2R043

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 38
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r04300
1RUI2 3VBSA 2RM23 1M06G 5DDJ3 2PLV2 4QPGA 1Z7S1 4CDWB 5A32A 5BNOB 4RHV1 1DDLA 1TMF1 1NCRB 4N43C 4CEYC 4YVWB 4SBVA 1HQNA 1VBC1 4JGZB 2QQPA 1RUJ2 4Y5Z0 1HXS2 1ND2B 4IV1C 2X5IA 2R061 1NCQC 3ZFEA 2DF7A 2Y26A 5LK7B 5BNNA 1B35C 1QJZA 1RUI1 2RS33 1R081 1PO23 2WZR3 3VBOB 5D8AC 1PIV1 4CDWA 5BNOA 2HWE1 2RS53 1ZBA1 1NCRA 4YVWA 2ZAHA 4RR3B 1HXS1 4WM8B 1PO11 4YVSC 4JGZA 1RUE3 3TN91 1R1A3 1ND2A 3NAPC 2RM21 5DDJ1 1MQTC 5BNPC 1AR63 2RS13 2BFUL 1PGL2 2RS52 3VBOA 4AEDC 2ZTNA 1K5MC 1ASJ3 1D4M3 2RMU3 1VBD3 4IV1B 5FOJB 2R073 3VBFC 1IHMA 1C8NA 1B35B 3CJIC 1R1A2 4RR3A 2GH8A 4WM8A 3ZFFB 1HRI2 1FOD3 2RS31 1BEV3 1PO21 4CDUC 1C8M3 2WZR1 1AR62 5J96B 2RS51 1VBA1 4Z92B 2HWC2 2HWB3 1RUG2 5CFCC 4Q4V3 4IV1A 1RUF3 1VRH2 1X36A 1RUE1 3NAPB 1RUH3 1MQTB 1R1A1 1AR82 1B35A 3ZFFA 1QJU2 5FMOL 1QJX3 4AEDB 1AR61 1RUC3 1K5MB 2RS11 3VBFB 2HWB2 1ASJ1 1D4M1 2RMU1 1VBD1 1HRV2 2R071 2PLV3 2MEV2 1VBB3 4IV3C 1RHI2 5JZGC 1V9U3 1TME2 3NAPA 4CEWC 1OOPC 1VB4A 4CDUB 1MQTA 4WM7C 1COV2 1FOD1 1BEV1 1RUD3 1C8M1 1RUJ3 3FBMA 1BBT2 4RS5C 4AEDA 3JD72 1AYM3 5CFCB 1K5MA 1FMD2 2HWB1 3VBFA 2XPJA 4Q4V1 1VBB2 1RUF1 2WLPA 4N53B 5C8CC 1RUH1 1AR92 1V9U2 2IZWA 1WCDJ 1H8TC 1QJX1 4CDUA 1RUD2 1NA1B 1RUC1 4JGYC 1AYM2 1EAH2 3S6PA 1R092 4NWWA 3VBRC 4IV3B 5C4WC 1W39A 5CFCA 1CJDA 2XBO3 3DPRC 2PLV1 3VDDC 1VBB1 2WFF2 4N53A 1V9U1 4RS5B 4RQPC 1RUD1 1RUJ1 2R043 1NA1A 1AYM1 1HRI3 5GKAC 5K0UC 2XBO2 2TBVA 4N43B 4CEYB 4IV3A 2WS92 1EV12 4LLFA 4GMP3 3VBHC 2HWC3 1NCQB 1RUG3 4RS5A 5AC92 2R042 4Y4YA 1VRH3 5C4WB 3DPRB 1AL22 1RMU3 1AR83 5D8AB 2XBO1 5L7OC 1QJU3 1PVC2 4N43A 4RQPB 4CEYA 1PGL1 2HWD2 3VBUC 2GSYA 4GH4C 1SMVA 4GB32 2HWF2 1BMV2 4YVSB 1HRV3 5ACA2 4QPGC 3JB8A 4Q4W3 3IDEA 2MEV3 2R041 1NCQA 1RHI3 2FZ1A 1RMU2 3VBRA 5BNPB 1ZBE3 5C4WA 1HRI1 1TME3 3DPRA 4QPIC 1COV3 1PGW2 4Q4X2 1VBE3 5D8AA 1CD3G 1BBT3 1OHFA 4GMP1 3JD73 4RQPA 1VB2A 1FMD3 1NG0A 2HWC1 3CJIB 4Q4W2 1RUG1 1FPN2 4YVSA 5ABJC 1VRH1 4CDWC 4Q4Y2 1ZBE2 1AR93 1AUYA 1RMU1 4GMP0 1AR81 1F2NA 4YVWC 5BNPA 1AYN2 4CDXC 1QJU1 1VBE2 3VBUB 1VAKA 4PDWC 3ZFGC 1EAH3 2BUKA 1RVF2 3JBG2 1R093 4RFT0 1RB8G 1HRV1 1HX6A 1NY72 4Q4W1 3J8F3 2MEV1 4RHV2 3CJIA 2VQ0A 2WFF3 4NWVA 1RHI1 4QPIB 1AL0G 1AR73 1TME1 1COV1 2WWSA 1VBE1 2R062 1BBT1 3M8LA 3VBUA 3ZXAC 3JD71 2BBVA 1FMD1 5ABJB 1R082 3J8F2 2FZ2A 5JZGB 1NY71 2BPA2 1PIV2 2WS93 4CEWB 1OOPB 1EV13 4WM7B 2HWE2 1AR91 1ZBA2 1AR72 4CDXB 4QPIA 1PO12 4PDWB 5C9AC 3ZFGB 3TN92 5AC93 1NOVA 1EAH1 1R091 2RM22 1AL23 5DDJ2 2BFUS 5C8CB 3ZFFC 4FTEA 3J8F1 5ABJA 1F8VA 1PVC3 2WFF1 5JZGA 1QQP3 1H8TB 1OOPA 1VBA3 1AR71 2HWD3 4CEWA 4WM7A 4GB33 2HWF3 4CDXA 4JGYB 5ACA3 3VBRB 4FSJA 4PDWA 3ZFGA 3JB4C 4CDQC 3VDDB 2RS32 5CFDC 1PO22 1POV3 2WZR2 2ZZQA 2RR13 1MEC3 4Q4X3 5C8CA 2WS91 1EV11 1QQP2 1VBA2 4FTSA 1ND3C 1X33A 5C9AB 5J98B 5A33B 4BCUA 3VBSC 1H8TA 3HAGA 1RUE2 5AC91 1FPN3 4JGYA 5K0UB 5FMOS 4Q4Y3 1AL21 2RR12 1MEC2 1AYN3 1QJY3 3VDDA 2RS12 1PVC1 2X5IC 1A6CA 3VBHB 1QQP1 3ZFEC 1ASJ2 1D4M2 2HWD1 1VBD2 2RMU2 5BNNC 2R072 1RVF3 3JBG3 1OPOA 4GB31 2HWF1 1BMV1 5C9AA 1Z7S3 5A33A 5ACA1 4CDQB 4RHV3 1TMF3 1GFF2 5BNOC 4N53C 5CFDB 1VBC3 1FOD2 5K0UA 5L7OB 1BEV2 1NCRC 1C8M2 1POV1 1QJY2 1PGW1 4FTBA 2RR11 1MEC1 4Q4X1 1ND3B 4GH4B 2R063 4JGZC 3VBSB 1NA1C 1ND2C 4QPGB 5A32B 3VBHA 1RUI3 4Q4V2 1Z7S2 1RUF2 1POV0 1R083 1RUH2 1E57A 1FPN1 1TMF2 1PIV3 4CDQA 2HWE3 4Q4Y1 1ZBE1 1VBC2 3VBOC 1ZBA3 5CFDA 1QJX2 2X5IB 1AYN1 1QJY1 1RUC2 3ZFEB 5L7OA 1HXS3 1PO13 5BNNB 3LOBA 3TN93 1ND3A 4RR3C 4WM8C 4EJRA 4GH4A 1RVF1 3JBG1
chains in the Genus database with same CATH superfamily
3VBSA 3LSDA 2AYHA 2E6VA 1M06G 1PNFA 2PLV2 3DKQA 5LY2A 3TNPB 3THDA 2BQPA 2JDUA 4NAOA 4AI1A 2I74A 1O8PA 3LFIA 3UK9A 2VOTA 3H7JA 1A8DA 5GZEA 1UY4A 4XABA 2XLGA 2PELA 3N9LA 3WDUA 3USUB 4FQ4A 4NIGA 3OUIA 4SBVA 2PAMA 1P8JA 1H1IA 4UT5A 3CU7A 5FXXA 4AWDA 2JDPA 2W08A 4YGCA 2LUWA 1S1AA 4I02A 2P4EA 4HPKB 4AG4A 5LWBA 2R061 4W4ZA 3HPNA 3WP4A 3SITA 1QEXA 2OX0A 3AL6A 3BOPA 5K8SA 5FZLA 1JH5A 1WA4A 5AFBA 3E97A 2XJPA 5FFOC 5I0SA 1TG7A 1QOTA 5FZEA 1PO23 4KMQA 5D8AC 1OSGA 2EICA 4P9XA 1PIV1 4CCEA 2BP6A 5JCTA 2HWE1 2E33A 2RS53 2RJLA 1JYXA 1NCRA 3G6JB 1XE0A 4CP1A 1U5XA 4K8RB 1ZRCA 1VR3A 4B29A 2IXJA 4ES9A 3AFGA 2WWJA 1ZZBA 3LGRA 2ZGRA 4JGZA 3VKNA 3TN91 4DO0A 1ND2A 1OH4A 2DVAA 4K40A 2G1MA 2VNVA 1MS3A 2YHJA 4BMBA 3NAPC 3KV6A 5C71A 4E8CA 2OT7A 4XUNA 1KDMA 3A7QA 1PZ8A 2DTYA 4PI0A 4XJ8A 4GWJA 4RGGA 3D0SA 1UCXA 2A5ZA 4GJYA 5LRSA 1PGL2 1WW7A 2FDHA 3OGRA 3VD5A 2RS52 3VBOA 5F37A 1W2TA 3B02A 4LMFA 2XHKA 1K5MC 2RMU3 1D4M3 3FE5A 1VBD3 1UZWA 3LDBA 1DGWX 4L9BA 2YUEA 4BYYA 1WD4A 2PA7A 4OHXA 3P3PA 2BGPA 4ZPIA 5I91A 4Y4RA 1H1AA 5KR7A 1VIWB 2W94A 1O8SA 3CJIC 2I2SA 1SLBA 3ZYJB 3H8RA 3I4IA 2QQUA 1HRI2 3UGGA 4J1XA 5FYSA 2OPWA 3MIEA 2WDBA 3OTFA 4KH9A 1PO21 4CDUC 5J96B 3AK0A 2CGOA 3VKFC 3WNPA 2JB8A 4Q26A 2RS51 3OF1A 3WNLA 1VBA1 1QF3A 5F5QA 3U11A 2VULA 1W6PB 1UPIA 2VZVA 4IV1A 1RUF3 4QKDA 2C5DA 2IUWA 1VRH2 1X36A 3U14A 3NAPB 4Y20A 1XOYA 2ZGQA 4I0WB 1RUH3 5EQUA 5FJHA 4CXYA 2Q1FA 3OGSA 2QQJA 4HK8A 4FOWA 1W6OB 4M3CF 1BCXA 3PUIA 4CCNA 5ISLA 2R1DA 5FMOL 5C3PA 4NR1A 4YG6A 1CIWA 1ENSA 2OXBA 4YW3A 1K5MB 4ARXA 3C2UA 4F7ZA 1I9RA 4R8HA 1IPJA 3TNQA 5JVVA 3OEBA 3WNNA 2RMU1 1D4M1 1VBD1 1HRV2 1UYPA 4YG3A 4I09A 5FMCA 1DG6A 5JLVA 2GNTA 1QKQA 1DGRN 3IDBB 3VZKA 4D6QA 1YQ8A 1RHI2 5ANNA 5IHRA 2AH2A 3MUY1 1JOBA 5JZGC 3QLQA 5K7PA 4Y1ZA 2YY1A 2ERFA 1RJ8A 5FUNA 2QQMA 4CDUB 1MQTA 3A21A 2FHRA 2PTMA 2WO3A 1DIWA 1L7LA 4TLGA 4AOCA 5LEJA 3ZN6B 3BCWA 4DXTA 1WUVA 4H55A 3B94A 2W0XA 3WQBA 1ENQA 4GQ7A 3JXSA 3O14A 4NPMA 5FZ0A 4Q2FA 4AEDA 1UF2C 3JD72 4AI2A 1AYM3 5CKNA 4QHBA 1IS3A 1HLCA 4XJUA 3VBFA 2XPJA 2BYVE 1IQAA 2V5DA 3C7GA 4H3WA 3MZHA 3QH7A 1RUF1 2XUEA 2W47A 4ZY9A 5GZDA 2YBPA 1RUH1 4BHPA 4LBOA 2DUPA 3B5LB 3E6BA 5T55A 4NHMA 2OQ6A 4FQZA 1W90A 3PVOA 1ENXA 3AP6A 2P5BA 2GMEA 5E6HA 2Y64A 4META 4M00A 1DZQA 4NJ4A 1AYM2 1EAH2 1W9YA 1GNHA 4GWNA 5BNQA 1QU0A 3MI8A 1W39A 2WAOA 4N7IA 3KQ4B 1LGCA 3DPRC 3IDCB 4ZXKA 4BDVB 1J3PA 3BODA 3VDDC 5IATA 2WFF2 3AP9A 4PLOA 1RL3A 4D7YA 3POEA 3KV4A 4FT8A 1AVBA 3NJVA 4N53A 3S5AA 5F39A 5DAXA 2BW8A 1GOGA 4OUMA 1W3VA 2P6CA 3LA7A 4O9GA 4ES8A 2XHNA 3HIFA 4OVEA 1ULEA 1WA6X 2OA2A 4S2HA 1ZZ9A 1AYM1 1X50A 3AZYA 2DCTA 4Q27A 2Q8CA 2WNUC 2XLFA 4RN5A 1PVXA 4WVWA 1PK6A 1QH7A 3VZJA 3WCSA 2VM9A 4PI2A 1CIYA 4AAXA 2P2KA 4N43B 2ZX1A 3Q8AA 4E4ZA 3KM5A 1N3PA 3HQRA 2Z2SB 5LA0A 2CL2A 3DGTA 3OPTA 2RDRA 1JHJA 3NV4A 3I2DA 4XBQA 2BRTA 4GMP3 1OT5A 1YFYA 3AZVA 2BVBA 3VBHC 3CMGA 1OD5A 4LJHA 4QX8A 3FN9A 4BE3A 4RS5A 5AC92 3H8XA 1CAVA 3KT1A 1KS5A 3DYMA 5JOYA 3M3CA 3MIDA 3S0MA 3DPRB 3FHAA 1RMU3 1Y7BA 1PMJX 1O4ZA 3T2TA 2ZGMA 3I3DA 4HSJA 3D6EA 5L7OC 1EYBA 2DCZA 4RA0A 5FY8A 3RS6A 2VUDA 4LQRA 4LUKA 1OPMA 5JR2A 4XFAA 3ETQA 4J25A 1AXZA 2JG9A 2P3YA 4GA9A 3ZOIA 1CAUA 5C7GA 4GH4C 5LBEA 1SMVA 1BMV2 1SCSA 1DBNA 1YJLA 4QPGC 3POBA 4INDA 3WNKA 1DZRA 4COWA 3K4AA 1OLME 2FZ1A 3WW1A 4A3ZA 1RMU2 4SLIA 2DU0A 3MIBA 1ZBE3 4KI5M 5C4WA 3CBNA 4COUA 3VKLA 2EIEA 4XTPA 3SISA 5FZGA 1JOPA 5JOXA 4FPYA 4M4RA 3AFKA 2XKPA 3AL5A 5D8AA 3H50A 4B3NA 5KXCA 4EE2A 3GNEA 4MXWA 2HH9A 2FMDA 2LALA 3WDTA 1DYKA 3K46A 4A44A 4GMP1 4NHKA 1V6NA 2E7AA 3VKMA 4XF3A 4ASKA 3NNLA 5FYZA 4UFJA 3UESA 4XE9A 2ZGNA 4XFHA 3CZJA 4I0BA 2GNDA 2ZXQA 1LEDA 1MZEA 3IDAA 3POYA 1ZBE2 3T0AA 4GZ9A 1RMU1 4GMP0 5JPNB 1CVNA 4S2FA 5KXBA 1BJQA 1JZ3A 4YVWC 1YNAA 5KHKA 2QUOA 4CDXC 3W20A 2OIIA 4PT6A 1FXZA 2GC3A 5DG1A 4YW4A 1VAKA 4BXSV 4X8NA 2VUCA 2JG8C 4BQXA 2GN7A 2P3JA 3SCFA 3ZFGC 2ZA9A 1RVF2 3JBG2 2XVLA 1R093 4KQ7A 4QKFA 2BNOA 1G9DA 1GZWB 4OHVA 4IXLA 1NLQA 3EQEA 1UU4A 2AZ5A 4RHV2 5CYYA 3CJIA 2HLEA 2VNGA 2W2IA 4LT5A 1WBFA 1JYWA 2QZ3A 2PQSA 3TEZA 5JDBA 1AR73 2PQQA 4LITA 4COZA 4DXSA 5A3WA 3VN4A 3A0KA 1S0DA 2NYYA 4MGKE 5EXOA 5DG2A 3ZYPA 4LIUA 2CSGA 4P08A 1XE8A 3M8LA 5L73A 3H9AA 4EN8B 3UT0A 5I93A 2GN3A 2PAKA 2BBVA 4QGMA 2VZTA 4KWKA 3CKHA 5FZCA 3AC0A 1W8HA 1C3HA 2IFRA 1UPSA 3RVHA 5DUXA 2WS93 3LEMA 1EV13 2ZHNA 4K7JA 5DZGA 4WM7B 5GLTA 1W04A 3GZEA 1UXXX 4EN6B 4ZKTB 1MVQA 3PJYA 4D0QA 1AR72 4CDXB 1DQ5A 3BYWA 5C8WA 1S0FA 5LBFA 2GC2A 3ZFGB 4DFSA 4CU8A 2V4AA 2W1UA 4KNCA 5A6ZA 5FZ6A 5SV5A 3RMXA 4EYUA 3H8UA 1R091 4EN0A 4C1XA 1GSLA 2YB7A 3KZ4C 4K1YA 4PHZA 2EXIA 2O8QA 4UYBA 3SH5A 3OY8A 4BQYA 1HN1A 3JQXA 2VJXA 3Q8CA 1OF4A 2YGLA 3AP4A 4G3YC 5T50A 4E4HA 3FHIB 4ZU5A 3HQUA 3B3QE 5CB7A 5JZGA 1YXWA 3O1SA 1WKYA 1OA3A 1AR71 1VAMA 5CKQA 2GMPA 1C5IA 2J7MA 5E16A 1PZ7A 5A70A 1UXZA 1PM7A 4GB33 1NQDA 1YFXA 2HWF3 5LY1A 2A6ZA 2CWSA 3Q8BA 4XAEA 4X6QB 3LEKA 1CZTA 3VBRB 3WG4A 4PDWA 2XJTA 4M3CE 5HCAA 2ENRA 2WN3A 3O1RA 1NXD1 2D3SA 1H4HA 4KWJA 1G8WA 5T52A 1OA4A 1LCLA 5CADA 3FJSA 4XF1A 3I59A 1MS0A 3IMNA 3H0OA 1UYYA 1CWPA 4MVTA 2RR13 1MEC3 3AJYA 4JV4A 5KBFA 4CP9B 2WS91 4MHUA 1EV11 1XYPA 2V4VA 1ZREA 4A2UA 5J48A 5KHJA 4Y24A 4QMAA 4BCUA 5FWJA 1J1TA 4XC9A 3CHXA 3RMYA 3VBSC 1JYIA 4QQPA 3HAGA 1GOFA 1H2KA 1R1ZA 1RUE2 2VH9A 3DXTA 4XETA 5FO8B 2BDRA 5D21A 4DEQA 5K0UB 5FMOS 3TEWA 3HBZA 3VL9A 1SBDA 4UW6A 4XOGA 1YI7A 1STMA 5DXDA 3URFA 2RR12 1MEC2 1AYN3 2GH2A 3MW3A 2A6YA 2DURA 4NIIA 1KS4A 3VDDA 4E9KA 1L3JA 4LKSA 2C9AA 3RWKX 5FPXA 3PU8A 1SEFA 5FZMA 2RJKA 2R072 3ZXJA 1N3QA 4LKDA 4N7UA 4GB31 2HWF1 3KQRA 1S0GA 2D98A 3KB5A 1FNZA 2Q5TA 1LULA 3RI8A 5FQ0A 1GYKA 3AX4A 2YXSA 4E2GA 3ME2A 4OHYA 2WNUA 2BU9A 4I3GA 5CG8A 3NVCA 4COYA 1W3XA 2BGOA 1NCRC 1CPNA 1UY2A 2Y6LA 4P9JA 4JQRA 1NQJA 1UYXA 4DUXA 3CZUA 4FTBA 1LENA 1GU3A 1MEC1 1XU1A 2RR11 3JCIA 3RJRA 4CTEA 3BKZA 2CGPA 3I54A 5F8PA 5FYBA 2A3WA 2LRPA 3FLRA 4JGZC 2WUHA 2A70A 3VBSB 3D5OA 3IPVA 4UI9L 5JXGA 1ND2C 1SFPA 4IDZA 2JIJA 5A32B 3VBHA 2WN2A 2JD9A 2XVGA 3HT2A 2Q1ZB 2VMHA 4NROA 3DYPA 2TNFA 3A0NA 2ZKLA 1SACA 4JKKA 4AHXA 1E57A 5A7WA 4ISRA 2NMOA 4AZZA 1G6NA 3MIFA 4CDQA 3ZPYA 1UMHA 1WCUA 3A4UA 4R9CA 4Q1PA 3VBOC 2A7AA 1ZBA3 4I3PA 4BK4A 4BB3A 4AVSA 5CFDA 3IIAA 1AYN1 5L7OA 2FD8A 3VD3A 3WT3A 1PO13 1IPKA 3A23A 4AHYA 3RZLA 4C0BA 1CESA 1JZ4A 2XWBB 1ND3A 3I7DA 4GH4A 4HANA 3V65A 4NOTA 4QQOA 2YGMA 4JHZA 4QPGA 4YFWA 1OA2A 2A1XA 1QGLA 3SEEA 3ZO0B 2VOXA 3AYEA 1G9BA 4FPCA 5IVJA 1NCRB 4CEYC 1OKOA 1W8UA 2ORXA 2JJ6A 4QU1A 1C5HA 4JKMA 3WVJA 4XUOA 3R4SA 4YRDA 4JGZB 4L11A 5FYVA 4Y5Z0 4IEQA 3ST7A 1SFNA 2WSUA 4A7YA 3U1XA 4B7EA 1ND2B 4IV1C 4LK6A 5FMBA 3IIIA 1NCQC 1S0CA 4Q1RA 4XMIA 1L7RA 2CV6A 4FPKA 4P00B 5EFUA 2VMCA 3AXEA 4FCAA 1LOCA 2X29A 4C8DA 2J1AA 3VBOB 1F5FA 1UY0A 2C24A 2ZGOA 5BNOA 2E32A 5IWFA 1ZZ8A 4IE0A 4YW7A 1CAWA 1ZBA1 3WHUA 3BTXA 2F4LA 4IEWA 2E53A 4OHWA 4YVWA 4Z2AA 1DCSA 2C1FA 2IXCA 3BPZA 4QX0A 1C1FA 5FY0A 2ZAHA 1SLLA 4RL7A 1G9AA 1PO11 1MS9A 4YVSC 1BYHA 1EPWA 5I8TA 3B69A 2R6QA 2JG8A 3PTRB 5A3NA 5KXDA 4OQ8A 3DECA 4HK9A 4TLFA 3MW2A 2Q1MA 4IE6A 2DVBA 5T5PA 1MQTC 5EYYA 2VZ1A 5BNPC 5F5IA 2WQ4A 5IJRA 1KITA 3SCGA 2RS13 1EUUA 2C4XA 3O7OA 3ECQA 1HIXA 2ZTNA 3OBRA 4AEDC 1LRHA 2YC0A 4E2SA 3TRSB 4IV1B 5IYYA 3CQOA 1X7NA 5FOJB 1DDLA 3VBFC 3GBFA 4Y20B 4AYUA 4CUBA 5JUVA 4IEZA 3ZXEA 4LK7A 4WZCA 4EWAA 4RR3A 3GBWA 4WM8A 5DUWA 1WGPA 2WO2A 3GZTB 1FX5A 4XHXA 1W05A 2JE9A 3EBRA 5FYMA 2WT0A 4W6WA 5H9PA 1FOD3 1YWKA 2YZ4A 2KR2A 3T1MA 1BEV3 4ET7A 2D7FA 3S7EA 2B8MA 3AP5A 1XE7A 2VZ3A 3LSEA 5I0DA 4C1WA 1IPSA 2VPVA 5FXWA 4B4QA 1O3SA 2CAVA 2ZHKA 3HNYM 1GKBA 2UYBA 4QU2A 4Z92B 1ULOA 2HWC2 2Z5WA 2A75A 1H0BA 4RYDA 1JOJA 3NQHA 4Y1VA 2J1RA 3ASIA 1N1TA 3J7MA 2VBBA 3I8TA 3AB0A 1MQTB 4M0NA 5DQ0A 4EV0A 2GMMA 3KF3A 1B35A 4NHYA 1GLHA 1W0NA 2ZACA 5FUPA 2X8KA 1W9TA 5E88A 4OULA 1JZ7A 4AFAA 4D6SA 1RIRA 1QJX3 2BNNA 2CWMA 3KCCA 5FWEA 1YYNA 4CCMA 4AEDB 4Y33A 3TBDA 2RS11 3UKNA 3KVAA 2SLIA 3UGFA 4DIQA 3VBFB 3MV01 3BUCA 4YZ3A 4DS0A 3HN3A 4XFGA 5DUVA 2VXRA 4CU9A 3F2ZA 2PLV3 1D7PM 1Q8VA 2D5HA 4URAA 3MIGA 3ALQA 3AZZA 3E1F1 3WZ1A 4GWMA 2VTXJ 2A3YA 2XUMA 5L36A 3L9JT 1NAEA 1YI9A 2XG3A 1TME2 4HVQA 1OOPC 1VB4A 4QDQA 5A80A 4AVTA 3LD8A 4YM3A 4DOUA 1FOD1 4HG6B 5DAWA 1BEV1 1QJFA 3ZLIA 4A3XA 3VD4A 2BEOA 4QHZA 4RS5C 3RGBA 2FDJA 3EMRA 3MGUA 5FCCA 1BKZA 3BIWE 3MV11 4DRVA 3NRUA 1UAIA 3QH6A 4ZZ8A 2BV4A 1X9TA 4IL7A 5FZ1A 3EB7A 2XB6C 1HV0A 3E6CC 1Y9GA 2JICA 3C7FA 4N53B 4DUWA 2WL1A 2QKDA 4V2WA 4QKBA 1WCKA 3RG0A 3W21A 1AR92 5M0TA 2IZWA 3T30A 1H1MA 5BV6A 5FZ7A 4UFKA 2JG9C 5LK5A 1WCDJ 3K3NA 3C7EA 4MGSA 2BZDA 1H8TC 1QJX1 1SLTA 2W87A 3AP7A 4AGGA 3SKJE 4JDNA 4MOAA 3ZMNA 4XIOA 1GWKA 5FXVA 3AZXA 1LHNA 4DB5A 1O91A 3DCQA 1PK6B 1XYOA 4IQPA 1I5PA 4NWWA 5C3RA 2ZEYA 1JUHA 1APNA 3ZR5A 5C4WC 5F6KA 1J3QA 1ZZ7A 5CFCA 3RZMA 1CJDA 4UFMA 2PLV1 1IS5A 5IK8A 1ONAA 2PHXA 3ES4A 4R9DA 1BVVA 1YQ6A 4LA2A 4XHBA 2EIDA 2UURA 4IEOA 1LAJA 3EYPA 2QE3A 4RS5B 2R32A 1CAVB 3D3AA 4KGGA 4LXLA 4XJAA 2WSVA 1AJKA 1XC6A 3PLQA 5FO9B 3RSJA 4XTMA 1N47A 1W8ZA 3GDBA 3R0RA 1ZVFA 2R043 4X6RB 4EQVA 2W52A 3T2PA 2D5FA 1HRI3 2JB4A 4MGZE 3D82A 1W28A 4CP0A 4HVRA 1TQ5A 4Q8LA 4IV3A 2OZ6A 3WD5A 4XUTA 2JG9B 4QX3A 1CAUB 1CZSA 1ZYBA 2BOJA 2G19A 2RHPA 3D8CA 4D7TA 2CHHA 1WW6A 2AREA 1WZXA 1UMIA 2ZX0A 4LBQD 3ZSKA 2E51A 2BNMA 3WDXA 1E5SA 1YQ2A 3BVCA 4OLLA 5F5CA 5T5LA 1QDOA 1UOFA 4NIAA 2R042 5FO7B 1VRBA 4HZFA 1VRH3 5C4WB 2TUNA 4LLOA 1LGNA 1AL22 3RJ2X 2KM2A 2P37A 4FO9A 5JXJA 5D8AB 1GOHA 4PLMA 4BK5A 1V6KA 3E5QA 4MXWB 1HB2A 3ABZA 5ANQA 3K4ZA 1QOSA 5IAXA 1O6UA 4YZ4A 5FK8A 4YGEA 1CPMA 3HN1A 4CEYA 5LA2A 1PGL1 1QOOA 2HWD2 5E89A 1W8NA 4QQLA 4W8JA 3AM2A 4YPJA 3R6SA 2O1QA 2FDFA 1HRV3 1H8VA 4MUVA 1YO8A 3O1VA 1MACA 5FLHA 5F2SA 3IDEA 2K0GA 3KMHA 4NIDA 2CGNA 2R041 1NCQA 4E8DA 4BQ4A 1RHI3 1JZ8A 3WW3A 5EP9A 4Y5SA 1HRI1 2VQUA 4L0PA 5DAQA 2O8OA 3MLLA 1ZRDA 2L9LA 1VPHA 4GXLA 2RVAA 1PGW2 3HOBA 2P6HA 3AKTA 3VKOA 3RYRA 3OD0A 5IVFA 1LOGA 2H0VA 5A6YA 1CD3G 3PIJA 1OHFA 3N35A 3THPA 3ZSMA 4FBFA 3TEYA 1ZX5A 2HBUA 3POJA 3JD73 3APBA 4RQPA 2UY9A 2CU5A 1V6JA 3CJIB 4Z82A 1FPN2 4YVSA 4PIXA 2WIIB 2EAAA 1VRH1 2VNRA 2WAAA 4AE2A 2W9XA 4CDWC 1HQLA 3SNMA 5IT6A 1S4CA 1SLAA 4XQWA 4QX2A 2ZGLA 4QWNA 3ILNA 2PFWA 4AVCA 5BNPA 3GYDA 2ZEZA 5KHHA 1XNTA 1CGPA 4BU2A 4PDWC 3LOIA 1DYPA 1EAH3 2XL9A 2NM1A 4DY3A 4CU6A 4NPRA 4FPOB 2Y6GA 5JMOA 4QM9A 1HRV1 1HX6A 4D3WA 4CXWA 1G7YA 1LOAA 4BQ2A 4IEXA 3RQ0A 2WFF3 2XL7A 1RHI1 2VBDA 2IFWA 3A22A 3I2IA 5LBCA 3VZLA 3AVRA 4U2AA 3AZWA 1OBNA 5LASA 1Z0HA 1MS4A 2WFPA 2PHUA 5A32A 1IS4A 3ZYRA 4LO7A 4W6XA 3PNAA 2R16A 4EROA 5HXMA 3PVNA 2QQVA 4P02B 2O0OA 3VBUA 1V70A 3JD71 3HJRA 3OY8B 4OI2A 5JR7B 2B39A 2X53S 5J36A 1UIKA 4G4FA 1R082 4FFGA 4HMZA 4I01A 3U07A 4AGVA 5JZGB 2E7TA 4P9LA 2BPA2 1IS6A 2UWBA 1WMEA 3NW4A 2FDIA 4FXGB 5J1XA 3LFMA 1V6MA 2RDSA 4ZU7A 1WW4A 4JTOA 3PVBB 1OD3A 3ON7A 1PHMA 2YC2A 1GP4A 3FUOA 4ZS3A 4OFGA 4AW7A 1AX0A 2JX9A 3ES1A 1GWMA 1REEA 1SBFA 4PDWB 1HB1A 2AENA 1OLMA 1V6LA 1WMXA 2VVFA 5AC93 2LTNA 4B7KA 4IE4A 4Y3OA 3I59B 4YLZA 3VZOA 4QPWA 1EAH1 4M0HA 2A6WA 2QQLA 2RM22 3MUZ1 5DDJ2 2E9QA 1H2LA 5C3OA 2Q8OA 4L2NA 4YM1A 3ZFFC 3AKRA 4YARA 2VBPA 5FZ4A 1O4YA 1SLCA 3LB9A 5ABJA 4ZZ5A 2WFF1 5LZ6A 5L9RA 3PIGA 3EXUA 5IAVA 3ZXLA 1OOPA 1OQEA 4IW3A 3LIGA 4GALA 2FCVA 5FREA 2D6OX 3LIHA 4A7ZA 5CBLA 5JXHA 4ONUA 1FAYA 4IERA 4YGDA 5JOWA 2IXHA 4FVVA 2JENA 4TXWA 2XMLA 3OSDA 3N9OA 4FSJA 4K1ZA 3N4MA 2G9ZA 4MSVA 2UY8A 4CDQC 1Y9MA 2DFCA 3MBWA 4LO4B 3VDDB 4D69A 1WLCA 2RS32 3ACFA 5J09A 1CAXA 2VZQA 4LBNA 5CFDC 5F3GA 1LTEA 2WZR2 2VMIA 3DYOA 4XIKA 1R64A 5LBBA 4XDPA 4AL9A 1CJPA 2WKKA 4NHLA 4UXAA 5FYYA 4FTSA 1DGWA 1ND3C 1UOBA 1X33A 1ZA7A 3GJBA 5J98B 4A6SA 5F3CA 5FQ0B 4YW6A 1H8TA 1UZYA 1UX7A 2J22A 3OGVA 5I0UA 3BTYA 3I3QA 3IZOA 3NNMA 1UOGA 4JCKA 2WNUB 5AC91 3AKPA 2XXZA 1K3IA 4TYSA 1REFA 4OQ9A 3WHTA 3MYXA 3C7HA 1AF9A 1X9PA 2JDNA 4XCBA 5LATA 4MG2A 1SQ4A 4HKLA 2VUJA 4AF9A 5FP7A 5T5OA 5A1LA 1W8WA 4LPLA 4EN9B 3IPVB 5AVPA 2Y33A 5GJ6A 1A6CA 3T2QA 2D3PA 3VBHB 2DTWA 2VY0A 5J7MA 1ASJ2 3ZPOA 1YLLA 3O1TA 1M4WA 1A3KA 1RVF3 3JBG3 5KWRA 1OPOA 2CDPA 1AXKA 1BMV1 5A7WB 5C9AA 1W2UA 3FHQA 4CDQB 2DUQA 4AHZA 3K3OA 1ULFA 3BU0A 4RHV3 4JDOA 2Y0OA 1TMF3 1KXGA 3WDYA 3ZXGA 1GFF2 5BNOC 5CFDB 3WY6A 1Y9QA 1O3TA 5L7OB 1XXNA 3RI9A 2QJVA 2C0ZA 3KSCA 5F3EA 3ZXFA 3ZYBA 1XBFA 2D6PA 1C8M2 1ZZCA 2RE9A 2XLAA 2VW2A 4JRLA 1ND3B 1MR5A 3RNSA 3LEIA 4GH4B 2Y60A 3H3UA 3NNGA 5DZEA 2YU2A 3O0WA 1NA1C 4FXKB 1YQ5A 1MVEA 4LBMA 2N7GA 3SQOA 2HYXA 4QPGB 3T1LA 2VOVA 4Q4V2 1WD3A 2WJSA 4H2AA 4NMIA 3H1YA 1TNFA 4WVVA 5D1IA 1SLIA 3NJXA 4YW2A 3UYJA 4XJZA 3ZYGA 4BM8A 2NN8A 1TMF2 1V00A 1I3HA 5FPBA 1JS9A 4FPEA 4O9EA 1Q8PA 1ZBE1 2Y0IA 2XH6A 3G7DA 4NE9A 4QDSA 2Q8DA 4A42A 4HSLA 1UU5A 2YROA 1VMHA 4Z2WA 5T54A 1RUC2 3HMYA 4M3CA 5H9SA 1LNSA 3SLIA 3OOXA 1REDA 3ATGA 3MPPG 4QKNA 5B4NA 4RR3C 4YG0A 1MZ5A 1XSQA 1LU2A 4WM8C 3WF0A 5FDBA 1EUTA 1RVF1 3JBG1 2QQNA 4TN7A 5HV4A 4LBQA 1RYYA 3IN9A 4PCRA 3UNPA 1LU1A 1NYWA 2ZAAA 4JAAA 5BNOB 2LS6A 4AQ6A 1U0AA 5FY4A 3V0BA 2W1WA 1CAWB 4RHV1 3ACIA 1BVP1 3S30A 1TMF1 2WZEA 5A7SA 3M70A 4FPLA 4QXKA 4YVWB 3FC0A 5D2AA 2VO5A 5CKMA 3WQ7A 2VC9A 4KBBA 4ASLA 1EY2A 3HWJA 4LO6B 2JECA 5HCHA 2W1QA 2QQPA 1RUJ2 3N9PA 5E1RA 4CRQA 2WZ8A 2JG8B 2RDQA 2WO1A 1W99A 2DBNA 3KT4A 1VLNA 3IBMA 4ATEA 2R0FA 2HBTA 2Y26A 4CZSA 5FOBB 1LOEA 3M3EA 5LK7B 5FAXA 3WOGA 5BNNA 1UKRA 1DP0A 4PJYA 1B35C 2B4KA 4JQTA 5FYCA 3T08A 1JU3A 2GNBA 3HD8B 1WCQA 1WW5A 1IKQA 3Q8FA 4ASMB 3ACLA 4UFIA 3T09A 2ARXA 4LHKA 1WMFA 3K77A 4CDWA 2JE8A 2DWRA 4QM8A 4W50A 1QMJA 5F6LB 3POWA 3LZZA 2H0BA 1JYNA 1H9PA 4RR3B 4WM8B 5FP3A 5FZOA 1RUE3 5F9TA 4LOSA 2R1BA 5FPVA 2PAEA 1R1A3 1UU6A 1LHWA 1AJOA 3AMMA 3H1WA 4Q0QA 2VMDA 1W2NA 3ZXKA 2E7QA 3N9MA 3O1MA 2XQXA 2JEMA 5FZIA 5I0TA 1BQPA 1BK1A 1OLQA 1AR63 2WR9A 2DBIA 2BFUL 2DVDA 5FV3A 1QXPA 1AZDA 1W8FA 4JRAA 1JZ6A 5GLUA 3NO8A 3WINE 3CL1A 2R073 5A3UA 1F31A 3OBZA 1IHMA 1C8NA 1XNBA 4R9BA 5CA6A 3IWZA 1OURA 1B35B 1E5IA 4L92A 3P5BA 1XNDA 3WSOA 1R1A2 3ACGA 1O4TA 5EJ3A 1XNAA 2VUAA 4YGBA 3WP6A 1NKGA 1JHNA 4LHSA 3LAGA 5AVAA 4OHZA 4AAPA 1QJEA 4XXAA 1PNGA 5F1RA 2WABA 5EV7A 3OUHA 4AVVA 1BHGA 3WF1A 1CX1A 2P1BA 4HN0A 1AR62 2FCTA 3J9SA 3HBKA 3U75A 2QFEA 4PF1A 3ZR6A 1HV1A 2D6KA 1DQ2A 1GNYA 5C70A 1UZ0A 2WNVA 3BU7A 3LA3A 2AGSA 3UKVA 4YW5A 4KGQA 1RUG2 5AFEA 5CFCC 1UD1A 5FY1A 4FAGA 1D4VB 3H7YA 3LA2A 1RUE1 2ETEA 3WXPA 1R1A1 1AR82 2IVIB 4Z1VA 2VMFA 4XURA 4AR2A 3PMEA 2E26A 1JODA 2NLRA 3L2HA 4OZXA 4LO5B 3HQXA 4XF0A 1QJU2 2D44A 2GU9A 3D4KA 3ZFFA 3O1PA 2VGDA 1AR61 1PMIA 1Q8SA 3J26N 3KGLA 3FLPA 3JZVA 4BOWA 3SHRA 2P34A 1PX4A 1VMJA 3PURA 1UZZA 4AEMA 4AI8A 4XJ9A 4WVZA 2FDGA 3ZM8A 1UW8A 2R071 1W6NA 2QTWB 3GM8A 3FBYA 5FPAA 2MEV2 2Q8EA 4AFDA 1GV9A 4UWDA 4CP2A 1OFNA 4IV3C 1RXFA 1S2KA 4ATFA 4BZ4A 3UJOA 1V9U3 2EXHA 4CCOA 5FY5A 4RFRB 4CEWC 3ILFA 1JI6A 5F2WA 2WO7A 1COV2 3OEAA 4UBGA 1OLRA 5JI9A 2WT2A 3NSTA 4UBHA 3IKWA 3FBMA 1BBT2 2VW0A 1S0BA 3H3ZA 5HXVA 4EWEA 5B2GB 3GHMA 5C5TA 1K42A 1NE6A 2DVGA 5CFCB 3H42B 5FLJA 1A34A 1FMD2 5EIYB 2CY6A 2YPJA 2Y38A 5CEHA 3EHKA 2DV9A 5C8CC 2NZ9A 3B00A 4R4ZA 3DXUA 4PBOA 3MFAA 1IQDC 1V9U2 3PU3A 4LOTA 3W5NA 2YFZA 4JZRA 1O7FA 3W5MA 2OS2A 2VVEA 3VV1A 2RJ2A 3ILRA 1MPXA 3THTA 3MF6A 3U78A 1W2OA 4JGYC 2X10A 1WCSA 2EXJA 3S6PA 2W91A 1AHSA 3WDVA 3LDRA 3ZXDA 2XOMA 3SKVA 3N7LA 4IV3B 5A1AA 1SHWB 1WLWA 3MPBA 5JIUA 1O3QA 2WQZC 1GZTA 2AEYA 2VNOA 2K2SA 5I8YA 1LJ7A 1W9WA 4A41A 4O65A 2GAUA 4XCAA 5B4XA 1U12A 1UX6A 2ZMKA 3OYWA 4F3JA 3S57A 4XZPA 1V9U1 1YFUA 2ADDA 2DDUA 3NWKA 2ES3A 5FZ9A 2NQYA 5EWSA 4RQPC 4B4PA 3PUSA 3VHRA 4MH0E 4M4PA 4LKFA 5DAPA 3QBQA 1DYOA 4N8MA 4K8FA 4JX0A 4AXOA 3MLJA 5BYNA 3AVSA 1NA1A 3DV8A 1YUDA 4CCDA 3AMPA 4IE5A 3I2OA 5CU1A 3B9CA 4Q0VA 1FV2A 2DUOA 3EO6A 5GKAC 4BXFA 2OVUA 4HBNA 5IK4A 4D6RA 2TBVA 2CDOA 4CEYB 4D94A 4UF0A 3N9QA 4LLFA 1W6QA 4XZUG 5FTTC 3NJYA 2V72A 3QD6A 3RPQA 5JOZA 2VCAA 2G4IA 3FFQA 4LHNA 1G9CA 1A78A 3I2GA 2HWC3 4Y22A 4Y1XA 2XJSA 1NCQB 2SBAA 2VOWA 4MGQA 1KD7A 3KV9A 4LORA 5JSRA 5IVBA 3V56A 1D2QA 1HB3A 1S0IA 2VZUA 3CLPA 4FP3A 5JSOA 1EPZA 3CJXA 1NX9A 1MS5A 2BWCA 3UETA 3ZSEA 1UY1A 1W8OA 1W2AX 3FLTA 4H7LA 2ZEWA 1PVC2 4CA9A 5CAZA 1ODNA 3J7LA 1VALA 4FPGA 2D6LX 4RQPB 3M2MA 3I2FA 2WYFA 3K48A 4XJWA 2GZWA 3VBUC 4W65A 2GSYA 2HJIA 5EHDA 4YVSB 4HKWA 2D97A 5ACA2 2R7EB 2FBEA 5FYHA 1YQCA 4K9SA 4YFZA 2OPKA 1I6XA 2ID4A 3BPSA 2YDEA 5BUVA 1HN0A 4OI0A 1I5ZA 3N9NA 3ROUA 3VBRA 5BNPB 5BPXA 3WDWA 5A3LA 3VHNA 1TME3 5C3QA 2A73B 3UKTA 5JWPA 1UY3A 4GKYA 1F4HA 2F6BA 2EVXA 4Q4X2 4BQ1A 1XRUA 1HQWA 4OMCA 5TSWA 3RZJA 4I30A 3IAPA 3MO4A 1IKPA 3I49A 3WCRA 1ST8A 1T6BX 3MF9A 5FKCA 4NRMA 4ARYA 3HVDA 5IVVA 2XR4A 3CIHA 1SPPA 1RGSA 1T2XA 1VB2A 2HWC1 1Q56A 3VHPA 5H9RA 1KEXA 2PHRA 4FPJA 5A7NA 1J58A 1PM4A 1YC61 3I3BA 5C6CA 4UOJA 4AEJA 5ABJC 3RZHA 2KXLA 2W68A 1NT0A 3KCYA 3U10A 3ZYFA 5LEKA 4Q4Y2 2VMEA 2ZGUA 3R4DB 4LBKA 1AR93 1AUYA 4AQTA 4Q8KA 1ULPA 3VDCA 1XPWA 2BWAA 1S55A 4UFLA 4UW4A 4XILA 4BH9A 3E5UA 1NLRA 3ZX7A 4CYDA 3NJZA 3NKGA 3VBUB 1MZFA 1HJGA 4FFIA 1DU3D 1JW6A 1EP0A 5FXZA 1OUSA 3THCA 2ADEA 1ZRIA 2HEWF 2QNKA 1G9FA 1Y43B 3SEPA 1J84A 1LOBA 1GUIA 2P3KA 2ZZJA 4HXCA 1V6IA 4P5YA 1X82A 3J8F3 2DCKA 3MEPA 3QACA 5KC5A 2VMGA 4U36A 1W6MA 2VQ0A 3I97A 5JSPA 2ZMNA 1GQPA 2EAKA 2K9ZA 4RGKA 4AFBA 4LIVA 1OKQA 5IK7A 4URTA 1TME1 2ZPXA 1F4AA 1OC1A 1BLZA 3I3MA 1J3RA 3CNAA 3O1UA 1TE1B 2EF6A 4QXHA 2EA7A 3LPFA 4OUEA 4KL1A 2BOIA 2R062 1O3RA 3F95A 4DQAA 3SH4A 5FY7A 5FPLA 3CEWA 3ZXAC 3VGIA 1HJFA 1F35A 2YYOA 5F5AA 3LCPA 5L9BA 2WNEA 2BBAA 2Y6FA 1JYVA 1W06A 5EJ1B 2B5HA 1IGOA 2Q0AA 1OMIA 5ABJB 4PQ9A 3UV9A 4CUCA 3J8F2 3N36A 2FZ2A 3PUAA 1ZRRA 4XQDA 5EZWA 1PIV2 5E8AA 2VCBA 1OOPB 3O12A 1FT9A 3UJQA 2HWE2 3BTAA 4QX1A 1AR91 5DZFA 2YFUA 2EIGA 4XFBA 4QPIA 4E4SA 3W9AA 5FIXA 2GNMA 3OGJA 2FQPA 5C9AC 3HEIA 1UO9A 3TN92 3IB3A 3VHOA 2GC0A 2DFBA 3P3NA 1Z78A 1CAXB 3Q8EA 1CONA 1GR3A 5BXXA 1AL23 2OUJA 3V64A 1K12A 2BFUS 4J6GA 3SXWA 4CE8A 1JBCA 3BOWA 4HVOA 4AVAA 1POQA 5HBAA 4WZFA 3J8F1 3T4VA 4DPNA 2UWCA 2Z42A 1QQP3 4AFCA 3HR9A 2CTVA 1ALYA 1H8TB 1VBA3 2HWD3 4IUGA 2JKXA 4CEWA 4CCKA 3U0ZA 4LA3A 4DNYA 2D93A 3WG2A 5JXIA 4MGYE 1DQ1A 3PDQA 1HB4A 4GKXA 5FP8A 5FZDA 4P9IA 4WBBA 4H7MA 1DGLA 3AMQA 3JB4C 1OI6A 2AEZA 3DL3A 1MZ6A 1FV3A 4WVMA 3GZAA 4XQ4A 4ZXEA 2XGXA 4MGIE 5F3IA 2AACA 5HCBA 3RWNA 3TOJA 3INAA 1PO22 2ZZQA 4XEZA 2AC1A 4MGTA 2XWJB 4JC1A 5C8CA 3O0VA 2D6NA 3ZYHA 3V0AA 1XNCA 4IE7A 4Y1YA 1H2MA 1QQP2 2JDMA 3K51A 5F32A 4CCLA 3BI3A 5FUIA 1VBA2 2F4PA 1W0OA 4LHLA 5C9AB 1L7QA 1FI2A 2KD7A 3VD7A 5L19A 3WNMA 3SC7X 3P1IA 2DYCA 2YMZA 5FY9A 5A7QA 5LRRA 3DEMA 2VCMA 3LWCA 1US2A 1FPN3 4JGYA 3WF3A 5CISA 4NRPA 4QX7A 3N7JA 5FMDA 3KD4A 4FP2A 2OUHA 2YBSA 2A3XA 3B9IA 3ELNA 1AL21 3O5SA 2ZX2A 3POIA 4OZOA 2VU9A 4HFSA 4R4XA 4JDMA 4XYXA 4C91A 5JPMB 1NZIA 4NO4A 3C8XA 3KT7A 3WR0A 2OZJA 2ZEXA 1DQ4A 2W1SA 2VZPA 2VVDA 4LTAA 3SCHA 4C0HA 4CUAA 1TNRA 3VDAA 2B9VA 1QQP1 3KCXA 2ORZA 1H2NA 1D4M2 2HWD1 1VBD2 2PHFA 2RMU2 2WQ8A 3IMMA 5BNNC 5HV0A 1YEWA 3FFZA 1Z7S3 3AXDA 1ZA4A 3PTYA 2VTFA 5A33A 2MPFA 2JD4A 3IT8A 1TVGA 5EPAA 4A4AA 2W46A 4NHXA 2G9FA 3JUUA 1DF0A 4MADA 5CIRA 3MDPA 4YNIA 1E5RA 4QXBA 1VBC3 3ZVXA 2K46A 4M3CB 1OH3A 3BN6A 4QB1A 5CZKA 3FUQA 2RDNA 4Q0PA 1VE0A 3T3YA 4XXPA 5FYIA 1PGW1 2CNAA 3WEZA 2HKXA 3KGZA 3WF4A 2WA4A 4BPZA 5IK5A 4V1PA 3WUDA 3QOPA 1VMFA 1SFYA 3POSA 5H9QA 4LBQB 4NPLA 4LEJA 5SV8A 3AYCA 2PXJA 3GALA 3SMHA 1LKNA 4N90A 1RUI3 3V0BB 1Z7S2 1Q3EA 1RUF2 5FZ3A 1R083 2XVKA 2ZOEB 1RUH2 4F83A 1OVPA 1FPN1 4ZHNA 1Q8QA 1SBEA 1X8MA 5FP4A 1WMDA 2VQAA 3EJKA 1VBC2 4OI4A 1FYUA 1XNKA 1ENRA 3M7AA 1LR5A 4Y5TA 1HXS3 3OPZA 4Q0UA 3T4HB 3MW4A 5LCWL 5BNNB 5IVEA 3LOBA 2NMNA 1QXRA 4EJRA 4RGAA 2VE1A 1RUI2 2WNOA 2RM23 2KA3A 4K21A 5DDJ3 1LEMA 1VAVA 3RRDA 2HEYF 1Z7S1 2Q4SA 3K75B 4CDWB 1LGBA 2F17A 4XDQA 4XUQA 4KG0A 4TTGA 2YPDA 4FFFA 2J1UA 4PIZA 4COVA 4XMAA 4Y1UA 4KWLA 4N43C 1DGRA 2QDRA 1HQNA 4V2VA 4NRQA 1NZCA 1VBC1 2BJSA 3P6BA 1QHDA 1T6GC 4OCTA 3GCWA 1XYNA 4CUGA 5DMYA 4PLNA 5FZOB 1YRZA 2WNVC 5G04L 3TAYA 4EZ4A 3TEXA 1HXS2 1RXGA 3RFRA 2PHLA 1GZCA 4FI9A 1AXYA 2X5IA 1JZ5A 4WV8A 2P17A 1BK0A 1WLDA 1ULDA 2W39A 2DF7A 3ZFEA 2I45A 1NUKA 3OG2A 4B8EA 1UWWA 5T3NA 4K6BA 3J7NA 1H4GA 1QJZA 3ZDSA 3B93A 4N9IA 1RTVA 1RUI1 3KVBA 4GJZA 4IETA 4YW1A 3MHZA 5FKBA 2DU1A 1UN1A 1R081 2RS33 2Y34A 3M3IA 4FPFA 4OYUA 1UL9A 3RDIA 1BZWA 2WZR3 1KFXL 3POFA 3M3OA 1YIFA 2GP3A 2Q30A 1N1VA 5IUQA 3SH3A 3L2YA 4D8MA 5CG9A 5IW0A 3USUA 4P9YA 5HPOA 3VD9A 4XUPA 5EJZB 4AGRA 4QQ2A 3R05A 1HXS1 2ZBJA 1YCIA 3GBGA 1Q8OA 5T5JA 3VZMA 3WG1A 1OVSA 4DZGA 3VDBA 5A7PA 3OUJA 4H14A 1A8MA 3WW2A 1GBGA 4HPKA 2V09A 2WRAA 3IAQA 1WLTA 5HCFA 2RM21 4ISQA 5DDJ1 4P5HA 2RG4A 4RD7A 2QZ2A 1US3A 1UKGA 2WNVB 4XF4A 5DABA 2NP0A 1H9WA 2VTXA 2QBXA 1ASJ3 2DVFA 3GXUA 1CN1A 2Y6JA 2ZS6B 2EXKA 5A7OA 1TZOA 2ZGTA 2JE7A 4QAWA 4KWUA 1GQGA 2ILMA 3HNBM 1GICA 3N7KA 1DFQA 5JIAA 1HKDA 2GH8A 1JN2P 4L99A 3ZFFB 2R30A 1FNYA 1LHUA 2VZSA 2XJUA 2YU1A 3D0JA 4MYEA 2ARCA 3GZUC 2VG9A 2RS31 5IFPA 1RITA 1TEIA 4IEYA 3BGAA 1C8M3 2WZR1 3S5QA 3UGHA 2E63A 3DKWA 2W95A 4QB2A 1JZ2A 1KRIA 3AKSA 4HL0A 4XW3A 2IXIA 2MNGA 1RUOA 1W6NB 1HW5A 4AEKA 2VW1A 2MHFA 4BQ3A 3AYAA 4EN7B 2XJQA 1QY4A 2HWB3 3AMHA 5DAVA 4BMEA 4GD4A 1O5LA 1ZM1A 5FYUA 4Q4V3 2J1TA 2YG0A 3TYJA 4O7XA 2QCSB 2JDKA 3TB0A 1UOJA 2WT1A 1UNBA 1GZ9A 1MS8A 4CPBA 1F9KA 1S2EA 4CCCA 4LUMA 1XJAA 5FLIA 4LR4A 4YM2A 2LW8A 2AUYA 1RUC3 3I3EA 1YIPA 1UZVA 4UW5A 3J4UH 3ORJA 3AMNA 4XFFA 1U5ZA 4UW3A 4QD2A 3TWIA 3Q9OA 2HWB2 1ASJ1 5FBZA 4FAHA 3LE0A 3WQ1A 4LO8A 2OKXA 3OPWA 5FZBA 4YSFA 1N1YA 3ZIWA 5GLWA 1VBB3 4MV2A 3N3HA 1W6PA 3DN7A 4BLJA 3ZKYA 1SDWA 4FPHA 3HT1A 3U4SA 3WQ0A 3NAPA 1H30A 1SDDB 1W03A 2C9KA 4WM7C 1ZRFA 3AYDA 2VL4A 4DINB 4TSVA 2GC1A 2JWPA 1RUD3 1C8M1 1RUJ3 1W6OA 1Y3TA 2PN5A 4QXCA 4HN1A 1Q5OA 3OBTA 3ZN4A 4XACA 2C26A 3ZN5A 3PMSA 2LROA 2RV9A 5FZKA 5FZHA 3WNXA 1K5MA 1K5JA 2WA3A 1ZZ6A 2HWB1 1W9FA 1OQDA 1SG3A 2VECA 4Z8BA 5F7UA 2X09A 3LF7A 3OYWB 1VBB2 1N3OA 1S0EA 2WLPA 4Q4V1 4EWDA 1CR7A 3W59A 3AJZA 4GIQA 1V6OA 2VZOA 1H6XA 2FCUA 2WLQA 2DCJA 5IVCA 2A6XA 4YWAA 3LPGA 2GP5A 4KU8A 5FPUA 1UMZA 3T0DA 2ZX3A 5K4LA 1IG0A 2A6VA 4CDUA 1RUD2 1LHOA 1NA1B 1C28A 1RUC1 2VZRA 3ZN6A 4Q29A 1PMHX 1R092 3VBRC 2B45X 2PHDA 3NNJA 4W6YA 4DUVA 3WF2A 3VB9A 4UF0B 3DF0A 2XBO3 1W6QB 4BLIA 2UU8A 2BERA 1JXNA 1NLSA 1I1EA 1VBB1 3WG3A 4K3UA 4N9HA 4EZHA 5FZFA 1URXA 2Z69A 5JAXA 2J1EA 4Y22B 2J1VA 4CP9A 1LOFC 2CYFA 1JYCA 1VJ2A 4R52A 1RC6A 1JUIA 1KQRA 3RZGA 1GP6A 4KBZA 1CQ9A 5A3OA 3VL8A 4YZ5A 1RUD1 1RUJ1 5FRAA 2ATFA 2OQ7A 2IVJA 5CVRA 4JHTA 2BGCA 4IESA 4MHRA 1QWRA 2LM3A 2QQKA 2R0HA 5GLZA 3X29B 3PJQA 5K0UC 2IWGB 2XBO2 4AI3A 4DXZA 2ZABA 5A3TA 3RZZA 1PX3A 2IC1A 2WS92 1EV12 1N1SA 3GJAA 2D43A 4QT6A 3H1MA 4HOOA 5GLVA 3KHCA 2PMWB 4LE3A 5APAA 1QXJA 3K2OA 3QCWA 5GALA 3POGA 3J7HA 4PF5A 1GNZA 5BY5A 4RSUA 1RUG3 1AX1A 1LODA 2VQTA 3ETPA 5GZGA 3LDKA 2D40A 2W3JA 4Y4YA 2FMYA 5KC6A 5KXEA 1S0JA 5LA9A 3FWEA 3FMGA 3BALA 4NVPA 1AR83 1SZBA 3OCPA 4QB6A 1OQ1A 2W5FA 4ZU4A 1C4RA 2XBO1 2ZCWA 3WV6A 4XBNA 1XU2A 4A7KA 1QJU3 3ZKUA 4N43A 2B42B 1SPPB 1KGYA 4X8PA 3MLKA 2YC4A 4LE4A 4HLTA 4CVUA 1JU4A 1PGSA 2PYTA 2HWF2 4GB32 3ZYIB 3JB8A 1AX2A 2XJRA 5FP9A 4Q4W3 2MEV3 2P3IA 3GCXA 3T0BA 4Z07A 4DXRA 2AR6A 3ZSJA 3B01A 4P14A 1WBLA 2D3RA 2O14A 2ZKNA 4F8AA 5FZ8A 3WUCA 3KHBA 2WBKA 3DPRA 5ERLA 2C6SA 1IOAA 3JQWA 1COV3 2JDYA 1FATA 2VR4A 4QPIC 3WX5A 5I8SA 3S7IA 2QQWA 4ITCA 1VBE3 1F15A 2PHWA 4AI9A 1V0AA 4IEUA 1BBT3 3GF6A 3PUHA 2G9GA 1ULGA 4DRRA 1F5JA 1GMMA 4MZUA 5I0RA 1XSRA 2UWAA 1DLCA 5JMCA 4IEVA 3GHNA 3U4XA 1FMD3 1NG0A 1W6MB 2DCYA 4NUBA 4Q4W2 5LW9A 1RUG1 2QQIA 3E5XA 2CAUA 5FJKA 3WNOA 1G86A 1DZTA 3DUIA 4E27A 1ODMA 2ZHLA 3K4DA 5FYTA 1RJ7A 4QQHA 1JYTA 3KS7A 4UAPA 4IGPA 2Z4FA 1AR81 5DPNA 4MX3A 1OUXA 1KJRA 4BISA 1F2NA 1ULCA 1QIQA 1X8EA 3R4UA 4S2DA 1AYN2 2VXJA 4C90A 2Z79A 5FPZA 1QJU1 1VBE2 4P9WA 4AQSA 4XFCA 4QX5A 2Y6KA 3CDZB 4BIOA 1UQXA 1Y4WA 2B7YA 4IEPA 3BIEA 3OB8A 2BUKA 4FOYA 1D0GA 2WWUA 4MXVA 2JKBA 3ZIXA 1LB2A 4RFT0 3AKQA 1CZVA 1W0PA 4I0AA 5GZFA 1RB8G 1YHFA 5LA1A 5EYXA 1LESA 1IZ3A 2B9UA 2H6BA 2ZX4A 1NY72 4Q4W1 2MEV1 1C57A 4NWVA 3I2HA 4NIHA 2J1SA 5FBJA 5IVYA 2I07B 4QPIB 3MFCA 3PVEA 1YFWA 1DQ0A 1AL0G 4OI1A 3E6DA 4P9GA 1W8TA 2ARAA 2XKOA 1COV1 3O1OA 1GANA 1H6YA 5GZCA 4IGQA 2WWSA 1VBE1 2ZGKA 1KJLA 4E2QA 1BBT1 3FX3A 4BQWA 2ZJCA 2FDKA 4KG8A 3JU9A 3RYPA 1GQHA 2XQRA 3C7OA 2OYZA 4I2OA 3T2OA 5C5UA 3BB6A 2EIBA 1FMD1 2OW4A 3RYKA 5LB6A 4MLOA 4D7SA 5K9YA 3I2KA 1GZWA 4L8QA 1NY71 4JKLA 4GWIA 2WC2A 4CEWB 4Y26A 4BJ0A 4GAZA 4LNVA 5A3MA 5KHGA 1ZBA2 4DEVA 1D0HA 5IFTA 1ACCA 1Q43A 3WP5A 3KLSA 3H8OA 1PO12 4HONA 3OBAA 5C33A 1PZ9A 4R9AA 2JIGA 2HYKA 5FZAA 4WVMB 1NOVA 3RZKA 1MS1A 3B7MA 1GWLA 3PHMA 4BIFA 4XAAA 1DQ6A 2YBKA 4PIYA 3NV3A 1B09A 2GALA 5C8CB 4HT1T 4AI0A 3V0AB 3OGGA 1VP6A 1ZNPA 1JMUB 4G9SB 4JTNA 5CNAA 5G05L 3CF6E 4FTEA 1F8VA 1J83A 1GP5A 2B46X 1PVC3 3IM0A 3KV5A 1UYZA 3ZDVA 4QGLA 2WINB 4LKEA 4FOVA 2GDFA 4WM7A 1LHVA 4CSWA 2IXKA 2VCCA 2NPIA 4A6OA 4CDXA 4JGYB 2ET7A 4FOQA 4QGNA 3ZMOA 1NXMA 2H6CA 3M3QA 5ACA3 4CCJA 5C3SA 3ZFGA 1C1LA 3LQCA 1J59A 2BVVA 4ZONA 1XQNA 2QVSB 4CXXA 5FR3A 2VOKA 1KFUL 2JDAA 3NMBA 1POV3 4XF9A 1IG3A 1LECA 4Q4X3 1OF3A 4HETA 5JI7A 2JDHA 4ZS2A 3VZNA 1QDCA 5A1FA 4L97A 5DUUA 3GGLA 3OD4A 4XPVA 3NV2A 3I2JA 5A3PA 4UFHA 5A33B 4JVAA 2Y8KA 1DHKB 4BA6A 3LKJA 4E4DX 4Q0SA 3KWVA 2ZHMA 4AFMA 5J37A 2EALA 1QH6A 1U5IA 4YZ2A 2UYAA 4QDRA 2WYSA 2YV8A 3NV1A 4AVBA 4HKOA 4M01A 4Q4Y3 5J3UA 2XONA 5GM0A 5KHIA 3WP3A 1NE4A 4IGOA 3ITQA 2X05A 2VAUA 4NAMA 4BWOA 4DY5A 2Y6HA 1QJY3 4AQ2A 2RS12 3MICA 1W9SA 1RUNA 1PVC1 4XFIA 4FFHA 2X5IC 4A45A 1QNWA 2VD7A 2QDNA 3M1HA 4LBLA 3ZFEC 3ZSLA 2XDVA 3U37A 1LOFA 2W92A 4AHWA 2QQOA 4LBJA 4PQQA 1OFSA 3NKTA 4BQ5A 1DLLA 2TEPA 3WLUA 3MIHA 1O59A 1WWYA 5DN2A 4YYOA 5L9VA 3NL1A 2R49A 1J1LA 2E31A 2ZMLA 2J42A 2PHTA 2HEVF 5ACA1 3C3VA 4OUSA 5A6QA 1K45A 2ARBA 2XJVA 4LULA 3W58A 2WZPP 1O5UA 4N53C 3USSA 3N7MA 3CO2A 2JDZA 4GULA 3BTZA 5K0UA 1FOD2 3ACHA 1BEV2 1S2BA 4OMDA 4ORFA 3WW4A 1POV1 1QJY2 5HI0A 3FZ3A 4Q4X1 4NN0A 4MO3M 3PUQA 5FK7A 2R063 4XVHA 3VUOA 4YZ1A 1E5HA 2D6MA 3LEGA 3M4FA 4Q5OA 4KU7A 4CU7A 1HDKA 1SCRA 4QPYA 1PK6C 4J1WA 2A71A 1POV0 4TWTA 1U5YA 1YJKA 3FL7A 4B4RA 3O0XA 1KDKA 4TZDA 4K20A 5A6XA 1PIV3 4XBLA 3OJBA 2BTVC 4S2GA 3VLBB 3ENRA 2HWE3 1OXCA 2ZGPA 3PL0A 4Q4Y1 3HNMA 4O61A 1QJX2 2X5IB 4YM0A 3UL2A 4B1MA 1XB9A 1RINA 2ZGSA 2V73A 4QHOA 3ZFEB 1QJY1 1QNYA 4AK3A 2JXAA 1D2SA 1CX4A 2ET1A 3H3LA 3NNFA 4XDOA 4PBPA 3TN93 4DMIA 2V5YA 1BXHA 3KF5A 4B1LA 4CPBD 1UIJA 2IXLA 1JTZX
chains in the Genus database with same CATH topology
3VBSA 3LSDA 2AYHA 2E6VA 1M06G 1PNFA 2PLV2 3TNPB 2BQPA 4AI1A 2I74A 3UK9A 5A32A 3H7JA 1A8DA 5GZEA 2XLGA 2PELA 3WDUA 3USUB 4FQ4A 4SBVA 2PAMA 1H1IA 3CU7A 4AWDA 2W08A 4YGCA 2LUWA 1S1AA 4I02A 4HPKB 4AG4A 2R061 3WP4A 3SITA 3BOPA 5K8SA 5I0SA 1JH5A 1WA4A 5AFBA 3E97A 2XJPA 5FFOC 1QOTA 1PO23 5D8AC 1OSGA 4P9XA 1PIV1 5JCTA 2HWE1 2RS53 2RJLA 1NCRA 3G6JB 4CP1A 1U5XA 1ZRCA 1VR3A 4B29A 2IXJA 4ES9A 3AFGA 3LGRA 1ZZBA 4JGZA 2ZGRA 3VKNA 3TN91 1ND2A 2DVAA 4K40A 4BMBA 2YHJA 1MS3A 3NAPC 1KDMA 1PZ8A 2DTYA 4XJ8A 4RGGA 3D0SA 1UCXA 2A5ZA 5LRSA 1PGL2 1WW7A 2RS52 3VBOA 3B02A 2XHKA 1K5MC 2RMU3 1D4M3 3FE5A 1VBD3 4L9BA 1DGWX 4BYYA 2YUEA 1WD4A 2PA7A 4OHXA 3P3PA 5I91A 1H1AA 1VIWB 3CJIC 2I2SA 1SLBA 3ZYJB 3I4IA 1HRI2 4J1XA 3MIEA 3OTFA 4KH9A 1PO21 4CDUC 5J96B 3AK0A 2CGOA 3VKFC 4Q26A 2RS51 3OF1A 1VBA1 1QF3A 5F5QA 3U11A 2VULA 1W6PB 1UPIA 4IV1A 1RUF3 2C5DA 1VRH2 1X36A 3NAPB 4Y20A 2ZGQA 4I0WB 1RUH3 4HK8A 4FOWA 1W6OB 4M3CF 1BCXA 2R1DA 5FMOL 4NR1A 4YG6A 1CIWA 1ENSA 4YW3A 1K5MB 3C2UA 4F7ZA 1I9RA 4R8HA 1IPJA 3TNQA 5JVVA 2RMU1 1D4M1 1VBD1 1HRV2 4YG3A 4I09A 1DG6A 5JLVA 2GNTA 1QKQA 1DGRN 3IDBB 3VZKA 1RHI2 2AH2A 5JZGC 3QLQA 5K7PA 4Y1ZA 2YY1A 2ERFA 1RJ8A 4CDUB 1MQTA 2FHRA 2PTMA 1DIWA 5LEJA 3ZN6B 3BCWA 1WUVA 4H55A 3B94A 2W0XA 1ENQA 4GQ7A 3O14A 4Q2FA 4AEDA 1UF2C 3JD72 4AI2A 1AYM3 4QHBA 1IS3A 1HLCA 4XJUA 3VBFA 2XPJA 2BYVE 1IQAA 3MZHA 4H3WA 3QH7A 1RUF1 5GZDA 1RUH1 4BHPA 4LBOA 2DUPA 3B5LB 3E6BA 5T55A 4NHMA 4FQZA 3PVOA 1ENXA 3AP6A 2GMEA 4META 4M00A 1DZQA 1AYM2 1EAH2 1GNHA 4GWNA 5BNQA 1QU0A 3MI8A 1W39A 4N7IA 1LGCA 3DPRC 3IDCB 4ZXKA 1J3PA 3BODA 3VDDC 2WFF2 3AP9A 4PLOA 1RL3A 4D7YA 4FT8A 1AVBA 4N53A 2BW8A 4OUMA 3LA7A 4O9GA 4ES8A 3HIFA 4OVEA 1ULEA 2OA2A 4S2HA 1ZZ9A 1AYM1 1X50A 3AZYA 2DCTA 4Q27A 2WNUC 2XLFA 3WQ7A 1PVXA 4WVWA 1PK6A 1QH7A 3VZJA 3WCSA 2P2KA 4N43B 2ZX1A 4E4ZA 3KM5A 1N3PA 2Z2SB 2CL2A 3DGTA 3NV4A 3I2DA 4XBQA 4GMP3 1YFYA 3AZVA 2BVBA 3VBHC 1OD5A 4BE3A 4RS5A 5AC92 1CAVA 3KT1A 1KS5A 5JOYA 3M3CA 3MIDA 3S0MA 3DPRB 1RMU3 1Y7BA 3T2TA 1O4ZA 2ZGMA 4HSJA 3D6EA 5L7OC 1EYBA 2DCZA 4RA0A 3RS6A 4LUKA 1OPMA 4XFAA 3ETQA 1AXZA 2JG9A 4GA9A 1CAUA 4GH4C 1SMVA 1BMV2 1SCSA 1DBNA 1YJLA 4QPGC 4INDA 1DZRA 4COWA 2FZ1A 3WW1A 1RMU2 4SLIA 2DU0A 3MIBA 1ZBE3 5C4WA 4COUA 3VKLA 4XTPA 3SISA 5JOXA 4FPYA 3AFKA 2XKPA 5D8AA 3H50A 4B3NA 5KXCA 3GNEA 4MXWA 2FMDA 2LALA 3WDTA 1DYKA 4GMP1 4NHKA 1V6NA 2E7AA 3VKMA 4XF3A 4XE9A 2ZGNA 4XFHA 4I0BA 2GNDA 1LEDA 1MZEA 3POYA 1ZBE2 1RMU1 4GMP0 5JPNB 1CVNA 4S2FA 5KXBA 1BJQA 4YVWC 1YNAA 5KHKA 2QUOA 4CDXC 2OIIA 1FXZA 2GC3A 5DG1A 4YW4A 1VAKA 4X8NA 2JG8C 2GN7A 2P3JA 3SCFA 3ZFGC 2ZA9A 1RVF2 3JBG2 2XVLA 1R093 4KQ7A 1G9DA 2BNOA 1GZWB 4OHVA 4IXLA 3EQEA 1UU4A 2AZ5A 4RHV2 3CJIA 2VNGA 4LT5A 1WBFA 2QZ3A 5JDBA 1AR73 2PQQA 4COZA 3VN4A 3A0KA 1S0DA 2NYYA 4MGKE 5EXOA 5DG2A 3ZYPA 1XE8A 3M8LA 5L73A 3H9AA 4EN8B 5I93A 2GN3A 2PAKA 2BBVA 4QGMA 4KWKA 1C3HA 2IFRA 1UPSA 5DUXA 2WS93 1EV13 2ZHNA 4K7JA 5DZGA 4WM7B 5GLTA 4EN6B 4ZKTB 1MVQA 3PJYA 5C8WA 1AR72 4CDXB 1DQ5A 1S0FA 2GC2A 3ZFGB 4DFSA 4KNCA 5SV5A 3RMXA 3H8UA 1R091 4EN0A 4C1XA 1GSLA 3KZ4C 4K1YA 2EXIA 2O8QA 3SH5A 3OY8A 3JQXA 5T50A 2YGLA 3AP4A 4G3YC 3FHIB 4ZU5A 5CB7A 3B3QE 5JZGA 1YXWA 1OA3A 1AR71 1VAMA 5E16A 2GMPA 1C5IA 1PZ7A 1PM7A 4GB33 1NQDA 1YFXA 2HWF3 2A6ZA 2CWSA 4X6QB 3WG4A 3VBRB 4PDWA 2XJTA 4M3CE 5HCAA 2ENRA 1NXD1 2D3SA 1H4HA 4KWJA 1G8WA 5T52A 1OA4A 1LCLA 5CADA 3FJSA 4XF1A 3I59A 1MS0A 3IMNA 3H0OA 4MVTA 2RR13 1MEC3 3AJYA 4JV4A 5KBFA 2WS91 1EV11 1XYPA 1ZREA 4A2UA 5J48A 5KHJA 4Y24A 4QMAA 4BCUA 1J1TA 3RMYA 3VBSC 1JYIA 4QQPA 3HAGA 1RUE2 1H2KA 1R1ZA 4XETA 2VH9A 5FO8B 5K0UB 5FMOS 3HBZA 3VL9A 1SBDA 4UW6A 4XOGA 1YI7A 5DXDA 3URFA 2RR12 1MEC2 1AYN3 2GH2A 3MW3A 2A6YA 2DURA 3VDDA 1KS4A 4E9KA 1L3JA 2C9AA 5FPXA 1SEFA 2RJKA 2R072 3ZXJA 1N3QA 4N7UA 4GB31 2HWF1 3KQRA 1S0GA 2D98A 3KB5A 1FNZA 2Q5TA 1LULA 3RI8A 5FQ0A 1GYKA 3AX4A 2YXSA 4E2GA 3ME2A 4OHYA 2WNUA 4I3GA 5CG8A 3NVCA 4COYA 1NCRC 1CPNA 4P9JA 4JQRA 1NQJA 4FTBA 1LENA 1XU1A 1MEC1 2RR11 3JCIA 3RJRA 4CTEA 2CGPA 3I54A 2A3WA 4JGZC 3FLRA 2A70A 3VBSB 3D5OA 3IPVA 1ND2C 5A32B 3VBHA 2XVGA 3HT2A 2Q1ZB 2VMHA 2TNFA 3A0NA 2ZKLA 1SACA 4AHXA 1E57A 4ISRA 2NMOA 1G6NA 3MIFA 4CDQA 3ZPYA 3A4UA 4R9CA 4Q1PA 3VBOC 2A7AA 1ZBA3 4I3PA 4AVSA 5CFDA 3IIAA 1AYN1 5L7OA 3WT3A 1PO13 1IPKA 4AHYA 4C0BA 1CESA 2XWBB 1ND3A 3I7DA 4GH4A 4HANA 3V65A 4NOTA 4QQOA 2YGMA 4QPGA 4YFWA 1OA2A 3ZO0B 1QGLA 2VOXA 3AYEA 1G9BA 4FPCA 1NCRB 4CEYC 2JJ6A 1C5HA 3WVJA 3R4SA 4YRDA 4JGZB 4L11A 3ST7A 4Y5Z0 4IEQA 1SFNA 2WSUA 4A7YA 4B7EA 1ND2B 4IV1C 1NCQC 1S0CA 4Q1RA 4XMIA 2CV6A 4FPKA 5EFUA 3AXEA 4FCAA 1LOCA 2X29A 3VBOB 1F5FA 2ZGOA 5BNOA 1ZZ8A 1CAWA 1ZBA1 3WHUA 4IEWA 2E53A 4OHWA 4YVWA 2C1FA 2IXCA 3BPZA 1C1FA 2ZAHA 1SLLA 4RL7A 1G9AA 1PO11 1MS9A 4YVSC 1BYHA 1EPWA 5I8TA 3B69A 2R6QA 2JG8A 5KXDA 4HK9A 4TLFA 3MW2A 2Q1MA 2DVBA 5T5PA 1MQTC 5EYYA 5BNPC 2WQ4A 1KITA 3SCGA 2RS13 3O7OA 3ECQA 1HIXA 2ZTNA 3OBRA 4AEDC 1LRHA 2YC0A 4E2SA 3TRSB 4IV1B 5FOJB 1X7NA 3VBFC 3GBFA 4Y20B 4AYUA 4IEZA 3ZXEA 4WZCA 4EWAA 4RR3A 3GBWA 4WM8A 5DUWA 1WGPA 3GZTB 1FX5A 4XHXA 2JE9A 3EBRA 2WT0A 4W6WA 5H9PA 1FOD3 1YWKA 2YZ4A 3T1MA 1BEV3 2D7FA 3S7EA 2B8MA 3AP5A 1XE7A 3LSEA 4C1WA 2VPVA 4B4QA 1O3SA 2CAVA 2ZHKA 1GKBA 2UYBA 4QU2A 4Z92B 2HWC2 2Z5WA 2A75A 1H0BA 1JOJA 4Y1VA 3ASIA 1N1TA 3I8TA 3AB0A 1MQTB 4M0NA 4EV0A 2GMMA 1B35A 1GLHA 2ZACA 2X8KA 5E88A 4OULA 4AFAA 1RIRA 1QJX3 2BNNA 2CWMA 3KCCA 1YYNA 4AEDB 3TBDA 2RS11 3UKNA 2SLIA 3VBFB 4YZ3A 4DS0A 4XFGA 5DUVA 2VXRA 2PLV3 1Q8VA 2D5HA 3MIGA 3ALQA 3AZZA 3WZ1A 4GWMA 2XUMA 2A3YA 5L36A 3L9JT 1YI9A 2XG3A 1TME2 4HVQA 1OOPC 1VB4A 4AVTA 4YM3A 4DOUA 1FOD1 1BEV1 4A3XA 2BEOA 4RS5C 3MGUA 5FCCA 1BKZA 3BIWE 4DRVA 1UAIA 3QH6A 4IL7A 2XB6C 1HV0A 3E6CC 2JICA 4N53B 2WL1A 2QKDA 1WCKA 3RG0A 1AR92 2IZWA 1H1MA 5BV6A 2JG9C 5LK5A 1WCDJ 1H8TC 1QJX1 1SLTA 3AP7A 4AGGA 3ZMNA 4JDNA 4XIOA 3AZXA 1LHNA 4DB5A 1O91A 1PK6B 1XYOA 4IQPA 4NWWA 1JUHA 1APNA 5C4WC 5F6KA 1J3QA 1ZZ7A 5CFCA 1CJDA 2PLV1 1IS5A 5IK8A 1ONAA 2PHXA 3ES4A 4R9DA 1BVVA 4LA2A 4XHBA 2UURA 4IEOA 2QE3A 4RS5B 2R32A 1CAVB 4KGGA 4XJAA 2WSVA 1AJKA 3PLQA 5FO9B 3RSJA 4XTMA 1N47A 3R0RA 1ZVFA 2R043 4X6RB 2W52A 2D5FA 1HRI3 4MGZE 3D82A 4CP0A 4HVRA 1TQ5A 4Q8LA 4IV3A 2OZ6A 3WD5A 2JG9B 1CAUB 2RHPA 1ZYBA 3D8CA 4D7TA 1WW6A 2AREA 2ZX0A 4LBQD 3ZSKA 2E51A 2BNMA 3WDXA 4OLLA 5T5LA 1QDOA 2R042 5FO7B 4HZFA 1VRH3 5C4WB 2TUNA 4LLOA 1LGNA 1AL22 3RJ2X 2KM2A 2P37A 4FO9A 5D8AB 4PLMA 1V6KA 3E5QA 4MXWB 1QOSA 4YZ4A 4YGEA 1CPMA 3HN1A 4CEYA 1PGL1 1QOOA 2HWD2 5E89A 4QQLA 3AM2A 3R6SA 2O1QA 1HRV3 1H8VA 4MUVA 1YO8A 1MACA 5FLHA 3IDEA 2K0GA 3KMHA 2CGNA 2R041 1NCQA 1RHI3 3WW3A 1HRI1 2O8OA 3MLLA 1ZRDA 4GXLA 1PGW2 3AKTA 3VKOA 3RYRA 3OD0A 1LOGA 2H0VA 1CD3G 1OHFA 3N35A 3THPA 3ZSMA 4FBFA 1ZX5A 3JD73 3APBA 4RQPA 2UY9A 1V6JA 3CJIB 4Z82A 1FPN2 4YVSA 4PIXA 2WIIB 2EAAA 1VRH1 2VNRA 4AE2A 4CDWC 1HQLA 3SNMA 5IT6A 1SLAA 4XQWA 2ZGLA 4AVCA 3ILNA 2PFWA 5BNPA 3GYDA 5KHHA 1CGPA 4PDWC 3LOIA 1DYPA 1EAH3 2XL9A 2NM1A 4DY3A 4NPRA 4FPOB 4QM9A 1HRV1 1HX6A 4D3WA 1G7YA 1LOAA 4IEXA 3RQ0A 2WFF3 2XL7A 1RHI1 2IFWA 3VZLA 4U2AA 3AZWA 1Z0HA 1MS4A 2WFPA 2PHUA 1IS4A 3ZYRA 4LO7A 4W6XA 3PNAA 2R16A 4EROA 3PVNA 2O0OA 3VBUA 1V70A 3JD71 3OY8B 4OI2A 5JR7B 2B39A 2X53S 5J36A 1UIKA 4G4FA 1R082 4HMZA 4I01A 3U07A 4AGVA 5JZGB 2E7TA 4P9LA 2BPA2 1IS6A 2UWBA 1WMEA 3NW4A 4FXGB 1V6MA 4ZU7A 1WW4A 4JTOA 3PVBB 1PHMA 4AW7A 3FUOA 4OFGA 1AX0A 2JX9A 3ES1A 1REEA 1SBFA 4PDWB 2AENA 1V6LA 2VVFA 5AC93 2LTNA 4B7KA 3I59B 4YLZA 3VZOA 1EAH1 4M0HA 2A6WA 2RM22 5DDJ2 2E9QA 1H2LA 2Q8OA 4L2NA 4YM1A 3ZFFC 3AKRA 4YARA 1O4YA 1SLCA 3LB9A 5ABJA 2WFF1 3EXUA 3ZXLA 1OOPA 1OQEA 5FREA 4GALA 4A7ZA 2D6OX 5CBLA 4ONUA 1FAYA 4IERA 4YGDA 5JOWA 2IXHA 4FVVA 2JENA 4FSJA 4K1ZA 3N4MA 4MSVA 2UY8A 4CDQC 4LO4B 2DFCA 3VDDB 4D69A 1WLCA 2RS32 5J09A 1CAXA 4LBNA 5CFDC 1LTEA 2WZR2 2VMIA 4XIKA 1CJPA 2WKKA 4NHLA 4UXAA 4FTSA 1DGWA 1ND3C 1X33A 5J98B 5FQ0B 1H8TA 1UZYA 5I0UA 4JCKA 2WNUB 5AC91 3AKPA 4TYSA 1REFA 3WHTA 3MYXA 1AF9A 1SQ4A 4HKLA 2VUJA 4AF9A 5T5OA 4EN9B 3IPVB 5AVPA 5GJ6A 1A6CA 2D3PA 3VBHB 2DTWA 2VY0A 5J7MA 1ASJ2 1YLLA 1M4WA 1A3KA 1RVF3 3JBG3 5KWRA 1OPOA 1AXKA 1BMV1 5C9AA 1W2UA 4CDQB 2DUQA 4AHZA 1ULFA 4RHV3 4JDOA 2Y0OA 1TMF3 1KXGA 3WDYA 3ZXGA 1GFF2 5BNOC 5CFDB 3WY6A 1Y9QA 1O3TA 5L7OB 1XXNA 3RI9A 2QJVA 2C0ZA 3KSCA 3ZXFA 2D6PA 1C8M2 2RE9A 1ZZCA 2XLAA 2VW2A 4JRLA 1ND3B 1MR5A 3RNSA 4GH4B 3H3UA 5DZEA 3O0WA 1NA1C 4FXKB 4LBMA 1MVEA 2N7GA 4QPGB 3T1LA 2VOVA 4Q4V2 1WD3A 2WJSA 4WVVA 4YW2A 3H1YA 1TNFA 5D1IA 1SLIA 4XJZA 3ZYGA 4BM8A 2NN8A 1TMF2 1V00A 1I3HA 4FPEA 4O9EA 1Q8PA 1ZBE1 2Y0IA 2XH6A 3G7DA 4HSLA 1UU5A 2YROA 4Z2WA 5T54A 1RUC2 3HMYA 4M3CA 5H9SA 3SLIA 1REDA 3ATGA 3MPPG 4RR3C 4YG0A 1MZ5A 4WM8C 1LU2A 5FDBA 1RVF1 3JBG1 4LBQA 3IN9A 4PCRA 1LU1A 1NYWA 2ZAAA 4JAAA 5BNOB 4AQ6A 3V0BA 1U0AA 1CAWB 4RHV1 1DDLA 1BVP1 3S30A 1TMF1 3M70A 4FPLA 4QXKA 4YVWB 3FC0A 4KBBA 4ASLA 1EY2A 3HWJA 4LO6B 2JECA 2QQPA 1RUJ2 5E1RA 4CRQA 2JG8B 3KT4A 1VLNA 3IBMA 4ATEA 2R0FA 4CZSA 2Y26A 5FOBB 5JI9A 1LOEA 3M3EA 5LK7B 5FAXA 3WOGA 5BNNA 1UKRA 4PJYA 1B35C 2GNBA 3HD8B 1WW5A 1IKQA 4ASMB 3ACLA 2ARXA 4LHKA 1WMFA 4CDWA 2DWRA 4QM8A 1QMJA 5F6LB 3POWA 3LZZA 2H0BA 1H9PA 4RR3B 4WM8B 1RUE3 5F9TA 2R1BA 2PAEA 1R1A3 1UU6A 1LHWA 1AJOA 3AMMA 3H1WA 4Q0QA 3ZXKA 2E7QA 2JEMA 5I0TA 1BQPA 1BK1A 1OLQA 1AR63 2BFUL 2DVDA 1QXPA 1AZDA 4JRAA 5GLUA 3NO8A 3WINE 3CL1A 2R073 1F31A 1IHMA 1C8NA 1XNBA 4R9BA 5CA6A 3IWZA 4L92A 1B35B 1XNDA 1R1A2 1O4TA 5EJ3A 2VUAA 3WP6A 4YGBA 1JHNA 5AVAA 3LAGA 4OHZA 4XXAA 1PNGA 5F1RA 5EV7A 4AVVA 4HN0A 1AR62 3J9SA 2QFEA 1HV1A 2D6KA 1DQ2A 2WNVA 3BU7A 3LA3A 2AGSA 3UKVA 4YW5A 4KGQA 1RUG2 5AFEA 5CFCC 1UD1A 4FAGA 1D4VB 3H7YA 3LA2A 1RUE1 2ETEA 3WXPA 1R1A1 1AR82 4Z1VA 3PMEA 4XF0A 2NLRA 4OZXA 3L2HA 3ZFFA 4LO5B 3HQXA 5GZGA 1QJU2 2D44A 2GU9A 3D4KA 2VGDA 1AR61 1PMIA 1Q8SA 3J26N 3KGLA 3FLPA 3JZVA 4BOWA 3SHRA 2P34A 4AEMA 1UZZA 4AI8A 4XJ9A 4WVZA 1UW8A 2R071 1W6NA 3FBYA 2MEV2 4AFDA 1GV9A 4CP2A 1OFNA 4IV3C 1S2KA 4BZ4A 4ATFA 3UJOA 1V9U3 2EXHA 4CEWC 3ILFA 1COV2 4UBGA 1OLRA 2WT2A 3NSTA 4UBHA 3IKWA 3FBMA 1BBT2 2VW0A 1S0BA 3H3ZA 5HXVA 4EWEA 5B2GB 3GHMA 1NE6A 2DVGA 5CFCB 5FLJA 1FMD2 2CY6A 2YPJA 2Y38A 3EHKA 2DV9A 5C8CC 2NZ9A 3B00A 4R4ZA 4PBOA 3MFAA 1V9U2 1O7FA 2VVEA 3VV1A 3ILRA 3THTA 3MF6A 4JGYC 1WCSA 2EXJA 3S6PA 1AHSA 3WDVA 3ZXDA 3N7LA 4IV3B 1WLWA 3MPBA 5JIUA 1O3QA 2WQZC 2VNOA 2K2SA 5I8YA 1LJ7A 2GAUA 1U12A 1UX6A 2ZMKA 3OYWA 4F3JA 4XZPA 1V9U1 1YFUA 3NWKA 2ES3A 2NQYA 5EWSA 4RQPC 4B4PA 3VHRA 4MH0E 3QBQA 4K8FA