2WO1A

Crystal structure of the epha4 ligand binding domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
183
structure length
180
Chain Sequence
ETGEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKRTKHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords EPHRIN TYPE-A RECEPTOR
publication title Structural Plasticity of Eph-Receptor A4 Facilitates Cross-Class Ephrin Signalling
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 180
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wo1A00
3C7HA 1JZ7A 1OT5A 3IAQA 4QX2A 3WQBA 3WNMA 3LEKA 1SDDB 3I2IA 3I2GA 4A6OA 2L9LA 2VZQA 2ZEWA 4Z2AA 2EIEA 2J1AA 4QDRA 1XNTA 3LQCA 2VCCA 3WF3A 5JXHA 5JUVA 4A41A 5A1AA 2J22A 2JDAA 2LW8A 3GGLA 2DCJA 4MOAA 3VD4A 4PF1A 3BGAA 3VD9A 2YFUA 1NUKA 3C7EA 3C7GA 3THDA 3T09A 3ETPA 2WO1A 5JXGA 3VD7A 3OBAA 3DYPA 3IDAA 3OGRA 2J1SA 4TXWA 2VZ1A 2VMDA 2W87A 2LS6A 3ZM8A 5G05L 2QQIA 4P08A 4PT6A 3FL7A 3E1F1 1PX3A 1ULPA 2VZVA 1JHJA 4OMDA 1W9SA 2VCAA 4P02B 4AAXA 1UWWA 2VCBA 5CZKA 2J1TA 4LKSA 4XUOA 4L0PA 2W5FA 1GOGA 4P00B 4A44A 4LHSA 2VL4A 4A4AA 2HLEA 2QQOA 5F7UA 2W46A 4OYUA 3GM8A 2W47A 3VD5A 3MBWA 2VTFA 2WQ8A 2ORXA 1UY4A 3VD3A 1JYNA 1XNAA 1UYXA 2XQXA 4JKLA 3WNOA 2WZ8A 4MGQA 4QX0A 2VQTA 1GUIA 4ET7A 2V5DA 4XUQA 3P1IA 2J1EA 3K4ZA 4XUNA 1W99A 2RJ2A 4W50A 1O59A 4QX1A 3K46A 2C26A 1RYYA 1UY2A 4DUVA 1H6XA 3OB8A 4GWIA 3THCA 4CU9A 2Y8KA 4ZY9A 3HNBM 1JZ3A 3WEZA 1DYOA 3LEIA 3UETA 3NJVA 1UMIA 4XUPA 2BGOA 2RVAA 5FUIA 3C7OA 2VO5A 4RN5A 1JZ6A 3OGVA 5DQ0A 4YPJA 2BERA 3UESA 3WF1A 3I3EA 1JZ2A 3WNNA 3OGSA 2DCKA 2W9XA 1GOHA 1US2A 3IB3A 2YG0A 3K4AA 4QB2A 1DP0A 1K45A 3FHAA 4LQRA 5JR2A 2E31A 4XUTA 1O8SA 3SEEA 4UOJA 5B4NA 3MO4A 1SG3A 2QQKA 3A23A 3C8XA 3GDBA 3HJRA 1OH4A 2YC4A 1L7QA 3FHQA 1F4HA 1JZ8A 3DYOA 3DYMA 1TG7A 1CX1A 3WNLA 1CZVA 2JKXA 2Y6HA 3J7HA 3OG2A 4IUGA 4XZUG 4KI5M 4QB6A 3UNPA 2VZTA 4ARYA 2W91A 4DEVA 1OF4A 1W9WA 2BBAA 5JXJA 3C7FA 3ECQA 3SKJE 2R7EB 4BK5A 1K12A 3HPNA 3HEIA 5HXMA 1IQDC 1CZSA 2VZOA 2YB7A 2QQJA 4P5YA 2J1UA 3F2ZA 2WO2A 1GNYA 2VMFA 2X09A 2X05A 2E26A 2VZPA 3LE0A 2VR4A 1JU3A 4XURA 3MUZ1 4RYDA 3SEPA 4MGSA 1W8OA 5IHRA 2VMEA 1XC6A 3MUY1 2VC9A 3CZUA 2QQMA 1PMJX 4DXTA 2Y6KA 1JU4A 2QQNA 2WUHA 2DDUA 1JYWA 1JYXA 2PQSA 1NX9A 2W94A 2XONA 1DLCA 4PQQA 3AC0A 1GOFA 4HG6B 3VDCA 1CIYA 4BXSV 4CUBA 1GQPA 1W9TA 4W8JA 1J84A 4OUEA 3I97A 1W8NA 3NJXA 2WABA 1I5PA 1GMMA 3IAPA 1NKGA 4DUWA 4DEQA 2V72A 2J1VA 3P6BA 1UXXX 1JYVA 2Y6LA 4CU7A 5EJZB 3SKVA 2C9KA 4AG4A 3I2HA 2W95A 5IFTA 3K75B 2WAAA 2QBXA 1L7RA 3ACHA 5LCWL 5C71A 4MO3M 4W4ZA 3A22A 2Y6GA 3EYPA 4ZZ8A 5LA0A 2WZEA 1GU3A 4E8DA 3K77A 4KMQA 1JZ5A 4BJ0A 1MPXA 2EIBA 3W5NA 3VDAA 5J1XA 5EIYB 4DXSA 4JKMA 2VM9A 2JE8A 3U37A 4BDVB 1O8PA 5DPNA 3I2KA 2BZDA 2EICA 3T2QA 4JHZA 1P8JA 1US3A 5HPOA 2ORZA 2VMCA 1T2XA 2VZSA 5CYYA 4A3ZA 5IJRA 2WAOA 3MV11 1JI6A 2XHNA 2J1RA 4MADA 4OZOA 3WSOA 5LA1A 2ZEZA 4QX3A 2VJXA 4GZ9A 3T0DA 1PMHX 4A42A 2B4KA 2ZXQA 1TVGA 1HN1A 5G04L 3T0BA 2W3JA 1D7PM 4M4PA 3HN3A 3NRUA 2OKXA 4D0QA 1J83A 3LPGA 4CUCA 3HOBA 2EIDA 5C7GA 3I3BA 3PUHA 1EUUA 5EJ1B 1LNSA 1W0NA 2ZEXA 2WDBA 4QDQA 5IYYA 4QDSA 1PX4A 5C70A 3T2OA 4BK4A 3NQHA 4TTGA 2WBKA 2W1UA 2E32A 1SHWB 3T08A 2W1SA 2WN3A 4A45A 3I2JA 3BN6A 3CZJA 3MV01 2W1WA 3WF2A 2WYSA 4JX0A 5B4XA 1UZ0A 2B9VA 3HNMA 1NAEA 2XOMA 4CVUA 2BGPA 3DECA 4CU6A 1WCQA 2VZ3A 3HNYM 4GWJA 1KEXA 1UY0A 3VDBA 1UYZA 3T0AA 2J7MA 4ARXA 3GXUA 1K42A 2VQUA 3LEGA 4QB1A 3WF0A 1CZTA 2Y64A 3A21A 3OEBA 2W1QA 2W92A 5IFPA 1UYYA 3IIIA 1UXZA 1UX7A 1H6YA 2VZUA 1KGYA 1WKYA 1UMHA 4DUXA 4OMCA 3WNKA 2ZEYA 2YFZA 3I2FA 2Z4FA 3T2PA 3WF4A 3W5MA 3I3DA 4XVHA 1XPWA 1F4AA 2YC2A 3A7QA 1ULOA 2VZRA 3FN9A 3CMGA 4E8CA 1YQ2A 3WNPA 4KWUA 1OD3A 2WO3A 5JXIA 1UY1A 1K3IA 2JD9A 5DMYA 2E33A 3NNGA 1JZ4A 2CDPA 2Y6JA 3CKHA 3CQOA 3CDZB 1BHGA 4CUAA 4ZZ5A 2C4XA 1R64A 2X10A 4D8MA 4UAPA 3EB7A 2KD7A 4UI9L 3JXSA 5DN2A 2HYXA 4FI9A 4QAWA 3ABZA 2CDOA 3ACGA 3ACIA 3LPFA 4M4RA 2VOTA 5LA2A 2ID4A 1OF3A 4LPLA 2V4VA 2QQLA 4CU8A 4JKKA 3PUIA 3K4DA 2RV9A 3OEAA 5JMOA 4DXRA 4QPWA 1UY3A 2WN2A 3ACFA 3D3AA 3CIHA 4ZXEA 5I0DA 1EUTA
chains in the Genus database with same CATH superfamily
3C7HA 2AENA 1RUC2 2LROA 2Q1FA 3IAQA 3OY8B 4Q0QA 2XVLA 3PDQA 4QX2A 4XAEA 5D8AB 3W21A 4CEYC 3SLIA 4N43C 3D6EA 4QT6A 5JAXA 3TAYA 2IXKA 1RUI2 4GH4C 1K5JA 2WFF1 1R091 1RUH2 1XNTA 1ZYBA 4HKOA 4UW6A 1W6OA 4FFFA 2Q30A 5DAPA 3EJKA 4TWTA 4AVCA 2IC1A 5A1AA 5FOBB 1G9AA 5FYTA 1C8M1 1VBD2 2XJQA 4H14A 1POV3 1XQNA 4XXPA 4BA6A 5K8SA 4YZ2A 4CXWA 3VD4A 2VAUA 3MFAA 3VGIA 5A70A 1TZOA 2DVBA 2HWF1 2RHPA 3BGAA 2ZZQA 3AP5A 5FMOL 3T09A 3HBZA 3L2YA 5CFCA 2OA2A 2IVIB 1JW6A 2DF7A 5FZLA 4CRQA 5ABJB 1LKNA 4OQ8A 4IV3B 3U10A 1CAVA 4K20A 1X9TA 3OGRA 4CP2A 1IOAA 2VZ1A 3AMPA 2W87A 3ZKYA 4OUSA 1AR92 5G05L 3VL8A 3ZFGC 4D6SA 3ETQA 1BVP1 3FL7A 4NROA 4BMEA 1D4VB 2VG9A 4YVWA 4OQ9A 1PX3A 2RMU3 1GWMA 3PNAA 3RZZA 1FPN2 4CE8A 3H8XA 1V9U3 2O8OA 4RD7A 3SXWA 4P02B 2DFCA 1DU3D 1NZCA 1JODA 1OLRA 5B2GB 3OCPA 4E2GA 1CGPA 4KBBA 5CG8A 4XTMA 1H2LA 3K51A 5FZAA 3VZLA 4L0PA 4IV3C 5A7WA 3P3NA 3BTAA 2JE7A 1I9RA 3UL2A 1Y9MA 2VL4A 4LHSA 4CCNA 2ZHMA 4A4AA 2UU8A 3R6SA 3GBWA 3HVDA 5FAXA 4D69A 1YUDA 1YIFA 1VMHA 4BB3A 1F31A 1V6KA 2W47A 4XFIA 1VBA1 2VUCA 2W0XA 4MGZE 1UYPA 2AREA 1QEXA 2JG9A 2RR12 2WQ8A 3H3LA 3VD3A 1QH6A 5F1RA 2JXAA 4UT5A 1S55A 4Y24A 1CJPA 1FX5A 1W6OB 1XNAA 2TBVA 3AMHA 2R043 5LBBA 3RYKA 1JYCA 4BQWA 4JKLA 5A6QA 1RINA 1QJEA 1WBLA 1EPZA 4OHXA 5FYMA 4AXOA 1OBNA 4AEDA 1BEV1 2VQTA 3T3YA 1QQP1 1LHOA 1VE0A 4H55A 3I3QA 1IS4A 2RS33 4XUQA 1HB1A 2WNUC 5IT6A 1F2NA 5FY0A 3KCCA 4OULA 1JHNA 2RM23 1REEA 4LLFA 4DPNA 2D5HA 5CFCB 4QX1A 2XVKA 3K46A 1UQXA 3WDUA 5IVBA 5A33A 1BVVA 2V5YA 2BGCA 1CAVB 2ZTNA 3OB8A 4IEPA 2GDFA 1NLSA 5DUUA 5BUVA 1ASJ3 1DGRN 1Y3TA 1Q8VA 4O7XA 2VU9A 4UW5A 5DZFA 3TN91 5A6YA 5JZGA 4FFGA 2OW4A 3AKRA 4XETA 1Y43B 1TQ5A 4YVWB 5JSPA 4AVAA 3KV9A 3T2TA 4OI2A 4ZU4A 1G9BA 1KS5A 2Z79A 3EO6A 1PGL1 4HK8A 1JZ6A 1SLBA 3OGVA 3URFA 1E57A 2A6VA 5DDJ3 4O65A 3PMEA 3TEZA 3FFQA 4XJ8A 3CJXA 3ZIXA 3RSJA 2QFEA 2DCKA 1RJ7A 2W9XA 3LA3A 4ZPIA 4R4ZA 1US2A 2JJ6A 5A7WB 2XKPA 5LB6A 4NIIA 4YARA 2JDKA 4NE9A 3VKOA 1DP0A 3LIGA 4UF0A 4YVSC 3CU7A 1LOCA 1S2EA 3NKGA 2HWC2 3WR0A 5AC92 1YQ8A 2P1BA 3HQRA 1R083 4UOJA 4Y5TA 3MO4A 5FKBA 2CGNA 5LBFA 1LGCA 4J6GA 3BUCA 1AYN1 1CAWA 2VPVA 5J37A 1OH4A 1OSGA 1YRZA 2JG9B 1W28A 1IPSA 3FHQA 2YBKA 5A7NA 3DYMA 1TG7A 2Y6HA 4AI1A 1OXCA 4IEXA 1Z7S2 4M01A 4IUGA 1QXJA 2Y38A 3MW4A 4N9HA 4O9EA 4Y1ZA 4QB6A 3UNPA 3MZHA 2W91A 3OBRA 2P3JA 4GWNA 4K21A 1XU1A 4GJYA 4AEDB 4FAGA 3VDDC 3JBG2 4CCEA 2R7EB 3V0AA 4BK5A 4C0BA 4E2QA 2JIGA 1QJU1 1VAKA 2CY6A 4R9CA 1GP5A 3WDXA 3AP6A 4Z2WA 1SEFA 4XC9A 1WW5A 5IUQA 5LY2A 3RFRA 2TNFA 4ZHNA 1NCRA 5FJHA 4PJYA 2PQQA 1IQDC 1N1TA 5IK7A 4C1WA 5A33B 2QQJA 3KM5A 4J1WA 2J1UA 2ZA9A 4XFHA 4L92A 5FCCA 2WO2A 1I3HA 5K7PA 1V6MA 1DYPA 4GJZA 4SBVA 2FMYA 3NKTA 5JZGB 3N9QA 1CESA 3O1TA 1GKBA 1S0CA 2E26A 1LECA 4XDOA 4AEDC 2XGXA 3U78A 1JU3A 5FZGA 4XFAA 5HI0A 4XURA 1WD3A 3MUZ1 4JZRA 3M70A 3SEPA 3VKLA 1QIQA 3E5UA 3VHPA 4M3CF 1W8OA 5FREA 5IHRA 1PO13 1XNBA 1RUC3 1WMXA 2XR4A 1C1LA 2WWUA 3GCWA 4GKXA 4YW7A 5FZCA 2P3KA 2Q0AA 2A5ZA 5KHJA 1JU4A 2QNKA 1RUI3 2DDUA 2QQNA 3IWZA 3VZMA 4UF0B 5KC6A 1LU2A 3RVHA 1JYXA 1IPJA 1RUH3 4LKFA 1KITA 5FK8A 4V2WA 5FYHA 3AP9A 3AC0A 1GOFA 5D1IA 5FJKA 4ZU7A 2EXIA 3M2MA 2RE9A 5D2AA 4CUBA 1RUD2 1SBFA 3NVCA 4COZA 1CAWB 5A3OA 2DV9A 4Y20A 2BWAA 1XNDA 4GAZA 5ACA1 1UMZA 2WABA 4IV1C 5C5TA 1I5PA 2W2IA 4B4PA 1NKGA 3UT0A 5I8YA 1SACA 2X29A 4DEQA 3VV1A 1AR61 2E51A 2Q8EA 2DBIA 1A8DA 2QCSB 4M0HA 3RI8A 3MEPA 4DB5A 3RZLA 1MS5A 1HRI2 3N3HA 3ZDVA 2Q5TA 4H3WA 3BALA 1ND2C 2B9UA 1PGSA 3PLQA 3WOGA 2QTWB 3Q8AA 3I2HA 4LBKA 3CJIC 3V0AB 4H2AA 3MIEA 1UF2C 3KQRA 3WUDA 2ZABA 3GYDA 1NCRB 3K48A 4YYOA 2YBSA 4QKNA 4W4ZA 1IHMA 2CGOA 1X50A 4LULA 1WD4A 4LKDA 3VLBB 4E8DA 3HAGA 3KD4A 3BI3A 2AC1A 5JVVA 4B29A 1MS1A 1PZ9A 2WQZC 4CEWC 3B02A 1LENA 1QWRA 1JZ5A 3MHZA 3W5NA 1F15A 1H2MA 3ZX7A 2RS51 3WD5A 4JKMA 1W8FA 1RUG1 2VM9A 1UZYA 3IDCB 4LT5A 1AX2A 4JAAA 1O8PA 5EFUA 2QZ2A 1OFSA 5DPNA 3I2KA 5FV3A 2OX0A 3T2QA 1KS4A 4DY5A 1S1AA 4MHUA 1AL0G 3O7OA 1P8JA 1WUVA 4K8FA 1HQNA 1WLWA 3IDEA 1OHFA 1SLTA 2E63A 1GP6A 4PF5A 5HXVA 3ZXFA 5CYYA 3KT7A 2RR13 5C4WC 2QVSB 5IJRA 3MV11 3AVRA 1RGSA 2A6YA 4IDZA 5FWEA 2EAAA 4MYEA 1LGBA 4MADA 3WSOA 5BXXA 4XAAA 2XJUA 2ZACA 4LK6A 1N3PA 3V64A 4PI2A 1SQ4A 2IXLA 4HFSA 1PMHX 4CTEA 4RGGA 1QNWA 4IGOA 4Q29A 4Y20B 2BPA2 2OUHA 2VOXA 4LHKA 4COVA 3CEWA 3AX4A 2AZ5A 4RR3A 1C5IA 2XQRA 2OKXA 4OFGA 1RXGA 3TNPB 1J83A 2XH6A 4YW1A 4D0QA 4AHZA 1W8TA 3HOBA 1NLRA 1POQA 1VB4A 2HEYF 3MICA 5C7GA 4BM8A 3PUHA 1UKRA 1ZA7A 3M3EA 2E6VA 1E5RA 2DUOA 2E9QA 2IXCA 4QMAA 5EWSA 3ENRA 4MGYE 1PO22 2Q1MA 3WQ1A 5BNOA 2P3YA 5IYYA 1ULGA 5FY1A 1MS8A 1PX4A 3VBHC 4BXFA 3HWJA 4LO7A 1H8VA 4OLLA 1WA6X 5GLTA 4TTGA 2WFPA 2R6QA 4YW3A 4QD2A 3T08A 2WN3A 5T5JA 4GD4A 1CAXA 3H0OA 5GLZA 1OQEA 4HVRA 5AVAA 3DUIA 2EIGA 3H8UA 4QM8A 1UL9A 4I3PA 3MV01 5E6HA 1KRIA 4N7IA 2F4LA 2W1WA 5CADA 1BMV2 3I54A 1ZBE2 1V9U1 4JX0A 3MDPA 4Y5Z0 5B4XA 2HWC3 5AC93 1MVEA 2ADDA 5BNQA 5DUWA 2XG3A 2CGPA 5JDBA 2PFWA 4LBMA 2QUOA 3KQ4B 3POBA 4FFHA 4XILA 5FZMA 5KHKA 4WM8C 1AYM2 4YG0A 3HNYM 2RJKA 4LIUA 1YHFA 3PTRB 3OGGA 4HVQA 1SZBA 2LUWA 4QX8A 2UURA 3T0AA 1GZCA 3ZSEA 4B8EA 1Z7S3 3OPWA 1YJLA 1E5SA 5FPBA 1VIWB 2G9FA 2VQUA 3PUSA 4X8NA 4BE3A 2Y64A 5H9SA 1EAH3 2A6XA 1W2TA 3ZYJB 4XE9A 2DVFA 1U5IA 1UYYA 3FUOA 4MUVA 2JIJA 2K0GA 3MW2A 3QOPA 3UGGA 2R041 4RR3B 2WS91 3X29B 2FDKA 5F37A 3PU8A 2XHKA 4H7MA 1ZRDA 5FLJA 4N53C 2ZMLA 1UMHA 4COUA 1STMA 3ILRA 4OMCA 1IKPA 4AVSA 3DEMA 4CP1A 3PVNA 3WHUA 4OZXA 3CBNA 2ET7A 2RM21 2BOIA 2XJRA 3JD71 4FO9A 5BNOB 1W2UA 1XSQA 1Z0HA 1HRV2 1DLLA 2I07B 2DU1A 4ATEA 3R4SA 2D3PA 2X5IC 5F3IA 3O14A 3ME2A 4P14A 4D6QA 5F2SA 2GNBA 4DMIA 1ASJ1 2A6WA 3A0KA 4LJHA 5LBEA 4CCKA 1ZZ7A 1CAXB 1F5JA 1TEIA 3POFA 2DU0A 3PVBB 2YC2A 2TEPA 4B1LA 2VOWA 4BQ3A 2CAVA 4QKBA 3HD8B 4FXGB 4R4XA 1AJOA 1YO8A 5CEHA 1UU5A 5FY8A 5FZFA 3UYJA 1W8ZA 2GC3A 1W8HA 2MEV2 5LRRA 4AFAA 5DDJ1 3HT2A 1UZWA 4YW2A 5EP9A 3AXDA 2YU1A 4NRMA 1BQPA 1RMU2 2FD8A 2VVEA 3AMNA 5FY7A 3DKWA 4YZ1A 2R30A 2RDSA 4Y33A 3AYAA 1XJAA 2JD9A 3LGRA 3O1VA 3AXEA 5KHGA 3KHCA 4KH9A 1L7LA 1VBE3 2CDPA 2UYAA 3CQOA 3ZFEC 4LO8A 3GZTB 3KB5A 4LBOA 3BU7A 2JG8C 4LA2A 4PDWA 2KD7A 2DCYA 2GAUA 1NE4A 3SCFA 2HYXA 4QAWA 1LOEA 1HRI3 4KBZA 1F8VA 5LW9A 4CDQA 5J7MA 2V73A 2VOTA 4NHMA 1O4TA 2JB8A 2D7FA 1GYKA 2X53S 3GF6A 4XF0A 2WNEA 5FYZA 3U11A 2KR2A 3MF6A 5FMDA 2YDEA 3INAA 2V4VA 2BTVC 1EP0A 4Y1VA 4DINB 2GC0A 3H1MA 2XL9A 2DTWA 2Q1ZB 4IE4A 2QDNA 1A78A 5EYYA 1Q43A 3RGBA 1TME3 2WZR2 1W6MA 3S7EA 4DXRA 4QPWA 2PAEA 3WF2A 3ACFA 5LATA 3IN9A 2RMU2 3D3AA 5FZ7A 4MGTA 2A70A 3RZJA 1Q8QA 4NRQA 4URTA 5F3GA 3PIGA 3ZIWA 2VMGA 4NMIA 2C0ZA 3NL1A 1RUJ3 4HN1A 3LCPA 3WNMA 3J4UH 3LEKA 4D94A 5C5UA 2ATFA 4NOTA 4A6OA 3L2HA 1IPKA 1LOAA 1B35A 1OKQA 2VZQA 2ZEWA 5CKQA 2EIEA 2HWB2 3KLSA 4Z2AA 1AR72 4TSVA 5FFOC 3NMBA 4QDRA 3LSDA 2QZ3A 2ZGQA 5FP3A 4IEYA 5KXCA 2VW2A 2XBO3 2FCTA 1W2OA 4PLNA 2YU2A 1HXS3 1RUC1 4WZCA 2ARAA 2ZGLA 1ND3C 3B9IA 4MV2A 2B8MA 3KV6A 1BBT2 1M4WA 1NUKA 2ARCA 5CA6A 1RUI1 3ETPA 2WO1A 4MG2A 1RUH1 1GP4A 3VD7A 3KT1A 4J25A 4AVTA 3IDAA 4B7KA 2E53A 2XJVA 1CAUA 3AYDA 1VBD1 1VBB2 1RTVA 4PDWB 3MLJA 4XF4A 3WP6A 2F4PA 4WBBA 1W03A 1OPMA 2VMDA 3IKWA 3MIGA 2LS6A 2WO7A 3AMMA 3O0WA 3OUHA 4L8QA 4EJRA 2QQIA 1O3SA 4XOGA 1UOBA 2RS32 4LBJA 4CDQB 3E6BA 3E1F1 1PO23 5A6ZA 4NPRA 3THPA 5CBLA 2WLPA 4OMDA 1W9SA 4BOWA 2E7AA 4X8PA 4UW3A 4AAXA 3AZWA 4FPGA 4AVVA 5GKAC 2LRPA 5L7OC 2Z69A 4R9BA 5JLVA 4HKWA 3ES4A 4QXBA 2A3XA 5KXDA 4LKSA 4XUOA 2VBPA 3BIWE 2OZ6A 2BVVA 1AR91 1W6MB 5EZWA 4IEQA 2BV4A 2WWJA 1W06A 4AGGA 1FAYA 4Q1RA 2DURA 3G6JB 4MGKE 1FPN1 3VUOA 1ZBE3 3B3QE 3UV9A 4NN0A 1AF9A 2W46A 4OYUA 3RS6A 1I5ZA 1OLQA 4FP2A 4LHLA 4IGQA 3WLUA 1B35B 1YWKA 5C3PA 5K9YA 3N4MA 3GCXA 4MVTA 2C6SA 1LAJA 2QQVA 1F35A 3KGZA 4XHBA 4IETA 2D6NA 1CJDA 1DQ4A 3N36A 1MACA 3MIDA 1IS5A 1FT9A 1UD1A 4D6RA 4MGQA 2F6BA 4Y1XA 4NIHA 4TN7A 4F83A 4YW4A 3WP4A 5IW0A 4NRPA 2V5DA 5J98B 3ZXEA 3THTA 3K4ZA 3LOBA 2RR11 3N7JA 5I8TA 1O59A 2WNVC 2HKXA 1GZ9A 1WW6A 5LK5A 1PVC3 1H6XA 4DUVA 4XBQA 5FPAA 1CAUB 5FZ9A 4YGDA 4GWIA 3FWEA 3ZR6A 4NWVA 3VBSC 4ZY9A 3NV1A 2ARXA 2OXBA 2UWBA 3DCQA 1ZRCA 1EV13 1JZ3A 2YY1A 4QPIA 1ALYA 3OPTA 5I8SA 1SCRA 3B69A 2ET1A 2UWAA 5GLUA 4P9JA 4DOUA 2GALA 4JGZC 1ZVFA 1UN1A 2C24A 2LTNA 4XZPA 1S0IA 2WT0A 4PCRA 4YPJA 3UESA 5F2WA 3WF1A 2YYOA 2ZX4A 3I3EA 5T54A 3USUA 5IWFA 3WNNA 1OMIA 2ZBJA 3FUQA 3ZYHA 2Y26A 1MEC3 2D3RA 3K4AA 3EXUA 4S2HA 3F95A 3FHAA 1K45A 3ZYGA 5J48A 2YGLA 4L99A 1QMJA 1RIRA 3KGLA 5BNNC 1QF3A 1XB9A 2OS2A 4LQRA 5DAXA 5JR2A 1O8SA 3MYXA 2VW0A 4LO4B 3H3UA 4U2AA 2PLV2 1XXNA 4NHKA 2A6ZA 3V0BA 3IDBB 3OBTA 4V1PA 1PO12 3B01A 1UNBA 2W68A 1RMU3 3BVCA 4L2NA 4YM2A 5F3EA 1F4HA 1MS3A 1JZ8A 4FXKB 1LTEA 3LOIA 4QKFA 5CIRA 5C3SA 5FPUA 1CX1A 2JDMA 2O1QA 3J7HA 1J3QA 2G4IA 3LFMA 1QGLA 4AI0A 2D6KA 4A2UA 4C90A 2HBUA 2HWC1 5AC91 4GB32 2VZTA 5FYIA 3ROUA 4ARYA 1OH3A 4YFZA 1OF4A 1W9WA 1SFYA 2BBAA 3WNXA 1DYKA 2YPDA 1FOD3 3ECQA 4I01A 2CV6A 5LBCA 4E27A 1K12A 4IE5A 2I74A 4EROA 3HEIA 1DGLA 2V4AA 4S2DA 2FDGA 2FBEA 5D8AC 3CO2A 4K3UA 4LR4A 4XF1A 4Q0PA 2YB7A 1Z7S1 3MLLA 4HETA 4P5YA 3BTXA 4FPHA 1WGPA 4ISRA 4U36A 4XFCA 1GNYA 1FMD2 1VMFA 2GMEA 1PVXA 2NPIA 4X6RB 3H3ZA 2X09A 5GM0A 1V00A 4C1XA 3AZVA 3JB8A 3JBG1 2DCZA 2FCVA 2X05A 2WZR3 4ONUA 4TLFA 1J1LA 5A80A 5FQ0A 4QPIB 2VECA 2VR4A 5JOYA 1JYTA 3MLKA 4EYUA 1SBDA 1DFQA 1HIXA 3WDTA 4AQSA 3VBFA 4DFSA 5BYNA 4MGSA 3SCGA 4WV8A 4XPVA 5I0UA 2QDRA 3USUB 3AMQA 1XC6A 4HMZA 3RG0A 3JU9A 1QXRA 2VC9A 3CZUA 1PZ7A 5IAVA 1KXGA 5SV8A 1PMJX 4E4SA 2DTYA 2Y6KA 4CDXA 5LZ6A 5ABJC 5I0SA 2HWB3 2WUHA 4XCBA 4YSFA 1AR73 3PL0A 3O1MA 1OUXA 1WW4A 2XWBB 4KNCA 2W94A 2AYHA 1DLCA 2AACA 3WX5A 1D4M3 3V0BB 2YGMA 4BXSV 1V6JA 1W9TA 1HV1A 4QGLA 4F3JA 1J84A 5IVEA 3ACLA 4HN0A 3WG1A 5C3OA 1W8NA 1YFUA 4W6WA 2DCTA 3VBUA 2R073 3AZZA 1GQHA 1VBC2 2XJTA 1BBT3 2ETEA 5T5PA 1LEDA 4DUWA 3FX3A 2H0VA 4W6XA 2WZPP 1MQTA 2CTVA 1JMUB 4IQPA 4P9GA 1J3PA 2J1VA 5A1LA 4HK9A 1TNFA 2WSVA 1YXWA 1QJY3 4JHTA 4ASKA 1VBB3 2EXHA 5F5QA 3NNLA 2Y6LA 1Y9QA 1RUD1 2C9KA 2WR9A 2Y60A 3EMRA 5FZKA 3N9NA 3SKVA 5FY5A 3K75B 2WAAA 3ZYIB 4WM7A 3ACHA 4XJUA 1HLCA 5F9TA 1YFYA 1OQDA 1XRUA 4HT1T 5FP9A 5E88A 5I0RA 5JSOA 2GZWA 5KBFA 4D3WA 2ENRA 4ZZ8A 1GU3A 4JVAA 2Q8OA 3AP4A 1HRI1 1BCXA 2FCUA 4FCAA 2BBVA 1V6OA 1MPXA 1XE7A 2EIBA 3D82A 3MIHA 4EE2A 5J1XA 4CDWA 2CU5A 5EIYB 2XPJA 5FQ0B 3PTYA 4AI2A 2JE8A 2GN3A 1CWPA 2XXZA 3U37A 3DXUA 1KD7A 2HH9A 5H9PA 4QQPA 1PM7A 1PK6A 3T30A 5L36A 3WINE 2EICA 4FPOB 1CIWA 3MIFA 4LO6B 3VBFB 3GNEA 5IAXA 1LOFA 4JDOA 1GR3A 2XL7A 3DKQA 3AYEA 5HPOA 2ORZA 1LJ7A 1POV0 4M3CE 2YHJA 3H7JA 3LZZA 1YFXA 4JQRA 5DABA 2OT7A 1W9FA 3SCHA 5CB7A 5CFCC 4UFLA 3MGUA 3N9PA 1S4CA 2VE1A 3S57A 4Y4YA 4CDXB 4LBNA 1APNA 5FMCA 4AQ6A 1YEWA 3E5XA 1TNRA 2WAOA 2ZGTA 4IEOA 5H9RA 5D21A 4OZOA 4EZ4A 3OD0A 4HKLA 5LA1A 2WKKA 2CHHA 3QD6A 4HL0A 1S0DA 4QX3A 2DVDA 2HWD3 4GZ9A 3TWIA 3T0DA 1ZZBA 4YVWC 5FZOA 4AFCA 2VTXJ 4LTAA 4A42A 1C28A 1E5IA 3KV4A 2B4KA 2ZXQA 4UBGA 3VBUB 3WQ0A 2W3JA 2Q8DA 4XJZA 2ZGUA 5BPXA 2XVGA 4M4PA 3WG2A 2VOKA 4CCDA 1IG0A 3P3PA 1MQTB 3GJAA 5HBAA 3LPGA 2AR6A 2C5DA 5FUPA 3PHMA 5FXWA 3RZGA 2JDYA 1HB3A 4ITCA 1LCLA 3NAPA 1Q8OA 1EAH2 1W3XA 2XJPA 2P4EA 3SQOA 2ZEXA 2SLIA 4QDQA 2FDIA 3KF3A 5FZIA 3LIHA 4KG8A 2FDHA 5HCAA 1JUIA 4QDSA 1IS3A 4WM7B 5GZGA 1GZWA 4LIVA 4FTBA 1QDCA 1OFNA 5LA9A 3OPZA 4BK4A 4NPMA 4Q4V3 1YC61 3POEA 2DVGA 1SHWB 1QKQA 4XIOA 2W1SA 2JG9C 4AFBA 4QHOA 5C6CA 4NIGA 4XQDA 1NCQA 3AYCA 4E4HA 1ZBA3 2O0OA 4WVZA 1VP6A 4AFMA 5JSRA 2ES3A 2BNMA 3CZJA 2O14A 2UY9A 1W90A 4AAPA 4J1XA 3D0SA 5FZ0A 2BP6A 5KHHA 4CDWB 1PO21 1U5XA 3AP7A 1UCXA 2Y6FA 4COWA 4A7ZA 5IK5A 1GNZA 1PK6B 3Q8FA 1TMF3 4Y4RA 3H7YA 3OGJA 3NV2A 3M4FA 4I3GA 2PLV3 1JOBA 5DAWA 5DAQA 4AGVA 1YYNA 2KXLA 3O1RA 4FQ4A 2BGPA 2BVBA 4BWOA 4DO0A 1H1IA 1XBFA 4UFKA 4E2SA 1WCQA 3NO8A 4XYXA 3DL3A 3KV5A 5FBZA 1V70A 4JRAA 4M0NA 4NIDA 1KEXA 3TBDA 5F5CA 4KWKA 5C8CA 4ES9A 3OJBA 2VXJA 4PLOA 1BMV1 3S7IA 1ZBE1 2J7MA 1WWYA 3GXUA 4RHV2 1ENQA 5JZGC 4GB33 1HV0A 5BNPA 2N7GA 3VN4A 5FP7A 1UOJA 1GZTA 3A21A 3J7NA 3LA2A 5FZOB 4F8AA 1PK6C 3VBOA 2W1QA 1FXZA 4N8MA 1N3QA 2CWMA 4XDQA 1LULA 3M3QA 4GMP3 2P2KA 1AYM1 2JENA 1LRHA 3J8F3 1JOJA 2FZ1A 1H1AA 1PNFA 1UX7A 4A3XA 1DZTA 2VZUA 4K1ZA 3WZ1A 1Q8PA 1O7FA 1VBE2 4N7UA 4QXCA 4WZFA 1ULFA 1VAVA 1SLLA 3CHXA 3VHRA 1QJFA 3WNKA 2PA7A 2X8KA 4DZGA 1FMD3 3NAPB 3BODA 3IZOA 2YFZA 1LHNA 1T6GC 3BTZA 3ZMNA 1GZWB 3QCWA 3WP3A 4AW7A 3ZLIA 1OURA 4KG0A 3U0ZA 1RUNA 2CYFA 1W05A 1NG0A 4XVHA 4YZ3A 4JTOA 2VXRA 1HKDA 1XPWA 1FNZA 3OBZA 1CN1A 4BU2A 2EAKA 1ZZ6A 1ULEA 1GSLA 1NCQB 1O5LA 1S0JA 4BYYA 1H0BA 2ARBA 1TME2 1KJRA 3A7QA 1REFA 5FPLA 3O1UA 4Y26A 4K8RB 1ULOA 1XE8A 4DQAA 1G7YA 1HRV1 4FOYA 4E8CA 1ODMA 1DF0A 3V65A 4Q4W3 5C9AA 1YQ2A 4AHXA 1PGW2 5J96B 1RUJ2 4XJWA 5FY9A 3BOWA 2GNMA 3CNAA 1RVF2 2JWPA 3JQXA 1UY1A 2A3YA 2EF6A 3H9AA 3POSA 1QHDA 3U4XA 3KWVA 4AGRA 1NCRC 5HCHA 3I49A 5DMYA 2R1BA 1VBC3 4BQYA 5C8CB 1JZ4A 4Y1YA 1HJFA 2VUAA 3CKHA 3AZYA 1AR82 1HB4A 2AEYA 1R64A 2MEV1 2X10A 2XBO2 2GN7A 3RI9A 4D8MA 5A3MA 3EB7A 4AK3A 5FZDA 1HXS2 2VNVA 4UI9L 3UKNA 3R0RA 5BNPB 2IVJA 2GMPA 2ZGSA 2VVFA 4GWMA 2A1XA 1RMU1 2FDJA 2HEWF 1BYHA 1SDWA 3ACGA 3ABZA 4M4RA 3VBOB 5CAZA 3WQ7A 2ID4A 3D0JA 3PIJA 2BDRA 4C0HA 1LOBA 4KGQA 1OA2A 2BJSA 4LITA 3RJRA 2WWSA 4CU8A 4JCKA 4BCUA 4Z92B 1NE6A 2IXJA 3K4DA 1HW5A 2R063 1POV1 3ZMOA 1COV2 4MH0E 5KHIA 3ZO0B 5CISA 5K4LA 4R52A 4YWAA 1TE1B 1V0AA 5I0DA 4HXCA 1EUTA 3VBOC 2OPKA 1MZ6A 1W3VA 2ZGNA 1JZ7A 2YC0A 4MLOA 3SH3A 1YIPA 1SDDB 2WA4A 3LDBA 4IEVA 3WW4A 3I2GA 3O12A 2H6CA 5LWBA 1F5FA 3MIBA 1BZWA 3N9MA 4RGAA 1Y7BA 2WZR1 1UZVA 4E9KA 4JV4A 1RXFA 4LHNA 4AI3A 2WLQA 3LQCA 4K40A 3WF3A 5JUVA 1ULDA 2RMU1 4LMFA 2J22A 2JDAA 2LW8A 3C2UA 5C9AB 5JR7B 3GGLA 1RUE3 2DCJA 4W65A 5A3WA 4PF1A 1OQ1A 1H2NA 3Q8CA 4IESA 2VGDA 1X36A 1GICA 3WT3A 4CDUA 1W0OA 3ZN6A 2HWB1 1LU1A 1SCSA 2DBNA 1AR71 1H8TA 5JXGA 1A8MA 5SV5A 3OBAA 3DYPA 2JX9A 3BPZA 4Q27A 4NHXA 3VHNA 1WMEA 2CL2A 1FI2A 3R05A 3VKNA 2YMZA 4EZHA 3ZM8A 4QKDA 1QJX2 3ZVXA 4PT6A 4B4QA 5KWRA 1BBT1 1A6CA 2BU9A 2VZVA 2P5BA 4HOOA 1S0BA 4JGYA 2VCAA 4EWDA 5FO8B 1ST8A 1UWWA 1PVC2 1GNHA 3BOPA 5GALA 4FSJA 3POJA 2HWF3 3APBA 1VBB1 4RS5A 3LFIA 3VL9A 3HBKA 3PUQA 4B4RA 4DY3A 5BV6A 4V2VA 2W5FA 1EV12 3ZFFA 2RS31 4XCAA 1Q5OA 1GBGA 3M3CA 2Z42A 2HLEA 1W2AX 4XXAA 3WVJA 1GANA 3BPSA 1W8UA 4XTPA 2Q8CA 5F7UA 2JD4A 5A3UA 3VKFC 4EWAA 5LEKA 3AKPA 2FHRA 2P6CA 3VD5A 3MBWA 3BCWA 4C91A 2RJLA 2B45X 4RR3C 3GBFA 1MEC2 1JYNA 1QNYA 1T6BX 2JDPA 4LO5B 2Y33A 1UYXA 4IEWA 2AH2A 3LA7A 4QPGA 4RHV3 1ZREA 3VBRA 4ET7A 2QQUA 5BNOC 4N90A 1VRH2 3ASIA 4HBNA 1OOPA 2JE9A 2J1EA 3P1IA 1SLAA 2ZGPA 3H50A 5HCFA 3ZN6B 4CDUB 1GLHA 3GZEA 4XUNA 5F8PA 1J59A 1W99A 2RJ2A 1H8TB 3KCYA 3RWNA 3JCIA 5FO9B 1JOPA 2C26A 1RYYA 3WW3A 4QU2A 1VBA3 3W58A 1X8MA 4AR2A 1R081 4KL1A 3W59A 3Q9OA 1PNGA 1N1VA 3EBRA 2ZGMA 5T50A 1FOD2 4Z82A 4BQXA 1NXMA 1REDA 5FDBA 4XHXA 2HWE2 3IMNA 3LEIA 3RQ0A 3VZOA 1OA3A 3S30A 3NJVA 1UMIA 1DGWA 4LUKA 2BGOA 4XUPA 5JPNB 3C7OA 4YG3A 4CSWA 2VO5A 4RN5A 4JGYB 5DQ0A 2NYYA 1ZRFA 2BERA 1ENXA 1QQP3 5J09A 2ZHLA 2VBDA 3ORJA 1H1MA 3OGSA 4RS5B 2VD7A 5K0UA 5FZHA 3S5QA 2Y34A 3WDWA 4BISA 1N1YA 5HCBA 3ZFFB 4QB2A 3ZYRA 4QPYA 2E31A 2D43A 3HIFA 2PHLA 2NM1A 3SEEA 1X33A 1UOGA 5B4NA 4ZXKA 1SG3A 5JCTA 3C8XA 4CCOA 3GDBA 3LDKA 1GWKA 3HJRA 1JH5A 1SFPA 3A0NA 1RVF3 3DXTA 5HV4A 2JDHA 5F6LB 3O1PA 3AZXA 1OI6A 2PHXA 2WRAA 3M8LA 3DYOA 5EPAA 5FPXA 4QGNA 1AXZA 2IXHA 1FV3A 3OG2A 1GV9A 1O3QA 4F7ZA 2LALA 3IBMA 1S0GA 1SFNA 4I2OA 2JICA 1AR83 4QPGB 1D4M2 2PLV1 4DEVA 3VBRB 4UYBA 5JXJA 5EJ3A 1PO11 3C7FA 1ZZ8A 1BK1A 3SKJE 1I1EA 1UIJA 1G86A 3UGFA 1OOPB 4JDNA 2B46X 5FZ4A 4EN7B 1NZIA 5L19A 5LK7B 2WIIB 2R072 1S0EA 4QM9A 5F39A 2NQYA 4DRRA 4EN6B 2PHRA 2CAUA 3KT4A 4NIAA 1CZSA 2VZOA 4IEZA 5J3UA 5JOWA 1MS4A 1HN0A 2IWGB 3QLQA 4GIQA 5IVCA 1C5HA 1RUOA 3F2ZA 3WQBA 4GB31 4R9AA 4XF9A 1QJY2 3K2OA 3DV8A 5FY4A 3J7LA 2G9GA 1OLME 3VZNA 3I7DA 4AOCA 4YGCA 1COV3 4G9SB 5FZ6A 2D98A 4FPLA 5F32A 1H9PA 2PHWA 1JXNA 3E6DA 3AJYA 3TOJA 5FP4A 4FPFA 2D93A 3LE0A 1KFXL 4BIOA 1AHSA 2ZJCA 1K5MA 4FTEA 3RZHA 1NA1A 5CFDA 1C3HA 1PIV2 3AK0A 1KJLA 2VMEA 5KXBA 5IVYA 1FMD1 1AX1A 3NNFA 3MUY1 1NY72 5K0UB 2G1MA 1QOTA 4DXTA 1JS9A 3VB9A 1Y4WA 2AGSA 2ZHKA 1DHKB 3IPVA 4A6SA 1O91A 2NZ9A 2P37A 4IE0A 4PDWC 1N47A 1X7NA 1NX9A 2K2SA 2GP3A 3E97A 2QQWA 5FO7B 3ZXLA 4HG6B 4JQTA 4DIQA 4CDQC 1M06G 2WYFA 4JTNA 4NHLA 4KGGA 1DGWX 4OUEA 4PIXA 4UXAA 4CEYA 4CUGA 4FP3A 3VHOA 3D5OA 5ISLA 5CG9A 2RG4A 4N43A 3NJXA 4Q4Y2 1DQ2A 3N9LA 1FYUA 1QDOA 1GMMA 3RJ2X 4R9DA 4GH4A 4CYDA 4D7TA 1CX4A 4XW3A 2E7QA 2D40A 4OI0A 4NVPA 3MW3A 3P6BA 4FPJA 3AKQA 1UXXX 2HWD2 5DAVA 1JYVA 2ZOEB 2A73B 5JMCA 4AG4A 5IFTA 3E6CC 1QJX3 4ZONA 1ZRIA 2GU9A 1L7RA 1VBC1 5DG1A 5LCWL 3W9AA 4Y1UA 1JYIA 2V09A 4MO3M 1Q3EA 3R4UA 1AJKA 1EPWA 2YUEA 1B35C 4RL7A 4DRVA 3EYPA 2Z5WA 3J26N 2WZEA 4KMQA 3KCXA 4DNYA 4KWJA 2RDRA 3GZAA 4RA0A 2IFWA 3RMXA 3TEXA 4NJ4A 1OVSA 2ZX0A 3M3OA 5FPVA 3RNSA 1F9KA 1NLQA 4DXSA 3PURA 1R1A2 4Q8KA 1WCUA 3TB0A 4BLIA 4XFFA 3ZFGA 4BDVB 4XDPA 4QXHA 3SH4A 4RFRB 4Q4V2 1K5MB 1NA1B 2WL1A 3ZN4A 2YROA 4ASLA 5CFDB 3TRSB 5DZGA 2ZHNA 4AQTA 1QOOA 5GZCA 1DQ5A 2RDNA 1ZBA2 1VAMA 5A3LA 1XOYA 2VZSA 3BU0A 3BYWA 1NXD1 4A3ZA 4HZFA 1DZRA 4XBLA 3WUCA 1W6NA 3IPVB 4MXWA 1JI6A 1AL22 2VMIA 3OUIA 2XHNA 2R32A 3WCRA 3ZXGA 2J1RA 1BLZA 4K1YA 5EV7A 1TMF2 2ZEZA 5FYBA 2GSYA 3R4DB 4QX7A 1I6XA 1DQ0A 1N1SA 2RS53 2EXJA 4CXYA 4XFBA 1VRH3 1YCIA 4CEYB 1K5MC 1UOFA 3WDYA 1UPSA 3WP5A 1SLIA 1NA1C 4N43B 5G04L 5FYYA 3B94A 2P17A 3AVSA 4QGMA 1FV2A 4L11A 2JECA 2BEOA 1VJ2A 2WJSA 3HN3A 4GH4B 3NRUA 4EWEA 5A1FA 4Q4X2 3NV4A 1D2SA 2K9ZA 2PAMA 1RUF2 4RSUA 5CNAA 3I3BA 3ZXDA 2OUJA 5LY1A 1WMFA 3D4KA 1LNSA 2RDQA 1PHMA 1VPHA 2WDBA 3JZVA 1C4RA 2G9ZA 2HWE3 1UIKA 2WNUA 3J8F2 4P9YA 2VBBA 5C70A 3T2OA 1ZX5A 2WBKA 4CZSA 4LUMA 2E32A 5FP8A 3WCSA 3MF9A 4I02A 3I2DA 4FFIA 5JPMB 2TUNA 4A45A 1OUSA 5DUXA 4URAA 2ZX2A 4IXLA 3I2JA 2FDFA 1FNYA 2D44A 4I0AA 1UU4A 1Z78A 5FZ3A 4M3CA 3W20A 3ZSKA 5TSWA 1EAH1 2VVDA 1KDKA 3ZR5A 1SPPA 3U75A 3AFKA 1DCSA 3ZFGB 4B1MA 4YLZA 1G9DA 3KZ4C 4MHRA 1UZ0A 2B9VA 1SMVA 2VNGA 1UX6A 3N9OA 5DG2A 5GJ6A 3QACA 3ILNA 5FIXA 3IM0A 4S2FA 4CU6A 4YW6A 4UWDA 2VZ3A 2G19A 1FATA 4M00A 3I3MA 4GWJA 2VULA 2JDUA 1NT0A 2XWJB 2ZCWA 4EN9B 1W6NB 3ES1A 4MXWB 5DZEA 3S0MA 1VMJA 1UYZA 2R1DA 5FYUA 4YVSA 4UFIA 4Q4W2 4Q0SA 4BLJA 4BZ4A 4NO4A 1K42A 2YXSA 1VLNA 4UFJA 3LEGA 3WF0A 2JDZA 1CZTA 5F5IA 4QPIC 3OEBA 3ZYFA 4MZUA 4Z1VA 1PZ8A 5FZ8A 2PYTA 4KQ7A 5FPZA 3IIIA 3U1XA 4BMBA 1UXZA 2ZMKA 1PM4A 2IFRA 3U14A 1KGYA 1KQRA 1Y9GA 2XLGA 3M3IA 1WKYA 4P9LA 2VY0A 3I59A 4RHV1 4META 4NHYA 4D7YA 4DUXA 1D0HA 4H7LA 2RS12 2ZEYA 3GHNA 5LEJA 3LB9A 3NNMA 1MZ5A 5T52A 3UKTA 1A3KA 4BQ2A 1J1TA 3VDDA 2Z4FA 3NSTA 2WNUB 3BIEA 2KA3A 5JI9A 3WF4A 5FBJA 4EQVA 1VBE1 3KHBA 4LLOA 1S2BA 2B42B 3OD4A 1F4AA 1GQGA 1LODA 1PIV3 2J42A 2R062 4M3CB 2PHFA 4Q8LA 1GWLA 3VKMA 2GNTA 4EN0A 1H4GA 5ANNA 4FPCA 1HDKA 2WS93 3QBQA 4LOSA 5E1RA 1SPPB 4YW5A 2VZRA 3FN9A 2OQ6A 1DQ6A 5A3PA 4LXLA 1JTZX 2WO3A 4O61A 2WSUA 3M7AA 3Q8BA 3N35A 5A7SA 5JXIA 1K3IA 3JD73 5IVFA 4JDMA 4LEJA 1U12A 3UGHA 5HV0A 2UYBA 1NYWA 1TME1 2BUKA 3RMYA 5KR7A 5IATA 5JOZA 2DFBA 1HQLA 4P5HA 4Q4Y3 4ZU5A 2VUDA 2WINB 4C8DA 5FWJA 3FC0A 2XB6C 1YQ6A 2Y6JA 4YVSB 4ZZ5A 2PHDA 4RQPA 4ATFA 1PGW1 4UAPA 1RHI2 4N9IA 1RUE2 1OC1A 3VZJA 5DN2A 1RB8G 1RUJ1 4FI9A 5A6XA 1RVF1 2CSGA 1QH7A 4QQ2A 4LKEA 2ZAAA 2ZGKA 3PU3A 4GQ7A 4IEUA 4AQ2A 1AVBA 4PQ9A 1HQWA 3CL1A 2A3WA 3VBFC 1OF3A 1YQ5A 3POYA 4YNIA 4W6YA 3SITA 5T55A 2VOVA 3SMHA 1AUYA 1W0PA 3WW2A 4AYUA 4LPLA 1JN2P 1BKZA 2H0BA 1J3RA 2UY8A 1LGNA 2QQLA 3PVOA 4I0WB 4IV1A 2ILMA 3ILFA 1ENRA 1AR81 2AEZA 2XUEA 3I59B 2BQPA 4Y5SA 2XBO1 3RRDA 3NJZA 2RV9A 4CDXC 3OEAA 1HXS1 4FOVA 3FE5A 5JMOA 4A7YA 2PTMA 3AFGA 1WCDJ 2WFF2 1R092 1UY3A 1ZA4A 4BIFA 2WN2A 1ND2A 3VDDB 4NAOA 2D6MA 1R1A3 1U0AA 2D3SA 3CJIA 3CIHA 4ZXEA 1C8M2 1YNAA 3ZDSA 4I30A 4B7EA 1NQJA 2VUJA 1OT5A 3RYPA 3ZXKA 2BFUS 4HANA 2VQ0A 3I2IA 3VBUC 2HWF2 2L9LA 5A7QA 4DXZA 4GKYA 4RGKA 2DUQA 4HONA 4CCCA 1COV1 2J1AA 1MQTC 4Q0VA 4KU8A 4CEWA 2VCCA 5JXHA 4NUBA 2VH9A 4LK7A 3GHMA 2QE3A 4A41A 5AFEA 2EALA 4GULA 3T4VA 1AL23 1C57A 2ADEA 3JQWA 4MOAA 1H4HA 2YPJA 1W04A 1MZFA 4WM7C 5CKMA 1S2KA 3VD9A 2YFUA 3C7EA 3C7GA 5CKNA 3THDA 3HQUA 2DUPA 1W6QA 3T1MA 3IIAA 4IERA 4AZZA 4CCLA 4HSJA 2Y0IA 3RZKA 3HQXA 2BWCA 4I09A 3D8CA 5C4WA 4IE6A 2OIIA 4XABA 4RQPB 4ORFA 5FYSA 3LD8A 4L97A 4Q4X3 1G9FA 2J1SA 4TXWA 1IZ3A 2FZ2A 3FLTA 1RUF3 2PMWB 4PLMA 4CDWC 1XU2A 4PHZA 3ZPYA 2DVAA 4GALA 4P08A 4YFWA 4KU7A 4UBHA 2BRTA 4FPKA 3O1OA 4PIYA 3H8RA 1ULPA 3HN1A 3MFCA 4BQ5A 4XEZA 1A34A 4HPKA 1JHJA 1LOFC 4AE2A 4IV1B 4BQ1A 5FKCA 2VCMA 5J36A 3N7LA 3TEWA 1D0GA 2VCBA 1CR7A 1DBNA 1VRBA 2Y0OA 1VBA2 5CZKA 1YI9A 2YV8A 5T5LA 4COYA 2J1TA 2Q4SA 2FMDA 3TNQA 4LBLA 2VMHA 1QJX1 4RQPC 2MNGA 2LM3A 1GOGA 4MXVA 4P00B 4A44A 1ND2B 3IMMA 4YRDA 2B39A 3CJIB 2OYZA 3WDVA 1VBD3 3PJYA 2C9AA 3POIA 4LNVA 4YZ4A 1MZEA 3O0VA 1VB2A 2QQOA 2R16A 3VBHA 3G7DA 1BK0A 1BEV2 2ERFA 1QQP2 1PVC1 1WLDA 3GM8A 2OZJA 2NMNA 1D2QA 2VTFA 1J58A 4BPZA 4X6QB 1O4ZA 3I8TA 2NMOA 2ORXA 4P9WA 5CVRA 1UY4A 5LASA 2XDVA 1EV11 4CEWB 5FLIA 4JRLA 4LE3A 1EY2A 4FQZA 2XQXA 2WQ4A 4SLIA 5AVPA 3WNOA 4CA9A 3NAPC 3OTFA 2GH2A 2WZ8A 4TYSA 4XMIA 4OI1A 4QX0A 3SNMA 3TN92 1RITA 2R0FA 3KSCA 1GUIA 2EVXA 1AR93 5FK7A 3ST7A 3UKVA 1V6LA 4NPLA 1ZZ9A 2KM2A 4Q0UA 3M1HA 3NJYA 3ALQA 4AL9A 1W6QB 1FPN3 4OHZA 1MEC1 3CLPA 4WM8A 5EXOA 4W50A 1G6NA 1PGL2 2VW1A 3O0XA 3K3NA 4NAMA 1UY2A 4OCTA 1VR3A 3RPQA 1NCQC 5A3NA 1MS9A 4QQOA 4QQLA 5C4WB 3ZSJA 3B00A 4AHWA 3THCA 4XMAA 4CU9A 2Y8KA 3C3VA 3HNBM 3RYRA 3FJSA 4O9GA 3LEMA 1VRH1 2RS13 1OKOA 3WEZA 3OOXA 1DYOA 3B7MA 3UETA 3FHIB 2QKDA 3LSEA 2RVAA 5FUIA 1C1FA 4ASMB 3AL6A 4HPKB 3KVAA 3NNJA 2IXIA 3AL5A 3MPBA 2ZPXA 1G9CA 1AYN2 1JZ2A 3S6PA 3FZ3A 2O8QA 2P6HA 4LE4A 2PAKA 2K46A 3AB0A 4G3YC 1GOHA 1SLCA 4GXLA 4N53A 5C8CC 2D6PA 3IB3A 1MS0A 2YG0A 3IT8A 1FOD1 4OVEA 2BNOA 5M0TA 1HB2A 1LR5A 1LEMA 2HWE1 5EYXA 2VQAA 5IVJA 4S2GA 1R1ZA 2VNRA 4XUTA 5BNPC 5C3RA 4ISQA 4LOTA 1S0FA 5FMBA 4NWWA 3VBHB 2QQKA 3ON7A 3A23A 1IGOA 3I4IA 4LA3A 4KWLA 3SISA 2X5IA 3T1LA 5A7PA 4YGBA 1QJU2 2YC4A 1L7QA 2JEMA 5F5AA 4YM0A 2P34A 2BW8A 2BYVE 4PBPA 5FYCA 4GMP0 4AWDA 5GZDA 1CZVA 3WNLA 1QU0A 2JKXA 4AFDA 3LDRA 4XZUG 5DXDA 5BY5A 1SBEA 3WXPA 4KI5M 2MHFA 2XMLA 4XFGA 4AI9A 5GZEA 4XQWA 5A32A 3HMYA 5F3CA 1RHI3 2NP0A 4QXKA 3ZXAC 4WVVA 1X8EA 2HBTA 3B9CA 4G4FA 3HPNA 4ZS2A 2ZKNA 1DIWA 2ZGOA 2F17A 4MGIE 3LF7A 3ELNA 5HXMA 4WM8B 2BFUL 1O3TA 4FTSA 1ZM1A 3FBMA 3UJOA 1Q56A 2DWRA 1CPMA 4YGEA 1QJZA 2VMFA 3ZFEA 1D4M1 5FUNA 1V6NA 3SHRA 2JG8A 3KS7A 4K9SA 2IUWA 3VZKA 5C9AC 2VZPA 1WW7A 4HLTA 2WFF3 1R093 3PJQA 2SBAA 2R071 2R0HA 4FPYA 3CF6E 3BTYA 1WZXA 1AXYA 1DG6A 2GC2A 5KC5A 4RYDA 1C8M3 1OA4A 3PMSA 5H9QA 4IW3A 5L9BA 2WA3A 1OD5A 2D97A 2EA7A 5ANQA 1O6UA 5E8AA 4JC1A 3EQEA 1QJY1 2XKOA 4N53B 2QQMA 4YZ5A 5ACA2 5L9RA 2D6LX 1QY4A 4LBQA 2PXJA 5I91A 3Q8EA 1JYWA 1LESA 2HEVF 3POGA 2PQSA 5I0TA 5L9VA 1AR62 3LKJA 3OSDA 4BHPA 3U4SA 4AEKA 1ODNA 3E5QA 1WMDA 2ZAHA 2XONA 5T3NA 4PQQA 1CQ9A 5GLVA 1RL3A 3VDCA 1CIYA 3LAGA 3ZKUA 3JBG3 1GQPA 1PIV1 2A75A 1LHVA 2X5IB 4MSVA 3OYWA 4W8JA 4AI8A 3I97A 5FXXA 3I2OA 1NY71 4LBQD 4YG6A 5JOXA 1DDLA 3GBGA 3QH6A 3ZPOA 1CVNA 5FZ1A 1LOGA 1ENSA 2MPFA 3IAPA 4ZKTB 4NR1A 2V72A 5FOJB 4AF9A 2IZWA 4XJAA 1G8WA 3DN7A 3AJZA 2QQPA 5A32B 3UJQA 3OUJA 4MX3A 1E5HA 1KDMA 4OHVA 1UZZA 4QU1A 5EJZB 2RS52 4AEJA 5ERLA 4CU7A 4IL7A 2W95A 1RUG2 1OLMA 1ND3A 2P3IA 3DPRA 5E89A 4EV0A 2QBXA 2VNOA 4Q4Y1 1UU6A 1DZQA 1L3JA 2W39A 3KMHA 4INDA 5C71A 3FLPA 3MPPG 3L9JT 5L73A 5FZBA 3A22A 2Y6GA 1W6PA 3K3OA 3KVBA 3POWA 4PI0A 3BKZA 5LA0A 5FRAA 4AVBA 3K77A 3ZFEB 3WV6A 4Z8BA 5FTTC 4Y3OA 4BJ0A 2HWD1 4K7JA 2JG8B 1XNKA 5C33A 3VDAA 3BB6A 2A71A 2CWSA 4IE7A 4Y22A 4OHWA 5GLWA 1Q8SA 1V6IA 2BZDA 4Z07A 4JHZA 3H42B 2HYKA 3ZYPA 4CDUC 3S5AA 3FMGA 1RJ8A 1RUD3 1US3A 3ZN5A 1BEV3 4BQ4A 5L7OA 2VMCA 4B3NA 1H8TC 3RZMA 4QQHA 2R49A 1T2XA 1QOSA 3A4UA 2PN5A 4LBQB 5JWPA 5FR3A 5C8WA 1R1A1 4RFT0 4CP0A 3H1WA 1O5UA 1N3OA 1ACCA 3WY6A 2OQ7A 1XYOA 4Q4V1 2VJXA 3J7MA 5JI7A 3TN93 4HVOA 3OYWB 4FBFA 2H6BA 1TVGA 1HN1A 1ZBA1 1LB2A 4JGYC 1XYPA 3T0BA 2HJIA 4AHYA 4XIKA 4CCJA 1O3RA 1D7PM 1H2KA 1LHUA 3JB4C 1GFF2 4FPEA 3WG4A 4WVMA 1AL21 4RS5C 4WVWA 5IVVA 4CUCA 3V56A 5E16A 4LORA 5IK8A 2Z2SB 2EIDA 1TMF1 1DQ1A 3ZFFC 3FBYA 3LWCA 4XACA 1EUUA 3TYJA 5EJ1B 1W0NA 2E7TA 2XLFA 1O4YA 2WNOA 2YBPA 4QHZA 1ND3B 1AZDA 3DPRB 1V9U2 4P9XA 1H9WA 1CD3G 5FYVA 4D7SA 4UW4A 5FMOS 1UAIA 3NQHA 2PHUA 2W1UA 2ZGRA 1YQCA 2ZX3A 3NWKA 3HT1A 2WNVA 2I45A 4Q4X1 1W6PB 5A3TA 1RUF1 3BN6A 1AYN3 1PMIA 3J9SA 4ES8A 1XSRA 1YI7A 2CNAA 3RWKX 3VBSA 3GZUC 4PBOA 2QJVA 4FAHA 1EYBA 4Q26A 4GMP1 4BH9A 1CONA 3NW4A 4Y22B 1MR5A 1W8WA 2WYSA 3O5SA 3J8F1 4HSLA 4QPGC 3N7KA 1XYNA 3DF0A 4Q1PA 4YM1A 4I0BA 3VBRC 2DYCA 1OVPA 1RC6A 3HNMA 4FOWA 2BOJA 3DPRC 1ZRRA 2D6OX 3MI8A 5FLHA 1OOPC 4QHBA 1NAEA 2XOMA 2OPWA 4JGZA 3B5LB 4CVUA 3B93A 5IK4A 5L7OB 3OF1A 3DECA 1ULCA 1QJU3 4R8HA 4XF3A 3RDIA 3T4HB 2R042 1UY0A 2GH8A 2WS92 1HJGA 3ZXJA 2BNNA 3FFZA 3ITQA 3VDBA 3AKSA 4ARXA 5BNNA 3SH5A 2XJSA 4FOQA 2GMMA 4QB1A 3ZYBA 4FT8A 3H8OA 3HR9A 4UFMA 3AKTA 5F6KA 2RM22 4CXXA 3DGTA 3JD72 1UPIA 2W92A 2PHTA 1CPNA 2FQPA 1BJQA 1WBFA 4ZS3A 4XQ4A 1U5ZA 5IFPA 1YJKA 1H6YA 2WC2A 4TZDA 2OVUA 1ZZCA 4WVMB 1X9PA 1XE0A 2B5HA 2JDNA 2PELA 1ASJ2 5K0UC 4Q4W1 2NN8A 2XUMA 1LHWA 2NLRA 3ATGA 5EQUA 2YZ4A 4UFHA 1AX0A 1NOVA 1WA4A 3WG3A 1BXHA 3ZOIA 4CP9A 3U07A 1VALA 2VTXA 5JIAA 3I2FA 1DGRA 4E4DX 1MVQA 4OUMA 3T2PA 1WLTA 3WW1A 3P5BA 2W52A 1H30A 5A7OA 3W5MA 3I3DA 5DDJ2 3SC7X 1W39A 1XNCA 3OY8A 1B09A 5D8AA 4EN8B 2WNVB 5I93A 4OHYA 4XJ9A 1AYM3 1UKGA 2GP5A 2RS11 5KXEA 5EHDA 3VBSB 3QH7A 5FXZA 1URXA 5ACA3 5C3QA 1W9YA 4FVVA 1YFWA 5T5OA 2A7AA 3H1YA 3CMGA 4XBNA 1R082 1U5YA 1C8NA 3WNPA 2JKBA 1AR63 4KWUA 1OD3A 3ZSLA 2GC1A 4L9BA 5LRSA 1IS6A 2ZS6B 4JGZB 2WT1A 4CPBA 4PIZA 4QX5A 1YLLA 4OI4A 3EHKA 2R061 3JUUA 2XLAA 3PVEA 4E4ZA 4P9IA 1WCSA 2UWCA 3KF5A 4Q2FA 2B7YA 2E33A 1IQAA 3NNGA 4CCMA 4Q5OA 2WT2A 5ABJA 4IV3A 3CDZB 1BHGA 1IKQA 5APAA 2C4XA 1ONAA 4TLGA 4CUAA 5BNNB 5DUVA 2AUYA 4CPBD 3JXSA 3N7MA 2C1FA 5JIUA 3UK9A 3AM2A 3FLRA 1X82A 4A7KA 3LPFA 2CDOA 3ACIA 3GJBA 4IGPA 2EXKA 5LA2A 1HRV3 2ZKLA 1KFUL 3PUAA 1RUG3 4YM3A 5AFBA 1ZNPA 1WCKA 2ZMNA 3O1SA 5CFDC 2W08A 5GZFA 1QXPA 1OPOA 4AEMA 1JUHA 1IG3A 2ZZJA 1AXKA 1JBCA 2GNDA 4K6BA 4JKKA 3PUIA 3WHTA 1UW8A 1UO9A 2I2SA 1WLCA 3TEYA 1NQDA 1RHI1 4QWNA 1RUE1 4CP9B 1HX6A 2JB4A 3GALA 3USSA 3NV3A 5FXVA 1W2NA 2ZX1A 2MEV3 5FZEA 2D5FA 4DS0A 3ZSMA 5CU1A 4GA9A
chains in the Genus database with same CATH topology
3C7HA 1JZ7A 1OT5A 3IAQA 4QX2A 3WQBA 3WNMA 3LEKA 1SDDB 3I2IA 3I2GA 4A6OA 2L9LA 2VZQA 2ZEWA 4Z2AA 2EIEA 2J1AA 4QDRA 1XNTA 3LQCA 2VCCA 3WF3A 5JXHA 5JUVA 4A41A 5A1AA 2J22A 2JDAA 2LW8A 3GGLA 2DCJA 4MOAA 3VD4A 4PF1A 3BGAA 3VD9A 2YFUA 1NUKA 3C7EA 3C7GA 3THDA 3T09A 3ETPA 2WO1A 5JXGA 3VD7A 3OBAA 3DYPA 3IDAA 3OGRA 2J1SA 4TXWA 2VZ1A 2VMDA 2W87A 2LS6A 3ZM8A 5G05L 2QQIA 4P08A 4PT6A 3FL7A 3E1F1 1PX3A 1ULPA 2VZVA 1JHJA 4OMDA 1W9SA 2VCAA 4P02B 4AAXA 1UWWA 2VCBA 5CZKA 2J1TA 4LKSA 4XUOA 4L0PA 2W5FA 1GOGA 4P00B 4A44A 4LHSA 2VL4A 4A4AA 2HLEA 2QQOA 5F7UA 2W46A 4OYUA 3GM8A 2W47A 3VD5A 3MBWA 2VTFA 2WQ8A 2ORXA 1UY4A 3VD3A 1JYNA 1XNAA 1UYXA 2XQXA 4JKLA 3WNOA 2WZ8A 4MGQA 4QX0A 2VQTA 1GUIA 4ET7A 2V5DA 4XUQA 3P1IA 2J1EA 3K4ZA 4XUNA 1W99A 2RJ2A 4W50A 1O59A 4QX1A 3K46A 2C26A 1RYYA 1UY2A 4DUVA 1H6XA 3OB8A 4GWIA 3THCA 4CU9A 2Y8KA 4ZY9A 3HNBM 1JZ3A 3WEZA 1DYOA 3LEIA 3UETA 3NJVA 1UMIA 4XUPA 2BGOA 2RVAA 5FUIA 3C7OA 2VO5A 4RN5A 1JZ6A 3OGVA 5DQ0A 4YPJA 2BERA 3UESA 3WF1A 3I3EA 1JZ2A 3WNNA 3OGSA 2DCKA 2W9XA 1GOHA 1US2A 3IB3A 2YG0A 3K4AA 4QB2A 1DP0A 1K45A 3FHAA 4LQRA 5JR2A 2E31A 4XUTA 1O8SA 3SEEA 4UOJA 5B4NA 3MO4A 1SG3A 2QQKA 3A23A 3C8XA 3GDBA 3HJRA 1OH4A 2YC4A 1L7QA 3FHQA 1F4HA 1JZ8A 3DYOA 3DYMA 1TG7A 1CX1A 3WNLA 1CZVA 2JKXA 2Y6HA 3J7HA 3OG2A 4IUGA 4XZUG 4KI5M 4QB6A 3UNPA 2VZTA 4ARYA 2W91A 4DEVA 1OF4A 1W9WA 2BBAA 5JXJA 3C7FA 3ECQA 3SKJE 2R7EB 4BK5A 1K12A 3HPNA 3HEIA 5HXMA 1IQDC 1CZSA 2VZOA 2YB7A 2QQJA 4P5YA 2J1UA 3F2ZA 2WO2A 1GNYA 2VMFA 2X09A 2X05A 2E26A 2VZPA 3LE0A 2VR4A 1JU3A 4XURA 3MUZ1 4RYDA 3SEPA 4MGSA 1W8OA 5IHRA 2VMEA 1XC6A 3MUY1 2VC9A 3CZUA 2QQMA 1PMJX 4DXTA 2Y6KA 1JU4A 2QQNA 2WUHA 2DDUA 1JYWA 1JYXA 2PQSA 1NX9A 2W94A 2XONA 1DLCA 4PQQA 3AC0A 1GOFA 4HG6B 3VDCA 1CIYA 4BXSV 4CUBA 1GQPA 1W9TA 4W8JA 1J84A 4OUEA 3I97A 1W8NA 3NJXA 2WABA 1I5PA 1GMMA 3IAPA 1NKGA 4DUWA 4DEQA 2V72A 2J1VA 3P6BA 1UXXX 1JYVA 2Y6LA 4CU7A 5EJZB 3SKVA 2C9KA 4AG4A 3I2HA 2W95A 5IFTA 3K75B 2WAAA 2QBXA 1L7RA 3ACHA 5LCWL 5C71A 4MO3M 4W4ZA 3A22A 2Y6GA 3EYPA 4ZZ8A 5LA0A 2WZEA 1GU3A 4E8DA 3K77A 4KMQA 1JZ5A 4BJ0A 1MPXA 2EIBA 3W5NA 3VDAA 5J1XA 5EIYB 4DXSA 4JKMA 2VM9A 2JE8A 3U37A 4BDVB 1O8PA 5DPNA 3I2KA 2BZDA 2EICA 3T2QA 4JHZA 1P8JA 1US3A 5HPOA 2ORZA 2VMCA 1T2XA 2VZSA 5CYYA 4A3ZA 5IJRA 2WAOA 3MV11 1JI6A 2XHNA 2J1RA 4MADA 4OZOA 3WSOA 5LA1A 2ZEZA 4QX3A 2VJXA 4GZ9A 3T0DA 1PMHX 4A42A 2B4KA 2ZXQA 1TVGA 1HN1A 5G04L 3T0BA 2W3JA 1D7PM 4M4PA 3HN3A 3NRUA 2OKXA 4D0QA 1J83A 3LPGA 4CUCA 3HOBA 2EIDA 5C7GA 3I3BA 3PUHA 1EUUA 5EJ1B 1LNSA 1W0NA 2ZEXA 2WDBA 4QDQA 5IYYA 4QDSA 1PX4A 5C70A 3T2OA 4BK4A 3NQHA 4TTGA 2WBKA 2W1UA 2E32A 1SHWB 3T08A 2W1SA 2WN3A 4A45A 3I2JA 3BN6A 3CZJA 3MV01 2W1WA 3WF2A 2WYSA 4JX0A 5B4XA 1UZ0A 2B9VA 3HNMA 1NAEA 2XOMA 4CVUA 2BGPA 3DECA 4CU6A 1WCQA 2VZ3A 3HNYM 4GWJA 1KEXA 1UY0A 3VDBA 1UYZA 3T0AA 2J7MA 4ARXA 3GXUA 1K42A 2VQUA 3LEGA 4QB1A 3WF0A 1CZTA 2Y64A 3A21A 3OEBA 2W1QA 2W92A 5IFPA 1UYYA 3IIIA 1UXZA 1UX7A 1H6YA 2VZUA 1KGYA 1WKYA 1UMHA 4DUXA 4OMCA 3WNKA 2ZEYA 2YFZA 3I2FA 2Z4FA 3T2PA 3WF4A 3W5MA 3I3DA 4XVHA 1XPWA 1F4AA 2YC2A 3A7QA 1ULOA 2VZRA 3FN9A 3CMGA 4E8CA 1YQ2A 3WNPA 4KWUA 1OD3A 2WO3A 5JXIA 1UY1A 1K3IA 2JD9A 5DMYA 2E33A 3NNGA 1JZ4A 2CDPA 2Y6JA 3CKHA 3CQOA 3CDZB 1BHGA 4CUAA 4ZZ5A 2C4XA 1R64A 2X10A 4D8MA 4UAPA 3EB7A 2KD7A 4UI9L 3JXSA 5DN2A 2HYXA 4FI9A 4QAWA 3ABZA 2CDOA 3ACGA 3ACIA 3LPFA 4M4RA 2VOTA 5LA2A 2ID4A 1OF3A 4LPLA 2V4VA 2QQLA 4CU8A 4JKKA 3PUIA 3K4DA 2RV9A 3OEAA 5JMOA 4DXRA 4QPWA 1UY3A 2WN2A 3ACFA 3D3AA 3CIHA 4ZXEA 5I0DA 1EUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C7H A;  1JZ7 A;  1OT5 A;  3IAQ A;  4QX2 A;  3WQB A;  3WNM A;  3LEK A;  1SDD B;  3I2I A;  3I2G A;  4A6O A;  2L9L A;  2VZQ A;  2ZEW A;  4Z2A A;  2EIE A;  2J1A A;  4QDR A;  1XNT A;  3LQC A;  2VCC A;  3WF3 A;  5JXH A;  5JUV A;  4A41 A;  5A1A A;  2J22 A;  2JDA A;  2LW8 A;  3GGL A;  2DCJ A;  4MOA A;  3VD4 A;  4PF1 A;  3BGA A;  3VD9 A;  2YFU A;  1NUK A;  3C7E A;  3C7G A;  3THD A;  3T09 A;  3ETP A;  2WO1 A;  5JXG A;  3VD7 A;  3OBA A;  3DYP A;  3IDA A;  3OGR A;  2J1S A;  4TXW A;  2VZ1 A;  2VMD A;  2W87 A;  2LS6 A;  3ZM8 A;  5G05 L;  2QQI A;  4P08 A;  4PT6 A;  3FL7 A;  3E1F 1;  1PX3 A;  1ULP A;  2VZV A;  1JHJ A;  4OMD A;  1W9S A;  2VCA A;  4P02 B;  4AAX A;  1UWW A;  2VCB A;  5CZK A;  2J1T A;  4LKS A;  4XUO A;  4L0P A;  2W5F A;  1GOG A;  4P00 B;  4A44 A;  4LHS A;  2VL4 A;  4A4A A;  2HLE A;  2QQO A;  5F7U A;  2W46 A;  4OYU A;  3GM8 A;  2W47 A;  3VD5 A;  3MBW A;  2VTF A;  2WQ8 A;  2ORX A;  1UY4 A;  3VD3 A;  1JYN A;  1XNA A;  1UYX A;  2XQX A;  4JKL A;  3WNO A;  2WZ8 A;  4MGQ A;  4QX0 A;  2VQT A;  1GUI A;  4ET7 A;  2V5D A;  4XUQ A;  3P1I A;  2J1E A;  3K4Z A;  4XUN A;  1W99 A;  2RJ2 A;  4W50 A;  1O59 A;  4QX1 A;  3K46 A;  2C26 A;  1RYY A;  1UY2 A;  4DUV A;  1H6X A;  3OB8 A;  4GWI A;  3THC A;  4CU9 A;  2Y8K A;  4ZY9 A;  3HNB M;  1JZ3 A;  3WEZ A;  1DYO A;  3LEI A;  3UET A;  3NJV A;  1UMI A;  4XUP A;  2BGO A;  2RVA A;  5FUI A;  3C7O A;  2VO5 A;  4RN5 A;  1JZ6 A;  3OGV A;  5DQ0 A;  4YPJ A;  2BER A;  3UES A;  3WF1 A;  3I3E A;  1JZ2 A;  3WNN A;  3OGS A;  2DCK A;  2W9X A;  1GOH A;  1US2 A;  3IB3 A;  2YG0 A;  3K4A A;  4QB2 A;  1DP0 A;  1K45 A;  3FHA A;  4LQR A;  5JR2 A;  2E31 A;  4XUT A;  1O8S A;  3SEE A;  4UOJ A;  5B4N A;  3MO4 A;  1SG3 A;  2QQK A;  3A23 A;  3C8X A;  3GDB A;  3HJR A;  1OH4 A;  2YC4 A;  1L7Q A;  3FHQ A;  1F4H A;  1JZ8 A;  3DYO A;  3DYM A;  1TG7 A;  1CX1 A;  3WNL A;  1CZV A;  2JKX A;  2Y6H A;  3J7H A;  3OG2 A;  4IUG A;  4XZU G;  4KI5 M;  4QB6 A;  3UNP A;  2VZT A;  4ARY A;  2W91 A;  4DEV A;  1OF4 A;  1W9W A;  2BBA A;  5JXJ A;  3C7F A;  3ECQ A;  3SKJ E;  2R7E B;  4BK5 A;  1K12 A;  3HPN A;  3HEI A;  5HXM A;  1IQD C;  1CZS A;  2VZO A;  2YB7 A;  2QQJ A;  4P5Y A;  2J1U A;  3F2Z A;  2WO2 A;  1GNY A;  2VMF A;  2X09 A;  2X05 A;  2E26 A;  2VZP A;  3LE0 A;  2VR4 A;  1JU3 A;  4XUR A;  3MUZ 1;  4RYD A;  3SEP A;  4MGS A;  1W8O A;  5IHR A;  2VME A;  1XC6 A;  3MUY 1;  2VC9 A;  3CZU A;  2QQM A;  1PMJ X;  4DXT A;  2Y6K A;  1JU4 A;  2QQN A;  2WUH A;  2DDU A;  1JYW A;  1JYX A;  2PQS A;  1NX9 A;  2W94 A;  2XON A;  1DLC A;  4PQQ A;  3AC0 A;  1GOF A;  4HG6 B;  3VDC A;  1CIY A;  4BXS V;  4CUB A;  1GQP A;  1W9T A;  4W8J A;  1J84 A;  4OUE A;  3I97 A;  1W8N A;  3NJX A;  2WAB A;  1I5P A;  1GMM A;  3IAP A;  1NKG A;  4DUW A;  4DEQ A;  2V72 A;  2J1V A;  3P6B A;  1UXX X;  1JYV A;  2Y6L A;  4CU7 A;  5EJZ B;  3SKV A;  2C9K A;  4AG4 A;  3I2H A;  2W95 A;  5IFT A;  3K75 B;  2WAA A;  2QBX A;  1L7R A;  3ACH A;  5LCW L;  5C71 A;  4MO3 M;  4W4Z A;  3A22 A;  2Y6G A;  3EYP A;  4ZZ8 A;  5LA0 A;  2WZE A;  1GU3 A;  4E8D A;  3K77 A;  4KMQ A;  1JZ5 A;  4BJ0 A;  1MPX A;  2EIB A;  3W5N A;  3VDA A;  5J1X A;  5EIY B;  4DXS A;  4JKM A;  2VM9 A;  2JE8 A;  3U37 A;  4BDV B;  1O8P A;  5DPN A;  3I2K A;  2BZD A;  2EIC A;  3T2Q A;  4JHZ A;  1P8J A;  1US3 A;  5HPO A;  2ORZ A;  2VMC A;  1T2X A;  2VZS A;  5CYY A;  4A3Z A;  5IJR A;  2WAO A;  3MV1 1;  1JI6 A;  2XHN A;  2J1R A;  4MAD A;  4OZO A;  3WSO A;  5LA1 A;  2ZEZ A;  4QX3 A;  2VJX A;  4GZ9 A;  3T0D A;  1PMH X;  4A42 A;  2B4K A;  2ZXQ A;  1TVG A;  1HN1 A;  5G04 L;  3T0B A;  2W3J A;  1D7P M;  4M4P A;  3HN3 A;  3NRU A;  2OKX A;  4D0Q A;  1J83 A;  3LPG A;  4CUC A;  3HOB A;  2EID A;  5C7G A;  3I3B A;  3PUH A;  1EUU A;  5EJ1 B;  1LNS A;  1W0N A;  2ZEX A;  2WDB A;  4QDQ A;  5IYY A;  4QDS A;  1PX4 A;  5C70 A;  3T2O A;  4BK4 A;  3NQH A;  4TTG A;  2WBK A;  2W1U A;  2E32 A;  1SHW B;  3T08 A;  2W1S A;  2WN3 A;  4A45 A;  3I2J A;  3BN6 A;  3CZJ A;  3MV0 1;  2W1W A;  3WF2 A;  2WYS A;  4JX0 A;  5B4X A;  1UZ0 A;  2B9V A;  3HNM A;  1NAE A;  2XOM A;  4CVU A;  2BGP A;  3DEC A;  4CU6 A;  1WCQ A;  2VZ3 A;  3HNY M;  4GWJ A;  1KEX A;  1UY0 A;  3VDB A;  1UYZ A;  3T0A A;  2J7M A;  4ARX A;  3GXU A;  1K42 A;  2VQU A;  3LEG A;  4QB1 A;  3WF0 A;  1CZT A;  2Y64 A;  3A21 A;  3OEB A;  2W1Q A;  2W92 A;  5IFP A;  1UYY A;  3III A;  1UXZ A;  1UX7 A;  1H6Y A;  2VZU A;  1KGY A;  1WKY A;  1UMH A;  4DUX A;  4OMC A;  3WNK A;  2ZEY A;  2YFZ A;  3I2F A;  2Z4F A;  3T2P A;  3WF4 A;  3W5M A;  3I3D A;  4XVH A;  1XPW A;  1F4A A;  2YC2 A;  3A7Q A;  1ULO A;  2VZR A;  3FN9 A;  3CMG A;  4E8C A;  1YQ2 A;  3WNP A;  4KWU A;  1OD3 A;  2WO3 A;  5JXI A;  1UY1 A;  1K3I A;  2JD9 A;  5DMY A;  2E33 A;  3NNG A;  1JZ4 A;  2CDP A;  2Y6J A;  3CKH A;  3CQO A;  3CDZ B;  1BHG A;  4CUA A;  4ZZ5 A;  2C4X A;  1R64 A;  2X10 A;  4D8M A;  4UAP A;  3EB7 A;  2KD7 A;  4UI9 L;  3JXS A;  5DN2 A;  2HYX A;  4FI9 A;  4QAW A;  3ABZ A;  2CDO A;  3ACG A;  3ACI A;  3LPF A;  4M4R A;  2VOT A;  5LA2 A;  2ID4 A;  1OF3 A;  4LPL A;  2V4V A;  2QQL A;  4CU8 A;  4JKK A;  3PUI A;  3K4D A;  2RV9 A;  3OEA A;  5JMO A;  4DXR A;  4QPW A;  1UY3 A;  2WN2 A;  3ACF A;  3D3A A;  3CIH A;  4ZXE A;  5I0D A;  1EUT A; 
#chains in the Genus database with same CATH topology
 3C7H A;  2AEN A;  1RUC 2;  2LRO A;  2Q1F A;  3IAQ A;  3OY8 B;  4Q0Q A;  2XVL A;  3PDQ A;  4QX2 A;  4XAE A;  5D8A B;  3W21 A;  4CEY C;  3SLI A;  4N43 C;  3D6E A;  4QT6 A;  5JAX A;  3TAY A;  2IXK A;  1RUI 2;  4GH4 C;  1K5J A;  2WFF 1;  1R09 1;  1RUH 2;  1XNT A;  1ZYB A;  4HKO A;  4UW6 A;  1W6O A;  4FFF A;  2Q30 A;  5DAP A;  3EJK A;  4TWT A;  4AVC A;  2IC1 A;  5A1A A;  5FOB B;  1G9A A;  5FYT A;  1C8M 1;  1VBD 2;  2XJQ A;  4H14 A;  1POV 3;  1XQN A;  4XXP A;  4BA6 A;  5K8S A;  4YZ2 A;  4CXW A;  3VD4 A;  2VAU A;  3MFA A;  3VGI A;  5A70 A;  1TZO A;  2DVB A;  2HWF 1;  2RHP A;  3BGA A;  2ZZQ A;  3AP5 A;  5FMO L;  3T09 A;  3HBZ A;  3L2Y A;  5CFC A;  2OA2 A;  2IVI B;  1JW6 A;  2DF7 A;  5FZL A;  4CRQ A;  5ABJ B;  1LKN A;  4OQ8 A;  4IV3 B;  3U10 A;  1CAV A;  4K20 A;  1X9T A;  3OGR A;  4CP2 A;  1IOA A;  2VZ1 A;  3AMP A;  2W87 A;  3ZKY A;  4OUS A;  1AR9 2;  5G05 L;  3VL8 A;  3ZFG C;  4D6S A;  3ETQ A;  1BVP 1;  3FL7 A;  4NRO A;  4BME A;  1D4V B;  2VG9 A;  4YVW A;  4OQ9 A;  1PX3 A;  2RMU 3;  1GWM A;  3PNA A;  3RZZ A;  1FPN 2;  4CE8 A;  3H8X A;  1V9U 3;  2O8O A;  4RD7 A;  3SXW A;  4P02 B;  2DFC A;  1DU3 D;  1NZC A;  1JOD A;  1OLR A;  5B2G B;  3OCP A;  4E2G A;  1CGP A;  4KBB A;  5CG8 A;  4XTM A;  1H2L A;  3K51 A;  5FZA A;  3VZL A;  4L0P A;  4IV3 C;  5A7W A;  3P3N A;  3BTA A;  2JE7 A;  1I9R A;  3UL2 A;  1Y9M A;  2VL4 A;  4LHS A;  4CCN A;  2ZHM A;  4A4A A;  2UU8 A;  3R6S A;  3GBW A;  3HVD A;  5FAX A;  4D69 A;  1YUD A;  1YIF A;  1VMH A;  4BB3 A;  1F31 A;  1V6K A;  2W47 A;  4XFI A;  1VBA 1;  2VUC A;  2W0X A;  4MGZ E;  1UYP A;  2ARE A;  1QEX A;  2JG9 A;  2RR1 2;  2WQ8 A;  3H3L A;  3VD3 A;  1QH6 A;  5F1R A;  2JXA A;  4UT5 A;  1S55 A;  4Y24 A;  1CJP A;  1FX5 A;  1W6O B;  1XNA A;  2TBV A;  3AMH A;  2R04 3;  5LBB A;  3RYK A;  1JYC A;  4BQW A;  4JKL A;  5A6Q A;  1RIN A;  1QJE A;  1WBL A;  1EPZ A;  4OHX A;  5FYM A;  4AXO A;  1OBN A;  4AED A;  1BEV 1;  2VQT A;  3T3Y A;  1QQP 1;  1LHO A;  1VE0 A;  4H55 A;  3I3Q A;  1IS4 A;  2RS3 3;  4XUQ A;  1HB1 A;  2WNU C;  5IT6 A;  1F2N A;  5FY0 A;  3KCC A;  4OUL A;  1JHN A;  2RM2 3;  1REE A;  4LLF A;  4DPN A;  2D5H A;  5CFC B;  4QX1 A;  2XVK A;  3K46 A;  1UQX A;  3WDU A;  5IVB A;  5A33 A;  1BVV A;  2V5Y A;  2BGC A;  1CAV B;  2ZTN A;  3OB8 A;  4IEP A;  2GDF A;  1NLS A;  5DUU A;  5BUV A;  1ASJ 3;  1DGR N;  1Y3T A;  1Q8V A;  4O7X A;  2VU9 A;  4UW5 A;  5DZF A;  3TN9 1;  5A6Y A;  5JZG A;  4FFG A;  2OW4 A;  3AKR A;  4XET A;  1Y43 B;  1TQ5 A;  4YVW B;  5JSP A;  4AVA A;  3KV9 A;  3T2T A;  4OI2 A;  4ZU4 A;  1G9B A;  1KS5 A;  2Z79 A;  3EO6 A;  1PGL 1;  4HK8 A;  1JZ6 A;  1SLB A;  3OGV A;  3URF A;  1E57 A;  2A6V A;  5DDJ 3;  4O65 A;  3PME A;  3TEZ A;  3FFQ A;  4XJ8 A;  3CJX A;  3ZIX A;  3RSJ A;  2QFE A;  2DCK A;  1RJ7 A;  2W9X A;  3LA3 A;  4ZPI A;  4R4Z A;  1US2 A;  2JJ6 A;  5A7W B;  2XKP A;  5LB6 A;  4NII A;  4YAR A;  2JDK A;  4NE9 A;  3VKO A;  1DP0 A;  3LIG A;  4UF0 A;  4YVS C;  3CU7 A;  1LOC A;  1S2E A;  3NKG A;  2HWC 2;  3WR0 A;  5AC9 2;  1YQ8 A;  2P1B A;  3HQR A;  1R08 3;  4UOJ A;  4Y5T A;  3MO4 A;  5FKB A;  2CGN A;  5LBF A;  1LGC A;  4J6G A;  3BUC A;  1AYN 1;  1CAW A;  2VPV A;  5J37 A;  1OH4 A;  1OSG A;  1YRZ A;  2JG9 B;  1W28 A;  1IPS A;  3FHQ A;  2YBK A;  5A7N A;  3DYM A;  1TG7 A;  2Y6H A;  4AI1 A;  1OXC A;  4IEX A;  1Z7S 2;  4M01 A;  4IUG A;  1QXJ A;  2Y38 A;  3MW4 A;  4N9H A;  4O9E A;  4Y1Z A;  4QB6 A;  3UNP A;  3MZH A;  2W91 A;  3OBR A;  2P3J A;  4GWN A;  4K21 A;  1XU1 A;  4GJY A;  4AED B;  4FAG A;  3VDD C;  3JBG 2;  4CCE A;  2R7E B;  3V0A A;  4BK5 A;  4C0B A;  4E2Q A;  2JIG A;  1QJU 1;  1VAK A;  2CY6 A;  4R9C A;  1GP5 A;  3WDX A;  3AP6 A;  4Z2W A;  1SEF A;  4XC9 A;  1WW5 A;  5IUQ A;  5LY2 A;  3RFR A;  2TNF A;  4ZHN A;  1NCR A;  5FJH A;  4PJY A;  2PQQ A;  1IQD C;  1N1T A;  5IK7 A;  4C1W A;  5A33 B;  2QQJ A;  3KM5 A;  4J1W A;  2J1U A;  2ZA9 A;  4XFH A;  4L92 A;  5FCC A;  2WO2 A;  1I3H A;  5K7P A;  1V6M A;  1DYP A;  4GJZ A;  4SBV A;  2FMY A;  3NKT A;  5JZG B;  3N9Q A;  1CES A;  3O1T A;  1GKB A;  1S0C A;  2E26 A;  1LEC A;  4XDO A;  4AED C;  2XGX A;  3U78 A;  1JU3 A;  5FZG A;  4XFA A;  5HI0 A;  4XUR A;  1WD3 A;  3MUZ 1;  4JZR A;  3M70 A;  3SEP A;  3VKL A;  1QIQ A;  3E5U A;  3VHP A;  4M3C F;  1W8O A;  5FRE A;  5IHR A;  1PO1 3;  1XNB A;  1RUC 3;  1WMX A;  2XR4 A;  1C1L A;  2WWU A;  3GCW A;  4GKX A;  4YW7 A;  5FZC A;  2P3K A;  2Q0A A;  2A5Z A;  5KHJ A;  1JU4 A;  2QNK A;  1RUI 3;  2DDU A;  2QQN A;  3IWZ A;  3VZM A;  4UF0 B;  5KC6 A;  1LU2 A;  3RVH A;  1JYX A;  1IPJ A;  1RUH 3;  4LKF A;  1KIT A;  5FK8 A;  4V2W A;  5FYH A;  3AP9 A;  3AC0 A;  1GOF A;  5D1I A;  5FJK A;  4ZU7 A;  2EXI A;  3M2M A;  2RE9 A;  5D2A A;  4CUB A;  1RUD 2;  1SBF A;  3NVC A;  4COZ A;  1CAW B;  5A3O A;  2DV9 A;  4Y20 A;  2BWA A;  1XND A;  4GAZ A;  5ACA 1;  1UMZ A;  2WAB A;  4IV1 C;  5C5T A;  1I5P A;  2W2I A;  4B4P A;  1NKG A;  3UT0 A;  5I8Y A;  1SAC A;  2X29 A;  4DEQ A;  3VV1 A;  1AR6 1;  2E51 A;  2Q8E A;  2DBI A;  1A8D A;  2QCS B;  4M0H A;  3RI8 A;  3MEP A;  4DB5 A;  3RZL A;  1MS5 A;  1HRI 2;  3N3H A;  3ZDV A;  2Q5T A;  4H3W A;  3BAL A;  1ND2 C;  2B9U A;  1PGS A;  3PLQ A;  3WOG A;  2QTW B;  3Q8A A;  3I2H A;  4LBK A;  3CJI C;  3V0A B;  4H2A A;  3MIE A;  1UF2 C;  3KQR A;  3WUD A;  2ZAB A;  3GYD A;  1NCR B;  3K48 A;  4YYO A;  2YBS A;  4QKN A;  4W4Z A;  1IHM A;  2CGO A;  1X50 A;  4LUL A;  1WD4 A;  4LKD A;  3VLB B;  4E8D A;  3HAG A;  3KD4 A;  3BI3 A;  2AC1 A;  5JVV A;  4B29 A;  1MS1 A;  1PZ9 A;  2WQZ C;  4CEW C;  3B02 A;  1LEN A;  1QWR A;  1JZ5 A;  3MHZ A;  3W5N A;  1F15 A;  1H2M A;  3ZX7 A;  2RS5 1;  3WD5 A;  4JKM A;  1W8F A;  1RUG 1;  2VM9 A;  1UZY A;  3IDC B;  4LT5 A;  1AX2 A;  4JAA A;  1O8P A;  5EFU A;  2QZ2 A;  1OFS A;  5DPN A;  3I2K A;  5FV3 A;  2OX0 A;  3T2Q A;  1KS4 A;  4DY5 A;  1S1A A;  4MHU A;  1AL0 G;  3O7O A;  1P8J A;  1WUV A;  4K8F A;  1HQN A;  1WLW A;  3IDE A;  1OHF A;  1SLT A;  2E63 A;  1GP6 A;  4PF5 A;  5HXV A;  3ZXF A;  5CYY A;  3KT7 A;  2RR1 3;  5C4W C;  2QVS B;  5IJR A;  3MV1 1;  3AVR A;  1RGS A;  2A6Y A;  4IDZ A;  5FWE A;  2EAA A;  4MYE A;  1LGB A;  4MAD A;  3WSO A;  5BXX A;  4XAA A;  2XJU A;  2ZAC A;  4LK6 A;  1N3P A;  3V64 A;  4PI2 A;  1SQ4 A;  2IXL A;  4HFS A;  1PMH X;  4CTE A;  4RGG A;  1QNW A;  4IGO A;  4Q29 A;  4Y20 B;  2BPA 2;  2OUH A;  2VOX A;  4LHK A;  4COV A;  3CEW A;  3AX4 A;  2AZ5 A;  4RR3 A;  1C5I A;  2XQR A;  2OKX A;  4OFG A;  1RXG A;  3TNP B;  1J83 A;  2XH6 A;  4YW1 A;  4D0Q A;  4AHZ A;  1W8T A;  3HOB A;  1NLR A;  1POQ A;  1VB4 A;  2HEY F;  3MIC A;  5C7G A;  4BM8 A;  3PUH A;  1UKR A;  1ZA7 A;  3M3E A;  2E6V A;  1E5R A;  2DUO A;  2E9Q A;  2IXC A;  4QMA A;  5EWS A;  3ENR A;  4MGY E;  1PO2 2;  2Q1M A;  3WQ1 A;  5BNO A;  2P3Y A;  5IYY A;  1ULG A;  5FY1 A;  1MS8 A;  1PX4 A;  3VBH C;  4BXF A;  3HWJ A;  4LO7 A;  1H8V A;  4OLL A;  1WA6 X;  5GLT A;  4TTG A;  2WFP A;  2R6Q A;  4YW3 A;  4QD2 A;  3T08 A;  2WN3 A;  5T5J A;  4GD4 A;  1CAX A;  3H0O A;  5GLZ A;  1OQE A;  4HVR A;  5AVA A;  3DUI A;  2EIG A;  3H8U A;  4QM8 A;  1UL9 A;  4I3P A;  3MV0 1;  5E6H A;  1KRI A;  4N7I A;  2F4L A;  2W1W A;  5CAD A;  1BMV 2;  3I54 A;  1ZBE 2;  1V9U 1;  4JX0 A;  3MDP A;  4Y5Z 0;  5B4X A;  2HWC 3;  5AC9 3;  1MVE A;  2ADD A;  5BNQ A;  5DUW A;  2XG3 A;  2CGP A;  5JDB A;  2PFW A;  4LBM A;  2QUO A;  3KQ4 B;  3POB A;  4FFH A;  4XIL A;  5FZM A;  5KHK A;  4WM8 C;  1AYM 2;  4YG0 A;  3HNY M;  2RJK A;  4LIU A;  1YHF A;  3PTR B;  3OGG A;  4HVQ A;  1SZB A;  2LUW A;  4QX8 A;  2UUR A;  3T0A A;  1GZC A;  3ZSE A;  4B8E A;  1Z7S 3;  3OPW A;  1YJL A;  1E5S A;  5FPB A;  1VIW B;  2G9F A;  2VQU A;  3PUS A;  4X8N A;  4BE3 A;  2Y64 A;  5H9S A;  1EAH 3;  2A6X A;  1W2T A;  3ZYJ B;  4XE9 A;  2DVF A;  1U5I A;  1UYY A;  3FUO A;  4MUV A;  2JIJ A;  2K0G A;  3MW2 A;  3QOP A;  3UGG A;  2R04 1;  4RR3 B;  2WS9 1;  3X29 B;  2FDK A;  5F37 A;  3PU8 A;  2XHK A;  4H7M A;  1ZRD A;  5FLJ A;  4N53 C;  2ZML A;  1UMH A;  4COU A;  1STM A;  3ILR A;  4OMC A;  1IKP A;  4AVS A;  3DEM A;  4CP1 A;  3PVN A;  3WHU A;  4OZX A;  3CBN A;  2ET7 A;  2RM2 1;  2BOI A;  2XJR A;  3JD7 1;  4FO9 A;  5BNO B;  1W2U A;  1XSQ A;  1Z0H A;  1HRV 2;  1DLL A;  2I07 B;  2DU1 A;  4ATE A;  3R4S A;  2D3P A;  2X5I C;  5F3I A;  3O14 A;  3ME2 A;  4P14 A;  4D6Q A;  5F2S A;  2GNB A;  4DMI A;  1ASJ 1;  2A6W A;  3A0K A;  4LJH A;  5LBE A;  4CCK A;  1ZZ7 A;  1CAX B;  1F5J A;  1TEI A;  3POF A;  2DU0 A;  3PVB B;  2YC2 A;  2TEP A;  4B1L A;  2VOW A;  4BQ3 A;  2CAV A;  4QKB A;  3HD8 B;  4FXG B;  4R4X A;  1AJO A;  1YO8 A;  5CEH A;  1UU5 A;  5FY8 A;  5FZF A;  3UYJ A;  1W8Z A;  2GC3 A;  1W8H A;  2MEV 2;  5LRR A;  4AFA A;  5DDJ 1;  3HT2 A;  1UZW A;  4YW2 A;  5EP9 A;  3AXD A;  2YU1 A;  4NRM A;  1BQP A;  1RMU 2;  2FD8 A;  2VVE A;  3AMN A;  5FY7 A;  3DKW A;  4YZ1 A;  2R30 A;  2RDS A;  4Y33 A;  3AYA A;  1XJA A;  2JD9 A;  3LGR A;  3O1V A;  3AXE A;  5KHG A;  3KHC A;  4KH9 A;  1L7L A;  1VBE 3;  2CDP A;  2UYA A;  3CQO A;  3ZFE C;  4LO8 A;  3GZT B;  3KB5 A;  4LBO A;  3BU7 A;  2JG8 C;  4LA2 A;  4PDW A;  2KD7 A;  2DCY A;  2GAU A;  1NE4 A;  3SCF A;  2HYX A;  4QAW A;  1LOE A;  1HRI 3;  4KBZ A;  1F8V A;  5LW9 A;  4CDQ A;  5J7M A;  2V73 A;  2VOT A;  4NHM A;  1O4T A;  2JB8 A;  2D7F A;  1GYK A;  2X53 S;  3GF6 A;  4XF0 A;  2WNE A;  5FYZ A;  3U11 A;  2KR2 A;  3MF6 A;  5FMD A;  2YDE A;  3INA A;  2V4V A;  2BTV C;  1EP0 A;  4Y1V A;  4DIN B;  2GC0 A;  3H1M A;  2XL9 A;  2DTW A;  2Q1Z B;  4IE4 A;  2QDN A;  1A78 A;  5EYY A;  1Q43 A;  3RGB A;  1TME 3;  2WZR 2;  1W6M A;  3S7E A;  4DXR A;  4QPW A;  2PAE A;  3WF2 A;  3ACF A;  5LAT A;  3IN9 A;  2RMU 2;  3D3A A;  5FZ7 A;  4MGT A;  2A70 A;  3RZJ A;  1Q8Q A;  4NRQ A;  4URT A;  5F3G A;  3PIG A;  3ZIW A;  2VMG A;  4NMI A;  2C0Z A;  3NL1 A;  1RUJ 3;  4HN1 A;  3LCP A;  3WNM A;  3J4U H;  3LEK A;  4D94 A;  5C5U A;  2ATF A;  4NOT A;  4A6O A;  3L2H A;  1IPK A;  1LOA A;  1B35 A;  1OKQ A;  2VZQ A;  2ZEW A;  5CKQ A;  2EIE A;  2HWB 2;  3KLS A;  4Z2A A;  1AR7 2;  4TSV A;  5FFO C;  3NMB A;  4QDR A;  3LSD A;  2QZ3 A;  2ZGQ A;  5FP3 A;  4IEY A;  5KXC A;  2VW2 A;  2XBO 3;  2FCT A;  1W2O A;  4PLN A;  2YU2 A;  1HXS 3;  1RUC 1;  4WZC A;  2ARA A;  2ZGL A;  1ND3 C;  3B9I A;  4MV2 A;  2B8M A;  3KV6 A;  1BBT 2;  1M4W A;  1NUK A;  2ARC A;  5CA6 A;  1RUI 1;  3ETP A;  2WO1 A;  4MG2 A;  1RUH 1;  1GP4 A;  3VD7 A;  3KT1 A;  4J25 A;  4AVT A;  3IDA A;  4B7K A;  2E53 A;  2XJV A;  1CAU A;  3AYD A;  1VBD 1;  1VBB 2;  1RTV A;  4PDW B;  3MLJ A;  4XF4 A;  3WP6 A;  2F4P A;  4WBB A;  1W03 A;  1OPM A;  2VMD A;  3IKW A;  3MIG A;  2LS6 A;  2WO7 A;  3AMM A;  3O0W A;  3OUH A;  4L8Q A;  4EJR A;  2QQI A;  1O3S A;  4XOG A;  1UOB A;  2RS3 2;  4LBJ A;  4CDQ B;  3E6B A;  3E1F 1;  1PO2 3;  5A6Z A;  4NPR A;  3THP A;  5CBL A;  2WLP A;  4OMD A;  1W9S A;  4BOW A;  2E7A A;  4X8P A;  4UW3 A;  4AAX A;  3AZW A;  4FPG A;  4AVV A;  5GKA C;  2LRP A;  5L7O C;  2Z69 A;  4R9B A;  5JLV A;  4HKW A;  3ES4 A;  4QXB A;  2A3X A;  5KXD A;  4LKS A;  4XUO A;  2VBP A;  3BIW E;  2OZ6 A;  2BVV A;  1AR9 1;  1W6M B;  5EZW A;  4IEQ A;  2BV4 A;  2WWJ A;  1W06 A;  4AGG A;  1FAY A;  4Q1R A;  2DUR A;  3G6J B;  4MGK E;  1FPN 1;  3VUO A;  1ZBE 3;  3B3Q E;  3UV9 A;  4NN0 A;  1AF9 A;  2W46 A;  4OYU A;  3RS6 A;  1I5Z A;  1OLQ A;  4FP2 A;  4LHL A;  4IGQ A;  3WLU A;  1B35 B;  1YWK A;  5C3P A;  5K9Y A;  3N4M A;  3GCX A;  4MVT A;  2C6S A;  1LAJ A;  2QQV A;  1F35 A;  3KGZ A;  4XHB A;  4IET A;  2D6N A;  1CJD A;  1DQ4 A;  3N36 A;  1MAC A;  3MID A;  1IS5 A;  1FT9 A;  1UD1 A;  4D6R A;  4MGQ A;  2F6B A;  4Y1X A;  4NIH A;  4TN7 A;  4F83 A;  4YW4 A;  3WP4 A;  5IW0 A;  4NRP A;  2V5D A;  5J98 B;  3ZXE A;  3THT A;  3K4Z A;  3LOB A;  2RR1 1;  3N7J A;  5I8T A;  1O59 A;  2WNV C;  2HKX A;  1GZ9 A;  1WW6 A;  5LK5 A;  1PVC 3;  1H6X A;  4DUV A;  4XBQ A;  5FPA A;  1CAU B;  5FZ9 A;  4YGD A;  4GWI A;  3FWE A;  3ZR6 A;  4NWV A;  3VBS C;  4ZY9 A;  3NV1 A;  2ARX A;  2OXB A;  2UWB A;  3DCQ A;  1ZRC A;  1EV1 3;  1JZ3 A;  2YY1 A;  4QPI A;  1ALY A;  3OPT A;  5I8S A;  1SCR A;  3B69 A;  2ET1 A;  2UWA A;  5GLU A;  4P9J A;  4DOU A;  2GAL A;  4JGZ C;  1ZVF A;  1UN1 A;  2C24 A;  2LTN A;  4XZP A;  1S0I A;  2WT0 A;  4PCR A;  4YPJ A;  3UES A;  5F2W A;  3WF1 A;  2YYO A;  2ZX4 A;  3I3E A;  5T54 A;  3USU A;  5IWF A;  3WNN A;  1OMI A;  2ZBJ A;  3FUQ A;  3ZYH A;  2Y26 A;  1MEC 3;  2D3R A;  3K4A A;  3EXU A;  4S2H A;  3F95 A;  3FHA A;  1K45 A;  3ZYG A;  5J48 A;  2YGL A;  4L99 A;  1QMJ A;  1RIR A;  3KGL A;  5BNN C;  1QF3 A;  1XB9 A;  2OS2 A;  4LQR A;  5DAX A;  5JR2 A;  1O8S A;  3MYX A;  2VW0 A;  4LO4 B;  3H3U A;  4U2A A;  2PLV 2;  1XXN A;  4NHK A;  2A6Z A;  3V0B A;  3IDB B;  3OBT A;  4V1P A;  1PO1 2;  3B01 A;  1UNB A;  2W68 A;  1RMU 3;  3BVC A;  4L2N A;  4YM2 A;  5F3E A;  1F4H A;  1MS3 A;  1JZ8 A;  4FXK B;  1LTE A;  3LOI A;  4QKF A;  5CIR A;  5C3S A;  5FPU A;  1CX1 A;  2JDM A;  2O1Q A;  3J7H A;  1J3Q A;  2G4I A;  3LFM A;  1QGL A;  4AI0 A;  2D6K A;  4A2U A;  4C90 A;  2HBU A;  2HWC 1;  5AC9 1;  4GB3 2;  2VZT A;  5FYI A;  3ROU A;  4ARY A;  1OH3 A;  4YFZ A;  1OF4 A;  1W9W A;  1SFY A;  2BBA A;  3WNX A;  1DYK A;  2YPD A;  1FOD 3;  3ECQ A;  4I01 A;  2CV6 A;  5LBC A;  4E27 A;  1K12 A;  4IE5 A;  2I74 A;  4ERO A;  3HEI A;  1DGL A;  2V4A A;  4S2D A;  2FDG A;  2FBE A;  5D8A C;  3CO2 A;  4K3U A;  4LR4 A;  4XF1 A;  4Q0P A;  2YB7 A;  1Z7S 1;  3MLL A;  4HET A;  4P5Y A;  3BTX A;  4FPH A;  1WGP A;  4ISR A;  4U36 A;  4XFC A;  1GNY A;  1FMD 2;  1VMF A;  2GME A;  1PVX A;  2NPI A;  4X6R B;  3H3Z A;  2X09 A;  5GM0 A;  1V00 A;  4C1X A;  3AZV A;  3JB8 A;  3JBG 1;  2DCZ A;  2FCV A;  2X05 A;  2WZR 3;  4ONU A;  4TLF A;  1J1L A;  5A80 A;  5FQ0 A;  4QPI B;  2VEC A;  2VR4 A;  5JOY A;  1JYT A;  3MLK A;  4EYU A;  1SBD A;  1DFQ A;  1HIX A;  3WDT A;  4AQS A;  3VBF A;  4DFS A;  5BYN A;  4MGS A;  3SCG A;  4WV8 A;  4XPV A;  5I0U A;  2QDR A;  3USU B;  3AMQ A;  1XC6 A;  4HMZ A;  3RG0 A;  3JU9 A;  1QXR A;  2VC9 A;  3CZU A;  1PZ7 A;  5IAV A;  1KXG A;  5SV8 A;  1PMJ X;  4E4S A;  2DTY A;  2Y6K A;  4CDX A;  5LZ6 A;  5ABJ C;  5I0S A;  2HWB 3;  2WUH A;  4XCB A;  4YSF A;  1AR7 3;  3PL0 A;  3O1M A;  1OUX A;  1WW4 A;  2XWB B;  4KNC A;  2W94 A;  2AYH A;  1DLC A;  2AAC A;  3WX5 A;  1D4M 3;  3V0B B;  2YGM A;  4BXS V;  1V6J A;  1W9T A;  1HV1 A;  4QGL A;  4F3J A;  1J84 A;  5IVE A;  3ACL A;  4HN0 A;  3WG1 A;  5C3O A;  1W8N A;  1YFU A;  4W6W A;  2DCT A;  3VBU A;  2R07 3;  3AZZ A;  1GQH A;  1VBC 2;  2XJT A;  1BBT 3;  2ETE A;  5T5P A;  1LED A;  4DUW A;  3FX3 A;  2H0V A;  4W6X A;  2WZP P;  1MQT A;  2CTV A;  1JMU B;  4IQP A;  4P9G A;  1J3P A;  2J1V A;  5A1L A;  4HK9 A;  1TNF A;  2WSV A;  1YXW A;  1QJY 3;  4JHT A;  4ASK A;  1VBB 3;  2EXH A;  5F5Q A;  3NNL A;  2Y6L A;  1Y9Q A;  1RUD 1;  2C9K A;  2WR9 A;  2Y60 A;  3EMR A;  5FZK A;  3N9N A;  3SKV A;  5FY5 A;  3K75 B;  2WAA A;  3ZYI B;  4WM7 A;  3ACH A;  4XJU A;  1HLC A;  5F9T A;  1YFY A;  1OQD A;  1XRU A;  4HT1 T;  5FP9 A;  5E88 A;  5I0R A;  5JSO A;  2GZW A;  5KBF A;  4D3W A;  2ENR A;  4ZZ8 A;  1GU3 A;  4JVA A;  2Q8O A;  3AP4 A;  1HRI 1;  1BCX A;  2FCU A;  4FCA A;  2BBV A;  1V6O A;  1MPX A;  1XE7 A;  2EIB A;  3D82 A;  3MIH A;  4EE2 A;  5J1X A;  4CDW A;  2CU5 A;  5EIY B;  2XPJ A;  5FQ0 B;  3PTY A;  4AI2 A;  2JE8 A;  2GN3 A;  1CWP A;  2XXZ A;  3U37 A;  3DXU A;  1KD7 A;  2HH9 A;  5H9P A;  4QQP A;  1PM7 A;  1PK6 A;  3T30 A;  5L36 A;  3WIN E;  2EIC A;  4FPO B;  1CIW A;  3MIF A;  4LO6 B;  3VBF B;  3GNE A;  5IAX A;  1LOF A;  4JDO A;  1GR3 A;  2XL7 A;  3DKQ A;  3AYE A;  5HPO A;  2ORZ A;  1LJ7 A;  1POV 0;  4M3C E;  2YHJ A;  3H7J A;  3LZZ A;  1YFX A;  4JQR A;  5DAB A;  2OT7 A;  1W9F A;  3SCH A;  5CB7 A;  5CFC C;  4UFL A;  3MGU A;  3N9P A;  1S4C A;  2VE1 A;  3S57 A;  4Y4Y A;  4CDX B;  4LBN A;  1APN A;  5FMC A;  4AQ6 A;  1YEW A;  3E5X A;  1TNR A;  2WAO A;  2ZGT A;  4IEO A;  5H9R A;  5D21 A;  4OZO A;  4EZ4 A;  3OD0 A;  4HKL A;  5LA1 A;  2WKK A;  2CHH A;  3QD6 A;  4HL0 A;  1S0D A;  4QX3 A;  2DVD A;  2HWD 3;  4GZ9 A;  3TWI A;  3T0D A;  1ZZB A;  4YVW C;  5FZO A;  4AFC A;  2VTX J;  4LTA A;  4A42 A;  1C28 A;  1E5I A;  3KV4 A;  2B4K A;  2ZXQ A;  4UBG A;  3VBU B;  3WQ0 A;  2W3J A;  2Q8D A;  4XJZ A;  2ZGU A;  5BPX A;  2XVG A;  4M4P A;  3WG2 A;  2VOK A;  4CCD A;  1IG0 A;  3P3P A;  1MQT B;  3GJA A;  5HBA A;  3LPG A;  2AR6 A;  2C5D A;  5FUP A;  3PHM A;  5FXW A;  3RZG A;  2JDY A;  1HB3 A;  4ITC A;  1LCL A;  3NAP A;  1Q8O A;  1EAH 2;  1W3X A;  2XJP A;  2P4E A;  3SQO A;  2ZEX A;  2SLI A;  4QDQ A;  2FDI A;  3KF3 A;  5FZI A;  3LIH A;  4KG8 A;  2FDH A;  5HCA A;  1JUI A;  4QDS A;  1IS3 A;  4WM7 B;  5GZG A;  1GZW A;  4LIV A;  4FTB A;  1QDC A;  1OFN A;  5LA9 A;  3OPZ A;  4BK4 A;  4NPM A;  4Q4V 3;  1YC6 1;  3POE A;  2DVG A;  1SHW B;  1QKQ A;  4XIO A;  2W1S A;  2JG9 C;  4AFB A;  4QHO A;  5C6C A;  4NIG A;  4XQD A;  1NCQ A;  3AYC A;  4E4H A;  1ZBA 3;  2O0O A;  4WVZ A;  1VP6 A;  4AFM A;  5JSR A;  2ES3 A;  2BNM A;  3CZJ A;  2O14 A;  2UY9 A;  1W90 A;  4AAP A;  4J1X A;  3D0S A;  5FZ0 A;  2BP6 A;  5KHH A;  4CDW B;  1PO2 1;  1U5X A;  3AP7 A;  1UCX A;  2Y6F A;  4COW A;  4A7Z A;  5IK5 A;  1GNZ A;  1PK6 B;  3Q8F A;  1TMF 3;  4Y4R A;  3H7Y A;  3OGJ A;  3NV2 A;  3M4F A;  4I3G A;  2PLV 3;  1JOB A;  5DAW A;  5DAQ A;  4AGV A;  1YYN A;  2KXL A;  3O1R A;  4FQ4 A;  2BGP A;  2BVB A;  4BWO A;  4DO0 A;  1H1I A;  1XBF A;  4UFK A;  4E2S A;  1WCQ A;  3NO8 A;  4XYX A;  3DL3 A;  3KV5 A;  5FBZ A;  1V70 A;  4JRA A;  4M0N A;  4NID A;  1KEX A;  3TBD A;  5F5C A;  4KWK A;  5C8C A;  4ES9 A;  3OJB A;  2VXJ A;  4PLO A;  1BMV 1;  3S7I A;  1ZBE 1;  2J7M A;  1WWY A;  3GXU A;  4RHV 2;  1ENQ A;  5JZG C;  4GB3 3;  1HV0 A;  5BNP A;  2N7G A;  3VN4 A;  5FP7 A;  1UOJ A;  1GZT A;  3A21 A;  3J7N A;  3LA2 A;  5FZO B;  4F8A A;  1PK6 C;  3VBO A;  2W1Q A;  1FXZ A;  4N8M A;  1N3Q A;  2CWM A;  4XDQ A;  1LUL A;  3M3Q A;  4GMP 3;  2P2K A;  1AYM 1;  2JEN A;  1LRH A;  3J8F 3;  1JOJ A;  2FZ1 A;  1H1A A;  1PNF A;  1UX7 A;  4A3X A;  1DZT A;  2VZU A;  4K1Z A;  3WZ1 A;  1Q8P A;  1O7F A;  1VBE 2;  4N7U A;  4QXC A;  4WZF A;  1ULF A;  1VAV A;  1SLL A;  3CHX A;  3VHR A;  1QJF A;  3WNK A;  2PA7 A;  2X8K A;  4DZG A;  1FMD 3;  3NAP B;  3BOD A;  3IZO A;  2YFZ A;  1LHN A;  1T6G C;  3BTZ A;  3ZMN A;  1GZW B;  3QCW A;  3WP3 A;  4AW7 A;  3ZLI A;  1OUR A;  4KG0 A;  3U0Z A;  1RUN A;  2CYF A;  1W05 A;  1NG0 A;  4XVH A;  4YZ3 A;  4JTO A;  2VXR A;  1HKD A;  1XPW A;  1FNZ A;  3OBZ A;  1CN1 A;  4BU2 A;  2EAK A;  1ZZ6 A;  1ULE A;  1GSL A;  1NCQ B;  1O5L A;  1S0J A;  4BYY A;  1H0B A;  2ARB A;  1TME 2;  1KJR A;  3A7Q A;  1REF A;  5FPL A;  3O1U A;  4Y26 A;  4K8R B;  1ULO A;  1XE8 A;  4DQA A;  1G7Y A;  1HRV 1;  4FOY A;  4E8C A;  1ODM A;  1DF0 A;  3V65 A;  4Q4W 3;  5C9A A;  1YQ2 A;  4AHX A;  1PGW 2;  5J96 B;  1RUJ 2;  4XJW A;  5FY9 A;  3BOW A;  2GNM A;  3CNA A;  1RVF 2;  2JWP A;  3JQX A;  1UY1 A;  2A3Y A;  2EF6 A;  3H9A A;  3POS A;  1QHD A;  3U4X A;  3KWV A;  4AGR A;  1NCR C;  5HCH A;  3I49 A;  5DMY A;  2R1B A;  1VBC 3;  4BQY A;  5C8C B;  1JZ4 A;  4Y1Y A;  1HJF A;  2VUA A;  3CKH A;  3AZY A;  1AR8 2;  1HB4 A;  2AEY A;  1R64 A;  2MEV 1;  2X10 A;  2XBO 2;  2GN7 A;  3RI9 A;  4D8M A;  5A3M A;  3EB7 A;  4AK3 A;  5FZD A;  1HXS 2;  2VNV A;  4UI9 L;  3UKN A;  3R0R A;  5BNP B;  2IVJ A;  2GMP A;  2ZGS A;  2VVF A;  4GWM A;  2A1X A;  1RMU 1;  2FDJ A;  2HEW F;  1BYH A;  1SDW A;  3ACG A;  3ABZ A;  4M4R A;  3VBO B;  5CAZ A;  3WQ7 A;  2ID4 A;  3D0J A;  3PIJ A;  2BDR A;  4C0H A;  1LOB A;  4KGQ A;  1OA2 A;  2BJS A;  4LIT A;  3RJR A;  2WWS A;  4CU8 A;  4JCK A;  4BCU A;  4Z92 B;  1NE6 A;  2IXJ A;  3K4D A;  1HW5 A;  2R06 3;  1POV 1;  3ZMO A;  1COV 2;  4MH0 E;  5KHI A;  3ZO0 B;  5CIS A;  5K4L A;  4R52 A;  4YWA A;  1TE1 B;  1V0A A;  5I0D A;  4HXC A;  1EUT A;  3VBO C;  2OPK A;  1MZ6 A;  1W3V A;  2ZGN A;  1JZ7 A;  2YC0 A;  4MLO A;  3SH3 A;  1YIP A;  1SDD B;  2WA4 A;  3LDB A;  4IEV A;  3WW4 A;  3I2G A;  3O12 A;  2H6C A;  5LWB A;  1F5F A;  3MIB A;  1BZW A;  3N9M A;  4RGA A;  1Y7B A;  2WZR 1;  1UZV A;  4E9K A;  4JV4 A;  1RXF A;  4LHN A;  4AI3 A;  2WLQ A;  3LQC A;  4K40 A;  3WF3 A;  5JUV A;  1ULD A;  2RMU 1;  4LMF A;  2J22 A;  2JDA A;  2LW8 A;  3C2U A;  5C9A B;  5JR7 B;  3GGL A;  1RUE 3;  2DCJ A;  4W65 A;  5A3W A;  4PF1 A;  1OQ1 A;  1H2N A;  3Q8C A;  4IES A;  2VGD A;  1X36 A;  1GIC A;  3WT3 A;  4CDU A;  1W0O A;  3ZN6 A;  2HWB 1;  1LU1 A;  1SCS A;  2DBN A;  1AR7 1;  1H8T A;  5JXG A;  1A8M A;  5SV5 A;  3OBA A;  3DYP A;  2JX9 A;  3BPZ A;  4Q27 A;  4NHX A;  3VHN A;  1WME A;  2CL2 A;  1FI2 A;  3R05 A;  3VKN A;  2YMZ A;  4EZH A;  3ZM8 A;  4QKD A;  1QJX 2;  3ZVX A;  4PT6 A;  4B4Q A;  5KWR A;  1BBT 1;  1A6C A;  2BU9 A;  2VZV A;  2P5B A;  4HOO A;  1S0B A;  4JGY A;  2VCA A;  4EWD A;  5FO8 B;  1ST8 A;  1UWW A;  1PVC 2;  1GNH A;  3BOP A;  5GAL A;  4FSJ A;  3POJ A;  2HWF 3;  3APB A;  1VBB 1;  4RS5 A;  3LFI A;  3VL9 A;  3HBK A;  3PUQ A;  4B4R A;  4DY3 A;  5BV6 A;  4V2V A;  2W5F A;  1EV1 2;  3ZFF A;  2RS3 1;  4XCA A;  1Q5O A;  1GBG A;  3M3C A;  2Z42 A;  2HLE A;  1W2A X;  4XXA A;  3WVJ A;  1GAN A;  3BPS A;  1W8U A;  4XTP A;  2Q8C A;  5F7U A;  2JD4 A;  5A3U A;  3VKF C;  4EWA A;  5LEK A;  3AKP A;  2FHR A;  2P6C A;  3VD5 A;  3MBW A;  3BCW A;  4C91 A;  2RJL A;  2B45 X;  4RR3 C;  3GBF A;  1MEC 2;  1JYN A;  1QNY A;  1T6B X;  2JDP A;  4LO5 B;  2Y33 A;  1UYX A;  4IEW A;  2AH2 A;  3LA7 A;  4QPG A;  4RHV 3;  1ZRE A;  3VBR A;  4ET7 A;  2QQU A;  5BNO C;  4N90 A;  1VRH 2;  3ASI A;  4HBN A;  1OOP A;  2JE9 A;  2J1E A;  3P1I A;  1SLA A;  2ZGP A;  3H50 A;  5HCF A;  3ZN6 B;  4CDU B;  1GLH A;  3GZE A;  4XUN A;  5F8P A;  1J59 A;  1W99 A;  2RJ2 A;  1H8T B;  3KCY A;  3RWN A;  3JCI A;  5FO9 B;  1JOP A;  2C26 A;  1RYY A;  3WW3 A;  4QU2 A;  1VBA 3;  3W58 A;  1X8M A;  4AR2 A;  1R08 1;  4KL1 A;  3W59 A;  3Q9O A;  1PNG A;  1N1V A;  3EBR A;  2ZGM A;  5T50 A;  1FOD 2;  4Z82 A;  4BQX A;  1NXM A;  1RED A;  5FDB A;  4XHX A;  2HWE 2;  3IMN A;  3LEI A;  3RQ0 A;  3VZO A;  1OA3 A;  3S30 A;  3NJV A;  1UMI A;  1DGW A;  4LUK A;  2BGO A;  4XUP A;  5JPN B;  3C7O A;  4YG3 A;  4CSW A;  2VO5 A;  4RN5 A;  4JGY B;  5DQ0 A;  2NYY A;  1ZRF A;  2BER A;  1ENX A;  1QQP 3;  5J09 A;  2ZHL A;  2VBD A;  3ORJ A;  1H1M A;  3OGS A;  4RS5 B;  2VD7 A;  5K0U A;  5FZH A;  3S5Q A;  2Y34 A;  3WDW A;  4BIS A;  1N1Y A;  5HCB A;  3ZFF B;  4QB2 A;  3ZYR A;  4QPY A;  2E31 A;  2D43 A;  3HIF A;  2PHL A;  2NM1 A;  3SEE A;  1X33 A;  1UOG A;  5B4N A;  4ZXK A;  1SG3 A;  5JCT A;  3C8X A;  4CCO A;  3GDB A;  3LDK A;  1GWK A;  3HJR A;  1JH5 A;  1SFP A;  3A0N A;  1RVF 3;  3DXT A;  5HV4 A;  2JDH A;  5F6L B;  3O1P A;  3AZX A;  1OI6 A;  2PHX A;  2WRA A;  3M8L A;  3DYO A;  5EPA A;  5FPX A;  4QGN A;  1AXZ A;  2IXH A;  1FV3 A;  3OG2 A;  1GV9 A;  1O3Q A;  4F7Z A;  2LAL A;  3IBM A;  1S0G A;  1SFN A;  4I2O A;  2JIC A;  1AR8 3;  4QPG B;  1D4M 2;  2PLV 1;  4DEV A;  3VBR B;  4UYB A;  5JXJ A;  5EJ3 A;  1PO1 1;  3C7F A;  1ZZ8 A;  1BK1 A;  3SKJ E;  1I1E A;  1UIJ A;  1G86 A;  3UGF A;  1OOP B;  4JDN A;  2B46 X;  5FZ4 A;  4EN7 B;  1NZI A;  5L19 A;  5LK7 B;  2WII B;  2R07 2;  1S0E A;  4QM9 A;  5F39 A;  2NQY A;  4DRR A;  4EN6 B;  2PHR A;  2CAU A;  3KT4 A;  4NIA A;  1CZS A;  2VZO A;  4IEZ A;  5J3U A;  5JOW A;  1MS4 A;  1HN0 A;  2IWG B;  3QLQ A;  4GIQ A;  5IVC A;  1C5H A;  1RUO A;  3F2Z A;  3WQB A;  4GB3 1;  4R9A A;  4XF9 A;  1QJY 2;  3K2O A;  3DV8 A;  5FY4 A;  3J7L A;  2G9G A;  1OLM E;  3VZN A;  3I7D A;  4AOC A;  4YGC A;  1COV 3;  4G9S B;  5FZ6 A;  2D98 A;  4FPL A;  5F32 A;  1H9P A;  2PHW A;  1JXN A;  3E6D A;  3AJY A;  3TOJ A;  5FP4 A;  4FPF A;  2D93 A;  3LE0 A;  1KFX L;  4BIO A;  1AHS A;  2ZJC A;  1K5M A;  4FTE A;  3RZH A;  1NA1 A;  5CFD A;  1C3H A;  1PIV 2;  3AK0 A;  1KJL A;  2VME A;  5KXB A;  5IVY A;  1FMD 1;  1AX1 A;  3NNF A;  3MUY 1;  1NY7 2;  5K0U B;  2G1M A;  1QOT A;  4DXT A;  1JS9 A;  3VB9 A;  1Y4W A;  2AGS A;  2ZHK A;  1DHK B;  3IPV A;  4A6S A;  1O91 A;  2NZ9 A;  2P37 A;  4IE0 A;  4PDW C;  1N47 A;  1X7N A;  1NX9 A;  2K2S A;  2GP3 A;  3E97 A;  2QQW A;  5FO7 B;  3ZXL A;  4HG6 B;  4JQT A;  4DIQ A;  4CDQ C;  1M06 G;  2WYF A;  4JTN A;  4NHL A;  4KGG A;  1DGW X;  4OUE A;  4PIX A;  4UXA A;  4CEY A;  4CUG A;  4FP3 A;  3VHO A;  3D5O A;  5ISL A;  5CG9 A;  2RG4 A;  4N43 A;  3NJX A;  4Q4Y 2;  1DQ2 A;  3N9L A;  1FYU A;  1QDO A;  1GMM A;  3RJ2 X;  4R9D A;  4GH4 A;  4CYD A;  4D7T A;  1CX4 A;  4XW3 A;  2E7Q A;  2D40 A;  4OI0 A;  4NVP A;  3MW3 A;  3P6B A;  4FPJ A;  3AKQ A;  1UXX X;  2HWD 2;  5DAV A;  1JYV A;  2ZOE B;  2A73 B;  5JMC A;  4AG4 A;  5IFT A;  3E6C C;  1QJX 3;  4ZON A;  1ZRI A;  2GU9 A;  1L7R A;  1VBC 1;  5DG1 A;  5LCW L;  3W9A A;  4Y1U A;  1JYI A;  2V09 A;  4MO3 M;  1Q3E A;  3R4U A;  1AJK A;  1EPW A;  2YUE A;  1B35 C;  4RL7 A;  4DRV A;  3EYP A;  2Z5W A;  3J26 N;  2WZE A;  4KMQ A;  3KCX A;  4DNY A;  4KWJ A;  2RDR A;  3GZA A;  4RA0 A;  2IFW A;  3RMX A;  3TEX A;  4NJ4 A;  1OVS A;  2ZX0 A;  3M3O A;  5FPV A;  3RNS A;  1F9K A;  1NLQ A;  4DXS A;  3PUR A;  1R1A 2;  4Q8K A;  1WCU A;  3TB0 A;  4BLI A;  4XFF A;  3ZFG A;  4BDV B;  4XDP A;  4QXH A;  3SH4 A;  4RFR B;  4Q4V 2;  1K5M B;  1NA1 B;  2WL1 A;  3ZN4 A;  2YRO A;  4ASL A;  5CFD B;  3TRS B;  5DZG A;  2ZHN A;  4AQT A;  1QOO A;  5GZC A;  1DQ5 A;  2RDN A;  1ZBA 2;  1VAM A;  5A3L A;  1XOY A;  2VZS A;  3BU0 A;  3BYW A;  1NXD 1;  4A3Z A;  4HZF A;  1DZR A;  4XBL A;  3WUC A;  1W6N A;  3IPV B;  4MXW A;  1JI6 A;  1AL2 2;  2VMI A;  3OUI A;  2XHN A;  2R32 A;  3WCR A;  3ZXG A;  2J1R A;  1BLZ A;  4K1Y A;  5EV7 A;  1TMF 2;  2ZEZ A;  5FYB A;  2GSY A;  3R4D B;  4QX7 A;  1I6X A;  1DQ0 A;  1N1S A;  2RS5 3;  2EXJ A;  4CXY A;  4XFB A;  1VRH 3;  1YCI A;  4CEY B;  1K5M C;  1UOF A;  3WDY A;  1UPS A;  3WP5 A;  1SLI A;  1NA1 C;  4N43 B;  5G04 L;  5FYY A;  3B94 A;  2P17 A;  3AVS A;  4QGM A;  1FV2 A;  4L11 A;  2JEC A;  2BEO A;  1VJ2 A;  2WJS A;  3HN3 A;  4GH4 B;  3NRU A;  4EWE A;  5A1F A;  4Q4X 2;  3NV4 A;  1D2S A;  2K9Z A;  2PAM A;  1RUF 2;  4RSU A;  5CNA A;  3I3B A;  3ZXD A;  2OUJ A;  5LY1 A;  1WMF A;  3D4K A;  1LNS A;  2RDQ A;  1PHM A;  1VPH A;  2WDB A;  3JZV A;  1C4R A;  2G9Z A;  2HWE 3;  1UIK A;  2WNU A;  3J8F 2;  4P9Y A;  2VBB A;  5C70 A;  3T2O A;  1ZX5 A;  2WBK A;  4CZS A;  4LUM A;  2E32 A;  5FP8 A;  3WCS A;  3MF9 A;  4I02 A;  3I2D A;  4FFI A;  5JPM B;  2TUN A;  4A45 A;  1OUS A;  5DUX A;  4URA A;  2ZX2 A;  4IXL A;  3I2J A;  2FDF A;  1FNY A;  2D44 A;  4I0A A;  1UU4 A;  1Z78 A;  5FZ3 A;  4M3C A;  3W20 A;  3ZSK A;  5TSW A;  1EAH 1;  2VVD A;  1KDK A;  3ZR5 A;  1SPP A;  3U75 A;  3AFK A;  1DCS A;  3ZFG B;  4B1M A;  4YLZ A;  1G9D A;  3KZ4 C;  4MHR A;  1UZ0 A;  2B9V A;  1SMV A;  2VNG A;  1UX6 A;  3N9O A;  5DG2 A;  5GJ6 A;  3QAC A;  3ILN A;  5FIX A;  3IM0 A;  4S2F A;  4CU6 A;  4YW6 A;  4UWD A;  2VZ3 A;  2G19 A;  1FAT A;  4M00 A;  3I3M A;  4GWJ A;  2VUL A;  2JDU A;  1NT0 A;  2XWJ B;  2ZCW A;  4EN9 B;  1W6N B;  3ES1 A;  4MXW B;  5DZE A;  3S0M A;  1VMJ A;  1UYZ A;  2R1D A;  5FYU A;  4YVS A;  4UFI A;  4Q4W 2;  4Q0S A;  4BLJ A;  4BZ4 A;  4NO4 A;  1K42 A;  2YXS A;  1VLN A;  4UFJ A;  3LEG A;  3WF0 A;  2JDZ A;  1CZT A;  5F5I A;  4QPI C;  3OEB A;  3ZYF A;  4MZU A;  4Z1V A;  1PZ8 A;  5FZ8 A;  2PYT A;  4KQ7 A;  5FPZ A;  3III A;  3U1X A;  4BMB A;  1UXZ A;  2ZMK A;  1PM4 A;  2IFR A;  3U14 A;  1KGY A;  1KQR A;  1Y9G A;  2XLG A;  3M3I A;  1WKY A;  4P9L A;  2VY0 A;  3I59 A;  4RHV 1;  4MET A;  4NHY A;  4D7Y A;  4DUX A;  1D0H A;  4H7L A;  2RS1 2;  2ZEY A;  3GHN A;  5LEJ A;  3LB9 A;  3NNM A;  1MZ5 A;  5T52 A;  3UKT A;  1A3K A;  4BQ2 A;  1J1T A;  3VDD A;  2Z4F A;  3NST A;  2WNU B;  3BIE A;  2KA3 A;  5JI9 A;  3WF4 A;  5FBJ A;  4EQV A;  1VBE 1;  3KHB A;  4LLO A;  1S2B A;  2B42 B;  3OD4 A;  1F4A A;  1GQG A;  1LOD A;  1PIV 3;  2J42 A;  2R06 2;  4M3C B;  2PHF A;  4Q8L A;  1GWL A;  3VKM A;  2GNT A;  4EN0 A;  1H4G A;  5ANN A;  4FPC A;  1HDK A;  2WS9 3;  3QBQ A;  4LOS A;  5E1R A;  1SPP B;  4YW5 A;  2VZR A;  3FN9 A;  2OQ6 A;  1DQ6 A;  5A3P A;  4LXL A;  1JTZ X;  2WO3 A;  4O61 A;  2WSU A;  3M7A A;  3Q8B A;  3N35 A;  5A7S A;  5JXI A;  1K3I A;  3JD7 3;  5IVF A;  4JDM A;  4LEJ A;  1U12 A;  3UGH A;  5HV0 A;  2UYB A;  1NYW A;  1TME 1;  2BUK A;  3RMY A;  5KR7 A;  5IAT A;  5JOZ A;  2DFB A;  1HQL A;  4P5H A;  4Q4Y 3;  4ZU5 A;  2VUD A;  2WIN B;  4C8D A;  5FWJ A;  3FC0 A;  2XB6 C;  1YQ6 A;  2Y6J A;  4YVS B;  4ZZ5 A;  2PHD A;  4RQP A;  4ATF A;  1PGW 1;  4UAP A;  1RHI 2;  4N9I A;  1RUE 2;  1OC1 A;  3VZJ A;  5DN2 A;  1RB8 G;  1RUJ 1;  4FI9 A;  5A6X A;  1RVF 1;  2CSG A;  1QH7 A;  4QQ2 A;  4LKE A;  2ZAA A;  2ZGK A;  3PU3 A;  4GQ7 A;  4IEU A;  4AQ2 A;  1AVB A;  4PQ9 A;  1HQW A;  3CL1 A;  2A3W A;  3VBF C;  1OF3 A;  1YQ5 A;  3POY A;  4YNI A;  4W6Y A;  3SIT A;  5T55 A;  2VOV A;  3SMH A;  1AUY A;  1W0P A;  3WW2 A;  4AYU A;  4LPL A;  1JN2 P;  1BKZ A;  2H0B A;  1J3R A;  2UY8 A;  1LGN A;  2QQL A;  3PVO A;  4I0W B;  4IV1 A;  2ILM A;  3ILF A;  1ENR A;  1AR8 1;  2AEZ A;  2XUE A;  3I59 B;  2BQP A;  4Y5S A;  2XBO 1;  3RRD A;  3NJZ A;  2RV9 A;  4CDX C;  3OEA A;  1HXS 1;  4FOV A;  3FE5 A;  5JMO A;  4A7Y A;  2PTM A;  3AFG A;  1WCD J;  2WFF 2;  1R09 2;  1UY3 A;  1ZA4 A;  4BIF A;  2WN2 A;  1ND2 A;  3VDD B;  4NAO A;  2D6M A;  1R1A 3;  1U0A A;  2D3S A;  3CJI A;  3CIH A;  4ZXE A;  1C8M 2;  1YNA A;  3ZDS A;  4I30 A;  4B7E A;  1NQJ A;  2VUJ A;  1OT5 A;  3RYP A;  3ZXK A;  2BFU S;  4HAN A;  2VQ0 A;  3I2I A;  3VBU C;  2HWF 2;  2L9L A;  5A7Q A;  4DXZ A;  4GKY A;  4RGK A;  2DUQ A;  4HON A;  4CCC A;  1COV 1;  2J1A A;  1MQT C;  4Q0V A;  4KU8 A;  4CEW A;  2VCC A;  5JXH A;  4NUB A;  2VH9 A;  4LK7 A;  3GHM A;  2QE3 A;  4A41 A;  5AFE A;  2EAL A;  4GUL A;  3T4V A;  1AL2 3;  1C57 A;  2ADE A;  3JQW A;  4MOA A;  1H4H A;  2YPJ A;  1W04 A;  1MZF A;  4WM7 C;  5CKM A;  1S2K A;  3VD9 A;  2YFU A;  3C7E A;  3C7G A;  5CKN A;  3THD A;  3HQU A;  2DUP A;  1W6Q A;  3T1M A;  3IIA A;  4IER A;  4AZZ A;  4CCL A;  4HSJ A;  2Y0I A;  3RZK A;  3HQX A;  2BWC A;  4I09 A;  3D8C A;  5C4W A;  4IE6 A;  2OII A;  4XAB A;  4RQP B;  4ORF A;  5FYS A;  3LD8 A;  4L97 A;  4Q4X 3;  1G9F A;  2J1S A;  4TXW A;  1IZ3 A;  2FZ2 A;  3FLT A;  1RUF 3;  2PMW B;  4PLM A;  4CDW C;  1XU2 A;  4PHZ A;  3ZPY A;  2DVA A;  4GAL A;  4P08 A;  4YFW A;  4KU7 A;  4UBH A;  2BRT A;  4FPK A;  3O1O A;  4PIY A;  3H8R A;  1ULP A;  3HN1 A;  3MFC A;  4BQ5 A;  4XEZ A;  1A34 A;  4HPK A;  1JHJ A;  1LOF C;  4AE2 A;  4IV1 B;  4BQ1 A;  5FKC A;  2VCM A;  5J36 A;  3N7L A;  3TEW A;  1D0G A;  2VCB A;  1CR7 A;  1DBN A;  1VRB A;  2Y0O A;  1VBA 2;  5CZK A;  1YI9 A;  2YV8 A;  5T5L A;  4COY A;  2J1T A;  2Q4S A;  2FMD A;  3TNQ A;  4LBL A;  2VMH A;  1QJX 1;  4RQP C;  2MNG A;  2LM3 A;  1GOG A;  4MXV A;  4P00 B;  4A44 A;  1ND2 B;  3IMM A;  4YRD A;  2B39 A;  3CJI B;  2OYZ A;  3WDV A;  1VBD 3;  3PJY A;  2C9A A;  3POI A;  4LNV A;  4YZ4 A;  1MZE A;  3O0V A;  1VB2 A;  2QQO A;  2R16 A;  3VBH A;  3G7D A;  1BK0 A;  1BEV 2;  2ERF A;  1QQP 2;  1PVC 1;  1WLD A;  3GM8 A;  2OZJ A;  2NMN A;  1D2Q A;  2VTF A;  1J58 A;  4BPZ A;  4X6Q B;  1O4Z A;  3I8T A;  2NMO A;  2ORX A;  4P9W A;  5CVR A;  1UY4 A;  5LAS A;  2XDV A;  1EV1 1;  4CEW B;  5FLI A;  4JRL A;  4LE3 A;  1EY2 A;  4FQZ A;  2XQX A;  2WQ4 A;  4SLI A;  5AVP A;  3WNO A;  4CA9 A;  3NAP C;  3OTF A;  2GH2 A;  2WZ8 A;  4TYS A;  4XMI A;  4OI1 A;  4QX0 A;  3SNM A;  3TN9 2;  1RIT A;  2R0F A;  3KSC A;  1GUI A;  2EVX A;  1AR9 3;  5FK7 A;  3ST7 A;  3UKV A;  1V6L A;  4NPL A;  1ZZ9 A;  2KM2 A;  4Q0U A;  3M1H A;  3NJY A;  3ALQ A;  4AL9 A;  1W6Q B;  1FPN 3;  4OHZ A;  1MEC 1;  3CLP A;  4WM8 A;  5EXO A;  4W50 A;  1G6N A;  1PGL 2;  2VW1 A;  3O0X A;  3K3N A;  4NAM A;  1UY2 A;  4OCT A;  1VR3 A;  3RPQ A;  1NCQ C;  5A3N A;  1MS9 A;  4QQO A;  4QQL A;  5C4W B;  3ZSJ A;  3B00 A;  4AHW A;  3THC A;  4XMA A;  4CU9 A;  2Y8K A;  3C3V A;  3HNB M;  3RYR A;  3FJS A;  4O9G A;  3LEM A;  1VRH 1;  2RS1 3;  1OKO A;  3WEZ A;  3OOX A;  1DYO A;  3B7M A;  3UET A;  3FHI B;  2QKD A;  3LSE A;  2RVA A;  5FUI A;  1C1F A;  4ASM B;  3AL6 A;  4HPK B;  3KVA A;  3NNJ A;  2IXI A;  3AL5 A;  3MPB A;  2ZPX A;  1G9C A;  1AYN 2;  1JZ2 A;  3S6P A;  3FZ3 A;  2O8Q A;  2P6H A;  4LE4 A;  2PAK A;  2K46 A;  3AB0 A;  4G3Y C;  1GOH A;  1SLC A;  4GXL A;  4N53 A;  5C8C C;  2D6P A;  3IB3 A;  1MS0 A;  2YG0 A;  3IT8 A;  1FOD 1;  4OVE A;  2BNO A;  5M0T A;  1HB2 A;  1LR5 A;  1LEM A;  2HWE 1;  5EYX A;  2VQA A;  5IVJ A;  4S2G A;  1R1Z A;  2VNR A;  4XUT A;  5BNP C;  5C3R A;  4ISQ A;  4LOT A;  1S0F A;  5FMB A;  4NWW A;  3VBH B;  2QQK A;  3ON7 A;  3A23 A;  1IGO A;  3I4I A;  4LA3 A;  4KWL A;  3SIS A;  2X5I A;  3T1L A;  5A7P A;  4YGB A;  1QJU 2;  2YC4 A;  1L7Q A;  2JEM A;  5F5A A;  4YM0 A;  2P34 A;  2BW8 A;  2BYV E;  4PBP A;  5FYC A;  4GMP 0;  4AWD A;  5GZD A;  1CZV A;  3WNL A;  1QU0 A;  2JKX A;  4AFD A;  3LDR A;  4XZU G;  5DXD A;  5BY5 A;  1SBE A;  3WXP A;  4KI5 M;  2MHF A;  2XML A;  4XFG A;  4AI9 A;  5GZE A;  4XQW A;  5A32 A;  3HMY A;  5F3C A;  1RHI 3;  2NP0 A;  4QXK A;  3ZXA C;  4WVV A;  1X8E A;  2HBT A;  3B9C A;  4G4F A;  3HPN A;  4ZS2 A;  2ZKN A;  1DIW A;  2ZGO A;  2F17 A;  4MGI E;  3LF7 A;  3ELN A;  5HXM A;  4WM8 B;  2BFU L;  1O3T A;  4FTS A;  1ZM1 A;  3FBM A;  3UJO A;  1Q56 A;  2DWR A;  1CPM A;  4YGE A;  1QJZ A;  2VMF A;  3ZFE A;  1D4M 1;  5FUN A;  1V6N A;  3SHR A;  2JG8 A;  3KS7 A;  4K9S A;  2IUW A;  3VZK A;  5C9A C;  2VZP A;  1WW7 A;  4HLT A;  2WFF 3;  1R09 3;  3PJQ A;  2SBA A;  2R07 1;  2R0H A;  4FPY A;  3CF6 E;  3BTY A;  1WZX A;  1AXY A;  1DG6 A;  2GC2 A;  5KC5 A;  4RYD A;  1C8M 3;  1OA4 A;  3PMS A;  5H9Q A;  4IW3 A;  5L9B A;  2WA3 A;  1OD5 A;  2D97 A;  2EA7 A;  5ANQ A;  1O6U A;  5E8A A;  4JC1 A;  3EQE A;  1QJY 1;  2XKO A;  4N53 B;  2QQM A;  4YZ5 A;  5ACA 2;  5L9R A;  2D6L X;  1QY4 A;  4LBQ A;  2PXJ A;  5I91 A;  3Q8E A;  1JYW A;  1LES A;  2HEV F;  3POG A;  2PQS A;  5I0T A;  5L9V A;  1AR6 2;  3LKJ A;  3OSD A;  4BHP A;  3U4S A;  4AEK A;  1ODN A;  3E5Q A;  1WMD A;  2ZAH A;  2XON A;  5T3N A;  4PQQ A;  1CQ9 A;  5GLV A;  1RL3 A;  3VDC A;  1CIY A;  3LAG A;  3ZKU A;  3JBG 3;  1GQP A;  1PIV 1;  2A75 A;  1LHV A;  2X5I B;  4MSV A;  3OYW A;  4W8J A;  4AI8 A;  3I97 A;  5FXX A;  3I2O A;  1NY7 1;  4LBQ D;  4YG6 A;  5JOX A;  1DDL A;  3GBG A;  3QH6 A;  3ZPO A;  1CVN A;  5FZ1 A;  1LOG A;  1ENS A;  2MPF A;  3IAP A;  4ZKT B;  4NR1 A;  2V72 A;  5FOJ B;  4AF9 A;  2IZW A;  4XJA A;  1G8W A;  3DN7 A;  3AJZ A;  2QQP A;  5A32 B;  3UJQ A;  3OUJ A;  4MX3 A;  1E5H A;  1KDM A;  4OHV A;  1UZZ A;  4QU1 A;  5EJZ B;  2RS5 2;  4AEJ A;  5ERL A;  4CU7 A;  4IL7 A;  2W95 A;  1RUG 2;  1OLM A;  1ND3 A;  2P3I A;  3DPR A;  5E89 A;  4EV0 A;  2QBX A;  2VNO A;  4Q4Y 1;  1UU6 A;  1DZQ A;  1L3J A;  2W39 A;  3KMH A;  4IND A;  5C71 A;  3FLP A;  3MPP G;  3L9J T;  5L73 A;  5FZB A;  3A22 A;  2Y6G A;  1W6P A;  3K3O A;  3KVB A;  3POW A;  4PI0 A;  3BKZ A;  5LA0 A;  5FRA A;  4AVB A;  3K77 A;  3ZFE B;  3WV6 A;  4Z8B A;  5FTT C;  4Y3O A;  4BJ0 A;  2HWD 1;  4K7J A;  2JG8 B;  1XNK A;  5C33 A;  3VDA A;  3BB6 A;  2A71 A;  2CWS A;  4IE7 A;  4Y22 A;  4OHW A;  5GLW A;  1Q8S A;  1V6I A;  2BZD A;  4Z07 A;  4JHZ A;  3H42 B;  2HYK A;  3ZYP A;  4CDU C;  3S5A A;  3FMG A;  1RJ8 A;  1RUD 3;  1US3 A;  3ZN5 A;  1BEV 3;  4BQ4 A;  5L7O A;  2VMC A;  4B3N A;  1H8T C;  3RZM A;  4QQH A;  2R49 A;  1T2X A;  1QOS A;  3A4U A;  2PN5 A;  4LBQ B;  5JWP A;  5FR3 A;  5C8W A;  1R1A 1;  4RFT 0;  4CP0 A;  3H1W A;  1O5U A;  1N3O A;  1ACC A;  3WY6 A;  2OQ7 A;  1XYO A;  4Q4V 1;  2VJX A;  3J7M A;  5JI7 A;  3TN9 3;  4HVO A;  3OYW B;  4FBF A;  2H6B A;  1TVG A;  1HN1 A;  1ZBA 1;  1LB2 A;  4JGY C;  1XYP A;  3T0B A;  2HJI A;  4AHY A;  4XIK A;  4CCJ A;  1O3R A;  1D7P M;  1H2K A;  1LHU A;  3JB4 C;  1GFF 2;  4FPE A;  3WG4 A;  4WVM A;  1AL2 1;  4RS5 C;  4WVW A;  5IVV A;  4CUC A;  3V56 A;  5E16 A;  4LOR A;  5IK8 A;  2Z2S B;  2EID A;  1TMF 1;  1DQ1 A;  3ZFF C;  3FBY A;  3LWC A;  4XAC A;  1EUU A;  3TYJ A;  5EJ1 B;  1W0N A;  2E7T A;  2XLF A;  1O4Y A;  2WNO A;  2YBP A;  4QHZ A;  1ND3 B;  1AZD A;  3DPR B;  1V9U 2;  4P9X A;  1H9W A;  1CD3 G;  5FYV A;  4D7S A;  4UW4 A;  5FMO S;  1UAI A;  3NQH A;  2PHU A;  2W1U A;  2ZGR A;  1YQC A;  2ZX3 A;  3NWK A;  3HT1 A;  2WNV A;  2I45 A;  4Q4X 1;  1W6P B;  5A3T A;  1RUF 1;  3BN6 A;  1AYN 3;  1PMI A;  3J9S A;  4ES8 A;  1XSR A;  1YI7 A;  2CNA A;  3RWK X;  3VBS A;  3GZU C;  4PBO A;  2QJV A;  4FAH A;  1EYB A;  4Q26 A;  4GMP 1;  4BH9 A;  1CON A;  3NW4 A;  4Y22 B;  1MR5 A;  1W8W A;  2WYS A;  3O5S A;  3J8F 1;  4HSL A;  4QPG C;  3N7K A;  1XYN A;  3DF0 A;  4Q1P A;  4YM1 A;  4I0B A;  3VBR C;  2DYC A;  1OVP A;  1RC6 A;  3HNM A;  4FOW A;  2BOJ A;  3DPR C;  1ZRR A;  2D6O X;  3MI8 A;  5FLH A;  1OOP C;  4QHB A;  1NAE A;  2XOM A;  2OPW A;  4JGZ A;  3B5L B;  4CVU A;  3B93 A;  5IK4 A;  5L7O B;  3OF1 A;  3DEC A;  1ULC A;  1QJU 3;  4R8H A;  4XF3 A;  3RDI A;  3T4H B;  2R04 2;  1UY0 A;  2GH8 A;  2WS9 2;  1HJG A;  3ZXJ A;  2BNN A;  3FFZ A;  3ITQ A;  3VDB A;  3AKS A;  4ARX A;  5BNN A;  3SH5 A;  2XJS A;  4FOQ A;  2GMM A;  4QB1 A;  3ZYB A;  4FT8 A;  3H8O A;  3HR9 A;  4UFM A;  3AKT A;  5F6K A;  2RM2 2;  4CXX A;  3DGT A;  3JD7 2;  1UPI A;  2W92 A;  2PHT A;  1CPN A;  2FQP A;  1BJQ A;  1WBF A;  4ZS3 A;  4XQ4 A;  1U5Z A;  5IFP A;  1YJK A;  1H6Y A;  2WC2 A;  4TZD A;  2OVU A;  1ZZC A;  4WVM B;  1X9P A;  1XE0 A;  2B5H A;  2JDN A;  2PEL A;  1ASJ 2;  5K0U C;  4Q4W 1;  2NN8 A;  2XUM A;  1LHW A;  2NLR A;  3ATG A;  5EQU A;  2YZ4 A;  4UFH A;  1AX0 A;  1NOV A;  1WA4 A;  3WG3 A;  1BXH A;  3ZOI A;  4CP9 A;  3U07 A;  1VAL A;  2VTX A;  5JIA A;  3I2F A;  1DGR A;  4E4D X;  1MVQ A;  4OUM A;  3T2P A;  1WLT A;  3WW1 A;  3P5B A;  2W52 A;  1H30 A;  5A7O A;  3W5M A;  3I3D A;  5DDJ 2;  3SC7 X;  1W39 A;  1XNC A;  3OY8 A;  1B09 A;  5D8A A;  4EN8 B;  2WNV B;  5I93 A;  4OHY A;  4XJ9 A;  1AYM 3;  1UKG A;  2GP5 A;  2RS1 1;  5KXE A;  5EHD A;  3VBS B;  3QH7 A;  5FXZ A;  1URX A;  5ACA 3;  5C3Q A;  1W9Y A;  4FVV A;  1YFW A;  5T5O A;  2A7A A;  3H1Y A;  3CMG A;  4XBN A;  1R08 2;  1U5Y A;  1C8N A;  3WNP A;  2JKB A;  1AR6 3;  4KWU A;  1OD3 A;  3ZSL A;  2GC1 A;  4L9B A;  5LRS A;  1IS6 A;  2ZS6 B;  4JGZ B;  2WT1 A;  4CPB A;  4PIZ A;  4QX5 A;  1YLL A;  4OI4 A;  3EHK A;  2R06 1;  3JUU A;  2XLA A;  3PVE A;  4E4Z A;  4P9I A;  1WCS A;  2UWC A;  3KF5 A;  4Q2F A;  2B7Y A;  2E33 A;  1IQA A;  3NNG A;  4CCM A;  4Q5O A;  2WT2 A;  5ABJ A;  4IV3 A;  3CDZ B;  1BHG A;  1IKQ A;  5APA A;  2C4X A;  1ONA A;  4TLG A;  4CUA A;  5BNN B;  5DUV A;  2AUY A;  4CPB D;  3JXS A;  3N7M A;  2C1F A;  5JIU A;  3UK9 A;  3AM2 A;  3FLR A;  1X82 A;  4A7K A;  3LPF A;  2CDO A;  3ACI A;  3GJB A;  4IGP A;  2EXK A;  5LA2 A;  1HRV 3;  2ZKL A;  1KFU L;  3PUA A;  1RUG 3;  4YM3 A;  5AFB A;  1ZNP A;  1WCK A;  2ZMN A;  3O1S A;  5CFD C;  2W08 A;  5GZF A;  1QXP A;  1OPO A;  4AEM A;  1JUH A;  1IG3 A;  2ZZJ A;  1AXK A;  1JBC A;  2GND A;  4K6B A;  4JKK A;  3PUI A;  3WHT A;  1UW8 A;  1UO9 A;  2I2S A;  1WLC A;  3TEY A;  1NQD A;  1RHI 1;  4QWN A;  1RUE 1;  4CP9 B;  1HX6 A;  2JB4 A;  3GAL A;  3USS A;  3NV3 A;  5FXV A;  1W2N A;  2ZX1 A;  2MEV 3;  5FZE A;  2D5F A;  4DS0 A;  3ZSM A;  5CU1 A;  4GA9 A; 
#chains in the Genus database with same CATH homology
 3C7H A;  1JZ7 A;  1OT5 A;  3IAQ A;  4QX2 A;  3WQB A;  3WNM A;  3LEK A;  1SDD B;  3I2I A;  3I2G A;  4A6O A;  2L9L A;  2VZQ A;  2ZEW A;  4Z2A A;  2EIE A;  2J1A A;  4QDR A;  1XNT A;  3LQC A;  2VCC A;  3WF3 A;  5JXH A;  5JUV A;  4A41 A;  5A1A A;  2J22 A;  2JDA A;  2LW8 A;  3GGL A;  2DCJ A;  4MOA A;  3VD4 A;  4PF1 A;  3BGA A;  3VD9 A;  2YFU A;  1NUK A;  3C7E A;  3C7G A;  3THD A;  3T09 A;  3ETP A;  2WO1 A;  5JXG A;  3VD7 A;  3OBA A;  3DYP A;  3IDA A;  3OGR A;  2J1S A;  4TXW A;  2VZ1 A;  2VMD A;  2W87 A;  2LS6 A;  3ZM8 A;  5G05 L;  2QQI A;  4P08 A;  4PT6 A;  3FL7 A;  3E1F 1;  1PX3 A;  1ULP A;  2VZV A;  1JHJ A;  4OMD A;  1W9S A;  2VCA A;  4P02 B;  4AAX A;  1UWW A;  2VCB A;  5CZK A;  2J1T A;  4LKS A;  4XUO A;  4L0P A;  2W5F A;  1GOG A;  4P00 B;  4A44 A;  4LHS A;  2VL4 A;  4A4A A;  2HLE A;  2QQO A;  5F7U A;  2W46 A;  4OYU A;  3GM8 A;  2W47 A;  3VD5 A;  3MBW A;  2VTF A;  2WQ8 A;  2ORX A;  1UY4 A;  3VD3 A;  1JYN A;  1XNA A;  1UYX A;  2XQX A;  4JKL A;  3WNO A;  2WZ8 A;  4MGQ A;  4QX0 A;  2VQT A;  1GUI A;  4ET7 A;  2V5D A;  4XUQ A;  3P1I A;  2J1E A;  3K4Z A;  4XUN A;  1W99 A;  2RJ2 A;  4W50 A;  1O59 A;  4QX1 A;  3K46 A;  2C26 A;  1RYY A;  1UY2 A;  4DUV A;  1H6X A;  3OB8 A;  4GWI A;  3THC A;  4CU9 A;  2Y8K A;  4ZY9 A;  3HNB M;  1JZ3 A;  3WEZ A;  1DYO A;  3LEI A;  3UET A;  3NJV A;  1UMI A;  4XUP A;  2BGO A;  2RVA A;  5FUI A;  3C7O A;  2VO5 A;  4RN5 A;  1JZ6 A;  3OGV A;  5DQ0 A;  4YPJ A;  2BER A;  3UES A;  3WF1 A;  3I3E A;  1JZ2 A;  3WNN A;  3OGS A;  2DCK A;  2W9X A;  1GOH A;  1US2 A;  3IB3 A;  2YG0 A;  3K4A A;  4QB2 A;  1DP0 A;  1K45 A;  3FHA A;  4LQR A;  5JR2 A;  2E31 A;  4XUT A;  1O8S A;  3SEE A;  4UOJ A;  5B4N A;  3MO4 A;  1SG3 A;  2QQK A;  3A23 A;  3C8X A;  3GDB A;  3HJR A;  1OH4 A;  2YC4 A;  1L7Q A;  3FHQ A;  1F4H A;  1JZ8 A;  3DYO A;  3DYM A;  1TG7 A;  1CX1 A;  3WNL A;  1CZV A;  2JKX A;  2Y6H A;  3J7H A;  3OG2 A;  4IUG A;  4XZU G;  4KI5 M;  4QB6 A;  3UNP A;  2VZT A;  4ARY A;  2W91 A;  4DEV A;  1OF4 A;  1W9W A;  2BBA A;  5JXJ A;  3C7F A;  3ECQ A;  3SKJ E;  2R7E B;  4BK5 A;  1K12 A;  3HPN A;  3HEI A;  5HXM A;  1IQD C;  1CZS A;  2VZO A;  2YB7 A;  2QQJ A;  4P5Y A;  2J1U A;  3F2Z A;  2WO2 A;  1GNY A;  2VMF A;  2X09 A;  2X05 A;  2E26 A;  2VZP A;  3LE0 A;  2VR4 A;  1JU3 A;  4XUR A;  3MUZ 1;  4RYD A;  3SEP A;  4MGS A;  1W8O A;  5IHR A;  2VME A;  1XC6 A;  3MUY 1;  2VC9 A;  3CZU A;  2QQM A;  1PMJ X;  4DXT A;  2Y6K A;  1JU4 A;  2QQN A;  2WUH A;  2DDU A;  1JYW A;  1JYX A;  2PQS A;  1NX9 A;  2W94 A;  2XON A;  1DLC A;  4PQQ A;  3AC0 A;  1GOF A;  4HG6 B;  3VDC A;  1CIY A;  4BXS V;  4CUB A;  1GQP A;  1W9T A;  4W8J A;  1J84 A;  4OUE A;  3I97 A;  1W8N A;  3NJX A;  2WAB A;  1I5P A;  1GMM A;  3IAP A;  1NKG A;  4DUW A;  4DEQ A;  2V72 A;  2J1V A;  3P6B A;  1UXX X;  1JYV A;  2Y6L A;  4CU7 A;  5EJZ B;  3SKV A;  2C9K A;  4AG4 A;  3I2H A;  2W95 A;  5IFT A;  3K75 B;  2WAA A;  2QBX A;  1L7R A;  3ACH A;  5LCW L;  5C71 A;  4MO3 M;  4W4Z A;  3A22 A;  2Y6G A;  3EYP A;  4ZZ8 A;  5LA0 A;  2WZE A;  1GU3 A;  4E8D A;  3K77 A;  4KMQ A;  1JZ5 A;  4BJ0 A;  1MPX A;  2EIB A;  3W5N A;  3VDA A;  5J1X A;  5EIY B;  4DXS A;  4JKM A;  2VM9 A;  2JE8 A;  3U37 A;  4BDV B;  1O8P A;  5DPN A;  3I2K A;  2BZD A;  2EIC A;  3T2Q A;  4JHZ A;  1P8J A;  1US3 A;  5HPO A;  2ORZ A;  2VMC A;  1T2X A;  2VZS A;  5CYY A;  4A3Z A;  5IJR A;  2WAO A;  3MV1 1;  1JI6 A;  2XHN A;  2J1R A;  4MAD A;  4OZO A;  3WSO A;  5LA1 A;  2ZEZ A;  4QX3 A;  2VJX A;  4GZ9 A;  3T0D A;  1PMH X;  4A42 A;  2B4K A;  2ZXQ A;  1TVG A;  1HN1 A;  5G04 L;  3T0B A;  2W3J A;  1D7P M;  4M4P A;  3HN3 A;  3NRU A;  2OKX A;  4D0Q A;  1J83 A;  3LPG A;  4CUC A;  3HOB A;  2EID A;  5C7G A;  3I3B A;  3PUH A;  1EUU A;  5EJ1 B;  1LNS A;  1W0N A;  2ZEX A;  2WDB A;  4QDQ A;  5IYY A;  4QDS A;  1PX4 A;  5C70 A;  3T2O A;  4BK4 A;  3NQH A;  4TTG A;  2WBK A;  2W1U A;  2E32 A;  1SHW B;  3T08 A;  2W1S A;  2WN3 A;  4A45 A;  3I2J A;  3BN6 A;  3CZJ A;  3MV0 1;  2W1W A;  3WF2 A;  2WYS A;  4JX0 A;  5B4X A;  1UZ0 A;  2B9V A;  3HNM A;  1NAE A;  2XOM A;  4CVU A;  2BGP A;  3DEC A;  4CU6 A;  1WCQ A;  2VZ3 A;  3HNY M;  4GWJ A;  1KEX A;  1UY0 A;  3VDB A;  1UYZ A;  3T0A A;  2J7M A;  4ARX A;  3GXU A;  1K42 A;  2VQU A;  3LEG A;  4QB1 A;  3WF0 A;  1CZT A;  2Y64 A;  3A21 A;  3OEB A;  2W1Q A;  2W92 A;  5IFP A;  1UYY A;  3III A;  1UXZ A;  1UX7 A;  1H6Y A;  2VZU A;  1KGY A;  1WKY A;  1UMH A;  4DUX A;  4OMC A;  3WNK A;  2ZEY A;  2YFZ A;  3I2F A;  2Z4F A;  3T2P A;  3WF4 A;  3W5M A;  3I3D A;  4XVH A;  1XPW A;  1F4A A;  2YC2 A;  3A7Q A;  1ULO A;  2VZR A;  3FN9 A;  3CMG A;  4E8C A;  1YQ2 A;  3WNP A;  4KWU A;  1OD3 A;  2WO3 A;  5JXI A;  1UY1 A;  1K3I A;  2JD9 A;  5DMY A;  2E33 A;  3NNG A;  1JZ4 A;  2CDP A;  2Y6J A;  3CKH A;  3CQO A;  3CDZ B;  1BHG A;  4CUA A;  4ZZ5 A;  2C4X A;  1R64 A;  2X10 A;  4D8M A;  4UAP A;  3EB7 A;  2KD7 A;  4UI9 L;  3JXS A;  5DN2 A;  2HYX A;  4FI9 A;  4QAW A;  3ABZ A;  2CDO A;  3ACG A;  3ACI A;  3LPF A;  4M4R A;  2VOT A;  5LA2 A;  2ID4 A;  1OF3 A;  4LPL A;  2V4V A;  2QQL A;  4CU8 A;  4JKK A;  3PUI A;  3K4D A;  2RV9 A;  3OEA A;  5JMO A;  4DXR A;  4QPW A;  1UY3 A;  2WN2 A;  3ACF A;  3D3A A;  3CIH A;  4ZXE A;  5I0D A;  1EUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...