2WO1A

Crystal structure of the epha4 ligand binding domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
183
structure length
180
Chain Sequence
b'ETGEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKRTKHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPHRIN TYPE-A RECEPTOR
molecule tags Transferase
source organism Homo sapiens
publication title Structural Plasticity of Eph-Receptor A4 Facilitates Cross-Class Ephrin Signalling
pubmed doi rcsb
total genus 34
structure length 180
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wo1A00
4OMDA 1PMHX 1UWWA 4TXWA 2EIDA 1JZ5A 1DYOA 1UY0A 1TG7A 2J1RA 3K77A 2W1SA 4ZXEA 3IIIA 2EICA 1CIYA 2QQMA 2QQKA 4PF1A 4ZZ5A 4KI5M 1W0NA 2W1UA 1BHGA 2J22A 2WO3A 3I3DA 1GOFA 1JYXA 2QQOA 2V5DA 4LQRA 3OB8A 2VZUA 1PX3A 2J1AA 5LCWL 1GNYA 4M4RA 1K12A 4KMQA 2CDPA 3CKHA 2W95A 5JR2A 5C71A 2WYSA 2C9KA 3HPNA 1MPXA 3BGAA 4JKKA 4GWIA 5F7UA 4CUBA 3I2KA 1NX9A 3MV01 4A45A 1UMHA 2VMDA 2J1EA 2C4XA 1ULPA 4QB6A 5EIYB 2EIBA 3MUZ1 4A42A 4BK5A 3WF1A 3J7HA 2VMFA 3LPFA 1KGYA 1O8SA 3THCA 1J84A 1LNSA 2B9VA 1UX7A 2VO5A 3A7QA 2VR4A 3IAPA 1JHJA 4ZY9A 3WSOA 2BBAA 1GMMA 1W9WA 3SEPA 2VZTA 2B4KA 1K42A 3K75B 1L7RA 4A4AA 1D7PM 1XNTA 3SKJE 1NAEA 2E31A 2W1WA 2J1UA 3OGVA 1UXXX 2XOMA 1SDDB 2WN3A 2LS6A 2DDUA 3MV11 1JZ6A 4YPJA 5IHRA 4XUTA 5LA2A 1O59A 3U37A 3VD5A 3LE0A 1XNAA 5JXJA 2VQUA 4D8MA 5CYYA 3K4ZA 1JZ2A 3C8XA 4XUQA 2WZ8A 1HN1A 2VM9A 2OKXA 1H6YA 4XUOA 2YC4A 3W5MA 5IYYA 2DCKA 1GU3A 2BGPA 5JXIA 1JI6A 4GZ9A 2VZPA 3LEIA 1PMJX 5C70A 3ZM8A 1F4HA 4ARXA 4W8JA 2Y6JA 4A41A 3A22A 3LEGA 3CIHA 3NQHA 1TVGA 1O8PA 2VC9A 3K4DA 1XC6A 5HXMA 1OD3A 2JE8A 3C7EA 1K45A 1NKGA 3VD3A 1UYXA 3LPGA 4DUXA 3DECA 2VTFA 4OYUA 1SHWB 1GOGA 3THDA 2VJXA 3I97A 3LQCA 3CMGA 3ETPA 4UOJA 4OUEA 1UY4A 5EJ1B 1JU4A 1JYVA 3HOBA 4BJ0A 2C26A 4CUAA 1JYNA 1WKYA 2QQNA 2RV9A 2PQSA 3WF4A 1CX1A 3SKVA 4BDVB 2Y6GA 2VMCA 2BGOA 1OF4A 3IAQA 4MOAA 4QDSA 1UYZA 5CZKA 3CQOA 1OF3A 5C7GA 4XUPA 1OT5A 3GDBA 4RYDA 3OBAA 2W1QA 3A23A 1DLCA 4P5YA 5J1XA 3CDZB 4BK4A 5FUIA 2VCAA 3WNPA 4XURA 5IFTA 1JZ7A 2QBXA 4TTGA 4CUCA 4QAWA 3WQBA 2V4VA 2WUHA 3HJRA 4LPLA 4DUWA 3WNOA 3WNMA 2ZEWA 1UY2A 4W50A 4Z2AA 4KWUA 5JMOA 5EJZB 2J1SA 4QX0A 2ZEZA 1R64A 3EYPA 4CU7A 3A21A 3EB7A 3E1F1 3FL7A 3OGRA 4DXSA 4ET7A 2ZEYA 4P00B 4LKSA 5JUVA 3NJVA 4UAPA 3T0DA 2VCBA 2YFZA 3C7GA 3SEEA 2J7MA 3MO4A 4ZZ8A 2WAAA 4QDRA 2CDOA 1W8OA 2W87A 3MBWA 3ACIA 4IUGA 4QB2A 4QPWA 4DEVA 3I3EA 4HG6B 4E8CA 2VZ3A 5DQ0A 4A6OA 4RN5A 2X05A 5IJRA 3VD7A 3T08A 3GM8A 1GOHA 3C7FA 3K46A 2L9LA 4A44A 5B4NA 3FHQA 2VQTA 5G05L 3WF2A 2ORXA 2W91A 2ZXQA 1W9TA 1UMIA 2XONA 2BZDA 1CZTA 1W99A 2VZOA 1I5PA 4GWJA 4DEQA 2W5FA 2VMEA 4FI9A 2WN2A 2VZRA 1UY1A 4MO3M 2JKXA 4D0QA 3P6BA 1L7QA 2JD9A 3WF3A 1CZVA 2WQ8A 3T09A 4JHZA 1SG3A 4UI9L 3T0AA 4P08A 4JKLA 1UYYA 2WBKA 2VCCA 2YC2A 3NRUA 2YB7A 1YQ2A 1RYYA 3UESA 3UNPA 2W92A 4CVUA 1EUUA 3JXSA 2RJ2A 4XVHA 3GGLA 4AG4A 1ULOA 4CU9A 4A3ZA 2WO2A 3OG2A 3OEAA 2YG0A 3W5NA 2V72A 1XPWA 2Z4FA 2E33A 3I2FA 3LEKA 4E8DA 2XHNA 3GXUA 4MGQA 3VD9A 3CZJA 4XZUG 2Y64A 4OMCA 2ORZA 3AC0A 3ACGA 2W46A 2QQLA 1JYWA 2X10A 2BERA 4MGSA 4QX3A 1H6XA 2VZVA 4BXSV 1P8JA 3WNNA 2X09A 3ABZA 2W94A 3NJXA 3I2IA 2EIEA 4JKMA 2ZEXA 4M4PA 2WAOA 3WEZA 4ARYA 5A1AA 2QQJA 5G04L 2VL4A 4OZOA 4QX2A 4XUNA 1WCQA 5LA1A 2J1VA 4QB1A 3VDCA 1IQDC 3DYOA 2WZEA 4DXTA 3CZUA 1K3IA 3WF0A 2W9XA 3D3AA 3DYPA 3T0BA 4DXRA 3F2ZA 1J83A 2J1TA 2Y6HA 3VDAA 2W47A 3P1IA 2HLEA 2W3JA 3IDAA 1NUKA 4CU6A 1EUTA 2Y8KA 1GUIA 2DCJA 4JX0A 3OGSA 5DN2A 2XQXA 2WDBA 2E26A 2VZQA 3I3BA 3ECQA 1US2A 4QX1A 2YFUA 2R7EB 4W4ZA 3WNLA 1CZSA 1PX4A 1UY3A 1KEXA 3FN9A 3HNYM 3HNBM 3OEBA 3VDBA 5I0DA 2ID4A 3DYMA 4L0PA 3I2GA 3NNGA 1T2XA 1JU3A 1F4AA 5DPNA 2WO1A 3ACHA 1UXZA 4AAXA 5JXHA 3MUY1 1DP0A 4LHSA 2LW8A 2VZ1A 2RVAA 5JXGA 2VOTA 1JZ8A 3BN6A 3PUIA 3HEIA 1JZ4A 5HPOA 2WABA 3I2HA 3UETA 2VZSA 2JDAA 3K4AA 4CU8A 3FHAA 1OH4A 2Y6LA 2Y6KA 3T2PA 5IFPA 4MADA 3T2OA 1JZ3A 1W9SA 5DMYA 5B4XA 1W8NA 1US3A 3T2QA 4P02B 1UZ0A 3PUHA 4DUVA 3C7HA 2KD7A 1GQPA 3WNKA 3C7OA 4QDQA 3IB3A 5LA0A 3HN3A 3ACFA 4PQQA 2QQIA 2E32A 3HNMA 3I2JA 2HYXA 4PT6A 3VD4A
chains in the Genus database with same CATH superfamily
5FK7A 2VBBA 4XCAA 4TXWA 4YFWA 3LD8A 3D8CA 5D8AB 5KHGA 1QQP2 3GF6A 5JCTA 5BNPB 1UY0A 5DDJ3 4CDUA 1TG7A 2D43A 2MPFA 1E5RA 1ZZ7A 2WO7A 1HRV2 3K77A 4GA9A 2WZPP 5GZEA 5IVJA 4YNIA 1MZ6A 1QHDA 3D82A 4LR4A 5DDJ2 5EP9A 2QNKA 5IK5A 2QKDA 1CIWA 4WM8B 2FDFA 4Y22A 4IEPA 1OQDA 3ZSMA 2P6CA 1AXKA 1DHKB 3MI8A 5K0UB 3SXWA 1QDCA 1GQGA 4S2GA 1GOFA 5BNNC 5JI9A 2V5DA 4XPVA 1GICA 4AQ2A 1TME2 2WZR2 3AX4A 4FQ4A 1ASJ3 3EBRA 1ZVFA 1S0JA 3WLUA 3RS6A 4A6SA 1C1LA 3UGGA 3FWEA 1GNYA 3KS7A 2ZA9A 3GBWA 5GLWA 4M4RA 3IDEA 2RS52 5FZIA 1I6XA 4QX8A 4YW7A 4AE2A 2CDPA 1AR71 5FO7B 1OD5A 4GH4A 5C3PA 1S55A 2ZBJA 5FYYA 3U07A 3U78A 5IK7A 1DDLA 4C1XA 1HQNA 1RUG1 1MPXA 3EO6A 1MZFA 5AC91 2W39A 5JZGC 2WWUA 3USUA 2GC2A 5I0UA 2R073 1Q8VA 5BY5A 5E6HA 1HV1A 1W2TA 1REFA 4QKFA 1LB2A 1F9KA 3ZYRA 5ACA1 1O91A 4CP9B 2IVJA 5LBFA 1E57A 5EIYB 3T4HB 2BFUS 2ARXA 1QDOA 4BK5A 3J7HA 3SITA 4YWAA 2UWAA 3AKQA 1HX6A 2R061 4L11A 1VAMA 2DURA 1JTZX 4HSJA 4FTBA 3PVBB 2VUJA 4OHWA 1J84A 1VBE3 1O4YA 2R49A 4BPZA 3POBA 1UX7A 3AJZA 5IVBA 2VO5A 2VW0A 1Y9GA 1CJPA 2JG9A 2PHRA 4Q4X2 4W6WA 4META 4BOWA 1W9WA 4AXOA 1O5UA 2DFBA 2VZTA 1ENRA 1WBFA 2A73B 2WSVA 2ZPXA 3K75B 3ZXAC 1K42A 5AFEA 2HWC2 3NNLA 2IWGB 2UWCA 1WLWA 3WNXA 2E31A 1OPOA 1R1ZA 2DU1A 5F6LB 2ZKLA 5FRAA 4HANA 4YZ2A 2XOMA 2VUAA 2XLAA 4GH4C 2PAMA 2QDNA 2GNDA 3B7MA 3RZZA 1GP6A 3R05A 3FJSA 2P3KA 3L9JT 1GYKA 2RDQA 2VBDA 4BMEA 3J8F3 3WHTA 5JZGA 4XFAA 1A8MA 1LHWA 5GZDA 3K4ZA 3VZKA 4UFKA 4Z92B 2RDNA 3ZYFA 2O8OA 2WZ8A 2X8KA 4I0BA 1H6YA 3ZXJA 2YC4A 3QOPA 5CKNA 3OY8B 1N47A 2DTYA 5IYYA 3WG1A 4S2DA 3BTAA 4QPIB 1ODMA 5D2AA 4JGZB 4JAAA 5JXIA 2Z79A 3BTYA 3V56A 1NZIA 3KVBA 5FR3A 2E7AA 1FPN2 4I0AA 1EYBA 2VUCA 3U75A 1H8TC 3DXTA 3WQ7A 4QWNA 2JDMA 1SBDA 4IESA 1VP6A 2Q8DA 4A41A 5L36A 2YBKA 1RTVA 1J3PA 3WG4A 1WW6A 1EPWA 3LEGA 4Q4V1 4EZ4A 3S5AA 2ZGTA 3K48A 2XG3A 3CIHA 3NQHA 3DPRB 2HYKA 4P9JA 2E7QA 1HW5A 5LEJA 2BVBA 4K6BA 3VBRC 4UT5A 4YM0A 5FMOL 1VAVA 1CPMA 3HN1A 1DZQA 2XL9A 2DCYA 3RZGA 1BKZA 2B39A 3NKGA 4DUXA 5LBCA 2GMPA 1MACA 4OYUA 3CU7A 4E27A 2JG8C 4B1MA 3DV8A 3AYDA 4K40A 2VNVA 3CJIB 4AI8A 4Z07A 2XMLA 4OQ9A 5AFBA 3ZPYA 3RDIA 3LFIA 2Q8CA 1ND2B 2EXJA 3CMGA 3ETPA 4UOJA 3O1SA 4LBLA 3DCQA 2A3WA 4Z82A 4PLMA 3S6PA 5LRRA 4M0NA 3ZVXA 4XHXA 2FBEA 2RV9A 1RUH2 4AEDA 1EV13 4WVVA 3BTZA 3RSJA 1H9PA 5KC5A 1OC1A 2Y6GA 2RMU3 4LJHA 4Q4X3 4C0HA 1AR63 4AEMA 5DG2A 2VMCA 1OF4A 3ZFEA 1KS5A 3I7DA 4MGTA 5LEKA 3WV6A 3TEXA 1KD7A 4GALA 4ZU5A 1YIPA 2R1DA 2XL7A 3AKTA 4KNCA 4XABA 3W9AA 1G6NA 4Y4YA 4QDSA 5FLHA 3AZZA 3N7MA 5CZKA 4JGZA 2BVVA 1WBLA 2A6YA 3IKWA 1ZZ8A 2W1QA 5IUQA 3ZSLA 1YJLA 5K7PA 2YMZA 5IVCA 5J1XA 3E6DA 2V4AA 4N53A 2F6BA 2UYBA 4BK4A 2K9ZA 2VTXJ 2XDVA 3RGBA 4PF5A 2VCAA 1QNWA 3KWVA 1JH5A 2FHRA 3VBRA 1D2QA 1PM4A 2QBXA 2R0HA 5FJHA 5FYUA 4Y33A 4WBBA 5A3OA 1IPJA 1KS4A 2WS92 2G9ZA 4CDUC 3WNMA 4BQYA 5A6QA 4GMP0 1OXCA 4XMAA 1ENQA 1PM7A 2ZEWA 4YM2A 3DEMA 3K3OA 2NM1A 2QE3A 2V09A 4KWUA 4XBNA 5F39A 2XH6A 1YEWA 4AVCA 1R64A 2BRTA 3EB7A 5FZGA 5GKAC 3AP5A 3VZLA 3WG3A 4DXSA 3LDRA 5FIXA 4LKSA 3VBUB 1VBB3 3NJVA 3PL0A 4UAPA 4W6XA 2YFZA 4KQ7A 3BIEA 3Q8EA 2DF7A 5HCBA 1OOPB 3SEEA 4CDWA 4FPKA 1J3RA 3GYDA 4L8QA 1WD3A 4QDRA 1UZYA 1E5HA 5FDBA 1W8OA 2W87A 5C8CB 1UN1A 3ZFGC 3WG2A 4CSWA 4P14A 1JYCA 4FOWA 3GNEA 1ZNPA 4MZUA 5JPNB 4NUBA 1CN1A 1COV2 3FUQA 4KG0A 4MHRA 1ZZCA 3RFRA 2R32A 1LULA 1C4RA 5KC6A 1NXD1 4KWJA 1Q8OA 1JOPA 5CB7A 3MIBA 1RUE3 3WUCA 3NJZA 2VOXA 3FHQA 2VQTA 4Y5Z0 3WVJA 2ORXA 4NHKA 4ZKTB 1FI2A 4COVA 2P1BA 1CQ9A 2W91A 2ZXQA 2WNOA 1AVBA 3M8LA 1K5MA 4QHBA 2GP3A 2XONA 5CG8A 1H8TA 1VJ2A 1W9FA 1LGNA 4GWJA 1IKQA 3IDCB 1OUSA 3OGGA 3OD4A 4QPIC 4U2AA 3LSEA 4M0HA 4XJ8A 4FP3A 5FY1A 4WM7A 2DVFA 1UY1A 4MO3M 2CV6A 1F35A 4HONA 4O65A 4XJUA 1WCSA 5I93A 3H8XA 3UKNA 3HD8B 5FO8B 3P6BA 1QJY1 1ASJ1 3MHZA 3RVHA 2YBSA 3L2HA 3T09A 4UI9L 1V6NA 1R1A2 2A6WA 1UYYA 3PVNA 5F8PA 2WNUB 5IVEA 2YC2A 1WCDJ 1XNBA 2ZTNA 3O1UA 4OHYA 3IPVB 1YQ2A 4L92A 1N3PA 5KXEA 3NL1A 3WP6A 5IAXA 4IEOA 3UESA 2ZGQA 4Y24A 3UNPA 1SEFA 1WD4A 1EUUA 3KGZA 2RG4A 3C3VA 1OLRA 1EAH2 2VU9A 2PHLA 4FPOB 4J6GA 2RJ2A 4XVHA 3GGLA 5CFCB 3MGUA 1LHUA 2UYAA 1CESA 1SACA 2WO2A 3E97A 4IEUA 4A3ZA 1AR91 2ARBA 4J1WA 1JN2P 4CCCA 4BU2A 4YZ5A 2QUOA 1LGCA 5J09A 1DGWX 1VBA1 4HVOA 4K3UA 3SMHA 3Q9OA 2GH2A 5I91A 2ZCWA 3I2OA 1YCIA 1RB8G 4H14A 1NCRC 1SCSA 2ZOEB 5A3MA 3VHOA 1BEV2 2E33A 1AJOA 1EAH3 2RJLA 4BQ2A 2ZX1A 5JAXA 1SLIA 1HV0A 2ZHMA 3VBHA 5JR7B 4Q4W3 3VDDC 3GXUA 3U11A 1RITA 4MGQA 5DZGA 1RGSA 1WLTA 3WDVA 3VD9A 1K5MB 1F5FA 2R16A 4XZUG 2BOJA 4OHXA 3AVSA 4ATFA 5ABJC 3RZMA 1RINA 5LRSA 5D1IA 1NCQB 5FZ6A 4B3NA 1RUI2 5FZAA 3AZWA 5K9YA 1JYWA 2DWRA 4MGSA 4QX3A 2K0GA 1G9CA 2LRPA 1S2KA 4RS5B 4RR3A 1MZ5A 1W6NA 3AJYA 4K21A 4N43C 4XCBA 3LA3A 4WM8C 1RUD1 4QQ2A 1VAKA 1OLME 4E4ZA 4QXKA 3ZSJA 4CCJA 1W3VA 2X09A 2ZMLA 4QKDA 4QHOA 4EWEA 3U10A 2BU9A 3WW4A 1PGW1 2ZGUA 3O1OA 2JDPA 2WAOA 1LOBA 1UOJA 2JJ6A 5JZGB 5G04L 3WP5A 1RL3A 4OZOA 2JX9A 2BNMA 1WCQA 3M7AA 1V9U1 3IBMA 1QJX1 3FE5A 5FP9A 4IETA 1IS5A 1ULGA 3PLQA 3B01A 1QJX2 1N3OA 1XYPA 3DYOA 5I0SA 1V9U2 1XYOA 2A3YA 1MS0A 4R4XA 5L9BA 3AKRA 4UFJA 4QPGB 5FMBA 5LK5A 4BLJA 4BYYA 3VZNA 1QJEA 1ZBE3 2WT0A 1PGW2 1V6LA 3KGLA 1J83A 2Y6HA 3PURA 4FTSA 2WNVC 5KHHA 1YLLA 3A4UA 3W20A 4NHLA 3GJBA 1N1YA 1NUKA 2I45A 3B9IA 3ZR6A 4RHV3 1C8M1 1OKQA 3ZXDA 4Q0UA 4FAGA 1Y7BA 1SMVA 3OGSA 3AMMA 1U5ZA 4JDNA 1Y4WA 1NA1B 4O9EA 5DN2A 2O8QA 3ZXGA 3VL8A 2E26A 5BUVA 1PK6A 3I3BA 4XFFA 5FJKA 5A7SA 3UGHA 1US2A 4JV4A 1Q5OA 2HWE2 1CGPA 4QX7A 5FP4A 2P2KA 1RUNA 4XHBA 2I2SA 2EVXA 5D8AC 4CP9A 3ZN6B 3CJIA 4LO6B 1UPIA 1PX4A 4LBMA 1DQ5A 4XETA 1BEV1 3PUQA 5A33A 4DFSA 5C6CA 1W28A 4GQ7A 2TBVA 1AL0G 2ID4A 4XDQA 3ZYJB 3NWKA 1VLNA 2WS93 1VBA2 1ULEA 5KXDA 2BFUL 3B9CA 4I02A 1QEXA 1T2XA 1AYM2 1TNRA 2P37A 3ZMOA 2YROA 1JU3A 4AEDB 2WSUA 4CZSA 5FV3A 2JG9B 1UAIA 4V2WA 4EN8B 1UXZA 2AH2A 2XKOA 3POWA 1GANA 1GFF2 4X8NA 4HOOA 2RR13 2RS33 2E9QA 1H1MA 5F3GA 4LXLA 1CAUA 4Q2FA 4WVZA 5GZFA 1LOAA 3MIDA 4Q5OA 4XJWA 3O1MA 5EQUA 1GNZA 1V00A 2F4LA 2VOTA 3FLTA 3HEIA 2V5YA 2WFF3 4YW3A 4Q8KA 5A70A 5J7MA 3WDYA 3KD4A 2HWB3 1JZ4A 2A5ZA 1CAVA 2BP6A 5HPOA 4NPLA 3M3EA 3JB4C 3ZFFB 1V6MA 1R1A1 4LNVA 4N53B 2Y6LA 3MIFA 4Q0QA 5BNNA 2Y60A 1QJY2 1YQCA 4RD7A 3F95A 4QQLA 2JECA 1UKRA 2DCZA 2WA4A 1NE4A 4FOVA 3UT0A 2Y0OA 3VHNA 5DMYA 1ULCA 3G6JB 1POV3 1PGSA 2WINB 4PQ9A 4AFMA 3IPVA 1W8NA 3WP3A 5C8CC 4GMP1 5IW0A 4BA6A 4IEYA 3NAPA 4P9XA 1YXWA 3ZYGA 2FMDA 4JTOA 1YQ6A 3AZYA 1UZ0A 3VBHC 1FV3A 3VDDA 2XUMA 5A7QA 3Q8FA 5DZFA 1UQXA 2HWD1 3EQEA 3GALA 3BCWA 2MNGA 1LKNA 3AMNA 3C7OA 3LIGA 4CCDA 4Z2WA 1UOBA 1JYTA 1QGLA 1D2SA 2K2SA 5CEHA 1MS3A 4M01A 4CCMA 3CL1A 3KV5A 3URFA 5FBJA 3LZZA 3POEA 3OOXA 2GZWA 3UJQA 4CYDA 1W8UA 2VUDA 5EPAA 3APBA 4P9GA 3I2JA 2NMNA 3MIEA 4AZZA 1XRUA 4IGQA 4OMDA 1OH3A 4Y20B 4BMBA 5F9TA 4EN6B 4JQTA 1JZ5A 2ET1A 2WYFA 4KBBA 2J1RA 1HB3A 1FPN3 2QTWB 3AYAA 3IIIA 4LK7A 4UW6A 2KXLA 4ZXEA 1J59A 1AYN3 1NLQA 3NMBA 2EICA 4AW7A 1CIYA 1IKPA 4LBOA 3Q8AA 5DUXA 4Y4RA 5FTTC 3POFA 4YGCA 2QQMA 5FY5A 4ZZ5A 5SV8A 1W0NA 1C57A 1BHGA 2FCUA 4IEXA 2QZ3A 2J22A 2HEYF 2VMHA 1O5LA 1VRH3 3QBQA 4FBFA 4UBGA 1PO13 2VZUA 3ROUA 3FLPA 3DKQA 4YM1A 3Q8CA 1Z7S3 1NOVA 3NV3A 1ENXA 1K12A 1V6JA 1WW4A 2P6HA 1DZRA 1OVPA 2XBO3 1W6QB 4KMQA 1OI6A 4Q0VA 2VOVA 5FZHA 1UOFA 3NAPB 2A6VA 1XE7A 1ZZBA 2RM23 2P3IA 2Y0IA 3NV2A 5JIAA 4YGBA 4FPHA 2AREA 1SLLA 1YHFA 4FO9A 3WT3A 4XE9A 3FFQA 1LECA 1GWLA 1LHNA 1XU1A 4GWIA 4JKKA 4QMAA 3GHNA 1DGRA 1NCRB 4FP2A 4AI0A 2GC1A 2SLIA 4CDWB 1KFXL 1NX9A 3QACA 5LATA 4MSVA 2WNVA 3MLLA 1T6BX 4HXCA 4ASMB 4YSFA 4QB6A 3VBRB 1AX0A 4DS0A 1QNYA 1NE6A 3ZYPA 4EWAA 1GKBA 2EIBA 3H1YA 4GB32 3WR0A 3ZXKA 5L7OA 4JC1A 4XF1A 2OUJA 1U0AA 1WZXA 2X29A 4BLIA 5J96B 4A7ZA 4MHUA 3JQWA 1D0GA 5A7PA 1FOD2 3GBFA 4LO4B 2NQYA 3QH7A 3ZXFA 4A7KA 2C6SA 1DQ1A 3MW4A 2FZ1A 2YU1A 1YUDA 2XGXA 3VDDB 4AF9A 4AEJA 2JDNA 3BODA 1DQ2A 2R0FA 2VNOA 3FZ3A 1ZZ9A 5FZ9A 4ZY9A 3W58A 2BBAA 4DRRA 5GZGA 3SCHA 3UK9A 5CNAA 1REDA 1BVVA 3SEPA 4Z1VA 1VBE1 2B4KA 1UCXA 2G19A 4WVWA 3FLRA 3A0KA 3B02A 4A4AA 2K46A 1XNTA 2DCTA 1ZA4A 3GBGA 2W1WA 2ZX3A 1HJGA 4UW4A 3V64A 2WN3A 4A7YA 2DDUA 3N35A 1RVF3 4LLOA 1L3JA 3MV11 1JZ6A 1VMFA 4UFLA 4YARA 3U4SA 4XUTA 5LA2A 4E4HA 2VCMA 2XLFA 4ZS3A 3U37A 3LE0A 3VD5A 4CTEA 1QH7A 1XNAA 3D4KA 4QPYA 5JXJA 3S0MA 4D8MA 2JICA 4JTNA 3PTRB 1GR3A 3O1TA 1IQAA 5C9AB 1ZM1A 3C8XA 1WMDA 3O5SA 4LITA 2WLQA 4LULA 1JZ2A 4JHTA 3AFKA 4YLZA 5GLVA 1FPN1 2Z5WA 4LUKA 4MLOA 5FZOA 3W5MA 1RMU2 2XB6C 4H3WA 2Q5TA 1IGOA 2Q8OA 1IG3A 3K3NA 2ZGNA 1YFUA 2XPJA 1CAXA 1ZBE2 2VZPA 3ASIA 2FCVA 2EALA 3J26N 4R4ZA 3AYCA 1B35A 1F4HA 4YFZA 4H7LA 4XFCA 4ARXA 4N7UA 1DQ6A 3ZMNA 4MH0E 2D6NA 2Y6JA 4L9BA 3ZSKA 1IS4A 5A6YA 1YC61 1YJKA 2PAEA 4AOCA 4YGDA 1NLRA 5C3SA 2ZHLA 2DBIA 1AL22 1XC6A 2FMYA 5HXMA 2ZGPA 1IS3A 2DFCA 3C7EA 4COUA 4Q8LA 5LW9A 3THTA 3VD3A 1UYXA 4E4SA 5FMDA 4AHYA 2VTFA 2R042 1C5IA 2IC1A 1PIV1 4HK9A 5IVVA 3ME2A 3ZYBA 3THPA 1H9WA 2HWC1 1W90A 2VJXA 2ZX2A 1QXPA 4X6RB 5FZ8A 3LQCA 4HN1A 3ZR5A 1BJQA 4LKEA 3O1VA 1O3TA 4BH9A 2DBNA 2XKPA 3AB0A 3VHPA 3HOBA 4BJ0A 2C26A 3POSA 3ZN6A 3R4SA 2AEYA 4H2AA 2PQSA 3IM0A 1SLAA 2XJPA 1AJKA 4RL7A 3SKVA 3DPRC 2R062 5HCAA 5FZ0A 5JI7A 3MLKA 3IAQA 5E16A 5JSRA 1BEV3 3W59A 4AVAA 1FMD2 5ACA2 4QXCA 5KBFA 3N7JA 1UYZA 5FYZA 3CQOA 5C7GA 1MS4A 5A7OA 2D44A 2QDRA 4QKNA 1JXNA 1S2BA 3POYA 2WJSA 4RYDA 2F17A 4OFGA 4YZ4A 3OUIA 1OFSA 1T6GC 2Q1FA 4GB33 2ES3A 2E53A 5ACA3 4S2HA 3S5QA 5AC92 1D4M3 3MW2A 2CU5A 2OX0A 4EN0A 5KHKA 3B69A 4JGYB 1DCSA 3MLJA 1Q8PA 1W0OA 1JZ7A 2R063 4TTGA 3JUUA 3N36A 4IQPA 1UZWA 3SCFA 4CUCA 4KWLA 1AR72 2BJSA 2DYCA 4LTAA 5DUWA 3WQBA 1AX2A 2DVAA 3PTYA 4NRPA 5BYNA 2RS51 1RUD3 3AXDA 3LEMA 3ZN4A 4FFIA 4W50A 4Z2AA 4UFHA 5JMOA 5FY0A 1ZBA3 2E63A 2J1SA 5FY4A 4QX0A 2RM22 4LBJA 3EYPA 1TME1 1ULFA 4CU7A 5C4WC 2DVGA 1W8FA 2XBO2 1OOPA 4P00B 2JDKA 3DGTA 5JUVA 2Y33A 4URAA 2YGLA 4XJAA 2J7MA 4XTMA 3OPZA 4ZZ8A 1PO12 2CDOA 1RHI2 1AF9A 3JD72 1JUHA 2Q0AA 5DDJ1 3J4UH 3ZPOA 3PIGA 2VD7A 3ACIA 1AL23 1HRV1 4IUGA 4QPWA 3WD5A 1PVC1 4E9KA 4ZHNA 3SQOA 4PIXA 5BNPA 3FC0A 4IV3B 4NAOA 1TZOA 1X36A 2NPIA 4GIQA 1QQP1 1DF0A 5IWFA 3VGIA 4P9IA 4YG3A 5LASA 3H3LA 2VZ3A 1AHSA 1UU6A 2N7GA 3GZUC 3BIWE 4M3CA 1GSLA 4BISA 3MF6A 4NMIA 3P3PA 1TEIA 1WLDA 4B7KA 3BPSA 3GM8A 1SFPA 1GOHA 3K46A 4RGGA 1K5JA 1YNAA 2AACA 4B4PA 1SCRA 2BGCA 3BYWA 2FQPA 5G05L 4N7IA 4PI0A 5JVVA 1RUF1 1VIWB 1CAVB 2HWF2 3O0XA 4Q27A 2XUEA 3LFMA 1QJU3 2B8MA 4DEQA 3POJA 2W5FA 4C1WA 1KJLA 4FI9A 4FFHA 1KQRA 2WN2A 4QQOA 1H8TB 1RUG3 1RUJ1 2VZRA 1VBD2 2JKXA 5ERLA 1ZRRA 4BQ5A 1Z78A 2R071 2Z2SB 3M2MA 5CVRA 2JD9A 3WF3A 4K1YA 3N9MA 1CAXB 4GAZA 4F8AA 3BTXA 1TMF3 1JW6A 2PLV2 3OSDA 1SG3A 4G4FA 4JHZA 1W2OA 2UY9A 3OUHA 4XW3A 3TWIA 4ES9A 4LKFA 3M3CA 5JOXA 2YB7A 1AR93 4I2OA 2QQPA 1RYYA 4RFT0 2HJIA 1WMEA 2IFRA 2W0XA 5CISA 3PUAA 5LA9A 1ZREA 3AP6A 4CCKA 1EY2A 3J7NA 1NCRA 3NJYA 4GKYA 1RUC3 1E5SA 2HWB1 2CGNA 3VBSB 3OYWB 1FOD3 2W52A 2Y6FA 4IV3A 1MZEA 2WRAA 4Y20A 5EYXA 1WCUA 2RHPA 3LOIA 4XQDA 5FZDA 2YG0A 1O4TA 4XFHA 4HVQA 1PNFA 1J1LA 4AL9A 1RJ7A 5JLVA 4HVRA 3LAGA 4MGYE 2ZGRA 2Z4FA 1J3QA 4XZPA 4CPBA 1FX5A 4LE4A 1RUC2 5A3UA 5FYIA 4AGRA 4CXYA 3WW1A 1ZBA1 5EJ3A 4RSUA 4ATEA 2XHNA 1QWRA 2YDEA 3FHIB 4IV1C 1VBC3 1ZRFA 4FPYA 5DAWA 3DUIA 2XQRA 2Y64A 4OMCA 2ORZA 1SZBA 2NYYA 4IE0A 4IEQA 1O3SA 2YBPA 3J8F1 2ARAA 3KZ4C 3RG0A 3WHUA 2W46A 1NQJA 4EE2A 4GJZA 3RJRA 5JWPA 3HWJA 4FOYA 4LO5B 2X10A 4Q4W1 2BERA 3ZOIA 3SCGA 4IEVA 4BXSV 5A1FA 1XE8A 4G3YC 1BVP1 1DGRN 5FYTA 3QCWA 3H1MA 1X8MA 3HQRA 4YRDA 1BMV2 2W94A 1XQNA 1XXNA 2MHFA 3NJXA 2D6LX 2YPJA 5FZBA 3ZKUA 3LWCA 4AI1A 4R52A 3VBOC 4M4PA 1AR83 1QJU2 4RGKA 4J25A 2ZGLA 4PLOA 3KT1A 3PU3A 2VL4A 4QX2A 3AP4A 1JODA 5LA1A 2YXSA 1AYN1 1I5ZA 2D3RA 5FZLA 2J1VA 4HFSA 4QB1A 2XLGA 3GHMA 3IIAA 4IE5A 2FDKA 2QVSB 4OUSA 4ZU4A 5HCHA 4CCEA 2ZABA 3JQXA 1IQDC 5A7WA 3TRSB 3H3ZA 3ZXEA 4DY5A 5GM0A 4QU1A 4YVWB 2OA2A 1R082 3AKPA 4DXTA 1V6KA 4E2GA 5C5UA 4QHZA 5CADA 3WF0A 4RHV1 1RXFA 2ADDA 1VRH1 4ZONA 2GP5A 5ISLA 4DXRA 1QJX3 3AP9A 3F2ZA 3WCRA 3LCPA 3M4FA 1OMIA 2PN5A 2H6CA 2W68A 4DINB 4O61A 3WQ1A 3VLBB 2ZZJA 3B93A 4KWKA 3HAGA 1XOYA 5KR7A 2C24A 4BIFA 4BIOA 2Y8KA 5APAA 1S0EA 3IZOA 4FQZA 1QIQA 3GZEA 1MQTC 3O0VA 1LAJA 5HV0A 1TMF1 2XQXA 1JS9A 5FKCA 1L7LA 3H8RA 5F3CA 3SH4A 4Y1ZA 4D6QA 1ND3A 3KLSA 3RI9A 3ECQA 1W04A 4AGVA 1LU2A 1YRZA 2SBAA 4Q4Y2 1EV11 3KQ4B 5BNPC 4IE6A 5F5IA 4JVAA 2R7EB 5FPAA 1H1IA 4CDQA 3E6BA 4W4ZA 4HKLA 1RUI3 3AVRA 2QFEA 1KEXA 2EXKA 3HNYM 5FP8A 3HNBM 5FQ0A 4B4QA 2WLPA 2A7AA 2HWC3 3OEBA 2KR2A 1UF2C 1FV2A 2BNOA 3DF0A 3J7LA 4QGLA 5FY8A 5EWSA 5IVYA 3VDBA 1AR73 2E7TA 2Q30A 1ZA7A 1R092 4FT8A 4L0PA 4FTEA 3NNGA 1UZVA 3X29B 5I0RA 4LEJA 4D7TA 3CJXA 4BQ4A 4D6SA 1QXJA 3LA7A 5L7OC 5T5JA 5J37A 1JOJA 3ACHA 4ES8A 3N7KA 4AWDA 4A3XA 1N1VA 1DP0A 1HJFA 4M3CF 4AVBA 4EQVA 5FWEA 1BK1A 1MS1A 2CWSA 1VPHA 4AFDA 4C0BA 1LENA 3RZHA 1OUXA 4QGMA 1POV1 2WABA 2P4EA 1VMHA 2YZ4A 2VZSA 4OI2A 3UETA 1N1SA 1NG0A 4YVSC 1XJAA 1IZ3A 4LBQD 1XYNA 1HQLA 3UJOA 3EXUA 2Y6KA 1J1TA 4ISQA 4PI2A 4WZFA 4MADA 2JB8A 1U5XA 5I8YA 3HVDA 3ZFGB 1QKQA 1VBB1 4XTPA 5FYVA 1BLZA 3T2QA 4PIYA 2AUYA 2X5IC 4YZ1A 5C3QA 4K9SA 1FATA 3LIHA 1NT0A 2MEV2 2Y34A 2Z42A 1N3QA 3BALA 4P02B 3VBUA 1H2LA 4DUVA 5FXXA 1ND3B 2ZMKA 3VL9A 4KU7A 4HMZA 1Q8SA 1GQPA 2JDZA 4XF9A 3JBG2 1KRIA 1H2KA 4QDQA 1W6OA 5F2SA 3IB3A 5F5CA 5LA0A 1E5IA 2A70A 2PHFA 3VKMA 2GMMA 1DBNA 3VUOA 2FDJA 3D0SA 4JRAA 4R8HA 1Q3EA 3AFGA 3R4DB 1O3RA 4PT6A 1Y43B 4WVMB 4LKDA 1IG0A 3NNJA 1KITA 4RS5C 4LT5A 2EIDA 1CX4A 1WA4A 1X8EA 4ZS2A 3E5QA 4Z8BA 1RUE2 2D3SA 4D94A 2EF6A 4DRVA 2G9GA 2W1SA 4IXLA 3QD6A 4LBQB 4DOUA 4KU8A 3BU0A 1DGLA 1COV3 5AVAA 4X6QB 3GZTB 5EXOA 2VULA 3H1WA 1EP0A 5FZ1A 4XMIA 5I8SA 1NXMA 2QQKA 2G1MA 4PF1A 4KI5M 1RMU3 1Z7S1 2W1UA 3ZFEC 4DO0A 2B42B 3NW4A 4PBPA 2WO3A 5HXVA 1R081 4N8MA 5J48A 2QQOA 2GDFA 1QJFA 4LQRA 1YQ8A 2J1AA 5LBEA 5T52A 1DZTA 3ES4A 4W65A 4CXXA 3DN7A 2UWBA 1OSGA 1UMZA 3FX3A 5H9SA 1HDKA 2TNFA 5FLJA 4YVWC 3ORJA 2FDHA 5ABJB 3CEWA 3I54A 3T1MA 3V65A 5SV5A 3CKHA 2W95A 1W03A 1DYPA 2MEV3 2WYSA 3KVAA 2EXHA 2P17A 3D5OA 4F3JA 3HPNA 3DKWA 5KHJA 2VBPA 4C8DA 2EAAA 2GALA 3BGAA 3WW2A 2ETEA 5A1LA 5GLTA 5C9AC 3MZHA 1BMV1 5FZFA 4XXAA 2ZS6B 1FT9A 4CEWC 2YV8A 1OVSA 4Q4W2 4CUBA 3I2KA 1HB4A 4XC9A 3VHRA 2RDRA 4I3PA 3MV01 4AEKA 4A45A 5F5AA 1UMHA 2DUQA 2VMDA 4FPJA 1XU2A 2EIGA 5E1RA 3HMYA 2J1EA 1D0HA 1ULPA 2C4XA 5F32A 4D6RA 1NLSA 5T5LA 2Y26A 3ST7A 5FWJA 3MUZ1 3MIHA 2D3PA 1MS8A 4WVMA 3WF1A 1F8VA 3RYRA 2VXJA 4LLFA 4MVTA 3ILRA 3LPFA 1KGYA 3C2UA 1O8SA 3THCA 2GH8A 1ND2C 2HBTA 4I09A 1RUC1 1UKGA 5FPVA 3AZVA 2B9VA 1WLCA 2GNTA 3MFCA 1LOGA 3A7QA 4LBNA 5A32A 2VR4A 3IAPA 2B46X 2E51A 5FPLA 1GP5A 4EZHA 5JSPA 1AR62 1VB4A 5FKBA 1RVF1 4LHKA 5H9RA 2YC0A 1GMMA 1HRI3 1HQWA 3USSA 2EA7A 4KGGA 1PK6B 3CF6E 2UY8A 1L7RA 3KF5A 1D7PM 4X8PA 1BBT2 2PHUA 1NAEA 3S30A 5GALA 2J1UA 3ENRA 3AMQA 4N43A 1DFQA 4QU2A 4WM8A 3TN93 3MEPA 4E2QA 1HXS3 4PIZA 4PLNA 5L9RA 4E4DX 5A3NA 5IHRA 3TNPB 4Q4Y3 4KG8A 1PVC3 2VH9A 2DU0A 4NWWA 2KA3A 4YG6A 3GCWA 3MF9A 2PLV1 5CYYA 3KT4A 4QD2A 4NPRA 5FPBA 2IFWA 2LM3A 4OLLA 3KMHA 3B3QE 4TN7A 2WR9A 5HBAA 4QT6A 1HN1A 1MS5A 1VBD1 1RUJ2 2LTNA 2DVDA 2DCKA 1CVNA 5FPXA 3ACLA 4GZ9A 1GV9A 1OURA 3LEIA 1OQEA 2FDIA 3N7LA 2CGPA 2HWF1 1R083 4YW2A 4CCOA 2VY0A 4LUMA 4MGZE 2WFPA 2IXLA 4CP0A 1V70A 1Y9MA 4NRMA 2VOKA 1W05A 1G9DA 3S7IA 4O9GA 5IATA 3VBUC 1LJ7A 4XXPA 5J3UA 4DPNA 1UO9A 5C5TA 2R1BA 2DVBA 4JDOA 1O8PA 3K4DA 4IERA 3GJAA 1F31A 1AR82 1OD3A 3RJ2X 1PK6C 1UU5A 2PHTA 4GWNA 1F2NA 3P3NA 1G7YA 2ZAHA 5KXCA 4NOTA 2IXIA 3S7EA 1SHWB 2AEZA 4IV1B 3THDA 2D6PA 3M3OA 3ZDVA 5BPXA 4AR2A 2GC0A 3W21A 3WINE 1PVC2 2B5HA 2CL2A 4MX3A 4NO4A 3BKZA 1ZRIA 1ALYA 3I97A 1HLCA 5A3WA 1NY71 1RHI1 3JD71 5CU1A 1DLLA 1PO11 4NROA 5IVFA 4Q26A 2BV4A 1CAWA 5A80A 1RUOA 2VQ0A 2GU9A 1JU4A 1V6OA 1JYVA 1UNBA 4NIAA 4AHWA 1JYNA 3BUCA 4NIGA 1CD3G 1APNA 1OFNA 2QQNA 1DYKA 2HKXA 2XBO1 1AXYA 2RR11 1KXGA 2RS31 4JRLA 4BDVB 3RNSA 1HRI2 3NO8A 4COZA 2RM21 3SH3A 4JZRA 4DZGA 2QJVA 1SDWA 5FYBA 3VKNA 1J58A 3EHKA 2WFF2 1HKDA 1GZTA 3G7DA 5H9PA 4XUPA 1OT5A 3RMXA 3O0WA 4CEWA 5EYYA 4HSLA 1VR3A 1M06G 2VECA 1GLHA 3E5XA 5JPMB 3A23A 1VBC1 4FSJA 1MVQA 5A7WB 4P5YA 5A7NA 3CDZB 5FAXA 1BYHA 5ABJA 1GBGA 3J7MA 3CBNA 5FUIA 2XJVA 4H7MA 3WNPA 4NIHA 2AYHA 1W6MA 3UKVA 4XURA 5IFTA 4XIKA 2RMU2 4MG2A 3WCSA 1ZRCA 4LA3A 1EPZA 4P9WA 1RUH3 2V4VA 2WUHA 3HJRA 5KXBA 4DUWA 1FMD1 3WNOA 5JOWA 4LOSA 4TLGA 3KCCA 3ZIWA 4MV2A 3ZKYA 2D7FA 1UY2A 4RQPA 2VMGA 2WWJA 5EJZB 1LGBA 1LHVA 1NYWA 2ZEZA 4OUMA 4AVSA 3RZKA 3A21A 3E1F1 4Q0PA 4Y1VA 4ET7A 2ZEYA 4F7ZA 5CFCA 4UYBA 3T0DA 2VCBA 1C8NA 1H2MA 1VB2A 4MGIE 2A6ZA 3C7GA 4OQ8A 3T2TA 3OTFA 4GKXA 4OI4A 5DAVA 2NN8A 2JIGA 1GP4A 3MDPA 4COYA 3MBWA 3CLPA 3KV9A 3BOPA 3M1HA 4QB2A 4XBQA 1GZ9A 3PNAA 4BE3A 4XEZA 4CEYB 1LHOA 2RS13 4HG6B 1PO21 4E8CA 1PIV2 2A3XA 2R041 2PELA 4E2SA 1ODNA 3LA2A 1AZDA 4NJ4A 5DQ0A 3N4MA 4RN5A 1BK0A 2X05A 1AL21 1HRV3 3VD7A 1YIFA 3T08A 5C9AA 1V9U3 2L9LA 4O7XA 5AVPA 3NAPC 2EXIA 4A44A 2XJTA 2WQZC 3I59B 5BXXA 1NZCA 1QQP3 3VBHB 3WF2A 2VMIA 1DQ0A 5FZOB 3FFZA 3PDQA 1TQ5A 2R6QA 4SLIA 2OUHA 3ZFEB 4C90A 4UFIA 1PZ9A 1W9TA 1UMIA 4K1ZA 5D21A 3V0BB 3FBMA 3AYEA 2BZDA 4EJRA 3TEWA 1CZTA 2JD4A 5GJ6A 1I5PA 1W6PA 5A3LA 1ZBE1 1ACCA 3NKTA 1W6QA 1RUF3 2DV9A 3LKJA 1RMU1 4XF3A 3ILFA 5JOYA 3OY8A 1X33A 2F4PA 5IT6A 1RXGA 1UX6A 4D0QA 5C4WA 3ELNA 4OHZA 1B09A 3ON7A 1L7QA 1W2UA 4COWA 4CP2A 4OULA 4FPGA 3T1LA 2WQ8A 3AXEA 1SFYA 2YYOA 3WXPA 1U5YA 4DQAA 1S0IA 4D3WA 4JKLA 2JKBA 1JBCA 2WBKA 4UBHA 3RZLA 2CHHA 3ES1A 4TZDA 2NP0A 3I49A 4XF0A 5FP3A 2PMWB 3MICA 1LESA 5LY1A 3RWKX 4RGAA 4CVUA 1OLQA 1HB2A 3JCIA 5FUPA 1W6MB 4HKWA 4D7SA 3JXSA 1A6CA 1D4M2 3VKOA 4XILA 1MEC1 1JUIA 1VBE2 4K7JA 1ULOA 4HETA 4AG4A 3U0ZA 3OG2A 3ETQA 3UGFA 2GSYA 1O7FA 2QZ2A 2A71A 3ZYHA 4IV1A 3W5NA 3OYWA 2V72A 1G86A 4RQPB 2JENA 1SLTA 1XPWA 3Q8BA 1Q43A 2A75A 2IXCA 2IZWA 3SC7X 3TAYA 1DIWA 4LBQA 4XDPA 3I2FA 4AK3A 5M0TA 1FOD1 4CEYA 2VGDA 1ND2A 1YO8A 2VOWA 3I3QA 4PDWB 1OQ1A 3WUDA 4E8DA 1H8VA 1NA1A 4FPLA 2CYFA 5FZ4A 4HN0A 1PZ8A 3OCPA 3L2YA 4XBLA 5DAPA 1FXZA 5FZEA 5FYMA 4GB31 3LSDA 2YU2A 2JG9C 1SBEA 2GN3A 4MXWB 3CZJA 2OVUA 2WC2A 4AEDC 5FYSA 3AC0A 1R1A3 4AHXA 5EFUA 3ZSEA 3WDTA 4B29A 3OBTA 4FVVA 3VBSC 1VRBA 2XWJB 1YYNA 3PIJA 3RQ0A 4URTA 3KSCA 3GZAA 3H7YA 3KT7A 2PA7A 3WNNA 4KBZA 2RS11 5CG9A 1W6PB 3I2IA 4HL0A 4YW6A 2EIEA 4N9HA 5IK8A 4ARYA 5T5PA 2OIIA 2QQJA 5A1AA 2BNNA 4XQ4A 5FZCA 2P34A 4XJZA 4XUNA 1ENSA 3ZIXA 4CE8A 3V0BA 1RIRA 4QM9A 2NZ9A 4FPFA 1FYUA 3VDCA 2D5HA 2WQ4A 2HH9A 1S0DA 1OA4A 5CKMA 2ARCA 1ZX5A 5GZCA 1GWKA 4DNYA 2JIJA 4FPEA 3K2OA 4QQHA 2W9XA 3D3AA 1VMJA 3DYPA 4DB5A 2OZJA 5CFDC 3ZDSA 3EMRA 5T50A 4ISRA 3V0AB 2DTWA 4OI0A 1G9BA 2J1TA 1GNHA 1LEMA 1POV0 1Y3TA 3VDAA 1PIV3 1ND3C 2YUEA 1HB1A 2RS12 2OW4A 3O14A 3FMGA 3P1IA 3KV4A 1WWYA 2A1XA 4Q0SA 4JCKA 4Y26A 4HKOA 3RI8A 3VBFA 3RWNA 3I8TA 5ANNA 1EUTA 5K0UC 2QQWA 4M3CB 2OZ6A 4JX0A 1WMXA 4AFBA 5LK7B 4K8FA 1W39A 4NRQA 5LY2A 3WOGA 2QQUA 3E6CC 1C28A 3NV4A 2WDBA 3AK0A 4EWDA 2VZQA 4CCNA 4MXWA 4EYUA 2FD8A 2ERFA 2YPDA 5BNOA 1F5JA 1CZSA 2AC1A 2UU8A 2BWCA 3FN9A 5T55A 5E8AA 1UW8A 3N9LA 4WM7C 2ILMA 3R4UA 1B35C 2HWD2 3HT1A 5A6ZA 5DXDA 3DYMA 4KH9A 1AX1A 5FQ0B 4CUGA 1SPPA 2XVKA 3AL5A 1MQTB 3DL3A 4LMFA 4CDQC 3WDUA 2P3JA 1DU3D 4NPMA 4ORFA 1Y9QA 2JXAA 5DABA 1K5MC 2WO1A 1MEC2 4PDWA 1ZRDA 4R9DA 1ZZ6A 3VKFC 2JDYA 1D4M1 4AAXA 4DMIA 2PTMA 1CPNA 1KDKA 5JXHA 1U12A 3ILNA 3MUY1 4LHSA 4QPIA 4JDMA 4TSVA 1O3QA 2VVEA 1OA2A 4OCTA 2R30A 4EROA 2ZGOA 1JZ8A 5I0TA 1DGWA 1X9TA 2VVDA 4N43B 4JGYA 3BU7A 2D97A 1GZWA 2Q4SA 3I2HA 4Q1PA 3POGA 5FYHA 2YY1A 2VQAA 3RPQA 3K4AA 2PHXA 3AM2A 1W8WA 3B5LB 4N53C 1OH4A 5IFPA 2BPA2 3T2PA 2XJQA 4LIUA 3T2OA 1JZ3A 2ZAAA 5L7OB 1W9SA 1YI7A 1AUYA 4IW3A 5B4XA 4Q29A 3WY6A 3MYXA 2GN7A 1AYM1 1X9PA 2JWPA 1XE0A 3HIFA 1KFUL 5LB6A 2BTVC 4AQ6A 2B9UA 2KM2A 4QX5A 3C7HA 4RQPC 3E5UA 2ZJCA 1VBD3 1VE0A 4PJYA 2BUKA 3WNKA 2O14A 5LBBA 1S0BA 5FZKA 2X5IA 1JMUB 3ACFA 5K4LA 1QY4A 3RRDA 4FOQA 4QPGA 2WNVB 4PQQA 4N90A 4QXBA 1CONA 4XF4A 4YVSB 4YW4A 4BQ3A 4R9CA 4BQXA 2HWE1 3VB9A 1IS6A 1ULDA 2YGMA 2HWF3 4F83A 3I4IA 2HYXA 4NE9A 4Y5TA 1GQHA 5L73A 4Y1XA 3VD4A 5C4WB 2C1FA 1PMHX 1UWWA 1SFNA 3OBZA 4GWMA 1PO22 2TEPA 2VPVA 1DYOA 4QKBA 1QF3A 1C8M2 3VN4A 2BQPA 1LEDA 1BQPA 2D6OX 2WA3A 2E6VA 2CNAA 5FCCA 5FK8A 5LZ6A 5A6XA 1SPPB 5FMOS 4FCAA 4Y5SA 4LO8A 1X82A 2OPWA 1FNZA 1RUJ3 1W6NB 1OOPC 3ALQA 1ST8A 3I59A 1JYXA 3I3DA 2WT2A 4L99A 1CAWB 4YW1A 3OF1A 3PMSA 3OB8A 3PMEA 1PX3A 5DG1A 3N9NA 2XJUA 5LCWL 3H7JA 4IEWA 1NCQC 4FFGA 5FXWA 1MQTA 3KF3A 4B7EA 4BQWA 1D4VB 1LOCA 3OD0A 3O1RA 1W0PA 1XNKA 3KB5A 4MUVA 3M70A 2EAKA 1PHMA 4YG0A 5JR2A 2RMU1 5C71A 1V6IA 1M4WA 4BQ1A 4QQPA 2ZGMA 5CA6A 5GLZA 2C9KA 2CY6A 1TNFA 1TE1B 3SLIA 5L9VA 3S57A 1RUD2 4HLTA 2JE7A 3NNFA 3QH6A 1NQDA 2ET7A 1UYPA 1VBC2 2W2IA 4HPKB 5F7UA 3JZVA 1QJY3 3LDBA 3ZFFA 3VBSA 1RUI1 3MPPG 1XSRA 1CWPA 2AZ5A 3USUB 2D6MA 2WFF1 4ZPIA 1UIKA 4CDQB 2H6BA 5FMCA 2ENRA 1Q8QA 2ZZQA 3MFAA 4A42A 4D7YA 2VMFA 2XJSA 3UL2A 3I2DA 1A3KA 1HRI1 5CKQA 3PJQA 1LNSA 2RR12 2RS32 1W8HA 1FMD3 2JE9A 3ATGA 5BNQA 1MEC3 3MW3A 1AYM3 1JHJA 5BNOC 2Z69A 5FZMA 3WSOA 1RC6A 2DUPA 1AR92 1LCLA 2C5DA 1NY72 1VBA3 2QCSB 2ZGKA 3D0JA 4NHXA 3VV1A 2WL1A 4FPCA 2HWD3 2YHJA 4HZFA 4AI3A 1HN0A 2LROA 1EAH1 3IWZA 3OGVA 4XJ9A 1QOSA 2PAKA 4KL1A 3SKJE 2IUWA 1JYIA 1UXXX 4Y1UA 5BNOB 4TYSA 1SDDB 2LS6A 2AENA 2ADEA 1G8WA 4YPJA 1AR81 2H0BA 2VXRA 1LODA 3JU9A 3NVCA 3TYJA 1O59A 1F15A 2RS53 1H4GA 4LO7A 3VBOA 4CCLA 3SHRA 5JOZA 1XB9A 3O1PA 5DZEA 1YQ5A 2VQUA 3AP7A 4UW3A 3IMNA 4DXZA 1IPKA 3ZFGA 1ASJ2 2WZR3 1TME3 2XVLA 4JGYC 2VM9A 2OKXA 4UFMA 4XUOA 5DUUA 2WNUA 5CIRA 3WP4A 3DXUA 1SLBA 2PQQA 1GU3A 2BGPA 2VVFA 4G9SB 1JI6A 3CJIC 5DUVA 2D93A 3EJKA 5T5OA 1PMJX 4LIVA 1PVXA 4ASKA 3KM5A 5C70A 3ZM8A 4B4RA 5KWRA 5FREA 2HEWF 4W8JA 3R6SA 3UKTA 3INAA 3A22A 1V0AA 2JG8A 4BWOA 1XNDA 2BOIA 5C8WA 3MIGA 1ZYBA 1TVGA 1WA6X 3BPZA 4S2FA 1A34A 2VC9A 2CWMA 3O12A 5FO9B 4AVVA 2JE8A 4PHZA 1RHI3 3JD73 1COV1 1K45A 1NKGA 3CNAA 4IV3C 2IXHA 5HCFA 3LPGA 4CPBD 1I1EA 3DECA 3VBFC 5F1RA 4XQWA 3ZYIB 2I07B 1GOGA 2Q8EA 2OQ7A 4P9LA 1BBT1 5EV7A 3JBG3 4V2VA 3U14A 4B8EA 1HIXA 3TEZA 3P5BA 1QXRA 4AFAA 1W6OB 4YGEA 3D6EA 2XHKA 1RVF2 2NMOA 3H9AA 2Q1ZB 1AR61 1GZCA 3VZMA 4CRQA 3N3HA 4OUEA 1UY4A 5EJ1B 2VE1A 2XR4A 4CUAA 3AL6A 5EHDA 1WKYA 1XBFA 5E88A 1YFWA 1SLCA 4MYEA 3RYKA 5B4NA 5JDBA 1O6UA 3WF4A 4NIDA 5KHIA 2ZHNA 1CX1A 4QM8A 5E89A 2WKKA 5I8TA 2WNEA 3IT8A 3PHMA 2BGOA 4N9IA 4QXHA 5FFOC 2JDHA 4CDUB 4GH4B 1QU0A 4CA9A 3POIA 4L2NA 4MOAA 2WS91 2QQVA 1OF3A 4IL7A 1OLMA 2BYVE 1POQA 3GDBA 4V1PA 5HV4A 5FPUA 4H55A 2HEVF 4AQTA 4W6YA 1OPMA 1UU4A 3OBAA 1S1AA 1DLCA 1NCQA 4SBVA 1OKOA 2C0ZA 3H8OA 4CEWB 5GLUA 1LOFA 3R0RA 5F2WA 3IMMA 3N9PA 4AQSA 1MVEA 5FOJB 4JGZC 2XXZA 1W8ZA 1MS9A 3TOJA 5FZ3A 1R093 1STMA 2ZX4A 3VZOA 4QAWA 4LBKA 3ITQA 5FBZA 4LPLA 2BW8A 1VALA 5T3NA 3VBFB 3BOWA 2ZX0A 4HT1T 1CR7A 2FZ2A 3H42B 3TBDA 4YW5A 4CDWC 1H4HA 3LDKA 3N9QA 4WZCA 2WWSA 2VW1A 1BCXA 2JG8B 1BXHA 3AMPA 4IE7A 4U36A 4WV8A 2J42A 3HQXA 1ONAA 1RUH1 1WW7A 1DG6A 3FL7A 3OGRA 5ANQA 3HR9A 1LRHA 4BB3A 2GC3A 3IN9A 1IHMA 1Z7S2 4UXAA 3LB9A 4B1LA 5C3OA 2FCTA 4GMP3 3SNMA 2XVGA 3NNMA 4RA0A 4AGGA 2JEMA 3MO4A 5IAVA 1H0BA 5TSWA 2JB4A 4A2UA 1B35B 1WUVA 2WAAA 3V0AA 1W2AX 4IE4A 2VAUA 4LHNA 5FZ7A 4AHZA 3RZJA 4NHYA 5F3IA 4DEVA 5BV6A 4NWVA 3H0OA 4EV0A 1UIJA 4ITCA 3I3EA 4YVSA 1RUE1 5FXZA 1C1FA 2OYZA 2GMEA 1C5HA 3M3IA 2LALA 3FBYA 5K8SA 4NIIA 4A6OA 3PUSA 5IJRA 3A0NA 2O0OA 3C7FA 1C8M3 4HK8A 1S4CA 4Q4V2 2P5BA 5FPZA 4FXGB 3HBZA 1DQ4A 3N9OA 3JBG1 1IPSA 4NHMA 3H50A 1KDMA 2V73A 1QOOA 3AKSA 4JQRA 4INDA 4I01A 1W99A 2VZOA 1WW5A 2OQ6A 5DAQA 4KGQA 2MEV1 4YVWA 5A3PA 2AR6A 5BNNB 2VMEA 1LTEA 1UPSA 1VBB2 3FUOA 2WT1A 2VTXA 5LWBA 1YFXA 1H30A 1CZVA 5F3EA 1XNCA 4UF0A 1WMFA 4AFCA 1LR5A 3M3QA 3T0AA 4P08A 1CAUB 3OUJA 4I3GA 1QJZA 2CAVA 5J98B 2VCCA 3NRUA 5B2GB 2CSGA 2BBVA 1Q56A 2PFWA 2BDRA 2X5IB 2ZHKA 1GZWB 1BZWA 3KHBA 4CXWA 2W92A 3AZXA 2BWAA 3ZXLA 3HT2A 4HPKA 3O7OA 3I3MA 2B7YA 2RE9A 2D40A 3WW3A 4IGOA 4CU9A 5L19A 2ZKNA 5F37A 1WGPA 4Q4X1 4XOGA 3OEAA 5EZWA 5CFDA 5HI0A 3WZ1A 1MR5A 1R091 3BVCA 4LA2A 2OPKA 2RDSA 3SISA 3TB0A 2UURA 4EN7B 1WCKA 4P9YA 3RMYA 5C33A 2C9AA 4YZ3A 1UZZA 3LEKA 3B00A 5FY7A 2G9FA 3T4VA 4AYUA 2ZMNA 5CBLA 2OT7A 2PYTA 2LUWA 4OZXA 1SBFA 3CO2A 4CDXA 1YWKA 1EV12 1H1AA 3ZO0B 4Q1RA 4Q4Y1 3WDWA 4LOTA 1JOBA 2PXJA 1S0FA 4P5HA 1LOFC 3PJYA 2D5FA 4PBOA 4TWTA 3NV1A 2B45X 3ACGA 1TMF2 2PLV3 3MPBA 4TLFA 5T54A 4BCUA 1SQ4A 5F5QA 2QQLA 4Y22B 4D69A 4IGPA 4OHVA 1H6XA 2VZVA 4AI2A 1O4ZA 1X7NA 2HWE3 3LF7A 4ONUA 4XDOA 4EN9B 3U4XA 3J9SA 1P8JA 3OBRA 4QPGC 4YM3A 4XIOA 2Q1MA 1RUG2 4HBNA 1I9RA 3RYPA 2IVIB 3UV9A 2A6XA 2I74A 3ABZA 1W2NA 4RR3B 2XJRA 4RS5A 4DY3A 5J36A 4NN0A 1S0GA 2CAUA 3PVOA 5FY9A 4JKMA 2ZEXA 3BI3A 1VRH2 1JHNA 4I0WB 4Y1YA 1GWMA 4RHV2 4NR1A 3WEZA 3WDXA 4M3CE 1QMJA 4FAHA 3H3UA 4LHLA 2GNMA 3NSTA 3SH5A 1URXA 3HBKA 4Q4V3 2WZR1 3ZLIA 2O1QA 4LK6A 5CAZA 2H0VA 1AYN2 2WZEA 3UYJA 3CZUA 5FP7A 3KHCA 1K3IA 2ZACA 2X53S 4QGNA 1QJU1 3T0BA 4R9AA 4XYXA 3DPRA 1PO23 2VNGA 1W06A 1W8TA 1X50A 2G4IA 2FDGA 3QLQA 2W47A 2HLEA 1C3HA 2W3JA 3JB8A 4GXLA 3HQUA 4PCRA 1UL9A 3TEYA 5H9QA 2NLRA 3AMHA 3IDAA 4UF0B 4CU6A 1G9FA 5DAXA 1OBNA 1NA1C 4UWDA 4RFRB 3KCYA 1OHFA 3OPTA 1GUIA 1QOTA 3OGJA 2DCJA 1OA3A 5CFDB 2TUNA 4XACA 3BB6A 4MXVA 5F6KA 3J8F2 4GJYA 1IOAA 1G9AA 5JIUA 1QH6A 2P3YA 3CHXA 3LOBA 1U5IA 4QX1A 2YFUA 2VNRA 4C91A 5FLIA 4NVPA 4OVEA 5K0UA 1HXS2 4RR3C 4XFGA 3TN92 3WNLA 1ZBA2 1CJDA 4FXKB 1UY3A 2W08A 1REEA 3WX5A 4CDXB 1BBT3 3H8UA 1H2NA 4XFBA 3ZX7A 1S0CA 1LOEA 4BHPA 1YI9A 5I0DA 4XAEA 4Y3OA 3ZN5A 2ATFA 4FFFA 1W9YA 2PHDA 1PMIA 2CGOA 3I2GA 4WM7B 2BEOA 4OI1A 4XFIA 5D8AA 2WIIB 4LE3A 4R9BA 3VKLA 1Z0HA 2Y38A 1A78A 3WQ0A 1PZ7A 3OPWA 1F4AA 5DPNA 4AI9A 3IDBB 5AC93 2HBUA 1XSQA 2HWB2 3PVEA 4AAPA 3VZJA 1FNYA 1KJRA 3PU8A 4MGKE 4LORA 5FUNA 1PGL2 2LW8A 2VZ1A 2RVAA 5JXGA 3BN6A 3PUIA 1LU1A 4ZXKA 4AVTA 1AXZA 3B94A 2VG9A 4PDWC 1W3XA 3KV6A 4NAMA 3T3YA 2AGSA 4IEZA 4K8RB 2JDAA 3K51A 4GD4A 3U1XA 4CU8A 5FOBB 2PHWA 4DIQA 3FHAA 3VBOB 1PGL1 2OXBA 5JMCA 1A8DA 2R072 2ZGSA 1I3HA 4CEYC 2IXKA 5C3RA 3OJBA 4XAAA 3T30A 4ZU7A 1US3A 2D98A 4ASLA 5A33B 5CFCC 2CTVA 1S2EA 2IXJA 3LGRA 4CP1A 1UOGA 3PUHA 4GULA 4BXFA 5JSOA 5A32B 4J1XA 3GCXA 5IK4A 2KD7A 5FXVA 4CDXC 4I30A 1YFYA 2GAUA 2XWBB 4M00A 1RJ8A 2RJKA 4IDZA 2JDUA 4YYOA 5C8CA 1RUF2 3HN3A 2R043 4L97A 2WNUC 3TN91 2OS2A 2VW2A 1HXS1 4BZ4A 3KQRA 4K20A 1N1TA 1UD1A 3KCXA 1FAYA 2QQIA 3TNQA 4BM8A 2D6KA 4UW5A 3ZFFC 5A3TA 2E32A 2GNBA 3HNMA 2DUOA 5FYCA 4XUQA 1PNGA
chains in the Genus database with same CATH topology
4OMDA 1PMHX 1UWWA 4TXWA 2EIDA 1JZ5A 1DYOA 1UY0A 1TG7A 2J1RA 3K77A 2W1SA 4ZXEA 3IIIA 2EICA 1CIYA 2QQMA 2QQKA 4PF1A 4ZZ5A 4KI5M 1W0NA 2W1UA 1BHGA 2J22A 2WO3A 3I3DA 1GOFA 1JYXA 2QQOA 2V5DA 4LQRA 3OB8A 2VZUA 1PX3A 2J1AA 5LCWL 1GNYA 4M4RA 1K12A 4KMQA 2CDPA 3CKHA 2W95A 5JR2A 5C71A 2WYSA 2C9KA 3HPNA 1MPXA 3BGAA 4JKKA 4GWIA 5F7UA 4CUBA 3I2KA 1NX9A 3MV01 4A45A 1UMHA 2VMDA 2J1EA 2C4XA 1ULPA 4QB6A 5EIYB 2EIBA 3MUZ1 4A42A 4BK5A 3WF1A 3J7HA 2VMFA 3LPFA 1KGYA 1O8SA 3THCA 1J84A 1LNSA 2B9VA 1UX7A 2VO5A 3A7QA 2VR4A 3IAPA 1JHJA 4ZY9A 3WSOA 2BBAA 1GMMA 1W9WA 3SEPA 2VZTA 2B4KA 1K42A 3K75B 1L7RA 4A4AA 1D7PM 1XNTA 3SKJE 1NAEA 2E31A 2W1WA 2J1UA 3OGVA 1UXXX 2XOMA 1SDDB 2WN3A 2LS6A 2DDUA 3MV11 1JZ6A 4YPJA 5IHRA 4XUTA 5LA2A 1O59A 3U37A 3VD5A 3LE0A 1XNAA 5JXJA 2VQUA 4D8MA 5CYYA 3K4ZA 1JZ2A 3C8XA 4XUQA 2WZ8A 1HN1A 2VM9A 2OKXA 1H6YA 4XUOA 2YC4A 3W5MA 5IYYA 2DCKA 1GU3A 2BGPA 5JXIA 1JI6A 4GZ9A 2VZPA 3LEIA 1PMJX 5C70A 3ZM8A 1F4HA 4ARXA 4W8JA 2Y6JA 4A41A 3A22A 3LEGA 3CIHA 3NQHA 1TVGA 1O8PA 2VC9A 3K4DA 1XC6A 5HXMA 1OD3A 2JE8A 3C7EA 1K45A 1NKGA 3VD3A 1UYXA 3LPGA 4DUXA 3DECA 2VTFA 4OYUA 1SHWB 1GOGA 3THDA 2VJXA 3I97A 3LQCA 3CMGA 3ETPA 4UOJA 4OUEA 1UY4A 5EJ1B 1JU4A 1JYVA 3HOBA 4BJ0A 2C26A 4CUAA 1JYNA 1WKYA 2QQNA 2RV9A 2PQSA 3WF4A 1CX1A 3SKVA 4BDVB 2Y6GA 2VMCA 2BGOA 1OF4A 3IAQA 4MOAA 4QDSA 1UYZA 5CZKA 3CQOA 1OF3A 5C7GA 4XUPA 1OT5A 3GDBA 4RYDA 3OBAA 2W1QA 3A23A 1DLCA 4P5YA 5J1XA 3CDZB 4BK4A 5FUIA 2VCAA 3WNPA 4XURA 5IFTA 1JZ7A 2QBXA 4TTGA 4CUCA 4QAWA 3WQBA 2V4VA 2WUHA 3HJRA 4LPLA 4DUWA 3WNOA 3WNMA 2ZEWA 1UY2A 4W50A 4Z2AA 4KWUA 5JMOA 5EJZB 2J1SA 4QX0A 2ZEZA 1R64A 3EYPA 4CU7A 3A21A 3EB7A 3E1F1 3FL7A 3OGRA 4DXSA 4ET7A 2ZEYA 4P00B 4LKSA 5JUVA 3NJVA 4UAPA 3T0DA 2VCBA 2YFZA 3C7GA 3SEEA 2J7MA 3MO4A 4ZZ8A 2WAAA 4QDRA 2CDOA 1W8OA 2W87A 3MBWA 3ACIA 4IUGA 4QB2A 4QPWA 4DEVA 3I3EA 4HG6B 4E8CA 2VZ3A 5DQ0A 4A6OA 4RN5A 2X05A 5IJRA 3VD7A 3T08A 3GM8A 1GOHA 3C7FA 3K46A 2L9LA 4A44A 5B4NA 3FHQA 2VQTA 5G05L 3WF2A 2ORXA 2W91A 2ZXQA 1W9TA 1UMIA 2XONA 2BZDA 1CZTA 1W99A 2VZOA 1I5PA 4GWJA 4DEQA 2W5FA 2VMEA 4FI9A 2WN2A 2VZRA 1UY1A 4MO3M 2JKXA 4D0QA 3P6BA 1L7QA 2JD9A 3WF3A 1CZVA 2WQ8A 3T09A 4JHZA 1SG3A 4UI9L 3T0AA 4P08A 4JKLA 1UYYA 2WBKA 2VCCA 2YC2A 3NRUA 2YB7A 1YQ2A 1RYYA 3UESA 3UNPA 2W92A 4CVUA 1EUUA 3JXSA 2RJ2A 4XVHA 3GGLA 4AG4A 1ULOA 4CU9A 4A3ZA 2WO2A 3OG2A 3OEAA 2YG0A 3W5NA 2V72A 1XPWA 2Z4FA 2E33A 3I2FA 3LEKA 4E8DA 2XHNA 3GXUA 4MGQA 3VD9A 3CZJA 4XZUG 2Y64A 4OMCA 2ORZA 3AC0A 3ACGA 2W46A 2QQLA 1JYWA 2X10A 2BERA 4MGSA 4QX3A 1H6XA 2VZVA 4BXSV 1P8JA 3WNNA 2X09A 3ABZA 2W94A 3NJXA 3I2IA 2EIEA 4JKMA 2ZEXA 4M4PA 2WAOA 3WEZA 4ARYA 5A1AA 2QQJA 5G04L 2VL4A 4OZOA 4QX2A 4XUNA 1WCQA 5LA1A 2J1VA 4QB1A 3VDCA 1IQDC 3DYOA 2WZEA 4DXTA 3CZUA 1K3IA 3WF0A 2W9XA 3D3AA 3DYPA 3T0BA 4DXRA 3F2ZA 1J83A 2J1TA 2Y6HA 3VDAA 2W47A 3P1IA 2HLEA 2W3JA 3IDAA 1NUKA 4CU6A 1EUTA 2Y8KA 1GUIA 2DCJA 4JX0A 3OGSA 5DN2A 2XQXA 2WDBA 2E26A 2VZQA 3I3BA 3ECQA 1US2A 4QX1A 2YFUA 2R7EB 4W4ZA 3WNLA 1CZSA 1PX4A 1UY3A 1KEXA 3FN9A 3HNYM 3HNBM 3OEBA 3VDBA 5I0DA 2ID4A 3DYMA 4L0PA 3I2GA 3NNGA 1T2XA 1JU3A 1F4AA 5DPNA 2WO1A 3ACHA 1UXZA 4AAXA 5JXHA 3MUY1 1DP0A 4LHSA 2LW8A 2VZ1A 2RVAA 5JXGA 2VOTA 1JZ8A 3BN6A 3PUIA 3HEIA 1JZ4A 5HPOA 2WABA 3I2HA 3UETA 2VZSA 2JDAA 3K4AA 4CU8A 3FHAA 1OH4A 2Y6LA 2Y6KA 3T2PA 5IFPA 4MADA 3T2OA 1JZ3A 1W9SA 5DMYA 5B4XA 1W8NA 1US3A 3T2QA 4P02B 1UZ0A 3PUHA 4DUVA 3C7HA 2KD7A 1GQPA 3WNKA 3C7OA 4QDQA 3IB3A 5LA0A 3HN3A 3ACFA 4PQQA 2QQIA 2E32A 3HNMA 3I2JA 2HYXA 4PT6A 3VD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OMD A;  1PMH X;  1UWW A;  4TXW A;  2EID A;  1JZ5 A;  1DYO A;  1UY0 A;  1TG7 A;  2J1R A;  3K77 A;  2W1S A;  4ZXE A;  3III A;  2EIC A;  1CIY A;  2QQM A;  2QQK A;  4PF1 A;  4ZZ5 A;  4KI5 M;  1W0N A;  2W1U A;  1BHG A;  2J22 A;  2WO3 A;  3I3D A;  1GOF A;  1JYX A;  2QQO A;  2V5D A;  4LQR A;  3OB8 A;  2VZU A;  1PX3 A;  2J1A A;  5LCW L;  1GNY A;  4M4R A;  1K12 A;  4KMQ A;  2CDP A;  3CKH A;  2W95 A;  5JR2 A;  5C71 A;  2WYS A;  2C9K A;  3HPN A;  1MPX A;  3BGA A;  4JKK A;  4GWI A;  5F7U A;  4CUB A;  3I2K A;  1NX9 A;  3MV0 1;  4A45 A;  1UMH A;  2VMD A;  2J1E A;  2C4X A;  1ULP A;  4QB6 A;  5EIY B;  2EIB A;  3MUZ 1;  4A42 A;  4BK5 A;  3WF1 A;  3J7H A;  2VMF A;  3LPF A;  1KGY A;  1O8S A;  3THC A;  1J84 A;  1LNS A;  2B9V A;  1UX7 A;  2VO5 A;  3A7Q A;  2VR4 A;  3IAP A;  1JHJ A;  4ZY9 A;  3WSO A;  2BBA A;  1GMM A;  1W9W A;  3SEP A;  2VZT A;  2B4K A;  1K42 A;  3K75 B;  1L7R A;  4A4A A;  1D7P M;  1XNT A;  3SKJ E;  1NAE A;  2E31 A;  2W1W A;  2J1U A;  3OGV A;  1UXX X;  2XOM A;  1SDD B;  2WN3 A;  2LS6 A;  2DDU A;  3MV1 1;  1JZ6 A;  4YPJ A;  5IHR A;  4XUT A;  5LA2 A;  1O59 A;  3U37 A;  3VD5 A;  3LE0 A;  1XNA A;  5JXJ A;  2VQU A;  4D8M A;  5CYY A;  3K4Z A;  1JZ2 A;  3C8X A;  4XUQ A;  2WZ8 A;  1HN1 A;  2VM9 A;  2OKX A;  1H6Y A;  4XUO A;  2YC4 A;  3W5M A;  5IYY A;  2DCK A;  1GU3 A;  2BGP A;  5JXI A;  1JI6 A;  4GZ9 A;  2VZP A;  3LEI A;  1PMJ X;  5C70 A;  3ZM8 A;  1F4H A;  4ARX A;  4W8J A;  2Y6J A;  4A41 A;  3A22 A;  3LEG A;  3CIH A;  3NQH A;  1TVG A;  1O8P A;  2VC9 A;  3K4D A;  1XC6 A;  5HXM A;  1OD3 A;  2JE8 A;  3C7E A;  1K45 A;  1NKG A;  3VD3 A;  1UYX A;  3LPG A;  4DUX A;  3DEC A;  2VTF A;  4OYU A;  1SHW B;  1GOG A;  3THD A;  2VJX A;  3I97 A;  3LQC A;  3CMG A;  3ETP A;  4UOJ A;  4OUE A;  1UY4 A;  5EJ1 B;  1JU4 A;  1JYV A;  3HOB A;  4BJ0 A;  2C26 A;  4CUA A;  1JYN A;  1WKY A;  2QQN A;  2RV9 A;  2PQS A;  3WF4 A;  1CX1 A;  3SKV A;  4BDV B;  2Y6G A;  2VMC A;  2BGO A;  1OF4 A;  3IAQ A;  4MOA A;  4QDS A;  1UYZ A;  5CZK A;  3CQO A;  1OF3 A;  5C7G A;  4XUP A;  1OT5 A;  3GDB A;  4RYD A;  3OBA A;  2W1Q A;  3A23 A;  1DLC A;  4P5Y A;  5J1X A;  3CDZ B;  4BK4 A;  5FUI A;  2VCA A;  3WNP A;  4XUR A;  5IFT A;  1JZ7 A;  2QBX A;  4TTG A;  4CUC A;  4QAW A;  3WQB A;  2V4V A;  2WUH A;  3HJR A;  4LPL A;  4DUW A;  3WNO A;  3WNM A;  2ZEW A;  1UY2 A;  4W50 A;  4Z2A A;  4KWU A;  5JMO A;  5EJZ B;  2J1S A;  4QX0 A;  2ZEZ A;  1R64 A;  3EYP A;  4CU7 A;  3A21 A;  3EB7 A;  3E1F 1;  3FL7 A;  3OGR A;  4DXS A;  4ET7 A;  2ZEY A;  4P00 B;  4LKS A;  5JUV A;  3NJV A;  4UAP A;  3T0D A;  2VCB A;  2YFZ A;  3C7G A;  3SEE A;  2J7M A;  3MO4 A;  4ZZ8 A;  2WAA A;  4QDR A;  2CDO A;  1W8O A;  2W87 A;  3MBW A;  3ACI A;  4IUG A;  4QB2 A;  4QPW A;  4DEV A;  3I3E A;  4HG6 B;  4E8C A;  2VZ3 A;  5DQ0 A;  4A6O A;  4RN5 A;  2X05 A;  5IJR A;  3VD7 A;  3T08 A;  3GM8 A;  1GOH A;  3C7F A;  3K46 A;  2L9L A;  4A44 A;  5B4N A;  3FHQ A;  2VQT A;  5G05 L;  3WF2 A;  2ORX A;  2W91 A;  2ZXQ A;  1W9T A;  1UMI A;  2XON A;  2BZD A;  1CZT A;  1W99 A;  2VZO A;  1I5P A;  4GWJ A;  4DEQ A;  2W5F A;  2VME A;  4FI9 A;  2WN2 A;  2VZR A;  1UY1 A;  4MO3 M;  2JKX A;  4D0Q A;  3P6B A;  1L7Q A;  2JD9 A;  3WF3 A;  1CZV A;  2WQ8 A;  3T09 A;  4JHZ A;  1SG3 A;  4UI9 L;  3T0A A;  4P08 A;  4JKL A;  1UYY A;  2WBK A;  2VCC A;  2YC2 A;  3NRU A;  2YB7 A;  1YQ2 A;  1RYY A;  3UES A;  3UNP A;  2W92 A;  4CVU A;  1EUU A;  3JXS A;  2RJ2 A;  4XVH A;  3GGL A;  4AG4 A;  1ULO A;  4CU9 A;  4A3Z A;  2WO2 A;  3OG2 A;  3OEA A;  2YG0 A;  3W5N A;  2V72 A;  1XPW A;  2Z4F A;  2E33 A;  3I2F A;  3LEK A;  4E8D A;  2XHN A;  3GXU A;  4MGQ A;  3VD9 A;  3CZJ A;  4XZU G;  2Y64 A;  4OMC A;  2ORZ A;  3AC0 A;  3ACG A;  2W46 A;  2QQL A;  1JYW A;  2X10 A;  2BER A;  4MGS A;  4QX3 A;  1H6X A;  2VZV A;  4BXS V;  1P8J A;  3WNN A;  2X09 A;  3ABZ A;  2W94 A;  3NJX A;  3I2I A;  2EIE A;  4JKM A;  2ZEX A;  4M4P A;  2WAO A;  3WEZ A;  4ARY A;  5A1A A;  2QQJ A;  5G04 L;  2VL4 A;  4OZO A;  4QX2 A;  4XUN A;  1WCQ A;  5LA1 A;  2J1V A;  4QB1 A;  3VDC A;  1IQD C;  3DYO A;  2WZE A;  4DXT A;  3CZU A;  1K3I A;  3WF0 A;  2W9X A;  3D3A A;  3DYP A;  3T0B A;  4DXR A;  3F2Z A;  1J83 A;  2J1T A;  2Y6H A;  3VDA A;  2W47 A;  3P1I A;  2HLE A;  2W3J A;  3IDA A;  1NUK A;  4CU6 A;  1EUT A;  2Y8K A;  1GUI A;  2DCJ A;  4JX0 A;  3OGS A;  5DN2 A;  2XQX A;  2WDB A;  2E26 A;  2VZQ A;  3I3B A;  3ECQ A;  1US2 A;  4QX1 A;  2YFU A;  2R7E B;  4W4Z A;  3WNL A;  1CZS A;  1PX4 A;  1UY3 A;  1KEX A;  3FN9 A;  3HNY M;  3HNB M;  3OEB A;  3VDB A;  5I0D A;  2ID4 A;  3DYM A;  4L0P A;  3I2G A;  3NNG A;  1T2X A;  1JU3 A;  1F4A A;  5DPN A;  2WO1 A;  3ACH A;  1UXZ A;  4AAX A;  5JXH A;  3MUY 1;  1DP0 A;  4LHS A;  2LW8 A;  2VZ1 A;  2RVA A;  5JXG A;  2VOT A;  1JZ8 A;  3BN6 A;  3PUI A;  3HEI A;  1JZ4 A;  5HPO A;  2WAB A;  3I2H A;  3UET A;  2VZS A;  2JDA A;  3K4A A;  4CU8 A;  3FHA A;  1OH4 A;  2Y6L A;  2Y6K A;  3T2P A;  5IFP A;  4MAD A;  3T2O A;  1JZ3 A;  1W9S A;  5DMY A;  5B4X A;  1W8N A;  1US3 A;  3T2Q A;  4P02 B;  1UZ0 A;  3PUH A;  4DUV A;  3C7H A;  2KD7 A;  1GQP A;  3WNK A;  3C7O A;  4QDQ A;  3IB3 A;  5LA0 A;  3HN3 A;  3ACF A;  4PQQ A;  2QQI A;  2E32 A;  3HNM A;  3I2J A;  2HYX A;  4PT6 A;  3VD4 A; 
#chains in the Genus database with same CATH topology
 5FK7 A;  2VBB A;  4XCA A;  4TXW A;  4YFW A;  3LD8 A;  3D8C A;  5D8A B;  5KHG A;  1QQP 2;  3GF6 A;  5JCT A;  5BNP B;  1UY0 A;  5DDJ 3;  4CDU A;  1TG7 A;  2D43 A;  2MPF A;  1E5R A;  1ZZ7 A;  2WO7 A;  1HRV 2;  3K77 A;  4GA9 A;  2WZP P;  5GZE A;  5IVJ A;  4YNI A;  1MZ6 A;  1QHD A;  3D82 A;  4LR4 A;  5DDJ 2;  5EP9 A;  2QNK A;  5IK5 A;  2QKD A;  1CIW A;  4WM8 B;  2FDF A;  4Y22 A;  4IEP A;  1OQD A;  3ZSM A;  2P6C A;  1AXK A;  1DHK B;  3MI8 A;  5K0U B;  3SXW A;  1QDC A;  1GQG A;  4S2G A;  1GOF A;  5BNN C;  5JI9 A;  2V5D A;  4XPV A;  1GIC A;  4AQ2 A;  1TME 2;  2WZR 2;  3AX4 A;  4FQ4 A;  1ASJ 3;  3EBR A;  1ZVF A;  1S0J A;  3WLU A;  3RS6 A;  4A6S A;  1C1L A;  3UGG A;  3FWE A;  1GNY A;  3KS7 A;  2ZA9 A;  3GBW A;  5GLW A;  4M4R A;  3IDE A;  2RS5 2;  5FZI A;  1I6X A;  4QX8 A;  4YW7 A;  4AE2 A;  2CDP A;  1AR7 1;  5FO7 B;  1OD5 A;  4GH4 A;  5C3P A;  1S55 A;  2ZBJ A;  5FYY A;  3U07 A;  3U78 A;  5IK7 A;  1DDL A;  4C1X A;  1HQN A;  1RUG 1;  1MPX A;  3EO6 A;  1MZF A;  5AC9 1;  2W39 A;  5JZG C;  2WWU A;  3USU A;  2GC2 A;  5I0U A;  2R07 3;  1Q8V A;  5BY5 A;  5E6H A;  1HV1 A;  1W2T A;  1REF A;  4QKF A;  1LB2 A;  1F9K A;  3ZYR A;  5ACA 1;  1O91 A;  4CP9 B;  2IVJ A;  5LBF A;  1E57 A;  5EIY B;  3T4H B;  2BFU S;  2ARX A;  1QDO A;  4BK5 A;  3J7H A;  3SIT A;  4YWA A;  2UWA A;  3AKQ A;  1HX6 A;  2R06 1;  4L11 A;  1VAM A;  2DUR A;  1JTZ X;  4HSJ A;  4FTB A;  3PVB B;  2VUJ A;  4OHW A;  1J84 A;  1VBE 3;  1O4Y A;  2R49 A;  4BPZ A;  3POB A;  1UX7 A;  3AJZ A;  5IVB A;  2VO5 A;  2VW0 A;  1Y9G A;  1CJP A;  2JG9 A;  2PHR A;  4Q4X 2;  4W6W A;  4MET A;  4BOW A;  1W9W A;  4AXO A;  1O5U A;  2DFB A;  2VZT A;  1ENR A;  1WBF A;  2A73 B;  2WSV A;  2ZPX A;  3K75 B;  3ZXA C;  1K42 A;  5AFE A;  2HWC 2;  3NNL A;  2IWG B;  2UWC A;  1WLW A;  3WNX A;  2E31 A;  1OPO A;  1R1Z A;  2DU1 A;  5F6L B;  2ZKL A;  5FRA A;  4HAN A;  4YZ2 A;  2XOM A;  2VUA A;  2XLA A;  4GH4 C;  2PAM A;  2QDN A;  2GND A;  3B7M A;  3RZZ A;  1GP6 A;  3R05 A;  3FJS A;  2P3K A;  3L9J T;  1GYK A;  2RDQ A;  2VBD A;  4BME A;  3J8F 3;  3WHT A;  5JZG A;  4XFA A;  1A8M A;  1LHW A;  5GZD A;  3K4Z A;  3VZK A;  4UFK A;  4Z92 B;  2RDN A;  3ZYF A;  2O8O A;  2WZ8 A;  2X8K A;  4I0B A;  1H6Y A;  3ZXJ A;  2YC4 A;  3QOP A;  5CKN A;  3OY8 B;  1N47 A;  2DTY A;  5IYY A;  3WG1 A;  4S2D A;  3BTA A;  4QPI B;  1ODM A;  5D2A A;  4JGZ B;  4JAA A;  5JXI A;  2Z79 A;  3BTY A;  3V56 A;  1NZI A;  3KVB A;  5FR3 A;  2E7A A;  1FPN 2;  4I0A A;  1EYB A;  2VUC A;  3U75 A;  1H8T C;  3DXT A;  3WQ7 A;  4QWN A;  2JDM A;  1SBD A;  4IES A;  1VP6 A;  2Q8D A;  4A41 A;  5L36 A;  2YBK A;  1RTV A;  1J3P A;  3WG4 A;  1WW6 A;  1EPW A;  3LEG A;  4Q4V 1;  4EZ4 A;  3S5A A;  2ZGT A;  3K48 A;  2XG3 A;  3CIH A;  3NQH A;  3DPR B;  2HYK A;  4P9J A;  2E7Q A;  1HW5 A;  5LEJ A;  2BVB A;  4K6B A;  3VBR C;  4UT5 A;  4YM0 A;  5FMO L;  1VAV A;  1CPM A;  3HN1 A;  1DZQ A;  2XL9 A;  2DCY A;  3RZG A;  1BKZ A;  2B39 A;  3NKG A;  4DUX A;  5LBC A;  2GMP A;  1MAC A;  4OYU A;  3CU7 A;  4E27 A;  2JG8 C;  4B1M A;  3DV8 A;  3AYD A;  4K40 A;  2VNV A;  3CJI B;  4AI8 A;  4Z07 A;  2XML A;  4OQ9 A;  5AFB A;  3ZPY A;  3RDI A;  3LFI A;  2Q8C A;  1ND2 B;  2EXJ A;  3CMG A;  3ETP A;  4UOJ A;  3O1S A;  4LBL A;  3DCQ A;  2A3W A;  4Z82 A;  4PLM A;  3S6P A;  5LRR A;  4M0N A;  3ZVX A;  4XHX A;  2FBE A;  2RV9 A;  1RUH 2;  4AED A;  1EV1 3;  4WVV A;  3BTZ A;  3RSJ A;  1H9P A;  5KC5 A;  1OC1 A;  2Y6G A;  2RMU 3;  4LJH A;  4Q4X 3;  4C0H A;  1AR6 3;  4AEM A;  5DG2 A;  2VMC A;  1OF4 A;  3ZFE A;  1KS5 A;  3I7D A;  4MGT A;  5LEK A;  3WV6 A;  3TEX A;  1KD7 A;  4GAL A;  4ZU5 A;  1YIP A;  2R1D A;  2XL7 A;  3AKT A;  4KNC A;  4XAB A;  3W9A A;  1G6N A;  4Y4Y A;  4QDS A;  5FLH A;  3AZZ A;  3N7M A;  5CZK A;  4JGZ A;  2BVV A;  1WBL A;  2A6Y A;  3IKW A;  1ZZ8 A;  2W1Q A;  5IUQ A;  3ZSL A;  1YJL A;  5K7P A;  2YMZ A;  5IVC A;  5J1X A;  3E6D A;  2V4A A;  4N53 A;  2F6B A;  2UYB A;  4BK4 A;  2K9Z A;  2VTX J;  2XDV A;  3RGB A;  4PF5 A;  2VCA A;  1QNW A;  3KWV A;  1JH5 A;  2FHR A;  3VBR A;  1D2Q A;  1PM4 A;  2QBX A;  2R0H A;  5FJH A;  5FYU A;  4Y33 A;  4WBB A;  5A3O A;  1IPJ A;  1KS4 A;  2WS9 2;  2G9Z A;  4CDU C;  3WNM A;  4BQY A;  5A6Q A;  4GMP 0;  1OXC A;  4XMA A;  1ENQ A;  1PM7 A;  2ZEW A;  4YM2 A;  3DEM A;  3K3O A;  2NM1 A;  2QE3 A;  2V09 A;  4KWU A;  4XBN A;  5F39 A;  2XH6 A;  1YEW A;  4AVC A;  1R64 A;  2BRT A;  3EB7 A;  5FZG A;  5GKA C;  3AP5 A;  3VZL A;  3WG3 A;  4DXS A;  3LDR A;  5FIX A;  4LKS A;  3VBU B;  1VBB 3;  3NJV A;  3PL0 A;  4UAP A;  4W6X A;  2YFZ A;  4KQ7 A;  3BIE A;  3Q8E A;  2DF7 A;  5HCB A;  1OOP B;  3SEE A;  4CDW A;  4FPK A;  1J3R A;  3GYD A;  4L8Q A;  1WD3 A;  4QDR A;  1UZY A;  1E5H A;  5FDB A;  1W8O A;  2W87 A;  5C8C B;  1UN1 A;  3ZFG C;  3WG2 A;  4CSW A;  4P14 A;  1JYC A;  4FOW A;  3GNE A;  1ZNP A;  4MZU A;  5JPN B;  4NUB A;  1CN1 A;  1COV 2;  3FUQ A;  4KG0 A;  4MHR A;  1ZZC A;  3RFR A;  2R32 A;  1LUL A;  1C4R A;  5KC6 A;  1NXD 1;  4KWJ A;  1Q8O A;  1JOP A;  5CB7 A;  3MIB A;  1RUE 3;  3WUC A;  3NJZ A;  2VOX A;  3FHQ A;  2VQT A;  4Y5Z 0;  3WVJ A;  2ORX A;  4NHK A;  4ZKT B;  1FI2 A;  4COV A;  2P1B A;  1CQ9 A;  2W91 A;  2ZXQ A;  2WNO A;  1AVB A;  3M8L A;  1K5M A;  4QHB A;  2GP3 A;  2XON A;  5CG8 A;  1H8T A;  1VJ2 A;  1W9F A;  1LGN A;  4GWJ A;  1IKQ A;  3IDC B;  1OUS A;  3OGG A;  3OD4 A;  4QPI C;  4U2A A;  3LSE A;  4M0H A;  4XJ8 A;  4FP3 A;  5FY1 A;  4WM7 A;  2DVF A;  1UY1 A;  4MO3 M;  2CV6 A;  1F35 A;  4HON A;  4O65 A;  4XJU A;  1WCS A;  5I93 A;  3H8X A;  3UKN A;  3HD8 B;  5FO8 B;  3P6B A;  1QJY 1;  1ASJ 1;  3MHZ A;  3RVH A;  2YBS A;  3L2H A;  3T09 A;  4UI9 L;  1V6N A;  1R1A 2;  2A6W A;  1UYY A;  3PVN A;  5F8P A;  2WNU B;  5IVE A;  2YC2 A;  1WCD J;  1XNB A;  2ZTN A;  3O1U A;  4OHY A;  3IPV B;  1YQ2 A;  4L92 A;  1N3P A;  5KXE A;  3NL1 A;  3WP6 A;  5IAX A;  4IEO A;  3UES A;  2ZGQ A;  4Y24 A;  3UNP A;  1SEF A;  1WD4 A;  1EUU A;  3KGZ A;  2RG4 A;  3C3V A;  1OLR A;  1EAH 2;  2VU9 A;  2PHL A;  4FPO B;  4J6G A;  2RJ2 A;  4XVH A;  3GGL A;  5CFC B;  3MGU A;  1LHU A;  2UYA A;  1CES A;  1SAC A;  2WO2 A;  3E97 A;  4IEU A;  4A3Z A;  1AR9 1;  2ARB A;  4J1W A;  1JN2 P;  4CCC A;  4BU2 A;  4YZ5 A;  2QUO A;  1LGC A;  5J09 A;  1DGW X;  1VBA 1;  4HVO A;  4K3U A;  3SMH A;  3Q9O A;  2GH2 A;  5I91 A;  2ZCW A;  3I2O A;  1YCI A;  1RB8 G;  4H14 A;  1NCR C;  1SCS A;  2ZOE B;  5A3M A;  3VHO A;  1BEV 2;  2E33 A;  1AJO A;  1EAH 3;  2RJL A;  4BQ2 A;  2ZX1 A;  5JAX A;  1SLI A;  1HV0 A;  2ZHM A;  3VBH A;  5JR7 B;  4Q4W 3;  3VDD C;  3GXU A;  3U11 A;  1RIT A;  4MGQ A;  5DZG A;  1RGS A;  1WLT A;  3WDV A;  3VD9 A;  1K5M B;  1F5F A;  2R16 A;  4XZU G;  2BOJ A;  4OHX A;  3AVS A;  4ATF A;  5ABJ C;  3RZM A;  1RIN A;  5LRS A;  5D1I A;  1NCQ B;  5FZ6 A;  4B3N A;  1RUI 2;  5FZA A;  3AZW A;  5K9Y A;  1JYW A;  2DWR A;  4MGS A;  4QX3 A;  2K0G A;  1G9C A;  2LRP A;  1S2K A;  4RS5 B;  4RR3 A;  1MZ5 A;  1W6N A;  3AJY A;  4K21 A;  4N43 C;  4XCB A;  3LA3 A;  4WM8 C;  1RUD 1;  4QQ2 A;  1VAK A;  1OLM E;  4E4Z A;  4QXK A;  3ZSJ A;  4CCJ A;  1W3V A;  2X09 A;  2ZML A;  4QKD A;  4QHO A;  4EWE A;  3U10 A;  2BU9 A;  3WW4 A;  1PGW 1;  2ZGU A;  3O1O A;  2JDP A;  2WAO A;  1LOB A;  1UOJ A;  2JJ6 A;  5JZG B;  5G04 L;  3WP5 A;  1RL3 A;  4OZO A;  2JX9 A;  2BNM A;  1WCQ A;  3M7A A;  1V9U 1;  3IBM A;  1QJX 1;  3FE5 A;  5FP9 A;  4IET A;  1IS5 A;  1ULG A;  3PLQ A;  3B01 A;  1QJX 2;  1N3O A;  1XYP A;  3DYO A;  5I0S A;  1V9U 2;  1XYO A;  2A3Y A;  1MS0 A;  4R4X A;  5L9B A;  3AKR A;  4UFJ A;  4QPG B;  5FMB A;  5LK5 A;  4BLJ A;  4BYY A;  3VZN A;  1QJE A;  1ZBE 3;  2WT0 A;  1PGW 2;  1V6L A;  3KGL A;  1J83 A;  2Y6H A;  3PUR A;  4FTS A;  2WNV C;  5KHH A;  1YLL A;  3A4U A;  3W20 A;  4NHL A;  3GJB A;  1N1Y A;  1NUK A;  2I45 A;  3B9I A;  3ZR6 A;  4RHV 3;  1C8M 1;  1OKQ A;  3ZXD A;  4Q0U A;  4FAG A;  1Y7B A;  1SMV A;  3OGS A;  3AMM A;  1U5Z A;  4JDN A;  1Y4W A;  1NA1 B;  4O9E A;  5DN2 A;  2O8Q A;  3ZXG A;  3VL8 A;  2E26 A;  5BUV A;  1PK6 A;  3I3B A;  4XFF A;  5FJK A;  5A7S A;  3UGH A;  1US2 A;  4JV4 A;  1Q5O A;  2HWE 2;  1CGP A;  4QX7 A;  5FP4 A;  2P2K A;  1RUN A;  4XHB A;  2I2S A;  2EVX A;  5D8A C;  4CP9 A;  3ZN6 B;  3CJI A;  4LO6 B;  1UPI A;  1PX4 A;  4LBM A;  1DQ5 A;  4XET A;  1BEV 1;  3PUQ A;  5A33 A;  4DFS A;  5C6C A;  1W28 A;  4GQ7 A;  2TBV A;  1AL0 G;  2ID4 A;  4XDQ A;  3ZYJ B;  3NWK A;  1VLN A;  2WS9 3;  1VBA 2;  1ULE A;  5KXD A;  2BFU L;  3B9C A;  4I02 A;  1QEX A;  1T2X A;  1AYM 2;  1TNR A;  2P37 A;  3ZMO A;  2YRO A;  1JU3 A;  4AED B;  2WSU A;  4CZS A;  5FV3 A;  2JG9 B;  1UAI A;  4V2W A;  4EN8 B;  1UXZ A;  2AH2 A;  2XKO A;  3POW A;  1GAN A;  1GFF 2;  4X8N A;  4HOO A;  2RR1 3;  2RS3 3;  2E9Q A;  1H1M A;  5F3G A;  4LXL A;  1CAU A;  4Q2F A;  4WVZ A;  5GZF A;  1LOA A;  3MID A;  4Q5O A;  4XJW A;  3O1M A;  5EQU A;  1GNZ A;  1V00 A;  2F4L A;  2VOT A;  3FLT A;  3HEI A;  2V5Y A;  2WFF 3;  4YW3 A;  4Q8K A;  5A70 A;  5J7M A;  3WDY A;  3KD4 A;  2HWB 3;  1JZ4 A;  2A5Z A;  1CAV A;  2BP6 A;  5HPO A;  4NPL A;  3M3E A;  3JB4 C;  3ZFF B;  1V6M A;  1R1A 1;  4LNV A;  4N53 B;  2Y6L A;  3MIF A;  4Q0Q A;  5BNN A;  2Y60 A;  1QJY 2;  1YQC A;  4RD7 A;  3F95 A;  4QQL A;  2JEC A;  1UKR A;  2DCZ A;  2WA4 A;  1NE4 A;  4FOV A;  3UT0 A;  2Y0O A;  3VHN A;  5DMY A;  1ULC A;  3G6J B;  1POV 3;  1PGS A;  2WIN B;  4PQ9 A;  4AFM A;  3IPV A;  1W8N A;  3WP3 A;  5C8C C;  4GMP 1;  5IW0 A;  4BA6 A;  4IEY A;  3NAP A;  4P9X A;  1YXW A;  3ZYG A;  2FMD A;  4JTO A;  1YQ6 A;  3AZY A;  1UZ0 A;  3VBH C;  1FV3 A;  3VDD A;  2XUM A;  5A7Q A;  3Q8F A;  5DZF A;  1UQX A;  2HWD 1;  3EQE A;  3GAL A;  3BCW A;  2MNG A;  1LKN A;  3AMN A;  3C7O A;  3LIG A;  4CCD A;  4Z2W A;  1UOB A;  1JYT A;  1QGL A;  1D2S A;  2K2S A;  5CEH A;  1MS3 A;  4M01 A;  4CCM A;  3CL1 A;  3KV5 A;  3URF A;  5FBJ A;  3LZZ A;  3POE A;  3OOX A;  2GZW A;  3UJQ A;  4CYD A;  1W8U A;  2VUD A;  5EPA A;  3APB A;  4P9G A;  3I2J A;  2NMN A;  3MIE A;  4AZZ A;  1XRU A;  4IGQ A;  4OMD A;  1OH3 A;  4Y20 B;  4BMB A;  5F9T A;  4EN6 B;  4JQT A;  1JZ5 A;  2ET1 A;  2WYF A;  4KBB A;  2J1R A;  1HB3 A;  1FPN 3;  2QTW B;  3AYA A;  3III A;  4LK7 A;  4UW6 A;  2KXL A;  4ZXE A;  1J59 A;  1AYN 3;  1NLQ A;  3NMB A;  2EIC A;  4AW7 A;  1CIY A;  1IKP A;  4LBO A;  3Q8A A;  5DUX A;  4Y4R A;  5FTT C;  3POF A;  4YGC A;  2QQM A;  5FY5 A;  4ZZ5 A;  5SV8 A;  1W0N A;  1C57 A;  1BHG A;  2FCU A;  4IEX A;  2QZ3 A;  2J22 A;  2HEY F;  2VMH A;  1O5L A;  1VRH 3;  3QBQ A;  4FBF A;  4UBG A;  1PO1 3;  2VZU A;  3ROU A;  3FLP A;  3DKQ A;  4YM1 A;  3Q8C A;  1Z7S 3;  1NOV A;  3NV3 A;  1ENX A;  1K12 A;  1V6J A;  1WW4 A;  2P6H A;  1DZR A;  1OVP A;  2XBO 3;  1W6Q B;  4KMQ A;  1OI6 A;  4Q0V A;  2VOV A;  5FZH A;  1UOF A;  3NAP B;  2A6V A;  1XE7 A;  1ZZB A;  2RM2 3;  2P3I A;  2Y0I A;  3NV2 A;  5JIA A;  4YGB A;  4FPH A;  2ARE A;  1SLL A;  1YHF A;  4FO9 A;  3WT3 A;  4XE9 A;  3FFQ A;  1LEC A;  1GWL A;  1LHN A;  1XU1 A;  4GWI A;  4JKK A;  4QMA A;  3GHN A;  1DGR A;  1NCR B;  4FP2 A;  4AI0 A;  2GC1 A;  2SLI A;  4CDW B;  1KFX L;  1NX9 A;  3QAC A;  5LAT A;  4MSV A;  2WNV A;  3MLL A;  1T6B X;  4HXC A;  4ASM B;  4YSF A;  4QB6 A;  3VBR B;  1AX0 A;  4DS0 A;  1QNY A;  1NE6 A;  3ZYP A;  4EWA A;  1GKB A;  2EIB A;  3H1Y A;  4GB3 2;  3WR0 A;  3ZXK A;  5L7O A;  4JC1 A;  4XF1 A;  2OUJ A;  1U0A A;  1WZX A;  2X29 A;  4BLI A;  5J96 B;  4A7Z A;  4MHU A;  3JQW A;  1D0G A;  5A7P A;  1FOD 2;  3GBF A;  4LO4 B;  2NQY A;  3QH7 A;  3ZXF A;  4A7K A;  2C6S A;  1DQ1 A;  3MW4 A;  2FZ1 A;  2YU1 A;  1YUD A;  2XGX A;  3VDD B;  4AF9 A;  4AEJ A;  2JDN A;  3BOD A;  1DQ2 A;  2R0F A;  2VNO A;  3FZ3 A;  1ZZ9 A;  5FZ9 A;  4ZY9 A;  3W58 A;  2BBA A;  4DRR A;  5GZG A;  3SCH A;  3UK9 A;  5CNA A;  1RED A;  1BVV A;  3SEP A;  4Z1V A;  1VBE 1;  2B4K A;  1UCX A;  2G19 A;  4WVW A;  3FLR A;  3A0K A;  3B02 A;  4A4A A;  2K46 A;  1XNT A;  2DCT A;  1ZA4 A;  3GBG A;  2W1W A;  2ZX3 A;  1HJG A;  4UW4 A;  3V64 A;  2WN3 A;  4A7Y A;  2DDU A;  3N35 A;  1RVF 3;  4LLO A;  1L3J A;  3MV1 1;  1JZ6 A;  1VMF A;  4UFL A;  4YAR A;  3U4S A;  4XUT A;  5LA2 A;  4E4H A;  2VCM A;  2XLF A;  4ZS3 A;  3U37 A;  3LE0 A;  3VD5 A;  4CTE A;  1QH7 A;  1XNA A;  3D4K A;  4QPY A;  5JXJ A;  3S0M A;  4D8M A;  2JIC A;  4JTN A;  3PTR B;  1GR3 A;  3O1T A;  1IQA A;  5C9A B;  1ZM1 A;  3C8X A;  1WMD A;  3O5S A;  4LIT A;  2WLQ A;  4LUL A;  1JZ2 A;  4JHT A;  3AFK A;  4YLZ A;  5GLV A;  1FPN 1;  2Z5W A;  4LUK A;  4MLO A;  5FZO A;  3W5M A;  1RMU 2;  2XB6 C;  4H3W A;  2Q5T A;  1IGO A;  2Q8O A;  1IG3 A;  3K3N A;  2ZGN A;  1YFU A;  2XPJ A;  1CAX A;  1ZBE 2;  2VZP A;  3ASI A;  2FCV A;  2EAL A;  3J26 N;  4R4Z A;  3AYC A;  1B35 A;  1F4H A;  4YFZ A;  4H7L A;  4XFC A;  4ARX A;  4N7U A;  1DQ6 A;  3ZMN A;  4MH0 E;  2D6N A;  2Y6J A;  4L9B A;  3ZSK A;  1IS4 A;  5A6Y A;  1YC6 1;  1YJK A;  2PAE A;  4AOC A;  4YGD A;  1NLR A;  5C3S A;  2ZHL A;  2DBI A;  1AL2 2;  1XC6 A;  2FMY A;  5HXM A;  2ZGP A;  1IS3 A;  2DFC A;  3C7E A;  4COU A;  4Q8L A;  5LW9 A;  3THT A;  3VD3 A;  1UYX A;  4E4S A;  5FMD A;  4AHY A;  2VTF A;  2R04 2;  1C5I A;  2IC1 A;  1PIV 1;  4HK9 A;  5IVV A;  3ME2 A;  3ZYB A;  3THP A;  1H9W A;  2HWC 1;  1W90 A;  2VJX A;  2ZX2 A;  1QXP A;  4X6R B;  5FZ8 A;  3LQC A;  4HN1 A;  3ZR5 A;  1BJQ A;  4LKE A;  3O1V A;  1O3T A;  4BH9 A;  2DBN A;  2XKP A;  3AB0 A;  3VHP A;  3HOB A;  4BJ0 A;  2C26 A;  3POS A;  3ZN6 A;  3R4S A;  2AEY A;  4H2A A;  2PQS A;  3IM0 A;  1SLA A;  2XJP A;  1AJK A;  4RL7 A;  3SKV A;  3DPR C;  2R06 2;  5HCA A;  5FZ0 A;  5JI7 A;  3MLK A;  3IAQ A;  5E16 A;  5JSR A;  1BEV 3;  3W59 A;  4AVA A;  1FMD 2;  5ACA 2;  4QXC A;  5KBF A;  3N7J A;  1UYZ A;  5FYZ A;  3CQO A;  5C7G A;  1MS4 A;  5A7O A;  2D44 A;  2QDR A;  4QKN A;  1JXN A;  1S2B A;  3POY A;  2WJS A;  4RYD A;  2F17 A;  4OFG A;  4YZ4 A;  3OUI A;  1OFS A;  1T6G C;  2Q1F A;  4GB3 3;  2ES3 A;  2E53 A;  5ACA 3;  4S2H A;  3S5Q A;  5AC9 2;  1D4M 3;  3MW2 A;  2CU5 A;  2OX0 A;  4EN0 A;  5KHK A;  3B69 A;  4JGY B;  1DCS A;  3MLJ A;  1Q8P A;  1W0O A;  1JZ7 A;  2R06 3;  4TTG A;  3JUU A;  3N36 A;  4IQP A;  1UZW A;  3SCF A;  4CUC A;  4KWL A;  1AR7 2;  2BJS A;  2DYC A;  4LTA A;  5DUW A;  3WQB A;  1AX2 A;  2DVA A;  3PTY A;  4NRP A;  5BYN A;  2RS5 1;  1RUD 3;  3AXD A;  3LEM A;  3ZN4 A;  4FFI A;  4W50 A;  4Z2A A;  4UFH A;  5JMO A;  5FY0 A;  1ZBA 3;  2E63 A;  2J1S A;  5FY4 A;  4QX0 A;  2RM2 2;  4LBJ A;  3EYP A;  1TME 1;  1ULF A;  4CU7 A;  5C4W C;  2DVG A;  1W8F A;  2XBO 2;  1OOP A;  4P00 B;  2JDK A;  3DGT A;  5JUV A;  2Y33 A;  4URA A;  2YGL A;  4XJA A;  2J7M A;  4XTM A;  3OPZ A;  4ZZ8 A;  1PO1 2;  2CDO A;  1RHI 2;  1AF9 A;  3JD7 2;  1JUH A;  2Q0A A;  5DDJ 1;  3J4U H;  3ZPO A;  3PIG A;  2VD7 A;  3ACI A;  1AL2 3;  1HRV 1;  4IUG A;  4QPW A;  3WD5 A;  1PVC 1;  4E9K A;  4ZHN A;  3SQO A;  4PIX A;  5BNP A;  3FC0 A;  4IV3 B;  4NAO A;  1TZO A;  1X36 A;  2NPI A;  4GIQ A;  1QQP 1;  1DF0 A;  5IWF A;  3VGI A;  4P9I A;  4YG3 A;  5LAS A;  3H3L A;  2VZ3 A;  1AHS A;  1UU6 A;  2N7G A;  3GZU C;  3BIW E;  4M3C A;  1GSL A;  4BIS A;  3MF6 A;  4NMI A;  3P3P A;  1TEI A;  1WLD A;  4B7K A;  3BPS A;  3GM8 A;  1SFP A;  1GOH A;  3K46 A;  4RGG A;  1K5J A;  1YNA A;  2AAC A;  4B4P A;  1SCR A;  2BGC A;  3BYW A;  2FQP A;  5G05 L;  4N7I A;  4PI0 A;  5JVV A;  1RUF 1;  1VIW B;  1CAV B;  2HWF 2;  3O0X A;  4Q27 A;  2XUE A;  3LFM A;  1QJU 3;  2B8M A;  4DEQ A;  3POJ A;  2W5F A;  4C1W A;  1KJL A;  4FI9 A;  4FFH A;  1KQR A;  2WN2 A;  4QQO A;  1H8T B;  1RUG 3;  1RUJ 1;  2VZR A;  1VBD 2;  2JKX A;  5ERL A;  1ZRR A;  4BQ5 A;  1Z78 A;  2R07 1;  2Z2S B;  3M2M A;  5CVR A;  2JD9 A;  3WF3 A;  4K1Y A;  3N9M A;  1CAX B;  4GAZ A;  4F8A A;  3BTX A;  1TMF 3;  1JW6 A;  2PLV 2;  3OSD A;  1SG3 A;  4G4F A;  4JHZ A;  1W2O A;  2UY9 A;  3OUH A;  4XW3 A;  3TWI A;  4ES9 A;  4LKF A;  3M3C A;  5JOX A;  2YB7 A;  1AR9 3;  4I2O A;  2QQP A;  1RYY A;  4RFT 0;  2HJI A;  1WME A;  2IFR A;  2W0X A;  5CIS A;  3PUA A;  5LA9 A;  1ZRE A;  3AP6 A;  4CCK A;  1EY2 A;  3J7N A;  1NCR A;  3NJY A;  4GKY A;  1RUC 3;  1E5S A;  2HWB 1;  2CGN A;  3VBS B;  3OYW B;  1FOD 3;  2W52 A;  2Y6F A;  4IV3 A;  1MZE A;  2WRA A;  4Y20 A;  5EYX A;  1WCU A;  2RHP A;  3LOI A;  4XQD A;  5FZD A;  2YG0 A;  1O4T A;  4XFH A;  4HVQ A;  1PNF A;  1J1L A;  4AL9 A;  1RJ7 A;  5JLV A;  4HVR A;  3LAG A;  4MGY E;  2ZGR A;  2Z4F A;  1J3Q A;  4XZP A;  4CPB A;  1FX5 A;  4LE4 A;  1RUC 2;  5A3U A;  5FYI A;  4AGR A;  4CXY A;  3WW1 A;  1ZBA 1;  5EJ3 A;  4RSU A;  4ATE A;  2XHN A;  1QWR A;  2YDE A;  3FHI B;  4IV1 C;  1VBC 3;  1ZRF A;  4FPY A;  5DAW A;  3DUI A;  2XQR A;  2Y64 A;  4OMC A;  2ORZ A;  1SZB A;  2NYY A;  4IE0 A;  4IEQ A;  1O3S A;  2YBP A;  3J8F 1;  2ARA A;  3KZ4 C;  3RG0 A;  3WHU A;  2W46 A;  1NQJ A;  4EE2 A;  4GJZ A;  3RJR A;  5JWP A;  3HWJ A;  4FOY A;  4LO5 B;  2X10 A;  4Q4W 1;  2BER A;  3ZOI A;  3SCG A;  4IEV A;  4BXS V;  5A1F A;  1XE8 A;  4G3Y C;  1BVP 1;  1DGR N;  5FYT A;  3QCW A;  3H1M A;  1X8M A;  3HQR A;  4YRD A;  1BMV 2;  2W94 A;  1XQN A;  1XXN A;  2MHF A;  3NJX A;  2D6L X;  2YPJ A;  5FZB A;  3ZKU A;  3LWC A;  4AI1 A;  4R52 A;  3VBO C;  4M4P A;  1AR8 3;  1QJU 2;  4RGK A;  4J25 A;  2ZGL A;  4PLO A;  3KT1 A;  3PU3 A;  2VL4 A;  4QX2 A;  3AP4 A;  1JOD A;  5LA1 A;  2YXS A;  1AYN 1;  1I5Z A;  2D3R A;  5FZL A;  2J1V A;  4HFS A;  4QB1 A;  2XLG A;  3GHM A;  3IIA A;  4IE5 A;  2FDK A;  2QVS B;  4OUS A;  4ZU4 A;  5HCH A;  4CCE A;  2ZAB A;  3JQX A;  1IQD C;  5A7W A;  3TRS B;  3H3Z A;  3ZXE A;  4DY5 A;  5GM0 A;  4QU1 A;  4YVW B;  2OA2 A;  1R08 2;  3AKP A;  4DXT A;  1V6K A;  4E2G A;  5C5U A;  4QHZ A;  5CAD A;  3WF0 A;  4RHV 1;  1RXF A;  2ADD A;  1VRH 1;  4ZON A;  2GP5 A;  5ISL A;  4DXR A;  1QJX 3;  3AP9 A;  3F2Z A;  3WCR A;  3LCP A;  3M4F A;  1OMI A;  2PN5 A;  2H6C A;  2W68 A;  4DIN B;  4O61 A;  3WQ1 A;  3VLB B;  2ZZJ A;  3B93 A;  4KWK A;  3HAG A;  1XOY A;  5KR7 A;  2C24 A;  4BIF A;  4BIO A;  2Y8K A;  5APA A;  1S0E A;  3IZO A;  4FQZ A;  1QIQ A;  3GZE A;  1MQT C;  3O0V A;  1LAJ A;  5HV0 A;  1TMF 1;  2XQX A;  1JS9 A;  5FKC A;  1L7L A;  3H8R A;  5F3C A;  3SH4 A;  4Y1Z A;  4D6Q A;  1ND3 A;  3KLS A;  3RI9 A;  3ECQ A;  1W04 A;  4AGV A;  1LU2 A;  1YRZ A;  2SBA A;  4Q4Y 2;  1EV1 1;  3KQ4 B;  5BNP C;  4IE6 A;  5F5I A;  4JVA A;  2R7E B;  5FPA A;  1H1I A;  4CDQ A;  3E6B A;  4W4Z A;  4HKL A;  1RUI 3;  3AVR A;  2QFE A;  1KEX A;  2EXK A;  3HNY M;  5FP8 A;  3HNB M;  5FQ0 A;  4B4Q A;  2WLP A;  2A7A A;  2HWC 3;  3OEB A;  2KR2 A;  1UF2 C;  1FV2 A;  2BNO A;  3DF0 A;  3J7L A;  4QGL A;  5FY8 A;  5EWS A;  5IVY A;  3VDB A;  1AR7 3;  2E7T A;  2Q30 A;  1ZA7 A;  1R09 2;  4FT8 A;  4L0P A;  4FTE A;  3NNG A;  1UZV A;  3X29 B;  5I0R A;  4LEJ A;  4D7T A;  3CJX A;  4BQ4 A;  4D6S A;  1QXJ A;  3LA7 A;  5L7O C;  5T5J A;  5J37 A;  1JOJ A;  3ACH A;  4ES8 A;  3N7K A;  4AWD A;  4A3X A;  1N1V A;  1DP0 A;  1HJF A;  4M3C F;  4AVB A;  4EQV A;  5FWE A;  1BK1 A;  1MS1 A;  2CWS A;  1VPH A;  4AFD A;  4C0B A;  1LEN A;  3RZH A;  1OUX A;  4QGM A;  1POV 1;  2WAB A;  2P4E A;  1VMH A;  2YZ4 A;  2VZS A;  4OI2 A;  3UET A;  1N1S A;  1NG0 A;  4YVS C;  1XJA A;  1IZ3 A;  4LBQ D;  1XYN A;  1HQL A;  3UJO A;  3EXU A;  2Y6K A;  1J1T A;  4ISQ A;  4PI2 A;  4WZF A;  4MAD A;  2JB8 A;  1U5X A;  5I8Y A;  3HVD A;  3ZFG B;  1QKQ A;  1VBB 1;  4XTP A;  5FYV A;  1BLZ A;  3T2Q A;  4PIY A;  2AUY A;  2X5I C;  4YZ1 A;  5C3Q A;  4K9S A;  1FAT A;  3LIH A;  1NT0 A;  2MEV 2;  2Y34 A;  2Z42 A;  1N3Q A;  3BAL A;  4P02 B;  3VBU A;  1H2L A;  4DUV A;  5FXX A;  1ND3 B;  2ZMK A;  3VL9 A;  4KU7 A;  4HMZ A;  1Q8S A;  1GQP A;  2JDZ A;  4XF9 A;  3JBG 2;  1KRI A;  1H2K A;  4QDQ A;  1W6O A;  5F2S A;  3IB3 A;  5F5C A;  5LA0 A;  1E5I A;  2A70 A;  2PHF A;  3VKM A;  2GMM A;  1DBN A;  3VUO A;  2FDJ A;  3D0S A;  4JRA A;  4R8H A;  1Q3E A;  3AFG A;  3R4D B;  1O3R A;  4PT6 A;  1Y43 B;  4WVM B;  4LKD A;  1IG0 A;  3NNJ A;  1KIT A;  4RS5 C;  4LT5 A;  2EID A;  1CX4 A;  1WA4 A;  1X8E A;  4ZS2 A;  3E5Q A;  4Z8B A;  1RUE 2;  2D3S A;  4D94 A;  2EF6 A;  4DRV A;  2G9G A;  2W1S A;  4IXL A;  3QD6 A;  4LBQ B;  4DOU A;  4KU8 A;  3BU0 A;  1DGL A;  1COV 3;  5AVA A;  4X6Q B;  3GZT B;  5EXO A;  2VUL A;  3H1W A;  1EP0 A;  5FZ1 A;  4XMI A;  5I8S A;  1NXM A;  2QQK A;  2G1M A;  4PF1 A;  4KI5 M;  1RMU 3;  1Z7S 1;  2W1U A;  3ZFE C;  4DO0 A;  2B42 B;  3NW4 A;  4PBP A;  2WO3 A;  5HXV A;  1R08 1;  4N8M A;  5J48 A;  2QQO A;  2GDF A;  1QJF A;  4LQR A;  1YQ8 A;  2J1A A;  5LBE A;  5T52 A;  1DZT A;  3ES4 A;  4W65 A;  4CXX A;  3DN7 A;  2UWB A;  1OSG A;  1UMZ A;  3FX3 A;  5H9S A;  1HDK A;  2TNF A;  5FLJ A;  4YVW C;  3ORJ A;  2FDH A;  5ABJ B;  3CEW A;  3I54 A;  3T1M A;  3V65 A;  5SV5 A;  3CKH A;  2W95 A;  1W03 A;  1DYP A;  2MEV 3;  2WYS A;  3KVA A;  2EXH A;  2P17 A;  3D5O A;  4F3J A;  3HPN A;  3DKW A;  5KHJ A;  2VBP A;  4C8D A;  2EAA A;  2GAL A;  3BGA A;  3WW2 A;  2ETE A;  5A1L A;  5GLT A;  5C9A C;  3MZH A;  1BMV 1;  5FZF A;  4XXA A;  2ZS6 B;  1FT9 A;  4CEW C;  2YV8 A;  1OVS A;  4Q4W 2;  4CUB A;  3I2K A;  1HB4 A;  4XC9 A;  3VHR A;  2RDR A;  4I3P A;  3MV0 1;  4AEK A;  4A45 A;  5F5A A;  1UMH A;  2DUQ A;  2VMD A;  4FPJ A;  1XU2 A;  2EIG A;  5E1R A;  3HMY A;  2J1E A;  1D0H A;  1ULP A;  2C4X A;  5F32 A;  4D6R A;  1NLS A;  5T5L A;  2Y26 A;  3ST7 A;  5FWJ A;  3MUZ 1;  3MIH A;  2D3P A;  1MS8 A;  4WVM A;  3WF1 A;  1F8V A;  3RYR A;  2VXJ A;  4LLF A;  4MVT A;  3ILR A;  3LPF A;  1KGY A;  3C2U A;  1O8S A;  3THC A;  2GH8 A;  1ND2 C;  2HBT A;  4I09 A;  1RUC 1;  1UKG A;  5FPV A;  3AZV A;  2B9V A;  1WLC A;  2GNT A;  3MFC A;  1LOG A;  3A7Q A;  4LBN A;  5A32 A;  2VR4 A;  3IAP A;  2B46 X;  2E51 A;  5FPL A;  1GP5 A;  4EZH A;  5JSP A;  1AR6 2;  1VB4 A;  5FKB A;  1RVF 1;  4LHK A;  5H9R A;  2YC0 A;  1GMM A;  1HRI 3;  1HQW A;  3USS A;  2EA7 A;  4KGG A;  1PK6 B;  3CF6 E;  2UY8 A;  1L7R A;  3KF5 A;  1D7P M;  4X8P A;  1BBT 2;  2PHU A;  1NAE A;  3S30 A;  5GAL A;  2J1U A;  3ENR A;  3AMQ A;  4N43 A;  1DFQ A;  4QU2 A;  4WM8 A;  3TN9 3;  3MEP A;  4E2Q A;  1HXS 3;  4PIZ A;  4PLN A;  5L9R A;  4E4D X;  5A3N A;  5IHR A;  3TNP B;  4Q4Y 3;  4KG8 A;  1PVC 3;  2VH9 A;  2DU0 A;  4NWW A;  2KA3 A;  4YG6 A;  3GCW A;  3MF9 A;  2PLV 1;  5CYY A;  3KT4 A;  4QD2 A;  4NPR A;  5FPB A;  2IFW A;  2LM3 A;  4OLL A;  3KMH A;  3B3Q E;  4TN7 A;  2WR9 A;  5HBA A;  4QT6 A;  1HN1 A;  1MS5 A;  1VBD 1;  1RUJ 2;  2LTN A;  2DVD A;  2DCK A;  1CVN A;  5FPX A;  3ACL A;  4GZ9 A;  1GV9 A;  1OUR A;  3LEI A;  1OQE A;  2FDI A;  3N7L A;  2CGP A;  2HWF 1;  1R08 3;  4YW2 A;  4CCO A;  2VY0 A;  4LUM A;  4MGZ E;  2WFP A;  2IXL A;  4CP0 A;  1V70 A;  1Y9M A;  4NRM A;  2VOK A;  1W05 A;  1G9D A;  3S7I A;  4O9G A;  5IAT A;  3VBU C;  1LJ7 A;  4XXP A;  5J3U A;  4DPN A;  1UO9 A;  5C5T A;  2R1B A;  2DVB A;  4JDO A;  1O8P A;  3K4D A;  4IER A;  3GJA A;  1F31 A;  1AR8 2;  1OD3 A;  3RJ2 X;  1PK6 C;  1UU5 A;  2PHT A;  4GWN A;  1F2N A;  3P3N A;  1G7Y A;  2ZAH A;  5KXC A;  4NOT A;  2IXI A;  3S7E A;  1SHW B;  2AEZ A;  4IV1 B;  3THD A;  2D6P A;  3M3O A;  3ZDV A;  5BPX A;  4AR2 A;  2GC0 A;  3W21 A;  3WIN E;  1PVC 2;  2B5H A;  2CL2 A;  4MX3 A;  4NO4 A;  3BKZ A;  1ZRI A;  1ALY A;  3I97 A;  1HLC A;  5A3W A;  1NY7 1;  1RHI 1;  3JD7 1;  5CU1 A;  1DLL A;  1PO1 1;  4NRO A;  5IVF A;  4Q26 A;  2BV4 A;  1CAW A;  5A80 A;  1RUO A;  2VQ0 A;  2GU9 A;  1JU4 A;  1V6O A;  1JYV A;  1UNB A;  4NIA A;  4AHW A;  1JYN A;  3BUC A;  4NIG A;  1CD3 G;  1APN A;  1OFN A;  2QQN A;  1DYK A;  2HKX A;  2XBO 1;  1AXY A;  2RR1 1;  1KXG A;  2RS3 1;  4JRL A;  4BDV B;  3RNS A;  1HRI 2;  3NO8 A;  4COZ A;  2RM2 1;  3SH3 A;  4JZR A;  4DZG A;  2QJV A;  1SDW A;  5FYB A;  3VKN A;  1J58 A;  3EHK A;  2WFF 2;  1HKD A;  1GZT A;  3G7D A;  5H9P A;  4XUP A;  1OT5 A;  3RMX A;  3O0W A;  4CEW A;  5EYY A;  4HSL A;  1VR3 A;  1M06 G;  2VEC A;  1GLH A;  3E5X A;  5JPM B;  3A23 A;  1VBC 1;  4FSJ A;  1MVQ A;  5A7W B;  4P5Y A;  5A7N A;  3CDZ B;  5FAX A;  1BYH A;  5ABJ A;  1GBG A;  3J7M A;  3CBN A;  5FUI A;  2XJV A;  4H7M A;  3WNP A;  4NIH A;  2AYH A;  1W6M A;  3UKV A;  4XUR A;  5IFT A;  4XIK A;  2RMU 2;  4MG2 A;  3WCS A;  1ZRC A;  4LA3 A;  1EPZ A;  4P9W A;  1RUH 3;  2V4V A;  2WUH A;  3HJR A;  5KXB A;  4DUW A;  1FMD 1;  3WNO A;  5JOW A;  4LOS A;  4TLG A;  3KCC A;  3ZIW A;  4MV2 A;  3ZKY A;  2D7F A;  1UY2 A;  4RQP A;  2VMG A;  2WWJ A;  5EJZ B;  1LGB A;  1LHV A;  1NYW A;  2ZEZ A;  4OUM A;  4AVS A;  3RZK A;  3A21 A;  3E1F 1;  4Q0P A;  4Y1V A;  4ET7 A;  2ZEY A;  4F7Z A;  5CFC A;  4UYB A;  3T0D A;  2VCB A;  1C8N A;  1H2M A;  1VB2 A;  4MGI E;  2A6Z A;  3C7G A;  4OQ8 A;  3T2T A;  3OTF A;  4GKX A;  4OI4 A;  5DAV A;  2NN8 A;  2JIG A;  1GP4 A;  3MDP A;  4COY A;  3MBW A;  3CLP A;  3KV9 A;  3BOP A;  3M1H A;  4QB2 A;  4XBQ A;  1GZ9 A;  3PNA A;  4BE3 A;  4XEZ A;  4CEY B;  1LHO A;  2RS1 3;  4HG6 B;  1PO2 1;  4E8C A;  1PIV 2;  2A3X A;  2R04 1;  2PEL A;  4E2S A;  1ODN A;  3LA2 A;  1AZD A;  4NJ4 A;  5DQ0 A;  3N4M A;  4RN5 A;  1BK0 A;  2X05 A;  1AL2 1;  1HRV 3;  3VD7 A;  1YIF A;  3T08 A;  5C9A A;  1V9U 3;  2L9L A;  4O7X A;  5AVP A;  3NAP C;  2EXI A;  4A44 A;  2XJT A;  2WQZ C;  3I59 B;  5BXX A;  1NZC A;  1QQP 3;  3VBH B;  3WF2 A;  2VMI A;  1DQ0 A;  5FZO B;  3FFZ A;  3PDQ A;  1TQ5 A;  2R6Q A;  4SLI A;  2OUH A;  3ZFE B;  4C90 A;  4UFI A;  1PZ9 A;  1W9T A;  1UMI A;  4K1Z A;  5D21 A;  3V0B B;  3FBM A;  3AYE A;  2BZD A;  4EJR A;  3TEW A;  1CZT A;  2JD4 A;  5GJ6 A;  1I5P A;  1W6P A;  5A3L A;  1ZBE 1;  1ACC A;  3NKT A;  1W6Q A;  1RUF 3;  2DV9 A;  3LKJ A;  1RMU 1;  4XF3 A;  3ILF A;  5JOY A;  3OY8 A;  1X33 A;  2F4P A;  5IT6 A;  1RXG A;  1UX6 A;  4D0Q A;  5C4W A;  3ELN A;  4OHZ A;  1B09 A;  3ON7 A;  1L7Q A;  1W2U A;  4COW A;  4CP2 A;  4OUL A;  4FPG A;  3T1L A;  2WQ8 A;  3AXE A;  1SFY A;  2YYO A;  3WXP A;  1U5Y A;  4DQA A;  1S0I A;  4D3W A;  4JKL A;  2JKB A;  1JBC A;  2WBK A;  4UBH A;  3RZL A;  2CHH A;  3ES1 A;  4TZD A;  2NP0 A;  3I49 A;  4XF0 A;  5FP3 A;  2PMW B;  3MIC A;  1LES A;  5LY1 A;  3RWK X;  4RGA A;  4CVU A;  1OLQ A;  1HB2 A;  3JCI A;  5FUP A;  1W6M B;  4HKW A;  4D7S A;  3JXS A;  1A6C A;  1D4M 2;  3VKO A;  4XIL A;  1MEC 1;  1JUI A;  1VBE 2;  4K7J A;  1ULO A;  4HET A;  4AG4 A;  3U0Z A;  3OG2 A;  3ETQ A;  3UGF A;  2GSY A;  1O7F A;  2QZ2 A;  2A71 A;  3ZYH A;  4IV1 A;  3W5N A;  3OYW A;  2V72 A;  1G86 A;  4RQP B;  2JEN A;  1SLT A;  1XPW A;  3Q8B A;  1Q43 A;  2A75 A;  2IXC A;  2IZW A;  3SC7 X;  3TAY A;  1DIW A;  4LBQ A;  4XDP A;  3I2F A;  4AK3 A;  5M0T A;  1FOD 1;  4CEY A;  2VGD A;  1ND2 A;  1YO8 A;  2VOW A;  3I3Q A;  4PDW B;  1OQ1 A;  3WUD A;  4E8D A;  1H8V A;  1NA1 A;  4FPL A;  2CYF A;  5FZ4 A;  4HN0 A;  1PZ8 A;  3OCP A;  3L2Y A;  4XBL A;  5DAP A;  1FXZ A;  5FZE A;  5FYM A;  4GB3 1;  3LSD A;  2YU2 A;  2JG9 C;  1SBE A;  2GN3 A;  4MXW B;  3CZJ A;  2OVU A;  2WC2 A;  4AED C;  5FYS A;  3AC0 A;  1R1A 3;  4AHX A;  5EFU A;  3ZSE A;  3WDT A;  4B29 A;  3OBT A;  4FVV A;  3VBS C;  1VRB A;  2XWJ B;  1YYN A;  3PIJ A;  3RQ0 A;  4URT A;  3KSC A;  3GZA A;  3H7Y A;  3KT7 A;  2PA7 A;  3WNN A;  4KBZ A;  2RS1 1;  5CG9 A;  1W6P B;  3I2I A;  4HL0 A;  4YW6 A;  2EIE A;  4N9H A;  5IK8 A;  4ARY A;  5T5P A;  2OII A;  2QQJ A;  5A1A A;  2BNN A;  4XQ4 A;  5FZC A;  2P34 A;  4XJZ A;  4XUN A;  1ENS A;  3ZIX A;  4CE8 A;  3V0B A;  1RIR A;  4QM9 A;  2NZ9 A;  4FPF A;  1FYU A;  3VDC A;  2D5H A;  2WQ4 A;  2HH9 A;  1S0D A;  1OA4 A;  5CKM A;  2ARC A;  1ZX5 A;  5GZC A;  1GWK A;  4DNY A;  2JIJ A;  4FPE A;  3K2O A;  4QQH A;  2W9X A;  3D3A A;  1VMJ A;  3DYP A;  4DB5 A;  2OZJ A;  5CFD C;  3ZDS A;  3EMR A;  5T50 A;  4ISR A;  3V0A B;  2DTW A;  4OI0 A;  1G9B A;  2J1T A;  1GNH A;  1LEM A;  1POV 0;  1Y3T A;  3VDA A;  1PIV 3;  1ND3 C;  2YUE A;  1HB1 A;  2RS1 2;  2OW4 A;  3O14 A;  3FMG A;  3P1I A;  3KV4 A;  1WWY A;  2A1X A;  4Q0S A;  4JCK A;  4Y26 A;  4HKO A;  3RI8 A;  3VBF A;  3RWN A;  3I8T A;  5ANN A;  1EUT A;  5K0U C;  2QQW A;  4M3C B;  2OZ6 A;  4JX0 A;  1WMX A;  4AFB A;  5LK7 B;  4K8F A;  1W39 A;  4NRQ A;  5LY2 A;  3WOG A;  2QQU A;  3E6C C;  1C28 A;  3NV4 A;  2WDB A;  3AK0 A;  4EWD A;  2VZQ A;  4CCN A;  4MXW A;  4EYU A;  2FD8 A;  2ERF A;  2YPD A;  5BNO A;  1F5J A;  1CZS A;  2AC1 A;  2UU8 A;  2BWC A;  3FN9 A;  5T55 A;  5E8A A;  1UW8 A;  3N9L A;  4WM7 C;  2ILM A;  3R4U A;  1B35 C;  2HWD 2;  3HT1 A;  5A6Z A;  5DXD A;  3DYM A;  4KH9 A;  1AX1 A;  5FQ0 B;  4CUG A;  1SPP A;  2XVK A;  3AL5 A;  1MQT B;  3DL3 A;  4LMF A;  4CDQ C;  3WDU A;  2P3J A;  1DU3 D;  4NPM A;  4ORF A;  1Y9Q A;  2JXA A;  5DAB A;  1K5M C;  2WO1 A;  1MEC 2;  4PDW A;  1ZRD A;  4R9D A;  1ZZ6 A;  3VKF C;  2JDY A;  1D4M 1;  4AAX A;  4DMI A;  2PTM A;  1CPN A;  1KDK A;  5JXH A;  1U12 A;  3ILN A;  3MUY 1;  4LHS A;  4QPI A;  4JDM A;  4TSV A;  1O3Q A;  2VVE A;  1OA2 A;  4OCT A;  2R30 A;  4ERO A;  2ZGO A;  1JZ8 A;  5I0T A;  1DGW A;  1X9T A;  2VVD A;  4N43 B;  4JGY A;  3BU7 A;  2D97 A;  1GZW A;  2Q4S A;  3I2H A;  4Q1P A;  3POG A;  5FYH A;  2YY1 A;  2VQA A;  3RPQ A;  3K4A A;  2PHX A;  3AM2 A;  1W8W A;  3B5L B;  4N53 C;  1OH4 A;  5IFP A;  2BPA 2;  3T2P A;  2XJQ A;  4LIU A;  3T2O A;  1JZ3 A;  2ZAA A;  5L7O B;  1W9S A;  1YI7 A;  1AUY A;  4IW3 A;  5B4X A;  4Q29 A;  3WY6 A;  3MYX A;  2GN7 A;  1AYM 1;  1X9P A;  2JWP A;  1XE0 A;  3HIF A;  1KFU L;  5LB6 A;  2BTV C;  4AQ6 A;  2B9U A;  2KM2 A;  4QX5 A;  3C7H A;  4RQP C;  3E5U A;  2ZJC A;  1VBD 3;  1VE0 A;  4PJY A;  2BUK A;  3WNK A;  2O14 A;  5LBB A;  1S0B A;  5FZK A;  2X5I A;  1JMU B;  3ACF A;  5K4L A;  1QY4 A;  3RRD A;  4FOQ A;  4QPG A;  2WNV B;  4PQQ A;  4N90 A;  4QXB A;  1CON A;  4XF4 A;  4YVS B;  4YW4 A;  4BQ3 A;  4R9C A;  4BQX A;  2HWE 1;  3VB9 A;  1IS6 A;  1ULD A;  2YGM A;  2HWF 3;  4F83 A;  3I4I A;  2HYX A;  4NE9 A;  4Y5T A;  1GQH A;  5L73 A;  4Y1X A;  3VD4 A;  5C4W B;  2C1F A;  1PMH X;  1UWW A;  1SFN A;  3OBZ A;  4GWM A;  1PO2 2;  2TEP A;  2VPV A;  1DYO A;  4QKB A;  1QF3 A;  1C8M 2;  3VN4 A;  2BQP A;  1LED A;  1BQP A;  2D6O X;  2WA3 A;  2E6V A;  2CNA A;  5FCC A;  5FK8 A;  5LZ6 A;  5A6X A;  1SPP B;  5FMO S;  4FCA A;  4Y5S A;  4LO8 A;  1X82 A;  2OPW A;  1FNZ A;  1RUJ 3;  1W6N B;  1OOP C;  3ALQ A;  1ST8 A;  3I59 A;  1JYX A;  3I3D A;  2WT2 A;  4L99 A;  1CAW B;  4YW1 A;  3OF1 A;  3PMS A;  3OB8 A;  3PME A;  1PX3 A;  5DG1 A;  3N9N A;  2XJU A;  5LCW L;  3H7J A;  4IEW A;  1NCQ C;  4FFG A;  5FXW A;  1MQT A;  3KF3 A;  4B7E A;  4BQW A;  1D4V B;  1LOC A;  3OD0 A;  3O1R A;  1W0P A;  1XNK A;  3KB5 A;  4MUV A;  3M70 A;  2EAK A;  1PHM A;  4YG0 A;  5JR2 A;  2RMU 1;  5C71 A;  1V6I A;  1M4W A;  4BQ1 A;  4QQP A;  2ZGM A;  5CA6 A;  5GLZ A;  2C9K A;  2CY6 A;  1TNF A;  1TE1 B;  3SLI A;  5L9V A;  3S57 A;  1RUD 2;  4HLT A;  2JE7 A;  3NNF A;  3QH6 A;  1NQD A;  2ET7 A;  1UYP A;  1VBC 2;  2W2I A;  4HPK B;  5F7U A;  3JZV A;  1QJY 3;  3LDB A;  3ZFF A;  3VBS A;  1RUI 1;  3MPP G;  1XSR A;  1CWP A;  2AZ5 A;  3USU B;  2D6M A;  2WFF 1;  4ZPI A;  1UIK A;  4CDQ B;  2H6B A;  5FMC A;  2ENR A;  1Q8Q A;  2ZZQ A;  3MFA A;  4A42 A;  4D7Y A;  2VMF A;  2XJS A;  3UL2 A;  3I2D A;  1A3K A;  1HRI 1;  5CKQ A;  3PJQ A;  1LNS A;  2RR1 2;  2RS3 2;  1W8H A;  1FMD 3;  2JE9 A;  3ATG A;  5BNQ A;  1MEC 3;  3MW3 A;  1AYM 3;  1JHJ A;  5BNO C;  2Z69 A;  5FZM A;  3WSO A;  1RC6 A;  2DUP A;  1AR9 2;  1LCL A;  2C5D A;  1NY7 2;  1VBA 3;  2QCS B;  2ZGK A;  3D0J A;  4NHX A;  3VV1 A;  2WL1 A;  4FPC A;  2HWD 3;  2YHJ A;  4HZF A;  4AI3 A;  1HN0 A;  2LRO A;  1EAH 1;  3IWZ A;  3OGV A;  4XJ9 A;  1QOS A;  2PAK A;  4KL1 A;  3SKJ E;  2IUW A;  1JYI A;  1UXX X;  4Y1U A;  5BNO B;  4TYS A;  1SDD B;  2LS6 A;  2AEN A;  2ADE A;  1G8W A;  4YPJ A;  1AR8 1;  2H0B A;  2VXR A;  1LOD A;  3JU9 A;  3NVC A;  3TYJ A;  1O59 A;  1F15 A;  2RS5 3;  1H4G A;  4LO7 A;  3VBO A;  4CCL A;  3SHR A;  5JOZ A;  1XB9 A;  3O1P A;  5DZE A;  1YQ5 A;  2VQU A;  3AP7 A;  4UW3 A;  3IMN A;  4DXZ A;  1IPK A;  3ZFG A;  1ASJ 2;  2WZR 3;  1TME 3;  2XVL A;  4JGY C;  2VM9 A;  2OKX A;  4UFM A;  4XUO A;  5DUU A;  2WNU A;  5CIR A;  3WP4 A;  3DXU A;  1SLB A;  2PQQ A;  1GU3 A;  2BGP A;  2VVF A;  4G9S B;  1JI6 A;  3CJI C;  5DUV A;  2D93 A;  3EJK A;  5T5O A;  1PMJ X;  4LIV A;  1PVX A;  4ASK A;  3KM5 A;  5C70 A;  3ZM8 A;  4B4R A;  5KWR A;  5FRE A;  2HEW F;  4W8J A;  3R6S A;  3UKT A;  3INA A;  3A22 A;  1V0A A;  2JG8 A;  4BWO A;  1XND A;  2BOI A;  5C8W A;  3MIG A;  1ZYB A;  1TVG A;  1WA6 X;  3BPZ A;  4S2F A;  1A34 A;  2VC9 A;  2CWM A;  3O12 A;  5FO9 B;  4AVV A;  2JE8 A;  4PHZ A;  1RHI 3;  3JD7 3;  1COV 1;  1K45 A;  1NKG A;  3CNA A;  4IV3 C;  2IXH A;  5HCF A;  3LPG A;  4CPB D;  1I1E A;  3DEC A;  3VBF C;  5F1R A;  4XQW A;  3ZYI B;  2I07 B;  1GOG A;  2Q8E A;  2OQ7 A;  4P9L A;  1BBT 1;  5EV7 A;  3JBG 3;  4V2V A;  3U14 A;  4B8E A;  1HIX A;  3TEZ A;  3P5B A;  1QXR A;  4AFA A;  1W6O B;  4YGE A;  3D6E A;  2XHK A;  1RVF 2;  2NMO A;  3H9A A;  2Q1Z B;  1AR6 1;  1GZC A;  3VZM A;  4CRQ A;  3N3H A;  4OUE A;  1UY4 A;  5EJ1 B;  2VE1 A;  2XR4 A;  4CUA A;  3AL6 A;  5EHD A;  1WKY A;  1XBF A;  5E88 A;  1YFW A;  1SLC A;  4MYE A;  3RYK A;  5B4N A;  5JDB A;  1O6U A;  3WF4 A;  4NID A;  5KHI A;  2ZHN A;  1CX1 A;  4QM8 A;  5E89 A;  2WKK A;  5I8T A;  2WNE A;  3IT8 A;  3PHM A;  2BGO A;  4N9I A;  4QXH A;  5FFO C;  2JDH A;  4CDU B;  4GH4 B;  1QU0 A;  4CA9 A;  3POI A;  4L2N A;  4MOA A;  2WS9 1;  2QQV A;  1OF3 A;  4IL7 A;  1OLM A;  2BYV E;  1POQ A;  3GDB A;  4V1P A;  5HV4 A;  5FPU A;  4H55 A;  2HEV F;  4AQT A;  4W6Y A;  1OPM A;  1UU4 A;  3OBA A;  1S1A A;  1DLC A;  1NCQ A;  4SBV A;  1OKO A;  2C0Z A;  3H8O A;  4CEW B;  5GLU A;  1LOF A;  3R0R A;  5F2W A;  3IMM A;  3N9P A;  4AQS A;  1MVE A;  5FOJ B;  4JGZ C;  2XXZ A;  1W8Z A;  1MS9 A;  3TOJ A;  5FZ3 A;  1R09 3;  1STM A;  2ZX4 A;  3VZO A;  4QAW A;  4LBK A;  3ITQ A;  5FBZ A;  4LPL A;  2BW8 A;  1VAL A;  5T3N A;  3VBF B;  3BOW A;  2ZX0 A;  4HT1 T;  1CR7 A;  2FZ2 A;  3H42 B;  3TBD A;  4YW5 A;  4CDW C;  1H4H A;  3LDK A;  3N9Q A;  4WZC A;  2WWS A;  2VW1 A;  1BCX A;  2JG8 B;  1BXH A;  3AMP A;  4IE7 A;  4U36 A;  4WV8 A;  2J42 A;  3HQX A;  1ONA A;  1RUH 1;  1WW7 A;  1DG6 A;  3FL7 A;  3OGR A;  5ANQ A;  3HR9 A;  1LRH A;  4BB3 A;  2GC3 A;  3IN9 A;  1IHM A;  1Z7S 2;  4UXA A;  3LB9 A;  4B1L A;  5C3O A;  2FCT A;  4GMP 3;  3SNM A;  2XVG A;  3NNM A;  4RA0 A;  4AGG A;  2JEM A;  3MO4 A;  5IAV A;  1H0B A;  5TSW A;  2JB4 A;  4A2U A;  1B35 B;  1WUV A;  2WAA A;  3V0A A;  1W2A X;  4IE4 A;  2VAU A;  4LHN A;  5FZ7 A;  4AHZ A;  3RZJ A;  4NHY A;  5F3I A;  4DEV A;  5BV6 A;  4NWV A;  3H0O A;  4EV0 A;  1UIJ A;  4ITC A;  3I3E A;  4YVS A;  1RUE 1;  5FXZ A;  1C1F A;  2OYZ A;  2GME A;  1C5H A;  3M3I A;  2LAL A;  3FBY A;  5K8S A;  4NII A;  4A6O A;  3PUS A;  5IJR A;  3A0N A;  2O0O A;  3C7F A;  1C8M 3;  4HK8 A;  1S4C A;  4Q4V 2;  2P5B A;  5FPZ A;  4FXG B;  3HBZ A;  1DQ4 A;  3N9O A;  3JBG 1;  1IPS A;  4NHM A;  3H50 A;  1KDM A;  2V73 A;  1QOO A;  3AKS A;  4JQR A;  4IND A;  4I01 A;  1W99 A;  2VZO A;  1WW5 A;  2OQ6 A;  5DAQ A;  4KGQ A;  2MEV 1;  4YVW A;  5A3P A;  2AR6 A;  5BNN B;  2VME A;  1LTE A;  1UPS A;  1VBB 2;  3FUO A;  2WT1 A;  2VTX A;  5LWB A;  1YFX A;  1H30 A;  1CZV A;  5F3E A;  1XNC A;  4UF0 A;  1WMF A;  4AFC A;  1LR5 A;  3M3Q A;  3T0A A;  4P08 A;  1CAU B;  3OUJ A;  4I3G A;  1QJZ A;  2CAV A;  5J98 B;  2VCC A;  3NRU A;  5B2G B;  2CSG A;  2BBV A;  1Q56 A;  2PFW A;  2BDR A;  2X5I B;  2ZHK A;  1GZW B;  1BZW A;  3KHB A;  4CXW A;  2W92 A;  3AZX A;  2BWA A;  3ZXL A;  3HT2 A;  4HPK A;  3O7O A;  3I3M A;  2B7Y A;  2RE9 A;  2D40 A;  3WW3 A;  4IGO A;  4CU9 A;  5L19 A;  2ZKN A;  5F37 A;  1WGP A;  4Q4X 1;  4XOG A;  3OEA A;  5EZW A;  5CFD A;  5HI0 A;  3WZ1 A;  1MR5 A;  1R09 1;  3BVC A;  4LA2 A;  2OPK A;  2RDS A;  3SIS A;  3TB0 A;  2UUR A;  4EN7 B;  1WCK A;  4P9Y A;  3RMY A;  5C33 A;  2C9A A;  4YZ3 A;  1UZZ A;  3LEK A;  3B00 A;  5FY7 A;  2G9F A;  3T4V A;  4AYU A;  2ZMN A;  5CBL A;  2OT7 A;  2PYT A;  2LUW A;  4OZX A;  1SBF A;  3CO2 A;  4CDX A;  1YWK A;  1EV1 2;  1H1A A;  3ZO0 B;  4Q1R A;  4Q4Y 1;  3WDW A;  4LOT A;  1JOB A;  2PXJ A;  1S0F A;  4P5H A;  1LOF C;  3PJY A;  2D5F A;  4PBO A;  4TWT A;  3NV1 A;  2B45 X;  3ACG A;  1TMF 2;  2PLV 3;  3MPB A;  4TLF A;  5T54 A;  4BCU A;  1SQ4 A;  5F5Q A;  2QQL A;  4Y22 B;  4D69 A;  4IGP A;  4OHV A;  1H6X A;  2VZV A;  4AI2 A;  1O4Z A;  1X7N A;  2HWE 3;  3LF7 A;  4ONU A;  4XDO A;  4EN9 B;  3U4X A;  3J9S A;  1P8J A;  3OBR A;  4QPG C;  4YM3 A;  4XIO A;  2Q1M A;  1RUG 2;  4HBN A;  1I9R A;  3RYP A;  2IVI B;  3UV9 A;  2A6X A;  2I74 A;  3ABZ A;  1W2N A;  4RR3 B;  2XJR A;  4RS5 A;  4DY3 A;  5J36 A;  4NN0 A;  1S0G A;  2CAU A;  3PVO A;  5FY9 A;  4JKM A;  2ZEX A;  3BI3 A;  1VRH 2;  1JHN A;  4I0W B;  4Y1Y A;  1GWM A;  4RHV 2;  4NR1 A;  3WEZ A;  3WDX A;  4M3C E;  1QMJ A;  4FAH A;  3H3U A;  4LHL A;  2GNM A;  3NST A;  3SH5 A;  1URX A;  3HBK A;  4Q4V 3;  2WZR 1;  3ZLI A;  2O1Q A;  4LK6 A;  5CAZ A;  2H0V A;  1AYN 2;  2WZE A;  3UYJ A;  3CZU A;  5FP7 A;  3KHC A;  1K3I A;  2ZAC A;  2X53 S;  4QGN A;  1QJU 1;  3T0B A;  4R9A A;  4XYX A;  3DPR A;  1PO2 3;  2VNG A;  1W06 A;  1W8T A;  1X50 A;  2G4I A;  2FDG A;  3QLQ A;  2W47 A;  2HLE A;  1C3H A;  2W3J A;  3JB8 A;  4GXL A;  3HQU A;  4PCR A;  1UL9 A;  3TEY A;  5H9Q A;  2NLR A;  3AMH A;  3IDA A;  4UF0 B;  4CU6 A;  1G9F A;  5DAX A;  1OBN A;  1NA1 C;  4UWD A;  4RFR B;  3KCY A;  1OHF A;  3OPT A;  1GUI A;  1QOT A;  3OGJ A;  2DCJ A;  1OA3 A;  5CFD B;  2TUN A;  4XAC A;  3BB6 A;  4MXV A;  5F6K A;  3J8F 2;  4GJY A;  1IOA A;  1G9A A;  5JIU A;  1QH6 A;  2P3Y A;  3CHX A;  3LOB A;  1U5I A;  4QX1 A;  2YFU A;  2VNR A;  4C91 A;  5FLI A;  4NVP A;  4OVE A;  5K0U A;  1HXS 2;  4RR3 C;  4XFG A;  3TN9 2;  3WNL A;  1ZBA 2;  1CJD A;  4FXK B;  1UY3 A;  2W08 A;  1REE A;  3WX5 A;  4CDX B;  1BBT 3;  3H8U A;  1H2N A;  4XFB A;  3ZX7 A;  1S0C A;  1LOE A;  4BHP A;  1YI9 A;  5I0D A;  4XAE A;  4Y3O A;  3ZN5 A;  2ATF A;  4FFF A;  1W9Y A;  2PHD A;  1PMI A;  2CGO A;  3I2G A;  4WM7 B;  2BEO A;  4OI1 A;  4XFI A;  5D8A A;  2WII B;  4LE3 A;  4R9B A;  3VKL A;  1Z0H A;  2Y38 A;  1A78 A;  3WQ0 A;  1PZ7 A;  3OPW A;  1F4A A;  5DPN A;  4AI9 A;  3IDB B;  5AC9 3;  2HBU A;  1XSQ A;  2HWB 2;  3PVE A;  4AAP A;  3VZJ A;  1FNY A;  1KJR A;  3PU8 A;  4MGK E;  4LOR A;  5FUN A;  1PGL 2;  2LW8 A;  2VZ1 A;  2RVA A;  5JXG A;  3BN6 A;  3PUI A;  1LU1 A;  4ZXK A;  4AVT A;  1AXZ A;  3B94 A;  2VG9 A;  4PDW C;  1W3X A;  3KV6 A;  4NAM A;  3T3Y A;  2AGS A;  4IEZ A;  4K8R B;  2JDA A;  3K51 A;  4GD4 A;  3U1X A;  4CU8 A;  5FOB B;  2PHW A;  4DIQ A;  3FHA A;  3VBO B;  1PGL 1;  2OXB A;  5JMC A;  1A8D A;  2R07 2;  2ZGS A;  1I3H A;  4CEY C;  2IXK A;  5C3R A;  3OJB A;  4XAA A;  3T30 A;  4ZU7 A;  1US3 A;  2D98 A;  4ASL A;  5A33 B;  5CFC C;  2CTV A;  1S2E A;  2IXJ A;  3LGR A;  4CP1 A;  1UOG A;  3PUH A;  4GUL A;  4BXF A;  5JSO A;  5A32 B;  4J1X A;  3GCX A;  5IK4 A;  2KD7 A;  5FXV A;  4CDX C;  4I30 A;  1YFY A;  2GAU A;  2XWB B;  4M00 A;  1RJ8 A;  2RJK A;  4IDZ A;  2JDU A;  4YYO A;  5C8C A;  1RUF 2;  3HN3 A;  2R04 3;  4L97 A;  2WNU C;  3TN9 1;  2OS2 A;  2VW2 A;  1HXS 1;  4BZ4 A;  3KQR A;  4K20 A;  1N1T A;  1UD1 A;  3KCX A;  1FAY A;  2QQI A;  3TNQ A;  4BM8 A;  2D6K A;  4UW5 A;  3ZFF C;  5A3T A;  2E32 A;  2GNB A;  3HNM A;  2DUO A;  5FYC A;  4XUQ A;  1PNG A; 
#chains in the Genus database with same CATH homology
 4OMD A;  1PMH X;  1UWW A;  4TXW A;  2EID A;  1JZ5 A;  1DYO A;  1UY0 A;  1TG7 A;  2J1R A;  3K77 A;  2W1S A;  4ZXE A;  3III A;  2EIC A;  1CIY A;  2QQM A;  2QQK A;  4PF1 A;  4ZZ5 A;  4KI5 M;  1W0N A;  2W1U A;  1BHG A;  2J22 A;  2WO3 A;  3I3D A;  1GOF A;  1JYX A;  2QQO A;  2V5D A;  4LQR A;  3OB8 A;  2VZU A;  1PX3 A;  2J1A A;  5LCW L;  1GNY A;  4M4R A;  1K12 A;  4KMQ A;  2CDP A;  3CKH A;  2W95 A;  5JR2 A;  5C71 A;  2WYS A;  2C9K A;  3HPN A;  1MPX A;  3BGA A;  4JKK A;  4GWI A;  5F7U A;  4CUB A;  3I2K A;  1NX9 A;  3MV0 1;  4A45 A;  1UMH A;  2VMD A;  2J1E A;  2C4X A;  1ULP A;  4QB6 A;  5EIY B;  2EIB A;  3MUZ 1;  4A42 A;  4BK5 A;  3WF1 A;  3J7H A;  2VMF A;  3LPF A;  1KGY A;  1O8S A;  3THC A;  1J84 A;  1LNS A;  2B9V A;  1UX7 A;  2VO5 A;  3A7Q A;  2VR4 A;  3IAP A;  1JHJ A;  4ZY9 A;  3WSO A;  2BBA A;  1GMM A;  1W9W A;  3SEP A;  2VZT A;  2B4K A;  1K42 A;  3K75 B;  1L7R A;  4A4A A;  1D7P M;  1XNT A;  3SKJ E;  1NAE A;  2E31 A;  2W1W A;  2J1U A;  3OGV A;  1UXX X;  2XOM A;  1SDD B;  2WN3 A;  2LS6 A;  2DDU A;  3MV1 1;  1JZ6 A;  4YPJ A;  5IHR A;  4XUT A;  5LA2 A;  1O59 A;  3U37 A;  3VD5 A;  3LE0 A;  1XNA A;  5JXJ A;  2VQU A;  4D8M A;  5CYY A;  3K4Z A;  1JZ2 A;  3C8X A;  4XUQ A;  2WZ8 A;  1HN1 A;  2VM9 A;  2OKX A;  1H6Y A;  4XUO A;  2YC4 A;  3W5M A;  5IYY A;  2DCK A;  1GU3 A;  2BGP A;  5JXI A;  1JI6 A;  4GZ9 A;  2VZP A;  3LEI A;  1PMJ X;  5C70 A;  3ZM8 A;  1F4H A;  4ARX A;  4W8J A;  2Y6J A;  4A41 A;  3A22 A;  3LEG A;  3CIH A;  3NQH A;  1TVG A;  1O8P A;  2VC9 A;  3K4D A;  1XC6 A;  5HXM A;  1OD3 A;  2JE8 A;  3C7E A;  1K45 A;  1NKG A;  3VD3 A;  1UYX A;  3LPG A;  4DUX A;  3DEC A;  2VTF A;  4OYU A;  1SHW B;  1GOG A;  3THD A;  2VJX A;  3I97 A;  3LQC A;  3CMG A;  3ETP A;  4UOJ A;  4OUE A;  1UY4 A;  5EJ1 B;  1JU4 A;  1JYV A;  3HOB A;  4BJ0 A;  2C26 A;  4CUA A;  1JYN A;  1WKY A;  2QQN A;  2RV9 A;  2PQS A;  3WF4 A;  1CX1 A;  3SKV A;  4BDV B;  2Y6G A;  2VMC A;  2BGO A;  1OF4 A;  3IAQ A;  4MOA A;  4QDS A;  1UYZ A;  5CZK A;  3CQO A;  1OF3 A;  5C7G A;  4XUP A;  1OT5 A;  3GDB A;  4RYD A;  3OBA A;  2W1Q A;  3A23 A;  1DLC A;  4P5Y A;  5J1X A;  3CDZ B;  4BK4 A;  5FUI A;  2VCA A;  3WNP A;  4XUR A;  5IFT A;  1JZ7 A;  2QBX A;  4TTG A;  4CUC A;  4QAW A;  3WQB A;  2V4V A;  2WUH A;  3HJR A;  4LPL A;  4DUW A;  3WNO A;  3WNM A;  2ZEW A;  1UY2 A;  4W50 A;  4Z2A A;  4KWU A;  5JMO A;  5EJZ B;  2J1S A;  4QX0 A;  2ZEZ A;  1R64 A;  3EYP A;  4CU7 A;  3A21 A;  3EB7 A;  3E1F 1;  3FL7 A;  3OGR A;  4DXS A;  4ET7 A;  2ZEY A;  4P00 B;  4LKS A;  5JUV A;  3NJV A;  4UAP A;  3T0D A;  2VCB A;  2YFZ A;  3C7G A;  3SEE A;  2J7M A;  3MO4 A;  4ZZ8 A;  2WAA A;  4QDR A;  2CDO A;  1W8O A;  2W87 A;  3MBW A;  3ACI A;  4IUG A;  4QB2 A;  4QPW A;  4DEV A;  3I3E A;  4HG6 B;  4E8C A;  2VZ3 A;  5DQ0 A;  4A6O A;  4RN5 A;  2X05 A;  5IJR A;  3VD7 A;  3T08 A;  3GM8 A;  1GOH A;  3C7F A;  3K46 A;  2L9L A;  4A44 A;  5B4N A;  3FHQ A;  2VQT A;  5G05 L;  3WF2 A;  2ORX A;  2W91 A;  2ZXQ A;  1W9T A;  1UMI A;  2XON A;  2BZD A;  1CZT A;  1W99 A;  2VZO A;  1I5P A;  4GWJ A;  4DEQ A;  2W5F A;  2VME A;  4FI9 A;  2WN2 A;  2VZR A;  1UY1 A;  4MO3 M;  2JKX A;  4D0Q A;  3P6B A;  1L7Q A;  2JD9 A;  3WF3 A;  1CZV A;  2WQ8 A;  3T09 A;  4JHZ A;  1SG3 A;  4UI9 L;  3T0A A;  4P08 A;  4JKL A;  1UYY A;  2WBK A;  2VCC A;  2YC2 A;  3NRU A;  2YB7 A;  1YQ2 A;  1RYY A;  3UES A;  3UNP A;  2W92 A;  4CVU A;  1EUU A;  3JXS A;  2RJ2 A;  4XVH A;  3GGL A;  4AG4 A;  1ULO A;  4CU9 A;  4A3Z A;  2WO2 A;  3OG2 A;  3OEA A;  2YG0 A;  3W5N A;  2V72 A;  1XPW A;  2Z4F A;  2E33 A;  3I2F A;  3LEK A;  4E8D A;  2XHN A;  3GXU A;  4MGQ A;  3VD9 A;  3CZJ A;  4XZU G;  2Y64 A;  4OMC A;  2ORZ A;  3AC0 A;  3ACG A;  2W46 A;  2QQL A;  1JYW A;  2X10 A;  2BER A;  4MGS A;  4QX3 A;  1H6X A;  2VZV A;  4BXS V;  1P8J A;  3WNN A;  2X09 A;  3ABZ A;  2W94 A;  3NJX A;  3I2I A;  2EIE A;  4JKM A;  2ZEX A;  4M4P A;  2WAO A;  3WEZ A;  4ARY A;  5A1A A;  2QQJ A;  5G04 L;  2VL4 A;  4OZO A;  4QX2 A;  4XUN A;  1WCQ A;  5LA1 A;  2J1V A;  4QB1 A;  3VDC A;  1IQD C;  3DYO A;  2WZE A;  4DXT A;  3CZU A;  1K3I A;  3WF0 A;  2W9X A;  3D3A A;  3DYP A;  3T0B A;  4DXR A;  3F2Z A;  1J83 A;  2J1T A;  2Y6H A;  3VDA A;  2W47 A;  3P1I A;  2HLE A;  2W3J A;  3IDA A;  1NUK A;  4CU6 A;  1EUT A;  2Y8K A;  1GUI A;  2DCJ A;  4JX0 A;  3OGS A;  5DN2 A;  2XQX A;  2WDB A;  2E26 A;  2VZQ A;  3I3B A;  3ECQ A;  1US2 A;  4QX1 A;  2YFU A;  2R7E B;  4W4Z A;  3WNL A;  1CZS A;  1PX4 A;  1UY3 A;  1KEX A;  3FN9 A;  3HNY M;  3HNB M;  3OEB A;  3VDB A;  5I0D A;  2ID4 A;  3DYM A;  4L0P A;  3I2G A;  3NNG A;  1T2X A;  1JU3 A;  1F4A A;  5DPN A;  2WO1 A;  3ACH A;  1UXZ A;  4AAX A;  5JXH A;  3MUY 1;  1DP0 A;  4LHS A;  2LW8 A;  2VZ1 A;  2RVA A;  5JXG A;  2VOT A;  1JZ8 A;  3BN6 A;  3PUI A;  3HEI A;  1JZ4 A;  5HPO A;  2WAB A;  3I2H A;  3UET A;  2VZS A;  2JDA A;  3K4A A;  4CU8 A;  3FHA A;  1OH4 A;  2Y6L A;  2Y6K A;  3T2P A;  5IFP A;  4MAD A;  3T2O A;  1JZ3 A;  1W9S A;  5DMY A;  5B4X A;  1W8N A;  1US3 A;  3T2Q A;  4P02 B;  1UZ0 A;  3PUH A;  4DUV A;  3C7H A;  2KD7 A;  1GQP A;  3WNK A;  3C7O A;  4QDQ A;  3IB3 A;  5LA0 A;  3HN3 A;  3ACF A;  4PQQ A;  2QQI A;  2E32 A;  3HNM A;  3I2J A;  2HYX A;  4PT6 A;  3VD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...