2WO1A

Crystal structure of the epha4 ligand binding domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
183
structure length
180
Chain Sequence
ETGEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKRTKHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Plasticity of Eph-Receptor A4 Facilitates Cross-Class Ephrin Signalling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords EPHRIN TYPE-A RECEPTOR
total genus 34
structure length 180
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wo1A00
2YFUA 2W1UA 2WDBA 2RV9A 2EIDA 4MO3M 3I3EA 2WAOA 3VD3A 3I3BA 2VL4A 4W4ZA 2B9VA 2VMCA 2QBXA 3WF2A 4UOJA 3IDAA 4DUVA 4MGQA 3C8XA 5IHRA 2ZEXA 2QQJA 4CVUA 2OKXA 3NRUA 2Y6HA 4AG4A 1NUKA 2VZVA 2WZEA 2WO1A 1PMJX 2XOMA 3WNPA 4P5YA 3U37A 2ORXA 3LEIA 4DUWA 3WNOA 1CZTA 5EJZB 3I3DA 1RYYA 3WNLA 1GMMA 1O59A 1DYOA 2VCCA 2C26A 2JDAA 3MUY1 4D0QA 1GQPA 4IUGA 4XUQA 3HPNA 2ZEYA 4QX2A 5IFPA 4A4AA 2VQUA 3ETPA 2VZTA 4DEQA 2VJXA 1JZ8A 4BK5A 4RYDA 1W0NA 1JYWA 2VM9A 5JXHA 3K75B 2ID4A 2VOTA 4MOAA 1UYXA 4MADA 2DDUA 2WQ8A 4CU9A 4YPJA 3VD5A 4TTGA 1GOGA 1P8JA 2Y6LA 3VDBA 2JKXA 2X05A 4CUCA 4GZ9A 5C70A 2BGPA 4LPLA 3UNPA 1UMIA 5B4XA 2WO3A 2KD7A 1UY2A 1NAEA 3HNMA 2Y6JA 5C71A 2VQTA 1XNTA 2ZXQA 2Z4FA 1PX4A 3T0DA 2XHNA 3K46A 1W9SA 4JHZA 4XURA 1US2A 3LPGA 5C7GA 3UESA 2X09A 4P08A 3VD7A 2J1EA 3OG2A 4KWUA 4XUPA 4DEVA 3HEIA 3GM8A 3MUZ1 3P1IA 3ACGA 1JZ2A 2WABA 3DECA 2WYSA 5DMYA 1K42A 1MPXA 3GDBA 3WF4A 2VZRA 1W8NA 1OF3A 2W9XA 5G05L 2CDPA 4XUNA 2VZQA 4JKKA 3OBAA 4TXWA 2WUHA 2YB7A 4CU7A 4XVHA 4A41A 2W1QA 1JZ3A 4P02B 3NJVA 5JXIA 1OD3A 2WN2A 4A3ZA 2V5DA 1GU3A 3OEBA 2E32A 2CDOA 4UI9L 3OEAA 1DLCA 1UY4A 1WCQA 2L9LA 3I2IA 4D8MA 4M4RA 4ZZ8A 1BHGA 1GNYA 3MV01 4QB6A 5JMOA 4UAPA 3T08A 4CUBA 3LEGA 3IIIA 5DQ0A 2VZUA 2Y64A 1SDDB 4HG6B 4QX0A 4W50A 2EIBA 3SKVA 1JZ4A 3BGAA 3WSOA 1HN1A 3LQCA 2LS6A 4E8CA 4MGSA 4CU8A 1SG3A 2PQSA 2QQOA 3HNYM 3WF1A 1UY3A 3HNBM 3OGSA 1SHWB 2VC9A 3W5NA 1JI6A 3THDA 5IJRA 2ORZA 1K3IA 2QQLA 3ZM8A 3JXSA 4JKLA 1ULOA 4QX1A 3CIHA 1UXZA 3WNKA 3VD9A 4DUXA 4FI9A 1JU3A 4PQQA 4A45A 1K45A 4KMQA 2YC4A 3OB8A 2J1TA 4OYUA 2C4XA 1F4HA 3UETA 3SEPA 5LA0A 4OMCA 3C7EA 3T2QA 2VMDA 2VZPA 2VZOA 3FHAA 3FL7A 1KGYA 3I2FA 3WNNA 2Y6GA 1UY0A 1KEXA 5LA1A 1XPWA 3I2KA 4QB2A 3IB3A 1UX7A 1US3A 4ET7A 4XUOA 1EUTA 5FUIA 1DP0A 1IQDC 5CZKA 4JKMA 1CZSA 2V72A 4PT6A 3WEZA 3F2ZA 4JX0A 3C7GA 3I97A 3ABZA 2YC2A 5CYYA 2JE8A 2WZ8A 3WF0A 2HYXA 2W3JA 1ULPA 2VCBA 2WAAA 2E26A 3K77A 2EICA 2WBKA 1XC6A 2W5FA 3MO4A 3CQOA 3CZJA 4GWIA 4KI5M 4LHSA 4P00B 4BXSV 2DCKA 3ACIA 5DPNA 2R7EB 2VR4A 4LQRA 3WQBA 3A22A 3DYMA 4QDRA 1PMHX 3T2PA 2WO2A 2C9KA 3WNMA 5EIYB 1W99A 3LPFA 3OGVA 1OF4A 4ZZ5A 3MBWA 3VDAA 3CZUA 3A23A 3PUIA 2J1SA 4GWJA 4QAWA 2EIEA 2E33A 1W9TA 3D3AA 2QQNA 3IAPA 3K4AA 1F4AA 1WKYA 4PF1A 4A6OA 2HLEA 3CMGA 5I0DA 4M4PA 3OGRA 2W1SA 1GUIA 3E1F1 4LKSA 3DYOA 3THCA 1UZ0A 2V4VA 2W87A 3ECQA 3T0BA 2VZ1A 2YFZA 3AC0A 3HJRA 2VMEA 5A1AA 5JR2A 4OMDA 1W9WA 1L7RA 2YG0A 4A42A 1OT5A 4QX3A 2VTFA 1J84A 2J1UA 2WN3A 3EB7A 4AAXA 2QQMA 5JXGA 1JZ6A 5G04L 1JHJA 1EUUA 2Y8KA 5J1XA 2J1AA 3K4ZA 3DYPA 2W47A 5DN2A 3I2JA 3SKJE 5JXJA 3CDZB 4ARYA 2VCAA 3ACHA 3FHQA 4QB1A 1XNAA 1UWWA 3J7HA 1JYXA 5B4NA 3NQHA 3A7QA 3I2GA 4CUAA 4XUTA 3NJXA 4L0PA 3HOBA 4A44A 3P6BA 5IYYA 1JZ7A 1K12A 1YQ2A 3HN3A 1LNSA 2RVAA 2XQXA 1JYNA 3NNGA 3C7OA 3LE0A 5EJ1B 3VDCA 2E31A 2J1RA 2W95A 4QPWA 4ZY9A 2VZSA 4E8DA 3I2HA 3CKHA 1R64A 2BZDA 3VD4A 3SEEA 3EYPA 3PUHA 3MV11 2W46A 2VO5A 3C7HA 5HXMA 1D7PM 2W94A 3A21A 2J22A 2VMFA 3GGLA 4RN5A 2ZEZA 1UXXX 1NKGA 3W5MA 5IFTA 2X10A 3T2OA 3T09A 2QQIA 1UYZA 4XZUG 1J83A 2QQKA 3C7FA 1JYVA 2ZEWA 4BK4A 4DXSA 2Y6KA 4W8JA 3IAQA 1GOHA 1H6YA 2BBAA 3LEKA 1UY1A 3FN9A 3ACFA 5F7UA 5HPOA 4Z2AA 1O8PA 5LA2A 2J7MA 4OZOA 3WF3A 4BDVB 4QDQA 2B4KA 1OH4A 2W1WA 4ZXEA 1JU4A 4DXRA 1GOFA 2JD9A 2LW8A 2J1VA 1NX9A 3T0AA 3BN6A 5JUVA 2DCJA 1H6XA 1CIYA 1TVGA 1PX3A 1L7QA 4ARXA 4DXTA 2W91A 1CX1A 1JZ5A 2W92A 2VZ3A 4OUEA 4QDSA 4BJ0A 3K4DA 4CU6A 1W8OA 1UYYA 2BERA 2BGOA 1TG7A 1UMHA 1O8SA 1CZVA 1T2XA 2RJ2A 1I5PA 5LCWL 3GXUA 2XONA
chains in the Genus database with same CATH superfamily
4FP2A 2WNOA 4Q4W1 5DXDA 4DFSA 4TZDA 4XE9A 3NW4A 2BV4A 3WG1A 1ZBE1 2DCYA 2JG8B 4HONA 4DB5A 3FUOA 4ZONA 4AI0A 3DPRB 3AZVA 5JPNB 1PZ7A 1H30A 3WF2A 1ODMA 3IDAA 3N3HA 4AQSA 4DUVA 3ZVXA 2C5DA 5M0TA 1S0IA 1RUE1 2FZ2A 2G4IA 2ZGRA 3CJIC 1SLCA 2PYTA 2DVAA 5FXWA 2Q8DA 4AK3A 2QQJA 1M06G 2OKXA 1F8VA 4BQ2A 5CG9A 3R6SA 3S0MA 1LRHA 4QX8A 2WO1A 1PMJX 1H2KA 1AJKA 2YBPA 2PXJA 1DFQA 4KGGA 4F83A 4OULA 1TQ5A 4QT6A 5FO7B 2PHDA 2A3YA 1AZDA 3IIAA 1XSRA 1YCIA 1IOAA 1M4WA 1TME3 1O5UA 2B42B 1NCQC 2P1BA 4NE9A 5DABA 1DYOA 1L3JA 2VCCA 2XGXA 1YI7A 3N9PA 1ENSA 2CY6A 3AKSA 4FOVA 2R063 2YPDA 4ONUA 1UOGA 1IG0A 3LGRA 4D0QA 3P3PA 1YQ8A 3J8F1 1VBD2 4M00A 5FO9B 1YYNA 2B9UA 3JBG3 2D7FA 1KXGA 2WWSA 4GULA 2CGOA 3ETPA 4DEQA 2ARAA 3B7MA 1WBFA 2HWD2 4K3UA 1MS8A 4I3GA 1CAWA 5FYZA 4FAHA 5ACA1 4LO8A 4RR3C 1AX1A 4XPVA 3I2OA 4MOAA 4LXLA 2VY0A 2HWD1 2VW1A 4UBGA 2VMIA 3SISA 4MADA 5FO8B 2WQ8A 1SFPA 2XQRA 5FYYA 4TTGA 1GOGA 5IVVA 3ITQA 3H7JA 2VG9A 4QM9A 5F6KA 5C5TA 1AYM1 3AKTA 3LEMA 4RFT0 5FKBA 1UKRA 2WYFA 4IE6A 3PUQA 1YFXA 2KD7A 2VU9A 3VKOA 4UYBA 1NAEA 5KWRA 2HWB2 4GMP3 1FOD2 5AFBA 1XNTA 4L8QA 4FQZA 4U36A 1BCXA 2Y0OA 2XHNA 3LB9A 4YVSC 3GZEA 2QCSB 2IVIB 1H1IA 4JGZB 3B9CA 3D82A 4K40A 4G3YC 5JMCA 1AXZA 1D4M3 3T30A 2DVBA 2XJVA 5D8AA 1R092 4XURA 3ZDSA 4RR3A 1SLLA 2JXAA 1GQGA 3CO2A 4Y20A 3VDDC 1LEDA 2HEYF 3S7IA 3OOXA 3RGBA 3M8LA 2QDNA 3RI9A 4K21A 4R9CA 3GF6A 4IQPA 2GNDA 3OG2A 4DEVA 1JUIA 3MIDA 2PN5A 3HEIA 2HWD3 3GYDA 5D2AA 3RVHA 3P1IA 5C8WA 1QJY3 3M70A 3PTRB 4FPEA 4NN0A 2MHFA 3KLSA 3U11A 5DMYA 4ZS2A 3LCPA 3EBRA 2ZMNA 3DF0A 3QOPA 4E9KA 3WF4A 5FP3A 4JDMA 5FXZA 5BNQA 1KQRA 5BUVA 3ATGA 1VBA1 5FPXA 2YMZA 5G05L 4PHZA 1YC61 2WS91 4XCBA 4XUNA 3ALQA 3AMQA 2O8QA 2VZQA 2YHJA 3BIWE 3PVOA 1AR62 4CRQA 4U2AA 3RRDA 3OBAA 3WT3A 4IETA 1VRH1 1IKQA 3WINE 3H1WA 4AEDC 2AC1A 2G9FA 1H9PA 1ZA7A 5JOZA 1XNCA 3JQWA 1JZ3A 5JXIA 4P9WA 4ATEA 4CP0A 2DCZA 3AP9A 3T4HB 5DDJ1 1WLWA 1GU3A 3OEBA 1EAH1 2XUMA 2EF6A 2B5HA 1VE0A 1EPZA 3KT7A 3OEAA 4XFFA 5FP7A 4D8MA 3OYWA 4Y5SA 5IT6A 5JMOA 2XWBB 2JWPA 5FP9A 4CUBA 4QX7A 1IG3A 3IIIA 3MIEA 3RMXA 2VXRA 2RMU3 4FXKB 4PIYA 1CAUA 3SLIA 3ZX7A 4B1LA 4CDWB 1W05A 3UJQA 1AR73 3RJ2X 1A78A 1XJAA 1GYKA 1QMJA 3D4KA 5FZ9A 3SKVA 5FYHA 1LU1A 4CCDA 2BYVE 3C3VA 4YG6A 2N7GA 3URFA 4BQXA 1NG0A 2IUWA 3SITA 5GLVA 5CFCB 1EAH2 1F2NA 3ZXJA 1W8FA 1Q43A 2PQSA 1OQDA 1NCQB 1S0FA 3LA7A 2C24A 1WZXA 2XVLA 3NV3A 3WF1A 3ZSJA 4Y33A 1VMJA 2JJ6A 1PGL1 4INDA 3BB6A 1NXMA 2DCTA 3MZHA 4J25A 2GNTA 4Q2FA 1KDMA 5FY8A 3WX5A 3W5NA 1DG6A 1JI6A 2EXIA 2XHKA 4JQTA 2LUWA 4QPIB 1RUE3 4XF0A 4YVWC 5IJRA 1LTEA 2A75A 3THDA 4X6RB 2AACA 2EAAA 2JD4A 4YVSA 5FIXA 2R041 3ZM8A 4XF9A 4CDXB 1ULOA 4R8HA 1N1YA 1WMEA 4Y24A 2DYCA 2OXBA 4QWNA 1ZBE3 4OHYA 1UNBA 4HK8A 4CCOA 4BQ5A 1V6JA 1UU6A 3D0SA 1RINA 3DXUA 4JRAA 5FZKA 4NMIA 4KMQA 1CQ9A 3USUB 5LW9A 4RSUA 2ZGMA 3TYJA 4Y1UA 2OPKA 1A8MA 4LBQA 2YC4A 2ATFA 1HV0A 4OYUA 2XJRA 2EIGA 3UKTA 1Z7S1 1F4HA 3D0JA 3MIHA 1OFNA 5HCHA 3KSCA 2BBVA 2RMU2 4IGOA 5KHGA 4IW3A 5HV4A 4QQOA 3MGUA 2VZOA 5LATA 2ZX1A 1DLLA 1Z7S2 5HCFA 1C8NA 1QEXA 2PFWA 1DGRN 1YXWA 1PM4A 2EXKA 3K3NA 2OZJA 5EHDA 4XFAA 3JU9A 1HRV1 2RS33 4CCJA 1RUJ1 1UX7A 1US3A 4HPKB 1GWLA 1PNFA 2E7TA 2OZ6A 2BWCA 5L7OA 2D98A 4FFIA 1J58A 2GH8A 5FUIA 5LA9A 4I2OA 1HRI3 3GCWA 1IQDC 5LY2A 2HWB1 2PHFA 2C9AA 4TWTA 3RQ0A 5JSPA 4EWAA 4B4QA 2GNBA 1CZSA 1TNRA 4CEYA 1PGW2 5CFDA 5A3PA 1ND3C 1S0CA 4BYYA 3H9AA 4QQLA 4KWLA 1COV3 3F2ZA 1REDA 2ERFA 1Q5OA 3C7GA 3ZPOA 4NAMA 1OFSA 1R1A1 4TSVA 5C3QA 1GANA 1AL22 3AM2A 2PHUA 1WW6A 1SDWA 2WZ8A 3ZXKA 4WZCA 1ULPA 2ET1A 3N9LA 4LOSA 1E5SA 1CJPA 5JZGC 1BZWA 2VVEA 1DQ5A 1KJRA 4Q4W2 5A1LA 1VALA 2EICA 1LOCA 1DHKB 3PUSA 4GWIA 5DZEA 3QACA 1I3HA 4DMIA 4P00B 4JRLA 5KHHA 2XH6A 1D4VB 3WP3A 1MS9A 2DCKA 1KFXL 3VBHB 1VJ2A 4R9DA 4PLMA 3P3NA 1IS6A 1W39A 3M3EA 4DRRA 1N3OA 1QF3A 4ZXKA 1RUC3 2JDZA 1ODNA 2FCTA 3I4IA 4QDRA 5J37A 5A3NA 2XL7A 2C9KA 2CWSA 5L7OB 2XLGA 3BU0A 2D3RA 5SV5A 3TN91 4ZZ5A 3BCWA 3NMBA 3TNPB 3AYAA 3NKTA 3BTAA 4LTAA 3A23A 1W06A 1QJY1 4HKOA 1PO23 4RA0A 4QU1A 4BMEA 4GB33 1NZIA 4QQ2A 2JG9C 2GMEA 2PHWA 4P9YA 1JS9A 4IV1B 5JIAA 1ZZ6A 2RM23 2YBKA 3VDDA 4WM8B 1LODA 3NAPB 5FLIA 1RUC1 5GLUA 5CAZA 3NV4A 1TEIA 3NNFA 2A6VA 5A7WA 2ADEA 4MV2A 1AF9A 4CCKA 3ZIXA 4QKDA 1RUF2 1ZRCA 4BXFA 3TEZA 1CPMA 1R1ZA 3TN92 2ILMA 3DPRC 2RS13 4LEJA 1QY4A 4YW6A 5A1AA 5JR2A 1E57A 1VMFA 4OMDA 4H14A 3NNLA 4KNCA 1YRZA 4ASLA 2AUYA 1IS4A 3QH6A 5CFDB 2IXJA 4GKYA 4N90A 4P9LA 4AR2A 5IVJA 2VULA 4MX3A 3TN93 3L2YA 5FOBB 1S1AA 2VTFA 4UFHA 1U5XA 5BNPA 3DL3A 1C5IA 1XQNA 5JXGA 4QPIC 4YVWB 5G04L 3E5XA 4AW7A 1JZ6A 1EUUA 3ZFFA 3O1MA 4NIDA 2F6BA 2VUCA 3WUDA 2WJSA 2WT0A 2BFUL 3K4ZA 3U0ZA 5JXJA 2JX9A 4AI8A 4ARYA 1DZQA 2ZKLA 4K9SA 4XILA 4BB3A 2JDUA 2JB4A 3IWZA 3IPVA 5FFOC 1FOD3 3I2GA 3ZYHA 1WW5A 1PO22 2TUNA 3EXUA 1J1LA 3FUQA 5C4WB 3WW1A 5KHJA 4CXWA 4M01A 1YQ2A 1QDOA 5GLTA 5LEKA 4AI1A 2VQAA 1RUG1 4LK6A 1K5MA 4LO7A 2OX0A 1QIQA 3AMMA 1W9YA 2W95A 4ASKA 4EN7B 2WNVA 2P5BA 2ZHMA 5FZMA 3CKHA 2CHHA 2FHRA 4MSVA 5LBFA 1ULEA 5FZ7A 3VD4A 1C1FA 2D3PA 2WZR2 4FO9A 3OUJA 2WS93 1S0DA 1WUVA 2QDRA 2VO5A 4OI4A 2G9GA 3LA2A 5HXMA 1D7PM 4WVMB 4YRDA 3VZJA 4IE0A 5BNNB 2O0OA 2QUOA 3UGFA 5T3NA 2ZZJA 4KBZA 1CWPA 4EROA 1W0PA 1OA3A 4X8PA 3W5MA 4RHV1 2ZPXA 4Y1YA 1QNYA 1LGBA 2QQIA 1DQ0A 1U5ZA 2BP6A 3O7OA 1UYZA 2YGLA 3RJRA 2WLQA 3EQEA 2W52A 3BKZA 4AVTA 5CNAA 1MQTB 5EYXA 2A6ZA 4PLNA 5EYYA 4MXWA 3ZLIA 3JD71 5ISLA 1GOHA 1H6YA 1QJZA 3AMPA 1FPN3 4UW6A 3ZXEA 3VHPA 4JVAA 4XJAA 3SNMA 1J3PA 2WZR1 2DBIA 2FD8A 5ERLA 3OCPA 1O8PA 1MQTA 3IMNA 4N9HA 4Y1XA 4CDQA 1I5ZA 2PA7A 2UU8A 1CAXA 2J7MA 3DKQA 2VMGA 5CVRA 2DFCA 4Z82A 4PIZA 1CIWA 1AYN1 2D6PA 4L99A 3KGLA 4RQPA 3M3QA 1V6LA 4DXRA 1GOFA 2LW8A 4LHKA 4NVPA 2VTXJ 5JVVA 4JGYC 1S55A 5E6HA 3FLPA 5I93A 2VOKA 5JUVA 1HLCA 2R30A 4AVSA 2BTVC 1O7FA 2DCJA 2GC1A 3GZTB 4Y4RA 2WFF3 1H6XA 3WW3A 4A7KA 4QPYA 1L7QA 4ARXA 3KT4A 5GZDA 3TEXA 3SCGA 2W91A 1PIV1 1JZ5A 1WMFA 1BBT2 3AFGA 3Q8EA 4FTBA 1ZBE2 4LULA 2OYZA 2WNVB 1HXS1 4AFBA 1PK6C 5FZ1A 2YXSA 1EV13 4XQWA 4BJ0A 1Z0HA 4PJYA 1NXD1 3NV1A 4XBQA 4CU6A 1W8OA 4IEXA 1WLCA 1UMHA 4IV1C 4KL1A 2ENRA 3M2MA 3I54A 4J1XA 1T2XA 1H1MA 2JB8A 1KFUL 3AZWA 4EV0A 2F4LA 2B9VA 2XONA 2ZHLA 1OA2A 3AX4A 2W1UA 3KHBA 5JI7A 4Q5OA 4AI9A 5FZ8A 2PHLA 1QJU1 4CA9A 4O9EA 5FXVA 3J4UH 4AF9A 4MO3M 4CZSA 3A0NA 5T52A 2D6LX 4COYA 1C3HA 3O0VA 3I3BA 2VL4A 3ELNA 3S6PA 4AHYA 1Y3TA 2E7AA 4HZFA 2NPIA 3ZFEA 1DYPA 4UOJA 4GJZA 1GICA 3ZFFB 5A3LA 1NCRC 1QH7A 1QNWA 3C8XA 4LIUA 4YGEA 4YSFA 1TME1 4QHOA 4ES8A 4TLFA 4FPFA 4GD4A 3WUCA 2EA7A 2RR11 3MIFA 1C5HA 1C1LA 5FZLA 2Y6HA 3AKRA 1NUKA 3KV4A 3OD4A 3S5AA 2WZEA 4LO6B 4XJWA 2VUDA 5FJKA 3VBUB 2XOMA 1LKNA 4HMZA 4Y20B 2NN8A 1BQPA 1VP6A 3ENRA 3U10A 4AQ2A 4GKXA 5CISA 2G9ZA 4UFJA 3U37A 3O1VA 5K8SA 1YLLA 3GJAA 4Q1PA 2YZ4A 1B35A 3WG2A 2NM1A 4IEVA 1CZTA 1RIRA 2MEV1 5EJZB 4E27A 5ACA2 5E16A 1FX5A 5GALA 4NIIA 1AL0G 1G86A 2Y38A 4FTSA 1UIJA 1WCKA 2Z79A 5FREA 4QPGC 3JB8A 3POFA 3ZMNA 1DYKA 1VLNA 4IL7A 4XOGA 4AL9A 2WA3A 3FBMA 3WP6A 1W6OA 4URTA 1BEV1 1HRV2 2C26A 4G4FA 4COWA 1UKGA 4OVEA 5EP9A 1A34A 4DRVA 3QD6A 4JTNA 4AVAA 2ZX0A 3Q9OA 4LK7A 3V65A 4XDOA 3HPNA 3WDUA 1RUI3 1Q3EA 5T50A 4A4AA 5IFPA 2YPJA 4QXCA 3O0XA 5T55A 1JH5A 2VJXA 5BNOA 2A7AA 4DS0A 2D6MA 3LDKA 1LULA 1W0NA 2GNMA 3ILFA 3FLTA 1JYWA 1V70A 3K75B 2ID4A 4OI0A 4CDQC 1O3QA 2DDUA 3ZDVA 3LIGA 2VAUA 1SBDA 5GLZA 2ZGUA 4UF0A 4HT1T 4Q27A 1IGOA 1CPNA 2B45X 4JDOA 1R1A2 2P6HA 1O3RA 3A4UA 1JBCA 4JGYA 3B5LB 1W6MA 2BNNA 2BQPA 2XKOA 1PVXA 2R1BA 3APBA 1O91A 3MEPA 1UY2A 1YFYA 1SZBA 1GFF2 4UW5A 1QDCA 1RUF3 4K8FA 4LUMA 1LOBA 1R093 3B3QE 2Z4FA 2ZXQA 3T0DA 1NY71 3CJXA 4EN0A 2PAEA 4XAAA 3G7DA 1IZ3A 1BJQA 2RDRA 1CONA 4PDWA 4PCRA 1LJ7A 2Z69A 2IFRA 3HAGA 3M3CA 4GB31 1W9SA 2GP5A 3W9AA 2DVFA 5A3UA 4ZKTB 3POJA 4NIAA 5H9SA 3B93A 1EPWA 5C7GA 1VRH2 1R081 3PUAA 5DUVA 4LBMA 4RL7A 1A8DA 2VOVA 2A6XA 4KWUA 1VBC2 4M0NA 4Z1VA 2C1FA 1W03A 3MW4A 1ASJ3 1QJEA 5DDJ2 3ACGA 3SMHA 3VZMA 1ZYBA 3WQ7A 4FQ4A 1JZ2A 3LOBA 3DECA 4NHMA 2P34A 3CEWA 3KT1A 4XJUA 4FSJA 4YFWA 5GJ6A 1D0HA 2CNAA 5A33A 4C8DA 4XFGA 1KS5A 4AHXA 4RGKA 4XF3A 1CJDA 1OOPC 3MFAA 2P17A 2A6WA 4W6WA 2BNOA 2CDPA 4KWJA 3I59B 1QHDA 1LOAA 1RUF1 3OBRA 2XKPA 5K0UA 1H2MA 2HEVF 2WRAA 5BNPC 1ND2C 5CBLA 4GQ7A 2YB7A 4CU7A 4GJYA 1HB2A 2XB6C 4LBQB 3THPA 1GV9A 4DO0A 4MHRA 4YW3A 1RTVA 2WN2A 3W58A 4BH9A 3PLQA 4A3ZA 5L7OC 4I3PA 1CAVA 1W6QA 2VCMA 3VLBB 4FPJA 3UKVA 2FDFA 2FDGA 2FZ1A 3VBOA 2XJUA 2DFBA 2CDOA 3K3OA 1D4M2 2QE3A 4YZ5A 4LE3A 2PELA 4ZZ8A 3RZKA 1SACA 3VDDB 1PGSA 5FYUA 4CCMA 5A6XA 1S2EA 3H50A 4O7XA 5CG8A 4IE4A 1XU1A 1QQP2 5DQ0A 2K46A 3VZOA 4CDWC 2WR9A 2GN3A 2EALA 4BQ3A 2JDMA 1SDDB 3BODA 1ALYA 4QX0A 5FUNA 1SLBA 1ASJ2 5DDJ3 3UJOA 1D2SA 1Z7S3 5CFCA 5A3OA 2MEV2 1BXHA 4OZXA 2R042 3WSOA 4QKBA 4BLIA 4EJRA 4EE2A 2QKDA 1UZVA 1FMD2 1XYNA 4BU2A 3M1HA 4CU8A 5A33B 4NAOA 3BTZA 5F9TA 3AP5A 2ZGSA 4LR4A 2E53A 5H9QA 5CA6A 1WWYA 3H8UA 4RHV2 3RZGA 2RMU1 3HNBM 3CHXA 1LHUA 1OXCA 3OGSA 1RC6A 1W3XA 5T5OA 4AEDB 2VOWA 4NRPA 3KCCA 1DIWA 1H4GA 1QWRA 4RQPC 3JQXA 3NSTA 5L19A 4OQ8A 2ORZA 3NJYA 4BA6A 1K3IA 1DGLA 2QQLA 3JXSA 1NZCA 4N9IA 4H7LA 1UXZA 2HWE2 2ES3A 2B8MA 2NYYA 2B7YA 2W39A 3VD9A 3UYJA 5I0TA 3HQXA 1QOSA 3ZXAC 4FI9A 5IK4A 4A45A 1W6MB 4COVA 2D40A 3U4XA 1K45A 1V9U2 3E6DA 4GWMA 4HL0A 4RGGA 5DUUA 3S30A 2XBO2 2YC0A 3VBSA 3J7MA 5FCCA 1QXPA 4HKLA 3O0WA 4UW4A 1RMU3 1C28A 4QHBA 1ZRIA 4EZ4A 3RWKX 5C4WC 3PHMA 4BLJA 5K0UC 4YARA 5FZHA 5LA0A 2I07B 2KR2A 3FHAA 5ABJB 3U07A 5F5AA 4D6RA 3N9QA 2BU9A 1FXZA 4R9BA 1UMZA 5A32B 3I2FA 2Z5WA 4N8MA 1HXS2 2Y6GA 3CL1A 4GH4B 2B39A 5A6YA 4LKEA 1R1A3 3ZR6A 1YNAA 1U5YA 2KA3A 3I2KA 3HQRA 1GWKA 1SFNA 4NHKA 5FV3A 3H1MA 2X29A 4YM1A 1MEC1 2VNGA 3CJIB 3OPZA 3TNQA 4XUOA 3SH5A 5AC91 4WM7A 4AI2A 1EUTA 1QXJA 4IEWA 5KC5A 4EWDA 5BNOB 4CEYC 5FK8A 1WMDA 4LT5A 1ZZ7A 5CZKA 4C0HA 4IDZA 5A7OA 4B4RA 3N9NA 5EWSA 1VBC1 1NY72 2XJTA 3ZO0B 1LOGA 1EV11 3ZKUA 3POWA 1UIKA 2PHXA 5FMOL 1HIXA 2X5IB 5ANQA 3WEZA 4P9JA 2I74A 2WWJA 2QZ3A 5F8PA 2EVXA 3AXEA 1Y43B 4L9BA 4FPGA 1MVEA 2PLV3 5FRAA 4AVBA 3ZN4A 2IWGB 4CTEA 3OUIA 4P9XA 3PIGA 3TWIA 4OHWA 1KITA 3AFKA 1TME2 2R0FA 2W2IA 2I45A 4XDPA 3K77A 1LHNA 1ND2A 2O1QA 3D8CA 3GBFA 1OOPB 5L9RA 4B1MA 5FY4A 1UOFA 4FPLA 4IE5A 3MO4A 3CQOA 3HT2A 1GP6A 5FZ3A 2RR13 1F5JA 3B02A 4LHSA 1F5FA 4UW3A 2A71A 2Q4SA 1OUSA 2VMHA 1W3VA 1RVF3 3ZSLA 1POV3 3PMSA 2FMYA 4Q4X1 5CIRA 3OF1A 4Z07A 2LM3A 3WQBA 4A7YA 3A22A 3DYMA 4XIOA 1W2OA 1LAJA 3VBFC 4Q0UA 2PHTA 2ZKNA 1W2UA 2JDYA 3ZXLA 4EQVA 1UOBA 3OGVA 1OF4A 4AAPA 3PIJA 5FLHA 2D6OX 3NNJA 1JMUB 1HRI1 3J7LA 3M3IA 1YJLA 1LHWA 4HSLA 4J1WA 5DAQA 1UU4A 1UAIA 2MNGA 4IESA 5LY1A 5IUQA 2JENA 4MZUA 5JLVA 4GWJA 1MS0A 1ZBA3 4GH4A 1POV1 2SBAA 4HBNA 4XF1A 5A7PA 3SH4A 2R0HA 2NLRA 4D7YA 2WLPA 3D3AA 2VNRA 3IAPA 1HV1A 1Q8SA 3AYCA 3FZ3A 4WM8C 1W8UA 1F4AA 1WKYA 3AMHA 1DF0A 4WZFA 3HD8B 4XHXA 3ZXDA 4XBNA 5LBCA 3O1SA 1UO9A 4AYUA 2Q0AA 1MQTC 3BOPA 4M4PA 4N7IA 1PVC3 3OGRA 4P9IA 2W1SA 1NT0A 4XFHA 2R49A 1XNDA 1GZCA 3FMGA 3E1F1 4LKSA 4NRQA 3ACLA 3DYOA 2FCUA 1UZ0A 4FVVA 4GWNA 3TAYA 3ECQA 1AR63 1O5LA 1SLTA 3AYDA 3MLKA 2VZ1A 4P14A 5EXOA 1RVF1 2YFZA 1PO21 3HJRA 4QXHA 4C90A 5JOWA 2Y60A 3J8F3 1W2TA 4K7JA 1OKOA 1W6PB 1B09A 1KJLA 1KS4A 1QGLA 4XFCA 1S4CA 3WP5A 4ASMB 3VBHC 4GALA 2D5HA 5FWEA 2RJKA 3RFRA 4YG0A 2MPFA 1PMIA 3VBUC 4AAXA 1R091 1PK6A 2QQMA 5L36A 1NCRA 2ZGTA 4RQPB 2Y6FA 4AEJA 2O8OA 1G7YA 1X9TA 2Y8KA 4FFHA 5JSRA 2IXIA 2WNUB 1LESA 2J1AA 1GQHA 1JW6A 1NLRA 3DYPA 1FI2A 3DV8A 3WDVA 3WXPA 1FV2A 4XHBA 3SKJE 3CDZB 4E2SA 3R05A 4YG3A 1PK6B 3ACHA 4M3CA 4CEWA 2BPA2 1UWWA 4K8RB 2PAMA 3WHTA 5B4NA 2ZABA 1YFWA 4B7KA 3H8RA 2PAKA 2AYHA 2VE1A 1SMVA 4CUAA 4XUTA 5J96B 1F31A 1OKQA 3ETQA 3GBWA 3KV9A 5EZWA 5ABJA 4R4XA 5I8YA 1O6UA 1JZ7A 2ZCWA 3ES1A 4S2GA 1X8EA 3HN3A 1OMIA 4AOCA 4LJHA 3R0RA 4AVCA 2WZR3 3ZYJB 2RVAA 2Q1FA 5FBJA 4NOTA 4CDUB 3PNAA 2W08A 3R4UA 1XYPA 1IPSA 3NNGA 1ZZ8A 3LE0A 1LOFC 4N43B 5DG2A 4C1XA 4Z2WA 3POIA 2J1RA 4R9AA 2YDEA 2QQUA 2RHPA 4H7MA 4OCTA 2D44A 3MPPG 2VZSA 1S0GA 1ZZBA 3SEEA 3MV11 5KR7A 4Q0SA 1W6QB 2CV6A 4LIVA 5FXXA 3A21A 4KQ7A 2FDHA 4AFDA 1H8TA 4Y4YA 2VOXA 4WVWA 3U78A 4COUA 2CWMA 3IT8A 4XMIA 5A7SA 1TNFA 3E6CC 3GGLA 1HXS3 2XXZA 1W28A 5FZIA 3T2OA 2ZS6B 1XXNA 3T09A 3EJKA 4ZPIA 3LSEA 3ON7A 1AR81 4S2DA 5F6LB 1J83A 5C8CB 1NA1B 5FZAA 4URAA 1JYVA 2ZEWA 2AZ5A 1CN1A 2Y6KA 5D8AC 4W8JA 1OLRA 3NVCA 3N7KA 2BBAA 1AYN2 3LEKA 5IAVA 2AR6A 3FN9A 5F7UA 4XACA 4BQ4A 5FPZA 4Q4Y1 3PMEA 5K9YA 4IE7A 4A2UA 3ZYIB 1FMD3 2VNOA 5LA2A 4AGGA 4OZOA 3TB0A 1H4HA 4A3XA 1QQP1 5L9BA 1OLME 4BDVB 4ES9A 4QQHA 5FPUA 4WVZA 4QPGA 4FT8A 3CU7A 4LOTA 1AR71 3OPWA 1VAKA 2OW4A 3PU3A 3T0AA 4OHVA 4CPBA 2NQYA 3FJSA 3GJBA 4CP9B 1ND3B 1UCXA 1LB2A 3E6BA 5HI0A 2GC2A 4UT5A 1WD4A 4RD7A 4DXTA 2UURA 4Q29A 1YWKA 4IEQA 1NOVA 1OSGA 3KCYA 1JYTA 2OUJA 3MIBA 2UYAA 5HCAA 4MG2A 3ASIA 4IV1A 1RUH1 3LFMA 4M0HA 3PU8A 2AH2A 3J8F2 5DZGA 5E88A 2MEV3 2XVGA 1O8SA 4FCAA 1CZVA 4YZ2A 4META 2EXJA 3CBNA 1RL3A 1BVP1 5FTTC 5LCWL 2YFUA 4J6GA 5A3WA 3WG4A 3NAPA 4C0BA 1G9BA 1GZ9A 2E7QA 3AZXA 2NMNA 2RV9A 1ULDA 2XLFA 3E97A 3NKGA 2HWC2 3I3EA 2IZWA 2WAOA 3VD3A 1AVBA 4IEPA 2Q1MA 4W4ZA 2VMCA 5FP4A 2RM22 5I0UA 4AE2A 2WNEA 3KF5A 1AYN3 4YGDA 2HWC1 2OS2A 1YJKA 3U75A 3O1TA 4F7ZA 1HKDA 1VBB2 3WDTA 3WOGA 1DGRA 5I0DA 3JUUA 3WQ0A 4D7TA 3I3MA 3VL9A 3DGTA 1KD7A 5IHRA 1LEMA 2R043 1XYOA 1MS3A 2ZX3A 4ITCA 2HWE1 4XJ8A 4CVUA 2UY9A 1X8MA 4AG4A 1W2AX 1VAMA 2VBBA 1VBE2 1ENRA 2BWAA 4CXXA 3WNPA 2VVFA 3WCRA 1WCSA 3QLQA 4P5YA 1IQAA 4NPRA 3O1OA 3J26N 5CKMA 2LTNA 1DGWA 1NE6A 5D21A 1KRIA 3PTYA 2EXHA 5IK7A 1COV2 3LEIA 2XL9A 3WNOA 4MGKE 2R062 4E4SA 2QVSB 1LU2A 3N7MA 4MVTA 4XXPA 2AGSA 1YQ5A 1GMMA 2ETEA 3LKJA 2WZPP 1MS1A 1QJFA 2P6CA 2KXLA 5FYSA 2CTVA 4LO5B 1RUD1 4Q4W3 3NJZA 4QPGB 3UGHA 4FPKA 1GZWB 4CXYA 2WA4A 3VBOC 5IVEA 2YYOA 4NUBA 4ZU7A 1G9AA 1URXA 4Y1ZA 4AFAA 2BW8A 4IV3C 3N9OA 2G1MA 2CGPA 5AC92 2H0BA 2RS32 2BVVA 3T1MA 1GQPA 1UQXA 2VVDA 2V4AA 2ZJCA 4JGYB 4R52A 5FDBA 5FQ0A 5KBFA 2ZEYA 3POBA 2DURA 4QD2A 1HRV3 1W8WA 2JG8A 2VQUA 2VZTA 4XW3A 2VUJA 4GMP0 4EN9B 4I0WB 4IEZA 2OA2A 2R071 2BEOA 4BK5A 4RYDA 4AHZA 2GN7A 1VR3A 3IDEA 5LEJA 4YM2A 2VM9A 4NWWA 4Q0VA 5FZFA 1EYBA 2NZ9A 4D3WA 1XB9A 2QZ2A 2K2SA 5F3CA 4CU9A 1POQA 1SFYA 1ZM1A 4YPJA 2JG9B 3OJBA 1IHMA 1P8JA 1UPIA 4Q4X2 2Y6LA 3MF6A 3RZJA 4DZGA 2JKXA 1C4RA 2UWCA 4CUCA 5C70A 4LPLA 1N47A 5HV0A 3OPTA 5J48A 1H2NA 5B4XA 3AVSA 1OA4A 4XEZA 1EP0A 3GBGA 4IGQA 4YYOA 2VUAA 2Y6JA 1NQDA 2VQTA 1V0AA 3N9MA 5C71A 3JCIA 4OQ9A 5T5LA 4QKNA 1JOPA 3K46A 2JDKA 5FMBA 4UFMA 3OGGA 4HKWA 3KS7A 3SCHA 4CDUA 2Y0IA 3VHOA 5C33A 1XNKA 4MLOA 2WIIB 3THTA 1QJY2 5LK5A 3AMNA 2ZGLA 3ZFFC 1LGNA 1ONAA 1TMF1 4Q0QA 5FUPA 5CFDC 2VGDA 1OLMA 5ANNA 1HB4A 1W04A 2JIGA 4ZHNA 1DGWX 1XOYA 3MW3A 1V6IA 3O1RA 2HJIA 3POGA 4S2HA 5JSOA 3RNSA 1NE4A 2RS51 5JI9A 3FC0A 2Q1ZB 3BYWA 1JOJA 1DQ1A 3JBG2 4XUPA 3UT0A 3B69A 3MUZ1 1J3RA 1H1AA 5A7NA 4BE3A 2GH2A 3HR9A 5F3IA 3ZPYA 3HBKA 1RVF2 2JEMA 1TZOA 2YU1A 5IATA 2WABA 5GZCA 2WYSA 1LHVA 2GZWA 4LBLA 1NCQA 3U1XA 3ZFEB 3WW2A 3F95A 3RZZA 5FZ4A 4CDQB 1K42A 1MZFA 3GDBA 3EMRA 1AXKA 3POSA 1Y4WA 3U4SA 4B4PA 4O65A 2FQPA 4Y5TA 1EAH3 3OYWB 4PDWC 4Y3OA 4IGPA 5A70A 5JDBA 2D93A 1ZA4A 4B3NA 5IK8A 2BGCA 2XDVA 3W21A 1ZX5A 1HJGA 4IEUA 2WINB 1XE8A 4TXWA 1XRUA 5A3TA 4SBVA 4A41A 5FJHA 2W1QA 4LKDA 1D4M1 1J3QA 4P02B 1H8TC 3NJVA 4XDQA 1OD3A 1W6NB 1J59A 5BNNA 4GA9A 4CSWA 3K51A 2VW0A 2JDPA 5KXEA 2V5DA 3FE5A 2O14A 1WA6X 1HQWA 1N1SA 4CP2A 4BPZA 1OLQA 4P9GA 4LO4B 4SLIA 1GP5A 1DQ4A 4UI9L 1GWMA 1DLCA 1UY4A 1WBLA 2BUKA 2L9LA 3I2IA 4M4RA 5EPAA 4D6SA 1GNYA 3MV01 4QB6A 3VBRC 4E4DX 1FMD1 4UAPA 2P3JA 1ASJ1 1IPKA 1VRH3 2X53S 5EQUA 3LEGA 4XIKA 4UF0B 1W2NA 4COZA 5KXDA 2VZUA 4M3CE 1MZEA 3NNMA 4FOWA 1VBA2 2SLIA 1FNZA 4OUSA 2C6SA 4HG6B 1XBFA 3O14A 2XJQA 4YW5A 5LRSA 3WLUA 1AJOA 4EN8B 4LLOA 1JTZX 4W50A 2BVBA 1RUNA 2Q5TA 3LFIA 1YHFA 3BGAA 4MGTA 3N4MA 4Y1VA 5IW0A 3VZLA 3T1LA 3VKMA 3LQCA 3KMHA 1PIV3 2LS6A 2E63A 1D2QA 4E8CA 2RDSA 1SG3A 4UXAA 2H6CA 2JICA 2QQOA 3HNYM 1LGCA 1W8TA 1MR5A 2TBVA 1SCRA 2ZTNA 4JHTA 1STMA 3WP4A 1JYNA 3BUCA 1Y9QA 1CGPA 2CL2A 3ES4A 5IK5A 2VH9A 5F2WA 1RMU1 4LBJA 2BOJA 3H3UA 2K0GA 2VC9A 5BNPB 1NLSA 1ND2B 4NHXA 1V9U3 1FYUA 4FOYA 3ILNA 3VBRA 3BPZA 1ENQA 1RUJ2 3PJQA 4DNYA 1W8HA 4CCLA 2XBO1 4QM8A 3U14A 4MYEA 3CIHA 4I30A 2HWB3 4MGIE 1FT9A 3BPSA 4XQDA 2RS12 5F3EA 3MIGA 4LBQD 1Q8PA 2VQ0A 4N53C 1JU3A 1PO11 5F39A 2RE9A 4HN1A 2YBSA 4TLGA 1HQNA 1WMXA 1AR82 3PVEA 3ZFGC 2JIJA 2RS31 3BU7A 5H9PA 3WY6A 2A70A 2F4PA 1XU2A 1WW7A 4KH9A 5FYCA 2J1TA 2C4XA 1GLHA 1C8M2 2OUHA 3PURA 3UETA 1YIPA 2ZGQA 3BVCA 4IEOA 2R072 3BTYA 4JC1A 4QXKA 2ZGPA 3POEA 1MACA 3C7EA 2DBNA 2GALA 2VMDA 2VZPA 3G6JB 4JQRA 4Q4Y3 4RS5A 3T2QA 4AGRA 3FL7A 1VBC3 1C8M1 2VPVA 3ZFGA 1KGYA 2V5YA 3ZYRA 3K2OA 5C9AA 1RB8G 3WNNA 4YFZA 3OY8A 3RWNA 1AXYA 1PIV2 2UYBA 3OUHA 4PI0A 5J09A 3RZLA 5GZGA 3V0BB 5LRRA 4Y22B 1G8WA 1LHOA 1OPMA 1ST8A 3LZZA 4H55A 1MVQA 2DUOA 3E5QA 1ZRFA 2XMLA 3P5BA 5FY7A 3DUIA 1OOPA 2UWAA 4HOOA 1DP0A 4O61A 2DTWA 1BEV3 5BNOC 3VBSB 3K48A 4FP3A 5C3RA 5FYTA 1QJU3 4BWOA 5F5CA 1CVNA 3LSDA 2IFWA 3TRSB 4AI3A 5C8CC 2DTYA 2RM21 4ORFA 5FZBA 3I97A 1HRI2 2GMMA 2UWBA 3ZR5A 1FNYA 4BCUA 2Q30A 4JV4A 2RR12 5DUWA 1HX6A 1VB2A 4Z8BA 1BEV2 2P4EA 1GBGA 4LITA 4RFRB 4DOUA 4QMAA 2E26A 4E4HA 4WV8A 4YNIA 2QQVA 3V0AB 1IPJA 4WM7B 3H8XA 2WBKA 2RS52 1OPOA 4KI5M 1I1EA 2FDIA 3CF6E 1X50A 4W6YA 3ZYPA 2ZX2A 5FZDA 1PM7A 3ACIA 4QGMA 3VV1A 2R7EB 4WM8A 1VBB3 1V6OA 1I6XA 5ABJC 1BK0A 4PIXA 1RUI2 3T2PA 1PMHX 1XE7A 2C0ZA 2FBEA 2WO2A 3KB5A 4LNVA 5EIYB 1W99A 1BVVA 3J7NA 4YW2A 1WGPA 3MBWA 3KV6A 4HPKA 3VDAA 4DXZA 3CZUA 2BOIA 4QU2A 3GZAA 3KVBA 2WL1A 3PUIA 1J1TA 2J1SA 1RJ7A 4QAWA 2RDQA 3N35A 2EIEA 2H6BA 5JIUA 4TN7A 1COV1 1N3QA 3K4AA 1R083 3VBHA 4FFGA 2E6VA 2EAKA 2WSVA 3AP4A 2RDNA 2HWF3 1G9DA 3CMGA 3N7JA 4OUMA 1CAVB 2ZMKA 2X5IC 1FAYA 4HK9A 4Q1RA 3SH3A 4ATFA 1PZ8A 1DQ2A 1RUD3 2ET7A 3JB4C 3AYEA 2ZMLA 4GH4C 3Q8CA 4CP9A 5C9AC 3THCA 4DIQA 2GU9A 3DEMA 4NWVA 3KGZA 3LA3A 1QOOA 1TE1B 2ARBA 3AC0A 4LA3A 1WLDA 4KGQA 5APAA 4YW1A 3ST7A 1HDKA 4Q8LA 2R1DA 3HN1A 5J3UA 2FMDA 1UOJA 4FTEA 3D5OA 2XWJB 4PQ9A 4YZ3A 2CGNA 1F15A 2LROA 4ZU5A 1SPPB 3S5QA 4CEYB 2GC3A 1S0EA 3JZVA 4NPMA 5T5JA 1OT5A 5DAXA 4QPIA 3ZN6A 5B2GB 2VXJA 2IXKA 1REFA 1J84A 2W0XA 2ZHKA 4LLFA 2IXLA 2JDHA 4LE4A 3AJZA 2WC2A 3GHNA 5GLWA 3VL8A 1JHJA 5TSWA 2LALA 1T6GC 1UYPA 4GIQA 1HQLA 4DY3A 4L2NA 3RI8A 5C8CA 2RS11 5I0SA 1G9CA 5DN2A 2YROA 2A6YA 2ZAAA 1GKBA 4MHUA 2NP0A 4BMBA 5JOXA 1XNAA 3GCXA 4GB32 3ZN6B 1OI6A 3LD8A 4OLLA 4NHYA 3ZFGB 2ADDA 3NJXA 4CE8A 2P3YA 1JUHA 3OD0A 5IYYA 1K12A 1ZBA2 4RS5B 5F32A 2GSYA 3VBOB 3WG3A 4C1WA 4QX5A 1OVPA 1LNSA 1LECA 1DQ6A 4AWDA 3NV2A 1BYHA 3VBFB 2IXHA 4YW7A 1JXNA 3MPBA 2OIIA 4G9SB 3VDCA 2Y26A 2E31A 2BJSA 5IWFA 3WDWA 1TMF3 1MS4A 4E8DA 3I2HA 1RHI3 3MYXA 3QH7A 5EJ3A 2WSUA 1WA4A 3RZMA 4Q0PA 3EYPA 5FPAA 2GAUA 4HSJA 3AKPA 3DCQA 3OBZA 3C7HA 3B01A 2W94A 2JE9A 1ULCA 5A3MA 3MW2A 4OHZA 1ZRRA 4BIOA 2JKBA 2X8KA 3AVRA 3N36A 4X6QB 1SLIA 1X9PA 2J22A 3R4SA 4N43A 4XBLA 4D7SA 4RN5A 5DZFA 2ZEZA 1NKGA 1UXXX 4V2VA 3WHUA 2X10A 5IFTA 1UX6A 1DDLA 2IC1A 5CU1A 4FBFA 4LORA 1SEFA 1EY2A 1VBA3 2QQKA 3KM5A 4NJ4A 4XZUG 3C7FA 2WNUC 1BMV1 4XJ9A 1D0GA 2CAUA 2DVGA 4EYUA 1OH3A 3NO8A 2F17A 4HVRA 2NMOA 4Q4V3 1X82A 5DAVA 2G19A 3ACFA 1BMV2 5HPOA 3TEYA 3MLJA 4MXWB 1B35C 4E2GA 2ZAHA 3FHIB 3HWJA 1C57A 3I7DA 4XMAA 5CB7A 2A3XA 2P3KA 2WNUA 5FZGA 1E5HA 5FPBA 4LBKA 1PHMA 4RHV3 2WFF2 3CNAA 3KQRA 4ISQA 4ZXEA 1JU4A 1QKQA 4XJZA 3B9IA 3IDBB 5GZFA 2OVUA 1JHNA 1O4YA 1ZRDA 3AJYA 2J1VA 1NX9A 3BN6A 5FPLA 2XR4A 1AUYA 1JODA 4N43C 4Q4V1 1CIYA 3KCXA 5E1RA 3BTXA 1PX3A 2WT2A 2YUEA 4LHNA 4RR3B 4BQWA 4CCNA 2CSGA 2W92A 4DPNA 5J7MA 2VZ3A 4QHZA 5FMDA 1SBFA 2CU5A 3AP6A 4MXVA 5H9RA 4QDSA 3ZKYA 1SQ4A 2A1XA 2YGMA 4HN0A 4JGZA 2HWC3 4TYSA 1AR83 1RMU2 1W0OA 2D43A 3WZ1A 2BERA 2PLV1 3WDYA 2BGOA 1TG7A 1YEWA 1K5MB 4LHLA 1MEC3 1UL9A 5IVYA 4B7EA 3QBQA 4FPCA 3WDXA 2RJ2A 1VBD3 4E4ZA 1I5PA 3AZYA 1PGW1 5C4WA 4CDUC 4CPBD 5FR3A 2WDBA 4CCEA 4WBBA 5CADA 4P5HA 2EIDA 2HKXA 3WW4A 4FPHA 3OY8B 4IERA 1VBE1 3FWEA 2R061 1UZZA 2XJSA 3I2DA 3IPVB 1QH6A 3KZ4C 5FY5A 1Q8VA 5FBZA 1UN1A 5C9AB 1QQP3 5FOJB 1MEC2 3H0OA 5KXBA 2XPJA 2QBXA 1FPN2 4BHPA 3H1YA 1V9U1 1GNHA 1FATA 1WD3A 4LA2A 4MGQA 1W6OB 1PO12 4YGCA 2HWF2 5DG1A 1O4TA 4XYXA 1CAWB 4QGNA 1CR7A 1Y7BA 2ZEXA 1RXGA 2HH9A 3NRUA 4JTOA 2VZVA 5I91A 3USUA 2WKKA 3L9JT 4AGVA 3EHKA 2QFEA 3T2TA 4CDXC 5D8AB 5LBBA 1IKPA 1GZWA 2ORXA 4XF4A 1L7LA 4DUWA 4LUKA 2E51A 4O9GA 1LOFA 4YVSB 1ENXA 3GZUC 3I3DA 1RYYA 5FPVA 1WCUA 3WNLA 1HN0A 1EV12 5L73A 3M4FA 1OURA 5BV6A 3CJIA 1O59A 1UZWA 2R6QA 5JR7B 1AR61 3FLRA 4CYDA 2ZZQA 2JDAA 3MUY1 4Q8KA 2IXCA 3ORJA 3J9SA 4IUGA 2ZGKA 4XUQA 4YGBA 3O1PA 4QX2A 2D6NA 1MZ6A 1S2KA 1U0AA 1CESA 5C3SA 2TNFA 5LWBA 1JZ8A 2IVJA 4C91A 2QTWB 5AC93 2BRTA 1RGSA 2Z42A 5JXHA 1Y9GA 2VOTA 3DXTA 1ZREA 1UYXA 3RS6A 3KVAA 4OI1A 4D6QA 5BY5A 1CAUB 1GZTA 1XE0A 4CDWA 3VD5A 4GAZA 3KQ4B 3TOJA 1Z78A 3VHRA 3VDBA 5FY9A 2X05A 3VKNA 5FQ0B 4GZ9A 1TMF2 1RUI1 2BGPA 4QXBA 5FYIA 1V6MA 4QGLA 2AENA 2VW2A 5FAXA 5FY0A 1ULGA 5F1RA 1UMIA 3UNPA 3S57A 1H2LA 2BDRA 2WO3A 5E89A 1REEA 3A0KA 3HNMA 2XJPA 2HBUA 2I2SA 3V0AA 4XCAA 4JDNA 1PX4A 3KWVA 3OTFA 2VNVA 4JGZC 2QJVA 1QJX2 3SXWA 5CKQA 4B8EA 2OQ6A 1BBT3 3GNEA 5FZOA 1HB1A 1VBB1 4JHZA 4KBBA 4N53A 4UBHA 1V00A 1US2A 1VIWB 3LPGA 3AXDA 3UESA 2X09A 4P08A 3VD7A 5FKCA 5FZ0A 3UKNA 5DAPA 2ZA9A 4IV3B 5FWJA 5GM0A 2R073 4WVVA 1V6NA 2J1EA 3I49A 3ZN5A 1W9FA 5FMCA 5IAXA 3NWKA 3PJYA 4E2QA 4GMP1 2QNKA 4PBOA 2ZBJA 1VB4A 3GM8A 1IS3A 3E5UA 4FXGB 1WLTA 3UK9A 3RYPA 1DZRA 1Y9MA 3VN4A 2Z2SB 4Y22A 2K9ZA 2ZACA 4HFSA 1G9FA 2PMWB 3ZSMA 1MPXA 3FFQA 1E5IA 1RJ8A 1X7NA 2VZRA 1W8NA 2J42A 2BFUS 4ZS3A 1Q8OA 1PVC2 1OF3A 2W9XA 3Q8FA 3I3QA 4WVMA 1ZNPA 5C5UA 4XAEA 4XETA 1SPPA 3T3YA 4JKKA 2JECA 3H8OA 4A6SA 1K5MC 4L92A 2QQPA 4XZPA 1YFUA 4Q4V2 5HBAA 1NLQA 2WO7A 5FP8A 2WUHA 1ACCA 5LK7B 1MZ5A 4FFFA 1DCSA 4XVHA 1DU3D 1RXFA 2DUQA 4D94A 5C3OA 2D6KA 2PTMA 4D69A 5LZ6A 3GALA 4KG0A 2JG8C 3HVDA 3VBFA 1H8TB 5KC6A 1KDKA 3W20A 1R082 2D3SA 2W68A 4EN6B 4NRMA 2R16A 2VBPA 2RJLA 4ISRA 4Q26A 3ZSEA 1OVSA 4DQAA 2WS92 2E32A 5AVAA 2RS53 2XBO3 1HW5A 4EWEA 1WCQA 3HMYA 1BHGA 4XABA 5EFUA 5F3GA 3T08A 3VBRB 3CLPA 5BNNC 3GHMA 3KHCA 1OHFA 5A1FA 2ZHNA 4YWAA 3C2UA 1V6KA 5EV7A 4K1YA 2ZGOA 1GSLA 4L11A 2Y64A 2FCVA 1NA1C 1WCDJ 2KM2A 5J36A 4Q4Y2 3LAGA 2B46X 3I59A 5C3PA 5CEHA 5LBEA 5JPMB 4DY5A 2EIBA 3B00A 5A7QA 4YM3A 1JZ4A 1Q8QA 1UD1A 1HN1A 2XLAA 4IEYA 5CFCC 1W90A 2GMPA 4M3CB 4S2FA 4CEWB 5J98B 1O4ZA 4MGSA 5AFEA 3USSA 3WD5A 1NA1A 1G6NA 1BLZA 5IVFA 2OT7A 2YV8A 1XNBA 1UU5A 1UY3A 1H9WA 2VD7A 4NPLA 2Q8CA 4AEKA 1N1VA 4N7UA 4F3JA 1SHWB 5FLJA 3DKWA 3PVBB 5F2SA 3H7YA 1JOBA 1RITA 4HVOA 5KHIA 4R4ZA 3AB0A 4JAAA 1SLAA 2Y33A 2ZOEB 1F9KA 4JKLA 4QX1A 5A7WB 5FZEA 1C8M3 3AK0A 3WNKA 4BQYA 2HEWF 1W6PA 2CYFA 4DUXA 1VMHA 5FZOB 5IVBA 1RUE2 2OQ7A 4PQQA 4V1PA 1QJX3 5JZGB 5T5PA 3BALA 1OBNA 1UW8A 2PHRA 1W6NA 2OPWA 3IKWA 4PDWB 5SV8A 3BOWA 4BM8A 4MGZE 4F8AA 3OB8A 1VRBA 3VGIA 4NHLA 2DF7A 1A3KA 1DZTA 2AEZA 3SEPA 3VKLA 4CP1A 3FX3A 4HLTA 4OMCA 3H3ZA 1MS5A 2ZX4A 2V73A 3V0BA 3O1UA 2JE7A 1W8ZA 1QOTA 3VZNA 1UY0A 4Q4X3 1KEXA 5T54A 1QJX1 2BNMA 4YZ4A 5A6ZA 5K7PA 5LA1A 5I0RA 1XPWA 4LBOA 3ZYBA 2E9QA 5BXXA 3TEWA 1NQJA 5LB6A 3MICA 4QB2A 3IB3A 2GDFA 5DAWA 3DN7A 3V64A 3ZXGA 1RUH2 4ET7A 2DV9A 2JDNA 1NCRB 4JCKA 4MUVA 3ZSKA 1S0JA 1VBD1 4FOQA 5JOYA 3KV5A 1YUDA 4UWDA 4JKMA 4Y26A 5JAXA 4AZZA 2PLV2 1BK1A 4NIGA 2V72A 3BIEA 2YU2A 1H8VA 1PNGA 1VBE3 4OI2A 4PT6A 1UPSA 2VTXA 4CUGA 4JX0A 5D1IA 5JCTA 3OGJA 1RUH3 2D97A 3ABZA 2YC2A 5CYYA 1A6CA 5KHKA 2JE8A 1T6BX 3PL0A 4XFIA 5HCBA 3VBUA 2HYXA 3WF0A 3RYRA 4CDXA 1IS5A 2W3JA 2VCBA 5ACA3 2WAAA 2HWF1 3WNXA 4AEMA 3VUOA 1AYM2 5FK7A 1PVC1 5HXVA 3VB9A 1AX2A 1XC6A 3HIFA 2W5FA 1H0BA 3CZJA 1B35B 4WM7C 4GXLA 5LASA 3RSJA 3UGGA 3H3LA 2V09A 2WQZC 4BIFA 4PI2A 3VZKA 2DUPA 5E8AA 1PZ9A 4AFCA 4BXSV 3IMMA 4KWKA 5DPNA 2WQ4A 4A7ZA 2VR4A 4K1ZA 3KF3A 3NL1A 4XTMA 1JYCA 1N1TA 4LQRA 4M3CF 1AHSA 3Q8BA 3RPQA 3AL5A 3MHZA 1U12A 2DWRA 2JG9A 3ZYFA 3UL2A 1RUOA 2VECA 4QKFA 3RZHA 3Q8AA 3WNMA 5I8SA 3LWCA 3LPFA 4AFMA 4AQTA 2P37A 4CCCA 4HANA 1JYIA 2WWUA 1WW4A 3VKFC 1F35A 2RG4A 2VBDA 4RGAA 2Q8EA 1Q56A 1O3TA 4FPYA 1OD5A 3SC7X 4I0AA 1RUD2 4YZ1A 2XVKA 1HJFA 4W6XA 3I8TA 5FMOS 4MGYE 5IVCA 2E33A 1X36A 1CX4A 5K4LA 1W9TA 5A32A 3WVJA 2QQNA 4I01A 5I8TA 4HXCA 4I02A 4PF1A 1CD3G 3S7EA 4A6OA 2HLEA 4KU7A 3WCSA 4NIHA 4W65A 2ARXA 1GUIA 1YO8A 1LOEA 1VAVA 4L97A 2V4VA 2W87A 3HQUA 3T0BA 4UFIA 1SBEA 1JN2P 2GP3A 3IM0A 5BPXA 1HB3A 5GZEA 2VMEA 2FDKA 4CEWC 1I9RA 4XC9A 3D6EA 2H0VA 2A73B 4PLOA 1AYM3 1W9WA 4XTPA 1X33A 3T4VA 3RMYA 3SHRA 1QU0A 3JBG1 2LRPA 3MLLA 1L7RA 3IBMA 3ZYGA 4AVVA 5L9VA 4I0BA 5BYNA 1ZZ9A 2YG0A 4JZRA 2TEPA 3VBSC 3ZOIA 4A42A 1GNZA 5FYVA 4LKFA 2J1UA 2WN3A 3EB7A 5FZ6A 3AKQA 4AEDA 2AREA 3X29B 1RUG3 2UY8A 1RUC2 3PDQA 4AXOA 3QCWA 5J1XA 2P2KA 1ZBA1 1GR3A 3ZFEC 1CAXB 2W47A 4K6BA 1BBT1 3I2JA 3DPRA 1LR5A 5JWPA 1LCLA 3ROUA 2VCAA 2WT1A 3FHQA 4QB1A 1RHI1 3J7HA 2AEYA 3UV9A 2XG3A 2ZGNA 4I09A 3ZMOA 3NQHA 3A7QA 1JYXA 1S2BA 5KXCA 5F5QA 4FAGA 2YY1A 3JD73 4L0PA 3HOBA 3OBTA 3P6BA 3HBZA 4A44A 1AR72 3IN9A 1OC1A 4H2AA 1ZVFA 1RHI2 4PBPA 3VHNA 3RYKA 5C6CA 3N7LA 2R32A 4LBNA 3L2HA 2XQXA 3IZOA 1QJU2 3MDPA 1BKZA 4XXAA 4EZHA 5A80A 5F37A 3C7OA 2DU1A 4BISA 5EJ1B 4QPWA 5JZGA 1PGL2 1UZYA 3LF7A 2Y34A 5GKAC 4ZY9A 1OUXA 3FFZA 3IDCB 4FPOB 3V56A 1R64A 4YM0A 4YLZA 5AVPA 5F5IA 2BZDA 1FOD1 3PUHA 3O12A 2WNVC 4YW4A 4ZU4A 2W46A 1LENA 4H3WA 1U5IA 1ND3A 2DU0A 3POYA 4HETA 3KD4A 5FY1A 1O3SA 2FDJA 3B94A 3LIHA 4UFLA 2WFPA 3INAA 3W59A 4DINB 2VMFA 4AQ6A 1UF2C 5CKNA 1YI9A 4LMFA 4NR1A 3AL6A 1ZZCA 4PF5A 4X8NA 3RDIA 2CAVA 4BQ1A 1RUG2 3EO6A 4XQ4A 3SCFA 4BK4A 4DXSA 2HYKA 2Q8OA 3MI8A 4B29A 2A5ZA 2A3WA 3IAQA 4HVQA 2WFF1 4KU8A 3LDBA 1UY1A 2ARCA 1YQCA 3R4DB 1AR91 4OHXA 2HBTA 1OQ1A 4Z2AA 4V2WA 3MFCA 2PQQA 1PO13 5FZCA 3HT1A 1DBNA 3ME2A 1K5JA 4K20A 4RS5C 3TBDA 1AR92 3JD72 4UFKA 3WF3A 3WR0A 3WV6A 3M7AA 4QDQA 2B4KA 4BOWA 1XSQA 1OH4A 4Z92B 2W1WA 2GC0A 4YVWA 5FYMA 1AL23 1YQ6A 4MH0E 3LDRA 3FBYA 4NO4A 2JD9A 2XUEA 3PVNA 1YIFA 1RUJ3 1NYWA 4IXLA 3OSDA 4AHWA 1OQEA 4KG8A 1GP4A 1VPHA 2D5FA 1APNA 4IV3A 1FV3A 1FPN1 2HWE3 4QX3A 2QQWA 1TVGA 1AX0A 1AR93 3H42B 1ULFA 2X5IA 3SQOA 4N53B 3MF9A 3M3OA 5A6QA 1CX1A 4Y5Z0 3ZIWA 1S0BA 3AZZA 1POV0 2DVDA 4OUEA 3K4DA 3WQ1A 3ZXFA 3BI3A 3RG0A 3LOIA 4XFBA 1UYYA 3AP7A 3ILRA 4OFGA 1QXRA 1AL21 1E5RA 3O5SA 1SCSA 4BZ4A 4NROA 5DUXA 1N3PA 4QQPA 3NAPC 2P3IA 5FYBA 5K0UB 3GXUA
chains in the Genus database with same CATH topology
2YFUA 2W1UA 2WDBA 2RV9A 2EIDA 4MO3M 3I3EA 2WAOA 3VD3A 3I3BA 2VL4A 4W4ZA 2B9VA 2VMCA 2QBXA 3WF2A 4UOJA 3IDAA 4DUVA 4MGQA 3C8XA 5IHRA 2ZEXA 2QQJA 4CVUA 2OKXA 3NRUA 2Y6HA 4AG4A 1NUKA 2VZVA 2WZEA 2WO1A 1PMJX 2XOMA 3WNPA 4P5YA 3U37A 2ORXA 3LEIA 4DUWA 3WNOA 1CZTA 5EJZB 3I3DA 1RYYA 3WNLA 1GMMA 1O59A 1DYOA 2VCCA 2C26A 2JDAA 3MUY1 4D0QA 1GQPA 4IUGA 4XUQA 3HPNA 2ZEYA 4QX2A 5IFPA 4A4AA 2VQUA 3ETPA 2VZTA 4DEQA 2VJXA 1JZ8A 4BK5A 4RYDA 1W0NA 1JYWA 2VM9A 5JXHA 3K75B 2ID4A 2VOTA 4MOAA 1UYXA 4MADA 2DDUA 2WQ8A 4CU9A 4YPJA 3VD5A 4TTGA 1GOGA 1P8JA 2Y6LA 3VDBA 2JKXA 2X05A 4CUCA 4GZ9A 5C70A 2BGPA 4LPLA 3UNPA 1UMIA 5B4XA 2WO3A 2KD7A 1UY2A 1NAEA 3HNMA 2Y6JA 5C71A 2VQTA 1XNTA 2ZXQA 2Z4FA 1PX4A 3T0DA 2XHNA 3K46A 1W9SA 4JHZA 4XURA 1US2A 3LPGA 5C7GA 3UESA 2X09A 4P08A 3VD7A 2J1EA 3OG2A 4KWUA 4XUPA 4DEVA 3HEIA 3GM8A 3MUZ1 3P1IA 3ACGA 1JZ2A 2WABA 3DECA 2WYSA 5DMYA 1K42A 1MPXA 3GDBA 3WF4A 2VZRA 1W8NA 1OF3A 2W9XA 5G05L 2CDPA 4XUNA 2VZQA 4JKKA 3OBAA 4TXWA 2WUHA 2YB7A 4CU7A 4XVHA 4A41A 2W1QA 1JZ3A 4P02B 3NJVA 5JXIA 1OD3A 2WN2A 4A3ZA 2V5DA 1GU3A 3OEBA 2E32A 2CDOA 4UI9L 3OEAA 1DLCA 1UY4A 1WCQA 2L9LA 3I2IA 4D8MA 4M4RA 4ZZ8A 1BHGA 1GNYA 3MV01 4QB6A 5JMOA 4UAPA 3T08A 4CUBA 3LEGA 3IIIA 5DQ0A 2VZUA 2Y64A 1SDDB 4HG6B 4QX0A 4W50A 2EIBA 3SKVA 1JZ4A 3BGAA 3WSOA 1HN1A 3LQCA 2LS6A 4E8CA 4MGSA 4CU8A 1SG3A 2PQSA 2QQOA 3HNYM 3WF1A 1UY3A 3HNBM 3OGSA 1SHWB 2VC9A 3W5NA 1JI6A 3THDA 5IJRA 2ORZA 1K3IA 2QQLA 3ZM8A 3JXSA 4JKLA 1ULOA 4QX1A 3CIHA 1UXZA 3WNKA 3VD9A 4DUXA 4FI9A 1JU3A 4PQQA 4A45A 1K45A 4KMQA 2YC4A 3OB8A 2J1TA 4OYUA 2C4XA 1F4HA 3UETA 3SEPA 5LA0A 4OMCA 3C7EA 3T2QA 2VMDA 2VZPA 2VZOA 3FHAA 3FL7A 1KGYA 3I2FA 3WNNA 2Y6GA 1UY0A 1KEXA 5LA1A 1XPWA 3I2KA 4QB2A 3IB3A 1UX7A 1US3A 4ET7A 4XUOA 1EUTA 5FUIA 1DP0A 1IQDC 5CZKA 4JKMA 1CZSA 2V72A 4PT6A 3WEZA 3F2ZA 4JX0A 3C7GA 3I97A 3ABZA 2YC2A 5CYYA 2JE8A 2WZ8A 3WF0A 2HYXA 2W3JA 1ULPA 2VCBA 2WAAA 2E26A 3K77A 2EICA 2WBKA 1XC6A 2W5FA 3MO4A 3CQOA 3CZJA 4GWIA 4KI5M 4LHSA 4P00B 4BXSV 2DCKA 3ACIA 5DPNA 2R7EB 2VR4A 4LQRA 3WQBA 3A22A 3DYMA 4QDRA 1PMHX 3T2PA 2WO2A 2C9KA 3WNMA 5EIYB 1W99A 3LPFA 3OGVA 1OF4A 4ZZ5A 3MBWA 3VDAA 3CZUA 3A23A 3PUIA 2J1SA 4GWJA 4QAWA 2EIEA 2E33A 1W9TA 3D3AA 2QQNA 3IAPA 3K4AA 1F4AA 1WKYA 4PF1A 4A6OA 2HLEA 3CMGA 5I0DA 4M4PA 3OGRA 2W1SA 1GUIA 3E1F1 4LKSA 3DYOA 3THCA 1UZ0A 2V4VA 2W87A 3ECQA 3T0BA 2VZ1A 2YFZA 3AC0A 3HJRA 2VMEA 5A1AA 5JR2A 4OMDA 1W9WA 1L7RA 2YG0A 4A42A 1OT5A 4QX3A 2VTFA 1J84A 2J1UA 2WN3A 3EB7A 4AAXA 2QQMA 5JXGA 1JZ6A 5G04L 1JHJA 1EUUA 2Y8KA 5J1XA 2J1AA 3K4ZA 3DYPA 2W47A 5DN2A 3I2JA 3SKJE 5JXJA 3CDZB 4ARYA 2VCAA 3ACHA 3FHQA 4QB1A 1XNAA 1UWWA 3J7HA 1JYXA 5B4NA 3NQHA 3A7QA 3I2GA 4CUAA 4XUTA 3NJXA 4L0PA 3HOBA 4A44A 3P6BA 5IYYA 1JZ7A 1K12A 1YQ2A 3HN3A 1LNSA 2RVAA 2XQXA 1JYNA 3NNGA 3C7OA 3LE0A 5EJ1B 3VDCA 2E31A 2J1RA 2W95A 4QPWA 4ZY9A 2VZSA 4E8DA 3I2HA 3CKHA 1R64A 2BZDA 3VD4A 3SEEA 3EYPA 3PUHA 3MV11 2W46A 2VO5A 3C7HA 5HXMA 1D7PM 2W94A 3A21A 2J22A 2VMFA 3GGLA 4RN5A 2ZEZA 1UXXX 1NKGA 3W5MA 5IFTA 2X10A 3T2OA 3T09A 2QQIA 1UYZA 4XZUG 1J83A 2QQKA 3C7FA 1JYVA 2ZEWA 4BK4A 4DXSA 2Y6KA 4W8JA 3IAQA 1GOHA 1H6YA 2BBAA 3LEKA 1UY1A 3FN9A 3ACFA 5F7UA 5HPOA 4Z2AA 1O8PA 5LA2A 2J7MA 4OZOA 3WF3A 4BDVB 4QDQA 2B4KA 1OH4A 2W1WA 4ZXEA 1JU4A 4DXRA 1GOFA 2JD9A 2LW8A 2J1VA 1NX9A 3T0AA 3BN6A 5JUVA 2DCJA 1H6XA 1CIYA 1TVGA 1PX3A 1L7QA 4ARXA 4DXTA 2W91A 1CX1A 1JZ5A 2W92A 2VZ3A 4OUEA 4QDSA 4BJ0A 3K4DA 4CU6A 1W8OA 1UYYA 2BERA 2BGOA 1TG7A 1UMHA 1O8SA 1CZVA 1T2XA 2RJ2A 1I5PA 5LCWL 3GXUA 2XONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YFU A;  2W1U A;  2WDB A;  2RV9 A;  2EID A;  4MO3 M;  3I3E A;  2WAO A;  3VD3 A;  3I3B A;  2VL4 A;  4W4Z A;  2B9V A;  2VMC A;  2QBX A;  3WF2 A;  4UOJ A;  3IDA A;  4DUV A;  4MGQ A;  3C8X A;  5IHR A;  2ZEX A;  2QQJ A;  4CVU A;  2OKX A;  3NRU A;  2Y6H A;  4AG4 A;  1NUK A;  2VZV A;  2WZE A;  2WO1 A;  1PMJ X;  2XOM A;  3WNP A;  4P5Y A;  3U37 A;  2ORX A;  3LEI A;  4DUW A;  3WNO A;  1CZT A;  5EJZ B;  3I3D A;  1RYY A;  3WNL A;  1GMM A;  1O59 A;  1DYO A;  2VCC A;  2C26 A;  2JDA A;  3MUY 1;  4D0Q A;  1GQP A;  4IUG A;  4XUQ A;  3HPN A;  2ZEY A;  4QX2 A;  5IFP A;  4A4A A;  2VQU A;  3ETP A;  2VZT A;  4DEQ A;  2VJX A;  1JZ8 A;  4BK5 A;  4RYD A;  1W0N A;  1JYW A;  2VM9 A;  5JXH A;  3K75 B;  2ID4 A;  2VOT A;  4MOA A;  1UYX A;  4MAD A;  2DDU A;  2WQ8 A;  4CU9 A;  4YPJ A;  3VD5 A;  4TTG A;  1GOG A;  1P8J A;  2Y6L A;  3VDB A;  2JKX A;  2X05 A;  4CUC A;  4GZ9 A;  5C70 A;  2BGP A;  4LPL A;  3UNP A;  1UMI A;  5B4X A;  2WO3 A;  2KD7 A;  1UY2 A;  1NAE A;  3HNM A;  2Y6J A;  5C71 A;  2VQT A;  1XNT A;  2ZXQ A;  2Z4F A;  1PX4 A;  3T0D A;  2XHN A;  3K46 A;  1W9S A;  4JHZ A;  4XUR A;  1US2 A;  3LPG A;  5C7G A;  3UES A;  2X09 A;  4P08 A;  3VD7 A;  2J1E A;  3OG2 A;  4KWU A;  4XUP A;  4DEV A;  3HEI A;  3GM8 A;  3MUZ 1;  3P1I A;  3ACG A;  1JZ2 A;  2WAB A;  3DEC A;  2WYS A;  5DMY A;  1K42 A;  1MPX A;  3GDB A;  3WF4 A;  2VZR A;  1W8N A;  1OF3 A;  2W9X A;  5G05 L;  2CDP A;  4XUN A;  2VZQ A;  4JKK A;  3OBA A;  4TXW A;  2WUH A;  2YB7 A;  4CU7 A;  4XVH A;  4A41 A;  2W1Q A;  1JZ3 A;  4P02 B;  3NJV A;  5JXI A;  1OD3 A;  2WN2 A;  4A3Z A;  2V5D A;  1GU3 A;  3OEB A;  2E32 A;  2CDO A;  4UI9 L;  3OEA A;  1DLC A;  1UY4 A;  1WCQ A;  2L9L A;  3I2I A;  4D8M A;  4M4R A;  4ZZ8 A;  1BHG A;  1GNY A;  3MV0 1;  4QB6 A;  5JMO A;  4UAP A;  3T08 A;  4CUB A;  3LEG A;  3III A;  5DQ0 A;  2VZU A;  2Y64 A;  1SDD B;  4HG6 B;  4QX0 A;  4W50 A;  2EIB A;  3SKV A;  1JZ4 A;  3BGA A;  3WSO A;  1HN1 A;  3LQC A;  2LS6 A;  4E8C A;  4MGS A;  4CU8 A;  1SG3 A;  2PQS A;  2QQO A;  3HNY M;  3WF1 A;  1UY3 A;  3HNB M;  3OGS A;  1SHW B;  2VC9 A;  3W5N A;  1JI6 A;  3THD A;  5IJR A;  2ORZ A;  1K3I A;  2QQL A;  3ZM8 A;  3JXS A;  4JKL A;  1ULO A;  4QX1 A;  3CIH A;  1UXZ A;  3WNK A;  3VD9 A;  4DUX A;  4FI9 A;  1JU3 A;  4PQQ A;  4A45 A;  1K45 A;  4KMQ A;  2YC4 A;  3OB8 A;  2J1T A;  4OYU A;  2C4X A;  1F4H A;  3UET A;  3SEP A;  5LA0 A;  4OMC A;  3C7E A;  3T2Q A;  2VMD A;  2VZP A;  2VZO A;  3FHA A;  3FL7 A;  1KGY A;  3I2F A;  3WNN A;  2Y6G A;  1UY0 A;  1KEX A;  5LA1 A;  1XPW A;  3I2K A;  4QB2 A;  3IB3 A;  1UX7 A;  1US3 A;  4ET7 A;  4XUO A;  1EUT A;  5FUI A;  1DP0 A;  1IQD C;  5CZK A;  4JKM A;  1CZS A;  2V72 A;  4PT6 A;  3WEZ A;  3F2Z A;  4JX0 A;  3C7G A;  3I97 A;  3ABZ A;  2YC2 A;  5CYY A;  2JE8 A;  2WZ8 A;  3WF0 A;  2HYX A;  2W3J A;  1ULP A;  2VCB A;  2WAA A;  2E26 A;  3K77 A;  2EIC A;  2WBK A;  1XC6 A;  2W5F A;  3MO4 A;  3CQO A;  3CZJ A;  4GWI A;  4KI5 M;  4LHS A;  4P00 B;  4BXS V;  2DCK A;  3ACI A;  5DPN A;  2R7E B;  2VR4 A;  4LQR A;  3WQB A;  3A22 A;  3DYM A;  4QDR A;  1PMH X;  3T2P A;  2WO2 A;  2C9K A;  3WNM A;  5EIY B;  1W99 A;  3LPF A;  3OGV A;  1OF4 A;  4ZZ5 A;  3MBW A;  3VDA A;  3CZU A;  3A23 A;  3PUI A;  2J1S A;  4GWJ A;  4QAW A;  2EIE A;  2E33 A;  1W9T A;  3D3A A;  2QQN A;  3IAP A;  3K4A A;  1F4A A;  1WKY A;  4PF1 A;  4A6O A;  2HLE A;  3CMG A;  5I0D A;  4M4P A;  3OGR A;  2W1S A;  1GUI A;  3E1F 1;  4LKS A;  3DYO A;  3THC A;  1UZ0 A;  2V4V A;  2W87 A;  3ECQ A;  3T0B A;  2VZ1 A;  2YFZ A;  3AC0 A;  3HJR A;  2VME A;  5A1A A;  5JR2 A;  4OMD A;  1W9W A;  1L7R A;  2YG0 A;  4A42 A;  1OT5 A;  4QX3 A;  2VTF A;  1J84 A;  2J1U A;  2WN3 A;  3EB7 A;  4AAX A;  2QQM A;  5JXG A;  1JZ6 A;  5G04 L;  1JHJ A;  1EUU A;  2Y8K A;  5J1X A;  2J1A A;  3K4Z A;  3DYP A;  2W47 A;  5DN2 A;  3I2J A;  3SKJ E;  5JXJ A;  3CDZ B;  4ARY A;  2VCA A;  3ACH A;  3FHQ A;  4QB1 A;  1XNA A;  1UWW A;  3J7H A;  1JYX A;  5B4N A;  3NQH A;  3A7Q A;  3I2G A;  4CUA A;  4XUT A;  3NJX A;  4L0P A;  3HOB A;  4A44 A;  3P6B A;  5IYY A;  1JZ7 A;  1K12 A;  1YQ2 A;  3HN3 A;  1LNS A;  2RVA A;  2XQX A;  1JYN A;  3NNG A;  3C7O A;  3LE0 A;  5EJ1 B;  3VDC A;  2E31 A;  2J1R A;  2W95 A;  4QPW A;  4ZY9 A;  2VZS A;  4E8D A;  3I2H A;  3CKH A;  1R64 A;  2BZD A;  3VD4 A;  3SEE A;  3EYP A;  3PUH A;  3MV1 1;  2W46 A;  2VO5 A;  3C7H A;  5HXM A;  1D7P M;  2W94 A;  3A21 A;  2J22 A;  2VMF A;  3GGL A;  4RN5 A;  2ZEZ A;  1UXX X;  1NKG A;  3W5M A;  5IFT A;  2X10 A;  3T2O A;  3T09 A;  2QQI A;  1UYZ A;  4XZU G;  1J83 A;  2QQK A;  3C7F A;  1JYV A;  2ZEW A;  4BK4 A;  4DXS A;  2Y6K A;  4W8J A;  3IAQ A;  1GOH A;  1H6Y A;  2BBA A;  3LEK A;  1UY1 A;  3FN9 A;  3ACF A;  5F7U A;  5HPO A;  4Z2A A;  1O8P A;  5LA2 A;  2J7M A;  4OZO A;  3WF3 A;  4BDV B;  4QDQ A;  2B4K A;  1OH4 A;  2W1W A;  4ZXE A;  1JU4 A;  4DXR A;  1GOF A;  2JD9 A;  2LW8 A;  2J1V A;  1NX9 A;  3T0A A;  3BN6 A;  5JUV A;  2DCJ A;  1H6X A;  1CIY A;  1TVG A;  1PX3 A;  1L7Q A;  4ARX A;  4DXT A;  2W91 A;  1CX1 A;  1JZ5 A;  2W92 A;  2VZ3 A;  4OUE A;  4QDS A;  4BJ0 A;  3K4D A;  4CU6 A;  1W8O A;  1UYY A;  2BER A;  2BGO A;  1TG7 A;  1UMH A;  1O8S A;  1CZV A;  1T2X A;  2RJ2 A;  1I5P A;  5LCW L;  3GXU A;  2XON A; 
#chains in the Genus database with same CATH topology
 4FP2 A;  2WNO A;  4Q4W 1;  5DXD A;  4DFS A;  4TZD A;  4XE9 A;  3NW4 A;  2BV4 A;  3WG1 A;  1ZBE 1;  2DCY A;  2JG8 B;  4HON A;  4DB5 A;  3FUO A;  4ZON A;  4AI0 A;  3DPR B;  3AZV A;  5JPN B;  1PZ7 A;  1H30 A;  3WF2 A;  1ODM A;  3IDA A;  3N3H A;  4AQS A;  4DUV A;  3ZVX A;  2C5D A;  5M0T A;  1S0I A;  1RUE 1;  2FZ2 A;  2G4I A;  2ZGR A;  3CJI C;  1SLC A;  2PYT A;  2DVA A;  5FXW A;  2Q8D A;  4AK3 A;  2QQJ A;  1M06 G;  2OKX A;  1F8V A;  4BQ2 A;  5CG9 A;  3R6S A;  3S0M A;  1LRH A;  4QX8 A;  2WO1 A;  1PMJ X;  1H2K A;  1AJK A;  2YBP A;  2PXJ A;  1DFQ A;  4KGG A;  4F83 A;  4OUL A;  1TQ5 A;  4QT6 A;  5FO7 B;  2PHD A;  2A3Y A;  1AZD A;  3IIA A;  1XSR A;  1YCI A;  1IOA A;  1M4W A;  1TME 3;  1O5U A;  2B42 B;  1NCQ C;  2P1B A;  4NE9 A;  5DAB A;  1DYO A;  1L3J A;  2VCC A;  2XGX A;  1YI7 A;  3N9P A;  1ENS A;  2CY6 A;  3AKS A;  4FOV A;  2R06 3;  2YPD A;  4ONU A;  1UOG A;  1IG0 A;  3LGR A;  4D0Q A;  3P3P A;  1YQ8 A;  3J8F 1;  1VBD 2;  4M00 A;  5FO9 B;  1YYN A;  2B9U A;  3JBG 3;  2D7F A;  1KXG A;  2WWS A;  4GUL A;  2CGO A;  3ETP A;  4DEQ A;  2ARA A;  3B7M A;  1WBF A;  2HWD 2;  4K3U A;  1MS8 A;  4I3G A;  1CAW A;  5FYZ A;  4FAH A;  5ACA 1;  4LO8 A;  4RR3 C;  1AX1 A;  4XPV A;  3I2O A;  4MOA A;  4LXL A;  2VY0 A;  2HWD 1;  2VW1 A;  4UBG A;  2VMI A;  3SIS A;  4MAD A;  5FO8 B;  2WQ8 A;  1SFP A;  2XQR A;  5FYY A;  4TTG A;  1GOG A;  5IVV A;  3ITQ A;  3H7J A;  2VG9 A;  4QM9 A;  5F6K A;  5C5T A;  1AYM 1;  3AKT A;  3LEM A;  4RFT 0;  5FKB A;  1UKR A;  2WYF A;  4IE6 A;  3PUQ A;  1YFX A;  2KD7 A;  2VU9 A;  3VKO A;  4UYB A;  1NAE A;  5KWR A;  2HWB 2;  4GMP 3;  1FOD 2;  5AFB A;  1XNT A;  4L8Q A;  4FQZ A;  4U36 A;  1BCX A;  2Y0O A;  2XHN A;  3LB9 A;  4YVS C;  3GZE A;  2QCS B;  2IVI B;  1H1I A;  4JGZ B;  3B9C A;  3D82 A;  4K40 A;  4G3Y C;  5JMC A;  1AXZ A;  1D4M 3;  3T30 A;  2DVB A;  2XJV A;  5D8A A;  1R09 2;  4XUR A;  3ZDS A;  4RR3 A;  1SLL A;  2JXA A;  1GQG A;  3CO2 A;  4Y20 A;  3VDD C;  1LED A;  2HEY F;  3S7I A;  3OOX A;  3RGB A;  3M8L A;  2QDN A;  3RI9 A;  4K21 A;  4R9C A;  3GF6 A;  4IQP A;  2GND A;  3OG2 A;  4DEV A;  1JUI A;  3MID A;  2PN5 A;  3HEI A;  2HWD 3;  3GYD A;  5D2A A;  3RVH A;  3P1I A;  5C8W A;  1QJY 3;  3M70 A;  3PTR B;  4FPE A;  4NN0 A;  2MHF A;  3KLS A;  3U11 A;  5DMY A;  4ZS2 A;  3LCP A;  3EBR A;  2ZMN A;  3DF0 A;  3QOP A;  4E9K A;  3WF4 A;  5FP3 A;  4JDM A;  5FXZ A;  5BNQ A;  1KQR A;  5BUV A;  3ATG A;  1VBA 1;  5FPX A;  2YMZ A;  5G05 L;  4PHZ A;  1YC6 1;  2WS9 1;  4XCB A;  4XUN A;  3ALQ A;  3AMQ A;  2O8Q A;  2VZQ A;  2YHJ A;  3BIW E;  3PVO A;  1AR6 2;  4CRQ A;  4U2A A;  3RRD A;  3OBA A;  3WT3 A;  4IET A;  1VRH 1;  1IKQ A;  3WIN E;  3H1W A;  4AED C;  2AC1 A;  2G9F A;  1H9P A;  1ZA7 A;  5JOZ A;  1XNC A;  3JQW A;  1JZ3 A;  5JXI A;  4P9W A;  4ATE A;  4CP0 A;  2DCZ A;  3AP9 A;  3T4H B;  5DDJ 1;  1WLW A;  1GU3 A;  3OEB A;  1EAH 1;  2XUM A;  2EF6 A;  2B5H A;  1VE0 A;  1EPZ A;  3KT7 A;  3OEA A;  4XFF A;  5FP7 A;  4D8M A;  3OYW A;  4Y5S A;  5IT6 A;  5JMO A;  2XWB B;  2JWP A;  5FP9 A;  4CUB A;  4QX7 A;  1IG3 A;  3III A;  3MIE A;  3RMX A;  2VXR A;  2RMU 3;  4FXK B;  4PIY A;  1CAU A;  3SLI A;  3ZX7 A;  4B1L A;  4CDW B;  1W05 A;  3UJQ A;  1AR7 3;  3RJ2 X;  1A78 A;  1XJA A;  1GYK A;  1QMJ A;  3D4K A;  5FZ9 A;  3SKV A;  5FYH A;  1LU1 A;  4CCD A;  2BYV E;  3C3V A;  4YG6 A;  2N7G A;  3URF A;  4BQX A;  1NG0 A;  2IUW A;  3SIT A;  5GLV A;  5CFC B;  1EAH 2;  1F2N A;  3ZXJ A;  1W8F A;  1Q43 A;  2PQS A;  1OQD A;  1NCQ B;  1S0F A;  3LA7 A;  2C24 A;  1WZX A;  2XVL A;  3NV3 A;  3WF1 A;  3ZSJ A;  4Y33 A;  1VMJ A;  2JJ6 A;  1PGL 1;  4IND A;  3BB6 A;  1NXM A;  2DCT A;  3MZH A;  4J25 A;  2GNT A;  4Q2F A;  1KDM A;  5FY8 A;  3WX5 A;  3W5N A;  1DG6 A;  1JI6 A;  2EXI A;  2XHK A;  4JQT A;  2LUW A;  4QPI B;  1RUE 3;  4XF0 A;  4YVW C;  5IJR A;  1LTE A;  2A75 A;  3THD A;  4X6R B;  2AAC A;  2EAA A;  2JD4 A;  4YVS A;  5FIX A;  2R04 1;  3ZM8 A;  4XF9 A;  4CDX B;  1ULO A;  4R8H A;  1N1Y A;  1WME A;  4Y24 A;  2DYC A;  2OXB A;  4QWN A;  1ZBE 3;  4OHY A;  1UNB A;  4HK8 A;  4CCO A;  4BQ5 A;  1V6J A;  1UU6 A;  3D0S A;  1RIN A;  3DXU A;  4JRA A;  5FZK A;  4NMI A;  4KMQ A;  1CQ9 A;  3USU B;  5LW9 A;  4RSU A;  2ZGM A;  3TYJ A;  4Y1U A;  2OPK A;  1A8M A;  4LBQ A;  2YC4 A;  2ATF A;  1HV0 A;  4OYU A;  2XJR A;  2EIG A;  3UKT A;  1Z7S 1;  1F4H A;  3D0J A;  3MIH A;  1OFN A;  5HCH A;  3KSC A;  2BBV A;  2RMU 2;  4IGO A;  5KHG A;  4IW3 A;  5HV4 A;  4QQO A;  3MGU A;  2VZO A;  5LAT A;  2ZX1 A;  1DLL A;  1Z7S 2;  5HCF A;  1C8N A;  1QEX A;  2PFW A;  1DGR N;  1YXW A;  1PM4 A;  2EXK A;  3K3N A;  2OZJ A;  5EHD A;  4XFA A;  3JU9 A;  1HRV 1;  2RS3 3;  4CCJ A;  1RUJ 1;  1UX7 A;  1US3 A;  4HPK B;  1GWL A;  1PNF A;  2E7T A;  2OZ6 A;  2BWC A;  5L7O A;  2D98 A;  4FFI A;  1J58 A;  2GH8 A;  5FUI A;  5LA9 A;  4I2O A;  1HRI 3;  3GCW A;  1IQD C;  5LY2 A;  2HWB 1;  2PHF A;  2C9A A;  4TWT A;  3RQ0 A;  5JSP A;  4EWA A;  4B4Q A;  2GNB A;  1CZS A;  1TNR A;  4CEY A;  1PGW 2;  5CFD A;  5A3P A;  1ND3 C;  1S0C A;  4BYY A;  3H9A A;  4QQL A;  4KWL A;  1COV 3;  3F2Z A;  1RED A;  2ERF A;  1Q5O A;  3C7G A;  3ZPO A;  4NAM A;  1OFS A;  1R1A 1;  4TSV A;  5C3Q A;  1GAN A;  1AL2 2;  3AM2 A;  2PHU A;  1WW6 A;  1SDW A;  2WZ8 A;  3ZXK A;  4WZC A;  1ULP A;  2ET1 A;  3N9L A;  4LOS A;  1E5S A;  1CJP A;  5JZG C;  1BZW A;  2VVE A;  1DQ5 A;  1KJR A;  4Q4W 2;  5A1L A;  1VAL A;  2EIC A;  1LOC A;  1DHK B;  3PUS A;  4GWI A;  5DZE A;  3QAC A;  1I3H A;  4DMI A;  4P00 B;  4JRL A;  5KHH A;  2XH6 A;  1D4V B;  3WP3 A;  1MS9 A;  2DCK A;  1KFX L;  3VBH B;  1VJ2 A;  4R9D A;  4PLM A;  3P3N A;  1IS6 A;  1W39 A;  3M3E A;  4DRR A;  1N3O A;  1QF3 A;  4ZXK A;  1RUC 3;  2JDZ A;  1ODN A;  2FCT A;  3I4I A;  4QDR A;  5J37 A;  5A3N A;  2XL7 A;  2C9K A;  2CWS A;  5L7O B;  2XLG A;  3BU0 A;  2D3R A;  5SV5 A;  3TN9 1;  4ZZ5 A;  3BCW A;  3NMB A;  3TNP B;  3AYA A;  3NKT A;  3BTA A;  4LTA A;  3A23 A;  1W06 A;  1QJY 1;  4HKO A;  1PO2 3;  4RA0 A;  4QU1 A;  4BME A;  4GB3 3;  1NZI A;  4QQ2 A;  2JG9 C;  2GME A;  2PHW A;  4P9Y A;  1JS9 A;  4IV1 B;  5JIA A;  1ZZ6 A;  2RM2 3;  2YBK A;  3VDD A;  4WM8 B;  1LOD A;  3NAP B;  5FLI A;  1RUC 1;  5GLU A;  5CAZ A;  3NV4 A;  1TEI A;  3NNF A;  2A6V A;  5A7W A;  2ADE A;  4MV2 A;  1AF9 A;  4CCK A;  3ZIX A;  4QKD A;  1RUF 2;  1ZRC A;  4BXF A;  3TEZ A;  1CPM A;  1R1Z A;  3TN9 2;  2ILM A;  3DPR C;  2RS1 3;  4LEJ A;  1QY4 A;  4YW6 A;  5A1A A;  5JR2 A;  1E57 A;  1VMF A;  4OMD A;  4H14 A;  3NNL A;  4KNC A;  1YRZ A;  4ASL A;  2AUY A;  1IS4 A;  3QH6 A;  5CFD B;  2IXJ A;  4GKY A;  4N90 A;  4P9L A;  4AR2 A;  5IVJ A;  2VUL A;  4MX3 A;  3TN9 3;  3L2Y A;  5FOB B;  1S1A A;  2VTF A;  4UFH A;  1U5X A;  5BNP A;  3DL3 A;  1C5I A;  1XQN A;  5JXG A;  4QPI C;  4YVW B;  5G04 L;  3E5X A;  4AW7 A;  1JZ6 A;  1EUU A;  3ZFF A;  3O1M A;  4NID A;  2F6B A;  2VUC A;  3WUD A;  2WJS A;  2WT0 A;  2BFU L;  3K4Z A;  3U0Z A;  5JXJ A;  2JX9 A;  4AI8 A;  4ARY A;  1DZQ A;  2ZKL A;  4K9S A;  4XIL A;  4BB3 A;  2JDU A;  2JB4 A;  3IWZ A;  3IPV A;  5FFO C;  1FOD 3;  3I2G A;  3ZYH A;  1WW5 A;  1PO2 2;  2TUN A;  3EXU A;  1J1L A;  3FUQ A;  5C4W B;  3WW1 A;  5KHJ A;  4CXW A;  4M01 A;  1YQ2 A;  1QDO A;  5GLT A;  5LEK A;  4AI1 A;  2VQA A;  1RUG 1;  4LK6 A;  1K5M A;  4LO7 A;  2OX0 A;  1QIQ A;  3AMM A;  1W9Y A;  2W95 A;  4ASK A;  4EN7 B;  2WNV A;  2P5B A;  2ZHM A;  5FZM A;  3CKH A;  2CHH A;  2FHR A;  4MSV A;  5LBF A;  1ULE A;  5FZ7 A;  3VD4 A;  1C1F A;  2D3P A;  2WZR 2;  4FO9 A;  3OUJ A;  2WS9 3;  1S0D A;  1WUV A;  2QDR A;  2VO5 A;  4OI4 A;  2G9G A;  3LA2 A;  5HXM A;  1D7P M;  4WVM B;  4YRD A;  3VZJ A;  4IE0 A;  5BNN B;  2O0O A;  2QUO A;  3UGF A;  5T3N A;  2ZZJ A;  4KBZ A;  1CWP A;  4ERO A;  1W0P A;  1OA3 A;  4X8P A;  3W5M A;  4RHV 1;  2ZPX A;  4Y1Y A;  1QNY A;  1LGB A;  2QQI A;  1DQ0 A;  1U5Z A;  2BP6 A;  3O7O A;  1UYZ A;  2YGL A;  3RJR A;  2WLQ A;  3EQE A;  2W52 A;  3BKZ A;  4AVT A;  5CNA A;  1MQT B;  5EYX A;  2A6Z A;  4PLN A;  5EYY A;  4MXW A;  3ZLI A;  3JD7 1;  5ISL A;  1GOH A;  1H6Y A;  1QJZ A;  3AMP A;  1FPN 3;  4UW6 A;  3ZXE A;  3VHP A;  4JVA A;  4XJA A;  3SNM A;  1J3P A;  2WZR 1;  2DBI A;  2FD8 A;  5ERL A;  3OCP A;  1O8P A;  1MQT A;  3IMN A;  4N9H A;  4Y1X A;  4CDQ A;  1I5Z A;  2PA7 A;  2UU8 A;  1CAX A;  2J7M A;  3DKQ A;  2VMG A;  5CVR A;  2DFC A;  4Z82 A;  4PIZ A;  1CIW A;  1AYN 1;  2D6P A;  4L99 A;  3KGL A;  4RQP A;  3M3Q A;  1V6L A;  4DXR A;  1GOF A;  2LW8 A;  4LHK A;  4NVP A;  2VTX J;  5JVV A;  4JGY C;  1S55 A;  5E6H A;  3FLP A;  5I93 A;  2VOK A;  5JUV A;  1HLC A;  2R30 A;  4AVS A;  2BTV C;  1O7F A;  2DCJ A;  2GC1 A;  3GZT B;  4Y4R A;  2WFF 3;  1H6X A;  3WW3 A;  4A7K A;  4QPY A;  1L7Q A;  4ARX A;  3KT4 A;  5GZD A;  3TEX A;  3SCG A;  2W91 A;  1PIV 1;  1JZ5 A;  1WMF A;  1BBT 2;  3AFG A;  3Q8E A;  4FTB A;  1ZBE 2;  4LUL A;  2OYZ A;  2WNV B;  1HXS 1;  4AFB A;  1PK6 C;  5FZ1 A;  2YXS A;  1EV1 3;  4XQW A;  4BJ0 A;  1Z0H A;  4PJY A;  1NXD 1;  3NV1 A;  4XBQ A;  4CU6 A;  1W8O A;  4IEX A;  1WLC A;  1UMH A;  4IV1 C;  4KL1 A;  2ENR A;  3M2M A;  3I54 A;  4J1X A;  1T2X A;  1H1M A;  2JB8 A;  1KFU L;  3AZW A;  4EV0 A;  2F4L A;  2B9V A;  2XON A;  2ZHL A;  1OA2 A;  3AX4 A;  2W1U A;  3KHB A;  5JI7 A;  4Q5O A;  4AI9 A;  5FZ8 A;  2PHL A;  1QJU 1;  4CA9 A;  4O9E A;  5FXV A;  3J4U H;  4AF9 A;  4MO3 M;  4CZS A;  3A0N A;  5T52 A;  2D6L X;  4COY A;  1C3H A;  3O0V A;  3I3B A;  2VL4 A;  3ELN A;  3S6P A;  4AHY A;  1Y3T A;  2E7A A;  4HZF A;  2NPI A;  3ZFE A;  1DYP A;  4UOJ A;  4GJZ A;  1GIC A;  3ZFF B;  5A3L A;  1NCR C;  1QH7 A;  1QNW A;  3C8X A;  4LIU A;  4YGE A;  4YSF A;  1TME 1;  4QHO A;  4ES8 A;  4TLF A;  4FPF A;  4GD4 A;  3WUC A;  2EA7 A;  2RR1 1;  3MIF A;  1C5H A;  1C1L A;  5FZL A;  2Y6H A;  3AKR A;  1NUK A;  3KV4 A;  3OD4 A;  3S5A A;  2WZE A;  4LO6 B;  4XJW A;  2VUD A;  5FJK A;  3VBU B;  2XOM A;  1LKN A;  4HMZ A;  4Y20 B;  2NN8 A;  1BQP A;  1VP6 A;  3ENR A;  3U10 A;  4AQ2 A;  4GKX A;  5CIS A;  2G9Z A;  4UFJ A;  3U37 A;  3O1V A;  5K8S A;  1YLL A;  3GJA A;  4Q1P A;  2YZ4 A;  1B35 A;  3WG2 A;  2NM1 A;  4IEV A;  1CZT A;  1RIR A;  2MEV 1;  5EJZ B;  4E27 A;  5ACA 2;  5E16 A;  1FX5 A;  5GAL A;  4NII A;  1AL0 G;  1G86 A;  2Y38 A;  4FTS A;  1UIJ A;  1WCK A;  2Z79 A;  5FRE A;  4QPG C;  3JB8 A;  3POF A;  3ZMN A;  1DYK A;  1VLN A;  4IL7 A;  4XOG A;  4AL9 A;  2WA3 A;  3FBM A;  3WP6 A;  1W6O A;  4URT A;  1BEV 1;  1HRV 2;  2C26 A;  4G4F A;  4COW A;  1UKG A;  4OVE A;  5EP9 A;  1A34 A;  4DRV A;  3QD6 A;  4JTN A;  4AVA A;  2ZX0 A;  3Q9O A;  4LK7 A;  3V65 A;  4XDO A;  3HPN A;  3WDU A;  1RUI 3;  1Q3E A;  5T50 A;  4A4A A;  5IFP A;  2YPJ A;  4QXC A;  3O0X A;  5T55 A;  1JH5 A;  2VJX A;  5BNO A;  2A7A A;  4DS0 A;  2D6M A;  3LDK A;  1LUL A;  1W0N A;  2GNM A;  3ILF A;  3FLT A;  1JYW A;  1V70 A;  3K75 B;  2ID4 A;  4OI0 A;  4CDQ C;  1O3Q A;  2DDU A;  3ZDV A;  3LIG A;  2VAU A;  1SBD A;  5GLZ A;  2ZGU A;  4UF0 A;  4HT1 T;  4Q27 A;  1IGO A;  1CPN A;  2B45 X;  4JDO A;  1R1A 2;  2P6H A;  1O3R A;  3A4U A;  1JBC A;  4JGY A;  3B5L B;  1W6M A;  2BNN A;  2BQP A;  2XKO A;  1PVX A;  2R1B A;  3APB A;  1O91 A;  3MEP A;  1UY2 A;  1YFY A;  1SZB A;  1GFF 2;  4UW5 A;  1QDC A;  1RUF 3;  4K8F A;  4LUM A;  1LOB A;  1R09 3;  3B3Q E;  2Z4F A;  2ZXQ A;  3T0D A;  1NY7 1;  3CJX A;  4EN0 A;  2PAE A;  4XAA A;  3G7D A;  1IZ3 A;  1BJQ A;  2RDR A;  1CON A;  4PDW A;  4PCR A;  1LJ7 A;  2Z69 A;  2IFR A;  3HAG A;  3M3C A;  4GB3 1;  1W9S A;  2GP5 A;  3W9A A;  2DVF A;  5A3U A;  4ZKT B;  3POJ A;  4NIA A;  5H9S A;  3B93 A;  1EPW A;  5C7G A;  1VRH 2;  1R08 1;  3PUA A;  5DUV A;  4LBM A;  4RL7 A;  1A8D A;  2VOV A;  2A6X A;  4KWU A;  1VBC 2;  4M0N A;  4Z1V A;  2C1F A;  1W03 A;  3MW4 A;  1ASJ 3;  1QJE A;  5DDJ 2;  3ACG A;  3SMH A;  3VZM A;  1ZYB A;  3WQ7 A;  4FQ4 A;  1JZ2 A;  3LOB A;  3DEC A;  4NHM A;  2P34 A;  3CEW A;  3KT1 A;  4XJU A;  4FSJ A;  4YFW A;  5GJ6 A;  1D0H A;  2CNA A;  5A33 A;  4C8D A;  4XFG A;  1KS5 A;  4AHX A;  4RGK A;  4XF3 A;  1CJD A;  1OOP C;  3MFA A;  2P17 A;  2A6W A;  4W6W A;  2BNO A;  2CDP A;  4KWJ A;  3I59 B;  1QHD A;  1LOA A;  1RUF 1;  3OBR A;  2XKP A;  5K0U A;  1H2M A;  2HEV F;  2WRA A;  5BNP C;  1ND2 C;  5CBL A;  4GQ7 A;  2YB7 A;  4CU7 A;  4GJY A;  1HB2 A;  2XB6 C;  4LBQ B;  3THP A;  1GV9 A;  4DO0 A;  4MHR A;  4YW3 A;  1RTV A;  2WN2 A;  3W58 A;  4BH9 A;  3PLQ A;  4A3Z A;  5L7O C;  4I3P A;  1CAV A;  1W6Q A;  2VCM A;  3VLB B;  4FPJ A;  3UKV A;  2FDF A;  2FDG A;  2FZ1 A;  3VBO A;  2XJU A;  2DFB A;  2CDO A;  3K3O A;  1D4M 2;  2QE3 A;  4YZ5 A;  4LE3 A;  2PEL A;  4ZZ8 A;  3RZK A;  1SAC A;  3VDD B;  1PGS A;  5FYU A;  4CCM A;  5A6X A;  1S2E A;  3H50 A;  4O7X A;  5CG8 A;  4IE4 A;  1XU1 A;  1QQP 2;  5DQ0 A;  2K46 A;  3VZO A;  4CDW C;  2WR9 A;  2GN3 A;  2EAL A;  4BQ3 A;  2JDM A;  1SDD B;  3BOD A;  1ALY A;  4QX0 A;  5FUN A;  1SLB A;  1ASJ 2;  5DDJ 3;  3UJO A;  1D2S A;  1Z7S 3;  5CFC A;  5A3O A;  2MEV 2;  1BXH A;  4OZX A;  2R04 2;  3WSO A;  4QKB A;  4BLI A;  4EJR A;  4EE2 A;  2QKD A;  1UZV A;  1FMD 2;  1XYN A;  4BU2 A;  3M1H A;  4CU8 A;  5A33 B;  4NAO A;  3BTZ A;  5F9T A;  3AP5 A;  2ZGS A;  4LR4 A;  2E53 A;  5H9Q A;  5CA6 A;  1WWY A;  3H8U A;  4RHV 2;  3RZG A;  2RMU 1;  3HNB M;  3CHX A;  1LHU A;  1OXC A;  3OGS A;  1RC6 A;  1W3X A;  5T5O A;  4AED B;  2VOW A;  4NRP A;  3KCC A;  1DIW A;  1H4G A;  1QWR A;  4RQP C;  3JQX A;  3NST A;  5L19 A;  4OQ8 A;  2ORZ A;  3NJY A;  4BA6 A;  1K3I A;  1DGL A;  2QQL A;  3JXS A;  1NZC A;  4N9I A;  4H7L A;  1UXZ A;  2HWE 2;  2ES3 A;  2B8M A;  2NYY A;  2B7Y A;  2W39 A;  3VD9 A;  3UYJ A;  5I0T A;  3HQX A;  1QOS A;  3ZXA C;  4FI9 A;  5IK4 A;  4A45 A;  1W6M B;  4COV A;  2D40 A;  3U4X A;  1K45 A;  1V9U 2;  3E6D A;  4GWM A;  4HL0 A;  4RGG A;  5DUU A;  3S30 A;  2XBO 2;  2YC0 A;  3VBS A;  3J7M A;  5FCC A;  1QXP A;  4HKL A;  3O0W A;  4UW4 A;  1RMU 3;  1C28 A;  4QHB A;  1ZRI A;  4EZ4 A;  3RWK X;  5C4W C;  3PHM A;  4BLJ A;  5K0U C;  4YAR A;  5FZH A;  5LA0 A;  2I07 B;  2KR2 A;  3FHA A;  5ABJ B;  3U07 A;  5F5A A;  4D6R A;  3N9Q A;  2BU9 A;  1FXZ A;  4R9B A;  1UMZ A;  5A32 B;  3I2F A;  2Z5W A;  4N8M A;  1HXS 2;  2Y6G A;  3CL1 A;  4GH4 B;  2B39 A;  5A6Y A;  4LKE A;  1R1A 3;  3ZR6 A;  1YNA A;  1U5Y A;  2KA3 A;  3I2K A;  3HQR A;  1GWK A;  1SFN A;  4NHK A;  5FV3 A;  3H1M A;  2X29 A;  4YM1 A;  1MEC 1;  2VNG A;  3CJI B;  3OPZ A;  3TNQ A;  4XUO A;  3SH5 A;  5AC9 1;  4WM7 A;  4AI2 A;  1EUT A;  1QXJ A;  4IEW A;  5KC5 A;  4EWD A;  5BNO B;  4CEY C;  5FK8 A;  1WMD A;  4LT5 A;  1ZZ7 A;  5CZK A;  4C0H A;  4IDZ A;  5A7O A;  4B4R A;  3N9N A;  5EWS A;  1VBC 1;  1NY7 2;  2XJT A;  3ZO0 B;  1LOG A;  1EV1 1;  3ZKU A;  3POW A;  1UIK A;  2PHX A;  5FMO L;  1HIX A;  2X5I B;  5ANQ A;  3WEZ A;  4P9J A;  2I74 A;  2WWJ A;  2QZ3 A;  5F8P A;  2EVX A;  3AXE A;  1Y43 B;  4L9B A;  4FPG A;  1MVE A;  2PLV 3;  5FRA A;  4AVB A;  3ZN4 A;  2IWG B;  4CTE A;  3OUI A;  4P9X A;  3PIG A;  3TWI A;  4OHW A;  1KIT A;  3AFK A;  1TME 2;  2R0F A;  2W2I A;  2I45 A;  4XDP A;  3K77 A;  1LHN A;  1ND2 A;  2O1Q A;  3D8C A;  3GBF A;  1OOP B;  5L9R A;  4B1M A;  5FY4 A;  1UOF A;  4FPL A;  4IE5 A;  3MO4 A;  3CQO A;  3HT2 A;  1GP6 A;  5FZ3 A;  2RR1 3;  1F5J A;  3B02 A;  4LHS A;  1F5F A;  4UW3 A;  2A71 A;  2Q4S A;  1OUS A;  2VMH A;  1W3V A;  1RVF 3;  3ZSL A;  1POV 3;  3PMS A;  2FMY A;  4Q4X 1;  5CIR A;  3OF1 A;  4Z07 A;  2LM3 A;  3WQB A;  4A7Y A;  3A22 A;  3DYM A;  4XIO A;  1W2O A;  1LAJ A;  3VBF C;  4Q0U A;  2PHT A;  2ZKN A;  1W2U A;  2JDY A;  3ZXL A;  4EQV A;  1UOB A;  3OGV A;  1OF4 A;  4AAP A;  3PIJ A;  5FLH A;  2D6O X;  3NNJ A;  1JMU B;  1HRI 1;  3J7L A;  3M3I A;  1YJL A;  1LHW A;  4HSL A;  4J1W A;  5DAQ A;  1UU4 A;  1UAI A;  2MNG A;  4IES A;  5LY1 A;  5IUQ A;  2JEN A;  4MZU A;  5JLV A;  4GWJ A;  1MS0 A;  1ZBA 3;  4GH4 A;  1POV 1;  2SBA A;  4HBN A;  4XF1 A;  5A7P A;  3SH4 A;  2R0H A;  2NLR A;  4D7Y A;  2WLP A;  3D3A A;  2VNR A;  3IAP A;  1HV1 A;  1Q8S A;  3AYC A;  3FZ3 A;  4WM8 C;  1W8U A;  1F4A A;  1WKY A;  3AMH A;  1DF0 A;  4WZF A;  3HD8 B;  4XHX A;  3ZXD A;  4XBN A;  5LBC A;  3O1S A;  1UO9 A;  4AYU A;  2Q0A A;  1MQT C;  3BOP A;  4M4P A;  4N7I A;  1PVC 3;  3OGR A;  4P9I A;  2W1S A;  1NT0 A;  4XFH A;  2R49 A;  1XND A;  1GZC A;  3FMG A;  3E1F 1;  4LKS A;  4NRQ A;  3ACL A;  3DYO A;  2FCU A;  1UZ0 A;  4FVV A;  4GWN A;  3TAY A;  3ECQ A;  1AR6 3;  1O5L A;  1SLT A;  3AYD A;  3MLK A;  2VZ1 A;  4P14 A;  5EXO A;  1RVF 1;  2YFZ A;  1PO2 1;  3HJR A;  4QXH A;  4C90 A;  5JOW A;  2Y60 A;  3J8F 3;  1W2T A;  4K7J A;  1OKO A;  1W6P B;  1B09 A;  1KJL A;  1KS4 A;  1QGL A;  4XFC A;  1S4C A;  3WP5 A;  4ASM B;  3VBH C;  4GAL A;  2D5H A;  5FWE A;  2RJK A;  3RFR A;  4YG0 A;  2MPF A;  1PMI A;  3VBU C;  4AAX A;  1R09 1;  1PK6 A;  2QQM A;  5L36 A;  1NCR A;  2ZGT A;  4RQP B;  2Y6F A;  4AEJ A;  2O8O A;  1G7Y A;  1X9T A;  2Y8K A;  4FFH A;  5JSR A;  2IXI A;  2WNU B;  1LES A;  2J1A A;  1GQH A;  1JW6 A;  1NLR A;  3DYP A;  1FI2 A;  3DV8 A;  3WDV A;  3WXP A;  1FV2 A;  4XHB A;  3SKJ E;  3CDZ B;  4E2S A;  3R05 A;  4YG3 A;  1PK6 B;  3ACH A;  4M3C A;  4CEW A;  2BPA 2;  1UWW A;  4K8R B;  2PAM A;  3WHT A;  5B4N A;  2ZAB A;  1YFW A;  4B7K A;  3H8R A;  2PAK A;  2AYH A;  2VE1 A;  1SMV A;  4CUA A;  4XUT A;  5J96 B;  1F31 A;  1OKQ A;  3ETQ A;  3GBW A;  3KV9 A;  5EZW A;  5ABJ A;  4R4X A;  5I8Y A;  1O6U A;  1JZ7 A;  2ZCW A;  3ES1 A;  4S2G A;  1X8E A;  3HN3 A;  1OMI A;  4AOC A;  4LJH A;  3R0R A;  4AVC A;  2WZR 3;  3ZYJ B;  2RVA A;  2Q1F A;  5FBJ A;  4NOT A;  4CDU B;  3PNA A;  2W08 A;  3R4U A;  1XYP A;  1IPS A;  3NNG A;  1ZZ8 A;  3LE0 A;  1LOF C;  4N43 B;  5DG2 A;  4C1X A;  4Z2W A;  3POI A;  2J1R A;  4R9A A;  2YDE A;  2QQU A;  2RHP A;  4H7M A;  4OCT A;  2D44 A;  3MPP G;  2VZS A;  1S0G A;  1ZZB A;  3SEE A;  3MV1 1;  5KR7 A;  4Q0S A;  1W6Q B;  2CV6 A;  4LIV A;  5FXX A;  3A21 A;  4KQ7 A;  2FDH A;  4AFD A;  1H8T A;  4Y4Y A;  2VOX A;  4WVW A;  3U78 A;  4COU A;  2CWM A;  3IT8 A;  4XMI A;  5A7S A;  1TNF A;  3E6C C;  3GGL A;  1HXS 3;  2XXZ A;  1W28 A;  5FZI A;  3T2O A;  2ZS6 B;  1XXN A;  3T09 A;  3EJK A;  4ZPI A;  3LSE A;  3ON7 A;  1AR8 1;  4S2D A;  5F6L B;  1J83 A;  5C8C B;  1NA1 B;  5FZA A;  4URA A;  1JYV A;  2ZEW A;  2AZ5 A;  1CN1 A;  2Y6K A;  5D8A C;  4W8J A;  1OLR A;  3NVC A;  3N7K A;  2BBA A;  1AYN 2;  3LEK A;  5IAV A;  2AR6 A;  3FN9 A;  5F7U A;  4XAC A;  4BQ4 A;  5FPZ A;  4Q4Y 1;  3PME A;  5K9Y A;  4IE7 A;  4A2U A;  3ZYI B;  1FMD 3;  2VNO A;  5LA2 A;  4AGG A;  4OZO A;  3TB0 A;  1H4H A;  4A3X A;  1QQP 1;  5L9B A;  1OLM E;  4BDV B;  4ES9 A;  4QQH A;  5FPU A;  4WVZ A;  4QPG A;  4FT8 A;  3CU7 A;  4LOT A;  1AR7 1;  3OPW A;  1VAK A;  2OW4 A;  3PU3 A;  3T0A A;  4OHV A;  4CPB A;  2NQY A;  3FJS A;  3GJB A;  4CP9 B;  1ND3 B;  1UCX A;  1LB2 A;  3E6B A;  5HI0 A;  2GC2 A;  4UT5 A;  1WD4 A;  4RD7 A;  4DXT A;  2UUR A;  4Q29 A;  1YWK A;  4IEQ A;  1NOV A;  1OSG A;  3KCY A;  1JYT A;  2OUJ A;  3MIB A;  2UYA A;  5HCA A;  4MG2 A;  3ASI A;  4IV1 A;  1RUH 1;  3LFM A;  4M0H A;  3PU8 A;  2AH2 A;  3J8F 2;  5DZG A;  5E88 A;  2MEV 3;  2XVG A;  1O8S A;  4FCA A;  1CZV A;  4YZ2 A;  4MET A;  2EXJ A;  3CBN A;  1RL3 A;  1BVP 1;  5FTT C;  5LCW L;  2YFU A;  4J6G A;  5A3W A;  3WG4 A;  3NAP A;  4C0B A;  1G9B A;  1GZ9 A;  2E7Q A;  3AZX A;  2NMN A;  2RV9 A;  1ULD A;  2XLF A;  3E97 A;  3NKG A;  2HWC 2;  3I3E A;  2IZW A;  2WAO A;  3VD3 A;  1AVB A;  4IEP A;  2Q1M A;  4W4Z A;  2VMC A;  5FP4 A;  2RM2 2;  5I0U A;  4AE2 A;  2WNE A;  3KF5 A;  1AYN 3;  4YGD A;  2HWC 1;  2OS2 A;  1YJK A;  3U75 A;  3O1T A;  4F7Z A;  1HKD A;  1VBB 2;  3WDT A;  3WOG A;  1DGR A;  5I0D A;  3JUU A;  3WQ0 A;  4D7T A;  3I3M A;  3VL9 A;  3DGT A;  1KD7 A;  5IHR A;  1LEM A;  2R04 3;  1XYO A;  1MS3 A;  2ZX3 A;  4ITC A;  2HWE 1;  4XJ8 A;  4CVU A;  2UY9 A;  1X8M A;  4AG4 A;  1W2A X;  1VAM A;  2VBB A;  1VBE 2;  1ENR A;  2BWA A;  4CXX A;  3WNP A;  2VVF A;  3WCR A;  1WCS A;  3QLQ A;  4P5Y A;  1IQA A;  4NPR A;  3O1O A;  3J26 N;  5CKM A;  2LTN A;  1DGW A;  1NE6 A;  5D21 A;  1KRI A;  3PTY A;  2EXH A;  5IK7 A;  1COV 2;  3LEI A;  2XL9 A;  3WNO A;  4MGK E;  2R06 2;  4E4S A;  2QVS B;  1LU2 A;  3N7M A;  4MVT A;  4XXP A;  2AGS A;  1YQ5 A;  1GMM A;  2ETE A;  3LKJ A;  2WZP P;  1MS1 A;  1QJF A;  2P6C A;  2KXL A;  5FYS A;  2CTV A;  4LO5 B;  1RUD 1;  4Q4W 3;  3NJZ A;  4QPG B;  3UGH A;  4FPK A;  1GZW B;  4CXY A;  2WA4 A;  3VBO C;  5IVE A;  2YYO A;  4NUB A;  4ZU7 A;  1G9A A;  1URX A;  4Y1Z A;  4AFA A;  2BW8 A;  4IV3 C;  3N9O A;  2G1M A;  2CGP A;  5AC9 2;  2H0B A;  2RS3 2;  2BVV A;  3T1M A;  1GQP A;  1UQX A;  2VVD A;  2V4A A;  2ZJC A;  4JGY B;  4R52 A;  5FDB A;  5FQ0 A;  5KBF A;  2ZEY A;  3POB A;  2DUR A;  4QD2 A;  1HRV 3;  1W8W A;  2JG8 A;  2VQU A;  2VZT A;  4XW3 A;  2VUJ A;  4GMP 0;  4EN9 B;  4I0W B;  4IEZ A;  2OA2 A;  2R07 1;  2BEO A;  4BK5 A;  4RYD A;  4AHZ A;  2GN7 A;  1VR3 A;  3IDE A;  5LEJ A;  4YM2 A;  2VM9 A;  4NWW A;  4Q0V A;  5FZF A;  1EYB A;  2NZ9 A;  4D3W A;  1XB9 A;  2QZ2 A;  2K2S A;  5F3C A;  4CU9 A;  1POQ A;  1SFY A;  1ZM1 A;  4YPJ A;  2JG9 B;  3OJB A;  1IHM A;  1P8J A;  1UPI A;  4Q4X 2;  2Y6L A;  3MF6 A;  3RZJ A;  4DZG A;  2JKX A;  1C4R A;  2UWC A;  4CUC A;  5C70 A;  4LPL A;  1N47 A;  5HV0 A;  3OPT A;  5J48 A;  1H2N A;  5B4X A;  3AVS A;  1OA4 A;  4XEZ A;  1EP0 A;  3GBG A;  4IGQ A;  4YYO A;  2VUA A;  2Y6J A;  1NQD A;  2VQT A;  1V0A A;  3N9M A;  5C71 A;  3JCI A;  4OQ9 A;  5T5L A;  4QKN A;  1JOP A;  3K46 A;  2JDK A;  5FMB A;  4UFM A;  3OGG A;  4HKW A;  3KS7 A;  3SCH A;  4CDU A;  2Y0I A;  3VHO A;  5C33 A;  1XNK A;  4MLO A;  2WII B;  3THT A;  1QJY 2;  5LK5 A;  3AMN A;  2ZGL A;  3ZFF C;  1LGN A;  1ONA A;  1TMF 1;  4Q0Q A;  5FUP A;  5CFD C;  2VGD A;  1OLM A;  5ANN A;  1HB4 A;  1W04 A;  2JIG A;  4ZHN A;  1DGW X;  1XOY A;  3MW3 A;  1V6I A;  3O1R A;  2HJI A;  3POG A;  4S2H A;  5JSO A;  3RNS A;  1NE4 A;  2RS5 1;  5JI9 A;  3FC0 A;  2Q1Z B;  3BYW A;  1JOJ A;  1DQ1 A;  3JBG 2;  4XUP A;  3UT0 A;  3B69 A;  3MUZ 1;  1J3R A;  1H1A A;  5A7N A;  4BE3 A;  2GH2 A;  3HR9 A;  5F3I A;  3ZPY A;  3HBK A;  1RVF 2;  2JEM A;  1TZO A;  2YU1 A;  5IAT A;  2WAB A;  5GZC A;  2WYS A;  1LHV A;  2GZW A;  4LBL A;  1NCQ A;  3U1X A;  3ZFE B;  3WW2 A;  3F95 A;  3RZZ A;  5FZ4 A;  4CDQ B;  1K42 A;  1MZF A;  3GDB A;  3EMR A;  1AXK A;  3POS A;  1Y4W A;  3U4S A;  4B4P A;  4O65 A;  2FQP A;  4Y5T A;  1EAH 3;  3OYW B;  4PDW C;  4Y3O A;  4IGP A;  5A70 A;  5JDB A;  2D93 A;  1ZA4 A;  4B3N A;  5IK8 A;  2BGC A;  2XDV A;  3W21 A;  1ZX5 A;  1HJG A;  4IEU A;  2WIN B;  1XE8 A;  4TXW A;  1XRU A;  5A3T A;  4SBV A;  4A41 A;  5FJH A;  2W1Q A;  4LKD A;  1D4M 1;  1J3Q A;  4P02 B;  1H8T C;  3NJV A;  4XDQ A;  1OD3 A;  1W6N B;  1J59 A;  5BNN A;  4GA9 A;  4CSW A;  3K51 A;  2VW0 A;  2JDP A;  5KXE A;  2V5D A;  3FE5 A;  2O14 A;  1WA6 X;  1HQW A;  1N1S A;  4CP2 A;  4BPZ A;  1OLQ A;  4P9G A;  4LO4 B;  4SLI A;  1GP5 A;  1DQ4 A;  4UI9 L;  1GWM A;  1DLC A;  1UY4 A;  1WBL A;  2BUK A;  2L9L A;  3I2I A;  4M4R A;  5EPA A;  4D6S A;  1GNY A;  3MV0 1;  4QB6 A;  3VBR C;  4E4D X;  1FMD 1;  4UAP A;  2P3J A;  1ASJ 1;  1IPK A;  1VRH 3;  2X53 S;  5EQU A;  3LEG A;  4XIK A;  4UF0 B;  1W2N A;  4COZ A;  5KXD A;  2VZU A;  4M3C E;  1MZE A;  3NNM A;  4FOW A;  1VBA 2;  2SLI A;  1FNZ A;  4OUS A;  2C6S A;  4HG6 B;  1XBF A;  3O14 A;  2XJQ A;  4YW5 A;  5LRS A;  3WLU A;  1AJO A;  4EN8 B;  4LLO A;  1JTZ X;  4W50 A;  2BVB A;  1RUN A;  2Q5T A;  3LFI A;  1YHF A;  3BGA A;  4MGT A;  3N4M A;  4Y1V A;  5IW0 A;  3VZL A;  3T1L A;  3VKM A;  3LQC A;  3KMH A;  1PIV 3;  2LS6 A;  2E63 A;  1D2Q A;  4E8C A;  2RDS A;  1SG3 A;  4UXA A;  2H6C A;  2JIC A;  2QQO A;  3HNY M;  1LGC A;  1W8T A;  1MR5 A;  2TBV A;  1SCR A;  2ZTN A;  4JHT A;  1STM A;  3WP4 A;  1JYN A;  3BUC A;  1Y9Q A;  1CGP A;  2CL2 A;  3ES4 A;  5IK5 A;  2VH9 A;  5F2W A;  1RMU 1;  4LBJ A;  2BOJ A;  3H3U A;  2K0G A;  2VC9 A;  5BNP B;  1NLS A;  1ND2 B;  4NHX A;  1V9U 3;  1FYU A;  4FOY A;  3ILN A;  3VBR A;  3BPZ A;  1ENQ A;  1RUJ 2;  3PJQ A;  4DNY A;  1W8H A;  4CCL A;  2XBO 1;  4QM8 A;  3U14 A;  4MYE A;  3CIH A;  4I30 A;  2HWB 3;  4MGI E;  1FT9 A;  3BPS A;  4XQD A;  2RS1 2;  5F3E A;  3MIG A;  4LBQ D;  1Q8P A;  2VQ0 A;  4N53 C;  1JU3 A;  1PO1 1;  5F39 A;  2RE9 A;  4HN1 A;  2YBS A;  4TLG A;  1HQN A;  1WMX A;  1AR8 2;  3PVE A;  3ZFG C;  2JIJ A;  2RS3 1;  3BU7 A;  5H9P A;  3WY6 A;  2A70 A;  2F4P A;  1XU2 A;  1WW7 A;  4KH9 A;  5FYC A;  2J1T A;  2C4X A;  1GLH A;  1C8M 2;  2OUH A;  3PUR A;  3UET A;  1YIP A;  2ZGQ A;  3BVC A;  4IEO A;  2R07 2;  3BTY A;  4JC1 A;  4QXK A;  2ZGP A;  3POE A;  1MAC A;  3C7E A;  2DBN A;  2GAL A;  2VMD A;  2VZP A;  3G6J B;  4JQR A;  4Q4Y 3;  4RS5 A;  3T2Q A;  4AGR A;  3FL7 A;  1VBC 3;  1C8M 1;  2VPV A;  3ZFG A;  1KGY A;  2V5Y A;  3ZYR A;  3K2O A;  5C9A A;  1RB8 G;  3WNN A;  4YFZ A;  3OY8 A;  3RWN A;  1AXY A;  1PIV 2;  2UYB A;  3OUH A;  4PI0 A;  5J09 A;  3RZL A;  5GZG A;  3V0B B;  5LRR A;  4Y22 B;  1G8W A;  1LHO A;  1OPM A;  1ST8 A;  3LZZ A;  4H55 A;  1MVQ A;  2DUO A;  3E5Q A;  1ZRF A;  2XML A;  3P5B A;  5FY7 A;  3DUI A;  1OOP A;  2UWA A;  4HOO A;  1DP0 A;  4O61 A;  2DTW A;  1BEV 3;  5BNO C;  3VBS B;  3K48 A;  4FP3 A;  5C3R A;  5FYT A;  1QJU 3;  4BWO A;  5F5C A;  1CVN A;  3LSD A;  2IFW A;  3TRS B;  4AI3 A;  5C8C C;  2DTY A;  2RM2 1;  4ORF A;  5FZB A;  3I97 A;  1HRI 2;  2GMM A;  2UWB A;  3ZR5 A;  1FNY A;  4BCU A;  2Q30 A;  4JV4 A;  2RR1 2;  5DUW A;  1HX6 A;  1VB2 A;  4Z8B A;  1BEV 2;  2P4E A;  1GBG A;  4LIT A;  4RFR B;  4DOU A;  4QMA A;  2E26 A;  4E4H A;  4WV8 A;  4YNI A;  2QQV A;  3V0A B;  1IPJ A;  4WM7 B;  3H8X A;  2WBK A;  2RS5 2;  1OPO A;  4KI5 M;  1I1E A;  2FDI A;  3CF6 E;  1X50 A;  4W6Y A;  3ZYP A;  2ZX2 A;  5FZD A;  1PM7 A;  3ACI A;  4QGM A;  3VV1 A;  2R7E B;  4WM8 A;  1VBB 3;  1V6O A;  1I6X A;  5ABJ C;  1BK0 A;  4PIX A;  1RUI 2;  3T2P A;  1PMH X;  1XE7 A;  2C0Z A;  2FBE A;  2WO2 A;  3KB5 A;  4LNV A;  5EIY B;  1W99 A;  1BVV A;  3J7N A;  4YW2 A;  1WGP A;  3MBW A;  3KV6 A;  4HPK A;  3VDA A;  4DXZ A;  3CZU A;  2BOI A;  4QU2 A;  3GZA A;  3KVB A;  2WL1 A;  3PUI A;  1J1T A;  2J1S A;  1RJ7 A;  4QAW A;  2RDQ A;  3N35 A;  2EIE A;  2H6B A;  5JIU A;  4TN7 A;  1COV 1;  1N3Q A;  3K4A A;  1R08 3;  3VBH A;  4FFG A;  2E6V A;  2EAK A;  2WSV A;  3AP4 A;  2RDN A;  2HWF 3;  1G9D A;  3CMG A;  3N7J A;  4OUM A;  1CAV B;  2ZMK A;  2X5I C;  1FAY A;  4HK9 A;  4Q1R A;  3SH3 A;  4ATF A;  1PZ8 A;  1DQ2 A;  1RUD 3;  2ET7 A;  3JB4 C;  3AYE A;  2ZML A;  4GH4 C;  3Q8C A;  4CP9 A;  5C9A C;  3THC A;  4DIQ A;  2GU9 A;  3DEM A;  4NWV A;  3KGZ A;  3LA3 A;  1QOO A;  1TE1 B;  2ARB A;  3AC0 A;  4LA3 A;  1WLD A;  4KGQ A;  5APA A;  4YW1 A;  3ST7 A;  1HDK A;  4Q8L A;  2R1D A;  3HN1 A;  5J3U A;  2FMD A;  1UOJ A;  4FTE A;  3D5O A;  2XWJ B;  4PQ9 A;  4YZ3 A;  2CGN A;  1F15 A;  2LRO A;  4ZU5 A;  1SPP B;  3S5Q A;  4CEY B;  2GC3 A;  1S0E A;  3JZV A;  4NPM A;  5T5J A;  1OT5 A;  5DAX A;  4QPI A;  3ZN6 A;  5B2G B;  2VXJ A;  2IXK A;  1REF A;  1J84 A;  2W0X A;  2ZHK A;  4LLF A;  2IXL A;  2JDH A;  4LE4 A;  3AJZ A;  2WC2 A;  3GHN A;  5GLW A;  3VL8 A;  1JHJ A;  5TSW A;  2LAL A;  1T6G C;  1UYP A;  4GIQ A;  1HQL A;  4DY3 A;  4L2N A;  3RI8 A;  5C8C A;  2RS1 1;  5I0S A;  1G9C A;  5DN2 A;  2YRO A;  2A6Y A;  2ZAA A;  1GKB A;  4MHU A;  2NP0 A;  4BMB A;  5JOX A;  1XNA A;  3GCX A;  4GB3 2;  3ZN6 B;  1OI6 A;  3LD8 A;  4OLL A;  4NHY A;  3ZFG B;  2ADD A;  3NJX A;  4CE8 A;  2P3Y A;  1JUH A;  3OD0 A;  5IYY A;  1K12 A;  1ZBA 2;  4RS5 B;  5F32 A;  2GSY A;  3VBO B;  3WG3 A;  4C1W A;  4QX5 A;  1OVP A;  1LNS A;  1LEC A;  1DQ6 A;  4AWD A;  3NV2 A;  1BYH A;  3VBF B;  2IXH A;  4YW7 A;  1JXN A;  3MPB A;  2OII A;  4G9S B;  3VDC A;  2Y26 A;  2E31 A;  2BJS A;  5IWF A;  3WDW A;  1TMF 3;  1MS4 A;  4E8D A;  3I2H A;  1RHI 3;  3MYX A;  3QH7 A;  5EJ3 A;  2WSU A;  1WA4 A;  3RZM A;  4Q0P A;  3EYP A;  5FPA A;  2GAU A;  4HSJ A;  3AKP A;  3DCQ A;  3OBZ A;  3C7H A;  3B01 A;  2W94 A;  2JE9 A;  1ULC A;  5A3M A;  3MW2 A;  4OHZ A;  1ZRR A;  4BIO A;  2JKB A;  2X8K A;  3AVR A;  3N36 A;  4X6Q B;  1SLI A;  1X9P A;  2J22 A;  3R4S A;  4N43 A;  4XBL A;  4D7S A;  4RN5 A;  5DZF A;  2ZEZ A;  1NKG A;  1UXX X;  4V2V A;  3WHU A;  2X10 A;  5IFT A;  1UX6 A;  1DDL A;  2IC1 A;  5CU1 A;  4FBF A;  4LOR A;  1SEF A;  1EY2 A;  1VBA 3;  2QQK A;  3KM5 A;  4NJ4 A;  4XZU G;  3C7F A;  2WNU C;  1BMV 1;  4XJ9 A;  1D0G A;  2CAU A;  2DVG A;  4EYU A;  1OH3 A;  3NO8 A;  2F17 A;  4HVR A;  2NMO A;  4Q4V 3;  1X82 A;  5DAV A;  2G19 A;  3ACF A;  1BMV 2;  5HPO A;  3TEY A;  3MLJ A;  4MXW B;  1B35 C;  4E2G A;  2ZAH A;  3FHI B;  3HWJ A;  1C57 A;  3I7D A;  4XMA A;  5CB7 A;  2A3X A;  2P3K A;  2WNU A;  5FZG A;  1E5H A;  5FPB A;  4LBK A;  1PHM A;  4RHV 3;  2WFF 2;  3CNA A;  3KQR A;  4ISQ A;  4ZXE A;  1JU4 A;  1QKQ A;  4XJZ A;  3B9I A;  3IDB B;  5GZF A;  2OVU A;  1JHN A;  1O4Y A;  1ZRD A;  3AJY A;  2J1V A;  1NX9 A;  3BN6 A;  5FPL A;  2XR4 A;  1AUY A;  1JOD A;  4N43 C;  4Q4V 1;  1CIY A;  3KCX A;  5E1R A;  3BTX A;  1PX3 A;  2WT2 A;  2YUE A;  4LHN A;  4RR3 B;  4BQW A;  4CCN A;  2CSG A;  2W92 A;  4DPN A;  5J7M A;  2VZ3 A;  4QHZ A;  5FMD A;  1SBF A;  2CU5 A;  3AP6 A;  4MXV A;  5H9R A;  4QDS A;  3ZKY A;  1SQ4 A;  2A1X A;  2YGM A;  4HN0 A;  4JGZ A;  2HWC 3;  4TYS A;  1AR8 3;  1RMU 2;  1W0O A;  2D43 A;  3WZ1 A;  2BER A;  2PLV 1;  3WDY A;  2BGO A;  1TG7 A;  1YEW A;  1K5M B;  4LHL A;  1MEC 3;  1UL9 A;  5IVY A;  4B7E A;  3QBQ A;  4FPC A;  3WDX A;  2RJ2 A;  1VBD 3;  4E4Z A;  1I5P A;  3AZY A;  1PGW 1;  5C4W A;  4CDU C;  4CPB D;  5FR3 A;  2WDB A;  4CCE A;  4WBB A;  5CAD A;  4P5H A;  2EID A;  2HKX A;  3WW4 A;  4FPH A;  3OY8 B;  4IER A;  1VBE 1;  3FWE A;  2R06 1;  1UZZ A;  2XJS A;  3I2D A;  3IPV B;  1QH6 A;  3KZ4 C;  5FY5 A;  1Q8V A;  5FBZ A;  1UN1 A;  5C9A B;  1QQP 3;  5FOJ B;  1MEC 2;  3H0O A;  5KXB A;  2XPJ A;  2QBX A;  1FPN 2;  4BHP A;  3H1Y A;  1V9U 1;  1GNH A;  1FAT A;  1WD3 A;  4LA2 A;  4MGQ A;  1W6O B;  1PO1 2;  4YGC A;  2HWF 2;  5DG1 A;  1O4T A;  4XYX A;  1CAW B;  4QGN A;  1CR7 A;  1Y7B A;  2ZEX A;  1RXG A;  2HH9 A;  3NRU A;  4JTO A;  2VZV A;  5I91 A;  3USU A;  2WKK A;  3L9J T;  4AGV A;  3EHK A;  2QFE A;  3T2T A;  4CDX C;  5D8A B;  5LBB A;  1IKP A;  1GZW A;  2ORX A;  4XF4 A;  1L7L A;  4DUW A;  4LUK A;  2E51 A;  4O9G A;  1LOF A;  4YVS B;  1ENX A;  3GZU C;  3I3D A;  1RYY A;  5FPV A;  1WCU A;  3WNL A;  1HN0 A;  1EV1 2;  5L73 A;  3M4F A;  1OUR A;  5BV6 A;  3CJI A;  1O59 A;  1UZW A;  2R6Q A;  5JR7 B;  1AR6 1;  3FLR A;  4CYD A;  2ZZQ A;  2JDA A;  3MUY 1;  4Q8K A;  2IXC A;  3ORJ A;  3J9S A;  4IUG A;  2ZGK A;  4XUQ A;  4YGB A;  3O1P A;  4QX2 A;  2D6N A;  1MZ6 A;  1S2K A;  1U0A A;  1CES A;  5C3S A;  2TNF A;  5LWB A;  1JZ8 A;  2IVJ A;  4C91 A;  2QTW B;  5AC9 3;  2BRT A;  1RGS A;  2Z42 A;  5JXH A;  1Y9G A;  2VOT A;  3DXT A;  1ZRE A;  1UYX A;  3RS6 A;  3KVA A;  4OI1 A;  4D6Q A;  5BY5 A;  1CAU B;  1GZT A;  1XE0 A;  4CDW A;  3VD5 A;  4GAZ A;  3KQ4 B;  3TOJ A;  1Z78 A;  3VHR A;  3VDB A;  5FY9 A;  2X05 A;  3VKN A;  5FQ0 B;  4GZ9 A;  1TMF 2;  1RUI 1;  2BGP A;  4QXB A;  5FYI A;  1V6M A;  4QGL A;  2AEN A;  2VW2 A;  5FAX A;  5FY0 A;  1ULG A;  5F1R A;  1UMI A;  3UNP A;  3S57 A;  1H2L A;  2BDR A;  2WO3 A;  5E89 A;  1REE A;  3A0K A;  3HNM A;  2XJP A;  2HBU A;  2I2S A;  3V0A A;  4XCA A;  4JDN A;  1PX4 A;  3KWV A;  3OTF A;  2VNV A;  4JGZ C;  2QJV A;  1QJX 2;  3SXW A;  5CKQ A;  4B8E A;  2OQ6 A;  1BBT 3;  3GNE A;  5FZO A;  1HB1 A;  1VBB 1;  4JHZ A;  4KBB A;  4N53 A;  4UBH A;  1V00 A;  1US2 A;  1VIW B;  3LPG A;  3AXD A;  3UES A;  2X09 A;  4P08 A;  3VD7 A;  5FKC A;  5FZ0 A;  3UKN A;  5DAP A;  2ZA9 A;  4IV3 B;  5FWJ A;  5GM0 A;  2R07 3;  4WVV A;  1V6N A;  2J1E A;  3I49 A;  3ZN5 A;  1W9F A;  5FMC A;  5IAX A;  3NWK A;  3PJY A;  4E2Q A;  4GMP 1;  2QNK A;  4PBO A;  2ZBJ A;  1VB4 A;  3GM8 A;  1IS3 A;  3E5U A;  4FXG B;  1WLT A;  3UK9 A;  3RYP A;  1DZR A;  1Y9M A;  3VN4 A;  2Z2S B;  4Y22 A;  2K9Z A;  2ZAC A;  4HFS A;  1G9F A;  2PMW B;  3ZSM A;  1MPX A;  3FFQ A;  1E5I A;  1RJ8 A;  1X7N A;  2VZR A;  1W8N A;  2J42 A;  2BFU S;  4ZS3 A;  1Q8O A;  1PVC 2;  1OF3 A;  2W9X A;  3Q8F A;  3I3Q A;  4WVM A;  1ZNP A;  5C5U A;  4XAE A;  4XET A;  1SPP A;  3T3Y A;  4JKK A;  2JEC A;  3H8O A;  4A6S A;  1K5M C;  4L92 A;  2QQP A;  4XZP A;  1YFU A;  4Q4V 2;  5HBA A;  1NLQ A;  2WO7 A;  5FP8 A;  2WUH A;  1ACC A;  5LK7 B;  1MZ5 A;  4FFF A;  1DCS A;  4XVH A;  1DU3 D;  1RXF A;  2DUQ A;  4D94 A;  5C3O A;  2D6K A;  2PTM A;  4D69 A;  5LZ6 A;  3GAL A;  4KG0 A;  2JG8 C;  3HVD A;  3VBF A;  1H8T B;  5KC6 A;  1KDK A;  3W20 A;  1R08 2;  2D3S A;  2W68 A;  4EN6 B;  4NRM A;  2R16 A;  2VBP A;  2RJL A;  4ISR A;  4Q26 A;  3ZSE A;  1OVS A;  4DQA A;  2WS9 2;  2E32 A;  5AVA A;  2RS5 3;  2XBO 3;  1HW5 A;  4EWE A;  1WCQ A;  3HMY A;  1BHG A;  4XAB A;  5EFU A;  5F3G A;  3T08 A;  3VBR B;  3CLP A;  5BNN C;  3GHM A;  3KHC A;  1OHF A;  5A1F A;  2ZHN A;  4YWA A;  3C2U A;  1V6K A;  5EV7 A;  4K1Y A;  2ZGO A;  1GSL A;  4L11 A;  2Y64 A;  2FCV A;  1NA1 C;  1WCD J;  2KM2 A;  5J36 A;  4Q4Y 2;  3LAG A;  2B46 X;  3I59 A;  5C3P A;  5CEH A;  5LBE A;  5JPM B;  4DY5 A;  2EIB A;  3B00 A;  5A7Q A;  4YM3 A;  1JZ4 A;  1Q8Q A;  1UD1 A;  1HN1 A;  2XLA A;  4IEY A;  5CFC C;  1W90 A;  2GMP A;  4M3C B;  4S2F A;  4CEW B;  5J98 B;  1O4Z A;  4MGS A;  5AFE A;  3USS A;  3WD5 A;  1NA1 A;  1G6N A;  1BLZ A;  5IVF A;  2OT7 A;  2YV8 A;  1XNB A;  1UU5 A;  1UY3 A;  1H9W A;  2VD7 A;  4NPL A;  2Q8C A;  4AEK A;  1N1V A;  4N7U A;  4F3J A;  1SHW B;  5FLJ A;  3DKW A;  3PVB B;  5F2S A;  3H7Y A;  1JOB A;  1RIT A;  4HVO A;  5KHI A;  4R4Z A;  3AB0 A;  4JAA A;  1SLA A;  2Y33 A;  2ZOE B;  1F9K A;  4JKL A;  4QX1 A;  5A7W B;  5FZE A;  1C8M 3;  3AK0 A;  3WNK A;  4BQY A;  2HEW F;  1W6P A;  2CYF A;  4DUX A;  1VMH A;  5FZO B;  5IVB A;  1RUE 2;  2OQ7 A;  4PQQ A;  4V1P A;  1QJX 3;  5JZG B;  5T5P A;  3BAL A;  1OBN A;  1UW8 A;  2PHR A;  1W6N A;  2OPW A;  3IKW A;  4PDW B;  5SV8 A;  3BOW A;  4BM8 A;  4MGZ E;  4F8A A;  3OB8 A;  1VRB A;  3VGI A;  4NHL A;  2DF7 A;  1A3K A;  1DZT A;  2AEZ A;  3SEP A;  3VKL A;  4CP1 A;  3FX3 A;  4HLT A;  4OMC A;  3H3Z A;  1MS5 A;  2ZX4 A;  2V73 A;  3V0B A;  3O1U A;  2JE7 A;  1W8Z A;  1QOT A;  3VZN A;  1UY0 A;  4Q4X 3;  1KEX A;  5T54 A;  1QJX 1;  2BNM A;  4YZ4 A;  5A6Z A;  5K7P A;  5LA1 A;  5I0R A;  1XPW A;  4LBO A;  3ZYB A;  2E9Q A;  5BXX A;  3TEW A;  1NQJ A;  5LB6 A;  3MIC A;  4QB2 A;  3IB3 A;  2GDF A;  5DAW A;  3DN7 A;  3V64 A;  3ZXG A;  1RUH 2;  4ET7 A;  2DV9 A;  2JDN A;  1NCR B;  4JCK A;  4MUV A;  3ZSK A;  1S0J A;  1VBD 1;  4FOQ A;  5JOY A;  3KV5 A;  1YUD A;  4UWD A;  4JKM A;  4Y26 A;  5JAX A;  4AZZ A;  2PLV 2;  1BK1 A;  4NIG A;  2V72 A;  3BIE A;  2YU2 A;  1H8V A;  1PNG A;  1VBE 3;  4OI2 A;  4PT6 A;  1UPS A;  2VTX A;  4CUG A;  4JX0 A;  5D1I A;  5JCT A;  3OGJ A;  1RUH 3;  2D97 A;  3ABZ A;  2YC2 A;  5CYY A;  1A6C A;  5KHK A;  2JE8 A;  1T6B X;  3PL0 A;  4XFI A;  5HCB A;  3VBU A;  2HYX A;  3WF0 A;  3RYR A;  4CDX A;  1IS5 A;  2W3J A;  2VCB A;  5ACA 3;  2WAA A;  2HWF 1;  3WNX A;  4AEM A;  3VUO A;  1AYM 2;  5FK7 A;  1PVC 1;  5HXV A;  3VB9 A;  1AX2 A;  1XC6 A;  3HIF A;  2W5F A;  1H0B A;  3CZJ A;  1B35 B;  4WM7 C;  4GXL A;  5LAS A;  3RSJ A;  3UGG A;  3H3L A;  2V09 A;  2WQZ C;  4BIF A;  4PI2 A;  3VZK A;  2DUP A;  5E8A A;  1PZ9 A;  4AFC A;  4BXS V;  3IMM A;  4KWK A;  5DPN A;  2WQ4 A;  4A7Z A;  2VR4 A;  4K1Z A;  3KF3 A;  3NL1 A;  4XTM A;  1JYC A;  1N1T A;  4LQR A;  4M3C F;  1AHS A;  3Q8B A;  3RPQ A;  3AL5 A;  3MHZ A;  1U12 A;  2DWR A;  2JG9 A;  3ZYF A;  3UL2 A;  1RUO A;  2VEC A;  4QKF A;  3RZH A;  3Q8A A;  3WNM A;  5I8S A;  3LWC A;  3LPF A;  4AFM A;  4AQT A;  2P37 A;  4CCC A;  4HAN A;  1JYI A;  2WWU A;  1WW4 A;  3VKF C;  1F35 A;  2RG4 A;  2VBD A;  4RGA A;  2Q8E A;  1Q56 A;  1O3T A;  4FPY A;  1OD5 A;  3SC7 X;  4I0A A;  1RUD 2;  4YZ1 A;  2XVK A;  1HJF A;  4W6X A;  3I8T A;  5FMO S;  4MGY E;  5IVC A;  2E33 A;  1X36 A;  1CX4 A;  5K4L A;  1W9T A;  5A32 A;  3WVJ A;  2QQN A;  4I01 A;  5I8T A;  4HXC A;  4I02 A;  4PF1 A;  1CD3 G;  3S7E A;  4A6O A;  2HLE A;  4KU7 A;  3WCS A;  4NIH A;  4W65 A;  2ARX A;  1GUI A;  1YO8 A;  1LOE A;  1VAV A;  4L97 A;  2V4V A;  2W87 A;  3HQU A;  3T0B A;  4UFI A;  1SBE A;  1JN2 P;  2GP3 A;  3IM0 A;  5BPX A;  1HB3 A;  5GZE A;  2VME A;  2FDK A;  4CEW C;  1I9R A;  4XC9 A;  3D6E A;  2H0V A;  2A73 B;  4PLO A;  1AYM 3;  1W9W A;  4XTP A;  1X33 A;  3T4V A;  3RMY A;  3SHR A;  1QU0 A;  3JBG 1;  2LRP A;  3MLL A;  1L7R A;  3IBM A;  3ZYG A;  4AVV A;  5L9V A;  4I0B A;  5BYN A;  1ZZ9 A;  2YG0 A;  4JZR A;  2TEP A;  3VBS C;  3ZOI A;  4A42 A;  1GNZ A;  5FYV A;  4LKF A;  2J1U A;  2WN3 A;  3EB7 A;  5FZ6 A;  3AKQ A;  4AED A;  2ARE A;  3X29 B;  1RUG 3;  2UY8 A;  1RUC 2;  3PDQ A;  4AXO A;  3QCW A;  5J1X A;  2P2K A;  1ZBA 1;  1GR3 A;  3ZFE C;  1CAX B;  2W47 A;  4K6B A;  1BBT 1;  3I2J A;  3DPR A;  1LR5 A;  5JWP A;  1LCL A;  3ROU A;  2VCA A;  2WT1 A;  3FHQ A;  4QB1 A;  1RHI 1;  3J7H A;  2AEY A;  3UV9 A;  2XG3 A;  2ZGN A;  4I09 A;  3ZMO A;  3NQH A;  3A7Q A;  1JYX A;  1S2B A;  5KXC A;  5F5Q A;  4FAG A;  2YY1 A;  3JD7 3;  4L0P A;  3HOB A;  3OBT A;  3P6B A;  3HBZ A;  4A44 A;  1AR7 2;  3IN9 A;  1OC1 A;  4H2A A;  1ZVF A;  1RHI 2;  4PBP A;  3VHN A;  3RYK A;  5C6C A;  3N7L A;  2R32 A;  4LBN A;  3L2H A;  2XQX A;  3IZO A;  1QJU 2;  3MDP A;  1BKZ A;  4XXA A;  4EZH A;  5A80 A;  5F37 A;  3C7O A;  2DU1 A;  4BIS A;  5EJ1 B;  4QPW A;  5JZG A;  1PGL 2;  1UZY A;  3LF7 A;  2Y34 A;  5GKA C;  4ZY9 A;  1OUX A;  3FFZ A;  3IDC B;  4FPO B;  3V56 A;  1R64 A;  4YM0 A;  4YLZ A;  5AVP A;  5F5I A;  2BZD A;  1FOD 1;  3PUH A;  3O12 A;  2WNV C;  4YW4 A;  4ZU4 A;  2W46 A;  1LEN A;  4H3W A;  1U5I A;  1ND3 A;  2DU0 A;  3POY A;  4HET A;  3KD4 A;  5FY1 A;  1O3S A;  2FDJ A;  3B94 A;  3LIH A;  4UFL A;  2WFP A;  3INA A;  3W59 A;  4DIN B;  2VMF A;  4AQ6 A;  1UF2 C;  5CKN A;  1YI9 A;  4LMF A;  4NR1 A;  3AL6 A;  1ZZC A;  4PF5 A;  4X8N A;  3RDI A;  2CAV A;  4BQ1 A;  1RUG 2;  3EO6 A;  4XQ4 A;  3SCF A;  4BK4 A;  4DXS A;  2HYK A;  2Q8O A;  3MI8 A;  4B29 A;  2A5Z A;  2A3W A;  3IAQ A;  4HVQ A;  2WFF 1;  4KU8 A;  3LDB A;  1UY1 A;  2ARC A;  1YQC A;  3R4D B;  1AR9 1;  4OHX A;  2HBT A;  1OQ1 A;  4Z2A A;  4V2W A;  3MFC A;  2PQQ A;  1PO1 3;  5FZC A;  3HT1 A;  1DBN A;  3ME2 A;  1K5J A;  4K20 A;  4RS5 C;  3TBD A;  1AR9 2;  3JD7 2;  4UFK A;  3WF3 A;  3WR0 A;  3WV6 A;  3M7A A;  4QDQ A;  2B4K A;  4BOW A;  1XSQ A;  1OH4 A;  4Z92 B;  2W1W A;  2GC0 A;  4YVW A;  5FYM A;  1AL2 3;  1YQ6 A;  4MH0 E;  3LDR A;  3FBY A;  4NO4 A;  2JD9 A;  2XUE A;  3PVN A;  1YIF A;  1RUJ 3;  1NYW A;  4IXL A;  3OSD A;  4AHW A;  1OQE A;  4KG8 A;  1GP4 A;  1VPH A;  2D5F A;  1APN A;  4IV3 A;  1FV3 A;  1FPN 1;  2HWE 3;  4QX3 A;  2QQW A;  1TVG A;  1AX0 A;  1AR9 3;  3H42 B;  1ULF A;  2X5I A;  3SQO A;  4N53 B;  3MF9 A;  3M3O A;  5A6Q A;  1CX1 A;  4Y5Z 0;  3ZIW A;  1S0B A;  3AZZ A;  1POV 0;  2DVD A;  4OUE A;  3K4D A;  3WQ1 A;  3ZXF A;  3BI3 A;  3RG0 A;  3LOI A;  4XFB A;  1UYY A;  3AP7 A;  3ILR A;  4OFG A;  1QXR A;  1AL2 1;  1E5R A;  3O5S A;  1SCS A;  4BZ4 A;  4NRO A;  5DUX A;  1N3P A;  4QQP A;  3NAP C;  2P3I A;  5FYB A;  5K0U B;  3GXU A; 
#chains in the Genus database with same CATH homology
 2YFU A;  2W1U A;  2WDB A;  2RV9 A;  2EID A;  4MO3 M;  3I3E A;  2WAO A;  3VD3 A;  3I3B A;  2VL4 A;  4W4Z A;  2B9V A;  2VMC A;  2QBX A;  3WF2 A;  4UOJ A;  3IDA A;  4DUV A;  4MGQ A;  3C8X A;  5IHR A;  2ZEX A;  2QQJ A;  4CVU A;  2OKX A;  3NRU A;  2Y6H A;  4AG4 A;  1NUK A;  2VZV A;  2WZE A;  2WO1 A;  1PMJ X;  2XOM A;  3WNP A;  4P5Y A;  3U37 A;  2ORX A;  3LEI A;  4DUW A;  3WNO A;  1CZT A;  5EJZ B;  3I3D A;  1RYY A;  3WNL A;  1GMM A;  1O59 A;  1DYO A;  2VCC A;  2C26 A;  2JDA A;  3MUY 1;  4D0Q A;  1GQP A;  4IUG A;  4XUQ A;  3HPN A;  2ZEY A;  4QX2 A;  5IFP A;  4A4A A;  2VQU A;  3ETP A;  2VZT A;  4DEQ A;  2VJX A;  1JZ8 A;  4BK5 A;  4RYD A;  1W0N A;  1JYW A;  2VM9 A;  5JXH A;  3K75 B;  2ID4 A;  2VOT A;  4MOA A;  1UYX A;  4MAD A;  2DDU A;  2WQ8 A;  4CU9 A;  4YPJ A;  3VD5 A;  4TTG A;  1GOG A;  1P8J A;  2Y6L A;  3VDB A;  2JKX A;  2X05 A;  4CUC A;  4GZ9 A;  5C70 A;  2BGP A;  4LPL A;  3UNP A;  1UMI A;  5B4X A;  2WO3 A;  2KD7 A;  1UY2 A;  1NAE A;  3HNM A;  2Y6J A;  5C71 A;  2VQT A;  1XNT A;  2ZXQ A;  2Z4F A;  1PX4 A;  3T0D A;  2XHN A;  3K46 A;  1W9S A;  4JHZ A;  4XUR A;  1US2 A;  3LPG A;  5C7G A;  3UES A;  2X09 A;  4P08 A;  3VD7 A;  2J1E A;  3OG2 A;  4KWU A;  4XUP A;  4DEV A;  3HEI A;  3GM8 A;  3MUZ 1;  3P1I A;  3ACG A;  1JZ2 A;  2WAB A;  3DEC A;  2WYS A;  5DMY A;  1K42 A;  1MPX A;  3GDB A;  3WF4 A;  2VZR A;  1W8N A;  1OF3 A;  2W9X A;  5G05 L;  2CDP A;  4XUN A;  2VZQ A;  4JKK A;  3OBA A;  4TXW A;  2WUH A;  2YB7 A;  4CU7 A;  4XVH A;  4A41 A;  2W1Q A;  1JZ3 A;  4P02 B;  3NJV A;  5JXI A;  1OD3 A;  2WN2 A;  4A3Z A;  2V5D A;  1GU3 A;  3OEB A;  2E32 A;  2CDO A;  4UI9 L;  3OEA A;  1DLC A;  1UY4 A;  1WCQ A;  2L9L A;  3I2I A;  4D8M A;  4M4R A;  4ZZ8 A;  1BHG A;  1GNY A;  3MV0 1;  4QB6 A;  5JMO A;  4UAP A;  3T08 A;  4CUB A;  3LEG A;  3III A;  5DQ0 A;  2VZU A;  2Y64 A;  1SDD B;  4HG6 B;  4QX0 A;  4W50 A;  2EIB A;  3SKV A;  1JZ4 A;  3BGA A;  3WSO A;  1HN1 A;  3LQC A;  2LS6 A;  4E8C A;  4MGS A;  4CU8 A;  1SG3 A;  2PQS A;  2QQO A;  3HNY M;  3WF1 A;  1UY3 A;  3HNB M;  3OGS A;  1SHW B;  2VC9 A;  3W5N A;  1JI6 A;  3THD A;  5IJR A;  2ORZ A;  1K3I A;  2QQL A;  3ZM8 A;  3JXS A;  4JKL A;  1ULO A;  4QX1 A;  3CIH A;  1UXZ A;  3WNK A;  3VD9 A;  4DUX A;  4FI9 A;  1JU3 A;  4PQQ A;  4A45 A;  1K45 A;  4KMQ A;  2YC4 A;  3OB8 A;  2J1T A;  4OYU A;  2C4X A;  1F4H A;  3UET A;  3SEP A;  5LA0 A;  4OMC A;  3C7E A;  3T2Q A;  2VMD A;  2VZP A;  2VZO A;  3FHA A;  3FL7 A;  1KGY A;  3I2F A;  3WNN A;  2Y6G A;  1UY0 A;  1KEX A;  5LA1 A;  1XPW A;  3I2K A;  4QB2 A;  3IB3 A;  1UX7 A;  1US3 A;  4ET7 A;  4XUO A;  1EUT A;  5FUI A;  1DP0 A;  1IQD C;  5CZK A;  4JKM A;  1CZS A;  2V72 A;  4PT6 A;  3WEZ A;  3F2Z A;  4JX0 A;  3C7G A;  3I97 A;  3ABZ A;  2YC2 A;  5CYY A;  2JE8 A;  2WZ8 A;  3WF0 A;  2HYX A;  2W3J A;  1ULP A;  2VCB A;  2WAA A;  2E26 A;  3K77 A;  2EIC A;  2WBK A;  1XC6 A;  2W5F A;  3MO4 A;  3CQO A;  3CZJ A;  4GWI A;  4KI5 M;  4LHS A;  4P00 B;  4BXS V;  2DCK A;  3ACI A;  5DPN A;  2R7E B;  2VR4 A;  4LQR A;  3WQB A;  3A22 A;  3DYM A;  4QDR A;  1PMH X;  3T2P A;  2WO2 A;  2C9K A;  3WNM A;  5EIY B;  1W99 A;  3LPF A;  3OGV A;  1OF4 A;  4ZZ5 A;  3MBW A;  3VDA A;  3CZU A;  3A23 A;  3PUI A;  2J1S A;  4GWJ A;  4QAW A;  2EIE A;  2E33 A;  1W9T A;  3D3A A;  2QQN A;  3IAP A;  3K4A A;  1F4A A;  1WKY A;  4PF1 A;  4A6O A;  2HLE A;  3CMG A;  5I0D A;  4M4P A;  3OGR A;  2W1S A;  1GUI A;  3E1F 1;  4LKS A;  3DYO A;  3THC A;  1UZ0 A;  2V4V A;  2W87 A;  3ECQ A;  3T0B A;  2VZ1 A;  2YFZ A;  3AC0 A;  3HJR A;  2VME A;  5A1A A;  5JR2 A;  4OMD A;  1W9W A;  1L7R A;  2YG0 A;  4A42 A;  1OT5 A;  4QX3 A;  2VTF A;  1J84 A;  2J1U A;  2WN3 A;  3EB7 A;  4AAX A;  2QQM A;  5JXG A;  1JZ6 A;  5G04 L;  1JHJ A;  1EUU A;  2Y8K A;  5J1X A;  2J1A A;  3K4Z A;  3DYP A;  2W47 A;  5DN2 A;  3I2J A;  3SKJ E;  5JXJ A;  3CDZ B;  4ARY A;  2VCA A;  3ACH A;  3FHQ A;  4QB1 A;  1XNA A;  1UWW A;  3J7H A;  1JYX A;  5B4N A;  3NQH A;  3A7Q A;  3I2G A;  4CUA A;  4XUT A;  3NJX A;  4L0P A;  3HOB A;  4A44 A;  3P6B A;  5IYY A;  1JZ7 A;  1K12 A;  1YQ2 A;  3HN3 A;  1LNS A;  2RVA A;  2XQX A;  1JYN A;  3NNG A;  3C7O A;  3LE0 A;  5EJ1 B;  3VDC A;  2E31 A;  2J1R A;  2W95 A;  4QPW A;  4ZY9 A;  2VZS A;  4E8D A;  3I2H A;  3CKH A;  1R64 A;  2BZD A;  3VD4 A;  3SEE A;  3EYP A;  3PUH A;  3MV1 1;  2W46 A;  2VO5 A;  3C7H A;  5HXM A;  1D7P M;  2W94 A;  3A21 A;  2J22 A;  2VMF A;  3GGL A;  4RN5 A;  2ZEZ A;  1UXX X;  1NKG A;  3W5M A;  5IFT A;  2X10 A;  3T2O A;  3T09 A;  2QQI A;  1UYZ A;  4XZU G;  1J83 A;  2QQK A;  3C7F A;  1JYV A;  2ZEW A;  4BK4 A;  4DXS A;  2Y6K A;  4W8J A;  3IAQ A;  1GOH A;  1H6Y A;  2BBA A;  3LEK A;  1UY1 A;  3FN9 A;  3ACF A;  5F7U A;  5HPO A;  4Z2A A;  1O8P A;  5LA2 A;  2J7M A;  4OZO A;  3WF3 A;  4BDV B;  4QDQ A;  2B4K A;  1OH4 A;  2W1W A;  4ZXE A;  1JU4 A;  4DXR A;  1GOF A;  2JD9 A;  2LW8 A;  2J1V A;  1NX9 A;  3T0A A;  3BN6 A;  5JUV A;  2DCJ A;  1H6X A;  1CIY A;  1TVG A;  1PX3 A;  1L7Q A;  4ARX A;  4DXT A;  2W91 A;  1CX1 A;  1JZ5 A;  2W92 A;  2VZ3 A;  4OUE A;  4QDS A;  4BJ0 A;  3K4D A;  4CU6 A;  1W8O A;  1UYY A;  2BER A;  2BGO A;  1TG7 A;  1UMH A;  1O8S A;  1CZV A;  1T2X A;  2RJ2 A;  1I5P A;  5LCW L;  3GXU A;  2XON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...