2WO1A

Crystal structure of the epha4 ligand binding domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
183
structure length
180
Chain Sequence
ETGEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKRTKHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Plasticity of Eph-Receptor A4 Facilitates Cross-Class Ephrin Signalling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords EPHRIN TYPE-A RECEPTOR
total genus 34
structure length 180
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wo1A00
3OG2A 3WNMA 4CU7A 4A41A 2DCKA 4YPJA 2DCJA 1I5PA 2LW8A 4JHZA 3SEPA 4MO3M 2XQXA 1H6XA 3LE0A 5EJZB 2VR4A 3LEKA 2J1TA 2RVAA 3OBAA 4MGQA 1TG7A 3FHAA 3D3AA 3I97A 5LA0A 2W46A 1KGYA 4DXRA 2C26A 2WO3A 3MO4A 3T2OA 3WNLA 4GWIA 4MGSA 4W50A 3WNPA 1GOGA 3NQHA 4A44A 3FHQA 3PUHA 1L7QA 3SKVA 4QX3A 4GZ9A 1OH4A 3VDAA 3NNGA 1ULOA 4BXSV 3EYPA 4OMCA 3WF0A 2QQKA 4BDVB 1H6YA 1UYXA 2C4XA 1W99A 4QB2A 2V5DA 3CMGA 3GDBA 2XOMA 2ZXQA 1K12A 3HNMA 4OUEA 2Z4FA 1W9SA 3JXSA 2QBXA 2W1UA 4XURA 2VZPA 5JXJA 3THCA 2W1WA 3I2KA 1PMHX 2E31A 4QB1A 2YFUA 5HPOA 3WNNA 1J83A 2V4VA 2ZEWA 2X10A 3E1F1 4UI9L 2VZUA 3VD9A 1YQ2A 2Y64A 4QX0A 4HG6B 3LEIA 3LEGA 4DUXA 1US2A 2WN3A 2EIEA 3OB8A 5FUIA 2ORXA 2BZDA 1W8OA 2B4KA 3J7HA 3T2QA 1JYWA 3WQBA 4DUWA 5IHRA 2CDOA 3CQOA 3T0DA 2XHNA 3PUIA 2VMFA 2VQTA 3ECQA 4ZY9A 3C8XA 3T0BA 2VC9A 4ZXEA 1JU3A 1PX4A 4PT6A 4XUPA 1CZVA 2J1RA 2EIDA 2HLEA 3ZM8A 4CU6A 2QQOA 1UYZA 3OGRA 2VZ3A 1O59A 2VCAA 5JXGA 3DYOA 4W8JA 5DPNA 3I3BA 3DYPA 2VTFA 2JDAA 3MUZ1 2E32A 1K42A 1NAEA 4BJ0A 4E8CA 4TTGA 1JZ8A 1OF4A 1UZ0A 4QB6A 2WZ8A 4Z2AA 3W5NA 3K46A 4UOJA 1OD3A 1JU4A 1CX1A 3ABZA 4AAXA 1GUIA 2W5FA 3I2GA 4QDSA 4ET7A 1W9WA 2QQJA 4XUNA 3W5MA 2QQMA 1DLCA 3WF1A 1JZ3A 3OGVA 3A21A 2QQNA 2WYSA 1K45A 3FN9A 1SG3A 2YB7A 3UETA 5LCWL 3K77A 2LS6A 4IUGA 4FI9A 3THDA 5I0DA 3I2IA 2WAOA 4XZUG 4LHSA 2QQLA 3C7HA 2VMCA 4LPLA 1MPXA 2J1UA 3SKJE 5DN2A 4JKKA 4PQQA 1EUUA 2W1QA 1GU3A 4BK4A 4A4AA 1NX9A 5G04L 4M4PA 4XUTA 2W91A 2J7MA 2VZVA 2HYXA 3IAPA 5C7GA 2RJ2A 4CU8A 3DYMA 2VZTA 2Y8KA 2ORZA 2WUHA 1XC6A 3VDCA 2EIBA 1DP0A 2WABA 1UWWA 1GOHA 3DECA 3MV01 4RN5A 1SHWB 4UAPA 1UMIA 3A23A 1NUKA 3AC0A 5IJRA 4XUOA 4L0PA 1GOFA 5IYYA 1XPWA 3BGAA 1JHJA 3HJRA 3ACIA 4GWJA 2WBKA 2JKXA 3LPFA 4DEQA 4LQRA 4A6OA 1JI6A 2Y6GA 5G05L 2W87A 2YC4A 1T2XA 2B9VA 1WKYA 4RYDA 2W94A 3A7QA 4PF1A 5C71A 1JZ2A 4BK5A 2ZEZA 1W8NA 3ACGA 4QAWA 3NRUA 3I2FA 3ACHA 3VD4A 1JZ4A 2R7EB 5JUVA 1UMHA 3I2HA 3I3DA 2YC2A 5CYYA 2VL4A 4ARYA 1JYXA 4MOAA 2JD9A 1PX3A 1UY1A 4OMDA 1UY4A 5EJ1B 2ZEXA 1UY2A 2ID4A 4P5YA 5J1XA 1GNYA 3F2ZA 4A45A 1F4AA 4DEVA 3MV11 3T2PA 2VM9A 3OEAA 2WN2A 2DDUA 1UY0A 2WO1A 3CZJA 2C9KA 3HOBA 3P1IA 1IQDC 2VZRA 4DUVA 3IB3A 3CDZB 3LQCA 1CZSA 1K3IA 3WNOA 4CVUA 1OF3A 2VQUA 2WAAA 2J1EA 3WF3A 3C7EA 2VZQA 3NJVA 4KWUA 3WEZA 3GGLA 3MBWA 4LKSA 2BGPA 3MUY1 2X05A 3GM8A 4M4RA 4A3ZA 3EB7A 4A42A 3I2JA 2J1AA 3T09A 5B4XA 2W47A 2YG0A 3VD3A 1BHGA 4W4ZA 5IFPA 3WF4A 2W95A 5CZKA 3GXUA 4P02B 2E26A 2ZEYA 4MADA 1JYNA 3T0AA 2CDPA 5DQ0A 2PQSA 2WQ8A 3P6BA 5HXMA 2VJXA 5LA2A 1CIYA 2KD7A 3WNKA 4XUQA 2JE8A 4AG4A 3HNYM 2L9LA 4D8MA 1SDDB 1XNAA 1R64A 5DMYA 5A1AA 2J1SA 4DXSA 4ZZ8A 3WSOA 2WDBA 3K4DA 1F4HA 1JZ6A 1OT5A 3HN3A 3ACFA 2VCBA 1J84A 1O8PA 2W1SA 3HEIA 5JMOA 2BBAA 3HNBM 1JYVA 3VD5A 4QPWA 3ETPA 4XVHA 1GMMA 3A22A 4JKLA 4QX2A 3CIHA 2VO5A 4ZZ5A 3IDAA 1TVGA 3C7OA 3IAQA 5JR2A 1UYYA 1NKGA 2Y6LA 3UNPA 3OGSA 3K4ZA 4CUCA 1W0NA 1UX7A 1EUTA 3VDBA 1O8SA 2OKXA 3CZUA 5B4NA 4CU9A 3K75B 4QDQA 4QX1A 4OYUA 2BERA 4JKMA 3IIIA 1CZTA 4P08A 2V72A 1DYOA 5C70A 1XNTA 2W9XA 2VCCA 2VZOA 2Y6KA 3BN6A 2X09A 1D7PM 1JZ7A 5F7UA 1P8JA 3I3EA 4OZOA 3K4AA 4ARXA 5JXIA 2XONA 2EICA 1JZ5A 4CUAA 2VMDA 2Y6HA 4CUBA 1HN1A 2VZSA 2VMEA 4KMQA 1RYYA 3FL7A 1ULPA 1UXZA 2VOTA 4D0QA 3C7FA 1WCQA 3U37A 3LPGA 3SEEA 2QQIA 2WO2A 2W92A 1W9TA 3UESA 1L7RA 3NJXA 3WF2A 1UXXX 5JXHA 3C7GA 1PMJX 2E33A 2W3JA 5IFTA 1US3A 1GQPA 3OEBA 4P00B 2YFZA 5LA1A 3CKHA 2RV9A 3HPNA 2VZ1A 3T08A 2WZEA 2Y6JA 2J22A 1UY3A 4E8DA 3VD7A 4JX0A 2BGOA 2J1VA 5EIYB 1LNSA 1KEXA 4QDRA 4KI5M 4TXWA 4DXTA
chains in the Genus database with same CATH superfamily
3OG2A 1YUDA 4CCOA 4MGTA 1HIXA 1ODMA 2VG9A 3VZKA 2VVEA 3W20A 4WM8B 2FCTA 4A41A 2DCKA 5FPVA 1NCRC 3ZSLA 3DPRB 4YPJA 1LOFC 2QNKA 1V0AA 5DG1A 4JHZA 2VW1A 3VBSC 1DG6A 4MVTA 2ZGKA 3B7MA 3FMGA 4OFGA 4ORFA 4U36A 3LE0A 2XVGA 1TQ5A 3WZ1A 3R4DB 4AHYA 3HR9A 1YC61 2J1TA 4RQPA 4YVWC 1IOAA 4XFCA 2FDFA 1POQA 5IVCA 3BOWA 1BBT1 5FZOB 3WR0A 2DTYA 1KFUL 1SLLA 1W8HA 1OMIA 2VXJA 4Q4Y1 1V6MA 1SEFA 3ZFFA 2X5IA 3KS7A 4S2GA 4EN0A 1M4WA 1D4VB 2XG3A 2C26A 4OVEA 1CD3G 4K8FA 2UWCA 1H9PA 3MO4A 1GZCA 4XJ9A 3T2OA 1PHMA 3LD8A 1RVF3 3WNLA 4DFSA 4YFZA 1W9YA 2OT7A 4MGSA 4IE4A 5JI9A 5HCHA 3WP6A 4A44A 4N53B 3J8F1 3PUHA 1GSLA 4UW6A 1DGRN 1QQP2 2PHRA 1VRBA 4BIFA 4UWDA 4PQ9A 1OLRA 1FMD2 1OPOA 3R6SA 4DY5A 4E4DX 1X9TA 5JOWA 5DG2A 4KU8A 4BXSV 4OMCA 1K5JA 5D1IA 1H6YA 2VXRA 3POJA 2BWAA 5H9QA 4AEDC 2OYZA 2V5DA 1W39A 4YZ2A 1RUNA 2MEV3 3O12A 4BHPA 1AXKA 4N7UA 2AREA 3MHZA 4IV1A 2YUEA 3GHNA 4PHZA 3S5QA 2TEPA 4OHYA 1Q43A 1MACA 3AMMA 4FT8A 4XZPA 3LA2A 4OUEA 5TSWA 2Z4FA 1W9SA 3INAA 3ELNA 3POWA 4BOWA 4DRVA 3AM2A 4MYEA 4Q4Y2 1D4M2 2HWD2 1MEC2 2YDEA 4YZ1A 5DAQA 4S2DA 1AL21 3SHRA 1HQLA 2WIIB 3GBWA 2E31A 4KGQA 2VD7A 2YFUA 3VHOA 4LO6B 4QQPA 1JS9A 4IV3C 3FZ3A 3WNNA 4PLMA 1J83A 1GZ9A 5A6XA 1WD3A 3PMSA 5IVVA 2X10A 1RUI1 5D2AA 5A3MA 1QQP1 2R042 4XDQA 4OHWA 4E4SA 3QOPA 1H2MA 1YQ2A 4C8DA 4XFHA 5DDJ2 3APBA 1VMJA 3O1PA 2ILMA 2O1QA 2HWC1 1MZ6A 5C4WB 5A7OA 4W6WA 3WV6A 2AH2A 4BLJA 4QKFA 2JDKA 5FUIA 1O4ZA 1WLCA 3I2OA 2BZDA 2B4KA 4IDZA 4MXVA 4XJAA 5DAXA 3T2QA 2K2SA 5C4WC 3SXWA 1G9AA 5FZ3A 3WNXA 4LLOA 5D8AA 4H14A 4CSWA 5IHRA 5FY4A 1UMZA 1O91A 4NRMA 2P2KA 5ANNA 3PUIA 2R49A 1J59A 1PO12 2HWF2 5LEKA 5ACA1 5IVJA 5JOXA 5F5QA 1K5MB 1DGWX 3C8XA 3NAPA 3GJBA 3T0BA 5C33A 1PGL1 5DAVA 3ZXJA 4CDWC 5FIXA 1WMXA 1PIV1 4XMIA 4Z82A 3O1SA 1R1ZA 3HT1A 4O7XA 5KXEA 1ULFA 2RM23 3S6PA 1MVQA 3KWVA 2HLEA 1LOEA 1TZOA 3ZM8A 4Q4V3 4CU6A 4AI9A 4Z1VA 2WSVA 3OGRA 1SFYA 2DCZA 4AFBA 2VZ3A 1O59A 1XU2A 1GNZA 5JXGA 1J3QA 3DYPA 2VTFA 3OBTA 1GICA 2JDNA 1G7YA 3VBFB 4LBMA 1RUJ2 2E32A 3FLTA 1HW5A 4NOTA 2JIJA 4UW4A 1K42A 1JYTA 1NAEA 2CGOA 2OW4A 1C1LA 3LA3A 4LK6A 4D3WA 3VBUA 4PLNA 4QPIC 5T5LA 1OF4A 3JUUA 1OLME 1ULGA 2D6MA 3DKWA 2C6SA 1QKQA 1MEC3 2YBPA 4BB3A 4BE3A 2P1BA 4CE8A 4Z2AA 1Z7S1 4CP1A 3KT7A 1S2KA 4LIUA 5A3TA 3CHXA 4RR3A 1ENRA 3VBHC 1OD3A 2XJUA 3J7LA 1V70A 1CX1A 3ABZA 1LHUA 4LEJA 2W5FA 1N1SA 2WFPA 1EPWA 3I2GA 3WP4A 5K0UA 2ZMNA 3HVDA 1VMFA 4CCCA 1E5HA 3KHBA 3LA7A 2QQJA 2YBSA 4I0WB 4LTAA 4NROA 3WDUA 5C8CB 3AMNA 3MICA 3NKGA 4XUNA 1QDCA 1ZREA 2X53S 5K9YA 3OUIA 3BI3A 3OGVA 1SLAA 2HH9A 3S0MA 2QQNA 1HV0A 3HIFA 2PAKA 5FZAA 4Y22A 3T2TA 5J3UA 4HSLA 4Q2FA 1FV2A 4KWLA 3ZFGC 1W3VA 3DXUA 5AVPA 4BQ5A 2VBBA 3MF9A 3SITA 4FI9A 5I0DA 2IVJA 3M8LA 4YVWB 4YW1A 5C9AA 2W52A 3POYA 2RR13 4EWEA 2RE9A 5FV3A 4LPLA 3VBSB 2YY1A 3AP5A 4A2UA 2CU5A 4G4FA 3ZFEC 3E5UA 1FXZA 4AZZA 1NLSA 2WS91 3GBFA 4C1WA 5FYYA 3GJAA 1REFA 2BNNA 2OIIA 1X82A 2W1QA 1AYN3 3AKQA 4A4AA 3ZR6A 3S57A 5CKMA 3AB0A 1O3QA 1OHFA 2OUHA 2W39A 2W91A 3AYDA 3Q8BA 1H8TB 3MIEA 5I0RA 2VTXA 5J98B 4GMP3 5EYXA 1JOJA 5L9BA 2X29A 5FP9A 4ATFA 4O61A 1YQ6A 2DVFA 3NJYA 1M06G 5FY9A 3T1MA 1WMFA 4CU8A 3DYMA 1OFSA 2Y8KA 2ZOEB 3WUDA 4FTBA 1LKNA 2AEYA 5APAA 1MS3A 2NM1A 1KITA 1PVC2 1RUD2 4QQ2A 4COZA 4DO0A 5C3SA 5AC92 2Z42A 1HRV2 1GOHA 5J48A 4UAPA 1Q3EA 2IFWA 4K8RB 5FOBB 1UMIA 2XHKA 1HRV1 4QHBA 1U5YA 3EBRA 4LKEA 4LHLA 1C8M2 1BLZA 2XKOA 4XUOA 2BV4A 3JBG1 1FX5A 1GOFA 1LCLA 4OHXA 2OQ7A 4XTPA 3U10A 1YRZA 1GWLA 1PO22 4PIYA 2CY6A 1JHJA 1RXFA 3ACIA 1W6OA 4GWJA 2JKXA 4LLFA 2HWD3 5FYMA 4LQRA 4DEQA 1JI6A 3B3QE 2XLFA 4RA0A 4AWDA 1FPN3 2WQZC 4CEWC 1IS3A 2IFRA 4CP2A 4NAMA 1T2XA 1S2EA 2AZ5A 2WNUA 1PGW2 2W94A 1UNBA 1NCQA 5F6LB 3ZXLA 3T1LA 1RUC1 2ZEZA 4RSUA 1GP4A 1H1MA 5FOJB 4OI2A 3E97A 2XL7A 3O0XA 3ACHA 4XXAA 4R9AA 2HWE2 1H2KA 1IZ3A 3I2DA 4XQ4A 3VZNA 2FD8A 3AFGA 3VD4A 1HRI2 1NY71 2A7AA 4WVVA 3KD4A 5JUVA 3I54A 1CJPA 5HI0A 4MHRA 2XB6C 2P37A 4AF9A 4NJ4A 4ATEA 2VL4A 1HB3A 2ZKLA 2UWBA 2XXZA 5I8TA 2D3PA 2CGPA 5A32A 3H7JA 3K51A 5HCAA 1LOBA 5ABJC 1UY1A 2YROA 2P17A 1UY4A 1HB1A 3TB0A 4QGMA 3TRSB 4P5YA 5JOZA 1XNBA 2GALA 3WP5A 1GP6A 3DKQA 5FPUA 3SQOA 2PLV2 4Q4W1 2J42A 1F4AA 3Q8EA 4GB33 3KQRA 5FXVA 3WD5A 1OC1A 1H8VA 4JTNA 4J6GA 2DDUA 3ME2A 4AQTA 2EXJA 1LGBA 1V9U2 4QPIA 4ES8A 1AR92 2A6XA 1OBNA 4RR3B 4W6YA 1LRHA 3KSCA 3ZDSA 2JG9B 4HSJA 4AOCA 1WMEA 4YZ5A 3ALQA 1K3IA 2ENRA 1OF3A 3WG1A 2BUKA 2XBO1 4B7EA 3ACLA 1Y9GA 3ZX7A 1O5UA 4P5HA 4Q5OA 4EQVA 3PTYA 1E5RA 1AR61 3IBMA 2WLQA 2I07B 4JC1A 1UIJA 3GGLA 3UGFA 4YVSA 1QJU3 4TLFA 5JOYA 2Q0AA 3JQXA 2A71A 2Y0IA 3AZXA 5F3IA 3Q8FA 1G9FA 4META 4ASLA 3EB7A 3AZYA 3I2JA 3ZIXA 4AAPA 4BA6A 2H6CA 4K1ZA 1SLCA 4QX5A 2W95A 4Y1YA 4CDWA 4FXGB 2E53A 4P02B 1OQEA 2ZHNA 5F2WA 3VHRA 2WFF2 3KGZA 1FOD2 2BNMA 1AF9A 4Y26A 3M3QA 3KZ4C 3PUAA 5HXMA 4IV3B 3SCGA 4P9GA 4XJZA 4CDXB 3RFRA 3WNKA 2ADEA 2CL2A 2L9LA 1Z7S2 1UIKA 1HRI3 4NIGA 4YGCA 2B46X 2AC1A 3USUB 5C3OA 2J1SA 4DXSA 4ZZ8A 4Y1XA 1W2UA 3K4DA 4F8AA 1JZ6A 5FZCA 3WP3A 5DDJ3 4QT6A 5L7OA 3R0RA 4JGZA 4E9KA 5CEHA 1LGNA 4GKYA 1O8PA 4KBZA 1C1FA 1YWKA 2P3YA 3N3HA 1PVXA 3DEMA 4AGRA 2BBAA 4FBFA 5JMOA 3HNBM 2R30A 3A4UA 4IEXA 4XIKA 3VD5A 3H1YA 4QPWA 3UKNA 1Z0HA 3AXDA 4LBQB 2IXKA 2O0OA 1RUOA 2ZS6B 5LBBA 1GMMA 1O4YA 5EFUA 1SPPB 3Q9OA 4JKLA 4N43B 3ZKUA 3PLQA 5ANQA 2D3SA 1RVF1 1RTVA 1FPN1 1U0AA 2HEYF 1POV0 2WWUA 4GMP1 5BPXA 4AYUA 5JR2A 4R8HA 2R0HA 2XUEA 3BYWA 2Y6LA 3UNPA 3LCPA 3WINE 4HVOA 3IN9A 5BNPC 4BQYA 1F31A 2AENA 1YYNA 1XNKA 5B4NA 4PF5A 1UU6A 4CU9A 4XJWA 1VRH3 3RS6A 1DIWA 4AHZA 5FXZA 1WGPA 5FY1A 2A6ZA 4XDOA 4JKMA 1HRV3 5KC6A 4XFBA 1W0PA 5L19A 4P08A 2X5IB 2V72A 3HQRA 4CYDA 4P9JA 3MW2A 1RUJ3 1W6MA 4IERA 1DYOA 1JH5A 3WHUA 1IPJA 3ZXFA 2B7YA 4V1PA 1W6PA 1XNTA 1S0EA 5ISLA 1YI7A 2K9ZA 2VZOA 2Y6KA 3AP4A 5FYSA 2R061 4GWNA 3IZOA 1NOVA 3PVEA 4Y22B 1JZ7A 2VW2A 1VRH1 1P8JA 1ND2C 3PU3A 1S55A 4NR1A 5A7SA 4FPKA 1JYCA 3BTYA 4LBLA 3TOJA 5FRAA 2QJVA 2VMIA 4CUAA 4BPZA 3B01A 4NHXA 1UKRA 3SC7X 4CUBA 4AFDA 1GWKA 4WM8C 4CDQA 1RUG3 3JQWA 3MI8A 2JD4A 2BJSA 5FZHA 4PBPA 2VMEA 2VOTA 1W8TA 3UGGA 1YQ8A 2JENA 2Z69A 5C8CC 2WT0A 1D2QA 1PIV3 4GKXA 1Y4WA 4XCAA 1VBE3 1DQ2A 2DYCA 4LUMA 3PVBB 1MS1A 2VQAA 1LODA 3H8UA 1DZRA 1QH7A 3V0AB 1AR82 5FQ0B 1SBFA 2RMU2 2VULA 4NWVA 4Q4W3 1GQPA 3OEBA 1VAKA 4AVSA 1F15A 3POBA 2RMU1 5LA1A 5JVVA 3VDDA 4BYYA 2PAEA 2RV9A 4URTA 1H1AA 1X9PA 2PQQA 4KWJA 4GB31 3T08A 3H8OA 5DXDA 2WNUC 1GZWB 2WZEA 2R16A 4XXPA 4YW3A 5A6QA 1UY3A 3TEXA 3VBFC 3RDIA 1UU4A 2PHFA 4D94A 2JX9A 2J1VA 1TNFA 1UOBA 2ZKNA 5EHDA 1WLDA 5LY2A 2WA4A 1KEXA 2OPKA 3H3LA 4QDRA 4QU1A 2R32A 2R072 2IXJA 4TXWA 2A3YA 3MPBA 4J1XA 4OUSA 4DXTA 3DL3A 4UBGA 1W6OB 2ES3A 1W03A 1LULA 4PIXA 5C9AB 4A6SA 5JMCA 1AR73 3UYJA 4YW7A 4CCDA 5C5TA 1Q8SA 1EY2A 2LW8A 4MO3M 1VALA 5FP8A 1R092 4AL9A 4YRDA 3U14A 4AEDA 1BCXA 1VBD1 3GCWA 3DF0A 4QMAA 5E88A 3VKNA 2RVAA 1NZIA 2XWBB 5FMBA 5A3UA 3NJZA 4DNYA 5BY5A 4XFAA 3FHAA 5JWPA 4NIDA 5I93A 4ES9A 1O6UA 4PIZA 1W8UA 4PCRA 1MEC1 4A7KA 5LA0A 2DCYA 2V09A 5CKQA 4DXRA 4WVMA 1CAXA 2ZX2A 1RXGA 1VBC1 2ZGLA 2WO3A 3RNSA 5BYNA 1DF0A 1KJRA 2Y38A 5A32B 3KCYA 4L8QA 1XNCA 3OD0A 1L7LA 1RHI3 2ZGSA 5FZ7A 2Y60A 2JE7A 1GOGA 1XRUA 4FOVA 4IEUA 4BLIA 1UU5A 2ZTNA 4CDUA 1QNWA 1R1A2 1UD1A 1A8DA 4N43A 3SKVA 2WYFA 4QX3A 5E8AA 1HDKA 1HJGA 1UAIA 3MIFA 4DXZA 1TME1 3FUQA 4UBHA 5AFBA 3M2MA 4QXHA 5FZ8A 1WLWA 3LF7A 2NZ9A 1KFXL 3IPVB 4BQ2A 5DDJ1 1WW6A 1ZZBA 1ULOA 4ZU7A 5F37A 1J3RA 1TMF3 1UKGA 5FUPA 2QQKA 4FFGA 3T30A 1D2SA 4H7MA 1LTEA 4QQOA 2G1MA 4K21A 4Q4V1 2C0ZA 2VNVA 4COWA 1UX6A 3H1MA 4HKLA 3KLSA 4YM3A 5CFCC 2ZXQA 1IGOA 3ES1A 3OSDA 4YSFA 1DGWA 1WA4A 1NCQB 4U2AA 3ILNA 2Z79A 4JGYC 2VNOA 4JVAA 1BYHA 3L2HA 4B7KA 4XBNA 5M0TA 3RZMA 1LGCA 4XURA 1QJX2 2RS12 3FBYA 4QQLA 5JXJA 3THCA 1OQ1A 5DAPA 3VKFC 1PGL2 3GZAA 2W1WA 2Q8EA 2VOKA 1PMHX 2WQ4A 2UY9A 3LAGA 3K3NA 5FO9B 4JZRA 4M00A 1HV1A 4M3CF 1LEMA 1GQHA 4QPGB 2OVUA 5F32A 2EA7A 1QEXA 3ZXAC 4JGZC 2ZEWA 3E1F1 1RIRA 2GU9A 4UI9L 4Q8KA 4A3XA 2LROA 4N7IA 5K7PA 4YYOA 3LDRA 4LA2A 4YGDA 3WX5A 1S4CA 2Y64A 3VBSA 3RYKA 2ADDA 2HEVF 2VOWA 3LEGA 3LEIA 4HG6B 5CB7A 4NAOA 2XH6A 5ERLA 2EIEA 3OB8A 2ORXA 4YM0A 2XR4A 2HWC2 3D5OA 2UYAA 4YM2A 4CPBD 4CP9B 4QQHA 1CJDA 3USUA 3I59A 1JMUB 5EQUA 1JYWA 2GNTA 3QLQA 3KGLA 2RHPA 1OA3A 4XHXA 1FATA 3ILFA 4AQSA 2CDOA 2OXBA 5FYHA 5L7OB 1W05A 4NE9A 2FDGA 4N9HA 2VMFA 2GP3A 2YC0A 3NNJA 4P9LA 3SLIA 4RR3C 4HT1T 4ZY9A 3BTZA 3IWZA 1ZBA3 2GC2A 4MH0E 4N8MA 3W58A 1FOD3 5DZGA 5A3PA 1ASJ1 2VCMA 3SH3A 2VC9A 4ZXEA 5IVFA 1JU3A 1PX4A 5CISA 5LBEA 4XUPA 5I0SA 2J1RA 2EIDA 3CJXA 2QQOA 4JQTA 1G9DA 2OA2A 3CLPA 2B45X 4NRPA 1ODNA 4N53A 2VCAA 3PVOA 4Y20B 5FUNA 5FBZA 5DPNA 4XEZA 2ZA9A 1AR83 3ZFGA 1A78A 4R4XA 3ZXGA 1KDKA 4Y5TA 4QXCA 2XBO3 3WOGA 2XQRA 2ZX3A 1WLTA 2F17A 3OPZA 4BJ0A 4HKWA 4TTGA 1JZ8A 3VZJA 4FTEA 4TZDA 2CAVA 4I0BA 3OUJA 3NV2A 1C3HA 4TSVA 2EXKA 3C3VA 3ZFEA 2ARXA 1S0JA 4XJ8A 3VBOA 2ZACA 1AR81 3W5NA 1ZZ7A 2A73B 2D6KA 3LZZA 3K46A 4MGKE 3TBDA 1NQDA 4UOJA 4C90A 5CG8A 2K0GA 1GUIA 3JD73 4CCKA 3GZEA 2R062 2R6QA 4Y1UA 1CONA 4HPKA 2AR6A 3KM5A 3IKWA 4NMIA 3HT2A 3OY8A 1RMU2 1OI6A 5I91A 1NCQC 4Y24A 2GDFA 3KF3A 1K45A 2WRAA 4I3PA 4JRAA 1AX0A 1YI9A 1O4TA 5DABA 4CDUB 3ZIWA 2BRTA 3WDYA 2R071 1OUXA 2YV8A 3U11A 3UETA 5LCWL 2LS6A 5EV7A 3JU9A 4UFMA 3VZMA 4IUGA 2A6WA 2VW0A 1CN1A 3JBG2 1HKDA 1ONAA 4XZUG 4NHLA 1AX2A 2QQLA 4TWTA 1QJU2 2FMDA 2VMCA 4FXKB 4L92A 4GALA 1VBC3 1MPXA 2WSUA 4QGLA 5SV5A 3E5QA 4Y3OA 3SKJE 3ZVXA 1GQGA 4XABA 4DIQA 1W2AX 1C57A 5JCTA 3WCSA 4LXLA 1QJY2 4PQQA 1RJ8A 1GU3A 4RFRB 1NXMA 1QWRA 1NX9A 2VUCA 3GALA 5EZWA 1T6BX 3I49A 1FAYA 2WNVA 2Q8CA 2VVFA 2AACA 5CIRA 2J7MA 5FDBA 4HFSA 2QZ2A 2IC1A 2UU8A 4OCTA 1F5JA 5KHIA 4FPOB 4C91A 3IAPA 5F9TA 4JGYA 2IUWA 5C6CA 1H8TC 5C7GA 2IXCA 5DZFA 3PUQA 5JIUA 4R9CA 2VZTA 5H9RA 3VHPA 4DS0A 2WUHA 2WZR2 3GNEA 4LE4A 1DP0A 1YQCA 3DECA 3MV01 4RN5A 4WZCA 1CAWA 1KRIA 3PU8A 3B5LB 4Q0PA 5IJRA 4BZ4A 3AL6A 4LORA 4L0PA 2IVIB 2NN8A 4KH9A 2BP6A 4HANA 3BODA 4NIHA 4IEVA 3BGAA 3S7IA 4AI0A 2NPIA 4V2WA 4PI0A 1AR63 5GLZA 4YZ4A 5FAXA 1MQTB 4XF4A 4NN0A 4XETA 4IE5A 5KHHA 1QIQA 4ZS3A 3SMHA 3VV1A 4R9DA 3S5AA 3UJQA 1YEWA 4I30A 1NT0A 1WKYA 1LHWA 5IK7A 5LZ6A 3J7MA 1RUF1 4P9WA 5C71A 1JZ2A 4BK5A 2HWB1 4RHV1 3V0AA 1MQTC 1W8NA 2PHLA 1S0BA 3RZHA 3NRUA 3OPWA 3N7LA 3KQ4B 2C5DA 5LB6A 4F83A 1I9RA 4Q27A 3T4HB 2BPA2 4MGYE 4GH4C 5CFDB 1HB4A 5FXXA 1XYOA 2GNDA 3AJZA 3ETQA 4I3GA 4X6RB 5I8SA 3BB6A 5DAWA 5LRSA 1UMHA 1VP6A 3I2HA 3I3DA 3PIJA 4IEOA 3AYCA 4K3UA 4QHZA 5FJKA 1QOSA 1X8MA 4QKNA 5IK8A 2AYHA 1X8EA 2MPFA 5CYYA 1JYXA 3RZLA 1LHNA 4GJZA 4GULA 1W0OA 4MOAA 3WG4A 4BQ4A 1AXZA 1H2NA 3KCXA 1H2LA 1BKZA 2LUWA 4Q29A 1XSRA 4QHOA 5FZLA 2AUYA 2ZEXA 3WG3A 1YIFA 3ZOIA 1F9KA 2ID4A 1KD7A 5IW0A 1GNYA 3I4IA 1FOD1 1IHMA 1QU0A 1SACA 4HMZA 3F2ZA 4DEVA 1QHDA 1IKQA 2BOIA 4EZHA 4IE7A 5FREA 3ZN5A 4CEYC 4HZFA 4D7YA 2WN2A 4FQ4A 2EIGA 3WCRA 5L9VA 1R1A3 4XE9A 4XCBA 3CU7A 1DQ0A 3I7DA 5FP7A 3JZVA 3ZXEA 1IQDC 1JTZX 4DZGA 1K5MC 5JDBA 4IGOA 3VL9A 4LNVA 3VBOC 4FOWA 1Z78A 2HBTA 5T5PA 1IG3A 2FMYA 4EN8B 2VZQA 3NJVA 3T3YA 4ITCA 4OUMA 2XBO2 2WNOA 1WW7A 3IIAA 5C8WA 2BFUL 1B35A 4Z07A 1LAJA 3W21A 2RR12 2CTVA 1VPHA 4K40A 3H50A 2RMU3 2BGPA 4A3ZA 3RZZA 4RGAA 1RJ7A 1H4HA 4A42A 1OVPA 3GZUC 2XKPA 2W47A 2DVBA 1HN0A 1BHGA 5B4XA 3RSJA 3V64A 3WF4A 2VOXA 4M3CB 4UFIA 5CZKA 1UOGA 5EJ3A 1FMD1 1FNYA 2E26A 3AKTA 4KU7A 1JYNA 4UYBA 1AXYA 1I5ZA 2CDPA 4R4ZA 2PQSA 1VJ2A 4XFIA 3M4FA 2WQ8A 3P6BA 1RGSA 1T6GC 2E7QA 2W2IA 1XE7A 3QACA 4YLZA 1NE4A 1EV13 3MW4A 3ZYFA 4XUQA 1C8NA 3BOPA 5A1LA 3N36A 4Q4V2 5GZFA 4Q0UA 3UKTA 4FPCA 4D8MA 1RUH2 1QQP3 1SDDB 1XNAA 4HK8A 5FMDA 2WNVB 1PO11 3H1WA 1N3OA 5A1AA 5HXVA 3TEYA 4XTMA 1IPKA 3AXEA 1CIWA 1TME3 2GMPA 4HXCA 4BMEA 5K0UB 4F3JA 2ERFA 2Q30A 5FYTA 2D6PA 1DYKA 4RD7A 3NVCA 1SMVA 2CYFA 5C8CA 1E5IA 3ACFA 2DBNA 3FC0A 3SH5A 1Y9QA 4LKFA 2YGLA 1ND3A 1R093 4IE0A 1W28A 2CNAA 1QOOA 1RMU1 3H7YA 2V4AA 1JYVA 3LIGA 4AGVA 5KR7A 2ZPXA 5DUUA 4DRRA 1HXS2 1POV3 3N7MA 3FBMA 3ETPA 3O1TA 3IMNA 1FPN2 2Q8OA 2CWMA 1JW6A 2QFEA 4BISA 1OD5A 1XNDA 4SBVA 5IT6A 3O1RA 4S2FA 1TVGA 1G9CA 2WWSA 3WW3A 2I74A 5L9RA 3ZN6B 4YW2A 4IETA 1MZEA 4K9SA 4NIAA 4AQ6A 3PTRB 4CUCA 1W0NA 2JDHA 2ETEA 4CEYB 4CCLA 4LO5B 3VDBA 1A3KA 4Y5SA 4XF9A 1OKQA 4KL1A 2B9UA 3K75B 4QM8A 2PFWA 2YXSA 1CAVB 3POEA 1R081 4OYUA 3TNPB 4OZXA 1GP5A 4EE2A 2IZWA 1GWMA 1XU1A 3ES4A 5J37A 3NAPC 4LBQA 4LR4A 4BMBA 4Z92B 5C70A 1XYPA 1S0CA 5A3LA 1X33A 1ZM1A 2GMMA 2VCCA 2X09A 2VNGA 2V73A 1ULEA 3QCWA 2D44A 2ZGQA 2A75A 2ZGMA 3I3EA 4EN6B 1R083 2WWJA 3CO2A 4OZOA 1IKPA 1I6XA 2A70A 4HOOA 2RS31 1O3SA 1ZA7A 3QD6A 2VMDA 3MYXA 1QXJA 4NRQA 4AEMA 5KHJA 3SH4A 1HN1A 4YG0A 1NYWA 1RVF2 4Y20A 4Y1ZA 1JUIA 2P34A 3NV1A 2VZSA 4NPRA 2G9FA 1RYYA 2E6VA 2E63A 2EAKA 3CEWA 3FL7A 4OLLA 4WM7A 5E6HA 4D0QA 1WCQA 4AI8A 3U37A 3RYRA 1AUYA 3J4UH 5KXBA 1VAMA 2JKBA 1RINA 1COV1 2WO2A 4LMFA 3V56A 4LO8A 2ARBA 2WNUB 3NW4A 5FYVA 1ZZCA 4Q4X2 1MVEA 3ZPYA 1ULCA 1STMA 1O7FA 1WCKA 3HBKA 1QOTA 2WT2A 1S0GA 3C7GA 3LFMA 3H8XA 2DVAA 4QXBA 1AL23 4NIIA 4E2SA 2KA3A 1ZNPA 2ZX1A 1ZYBA 4LHKA 3ZSEA 1US3A 4FPGA 3K2OA 1NCRA 1C8M3 2HWE1 4P00B 3GCXA 5FLHA 1PMIA 3VGIA 3VKMA 4AHWA 4TYSA 2MEV2 1W8WA 4RFT0 2WZR1 1K5MA 1VBC2 3H0OA 4AVAA 1PK6B 1PVC1 1RUD1 3OBRA 2MEV1 2HYKA 4ZU4A 3RJRA 3VBRC 3M7AA 1H4GA 2ET1A 1AJKA 4MHUA 1QJY3 3W59A 1E5SA 2XLAA 1R1A1 1JYIA 4ZKTB 1C8M1 4XBLA 1ZBA2 5EP9A 3CL1A 1A34A 1NA1C 1SPPA 5T5OA 4KI5M 4B29A 4ZPIA 4P9YA 1X36A 3PJYA 5FY8A 1APNA 1QXRA 4CZSA 2YMZA 5FMCA 5JSOA 3LB9A 3WNMA 5GLTA 1F2NA 4E4HA 3ENRA 4DB5A 5K8SA 1BMV2 2GC0A 4LBNA 2D93A 3SEPA 3ITQA 1PGW1 5HV0A 5FP4A 4YM1A 3KB5A 1HQNA 3N7KA 2O8OA 1UPIA 1MS9A 3WVJA 5GZEA 5BNNB 3B93A 4E4ZA 3BVCA 3ZPOA 2ZHLA 2D7FA 1DQ5A 1XE0A 1NXD1 4UFHA 3D3AA 1SZBA 2HWB2 3I97A 4RHV2 2W46A 2ZGRA 5JZGC 3ZMNA 4PDWA 3DN7A 1ND3B 4KBBA 4L11A 5A1FA 2ZHKA 1A6CA 5H9SA 5IUQA 1CX4A 5FR3A 1SCSA 3N9MA 4GWIA 3ZMOA 1BZWA 1XYNA 1YFXA 2ZAHA 2HKXA 4URAA 3WNPA 3WDXA 1EV12 1U5ZA 4AEKA 2ARCA 5GLVA 1JUHA 1LHOA 1SLIA 2RS52 1RUE1 1PNFA 2RM22 4YVWA 5BNQA 4FO9A 3JB4C 4M3CE 1L3JA 2RS51 3DUIA 4A7ZA 3EYPA 4IGPA 4JDNA 4B8EA 4EV0A 4FVVA 3MPPG 4LKDA 5DUVA 4IV3A 5A7QA 4Y33A 5BUVA 4EWDA 2OUJA 4QB2A 5F3EA 1LESA 4D6RA 3GDBA 1Q8PA 1B09A 1W90A 4HN1A 1H0BA 2FDJA 5F8PA 1K12A 4IXLA 4YNIA 4YGEA 3VDDC 3HNMA 1VBB2 1AVBA 2D5HA 3HMYA 4M0HA 3OYWA 3JXSA 2W1UA 3MFCA 2EXHA 1JODA 1B35B 1WCDJ 4Q1PA 1G8WA 2DTWA 1W2NA 5KHGA 3UJOA 1VMHA 5IATA 3FX3A 4MX3A 3WDVA 3BUCA 1GZWA 1AR71 4XMAA 5ABJA 3X29B 5GJ6A 1IS4A 2ATFA 4JQRA 2PYTA 5HPOA 1GV9A 3MLLA 1NLQA 3M70A 1RUI2 2OX0A 2BFUS 2V4VA 3J8F2 4M3CA 1AZDA 1MS5A 4E27A 5IWFA 5A3WA 5LEJA 1JHNA 4P9IA 1DYPA 1DBNA 5JSPA 2A6YA 1ACCA 5A7WB 3VD9A 1KJLA 1QH6A 3VL8A 2VMGA 3AYAA 4L99A 5FXWA 5FZ9A 2C24A 2AEZA 4JDOA 2Q1FA 3RZKA 1W06A 1ASJ3 1WCSA 1W8OA 2BTVC 4YARA 1URXA 1WBFA 4YG6A 1X50A 3WQBA 3M3CA 4GJYA 4NHYA 4JTOA 5A6ZA 5JSRA 2QDNA 5I0UA 1UZYA 1UZWA 5JI7A 5CADA 2BOJA 3ECQA 4QD2A 1VB2A 1FV3A 1W6QA 2D5FA 2WL1A 3MEPA 4PT6A 4FPFA 5CFDC 3ZYRA 1CESA 5F1RA 1CZVA 4N43C 1OLMA 3VBHA 4B4RA 2V5YA 1BEV3 4N9IA 4PLOA 2FCUA 1IS6A 1UYZA 1RUH3 4RGGA 4RS5A 4BXFA 3WG2A 1W2OA 5IAXA 1F8VA 3AZVA 3NV3A 3ZN6A 4XILA 1EAH2 3DYOA 4W8JA 5FZ6A 3I3BA 2D40A 3FUOA 1QJFA 3IDBB 3M3OA 4INDA 2JDAA 1KQRA 1AYM3 1LOAA 4A7YA 2YPDA 3MUZ1 1LU2A 1RC6A 5CFCB 5GKAC 5FPAA 2BW8A 2ZGUA 4LBOA 3S7EA 1RUC3 4H3WA 2JDZA 1VBB3 3RQ0A 3UGHA 3U4XA 2XPJA 2NP0A 3WW1A 2Y34A 3B9CA 4QB6A 4EYUA 3ON7A 5T52A 4I02A 4IEZA 4COUA 4FTSA 1AX1A 2BWCA 3WQ0A 4R52A 2Y33A 5LY1A 2JG9A 5FZOA 1ZZ8A 3RRDA 3ZR5A 4WV8A 1W9WA 4GA9A 3TAYA 1TEIA 3P5BA 3I3MA 5F5IA 3NKTA 1KDMA 2JDUA 3AX4A 5FZ0A 2QQMA 1DLCA 1W6PB 2RS32 3LKJA 4GAZA 2QZ3A 3T4VA 1SCRA 2R043 3SCHA 3U75A 4CEWB 4FFFA 1RUE3 2DUPA 1UYPA 1QMJA 2WYSA 3H42B 1OPMA 2CSGA 3VBUC 3ZYGA 5FP3A 3A0NA 4JV4A 4NVPA 2NMOA 2YB7A 2YU1A 2XDVA 1UW8A 4GH4A 1BQPA 1EAH1 3THDA 4JHTA 3FJSA 4LOSA 5A80A 3H9AA 2WAOA 1XJAA 5C3QA 4LHSA 4CXYA 5LATA 3C7HA 1DLLA 2X8KA 5GALA 4G9SB 4K1YA 4XBQA 4EZ4A 1ZRCA 1UOFA 2J1UA 2VU9A 2EAAA 1E57A 3EMRA 3AKRA 5HCFA 2FCVA 1V6OA 3OJBA 1NA1A 5FK7A 4CDXA 5J09A 1Y3TA 2K46A 4JKKA 4BQ1A 1HB2A 4IV1B 2JXAA 3I59B 2PLV3 1NCRB 4XJUA 5G04L 2TBVA 3HQUA 2JDYA 4M4PA 2ZGTA 4D69A 2XGXA 1CAVA 2F6BA 4GIQA 5FZMA 5GLUA 1KS4A 3AVSA 3ZN4A 5BNOA 3F95A 4RQPC 2PTMA 3NWKA 3ZYBA 2PHUA 3C2UA 1QJEA 4UW3A 3R4SA 2RJ2A 3LOIA 5AFEA 1MS0A 1MS8A 3POGA 1I1EA 1XC6A 5AC91 3VDCA 4IV1C 3HQXA 2BBVA 2GMEA 4NPMA 5FZKA 5ABJB 2EIBA 1LENA 2QDRA 4NO4A 2WABA 3LSEA 1G6NA 2RJLA 1UWWA 1ZZ6A 2VVDA 1S2BA 2YU2A 3OF1A 4WVWA 4XPVA 5EPAA 1SHWB 2D98A 4MV2A 4C0BA 2G9GA 1FNZA 1GR3A 3IPVA 5CAZA 1HQWA 2Z2SB 4OULA 5IYYA 1XPWA 5A7WA 1XSQA 4QX7A 2ZZJA 3ZFGB 3DV8A 1Y43B 3LIHA 3HJRA 1QJU1 2Q1MA 4ZU5A 1VLNA 1VB4A 3B00A 4KWKA 2Y6GA 1PZ8A 2DVDA 2ZCWA 5G05L 4A6OA 3ZXDA 4XAEA 2W87A 2VGDA 2WS92 1V9U1 1QDOA 1DZTA 4MSVA 2BNOA 3KV6A 4XACA 3TWIA 3VKOA 4L2NA 3VLBB 3AK0A 2OZ6A 4C1XA 4AEJA 3LSDA 5EYYA 3USSA 3LOBA 3D0SA 3J8F3 4TLGA 3I2FA 4O9GA 3EO6A 3HD8B 2WINB 1WBLA 1SLBA 2ZAAA 1JZ4A 1XXNA 1TMF2 2UURA 4XYXA 4B4PA 4NUBA 1ND2B 2E7AA 1CAXB 3ZDVA 3B69A 2YC2A 3Q8CA 2JG8B 5E89A 1GANA 5J96B 4XAAA 5GZGA 1ZRDA 3K48A 2VQ0A 3R05A 4Q0QA 1HJFA 4XFFA 3MIHA 2IXIA 2YYOA 5EJ1B 5C5UA 2OPWA 1VIWB 3ZSMA 1UY2A 4RL7A 1HX6A 1W04A 2PN5A 4J1WA 2PHTA 4L97A 4FPLA 1RHI1 2HJIA 3T2PA 3TEWA 4XHBA 4UXAA 5LW9A 3NL1A 4QXKA 4RGKA 3KVBA 4UFKA 5BNPB 5A7NA 1RUH1 2WO1A 3SISA 4FPJA 3HOBA 4FP2A 1BEV2 1J1TA 3ORJA 3O1UA 5BNNA 4GD4A 3CJIB 1AR91 5FKBA 1Q8OA 2RS11 5AVAA 1OKOA 5BV6A 1BBT2 3IB3A 3W9AA 3LQCA 1CZSA 4CTEA 3WNOA 3AP9A 4CVUA 3VB9A 2XJVA 2VQUA 2D6NA 4AQ2A 4XFGA 2YGMA 3ZYPA 1QJZA 2ZGNA 3JBG3 3WEZA 1QJX1 1UO9A 2GZWA 2VUAA 3IDEA 4KG8A 4LKSA 4OI4A 3O0VA 1AL22 1DGLA 2RJKA 5FMOS 1DQ4A 1PO23 3MUY1 2H6BA 4B1MA 3GM8A 3VZOA 2ZMKA 4QM9A 4W65A 5FYCA 4HK9A 2LRPA 1EV11 2P3JA 4YZ3A 5K0UC 1ZZ9A 4YW4A 3T09A 3NSTA 5KWRA 2O8QA 4W4ZA 1SDWA 1DQ1A 2F4PA 1Q8VA 1YO8A 2R0FA 4BU2A 2JJ6A 3PVNA 2Q5TA 5FTTC 1RHI2 2WFF1 2B42B 3HBZA 1NLRA 3OD4A 1FT9A 5D8AB 3UK9A 3MZHA 1CIYA 2P3IA 3WHTA 1JOBA 1MQTA 2JE8A 4AG4A 2RS33 2N7GA 4DINB 5FLJA 1OOPB 2G19A 1RUI3 1RUG1 4FSJA 1N1TA 3WSOA 2GSYA 1F4HA 1WZXA 3G7DA 4OHVA 3BALA 1RL3A 1HLCA 3LGRA 4BH9A 1PK6A 1V6LA 2DWRA 1J84A 1Y9MA 4OI0A 1CPNA 3EXUA 3D4KA 2W1SA 3AKSA 4BM8A 2YZ4A 4LJHA 3UL2A 5F5AA 2JE9A 1ASJ2 4M0NA 4RS5B 5IFPA 1MZFA 2UYBA 5FZDA 1YJKA 3RG0A 2RDRA 1S0DA 4Q0SA 4XVHA 3A22A 1OOPC 1SQ4A 2KM2A 2ET7A 4QX2A 4WZFA 5FZGA 2VO5A 4ZZ5A 5CFCA 4B3NA 2HWF3 4HETA 2D97A 4IEYA 2CHHA 3MIDA 3LEMA 2DU0A 1V9U3 4XQWA 1S0FA 1UYYA 2GNMA 1W8ZA 1ZVFA 2GC3A 3AP6A 2JECA 3J7NA 4F7ZA 5C9AC 1BXHA 1UX7A 3AMQA 2ZMLA 4M01A 1BBT3 3POIA 4SLIA 5L7OC 1O8SA 1YFYA 2WZPP 4CDQC 3D8CA 2OKXA 4RQPB 3WW4A 2RS53 3D6EA 4QDQA 4QX1A 4MLOA 3OCPA 4HBNA 1PGSA 2AGSA 2YBKA 3IIIA 1V6NA 4BQWA 1AYM2 2E9QA 5FZ1A 2VY0A 3BU7A 5FY5A 3P3NA 2DUOA 1N3PA 1LB2A 2P5BA 4H55A 3MLKA 4MUVA 2JEMA 4CEWA 5A33B 3BN6A 5JIAA 2BEOA 2Y6FA 3NNLA 5KC5A 5F7UA 4UF0A 3GYDA 4BWOA 5FZFA 2GAUA 4EN7B 3DPRC 1JBCA 3K4AA 5J36A 1CAWB 1BK0A 4GH4B 4QPGA 2EICA 3AZWA 2NYYA 2WS93 4IGQA 4Q4Y3 2WA3A 5LWBA 3BCWA 4FP3A 3MDPA 4AW7A 5KHKA 4IW3A 1ULPA 5GZDA 1PZ7A 3TNQA 1V6JA 3VBFA 5KXDA 1NA1B 2RDSA 4D7TA 4LT5A 5LK7B 1UF2C 3SEEA 2QQIA 2DURA 2WZR3 2PAMA 1Q56A 3B9IA 1W9TA 4D6SA 2QQWA 3WF2A 1UXXX 1CAUB 3U1XA 5JXHA 3D0JA 1O5LA 4O9EA 2DCTA 1MZ5A 1JXNA 1QJY1 2XWJB 2ZX4A 4HONA 2JG8C 3CJIA 5IFTA 2QQVA 1AYM1 3E5XA 4E2GA 3U78A 3PHMA 1HRI1 3CKHA 1UCXA 4Z2WA 1TMF1 3BPZA 5F2SA 3ST7A 3BIEA 2Z5WA 1H9WA 2E7TA 1IG0A 2Y6JA 1SBDA 1CGPA 5FFOC 2J22A 4GB32 3VD7A 4JX0A 4E8DA 1LHVA 3QH7A 4CCMA 2BGOA 2JIGA 1U12A 5FK8A 3MFAA 3U4SA 2RS13 5FZIA 2DV9A 1UZZA 5FYBA 4CCNA 2TUNA 3PL0A 1LNSA 2FBEA 3QH6A 3JD72 2QCSB 1VAVA 1AR93 4I0AA 1VBA1 5D21A 4Z8BA 1CVNA 3MF6A 4OQ9A 3NNMA 3BU0A 2E51A 2ZHMA 4CU7A 4YVSC 5FPXA 5GM0A 5FY0A 1BVP1 3ATGA 4ASKA 1WW4A 1CPMA 2A1XA 1SFPA 2DCJA 1I5PA 2XJQA 2F4LA 4UFJA 3A0KA 3OBZA 3OGGA 4HL0A 4CXWA 2XQXA 1H6XA 3THTA 2QQUA 3ZFEB 5EJZB 3NV4A 3TN91 2PHWA 2VR4A 3LEKA 5FKCA 2QQPA 1VE0A 3EQEA 3OBAA 4MGQA 1TG7A 2BQPA 5FZ4A 2OZJA 4B4QA 4OQ8A 1CWPA 3WQ7A 2HWC3 1H8TA 1RUC2 2GN3A 2DU1A 4EN9B 1RB8G 3V0BA 3KVAA 2BVBA 1KGYA 1WUVA 3NAPB 1DHKB 3ZSJA 3DGTA 3H3UA 3RZGA 3WLUA 3B94A 2WFF3 2VAUA 4Y4RA 3O0WA 5A6YA 4V2VA 5FO7B 4W50A 3LFIA 4XW3A 3WY6A 4AI3A 3NQHA 3FHQA 1DCSA 3ASIA 1VBE1 2B8MA 2CV6A 3AKPA 3H3ZA 1L7QA 2JDPA 1J58A 2QKDA 2VNRA 4FFHA 4TN7A 4GZ9A 3NO8A 3VKLA 1BJQA 1XB9A 4AE2A 1VBE2 3BTXA 2BVVA 3POSA 3IT8A 1OH4A 4KNCA 3VDAA 3Q8AA 3NNGA 1F5FA 4ZS2A 1GLHA 3WF0A 1RUE2 2JB8A 2RM21 2VUJA 2EVXA 1WD4A 4BDVB 4I09A 1LOCA 4Q4W2 1FI2A 1UYXA 4QPIB 4RS5C 1BMV1 1OQDA 2XL9A 2C4XA 1W99A 3CMGA 4IESA 1ZBE2 2XOMA 4JCKA 4QKBA 1YIPA 2W68A 1OUSA 4LA3A 2P6HA 3RJ2X 1ZBE1 3GHMA 4JRLA 2VTXJ 3I3QA 2OS2A 3WT3A 1RITA 5IVYA 3WXPA 1O3RA 2Y26A 1GBGA 1W6MB 2QBXA 1UL9A 1AR62 2VZPA 5FJHA 5T54A 4X8PA 2DFBA 4XF3A 1H30A 3KCCA 1LEDA 2MNGA 2NMNA 3I2KA 1AYN2 1EPZA 4QX8A 3KV9A 5FZEA 2VBPA 3KV4A 4QB1A 1W6NB 3O1VA 5FBJA 1QGLA 4K7JA 3ZYJB 3WDTA 3PJQA 2JG9C 1AR72 1I3HA 3AVRA 4CDWB 5C3RA 4QKDA 2XVKA 2RG4A 5FMOL 5F3GA 2FQPA 1TME2 3POFA 2VZUA 5T55A 3VUOA 4QX0A 3WUCA 4CEYA 4DUXA 1US2A 2JICA 2WKKA 2WN3A 2X5IC 3OPTA 1OOPA 5CNAA 5GLWA 5IVBA 1NG0A 2EF6A 4GQ7A 3J7HA 2CAUA 3CNAA 1DFQA 1HXS3 1CAUA 1UPSA 1J1LA 5BNPA 3V65A 5BNOB 3URFA 4DUWA 4P14A 1OA4A 1S1AA 2YHJA 3CQOA 4AFMA 1UQXA 3ILRA 5FQ0A 5JZGA 3T0DA 1V6KA 2XHNA 4JGZB 5ACA2 2VQTA 2R1BA 3IMMA 2PHDA 3GF6A 1U5IA 4PI2A 3CJIC 3MGUA 2QE3A 4KQ7A 5CA6A 4NHKA 2ZZQA 4LOTA 1QXPA 1HXS1 1AYN1 1PM4A 4IL7A 5FYUA 3VN4A 4AVBA 5T50A 2A6VA 1F35A 2ZJCA 1PIV2 4LIVA 3ZYHA 5FYZA 5BNOC 2D43A 3AMPA 3NMBA 1H1IA 4BIOA 5L73A 1PNGA 4K6BA 4ZONA 2HWE3 1D0GA 3AYEA 5SV8A 4GWMA 1LU1A 3QBQA 2D6LX 3OOXA 4IEWA 4QPYA 3DCQA 4IQPA 1C5HA 1YCIA 1PZ9A 4AK3A 3ZYIB 2P6CA 2GH2A 2C9AA 4P9XA 1DU3D 1Y7BA 5IK4A 1RUJ1 3PURA 4LBQD 2HWB3 4RHV3 4E8CA 4HVQA 2IWGB 3O7OA 4QGNA 4YW5A 1UZ0A 3OUHA 5DZEA 5I0TA 1R082 2WZ8A 1PM7A 5LASA 4YWAA 4AEDB 1AJOA 4QU2A 3RYPA 1VBA3 1YFWA 3R4UA 4L9BA 4CDXC 4FPEA 2SBAA 2XJTA 5J7MA 1JU4A 1N1VA 1QF3A 2Q1ZB 5A33A 2G9ZA 2NQYA 4AAXA 5A3NA 4ZXKA 4QDSA 4N53C 4B1LA 4ET7A 4UF0B 4WVMB 5JLVA 4COYA 3BIWE 4FPYA 4MXWA 3IM0A 4O65A 2Q8DA 4CP0A 4CPBA 1XQNA 4AI2A 3PIGA 3RI9A 3FLRA 3W5MA 3WF1A 1J3PA 4AVCA 3ROUA 1JN2P 3A21A 2R1DA 2VECA 3L9JT 4K20A 3HAGA 4H7LA 1W8FA 5DUWA 1VRH2 3KT1A 3M1HA 3FN9A 1G86A 1SG3A 3K77A 4AGGA 1X7NA 2VUDA 3CF6E 2FDKA 5HV4A 3PMEA 3I2IA 3FFZA 1PO21 3RVHA 2I2SA 3ZSKA 1SLTA 1BVVA 1ZRFA 3N9OA 3RGBA 1COV2 4W6XA 2GN7A 5IAVA 5A70A 2CGNA 4Q4X1 5DN2A 1N3QA 4IEQA 3THPA 5FY7A 3RMXA 1LECA 1EUUA 4BK4A 4G3YC 1XOYA 5HBAA 2PA7A 1OA2A 4FOYA 4UFLA 4X6QB 4X8NA 4XUTA 2FZ1A 4E2QA 5KBFA 1GFF2 1ZRRA 3N35A 3ZFFB 1V00A 2VZVA 2KXLA 2HYXA 2JWPA 1EP0A 1VR3A 1WMDA 5KXCA 4PDWB 3S30A 5FLIA 1A8MA 3FLPA 2NLRA 3N4MA 1YNAA 2UWAA 1W6QB 2ORZA 4HN0A 3O14A 5FWEA 4AVVA 3FE5A 5F39A 4DQAA 1ZBA1 1DQ6A 5BNNC 3AZZA 3RPQA 1W9FA 1YLLA 2XMLA 2Y0OA 3VBHB 3TEZA 3L2YA 3A23A 1ZBE3 1NUKA 3AC0A 4LUKA 3O1OA 1ZX5A 4AR2A 5B2GB 2VMHA 4AI1A 1YHFA 4BQXA 3G6JB 1LOGA 1WWYA 1VBA2 4JDMA 3BKZA 2PELA 1ALYA 5DUXA 2XUMA 3CBNA 4KGGA 5LBCA 1QJX3 2WBKA 1CQ9A 3LPFA 3VZLA 2FDHA 5FYIA 2SLIA 5LRRA 3VBUB 3TN92 2MHFA 2R063 2YC4A 4D6QA 1RUF2 2A3WA 2B9VA 4PJYA 5EWSA 5T3NA 2GH8A 4FQZA 1UN1A 3E6CC 4LBJA 4RYDA 3SCFA 2VBDA 3A7QA 4PF1A 3NNFA 1D0HA 2R073 3V0BB 1VBB1 3ACGA 4QAWA 4AXOA 1Q8QA 1KXGA 3RMYA 2DFCA 2ZABA 4XF0A 5JPNB 2HWD1 1FMD3 2RDNA 1OVSA 2GC1A 1DDLA 2R7EB 4LULA 1IPSA 2P4EA 4EWAA 3BTAA 3SNMA 1NQJA 1OSGA 1NY72 4NHMA 3WQ1A 4ARYA 2ZGOA 3B02A 3RWKX 2VPVA 1N47A 2JD9A 1LOFA 1PX3A 2VE1A 4OMDA 4IEPA 5A3OA 2PLV1 5LBFA 3K3OA 4MGIE 5J1XA 5ACA3 1N1YA 3HN1A 4WM7B 5H9PA 2WNEA 3U07A 2QVSB 2FHRA 4A45A 2QTWB 4S2HA 5IVEA 3MV11 2OQ6A 3M3IA 3ZFFC 2A3XA 1U5XA 2VM9A 5FPZA 3J9SA 3OEAA 2ZGPA 4LO4B 3VBRA 1POV1 4GMP0 4LHNA 1RUG2 1UY0A 1MS4A 4PBOA 3VBOB 2BDRA 2ZX0A 5JAXA 4ZHNA 4CCEA 3CZJA 4IE6A 2C9KA 1VBD2 5FCCA 3P1IA 5JPMB 1YFUA 1OH3A 4CRQA 5IK5A 2PMWB 5FPBA 2VZRA 1D4M1 4BCUA 2DUQA 4DUVA 5CKNA 3CDZB 4H2AA 3N9NA 1BK1A 2WAAA 2J1EA 4FCAA 3JCIA 3WF3A 3ZLIA 3OTFA 1W6NA 4XDPA 1AHSA 2BGCA 3C7EA 4UW5A 4KWUA 1JZ3A 2W08A 3M3EA 1KS5A 3OY8B 3MIGA 3MBWA 3OGJA 1LJ7A 4I01A 4AVTA 4BQ3A 5CG9A 2X05A 4CXXA 3FHIB 4M4RA 4Q0VA 2RR11 2I45A 3KT4A 4CDQB 4I2OA 2J1AA 5E1RA 2C1FA 2EALA 2YG0A 4ISQA 3VD3A 1UZVA 1WCUA 2DBIA 1RUF3 3GXUA 3AL5A 2KR2A 3AMHA 3MIBA 4LK7A 4CUGA 4XOGA 2EXIA 4NWWA 4CP9A 2ZEYA 4MADA 4WM8A 2HBUA 2R041 3T0AA 2FZ2A 5DQ0A 1OFNA 3DPRA 2WC2A 1TE1B 1W2TA 2VJXA 4QPGC 1C5IA 5LA2A 2KD7A 4WVZA 2B5HA 1LR5A 1FYUA 3HNYM 4DOUA 1G9BA 4Y5Z0 2A5ZA 1B35C 5DMYA 2LALA 1R64A 1ENXA 3J26N 1PVC3 1RUD3 4LITA 4XF1A 1BEV1 4FAGA 2H0VA 2WDBA 3KV5A 1ST8A 1OURA 1GNHA 3UT0A 3VDDB 5L36A 4Y1VA 1OT5A 4COVA 3HN3A 3FWEA 2QUOA 3FFQA 5HCBA 4Q4X3 4ASMB 3BPSA 2VCBA 4JGYB 2P3KA 4AFAA 2HWF1 4EROA 2XJSA 4ONUA 1ENQA 3HEIA 1S0IA 5CU1A 1MR5A 2UY8A 1COV3 2WLPA 3WW2A 1O3TA 5E16A 4YG3A 1JOPA 2LTNA 2WNVC 1C28A 3ZO0B 2FDIA 1ZRIA 2JG8A 4YGBA 3E6DA 4J25A 1AL0G 2H0BA 4FPHA 3CIHA 4Q26A 3IDAA 4Y4YA 5D8AC 1WW5A 2BU9A 3C7OA 4LBKA 3IAQA 1YJLA 1NKGA 1NZCA 1VBD3 3OGSA 3K4ZA 5F3CA 3PUSA 3EHKA 4CCJA 4C0HA 4FAHA 3RI8A 3AFKA 1V6IA 1EUTA 4XC9A 5K4LA 1Q5OA 3ZKYA 4D7SA 1OLQA 1GZTA 1NE6A 1ND3C 2XJRA 2G4IA 2GP5A 2ZBJA 3CZUA 2BYVE 3KMHA 4MG2A 2IXLA 2WJSA 5T5JA 4DPNA 2BERA 2HEWF 4JAAA 4N90A 5JR7B 5F5CA 4WM7C 4DY3A 3PNAA 1CZTA 3KF5A 5FPLA 5JZGB 3OYWB 5CVRA 3RWNA 1EYBA 1QY4A 2DVGA 1TNRA 3GZTB 3I8TA 2JB4A 2W9XA 4FOQA 4WBBA 1XE8A 3PDQA 5CFDA 4EJRA 2XJPA 1D7PM 3MLJA 5A7PA 2PHXA 2XVLA 5EXOA 1DZQA 3P3PA 3ZXKA 1YQ5A 2ARAA 1CR7A 3AP7A 1QNYA 5F6KA 1SFNA 3D82A 5FZBA 4ARXA 1W3XA 4YVSB 5JXIA 3U0ZA 3RZJA 4R9BA 2XONA 2DF7A 3TN93 1JZ5A 3O5SA 3JD71 2GNBA 3N9PA 1PO13 1ZA4A 2D6OX 2Y6HA 3HWJA 5BXXA 1OXCA 1C4RA 2VOVA 4CDUC 3H8RA 1DGRA 3LDKA 3MW3A 2XLGA 5FWJA 3AJYA 3E6BA 4KMQA 4FFIA 1UXZA 2IXHA 3LDBA 1REEA 1UOJA 3C7FA 5C4WA 2LM3A 3LPGA 2D3RA 2VH9A 4YW6A 2JDMA 1RMU3 2B39A 2Q4SA 1WA6X 3TYJA 1IS5A 2W92A 2CWSA 3O1MA 4LO7A 1R091 5I8YA 3VBRB 3UESA 3DXTA 1XBFA 1L7RA 3NJXA 1ENSA 1SBEA 5AC93 1EAH3 3N9LA 5CBLA 4MZUA 2PXJA 4NPLA 4AFCA 1PMJX 3VHNA 3GBGA 2E33A 1PK6C 4HLTA 4UT5A 5C3PA 3UKVA 2W3JA 3LWCA 4XIOA 2YFZA 2WT1A 2RDQA 3EJKA 3IDCB 4HKOA 2WO7A 4GXLA 3JB8A 3N7JA 1YXWA 3WDWA 3KHCA 1ND2A 2O14A 3N9QA 2W0XA 2VZ1A 1GYKA 3HPNA 4MXWB 4Q8LA 5LA9A 4AHXA 5GZCA 2YPJA 4HPKB 4CA9A 4QWNA 1ULDA 4KG0A 4MGZE 5FO8B 4ISRA 4Q1RA 1REDA 1GKBA 4OI1A 3UV9A 1D4M3 4LE3A 4HVRA 5EIYB 4OHZA 5LK5A 1IQAA 4YFWA 4XQDA 1Z7S3 4PDWC 2TNFA 2WR9A 4DMIA
chains in the Genus database with same CATH topology
3OG2A 3WNMA 4CU7A 4A41A 2DCKA 4YPJA 2DCJA 1I5PA 2LW8A 4JHZA 3SEPA 4MO3M 2XQXA 1H6XA 3LE0A 5EJZB 2VR4A 3LEKA 2J1TA 2RVAA 3OBAA 4MGQA 1TG7A 3FHAA 3D3AA 3I97A 5LA0A 2W46A 1KGYA 4DXRA 2C26A 2WO3A 3MO4A 3T2OA 3WNLA 4GWIA 4MGSA 4W50A 3WNPA 1GOGA 3NQHA 4A44A 3FHQA 3PUHA 1L7QA 3SKVA 4QX3A 4GZ9A 1OH4A 3VDAA 3NNGA 1ULOA 4BXSV 3EYPA 4OMCA 3WF0A 2QQKA 4BDVB 1H6YA 1UYXA 2C4XA 1W99A 4QB2A 2V5DA 3CMGA 3GDBA 2XOMA 2ZXQA 1K12A 3HNMA 4OUEA 2Z4FA 1W9SA 3JXSA 2QBXA 2W1UA 4XURA 2VZPA 5JXJA 3THCA 2W1WA 3I2KA 1PMHX 2E31A 4QB1A 2YFUA 5HPOA 3WNNA 1J83A 2V4VA 2ZEWA 2X10A 3E1F1 4UI9L 2VZUA 3VD9A 1YQ2A 2Y64A 4QX0A 4HG6B 3LEIA 3LEGA 4DUXA 1US2A 2WN3A 2EIEA 3OB8A 5FUIA 2ORXA 2BZDA 1W8OA 2B4KA 3J7HA 3T2QA 1JYWA 3WQBA 4DUWA 5IHRA 2CDOA 3CQOA 3T0DA 2XHNA 3PUIA 2VMFA 2VQTA 3ECQA 4ZY9A 3C8XA 3T0BA 2VC9A 4ZXEA 1JU3A 1PX4A 4PT6A 4XUPA 1CZVA 2J1RA 2EIDA 2HLEA 3ZM8A 4CU6A 2QQOA 1UYZA 3OGRA 2VZ3A 1O59A 2VCAA 5JXGA 3DYOA 4W8JA 5DPNA 3I3BA 3DYPA 2VTFA 2JDAA 3MUZ1 2E32A 1K42A 1NAEA 4BJ0A 4E8CA 4TTGA 1JZ8A 1OF4A 1UZ0A 4QB6A 2WZ8A 4Z2AA 3W5NA 3K46A 4UOJA 1OD3A 1JU4A 1CX1A 3ABZA 4AAXA 1GUIA 2W5FA 3I2GA 4QDSA 4ET7A 1W9WA 2QQJA 4XUNA 3W5MA 2QQMA 1DLCA 3WF1A 1JZ3A 3OGVA 3A21A 2QQNA 2WYSA 1K45A 3FN9A 1SG3A 2YB7A 3UETA 5LCWL 3K77A 2LS6A 4IUGA 4FI9A 3THDA 5I0DA 3I2IA 2WAOA 4XZUG 4LHSA 2QQLA 3C7HA 2VMCA 4LPLA 1MPXA 2J1UA 3SKJE 5DN2A 4JKKA 4PQQA 1EUUA 2W1QA 1GU3A 4BK4A 4A4AA 1NX9A 5G04L 4M4PA 4XUTA 2W91A 2J7MA 2VZVA 2HYXA 3IAPA 5C7GA 2RJ2A 4CU8A 3DYMA 2VZTA 2Y8KA 2ORZA 2WUHA 1XC6A 3VDCA 2EIBA 1DP0A 2WABA 1UWWA 1GOHA 3DECA 3MV01 4RN5A 1SHWB 4UAPA 1UMIA 3A23A 1NUKA 3AC0A 5IJRA 4XUOA 4L0PA 1GOFA 5IYYA 1XPWA 3BGAA 1JHJA 3HJRA 3ACIA 4GWJA 2WBKA 2JKXA 3LPFA 4DEQA 4LQRA 4A6OA 1JI6A 2Y6GA 5G05L 2W87A 2YC4A 1T2XA 2B9VA 1WKYA 4RYDA 2W94A 3A7QA 4PF1A 5C71A 1JZ2A 4BK5A 2ZEZA 1W8NA 3ACGA 4QAWA 3NRUA 3I2FA 3ACHA 3VD4A 1JZ4A 2R7EB 5JUVA 1UMHA 3I2HA 3I3DA 2YC2A 5CYYA 2VL4A 4ARYA 1JYXA 4MOAA 2JD9A 1PX3A 1UY1A 4OMDA 1UY4A 5EJ1B 2ZEXA 1UY2A 2ID4A 4P5YA 5J1XA 1GNYA 3F2ZA 4A45A 1F4AA 4DEVA 3MV11 3T2PA 2VM9A 3OEAA 2WN2A 2DDUA 1UY0A 2WO1A 3CZJA 2C9KA 3HOBA 3P1IA 1IQDC 2VZRA 4DUVA 3IB3A 3CDZB 3LQCA 1CZSA 1K3IA 3WNOA 4CVUA 1OF3A 2VQUA 2WAAA 2J1EA 3WF3A 3C7EA 2VZQA 3NJVA 4KWUA 3WEZA 3GGLA 3MBWA 4LKSA 2BGPA 3MUY1 2X05A 3GM8A 4M4RA 4A3ZA 3EB7A 4A42A 3I2JA 2J1AA 3T09A 5B4XA 2W47A 2YG0A 3VD3A 1BHGA 4W4ZA 5IFPA 3WF4A 2W95A 5CZKA 3GXUA 4P02B 2E26A 2ZEYA 4MADA 1JYNA 3T0AA 2CDPA 5DQ0A 2PQSA 2WQ8A 3P6BA 5HXMA 2VJXA 5LA2A 1CIYA 2KD7A 3WNKA 4XUQA 2JE8A 4AG4A 3HNYM 2L9LA 4D8MA 1SDDB 1XNAA 1R64A 5DMYA 5A1AA 2J1SA 4DXSA 4ZZ8A 3WSOA 2WDBA 3K4DA 1F4HA 1JZ6A 1OT5A 3HN3A 3ACFA 2VCBA 1J84A 1O8PA 2W1SA 3HEIA 5JMOA 2BBAA 3HNBM 1JYVA 3VD5A 4QPWA 3ETPA 4XVHA 1GMMA 3A22A 4JKLA 4QX2A 3CIHA 2VO5A 4ZZ5A 3IDAA 1TVGA 3C7OA 3IAQA 5JR2A 1UYYA 1NKGA 2Y6LA 3UNPA 3OGSA 3K4ZA 4CUCA 1W0NA 1UX7A 1EUTA 3VDBA 1O8SA 2OKXA 3CZUA 5B4NA 4CU9A 3K75B 4QDQA 4QX1A 4OYUA 2BERA 4JKMA 3IIIA 1CZTA 4P08A 2V72A 1DYOA 5C70A 1XNTA 2W9XA 2VCCA 2VZOA 2Y6KA 3BN6A 2X09A 1D7PM 1JZ7A 5F7UA 1P8JA 3I3EA 4OZOA 3K4AA 4ARXA 5JXIA 2XONA 2EICA 1JZ5A 4CUAA 2VMDA 2Y6HA 4CUBA 1HN1A 2VZSA 2VMEA 4KMQA 1RYYA 3FL7A 1ULPA 1UXZA 2VOTA 4D0QA 3C7FA 1WCQA 3U37A 3LPGA 3SEEA 2QQIA 2WO2A 2W92A 1W9TA 3UESA 1L7RA 3NJXA 3WF2A 1UXXX 5JXHA 3C7GA 1PMJX 2E33A 2W3JA 5IFTA 1US3A 1GQPA 3OEBA 4P00B 2YFZA 5LA1A 3CKHA 2RV9A 3HPNA 2VZ1A 3T08A 2WZEA 2Y6JA 2J22A 1UY3A 4E8DA 3VD7A 4JX0A 2BGOA 2J1VA 5EIYB 1LNSA 1KEXA 4QDRA 4KI5M 4TXWA 4DXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OG2 A;  3WNM A;  4CU7 A;  4A41 A;  2DCK A;  4YPJ A;  2DCJ A;  1I5P A;  2LW8 A;  4JHZ A;  3SEP A;  4MO3 M;  2XQX A;  1H6X A;  3LE0 A;  5EJZ B;  2VR4 A;  3LEK A;  2J1T A;  2RVA A;  3OBA A;  4MGQ A;  1TG7 A;  3FHA A;  3D3A A;  3I97 A;  5LA0 A;  2W46 A;  1KGY A;  4DXR A;  2C26 A;  2WO3 A;  3MO4 A;  3T2O A;  3WNL A;  4GWI A;  4MGS A;  4W50 A;  3WNP A;  1GOG A;  3NQH A;  4A44 A;  3FHQ A;  3PUH A;  1L7Q A;  3SKV A;  4QX3 A;  4GZ9 A;  1OH4 A;  3VDA A;  3NNG A;  1ULO A;  4BXS V;  3EYP A;  4OMC A;  3WF0 A;  2QQK A;  4BDV B;  1H6Y A;  1UYX A;  2C4X A;  1W99 A;  4QB2 A;  2V5D A;  3CMG A;  3GDB A;  2XOM A;  2ZXQ A;  1K12 A;  3HNM A;  4OUE A;  2Z4F A;  1W9S A;  3JXS A;  2QBX A;  2W1U A;  4XUR A;  2VZP A;  5JXJ A;  3THC A;  2W1W A;  3I2K A;  1PMH X;  2E31 A;  4QB1 A;  2YFU A;  5HPO A;  3WNN A;  1J83 A;  2V4V A;  2ZEW A;  2X10 A;  3E1F 1;  4UI9 L;  2VZU A;  3VD9 A;  1YQ2 A;  2Y64 A;  4QX0 A;  4HG6 B;  3LEI A;  3LEG A;  4DUX A;  1US2 A;  2WN3 A;  2EIE A;  3OB8 A;  5FUI A;  2ORX A;  2BZD A;  1W8O A;  2B4K A;  3J7H A;  3T2Q A;  1JYW A;  3WQB A;  4DUW A;  5IHR A;  2CDO A;  3CQO A;  3T0D A;  2XHN A;  3PUI A;  2VMF A;  2VQT A;  3ECQ A;  4ZY9 A;  3C8X A;  3T0B A;  2VC9 A;  4ZXE A;  1JU3 A;  1PX4 A;  4PT6 A;  4XUP A;  1CZV A;  2J1R A;  2EID A;  2HLE A;  3ZM8 A;  4CU6 A;  2QQO A;  1UYZ A;  3OGR A;  2VZ3 A;  1O59 A;  2VCA A;  5JXG A;  3DYO A;  4W8J A;  5DPN A;  3I3B A;  3DYP A;  2VTF A;  2JDA A;  3MUZ 1;  2E32 A;  1K42 A;  1NAE A;  4BJ0 A;  4E8C A;  4TTG A;  1JZ8 A;  1OF4 A;  1UZ0 A;  4QB6 A;  2WZ8 A;  4Z2A A;  3W5N A;  3K46 A;  4UOJ A;  1OD3 A;  1JU4 A;  1CX1 A;  3ABZ A;  4AAX A;  1GUI A;  2W5F A;  3I2G A;  4QDS A;  4ET7 A;  1W9W A;  2QQJ A;  4XUN A;  3W5M A;  2QQM A;  1DLC A;  3WF1 A;  1JZ3 A;  3OGV A;  3A21 A;  2QQN A;  2WYS A;  1K45 A;  3FN9 A;  1SG3 A;  2YB7 A;  3UET A;  5LCW L;  3K77 A;  2LS6 A;  4IUG A;  4FI9 A;  3THD A;  5I0D A;  3I2I A;  2WAO A;  4XZU G;  4LHS A;  2QQL A;  3C7H A;  2VMC A;  4LPL A;  1MPX A;  2J1U A;  3SKJ E;  5DN2 A;  4JKK A;  4PQQ A;  1EUU A;  2W1Q A;  1GU3 A;  4BK4 A;  4A4A A;  1NX9 A;  5G04 L;  4M4P A;  4XUT A;  2W91 A;  2J7M A;  2VZV A;  2HYX A;  3IAP A;  5C7G A;  2RJ2 A;  4CU8 A;  3DYM A;  2VZT A;  2Y8K A;  2ORZ A;  2WUH A;  1XC6 A;  3VDC A;  2EIB A;  1DP0 A;  2WAB A;  1UWW A;  1GOH A;  3DEC A;  3MV0 1;  4RN5 A;  1SHW B;  4UAP A;  1UMI A;  3A23 A;  1NUK A;  3AC0 A;  5IJR A;  4XUO A;  4L0P A;  1GOF A;  5IYY A;  1XPW A;  3BGA A;  1JHJ A;  3HJR A;  3ACI A;  4GWJ A;  2WBK A;  2JKX A;  3LPF A;  4DEQ A;  4LQR A;  4A6O A;  1JI6 A;  2Y6G A;  5G05 L;  2W87 A;  2YC4 A;  1T2X A;  2B9V A;  1WKY A;  4RYD A;  2W94 A;  3A7Q A;  4PF1 A;  5C71 A;  1JZ2 A;  4BK5 A;  2ZEZ A;  1W8N A;  3ACG A;  4QAW A;  3NRU A;  3I2F A;  3ACH A;  3VD4 A;  1JZ4 A;  2R7E B;  5JUV A;  1UMH A;  3I2H A;  3I3D A;  2YC2 A;  5CYY A;  2VL4 A;  4ARY A;  1JYX A;  4MOA A;  2JD9 A;  1PX3 A;  1UY1 A;  4OMD A;  1UY4 A;  5EJ1 B;  2ZEX A;  1UY2 A;  2ID4 A;  4P5Y A;  5J1X A;  1GNY A;  3F2Z A;  4A45 A;  1F4A A;  4DEV A;  3MV1 1;  3T2P A;  2VM9 A;  3OEA A;  2WN2 A;  2DDU A;  1UY0 A;  2WO1 A;  3CZJ A;  2C9K A;  3HOB A;  3P1I A;  1IQD C;  2VZR A;  4DUV A;  3IB3 A;  3CDZ B;  3LQC A;  1CZS A;  1K3I A;  3WNO A;  4CVU A;  1OF3 A;  2VQU A;  2WAA A;  2J1E A;  3WF3 A;  3C7E A;  2VZQ A;  3NJV A;  4KWU A;  3WEZ A;  3GGL A;  3MBW A;  4LKS A;  2BGP A;  3MUY 1;  2X05 A;  3GM8 A;  4M4R A;  4A3Z A;  3EB7 A;  4A42 A;  3I2J A;  2J1A A;  3T09 A;  5B4X A;  2W47 A;  2YG0 A;  3VD3 A;  1BHG A;  4W4Z A;  5IFP A;  3WF4 A;  2W95 A;  5CZK A;  3GXU A;  4P02 B;  2E26 A;  2ZEY A;  4MAD A;  1JYN A;  3T0A A;  2CDP A;  5DQ0 A;  2PQS A;  2WQ8 A;  3P6B A;  5HXM A;  2VJX A;  5LA2 A;  1CIY A;  2KD7 A;  3WNK A;  4XUQ A;  2JE8 A;  4AG4 A;  3HNY M;  2L9L A;  4D8M A;  1SDD B;  1XNA A;  1R64 A;  5DMY A;  5A1A A;  2J1S A;  4DXS A;  4ZZ8 A;  3WSO A;  2WDB A;  3K4D A;  1F4H A;  1JZ6 A;  1OT5 A;  3HN3 A;  3ACF A;  2VCB A;  1J84 A;  1O8P A;  2W1S A;  3HEI A;  5JMO A;  2BBA A;  3HNB M;  1JYV A;  3VD5 A;  4QPW A;  3ETP A;  4XVH A;  1GMM A;  3A22 A;  4JKL A;  4QX2 A;  3CIH A;  2VO5 A;  4ZZ5 A;  3IDA A;  1TVG A;  3C7O A;  3IAQ A;  5JR2 A;  1UYY A;  1NKG A;  2Y6L A;  3UNP A;  3OGS A;  3K4Z A;  4CUC A;  1W0N A;  1UX7 A;  1EUT A;  3VDB A;  1O8S A;  2OKX A;  3CZU A;  5B4N A;  4CU9 A;  3K75 B;  4QDQ A;  4QX1 A;  4OYU A;  2BER A;  4JKM A;  3III A;  1CZT A;  4P08 A;  2V72 A;  1DYO A;  5C70 A;  1XNT A;  2W9X A;  2VCC A;  2VZO A;  2Y6K A;  3BN6 A;  2X09 A;  1D7P M;  1JZ7 A;  5F7U A;  1P8J A;  3I3E A;  4OZO A;  3K4A A;  4ARX A;  5JXI A;  2XON A;  2EIC A;  1JZ5 A;  4CUA A;  2VMD A;  2Y6H A;  4CUB A;  1HN1 A;  2VZS A;  2VME A;  4KMQ A;  1RYY A;  3FL7 A;  1ULP A;  1UXZ A;  2VOT A;  4D0Q A;  3C7F A;  1WCQ A;  3U37 A;  3LPG A;  3SEE A;  2QQI A;  2WO2 A;  2W92 A;  1W9T A;  3UES A;  1L7R A;  3NJX A;  3WF2 A;  1UXX X;  5JXH A;  3C7G A;  1PMJ X;  2E33 A;  2W3J A;  5IFT A;  1US3 A;  1GQP A;  3OEB A;  4P00 B;  2YFZ A;  5LA1 A;  3CKH A;  2RV9 A;  3HPN A;  2VZ1 A;  3T08 A;  2WZE A;  2Y6J A;  2J22 A;  1UY3 A;  4E8D A;  3VD7 A;  4JX0 A;  2BGO A;  2J1V A;  5EIY B;  1LNS A;  1KEX A;  4QDR A;  4KI5 M;  4TXW A;  4DXT A; 
#chains in the Genus database with same CATH topology
 3OG2 A;  1YUD A;  4CCO A;  4MGT A;  1HIX A;  1ODM A;  2VG9 A;  3VZK A;  2VVE A;  3W20 A;  4WM8 B;  2FCT A;  4A41 A;  2DCK A;  5FPV A;  1NCR C;  3ZSL A;  3DPR B;  4YPJ A;  1LOF C;  2QNK A;  1V0A A;  5DG1 A;  4JHZ A;  2VW1 A;  3VBS C;  1DG6 A;  4MVT A;  2ZGK A;  3B7M A;  3FMG A;  4OFG A;  4ORF A;  4U36 A;  3LE0 A;  2XVG A;  1TQ5 A;  3WZ1 A;  3R4D B;  4AHY A;  3HR9 A;  1YC6 1;  2J1T A;  4RQP A;  4YVW C;  1IOA A;  4XFC A;  2FDF A;  1POQ A;  5IVC A;  3BOW A;  1BBT 1;  5FZO B;  3WR0 A;  2DTY A;  1KFU L;  1SLL A;  1W8H A;  1OMI A;  2VXJ A;  4Q4Y 1;  1V6M A;  1SEF A;  3ZFF A;  2X5I A;  3KS7 A;  4S2G A;  4EN0 A;  1M4W A;  1D4V B;  2XG3 A;  2C26 A;  4OVE A;  1CD3 G;  4K8F A;  2UWC A;  1H9P A;  3MO4 A;  1GZC A;  4XJ9 A;  3T2O A;  1PHM A;  3LD8 A;  1RVF 3;  3WNL A;  4DFS A;  4YFZ A;  1W9Y A;  2OT7 A;  4MGS A;  4IE4 A;  5JI9 A;  5HCH A;  3WP6 A;  4A44 A;  4N53 B;  3J8F 1;  3PUH A;  1GSL A;  4UW6 A;  1DGR N;  1QQP 2;  2PHR A;  1VRB A;  4BIF A;  4UWD A;  4PQ9 A;  1OLR A;  1FMD 2;  1OPO A;  3R6S A;  4DY5 A;  4E4D X;  1X9T A;  5JOW A;  5DG2 A;  4KU8 A;  4BXS V;  4OMC A;  1K5J A;  5D1I A;  1H6Y A;  2VXR A;  3POJ A;  2BWA A;  5H9Q A;  4AED C;  2OYZ A;  2V5D A;  1W39 A;  4YZ2 A;  1RUN A;  2MEV 3;  3O12 A;  4BHP A;  1AXK A;  4N7U A;  2ARE A;  3MHZ A;  4IV1 A;  2YUE A;  3GHN A;  4PHZ A;  3S5Q A;  2TEP A;  4OHY A;  1Q43 A;  1MAC A;  3AMM A;  4FT8 A;  4XZP A;  3LA2 A;  4OUE A;  5TSW A;  2Z4F A;  1W9S A;  3INA A;  3ELN A;  3POW A;  4BOW A;  4DRV A;  3AM2 A;  4MYE A;  4Q4Y 2;  1D4M 2;  2HWD 2;  1MEC 2;  2YDE A;  4YZ1 A;  5DAQ A;  4S2D A;  1AL2 1;  3SHR A;  1HQL A;  2WII B;  3GBW A;  2E31 A;  4KGQ A;  2VD7 A;  2YFU A;  3VHO A;  4LO6 B;  4QQP A;  1JS9 A;  4IV3 C;  3FZ3 A;  3WNN A;  4PLM A;  1J83 A;  1GZ9 A;  5A6X A;  1WD3 A;  3PMS A;  5IVV A;  2X10 A;  1RUI 1;  5D2A A;  5A3M A;  1QQP 1;  2R04 2;  4XDQ A;  4OHW A;  4E4S A;  3QOP A;  1H2M A;  1YQ2 A;  4C8D A;  4XFH A;  5DDJ 2;  3APB A;  1VMJ A;  3O1P A;  2ILM A;  2O1Q A;  2HWC 1;  1MZ6 A;  5C4W B;  5A7O A;  4W6W A;  3WV6 A;  2AH2 A;  4BLJ A;  4QKF A;  2JDK A;  5FUI A;  1O4Z A;  1WLC A;  3I2O A;  2BZD A;  2B4K A;  4IDZ A;  4MXV A;  4XJA A;  5DAX A;  3T2Q A;  2K2S A;  5C4W C;  3SXW A;  1G9A A;  5FZ3 A;  3WNX A;  4LLO A;  5D8A A;  4H14 A;  4CSW A;  5IHR A;  5FY4 A;  1UMZ A;  1O91 A;  4NRM A;  2P2K A;  5ANN A;  3PUI A;  2R49 A;  1J59 A;  1PO1 2;  2HWF 2;  5LEK A;  5ACA 1;  5IVJ A;  5JOX A;  5F5Q A;  1K5M B;  1DGW X;  3C8X A;  3NAP A;  3GJB A;  3T0B A;  5C33 A;  1PGL 1;  5DAV A;  3ZXJ A;  4CDW C;  5FIX A;  1WMX A;  1PIV 1;  4XMI A;  4Z82 A;  3O1S A;  1R1Z A;  3HT1 A;  4O7X A;  5KXE A;  1ULF A;  2RM2 3;  3S6P A;  1MVQ A;  3KWV A;  2HLE A;  1LOE A;  1TZO A;  3ZM8 A;  4Q4V 3;  4CU6 A;  4AI9 A;  4Z1V A;  2WSV A;  3OGR A;  1SFY A;  2DCZ A;  4AFB A;  2VZ3 A;  1O59 A;  1XU2 A;  1GNZ A;  5JXG A;  1J3Q A;  3DYP A;  2VTF A;  3OBT A;  1GIC A;  2JDN A;  1G7Y A;  3VBF B;  4LBM A;  1RUJ 2;  2E32 A;  3FLT A;  1HW5 A;  4NOT A;  2JIJ A;  4UW4 A;  1K42 A;  1JYT A;  1NAE A;  2CGO A;  2OW4 A;  1C1L A;  3LA3 A;  4LK6 A;  4D3W A;  3VBU A;  4PLN A;  4QPI C;  5T5L A;  1OF4 A;  3JUU A;  1OLM E;  1ULG A;  2D6M A;  3DKW A;  2C6S A;  1QKQ A;  1MEC 3;  2YBP A;  4BB3 A;  4BE3 A;  2P1B A;  4CE8 A;  4Z2A A;  1Z7S 1;  4CP1 A;  3KT7 A;  1S2K A;  4LIU A;  5A3T A;  3CHX A;  4RR3 A;  1ENR A;  3VBH C;  1OD3 A;  2XJU A;  3J7L A;  1V70 A;  1CX1 A;  3ABZ A;  1LHU A;  4LEJ A;  2W5F A;  1N1S A;  2WFP A;  1EPW A;  3I2G A;  3WP4 A;  5K0U A;  2ZMN A;  3HVD A;  1VMF A;  4CCC A;  1E5H A;  3KHB A;  3LA7 A;  2QQJ A;  2YBS A;  4I0W B;  4LTA A;  4NRO A;  3WDU A;  5C8C B;  3AMN A;  3MIC A;  3NKG A;  4XUN A;  1QDC A;  1ZRE A;  2X53 S;  5K9Y A;  3OUI A;  3BI3 A;  3OGV A;  1SLA A;  2HH9 A;  3S0M A;  2QQN A;  1HV0 A;  3HIF A;  2PAK A;  5FZA A;  4Y22 A;  3T2T A;  5J3U A;  4HSL A;  4Q2F A;  1FV2 A;  4KWL A;  3ZFG C;  1W3V A;  3DXU A;  5AVP A;  4BQ5 A;  2VBB A;  3MF9 A;  3SIT A;  4FI9 A;  5I0D A;  2IVJ A;  3M8L A;  4YVW B;  4YW1 A;  5C9A A;  2W52 A;  3POY A;  2RR1 3;  4EWE A;  2RE9 A;  5FV3 A;  4LPL A;  3VBS B;  2YY1 A;  3AP5 A;  4A2U A;  2CU5 A;  4G4F A;  3ZFE C;  3E5U A;  1FXZ A;  4AZZ A;  1NLS A;  2WS9 1;  3GBF A;  4C1W A;  5FYY A;  3GJA A;  1REF A;  2BNN A;  2OII A;  1X82 A;  2W1Q A;  1AYN 3;  3AKQ A;  4A4A A;  3ZR6 A;  3S57 A;  5CKM A;  3AB0 A;  1O3Q A;  1OHF A;  2OUH A;  2W39 A;  2W91 A;  3AYD A;  3Q8B A;  1H8T B;  3MIE A;  5I0R A;  2VTX A;  5J98 B;  4GMP 3;  5EYX A;  1JOJ A;  5L9B A;  2X29 A;  5FP9 A;  4ATF A;  4O61 A;  1YQ6 A;  2DVF A;  3NJY A;  1M06 G;  5FY9 A;  3T1M A;  1WMF A;  4CU8 A;  3DYM A;  1OFS A;  2Y8K A;  2ZOE B;  3WUD A;  4FTB A;  1LKN A;  2AEY A;  5APA A;  1MS3 A;  2NM1 A;  1KIT A;  1PVC 2;  1RUD 2;  4QQ2 A;  4COZ A;  4DO0 A;  5C3S A;  5AC9 2;  2Z42 A;  1HRV 2;  1GOH A;  5J48 A;  4UAP A;  1Q3E A;  2IFW A;  4K8R B;  5FOB B;  1UMI A;  2XHK A;  1HRV 1;  4QHB A;  1U5Y A;  3EBR A;  4LKE A;  4LHL A;  1C8M 2;  1BLZ A;  2XKO A;  4XUO A;  2BV4 A;  3JBG 1;  1FX5 A;  1GOF A;  1LCL A;  4OHX A;  2OQ7 A;  4XTP A;  3U10 A;  1YRZ A;  1GWL A;  1PO2 2;  4PIY A;  2CY6 A;  1JHJ A;  1RXF A;  3ACI A;  1W6O A;  4GWJ A;  2JKX A;  4LLF A;  2HWD 3;  5FYM A;  4LQR A;  4DEQ A;  1JI6 A;  3B3Q E;  2XLF A;  4RA0 A;  4AWD A;  1FPN 3;  2WQZ C;  4CEW C;  1IS3 A;  2IFR A;  4CP2 A;  4NAM A;  1T2X A;  1S2E A;  2AZ5 A;  2WNU A;  1PGW 2;  2W94 A;  1UNB A;  1NCQ A;  5F6L B;  3ZXL A;  3T1L A;  1RUC 1;  2ZEZ A;  4RSU A;  1GP4 A;  1H1M A;  5FOJ B;  4OI2 A;  3E97 A;  2XL7 A;  3O0X A;  3ACH A;  4XXA A;  4R9A A;  2HWE 2;  1H2K A;  1IZ3 A;  3I2D A;  4XQ4 A;  3VZN A;  2FD8 A;  3AFG A;  3VD4 A;  1HRI 2;  1NY7 1;  2A7A A;  4WVV A;  3KD4 A;  5JUV A;  3I54 A;  1CJP A;  5HI0 A;  4MHR A;  2XB6 C;  2P37 A;  4AF9 A;  4NJ4 A;  4ATE A;  2VL4 A;  1HB3 A;  2ZKL A;  2UWB A;  2XXZ A;  5I8T A;  2D3P A;  2CGP A;  5A32 A;  3H7J A;  3K51 A;  5HCA A;  1LOB A;  5ABJ C;  1UY1 A;  2YRO A;  2P17 A;  1UY4 A;  1HB1 A;  3TB0 A;  4QGM A;  3TRS B;  4P5Y A;  5JOZ A;  1XNB A;  2GAL A;  3WP5 A;  1GP6 A;  3DKQ A;  5FPU A;  3SQO A;  2PLV 2;  4Q4W 1;  2J42 A;  1F4A A;  3Q8E A;  4GB3 3;  3KQR A;  5FXV A;  3WD5 A;  1OC1 A;  1H8V A;  4JTN A;  4J6G A;  2DDU A;  3ME2 A;  4AQT A;  2EXJ A;  1LGB A;  1V9U 2;  4QPI A;  4ES8 A;  1AR9 2;  2A6X A;  1OBN A;  4RR3 B;  4W6Y A;  1LRH A;  3KSC A;  3ZDS A;  2JG9 B;  4HSJ A;  4AOC A;  1WME A;  4YZ5 A;  3ALQ A;  1K3I A;  2ENR A;  1OF3 A;  3WG1 A;  2BUK A;  2XBO 1;  4B7E A;  3ACL A;  1Y9G A;  3ZX7 A;  1O5U A;  4P5H A;  4Q5O A;  4EQV A;  3PTY A;  1E5R A;  1AR6 1;  3IBM A;  2WLQ A;  2I07 B;  4JC1 A;  1UIJ A;  3GGL A;  3UGF A;  4YVS A;  1QJU 3;  4TLF A;  5JOY A;  2Q0A A;  3JQX A;  2A71 A;  2Y0I A;  3AZX A;  5F3I A;  3Q8F A;  1G9F A;  4MET A;  4ASL A;  3EB7 A;  3AZY A;  3I2J A;  3ZIX A;  4AAP A;  4BA6 A;  2H6C A;  4K1Z A;  1SLC A;  4QX5 A;  2W95 A;  4Y1Y A;  4CDW A;  4FXG B;  2E53 A;  4P02 B;  1OQE A;  2ZHN A;  5F2W A;  3VHR A;  2WFF 2;  3KGZ A;  1FOD 2;  2BNM A;  1AF9 A;  4Y26 A;  3M3Q A;  3KZ4 C;  3PUA A;  5HXM A;  4IV3 B;  3SCG A;  4P9G A;  4XJZ A;  4CDX B;  3RFR A;  3WNK A;  2ADE A;  2CL2 A;  2L9L A;  1Z7S 2;  1UIK A;  1HRI 3;  4NIG A;  4YGC A;  2B46 X;  2AC1 A;  3USU B;  5C3O A;  2J1S A;  4DXS A;  4ZZ8 A;  4Y1X A;  1W2U A;  3K4D A;  4F8A A;  1JZ6 A;  5FZC A;  3WP3 A;  5DDJ 3;  4QT6 A;  5L7O A;  3R0R A;  4JGZ A;  4E9K A;  5CEH A;  1LGN A;  4GKY A;  1O8P A;  4KBZ A;  1C1F A;  1YWK A;  2P3Y A;  3N3H A;  1PVX A;  3DEM A;  4AGR A;  2BBA A;  4FBF A;  5JMO A;  3HNB M;  2R30 A;  3A4U A;  4IEX A;  4XIK A;  3VD5 A;  3H1Y A;  4QPW A;  3UKN A;  1Z0H A;  3AXD A;  4LBQ B;  2IXK A;  2O0O A;  1RUO A;  2ZS6 B;  5LBB A;  1GMM A;  1O4Y A;  5EFU A;  1SPP B;  3Q9O A;  4JKL A;  4N43 B;  3ZKU A;  3PLQ A;  5ANQ A;  2D3S A;  1RVF 1;  1RTV A;  1FPN 1;  1U0A A;  2HEY F;  1POV 0;  2WWU A;  4GMP 1;  5BPX A;  4AYU A;  5JR2 A;  4R8H A;  2R0H A;  2XUE A;  3BYW A;  2Y6L A;  3UNP A;  3LCP A;  3WIN E;  4HVO A;  3IN9 A;  5BNP C;  4BQY A;  1F31 A;  2AEN A;  1YYN A;  1XNK A;  5B4N A;  4PF5 A;  1UU6 A;  4CU9 A;  4XJW A;  1VRH 3;  3RS6 A;  1DIW A;  4AHZ A;  5FXZ A;  1WGP A;  5FY1 A;  2A6Z A;  4XDO A;  4JKM A;  1HRV 3;  5KC6 A;  4XFB A;  1W0P A;  5L19 A;  4P08 A;  2X5I B;  2V72 A;  3HQR A;  4CYD A;  4P9J A;  3MW2 A;  1RUJ 3;  1W6M A;  4IER A;  1DYO A;  1JH5 A;  3WHU A;  1IPJ A;  3ZXF A;  2B7Y A;  4V1P A;  1W6P A;  1XNT A;  1S0E A;  5ISL A;  1YI7 A;  2K9Z A;  2VZO A;  2Y6K A;  3AP4 A;  5FYS A;  2R06 1;  4GWN A;  3IZO A;  1NOV A;  3PVE A;  4Y22 B;  1JZ7 A;  2VW2 A;  1VRH 1;  1P8J A;  1ND2 C;  3PU3 A;  1S55 A;  4NR1 A;  5A7S A;  4FPK A;  1JYC A;  3BTY A;  4LBL A;  3TOJ A;  5FRA A;  2QJV A;  2VMI A;  4CUA A;  4BPZ A;  3B01 A;  4NHX A;  1UKR A;  3SC7 X;  4CUB A;  4AFD A;  1GWK A;  4WM8 C;  4CDQ A;  1RUG 3;  3JQW A;  3MI8 A;  2JD4 A;  2BJS A;  5FZH A;  4PBP A;  2VME A;  2VOT A;  1W8T A;  3UGG A;  1YQ8 A;  2JEN A;  2Z69 A;  5C8C C;  2WT0 A;  1D2Q A;  1PIV 3;  4GKX A;  1Y4W A;  4XCA A;  1VBE 3;  1DQ2 A;  2DYC A;  4LUM A;  3PVB B;  1MS1 A;  2VQA A;  1LOD A;  3H8U A;  1DZR A;  1QH7 A;  3V0A B;  1AR8 2;  5FQ0 B;  1SBF A;  2RMU 2;  2VUL A;  4NWV A;  4Q4W 3;  1GQP A;  3OEB A;  1VAK A;  4AVS A;  1F15 A;  3POB A;  2RMU 1;  5LA1 A;  5JVV A;  3VDD A;  4BYY A;  2PAE A;  2RV9 A;  4URT A;  1H1A A;  1X9P A;  2PQQ A;  4KWJ A;  4GB3 1;  3T08 A;  3H8O A;  5DXD A;  2WNU C;  1GZW B;  2WZE A;  2R16 A;  4XXP A;  4YW3 A;  5A6Q A;  1UY3 A;  3TEX A;  3VBF C;  3RDI A;  1UU4 A;  2PHF A;  4D94 A;  2JX9 A;  2J1V A;  1TNF A;  1UOB A;  2ZKN A;  5EHD A;  1WLD A;  5LY2 A;  2WA4 A;  1KEX A;  2OPK A;  3H3L A;  4QDR A;  4QU1 A;  2R32 A;  2R07 2;  2IXJ A;  4TXW A;  2A3Y A;  3MPB A;  4J1X A;  4OUS A;  4DXT A;  3DL3 A;  4UBG A;  1W6O B;  2ES3 A;  1W03 A;  1LUL A;  4PIX A;  5C9A B;  4A6S A;  5JMC A;  1AR7 3;  3UYJ A;  4YW7 A;  4CCD A;  5C5T A;  1Q8S A;  1EY2 A;  2LW8 A;  4MO3 M;  1VAL A;  5FP8 A;  1R09 2;  4AL9 A;  4YRD A;  3U14 A;  4AED A;  1BCX A;  1VBD 1;  3GCW A;  3DF0 A;  4QMA A;  5E88 A;  3VKN A;  2RVA A;  1NZI A;  2XWB B;  5FMB A;  5A3U A;  3NJZ A;  4DNY A;  5BY5 A;  4XFA A;  3FHA A;  5JWP A;  4NID A;  5I93 A;  4ES9 A;  1O6U A;  4PIZ A;  1W8U A;  4PCR A;  1MEC 1;  4A7K A;  5LA0 A;  2DCY A;  2V09 A;  5CKQ A;  4DXR A;  4WVM A;  1CAX A;  2ZX2 A;  1RXG A;  1VBC 1;  2ZGL A;  2WO3 A;  3RNS A;  5BYN A;  1DF0 A;  1KJR A;  2Y38 A;  5A32 B;  3KCY A;  4L8Q A;  1XNC A;  3OD0 A;  1L7L A;  1RHI 3;  2ZGS A;  5FZ7 A;  2Y60 A;  2JE7 A;  1GOG A;  1XRU A;  4FOV A;  4IEU A;  4BLI A;  1UU5 A;  2ZTN A;  4CDU A;  1QNW A;  1R1A 2;  1UD1 A;  1A8D A;  4N43 A;  3SKV A;  2WYF A;  4QX3 A;  5E8A A;  1HDK A;  1HJG A;  1UAI A;  3MIF A;  4DXZ A;  1TME 1;  3FUQ A;  4UBH A;  5AFB A;  3M2M A;  4QXH A;  5FZ8 A;  1WLW A;  3LF7 A;  2NZ9 A;  1KFX L;  3IPV B;  4BQ2 A;  5DDJ 1;  1WW6 A;  1ZZB A;  1ULO A;  4ZU7 A;  5F37 A;  1J3R A;  1TMF 3;  1UKG A;  5FUP A;  2QQK A;  4FFG A;  3T30 A;  1D2S A;  4H7M A;  1LTE A;  4QQO A;  2G1M A;  4K21 A;  4Q4V 1;  2C0Z A;  2VNV A;  4COW A;  1UX6 A;  3H1M A;  4HKL A;  3KLS A;  4YM3 A;  5CFC C;  2ZXQ A;  1IGO A;  3ES1 A;  3OSD A;  4YSF A;  1DGW A;  1WA4 A;  1NCQ B;  4U2A A;  3ILN A;  2Z79 A;  4JGY C;  2VNO A;  4JVA A;  1BYH A;  3L2H A;  4B7K A;  4XBN A;  5M0T A;  3RZM A;  1LGC A;  4XUR A;  1QJX 2;  2RS1 2;  3FBY A;  4QQL A;  5JXJ A;  3THC A;  1OQ1 A;  5DAP A;  3VKF C;  1PGL 2;  3GZA A;  2W1W A;  2Q8E A;  2VOK A;  1PMH X;  2WQ4 A;  2UY9 A;  3LAG A;  3K3N A;  5FO9 B;  4JZR A;  4M00 A;  1HV1 A;  4M3C F;  1LEM A;  1GQH A;  4QPG B;  2OVU A;  5F32 A;  2EA7 A;  1QEX A;  3ZXA C;  4JGZ C;  2ZEW A;  3E1F 1;  1RIR A;  2GU9 A;  4UI9 L;  4Q8K A;  4A3X A;  2LRO A;  4N7I A;  5K7P A;  4YYO A;  3LDR A;  4LA2 A;  4YGD A;  3WX5 A;  1S4C A;  2Y64 A;  3VBS A;  3RYK A;  2ADD A;  2HEV F;  2VOW A;  3LEG A;  3LEI A;  4HG6 B;  5CB7 A;  4NAO A;  2XH6 A;  5ERL A;  2EIE A;  3OB8 A;  2ORX A;  4YM0 A;  2XR4 A;  2HWC 2;  3D5O A;  2UYA A;  4YM2 A;  4CPB D;  4CP9 B;  4QQH A;  1CJD A;  3USU A;  3I59 A;  1JMU B;  5EQU A;  1JYW A;  2GNT A;  3QLQ A;  3KGL A;  2RHP A;  1OA3 A;  4XHX A;  1FAT A;  3ILF A;  4AQS A;  2CDO A;  2OXB A;  5FYH A;  5L7O B;  1W05 A;  4NE9 A;  2FDG A;  4N9H A;  2VMF A;  2GP3 A;  2YC0 A;  3NNJ A;  4P9L A;  3SLI A;  4RR3 C;  4HT1 T;  4ZY9 A;  3BTZ A;  3IWZ A;  1ZBA 3;  2GC2 A;  4MH0 E;  4N8M A;  3W58 A;  1FOD 3;  5DZG A;  5A3P A;  1ASJ 1;  2VCM A;  3SH3 A;  2VC9 A;  4ZXE A;  5IVF A;  1JU3 A;  1PX4 A;  5CIS A;  5LBE A;  4XUP A;  5I0S A;  2J1R A;  2EID A;  3CJX A;  2QQO A;  4JQT A;  1G9D A;  2OA2 A;  3CLP A;  2B45 X;  4NRP A;  1ODN A;  4N53 A;  2VCA A;  3PVO A;  4Y20 B;  5FUN A;  5FBZ A;  5DPN A;  4XEZ A;  2ZA9 A;  1AR8 3;  3ZFG A;  1A78 A;  4R4X A;  3ZXG A;  1KDK A;  4Y5T A;  4QXC A;  2XBO 3;  3WOG A;  2XQR A;  2ZX3 A;  1WLT A;  2F17 A;  3OPZ A;  4BJ0 A;  4HKW A;  4TTG A;  1JZ8 A;  3VZJ A;  4FTE A;  4TZD A;  2CAV A;  4I0B A;  3OUJ A;  3NV2 A;  1C3H A;  4TSV A;  2EXK A;  3C3V A;  3ZFE A;  2ARX A;  1S0J A;  4XJ8 A;  3VBO A;  2ZAC A;  1AR8 1;  3W5N A;  1ZZ7 A;  2A73 B;  2D6K A;  3LZZ A;  3K46 A;  4MGK E;  3TBD A;  1NQD A;  4UOJ A;  4C90 A;  5CG8 A;  2K0G A;  1GUI A;  3JD7 3;  4CCK A;  3GZE A;  2R06 2;  2R6Q A;  4Y1U A;  1CON A;  4HPK A;  2AR6 A;  3KM5 A;  3IKW A;  4NMI A;  3HT2 A;  3OY8 A;  1RMU 2;  1OI6 A;  5I91 A;  1NCQ C;  4Y24 A;  2GDF A;  3KF3 A;  1K45 A;  2WRA A;  4I3P A;  4JRA A;  1AX0 A;  1YI9 A;  1O4T A;  5DAB A;  4CDU B;  3ZIW A;  2BRT A;  3WDY A;  2R07 1;  1OUX A;  2YV8 A;  3U11 A;  3UET A;  5LCW L;  2LS6 A;  5EV7 A;  3JU9 A;  4UFM A;  3VZM A;  4IUG A;  2A6W A;  2VW0 A;  1CN1 A;  3JBG 2;  1HKD A;  1ONA A;  4XZU G;  4NHL A;  1AX2 A;  2QQL A;  4TWT A;  1QJU 2;  2FMD A;  2VMC A;  4FXK B;  4L92 A;  4GAL A;  1VBC 3;  1MPX A;  2WSU A;  4QGL A;  5SV5 A;  3E5Q A;  4Y3O A;  3SKJ E;  3ZVX A;  1GQG A;  4XAB A;  4DIQ A;  1W2A X;  1C57 A;  5JCT A;  3WCS A;  4LXL A;  1QJY 2;  4PQQ A;  1RJ8 A;  1GU3 A;  4RFR B;  1NXM A;  1QWR A;  1NX9 A;  2VUC A;  3GAL A;  5EZW A;  1T6B X;  3I49 A;  1FAY A;  2WNV A;  2Q8C A;  2VVF A;  2AAC A;  5CIR A;  2J7M A;  5FDB A;  4HFS A;  2QZ2 A;  2IC1 A;  2UU8 A;  4OCT A;  1F5J A;  5KHI A;  4FPO B;  4C91 A;  3IAP A;  5F9T A;  4JGY A;  2IUW A;  5C6C A;  1H8T C;  5C7G A;  2IXC A;  5DZF A;  3PUQ A;  5JIU A;  4R9C A;  2VZT A;  5H9R A;  3VHP A;  4DS0 A;  2WUH A;  2WZR 2;  3GNE A;  4LE4 A;  1DP0 A;  1YQC A;  3DEC A;  3MV0 1;  4RN5 A;  4WZC A;  1CAW A;  1KRI A;  3PU8 A;  3B5L B;  4Q0P A;  5IJR A;  4BZ4 A;  3AL6 A;  4LOR A;  4L0P A;  2IVI B;  2NN8 A;  4KH9 A;  2BP6 A;  4HAN A;  3BOD A;  4NIH A;  4IEV A;  3BGA A;  3S7I A;  4AI0 A;  2NPI A;  4V2W A;  4PI0 A;  1AR6 3;  5GLZ A;  4YZ4 A;  5FAX A;  1MQT B;  4XF4 A;  4NN0 A;  4XET A;  4IE5 A;  5KHH A;  1QIQ A;  4ZS3 A;  3SMH A;  3VV1 A;  4R9D A;  3S5A A;  3UJQ A;  1YEW A;  4I30 A;  1NT0 A;  1WKY A;  1LHW A;  5IK7 A;  5LZ6 A;  3J7M A;  1RUF 1;  4P9W A;  5C71 A;  1JZ2 A;  4BK5 A;  2HWB 1;  4RHV 1;  3V0A A;  1MQT C;  1W8N A;  2PHL A;  1S0B A;  3RZH A;  3NRU A;  3OPW A;  3N7L A;  3KQ4 B;  2C5D A;  5LB6 A;  4F83 A;  1I9R A;  4Q27 A;  3T4H B;  2BPA 2;  4MGY E;  4GH4 C;  5CFD B;  1HB4 A;  5FXX A;  1XYO A;  2GND A;  3AJZ A;  3ETQ A;  4I3G A;  4X6R B;  5I8S A;  3BB6 A;  5DAW A;  5LRS A;  1UMH A;  1VP6 A;  3I2H A;  3I3D A;  3PIJ A;  4IEO A;  3AYC A;  4K3U A;  4QHZ A;  5FJK A;  1QOS A;  1X8M A;  4QKN A;  5IK8 A;  2AYH A;  1X8E A;  2MPF A;  5CYY A;  1JYX A;  3RZL A;  1LHN A;  4GJZ A;  4GUL A;  1W0O A;  4MOA A;  3WG4 A;  4BQ4 A;  1AXZ A;  1H2N A;  3KCX A;  1H2L A;  1BKZ A;  2LUW A;  4Q29 A;  1XSR A;  4QHO A;  5FZL A;  2AUY A;  2ZEX A;  3WG3 A;  1YIF A;  3ZOI A;  1F9K A;  2ID4 A;  1KD7 A;  5IW0 A;  1GNY A;  3I4I A;  1FOD 1;  1IHM A;  1QU0 A;  1SAC A;  4HMZ A;  3F2Z A;  4DEV A;  1QHD A;  1IKQ A;  2BOI A;  4EZH A;  4IE7 A;  5FRE A;  3ZN5 A;  4CEY C;  4HZF A;  4D7Y A;  2WN2 A;  4FQ4 A;  2EIG A;  3WCR A;  5L9V A;  1R1A 3;  4XE9 A;  4XCB A;  3CU7 A;  1DQ0 A;  3I7D A;  5FP7 A;  3JZV A;  3ZXE A;  1IQD C;  1JTZ X;  4DZG A;  1K5M C;  5JDB A;  4IGO A;  3VL9 A;  4LNV A;  3VBO C;  4FOW A;  1Z78 A;  2HBT A;  5T5P A;  1IG3 A;  2FMY A;  4EN8 B;  2VZQ A;  3NJV A;  3T3Y A;  4ITC A;  4OUM A;  2XBO 2;  2WNO A;  1WW7 A;  3IIA A;  5C8W A;  2BFU L;  1B35 A;  4Z07 A;  1LAJ A;  3W21 A;  2RR1 2;  2CTV A;  1VPH A;  4K40 A;  3H50 A;  2RMU 3;  2BGP A;  4A3Z A;  3RZZ A;  4RGA A;  1RJ7 A;  1H4H A;  4A42 A;  1OVP A;  3GZU C;  2XKP A;  2W47 A;  2DVB A;  1HN0 A;  1BHG A;  5B4X A;  3RSJ A;  3V64 A;  3WF4 A;  2VOX A;  4M3C B;  4UFI A;  5CZK A;  1UOG A;  5EJ3 A;  1FMD 1;  1FNY A;  2E26 A;  3AKT A;  4KU7 A;  1JYN A;  4UYB A;  1AXY A;  1I5Z A;  2CDP A;  4R4Z A;  2PQS A;  1VJ2 A;  4XFI A;  3M4F A;  2WQ8 A;  3P6B A;  1RGS A;  1T6G C;  2E7Q A;  2W2I A;  1XE7 A;  3QAC A;  4YLZ A;  1NE4 A;  1EV1 3;  3MW4 A;  3ZYF A;  4XUQ A;  1C8N A;  3BOP A;  5A1L A;  3N36 A;  4Q4V 2;  5GZF A;  4Q0U A;  3UKT A;  4FPC A;  4D8M A;  1RUH 2;  1QQP 3;  1SDD B;  1XNA A;  4HK8 A;  5FMD A;  2WNV B;  1PO1 1;  3H1W A;  1N3O A;  5A1A A;  5HXV A;  3TEY A;  4XTM A;  1IPK A;  3AXE A;  1CIW A;  1TME 3;  2GMP A;  4HXC A;  4BME A;  5K0U B;  4F3J A;  2ERF A;  2Q30 A;  5FYT A;  2D6P A;  1DYK A;  4RD7 A;  3NVC A;  1SMV A;  2CYF A;  5C8C A;  1E5I A;  3ACF A;  2DBN A;  3FC0 A;  3SH5 A;  1Y9Q A;  4LKF A;  2YGL A;  1ND3 A;  1R09 3;  4IE0 A;  1W28 A;  2CNA A;  1QOO A;  1RMU 1;  3H7Y A;  2V4A A;  1JYV A;  3LIG A;  4AGV A;  5KR7 A;  2ZPX A;  5DUU A;  4DRR A;  1HXS 2;  1POV 3;  3N7M A;  3FBM A;  3ETP A;  3O1T A;  3IMN A;  1FPN 2;  2Q8O A;  2CWM A;  1JW6 A;  2QFE A;  4BIS A;  1OD5 A;  1XND A;  4SBV A;  5IT6 A;  3O1R A;  4S2F A;  1TVG A;  1G9C A;  2WWS A;  3WW3 A;  2I74 A;  5L9R A;  3ZN6 B;  4YW2 A;  4IET A;  1MZE A;  4K9S A;  4NIA A;  4AQ6 A;  3PTR B;  4CUC A;  1W0N A;  2JDH A;  2ETE A;  4CEY B;  4CCL A;  4LO5 B;  3VDB A;  1A3K A;  4Y5S A;  4XF9 A;  1OKQ A;  4KL1 A;  2B9U A;  3K75 B;  4QM8 A;  2PFW A;  2YXS A;  1CAV B;  3POE A;  1R08 1;  4OYU A;  3TNP B;  4OZX A;  1GP5 A;  4EE2 A;  2IZW A;  1GWM A;  1XU1 A;  3ES4 A;  5J37 A;  3NAP C;  4LBQ A;  4LR4 A;  4BMB A;  4Z92 B;  5C70 A;  1XYP A;  1S0C A;  5A3L A;  1X33 A;  1ZM1 A;  2GMM A;  2VCC A;  2X09 A;  2VNG A;  2V73 A;  1ULE A;  3QCW A;  2D44 A;  2ZGQ A;  2A75 A;  2ZGM A;  3I3E A;  4EN6 B;  1R08 3;  2WWJ A;  3CO2 A;  4OZO A;  1IKP A;  1I6X A;  2A70 A;  4HOO A;  2RS3 1;  1O3S A;  1ZA7 A;  3QD6 A;  2VMD A;  3MYX A;  1QXJ A;  4NRQ A;  4AEM A;  5KHJ A;  3SH4 A;  1HN1 A;  4YG0 A;  1NYW A;  1RVF 2;  4Y20 A;  4Y1Z A;  1JUI A;  2P34 A;  3NV1 A;  2VZS A;  4NPR A;  2G9F A;  1RYY A;  2E6V A;  2E63 A;  2EAK A;  3CEW A;  3FL7 A;  4OLL A;  4WM7 A;  5E6H A;  4D0Q A;  1WCQ A;  4AI8 A;  3U37 A;  3RYR A;  1AUY A;  3J4U H;  5KXB A;  1VAM A;  2JKB A;  1RIN A;  1COV 1;  2WO2 A;  4LMF A;  3V56 A;  4LO8 A;  2ARB A;  2WNU B;  3NW4 A;  5FYV A;  1ZZC A;  4Q4X 2;  1MVE A;  3ZPY A;  1ULC A;  1STM A;  1O7F A;  1WCK A;  3HBK A;  1QOT A;  2WT2 A;  1S0G A;  3C7G A;  3LFM A;  3H8X A;  2DVA A;  4QXB A;  1AL2 3;  4NII A;  4E2S A;  2KA3 A;  1ZNP A;  2ZX1 A;  1ZYB A;  4LHK A;  3ZSE A;  1US3 A;  4FPG A;  3K2O A;  1NCR A;  1C8M 3;  2HWE 1;  4P00 B;  3GCX A;  5FLH A;  1PMI A;  3VGI A;  3VKM A;  4AHW A;  4TYS A;  2MEV 2;  1W8W A;  4RFT 0;  2WZR 1;  1K5M A;  1VBC 2;  3H0O A;  4AVA A;  1PK6 B;  1PVC 1;  1RUD 1;  3OBR A;  2MEV 1;  2HYK A;  4ZU4 A;  3RJR A;  3VBR C;  3M7A A;  1H4G A;  2ET1 A;  1AJK A;  4MHU A;  1QJY 3;  3W59 A;  1E5S A;  2XLA A;  1R1A 1;  1JYI A;  4ZKT B;  1C8M 1;  4XBL A;  1ZBA 2;  5EP9 A;  3CL1 A;  1A34 A;  1NA1 C;  1SPP A;  5T5O A;  4KI5 M;  4B29 A;  4ZPI A;  4P9Y A;  1X36 A;  3PJY A;  5FY8 A;  1APN A;  1QXR A;  4CZS A;  2YMZ A;  5FMC A;  5JSO A;  3LB9 A;  3WNM A;  5GLT A;  1F2N A;  4E4H A;  3ENR A;  4DB5 A;  5K8S A;  1BMV 2;  2GC0 A;  4LBN A;  2D93 A;  3SEP A;  3ITQ A;  1PGW 1;  5HV0 A;  5FP4 A;  4YM1 A;  3KB5 A;  1HQN A;  3N7K A;  2O8O A;  1UPI A;  1MS9 A;  3WVJ A;  5GZE A;  5BNN B;  3B93 A;  4E4Z A;  3BVC A;  3ZPO A;  2ZHL A;  2D7F A;  1DQ5 A;  1XE0 A;  1NXD 1;  4UFH A;  3D3A A;  1SZB A;  2HWB 2;  3I97 A;  4RHV 2;  2W46 A;  2ZGR A;  5JZG C;  3ZMN A;  4PDW A;  3DN7 A;  1ND3 B;  4KBB A;  4L11 A;  5A1F A;  2ZHK A;  1A6C A;  5H9S A;  5IUQ A;  1CX4 A;  5FR3 A;  1SCS A;  3N9M A;  4GWI A;  3ZMO A;  1BZW A;  1XYN A;  1YFX A;  2ZAH A;  2HKX A;  4URA A;  3WNP A;  3WDX A;  1EV1 2;  1U5Z A;  4AEK A;  2ARC A;  5GLV A;  1JUH A;  1LHO A;  1SLI A;  2RS5 2;  1RUE 1;  1PNF A;  2RM2 2;  4YVW A;  5BNQ A;  4FO9 A;  3JB4 C;  4M3C E;  1L3J A;  2RS5 1;  3DUI A;  4A7Z A;  3EYP A;  4IGP A;  4JDN A;  4B8E A;  4EV0 A;  4FVV A;  3MPP G;  4LKD A;  5DUV A;  4IV3 A;  5A7Q A;  4Y33 A;  5BUV A;  4EWD A;  2OUJ A;  4QB2 A;  5F3E A;  1LES A;  4D6R A;  3GDB A;  1Q8P A;  1B09 A;  1W90 A;  4HN1 A;  1H0B A;  2FDJ A;  5F8P A;  1K12 A;  4IXL A;  4YNI A;  4YGE A;  3VDD C;  3HNM A;  1VBB 2;  1AVB A;  2D5H A;  3HMY A;  4M0H A;  3OYW A;  3JXS A;  2W1U A;  3MFC A;  2EXH A;  1JOD A;  1B35 B;  1WCD J;  4Q1P A;  1G8W A;  2DTW A;  1W2N A;  5KHG A;  3UJO A;  1VMH A;  5IAT A;  3FX3 A;  4MX3 A;  3WDV A;  3BUC A;  1GZW A;  1AR7 1;  4XMA A;  5ABJ A;  3X29 B;  5GJ6 A;  1IS4 A;  2ATF A;  4JQR A;  2PYT A;  5HPO A;  1GV9 A;  3MLL A;  1NLQ A;  3M70 A;  1RUI 2;  2OX0 A;  2BFU S;  2V4V A;  3J8F 2;  4M3C A;  1AZD A;  1MS5 A;  4E27 A;  5IWF A;  5A3W A;  5LEJ A;  1JHN A;  4P9I A;  1DYP A;  1DBN A;  5JSP A;  2A6Y A;  1ACC A;  5A7W B;  3VD9 A;  1KJL A;  1QH6 A;  3VL8 A;  2VMG A;  3AYA A;  4L99 A;  5FXW A;  5FZ9 A;  2C24 A;  2AEZ A;  4JDO A;  2Q1F A;  3RZK A;  1W06 A;  1ASJ 3;  1WCS A;  1W8O A;  2BTV C;  4YAR A;  1URX A;  1WBF A;  4YG6 A;  1X50 A;  3WQB A;  3M3C A;  4GJY A;  4NHY A;  4JTO A;  5A6Z A;  5JSR A;  2QDN A;  5I0U A;  1UZY A;  1UZW A;  5JI7 A;  5CAD A;  2BOJ A;  3ECQ A;  4QD2 A;  1VB2 A;  1FV3 A;  1W6Q A;  2D5F A;  2WL1 A;  3MEP A;  4PT6 A;  4FPF A;  5CFD C;  3ZYR A;  1CES A;  5F1R A;  1CZV A;  4N43 C;  1OLM A;  3VBH A;  4B4R A;  2V5Y A;  1BEV 3;  4N9I A;  4PLO A;  2FCU A;  1IS6 A;  1UYZ A;  1RUH 3;  4RGG A;  4RS5 A;  4BXF A;  3WG2 A;  1W2O A;  5IAX A;  1F8V A;  3AZV A;  3NV3 A;  3ZN6 A;  4XIL A;  1EAH 2;  3DYO A;  4W8J A;  5FZ6 A;  3I3B A;  2D40 A;  3FUO A;  1QJF A;  3IDB B;  3M3O A;  4IND A;  2JDA A;  1KQR A;  1AYM 3;  1LOA A;  4A7Y A;  2YPD A;  3MUZ 1;  1LU2 A;  1RC6 A;  5CFC B;  5GKA C;  5FPA A;  2BW8 A;  2ZGU A;  4LBO A;  3S7E A;  1RUC 3;  4H3W A;  2JDZ A;  1VBB 3;  3RQ0 A;  3UGH A;  3U4X A;  2XPJ A;  2NP0 A;  3WW1 A;  2Y34 A;  3B9C A;  4QB6 A;  4EYU A;  3ON7 A;  5T52 A;  4I02 A;  4IEZ A;  4COU A;  4FTS A;  1AX1 A;  2BWC A;  3WQ0 A;  4R52 A;  2Y33 A;  5LY1 A;  2JG9 A;  5FZO A;  1ZZ8 A;  3RRD A;  3ZR5 A;  4WV8 A;  1W9W A;  4GA9 A;  3TAY A;  1TEI A;  3P5B A;  3I3M A;  5F5I A;  3NKT A;  1KDM A;  2JDU A;  3AX4 A;  5FZ0 A;  2QQM A;  1DLC A;  1W6P B;  2RS3 2;  3LKJ A;  4GAZ A;  2QZ3 A;  3T4V A;  1SCR A;  2R04 3;  3SCH A;  3U75 A;  4CEW B;  4FFF A;  1RUE 3;  2DUP A;  1UYP A;  1QMJ A;  2WYS A;  3H42 B;  1OPM A;  2CSG A;  3VBU C;  3ZYG A;  5FP3 A;  3A0N A;  4JV4 A;  4NVP A;  2NMO A;  2YB7 A;  2YU1 A;  2XDV A;  1UW8 A;  4GH4 A;  1BQP A;  1EAH 1;  3THD A;  4JHT A;  3FJS A;  4LOS A;  5A80 A;  3H9A A;  2WAO A;  1XJA A;  5C3Q A;  4LHS A;  4CXY A;  5LAT A;  3C7H A;  1DLL A;  2X8K A;  5GAL A;  4G9S B;  4K1Y A;  4XBQ A;  4EZ4 A;  1ZRC A;  1UOF A;  2J1U A;  2VU9 A;  2EAA A;  1E57 A;  3EMR A;  3AKR A;  5HCF A;  2FCV A;  1V6O A;  3OJB A;  1NA1 A;  5FK7 A;  4CDX A;  5J09 A;  1Y3T A;  2K46 A;  4JKK A;  4BQ1 A;  1HB2 A;  4IV1 B;  2JXA A;  3I59 B;  2PLV 3;  1NCR B;  4XJU A;  5G04 L;  2TBV A;  3HQU A;  2JDY A;  4M4P A;  2ZGT A;  4D69 A;  2XGX A;  1CAV A;  2F6B A;  4GIQ A;  5FZM A;  5GLU A;  1KS4 A;  3AVS A;  3ZN4 A;  5BNO A;  3F95 A;  4RQP C;  2PTM A;  3NWK A;  3ZYB A;  2PHU A;  3C2U A;  1QJE A;  4UW3 A;  3R4S A;  2RJ2 A;  3LOI A;  5AFE A;  1MS0 A;  1MS8 A;  3POG A;  1I1E A;  1XC6 A;  5AC9 1;  3VDC A;  4IV1 C;  3HQX A;  2BBV A;  2GME A;  4NPM A;  5FZK A;  5ABJ B;  2EIB A;  1LEN A;  2QDR A;  4NO4 A;  2WAB A;  3LSE A;  1G6N A;  2RJL A;  1UWW A;  1ZZ6 A;  2VVD A;  1S2B A;  2YU2 A;  3OF1 A;  4WVW A;  4XPV A;  5EPA A;  1SHW B;  2D98 A;  4MV2 A;  4C0B A;  2G9G A;  1FNZ A;  1GR3 A;  3IPV A;  5CAZ A;  1HQW A;  2Z2S B;  4OUL A;  5IYY A;  1XPW A;  5A7W A;  1XSQ A;  4QX7 A;  2ZZJ A;  3ZFG B;  3DV8 A;  1Y43 B;  3LIH A;  3HJR A;  1QJU 1;  2Q1M A;  4ZU5 A;  1VLN A;  1VB4 A;  3B00 A;  4KWK A;  2Y6G A;  1PZ8 A;  2DVD A;  2ZCW A;  5G05 L;  4A6O A;  3ZXD A;  4XAE A;  2W87 A;  2VGD A;  2WS9 2;  1V9U 1;  1QDO A;  1DZT A;  4MSV A;  2BNO A;  3KV6 A;  4XAC A;  3TWI A;  3VKO A;  4L2N A;  3VLB B;  3AK0 A;  2OZ6 A;  4C1X A;  4AEJ A;  3LSD A;  5EYY A;  3USS A;  3LOB A;  3D0S A;  3J8F 3;  4TLG A;  3I2F A;  4O9G A;  3EO6 A;  3HD8 B;  2WIN B;  1WBL A;  1SLB A;  2ZAA A;  1JZ4 A;  1XXN A;  1TMF 2;  2UUR A;  4XYX A;  4B4P A;  4NUB A;  1ND2 B;  2E7A A;  1CAX B;  3ZDV A;  3B69 A;  2YC2 A;  3Q8C A;  2JG8 B;  5E89 A;  1GAN A;  5J96 B;  4XAA A;  5GZG A;  1ZRD A;  3K48 A;  2VQ0 A;  3R05 A;  4Q0Q A;  1HJF A;  4XFF A;  3MIH A;  2IXI A;  2YYO A;  5EJ1 B;  5C5U A;  2OPW A;  1VIW B;  3ZSM A;  1UY2 A;  4RL7 A;  1HX6 A;  1W04 A;  2PN5 A;  4J1W A;  2PHT A;  4L97 A;  4FPL A;  1RHI 1;  2HJI A;  3T2P A;  3TEW A;  4XHB A;  4UXA A;  5LW9 A;  3NL1 A;  4QXK A;  4RGK A;  3KVB A;  4UFK A;  5BNP B;  5A7N A;  1RUH 1;  2WO1 A;  3SIS A;  4FPJ A;  3HOB A;  4FP2 A;  1BEV 2;  1J1T A;  3ORJ A;  3O1U A;  5BNN A;  4GD4 A;  3CJI B;  1AR9 1;  5FKB A;  1Q8O A;  2RS1 1;  5AVA A;  1OKO A;  5BV6 A;  1BBT 2;  3IB3 A;  3W9A A;  3LQC A;  1CZS A;  4CTE A;  3WNO A;  3AP9 A;  4CVU A;  3VB9 A;  2XJV A;  2VQU A;  2D6N A;  4AQ2 A;  4XFG A;  2YGM A;  3ZYP A;  1QJZ A;  2ZGN A;  3JBG 3;  3WEZ A;  1QJX 1;  1UO9 A;  2GZW A;  2VUA A;  3IDE A;  4KG8 A;  4LKS A;  4OI4 A;  3O0V A;  1AL2 2;  1DGL A;  2RJK A;  5FMO S;  1DQ4 A;  1PO2 3;  3MUY 1;  2H6B A;  4B1M A;  3GM8 A;  3VZO A;  2ZMK A;  4QM9 A;  4W65 A;  5FYC A;  4HK9 A;  2LRP A;  1EV1 1;  2P3J A;  4YZ3 A;  5K0U C;  1ZZ9 A;  4YW4 A;  3T09 A;  3NST A;  5KWR A;  2O8Q A;  4W4Z A;  1SDW A;  1DQ1 A;  2F4P A;  1Q8V A;  1YO8 A;  2R0F A;  4BU2 A;  2JJ6 A;  3PVN A;  2Q5T A;  5FTT C;  1RHI 2;  2WFF 1;  2B42 B;  3HBZ A;  1NLR A;  3OD4 A;  1FT9 A;  5D8A B;  3UK9 A;  3MZH A;  1CIY A;  2P3I A;  3WHT A;  1JOB A;  1MQT A;  2JE8 A;  4AG4 A;  2RS3 3;  2N7G A;  4DIN B;  5FLJ A;  1OOP B;  2G19 A;  1RUI 3;  1RUG 1;  4FSJ A;  1N1T A;  3WSO A;  2GSY A;  1F4H A;  1WZX A;  3G7D A;  4OHV A;  3BAL A;  1RL3 A;  1HLC A;  3LGR A;  4BH9 A;  1PK6 A;  1V6L A;  2DWR A;  1J84 A;  1Y9M A;  4OI0 A;  1CPN A;  3EXU A;  3D4K A;  2W1S A;  3AKS A;  4BM8 A;  2YZ4 A;  4LJH A;  3UL2 A;  5F5A A;  2JE9 A;  1ASJ 2;  4M0N A;  4RS5 B;  5IFP A;  1MZF A;  2UYB A;  5FZD A;  1YJK A;  3RG0 A;  2RDR A;  1S0D A;  4Q0S A;  4XVH A;  3A22 A;  1OOP C;  1SQ4 A;  2KM2 A;  2ET7 A;  4QX2 A;  4WZF A;  5FZG A;  2VO5 A;  4ZZ5 A;  5CFC A;  4B3N A;  2HWF 3;  4HET A;  2D97 A;  4IEY A;  2CHH A;  3MID A;  3LEM A;  2DU0 A;  1V9U 3;  4XQW A;  1S0F A;  1UYY A;  2GNM A;  1W8Z A;  1ZVF A;  2GC3 A;  3AP6 A;  2JEC A;  3J7N A;  4F7Z A;  5C9A C;  1BXH A;  1UX7 A;  3AMQ A;  2ZML A;  4M01 A;  1BBT 3;  3POI A;  4SLI A;  5L7O C;  1O8S A;  1YFY A;  2WZP P;  4CDQ C;  3D8C A;  2OKX A;  4RQP B;  3WW4 A;  2RS5 3;  3D6E A;  4QDQ A;  4QX1 A;  4MLO A;  3OCP A;  4HBN A;  1PGS A;  2AGS A;  2YBK A;  3III A;  1V6N A;  4BQW A;  1AYM 2;  2E9Q A;  5FZ1 A;  2VY0 A;  3BU7 A;  5FY5 A;  3P3N A;  2DUO A;  1N3P A;  1LB2 A;  2P5B A;  4H55 A;  3MLK A;  4MUV A;  2JEM A;  4CEW A;  5A33 B;  3BN6 A;  5JIA A;  2BEO A;  2Y6F A;  3NNL A;  5KC5 A;  5F7U A;  4UF0 A;  3GYD A;  4BWO A;  5FZF A;  2GAU A;  4EN7 B;  3DPR C;  1JBC A;  3K4A A;  5J36 A;  1CAW B;  1BK0 A;  4GH4 B;  4QPG A;  2EIC A;  3AZW A;  2NYY A;  2WS9 3;  4IGQ A;  4Q4Y 3;  2WA3 A;  5LWB A;  3BCW A;  4FP3 A;  3MDP A;  4AW7 A;  5KHK A;  4IW3 A;  1ULP A;  5GZD A;  1PZ7 A;  3TNQ A;  1V6J A;  3VBF A;  5KXD A;  1NA1 B;  2RDS A;  4D7T A;  4LT5 A;  5LK7 B;  1UF2 C;  3SEE A;  2QQI A;  2DUR A;  2WZR 3;  2PAM A;  1Q56 A;  3B9I A;  1W9T A;  4D6S A;  2QQW A;  3WF2 A;  1UXX X;  1CAU B;  3U1X A;  5JXH A;  3D0J A;  1O5L A;  4O9E A;  2DCT A;  1MZ5 A;  1JXN A;  1QJY 1;  2XWJ B;  2ZX4 A;  4HON A;  2JG8 C;  3CJI A;  5IFT A;  2QQV A;  1AYM 1;  3E5X A;  4E2G A;  3U78 A;  3PHM A;  1HRI 1;  3CKH A;  1UCX A;  4Z2W A;  1TMF 1;  3BPZ A;  5F2S A;  3ST7 A;  3BIE A;  2Z5W A;  1H9W A;  2E7T A;  1IG0 A;  2Y6J A;  1SBD A;  1CGP A;  5FFO C;  2J22 A;  4GB3 2;  3VD7 A;  4JX0 A;  4E8D A;  1LHV A;  3QH7 A;  4CCM A;  2BGO A;  2JIG A;  1U12 A;  5FK8 A;  3MFA A;  3U4S A;  2RS1 3;  5FZI A;  2DV9 A;  1UZZ A;  5FYB A;  4CCN A;  2TUN A;  3PL0 A;  1LNS A;  2FBE A;  3QH6 A;  3JD7 2;  2QCS B;  1VAV A;  1AR9 3;  4I0A A;  1VBA 1;  5D21 A;  4Z8B A;  1CVN A;  3MF6 A;  4OQ9 A;  3NNM A;  3BU0 A;  2E51 A;  2ZHM A;  4CU7 A;  4YVS C;  5FPX A;  5GM0 A;  5FY0 A;  1BVP 1;  3ATG A;  4ASK A;  1WW4 A;  1CPM A;  2A1X A;  1SFP A;  2DCJ A;  1I5P A;  2XJQ A;  2F4L A;  4UFJ A;  3A0K A;  3OBZ A;  3OGG A;  4HL0 A;  4CXW A;  2XQX A;  1H6X A;  3THT A;  2QQU A;  3ZFE B;  5EJZ B;  3NV4 A;  3TN9 1;  2PHW A;  2VR4 A;  3LEK A;  5FKC A;  2QQP A;  1VE0 A;  3EQE A;  3OBA A;  4MGQ A;  1TG7 A;  2BQP A;  5FZ4 A;  2OZJ A;  4B4Q A;  4OQ8 A;  1CWP A;  3WQ7 A;  2HWC 3;  1H8T A;  1RUC 2;  2GN3 A;  2DU1 A;  4EN9 B;  1RB8 G;  3V0B A;  3KVA A;  2BVB A;  1KGY A;  1WUV A;  3NAP B;  1DHK B;  3ZSJ A;  3DGT A;  3H3U A;  3RZG A;  3WLU A;  3B94 A;  2WFF 3;  2VAU A;  4Y4R A;  3O0W A;  5A6Y A;  4V2V A;  5FO7 B;  4W50 A;  3LFI A;  4XW3 A;  3WY6 A;  4AI3 A;  3NQH A;  3FHQ A;  1DCS A;  3ASI A;  1VBE 1;  2B8M A;  2CV6 A;  3AKP A;  3H3Z A;  1L7Q A;  2JDP A;  1J58 A;  2QKD A;  2VNR A;  4FFH A;  4TN7 A;  4GZ9 A;  3NO8 A;  3VKL A;  1BJQ A;  1XB9 A;  4AE2 A;  1VBE 2;  3BTX A;  2BVV A;  3POS A;  3IT8 A;  1OH4 A;  4KNC A;  3VDA A;  3Q8A A;  3NNG A;  1F5F A;  4ZS2 A;  1GLH A;  3WF0 A;  1RUE 2;  2JB8 A;  2RM2 1;  2VUJ A;  2EVX A;  1WD4 A;  4BDV B;  4I09 A;  1LOC A;  4Q4W 2;  1FI2 A;  1UYX A;  4QPI B;  4RS5 C;  1BMV 1;  1OQD A;  2XL9 A;  2C4X A;  1W99 A;  3CMG A;  4IES A;  1ZBE 2;  2XOM A;  4JCK A;  4QKB A;  1YIP A;  2W68 A;  1OUS A;  4LA3 A;  2P6H A;  3RJ2 X;  1ZBE 1;  3GHM A;  4JRL A;  2VTX J;  3I3Q A;  2OS2 A;  3WT3 A;  1RIT A;  5IVY A;  3WXP A;  1O3R A;  2Y26 A;  1GBG A;  1W6M B;  2QBX A;  1UL9 A;  1AR6 2;  2VZP A;  5FJH A;  5T54 A;  4X8P A;  2DFB A;  4XF3 A;  1H30 A;  3KCC A;  1LED A;  2MNG A;  2NMN A;  3I2K A;  1AYN 2;  1EPZ A;  4QX8 A;  3KV9 A;  5FZE A;  2VBP A;  3KV4 A;  4QB1 A;  1W6N B;  3O1V A;  5FBJ A;  1QGL A;  4K7J A;  3ZYJ B;  3WDT A;  3PJQ A;  2JG9 C;  1AR7 2;  1I3H A;  3AVR A;  4CDW B;  5C3R A;  4QKD A;  2XVK A;  2RG4 A;  5FMO L;  5F3G A;  2FQP A;  1TME 2;  3POF A;  2VZU A;  5T55 A;  3VUO A;  4QX0 A;  3WUC A;  4CEY A;  4DUX A;  1US2 A;  2JIC A;  2WKK A;  2WN3 A;  2X5I C;  3OPT A;  1OOP A;  5CNA A;  5GLW A;  5IVB A;  1NG0 A;  2EF6 A;  4GQ7 A;  3J7H A;  2CAU A;  3CNA A;  1DFQ A;  1HXS 3;  1CAU A;  1UPS A;  1J1L A;  5BNP A;  3V65 A;  5BNO B;  3URF A;  4DUW A;  4P14 A;  1OA4 A;  1S1A A;  2YHJ A;  3CQO A;  4AFM A;  1UQX A;  3ILR A;  5FQ0 A;  5JZG A;  3T0D A;  1V6K A;  2XHN A;  4JGZ B;  5ACA 2;  2VQT A;  2R1B A;  3IMM A;  2PHD A;  3GF6 A;  1U5I A;  4PI2 A;  3CJI C;  3MGU A;  2QE3 A;  4KQ7 A;  5CA6 A;  4NHK A;  2ZZQ A;  4LOT A;  1QXP A;  1HXS 1;  1AYN 1;  1PM4 A;  4IL7 A;  5FYU A;  3VN4 A;  4AVB A;  5T50 A;  2A6V A;  1F35 A;  2ZJC A;  1PIV 2;  4LIV A;  3ZYH A;  5FYZ A;  5BNO C;  2D43 A;  3AMP A;  3NMB A;  1H1I A;  4BIO A;  5L73 A;  1PNG A;  4K6B A;  4ZON A;  2HWE 3;  1D0G A;  3AYE A;  5SV8 A;  4GWM A;  1LU1 A;  3QBQ A;  2D6L X;  3OOX A;  4IEW A;  4QPY A;  3DCQ A;  4IQP A;  1C5H A;  1YCI A;  1PZ9 A;  4AK3 A;  3ZYI B;  2P6C A;  2GH2 A;  2C9A A;  4P9X A;  1DU3 D;  1Y7B A;  5IK4 A;  1RUJ 1;  3PUR A;  4LBQ D;  2HWB 3;  4RHV 3;  4E8C A;  4HVQ A;  2IWG B;  3O7O A;  4QGN A;  4YW5 A;  1UZ0 A;  3OUH A;  5DZE A;  5I0T A;  1R08 2;  2WZ8 A;  1PM7 A;  5LAS A;  4YWA A;  4AED B;  1AJO A;  4QU2 A;  3RYP A;  1VBA 3;  1YFW A;  3R4U A;  4L9B A;  4CDX C;  4FPE A;  2SBA A;  2XJT A;  5J7M A;  1JU4 A;  1N1V A;  1QF3 A;  2Q1Z B;  5A33 A;  2G9Z A;  2NQY A;  4AAX A;  5A3N A;  4ZXK A;  4QDS A;  4N53 C;  4B1L A;  4ET7 A;  4UF0 B;  4WVM B;  5JLV A;  4COY A;  3BIW E;  4FPY A;  4MXW A;  3IM0 A;  4O65 A;  2Q8D A;  4CP0 A;  4CPB A;  1XQN A;  4AI2 A;  3PIG A;  3RI9 A;  3FLR A;  3W5M A;  3WF1 A;  1J3P A;  4AVC A;  3ROU A;  1JN2 P;  3A21 A;  2R1D A;  2VEC A;  3L9J T;  4K20 A;  3HAG A;  4H7L A;  1W8F A;  5DUW A;  1VRH 2;  3KT1 A;  3M1H A;  3FN9 A;  1G86 A;  1SG3 A;  3K77 A;  4AGG A;  1X7N A;  2VUD A;  3CF6 E;  2FDK A;  5HV4 A;  3PME A;  3I2I A;  3FFZ A;  1PO2 1;  3RVH A;  2I2S A;  3ZSK A;  1SLT A;  1BVV A;  1ZRF A;  3N9O A;  3RGB A;  1COV 2;  4W6X A;  2GN7 A;  5IAV A;  5A70 A;  2CGN A;  4Q4X 1;  5DN2 A;  1N3Q A;  4IEQ A;  3THP A;  5FY7 A;  3RMX A;  1LEC A;  1EUU A;  4BK4 A;  4G3Y C;  1XOY A;  5HBA A;  2PA7 A;  1OA2 A;  4FOY A;  4UFL A;  4X6Q B;  4X8N A;  4XUT A;  2FZ1 A;  4E2Q A;  5KBF A;  1GFF 2;  1ZRR A;  3N35 A;  3ZFF B;  1V00 A;  2VZV A;  2KXL A;  2HYX A;  2JWP A;  1EP0 A;  1VR3 A;  1WMD A;  5KXC A;  4PDW B;  3S30 A;  5FLI A;  1A8M A;  3FLP A;  2NLR A;  3N4M A;  1YNA A;  2UWA A;  1W6Q B;  2ORZ A;  4HN0 A;  3O14 A;  5FWE A;  4AVV A;  3FE5 A;  5F39 A;  4DQA A;  1ZBA 1;  1DQ6 A;  5BNN C;  3AZZ A;  3RPQ A;  1W9F A;  1YLL A;  2XML A;  2Y0O A;  3VBH B;  3TEZ A;  3L2Y A;  3A23 A;  1ZBE 3;  1NUK A;  3AC0 A;  4LUK A;  3O1O A;  1ZX5 A;  4AR2 A;  5B2G B;  2VMH A;  4AI1 A;  1YHF A;  4BQX A;  3G6J B;  1LOG A;  1WWY A;  1VBA 2;  4JDM A;  3BKZ A;  2PEL A;  1ALY A;  5DUX A;  2XUM A;  3CBN A;  4KGG A;  5LBC A;  1QJX 3;  2WBK A;  1CQ9 A;  3LPF A;  3VZL A;  2FDH A;  5FYI A;  2SLI A;  5LRR A;  3VBU B;  3TN9 2;  2MHF A;  2R06 3;  2YC4 A;  4D6Q A;  1RUF 2;  2A3W A;  2B9V A;  4PJY A;  5EWS A;  5T3N A;  2GH8 A;  4FQZ A;  1UN1 A;  3E6C C;  4LBJ A;  4RYD A;  3SCF A;  2VBD A;  3A7Q A;  4PF1 A;  3NNF A;  1D0H A;  2R07 3;  3V0B B;  1VBB 1;  3ACG A;  4QAW A;  4AXO A;  1Q8Q A;  1KXG A;  3RMY A;  2DFC A;  2ZAB A;  4XF0 A;  5JPN B;  2HWD 1;  1FMD 3;  2RDN A;  1OVS A;  2GC1 A;  1DDL A;  2R7E B;  4LUL A;  1IPS A;  2P4E A;  4EWA A;  3BTA A;  3SNM A;  1NQJ A;  1OSG A;  1NY7 2;  4NHM A;  3WQ1 A;  4ARY A;  2ZGO A;  3B02 A;  3RWK X;  2VPV A;  1N47 A;  2JD9 A;  1LOF A;  1PX3 A;  2VE1 A;  4OMD A;  4IEP A;  5A3O A;  2PLV 1;  5LBF A;  3K3O A;  4MGI E;  5J1X A;  5ACA 3;  1N1Y A;  3HN1 A;  4WM7 B;  5H9P A;  2WNE A;  3U07 A;  2QVS B;  2FHR A;  4A45 A;  2QTW B;  4S2H A;  5IVE A;  3MV1 1;  2OQ6 A;  3M3I A;  3ZFF C;  2A3X A;  1U5X A;  2VM9 A;  5FPZ A;  3J9S A;  3OEA A;  2ZGP A;  4LO4 B;  3VBR A;  1POV 1;  4GMP 0;  4LHN A;  1RUG 2;  1UY0 A;  1MS4 A;  4PBO A;  3VBO B;  2BDR A;  2ZX0 A;  5JAX A;  4ZHN A;  4CCE A;  3CZJ A;  4IE6 A;  2C9K A;  1VBD 2;  5FCC A;  3P1I A;  5JPM B;  1YFU A;  1OH3 A;  4CRQ A;  5IK5 A;  2PMW B;  5FPB A;  2VZR A;  1D4M 1;  4BCU A;  2DUQ A;  4DUV A;  5CKN A;  3CDZ B;  4H2A A;  3N9N A;  1BK1 A;  2WAA A;  2J1E A;  4FCA A;  3JCI A;  3WF3 A;  3ZLI A;  3OTF A;  1W6N A;  4XDP A;  1AHS A;  2BGC A;  3C7E A;  4UW5 A;  4KWU A;  1JZ3 A;  2W08 A;  3M3E A;  1KS5 A;  3OY8 B;  3MIG A;  3MBW A;  3OGJ A;  1LJ7 A;  4I01 A;  4AVT A;  4BQ3 A;  5CG9 A;  2X05 A;  4CXX A;  3FHI B;  4M4R A;  4Q0V A;  2RR1 1;  2I45 A;  3KT4 A;  4CDQ B;  4I2O A;  2J1A A;  5E1R A;  2C1F A;  2EAL A;  2YG0 A;  4ISQ A;  3VD3 A;  1UZV A;  1WCU A;  2DBI A;  1RUF 3;  3GXU A;  3AL5 A;  2KR2 A;  3AMH A;  3MIB A;  4LK7 A;  4CUG A;  4XOG A;  2EXI A;  4NWW A;  4CP9 A;  2ZEY A;  4MAD A;  4WM8 A;  2HBU A;  2R04 1;  3T0A A;  2FZ2 A;  5DQ0 A;  1OFN A;  3DPR A;  2WC2 A;  1TE1 B;  1W2T A;  2VJX A;  4QPG C;  1C5I A;  5LA2 A;  2KD7 A;  4WVZ A;  2B5H A;  1LR5 A;  1FYU A;  3HNY M;  4DOU A;  1G9B A;  4Y5Z 0;  2A5Z A;  1B35 C;  5DMY A;  2LAL A;  1R64 A;  1ENX A;  3J26 N;  1PVC 3;  1RUD 3;  4LIT A;  4XF1 A;  1BEV 1;  4FAG A;  2H0V A;  2WDB A;  3KV5 A;  1ST8 A;  1OUR A;  1GNH A;  3UT0 A;  3VDD B;  5L36 A;  4Y1V A;  1OT5 A;  4COV A;  3HN3 A;  3FWE A;  2QUO A;  3FFQ A;  5HCB A;  4Q4X 3;  4ASM B;  3BPS A;  2VCB A;  4JGY B;  2P3K A;  4AFA A;  2HWF 1;  4ERO A;  2XJS A;  4ONU A;  1ENQ A;  3HEI A;  1S0I A;  5CU1 A;  1MR5 A;  2UY8 A;  1COV 3;  2WLP A;  3WW2 A;  1O3T A;  5E16 A;  4YG3 A;  1JOP A;  2LTN A;  2WNV C;  1C28 A;  3ZO0 B;  2FDI A;  1ZRI A;  2JG8 A;  4YGB A;  3E6D A;  4J25 A;  1AL0 G;  2H0B A;  4FPH A;  3CIH A;  4Q26 A;  3IDA A;  4Y4Y A;  5D8A C;  1WW5 A;  2BU9 A;  3C7O A;  4LBK A;  3IAQ A;  1YJL A;  1NKG A;  1NZC A;  1VBD 3;  3OGS A;  3K4Z A;  5F3C A;  3PUS A;  3EHK A;  4CCJ A;  4C0H A;  4FAH A;  3RI8 A;  3AFK A;  1V6I A;  1EUT A;  4XC9 A;  5K4L A;  1Q5O A;  3ZKY A;  4D7S A;  1OLQ A;  1GZT A;  1NE6 A;  1ND3 C;  2XJR A;  2G4I A;  2GP5 A;  2ZBJ A;  3CZU A;  2BYV E;  3KMH A;  4MG2 A;  2IXL A;  2WJS A;  5T5J A;  4DPN A;  2BER A;  2HEW F;  4JAA A;  4N90 A;  5JR7 B;  5F5C A;  4WM7 C;  4DY3 A;  3PNA A;  1CZT A;  3KF5 A;  5FPL A;  5JZG B;  3OYW B;  5CVR A;  3RWN A;  1EYB A;  1QY4 A;  2DVG A;  1TNR A;  3GZT B;  3I8T A;  2JB4 A;  2W9X A;  4FOQ A;  4WBB A;  1XE8 A;  3PDQ A;  5CFD A;  4EJR A;  2XJP A;  1D7P M;  3MLJ A;  5A7P A;  2PHX A;  2XVL A;  5EXO A;  1DZQ A;  3P3P A;  3ZXK A;  1YQ5 A;  2ARA A;  1CR7 A;  3AP7 A;  1QNY A;  5F6K A;  1SFN A;  3D82 A;  5FZB A;  4ARX A;  1W3X A;  4YVS B;  5JXI A;  3U0Z A;  3RZJ A;  4R9B A;  2XON A;  2DF7 A;  3TN9 3;  1JZ5 A;  3O5S A;  3JD7 1;  2GNB A;  3N9P A;  1PO1 3;  1ZA4 A;  2D6O X;  2Y6H A;  3HWJ A;  5BXX A;  1OXC A;  1C4R A;  2VOV A;  4CDU C;  3H8R A;  1DGR A;  3LDK A;  3MW3 A;  2XLG A;  5FWJ A;  3AJY A;  3E6B A;  4KMQ A;  4FFI A;  1UXZ A;  2IXH A;  3LDB A;  1REE A;  1UOJ A;  3C7F A;  5C4W A;  2LM3 A;  3LPG A;  2D3R A;  2VH9 A;  4YW6 A;  2JDM A;  1RMU 3;  2B39 A;  2Q4S A;  1WA6 X;  3TYJ A;  1IS5 A;  2W92 A;  2CWS A;  3O1M A;  4LO7 A;  1R09 1;  5I8Y A;  3VBR B;  3UES A;  3DXT A;  1XBF A;  1L7R A;  3NJX A;  1ENS A;  1SBE A;  5AC9 3;  1EAH 3;  3N9L A;  5CBL A;  4MZU A;  2PXJ A;  4NPL A;  4AFC A;  1PMJ X;  3VHN A;  3GBG A;  2E33 A;  1PK6 C;  4HLT A;  4UT5 A;  5C3P A;  3UKV A;  2W3J A;  3LWC A;  4XIO A;  2YFZ A;  2WT1 A;  2RDQ A;  3EJK A;  3IDC B;  4HKO A;  2WO7 A;  4GXL A;  3JB8 A;  3N7J A;  1YXW A;  3WDW A;  3KHC A;  1ND2 A;  2O14 A;  3N9Q A;  2W0X A;  2VZ1 A;  1GYK A;  3HPN A;  4MXW B;  4Q8L A;  5LA9 A;  4AHX A;  5GZC A;  2YPJ A;  4HPK B;  4CA9 A;  4QWN A;  1ULD A;  4KG0 A;  4MGZ E;  5FO8 B;  4ISR A;  4Q1R A;  1RED A;  1GKB A;  4OI1 A;  3UV9 A;  1D4M 3;  4LE3 A;  4HVR A;  5EIY B;  4OHZ A;  5LK5 A;  1IQA A;  4YFW A;  4XQD A;  1Z7S 3;  4PDW C;  2TNF A;  2WR9 A;  4DMI A; 
#chains in the Genus database with same CATH homology
 3OG2 A;  3WNM A;  4CU7 A;  4A41 A;  2DCK A;  4YPJ A;  2DCJ A;  1I5P A;  2LW8 A;  4JHZ A;  3SEP A;  4MO3 M;  2XQX A;  1H6X A;  3LE0 A;  5EJZ B;  2VR4 A;  3LEK A;  2J1T A;  2RVA A;  3OBA A;  4MGQ A;  1TG7 A;  3FHA A;  3D3A A;  3I97 A;  5LA0 A;  2W46 A;  1KGY A;  4DXR A;  2C26 A;  2WO3 A;  3MO4 A;  3T2O A;  3WNL A;  4GWI A;  4MGS A;  4W50 A;  3WNP A;  1GOG A;  3NQH A;  4A44 A;  3FHQ A;  3PUH A;  1L7Q A;  3SKV A;  4QX3 A;  4GZ9 A;  1OH4 A;  3VDA A;  3NNG A;  1ULO A;  4BXS V;  3EYP A;  4OMC A;  3WF0 A;  2QQK A;  4BDV B;  1H6Y A;  1UYX A;  2C4X A;  1W99 A;  4QB2 A;  2V5D A;  3CMG A;  3GDB A;  2XOM A;  2ZXQ A;  1K12 A;  3HNM A;  4OUE A;  2Z4F A;  1W9S A;  3JXS A;  2QBX A;  2W1U A;  4XUR A;  2VZP A;  5JXJ A;  3THC A;  2W1W A;  3I2K A;  1PMH X;  2E31 A;  4QB1 A;  2YFU A;  5HPO A;  3WNN A;  1J83 A;  2V4V A;  2ZEW A;  2X10 A;  3E1F 1;  4UI9 L;  2VZU A;  3VD9 A;  1YQ2 A;  2Y64 A;  4QX0 A;  4HG6 B;  3LEI A;  3LEG A;  4DUX A;  1US2 A;  2WN3 A;  2EIE A;  3OB8 A;  5FUI A;  2ORX A;  2BZD A;  1W8O A;  2B4K A;  3J7H A;  3T2Q A;  1JYW A;  3WQB A;  4DUW A;  5IHR A;  2CDO A;  3CQO A;  3T0D A;  2XHN A;  3PUI A;  2VMF A;  2VQT A;  3ECQ A;  4ZY9 A;  3C8X A;  3T0B A;  2VC9 A;  4ZXE A;  1JU3 A;  1PX4 A;  4PT6 A;  4XUP A;  1CZV A;  2J1R A;  2EID A;  2HLE A;  3ZM8 A;  4CU6 A;  2QQO A;  1UYZ A;  3OGR A;  2VZ3 A;  1O59 A;  2VCA A;  5JXG A;  3DYO A;  4W8J A;  5DPN A;  3I3B A;  3DYP A;  2VTF A;  2JDA A;  3MUZ 1;  2E32 A;  1K42 A;  1NAE A;  4BJ0 A;  4E8C A;  4TTG A;  1JZ8 A;  1OF4 A;  1UZ0 A;  4QB6 A;  2WZ8 A;  4Z2A A;  3W5N A;  3K46 A;  4UOJ A;  1OD3 A;  1JU4 A;  1CX1 A;  3ABZ A;  4AAX A;  1GUI A;  2W5F A;  3I2G A;  4QDS A;  4ET7 A;  1W9W A;  2QQJ A;  4XUN A;  3W5M A;  2QQM A;  1DLC A;  3WF1 A;  1JZ3 A;  3OGV A;  3A21 A;  2QQN A;  2WYS A;  1K45 A;  3FN9 A;  1SG3 A;  2YB7 A;  3UET A;  5LCW L;  3K77 A;  2LS6 A;  4IUG A;  4FI9 A;  3THD A;  5I0D A;  3I2I A;  2WAO A;  4XZU G;  4LHS A;  2QQL A;  3C7H A;  2VMC A;  4LPL A;  1MPX A;  2J1U A;  3SKJ E;  5DN2 A;  4JKK A;  4PQQ A;  1EUU A;  2W1Q A;  1GU3 A;  4BK4 A;  4A4A A;  1NX9 A;  5G04 L;  4M4P A;  4XUT A;  2W91 A;  2J7M A;  2VZV A;  2HYX A;  3IAP A;  5C7G A;  2RJ2 A;  4CU8 A;  3DYM A;  2VZT A;  2Y8K A;  2ORZ A;  2WUH A;  1XC6 A;  3VDC A;  2EIB A;  1DP0 A;  2WAB A;  1UWW A;  1GOH A;  3DEC A;  3MV0 1;  4RN5 A;  1SHW B;  4UAP A;  1UMI A;  3A23 A;  1NUK A;  3AC0 A;  5IJR A;  4XUO A;  4L0P A;  1GOF A;  5IYY A;  1XPW A;  3BGA A;  1JHJ A;  3HJR A;  3ACI A;  4GWJ A;  2WBK A;  2JKX A;  3LPF A;  4DEQ A;  4LQR A;  4A6O A;  1JI6 A;  2Y6G A;  5G05 L;  2W87 A;  2YC4 A;  1T2X A;  2B9V A;  1WKY A;  4RYD A;  2W94 A;  3A7Q A;  4PF1 A;  5C71 A;  1JZ2 A;  4BK5 A;  2ZEZ A;  1W8N A;  3ACG A;  4QAW A;  3NRU A;  3I2F A;  3ACH A;  3VD4 A;  1JZ4 A;  2R7E B;  5JUV A;  1UMH A;  3I2H A;  3I3D A;  2YC2 A;  5CYY A;  2VL4 A;  4ARY A;  1JYX A;  4MOA A;  2JD9 A;  1PX3 A;  1UY1 A;  4OMD A;  1UY4 A;  5EJ1 B;  2ZEX A;  1UY2 A;  2ID4 A;  4P5Y A;  5J1X A;  1GNY A;  3F2Z A;  4A45 A;  1F4A A;  4DEV A;  3MV1 1;  3T2P A;  2VM9 A;  3OEA A;  2WN2 A;  2DDU A;  1UY0 A;  2WO1 A;  3CZJ A;  2C9K A;  3HOB A;  3P1I A;  1IQD C;  2VZR A;  4DUV A;  3IB3 A;  3CDZ B;  3LQC A;  1CZS A;  1K3I A;  3WNO A;  4CVU A;  1OF3 A;  2VQU A;  2WAA A;  2J1E A;  3WF3 A;  3C7E A;  2VZQ A;  3NJV A;  4KWU A;  3WEZ A;  3GGL A;  3MBW A;  4LKS A;  2BGP A;  3MUY 1;  2X05 A;  3GM8 A;  4M4R A;  4A3Z A;  3EB7 A;  4A42 A;  3I2J A;  2J1A A;  3T09 A;  5B4X A;  2W47 A;  2YG0 A;  3VD3 A;  1BHG A;  4W4Z A;  5IFP A;  3WF4 A;  2W95 A;  5CZK A;  3GXU A;  4P02 B;  2E26 A;  2ZEY A;  4MAD A;  1JYN A;  3T0A A;  2CDP A;  5DQ0 A;  2PQS A;  2WQ8 A;  3P6B A;  5HXM A;  2VJX A;  5LA2 A;  1CIY A;  2KD7 A;  3WNK A;  4XUQ A;  2JE8 A;  4AG4 A;  3HNY M;  2L9L A;  4D8M A;  1SDD B;  1XNA A;  1R64 A;  5DMY A;  5A1A A;  2J1S A;  4DXS A;  4ZZ8 A;  3WSO A;  2WDB A;  3K4D A;  1F4H A;  1JZ6 A;  1OT5 A;  3HN3 A;  3ACF A;  2VCB A;  1J84 A;  1O8P A;  2W1S A;  3HEI A;  5JMO A;  2BBA A;  3HNB M;  1JYV A;  3VD5 A;  4QPW A;  3ETP A;  4XVH A;  1GMM A;  3A22 A;  4JKL A;  4QX2 A;  3CIH A;  2VO5 A;  4ZZ5 A;  3IDA A;  1TVG A;  3C7O A;  3IAQ A;  5JR2 A;  1UYY A;  1NKG A;  2Y6L A;  3UNP A;  3OGS A;  3K4Z A;  4CUC A;  1W0N A;  1UX7 A;  1EUT A;  3VDB A;  1O8S A;  2OKX A;  3CZU A;  5B4N A;  4CU9 A;  3K75 B;  4QDQ A;  4QX1 A;  4OYU A;  2BER A;  4JKM A;  3III A;  1CZT A;  4P08 A;  2V72 A;  1DYO A;  5C70 A;  1XNT A;  2W9X A;  2VCC A;  2VZO A;  2Y6K A;  3BN6 A;  2X09 A;  1D7P M;  1JZ7 A;  5F7U A;  1P8J A;  3I3E A;  4OZO A;  3K4A A;  4ARX A;  5JXI A;  2XON A;  2EIC A;  1JZ5 A;  4CUA A;  2VMD A;  2Y6H A;  4CUB A;  1HN1 A;  2VZS A;  2VME A;  4KMQ A;  1RYY A;  3FL7 A;  1ULP A;  1UXZ A;  2VOT A;  4D0Q A;  3C7F A;  1WCQ A;  3U37 A;  3LPG A;  3SEE A;  2QQI A;  2WO2 A;  2W92 A;  1W9T A;  3UES A;  1L7R A;  3NJX A;  3WF2 A;  1UXX X;  5JXH A;  3C7G A;  1PMJ X;  2E33 A;  2W3J A;  5IFT A;  1US3 A;  1GQP A;  3OEB A;  4P00 B;  2YFZ A;  5LA1 A;  3CKH A;  2RV9 A;  3HPN A;  2VZ1 A;  3T08 A;  2WZE A;  2Y6J A;  2J22 A;  1UY3 A;  4E8D A;  3VD7 A;  4JX0 A;  2BGO A;  2J1V A;  5EIY B;  1LNS A;  1KEX A;  4QDR A;  4KI5 M;  4TXW A;  4DXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...