;  3ZSE A;  3VV1 A;  4NHY A;  5F39 A;  4AVS A;  4CXW A;  1LGN A;  5ERL A;  4Q4W 2;  4E4D X;  1OHF A;  2R6Q A;  2VE1 A;  4TTG A;  4JDM A;  2X5I A;  2XKP A;  1QDO A;  5CKM A;  2PHF A;  4CUB A;  2P4E A;  2RS1 3;  2AYH A;  3OPW A;  2QKD A;  2B9U A;  3ACL A;  4J25 A;  2VCC A;  1AF9 A;  1DYP A;  4H7L A;  3GBF A;  4BOW A;  4CEY A;  1NA1 A;  5K0U B;  3H8R A;  2O8O A;  5GM0 A;  3IWZ A;  2VO5 A;  3MF6 A;  2RS5 2;  4J1X A;  1O8S A;  2YB7 A;  5FMD A;  3FX3 A;  2BW8 A;  3RRD A;  4QGM A;  3T2O A;  2QJV A;  2W1S A;  2X53 S;  3CIH A;  3KHB A;  1LTE A;  3PHM A;  1REF A;  4ONU A;  1VBD 1;  1W0P A;  5DAW A;  2VNG A;  4FOV A;  5FYI A;  5ACA 1;  4YLZ A;  4DUW A;  2JXA A;  1V00 A;  2EAL A;  1BVP 1;  3LEI A;  3UK9 A;  4YAR A;  3Q9O A;  5LZ6 A;  5C33 A;  2FCV A;  1AYN 1;  2F6B A;  2JG8 C;  2Y6F A;  1LR5 A;  5JOY A;  2WDB A;  1VBB 2;  3AFG A;  4FO9 A;  2XWJ B;  4Q4X 1;  4EN7 B;  1JZ4 A;  4O65 A;  3T2Q A;  5BNP A;  4WM8 C;  3VDD A;  3IBM A;  4IV3 C;  5IHR A;  5BYN A;  5L7O A;  1XPW A;  4NOT A;  5A6X A;  2PYT A;  1QJX 1;  2XKO A;  3MF9 A;  3DGT A;  2ARX A;  4AI1 A;  3AZV A;  3IDE A;  1IPS A;  4EN8 B;  2FDK A;  2VOK A;  5C8C C;  2OX0 A;  4JGZ A;  4MX3 A;  2EAA A;  2IFW A;  4AVV A;  5FZ3 A;  2GC0 A;  3JD7 2;  2Y26 A;  3TEZ A;  1S0J A;  1VRH 3;  2VUJ A;  2VTX J;  1RUE 3;  2WLQ A;  5A3O A;  2ZS6 B;  5FY9 A;  4OUL A;  4EWA A;  2AEY A;  1X50 A;  2DBI A;  1ND3 B;  2ZGQ A;  3H1W A;  3HNM A;  4KGG A;  3WQB A;  4PF1 A;  1JBC A;  5CBL A;  1DZT A;  4WVW A;  4L8Q A;  2DCY A;  4CDU A;  5FWE A;  4Y1U A;  5FZI A;  3LA2 A;  1PNG A;  3I3Q A;  3TBD A;  1PO1 1;  5J7M A;  1MS8 A;  5CG8 A;  2JKX A;  3ELN A;  2VMH A;  2XHK A;  4DS0 A;  4CCN A;  1HX6 A;  1RJ8 A;  1UU6 A;  4ZON A;  4HK8 A;  4LOR A;  3GZT B;  1HRI 2;  2PMW B;  3ACI A;  4SBV A;  2ZGT A;  1X9P A;  5C4W B;  3III A;  4AGV A;  4BK5 A;  1EUU A;  4W65 A;  4DRR A;  3C3V A;  3MFA A;  2BFU S;  5A7N A;  1BYH A;  5E16 A;  4S2H A;  3MIH A;  4EV0 A;  3AYC A;  3GM8 A;  3MIC A;  1MZE A;  2ARA A;  4XJA A;  3MIB A;  1RUJ 2;  4JC1 A;  5JDB A;  2AAC A;  4QHB A;  3RWN A;  5JXI A;  5HV4 A;  1FOD 1;  2CAV A;  2XLF A;  3MHZ A;  5H9P A;  5EHD A;  4CEW B;  1N1T A;  2FDJ A;  4GKX A;  5I0U A;  1JHJ A;  1KJR A;  1RUH 3;  1A3K A;  2WNU C;  5DQ0 A;  2W1W A;  2VD7 A;  4CDX C;  2IXC A;  3BOP A;  5AC9 2;  5JSO A;  1MVE A;  3K51 A;  3KGL A;  2GC3 A;  5A7W A;  5A70 A;  1FI2 A;  2J42 A;  1AL2 1;  2W2I A;  4FP3 A;  3U0Z A;  3LDB A;  3ZOI A;  1QQP 3;  1HB4 A;  1T6B X;  3HBK A;  3O7O A;  4DEQ A;  1APN A;  2ERF A;  5FBZ A;  3P5B A;  3JD7 1;  2XOM A;  3BTA A;  4S2D A;  5LAT A;  1WBL A;  1HQL A;  3DKQ A;  4GKY A;  2ZX3 A;  4AF9 A;  4FPK A;  5BUV A;  4RR3 B;  4YYO A;  3JQX A;  2ZGP A;  3H3U A;  3KF5 A;  5FZ0 A;  3POI A;  1HRV 3;  4C8D A;  1UKG A;  1CAW B;  5FWJ A;  1W9F A;  1JU3 A;  1WA4 A;  2XJS A;  3UJO A;  1YFU A;  3VGI A;  1U5Z A;  5FO9 B;  2E7T A;  2YDE A;  5CIR A;  1F15 A;  3WNO A;  4CDQ A;  3RJ2 X;  1QJU 3;  1U5Y A;  2OYZ A;  1WW4 A;  1SZB A;  5JLV A;  2ZKN A;  1ZZ7 A;  2GU9 A;  1RUF 3;  1NZI A;  1XND A;  1AR6 1;  2A7A A;  1KS4 A;  2Q0A A;  2V5Y A;  2VZT A;  3D6E A;  4G3Y C;  4H2A A;  4MV2 A;  4WVV A;  3K77 A;  1OOP C;  4XUP A;  2H0V A;  4H7M A;  3LF7 A;  3OY8 B;  4Z8B A;  3VUO A;  2X5I B;  1EP0 A;  2F17 A;  1QDC A;  3LWC A;  4X8P A;  4PJY A;  3RMX A;  2A1X A;  3OBR A;  2MEV 2;  2JIG A;  2JDU A;  3ABZ A;  1GWM A;  5EP9 A;  1C4R A;  1HN1 A;  5CNA A;  1NA1 B;  1M4W A;  4AEM A;  5FLH A;  1QH6 A;  1W99 A;  3FC0 A;  1SDD B;  3THD A;  4A7Z A;  1W05 A;  1WZX A;  4I09 A;  3AMH A;  3R0R A;  4QQL A;  4HSL A;  2ZMK A;  3RZG A;  5GLZ A;  5EYY A;  4E2S A;  2W94 A;  4GAZ A;  5JZG B;  2BDR A;  1QJZ A;  1JUI A;  2ETE A;  4G4F A;  4HKL A;  5IK4 A;  1WME A;  4P9Y A;  1SLC A;  3USU A;  5LAS A;  3B7M A;  3D82 A;  1WCQ A;  3AB0 A;  1X7N A;  3VKF C;  3IIA A;  5IK7 A;  4XHX A;  5IVV A;  1MS5 A;  1WW5 A;  3LDK A;  4FQZ A;  4LKS A;  5BNP B;  1Z7S 3;  1JYT A;  1BBT 1;  2WSU A;  4GAL A;  2XG3 A;  5L7O B;  2VMI A;  1C28 A;  5DZG A;  4C90 A;  4P00 B;  3VD5 A;  2P3J A;  1V6M A;  4MZU A;  4YW2 A;  5KXE A;  4EE2 A;  2RG4 A;  1RUN A;  3PDQ A;  4XFB A;  2Q8D A;  3TN9 1;  1ST8 A;  3ES1 A;  4N53 A;  1JYN A;  3KLS A;  2WLP A;  2JD4 A;  5FOB B;  1JZ7 A;  2A70 A;  2ZXQ A;  4XIO A;  5IVB A;  3HD8 B;  3BTY A;  4BQY A;  5BPX A;  1OD5 A;  4AQS A;  4LHL A;  4ATF A;  1OLM E;  2VQA A;  2WYF A;  2CGN A;  4AHW A;  1H4H A;  2GP5 A;  1AYM 2;  4Y26 A;  3ZFF C;  1H1I A;  4LIU A;  2VOV A;  1JYW A;  3B5L B;  1UPI A;  5HV0 A;  2B8M A;  1LHO A;  1VR3 A;  2CHH A;  3INA A;  1WGP A;  2NPI A;  5CFD B;  1UY1 A;  3VBR C;  4MH0 E;  1DQ4 A;  1ZA4 A;  1O4Z A;  1FOD 3;  5AVA A;  1AUY A;  3DPR A;  3VBS C;  4L99 A;  2WA4 A;  4QX3 A;  3BIE A;  3FL7 A;  1D2Q A;  5APA A;  3IMM A;  1WW7 A;  3OJB A;  2PTM A;  2IC1 A;  4OFG A;  3WF3 A;  3ZDS A;  3KQ4 B;  3N9P A;  3HQX A;  3OGS A;  1JN2 P;  2DWR A;  5KXC A;  1PVX A;  4XAC A;  2TEP A;  2PEL A;  5BNN A;  2VUC A;  2IXK A;  5IWF A;  1UD1 A;  4YGC A;  4S2G A;  3CJX A;  2RS3 3;  1LHV A;  4Q4Y 2;  2J1E A;  2WNO A;  4XF4 A;  4UXA A;  3WG2 A;  3CQO A;  3ZIX A;  1Q3E A;  5L9R A;  5A80 A;  1KD7 A;  1D4M 1;  2VME A;  5FZ4 A;  4CXX A;  1NAE A;  3NAP B;  2WZP P;  3UET A;  1Q56 A;  3UYJ A;  2WWS A;  1XE8 A;  3K2O A;  3VLB B;  4BQ5 A;  2AR6 A;  1W8U A;  1UU4 A;  1H9W A;  4QDR A;  3CKH A;  3WW1 A;  4QKF A;  1PZ7 A;  4CUC A;  3WNP A;  3WNK A;  3JCI A;  3V0A A;  1SLT A;  2E9Q A;  4F83 A;  5AFB A;  3I54 A;  3CJI C;  1BCX A;  2Q8C A;  1CGP A;  4X8N A;  4QWN A;  4NWW A;  3CEW A;  3LIG A;  2EVX A;  3ETQ A;  1WLD A;  2XLG A;  4PBP A;  1POV 0;  5T54 A;  3CMG A;  2ZJC A;  2VGD A;  1UOJ A;  1KJL A;  2EAK A;  4JTO A;  4TLG A;  4OHX A;  5EZW A;  5A1L A;  2WFF 3;  3BKZ A;  3AYA A;  2CGP A;  2FZ1 A;  3AZW A;  3KHC A;  1POV 3;  3OUI A;  1GZT A;  2X29 A;  4Y3O A;  4IE0 A;  3T4V A;  3O12 A;  1X8E A;  1SFY A;  1YXW A;  1J3P A;  1PIV 2;  4NRO A;  5FO8 B;  4XW3 A;  4XMI A;  2RVA A;  3MLJ A;  3RWK X;  4HMZ A;  1F8V A;  4PIX A;  3AXE A;  1V9U 3;  2FDI A;  3AK0 A;  2RHP A;  2Q1F A;  1LU2 A;  4OHV A;  2YPD A;  1IS5 A;  2VXR A;  4FPG A;  4M00 A;  5FZE A;  2BZD A;  4P02 B;  1CZS A;  2D5H A;  5BXX A;  5C3O A;  5K9Y A;  2YC4 A;  3K4Z A;  1SCR A;  4LOT A;  4XAB A;  5DAP A;  5C3Q A;  1CAX A;  1DFQ A;  1CAV B;  4IEU A;  2VMD A;  4ZHN A;  5C9A A;  5FP8 A;  2ZAA A;  4N43 B;  4LJH A;  4JCK A;  3GJA A;  1W6N A;  4MLO A;  2BPA 2;  3PIG A;  5K7P A;  4XF1 A;  4AK3 A;  1NY7 2;  2PHR A;  3DF0 A;  4FQ4 A;  1W3V A;  2XR4 A;  2V72 A;  1AR7 3;  4AEJ A;  1YFW A;  1DQ6 A;  2VUA A;  1ULE A;  3O0W A;  4A7Y A;  3ZSM A;  2D93 A;  1BHG A;  3FFQ A;  4P5H A;  5A3M A;  2BP6 A;  2R07 1;  2WO3 A;  1VBE 1;  3A22 A;  1HB1 A;  1ND3 C;  3HNB M;  4FI9 A;  3EXU A;  3KZ4 C;  5FPZ A;  5CYY A;  4EJR A;  3T3Y A;  4RGA A;  2RM2 2;  5FYB A;  2K2S A;  2I07 B;  4ISR A;  1MEC 2;  1YNA A;  4WBB A;  1GMM A;  3J7N A;  2KM2 A;  3AJY A;  3FMG A;  4QPG A;  2HWE 2;  1VAK A;  3ZVX A;  1G9B A;  3U14 A;  4CA9 A;  5LEJ A;  1WCD J;  2E6V A;  1EUT A;  3AKP A;  3O1V A;  1WWY A;  4GIQ A;  4XF0 A;  1WLW A;  2LAL A;  5A7Q A;  4K8F A;  2ZHM A;  3VBH A;  3RI8 A;  2YMZ A;  4HZF A;  4HON A;  2VMG A;  3WF1 A;  1UMZ A;  4JV4 A;  1KXG A;  1PGW 1;  4MUV A;  1R1Z A;  1SBE A;  2P5B A;  1YQ2 A;  4AXO A;  3BU0 A;  4LMF A;  4ARX A;  4N53 B;  1DDL A;  3VL8 A;  4AW7 A;  2IVI B;  4ZY9 A;  3LQC A;  3UT0 A;  5J36 A;  1SPP A;  4ZXE A;  5C4W C;  4Y5T A;  3DKW A;  2ET1 A;  1BEV 2;  5I8T A;  3CU7 A;  5HPO A;  1ENR A;  4LQR A;  1D4V B;  2XBO 3;  2GNM A;  2FDF A;  5FRE A;  3WNX A;  1UZY A;  2VPV A;  2E7Q A;  2VZU A;  2JG9 A;  3HBZ A;  1NQD A;  3WX5 A;  3TYJ A;  1RMU 1;  1CPN A;  2GNT A;  3H42 B;  3N7L A;  3W9A A;  3HN3 A;  2TUN A;  4V2W A;  4CEW C;  1IGO A;  4BCU A;  1QH7 A;  1OH4 A;  3VDB A;  5T5J A;  4COU A;  3LZZ A;  1W6M A;  4DIN B;  1VIW B;  3H50 A;  1JYV A;  1U5I A;  3ZKY A;  5EJZ B;  2G4I A;  3B93 A;  4ZS2 A;  4WVM A;  5EJ1 B;  4YGE A;  1LUL A;  4A42 A;  5C6C A;  3KV9 A;  2VG9 A;  4Q2F A;  1H1M A;  1H2M A;  1B35 C;  3NNG A;  4LHS A;  3RS6 A;  3DPR B;  2MNG A;  2D3P A;  4P5Y A;  5GLT A;  2WWU A;  3B00 A;  1OUS A;  2ZBJ A;  3WW4 A;  1N1S A;  1S4C A;  4JGY C;  1WLC A;  3MIG A;  3T0A A;  2YGL A;  3SH3 A;  1IG0 A;  2D7F A;  4XFI A;  5I0D A;  2YU1 A;  3WQ1 A;  1RUD 2;  1F9K A;  5BNQ A;  1RXG A;  5BNN B;  1W6Q B;  4YWA A;  1DGR A;  1SDW A;  4M3C B;  5FY7 A;  3T2P A;  3GF6 A;  1CZT A;  1LEM A;  1AJO A;  2YYO A;  2B46 X;  4Y1Y A;  4CCJ A;  2QCS B;  3LOI A;  3JUU A;  5I0T A;  3X29 B;  2P3K A;  1Y9G A;  4KG0 A;  1JZ2 A;  5E8A A;  1F4H A;  1S0F A;  5KC5 A;  3O1U A;  1GOH A;  4BIO A;  1IKQ A;  3HOB A;  4LTA A;  3S7I A;  4D6S A;  3WP3 A;  3MGU A;  4N90 A;  1I5Z A;  2GMM A;  2ORZ A;  3SCG A;  2X5I C;  1WCK A;  2UYA A;  3LSE A;  4BA6 A;  4CDW B;  2K0G A;  3FUO A;  4QQH A;  3V0A B;  4MGQ A;  5FCC A;  2J1U A;  3ST7 A;  4FPC A;  4CTE A;  2W1Q A;  4TSV A;  2YU2 A;  3P6B A;  5A6Y A;  1JI6 A;  2DVB A;  5E89 A;  4OI0 A;  3ZR5 A;  4UFI A;  1VBC 3;  1W2O A;  4DQA A;  2NN8 A;  3IDA A;  4CEY C;  2JJ6 A;  1K45 A;  3LEM A;  4CPB A;  3J7H A;  2FDH A;  4LBQ B;  2VZ3 A;  3AZX A;  2V09 A;  5C70 A;  2BYV E;  3UGH A;  4BJ0 A;  4Q0Q A;  4HXC A;  3POB A;  1MS3 A;  4M4P A;  1GNY A;  4HBN A;  3CHX A;  3MIE A;  3THC A;  4E8D A;  2H6C A;  1OPM A;  2VY0 A;  5FYZ A;  5LBE A;  3I3M A;  5F3E A;  2QQL A;  3FBY A;  1EAH 1;  1H2K A;  1FPN 1;  3H8X A;  3SEP A;  5CKN A;  3WHT A;  2NYY A;  4AL9 A;  3WDT A;  1V6O A;  2Y0O A;  4XFH A;  4JRL A;  1CX1 A;  1A8M A;  1V6L A;  5BNP C;  2FMD A;  2WZR 2;  1ZX5 A;  3AXD A;  1D0G A;  3VDD C;  5L9B A;  5BY5 A;  4HL0 A;  4XFF A;  1R08 3;  1RUD 1;  5LWB A;  2BRT A;  2XL9 A;  4XCA A;  1O3Q A;  4R9A A;  1QIQ A;  4IE5 A;  4ASK A;  1REE A;  5ABJ A;  1QEX A;  4JGZ C;  2TBV A;  1MS1 A;  3LFI A;  1C1L A;  1UAI A;  4UFM A;  5C3S A;  2H6B A;  1RUG 2;  1RUC 1;  2XJU A;  3S57 A;  4AHY A;  5JR2 A;  3PNA A;  1UOF A;  2KR2 A;  1K5M B;  5FAX A;  1H30 A;  3KS7 A;  4N9H A;  5IAX A;  2WR9 A;  1F4A A;  4YW6 A;  5DDJ 2;  4AOC A;  1ZZB A;  2QBX A;  4EN0 A;  1AR9 3;  2WFP A;  3AX4 A;  1WLT A;  3DL3 A;  4XUR A;  4CDU C;  1G7Y A;  1W9W A;  2HH9 A;  1DGW A;  1PO2 2;  2RJ2 A;  4DXS A;  3HT2 A;  2ZGS A;  3UL2 A;  4LA3 A;  3SEE A;  3ZX7 A;  3U10 A;  4B4P A;  3OBZ A;  3SIS A;  2V5D A;  3PVB B;  1V70 A;  1LHU A;  3N7J A;  3K46 A;  5K0U A;  1SMV A;  1W8N A;  5JWP A;  1O4Y A;  4CSW A;  4HFS A;  3BGA A;  2E7A A;  2GAL A;  5CAD A;  4PLO A;  3T09 A;  1CVN A;  2HBT A;  1MAC A;  3OBT A;  1HXS 1;  4AHX A;  4K40 A;  4E8C A;  3FBM A;  2A3Y A;  2W9X A;  1RUE 2;  2R0F A;  1AHS A;  5FPL A;  1JH5 A;  1OC1 A;  4XJ8 A;  3TOJ A;  2OUH A;  4ATE A;  4D0Q A;  1YRZ A;  5JSP A;  2PLV 3;  2RS1 1;  2KA3 A;  2LS6 A;  4CP1 A;  4QAW A;  3HJR A;  3AC0 A;  2D6N A;  1WCS A;  4IDZ A;  5KWR A;  3ZXD A;  4H55 A;  2IWG B;  4TLF A;  1PHM A;  2DV9 A;  3E5X A;  4COZ A;  2W1U A;  3THP A;  2JIC A;  3JBG 1;  4KGQ A;  3MBW A;  3WUC A;  3U78 A;  2HEW F;  1GZC A;  2CSG A;  4IEO A;  2VH9 A;  4AED A;  3K75 B;  2D6P A;  2OZ6 A;  2XVL A;  2Z42 A;  3QD6 A;  4I0A A;  4EZH A;  4LIT A;  1LHN A;  3N35 A;  2W91 A;  4QPI B;  3VZL A;  2VQU A;  2Q1Z B;  3OTF A;  3NKT A;  4XUQ A;  4GXL A;  4ZPI A;  5IVC A;  3JB8 A;  3MID A;  4L9B A;  4L2N A;  4LBO A;  1XE0 A;  1ZBE 3;  2DF7 A;  3ZFG A;  2BER A;  2HWB 1;  1W0N A;  2R7E B;  3IZO A;  3WIN E;  2PQS A;  2R04 3;  3HT1 A;  4JVA A;  1WW6 A;  2HWC 1;  3QAC A;  2Y34 A;  4OQ8 A;  5DUV A;  3PU3 A;  4CDQ C;  1COV 2;  4NJ4 A;  3ZIW A;  3URF A;  1E5H A;  1BZW A;  1XNK A;  2DFB A;  1FXZ A;  4W8J A;  1BK1 A;  2YFU A;  3H8O A;  1US3 A;  2QDN A;  4FPY A;  3S7E A;  1SLL A;  1OF4 A;  4P9X A;  1O4T A;  4Y4R A;  1QQP 2;  3D0S A;  3L2H A;  5T5P A;  3TEX A;  5FOJ B;  5KC6 A;  2Z4F A;  4A7K A;  4KWK A;  3TEY A;  2W0X A;  1RVF 3;  2NQY A;  5GLW A;  1W8W A;  5FBJ A;  4XF9 A;  1VRH 1;  1MS0 A;  4KBB A;  1C8M 1;  3QBQ A;  3QOP A;  4P9L A;  1K12 A;  2EF6 A;  5CZK A;  2EXH A;  2E51 A;  1RUO A;  2BFU L;  3J8F 3;  2QQM A;  2WS9 1; 
#chains in the Genus database with same CATH homology
 3GM8 A;  1LNS A;  3OEA A;  3VD7 A;  4OZO A;  5JXI A;  4XUO A;  3E1F 1;  3DEC A;  3DYP A;  4BK4 A;  1JHJ A;  5DQ0 A;  4XZU G;  3F2Z A;  2W1W A;  1SG3 A;  1IQD C;  5IFT A;  4KMQ A;  1GUI A;  3NJX A;  2J1A A;  4DEQ A;  3WNL A;  1PMH X;  2XOM A;  4OMD A;  2WQ8 A;  1UY4 A;  2HLE A;  4A41 A;  5HXM A;  5DPN A;  2YFZ A;  3ECQ A;  3T08 A;  3VDC A;  1JU3 A;  5G05 L;  3MUZ 1;  1JZ6 A;  3LPG A;  3ETP A;  3WNO A;  2EIC A;  2W95 A;  2VMF A;  3MUY 1;  1L7R A;  5DMY A;  5IFP A;  3WF2 A;  3EYP A;  3C7O A;  1UX7 A;  3C7H A;  2ORX A;  2VZT A;  4UI9 L;  1OF3 A;  5JXG A;  4QB1 A;  2WAB A;  3K77 A;  4XUP A;  1DYO A;  4QPW A;  1UWW A;  1UY2 A;  3ACH A;  3PUI A;  4QX2 A;  4ET7 A;  3ABZ A;  2WO1 A;  4CVU A;  1HN1 A;  5DN2 A;  1W99 A;  3NRU A;  4A6O A;  1GU3 A;  1SDD B;  3THD A;  3W5M A;  2W94 A;  3FHQ A;  1US2 A;  2W5F A;  5IJR A;  3A7Q A;  3I3D A;  3I2G A;  4PQQ A;  3GDB A;  4CU8 A;  3MV0 1;  1WCQ A;  2YG0 A;  4AAX A;  4L0P A;  1TVG A;  4LKS A;  1H6X A;  4GWJ A;  2W92 A;  4P00 B;  3VD5 A;  4W50 A;  4JKL A;  4RYD A;  2L9L A;  2Y6G A;  1KGY A;  1GOF A;  2YC2 A;  1JYN A;  3I3B A;  4BDV B;  1JZ7 A;  2ZXQ A;  1JZ5 A;  4JKM A;  3K4D A;  4A4A A;  4MO3 M;  5G04 L;  2ZEZ A;  2VR4 A;  1DP0 A;  2E31 A;  1JYW A;  2BGP A;  2CDP A;  5LA0 A;  3P1I A;  1UY1 A;  4PT6 A;  3CZJ A;  2J1T A;  3A21 A;  3OGV A;  1XNA A;  4QX3 A;  5F7U A;  4LPL A;  3FL7 A;  3GXU A;  3WNM A;  4OYU A;  2B4K A;  2V4V A;  3WF3 A;  4ZZ5 A;  1PMJ X;  4BXS V;  1I5P A;  5JXH A;  3OGS A;  4KWU A;  1MPX A;  4M4R A;  2WUH A;  1NKG A;  1R64 A;  4MGS A;  2J1E A;  2XQX A;  4Z2A A;  3CQO A;  1NX9 A;  1XNT A;  4IUG A;  2VME A;  4OUE A;  3MO4 A;  1NAE A;  3UET A;  3ACF A;  2EID A;  4QDR A;  2QQN A;  3CKH A;  2WO2 A;  4CUC A;  3WNP A;  3WNK A;  2DCJ A;  3I2J A;  2VZP A;  3WF0 A;  5B4N A;  3I3E A;  3CMG A;  2QQI A;  4D8M A;  3NJV A;  2E32 A;  2RV9 A;  1W8O A;  1TG7 A;  3LPF A;  4YPJ A;  3HNY M;  2RVA A;  2W3J A;  1OD3 A;  4TXW A;  2VJX A;  4UAP A;  3W5N A;  4XUT A;  2BZD A;  4P02 B;  1CZS A;  3VD4 A;  2YC4 A;  3K4Z A;  4XUN A;  3T0B A;  1UZ0 A;  1T2X A;  2VMD A;  1WKY A;  3A23 A;  2X10 A;  3DYM A;  4OMC A;  4HG6 B;  4DEV A;  4A45 A;  1W9S A;  2WN2 A;  1UXX X;  2V72 A;  2BGO A;  2WAO A;  3I2H A;  1BHG A;  2WO3 A;  3HNB M;  3A22 A;  4FI9 A;  3LEG A;  5CYY A;  2WZ8 A;  3IAQ A;  3T0D A;  5B4X A;  4CU9 A;  3I2I A;  1GMM A;  1PX3 A;  4DUX A;  2EIE A;  1GOG A;  3VD3 A;  1J84 A;  1EUT A;  2J1S A;  3U37 A;  3C7F A;  2JDA A;  1KEX A;  3WF1 A;  1RYY A;  2WN3 A;  3HPN A;  1YQ2 A;  4CU6 A;  2VZ1 A;  4ARX A;  1JYX A;  4ZY9 A;  3LQC A;  1GQP A;  4ZXE A;  5HPO A;  3SKV A;  4LQR A;  1K42 A;  3CDZ B;  3WEZ A;  4A44 A;  2VZU A;  2EIB A;  1L7Q A;  2LW8 A;  2W87 A;  4DXT A;  3WF4 A;  2JD9 A;  3HN3 A;  2VTF A;  2WYS A;  3UNP A;  2W46 A;  2Y6L A;  2VMC A;  1OH4 A;  4W4Z A;  3OEB A;  3VDB A;  3UES A;  2HYX A;  3EB7 A;  3ZM8 A;  1JYV A;  1UMH A;  3IAP A;  5EJZ B;  5EJ1 B;  3LE0 A;  3I2K A;  2ZEX A;  4A42 A;  2ID4 A;  2VQT A;  2ZEW A;  3C8X A;  3NNG A;  3NQH A;  4LHS A;  4P5Y A;  5JUV A;  2XON A;  1UMI A;  2WBK A;  3T0A A;  4AG4 A;  5JXJ A;  3C7E A;  5JMO A;  5LCW L;  4DUV A;  4JX0 A;  5I0D A;  5EIY B;  2Y8K A;  2VZO A;  2VL4 A;  2WZE A;  2ZEY A;  3C7G A;  2VZV A;  1JZ8 A;  3OB8 A;  1UYY A;  3T2P A;  1CZT A;  2W47 A;  3SKJ E;  3BN6 A;  1JZ2 A;  2C9K A;  1F4H A;  4MOA A;  5LA1 A;  1GOH A;  5LA2 A;  3HOB A;  4ZZ8 A;  1D7P M;  2Y6H A;  2ORZ A;  1UY0 A;  1UYX A;  4XVH A;  3I97 A;  2VCA A;  4MGQ A;  2J1U A;  2W1Q A;  2E33 A;  3P6B A;  1JI6 A;  3OG2 A;  1OT5 A;  2DCK A;  3IDA A;  2X05 A;  2Y6J A;  4A3Z A;  1K45 A;  2J7M A;  3J7H A;  4RN5 A;  2VZ3 A;  4CUA A;  2VM9 A;  5C70 A;  4BJ0 A;  3OBA A;  4M4P A;  1GNY A;  2VZR A;  2QQO A;  3THC A;  4E8D A;  2B9V A;  2QQL A;  4QDQ A;  3CZU A;  3SEP A;  2KD7 A;  4GWI A;  2OKX A;  1CX1 A;  2Y64 A;  5A1A A;  1JZ3 A;  2JE8 A;  3FHA A;  1P8J A;  1UXZ A;  3DYO A;  4QDS A;  3VDA A;  2X09 A;  4UOJ A;  3VD9 A;  3WNN A;  2WAA A;  2E26 A;  5JR2 A;  2VZQ A;  4GZ9 A;  2C4X A;  2QQK A;  3IB3 A;  4KI5 M;  2QQJ A;  1F4A A;  2VOT A;  5FUI A;  3WSO A;  2QBX A;  5C7G A;  1UYZ A;  4TTG A;  4XUR A;  3MV1 1;  4CUB A;  1W9W A;  2RJ2 A;  4ARY A;  4DXS A;  3SEE A;  4QB2 A;  3JXS A;  2VCC A;  2J1V A;  4MAD A;  2BBA A;  2V5D A;  3K46 A;  1W8N A;  2CDO A;  2VO5 A;  3HEI A;  1O8S A;  2YB7 A;  3T2O A;  4JHZ A;  3BGA A;  2J1R A;  3T09 A;  2W1S A;  1J83 A;  3CIH A;  4E8C A;  4DUW A;  2VCB A;  2W9X A;  3LEI A;  1XC6 A;  1CIY A;  1JU4 A;  3FN9 A;  4D0Q A;  3GGL A;  2WDB A;  2LS6 A;  4QAW A;  3HJR A;  3OGR A;  3AC0 A;  3ACG A;  1JZ4 A;  3T2Q A;  4QX0 A;  1O8P A;  2XHN A;  5IHR A;  1XPW A;  2W1U A;  2J22 A;  3MBW A;  1PX4 A;  4QX1 A;  4P08 A;  3K75 B;  3PUH A;  1CZV A;  2C26 A;  3LEK A;  4QB6 A;  2W91 A;  1ULO A;  2Y6K A;  2VQU A;  4XUQ A;  2BER A;  1W0N A;  2R7E B;  1UY3 A;  2PQS A;  3HNM A;  1H6Y A;  3WQB A;  4JKK A;  4PF1 A;  1O59 A;  2VC9 A;  4W8J A;  1SHW B;  2YFU A;  1US3 A;  5C71 A;  1NUK A;  2DDU A;  1OF4 A;  5J1X A;  4DXR A;  1ULP A;  3D3A A;  3I2F A;  2Z4F A;  4CU7 A;  2JKX A;  1DLC A;  5IYY A;  1K3I A;  1W9T A;  3ACI A;  3K4A A;  5CZK A;  1K12 A;  3III A;  4BK5 A;  1EUU A;  2VZS A;  2QQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...