2R043

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 38
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r04300
1VBD3 3JD73 1BEV2 4QPGB 4YVWC 1VBC2 1PVC2 4PDWA 4AEDB 4GMP3 2R073 1RUG3 2FZ2A 2RM23 1PO23 5C4WB 2RR13 1K5MA 1AYM2 2R042 5K0UA 1QQP3 4Y5Z0 5BNPC 4YVSC 1EV12 1ASJ3 1HX6A 1POV3 1BBT3 1HXS2 2HWE1 4FTSA 1PO13 1HRI3 1HQNA 2RS33 1PIV1 5AC92 1NCQA 1QJX2 5DDJ1 1RUH2 2WFF3 3VBUC 3NAPA 4Q4X3 1NCRC 1SMVA 3ZFGC 1ZBE1 4IV3C 1RUD3 2WS91 4NWWA 1QJY3 2PLV1 4RS5C 5GKAC 1AR93 1RVF2 1C8M2 2RS53 1RMU1 1VBC1 1PVC1 4YVWB 4N43A 2BBVA 1FMD2 4GMP0 5L7OC 1RUF2 4Q4V2 2RS12 1H8TB 2BFUS 4QPIC 5JZGC 3JB4C 5A32A 1AYM1 2R041 4CDUB 5ACA2 1EV11 5C9AA 1NA1C 2ZTNA 1HXS1 1POV0 1RHI3 1B35C 5AC91 1QJX1 1VRH2 4Q4Y2 1V9U2 4Q4W1 2X5IA 3VBUB 1NCRB 1PGW1 3ZFGB 4CDWA 4IV3B 1FPN2 2RMU2 4GH4C 2PLV3 1MQTA 4RS5B 1PGL2 1C8M1 2HWD2 2XPJA 1RMU3 1VBC3 4RHV2 3ZFFC 1NOVA 4RR3A 1AR82 4Q4V1 1OOPC 2RS11 4QPGC 1R083 5C8CC 3LOBA 4N53A 5JZGB 1AYN1 4PDWC 5ACA1 1TME2 5ABJA 1AYM3 1D4M2 1EV13 1NY71 1AUYA 1RUJ2 1VRH1 1B35B 5AC93 1V9U1 5K0UC 4GB32 4Q4W3 4NWVA 1AL22 1QJU2 2RMU1 1Z7S2 1RB8G 1RUI3 1NCQC 4GH4B 5BNNA 4CDQA 1C8M3 1AR62 4RHV1 5LK7B 4Y4YA 4WM7B 4RQPC 2HWB3 4Q4V3 1OOPB 1VBB3 1AR72 5C8CB 1VBE2 1AYN3 1CD3G 2XBO2 4PDWB 4SBVA 1H8TC 3ZFEA 1RUJ1 4EJRA 4CDUC 1W39A 4JGZA 3JBG3 1K5MB 4GB31 5K0UB 2WZR1 1AL21 1QJU1 1Z7S1 5J96B 2RMU3 5CFDA 1A6CA 4FTBA 1NCQB 5FMOL 2GSYA 5C4WA 1AR61 2X5IC 1FOD2 3DPRA 3NAPB 2BUKA 2BPA2 4RHV3 4CDWC 1COV2 4LLFA 4RQPB 3VDDA 5D8AA 1BEV1 1AR71 2HWC2 3VBFA 4CEYA 3TN92 1VBE1 3VBRA 2WLPA 2XBO1 2HWF2 4N43B 4RR3C 1RUE2 1RUJ3 1HRV2 5A32B 5ABJC 4GB33 5C9AB 4FTEA 2WZR3 2HWE3 3IDEA 3VBSA 1F8VA 1Z7S3 4IV1A 1PIV3 1RUH1 5DDJ3 1AL0G 4BCUA 1VBD2 1AR63 1X36A 1ND3A 2X5IB 1ZBE3 2WS93 3VBOA 4CDWB 1RVF1 5BNPA 4YVSA 1BMV2 2HWC1 5BNNC 4CDQC 1VB2A 1BEV3 2RM22 1AR73 1PO22 4WM7C 1PVC3 2RR12 1FMD1 2HWF1 1GFF2 1RUF1 1QQP2 1F2NA 4RR3B 1RUE1 1VB4A 1BBT2 2MEV2 5A33A 1HRV1 4N53B 2RS32 5BNOA 2R043 4FSJA 5ABJB 2WFF2 1HXS3 4Q4X2 1ND2A 4Q4Y1 1QJX3 1IHMA 1QJY2 5L7OA 1K5MC 1TMF2 1RUH3 1VBD1 4QPIA 5JZGA 1FPN1 4JGYA 1PGL1 4GMP1 2FZ1A 2HWD1 1BMV1 1RVF3 1NA1A 2HWC3 1PO21 3NAPC 1B35A 5BNNB 3J8F2 4CDQB 2ZZQA 3DPRC 1FMD3 2HWF3 1AR81 1R092 3VDDC 1RUF3 3FBMA 2RS13 5D8AC 2DF7A 3CJIA 1BBT1 2MEV1 1RHI2 1RUE3 4CEYC 1R1A2 2RS31 4N43C 4WM8A 3ZXAC 1RUC2 1TME1 1D4M1 4CDXA 3VBRC 5ACA3 4RFT0 4CEWA 1ZBA2 2WFF1 3VBHA 4Q4X1 1DDLA 5J98B 1VRH3 3ZFFA 4Q4Y3 5CFCA 1V9U3 1TMF1 2PLV2 4QPGA 5C9AC 4AEDA 1RMU2 2TBVA 1FPN3 2BFUL 3VBSC 1X33A 4IV1C 3HAGA 5CFDB 2HWD3 2IZWA 1R082 3J8F1 1VBA2 1ND3C 3S6PA 3DPRB 2R062 3VBOC 1R091 1AR83 1MQTC 3VDDB 1RHI1 5D8AB 1EAH2 2MEV3 1R1A1 2WWSA 1WCDJ 3VBFB 4CEYB 1RUC1 1TME3 1D4M3 1ZBA1 3VBRB 4Q4W2 4N53C 4RQPA 1PGW2 5BNOC 1RUI2 1TMF3 2QQPA 4YVWA 1MEC2 1AL23 1QJU3 1OHFA 1ND2C 3VBSB 2HWB2 1H8TA 4IV1B 1R081 1VBB2 1FOD1 3JD72 1VBA1 3J8F3 1COV1 4CDUA 2R061 1ND3B 1AYN2 4JGYC 5FMOS 2R072 1RUG2 3VBOB 1R093 1MQTB 5BNPB 3TN91 1EAH1 4YVSB 2Y26A 1NY72 1R1A3 1VBE3 1RUC3 2XBO3 3JBG2 1ZBA3 3VBUA 1ASJ2 1NCRA 1QJZA 3ZFGA 4IV3A 3CJIC 1PO12 1HRI2 4RS5A 4WM8C 1RUI1 5A33B 4CDXC 5BNOB 4CEWC 1MEC1 3VBHC 3ZFEC 1CJDA 1RUD2 2HWB1 1ND2B 5CFCC 4JGZC 3JB8A 1OPOA 1AR92 1VBB1 5L7OB 2RS52 3JD71 1FOD3 1VBA3 4QPIB 1COV3 4AEDC 2R071 1RUG1 2R063 5CFDC 4JGYB 2RM21 5C4WC 1NA1B 3TN93 1EAH3 2RR11 2GH8A 1QQP1 3JBG1 1M06G 1ASJ1 1POV1 1PO11 3VBFC 1HRI1 2WZR2 4Z92B 1NG0A 2HWE2 3CJIB 4GH4A 1HRV3 1VAKA 1PIV2 2ZAHA 1C8NA 4WM8B 3M8LA 4CDXB 5DDJ2 4CEWB 4WM7A 1MEC3 1RUD1 3VBHB 3ZFEB 1ZBE2 1QJY1 2WS92 2VQ0A 3ZFFB 1E57A 1OOPA 1AR91 5CFCB 4JGZB 2RS51 5C8CA 5FOJB
chains in the Genus database with same CATH superfamily
1W03A 1VBD3 2VOKA 4XFIA 1K42A 1C1LA 5EJZB 3LEMA 3KZ4C 1BZWA 1HV1A 3CDZB 3T4VA 3UT0A 4A44A 2C9AA 3W21A 1CQ9A 4GMP3 4NN0A 4X6QB 2XJTA 5F39A 3UESA 4TZDA 4GAZA 2R6QA 3GZTB 4IGQA 4QM8A 2VZVA 3V56A 1PO23 2J1SA 2L9LA 2ZX1A 3H50A 5LA1A 2XONA 2JXAA 1C4RA 2FCUA 1RINA 1F5FA 5K0UA 2YB7A 2QQNA 1UYXA 1HX6A 1POV3 3N7KA 3WQ7A 2HWE1 1HXS2 4AI0A 4BE3A 5KXCA 4HN1A 4LIUA 5FZAA 5CYYA 4D6SA 4ZZ5A 1NCQA 5JSOA 1XQNA 2WQZC 3OB8A 5ANQA 5FYSA 4B3NA 3KVAA 4TLFA 1A8MA 1ST8A 2KM2A 2WFF3 4LIVA 4P9XA 4HT1T 1PK6A 1ZRCA 1NCRC 3AYAA 4BQWA 3RI8A 2EF6A 2WKKA 3WVJA 2XDVA 3MW3A 1G9FA 2B5HA 1JZ4A 2XJPA 4RYDA 2XXZA 2RV9A 4KWJA 5A1AA 1N47A 2RHPA 1A8DA 1AR93 3QBQA 3BALA 2QJVA 2DUQA 2AC1A 4WV8A 3J7LA 1PVC1 1YQ6A 3LSDA 4P9IA 3WP3A 4XJ9A 3VHNA 4AEKA 2HEYF 1XYPA 3E6CC 4JC1A 3SISA 4BISA 3NO8A 3PJQA 3SMHA 5E16A 1ZNPA 2YY1A 1XYOA 2JG9C 2QE3A 3LFMA 3ILRA 3KCCA 4N9IA 1Y43B 2BFUS 2DVDA 5F8PA 5FP9A 2A73B 4Q0PA 4QKFA 1AYM1 2MNGA 5ACA2 3O0WA 2WAOA 1EV11 2K46A 5C9AA 5EQUA 5FPVA 3LFIA 5CKNA 1Q8OA 2FDJA 1JN2P 3WQ1A 3FMGA 4QX5A 1LR5A 4AGGA 2ZHNA 4AE2A 4CE8A 4NIGA 4Q4Y2 3O1MA 3LA7A 2BGPA 3IKWA 3PUHA 1UN1A 1W6QA 1XNTA 3OEBA 1UZ0A 3T0DA 1DQ1A 1H2LA 4DB5A 3CU7A 3RWKX 2WRAA 4A7KA 1NCRB 5FP3A 3KD4A 5F3IA 3C7OA 4IE0A 2RMU2 5CVRA 2CGPA 2XWJB 2DBIA 1MQTA 4XJZA 4D8MA 3D0JA 1IPSA 3KQRA 2QKDA 5EP9A 2WC2A 2W1UA 2ZPXA 2DVGA 4XCAA 1OQEA 4Z2AA 1DP0A 3IMNA 3ZSJA 1LNSA 3G6JB 2VNOA 4W6WA 2YU2A 2VUJA 1NLQA 3ACGA 4W4ZA 5J48A 2JG8A 3AP4A 3GALA 4AI3A 1BLZA 4L9BA 3USSA 2JG9B 4N53A 4R9CA 1Q43A 2IXIA 1AYN1 1H2NA 2YC0A 3K3OA 5F5CA 4PDWC 3PL0A 1TME2 3POGA 2AH2A 4QPYA 2ZGLA 3BI3A 3DYOA 5FP8A 1RXGA 3R0RA 4HKOA 3MIEA 3BPZA 5IVEA 2VC9A 3TNPB 3VHOA 4C1XA 2J22A 5FYTA 5AC93 2OYZA 1OBNA 3AP5A 1O5UA 5LA2A 5IK8A 1OD5A 4NHLA 5F5QA 5FZMA 1CAXB 4Q4W3 3WNMA 1GZCA 5DABA 3W59A 4IEZA 3ETPA 4OI2A 3POIA 2PAKA 4FVVA 1VR3A 3MFCA 1UOFA 4ARYA 1PZ7A 1W05A 2YFZA 4BIOA 5BNNA 1BK1A 4MUVA 1C8M3 2WO7A 4E27A 2P17A 1HQLA 4M3CE 4AHXA 1ZRRA 4IEVA 4RHV1 5LK7B 2W94A 5GZFA 1LOBA 2QFEA 3GXUA 4Y20A 3AZYA 2XWBB 3VUOA 2CSGA 1RL3A 4LBMA 2OUJA 2B45X 5T52A 3ASIA 4OQ9A 1ZZCA 3P6BA 4RGKA 2J1TA 4CCEA 1UY4A 2YMZA 3WQBA 1CD3G 2XBO2 2CWMA 3FFZA 1Q5OA 4PDWB 4SBVA 1XU2A 4AHWA 3AVSA 4P5HA 3OBTA 4OMDA 4P9YA 1GQHA 5CISA 2DFCA 1RUJ1 5EYXA 2PQQA 3I7DA 4PIXA 1GNYA 4S2GA 5FZ4A 4EJRA 5FXVA 5LW9A 3KV4A 1VALA 1REFA 4LKDA 3AYEA 1HKDA 4YW5A 1H6YA 3E6DA 3IAQA 3MI8A 3MUY1 3WNLA 4AFCA 5FQ0A 2VZRA 1KQRA 3PURA 1N1SA 4YZ2A 2BGCA 1AF9A 2WA4A 1Z7S1 4ZZ8A 5CFDA 4OUMA 4YW3A 3FUQA 4P9JA 2ZZJA 5BXXA 4K20A 4FTBA 4PF1A 3M2MA 2GSYA 4QDRA 3WNOA 2V09A 1AR61 2A6VA 4A6SA 3AFKA 2NQYA 2YZ4A 5E8AA 4E4DX 3E5UA 3NAPB 4EV0A 1TQ5A 3OUIA 4I01A 3ST7A 1ULFA 2GN7A 4QT6A 1L7QA 4BH9A 1IS3A 1J83A 2HWC2 3WG4A 3MF6A 4D7SA 2D3RA 2ZGPA 1VBE1 1I1EA 1AJKA 2D40A 2D97A 1NE6A 3BTYA 1IPKA 3ECQA 5JI7A 5DAXA 2GMEA 4RR3C 2YXSA 5A3LA 3FLRA 4NHMA 4QD2A 3T1LA 1V6NA 5FY4A 4PLNA 5GZDA 1S1AA 3QOPA 2WIIB 1OLMA 4LORA 3ZM8A 4AVCA 2LALA 1CVNA 1H2MA 4NIIA 1UU6A 4DXRA 3NV2A 4WVVA 4YM3A 4XF3A 3IDEA 2BJSA 4UOJA 4XMAA 1HIXA 1SEFA 3AJYA 1F8VA 5CU1A 2OS2A 2G9GA 3I3MA 2G1MA 2QTWB 4YW2A 1P8JA 2RDNA 3ILFA 4BCUA 3TEWA 4B1MA 3LIHA 2O8QA 1VBD2 4BJ0A 1KFXL 3FL7A 1X8MA 4K9SA 2E31A 3B94A 3FC0A 1J84A 2VJXA 1I3HA 3GBFA 2YGMA 4UFIA 1H0BA 1RVF1 1OA4A 5A3TA 3SH5A 4BZ4A 1QH6A 4COVA 2BNMA 1N1VA 4XDPA 2P34A 3AMHA 3JUUA 1Q8VA 5JLVA 2XKPA 1PO22 5CZKA 4LA2A 2W5FA 3MZHA 1K3IA 4AGRA 1FMD1 2IXHA 1DU3D 1V70A 1RUF1 2W39A 3F2ZA 4HLTA 4RR3B 3RZJA 3KV6A 4IL7A 5BNQA 1O7FA 1K12A 1REDA 2XKOA 3KV9A 1H1AA 1NQJA 4XJUA 1HLCA 5D2AA 4X6RB 3U1XA 1MS9A 4DXZA 1G7YA 2WFF2 2XMLA 1UD1A 3M3EA 1S55A 4XF9A 1ND2A 4LJHA 5FZOA 5JXGA 3T2OA 1PVXA 1IHMA 1Q56A 3KQ4B 3A0NA 5H9QA 5JOYA 1RUH3 2VUAA 4NRQA 2FDFA 3D8CA 1YQCA 4P9WA 2DCTA 4QPIA 2XJVA 3UYJA 3ZSLA 4DEQA 1KRIA 1XNBA 3A23A 3UNPA 4JGYA 2Q0AA 3TEXA 3K46A 3SCGA 2RG4A 4BLIA 1AX0A 2NP0A 2Z79A 1B35A 1UYPA 3BVCA 4NRMA 3VDAA 1V6OA 1CIYA 5JXIA 4RA0A 3IPVB 3MW4A 2K0GA 2HWF3 2XVLA 1DYPA 3MICA 4IEYA 3FBMA 2VCBA 1LESA 2DYCA 1BBT1 4J1WA 2RS31 3ZXAC 2XUEA 1T6GC 5CIRA 1W8ZA 4JTOA 2X10A 4LUKA 4CEWA 1CN1A 4LBOA 5FY1A 2ORZA 2Y6LA 3T2TA 1O8SA 4EWAA 3WG2A 3MIGA 3D3AA 3MHZA 4Q4X1 3PVOA 4CRQA 4AFDA 1HW5A 1CAVB 3OJBA 4JHTA 4N7UA 4IQPA 4PJYA 3WDXA 4N9HA 4IERA 2WO2A 1TNFA 2D44A 5C9AC 1MR5A 3B3QE 4OVEA 4AHZA 4CCNA 1LHVA 5LRSA 4JDMA 2FHRA 4O9EA 4H7LA 4M4PA 1X33A 4IV1C 1IG0A 2W87A 4YPJA 2GNBA 1YFUA 2JB4A 1IPJA 4ZS3A 1MS4A 3RS6A 4W6YA 2B39A 4YGBA 2YV8A 1B09A 1FV3A 1WGPA 3C7EA 3ZXFA 4CA9A 4JQTA 1OQ1A 2P6HA 1T6BX 4P02B 1WW7A 4GULA 4HBNA 1AR83 1MQTC 2C6SA 4FPFA 1WW6A 2HLEA 4RFRB 1GQPA 1WCDJ 1RUC1 4CTEA 3CZJA 4TWTA 3RRDA 5T5JA 1D4M3 4NAOA 2HYXA 1ZBA1 3MPBA 5EIYB 2H6BA 1JZ2A 3OOXA 3ZPYA 1UYZA 2JG8C 3EBRA 2PFWA 4L2NA 4Q4W2 5C3RA 1BQPA 5FY7A 3NWKA 4LQRA 4N53C 4EZ4A 4AGVA 2PQSA 1PGW2 4ZY9A 4A41A 4XHXA 4XEZA 3AX4A 3DF0A 2YBSA 3GJBA 5CKQA 5DXDA 5I0UA 4V2VA 5FV3A 3AFGA 1AL23 1H6XA 1SQ4A 4BQ4A 4TSVA 4YM1A 1NXD1 5FZEA 4FPLA 4IGPA 1A3KA 4LO5B 3RZZA 1GWLA 3VL8A 4FFHA 3ZYIB 1SHWB 5JIUA 4IV1B 1DYKA 1R081 1W6QB 1U5YA 4LO6B 3CNAA 2VUCA 4YNIA 3JD72 2WNUC 1VAVA 5A3WA 1VBA1 3J8F3 4HPKB 3W9AA 3VZKA 2ZMNA 1X8EA 1WCKA 4F83A 2E32A 3I4IA 5LBBA 5KHIA 2VQAA 1RUG2 2XGXA 1R093 5A6YA 2WSUA 3OTFA 1MQTB 1DF0A 1FNZA 1XC6A 2WZEA 3IIAA 5BNPB 2FDIA 1SLIA 4YVSB 4MG2A 2Y6JA 2ZKNA 2VMEA 2RVAA 4RGGA 1QKQA 1DZQA 3RJRA 3B7MA 2WQ8A 1GZ9A 4NPRA 5IJRA 3U78A 2PHRA 1NCRA 4DUVA 3U0ZA 3BTXA 4HSJA 4MHRA 3SHRA 3W58A 2N7GA 4P9GA 1WZXA 3T0AA 3DUIA 4EN7B 1RUI1 3WW3A 2VR4A 4CEYB 1D0HA 4JX0A 4ARXA 4E2GA 4FOYA 1O4YA 4YZ4A 4HK9A 2ZHLA 4K6BA 1RUD2 2UWAA 4XFCA 5IVJA 2VNRA 2YPDA 2HWB1 1ULGA 5FZ7A 2YHJA 2DV9A 4XFHA 5CNAA 3PUIA 1PHMA 1OPOA 4NAMA 3WF4A 4D7YA 1VBB1 2YPJA 5L7OB 4LBJA 1QJEA 1ULCA 1IZ3A 1URXA 3R4DB 1I9RA 2WNUB 4NJ4A 4XUOA 1W0OA 5JMCA 2JDAA 1AZDA 5CFDC 4PQ9A 3WG1A 3OPWA 5CKMA 3GCWA 2HEVF 3DV8A 4QXBA 1FAYA 4K3UA 5H9PA 3V64A 3Q8FA 4MZUA 1NA1B 1W8WA 1XU1A 2DCKA 3FWEA 1EAH3 5HBAA 5T5PA 1SG3A 3OPZA 2KA3A 1CAXA 1QQP1 2AZ5A 5C3SA 1O4TA 3NKTA 2EIBA 3O1PA 3NL1A 2X05A 1HJFA 2BWCA 4BK5A 1PMJX 3ZXEA 3WHUA 2FMYA 3OCPA 3PUQA 2XL9A 5ANNA 1ULOA 3VKFC 4GA9A 1V00A 5FYMA 1PGL1 2EIGA 2VQUA 3T1MA 1MEC3 2BGOA 3WW1A 1QJY1 1ULDA 2ET7A 3QH7A 2BVVA 4UFJA 1E57A 2ZEXA 1F4AA 1VIWB 2V4AA 4PLMA 4XUNA 5FOJB 1I5ZA 1F4HA 2A75A 2B9UA 2MHFA 2O1QA 2D93A 2XB6C 1VBC2 2P37A 1WMEA 4QPGB 5DUUA 4PDWA 3D5OA 2NMOA 3CHXA 3ACIA 1YJKA 2VBBA 5LEJA 2R073 3NV4A 5E89A 2MPFA 3X29B 4UFKA 4BHPA 4D69A 2A5ZA 2RM23 4UW5A 3W5MA 2IWGB 5E1RA 5I8TA 2RR13 1TNRA 4M4RA 4DQAA 2OPWA 2F4LA 5F3GA 4XAEA 1YIPA 1N3QA 3HD8B 2BV4A 3VKMA 1ASJ3 4ZXEA 4AEMA 3MLKA 4D0QA 1UPIA 1PO13 4URAA 1HRI3 3VDBA 5FYCA 3KHCA 1CZVA 2WAAA 1POQA 1V6IA 3CMGA 5DDJ1 5FZCA 4YFZA 1RUH2 3WY6A 3UV9A 3NAPA 3H1MA 1SMVA 4MXWB 4XIOA 4XF4A 4IV3C 1YYNA 4J6GA 2PLV1 1OPMA 4LR4A 5IAVA 4NHKA 1UMZA 3CIHA 1UY2A 5A3PA 2CL2A 4K40A 5J7MA 2RS53 4GXLA 4GJYA 3JZVA 3WDYA 4MX3A 4AW7A 1NZIA 2D6LX 3AYDA 2BBVA 3MLLA 2JENA 3VKNA 3WUDA 4I02A 1QXRA 4GMP0 5FZ6A 3AKRA 5EV7A 4Q1PA 4CUCA 3VZJA 4Q4V2 1BCXA 3V65A 4ES8A 3U14A 1H8TB 3GNEA 3AKPA 2OT7A 4QPIC 5IVCA 2VGDA 3M3QA 3JB4C 4OMCA 3BOWA 5FZGA 3LOIA 2I2SA 4XMIA 4LULA 2E51A 3HR9A 3WHTA 5FK8A 4YW6A 3SEEA 4B7KA 1HXS1 1POV0 1RHI3 1UMIA 5FY8A 1B35C 1FX5A 3NV1A 5T3NA 4BMEA 2Q8OA 4KWLA 1GQGA 4XQ4A 4LBNA 4X8NA 4Y5SA 4QMAA 2JKXA 4L92A 1SCSA 2Q1FA 2XR4A 1GU3A 2GALA 4UW4A 4IV3B 4YGEA 1U12A 3NMBA 4FPYA 1HDKA 1PGL2 1JHNA 3D6EA 1RJ8A 3M4FA 4CXWA 1EY2A 2UWBA 4OLLA 4QAWA 3O1TA 3N9NA 4CZSA 4BWOA 3MFAA 3ELNA 2YUEA 5EJ3A 5A6XA 1OVPA 1NOVA 4RR3A 1IKQA 2CTVA 1AR82 1LEDA 3ES1A 5IVVA 1YFWA 2A3YA 3N36A 2QDNA 2ZACA 4FQ4A 4X8PA 3LOBA 1O3SA 2B9VA 1H1MA 3B5LB 2F17A 3RZLA 4QM9A 5ACA1 4CU6A 1AYM3 1D4M2 4LBQB 3WDTA 1ZRDA 5FY9A 5C7GA 3AL5A 1SLLA 4O9GA 1EV13 1WW5A 4XUTA 1C5HA 1E5HA 3LWCA 4LKEA 1AUYA 3CZUA 5KBFA 1B35B 1JI6A 4TXWA 3ZO0B 2PMWB 4BQ2A 2LW8A 4AI2A 4AHYA 5KHJA 3H3LA 3DKWA 1YQ5A 2AENA 4GB32 4HANA 3ABZA 5FK7A 3OBAA 4LHKA 1GMMA 4MXVA 4NWVA 1AL22 2E63A 2GAUA 2RMU1 3BCWA 3PJYA 4G4FA 5IAXA 1SLCA 3OGGA 4XABA 3WUCA 1A34A 1CAWB 5FPBA 3B9CA 2FMDA 1WW4A 1N3OA 3WF3A 5LB6A 2JICA 2R0FA 5FWJA 5L9RA 4IUGA 4WM7B 2YC4A 1HB1A 3DXTA 2R32A 3EJKA 3NRUA 2G19A 5DQ0A 1JYCA 3C7FA 1O3RA 2J1EA 1W2TA 4LTAA 1JU3A 1AR72 4ISQA 3RPQA 1N1YA 4FOWA 4FOQA 1AYN3 4Y24A 5DAVA 1WCUA 4S2DA 5FZ1A 4N8MA 1SFYA 3ZYBA 1JS9A 4JDNA 3VHPA 4IEOA 3UKTA 1CAVA 1EP0A 3A7QA 5A7PA 3WV6A 1BK0A 2WNEA 3DYMA 2OXBA 3WDWA 3A4UA 4JQRA 3LE0A 5F6KA 2XG3A 3DECA 1SLTA 4C8DA 2FD8A 1XPWA 2G4IA 3HPNA 1S0BA 1QNYA 4JGZA 4K7JA 2WFPA 3AZZA 3B9IA 2W1SA 1K5MB 1AX2A 1FT9A 2WZR1 3PMEA 5DN2A 5FLIA 4BPZA 4BQ3A 2Y33A 4KWUA 4CPBA 1W8HA 4ATFA 3EQEA 4CP1A 1OF4A 1AJOA 2KR2A 4ZS2A 3A0KA 2ZX3A 1UZYA 2Z69A 3KV5A 2WWJA 1F5JA 5C4WA 2ZJCA 1SFPA 4MHUA 4Y1YA 2BPA2 2GMPA 4RHV3 1VMFA 4LLFA 4RSUA 4AQ6A 5B4XA 2RJKA 1OLME 1BEV1 5DG2A 3BYWA 2XHNA 1JXNA 2Q8DA 1WBLA 3NVCA 1D0GA 3ORJA 1W6PB 4IEWA 1BYHA 1WLDA 3BOPA 4OHYA 1W6OB 2XBO1 5A7OA 1IS6A 2QQVA 4N43B 3RG0A 3P3NA 4E4SA 1VMHA 1JYIA 4N90A 1ZX5A 2PHUA 4NPLA 3AXDA 1W8TA 3OUHA 3NSTA 1RUE2 2RDRA 1QU0A 1UOJA 5FZ0A 4Y22B 1RUJ3 3CKHA 5T50A 3ZKYA 1OKOA 1WWYA 1V0AA 3N9LA 4H14A 4NIDA 2DTWA 1O8PA 2W3JA 5I8SA 4META 5A32B 4XQWA 1BVVA 3WCSA 2ZAAA 3JCIA 3LCPA 5A6QA 5ABJC 5ISLA 5K9YA 3WLUA 3S5AA 4MADA 2C24A 4HZFA 1MPXA 5GLVA 5J1XA 4JRAA 1Z7S3 4IV1A 1PIV3 3VZMA 3VV1A 3HBKA 1WKYA 4Z1VA 3ZSMA 2XLFA 3O1VA 1AL0G 3ZN4A 3IDBB 4HPKA 1AR63 1X36A 5KC6A 4BQXA 1ZBE3 4ET7A 1OT5A 1D2QA 2WS93 2ZGTA 4CCKA 1UU4A 1GP5A 2GC1A 3CJXA 5BNPA 5IK4A 4YVSA 4C90A 1BMV2 2HWC1 4DFSA 2RM22 1UY3A 5FP4A 1LECA 1O3TA 1KJRA 4MH0E 1UPSA 2BRTA 1OC1A 4DUWA 2RR12 2ZHMA 2JDHA 3VD4A 4MGZE 4AI1A 1GFF2 4W8JA 4S2FA 4CCLA 3MDPA 4DRVA 1G6NA 4CXYA 4I3GA 1WBFA 2QQWA 2CNAA 3IB3A 4NR1A 2MEV2 2OQ6A 1JYXA 1YCIA 2W2IA 3QCWA 2R043 2ZGOA 5I0SA 1ODMA 4FSJA 4GKYA 3ZSEA 4EWEA 5ABJB 2DUPA 2PHFA 5K4LA 1GP4A 2BYVE 1DIWA 5LWBA 5FYUA 2QZ2A 1W99A 1D4VB 1QJX3 3GDBA 4XBLA 4FPCA 2H0BA 5L7OA 3N7MA 5JSRA 5HCHA 1TMF2 1W9SA 2WLQA 1VBD1 2WNUA 1QY4A 5L73A 2FDHA 1FPN1 1XB9A 1QEXA 1KDKA 4MGQA 1HJGA 1IS5A 1KS4A 1W90A 1Y9QA 3FHQA 4GMP1 4AK3A 2VW2A 2FZ1A 2HWD1 1M4WA 1RVF3 1NA1A 2VD7A 1JUHA 2JD4A 2YU1A 5LK5A 2VUDA 4QQOA 1PO21 2VE1A 3NAPC 1LU1A 2VPVA 3TRSB 5FYIA 1VPHA 1H4GA 3DPRC 2JE9A 1FMD3 3ITQA 2QQKA 2AEYA 3SNMA 4B8EA 3K77A 2X29A 1RUF3 5CB7A 3AK0A 1YRZA 5LCWL 2RS13 2Y6HA 4SLIA 5D8AC 3NNFA 5FZIA 1W2NA 2HJIA 1RHI2 3C8XA 4CEYC 4NHYA 1UYYA 1R1A2 4IETA 4AL9A 4DOUA 3OBRA 2PAEA 1IKPA 2JE8A 3VBRC 1G86A 3ZDSA 2OVUA 2XQRA 3LA2A 3VD7A 1ZZ8A 2WR9A 2WFF1 1S0IA 3LB9A 3T4HB 5J37A 5FAXA 1Q8SA 1GYKA 3N7LA 1DDLA 3VZLA 3U07A 4EE2A 4DPNA 5DUWA 1VRH3 4HVRA 4HG6B 5IK5A 4LITA 1OFSA 3H8XA 1V9U3 3O0XA 2Q5TA 4QX7A 1JZ8A 3TOJA 5KHGA 4YG0A 3AZWA 4QPGA 3ZN6B 5JPNB 5KR7A 4LK6A 2WN2A 3TYJA 5A7WB 3WSOA 4PBOA 2TBVA 3VBSC 2VOXA 3ZXDA 3OPTA 5DPNA 2WNVC 3SKVA 4DINB 3HAGA 3KT4A 4HOOA 3UGGA 3ZSKA 2WBKA 3C7HA 4PF5A 3DKQA 5T5OA 4K1YA 2GN3A 2IZWA 5FYZA 5HCFA 1JZ3A 1EPZA 3HOBA 4GWIA 2D6MA 4XF1A 5JI9A 3S6PA 3AM2A 2XL7A 1ODNA 3DPRB 1OURA 2R062 3VBOC 1V6JA 3ZDVA 1ZZBA 3WXPA 1H2KA 4KBBA 2JDNA 4LO8A 5D8AB 1XBFA 1VJ2A 4Q0QA 1ZM1A 3HWJA 4HK8A 1EYBA 2NMNA 4YW4A 4JAAA 3I2HA 2D6KA 4AWDA 2WYFA 3WOGA 4EN0A 5HI0A 3T30A 1A78A 2GC0A 4Z07A 5T55A 3VBRB 5A3NA 1GWMA 5F9TA 3S7IA 4MXWA 1KXGA 1U5ZA 5A1FA 3OUJA 2QQIA 5HXMA 5F7UA 2VW1A 4KI5M 4H2AA 2OPKA 3ZYFA 3GGLA 4Y1XA 3KCYA 4WVMB 5BNOC 2YROA 2V5YA 3EXUA 3RI9A 2QQPA 2DBNA 5LATA 2QCSB 3POEA 1LODA 1C28A 4AQTA 1QJU3 1OHFA 2QNKA 3KT7A 4UWDA 3RNSA 2WN3A 5JMOA 5AFBA 3VBSB 1CJPA 3ZYJB 1H8TA 2WNVB 5A7NA 1J1LA 2A1XA 3I97A 4A45A 1PMHX 3EYPA 3POSA 3ZVXA 1FOD1 3C3VA 3IM0A 3SEPA 5F3CA 2UWCA 1COV1 2A7AA 3VLBB 3KWVA 2JJ6A 4XAAA 1PNFA 1AYN2 1F9KA 2H6CA 1GSLA 4I0BA 4V2WA 5FY5A 1LGNA 3VBOB 5FMDA 4HN0A 3KGZA 4L0PA 4AI8A 3TN91 1HV0A 1S0GA 2ARAA 5BUVA 1KITA 2Y26A 3BKZA 1NLSA 3MV11 3J9SA 3L2HA 1VAMA 2WABA 4CCDA 1W9WA 3BIEA 1RUC3 1WLWA 2IFRA 3S30A 3V0BB 3H7JA 4Q0UA 1J58A 4QQ2A 4R4XA 5EZWA 1XRUA 4MO3M 3WF0A 3FBYA 5I0TA 1ZBA3 1GP6A 2OQ7A 3RMYA 2UURA 5ERLA 5FYYA 4IV3A 1DGWX 3LA3A 3CJIC 4CU9A 2XOMA 3POYA 5I0DA 4XJWA 2DVFA 4LHLA 4F7ZA 4WM8C 5A33B 4CDXC 3AZVA 4UFMA 4QQLA 5FTTC 1W06A 1CZSA 2D5FA 3BN6A 4BYYA 4OUEA 1QGLA 4D6QA 5BNOB 3BUCA 1OVSA 3VBHC 3RMXA 5FJKA 4OI4A 3I2JA 3IT8A 5G05L 2E33A 2BOJA 3ZYRA 2GU9A 3AKTA 2GDFA 4CSWA 5IYYA 1YUDA 2CDPA 4JGZC 3WW4A 4EWDA 4QHOA 3B00A 5CFCC 1AR92 3K4DA 3VKLA 3WR0A 4MSVA 3JD71 4BU2A 2VU9A 4A3XA 4BB3A 1O3QA 1VBA3 4R9BA 3AKQA 3LQCA 3K51A 4IXLA 5FFOC 4LBQA 4Y4RA 4OZOA 5LA9A 3O0VA 1RUG1 1UW8A 1JODA 1GZTA 3MV01 4AOCA 4HKWA 5FZDA 1DLLA 2GNMA 4KGQA 1ULEA 2GC3A 5C4WC 4ZPIA 3PIJA 1CGPA 1VLNA 2YFUA 2VZQA 3GHMA 3VDCA 1JMUB 2QDRA 5F5AA 4CU7A 5A7QA 4HVOA 1LHWA 4LNVA 4XFFA 1UIJA 1NG0A 3CJIB 5FXXA 3HNYM 1HRV3 2DDUA 1CAWA 1VAKA 1PIV2 1OLRA 1RC6A 2R0HA 2VXJA 2VZOA 2ZAHA 4WM8B 1T2XA 4XFAA 2NPIA 3ON7A 4CDXB 5IHRA 2AYHA 2JDPA 2B46X 4B29A 4WM7A 1LGBA 2E6VA 1RUD1 3NNMA 2QZ3A 3ROUA 3VBHB 1ZBE2 3J4UH 3NJYA 1V6KA 1UL9A 2D5HA 2WS92 3CF6E 5FYHA 4COZA 1PX3A 3ZFFB 2A6WA 1G8WA 4HETA 4AF9A 5CFCB 4JGZB 4RD7A 1IQDC 1HQWA 1W2AX 2W1WA 4H55A 4QX8A 4E2QA 2ARXA 5GZCA 4C91A 1WLTA 2C0ZA 1RIRA 3AMPA 2C5DA 5JAXA 1S0JA 1RXFA 4QXCA 3PDQA 4QB1A 4XE9A 3USUB 1S0EA 3E6BA 4DRRA 5JDBA 1E5RA 3RGBA 4L8QA 2PHXA 3OD0A 4PT6A 4QHBA 4XUQA 1ULPA 3N9QA 5C33A 3H8UA 3U75A 4D7TA 4P14A 5C4WB 2Q8CA 1YHFA 2NN8A 3HQUA 2VNGA 1Y3TA 5H9RA 1K5MA 2R042 4V1PA 1QQP3 3R4SA 1QOTA 1JU4A 3GM8A 4QX0A 3UK9A 3FLPA 4YVSC 4B4RA 4D3WA 4FI9A 5FREA 5BNPC 4CP0A 1ZZ6A 4XJ8A 5F3EA 4DIQA 5AC92 4FQZA 3TEYA 1QJX2 2W46A 4R9DA 1TZOA 4Z82A 3VZNA 1SBDA 1C3HA 5FDBA 5KXDA 4XZUG 2IFWA 3ZFGC 2DCJA 2EICA 1W3VA 2WL1A 1UMHA 2JDKA 4PI0A 1XE0A 1QJY3 5DAWA 5GKAC 3HVDA 2W91A 2IUWA 1RVF2 2D7FA 3MW2A 3OF1A 4UAPA 1C8M2 2VCMA 1W6PA 4QHZA 1ACCA 1RMU1 1VBC1 1W6OA 3H7YA 3NNLA 1X9PA 4N43A 5F2SA 5IWFA 4Q0VA 2WUHA 2BW8A 2VMHA 1FMD2 4PIYA 1WD4A 2C1FA 4AFAA 5L7OC 1RUF2 4DO0A 4U36A 2RS12 2VMCA 2XJUA 4Y22A 3IBMA 5EHDA 4E8CA 1IOAA 1W0NA 2VXRA 1RTVA 1QIQA 2WA3A 1YEWA 3ATGA 3T09A 1H9WA 1OH4A 3GHNA 3T08A 4YZ1A 5A32A 1XE7A 4QQPA 4CDUB 2LRPA 4IEXA 5FO7B 1NA1C 5SV5A 1DQ5A 1QOSA 2VO5A 2ZTNA 4BIFA 3S7EA 4J1XA 2R49A 3U4XA 5FYBA 4WBBA 3RZHA 2Y6KA 1VRH2 2ET1A 3DCQA 1V9U2 2Z4FA 1LRHA 1JW6A 3HJRA 4YM0A 1AXYA 4RL7A 5DZEA 5F1RA 2SLIA 4CP9B 1OQDA 4QKDA 5FPXA 2D6OX 3U37A 3GBWA 4QX3A 3ZFGB 4E4ZA 3LPFA 3EHKA 1R1ZA 3RYPA 4HVQA 1NQDA 4QPWA 1CPNA 4GH4C 4IEPA 2PLV3 5C6CA 3MIDA 2VZUA 4YWAA 2XPJA 4FOVA 3M3OA 5DMYA 2LROA 4B4QA 1SACA 4ZU5A 3ZIXA 3O7OA 1SDDB 3DYPA 3K48A 4YM2A 4Q4V1 4XXAA 5FCCA 1LEMA 4O65A 2W52A 4Z2WA 4QPGC 5C8CC 1JUIA 2R16A 1DLCA 3SH4A 1QXPA 1IS4A 1HB3A 1HB4A 3OGVA 5ABJA 3IWZA 4O61A 3THCA 3VKOA 3J7HA 4C1WA 4Q29A 4D94A 1PZ9A 1UY1A 1JTZX 1NY71 3H3UA 4Q1RA 3KSCA 3QD6A 4LO7A 1WMDA 5C8WA 1JOBA 2EXIA 2HBTA 4ZKTB 2VL4A 1UCXA 5LZ6A 1VP6A 1XXNA 4BOWA 4Q5OA 4DY5A 1QJU2 1RUOA 2VZPA 3PNAA 3I54A 3PIGA 1RB8G 4AAXA 2AEZA 2JDUA 1N1TA 3LSEA 3EMRA 4GH4B 5EWSA 3C7GA 1NXMA 5IUQA 2OKXA 1W9FA 2JKBA 5APAA 3IIIA 4F8AA 3T2PA 1MS5A 2J1AA 2O14A 3U4SA 3RQ0A 5LA0A 1Y7BA 3FE5A 4LE3A 4XIKA 4Y4YA 1XYNA 5DUVA 1PM4A 3I2GA 1GOFA 3HMYA 4BA6A 3M3IA 3KB5A 4LMFA 3ENRA 2VBDA 5FKCA 3AL6A 5JOWA 2ZHKA 1PGSA 2P3KA 5C8CB 2VZTA 1WMXA 2WZPP 5K7PA 2ZBJA 3BU7A 2WO3A 4AQ2A 2VOWA 2UYAA 5FUIA 1ENQA 2Y34A 3K4AA 2EXHA 1H8TC 3ZXLA 1VRBA 1FYUA 4FPEA 1O4ZA 4XZPA 5FZKA 1I6XA 3ZFEA 1NT0A 1JYWA 1UU5A 4YARA 4KNCA 1W39A 1H8VA 2ID4A 1UOGA 4NOTA 3ZN6A 3JBG3 2LTNA 2CAUA 2Y0IA 3L2YA 4QXHA 2VMGA 3QLQA 4GB31 5A7WA 1YFXA 5T54A 4FXKB 1AL21 4M0NA 4MV2A 3MYXA 1ZA4A 3O1RA 4QQHA 3PUSA 1J1TA 4LOTA 1SLBA 2RMU3 1L7RA 4OHZA 3BPSA 2YDEA 3ES4A 2D6NA 4LBLA 5FMOL 5I8YA 3VN4A 5I0RA 5GALA 2DCYA 2WWUA 2X5IC 2ES3A 1W8UA 1ENRA 3LF7A 3DPRA 3PLQA 4CDWC 4XC9A 1S2KA 5BPXA 5DAPA 3NKGA 3LGRA 1PM7A 1LU2A 1OA3A 5D8AA 3ZPOA 1WLCA 2CGOA 1AR71 3IN9A 3FN9A 2DVBA 2KD7A 4CEYA 2ZGSA 3ACLA 4MGTA 2P3JA 1DZRA 1RJ7A 1W9TA 2EXJA 4P08A 3VBRA 2HWF2 4IE6A 1AHSA 4M0HA 3FZ3A 1BVP1 4W6XA 3ZLIA 2JIJA 4YZ5A 3OYWA 5SV8A 4OI0A 3OSDA 4WZCA 3ZXKA 4O7XA 5AVPA 1HB2A 3DXUA 3ZMOA 3MUZ1 4JDOA 5LY1A 1RITA 1BHGA 4M00A 2W9XA 4GWNA 4WVMA 3WX5A 1HRV2 4LK7A 2P3IA 4XVHA 4GQ7A 4AVSA 5FUPA 2WZR3 3BU0A 2HWE3 1DCSA 1LHOA 4Y3OA 5JR7B 1DZTA 5IVYA 2PHLA 2BU9A 5D21A 1O59A 3VBSA 2WNVA 4BQ1A 2JB8A 3I49A 2QBXA 4Y33A 3BTZA 4OULA 5KXEA 1W0PA 2HBUA 4AVBA 1FXZA 4BLJA 4LT5A 4PQQA 5T5LA 2E9QA 5H9SA 2ZOEB 3WNPA 2ZX2A 3MIHA 2ZA9A 2X5IB 2ENRA 4A3ZA 2V5DA 3H1YA 2QQOA 2NZ9A 3VBOA 5FIXA 4CDWB 2IXKA 1LOCA 3RYRA 2Y0OA 1XJAA 2UY8A 3MGUA 4YRDA 1W3XA 3IDCB 3J7MA 4CDQC 3OY8A 1BEV3 1U0AA 2HKXA 4WM7C 1PVC3 2CAVA 3V0BA 2JEMA 5FOBB 3WW2A 3DGTA 2F6BA 4Q8KA 4YSFA 1OMIA 1QQP2 1F2NA 1H30A 2CU5A 3E5QA 1RUE1 1UXZA 1VB4A 4OI1A 4PI2A 4KG8A 1AXKA 4CP2A 5A33A 4JTNA 5I91A 4TTGA 4R4ZA 4IESA 1OI6A 5BNOA 1MZFA 2EIDA 2K9ZA 1JH5A 2RJ2A 5L9VA 3TEZA 1DQ2A 1MS3A 1SBFA 3KS7A 1Q8QA 4PBPA 5FBJA 3RYKA 1MZEA 1IG3A 1SPPB 2JD9A 4FCAA 5IT6A 1QOOA 4Q4Y1 3CBNA 5C70A 1UZZA 1QJY2 4QDQA 1S0DA 4BQYA 4AG4A 1K5MC 3SXWA 1CX1A 4EQVA 5JCTA 3N9MA 2IC1A 4G9SB 3SC7X 2BNNA 3WCRA 2DWRA 5GJ6A 5JZGA 5L9BA 1G9CA 4FP2A 4FPHA 2OW4A 2D3SA 4ZU7A 2BTVC 1J59A 4MOAA 2XQXA 3S57A 1BMV1 2WO1A 4CCCA 2GH2A 4HXCA 5CA6A 3HN1A 2HWC3 5C71A 2B42B 5M0TA 3J8F2 3GZUC 4MGYE 3BIWE 4QWNA 4CDQB 3OGJA 2WSVA 1R64A 1REEA 4URTA 1V6LA 3URFA 2R7EB 1R092 3VDDC 5CAZA 3WDUA 2C9KA 1IGOA 4NMIA 2WT2A 2EAKA 3L9JT 5DZFA 2DF7A 3CJIA 4FFGA 2MEV1 4ATEA 3UGFA 3KVBA 4LKSA 4N43C 4WM8A 1TE1B 1TME1 2JDYA 3U11A 4CDXA 4LE4A 2PXJA 1YNAA 2PN5A 5EFUA 3Q8EA 3NV3A 4A6OA 3SLIA 1W6NB 3PUAA 3Q8CA 3VBHA 1GOHA 4JKLA 3W5NA 4M3CB 1BXHA 1K5JA 2YGLA 3I3QA 3ZFFA 1SCRA 5CFCA 2UU8A 3HT2A 3K2OA 1TMF1 2PLV2 1OA2A 3NW4A 4ISRA 3ZYGA 3POBA 1Y9GA 3S5QA 5C3PA 4DNYA 3CO2A 3H8OA 2Q30A 5LEKA 3T0BA 1FPN3 4L11A 4CUGA 2W68A 2XJQA 3USUA 1MVEA 2WQ4A 5F32A 3SQOA 3HQRA 4HONA 2JWPA 2UYBA 2HWD3 5FXWA 3K3NA 2Z5WA 4BXSV 4FPJA 4AVTA 2WINB 2YYOA 1ND3C 3D4KA 5HCBA 4A7YA 5B2GB 4R52A 2DU0A 5JUVA 3PHMA 2CHHA 5GLWA 4UYBA 1EUTA 3Q8AA 3VDDB 1OXCA 4P00B 1RHI1 2TUNA 2W92A 3M70A 4XFBA 4BM8A 1EAH2 1R1A1 1BJQA 2ORXA 1UZVA 2OZ6A 2VVEA 2WWSA 3HIFA 2ZGKA 3LDKA 4IE5A 3VBFB 3BODA 1GWKA 2EIEA 3MIBA 4EYUA 3MBWA 3N3HA 1LENA 4PLOA 3H0OA 1NLRA 4I0AA 4XBNA 1DQ0A 5GZGA 4RQPA 4LHSA 4AR2A 2VCAA 3QACA 3PVNA 1WCQA 5FPUA 1WA4A 4B4PA 5LY2A 2P2KA 2P1BA 1WD3A 3EO6A 3J26N 4FXGB 4N7IA 1HN1A 1MEC2 4CUBA 3K4ZA 5EJ1B 4F3JA 1XE8A 3RFRA 3F95A 3OBZA 3PMSA 1PMIA 3KT1A 3HBZA 5IK7A 4TYSA 3PTRB 4K1ZA 5DUXA 2IXJA 4NHXA 5D1IA 2ZEWA 3THTA 3ILNA 1QHDA 4LLOA 2BWAA 4A7ZA 1G9AA 4XETA 1YIFA 4CDUA 2ATFA 2R061 1ND3B 4W65A 3FHAA 5FMOS 2R072 4KMQA 1Q3EA 1YI7A 5A3MA 2W1QA 4NROA 3B01A 4B7EA 3G7DA 4XXPA 2XH6A 1UKGA 4ONUA 1NKGA 4Y1UA 4JRLA 5LASA 3N7JA 1W04A 1GR3A 1VBE3 1FI2A 4MGIE 1J3PA 1UXXX 3V0AB 4CP9A 3JBG2 1F35A 2ZX4A 3TWIA 3FHIB 2WYSA 1ASJ2 2WZ8A 3SCHA 3ZFGA 1CAUB 1PO12 3I8TA 1HRI2 5G04L 2YG0A 3MF9A 4NE9A 5JIAA 4WVZA 1KD7A 4RN5A 4MVTA 1LOFA 3OGRA 2ZGUA 4YYOA 4JCKA 4OYUA 1UOBA 4IE4A 5IVBA 1JZ7A 3ZFEC 3VGIA 4CVUA 1CJDA 2A70A 3FFQA 3PTYA 5I93A 5C5TA 1OF3A 2VMFA 4JVAA 4KH9A 2B7YA 2Y8KA 4LEJA 3I3BA 5IATA 2RS52 3T2QA 4Z8BA 3LIGA 1FOD3 1DG6A 3FX3A 3WP6A 2VBPA 1WMFA 1COV3 4AEDC 2VCCA 3I3EA 2JDZA 3CQOA 4UI9L 5IW0A 3MEPA 5FKBA 2NYYA 1FATA 4ZXKA 3TN93 1WA6X 4AVVA 2Q4SA 5FMBA 5JOZA 2X53S 5L36A 3RJ2X 1LHNA 2Y6GA 3KM5A 4S2HA 5KHKA 4ASMB 1L7LA 4XYXA 1M06G 1POV1 2JX9A 1SDWA 5KC5A 1S0CA 2CYFA 1OD3A 2VQTA 3KGLA 4A4AA 2TNFA 2Q1ZB 2WZR2 2HWE2 5FP7A 4AI9A 4YW7A 5GM0A 1JYVA 2PTMA 4GH4A 1KJLA 5FZ3A 2ZGNA 4JHZA 1C8NA 3AMMA 1NUKA 3M8LA 3MPPG 1VMJA 5FPAA 4CPBD 4GKXA 5FXZA 3JQWA 1OUSA 5JPMB 4I09A 3M3CA 3ZFEB 3ZIWA 3O14A 3MLJA 4Y1VA 3ZYHA 3LDBA 4YLZA 3I2OA 3JXSA 1AR91 1WUVA 2C4XA 2BZDA 4DZGA 4YGCA 5C8CA 3KMHA 4IW3A 4QB2A 3JD73 1RYYA 1BEV2 4YVWC 2PHWA 4QU2A 2BQPA 4Y26A 5F37A 1PVC2 2ARBA 1ZVFA 5FPLA 4AEDB 4EROA 1RUG3 1W2UA 2Y38A 5JWPA 5DG1A 3AJZA 1W8NA 1V6MA 3JQXA 1ZRFA 1QXJA 4ITCA 2OX0A 2Z2SB 4HL0A 1LAJA 3HNBM 3POFA 3Q9OA 4KBZA 5GZEA 5KHHA 2FQPA 3O1UA 1AYM2 2FZ2A 4LBKA 4Y5Z0 5LBCA 1W6MB 4UW6A 1EV12 4OFGA 2CV6A 5J09A 1BBT3 5FZ9A 1X82A 4FTSA 2RJLA 3GZAA 4UBGA 1HQNA 4UW3A 2RS33 1PIV1 5C3QA 2ADDA 5F6LB 4UF0B 1GV9A 5L19A 1FNYA 3SCFA 4M01A 1OSGA 1C57A 3VBUC 3OYWB 4CU8A 4Q4X3 3SITA 1MZ6A 2SBAA 1NAEA 1Q8PA 1W8FA 1ZBE1 2JIGA 3HEIA 2EVXA 4Q2FA 1RUD3 2QQMA 2WS91 4NWWA 4CUAA 4RS5C 1S2EA 2PELA 3NJXA 1U5IA 5FZ8A 4HKLA 3MO4A 2VZ1A 5FMCA 1GZWB 2Y60A 4ZHNA 4IGOA 5KXBA 2A3WA 1YXWA 3NQHA 4KG0A 3ZXGA 4XCBA 2J1UA 2P6CA 1DBNA 4YVWB 4KL1A 3I2KA 1ZRIA 3UKNA 4CCOA 3LD8A 1LGCA 2WDBA 4DXSA 4ES9A 2FDGA 3AVRA 3B02A 5JZGC 2GNTA 4OHWA 3K75B 3KCXA 2Z42A 2R041 3I59B 3EB7A 3WNKA 3O1SA 2VTXA 1S0FA 3I2DA 3RZMA 3GJAA 1H4HA 1I5PA 3PU3A 3GZEA 4XDOA 2OA2A 2BOIA 3A21A 4KQ7A 3PU8A 3OY8B 5AC91 4E4HA 1LOGA 1QJX1 3VD3A 2ZGQA 4LUMA 4XURA 4P9LA 4QXKA 4XJAA 1KDMA 2J1RA 3AMQA 3PVBB 2B4KA 4Q4W1 3NNGA 2X5IA 3T3YA 2NLRA 1MS8A 2PYTA 5EPAA 3VBUB 1PGW1 5BV6A 4CDWA 4GWJA 3GCXA 1AXZA 1FPN2 5AVAA 1JZ6A 2ZCWA 4AYUA 1ZZ7A 1N3PA 2AR6A 4RS5B 3UJOA 2FCVA 5J3UA 1C8M1 2HWD2 4UFLA 2GP3A 5FO8B 3UKVA 4CCMA 4MYEA 4PHZA 3NNJA 1MACA 1FV2A 2VULA 1RMU3 1VBC3 1QMJA 4RHV2 2QQJA 1F15A 3ZFFC 1TEIA 5F2WA 4XACA 4XTMA 3AC0A 3VB9A 2JECA 1OOPC 2RS11 2ADEA 1CX4A 1R083 3O12A 4QKBA 2VMIA 4QU1A 3ZN5A 3POWA 5JZGB 3WNXA 3JU9A 3GBGA 2HEWF 4OUSA 3ZMNA 4AAPA 1C5IA 1JYTA 1SPPA 1S4CA 4OQ8A 2XJRA 3LPGA 4INDA 3E97A 5K8SA 4QX2A 4C0HA 5FYVA 2V73A 3ALQA 1Y4WA 4G3YC 1RUJ2 1VRH1 2VNVA 3CLPA 3LZZA 4XDQA 1QF3A 1YWKA 4C0BA 4LPLA 1V9U1 2ILMA 2XHKA 1ALYA 4Q26A 4IEUA 2P5BA 1RGSA 3GF6A 4K8FA 5K0UC 2DCZA 1GNZA 1XNKA 2AGSA 2EXKA 2TEPA 2WT1A 1OH3A 4FAHA 5A6ZA 3KLSA 4FT8A 3ZKUA 2GZWA 3TNQA 5HV0A 1Z7S2 3OD4A 5GLTA 1U5XA 2VH9A 3UGHA 2IXLA 1OLQA 1VE0A 2RDQA 1RUI3 1NCQC 4PCRA 3ZX7A 1UAIA 1ZA7A 1CPMA 2LS6A 3WDVA 4CDQA 5JR2A 1LULA 2HYKA 2EAAA 3TB0A 3I2FA 2F4PA 1AR62 1PK6C 3P5BA 3VL9A 4NPMA 1AX1A 4RQPC 4COYA 1JZ5A 3THPA 4NVPA 1J3RA 2HWB3 3BB6A 4AVAA 4RGAA 2XVGA 3DL3A 1DGRN 2LM3A 4Q4V3 3W20A 1OOPB 1VBB3 2D43A 1YO8A 3R4UA 3R05A 4GALA 2GMMA 2R30A 2ZS6B 1DQ6A 1VBE2 3H1WA 4FPKA 1YQ2A 4EZHA 4AFMA 5IFPA 1ENSA 4NIHA 1W6NA 4KWKA 5JXJA 1WCSA 2Y6FA 2IVIB 1KS5A 3J7NA 4M3CA 4TN7A 3UL2A 4E2SA 2YBPA 3C2UA 4P5YA 4E8DA 2D6PA 5FBZA 1UZWA 2D3PA 5J36A 2BEOA 3SKJE 2OZJA 4CDUC 3H3ZA 1GKBA 1D2SA 2CWSA 2P3YA 2W0XA 4MGSA 5K0UB 4EN6B 1Z0HA 3FJSA 1QJU1 3WQ0A 1J3QA 3B93A 3M1HA 3WG3A 3H42B 1OFNA 4KGGA 5J96B 4LXLA 1DGWA 1A6CA 4L99A 1SFNA 2C26A 4YFWA 1NCQB 4NIAA 4EN9B 1TVGA 3AYCA 2VW0A 5A3UA 4GD4A 3OEAA 2XLGA 1FOD2 3ZR6A 1PK6B 2BUKA 2LUWA 1COV2 5DAQA 4RQPB 1BKZA 5A1LA 3A22A 3VDDA 5CG9A 3LDRA 2Q1MA 2J42A 2A3XA 3AXEA 3ZR5A 3S0MA 1LOFC 4NUBA 3VBFA 1DYOA 3POJA 3PVEA 3TN92 3AZXA 2OUHA 3WEZA 3N9PA 1XSQA 2AREA 2QVSB 2W47A 2WLPA 1GOGA 2I45A 5FJHA 4BK4A 4AZZA 3CL1A 5E6HA 2BNOA 3ZYPA 3AP9A 1XNCA 3RSJA 4DEVA 3FLTA 4DS0A 3LAGA 4BDVB 3ME2A 5FR3A 4XILA 3Q8BA 4H3WA 5CADA 2WT0A 1NX9A 4AEJA 1US3A 1RUNA 1E5IA 2D98A 2PA7A 4GB33 5IVFA 3KF3A 1ENXA 2BP6A 2DURA 4WZFA 5C9AB 1LOAA 4FTEA 2E7TA 1X7NA 2XLAA 1MS1A 2A6YA 2BVBA 2RE9A 2VECA 2OIIA 4OHXA 3N9OA 2AACA 1RUH1 5DDJ3 1ONAA 1CIWA 5FY0A 2QQUA 1YLLA 4ASLA 4CYDA 1ND3A 4I3PA 4ORFA 3VD9A 4UFHA 4JZRA 2K2SA 3R6SA 2G9ZA 3RZKA 1MVQA 1KEXA 5AFEA 3P3PA 1C1FA 4LBQD 1OUXA 5BNNC 1VB2A 3THDA 3WT3A 1AR73 1TG7A 1O6UA 4XQDA 4A42A 1EUUA 2XVKA 3V0AA 2X09A 1KGYA 2HWF1 3CEWA 3OG2A 4GIQA 4DXTA 4OZXA 3LEIA 1UX6A 1XOYA 1UWWA 4B1LA 2DU1A 1CAUA 1EPWA 2J7MA 4GZ9A 2PHDA 1PNGA 4QDSA 4QB6A 2JG8B 2JE7A 4EN8B 1BBT2 1GUIA 2BERA 1CONA 3IDAA 1HRV1 1QJFA 4N53B 3DEMA 2RS32 3GYDA 1STMA 1JOPA 1PX4A 2VOTA 3I3DA 3AMNA 4OCTA 1SZBA 1LHUA 2J1VA 5EYYA 1ZZ9A 4Y1ZA 1HXS3 4Q4X2 5A70A 3RZGA 2ZGRA 4LO4B 2R1BA 4COUA 3HN3A 4UT5A 3ZXJA 5JOXA 3HT1A 2JG9A 4XPVA 1Y9MA 5KWRA 3INAA 4YZ3A 3SH3A 3IAPA 4MLOA 4NRPA 4XTPA 5LRRA 2AUYA 1Z78A 4KU7A 1NYWA 4ZONA 3TAYA 3UJQA 5JVVA 4IE7A 2PAMA 4I30A 2RS51 1DFQA 3TBDA 5FZBA 2IVJA 4FFIA 3O1OA 5LBFA 2DFBA 4L97A 5BNNB 5HPOA 4XBQA 1LCLA 2ZZQA 1QDCA 1W2OA 3LEGA 3RDIA 2BBAA 2XJSA 3O5SA 4FAGA 1AR81 3APBA 3NJVA 3E5XA 3E1F1 5BY5A 1CR7A 5FO9B 3IMMA 1IQAA 1W28A 4Y20B 4BQ5A 1UX7A 5A7SA 2DTYA 1RUE3 5FZLA 4ZU4A 2ZEYA 3M7AA 5C3OA 1RUC2 2QQLA 1D4M1 1GLHA 1HN0A 2R1DA 2VY0A 3AP6A 5ACA3 3WINE 4RFT0 4U2AA 4AQSA 4FO9A 2VTXJ 1GNHA 1ZBA2 2VM9A 4I2OA 1UO9A 5FZFA 4W50A 2A71A 1YC61 3I2IA 4I0WB 5J98B 2IXCA 5GLUA 5JSPA 4Q4Y3 2I74A 2BDRA 2WNOA 5F5IA 3N4MA 4Q8LA 1GANA 1YFYA 5FQ0B 4COWA 2E7AA 3WZ1A 4AEDA 1RMU2 1ZYBA 2DUOA 2RDSA 2BFUL 2JDMA 1S2BA 1CESA 4QGMA 4WVWA 5CFDB 4XFGA 1E5SA 1QNWA 1R082 3J8F1 3OGSA 4IDZA 4AXOA 2Q8EA 1DGLA 1VBA2 1UF2C 3WP5A 4IEQA 5DZGA 4GJZA 4A2UA 1R091 1W6MA 2VG9A 4QGLA 4Q27A 4J25A 1F31A 3WNNA 2EA7A 1YJLA 1UKRA 2MEV3 4JV4A 1XNAA 4UF0A 4GWMA 4UXAA 1NZCA 1K45A 1TME3 3H9AA 3LEKA 4ASKA 3P1IA 1G9DA 1US2A 2QUOA 5HV4A 4TLGA 3WF1A 1QDOA 2VTFA 3QH6A 5FRAA 1H9PA 2CGNA 2ZXQA 4NO4A 2KXLA 3RVHA 4XW3A 1MS0A 2GC2A 3NJZA 3KF5A 4YG6A 5TSWA 5EXOA 4YGDA 1GZWA 4R8HA 1CZTA 5FPZA 4CCJA 1RUI2 2ZABA 1TMF3 2O8OA 3VZOA 5CBLA 4QX1A 2ZGMA 4LA3A 4KU8A 4LOSA 4YVWA 4Y5TA 5E88A 2VZSA 5FZHA 2H0VA 2YC2A 1ND2C 3IZOA 5C5UA 1O91A 1NE4A 2HWB2 1JBCA 1LTEA 3WD5A 1GICA 2W08A 4YG3A 1VBB2 4K8RB 4QKNA 3RWNA 1O5LA 4MGKE 4JKKA 1CWPA 3I59A 2UY9A 4BMBA 2CY6A 1OKQA 1YI9A 2V72A 1DQ4A 2VZ3A 2XUMA 4XHBA 4JGYC 3D0SA 1XNDA 2A6XA 4DY3A 5FWEA 4JKMA 3D82A 5CG8A 2FDKA 1SBEA 1SLAA 5BYNA 1DGRA 5B4NA 1D7PM 4LKFA 1EAH1 1H1IA 5FUNA 5FLJA 1LKNA 2ARCA 1APNA 2EALA 4M3CF 1NY72 4UBHA 1R1A3 3UETA 4FFFA 2A6ZA 3VHRA 2XBO3 1W8OA 3WF2A 2HH9A 3N35A 2ZX0A 3VBUA 4FPOB 4AFBA 1QJZA 3FUOA 1XSRA 2P4EA 3ZOIA 4FP3A 1UY0A 4FBFA 4XF0A 2FCTA 4RS5A 2PHTA 2O0OA 2ZMLA 4R9AA 4YW1A 2VMDA 5HCAA 2X8KA 2Y64A 1UNBA 4CXXA 1JHJA 1KFUL 4CEWC 3DN7A 1MEC1 4LHNA 4DMIA 1LJ7A 3MIFA 2V4VA 2G9FA 3B69A 1ND2B 5FLHA 2DVAA 3JB8A 2VOVA 4HFSA 5FZOB 3WP4A 3HNMA 4K21A 5HXVA 2WJSA 1W9YA 3H8RA 1JOJA 1LB2A 1DHKB 4HMZA 5IFTA 4FPGA 4QPIB 3ETQA 2NM1A 4BXFA 2GP5A 1GBGA 3AKSA 4XOGA 2R071 2R063 2B8MA 4JGYB 2RM21 1MZ5A 2CDOA 3U10A 2RR11 4PIZA 5A80A 1X9TA 2E26A 4Q0SA 2VAUA 2GH8A 3KHBA 4HSLA 2FBEA 2W95A 2ERFA 3HQXA 3JBG1 2GNDA 2ZEZA 2E7QA 5CEHA 1ASJ1 3VD5A 1PZ8A 5GLZA 3BGAA 1PO11 3VBFC 1HRI1 1ZREA 3AB0A 4DUXA 3AP7A 4Z92B 2I07B 1QWRA 1AVBA 2ZMKA 1YQ8A 4OHVA 2VVFA 5JXHA 3ACHA 4E9KA 4XUPA 2VVDA 1LOEA 5DDJ2 3ACFA 1JYNA 1QH7A 5A3OA 4CEWB 4D6RA 2ZKLA 5LBEA 2E53A 3IPVA 2YBKA 4QGNA 1X50A 2VQ0A 1L3JA 3LKJA 1OOPA 1UIKA 4H7MA 2ETEA 1UQXA 3BTAA 1G9BA
chains in the Genus database with same CATH topology
4XFIA 1VBD3 2VOKA 1C1LA 3KZ4C 1BZWA 1HV1A 2C9AA 1CQ9A 4GMP3 4NN0A 4X6QB 2XJTA 4TZDA 2R6QA 3GZTB 3V56A 4QM8A 1PO23 2ZX1A 3H50A 2JXAA 1C4RA 1RINA 1F5FA 5K0UA 1HX6A 1POV3 3N7KA 3WQ7A 2HWE1 1HXS2 4AI0A 4BE3A 5KXCA 4HN1A 1NCQA 5JSOA 1XQNA 2WQZC 4B3NA 4TLFA 1A8MA 2KM2A 2WFF3 4P9XA 1ZRCA 4HT1T 1PK6A 1NCRC 3AYAA 3RI8A 2EF6A 2WKKA 3WVJA 3MW3A 1G9FA 2B5HA 2XJPA 4KWJA 1N47A 2RHPA 1A8DA 1AR93 3QBQA 3BALA 2QJVA 2DUQA 4WV8A 1PVC1 3LSDA 4P9IA 3WP3A 4XJ9A 3VHNA 4AEKA 2HEYF 1XYPA 3E6CC 4JC1A 3SISA 3NO8A 3PJQA 3SMHA 5E16A 1ZNPA 2YY1A 1XYOA 2JG9C 2QE3A 4N9IA 3ILRA 3KCCA 1Y43B 2BFUS 2DVDA 2A73B 4Q0PA 1AYM1 2MNGA 5ACA2 3O0WA 1EV11 5C9AA 1Q8OA 1JN2P 3WQ1A 3FMGA 4QX5A 1LR5A 4AGGA 2ZHNA 4AE2A 4Q4Y2 3LA7A 3IKWA 1UN1A 1W6QA 1DQ1A 1H2LA 4DB5A 3CU7A 4A7KA 1NCRB 3KD4A 2RMU2 5CVRA 2CGPA 2XWJB 1MQTA 4XJZA 3D0JA 3KQRA 2QKDA 2WC2A 2ZPXA 2DVGA 1OQEA 3IMNA 3ZSJA 3G6JB 2VNOA 4W6WA 2VUJA 5J48A 2JG8A 3AP4A 3GALA 4AI3A 4L9BA 3USSA 2JG9B 4N53A 4R9CA 1Q43A 2IXIA 1AYN1 1H2NA 2YC0A 4PDWC 1TME2 2AH2A 4QPYA 2ZGLA 3R0RA 4HKOA 3MIEA 3BPZA 3TNPB 3VHOA 4C1XA 5AC93 2OYZA 3AP5A 1O5UA 5IK8A 1OD5A 4NHLA 5F5QA 1CAXB 4Q4W3 1GZCA 3W59A 4IEZA 4OI2A 2PAKA 4FVVA 1VR3A 3MFCA 1PZ7A 4BIOA 5BNNA 1BK1A 4MUVA 1C8M3 4E27A 2P17A 1HQLA 4M3CE 4AHXA 1ZRRA 4IEVA 4RHV1 5LK7B 5GZFA 1LOBA 2QFEA 4Y20A 3AZYA 2XWBB 3VUOA 1RL3A 4LBMA 2OUJA 2B45X 5T52A 3ASIA 1ZZCA 2YMZA 1CD3G 2XBO2 2CWMA 3FFZA 1Q5OA 4PDWB 4SBVA 1XU2A 4AHWA 4E4ZA 4P5HA 3OBTA 4P9YA 1GQHA 2DFCA 1RUJ1 5EYXA 2PQQA 3I7DA 4PIXA 4S2GA 4EJRA 1VALA 1REFA 3AYEA 1HKDA 4YW5A 3E6DA 3MI8A 4AFCA 5FQ0A 1KQRA 1N1SA 4YZ2A 2BGCA 1AF9A 2WA4A 1Z7S1 5CFDA 4OUMA 4YW3A 3FUQA 4P9JA 2ZZJA 5BXXA 4K20A 4FTBA 3M2MA 2GSYA 2V09A 1AR61 2A6VA 3AFKA 2NQYA 2YZ4A 5E8AA 4E4DX 3E5UA 3NAPB 4EV0A 1TQ5A 4I01A 3ST7A 1ULFA 2GN7A 4QT6A 4BH9A 1IS3A 3WG4A 2HWC2 3MF6A 4D7SA 2D3RA 2ZGPA 1VBE1 1I1EA 1AJKA 2D40A 2D97A 1NE6A 1IPKA 3ECQA 5JI7A 2GMEA 4RR3C 2YXSA 5A3LA 3FLRA 4NHMA 4QD2A 3T1LA 1V6NA 4PLNA 5GZDA 1S1AA 3QOPA 2WIIB 4AVCA 2LALA 1CVNA 1H2MA 1UU6A 3NV2A 4WVVA 4YM3A 4XF3A 3IDEA 4XMAA 1HIXA 1SEFA 3AJYA 1F8VA 5CU1A 2G9GA 4YW2A 3ILFA 4BCUA 2O8QA 1VBD2 1KFXL 4K9SA 1X8MA 3B94A 3FC0A 1I3HA 3GBFA 2YGMA 1H0BA 1RVF1 1OA4A 3SH5A 4BZ4A 1QH6A 4COVA 2BNMA 1N1VA 2P34A 3AMHA 3JUUA 1Q8VA 5JLVA 2XKPA 1PO22 4LA2A 3MZHA 4AGRA 1FMD1 2IXHA 1DU3D 1V70A 1RUF1 2W39A 4HLTA 4RR3B 4IL7A 5BNQA 1O7FA 1REDA 2XKOA 1H1AA 1NQJA 4XJUA 1HLCA 4X6RB 1MS9A 4DXZA 2WFF2 1G7YA 1UD1A 3M3EA 1S55A 4XF9A 1ND2A 1PVXA 1IHMA 1Q56A 3A0NA 5H9QA 5JOYA 1RUH3 2VUAA 3D8CA 4QPIA 4P9WA 2DCTA 3ZSLA 2XJVA 1KRIA 1XNBA 4JGYA 2Q0AA 3SCGA 4BLIA 1AX0A 2NP0A 2Z79A 1B35A 1V6OA 4RA0A 3IPVB 3MW4A 2K0GA 2HWF3 2XVLA 1DYPA 3MICA 4IEYA 3FBMA 1LESA 2DYCA 1BBT1 4J1WA 2RS31 3ZXAC 1T6GC 5CIRA 4JTOA 4LUKA 4CEWA 1CN1A 4LBOA 3T2TA 4EWAA 3WG2A 3MIGA 4Q4X1 3PVOA 4CRQA 4AFDA 1HW5A 1CAVB 3OJBA 4N7UA 4IQPA 4PJYA 3WDXA 4N9HA 4IERA 1TNFA 2D44A 5C9AC 1MR5A 3B3QE 4OVEA 4AHZA 1LHVA 5LRSA 4JDMA 2FHRA 4O9EA 4H7LA 1X33A 4IV1C 2GNBA 1YFUA 1IPJA 1MS4A 3RS6A 4W6YA 2B39A 4YGBA 2YV8A 1B09A 1FV3A 1WGPA 3ZXFA 1OQ1A 1WW7A 4GULA 4HBNA 1AR83 1MQTC 4FPFA 1WW6A 1WCDJ 1RUC1 4CTEA 4TWTA 3RRDA 5T5JA 1D4M3 1ZBA1 3MPBA 2H6BA 3ZPYA 2JG8C 4L2NA 3EBRA 2PFWA 4Q4W2 1BQPA 3NWKA 4N53C 4AGVA 1PGW2 4XHXA 4XEZA 3AX4A 3DF0A 5I0UA 5DXDA 3AFGA 1AL23 1SQ4A 4TSVA 4YM1A 1NXD1 3WW1A 4FPLA 3VL8A 1A3KA 4LO5B 3RZZA 3ZYIB 5JIUA 4IV1B 1DYKA 1R081 1W6QB 1U5YA 4LO6B 3CNAA 4YNIA 5BV6A 3JD72 2WNUC 1VAVA 1VBA1 3J8F3 4HPKB 3W9AA 3VZKA 2ZMNA 1X8EA 1WCKA 4F83A 3I4IA 5KHIA 2VQAA 1RUG2 2XGXA 1R093 2WSUA 3OTFA 1MQTB 1DF0A 1FNZA 3IIAA 5BNPB 1SLIA 4YVSB 2ZKNA 4RGGA 1QKQA 1DZQA 3RJRA 3B7MA 1GZ9A 4NPRA 2PHRA 1NCRA 3U0ZA 4HSJA 3SHRA 3W58A 2N7GA 4P9GA 3DUIA 4EN7B 1RUI1 3WW3A 1D0HA 4E2GA 4FOYA 1O4YA 4YZ4A 4HK9A 2ZHLA 4K6BA 1RUD2 2UWAA 4XFCA 2VNRA 2HWB1 1ULGA 2YHJA 2DV9A 4XFHA 5CNAA 1PHMA 1OPOA 4D7YA 1VBB1 2YPJA 5L7OB 4LBJA 1ULCA 1IZ3A 1URXA 3R4DB 1I9RA 2WNUB 5JMCA 1W0OA 1AZDA 5CFDC 4PQ9A 3WG1A 2HEVF 3DV8A 5H9PA 1FAYA 4K3UA 3V64A 4MZUA 1NA1B 1XU1A 2DCKA 3FWEA 1EAH3 5HBAA 5T5PA 3OPZA 2KA3A 1CAXA 1QQP1 2AZ5A 1O4TA 3NKTA 3NL1A 2BWCA 3ZXEA 3WHUA 2FMYA 3OCPA 2XL9A 3VKFC 4GA9A 1V00A 2EIGA 3T1MA 1MEC3 1QJY1 1ULDA 2ET7A 3QH7A 2BVVA 1E57A 1VIWB 4PLMA 5FOJB 1I5ZA 2A75A 2B9UA 2MHFA 2O1QA 4QPGB 2D93A 2XB6C 1VBC2 2P37A 1WMEA 5DUUA 4PDWA 3D5OA 2NMOA 1YJKA 5LEJA 2R073 3NV4A 5E89A 2MPFA 3X29B 4BHPA 4D69A 2A5ZA 2RM23 4UW5A 2IWGB 5E1RA 5I8TA 2RR13 1TNRA 4DQAA 1YIPA 1N3QA 3HD8B 3VKMA 1ASJ3 4AEMA 3MLKA 1UPIA 1PO13 1HRI3 1V6IA 5DDJ1 4YFZA 1RUH2 3WY6A 3UV9A 3NAPA 3H1MA 1SMVA 4MXWB 4XIOA 4XF4A 4IV3C 1YYNA 4J6GA 2PLV1 1OPMA 4LR4A 4NHKA 1UMZA 5J7MA 2CL2A 4K40A 2RS53 4GXLA 3JZVA 3WDYA 4MX3A 4AW7A 2D6LX 3AYDA 2BBVA 3MLLA 2JENA 3VKNA 3WUDA 4I02A 1QXRA 4GMP0 3AKRA 5EV7A 4Q1PA 3VZJA 4Q4V2 1BCXA 3V65A 4ES8A 1H8TB 3GNEA 3AKPA 4QPIC 2VGDA 3M3QA 3JB4C 3BOWA 3LOIA 2I2SA 4XMIA 4LULA 2E51A 3HR9A 3WHTA 4B7KA 1HXS1 1POV0 1RHI3 1B35C 1FX5A 3NV1A 5T3NA 4BMEA 2Q8OA 4KWLA 1GQGA 4XQ4A 4LBNA 4X8NA 4QMAA 4L92A 1SCSA 2GALA 4UW4A 4IV3B 4YGEA 1U12A 4FPYA 1HDKA 1PGL2 1JHNA 3D6EA 1RJ8A 3M4FA 1EY2A 2UWBA 4OLLA 4CZSA 4BWOA 3MFAA 3ELNA 2YUEA 5EJ3A 1NOVA 4RR3A 1IKQA 2CTVA 1AR82 1LEDA 3ES1A 1YFWA 2A3YA 3N36A 2QDNA 2ZACA 4FQ4A 4X8PA 3LOBA 1O3SA 1H1MA 3B5LB 4QM9A 2ETEA 5ACA1 1AYM3 1D4M2 4LBQB 3WDTA 1ZRDA 4O9GA 1SLLA 1EV13 1WW5A 1C5HA 3LWCA 1AUYA 5KBFA 1B35B 3ZO0B 4AI2A 4AHYA 5KHJA 3DKWA 2AENA 4GB32 4HANA 4LHKA 4NWVA 4MXVA 1AL22 2E63A 2GAUA 2RMU1 3BCWA 3PJYA 4G4FA 1SLCA 3OGGA 1CAWB 3B9CA 2FMDA 1WW4A 1N3OA 2JICA 2R0FA 4WM7B 2R32A 3EJKA 1JYCA 1O3RA 4LTAA 1AR72 4ISQA 3RPQA 1N1YA 4FOWA 4FOQA 1AYN3 4Y24A 4EWEA 4S2DA 1SFYA 4JDNA 3VHPA 4IEOA 3UKTA 1CAVA 1EP0A 3WV6A 2WNEA 3WDWA 3A4UA 4JQRA 5F6KA 2XG3A 1SLTA 2G4IA 1S0BA 1QNYA 4JGZA 4K7JA 2WFPA 3AZZA 3B9IA 1K5MB 1AX2A 1FT9A 2WZR1 3PMEA 5FLIA 4BPZA 4ATFA 3EQEA 4CP1A 1AJOA 3A0KA 2ZX3A 1UZYA 2Z69A 1F5JA 5C4WA 2ZJCA 4Y1YA 2BPA2 2GMPA 4RHV3 4LLFA 4RSUA 4AQ6A 2RJKA 1BEV1 5DG2A 1JXNA 1WBLA 3NVCA 1D0GA 4IEWA 1W6PB 1BYHA 1WLDA 3BOPA 4OHYA 1W6OB 2XBO1 1JYIA 1IS6A 4N43B 3RG0A 4E4SA 3P3NA 4N90A 1ZX5A 2PHUA 3AXDA 3NSTA 1RUE2 1QU0A 4Y22B 1RUJ3 5T50A 4H14A 2DTWA 3WCSA 5I8SA 5A32B 4META 5ABJC 4XQWA 1BVVA 2ZAAA 3JCIA 3LCPA 5K9YA 3WLUA 4HZFA 5GLVA 4JRAA 1Z7S3 4IV1A 1PIV3 3VZMA 3VV1A 4Z1VA 3ZSMA 2XLFA 1AL0G 3ZN4A 3IDBB 4HPKA 1AR63 1X36A 5KC6A 1ZBE3 1D2QA 2WS93 2ZGTA 1UU4A 2GC1A 3CJXA 5BNPA 5IK4A 4YVSA 4C90A 1BMV2 2HWC1 4DFSA 2RM22 1LECA 1O3TA 1KJRA 4MH0E 1UPSA 2RR12 2ZHMA 4MGZE 4AI1A 1GFF2 4S2FA 3MDPA 4DRVA 1G6NA 4I3GA 1WBFA 2CNAA 4NR1A 2MEV2 1YCIA 3QCWA 2R043 2ZGOA 5I0SA 4FSJA 4GKYA 3ZSEA 5ABJB 2DUPA 2PHFA 2BYVE 1DIWA 2QZ2A 1D4VB 1QJX3 4XBLA 4FPCA 2H0BA 5L7OA 3N7MA 5JSRA 1TMF2 2WLQA 1VBD1 2WNUA 1QY4A 5L73A 1FPN1 1KDKA 1IS5A 1KS4A 4GMP1 1Y9QA 4AK3A 2VW2A 2FZ1A 2HWD1 1M4WA 1RVF3 1NA1A 1JUHA 2JD4A 5LK5A 4QQOA 1PO21 3NAPC 1LU1A 2VPVA 3TRSB 1H4GA 3DPRC 2JE9A 1FMD3 3SNMA 4B8EA 2X29A 1RUF3 5CB7A 3AK0A 1YRZA 2RS13 4SLIA 5D8AC 2HJIA 1RHI2 4CEYC 1R1A2 4IETA 4DOUA 3OBRA 2PAEA 1IKPA 3VBRC 1G86A 3ZDSA 2OVUA 3LA2A 1ZZ8A 2WFF1 1S0IA 3LB9A 5J37A 5FAXA 1Q8SA 1GYKA 3N7LA 1DDLA 3VZLA 3U07A 4DPNA 5DUWA 1VRH3 4HVRA 5IK5A 1OFSA 1V9U3 3O0XA 2Q5TA 3TOJA 5KHGA 4YG0A 3AZWA 4QPGA 3ZN6B 5JPNB 3TYJA 4PBOA 2TBVA 3VBSC 2VOXA 3ZXDA 2WNVC 4DINB 3HAGA 3KT4A 3ZSKA 4PF5A 5T5OA 4K1YA 2GN3A 2IZWA 5HCFA 1EPZA 2D6MA 4XF1A 5JI9A 3S6PA 3AM2A 2XL7A 3DPRB 2R062 3VBOC 1V6JA 1ZZBA 3WXPA 1H2KA 4KBBA 4LO8A 5D8AB 1VJ2A 4Q0QA 1ZM1A 3HWJA 4HK8A 1EYBA 2NMNA 4YW4A 4JAAA 4CEYB 2D6KA 4AWDA 4EN0A 3WOGA 5HI0A 1A78A 2GC0A 4Z07A 5T55A 3VBRB 5F9TA 3S7IA 4MXWA 1KXGA 1U5ZA 2VW1A 2OPKA 4Y1XA 3KCYA 4WVMB 5BNOC 2YROA 2V5YA 3EXUA 3RI9A 2QQPA 2QCSB 1LODA 1C28A 4AQTA 1QJU3 1OHFA 2QNKA 3KT7A 3RNSA 5AFBA 3VBSB 1CJPA 3ZYJB 1H8TA 2WNVB 1J1LA 3POSA 3ZVXA 1FOD1 3C3VA 3IM0A 2UWCA 1COV1 2A7AA 3VLBB 2JJ6A 1PNFA 1AYN2 1F9KA 2H6CA 1GSLA 4I0BA 1LGNA 3VBOB 4HN0A 3KGZA 4AI8A 3TN91 1HV0A 1S0GA 5BUVA 1KITA 2Y26A 1NLSA 3J9SA 3L2HA 1VAMA 1RUC3 1WLWA 2IFRA 3S30A 3V0BB 3H7JA 4Q0UA 1J58A 4QQ2A 4R4XA 5EZWA 1XRUA 3FBYA 5I0TA 1ZBA3 3RMYA 2UURA 4IV3A 1DGWX 3LA3A 3CJIC 3POYA 4XJWA 2DVFA 4LHLA 4F7ZA 4WM8C 5A33B 4CDXC 3AZVA 4QQLA 5FTTC 5BNOB 4BYYA 2D5FA 1QGLA 3VBHC 4OI4A 3ZYRA 3IT8A 2GU9A 3AKTA 2GDFA 1YUDA 3WW4A 4JGZC 4EWDA 5CFCC 3B00A 1AR92 3VKLA 3WR0A 4MSVA 3JD71 2VU9A 4A3XA 1O3QA 1VBA3 4R9BA 3AKQA 5FFOC 3K51A 4IXLA 4LBQA 3O0VA 1RUG1 1UW8A 4HKWA 1DLLA 2GNMA 4KGQA 1ULEA 2GC3A 5C4WC 1CGPA 1VLNA 3GHMA 2QDRA 4HVOA 1LHWA 4LNVA 4XFFA 1UIJA 1NG0A 3CJIB 1HRV3 1CAWA 1VAKA 1PIV2 1OLRA 1RC6A 2R0HA 2ZAHA 4WM8B 3RMXA 4XFAA 2NPIA 4CDXB 2AYHA 4B29A 2B46X 4WM7A 1LGBA 2E6VA 1RUD1 3ROUA 2QZ3A 3VBHB 1ZBE2 3J4UH 1V6KA 1UL9A 2D5HA 2WS92 3CF6E 4COZA 3ZFFB 4AF9A 2A6WA 1G8WA 4HETA 5CFCB 4JGZB 4RD7A 1HQWA 4H55A 4E2QA 2ARXA 5GZCA 4C91A 1WLTA 2C0ZA 1RIRA 3AMPA 2C5DA 5JAXA 1S0JA 4XE9A 3USUB 1S0EA 3E6BA 4DRRA 5JDBA 3WUCA 4L8QA 2PHXA 3OD0A 4QHBA 2FZ2A 5C33A 3H8UA 4D7TA 4P14A 5C4WB 1YHFA 2NN8A 2VNGA 1Y3TA 5H9RA 1K5MA 2R042 4V1PA 1QQP3 3R4SA 1QOTA 3UK9A 5BNPC 4B4RA 3FLPA 4YVSC 4D3WA 5FREA 4CP0A 1ZZ6A 4XJ8A 5AC92 4FQZA 1QJX2 4R9DA 4Z82A 3VZNA 1SBDA 1C3HA 5FDBA 5KXDA 3ZFGC 2IFWA 2DCJA 2WL1A 1QJY3 5GKAC 1RVF2 2D7FA 3MW2A 3OF1A 1C8M2 1W6PA 1RMU1 1VBC1 1W6OA 3H7YA 4N43A 4Q0VA 2BW8A 2VMHA 1FMD2 4PIYA 1WD4A 2C1FA 4AFAA 5L7OC 1RUF2 4U36A 2RS12 2XJUA 4Y22A 3IBMA 1IOAA 2VXRA 1RTVA 2WA3A 3ATGA 1H9WA 3GHNA 5A32A 4YZ1A 1XE7A 4QQPA 4CDUB 4IEXA 5FO7B 1NA1C 5SV5A 1DQ5A 1QOSA 2ZTNA 4BIFA 3S7EA 4J1XA 2R49A 3U4XA 4WBBA 1VRH2 2ET1A 1V9U2 1LRHA 1JW6A 4YM0A 1AXYA 4RL7A 5DZEA 5F1RA 2SLIA 1OQDA 5FPXA 2D6OX 3GBWA 3ZFGB 3RYPA 3EHKA 1R1ZA 4HVQA 1NQDA 1CPNA 4GH4C 4IEPA 2PLV3 5C6CA 3MIDA 2XPJA 4FOVA 3M3OA 4B4QA 1SACA 4ZU5A 3ZIXA 3O7OA 3K48A 4YM2A 4Q4V1 4XXAA 1LEMA 2W52A 4Z2WA 4QPGC 5C8CC 1JUIA 2R16A 3SH4A 1QXPA 1IS4A 5ABJA 3IWZA 3VKOA 4C1WA 4Q29A 4D94A 1PZ9A 1JTZX 1NY71 3H3UA 4Q1RA 3KSCA 3QD6A 4LO7A 1WMDA 5C8WA 2EXIA 4ZKTB 1UCXA 1VP6A 1XXNA 4BOWA 4DY5A 1QJU2 1RUOA 3PNAA 3I54A 1RB8G 3LSEA 1N1TA 4GH4B 5EWSA 1NXMA 5IUQA 2JKBA 4F8AA 1MS5A 3RQ0A 1Y7BA 3FE5A 4LE3A 4XIKA 4Y4YA 1XYNA 5DUVA 4BA6A 3HMYA 3M3IA 3KB5A 3ENRA 5JOWA 2ZHKA 1PGSA 2P3KA 5C8CB 5K7PA 2WZPP 2ZBJA 3BU7A 4AQ2A 2VOWA 2UYAA 1ENQA 2EXHA 1H8TC 3ZXLA 1FYUA 4FPEA 1O4ZA 4XZPA 3ZFEA 1I6XA 1UU5A 4YARA 4KNCA 1W39A 1H8VA 3ZN6A 4NOTA 3JBG3 2LTNA 2CAUA 2Y0IA 3L2YA 2VMGA 3QLQA 4GB31 1YFXA 5T54A