2WO1A

Crystal structure of the epha4 ligand binding domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
183
structure length
180
Chain Sequence
ETGEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKRTKHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Plasticity of Eph-Receptor A4 Facilitates Cross-Class Ephrin Signalling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords EPHRIN TYPE-A RECEPTOR
total genus 34
structure length 180
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wo1A00
1JHJA 3VD9A 2W5FA 4QPWA 5IJRA 4JKLA 3ACGA 2BGPA 1OD3A 1WCQA 2V72A 4CU7A 5HPOA 2W87A 4YPJA 2BBAA 2W95A 3MUY1 4PQQA 4QB2A 4E8CA 3MV11 3DYOA 5DMYA 1GUIA 2WQ8A 2XQXA 5EJZB 4IUGA 2VZTA 3T0AA 3I2HA 1PX3A 2VZRA 4TTGA 3T08A 2W46A 3WNKA 3UESA 2EICA 4UI9L 1P8JA 1L7QA 2QQMA 3U37A 2E33A 3MO4A 4P00B 3W5NA 2Y6HA 3WF3A 3D3AA 4P02B 2J1TA 5G05L 1OH4A 4BXSV 1L7RA 3VD3A 1UYZA 2E26A 5I0DA 1CIYA 3WNLA 2ZEZA 2VR4A 4PT6A 3MUZ1 3K4DA 2JKXA 1W8NA 1JYNA 1ULOA 1CZTA 1OF4A 4GWIA 4ET7A 3THDA 1W8OA 2E32A 2W92A 4CU6A 4CU8A 1W0NA 3K46A 3C7OA 4GZ9A 2X10A 5JMOA 4DUXA 3IAQA 4OUEA 3LEKA 2W91A 3A7QA 5CZKA 3VDAA 3C8XA 2W9XA 2WZEA 2JD9A 4RN5A 3ACHA 2VJXA 2ID4A 4MGQA 3WF2A 4W8JA 4LHSA 5B4XA 2J1AA 4P08A 1W99A 4QDSA 4A4AA 1K12A 5JUVA 3UNPA 4CUCA 3SKVA 3WF4A 4DUWA 2RJ2A 3A22A 1UZ0A 1LNSA 1GNYA 2EIDA 1JU3A 1GQPA 3I3DA 4XUOA 5IYYA 5F7UA 4TXWA 4ZZ5A 1NAEA 2PQSA 1CZVA 3IDAA 3T0DA 5CYYA 1UMIA 2X09A 3NNGA 5A1AA 3GXUA 4FI9A 4JKMA 2DCKA 3FL7A 5JXGA 4JKKA 3OGVA 2VOTA 2WO3A 2JDAA 4D0QA 5DQ0A 2YC2A 2HYXA 2VCCA 3NRUA 1NUKA 1JI6A 2W47A 4RYDA 3WNPA 1UMHA 3CMGA 4W4ZA 1PX4A 3I3BA 1JZ6A 2VZSA 3LPGA 2VTFA 2W1QA 2Y6GA 1W9SA 5C7GA 3JXSA 2WN3A 2VMCA 3WEZA 1D7PM 1JZ8A 4QB1A 1RYYA 1NX9A 2DCJA 3J7HA 3UETA 3CKHA 2V5DA 3HPNA 3WNOA 4DEQA 2ORZA 4OMDA 1I5PA 3WQBA 1WKYA 2ZEYA 3CDZB 4XZUG 1JZ4A 2QBXA 3T0BA 3HN3A 3OEAA 3I3EA 1UWWA 3F2ZA 3ABZA 3SEPA 2XONA 2VZOA 3CZJA 5JR2A 5JXIA 2VO5A 3EYPA 3NJVA 2VL4A 4W50A 2J1RA 2LW8A 4P5YA 3FN9A 3MBWA 3VDCA 4KI5M 2R7EB 4CUBA 1OT5A 1TG7A 1K45A 4ZXEA 2VC9A 2VZ3A 2WZ8A 1SG3A 3I2IA 3OBAA 3T2OA 2W94A 2L9LA 4PF1A 1W9WA 1US3A 1DLCA 4AAXA 1T2XA 1K42A 1CZSA 1GOHA 5G04L 3WNNA 2C4XA 2BZDA 5C70A 1UY1A 2Y6KA 3C7HA 2Y6LA 1O59A 3HNMA 3LQCA 1W9TA 3BN6A 2W3JA 5EJ1B 1UY3A 1GOGA 3I2GA 3T2QA 4E8DA 2EIEA 1ULPA 1NKGA 2X05A 3A23A 3I2JA 3VD5A 2XOMA 1XNTA 1O8SA 4XUQA 4HG6B 1XPWA 1J84A 3C7GA 1IQDC 1F4HA 2YB7A 2BERA 1KGYA 4AG4A 1YQ2A 2QQLA 1UXXX 1SDDB 2WAAA 3SKJE 1OF3A 4QDQA 3HOBA 3NQHA 3AC0A 3IB3A 4XUNA 4ZZ8A 4ARYA 3ZM8A 1BHGA 2VCBA 4ZY9A 3GGLA 3W5MA 2E31A 4QX0A 3C7EA 4JHZA 4A41A 4Z2AA 3VDBA 2J1SA 2ORXA 5DPNA 3DYMA 5J1XA 5LA2A 2ZEWA 1K3IA 5IFPA 3WF1A 4BK4A 1JZ2A 2J1EA 2V4VA 4QAWA 1DYOA 2J1UA 3IIIA 3ACIA 3OG2A 2VMFA 3MV01 5IFTA 2EIBA 4QX3A 1JU4A 1JZ3A 2KD7A 1CX1A 4GWJA 1JYWA 2ZXQA 1O8PA 4DXTA 2W1SA 2LS6A 2CDPA 2J7MA 1JYVA 3C7FA 1H6YA 5DN2A 5LA1A 3CZUA 3GDBA 2WABA 2J1VA 3NJXA 2HLEA 4A42A 3ECQA 4KMQA 1US2A 4MOAA 3PUHA 2WUHA 3OGRA 4BK5A 1GU3A 1UYYA 2J22A 3SEEA 2VCAA 3P6BA 1UY0A 4DUVA 1SHWB 3THCA 1DP0A 2WDBA 1XNAA 4QB6A 4DXSA 2WO1A 3E1F1 2BGOA 3HJRA 3CIHA 3ACFA 4XVHA 4UOJA 3I2KA 1UYXA 2VM9A 2OKXA 4M4PA 4UAPA 5IHRA 3K4AA 3FHAA 2W1WA 3I2FA 1UX7A 1GOFA 2YFZA 4LQRA 2QQKA 2C9KA 5LCWL 3T2PA 3FHQA 4A3ZA 2C26A 2QQOA 4DEVA 2VMDA 2VQTA 3GM8A 2W1UA 4ARXA 1UY4A 2ZEXA 3CQOA 1J83A 4L0PA 2QQJA 2YFUA 2YG0A 3I97A 2QQIA 1UXZA 1TVGA 3LPFA 4DXRA 2WBKA 2Y6JA 1UY2A 2Y8KA 4KWUA 3DECA 4QDRA 1JYXA 1JZ5A 2VZUA 3VD7A 4JX0A 3PUIA 2VZVA 4A6OA 1XC6A 4XURA 3EB7A 5JXHA 3ETPA 4MO3M 2B4KA 3K75B 3T09A 3WSOA 2B9VA 2JE8A 4A44A 3HNBM 2YC4A 2Z4FA 4QX1A 1F4AA 3A21A 4CVUA 2RV9A 5HXMA 4QX2A 1JZ7A 4MGSA 3LEIA 4OMCA 4A45A 3IAPA 5B4NA 1MPXA 2VZ1A 2XHNA 5C71A 3WNMA 4D8MA 2VZPA 2WYSA 2WN2A 3K77A 1EUTA 3VD4A 2QQNA 4OZOA 3OEBA 1PMJX 4BDVB 3BGAA 3OGSA 3LE0A 4CUAA 2VZQA 4LPLA 5FUIA 4OYUA 4LKSA 2RVAA 1KEXA 4BJ0A 4XUPA 3K4ZA 3DYPA 2VQUA 2DDUA 3P1IA 4MADA 1HN1A 3HNYM 5JXJA 1R64A 1EUUA 3HEIA 4CU9A 3LEGA 4M4RA 1H6XA 3OB8A 4XUTA 2WAOA 1GMMA 2VMEA 2Y64A 3WF0A 1PMHX 2CDOA 5LA0A 2WO2A 5EIYB
chains in the Genus database with same CATH superfamily
4LIVA 2JJ6A 4RS5A 1OPOA 1W8UA 5K0UA 5BUVA 1Q8PA 5FWJA 3AKPA 4GULA 5ERLA 1SZBA 2RS13 4IV1A 4JKLA 3VBOC 4Q4Y1 1COV1 4IGOA 1Z7S3 1G9DA 3N9OA 3ACLA 4D69A 2ETEA 2A3XA 3RZKA 3O14A 2DCTA 4Q0VA 5IW0A 4KQ7A 3ZR5A 4AAPA 2W87A 4YPJA 2BBAA 2CHHA 3MUY1 4QB2A 1COV3 3I3MA 1UQXA 1LHWA 1DYPA 1PVC2 3KMHA 4E8CA 2DVAA 2IC1A 5JSOA 4P9LA 4UW5A 2HBUA 2XQXA 3OGGA 5EJZB 4DFSA 2FCTA 5I0TA 1T6GC 2PQQA 1QWRA 1YLLA 4N43C 1ND2A 5A7WA 4LKEA 3T0AA 3U10A 4BLIA 2TBVA 4BE3A 5IVYA 3J9SA 3O12A 2Q8CA 3SXWA 4LKFA 3VBUA 3VBHC 3VV1A 5FZ9A 3TEYA 5C3SA 1TZOA 4J6GA 3SMHA 1DHKB 4BA6A 1IOAA 1KXGA 4NR1A 4GD4A 1DU3D 1AR62 3MLJA 4IEVA 1O4ZA 4UI9L 5FMDA 2TEPA 3HBZA 5CG9A 1L7QA 2BNOA 3U37A 1W6QA 2E33A 2HH9A 4HZFA 4UFLA 5A80A 1XE0A 2CWSA 2OX0A 3RG0A 4ASKA 3WF3A 5JI9A 3KT4A 4G9SB 4HANA 1LHOA 1KS5A 2K2SA 2FHRA 3WDWA 2DUQA 4DS0A 4M3CE 4COVA 2HWE1 1WW6A 5BNNC 3ZKUA 5SV8A 2MNGA 3VD3A 2W68A 4IERA 5JI7A 3MLKA 4AFDA 2P3IA 5FMOL 4YW2A 3WNLA 3CNAA 5FOJB 4GIQA 4PT6A 1QXRA 3ZMOA 3WUCA 2W2IA 2R6QA 1TMF3 3OY8B 2VNOA 1WBFA 1O3QA 3MFCA 5A6QA 1OA2A 2FDGA 2VU9A 1CPMA 2BFUL 2BGCA 4FXKB 2D5HA 5CAZA 1OF4A 1AYM1 1YJLA 2CAVA 4PJYA 4QXCA 5KC5A 1D2SA 4BZ4A 1FV2A 4UFIA 5GKAC 1G9BA 2RE9A 1IS4A 4AVVA 4EQVA 5A3UA 4WM8B 3UK9A 3VKOA 2KM2A 4MGYE 1BXHA 2VVEA 2XLAA 2X10A 3NAPC 4XDPA 3IAQA 4OUEA 4XF1A 2V09A 2WNUB 3J26N 1BVP1 1W2OA 3PTYA 2BP6A 2GC3A 1GR3A 3A7QA 4BQ1A 5L9BA 2XKPA 4K1YA 4R8HA 1YFUA 1RIRA 4XFAA 1UNBA 3ACHA 2C0ZA 3GHNA 1DG6A 1EP0A 1W6PA 4IEXA 2I74A 4MGQA 1GP6A 2WSUA 1W06A 2JXAA 3IZOA 2B7YA 1K12A 1VP6A 5BV6A 3UNPA 1ENRA 4HPKB 1H8TB 3CJIC 3E5UA 4XE9A 3POEA 3VBHA 2MEV1 3DL3A 4FPKA 4HK8A 3ZFFB 2QUOA 3ME2A 3PURA 2QDRA 3U4SA 4KGQA 2HWF1 5A33B 4CEYA 4CE8A 1POV1 2WIIB 5ABJB 3MW3A 3WG4A 5F7UA 1N1YA 1NAEA 2EF6A 2H0VA 3LSDA 2FBEA 4G4FA 2PQSA 1CZVA 3IDAA 1QJX3 4NJ4A 3HQUA 3GBWA 3KF5A 4RD7A 2DCYA 2IFWA 2NQYA 2HWB1 1UZVA 3ZFGA 1FOD3 1RITA 3SISA 1Y4WA 1IZ3A 1QMJA 4OQ9A 2GC1A 1HB2A 4D0QA 1PGL2 2HYXA 2VCCA 3NMBA 5C8CC 1O3SA 3NRUA 3ITQA 4RFRB 3APBA 3WNPA 3SQOA 2WKKA 4HONA 2D6PA 2X8KA 4K21A 1LKNA 1IPJA 1S0EA 4W4ZA 1LGBA 1CJPA 2VZSA 1CR7A 3AMQA 4MHUA 4XCAA 4JV4A 4AI2A 2VAUA 1YFYA 2VTFA 4EROA 4FBFA 2Y6GA 1HRV2 2JB8A 3VBSB 4ASMB 1V9U3 2ADEA 4H7LA 1YYNA 2C24A 1W3VA 2JDYA 2MEV2 1OLRA 1D7PM 3GNEA 4FXGB 1JZ8A 1WD3A 2DYCA 1WW4A 4Z92B 2EA7A 1YIPA 2DBNA 5LATA 4GH4B 2VW0A 4DEQA 3PIGA 1PM4A 1XOYA 1H2MA 3GZUC 3O0VA 1ND2C 1WKYA 1X82A 1YFXA 3POFA 4YM0A 2ZEYA 2CTVA 4XZUG 5CVRA 3IPVB 3T0BA 3SNMA 3AJYA 2DF7A 1A6CA 2ZMNA 5F39A 3SEPA 3ES4A 4DZGA 1VRH3 3BYWA 5FMCA 3AKSA 1S0FA 2VO5A 4HT1T 4MGTA 1H2LA 3NJVA 4W50A 3H0OA 2FQPA 2E63A 3VBFA 4C1WA 3FLPA 4TSVA 4NROA 4C8DA 3MICA 1GBGA 4KI5M 4CUBA 1OT5A 4BISA 1NG0A 2JWPA 2CGPA 1EPWA 3TN91 2VBBA 2V4AA 1F9KA 2GALA 2K9ZA 2VZ3A 2VC9A 5DAVA 3VHRA 3AMMA 3I2IA 3OBAA 4I0WB 5KHIA 4TYSA 4CCDA 4AI3A 3P5BA 4IEQA 5GLVA 4RHV3 1JN2P 1LRHA 4YVWB 1DLCA 4AAXA 2PHRA 4L97A 4W6YA 2W39A 3JU9A 1YHFA 4WM7B 2G9ZA 1UOGA 5G04L 3ENRA 3WNNA 4BIOA 1JODA 3NWKA 4COWA 1LOEA 2A6YA 3TEXA 3LWCA 4B3NA 2XVLA 3VKMA 3PUAA 3KGZA 5CKNA 1LR5A 4S2HA 4IXLA 3I49A 2JICA 3HNMA 4Y20A 3LQCA 4IW3A 2B42B 1VBA1 4LLOA 3RYKA 4CUGA 1UY3A 1MS4A 2A6XA 2DFBA 3T2QA 4G3YC 1ULPA 3O1TA 2X05A 4AK3A 1O7FA 4BWOA 4IEPA 1RGSA 1S4CA 1OLQA 1VAKA 4LOSA 1XNTA 1DGWX 1XPWA 4NPMA 2VMHA 4XAAA 1RVF1 3T2TA 2JG8B 3R4DB 3VBSA 1Q8QA 1ST8A 3UGHA 4YGEA 5C3PA 2BERA 1YEWA 1JYIA 1LENA 4R9BA 4UBHA 1DQ5A 2Z5WA 1QY4A 1MZFA 3GF6A 2EALA 4K20A 3RVHA 3CLPA 1ZZCA 1Q3EA 2VMIA 4HXCA 4E4ZA 1QDOA 4Z2WA 5FYHA 3OUJA 1W6MA 4QHOA 3LAGA 4W6XA 4YW5A 3UT0A 4R9CA 4QDQA 3W20A 4OUMA 3VUOA 2VD7A 2JE7A 2HBTA 4QPGA 3IDEA 3NQHA 3BIEA 4YW4A 5FWEA 4ARYA 1V6KA 4XQDA 5FJKA 2VCBA 1RMU1 4L8QA 1H8VA 3JD73 3VKNA 4Q4Y2 4NPLA 4QX0A 4NO4A 2JDPA 2J1SA 2DVBA 3OBZA 1KJRA 2OUHA 3AP5A 2FDJA 4Y22A 5J1XA 4IEOA 5LA2A 5CFDA 4YFZA 3T4VA 5AC93 2A75A 4KGGA 4PI2A 1UYPA 4FFGA 3ASIA 5JOXA 1POV0 1LOBA 3J7NA 4QKDA 1V6OA 2NLRA 4LNVA 1DYOA 1W0OA 2R073 2ZHMA 3ACIA 4XF9A 4E2GA 2WLQA 2R062 3V0AB 3OSDA 1X33A 2BV4A 2PHWA 1JU4A 4IE6A 4U2AA 3B3QE 5FZMA 4WM7A 2KD7A 4RL7A 5FIXA 5J48A 4PLMA 2FMDA 1SFPA 2QQVA 4GMP3 3AZYA 4CCMA 1NCQB 3V0BA 1XBFA 1W6OB 4MHRA 2AH2A 1O8PA 1O5UA 2G9FA 4GWNA 5FCCA 3KLSA 5DUWA 2GC0A 2J7MA 3FWEA 1WA4A 2WC2A 3QBQA 4JQTA 2PMWB 1J1TA 5LA1A 3RS6A 5KR7A 2WABA 4Q26A 2HLEA 2LTNA 2WA3A 3J8F1 2PHDA 4XF3A 3S6PA 2RMU3 3IKWA 4B7KA 2YBPA 2ZGKA 2X5IA 1JOJA 3D4KA 2BEOA 4XJAA 1W28A 1ND3C 2Z42A 5DUXA 1Y7BA 4KG8A 4HBNA 2D6OX 4PDWA 3AYEA 2OPWA 3N7KA 4KG0A 2XMLA 1C28A 2R041 4H7MA 1CVNA 3Q8EA 1GU3A 3UYJA 1UYYA 4P5HA 2EAAA 1JMUB 2IVJA 3I59B 1ULEA 5L9RA 2J22A 3IWZA 1K5MB 1XB9A 5FXXA 5C9AC 3SEEA 1QDCA 2RJLA 2TNFA 2VCAA 1UZYA 3KQRA 5FPLA 4IE5A 3IMMA 2ZS6B 4P9WA 4A7ZA 3THCA 5GZEA 1XNAA 5C4WA 4EN9B 3ZX7A 1AR91 2P6CA 3DF0A 4C1XA 2IUWA 3E5QA 2WNVA 4CCNA 1Q8OA 1XYNA 1J58A 1OSGA 1VBC3 4AI1A 5LY1A 3TEZA 2YBSA 2QDNA 4TLGA 1QXPA 5FYVA 4BU2A 4IQPA 4UOJA 5HCFA 3B02A 5FZOB 2X5IC 3A0KA 5LEJA 3WCRA 3NV3A 4NHXA 5FP4A 5IHRA 4Q4W2 2DTYA 5FY9A 4CXWA 5FO9B 4NUBA 4C0HA 2JDUA 1GOFA 5FYYA 1OKOA 4UT5A 3UJOA 4BHPA 4IEUA 1BQPA 2YFZA 3RYRA 3OBRA 3MIEA 1A34A 2YV8A 5EPAA 2ZOEB 3ZXFA 3LEMA 4DEVA 2PAKA 1TMF2 3CJIB 5GM0A 2WYFA 1C8NA 3R6SA 5FY8A 4ARXA 4FTSA 5CKQA 5FMOS 4NIHA 3CQOA 5A7PA 3AL5A 5FXWA 1AL23 1ZBE3 3WQ0A 3ZYJB 3K2OA 1UKGA 1QH7A 3I97A 2QQIA 3MIDA 5GALA 4Q4W3 5JAXA 1C1LA 1HRI3 1UY2A 1YI7A 2GDFA 4JAAA 4I02A 5FXZA 3UJQA 3V65A 3VBFB 2XJUA 2QTWB 3GZEA 2XHKA 3U11A 4Q4V1 2OS2A 4HMZA 1SACA 4JTNA 4QGLA 1XXNA 3JD71 2VZUA 4UF0A 4JX0A 1OHFA 1S0GA 4UW6A 5F2WA 3PUIA 4BQ5A 1YQ8A 2ZGQA 3GZTB 4YGCA 2HWB3 1B35A 4EZHA 4V2WA 3EB7A 1YQ6A 1SLCA 3ETPA 1RMU3 1UU4A 3K75B 1YQCA 3E6BA 2B9VA 2JE8A 1HXS2 3HQXA 3WSOA 2NMOA 3KVBA 4LHLA 1F4AA 3A4UA 2RDNA 1VRBA 2FZ1A 2JG9C 4IV3C 3GBFA 4YVWA 4WZCA 1ZVFA 1JOBA 1QJFA 1R082 4LA3A 1QQP1 3IAPA 1GQGA 5B4NA 1UU5A 2VOKA 4FFHA 4OVEA 5CFCC 2UY9A 1TQ5A 5C5TA 1BEV3 1VBD3 2W0XA 3AX4A 3USSA 1ULCA 2WYSA 1XE7A 3AP6A 4SLIA 1COV2 3MIFA 3K77A 1LOFC 2DURA 3RMYA 3N35A 2QQNA 1PO21 3DPRB 3ZMNA 2BVVA 3BGAA 5LBCA 1GLHA 4HFSA 2AACA 1GFF2 4LO6B 2V5YA 1LAJA 2Q0AA 4PLNA 1RUF2 4Q4X3 4LUKA 4AF9A 2GAUA 2OIIA 2XJPA 5FREA 2RM22 3H42B 3K4ZA 3DYPA 1HRV1 3PVNA 2PTMA 4KH9A 4MH0E 4RGGA 4P9YA 1XSQA 2FCVA 2IXJA 4BMBA 3HNYM 4QQ2A 4CDQA 1YQ5A 4LO5B 3KT7A 5C3OA 5IK8A 5IVJA 3LD8A 1W8FA 3SH4A 1NYWA 4FT8A 4UW4A 1UIKA 4XUTA 1FT9A 5CFCB 1D4M1 1S1AA 3MIGA 4AVBA 2WAOA 1QJY2 5I8SA 3MZHA 4CEWA 4YW6A 5FUPA 2GC2A 4Q29A 4OUSA 2D6MA 2IXKA 4ITCA 1EV13 4XDOA 2ZGTA 3AK0A 4ZS2A 4QPWA 5IJRA 3CHXA 4YVSB 3DGTA 1JOPA 3O7OA 4IEWA 3ILRA 5HV4A 1RUG3 1KFXL 1W3XA 5FAXA 2UU8A 4XHXA 5FZIA 3O1UA 2WINB 1Y9QA 2R043 1RUJ2 3BTAA 4P14A 3BPZA 4LO8A 1I3HA 3OYWB 2ATFA 1QJU3 2V72A 4CU7A 4AFCA 5HPOA 1G9CA 1HXS3 5EFUA 5FYCA 2W95A 4UF0B 4FAHA 1UO9A 1AHSA 4BCUA 3EBRA 4Y4YA 5EWSA 2G1MA 2XBO3 1LGCA 3W9AA 1B35B 1PNGA 2WQ8A 4NOTA 5LW9A 1NQDA 2XJRA 3QACA 2HWB2 5FO7B 5FZFA 2VZTA 1ZBE1 4JVAA 3ZDVA 1VBC1 1PNFA 4CDXA 1UZZA 3AP4A 2E7AA 1LECA 3I2HA 2BVBA 4WVMA 5F3EA 3VBUB 4GB32 3T08A 4XBNA 2E7QA 5KXCA 4ES8A 2EICA 2JDHA 3H3LA 1KDKA 3FMGA 3VBOB 4JCKA 1SLLA 1AR73 2HWD3 2DVGA 2ZPXA 3E5XA 1A8MA 4PIYA 3RDIA 3PUSA 2ZGLA 1DLLA 2I07B 4V1PA 1PMIA 2HWF3 3GZAA 3JCIA 1LTEA 3KV4A 4Y1YA 3VBFC 4A3XA 4YGBA 4E9KA 4P00B 1D0GA 1PK6A 1BK1A 4LBJA 1ASJ1 3S30A 5A3TA 4ISQA 4XEZA 3UL2A 3VB9A 3Q8BA 3D3AA 5FBZA 4P02B 1SLBA 2FDHA 5F9TA 1SQ4A 4B4PA 1CIWA 3WW3A 1DCSA 3U14A 1N1TA 3PVEA 2XJTA 1UW8A 2DBIA 1DIWA 1LODA 1X9PA 1L7RA 4LO7A 3CBNA 5EYXA 1DZTA 3J7LA 3POWA 2BBVA 1UOFA 5LEKA 1CIYA 5FYIA 2OVUA 2B45X 3L2YA 3I8TA 5CFDB 3T1MA 3NSTA 3K4DA 2GNDA 4QX7A 3SH5A 2XLGA 3AZXA 3E6DA 4KU8A 3P3NA 3NV4A 4JC1A 4O61A 5KHKA 1JXNA 4JRAA 4JDMA 4FTEA 1OLMA 1K5MA 5AFEA 1DGWA 2Z79A 1B35C 1RUG2 2R1DA 3KQ4B 3ELNA 2JG8C 4Q5OA 4HN1A 2W92A 1V9U1 2D3RA 2XB6C 4CU8A 2LM3A 3PVOA 1MVEA 4NWVA 3K46A 4AQ6A 3NV1A 3AKQA 4AEDA 4COUA 3GALA 4DUXA 1VBA2 3AYAA 4Y1ZA 1LULA 4MG2A 1IKQA 3PL0A 5CZKA 2RHPA 3C8XA 1L7LA 5FZLA 4R4XA 1NXMA 2WZEA 1A3KA 2WNUC 4IESA 5DDJ3 2ERFA 2ZAHA 3ZXGA 2FMYA 2VJXA 3WOGA 5HV0A 5I8TA 4LHSA 3WDUA 3EQEA 4FOWA 3WINE 3KWVA 3NVCA 4P08A 4QDSA 2GNMA 2ILMA 5FJHA 2P34A 1ZREA 3ZOIA 1CGPA 3SKVA 5I93A 3KV5A 1BMV2 3WF4A 4AEMA 4ZXKA 5LBFA 5JOZA 5FZ4A 5T54A 2C9AA 4PI0A 4FQ4A 1UOBA 1AJOA 4LE3A 3ZFEA 1GQPA 2DWRA 3I3DA 4IGQA 5AVAA 4CDWB 4LJHA 3MYXA 3QH6A 4QPGC 1UN1A 5FPAA 4TXWA 5IYYA 2FZ2A 5DZEA 3NW4A 3T0DA 4XIOA 2UWAA 3FE5A 4OI1A 1GZTA 1UMIA 3FFZA 4QD2A 4LMFA 4YLZA 4FI9A 2ZX4A 2ZHLA 3B7MA 1MR5A 3FL7A 4LORA 1VALA 1UF2C 3OGVA 5DAXA 2VOTA 2WO3A 4I09A 2YC2A 4C0BA 3O0WA 5SV5A 3VBRA 2R072 4AW7A 3JBG3 1KFUL 4LHNA 2PN5A 4YARA 4FP3A 5JZGC 3SCHA 2YROA 4OZXA 4RYDA 3U1XA 1R1A2 2UURA 5FTTC 2BOIA 3U0ZA 3VZJA 3H1WA 1X36A 1CAVA 3AVRA 2QJVA 5JCTA 3E6CC 1YUDA 5FP7A 1RUOA 1PX4A 1HDKA 1JZ6A 1R092 1OXCA 3LPGA 4QXBA 4JGYB 4Q0UA 1J3QA 2JG9B 2PXJA 3RJRA 5C7GA 2WN3A 4MLOA 2VUJA 1ODMA 3W59A 3POIA 4Q27A 4ATFA 1ODNA 2VMCA 1U5IA 1WGPA 3WEZA 4CDWC 4DY5A 4QB1A 4Q4Y3 1Q8VA 2ARAA 3DKQA 1ZM1A 2PLV3 3UETA 2PAEA 1Q56A 4YFWA 3ZYHA 5ANQA 4EN6B 4I01A 2ORZA 3TWIA 5FBJA 4FQZA 4CDUB 3FHIB 2NPIA 1G9FA 4AI0A 1GYKA 2QBXA 3L2HA 5FPXA 3CO2A 3DUIA 2QKDA 3I3EA 3OEAA 3F2ZA 5AC91 2VTXJ 2DUPA 5I91A 3SCFA 1W2NA 2VZOA 3BI3A 1OD5A 4ZONA 1JH5A 5FXVA 5JMCA 1C8M2 1QEXA 2PA7A 2WT0A 5M0TA 3D0SA 4CA9A 3GJAA 4UYBA 5JXIA 4DRRA 3DPRC 3MIBA 2VL4A 2J1RA 3H8UA 1TNFA 1LCLA 4QQOA 1HN0A 1QHDA 4X8PA 3VDCA 4W65A 1XNKA 2P2KA 4DNYA 1W8HA 5HBAA 1RB8G 3IDCB 4KBBA 3ZIWA 2XWJB 1K45A 5FP8A 4XJ9A 4YW1A 4ZXEA 3VKLA 4C90A 4LEJA 5ABJC 5J98B 4E2SA 1SG3A 1VBC2 2I45A 1H4GA 2ZKLA 4YM1A 4YVWC 3T2OA 3VZKA 1MEC1 3ZKYA 4PF1A 1VMJA 2UYAA 3FJSA 3NNLA 4XW3A 1FAYA 4HKLA 1BLZA 1T2XA 4YVSA 3VGIA 3ZPOA 1K42A 2D6KA 5FY5A 1Y9MA 2D7FA 4RS5C 5FZEA 3NL1A 2BQPA 2RS31 4CP1A 1UY1A 4EN8B 5L9VA 4AEKA 4CZSA 2VVFA 1BBT1 1MACA 4PCRA 1F8VA 1NCQA 2IXIA 3TEWA 5T5OA 1VBE2 1IQAA 1PIV3 1W9TA 1LOGA 4C91A 4AYUA 5I8YA 4OI0A 2W3JA 2D40A 1GOGA 3I2GA 2A3WA 1VE0A 1NKGA 3M3IA 3I2JA 1X8EA 2XOMA 3O5SA 3AM2A 4GA9A 1WCKA 2JDMA 3FX3A 3W21A 2YUEA 3OOXA 3ZLIA 1VAVA 3HT1A 5T3NA 2PHLA 5DDJ1 1MS3A 2GN7A 5FZKA 1KGYA 4K6BA 3PHMA 4Q8LA 4NHYA 4XAEA 3HVDA 3ZSEA 3S0MA 4AL9A 1YQ2A 4GKYA 5IK5A 5APAA 1ZZ9A 4NAOA 2HWC2 3H3ZA 1AYN3 3WHUA 3SKJE 3WQ1A 1V6MA 4RR3C 1OF3A 4KBZA 5FZAA 1AX2A 5BNPA 4XJZA 4OCTA 1RUE2 1ZBA1 5E8AA 4WM8A 4QU2A 3AC0A 1GSLA 2A73B 3HMYA 1TME2 3ZM8A 4XJWA 3GGLA 4UFHA 1LU2A 5JDBA 2ZGNA 1APNA 1UPSA 1LEMA 4A41A 5GZCA 2MEV3 3VDBA 5FZOA 3HN1A 3PNAA 2ORXA 5F37A 5DPNA 3DYMA 3O1SA 3N3HA 2UWCA 5FPUA 4DMIA 2ZMKA 2DTWA 2ZEWA 4KU7A 1WA6X 3LFIA 4GWMA 2BNMA 2WO7A 3OUIA 2RR11 2VULA 4LBMA 1IHMA 4A6SA 3VBHB 1AVBA 1QGLA 4CDXB 1GWKA 4XMIA 4OHXA 3IIIA 2B46X 4HL0A 4BPZA 5AVPA 4XTMA 4QHBA 1DDLA 4CTEA 3TYJA 1SPPA 5J09A 4E4HA 1AXYA 1FOD2 1C5HA 2VPVA 3FZ3A 4K9SA 3ZDSA 2G9GA 1E57A 3O1PA 3V0BB 1IG0A 3ZFGB 3POYA 1W6NB 4AHZA 5KXBA 4INDA 4EWAA 1QH6A 5EQUA 3MF6A 4XDQA 3SLIA 1S0JA 1IKPA 2YU2A 2WNVC 4JGZC 3ZXAC 1PK6B 2CDPA 1EYBA 1PIV2 2VECA 4UWDA 4ORFA 4XFCA 1ZRFA 1H6YA 1S0CA 3N9MA 4COZA 2J1VA 3U75A 2P3JA 1W2AX 4A42A 5HI0A 1VBD1 2YPDA 1O4YA 4MOAA 1LOAA 3LDBA 3HBKA 5HXVA 4NHKA 3TRSB 3PUHA 1XQNA 4NRMA 2CGOA 1WBLA 2R1BA 5LZ6A 2EXJA 2WUHA 4UXAA 3I59A 4BK5A 4PIXA 3RFRA 3HR9A 1WLTA 5FKCA 4WV8A 4XABA 4N53B 2QZ3A 1ULDA 5IVCA 1DGRN 1HIXA 2VOVA 3O1MA 4FPFA 1UL9A 4DUVA 1OURA 5FLIA 1SHWB 1XYPA 1DP0A 2QFEA 2K0GA 2XJSA 1HB3A 2RDRA 2RM21 4QB6A 2XGXA 1GV9A 4DXSA 2WO1A 3E1F1 3CL1A 2C5DA 1N1VA 2F17A 1RC6A 1ULFA 3POBA 1SCRA 3KV6A 5IAXA 2AEZA 1RHI3 2A3YA 1BZWA 1NLQA 5H9SA 2VM9A 2X29A 2OKXA 4M4PA 2WFF2 1SLTA 2ZGUA 1M06G 4XQ4A 5T5JA 1RUH2 3FHAA 3I2FA 4XXAA 4XFGA 3ZXJA 1N3PA 3RPQA 3AFKA 5KHJA 3ZYRA 1FMD1 2YMZA 3VZOA 4NWWA 5JPMB 3MPPG 4JGZB 1CESA 1RVF2 2VXRA 4QT6A 2ZX0A 4Z07A 4TN7A 3VLBB 4K3UA 2C9KA 2D6LX 3T2PA 1WLWA 2CGNA 1F15A 3R4UA 4ZS3A 5J96B 3KSCA 2QQOA 4Q0QA 1ONAA 1V70A 2VMDA 4Q1PA 1XU1A 2VQTA 4H2AA 4B7EA 4ZKTB 1QNWA 4HSLA 4CEYC 4TWTA 1H30A 1RUJ1 1MS5A 1W9FA 4CP0A 4BQYA 4X6RB 1VAMA 2HJIA 2ZA9A 3EHKA 4AI9A 3VDDA 2YFUA 2P1BA 3LA7A 1TVGA 3WG3A 1HX6A 2XXZA 4EWDA 2VG9A 2Y6JA 4QPIA 1VBB3 2Y8KA 2CV6A 5A6ZA 3MDPA 4KWUA 4ASLA 2WWUA 4L11A 5C9AA 3H1YA 1RJ8A 3OYWA 1JYXA 3VBRB 4F8AA 2Y34A 1HRV3 1U5XA 2WZR1 4EN7B 2C1FA 1CPNA 3VHOA 1DGLA 3LCPA 3TN92 1U5ZA 1FPN3 1A78A 2DV9A 2JEMA 4HPKA 4HOOA 2Y6FA 4XURA 1RTVA 2HWC3 2FDFA 4CXYA 3ZFFA 4YG3A 4JGYA 5JLVA 3B00A 5IK7A 3T09A 4Q0PA 4RGKA 1PO12 3JBG1 2YC4A 3HQRA 2YBKA 2ZAAA 4CVUA 4Y24A 3LIHA 1U5YA 2RV9A 1TMF1 1YC61 2RJKA 4QX2A 1JZ7A 5F8PA 3LEIA 1MZEA 4OMCA 1N3QA 2MHFA 2SLIA 3AP9A 2WSVA 1AUYA 4KL1A 3UGGA 1QOSA 3OD4A 3HWJA 3WNMA 4EWEA 2VZPA 4ISRA 2HYKA 2VNGA 2WN2A 3THPA 2GSYA 3BCWA 3KCYA 5GLWA 2NP0A 3KB5A 5E1RA 1EUTA 2VNRA 5E89A 4AVAA 5C8CB 1DBNA 3PUQA 4F3JA 3S57A 2RS51 2VQ0A 3OEBA 5DDJ2 2JDZA 3OGSA 1MQTA 1GKBA 5I0RA 2CWMA 1PZ9A 4OYUA 1W8TA 3GCWA 1QJU1 2WT1A 1RVF3 1PZ8A 1VBA3 4FVVA 3H1MA 1ENQA 2RVAA 4L2NA 5FZ7A 4MYEA 1WW5A 1WWYA 1I1EA 4XUPA 4H3WA 4B1LA 5JR7B 3POSA 2R30A 2VQUA 3S7EA 1NCRB 3P1IA 4MADA 1BVVA 1HN1A 4I3GA 1F2NA 3ZSMA 3SC7X 5BNQA 1ZA7A 3M1HA 4BXSV 3HEIA 2W52A 5FKBA 1RHI2 5FYTA 1SDWA 1AF9A 1H6XA 1LHVA 3OB8A 4ZU4A 3JZVA 1OC1A 3I3QA 4DY3A 3WG2A 4CEWB 1UOJA 1AYN1 1GMMA 2Y64A 4GH4A 5DUVA 1NQJA 1S2BA 4RS5B 3WDTA 5K0UB 1AR61 1DQ6A 1PMHX 2CDOA 4A3ZA 5LA0A 1JHJA 3VD9A 4AVCA 4LXLA 3VKFC 3TNQA 4B8EA 3M4FA 5BNOB 4JDOA 1QJX1 3ACGA 3PU8A 3ZYFA 4EZ4A 1C3HA 1EPZA 2BGPA 1OD3A 4CP9A 3ES1A 3JB4C 5T55A 3ATGA 1Y3TA 1AJKA 3LZZA 1WCQA 4X6QB 2DFCA 4CCKA 2OUJA 2WT2A 1GZ9A 3ZSKA 5FOBB 3KS7A 4DIQA 1FPN1 5GZGA 5LK7B 1CAXA 4PQQA 1HLCA 3CEWA 2HEVF 2HWF2 1BKZA 2GMEA 2RS33 3DYOA 5DMYA 1E5SA 1GUIA 1ND2B 2ZX2A 4HVQA 2QQWA 3Q8CA 4UFKA 5FYBA 2VW1A 3FUQA 4IUGA 4IETA 1Z78A 4PF5A 5JIAA 4MVTA 5A7WB 4TTGA 5JWPA 1LESA 2PHUA 1V00A 3MFAA 4PDWB 4MXWB 1QOOA 2XH6A 4RQPB 3WNKA 3ZN5A 4IV1C 2PHFA 4SBVA 1O5LA 5KXDA 3T30A 2VH9A 3OPTA 4FFIA 3PJQA 4IE7A 5IVVA 2JIGA 2IXHA 1W9YA 4CCOA 3S5QA 1FMD3 1HQLA 1P8JA 4FOVA 4LBNA 2QQMA 4K40A 4DXZA 3F95A 3KHBA 5F2SA 3ZR6A 5FZ3A 3USUA 4B29A 2VQAA 1LOCA 1PO11 3JBG2 2BOJA 5A1FA 5FO8B 2P6HA 2Y6HA 1MQTB 2RS52 3GHMA 4LBLA 4LLFA 5JOYA 4AE2A 1XSRA 4S2GA 2R042 2J1TA 3NAPB 4N7UA 5G05L 1OBNA 3I7DA 1OH4A 4KWJA 2DUOA 3VDDC 1GWMA 1JYTA 4AFBA 3ST7A 5H9PA 4D6QA 1MS8A 1UYZA 2E26A 1V6LA 2BYVE 3WW4A 1PVC3 1Q8SA 3I54A 3ZYBA 1EV12 3CU7A 2ZEZA 1ACCA 3LIGA 3RZJA 4Y5SA 1CWPA 3J8F2 3WY6A 5LWBA 3EJKA 1S0DA 3ZSJA 1B09A 4GALA 3IT8A 1W8NA 3QOPA 1TME3 1ULOA 1Z7S2 3KZ4C 5CB7A 3CJIA 1LHUA 2O0OA 3WW2A 2PHTA 1GP4A 3RZMA 4A2UA 1CZTA 5DABA 1YI9A 3FBMA 5L36A 4UBGA 4ET7A 1HQNA 1I9RA 2AENA 5AFBA 1SLIA 1H0BA 2VW2A 4K7JA 4P9XA 2JENA 1SPPB 4QPGB 3ZO0B 4LK7A 1W0NA 4JDNA 4FPYA 3EXUA 4LITA 5IT6A 1PGSA 3C7OA 1YFWA 1UKRA 1AYN2 4GZ9A 4F7ZA 4YW7A 5JMOA 1WLDA 1GWLA 3LEKA 2Y0OA 4Q4X2 3WD5A 4BQXA 4ONUA 2AYHA 2OZ6A 2D98A 4D7SA 2W9XA 1W6PB 1VBB1 1F5JA 2JD9A 4RN5A 2ADDA 2WWJA 3ZXEA 4XIKA 1MS9A 4BH9A 5FUNA 2YPJA 5B4XA 1REEA 2J1AA 5BNOC 1LEDA 4A4AA 1H8TA 4XYXA 3H9AA 1ZBA2 5JUVA 4CP2A 1SBFA 4XFFA 4J1WA 2ZJCA 5ACA2 1NY72 4RR3A 4W6WA 1OUSA 2EIDA 2DVFA 3B94A 4RQPA 4NN0A 1OPMA 3NJZA 4XUOA 5J7MA 2TUNA 4XZPA 1RMU2 4CXXA 3W5NA 3CF6E 4OULA 5FYSA 1WZXA 3H50A 4N53A 2VOWA 3NNGA 5EHDA 5A70A 5A1AA 3GXUA 1TEIA 4IGPA 1EY2A 4QQLA 4WZFA 2XLFA 1G86A 4NE9A 4JKMA 2DCKA 2EXIA 2PYTA 4JKKA 3S5AA 1J59A 1VMHA 3DCQA 3OD0A 2JDAA 4QX5A 5DQ0A 1POQA 3DXTA 4LBQB 2I2SA 1IPSA 2BFUS 3OF1A 5D8AC 1NUKA 2VUDA 4FAGA 2W47A 1MS1A 3WV6A 4AOCA 4LE4A 2A6ZA 4OQ8A 3I2OA 2A71A 4ZU5A 3CMGA 4XJUA 1BK0A 2WZPP 4R4ZA 2WZR2 3U78A 2RS32 2W1QA 2P5BA 4WM7C 4DOUA 3OJBA 5L7OA 5ACA1 4JGZA 5FZCA 4GB33 3RWNA 4BQ2A 1MEC2 2XDVA 1L3JA 1HRI1 1KITA 1NX9A 2VNVA 1ZA4A 4IV3A 4KWKA 2P3YA 3BVCA 3CKHA 1W03A 3KD4A 3OTFA 2V5DA 4NHLA 4Y1XA 3RYPA 5K4LA 2VGDA 3WNOA 1RUH1 4K8RB 3T4HB 3WP6A 3WQBA 1SBEA 1JZ4A 3PDQA 2A70A 1H9WA 2XWBB 5FZ8A 2LRPA 3HN3A 1UWWA 4XBLA 3M3QA 5A32A 3ABZA 3VBUC 4M0NA 3CZJA 2PLV2 2ENRA 2EXKA 3RZZA 4IDZA 4NRQA 3THTA 5GZDA 4IE0A 5D2AA 5FZ1A 2AZ5A 3OPWA 3EYPA 5KHHA 5L7OB 2LW8A 4L92A 4P5YA 1UU6A 2ES3A 3T3YA 3MBWA 1BJQA 1ND3B 2R7EB 5DG2A 2BTVC 4XBQA 2BPA2 2Y38A 5ANNA 4B1MA 3LSEA 1QJY3 4GMP0 3B9IA 1AR71 2HWD1 4AVSA 4GH4C 5DZGA 5LY2A 2NZ9A 1DZRA 4EYUA 2W94A 1NLSA 5D1IA 2L9LA 3CJXA 2JKBA 4XPVA 5FR3A 4XTPA 1US3A 5IATA 1D4M2 4XFHA 5KHGA 3B5LB 1OFSA 4HETA 1CZSA 1PVC1 1GOHA 1QU0A 3N9LA 5F32A 2C4XA 2BZDA 2DU1A 2ZX3A 2FDKA 4D7YA 4ATEA 4E4DX 5DUUA 2OT7A 4XETA 1H1AA 2OZJA 2WS92 3HT2A 1ALYA 1S0IA 2Y6LA 3NJYA 4AI8A 2B8MA 2ZGMA 4J25A 1RINA 1W05A 5CKMA 4NAMA 2ZCWA 4E8DA 1PO13 4XCBA 3NO8A 2HEYF 5FRAA 3A23A 3VD5A 5K7PA 5EP9A 5IAVA 5A3NA 4DQAA 2JG8A 1BEV2 1FPN2 1O8SA 5A3OA 1BBT3 3C3VA 4HG6B 1AR81 1FYUA 1F4HA 4QX8A 3S7IA 1AL0G 4M0HA 1G9AA 4YZ5A 4YZ1A 2ARXA 1AXZA 2YB7A 4IEYA 4D3WA 2UYBA 4LHKA 5F5IA 5FP3A 5JVVA 4AG4A 1WCDJ 2ET1A 3RNSA 1IG3A 3LF7A 1W6MB 2P3KA 2QQLA 5EXOA 4Q8KA 1UXXX 2DCZA 2XL9A 2ZGOA 4PDWC 1GQHA 1STMA 4YZ3A 2F6BA 1FOD1 2ZACA 4S2FA 2BNNA 4PHZA 3N7JA 3HOBA 3WX5A 3AFGA 2XBO1 3USUB 5A32B 1DQ1A 1QXJA 3IB3A 4ZZ8A 5F3IA 5A3PA 4AEDB 3FBYA 2ARBA 1VBE1 2H6CA 4WVZA 5LRRA 4CP9B 3M2MA 3V56A 3JD72 1FXZA 2E31A 1D2QA 1PO23 1W2TA 3RJ2X 1SBDA 3OPZA 3ZYGA 1Z7S1 4Z2AA 3NV2A 5B2GB 5FFOC 4JGYC 3G6JB 4XFIA 1CAXB 1ZBE2 4IL7A 4FOQA 1IPKA 1K3IA 4HN0A 1KJLA 1VMFA 5LK5A 3WG1A 3RWKX 3RZLA 3RI8A 4YG6A 2HWE3 3DN7A 5BNNB 4BXFA 4MGIE 3WF1A 3MEPA 5JSPA 2D93A 2J1EA 3LDKA 3ZXDA 5I0UA 3W58A 4XACA 1AR93 4XF4A 4A7KA 3DEMA 1OQ1A 3D0JA 2J1UA 5A33A 3ZFEB 4YWAA 1NXD1 1GNZA 3O1OA 2EIBA 3AKTA 3L9JT 4QX3A 1AL21 4OI4A 4XILA 4AFAA 5KBFA 1JZ3A 4IV1B 3PMEA 5BYNA 1CX1A 2LROA 1FATA 2Q1MA 1NCRC 1G6NA 2Q1ZB 4O7XA 1JYWA 1W8WA 1W8ZA 3E97A 4FPGA 1O3TA 5A7SA 4LULA 1OVPA 5C4WC 1E5HA 2KR2A 5E16A 1JYVA 3C7FA 3BOWA 4QQPA 3CZUA 1H8TC 2VE1A 3NJXA 1G7YA 1ZYBA 3TAYA 3BB6A 2X5IB 1C4RA 4N9IA 3ECQA 1HKDA 4KMQA 3WP3A 1AR82 1OKQA 1PHMA 1H9PA 1YWKA 5HCBA 5J36A 1ZRIA 3ORJA 4RHV2 5FY7A 2QCSB 5A3LA 5FYMA 1JHNA 1RUJ3 4MUVA 5A7QA 3UKNA 4CCEA 5ACA3 2F4LA 3M3CA 3VBOA 4LIUA 1OOPB 3H7YA 2EVXA 4URTA 4XC9A 3D6EA 3BTYA 4MGKE 2O14A 1SLAA 1OMIA 4LKDA 3P6BA 1ZZ6A 2DU0A 2QQUA 4LBQD 4YM3A 5FLJA 3RGBA 1REDA 3MLLA 2WDBA 4QHZA 5C8CA 2BJSA 2YC0A 1DZQA 4LA2A 3GBGA 5C4WB 2BGOA 3SH3A 3ZN6A 3ETQA 3R4SA 2CNAA 4AWDA 1N3OA 5FV3A 3I2KA 1WUVA 3LOIA 2A6WA 3IIAA 3RQ0A 1NLRA 4FOYA 3K4AA 3TBDA 4RFT0 2J42A 4GMP1 5LBEA 3WP5A 4Y5Z0 2RM23 5CIRA 4AQTA 3BU7A 1W90A 3MIHA 1J3PA 5F3CA 1GZWA 1URXA 2R063 1PGW2 1RUF3 4FPLA 3U07A 2KA3A 2UWBA 3PVBB 2WFPA 5LCWL 2D3PA 1NCQC 1OOPC 3EO6A 5FZHA 2C26A 1E5IA 1BMV1 1WMDA 4J1XA 4TZDA 2VOXA 1UY4A 2OXBA 1OVSA 2ZEXA 3IMNA 2RMU1 5DXDA 2ZX1A 3N9QA 1XNBA 1I6XA 1SEFA 1WMEA 4L0PA 1RUE3 3IN9A 4AQSA 1F35A 2YG0A 4CDUC 3LPFA 4QPIB 3PIJA 3Q8AA 5F5QA 2WBKA 1R083 2GP5A 2LALA 1CAWA 1VLNA 3DECA 5A6XA 5H9RA 1FI2A 2VMGA 4GKXA 3FFQA 2SBAA 5LA9A 3ZXLA 4D6RA 2W08A 5A3MA 1NE6A 4QM9A 1JZ5A 3VD7A 2OQ6A 4HVOA 3TB0A 4JRLA 1KRIA 1ENXA 2GMMA 1UX6A 4AHWA 4NIIA 1NZIA 2Q4SA 3KGLA 1R1A1 5C5UA 4A6OA 4XJ8A 1UAIA 2F4PA 1EAH3 1ZX5A 4YGDA 4AFMA 5JXHA 2GZWA 4MO3M 2B4KA 1KD7A 5H9QA 3HNBM 4FCAA 4QX1A 3A21A 5T5PA 5ABJA 2BUKA 1NT0A 4CDWA 5F3GA 3O1VA 5HXMA 4M3CA 4MGSA 1WD4A 4A45A 3ZPYA 3KHCA 2JB4A 1MPXA 5J3UA 3IDBB 5C71A 4Z82A 1UIJA 3LA2A 1AL22 2PHXA 2ZGPA 1GICA 3RI9A 4WBBA 3POGA 2YXSA 2FCUA 1S0BA 4UFJA 3Q8FA 4I30A 4YW3A 5HCAA 3VD4A 1GZCA 5JZGB 1AX0A 4BDVB 3T1LA 4CUAA 2VZQA 2XL7A 2N7GA 4BLJA 2RDQA 2RG4A 3FLRA 4O65A 1PK6C 3BIWE 3AMPA 2WNOA 4QKNA 1N1SA 2XPJA 1YO8A 2PFWA 3NNJA 1NCRA 1HJGA 1UZWA 3K3NA 3NNFA 2DDUA 1RUG1 3ZFGC 2O8OA 4Z8BA 1R64A 3BALA 5A6YA 4OLLA 2Y26A 1EUUA 3D82A 5CFCA 3LB9A 3WW1A 2WFF1 4QQHA 1NOVA 4RHV1 4Z1VA 4MZUA 1QOTA 3JB8A 3LA3A 3B01A 1N47A 3WVJA 1RUE1 4MXVA 1LB2A 4IE4A 4AXOA 4CDXC 3J7MA 2A7AA 2VY0A 4CDUA 3RZHA 2IWGB 1O91A 1R1ZA 2ZZJA 2OPKA 3K51A 5EIYB 1VB4A 2W5FA 2HWC1 5BNPC 2G19A 3QLQA 4QWNA 2WQZC 4Y3OA 2JD4A 1E5RA 1H1IA 2NMNA 2VVDA 3GJBA 3KVAA 3OUHA 1S2EA 4QMAA 4LK6A 1ASJ2 5FK8A 5GZFA 5L7OC 4JHTA 3HAGA 1AZDA 2R061 2IVIB 3AL6A 5L19A 5IWFA 4BYYA 1S2KA 3DXUA 5CFDC 1W04A 4DO0A 2ZGRA 3MV11 4O9GA 3WR0A 4CYDA 1YJKA 5DAPA 1R093 1EV11 1O4TA 5A7NA 3VBSC 1AR63 1RUD1 2WJSA 4XXPA 4MGZE 4WVMB 4CEWC 3ZN4A 1PX3A 2VZRA 4MXWA 4RR3B 4NIGA 5FZ6A 2WS91 1A8DA 2W46A 4FSJA 1NA1A 3RRDA 4ES9A 5BY5A 3UESA 5A7OA 1Q43A 2JX9A 1JUHA 5CBLA 1MZ6A 4YNIA 4RA0A 4BM8A 5L73A 3TN93 5EZWA 3MW2A 5FLHA 3B69A 1DYKA 3M70A 1U12A 3D5OA 1K5MC 3D8CA 3POJA 5C9AB 3WXPA 4GJZA 4HKOA 5J37A 4BQWA 1D4VB 2AREA 4L99A 3MO4A 4QXKA 4Y20B 3SCGA 5C6CA 3NAPA 2EIGA 1VBB2 3AMNA 3N4MA 5KXEA 1XYOA 5FDBA 4AEDC 3N36A 2Q8EA 3A0NA 5A1LA 3PTRB 1ZZ7A 3C2UA 3QCWA 5T52A 1WW7A 3KF3A 4R52A 4WVVA 5C8WA 1CX4A 1IS5A 1MS0A 1U0AA 4N43A 1OLME 1QJX2 1V6NA 1W2UA 3IM0A 4H55A 4EE2A 2P37A 5I0DA 3BTXA 1RUNA 2NYYA 2VR4A 2O8QA 5FZ0A 3UGFA 3X29B 3MUZ1 4OHVA 5FY0A 1CONA 2YZ4A 2GP3A 2JKXA 1QF3A 2HKXA 2UY8A 2WWSA 1ASJ3 4H14A 3NKTA 4AEJA 1JYNA 4LT5A 4Y4RA 1CJDA 4AZZA 4URAA 5JIUA 1WMXA 4ZHNA 1DF0A 2B9UA 3QD6A 3H8OA 4GWIA 3THDA 1W8OA 2E32A 4CU6A 5IVFA 1ZZ8A 3AB0A 1CD3G 4Y26A 3BTZA 1UMZA 3N7LA 2A5ZA 2GNBA 2OQ7A 5IK4A 1NZCA 2NN8A 2W91A 4Q4V3 1W0PA 3P3PA 3VDAA 1KS4A 1C5IA 3U4XA 2D5FA 4NIAA 4E27A 3RSJA 1WCUA 3Q9OA 3LGRA 1PM7A 4AHYA 2ID4A 4LBKA 3WF2A 2YGMA 4W8JA 1XU2A 1LOFA 1AR83 1W99A 5F6KA 5LASA 3ROUA 1WCSA 5DAQA 4DRVA 4R9DA 4CCJA 2IZWA 3AZVA 1GP5A 4CUCA 1F5FA 3AYDA 4I0AA 3ZYPA 4DUWA 2RJ2A 2V73A 1UZ0A 2ARCA 2CL2A 3A22A 4FP2A 1LNSA 1GNYA 2WLPA 2XVKA 1ZRDA 1JU3A 1HJFA 5FYUA 1DGRA 3SITA 3FUOA 1RL3A 1J1LA 4U36A 3UKVA 4ZZ5A 4QU1A 3H3UA 5GLZA 4AHXA 4K8FA 3WLUA 1YNAA 2E53A 5FQ0A 3LFMA 3ILFA 5CYYA 4I3PA 4P9GA 2X09A 3R05A 5IVEA 3DKWA 2YDEA 2P17A 1W6NA 4YVSC 5JXGA 4OHYA 2VXJA 1QJEA 4LBQA 2E6VA 2A1XA 4S2DA 4QGMA 1OA4A 3M7AA 3AXEA 4PBPA 1AR92 4YM2A 1MVQA 5KWRA 4CPBD 1JI6A 2BWAA 4QKFA 4M3CF 1EAH2 1UMHA 3MPBA 1XJAA 4Y5TA 2HWE2 4HSJA 5IVBA 1ZNPA 1OH3A 3I3BA 2GN3A 3GCXA 5K0UC 3MW4A 4AVTA 2D6NA 2RR12 1Y43B 2XBO2 4BQ3A 1HW5A 1W9SA 1REFA 2IXCA 3JXSA 3N9NA 2JG9A 3OY8A 5I0SA 1GZWB 2E51A 4RQPC 4M3CB 1POV3 2MPFA 1HB1A 1QJU2 4JTOA 2BW8A 1I5ZA 1SMVA 1RYYA 1AXKA 1VRH2 1VRH1 2DCJA 3J7HA 4I0BA 2QE3A 4JQRA 3G7DA 3WQ7A 3HPNA 2YGLA 3VL8A 4OMDA 1LGNA 1HV1A 3ZIXA 1I5PA 4L9BA 4Y1UA 4QKBA 3CDZB 1RUD3 4COYA 2CY6A 2GMPA 4F83A 3IPVA 2WNVB 2XUEA 4BB3A 2XONA 3N7MA 1OQDA 2WNUA 3N9PA 3AKRA 4FPJA 5T50A 5IUQA 1X50A 4HLTA 5E88A 5JR2A 1GANA 2AR6A 4QPIC 1MQTC 2XG3A 1LU1A 2PELA 1JUIA 1V9U2 2R0HA 4MSVA 5EYYA 4LUMA 3AZWA 3FN9A 1X9TA 1ND3A 2D3SA 1D0HA 4CDQC 1VPHA 4N9HA 4O9EA 1UCXA 1TG7A 2VTXA 5FY4A 2HEWF 3ILNA 3PLQA 5BNNA 2Q8DA 1TE1B 3WUDA 1V6IA 3OGJA 1NY71 2WZ8A 2GH8A 3HIFA 2ZHKA 4GQ7A 2CYFA 1W9WA 4M00A 4DPNA 2GNTA 2WS93 2G4IA 2XJQA 2O1QA 4NPRA 2BU9A 4R9AA 1CQ9A 5JOWA 4XOGA 2VUAA 5C70A 2ZHNA 4M01A 2E7TA 5FPZA 1VBD2 3C7HA 1IS3A 2Y6KA 3HD8B 4OI2A 2QZ2A 4GB31 3ZVXA 1D4M3 1FX5A 2D97A 3J4UH 1YRZA 1O59A 2Q5TA 3WDYA 5HCHA 5GLTA 3PU3A 3BN6A 2AGSA 1VBE3 5EJ1B 2Y33A 1DQ4A 2EIEA 4QXHA 4CPBA 2CAUA 4E4SA 2B5HA 1IGOA 4NHMA 3WCSA 3VHPA 1SFYA 2P4EA 5BPXA 4I2OA 1QQP2 5DG1A 4XUQA 1FMD2 4X8NA 1J84A 1RJ7A 1PGW1 1IQDC 1Z0HA 3C7GA 4CSWA 3RZGA 3KV9A 5BXXA 5FK7A 1QJZA 5GJ6A 5FYZA 1QNYA 4YZ2A 2A6VA 5FP9A 4ZU7A 5F5AA 4KNCA 4AGVA 2EAKA 2JE9A 2JIJA 2D43A 5C3RA 1HRI2 1SDDB 2Q1FA 2WAAA 5CNAA 2Q8OA 3ZXKA 5BNPB 5EV7A 3ALQA 4OHZA 2WRAA 3M3EA 2JECA 3OCPA 1QJY1 3URFA 5F6LB 1MZ5A 2XJVA 2KXLA 3JQWA 4V2VA 4TLFA 3WDVA 4XUNA 3KT1A 4XQWA 2R49A 3DPRA 3JQXA 4N90A 4FTBA 1JS9A 2QNKA 2R16A 4UW3A 1BHGA 3AP7A 5LRSA 4ZY9A 3IBMA 3TNPB 4LOTA 1C8M3 1OQEA 1JTZX 4B4RA 3DV8A 2LUWA 5FY1A 1FNYA 3ZFFC 3W5MA 2DVDA 3C7EA 4JHZA 4AR2A 1H1MA 3PJYA 5D8AB 1YCIA 1HV0A 3NKGA 1RUC1 3K3OA 3M8LA 4N43B 1WMFA 2ZMLA 1XNCA 1V0AA 4OFGA 1SCSA 1ULGA 5K8SA 3KCCA 2WZR3 4N53C 2NM1A 4ZPIA 3BU0A 5DAWA 3LKJA 2AEYA 2ZKNA 5IFPA 4MV2A 2BWCA 2R32A 1SFNA 4Q2FA 4OHWA 4BK4A 1PO22 1JZ2A 1ZRCA 1AYM2 1RXFA 3PMSA 2Z2SB 2EXHA 2V4VA 4QAWA 3WP4A 1VR3A 2JDNA 4E2QA 3FC0A 4FPOB 5D21A 2VMFA 3OG2A 3VZMA 3MV01 3LDRA 5IFTA 1NA1B 3EMRA 5LB6A 1RUF1 2PAMA 1NE4A 4N8MA 4DINB 3AMHA 3VL9A 3WT3A 4D94A 1R1A3 4GWJA 1F31A 1VJ2A 1KDMA 2YU1A 2ZXQA 1ENSA 1J3RA 4DXTA 2W1SA 4A7YA 1PZ7A 1V6JA 2LS6A 4META 3INAA 1W6OA 3MI8A 4XMAA 5FZGA 5KC6A 1PIV1 3H8XA 2BDRA 1AX1A 1HB4A 1ZRRA 1CAUA 5DN2A 3GDBA 1RUI3 1BBT2 2RMU2 3ZYIB 1R081 2OW4A 1UD1A 4HK9A 1OFNA 3H8RA 1US2A 2RDSA 1JYCA 4NVPA 1K5JA 2VBDA 1HXS1 2H0BA 2XKOA 4KWLA 1FV3A 3ZFEC 2PLV1 1XNDA 3ON7A 4CEYB 5E6HA 1PGL1 3QH7A 4BOWA 3OGRA 5LBBA 2WQ4A 4PIZA 1OOPA 1YXWA 4XF0A 5FMBA 1O3RA 4FO9A 5FQ0B 1O6UA 2WA4A 4IV3B 4XFBA 4Y1VA 2ZABA 3VZLA 5FZDA 2IXLA 2RS12 5C3QA 2RS11 4WM8C 3LOBA 3AZZA 3SHRA 1H2NA 3KM5A 4GAZA 5CA6A 1UY0A 1GNHA 1RUI2 1BCXA 4AGGA 4B4QA 2OA2A 4MX3A 4EJRA 3ZN6B 3AJZA 4NMIA 5DZFA 2ET7A 1XE8A 4Q1RA 4D7TA 3BODA 5JZGA 4EN0A 3HJRA 1NA1C 5ISLA 3CIHA 3ACFA 4LO4B 3RMXA 4XVHA 5D8AA 1UYXA 4FPHA 3WZ1A 2CSGA 3MHZA 5A3WA 5FPBA 4Q4W1 3J8F3 4GJYA 4UAPA 4Y22B 5FPVA 1QIQA 1S55A 5AC92 4IEZA 2W1WA 1Q5OA 1RUD2 2AC1A 1UX7A 2X53S 3UKTA 3BUCA 5BNOA 2OYZA 2XVGA 4LQRA 2YHJA 2QQKA 4K1ZA 5T5LA 3MGUA 1PVXA 3AVSA 4EV0A 4D6SA 3I4IA 5K9YA 3FHQA 2XQRA 1AYM3 2YYOA 3KCXA 3BKZA 2VBPA 2E9QA 1IS6A 2RS53 3AXDA 4FPEA 4QPYA 3GM8A 2W1UA 5F1RA 3V0AA 1LHNA 2QVSB 4PLOA 1WLCA 1ZZBA 1UPIA 4GXLA 4FPCA 3VDDB 3MF9A 2RR13 1J83A 3O0XA 3TOJA 3VZNA 2QQJA 1RUH3 1C57A 1R091 1UXZA 1CAWB 4YYOA 4DXRA 2WFF3 1VIWB 3V64A 2QQPA 1DQ0A 1MEC3 3VBRC 4PQ9A 3K48A 4FFFA 3UV9A 3VHNA 4YSFA 5CEHA 2R0FA 4XHBA 3VN4A 1T6BX 2Z69A 4QDRA 5EJ3A 4YRDA 1CAUB 1HQWA 4BIFA 1H2KA 3B93A 3WDXA 2XUMA 2WNEA 1VB2A 1RUC2 2VZVA 4JZRA 4P9IA 1G8WA 2HWD2 1AR72 4AQ2A 4YG0A 1RUC3 2VCMA 1C1FA 1FNZA 1M4WA 2CU5A 4UFMA 3O1RA 4CCCA 1XC6A 4RSUA 2ZZQA 3JUUA 4HVRA 3R0RA 4LR4A 5FZBA 4Q4X1 4A44A 3NNMA 2Z4FA 3H7JA 1KQRA 2K46A 3BPSA 1X8MA 1CN1A 1TNRA 2R071 3GYDA 4Q0SA 2D44A 5JSRA 2VZ1A 4LBOA 2XHNA 1JW6A 3AYCA 4CRQA 2AUYA 4BMEA 4CCLA 1QQP3 1W39A 4D8MA 4DB5A 1DFQA 1DQ2A 1RUI1 1RXGA 3BOPA 4NRPA 1W6QB 4NIDA 2C6SA 4HKWA 4OZOA 4AGRA 1OA3A 1PMJX 1Y9GA 4YZ4A 2ZGSA 3M3OA 1XRUA 1OI6A 3LE0A 1EAH1 4LPLA 5FUIA 1QKQA 4LTAA 2H6BA 5GLUA 2XR4A 1OUXA 4LKSA 4BQ4A 2FD8A 4Q4V2 4P9JA 5CG8A 2VUCA 4N7IA 1C8M1 1CAVB 2WR9A 3WHTA 1X7NA 2GH2A 1KEXA 1JBCA 1ZBA3 5TSWA 4BJ0A 2Y60A 3FLTA 5C33A 1BYHA 1H4HA 1LJ7A 4QGNA 5JXJA 4PBOA 2B39A 3ZSLA 5CADA 4CU9A 5CISA 3LEGA 4CDQB 4M4RA 1RHI1 5JPNB 5CU1A 1TME1 4RGAA 2Q30A 3WNXA 5F5CA 2FDIA 2ZTNA 2GU9A 4WVWA 2Y0IA 4QM8A 4Y33A 2JDKA 2BRTA 1YIFA 2VMEA 2YY1A 2ZBJA 3I2DA 3OBTA 2IFRA 3WF0A 1BEV1 2WL1A 2WO2A 3B9CA
chains in the Genus database with same CATH topology
1JHJA 3VD9A 2W5FA 4QPWA 5IJRA 4JKLA 3ACGA 2BGPA 1OD3A 1WCQA 2V72A 4CU7A 5HPOA 2W87A 4YPJA 2BBAA 2W95A 3MUY1 4PQQA 4QB2A 4E8CA 3MV11 3DYOA 5DMYA 1GUIA 2WQ8A 2XQXA 5EJZB 4IUGA 2VZTA 3T0AA 3I2HA 1PX3A 2VZRA 4TTGA 3T08A 2W46A 3WNKA 3UESA 2EICA 4UI9L 1P8JA 1L7QA 2QQMA 3U37A 2E33A 3MO4A 4P00B 3W5NA 2Y6HA 3WF3A 3D3AA 4P02B 2J1TA 5G05L 1OH4A 4BXSV 1L7RA 3VD3A 1UYZA 2E26A 5I0DA 1CIYA 3WNLA 2ZEZA 2VR4A 4PT6A 3MUZ1 3K4DA 2JKXA 1W8NA 1JYNA 1ULOA 1CZTA 1OF4A 4GWIA 4ET7A 3THDA 1W8OA 2E32A 2W92A 4CU6A 4CU8A 1W0NA 3K46A 3C7OA 4GZ9A 2X10A 5JMOA 4DUXA 3IAQA 4OUEA 3LEKA 2W91A 3A7QA 5CZKA 3VDAA 3C8XA 2W9XA 2WZEA 2JD9A 4RN5A 3ACHA 2VJXA 2ID4A 4MGQA 3WF2A 4W8JA 4LHSA 5B4XA 2J1AA 4P08A 1W99A 4QDSA 4A4AA 1K12A 5JUVA 3UNPA 4CUCA 3SKVA 3WF4A 4DUWA 2RJ2A 3A22A 1UZ0A 1LNSA 1GNYA 2EIDA 1JU3A 1GQPA 3I3DA 4XUOA 5IYYA 5F7UA 4TXWA 4ZZ5A 1NAEA 2PQSA 1CZVA 3IDAA 3T0DA 5CYYA 1UMIA 2X09A 3NNGA 5A1AA 3GXUA 4FI9A 4JKMA 2DCKA 3FL7A 5JXGA 4JKKA 3OGVA 2VOTA 2WO3A 2JDAA 4D0QA 5DQ0A 2YC2A 2HYXA 2VCCA 3NRUA 1NUKA 1JI6A 2W47A 4RYDA 3WNPA 1UMHA 3CMGA 4W4ZA 1PX4A 3I3BA 1JZ6A 2VZSA 3LPGA 2VTFA 2W1QA 2Y6GA 1W9SA 5C7GA 3JXSA 2WN3A 2VMCA 3WEZA 1D7PM 1JZ8A 4QB1A 1RYYA 1NX9A 2DCJA 3J7HA 3UETA 3CKHA 2V5DA 3HPNA 3WNOA 4DEQA 2ORZA 4OMDA 1I5PA 3WQBA 1WKYA 2ZEYA 3CDZB 4XZUG 1JZ4A 2QBXA 3T0BA 3HN3A 3OEAA 3I3EA 1UWWA 3F2ZA 3ABZA 3SEPA 2XONA 2VZOA 3CZJA 5JR2A 5JXIA 2VO5A 3EYPA 3NJVA 2VL4A 4W50A 2J1RA 2LW8A 4P5YA 3FN9A 3MBWA 3VDCA 4KI5M 2R7EB 4CUBA 1OT5A 1TG7A 1K45A 4ZXEA 2VC9A 2VZ3A 2WZ8A 1SG3A 3I2IA 3OBAA 3T2OA 2W94A 2L9LA 4PF1A 1W9WA 1US3A 1DLCA 4AAXA 1T2XA 1K42A 1CZSA 1GOHA 5G04L 3WNNA 2C4XA 2BZDA 5C70A 1UY1A 2Y6KA 3C7HA 2Y6LA 1O59A 3HNMA 3LQCA 1W9TA 3BN6A 2W3JA 5EJ1B 1UY3A 1GOGA 3I2GA 3T2QA 4E8DA 2EIEA 1ULPA 1NKGA 2X05A 3A23A 3I2JA 3VD5A 2XOMA 1XNTA 1O8SA 4XUQA 4HG6B 1XPWA 1J84A 3C7GA 1IQDC 1F4HA 2YB7A 2BERA 1KGYA 4AG4A 1YQ2A 2QQLA 1UXXX 1SDDB 2WAAA 3SKJE 1OF3A 4QDQA 3HOBA 3NQHA 3AC0A 3IB3A 4XUNA 4ZZ8A 4ARYA 3ZM8A 1BHGA 2VCBA 4ZY9A 3GGLA 3W5MA 2E31A 4QX0A 3C7EA 4JHZA 4A41A 4Z2AA 3VDBA 2J1SA 2ORXA 5DPNA 3DYMA 5J1XA 5LA2A 2ZEWA 1K3IA 5IFPA 3WF1A 4BK4A 1JZ2A 2J1EA 2V4VA 4QAWA 1DYOA 2J1UA 3IIIA 3ACIA 3OG2A 2VMFA 3MV01 5IFTA 2EIBA 4QX3A 1JU4A 1JZ3A 2KD7A 1CX1A 4GWJA 1JYWA 2ZXQA 1O8PA 4DXTA 2W1SA 2LS6A 2CDPA 2J7MA 1JYVA 3C7FA 1H6YA 5DN2A 5LA1A 3CZUA 3GDBA 2WABA 2J1VA 3NJXA 2HLEA 4A42A 3ECQA 4KMQA 1US2A 4MOAA 3PUHA 2WUHA 3OGRA 4BK5A 1GU3A 1UYYA 2J22A 3SEEA 2VCAA 3P6BA 1UY0A 4DUVA 1SHWB 3THCA 1DP0A 2WDBA 1XNAA 4QB6A 4DXSA 2WO1A 3E1F1 2BGOA 3HJRA 3CIHA 3ACFA 4XVHA 4UOJA 3I2KA 1UYXA 2VM9A 2OKXA 4M4PA 4UAPA 5IHRA 3K4AA 3FHAA 2W1WA 3I2FA 1UX7A 1GOFA 2YFZA 4LQRA 2QQKA 2C9KA 5LCWL 3T2PA 3FHQA 4A3ZA 2C26A 2QQOA 4DEVA 2VMDA 2VQTA 3GM8A 2W1UA 4ARXA 1UY4A 2ZEXA 3CQOA 1J83A 4L0PA 2QQJA 2YFUA 2YG0A 3I97A 2QQIA 1UXZA 1TVGA 3LPFA 4DXRA 2WBKA 2Y6JA 1UY2A 2Y8KA 4KWUA 3DECA 4QDRA 1JYXA 1JZ5A 2VZUA 3VD7A 4JX0A 3PUIA 2VZVA 4A6OA 1XC6A 4XURA 3EB7A 5JXHA 3ETPA 4MO3M 2B4KA 3K75B 3T09A 3WSOA 2B9VA 2JE8A 4A44A 3HNBM 2YC4A 2Z4FA 4QX1A 1F4AA 3A21A 4CVUA 2RV9A 5HXMA 4QX2A 1JZ7A 4MGSA 3LEIA 4OMCA 4A45A 3IAPA 5B4NA 1MPXA 2VZ1A 2XHNA 5C71A 3WNMA 4D8MA 2VZPA 2WYSA 2WN2A 3K77A 1EUTA 3VD4A 2QQNA 4OZOA 3OEBA 1PMJX 4BDVB 3BGAA 3OGSA 3LE0A 4CUAA 2VZQA 4LPLA 5FUIA 4OYUA 4LKSA 2RVAA 1KEXA 4BJ0A 4XUPA 3K4ZA 3DYPA 2VQUA 2DDUA 3P1IA 4MADA 1HN1A 3HNYM 5JXJA 1R64A 1EUUA 3HEIA 4CU9A 3LEGA 4M4RA 1H6XA 3OB8A 4XUTA 2WAOA 1GMMA 2VMEA 2Y64A 3WF0A 1PMHX 2CDOA 5LA0A 2WO2A 5EIYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JHJ A;  3VD9 A;  2W5F A;  4QPW A;  5IJR A;  4JKL A;  3ACG A;  2BGP A;  1OD3 A;  1WCQ A;  2V72 A;  4CU7 A;  5HPO A;  2W87 A;  4YPJ A;  2BBA A;  2W95 A;  3MUY 1;  4PQQ A;  4QB2 A;  4E8C A;  3MV1 1;  3DYO A;  5DMY A;  1GUI A;  2WQ8 A;  2XQX A;  5EJZ B;  4IUG A;  2VZT A;  3T0A A;  3I2H A;  1PX3 A;  2VZR A;  4TTG A;  3T08 A;  2W46 A;  3WNK A;  3UES A;  2EIC A;  4UI9 L;  1P8J A;  1L7Q A;  2QQM A;  3U37 A;  2E33 A;  3MO4 A;  4P00 B;  3W5N A;  2Y6H A;  3WF3 A;  3D3A A;  4P02 B;  2J1T A;  5G05 L;  1OH4 A;  4BXS V;  1L7R A;  3VD3 A;  1UYZ A;  2E26 A;  5I0D A;  1CIY A;  3WNL A;  2ZEZ A;  2VR4 A;  4PT6 A;  3MUZ 1;  3K4D A;  2JKX A;  1W8N A;  1JYN A;  1ULO A;  1CZT A;  1OF4 A;  4GWI A;  4ET7 A;  3THD A;  1W8O A;  2E32 A;  2W92 A;  4CU6 A;  4CU8 A;  1W0N A;  3K46 A;  3C7O A;  4GZ9 A;  2X10 A;  5JMO A;  4DUX A;  3IAQ A;  4OUE A;  3LEK A;  2W91 A;  3A7Q A;  5CZK A;  3VDA A;  3C8X A;  2W9X A;  2WZE A;  2JD9 A;  4RN5 A;  3ACH A;  2VJX A;  2ID4 A;  4MGQ A;  3WF2 A;  4W8J A;  4LHS A;  5B4X A;  2J1A A;  4P08 A;  1W99 A;  4QDS A;  4A4A A;  1K12 A;  5JUV A;  3UNP A;  4CUC A;  3SKV A;  3WF4 A;  4DUW A;  2RJ2 A;  3A22 A;  1UZ0 A;  1LNS A;  1GNY A;  2EID A;  1JU3 A;  1GQP A;  3I3D A;  4XUO A;  5IYY A;  5F7U A;  4TXW A;  4ZZ5 A;  1NAE A;  2PQS A;  1CZV A;  3IDA A;  3T0D A;  5CYY A;  1UMI A;  2X09 A;  3NNG A;  5A1A A;  3GXU A;  4FI9 A;  4JKM A;  2DCK A;  3FL7 A;  5JXG A;  4JKK A;  3OGV A;  2VOT A;  2WO3 A;  2JDA A;  4D0Q A;  5DQ0 A;  2YC2 A;  2HYX A;  2VCC A;  3NRU A;  1NUK A;  1JI6 A;  2W47 A;  4RYD A;  3WNP A;  1UMH A;  3CMG A;  4W4Z A;  1PX4 A;  3I3B A;  1JZ6 A;  2VZS A;  3LPG A;  2VTF A;  2W1Q A;  2Y6G A;  1W9S A;  5C7G A;  3JXS A;  2WN3 A;  2VMC A;  3WEZ A;  1D7P M;  1JZ8 A;  4QB1 A;  1RYY A;  1NX9 A;  2DCJ A;  3J7H A;  3UET A;  3CKH A;  2V5D A;  3HPN A;  3WNO A;  4DEQ A;  2ORZ A;  4OMD A;  1I5P A;  3WQB A;  1WKY A;  2ZEY A;  3CDZ B;  4XZU G;  1JZ4 A;  2QBX A;  3T0B A;  3HN3 A;  3OEA A;  3I3E A;  1UWW A;  3F2Z A;  3ABZ A;  3SEP A;  2XON A;  2VZO A;  3CZJ A;  5JR2 A;  5JXI A;  2VO5 A;  3EYP A;  3NJV A;  2VL4 A;  4W50 A;  2J1R A;  2LW8 A;  4P5Y A;  3FN9 A;  3MBW A;  3VDC A;  4KI5 M;  2R7E B;  4CUB A;  1OT5 A;  1TG7 A;  1K45 A;  4ZXE A;  2VC9 A;  2VZ3 A;  2WZ8 A;  1SG3 A;  3I2I A;  3OBA A;  3T2O A;  2W94 A;  2L9L A;  4PF1 A;  1W9W A;  1US3 A;  1DLC A;  4AAX A;  1T2X A;  1K42 A;  1CZS A;  1GOH A;  5G04 L;  3WNN A;  2C4X A;  2BZD A;  5C70 A;  1UY1 A;  2Y6K A;  3C7H A;  2Y6L A;  1O59 A;  3HNM A;  3LQC A;  1W9T A;  3BN6 A;  2W3J A;  5EJ1 B;  1UY3 A;  1GOG A;  3I2G A;  3T2Q A;  4E8D A;  2EIE A;  1ULP A;  1NKG A;  2X05 A;  3A23 A;  3I2J A;  3VD5 A;  2XOM A;  1XNT A;  1O8S A;  4XUQ A;  4HG6 B;  1XPW A;  1J84 A;  3C7G A;  1IQD C;  1F4H A;  2YB7 A;  2BER A;  1KGY A;  4AG4 A;  1YQ2 A;  2QQL A;  1UXX X;  1SDD B;  2WAA A;  3SKJ E;  1OF3 A;  4QDQ A;  3HOB A;  3NQH A;  3AC0 A;  3IB3 A;  4XUN A;  4ZZ8 A;  4ARY A;  3ZM8 A;  1BHG A;  2VCB A;  4ZY9 A;  3GGL A;  3W5M A;  2E31 A;  4QX0 A;  3C7E A;  4JHZ A;  4A41 A;  4Z2A A;  3VDB A;  2J1S A;  2ORX A;  5DPN A;  3DYM A;  5J1X A;  5LA2 A;  2ZEW A;  1K3I A;  5IFP A;  3WF1 A;  4BK4 A;  1JZ2 A;  2J1E A;  2V4V A;  4QAW A;  1DYO A;  2J1U A;  3III A;  3ACI A;  3OG2 A;  2VMF A;  3MV0 1;  5IFT A;  2EIB A;  4QX3 A;  1JU4 A;  1JZ3 A;  2KD7 A;  1CX1 A;  4GWJ A;  1JYW A;  2ZXQ A;  1O8P A;  4DXT A;  2W1S A;  2LS6 A;  2CDP A;  2J7M A;  1JYV A;  3C7F A;  1H6Y A;  5DN2 A;  5LA1 A;  3CZU A;  3GDB A;  2WAB A;  2J1V A;  3NJX A;  2HLE A;  4A42 A;  3ECQ A;  4KMQ A;  1US2 A;  4MOA A;  3PUH A;  2WUH A;  3OGR A;  4BK5 A;  1GU3 A;  1UYY A;  2J22 A;  3SEE A;  2VCA A;  3P6B A;  1UY0 A;  4DUV A;  1SHW B;  3THC A;  1DP0 A;  2WDB A;  1XNA A;  4QB6 A;  4DXS A;  2WO1 A;  3E1F 1;  2BGO A;  3HJR A;  3CIH A;  3ACF A;  4XVH A;  4UOJ A;  3I2K A;  1UYX A;  2VM9 A;  2OKX A;  4M4P A;  4UAP A;  5IHR A;  3K4A A;  3FHA A;  2W1W A;  3I2F A;  1UX7 A;  1GOF A;  2YFZ A;  4LQR A;  2QQK A;  2C9K A;  5LCW L;  3T2P A;  3FHQ A;  4A3Z A;  2C26 A;  2QQO A;  4DEV A;  2VMD A;  2VQT A;  3GM8 A;  2W1U A;  4ARX A;  1UY4 A;  2ZEX A;  3CQO A;  1J83 A;  4L0P A;  2QQJ A;  2YFU A;  2YG0 A;  3I97 A;  2QQI A;  1UXZ A;  1TVG A;  3LPF A;  4DXR A;  2WBK A;  2Y6J A;  1UY2 A;  2Y8K A;  4KWU A;  3DEC A;  4QDR A;  1JYX A;  1JZ5 A;  2VZU A;  3VD7 A;  4JX0 A;  3PUI A;  2VZV A;  4A6O A;  1XC6 A;  4XUR A;  3EB7 A;  5JXH A;  3ETP A;  4MO3 M;  2B4K A;  3K75 B;  3T09 A;  3WSO A;  2B9V A;  2JE8 A;  4A44 A;  3HNB M;  2YC4 A;  2Z4F A;  4QX1 A;  1F4A A;  3A21 A;  4CVU A;  2RV9 A;  5HXM A;  4QX2 A;  1JZ7 A;  4MGS A;  3LEI A;  4OMC A;  4A45 A;  3IAP A;  5B4N A;  1MPX A;  2VZ1 A;  2XHN A;  5C71 A;  3WNM A;  4D8M A;  2VZP A;  2WYS A;  2WN2 A;  3K77 A;  1EUT A;  3VD4 A;  2QQN A;  4OZO A;  3OEB A;  1PMJ X;  4BDV B;  3BGA A;  3OGS A;  3LE0 A;  4CUA A;  2VZQ A;  4LPL A;  5FUI A;  4OYU A;  4LKS A;  2RVA A;  1KEX A;  4BJ0 A;  4XUP A;  3K4Z A;  3DYP A;  2VQU A;  2DDU A;  3P1I A;  4MAD A;  1HN1 A;  3HNY M;  5JXJ A;  1R64 A;  1EUU A;  3HEI A;  4CU9 A;  3LEG A;  4M4R A;  1H6X A;  3OB8 A;  4XUT A;  2WAO A;  1GMM A;  2VME A;  2Y64 A;  3WF0 A;  1PMH X;  2CDO A;  5LA0 A;  2WO2 A;  5EIY B; 
#chains in the Genus database with same CATH topology
 4LIV A;  2JJ6 A;  4RS5 A;  1OPO A;  1W8U A;  5K0U A;  5BUV A;  1Q8P A;  5FWJ A;  3AKP A;  4GUL A;  5ERL A;  1SZB A;  2RS1 3;  4IV1 A;  4JKL A;  3VBO C;  4Q4Y 1;  1COV 1;  4IGO A;  1Z7S 3;  1G9D A;  3N9O A;  3ACL A;  4D69 A;  2ETE A;  2A3X A;  3RZK A;  3O14 A;  2DCT A;  4Q0V A;  5IW0 A;  4KQ7 A;  3ZR5 A;  4AAP A;  2W87 A;  4YPJ A;  2BBA A;  2CHH A;  3MUY 1;  4QB2 A;  1COV 3;  3I3M A;  1UQX A;  1LHW A;  1DYP A;  1PVC 2;  3KMH A;  4E8C A;  2DVA A;  2IC1 A;  5JSO A;  4P9L A;  4UW5 A;  2HBU A;  2XQX A;  3OGG A;  5EJZ B;  4DFS A;  2FCT A;  5I0T A;  1T6G C;  2PQQ A;  1QWR A;  1YLL A;  4N43 C;  1ND2 A;  5A7W A;  4LKE A;  3T0A A;  3U10 A;  4BLI A;  2TBV A;  4BE3 A;  5IVY A;  3J9S A;  3O12 A;  2Q8C A;  3SXW A;  4LKF A;  3VBU A;  3VBH C;  3VV1 A;  5FZ9 A;  3TEY A;  5C3S A;  1TZO A;  4J6G A;  3SMH A;  1DHK B;  4BA6 A;  1IOA A;  1KXG A;  4NR1 A;  4GD4 A;  1DU3 D;  1AR6 2;  3MLJ A;  4IEV A;  1O4Z A;  4UI9 L;  5FMD A;  2TEP A;  3HBZ A;  5CG9 A;  1L7Q A;  2BNO A;  3U37 A;  1W6Q A;  2E33 A;  2HH9 A;  4HZF A;  4UFL A;  5A80 A;  1XE0 A;  2CWS A;  2OX0 A;  3RG0 A;  4ASK A;  3WF3 A;  5JI9 A;  3KT4 A;  4G9S B;  4HAN A;  1LHO A;  1KS5 A;  2K2S A;  2FHR A;  3WDW A;  2DUQ A;  4DS0 A;  4M3C E;  4COV A;  2HWE 1;  1WW6 A;  5BNN C;  3ZKU A;  5SV8 A;  2MNG A;  3VD3 A;  2W68 A;  4IER A;  5JI7 A;  3MLK A;  4AFD A;  2P3I A;  5FMO L;  4YW2 A;  3WNL A;  3CNA A;  5FOJ B;  4GIQ A;  4PT6 A;  1QXR A;  3ZMO A;  3WUC A;  2W2I A;  2R6Q A;  1TMF 3;  3OY8 B;  2VNO A;  1WBF A;  1O3Q A;  3MFC A;  5A6Q A;  1OA2 A;  2FDG A;  2VU9 A;  1CPM A;  2BFU L;  2BGC A;  4FXK B;  2D5H A;  5CAZ A;  1OF4 A;  1AYM 1;  1YJL A;  2CAV A;  4PJY A;  4QXC A;  5KC5 A;  1D2S A;  4BZ4 A;  1FV2 A;  4UFI A;  5GKA C;  1G9B A;  2RE9 A;  1IS4 A;  4AVV A;  4EQV A;  5A3U A;  4WM8 B;  3UK9 A;  3VKO A;  2KM2 A;  4MGY E;  1BXH A;  2VVE A;  2XLA A;  2X10 A;  3NAP C;  4XDP A;  3IAQ A;  4OUE A;  4XF1 A;  2V09 A;  2WNU B;  3J26 N;  1BVP 1;  1W2O A;  3PTY A;  2BP6 A;  2GC3 A;  1GR3 A;  3A7Q A;  4BQ1 A;  5L9B A;  2XKP A;  4K1Y A;  4R8H A;  1YFU A;  1RIR A;  4XFA A;  1UNB A;  3ACH A;  2C0Z A;  3GHN A;  1DG6 A;  1EP0 A;  1W6P A;  4IEX A;  2I74 A;  4MGQ A;  1GP6 A;  2WSU A;  1W06 A;  2JXA A;  3IZO A;  2B7Y A;  1K12 A;  1VP6 A;  5BV6 A;  3UNP A;  1ENR A;  4HPK B;  1H8T B;  3CJI C;  3E5U A;  4XE9 A;  3POE A;  3VBH A;  2MEV 1;  3DL3 A;  4FPK A;  4HK8 A;  3ZFF B;  2QUO A;  3ME2 A;  3PUR A;  2QDR A;  3U4S A;  4KGQ A;  2HWF 1;  5A33 B;  4CEY A;  4CE8 A;  1POV 1;  2WII B;  5ABJ B;  3MW3 A;  3WG4 A;  5F7U A;  1N1Y A;  1NAE A;  2EF6 A;  2H0V A;  3LSD A;  2FBE A;  4G4F A;  2PQS A;  1CZV A;  3IDA A;  1QJX 3;  4NJ4 A;  3HQU A;  3GBW A;  3KF5 A;  4RD7 A;  2DCY A;  2IFW A;  2NQY A;  2HWB 1;  1UZV A;  3ZFG A;  1FOD 3;  1RIT A;  3SIS A;  1Y4W A;  1IZ3 A;  1QMJ A;  4OQ9 A;  2GC1 A;  1HB2 A;  4D0Q A;  1PGL 2;  2HYX A;  2VCC A;  3NMB A;  5C8C C;  1O3S A;  3NRU A;  3ITQ A;  4RFR B;  3APB A;  3WNP A;  3SQO A;  2WKK A;  4HON A;  2D6P A;  2X8K A;  4K21 A;  1LKN A;  1IPJ A;  1S0E A;  4W4Z A;  1LGB A;  1CJP A;  2VZS A;  1CR7 A;  3AMQ A;  4MHU A;  4XCA A;  4JV4 A;  4AI2 A;  2VAU A;  1YFY A;  2VTF A;  4ERO A;  4FBF A;  2Y6G A;  1HRV 2;  2JB8 A;  3VBS B;  4ASM B;  1V9U 3;  2ADE A;  4H7L A;  1YYN A;  2C24 A;  1W3V A;  2JDY A;  2MEV 2;  1OLR A;  1D7P M;  3GNE A;  4FXG B;  1JZ8 A;  1WD3 A;  2DYC A;  1WW4 A;  4Z92 B;  2EA7 A;  1YIP A;  2DBN A;  5LAT A;  4GH4 B;  2VW0 A;  4DEQ A;  3PIG A;  1PM4 A;  1XOY A;  1H2M A;  3GZU C;  3O0V A;  1ND2 C;  1WKY A;  1X82 A;  1YFX A;  3POF A;  4YM0 A;  2ZEY A;  2CTV A;  4XZU G;  5CVR A;  3IPV B;  3T0B A;  3SNM A;  3AJY A;  2DF7 A;  1A6C A;  2ZMN A;  5F39 A;  3SEP A;  3ES4 A;  4DZG A;  1VRH 3;  3BYW A;  5FMC A;  3AKS A;  1S0F A;  2VO5 A;  4HT1 T;  4MGT A;  1H2L A;  3NJV A;  4W50 A;  3H0O A;  2FQP A;  2E63 A;  3VBF A;  4C1W A;  3FLP A;  4TSV A;  4NRO A;  4C8D A;  3MIC A;  1GBG A;  4KI5 M;  4CUB A;  1OT5 A;  4BIS A;  1NG0 A;  2JWP A;  2CGP A;  1EPW A;  3TN9 1;  2VBB A;  2V4A A;  1F9K A;  2GAL A;  2K9Z A;  2VZ3 A;  2VC9 A;  5DAV A;  3VHR A;  3AMM A;  3I2I A;  3OBA A;  4I0W B;  5KHI A;  4TYS A;  4CCD A;  4AI3 A;  3P5B A;  4IEQ A;  5GLV A;  4RHV 3;  1JN2 P;  1LRH A;  4YVW B;  1DLC A;  4AAX A;  2PHR A;  4L97 A;  4W6Y A;  2W39 A;  3JU9 A;  1YHF A;  4WM7 B;  2G9Z A;  1UOG A;  5G04 L;  3ENR A;  3WNN A;  4BIO A;  1JOD A;  3NWK A;  4COW A;  1LOE A;  2A6Y A;  3TEX A;  3LWC A;  4B3N A;  2XVL A;  3VKM A;  3PUA A;  3KGZ A;  5CKN A;  1LR5 A;  4S2H A;  4IXL A;  3I49 A;  2JIC A;  3HNM A;  4Y20 A;  3LQC A;  4IW3 A;  2B42 B;  1VBA 1;  4LLO A;  3RYK A;  4CUG A;  1UY3 A;  1MS4 A;  2A6X A;  2DFB A;  3T2Q A;  4G3Y C;  1ULP A;  3O1T A;  2X05 A;  4AK3 A;  1O7F A;  4BWO A;  4IEP A;  1RGS A;  1S4C A;  1OLQ A;  1VAK A;  4LOS A;  1XNT A;  1DGW X;  1XPW A;  4NPM A;  2VMH A;  4XAA A;  1RVF 1;  3T2T A;  2JG8 B;  3R4D B;  3VBS A;  1Q8Q A;  1ST8 A;  3UGH A;  4YGE A;  5C3P A;  2BER A;  1YEW A;  1JYI A;  1LEN A;  4R9B A;  4UBH A;  1DQ5 A;  2Z5W A;  1QY4 A;  1MZF A;  3GF6 A;  2EAL A;  4K20 A;  3RVH A;  3CLP A;  1ZZC A;  1Q3E A;  2VMI A;  4HXC A;  4E4Z A;  1QDO A;  4Z2W A;  5FYH A;  3OUJ A;  1W6M A;  4QHO A;  3LAG A;  4W6X A;  4YW5 A;  3UT0 A;  4R9C A;  4QDQ A;  3W20 A;  4OUM A;  3VUO A;  2VD7 A;  2JE7 A;  2HBT A;  4QPG A;  3IDE A;  3NQH A;  3BIE A;  4YW4 A;  5FWE A;  4ARY A;  1V6K A;  4XQD A;  5FJK A;  2VCB A;  1RMU 1;  4L8Q A;  1H8V A;  3JD7 3;  3VKN A;  4Q4Y 2;  4NPL A;  4QX0 A;  4NO4 A;  2JDP A;  2J1S A;  2DVB A;  3OBZ A;  1KJR A;  2OUH A;  3AP5 A;  2FDJ A;  4Y22 A;  5J1X A;  4IEO A;  5LA2 A;  5CFD A;  4YFZ A;  3T4V A;  5AC9 3;  2A75 A;  4KGG A;  4PI2 A;  1UYP A;  4FFG A;  3ASI A;  5JOX A;  1POV 0;  1LOB A;  3J7N A;  4QKD A;  1V6O A;  2NLR A;  4LNV A;  1DYO A;  1W0O A;  2R07 3;  2ZHM A;  3ACI A;  4XF9 A;  4E2G A;  2WLQ A;  2R06 2;  3V0A B;  3OSD A;  1X33 A;  2BV4 A;  2PHW A;  1JU4 A;  4IE6 A;  4U2A A;  3B3Q E;  5FZM A;  4WM7 A;  2KD7 A;  4RL7 A;  5FIX A;  5J48 A;  4PLM A;  2FMD A;  1SFP A;  2QQV A;  4GMP 3;  3AZY A;  4CCM A;  1NCQ B;  3V0B A;  1XBF A;  1W6O B;  4MHR A;  2AH2 A;  1O8P A;  1O5U A;  2G9F A;  4GWN A;  5FCC A;  3KLS A;  5DUW A;  2GC0 A;  2J7M A;  3FWE A;  1WA4 A;  2WC2 A;  3QBQ A;  4JQT A;  2PMW B;  1J1T A;  5LA1 A;  3RS6 A;  5KR7 A;  2WAB A;  4Q26 A;  2HLE A;  2LTN A;  2WA3 A;  3J8F 1;  2PHD A;  4XF3 A;  3S6P A;  2RMU 3;  3IKW A;  4B7K A;  2YBP A;  2ZGK A;  2X5I A;  1JOJ A;  3D4K A;  2BEO A;  4XJA A;  1W28 A;  1ND3 C;  2Z42 A;  5DUX A;  1Y7B A;  4KG8 A;  4HBN A;  2D6O X;  4PDW A;  3AYE A;  2OPW A;  3N7K A;  4KG0 A;  2XML A;  1C28 A;  2R04 1;  4H7M A;  1CVN A;  3Q8E A;  1GU3 A;  3UYJ A;  1UYY A;  4P5H A;  2EAA A;  1JMU B;  2IVJ A;  3I59 B;  1ULE A;  5L9R A;  2J22 A;  3IWZ A;  1K5M B;  1XB9 A;  5FXX A;  5C9A C;  3SEE A;  1QDC A;  2RJL A;  2TNF A;  2VCA A;  1UZY A;  3KQR A;  5FPL A;  4IE5 A;  3IMM A;  2ZS6 B;  4P9W A;  4A7Z A;  3THC A;  5GZE A;  1XNA A;  5C4W A;  4EN9 B;  3ZX7 A;  1AR9 1;  2P6C A;  3DF0 A;  4C1X A;  2IUW A;  3E5Q A;  2WNV A;  4CCN A;  1Q8O A;  1XYN A;  1J58 A;  1OSG A;  1VBC 3;  4AI1 A;  5LY1 A;  3TEZ A;  2YBS A;  2QDN A;  4TLG A;  1QXP A;  5FYV A;  4BU2 A;  4IQP A;  4UOJ A;  5HCF A;  3B02 A;  5FZO B;  2X5I C;  3A0K A;  5LEJ A;  3WCR A;  3NV3 A;  4NHX A;  5FP4 A;  5IHR A;  4Q4W 2;  2DTY A;  5FY9 A;  4CXW A;  5FO9 B;  4NUB A;  4C0H A;  2JDU A;  1GOF A;  5FYY A;  1OKO A;  4UT5 A;  3UJO A;  4BHP A;  4IEU A;  1BQP A;  2YFZ A;  3RYR A;  3OBR A;  3MIE A;  1A34 A;  2YV8 A;  5EPA A;  2ZOE B;  3ZXF A;  3LEM A;  4DEV A;  2PAK A;  1TMF 2;  3CJI B;  5GM0 A;  2WYF A;  1C8N A;  3R6S A;  5FY8 A;  4ARX A;  4FTS A;  5CKQ A;  5FMO S;  4NIH A;  3CQO A;  5A7P A;  3AL5 A;  5FXW A;  1AL2 3;  1ZBE 3;  3WQ0 A;  3ZYJ B;  3K2O A;  1UKG A;  1QH7 A;  3I97 A;  2QQI A;  3MID A;  5GAL A;  4Q4W 3;  5JAX A;  1C1L A;  1HRI 3;  1UY2 A;  1YI7 A;  2GDF A;  4JAA A;  4I02 A;  5FXZ A;  3UJQ A;  3V65 A;  3VBF B;  2XJU A;  2QTW B;  3GZE A;  2XHK A;  3U11 A;  4Q4V 1;  2OS2 A;  4HMZ A;  1SAC A;  4JTN A;  4QGL A;  1XXN A;  3JD7 1;  2VZU A;  4UF0 A;  4JX0 A;  1OHF A;  1S0G A;  4UW6 A;  5F2W A;  3PUI A;  4BQ5 A;  1YQ8 A;  2ZGQ A;  3GZT B;  4YGC A;  2HWB 3;  1B35 A;  4EZH A;  4V2W A;  3EB7 A;  1YQ6 A;  1SLC A;  3ETP A;  1RMU 3;  1UU4 A;  3K75 B;  1YQC A;  3E6B A;  2B9V A;  2JE8 A;  1HXS 2;  3HQX A;  3WSO A;  2NMO A;  3KVB A;  4LHL A;  1F4A A;  3A4U A;  2RDN A;  1VRB A;  2FZ1 A;  2JG9 C;  4IV3 C;  3GBF A;  4YVW A;  4WZC A;  1ZVF A;  1JOB A;  1QJF A;  1R08 2;  4LA3 A;  1QQP 1;  3IAP A;  1GQG A;  5B4N A;  1UU5 A;  2VOK A;  4FFH A;  4OVE A;  5CFC C;  2UY9 A;  1TQ5 A;  5C5T A;  1BEV 3;  1VBD 3;  2W0X A;  3AX4 A;  3USS A;  1ULC A;  2WYS A;  1XE7 A;  3AP6 A;  4SLI A;  1COV 2;  3MIF A;  3K77 A;  1LOF C;  2DUR A;  3RMY A;  3N35 A;  2QQN A;  1PO2 1;  3DPR B;  3ZMN A;  2BVV A;  3BGA A;  5LBC A;  1GLH A;  4HFS A;  2AAC A;  1GFF 2;  4LO6 B;  2V5Y A;  1LAJ A;  2Q0A A;  4PLN A;  1RUF 2;  4Q4X 3;  4LUK A;  4AF9 A;  2GAU A;  2OII A;  2XJP A;  5FRE A;  2RM2 2;  3H42 B;  3K4Z A;  3DYP A;  1HRV 1;  3PVN A;  2PTM A;  4KH9 A;  4MH0 E;  4RGG A;  4P9Y A;  1XSQ A;  2FCV A;  2IXJ A;  4BMB A;  3HNY M;  4QQ2 A;  4CDQ A;  1YQ5 A;  4LO5 B;  3KT7 A;  5C3O A;  5IK8 A;  5IVJ A;  3LD8 A;  1W8F A;  3SH4 A;  1NYW A;  4FT8 A;  4UW4 A;  1UIK A;  4XUT A;  1FT9 A;  5CFC B;  1D4M 1;  1S1A A;  3MIG A;  4AVB A;  2WAO A;  1QJY 2;  5I8S A;  3MZH A;  4CEW A;  4YW6 A;  5FUP A;  2GC2 A;  4Q29 A;  4OUS A;  2D6M A;  2IXK A;  4ITC A;  1EV1 3;  4XDO A;  2ZGT A;  3AK0 A;  4ZS2 A;  4QPW A;  5IJR A;  3CHX A;  4YVS B;  3DGT A;  1JOP A;  3O7O A;  4IEW A;  3ILR A;  5HV4 A;  1RUG 3;  1KFX L;  1W3X A;  5FAX A;  2UU8 A;  4XHX A;  5FZI A;  3O1U A;  2WIN B;  1Y9Q A;  2R04 3;  1RUJ 2;  3BTA A;  4P14 A;  3BPZ A;  4LO8 A;  1I3H A;  3OYW B;  2ATF A;  1QJU 3;  2V72 A;  4CU7 A;  4AFC A;  5HPO A;  1G9C A;  1HXS 3;  5EFU A;  5FYC A;  2W95 A;  4UF0 B;  4FAH A;  1UO9 A;  1AHS A;  4BCU A;  3EBR A;  4Y4Y A;  5EWS A;  2G1M A;  2XBO 3;  1LGC A;  3W9A A;  1B35 B;  1PNG A;  2WQ8 A;  4NOT A;  5LW9 A;  1NQD A;  2XJR A;  3QAC A;  2HWB 2;  5FO7 B;  5FZF A;  2VZT A;  1ZBE 1;  4JVA A;  3ZDV A;  1VBC 1;  1PNF A;  4CDX A;  1UZZ A;  3AP4 A;  2E7A A;  1LEC A;  3I2H A;  2BVB A;  4WVM A;  5F3E A;  3VBU B;  4GB3 2;  3T08 A;  4XBN A;  2E7Q A;  5KXC A;  4ES8 A;  2EIC A;  2JDH A;  3H3L A;  1KDK A;  3FMG A;  3VBO B;  4JCK A;  1SLL A;  1AR7 3;  2HWD 3;  2DVG A;  2ZPX A;  3E5X A;  1A8M A;  4PIY A;  3RDI A;  3PUS A;  2ZGL A;  1DLL A;  2I07 B;  4V1P A;  1PMI A;  2HWF 3;  3GZA A;  3JCI A;  1LTE A;  3KV4 A;  4Y1Y A;  3VBF C;  4A3X A;  4YGB A;  4E9K A;  4P00 B;  1D0G A;  1PK6 A;  1BK1 A;  4LBJ A;  1ASJ 1;  3S30 A;  5A3T A;  4ISQ A;  4XEZ A;  3UL2 A;  3VB9 A;  3Q8B A;  3D3A A;  5FBZ A;  4P02 B;  1SLB A;  2FDH A;  5F9T A;  1SQ4 A;  4B4P A;  1CIW A;  3WW3 A;  1DCS A;  3U14 A;  1N1T A;  3PVE A;  2XJT A;  1UW8 A;  2DBI A;  1DIW A;  1LOD A;  1X9P A;  1L7R A;  4LO7 A;  3CBN A;  5EYX A;  1DZT A;  3J7L A;  3POW A;  2BBV A;  1UOF A;  5LEK A;  1CIY A;  5FYI A;  2OVU A;  2B45 X;  3L2Y A;  3I8T A;  5CFD B;  3T1M A;  3NST A;  3K4D A;  2GND A;  4QX7 A;  3SH5 A;  2XLG A;  3AZX A;  3E6D A;  4KU8 A;  3P3N A;  3NV4 A;  4JC1 A;  4O61 A;  5KHK A;  1JXN A;  4JRA A;  4JDM A;  4FTE A;  1OLM A;  1K5M A;  5AFE A;  1DGW A;  2Z79 A;  1B35 C;  1RUG 2;  2R1D A;  3KQ4 B;  3ELN A;  2JG8 C;  4Q5O A;  4HN1 A;  2W92 A;  1V9U 1;  2D3R A;  2XB6 C;  4CU8 A;  2LM3 A;  3PVO A;  1MVE A;  4NWV A;  3K46 A;  4AQ6 A;  3NV1 A;  3AKQ A;  4AED A;  4COU A;  3GAL A;  4DUX A;  1VBA 2;  3AYA A;  4Y1Z A;  1LUL A;  4MG2 A;  1IKQ A;  3PL0 A;  5CZK A;  2RHP A;  3C8X A;  1L7L A;  5FZL A;  4R4X A;  1NXM A;  2WZE A;  1A3K A;  2WNU C;  4IES A;  5DDJ 3;  2ERF A;  2ZAH A;  3ZXG A;  2FMY A;  2VJX A;  3WOG A;  5HV0 A;  5I8T A;  4LHS A;  3WDU A;  3EQE A;  4FOW A;  3WIN E;  3KWV A;  3NVC A;  4P08 A;  4QDS A;  2GNM A;  2ILM A;  5FJH A;  2P34 A;  1ZRE A;  3ZOI A;  1CGP A;  3SKV A;  5I93 A;  3KV5 A;  1BMV 2;  3WF4 A;  4AEM A;  4ZXK A;  5LBF A;  5JOZ A;  5FZ4 A;  5T54 A;  2C9A A;  4PI0 A;  4FQ4 A;  1UOB A;  1AJO A;  4LE3 A;  3ZFE A;  1GQP A;  2DWR A;  3I3D A;  4IGQ A;  5AVA A;  4CDW B;  4LJH A;  3MYX A;  3QH6 A;  4QPG C;  1UN1 A;  5FPA A;  4TXW A;  5IYY A;  2FZ2 A;  5DZE A;  3NW4 A;  3T0D A;  4XIO A;  2UWA A;  3FE5 A;  4OI1 A;  1GZT A;  1UMI A;  3FFZ A;  4QD2 A;  4LMF A;  4YLZ A;  4FI9 A;  2ZX4 A;  2ZHL A;  3B7M A;  1MR5 A;  3FL7 A;  4LOR A;  1VAL A;  1UF2 C;  3OGV A;  5DAX A;  2VOT A;  2WO3 A;  4I09 A;  2YC2 A;  4C0B A;  3O0W A;  5SV5 A;  3VBR A;  2R07 2;  4AW7 A;  3JBG 3;  1KFU L;  4LHN A;  2PN5 A;  4YAR A;  4FP3 A;  5JZG C;  3SCH A;  2YRO A;  4OZX A;  4RYD A;  3U1X A;  1R1A 2;  2UUR A;  5FTT C;  2BOI A;  3U0Z A;  3VZJ A;  3H1W A;  1X36 A;  1CAV A;  3AVR A;  2QJV A;  5JCT A;  3E6C C;  1YUD A;  5FP7 A;  1RUO A;  1PX4 A;  1HDK A;  1JZ6 A;  1R09 2;  1OXC A;  3LPG A;  4QXB A;  4JGY B;  4Q0U A;  1J3Q A;  2JG9 B;  2PXJ A;  3RJR A;  5C7G A;  2WN3 A;  4MLO A;  2VUJ A;  1ODM A;  3W59 A;  3POI A;  4Q27 A;  4ATF A;  1ODN A;  2VMC A;  1U5I A;  1WGP A;  3WEZ A;  4CDW C;  4DY5 A;  4QB1 A;  4Q4Y 3;  1Q8V A;  2ARA A;  3DKQ A;  1ZM1 A;  2PLV 3;  3UET A;  2PAE A;  1Q56 A;  4YFW A;  3ZYH A;  5ANQ A;  4EN6 B;  4I01 A;  2ORZ A;  3TWI A;  5FBJ A;  4FQZ A;  4CDU B;  3FHI B;  2NPI A;  1G9F A;  4AI0 A;  1GYK A;  2QBX A;  3L2H A;  5FPX A;  3CO2 A;  3DUI A;  2QKD A;  3I3E A;  3OEA A;  3F2Z A;  5AC9 1;  2VTX J;  2DUP A;  5I91 A;  3SCF A;  1W2N A;  2VZO A;  3BI3 A;  1OD5 A;  4ZON A;  1JH5 A;  5FXV A;  5JMC A;  1C8M 2;  1QEX A;  2PA7 A;  2WT0 A;  5M0T A;  3D0S A;  4CA9 A;  3GJA A;  4UYB A;  5JXI A;  4DRR A;  3DPR C;  3MIB A;  2VL4 A;  2J1R A;  3H8U A;  1TNF A;  1LCL A;  4QQO A;  1HN0 A;  1QHD A;  4X8P A;  3VDC A;  4W65 A;  1XNK A;  2P2K A;  4DNY A;  1W8H A;  5HBA A;  1RB8 G;  3IDC B;  4KBB A;  3ZIW A;  2XWJ B;  1K45 A;  5FP8 A;  4XJ9 A;  4YW1 A;  4ZXE A;  3VKL A;  4C90 A;  4LEJ A;  5ABJ C;  5J98 B;  4E2S A;  1SG3 A;  1VBC 2;  2I45 A;  1H4G A;  2ZKL A;  4YM1 A;  4YVW C;  3T2O A;  3VZK A;  1MEC 1;  3ZKY A;  4PF1 A;  1VMJ A;  2UYA A;  3FJS A;  3NNL A;  4XW3 A;  1FAY A;  4HKL A;  1BLZ A;  1T2X A;  4YVS A;  3VGI A;  3ZPO A;  1K42 A;  2D6K A;  5FY5 A;  1Y9M A;  2D7F A;  4RS5 C;  5FZE A;  3NL1 A;  2BQP A;  2RS3 1;  4CP1 A;  1UY1 A;  4EN8 B;  5L9V A;  4AEK A;  4CZS A;  2VVF A;  1BBT 1;  1MAC A;  4PCR A;  1F8V A;  1NCQ A;  2IXI A;  3TEW A;  5T5O A;  1VBE 2;  1IQA A;  1PIV 3;  1W9T A;  1LOG A;  4C91 A;  4AYU A;  5I8Y A;  4OI0 A;  2W3J A;  2D40 A;  1GOG A;  3I2G A;  2A3W A;  1VE0 A;  1NKG A;  3M3I A;  3I2J A;  1X8E A;  2XOM A;  3O5S A;  3AM2 A;  4GA9 A;  1WCK A;  2JDM A;  3FX3 A;  3W21 A;  2YUE A;  3OOX A;  3ZLI A;  1VAV A;  3HT1 A;  5T3N A;  2PHL A;  5DDJ 1;  1MS3 A;  2GN7 A;  5FZK A;  1KGY A;  4K6B A;  3PHM A;  4Q8L A;  4NHY A;  4XAE A;  3HVD A;  3ZSE A;  3S0M A;  4AL9 A;  1YQ2 A;  4GKY A;  5IK5 A;  5APA A;  1ZZ9 A;  4NAO A;  2HWC 2;  3H3Z A;  1AYN 3;  3WHU A;  3SKJ E;  3WQ1 A;  1V6M A;  4RR3 C;  1OF3 A;  4KBZ A;  5FZA A;  1AX2 A;  5BNP A;  4XJZ A;  4OCT A;  1RUE 2;  1ZBA 1;  5E8A A;  4WM8 A;  4QU2 A;  3AC0 A;  1GSL A;  2A73 B;  3HMY A;  1TME 2;  3ZM8 A;  4XJW A;  3GGL A;  4UFH A;  1LU2 A;  5JDB A;  2ZGN A;  1APN A;  1UPS A;  1LEM A;  4A41 A;  5GZC A;  2MEV 3;  3VDB A;  5FZO A;  3HN1 A;  3PNA A;  2ORX A;  5F37 A;  5DPN A;  3DYM A;  3O1S A;  3N3H A;  2UWC A;  5FPU A;  4DMI A;  2ZMK A;  2DTW A;  2ZEW A;  4KU7 A;  1WA6 X;  3LFI A;  4GWM A;  2BNM A;  2WO7 A;  3OUI A;  2RR1 1;  2VUL A;  4LBM A;  1IHM A;  4A6S A;  3VBH B;  1AVB A;  1QGL A;  4CDX B;  1GWK A;  4XMI A;  4OHX A;  3III A;  2B46 X;  4HL0 A;  4BPZ A;  5AVP A;  4XTM A;  4QHB A;  1DDL A;  4CTE A;  3TYJ A;  1SPP A;  5J09 A;  4E4H A;  1AXY A;  1FOD 2;  1C5H A;  2VPV A;  3FZ3 A;  4K9S A;  3ZDS A;  2G9G A;  1E57 A;  3O1P A;  3V0B B;  1IG0 A;  3ZFG B;  3POY A;  1W6N B;  4AHZ A;  5KXB A;  4IND A;  4EWA A;  1QH6 A;  5EQU A;  3MF6 A;  4XDQ A;  3SLI A;  1S0J A;  1IKP A;  2YU2 A;  2WNV C;  4JGZ C;  3ZXA C;  1PK6 B;  2CDP A;  1EYB A;  1PIV 2;  2VEC A;  4UWD A;  4ORF A;  4XFC A;  1ZRF A;  1H6Y A;  1S0C A;  3N9M A;  4COZ A;  2J1V A;  3U75 A;  2P3J A;  1W2A X;  4A42 A;  5HI0 A;  1VBD 1;  2YPD A;  1O4Y A;  4MOA A;  1LOA A;  3LDB A;  3HBK A;  5HXV A;  4NHK A;  3TRS B;  3PUH A;  1XQN A;  4NRM A;  2CGO A;  1WBL A;  2R1B A;  5LZ6 A;  2EXJ A;  2WUH A;  4UXA A;  3I59 A;  4BK5 A;  4PIX A;  3RFR A;  3HR9 A;  1WLT A;  5FKC A;  4WV8 A;  4XAB A;  4N53 B;  2QZ3 A;  1ULD A;  5IVC A;  1DGR N;  1HIX A;  2VOV A;  3O1M A;  4FPF A;  1UL9 A;  4DUV A;  1OUR A;  5FLI A;  1SHW B;  1XYP A;  1DP0 A;  2QFE A;  2K0G A;  2XJS A;  1HB3 A;  2RDR A;  2RM2 1;  4QB6 A;  2XGX A;  1GV9 A;  4DXS A;  2WO1 A;  3E1F 1;  3CL1 A;  2C5D A;  1N1V A;  2F17 A;  1RC6 A;  1ULF A;  3POB A;  1SCR A;  3KV6 A;  5IAX A;  2AEZ A;  1RHI 3;  2A3Y A;  1BZW A;  1NLQ A;  5H9S A;  2VM9 A;  2X29 A;  2OKX A;  4M4P A;  2WFF 2;  1SLT A;  2ZGU A;  1M06 G;  4XQ4 A;  5T5J A;  1RUH 2;  3FHA A;  3I2F A;  4XXA A;  4XFG A;  3ZXJ A;  1N3P A;  3RPQ A;  3AFK A;  5KHJ A;  3ZYR A;  1FMD 1;  2YMZ A;  3VZO A;  4NWW A;  5JPM B;  3MPP G;  4JGZ B;  1CES A;  1RVF 2;  2VXR A;  4QT6 A;  2ZX0 A;  4Z07 A;  4TN7 A;  3VLB B;  4K3U A;  2C9K A;  2D6L X;  3T2P A;  1WLW A;  2CGN A;  1F15 A;  3R4U A;  4ZS3 A;  5J96 B;  3KSC A;  2QQO A;  4Q0Q A;  1ONA A;  1V70 A;  2VMD A;  4Q1P A;  1XU1 A;  2VQT A;  4H2A A;  4B7E A;  4ZKT B;  1QNW A;  4HSL A;  4CEY C;  4TWT A;  1H30 A;  1RUJ 1;  1MS5 A;  1W9F A;  4CP0 A;  4BQY A;  4X6R B;  1VAM A;  2HJI A;  2ZA9 A;  3EHK A;  4AI9 A;  3VDD A;  2YFU A;  2P1B A;  3LA7 A;  1TVG A;  3WG3 A;  1HX6 A;  2XXZ A;  4EWD A;  2VG9 A;  2Y6J A;  4QPI A;  1VBB 3;  2Y8K A;  2CV6 A;  5A6Z A;  3MDP A;  4KWU A;  4ASL A;  2WWU A;  4L11 A;  5C9A A;  3H1Y A;  1RJ8 A;  3OYW A;  1JYX A;  3VBR B;  4F8A A;  2Y34 A;  1HRV 3;  1U5X A;  2WZR 1;  4EN7 B;  2C1F A;  1CPN A;  3VHO A;  1DGL A;  3LCP A;  3TN9 2;  1U5Z A;  1FPN 3;  1A78 A;  2DV9 A;  2JEM A;  4HPK A;  4HOO A;  2Y6F A;  4XUR A;  1RTV A;  2HWC 3;  2FDF A;  4CXY A;  3ZFF A;  4YG3 A;  4JGY A;  5JLV A;  3B00 A;  5IK7 A;  3T09 A;  4Q0P A;  4RGK A;  1PO1 2;  3JBG 1;  2YC4 A;  3HQR A;  2YBK A;  2ZAA A;  4CVU A;  4Y24 A;  3LIH A;  1U5Y A;  2RV9 A;  1TMF 1;  1YC6 1;  2RJK A;  4QX2 A;  1JZ7 A;  5F8P A;  3LEI A;  1MZE A;  4OMC A;  1N3Q A;  2MHF A;  2SLI A;  3AP9 A;  2WSV A;  1AUY A;  4KL1 A;  3UGG A;  1QOS A;  3OD4 A;  3HWJ A;  3WNM A;  4EWE A;  2VZP A;  4ISR A;  2HYK A;  2VNG A;  2WN2 A;  3THP A;  2GSY A;  3BCW A;  3KCY A;  5GLW A;  2NP0 A;  3KB5 A;  5E1R A;  1EUT A;  2VNR A;  5E89 A;  4AVA A;  5C8C B;  1DBN A;  3PUQ A;  4F3J A;  3S57 A;  2RS5 1;  2VQ0 A;  3OEB A;  5DDJ 2;  2JDZ A;  3OGS A;  1MQT A;  1GKB A;  5I0R A;  2CWM A;  1PZ9 A;  4OYU A;  1W8T A;  3GCW A;  1QJU 1;  2WT1 A;  1RVF 3;  1PZ8 A;  1VBA 3;  4FVV A;  3H1M A;  1ENQ A;  2RVA A;  4L2N A;  5FZ7 A;  4MYE A;  1WW5 A;  1WWY A;  1I1E A;  4XUP A;  4H3W A;  4B1L A;  5JR7 B;  3POS A;  2R30 A;  2VQU A;  3S7E A;  1NCR B;  3P1I A;  4MAD A;  1BVV A;  1HN1 A;  4I3G A;  1F2N A;  3ZSM A;  3SC7 X;  5BNQ A;  1ZA7 A;  3M1H A;  4BXS V;  3HEI A;  2W52 A;  5FKB A;  1RHI 2;  5FYT A;  1SDW A;  1AF9 A;  1H6X A;  1LHV A;  3OB8 A;  4ZU4 A;  3JZV A;  1OC1 A;  3I3Q A;  4DY3 A;  3WG2 A;  4CEW B;  1UOJ A;  1AYN 1;  1GMM A;  2Y64 A;  4GH4 A;  5DUV A;  1NQJ A;  1S2B A;  4RS5 B;  3WDT A;  5K0U B;  1AR6 1;  1DQ6 A;  1PMH X;  2CDO A;  4A3Z A;  5LA0 A;  1JHJ A;  3VD9 A;  4AVC A;  4LXL A;  3VKF C;  3TNQ A;  4B8E A;  3M4F A;  5BNO B;  4JDO A;  1QJX 1;  3ACG A;  3PU8 A;  3ZYF A;  4EZ4 A;  1C3H A;  1EPZ A;  2BGP A;  1OD3 A;  4CP9 A;  3ES1 A;  3JB4 C;  5T55 A;  3ATG A;  1Y3T A;  1AJK A;  3LZZ A;  1WCQ A;  4X6Q B;  2DFC A;  4CCK A;  2OUJ A;  2WT2 A;  1GZ9 A;  3ZSK A;  5FOB B;  3KS7 A;  4DIQ A;  1FPN 1;  5GZG A;  5LK7 B;  1CAX A;  4PQQ A;  1HLC A;  3CEW A;  2HEV F;  2HWF 2;  1BKZ A;  2GME A;  2RS3 3;  3DYO A;  5DMY A;  1E5S A;  1GUI A;  1ND2 B;  2ZX2 A;  4HVQ A;  2QQW A;  3Q8C A;  4UFK A;  5FYB A;  2VW1 A;  3FUQ A;  4IUG A;  4IET A;  1Z78 A;  4PF5 A;  5JIA A;  4MVT A;  5A7W B;  4TTG A;  5JWP A;  1LES A;  2PHU A;  1V00 A;  3MFA A;  4PDW B;  4MXW B;  1QOO A;  2XH6 A;  4RQP B;  3WNK A;  3ZN5 A;  4IV1 C;  2PHF A;  4SBV A;  1O5L A;  5KXD A;  3T30 A;  2VH9 A;  3OPT A;  4FFI A;  3PJQ A;  4IE7 A;  5IVV A;  2JIG A;  2IXH A;  1W9Y A;  4CCO A;  3S5Q A;  1FMD 3;  1HQL A;  1P8J A;  4FOV A;  4LBN A;  2QQM A;  4K40 A;  4DXZ A;  3F95 A;  3KHB A;  5F2S A;  3ZR6 A;  5FZ3 A;  3USU A;  4B29 A;  2VQA A;  1LOC A;  1PO1 1;  3JBG 2;  2BOJ A;  5A1F A;  5FO8 B;  2P6H A;  2Y6H A;  1MQT B;  2RS5 2;  3GHM A;  4LBL A;  4LLF A;  5JOY A;  4AE2 A;  1XSR A;  4S2G A;  2R04 2;  2J1T A;  3NAP B;  4N7U A;  5G05 L;  1OBN A;  3I7D A;  1OH4 A;  4KWJ A;  2DUO A;  3VDD C;  1GWM A;  1JYT A;  4AFB A;  3ST7 A;  5H9P A;  4D6Q A;  1MS8 A;  1UYZ A;  2E26 A;  1V6L A;  2BYV E;  3WW4 A;  1PVC 3;  1Q8S A;  3I54 A;  3ZYB A;  1EV1 2;  3CU7 A;  2ZEZ A;  1ACC A;  3LIG A;  3RZJ A;  4Y5S A;  1CWP A;  3J8F 2;  3WY6 A;  5LWB A;  3EJK A;  1S0D A;  3ZSJ A;  1B09 A;  4GAL A;  3IT8 A;  1W8N A;  3QOP A;  1TME 3;  1ULO A;  1Z7S 2;  3KZ4 C;  5CB7 A;  3CJI A;  1LHU A;  2O0O A;  3WW2 A;  2PHT A;  1GP4 A;  3RZM A;  4A2U A;  1CZT A;  5DAB A;  1YI9 A;  3FBM A;  5L36 A;  4UBG A;  4ET7 A;  1HQN A;  1I9R A;  2AEN A;  5AFB A;  1SLI A;  1H0B A;  2VW2 A;  4K7J A;  4P9X A;  2JEN A;  1SPP B;  4QPG B;  3ZO0 B;  4LK7 A;  1W0N A;  4JDN A;  4FPY A;  3EXU A;  4LIT A;  5IT6 A;  1PGS A;  3C7O A;  1YFW A;  1UKR A;  1AYN 2;  4GZ9 A;  4F7Z A;  4YW7 A;  5JMO A;  1WLD A;  1GWL A;  3LEK A;  2Y0O A;  4Q4X 2;  3WD5 A;  4BQX A;  4ONU A;  2AYH A;  2OZ6 A;  2D98 A;  4D7S A;  2W9X A;  1W6P B;  1VBB 1;  1F5J A;  2JD9 A;  4RN5 A;  2ADD A;  2WWJ A;  3ZXE A;  4XIK A;  1MS9 A;  4BH9 A;  5FUN A;  2YPJ A;  5B4X A;  1REE A;  2J1A A;  5BNO C;  1LED A;  4A4A A;  1H8T A;  4XYX A;  3H9A A;  1ZBA 2;  5JUV A;  4CP2 A;  1SBF A;  4XFF A;  4J1W A;  2ZJC A;  5ACA 2;  1NY7 2;  4RR3 A;  4W6W A;  1OUS A;  2EID A;  2DVF A;  3B94 A;  4RQP A;  4NN0 A;  1OPM A;  3NJZ A;  4XUO A;  5J7M A;  2TUN A;  4XZP A;  1RMU 2;  4CXX A;  3W5N A;  3CF6 E;  4OUL A;  5FYS A;  1WZX A;  3H50 A;  4N53 A;  2VOW A;  3NNG A;  5EHD A;  5A70 A;  5A1A A;  3GXU A;  1TEI A;  4IGP A;  1EY2 A;  4QQL A;  4WZF A;  2XLF A;  1G86 A;  4NE9 A;  4JKM A;  2DCK A;  2EXI A;  2PYT A;  4JKK A;  3S5A A;  1J59 A;  1VMH A;  3DCQ A;  3OD0 A;  2JDA A;  4QX5 A;  5DQ0 A;  1POQ A;  3DXT A;  4LBQ B;  2I2S A;  1IPS A;  2BFU S;  3OF1 A;  5D8A C;  1NUK A;  2VUD A;  4FAG A;  2W47 A;  1MS1 A;  3WV6 A;  4AOC A;  4LE4 A;  2A6Z A;  4OQ8 A;  3I2O A;  2A71 A;  4ZU5 A;  3CMG A;  4XJU A;  1BK0 A;  2WZP P;  4R4Z A;  2WZR 2;  3U78 A;  2RS3 2;  2W1Q A;  2P5B A;  4WM7 C;  4DOU A;  3OJB A;  5L7O A;  5ACA 1;  4JGZ A;  5FZC A;  4GB3 3;  3RWN A;  4BQ2 A;  1MEC 2;  2XDV A;  1L3J A;  1HRI 1;  1KIT A;  1NX9 A;  2VNV A;  1ZA4 A;  4IV3 A;  4KWK A;  2P3Y A;  3BVC A;  3CKH A;  1W03 A;  3KD4 A;  3OTF A;  2V5D A;  4NHL A;  4Y1X A;  3RYP A;  5K4L A;  2VGD A;  3WNO A;  1RUH 1;  4K8R B;  3T4H B;  3WP6 A;  3WQB A;  1SBE A;  1JZ4 A;  3PDQ A;  2A70 A;  1H9W A;  2XWB B;  5FZ8 A;  2LRP A;  3HN3 A;  1UWW A;  4XBL A;  3M3Q A;  5A32 A;  3ABZ A;  3VBU C;  4M0N A;  3CZJ A;  2PLV 2;  2ENR A;  2EXK A;  3RZZ A;  4IDZ A;  4NRQ A;  3THT A;  5GZD A;  4IE0 A;  5D2A A;  5FZ1 A;  2AZ5 A;  3OPW A;  3EYP A;  5KHH A;  5L7O B;  2LW8 A;  4L92 A;  4P5Y A;  1UU6 A;  2ES3 A;  3T3Y A;  3MBW A;  1BJQ A;  1ND3 B;  2R7E B;  5DG2 A;  2BTV C;  4XBQ A;  2BPA 2;  2Y38 A;  5ANN A;  4B1M A;  3LSE A;  1QJY 3;  4GMP 0;  3B9I A;  1AR7 1;  2HWD 1;  4AVS A;  4GH4 C;  5DZG A;  5LY2 A;  2NZ9 A;  1DZR A;  4EYU A;  2W94 A;  1NLS A;  5D1I A;  2L9L A;  3CJX A;  2JKB A;  4XPV A;  5FR3 A;  4XTP A;  1US3 A;  5IAT A;  1D4M 2;  4XFH A;  5KHG A;  3B5L B;  1OFS A;  4HET A;  1CZS A;  1PVC 1;  1GOH A;  1QU0 A;  3N9L A;  5F32 A;  2C4X A;  2BZD A;  2DU1 A;  2ZX3 A;  2FDK A;  4D7Y A;  4ATE A;  4E4D X;  5DUU A;  2OT7 A;  4XET A;  1H1A A;  2OZJ A;  2WS9 2;  3HT2 A;  1ALY A;  1S0I A;  2Y6L A;  3NJY A;  4AI8 A;  2B8M A;  2ZGM A;  4J25 A;  1RIN A;  1W05 A;  5CKM A;  4NAM A;  2ZCW A;  4E8D A;  1PO1 3;  4XCB A;  3NO8 A;  2HEY F;  5FRA A;  3A23 A;  3VD5 A;  5K7P A;  5EP9 A;  5IAV A;  5A3N A;  4DQA A;  2JG8 A;  1BEV 2;  1FPN 2;  1O8S A;  5A3O A;  1BBT 3;  3C3V A;  4HG6 B;  1AR8 1;  1FYU A;  1F4H A;  4QX8 A;  3S7I A;  1AL0 G;  4M0H A;  1G9A A;  4YZ5 A;  4YZ1 A;  2ARX A;  1AXZ A;  2YB7 A;  4IEY A;  4D3W A;  2UYB A;  4LHK A;  5F5I A;  5FP3 A;  5JVV A;  4AG4 A;  1WCD J;  2ET1 A;  3RNS A;  1IG3 A;  3LF7 A;  1W6M B;  2P3K A;  2QQL A;  5EXO A;  4Q8K A;  1UXX X;  2DCZ A;  2XL9 A;  2ZGO A;  4PDW C;  1GQH A;  1STM A;  4YZ3 A;  2F6B A;  1FOD 1;  2ZAC A;  4S2F A;  2BNN A;  4PHZ A;  3N7J A;  3HOB A;  3WX5 A;  3AFG A;  2XBO 1;  3USU B;  5A32 B;  1DQ1 A;  1QXJ A;  3IB3 A;  4ZZ8 A;  5F3I A;  5A3P A;  4AED B;  3FBY A;  2ARB A;  1VBE 1;  2H6C A;  4WVZ A;  5LRR A;  4CP9 B;  3M2M A;  3V56 A;  3JD7 2;  1FXZ A;  2E31 A;  1D2Q A;  1PO2 3;  1W2T A;  3RJ2 X;  1SBD A;  3OPZ A;  3ZYG A;  1Z7S 1;  4Z2A A;  3NV2 A;  5B2G B;  5FFO C;  4JGY C;  3G6J B;  4XFI A;  1CAX B;  1ZBE 2;  4IL7 A;  4FOQ A;  1IPK A;  1K3I A;  4HN0 A;  1KJL A;  1VMF A;  5LK5 A;  3WG1 A;  3RWK X;  3RZL A;  3RI8 A;  4YG6 A;  2HWE 3;  3DN7 A;  5BNN B;  4BXF A;  4MGI E;  3WF1 A;  3MEP A;  5JSP A;  2D93 A;  2J1E A;  3LDK A;  3ZXD A;  5I0U A;  3W58 A;  4XAC A;  1AR9 3;  4XF4 A;  4A7K A;  3DEM A;  1OQ1 A;  3D0J A;  2J1U A;  5A33 A;  3ZFE B;  4YWA A;  1NXD 1;  1GNZ A;  3O1O A;  2EIB A;  3AKT A;  3L9J T;  4QX3 A;  1AL2 1;  4OI4 A;  4XIL A;  4AFA A;  5KBF A;  1JZ3 A;  4IV1 B;  3PME A;  5BYN A;  1CX1 A;  2LRO A;  1FAT A;  2Q1M A;  1NCR C;  1G6N A;  2Q1Z B;  4O7X A;  1JYW A;  1W8W A;  1W8Z A;  3E97 A;  4FPG A;  1O3T A;  5A7S A;  4LUL A;  1OVP A;  5C4W C;  1E5H A;  2KR2 A;  5E16 A;  1JYV A;  3C7F A;  3BOW A;  4QQP A;  3CZU A;  1H8T C;  2VE1 A;  3NJX A;  1G7Y A;  1ZYB A;  3TAY A;  3BB6 A;  2X5I B;  1C4R A;  4N9I A;  3ECQ A;  1HKD A;  4KMQ A;  3WP3 A;  1AR8 2;  1OKQ A;  1PHM A;  1H9P A;  1YWK A;  5HCB A;  5J36 A;  1ZRI A;  3ORJ A;  4RHV 2;  5FY7 A;  2QCS B;  5A3L A;  5FYM A;  1JHN A;  1RUJ 3;  4MUV A;  5A7Q A;  3UKN A;  4CCE A;  5ACA 3;  2F4L A;  3M3C A;  3VBO A;  4LIU A;  1OOP B;  3H7Y A;  2EVX A;  4URT A;  4XC9 A;  3D6E A;  3BTY A;  4MGK E;  2O14 A;  1SLA A;  1OMI A;  4LKD A;  3P6B A;  1ZZ6 A;  2DU0 A;  2QQU A;  4LBQ D;  4YM3 A;  5FLJ A;  3RGB A;  1RED A;  3MLL A;  2WDB A;  4QHZ A;  5C8C A;  2BJS A;  2YC0 A;  1DZQ A;  4LA2 A;  3GBG A;  5C4W B;  2BGO A;  3SH3 A;  3ZN6 A;  3ETQ A;  3R4S A;  2CNA A;  4AWD A;  1N3O A;  5FV3 A;  3I2K A;  1WUV A;  3LOI A;  2A6W A;  3IIA A;  3RQ0 A;  1NLR A;  4FOY A;  3K4A A;  3TBD A;  4RFT 0;  2J42 A;  4GMP 1;  5LBE A;  3WP5 A;  4Y5Z 0;  2RM2 3;  5CIR A;  4AQT A;  3BU7 A;  1W90 A;  3MIH A;  1J3P A;  5F3C A;  1GZW A;  1URX A;  2R06 3;  1PGW 2;  1RUF 3;  4FPL A;  3U07 A;  2KA3 A;  2UWB A;  3PVB B;  2WFP A;  5LCW L;  2D3P A;  1NCQ C;  1OOP C;  3EO6 A;  5FZH A;  2C26 A;  1E5I A;  1BMV 1;  1WMD A;  4J1X A;  4TZD A;  2VOX A;  1UY4 A;  2OXB A;  1OVS A;  2ZEX A;  3IMN A;  2RMU 1;  5DXD A;  2ZX1 A;  3N9Q A;  1XNB A;  1I6X A;  1SEF A;  1WME A;  4L0P A;  1RUE 3;  3IN9 A;  4AQS A;  1F35 A;  2YG0 A;  4CDU C;  3LPF A;  4QPI B;  3PIJ A;  3Q8A A;  5F5Q A;  2WBK A;  1R08 3;  2GP5 A;  2LAL A;  1CAW A;  1VLN A;  3DEC A;  5A6X A;  5H9R A;  1FI2 A;  2VMG A;  4GKX A;  3FFQ A;  2SBA A;  5LA9 A;  3ZXL A;  4D6R A;  2W08 A;  5A3M A;  1NE6 A;  4QM9 A;  1JZ5 A;  3VD7 A;  2OQ6 A;  4HVO A;  3TB0 A;  4JRL A;  1KRI A;  1ENX A;  2GMM A;  1UX6 A;  4AHW A;  4NII A;  1NZI A;  2Q4S A;  3KGL A;  1R1A 1;  5C5U A;  4A6O A;  4XJ8 A;  1UAI A;  2F4P A;  1EAH 3;  1ZX5 A;  4YGD A;  4AFM A;  5JXH A;  2GZW A;  4MO3 M;  2B4K A;  1KD7 A;  5H9Q A;  3HNB M;  4FCA A;  4QX1 A;  3A21 A;  5T5P A;  5ABJ A;  2BUK A;  1NT0 A;  4CDW A;  5F3G A;  3O1V A;  5HXM A;  4M3C A;  4MGS A;  1WD4 A;  4A45 A;  3ZPY A;  3KHC A;  2JB4 A;  1MPX A;  5J3U A;  3IDB B;  5C71 A;  4Z82 A;  1UIJ A;  3LA2 A;  1AL2 2;  2PHX A;  2ZGP A;  1GIC A;  3RI9 A;  4WBB A;  3POG A;  2YXS A;  2FCU A;  1S0B A;  4UFJ A;  3Q8F A;  4I30 A;  4YW3 A;  5HCA A;  3VD4 A;  1GZC A;  5JZG B;  1AX0 A;  4BDV B;  3T1L A;  4CUA A;  2VZQ A;  2XL7 A;  2N7G A;  4BLJ A;  2RDQ A;  2RG4 A;  3FLR A;  4O65 A;  1PK6 C;  3BIW E;  3AMP A;  2WNO A;  4QKN A;  1N1S A;  2XPJ A;  1YO8 A;  2PFW A;  3NNJ A;  1NCR A;  1HJG A;  1UZW A;  3K3N A;  3NNF A;  2DDU A;  1RUG 1;  3ZFG C;  2O8O A;  4Z8B A;  1R64 A;  3BAL A;  5A6Y A;  4OLL A;  2Y26 A;  1EUU A;  3D82 A;  5CFC A;  3LB9 A;  3WW1 A;  2WFF 1;  4QQH A;  1NOV A;  4RHV 1;  4Z1V A;  4MZU A;  1QOT A;  3JB8 A;  3LA3 A;  3B01 A;  1N47 A;  3WVJ A;  1RUE 1;  4MXV A;  1LB2 A;  4IE4 A;  4AXO A;  4CDX C;  3J7M A;  2A7A A;  2VY0 A;  4CDU A;  3RZH A;  2IWG B;  1O91 A;  1R1Z A;  2ZZJ A;  2OPK A;  3K51 A;  5EIY B;  1VB4 A;  2W5F A;  2HWC 1;  5BNP C;  2G19 A;  3QLQ A;  4QWN A;  2WQZ C;  4Y3O A;  2JD4 A;  1E5R A;  1H1I A;  2NMN A;  2VVD A;  3GJB A;  3KVA A;  3OUH A;  1S2E A;  4QMA A;  4LK6 A;  1ASJ 2;  5FK8 A;  5GZF A;  5L7O C;  4JHT A;  3HAG A;  1AZD A;  2R06 1;  2IVI B;  3AL6 A;  5L19 A;  5IWF A;  4BYY A;  1S2K A;  3DXU A;  5CFD C;  1W04 A;  4DO0 A;  2ZGR A;  3MV1 1;  4O9G A;  3WR0 A;  4CYD A;  1YJK A;  5DAP A;  1R09 3;  1EV1 1;  1O4T A;  5A7N A;  3VBS C;  1AR6 3;  1RUD 1;  2WJS A;  4XXP A;  4MGZ E;  4WVM B;  4CEW C;  3ZN4 A;  1PX3 A;  2VZR A;  4MXW A;  4RR3 B;  4NIG A;  5FZ6 A;  2WS9 1;  1A8D A;  2W46 A;  4FSJ A;  1NA1 A;  3RRD A;  4ES9 A;  5BY5 A;  3UES A;  5A7O A;  1Q43 A;  2JX9 A;  1JUH A;  5CBL A;  1MZ6 A;  4YNI A;  4RA0 A;  4BM8 A;  5L73 A;  3TN9 3;  5EZW A;  3MW2 A;  5FLH A;  3B69 A;  1DYK A;  3M70 A;  1U12 A;  3D5O A;  1K5M C;  3D8C A;  3POJ A;  5C9A B;  3WXP A;  4GJZ A;  4HKO A;  5J37 A;  4BQW A;  1D4V B;  2ARE A;  4L99 A;  3MO4 A;  4QXK A;  4Y20 B;  3SCG A;  5C6C A;  3NAP A;  2EIG A;  1VBB 2;  3AMN A;  3N4M A;  5KXE A;  1XYO A;  5FDB A;  4AED C;  3N36 A;  2Q8E A;  3A0N A;  5A1L A;  3PTR B;  1ZZ7 A;  3C2U A;  3QCW A;  5T52 A;  1WW7 A;  3KF3 A;  4R52 A;  4WVV A;  5C8W A;  1CX4 A;  1IS5 A;  1MS0 A;  1U0A A;  4N43 A;  1OLM E;  1QJX 2;  1V6N A;  1W2U A;  3IM0 A;  4H55 A;  4EE2 A;  2P37 A;  5I0D A;  3BTX A;  1RUN A;  2NYY A;  2VR4 A;  2O8Q A;  5FZ0 A;  3UGF A;  3X29 B;  3MUZ 1;  4OHV A;  5FY0 A;  1CON A;  2YZ4 A;  2GP3 A;  2JKX A;  1QF3 A;  2HKX A;  2UY8 A;  2WWS A;  1ASJ 3;  4H14 A;  3NKT A;  4AEJ A;  1JYN A;  4LT5 A;  4Y4R A;  1CJD A;  4AZZ A;  4URA A;  5JIU A;  1WMX A;  4ZHN A;  1DF0 A;  2B9U A;  3QD6 A;  3H8O A;  4GWI A;  3THD A;  1W8O A;  2E32 A;  4CU6 A;  5IVF A;  1ZZ8 A;  3AB0 A;  1CD3 G;  4Y26 A;  3BTZ A;  1UMZ A;  3N7L A;  2A5Z A;  2GNB A;  2OQ7 A;  5IK4 A;  1NZC A;  2NN8 A;  2W91 A;  4Q4V 3;  1W0P A;  3P3P A;  3VDA A;  1KS4 A;  1C5I A;  3U4X A;  2D5F A;  4NIA A;  4E27 A;  3RSJ A;  1WCU A;  3Q9O A;  3LGR A;  1PM7 A;  4AHY A;  2ID4 A;  4LBK A;  3WF2 A;  2YGM A;  4W8J A;  1XU2 A;  1LOF A;  1AR8 3;  1W99 A;  5F6K A;  5LAS A;  3ROU A;  1WCS A;  5DAQ A;  4DRV A;  4R9D A;  4CCJ A;  2IZW A;  3AZV A;  1GP5 A;  4CUC A;  1F5F A;  3AYD A;  4I0A A;  3ZYP A;  4DUW A;  2RJ2 A;  2V73 A;  1UZ0 A;  2ARC A;  2CL2 A;  3A22 A;  4FP2 A;  1LNS A;  1GNY A;  2WLP A;  2XVK A;  1ZRD A;  1JU3 A;  1HJF A;  5FYU A;  1DGR A;  3SIT A;  3FUO A;  1RL3 A;  1J1L A;  4U36 A;  3UKV A;  4ZZ5 A;  4QU1 A;  3H3U A;  5GLZ A;  4AHX A;  4K8F A;  3WLU A;  1YNA A;  2E53 A;  5FQ0 A;  3LFM A;  3ILF A;  5CYY A;  4I3P A;  4P9G A;  2X09 A;  3R05 A;  5IVE A;  3DKW A;  2YDE A;  2P17 A;  1W6N A;  4YVS C;  5JXG A;  4OHY A;  2VXJ A;  1QJE A;  4LBQ A;  2E6V A;  2A1X A;  4S2D A;  4QGM A;  1OA4 A;  3M7A A;  3AXE A;  4PBP A;  1AR9 2;  4YM2 A;  1MVQ A;  5KWR A;  4CPB D;  1JI6 A;  2BWA A;  4QKF A;  4M3C F;  1EAH 2;  1UMH A;  3MPB A;  1XJA A;  4Y5T A;  2HWE 2;  4HSJ A;  5IVB A;  1ZNP A;  1OH3 A;  3I3B A;  2GN3 A;  3GCX A;  5K0U C;  3MW4 A;  4AVT A;  2D6N A;  2RR1 2;  1Y43 B;  2XBO 2;  4BQ3 A;  1HW5 A;  1W9S A;  1REF A;  2IXC A;  3JXS A;  3N9N A;  2JG9 A;  3OY8 A;  5I0S A;  1GZW B;  2E51 A;  4RQP C;  4M3C B;  1POV 3;  2MPF A;  1HB1 A;  1QJU 2;  4JTO A;  2BW8 A;  1I5Z A;  1SMV A;  1RYY A;  1AXK A;  1VRH 2;  1VRH 1;  2DCJ A;  3J7H A;  4I0B A;  2QE3 A;  4JQR A;  3G7D A;  3WQ7 A;  3HPN A;  2YGL A;  3VL8 A;  4OMD A;  1LGN A;  1HV1 A;  3ZIX A;  1I5P A;  4L9B A;  4Y1U A;  4QKB A;  3CDZ B;  1RUD 3;  4COY A;  2CY6 A;  2GMP A;  4F83 A;  3IPV A;  2WNV B;  2XUE A;  4BB3 A;  2XON A;  3N7M A;  1OQD A;  2WNU A;  3N9P A;  3AKR A;  4FPJ A;  5T50 A;  5IUQ A;  1X50 A;  4HLT A;  5E88 A;  5JR2 A;  1GAN A;  2AR6 A;  4QPI C;  1MQT C;  2XG3 A;  1LU1 A;  2PEL A;  1JUI A;  1V9U 2;  2R0H A;  4MSV A;  5EYY A;  4LUM A;  3AZW A;  3FN9 A;  1X9T A;  1ND3 A;  2D3S A;  1D0H A;  4CDQ C;  1VPH A;  4N9H A;  4O9E A;  1UCX A;  1TG7 A;  2VTX A;  5FY4 A;  2HEW F;  3ILN A;  3PLQ A;  5BNN A;  2Q8D A;  1TE1 B;  3WUD A;  1V6I A;  3OGJ A;  1NY7 1;  2WZ8 A;  2GH8 A;  3HIF A;  2ZHK A;  4GQ7 A;  2CYF A;  1W9W A;  4M00 A;  4DPN A;  2GNT A;  2WS9 3;  2G4I A;  2XJQ A;  2O1Q A;  4NPR A;  2BU9 A;  4R9A A;  1CQ9 A;  5JOW A;  4XOG A;  2VUA A;  5C70 A;  2ZHN A;  4M01 A;  2E7T A;  5FPZ A;  1VBD 2;  3C7H A;  1IS3 A;  2Y6K A;  3HD8 B;  4OI2 A;  2QZ2 A;  4GB3 1;  3ZVX A;  1D4M 3;  1FX5 A;  2D97 A;  3J4U H;  1YRZ A;  1O59 A;  2Q5T A;  3WDY A;  5HCH A;  5GLT A;  3PU3 A;  3BN6 A;  2AGS A;  1VBE 3;  5EJ1 B;  2Y33 A;  1DQ4 A;  2EIE A;  4QXH A;  4CPB A;  2CAU A;  4E4S A;  2B5H A;  1IGO A;  4NHM A;  3WCS A;  3VHP A;  1SFY A;  2P4E A;  5BPX A;  4I2O A;  1QQP 2;  5DG1 A;  4XUQ A;  1FMD 2;  4X8N A;  1J84 A;  1RJ7 A;  1PGW 1;  1IQD C;  1Z0H A;  3C7G A;  4CSW A;  3RZG A;  3KV9 A;  5BXX A;  5FK7 A;  1QJZ A;  5GJ6 A;  5FYZ A;  1QNY A;  4YZ2 A;  2A6V A;  5FP9 A;  4ZU7 A;  5F5A A;  4KNC A;  4AGV A;  2EAK A;  2JE9 A;  2JIJ A;  2D43 A;  5C3R A;  1HRI 2;  1SDD B;  2Q1F A;  2WAA A;  5CNA A;  2Q8O A;  3ZXK A;  5BNP B;  5EV7 A;  3ALQ A;  4OHZ A;  2WRA A;  3M3E A;  2JEC A;  3OCP A;  1QJY 1;  3URF A;  5F6L B;  1MZ5 A;  2XJV A;  2KXL A;  3JQW A;  4V2V A;  4TLF A;  3WDV A;  4XUN A;  3KT1 A;  4XQW A;  2R49 A;  3DPR A;  3JQX A;  4N90 A;  4FTB A;  1JS9 A;  2QNK A;  2R16 A;  4UW3 A;  1BHG A;  3AP7 A;  5LRS A;  4ZY9 A;  3IBM A;  3TNP B;  4LOT A;  1C8M 3;  1OQE A;  1JTZ X;  4B4R A;  3DV8 A;  2LUW A;  5FY1 A;  1FNY A;  3ZFF C;  3W5M A;  2DVD A;  3C7E A;  4JHZ A;  4AR2 A;  1H1M A;  3PJY A;  5D8A B;  1YCI A;  1HV0 A;  3NKG A;  1RUC 1;  3K3O A;  3M8L A;  4N43 B;  1WMF A;  2ZML A;  1XNC A;  1V0A A;  4OFG A;  1SCS A;  1ULG A;  5K8S A;  3KCC A;  2WZR 3;  4N53 C;  2NM1 A;  4ZPI A;  3BU0 A;  5DAW A;  3LKJ A;  2AEY A;  2ZKN A;  5IFP A;  4MV2 A;  2BWC A;  2R32 A;  1SFN A;  4Q2F A;  4OHW A;  4BK4 A;  1PO2 2;  1JZ2 A;  1ZRC A;  1AYM 2;  1RXF A;  3PMS A;  2Z2S B;  2EXH A;  2V4V A;  4QAW A;  3WP4 A;  1VR3 A;  2JDN A;  4E2Q A;  3FC0 A;  4FPO B;  5D21 A;  2VMF A;  3OG2 A;  3VZM A;  3MV0 1;  3LDR A;  5IFT A;  1NA1 B;  3EMR A;  5LB6 A;  1RUF 1;  2PAM A;  1NE4 A;  4N8M A;  4DIN B;  3AMH A;  3VL9 A;  3WT3 A;  4D94 A;  1R1A 3;  4GWJ A;  1F31 A;  1VJ2 A;  1KDM A;  2YU1 A;  2ZXQ A;  1ENS A;  1J3R A;  4DXT A;  2W1S A;  4A7Y A;  1PZ7 A;  1V6J A;  2LS6 A;  4MET A;  3INA A;  1W6O A;  3MI8 A;  4XMA A;  5FZG A;  5KC6 A;  1PIV 1;  3H8X A;  2BDR A;  1AX1 A;  1HB4 A;  1ZRR A;  1CAU A;  5DN2 A;  3GDB A;  1RUI 3;  1BBT 2;  2RMU 2;  3ZYI B;  1R08 1;  2OW4 A;  1UD1 A;  4HK9 A;  1OFN A;  3H8R A;  1US2 A;  2RDS A;  1JYC A;  4NVP A;  1K5J A;  2VBD A;  1HXS 1;  2H0B A;  2XKO A;  4KWL A;  1FV3 A;  3ZFE C;  2PLV 1;  1XND A;  3ON7 A;  4CEY B;  5E6H A;  1PGL 1;  3QH7 A;  4BOW A;  3OGR A;  5LBB A;  2WQ4 A;  4PIZ A;  1OOP A;  1YXW A;  4XF0 A;  5FMB A;  1O3R A;  4FO9 A;  5FQ0 B;  1O6U A;  2WA4 A;  4IV3 B;  4XFB A;  4Y1V A;  2ZAB A;  3VZL A;  5FZD A;  2IXL A;  2RS1 2;  5C3Q A;  2RS1 1;  4WM8 C;  3LOB A;  3AZZ A;  3SHR A;  1H2N A;  3KM5 A;  4GAZ A;  5CA6 A;  1UY0 A;  1GNH A;  1RUI 2;  1BCX A;  4AGG A;  4B4Q A;  2OA2 A;  4MX3 A;  4EJR A;  3ZN6 B;  3AJZ A;  4NMI A;  5DZF A;  2ET7 A;  1XE8 A;  4Q1R A;  4D7T A;  3BOD A;  5JZG A;  4EN0 A;  3HJR A;  1NA1 C;  5ISL A;  3CIH A;  3ACF A;  4LO4 B;  3RMX A;  4XVH A;  5D8A A;  1UYX A;  4FPH A;  3WZ1 A;  2CSG A;  3MHZ A;  5A3W A;  5FPB A;  4Q4W 1;  3J8F 3;  4GJY A;  4UAP A;  4Y22 B;  5FPV A;  1QIQ A;  1S55 A;  5AC9 2;  4IEZ A;  2W1W A;  1Q5O A;  1RUD 2;  2AC1 A;  1UX7 A;  2X53 S;  3UKT A;  3BUC A;  5BNO A;  2OYZ A;  2XVG A;  4LQR A;  2YHJ A;  2QQK A;  4K1Z A;  5T5L A;  3MGU A;  1PVX A;  3AVS A;  4EV0 A;  4D6S A;  3I4I A;  5K9Y A;  3FHQ A;  2XQR A;  1AYM 3;  2YYO A;  3KCX A;  3BKZ A;  2VBP A;  2E9Q A;  1IS6 A;  2RS5 3;  3AXD A;  4FPE A;  4QPY A;  3GM8 A;  2W1U A;  5F1R A;  3V0A A;  1LHN A;  2QVS B;  4PLO A;  1WLC A;  1ZZB A;  1UPI A;  4GXL A;  4FPC A;  3VDD B;  3MF9 A;  2RR1 3;  1J83 A;  3O0X A;  3TOJ A;  3VZN A;  2QQJ A;  1RUH 3;  1C57 A;  1R09 1;  1UXZ A;  1CAW B;  4YYO A;  4DXR A;  2WFF 3;  1VIW B;  3V64 A;  2QQP A;  1DQ0 A;  1MEC 3;  3VBR C;  4PQ9 A;  3K48 A;  4FFF A;  3UV9 A;  3VHN A;  4YSF A;  5CEH A;  2R0F A;  4XHB A;  3VN4 A;  1T6B X;  2Z69 A;  4QDR A;  5EJ3 A;  4YRD A;  1CAU B;  1HQW A;  4BIF A;  1H2K A;  3B93 A;  3WDX A;  2XUM A;  2WNE A;  1VB2 A;  1RUC 2;  2VZV A;  4JZR A;  4P9I A;  1G8W A;  2HWD 2;  1AR7 2;  4AQ2 A;  4YG0 A;  1RUC 3;  2VCM A;  1C1F A;  1FNZ A;  1M4W A;  2CU5 A;  4UFM A;  3O1R A;  4CCC A;  1XC6 A;  4RSU A;  2ZZQ A;  3JUU A;  4HVR A;  3R0R A;  4LR4 A;  5FZB A;  4Q4X 1;  4A44 A;  3NNM A;  2Z4F A;  3H7J A;  1KQR A;  2K46 A;  3BPS A;  1X8M A;  1CN1 A;  1TNR A;  2R07 1;  3GYD A;  4Q0S A;  2D44 A;  5JSR A;  2VZ1 A;  4LBO A;  2XHN A;  1JW6 A;  3AYC A;  4CRQ A;  2AUY A;  4BME A;  4CCL A;  1QQP 3;  1W39 A;  4D8M A;  4DB5 A;  1DFQ A;  1DQ2 A;  1RUI 1;  1RXG A;  3BOP A;  4NRP A;  1W6Q B;  4NID A;  2C6S A;  4HKW A;  4OZO A;  4AGR A;  1OA3 A;  1PMJ X;  1Y9G A;  4YZ4 A;  2ZGS A;  3M3O A;  1XRU A;  1OI6 A;  3LE0 A;  1EAH 1;  4LPL A;  5FUI A;  1QKQ A;  4LTA A;  2H6B A;  5GLU A;  2XR4 A;  1OUX A;  4LKS A;  4BQ4 A;  2FD8 A;  4Q4V 2;  4P9J A;  5CG8 A;  2VUC A;  4N7I A;  1C8M 1;  1CAV B;  2WR9 A;  3WHT A;  1X7N A;  2GH2 A;  1KEX A;  1JBC A;  1ZBA 3;  5TSW A;  4BJ0 A;  2Y60 A;  3FLT A;  5C33 A;  1BYH A;  1H4H A;  1LJ7 A;  4QGN A;  5JXJ A;  4PBO A;  2B39 A;  3ZSL A;  5CAD A;  4CU9 A;  5CIS A;  3LEG A;  4CDQ B;  4M4R A;  1RHI 1;  5JPN B;  5CU1 A;  1TME 1;  4RGA A;  2Q30 A;  3WNX A;  5F5C A;  2FDI A;  2ZTN A;  2GU9 A;  4WVW A;  2Y0I A;  4QM8 A;  4Y33 A;  2JDK A;  2BRT A;  1YIF A;  2VME A;  2YY1 A;  2ZBJ A;  3I2D A;  3OBT A;  2IFR A;  3WF0 A;  1BEV 1;  2WL1 A;  2WO2 A;  3B9C A; 
#chains in the Genus database with same CATH homology
 1JHJ A;  3VD9 A;  2W5F A;  4QPW A;  5IJR A;  4JKL A;  3ACG A;  2BGP A;  1OD3 A;  1WCQ A;  2V72 A;  4CU7 A;  5HPO A;  2W87 A;  4YPJ A;  2BBA A;  2W95 A;  3MUY 1;  4PQQ A;  4QB2 A;  4E8C A;  3MV1 1;  3DYO A;  5DMY A;  1GUI A;  2WQ8 A;  2XQX A;  5EJZ B;  4IUG A;  2VZT A;  3T0A A;  3I2H A;  1PX3 A;  2VZR A;  4TTG A;  3T08 A;  2W46 A;  3WNK A;  3UES A;  2EIC A;  4UI9 L;  1P8J A;  1L7Q A;  2QQM A;  3U37 A;  2E33 A;  3MO4 A;  4P00 B;  3W5N A;  2Y6H A;  3WF3 A;  3D3A A;  4P02 B;  2J1T A;  5G05 L;  1OH4 A;  4BXS V;  1L7R A;  3VD3 A;  1UYZ A;  2E26 A;  5I0D A;  1CIY A;  3WNL A;  2ZEZ A;  2VR4 A;  4PT6 A;  3MUZ 1;  3K4D A;  2JKX A;  1W8N A;  1JYN A;  1ULO A;  1CZT A;  1OF4 A;  4GWI A;  4ET7 A;  3THD A;  1W8O A;  2E32 A;  2W92 A;  4CU6 A;  4CU8 A;  1W0N A;  3K46 A;  3C7O A;  4GZ9 A;  2X10 A;  5JMO A;  4DUX A;  3IAQ A;  4OUE A;  3LEK A;  2W91 A;  3A7Q A;  5CZK A;  3VDA A;  3C8X A;  2W9X A;  2WZE A;  2JD9 A;  4RN5 A;  3ACH A;  2VJX A;  2ID4 A;  4MGQ A;  3WF2 A;  4W8J A;  4LHS A;  5B4X A;  2J1A A;  4P08 A;  1W99 A;  4QDS A;  4A4A A;  1K12 A;  5JUV A;  3UNP A;  4CUC A;  3SKV A;  3WF4 A;  4DUW A;  2RJ2 A;  3A22 A;  1UZ0 A;  1LNS A;  1GNY A;  2EID A;  1JU3 A;  1GQP A;  3I3D A;  4XUO A;  5IYY A;  5F7U A;  4TXW A;  4ZZ5 A;  1NAE A;  2PQS A;  1CZV A;  3IDA A;  3T0D A;  5CYY A;  1UMI A;  2X09 A;  3NNG A;  5A1A A;  3GXU A;  4FI9 A;  4JKM A;  2DCK A;  3FL7 A;  5JXG A;  4JKK A;  3OGV A;  2VOT A;  2WO3 A;  2JDA A;  4D0Q A;  5DQ0 A;  2YC2 A;  2HYX A;  2VCC A;  3NRU A;  1NUK A;  1JI6 A;  2W47 A;  4RYD A;  3WNP A;  1UMH A;  3CMG A;  4W4Z A;  1PX4 A;  3I3B A;  1JZ6 A;  2VZS A;  3LPG A;  2VTF A;  2W1Q A;  2Y6G A;  1W9S A;  5C7G A;  3JXS A;  2WN3 A;  2VMC A;  3WEZ A;  1D7P M;  1JZ8 A;  4QB1 A;  1RYY A;  1NX9 A;  2DCJ A;  3J7H A;  3UET A;  3CKH A;  2V5D A;  3HPN A;  3WNO A;  4DEQ A;  2ORZ A;  4OMD A;  1I5P A;  3WQB A;  1WKY A;  2ZEY A;  3CDZ B;  4XZU G;  1JZ4 A;  2QBX A;  3T0B A;  3HN3 A;  3OEA A;  3I3E A;  1UWW A;  3F2Z A;  3ABZ A;  3SEP A;  2XON A;  2VZO A;  3CZJ A;  5JR2 A;  5JXI A;  2VO5 A;  3EYP A;  3NJV A;  2VL4 A;  4W50 A;  2J1R A;  2LW8 A;  4P5Y A;  3FN9 A;  3MBW A;  3VDC A;  4KI5 M;  2R7E B;  4CUB A;  1OT5 A;  1TG7 A;  1K45 A;  4ZXE A;  2VC9 A;  2VZ3 A;  2WZ8 A;  1SG3 A;  3I2I A;  3OBA A;  3T2O A;  2W94 A;  2L9L A;  4PF1 A;  1W9W A;  1US3 A;  1DLC A;  4AAX A;  1T2X A;  1K42 A;  1CZS A;  1GOH A;  5G04 L;  3WNN A;  2C4X A;  2BZD A;  5C70 A;  1UY1 A;  2Y6K A;  3C7H A;  2Y6L A;  1O59 A;  3HNM A;  3LQC A;  1W9T A;  3BN6 A;  2W3J A;  5EJ1 B;  1UY3 A;  1GOG A;  3I2G A;  3T2Q A;  4E8D A;  2EIE A;  1ULP A;  1NKG A;  2X05 A;  3A23 A;  3I2J A;  3VD5 A;  2XOM A;  1XNT A;  1O8S A;  4XUQ A;  4HG6 B;  1XPW A;  1J84 A;  3C7G A;  1IQD C;  1F4H A;  2YB7 A;  2BER A;  1KGY A;  4AG4 A;  1YQ2 A;  2QQL A;  1UXX X;  1SDD B;  2WAA A;  3SKJ E;  1OF3 A;  4QDQ A;  3HOB A;  3NQH A;  3AC0 A;  3IB3 A;  4XUN A;  4ZZ8 A;  4ARY A;  3ZM8 A;  1BHG A;  2VCB A;  4ZY9 A;  3GGL A;  3W5M A;  2E31 A;  4QX0 A;  3C7E A;  4JHZ A;  4A41 A;  4Z2A A;  3VDB A;  2J1S A;  2ORX A;  5DPN A;  3DYM A;  5J1X A;  5LA2 A;  2ZEW A;  1K3I A;  5IFP A;  3WF1 A;  4BK4 A;  1JZ2 A;  2J1E A;  2V4V A;  4QAW A;  1DYO A;  2J1U A;  3III A;  3ACI A;  3OG2 A;  2VMF A;  3MV0 1;  5IFT A;  2EIB A;  4QX3 A;  1JU4 A;  1JZ3 A;  2KD7 A;  1CX1 A;  4GWJ A;  1JYW A;  2ZXQ A;  1O8P A;  4DXT A;  2W1S A;  2LS6 A;  2CDP A;  2J7M A;  1JYV A;  3C7F A;  1H6Y A;  5DN2 A;  5LA1 A;  3CZU A;  3GDB A;  2WAB A;  2J1V A;  3NJX A;  2HLE A;  4A42 A;  3ECQ A;  4KMQ A;  1US2 A;  4MOA A;  3PUH A;  2WUH A;  3OGR A;  4BK5 A;  1GU3 A;  1UYY A;  2J22 A;  3SEE A;  2VCA A;  3P6B A;  1UY0 A;  4DUV A;  1SHW B;  3THC A;  1DP0 A;  2WDB A;  1XNA A;  4QB6 A;  4DXS A;  2WO1 A;  3E1F 1;  2BGO A;  3HJR A;  3CIH A;  3ACF A;  4XVH A;  4UOJ A;  3I2K A;  1UYX A;  2VM9 A;  2OKX A;  4M4P A;  4UAP A;  5IHR A;  3K4A A;  3FHA A;  2W1W A;  3I2F A;  1UX7 A;  1GOF A;  2YFZ A;  4LQR A;  2QQK A;  2C9K A;  5LCW L;  3T2P A;  3FHQ A;  4A3Z A;  2C26 A;  2QQO A;  4DEV A;  2VMD A;  2VQT A;  3GM8 A;  2W1U A;  4ARX A;  1UY4 A;  2ZEX A;  3CQO A;  1J83 A;  4L0P A;  2QQJ A;  2YFU A;  2YG0 A;  3I97 A;  2QQI A;  1UXZ A;  1TVG A;  3LPF A;  4DXR A;  2WBK A;  2Y6J A;  1UY2 A;  2Y8K A;  4KWU A;  3DEC A;  4QDR A;  1JYX A;  1JZ5 A;  2VZU A;  3VD7 A;  4JX0 A;  3PUI A;  2VZV A;  4A6O A;  1XC6 A;  4XUR A;  3EB7 A;  5JXH A;  3ETP A;  4MO3 M;  2B4K A;  3K75 B;  3T09 A;  3WSO A;  2B9V A;  2JE8 A;  4A44 A;  3HNB M;  2YC4 A;  2Z4F A;  4QX1 A;  1F4A A;  3A21 A;  4CVU A;  2RV9 A;  5HXM A;  4QX2 A;  1JZ7 A;  4MGS A;  3LEI A;  4OMC A;  4A45 A;  3IAP A;  5B4N A;  1MPX A;  2VZ1 A;  2XHN A;  5C71 A;  3WNM A;  4D8M A;  2VZP A;  2WYS A;  2WN2 A;  3K77 A;  1EUT A;  3VD4 A;  2QQN A;  4OZO A;  3OEB A;  1PMJ X;  4BDV B;  3BGA A;  3OGS A;  3LE0 A;  4CUA A;  2VZQ A;  4LPL A;  5FUI A;  4OYU A;  4LKS A;  2RVA A;  1KEX A;  4BJ0 A;  4XUP A;  3K4Z A;  3DYP A;  2VQU A;  2DDU A;  3P1I A;  4MAD A;  1HN1 A;  3HNY M;  5JXJ A;  1R64 A;  1EUU A;  3HEI A;  4CU9 A;  3LEG A;  4M4R A;  1H6X A;  3OB8 A;  4XUT A;  2WAO A;  1GMM A;  2VME A;  2Y64 A;  3WF0 A;  1PMH X;  2CDO A;  5LA0 A;  2WO2 A;  5EIY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...