3N36A

Erythrina corallodendron lectin mutant (y106g) in complex with galactose
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
242
structure length
242
Chain Sequence
VETISFSFSEFEPGNDNLTLQGASLITQSGVLQLTKINQNGMPAWDSTGRTLYAKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGGGYLGIFNNSKQDNSYQTLGVEFDTFSNQWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILHAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFQASLPETND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lectin
publication title Modification of the sugar specificity of a plant lectin: structural studies on a point mutant of Erythrina corallodendron lectin.
pubmed doi rcsb
source organism Erythrina corallodendron
molecule tags Sugar binding protein
total genus 51
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2010-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3n36A00
4XMIA 2JD4A 2GNTA 4XJAA 5GJ6A 3JU9A 3WG2A 2ZA9A 1LHNA 2ZGOA 2D6PA 1ULDA 4Q27A 3SH5A 1W0PA 1I1EA 4BPZA 1V6IA 4Y20B 3V65A 1F9KA 1W6PB 4XJ9A 1DLLA 2DUPA 2B7YA 4YM3A 3M3EA 2ZKNA 3UL2A 3B9CA 3D4KA 1IS4A 2GMEA 3BOPA 3WVJA 1MS0A 2EIGA 4UW6A 2DVGA 2ARBA 3KM5A 3ZSKA 3IM0A 2ZZJA 4XXAA 1QOOA 4YW3A 4YW2A 4R9DA 3T2TA 3N7LA 2FHRA 1C1LA 4YW5A 5L73A 4LBOA 4LBNA 3ILRA 1LU1A 2PHUA 2ZABA 4XIKA 2ZHLA 1GZWA 3OBTA 3MPPG 3AK0A 3ILNA 3I4IA 2P37A 4YZ1A 3AYAA 3M2MA 3SITA 3WOGA 4K1ZA 4XDQA 4YZ3A 2UWCA 5GZEA 1UX6A 1UAIA 1BJQA 2SLIA 2P34A 2W52A 2C5DA 4P9YA 1IS6A 1G9DA 2WT1A 2AH2A 1G9AA 1BZWA 4WZFA 2OVUA 1MVEA 4YZ5A 4XJZA 5HCAA 1GLHA 3R05A 1APNA 2A6WA 1SBEA 3VKLA 3WV6A 3AZVA 2UU8A 3HN1A 1WLCA 2D6LX 2ZAAA 5JOYA 1W6OB 3SNMA 2WQZC 3V0AB 3FLPA 2FMDA 1V6OA 1LCLA 4LBLA 3UJQA 4M3CF 1CR7A 2A6ZA 1JN2P 4L8QA 4U2AA 1N47A 1DGLA 4DRRA 3AFKA 3WDTA 3WNXA 5DUUA 5IT6A 2ZHMA 3PMEA 1UPSA 3CNAA 1WW6A 4GA9A 1G9CA 4ISRA 1S0DA 1ENSA 1J1TA 1H9WA 2E53A 1PZ8A 2W08A 4GKXA 3WDWA 3NV2A 1H9PA 2RHPA 2ZHKA 1SLAA 1LOAA 3C2UA 1JYIA 1LENA 3WZ1A 1AJOA 4FPLA 1ULCA 4K20A 3VKFC 4XYXA 1W6NA 1Q56A 3FUOA 1KDMA 4ITCA 3AZWA 1HQLA 2JKBA 1AXYA 1ULEA 4NOTA 1QDCA 2ZGRA 5T52A 3AXDA 1PZ9A 1Q8OA 4XJ8A 3WHTA 3FUQA 4AVSA 1W6QA 4Q26A 4FPHA 2BQPA 5CB7A 3PVEA 5GZDA 2YXSA 5GLUA 1LESA 2YMZA 1BXHA 1D2SA 1V6JA 1LHVA 3IPVA 3LCPA 1R1ZA 1Z0HA 2R0HA 3APBA 2VW2A 5E89A 4FPCA 3V0BA 2P3JA 2NZ9A 3WG1A 2ZGSA 1B09A 1JUIA 1KDKA 1Y7BA 3B01A 5DUXA 1MS1A 2EALA 1CVNA 2LALA 3FFZA 1DQ2A 4XMAA 3OYWA 1A78A 2DUQA 1QOSA 4TZDA 1I3HA 5KXEA 2CY6A 3N35A 1GZWB 2W68A 4XJWA 2ZMLA 1GV9A 3IMNA 4NO4A 5CA6A 1FX5A 2WSVA 3AX4A 5IK8A 3RQ0A 1GKBA 1QMJA 4YFZA 2ZMKA 3ZSJA 2C9AA 2CWSA 2DYCA 3N7MA 3AP4A 1N3QA 2D3PA 2CWMA 3WDUA 3ZYRA 4XOGA 4M3CA 2D6KA 3RG0A 2WKKA 2A3XA 3VKOA 1MACA 2GDFA 4W65A 2R0FA 5JOZA 3FBYA 1AX1A 4CZSA 4FPYA 5KXBA 1FV2A 4Y1XA 4P9WA 2UURA 1C57A 1KITA 3I8TA 3A0NA 3W58A 3ZXKA 4YW1A 1IKPA 1IS3A 2AENA 3OBRA 2DVFA 3AZZA 3N3HA 3O0VA 1S0FA 3JUUA 2V73A 3ATGA 3ZVXA 4HANA 1Q8PA 2CYFA 4BLJA 4FOQA 2DVBA 2Q5TA 3BIWE 3AXEA 1Q8SA 2G4IA 2PELA 5T5PA 1ENQA 1LHUA 4YM1A 5EYXA 1MS8A 3QCWA 4U36A 5CAZA 1JYCA 3T1LA 1W6NB 2ZGPA 1RIRA 1YIFA 2A75A 2D44A 3A0KA 3PVNA 1OFSA 4ATFA 5IK7A 1S0JA 3BTAA 1SLBA 2GN7A 1UL9A 3AYEA 2D6MA 4DQAA 2PHRA 1CONA 2ZHNA 1QNYA 1UMZA 2D7FA 1V6MA 1LOFC 3MW4A 1W6QB 4BQ1A 3RS6A 1F31A 1X50A 3ILFA 3OGGA 1DQ5A 2ES3A 5DG2A 2VH9A 4LBKA 2NN8A 3IPVB 4Y1VA 2GNBA 4YG3A 1FAYA 3IN9A 4LBQA 3MW2A 4BLIA 2CL2A 5EWSA 1TEIA 1G9BA 3V0BB 2UWAA 3ZSLA 1MZ6A 2Z42A 5GZCA 2OUJA 1JBCA 2DU0A 4XHXA 4Q8KA 2VU9A 2ZGMA 4SLIA 5GLTA 2AREA 5E8AA 5GLZA 5HCBA 3ZXJA 5IUQA 1Q8VA 1LOGA 3OYWB 2JECA 4YGCA 5DZFA 5JDBA 5DUVA 1LGCA 2A70A 3HR9A 1IS5A 1V6KA 5GLVA 4TYSA 3VV1A 2EXJA 1CN1A 2VUAA 1RITA 3AYCA 5DXDA 3AZXA 3W59A 3TB0A 2OW4A 3GALA 1CIWA 5SV8A 1DQ4A 4LBJA 5AVAA 1ENRA 1H30A 3O12A 1G8WA 1VAVA 1IKQA 5LK5A 1HLCA 3ZPYA 5H9RA 4P9XA 1XQNA 2ARXA 1WBLA 3OJBA 2WNEA 1LOBA 3WHUA 1GNZA 5CBLA 3INAA 2PHWA 4GWMA 1S0EA 5GM0A 2NM1A 4FQ4A 5F9TA 1DBNA 5DUWA 5H9QA 2YROA 3BODA 2I2SA 1FNYA 3D6EA 2DU1A 1UZZA 3USUA 1C4RA 4YG0A 1NLSA 1S0BA 1LEDA 2ZMNA 2HYKA 1YO8A 2EXHA 5H9SA 4PF5A 4XTMA 4YZ2A 5T50A 2UWBA 1YRZA 1AVBA 1O4ZA 1G7YA 2E7TA 3LSDA 3WDYA 4F83A 1LOCA 1WCSA 3V64A 3M3OA 1KJRA 1MR5A 3WG3A 3AJYA 1YXWA 2KM2A 1DQ0A 2P3KA 3AP9A 3PVOA 1GANA 2GMMA 2PHTA 4JC1A 5EXOA 3SISA 4PQ9A 5GZGA 4K1YA 3SLIA 2ZACA 4XZPA 2VXRA 4GWNA 1SLLA 4YFWA 2ZGLA 3OY8A 2PHXA 3N7JA 4KBBA 3ZXEA 1GYKA 4BMBA 4Z8BA 5JLVA 4YGBA 3VKMA 4FPGA 1GNHA 4FPFA 2PHFA 4GKYA 3R4SA 3RMXA 1GBGA 4M01A 1GICA 1BKZA 2SBAA 2ZGUA 1HKDA 4LBQB 5T54A 1D0HA 4Q1PA 1FV3A 3B00A 4WV8A 3WG4A 4Y22A 1W6MA 1V6LA 2DWRA 1VLNA 4ZKTB 4Q1RA 4XBLA 2GN3A 1MS3A 3MW3A 1WLDA 3LSEA 3UJOA 2AUYA 3AZYA 1DYKA 3TAYA 1LULA 2D3RA 1DYPA 4Y1UA 5T5LA 1CJPA 4XE9A 5HCFA 3WDXA 1N3PA 3WCRA 5KXDA 4FOWA 4WVVA 1WUVA 4XXPA 4I30A 1G86A 2GNMA 1WW7A 1BQPA 4UW5A 1FNZA 3QLQA 4H55A 4CRQA 1UKGA 1WW5A 1WD4A 2NMNA 4Y24A 1KJLA 1JOJA 1QF3A 1A3KA 2GMPA 3WCSA 3MEPA 2WLQA 1OKQA 3B3QE 4AGVA 1JHNA 1S1AA 3WDVA 1MVQA 1O4YA 4LBQD 1RINA 3AJZA 5DZGA 1KRIA 1GSLA 2ERFA 4LBMA 3N7KA 1N3OA 1N1VA 2P2KA 4FPJA 4BMEA 2TEPA 1SACA 1DQ1A 2ZGQA 3POYA 4C1XA 5KXCA 1WW4A 3AP5A 2DTYA 3Q9OA 4HL0A 4P14A 1ULGA 2VW0A 1SBFA 3AP6A 3M3QA 2AR6A 4AGRA 1AX2A 1CPNA 1AJKA 4FP2A 1LJ7A 4GXLA 4R9BA 2DVDA 1GZ9A 2ZGKA 3IKWA 4FPOB 3USUB 2WT0A 1LOEA 4M00A 2E6VA 1W0OA 3O0XA 2EF6A 2JDZA 1CESA 1KQRA 1QDOA 2ZGTA 3PJQA 4IQPA 5CNAA 1YYNA 5BYNA 4Y1YA 2ENRA 1QNWA 2R1BA 1V6NA 4FPKA 4YGEA 3FLRA 1EPWA 1C1FA 2V5YA 4FP3A 4GALA 3O0WA 1OQ1A 4XBNA 1QU0A 2WSUA 4FOVA 3SH4A 4FQZA 4BOWA 1N1YA 2D43A 1MS4A 3WUDA 1Q8QA 3OY8B 1IOAA 2DVAA 2NMOA 4RA0A 3UK9A 5FRAA 2JE9A 2XB6C 2YV8A 2YZ4A 2JJ6A 1VAMA 2NYYA 3AP7A 4DRVA 2A71A 4DS0A 5T5JA 1AF9A 1MS9A 1SLCA 5JMCA 5DZEA 5JOXA 2A3YA 1U0AA 2ZBJA 5E88A 1AX0A 4Y22B 1W6MB 3ZXFA 2WT2A 5IK5A 3DGTA 2A3WA 1AXKA 3R4UA 5FREA 2GNDA 1UZYA 1ZM1A 4M3CE 2ZGNA 1AXZA 3O5SA 2GALA 1WBFA 4FVVA 5JVVA 3ZXLA 4AYUA 2R1DA 3ASIA 3WLUA 4D69A 1HQWA 3NV3A 4Y1ZA 4ISQA 1LOFA 1QKQA 4XBQA 1F5FA 4AWDA 1HDKA 3D5OA 4K21A 4BM8A 1LHWA 2JE7A 4PBPA 1ONAA 2P3IA 2A6VA 1FATA 2W39A 2WJSA 4Q8LA 1GZCA 2E51A 4FOYA 1YI7A 4PBOA 4C1WA 2A6YA 1SLTA 3DUIA 1LGBA 4FPEA 3ZSMA 5GLWA 4YLZA 1VIWB 4Y20A 4YM2A 4XIOA 1MZ5A 1DQ6A 1W6PA 1S0CA 4M3CB 1LECA 5T55A 4ASMB 3NV1A 4YGDA 1DIWA 1JW6A 1QOTA 2DV9A 1PZ7A 4UW3A 4ZXKA 1DZQA 1BYHA 4R9CA 5IK4A 1URXA 3FLTA 3KQRA 1SCRA 3NV4A 2EXIA 3NWKA 1CPMA 1WD3A 2EXKA 1QGLA 1LHOA 4RL7A 5EYYA 4MYEA 5T5OA 1ZA4A 2D6NA 5F5QA 3SH3A 3WUCA 2YY1A 1V00A 4JCKA 4AVTA 1AZDA 4WVWA 4XJUA 4XTPA 3OPZA 2A5ZA 2VY0A 2VW1A 3VUOA 3H0OA 5JOWA 3AYDA 5H9PA 4AVVA 2LTNA 1MS5A 3ZYPA 1S0GA 1LTEA 3T1MA 1A8DA 4UW4A 1G9FA 3VKNA 1LU2A 2R49A 2EAKA 5GALA 2AGSA 1DFQA 4YZ4A 1SBDA 4DPNA 1ULFA 2DUOA 5DG1A 2NP0A 3A4UA 4R9AA 1LODA 1UN1A 2CTVA 4PCRA 4XILA 4Y26A 4ATEA 1CQ9A 4Q2FA 5GZFA 3M3CA 3U4XA 2AYHA 4XHBA 4YG6A 3RSJA 1Z78A 3L2YA 1FYUA 2D6OX 4DFSA 3M1HA 4YM0A 1S0IA 1N1SA 2A6XA 1NXD1 1SCSA 2A7AA 1N1TA 2OUHA 3N36A 1W6OA 1LGNA 3GNEA 3V0AA 1LEMA 4YW4A 1WLWA 2R16A 2H0BA 2D3SA 3HMYA 3POWA 4CTEA 4AGGA 1SFYA 2DTWA 3POSA 2E7QA 3ENRA 4JRAA 4OZXA 3RMYA 2DURA 1VALA 1DHKB 2CNAA 1JXNA 1SLIA 2XG3A 3B69A 3RRDA
chains in the Genus database with same CATH superfamily
1RUF1 4XMIA 2Y8KA 5F39A 2HEVF 4UWDA 4AFBA 2Q1FA 4E4SA 3IDBB 1HB2A 5GJ6A 4PDWA 4F83A 2OX0A 1YJLA 5FJHA 4KWJA 2ZA9A 4ZZ5A 1LHNA 1UW8A 3VD3A 1RVF2 3VB9A 2JG9A 3SH5A 3J7NA 2AZ5A 1V6IA 5FV3A 5CADA 3ROUA 1QH6A 4GMP3 1PVXA 1ZVFA 2X5IC 4RS5A 4CP0A 1IPSA 3VDDC 4JHTA 5LW9A 3H42B 4OHYA 4AEDC 3D4KA 4YVWA 2GMEA 1LB2A 3Q8EA 1ASJ1 1MS0A 1LNSA 2ARBA 4COUA 2VOTA 3MV11 3POGA 1OURA 3ZM8A 2GC3A 4MGSA 2C0ZA 2X29A 2VMFA 5LA0A 4D94A 1C8M2 4C0HA 3N7LA 1XYNA 2YG0A 1C1LA 4RYDA 3KD4A 4LO6B 2QVSB 1IPKA 4LBOA 1OFNA 4QHBA 2ZABA 4LE4A 2RDNA 1GZWA 3KF3A 3K46A 4CDXB 4EZHA 4JTNA 1PGW2 4JTOA 1OVPA 2JDUA 2P37A 5K9YA 5CKMA 3M3IA 3BU0A 4ZHNA 1YFYA 4K1ZA 5F3CA 1ND3C 1KEXA 3CJXA 5GZEA 2BBAA 1UAIA 1D4M1 4ZZ8A 4Q0UA 4A45A 3JBG3 1CGPA 2W52A 4AVBA 3RWNA 5FO7B 2AH2A 4A7KA 3HT1A 1G9AA 1BZWA 5FYVA 5K0UC 2R32A 3BVCA 1GLHA 3RVHA 3NQHA 3UKNA 5FZ7A 3VKLA 3FBMA 2AC1A 2J1TA 1WLCA 2WZ8A 1FMD1 2ZAAA 1UYYA 1W6OB 4AFMA 5DDJ2 3VBOB 4IV1C 3AL5A 3LAGA 2BRTA 3FLPA 5CIRA 1LCLA 4LBLA 5FZ0A 3UJQA 1CR7A 2A6ZA 1ZA7A 3H8RA 1DGLA 3WDTA 1I5PA 5DUUA 4PF1A 4RR3B 4A7ZA 3WT3A 1RHI2 3HIFA 4SBVA 3VD5A 1VR3A 3ZIXA 1K3IA 1D2QA 1PZ8A 2QQVA 2YYOA 2VZQA 4FFGA 4G4FA 4OHWA 4QU1A 5DPNA 5A7OA 4CDUA 1OA2A 2HWB1 3C2UA 5DABA 3J8F1 4LUMA 1AYN2 3N9QA 4M4RA 1FPN3 1W6NA 4XYXA 1US3A 4HXCA 4BQ4A 2LM3A 3B5LB 2JKBA 4OHVA 1AXYA 4XUNA 4J6GA 2CHHA 3CZJA 5T52A 4AVSA 1PZ9A 2RDRA 1RUG2 3FUQA 3FN9A 1HB1A 1W6QA 1W8FA 4FPHA 3H8UA 1D4VB 3VHPA 5BNQA 4K7JA 1Q3EA 5GZDA 3VZKA 1LESA 2RR13 1BXHA 1XE7A 4Q4V1 1NT0A 3IPVA 3ZXAC 4FPCA 4PQQA 3V0BA 1ZREA 1PHMA 5CFCA 2ZGSA 3HBZA 1Y7BA 3B01A 5A3UA 1LAJA 1KGYA 2EALA 3OBAA 4YNIA 5C4WB 3CL1A 3OYWA 2WA3A 3R4DB 3OGRA 1QOSA 2DBNA 4G3YC 5KXEA 3BOWA 3WP3A 3ZDSA 5FDBA 1SDWA 2YFZA 4NO4A 5C5TA 4AF9A 1E5IA 2WNUA 5FYIA 3I2HA 2BW8A 4BJ0A 2ZMKA 2HYXA 1OC1A 2HWC2 3AL6A 3DPRA 3KF5A 3KMHA 3ZSJA 3VBHC 2CWSA 5FTTC 3MI8A 5FZLA 3N7MA 3AP4A 4QM8A 5JCTA 5JZGA 3RZZA 2CWMA 3JQWA 5L19A 3U10A 1COV1 3NNMA 2XWJB 4XOGA 3ZYBA 3RG0A 2WNVA 3PU3A 2PLV1 5FY8A 2GDFA 4W65A 2GC2A 5JOZA 3UNPA 3OPWA 3FBYA 5F3IA 2C26A 3JZVA 4H7MA 1FV2A 4Y1XA 5D2AA 4LHSA 2UURA 2X5IB 3VDDB 4UXAA 5K8SA 2WFF2 3VBRC 1IKPA 2XKOA 4XETA 3DL3A 2AENA 2VE1A 3LGRA 2HWD3 4TSVA 4N9IA 3ATGA 1PIV1 2HWF3 3KHBA 3LIGA 3I49A 1FXZA 3T09A 3NNFA 5C70A 3ZFFC 2Z4FA 4BQ3A 4IEOA 2PELA 5C71A 4MSVA 5EYXA 1MS8A 4UYBA 4EQVA 4CU7A 4QM9A 1DU3D 3JB4C 4QDQA 5IJRA 1VB4A 5D21A 4ATFA 4EN6B 1D7PM 1DGWX 3BTAA 4DXTA 2GN7A 1FOD1 4LEJA 5LRSA 3ACHA 1CONA 2VCBA 1ND3B 2JX9A 3A7QA 1UMZA 1PK6C 2D7FA 1LOFC 3ZLIA 1V70A 2VNOA 2W87A 5DG2A 3TN92 2VH9A 3A21A 4LBKA 3U37A 1TNRA 2NN8A 4DB5A 2GNBA 1FAYA 3IN9A 4LBQA 3MW2A 3TBDA 4Z1VA 1TEIA 5K0UB 4ES9A 3RFRA 1A34A 1AR62 4QWNA 1JBCA 2DU0A 4OULA 5EP9A 5HCBA 5B2GB 1OPMA 2ZX1A 5FUPA 1VBC3 5LY1A 4PI2A 4GWJA 2XBO2 3POFA 1B35A 4K3UA 5DZFA 1O4TA 3HR9A 5DUVA 3THDA 5JDBA 5FR3A 3RYKA 1JZ6A 1Y9MA 1RGSA 3AKSA 1F2NA 2BERA 1UCXA 4MO3M 4BISA 4TLGA 3SQOA 1PMJX 2RS52 1KD7A 4P08A 4IETA 3PUQA 3WD5A 2VUAA 1RITA 3ZFEA 3AYCA 5FYCA 1JZ4A 2VZPA 1CX4A 4JVAA 1RUD1 2OW4A 5EJ1B 2R042 4EWDA 2JB8A 2V5DA 1AL23 2EICA 2W1WA 4QQ2A 1VRH1 3U75A 5AVAA 1J3RA 5JPNB 4FAGA 1ENRA 2KXLA 3C7OA 4E2GA 1VAVA 2JWPA 4QB1A 1HLCA 2B46X 5JI9A 5F5IA 1ND2A 2RMU2 4P9XA 3D82A 1XQNA 2ARXA 5C8CC 4HPKB 4YW6A 1IG3A 1TMF2 4MOAA 1V9U2 5CBLA 1RL3A 4YPJA 3MHZA 1QY4A 3OOXA 5H9QA 5A33A 3BODA 1FNYA 3ZR6A 4W8JA 3D6EA 2BYVE 3POIA 1UZZA 2CGNA 3NSTA 4K40A 3O1RA 4AQ2A 1K5JA 5F37A 1GP6A 4A4AA 2ZEWA 4CUGA 4CP1A 3LWCA 3IZOA 4HETA 4CXYA 4CEWC 1WCSA 4GMP1 4Q1PA 1YXWA 2GU9A 1DQ0A 1U5IA 2ET1A 2RG4A 1GANA 3PVOA 4JC1A 4XF3A 1NLQA 3OPTA 5EXOA 1F4HA 3SISA 5BNOA 5GZGA 2VZ3A 4LITA 2VXRA 2RS12 3LPGA 4H7LA 1HW5A 2MEV3 3OSDA 1UNBA 4Q4X2 1VJ2A 5K7PA 1JYTA 1C8NA 3VBHB 2JDHA 1C5IA 1HXS2 4YGBA 1WMDA 3U07A 1Z7S2 2Q1MA 2Y0IA 3K75B 5FP8A 2QZ3A 4PT6A 5I93A 1BKZA 3H1MA 2YPJA 4V2VA 2OIIA 2ZGUA 5AVPA 5T54A 1D0HA 3V56A 4Y5TA 5D8AA 2PAKA 4FTSA 3MIFA 2HWE2 3WG4A 1W6MA 2QQJA 4W6YA 2R062 1ZRIA 2JDPA 4I0BA 3DYOA 3LDBA 3L9JT 4P02B 3MW3A 1WLDA 3LSEA 3VBRB 2AUYA 3P3PA 2IXHA 1DYKA 2XLAA 5F3GA 4NPRA 1DYPA 2VMCA 1GWLA 4D0QA 1H4GA 4XE9A 3W5NA 2XPJA 5KXDA 3JBG1 5IAVA 4XXPA 1RUE2 4MXWB 5HXMA 1XOYA 1IGOA 3ZFFB 1CAWB 2V72A 4NAOA 3IMMA 4CXXA 5E6HA 1JOJA 2GMPA 5FPVA 1ZBE3 5FYUA 4IEYA 4X8NA 4NPLA 1OKQA 4O61A 4FO9A 1BMV2 1UYPA 1AL0G 2PAMA 3OGJA 1MVQA 1SMVA 3AMMA 3AJZA 4AK3A 1SFNA 4PI0A 5EHDA 1BLZA 4E4ZA 1PK6B 1N3OA 4FPJA 1C3HA 2YGMA 4H14A 4CPBA 1SACA 1DQ1A 2GC1A 2WAAA 3EO6A 3BCWA 3POYA 1AR91 1WW4A 3KV5A 2VVDA 4IEPA 5FZ9A 5KXCA 1QJX3 1J58A 1BK1A 1PO23 1ULGA 2VCCA 3M3QA 2X09A 3WNNA 2AR6A 5IVFA 4G9SB 3WNMA 2ZEXA 2VUJA 1VAKA 3CLPA 5FZOB 4DXZA 1MEC2 1K45A 3USUB 2BU9A 3SMHA 5FQ0B 1LOEA 3RDIA 2E6VA 1CAUB 1FPN1 2VZUA 3O0XA 2EF6A 5CNAA 1CESA 1KQRA 5LK7B 1XB9A 3FE5A 3PJQA 2P3YA 1RXGA 4LR4A 3SC7X 4OVEA 4FCAA 1WMXA 4LKSA 2IWGB 4Y1YA 4IUGA 3KT1A 3I59B 4HKWA 2YUEA 1EPWA 4FP3A 2ZJCA 5L9RA 5A6XA 2VGDA 3K77A 4EZ4A 4DIQA 2IXJA 5D1IA 1QU0A 2RR11 4FQZA 4BOWA 5CFDC 3P1IA 1BBT3 1MS4A 4GB32 5FPLA 4CUBA 2VQUA 3OY8B 2NMOA 4RA0A 4IEZA 2JE9A 2XB6C 2YV8A 1PX3A 2ZOEB 4D3WA 1VAMA 1ULOA 2QQLA 1HB3A 4I0AA 2VBDA 2VO5A 1MS9A 2XUMA 1YWKA 2BGCA 3H1WA 4HK8A 5FZKA 5T5JA 5AC92 1VMHA 3SEPA 4KGQA 5FYTA 4K8FA 5JOXA 2A3YA 3Q8FA 2ZBJA 3VL8A 3AVRA 2X10A 4MVTA 1W2OA 4XF4A 4IE7A 5C8CB 2A3WA 1RUI3 2VECA 2W47A 3DYMA 5J3UA 1DDLA 1HRI3 2BV4A 4DO0A 4MG2A 3LIHA 1AYM3 1GOGA 1O7FA 2KA3A 3R4UA 5FKCA 1AR82 3I3MA 4QKNA 1YI9A 1HRV2 1VMJA 2ZGNA 1O3QA 2GALA 4X8PA 1WBFA 3SCGA 1W05A 4S2HA 3E6BA 1UD1A 3ZXGA 5JWPA 2DFCA 2J1VA 2Y6GA 3D5OA 4MH0E 2WL1A 2BP6A 4CEWB 3T30A 5FZ1A 3PUIA 5LEKA 1W04A 1QXJA 1OD3A 1EAH3 4GWIA 2WO1A 1QH7A 1GZCA 2E51A 1T6BX 2HWD1 4DOUA 4HMZA 1SLTA 1QHDA 1LGBA 2HWF1 3FL7A 3AKRA 4FPEA 4PJYA 4NIIA 3VBFC 4YLZA 3UGFA 3BTZA 2XVKA 4YM2A 2VMEA 4XIOA 3WQ7A 5CYYA 2DBIA 1LECA 1OLME 2PA7A 4BCUA 5FP9A 3TWIA 3NV1A 4C91A 1MZFA 1S4CA 4J25A 5ACA3 1JW6A 1QOTA 2JG8C 3FZ3A 4PLNA 4UW3A 4IEVA 1OF3A 3ME2A 1DZQA 4R9CA 3LFMA 5IK4A 3I3QA 1HJFA 3FLTA 3ES1A 3MPBA 3PU8A 3LZZA 3ZKYA 3NV4A 4TTGA 3MF6A 3NL1A 3WINE 1JTZX 3D0JA 1LHOA 5EYYA 2OZ6A 3GZEA 4MYEA 1ZA4A 5DAXA 3SH3A 4AVTA 4LO4B 3C7HA 4XJUA 2BFUL 3OPZA 1H6XA 4KNCA 2VY0A 2VCMA 2VW1A 3H0OA 4N8MA 3Q8AA 3AYDA 2LTNA 4CDXA 2PQSA 1NUKA 3O1SA 4OYUA 3T1MA 3JCIA 1GWMA 3VZMA 2R073 5GALA 3UV9A 1DFQA 1POQA 3FMGA 4YZ4A 1U12A 4EWEA 3IAPA 5C5UA 4A7YA 5A7NA 1VBC1 2DUOA 5F1RA 1RMU3 1LODA 5FY5A 3WNPA 1NE6A 3M70A 4Q2FA 5GZFA 4BXFA 5KHIA 1K5MC 2AYHA 1UOJA 2WUHA 1W9SA 1IQDC 1FYUA 1PGSA 2ZKLA 3LB9A 4UFHA 3TNQA 3WF1A 4DFSA 5J7MA 3O1PA 2WO7A 3M1HA 3AVSA 1N1SA 2WZR2 5FZMA 4DXRA 4E4DX 3MGUA 1H8TC 2OUHA 3N36A 1NX9A 3RZMA 1W6OA 3OTFA 2QZ2A 4PHZA 3CZUA 1ZYBA 3JB8A 1Y3TA 3WQ1A 1M06G 1LEMA 2VMIA 1AL21 2BVVA 2H0BA 2D3SA 3HMYA 3JD73 3GXUA 1O3TA 4NHKA 2XONA 1R092 4UBGA 4CCMA 2ZCWA 4RR3A 3POSA 2E7QA 3WX5A 5A1FA 1W2NA 3ENRA 2DURA 5I91A 1W90A 4QKDA 1JXNA 2CAUA 2NPIA 1SLIA 4XTPA 5JOWA 2JDNA 1OHFA 1UY2A 1CAVB 3KV6A 1JYXA 2JD4A 5I0DA 2GNTA 5G05L 2YBPA 4HBNA 5CFDB 1PNFA 2WS93 2CSGA 1UF2C 3JU9A 3LEKA 3U0ZA 3GBWA 2BGPA 3C8XA 1QQP3 3ORJA 3VHRA 2WRAA 2WFPA 1JYNA 3T08A 4COVA 3V65A 1DLLA 2DUPA 3UKVA 3M3EA 3THPA 1QJEA 2VZTA 2ZKNA 3B9CA 1IZ3A 2W1QA 1OT5A 1RUH2 2BWCA 2JE8A 2W5FA 2DVGA 1EP0A 4HOOA 4L9BA 4LHNA 4QQLA 5FLIA 4WBBA 3AFGA 1OF4A 1VBE3 4NHLA 2MEV1 5A6ZA 1QOOA 3NAPA 1OLMA 4V2WA 4YW3A 1QJY2 3K3OA 2L9LA 4I09A 5FYBA 3VHOA 3T2TA 4QPGC 5C4WA 3RI8A 5L73A 1UXXX 3S5AA 3R6SA 4Y5SA 3ILRA 1LU1A 3MLLA 3KVBA 3RYRA 3VBUC 2IXKA 3MPPG 5LA2A 3AK0A 3E6DA 3WY6A 3AYAA 2QUOA 3DCQA 2FDJA 1RVF3 5J1XA 4P9JA 5EIYB 5APAA 4QDRA 4XDQA 3VD4A 2UWCA 3WW4A 4Q4W1 1UX6A 1AR71 1RUF2 2OS2A 4BDVB 2KR2A 3I3EA 3HT2A 3SEEA 2XMLA 5I8SA 4JGZC 1G9DA 3PTYA 1SQ4A 4BZ4A 1R64A 3NJZA 4CYDA 4WZFA 2VOKA 1MVEA 4XUTA 2I07B 5HCAA 3R05A 3VBFB 1APNA 2BUKA 3H8XA 3FHIB 2UU8A 3HN1A 1C8M3 2D6LX 4D6QA 3WF4A 5LZ6A 3KV4A 3VDDA 3SNMA 1XNKA 2GC0A 2WQZC 3V0AB 1LKNA 1XRUA 2VUDA 2OPKA 4L0PA 2JG8B 1ASJ2 1DZTA 1JN2P 1ZBE1 1XNBA 3FWEA 4U2AA 4DRRA 4AXOA 3PMEA 2XJTA 3CNAA 4YARA 2WQ8A 1PX4A 1ENSA 3NMBA 1J1TA 5T3NA 1ZRDA 2E53A 4AI0A 5IVVA 4CDWC 5BNPB 1H9PA 2RHPA 2Y0OA 2ZHKA 1S2KA 1SLAA 1BK0A 1PO21 3OD4A 4IV3C 1AJOA 1NKGA 1REFA 2XDVA 4META 1PVC2 3PL0A 3NNJA 4QHOA 5A3WA 2QJVA 3AZWA 1HQLA 4X6QB 2GH8A 4AFCA 3ES4A 4DY5A 1ND3A 3WR0A 1OKOA 3AXDA 4BQYA 4LOTA 4EN0A 3RZLA 1ACCA 2O0OA 4O7XA 2O1QA 3DEMA 4LKDA 1D4M2 4LIVA 4QU2A 3ZYJB 2XJSA 3WNOA 3T2QA 2YMZA 1K5MB 4IE6A 3J7MA 2J1EA 1R1ZA 2R0HA 3APBA 5E89A 2VW2A 3ZXDA 1TG7A 2VUCA 3WG1A 3AMHA 5KHGA 5A7WB 4I3PA 1BBT1 2A73B 3I2DA 1MS1A 1H8TB 2OT7A 2RJ2A 4A6SA 1PNGA 4XMAA 2YC2A 3KS7A 3POJA 2QDNA 3FFQA 1I3HA 1AYN3 2CY6A 1W8OA 2VOXA 2W68A 1VBD3 5ANNA 2G19A 3AX4A 2VCAA 2WSVA 4QX5A 4XQ4A 2WYSA 5FZFA 5FZGA 5IK8A 4I3GA 1GKBA 2ADEA 3U78A 1RUI1 1RUG3 4XFIA 1HRI1 2C9AA 5A3PA 3B94A 4HLTA 1AYM1 4HKLA 4N53B 4P5HA 4MGYE 1N3QA 3J8F2 3MLKA 4QPIC 3WDUA 3ZYRA 3H7YA 1MACA 3K4AA 4AQTA 5CG8A 2RDSA 1S55A 4V1PA 1RUJ3 1UOFA 1W2UA 3J7HA 5DAQA 1OH3A 1UMIA 2XLFA 4ORFA 4FAHA 1H1IA 1KITA 3I8TA 5EJZB 3A0NA 3ZXKA 1WWYA 4AFDA 4UF0B 4JGYA 3B93A 1H2MA 1XYOA 2DVFA 2DF7A 3IIIA 3N3HA 3O0VA 1S0FA 4Q4V2 3T0AA 4GAZA 1CAXB 1EAH1 2ZS6B 3ZVXA 1QWRA 5FBZA 3VGIA 1F8VA 5FZAA 4BLJA 1ZBA3 2DVBA 2Q5TA 4PIZA 4A3XA 1Q8SA 2G4IA 3C7FA 4QPGB 5T5PA 3T0DA 1LHUA 4OI0A 2H0VA 5A3NA 2Y6JA 5ABJC 5C9AC 5FUIA 3VBUB 3S57A 1RIRA 2A75A 3WW2A 5IFPA 3A0KA 5ACA1 1OFSA 5IK7A 1UL9A 3ON7A 4W6WA 2ZHNA 5I0TA 1JYVA 3E1F1 4QX0A 4CEYC 4RHV3 1YJKA 3MW4A 3NRUA 3ZMNA 5A3TA 3OCPA 3VBHA 5J98B 1C28A 1X50A 3ILFA 3OGGA 1DQ5A 3VDCA 1T6GC 2WAOA 2BOIA 5C3RA 4JGZB 4YG3A 3LDRA 1COV2 1X8EA 4BLIA 5EWSA 4URAA 1G9BA 1JMUB 3EXUA 3S6PA 4NN0A 4LNVA 1OH4A 3H3LA 5TSWA 3H1YA 4Q8KA 2ZGMA 5GLTA 2AREA 5GLZA 2C1FA 2R071 3BTYA 1NG0A 4QDSA 3VBRA 1GOHA 1H0BA 2A70A 1ZZ9A 4A6OA 2LUWA 3VD7A 1RMU1 1OQEA 1ZRFA 1IS5A 1V6KA 1ODNA 4BU2A 1UO9A 3CJIC 1PIV2 1UY0A 3RZJA 4MXWA 1U5ZA 2VZ1A 3IAQA 1CAWA 4CDWB 2GP3A 2VBPA 4B1MA 1EV13 2XUEA 4IV3B 3GALA 1J83A 2LS6A 3Q8BA 4QGLA 1F35A 5SV8A 3WSOA 2Y60A 4LBJA 2OXBA 4HVRA 2YBKA 4KG8A 3BPZA 3ZO0B 5AFBA 2FDKA 1IKQA 1AR93 1FOD2 4KMQA 3JD71 3KSCA 2WNEA 1PK6A 2JDMA 3INAA 3HVDA 4GWMA 4HG6B 5JPMB 1DBNA 3K51A 5DUWA 4YVSC 3SCHA 4COWA 3KGZA 2XJRA 5FPUA 5FZOA 1WCQA 1K42A 2DU1A 3USUA 1S0BA 5FQ0A 2ID4A 3AKQA 2RS53 1V0AA 1CAUA 2HYKA 2WS91 5H9SA 5LBFA 3ZN6A 1YFWA 2RVAA 4JKKA 3P5BA 4AI1A 4XTMA 3GJAA 4YZ2A 2UWBA 3MFCA 1O4ZA 3I7DA 1QQP1 5ERLA 3EQEA 3ZFGC 1OI6A 4CE8A 1MR5A 2OQ6A 2RJKA 2HBUA 2ZAHA 3RYPA 4K1YA 4WM8C 4CXWA 3PDQA 4JKMA 2RMU3 1SZBA 2XVLA 3O7OA 2ZGLA 3OY8A 2WZPP 5DQ0A 1TMF3 5F2SA 2YBSA 1VBE1 3OD0A 4KBBA 5JLVA 2FDFA 3EMRA 1OBNA 1RUD2 3TOJA 2HH9A 3N9PA 4GIQA 4QPIB 2FZ1A 2SBAA 2ATFA 1VRH2 3ACLA 1FV3A 4XC9A 1RJ8A 2JICA 5BV6A 3T2OA 4QGNA 4DMIA 3J26N 4PDWC 2RDQA 2DWRA 5C8CA 5HXVA 4ZKTB 4Q1RA 1RVF1 3LPFA 4XBLA 4CA9A 1W06A 2GN3A 2JG9C 2MNGA 2VOWA 2VQTA 4N90A 5A80A 3THTA 4IXLA 4Y1UA 3NJYA 5T5LA 1CJPA 1TQ5A 2ZPXA 5F7UA 3Q8CA 3WCRA 3KB5A 4YVWC 1RUC3 3PHMA 4I30A 1G86A 5EFUA 3HNMA 3VZJA 2GNMA 1WW7A 1BQPA 2QKDA 4UW5A 1ZZCA 1XJAA 2XXZA 4Q4X3 3MO4A 1UKGA 2F17A 1WW5A 3AB0A 3A22A 5ANQA 4LE3A 2NMNA 3ZFGA 4AEDB 3DV8A 2YB7A 4CEWA 1Z7S3 4ARXA 1C8M1 5ABJB 5C9AB 3WCSA 3MEPA 2WLQA 2XKPA 4BIFA 5J96B 2WBKA 1JHNA 5FP3A 2HWE3 3M8LA 3WP5A 1JI6A 2R063 5BUVA 5I0SA 3CIHA 4CEYB 1H2NA 1UY1A 3IDCB 3Q9OA 3TEYA 4CU9A 1SBFA 4LLOA 5C3OA 4AGRA 1AX2A 1CPNA 1R082 1UYZA 1LJ7A 2QFEA 4FP2A 2ZGKA 4HKOA 5IATA 3IKWA 3BI3A 2WT0A 4CU6A 3MDPA 3MIBA 1IHMA 3U1XA 3VZLA 1OXCA 1RUE3 1UOGA 2QQKA 4IQPA 1Q5OA 1QDOA 3ZYIB 4NJ4A 3ST7A 5BYNA 4KH9A 2UY8A 2R1BA 3T4HB 2VZOA 5BY5A 2V5YA 1C1FA 2DCTA 4PLMA 2VAUA 1UX7A 3O0WA 3NJXA 3CJIB 3MUY1 3THCA 4MLOA 1OUSA 3WUDA 2Q0AA 4IGQA 4Q4Y3 4HT1T 4AEJA 4RFRB 4IV1B 4MXVA 2XQRA 1L7QA 2JJ6A 1QXRA 3KT4A 3W20A 2B9VA 4IEXA 1DGRA 1SLCA 3GZTB 4I0WB 5JMCA 1J84A 5DZEA 4JDOA 1H2LA 1U0AA 5IVJA 3PTRB 1AYN1 5E88A 2BNNA 2DFBA 1VBD1 2WT2A 4LUKA 4Z2WA 5IK5A 2WIIB 3T4VA 4A42A 1E5HA 4N7IA 5ISLA 4YVSB 2Q8CA 1RUG1 3H3UA 4XDPA 1YNAA 2H6BA 2GNDA 1UZYA 1ZM1A 5FMBA 1SPPB 4M3CE 2XJQA 4NAMA 1FPN2 1WA4A 2WA4A 4FVVA 1YHFA 4W50A 5LBEA 4P00B 4GJZA 1XNCA 1HQWA 4XURA 3WLUA 4ISQA 4XBQA 3VLBB 4AWDA 1KS4A 3K4ZA 2D40A 5L9BA 5CFCC 1RUJ1 4LTAA 3D8CA 5FYSA 2QQPA 1NZCA 1NXMA 2EIBA 2J1SA 3RJ2X 2QQUA 2RE9A 5AC93 1CAVA 2JE7A 3KLSA 5FY7A 4GH4C 4EV0A 1OMIA 4WM8B 1YQ2A 3H50A 5FMOS 4AQ6A 2RR12 5CFDA 4F8AA 2A6YA 3DUIA 2WYFA 5FMCA 2VNRA 4Q0VA 3ZSMA 1OOPC 4O9GA 1ZBA1 1VIWB 2WZEA 1RUNA 1VBB3 1W0NA 1MZ5A 3J4UH 3VN4A 3B7MA 3KCCA 5J09A 4YWAA 2WLPA 4OUMA 4EN8B 4EROA 3ACIA 1GUIA 3LE0A 5I0UA 4NVPA 4PDWB 2IXCA 5JMOA 2V4AA 5FLHA 1SCRA 1XU1A 3PVBB 2JG9B 1CPMA 2K9ZA 3C7GA 5T5OA 2XLGA 2ILMA 3FJSA 3WUCA 4RHV1 2YY1A 5E16A 1JZ3A 1NAEA 4JKLA 4AAXA 4LXLA 5FK8A 4YVWB 1K12A 3W9AA 5FY4A 1XC6A 4GQ7A 5H9PA 4AVVA 1MS5A 4RGKA 4IGPA 1IPJA 3T2PA 3ZDVA 1A8DA 4Q4W3 2W94A 3VKNA 3B02A 4XF1A 1AR73 2EAKA 5JIUA 2AGSA 1HB4A 3UESA 4L2NA 3X29B 4LLFA 1W3XA 4MGQA 2G9GA 2CTVA 2WNOA 3S5QA 2ET7A 4CVUA 3M3CA 1XNTA 3U4XA 2BPA2 4XHBA 4H3WA 2JIGA 2X8KA 2ZZQA 4ONUA 1DGRN 4YG6A 2I45A 5A7PA 1XBFA 2HWF2 3VBFA 4YM0A 4KI5M 2JXAA 4UI9L 1RB8G 4JAAA 2Y6LA 2A7AA 2JDYA 3WF2A 1X36A 1PO13 5C33A 1NQDA 2IXLA 1NCQA 1VBA3 1O3RA 2DCJA 1EV11 4RSUA 2UYAA 4JZRA 4Y3OA 4BHPA 3V0AA 4LMFA 2BGOA 2FCTA 3C3VA 4CP2A 3POWA 2RM23 4HSLA 3O1UA 4CTEA 5HV0A 3OEAA 4CCOA 2DTWA 4AAPA 1KS5A 2DCYA 4PIYA 4KL1A 4B4QA 1X7NA 2VULA 4DXSA 1NA1A 4LA2A 4M3CA 2XG3A 5BNPA 2W46A 3NNGA 4LK7A 2LRPA 5A3LA 4XUOA 2Y6FA 1UOBA 1DF0A 5FK7A 2LW8A 3WG2A 3ACGA 2ZGOA 4AHWA 2D6PA 2PHDA 2RS51 5A7SA 4O65A 1I1EA 4OI1A 4BPZA 1F9KA 1W6PB 1VRBA 3J7LA 1VBC2 4DEVA 4YM3A 1EPZA 2P1BA 2W92A 4IDZA 1ZRCA 3KVAA 5FZBA 5C3PA 3WVJA 2EIGA 4UW6A 2E33A 4RN5A 2E31A 1NQJA 1R093 2ZZJA 4EE2A 5EJ3A 4QXBA 1R1A3 4Q5OA 5A7WA 2RMU1 1ND2C 4CP9B 2FDGA 1TMF1 4S2DA 5FZ4A 3KZ4C 4ZPIA 3SXWA 2ZTNA 2Y34A 4LBNA 1YQ5A 2PHUA 4XIKA 5CG9A 1AL22 1W8ZA 4A3ZA 4B29A 4CUCA 3ILNA 3PIJA 3S30A 3I4IA 1GFF2 2P6HA 2O14A 4YZ1A 4MGZE 4JRLA 4MGIE 5CFCB 5FOJB 3H8OA 3WOGA 3LQCA 3LD8A 4YZ3A 1CZVA 2QQIA 4KWUA 2P6CA 1BJQA 5JXHA 4GH4B 2SLIA 4N53A 2G9FA 2C4XA 2P34A 3GDBA 3LF7A 1IS6A 5C3SA 2WT1A 1WA6X 3I2FA 3VBSA 1S2BA 1WCUA 4GZ9A 5BNOC 5FZ3A 1RUC1 1OOPB 4MZUA 3WV6A 1UXZA 3NO8A 2ORXA 4Z07A 5JOYA 5FJKA 5IVBA 4Q4X1 5FZEA 1YCIA 3KCXA 4QQPA 3TYJA 1HXS1 2VTXJ 2FMDA 4QX8A 1Z7S1 4L8QA 1GOFA 3WNXA 4J1WA 4DINB 1VB2A 5D8AC 1UPSA 2HWE1 1BVVA 1WW6A 4GA9A 4QKBA 2MEV2 2R061 2ARAA 1GR3A 2W08A 4GKXA 3QH6A 4QPGA 3NV2A 1JYIA 4RFT0 1LENA 4Q0QA 3VL9A 3CU7A 3OGVA 1TME2 2VC9A 1EUTA 3LEGA 4FPLA 4WM7C 4XW3A 3VBUA 1ZZ6A 2W0XA 5JXGA 5JXIA 4DUWA 1ZRRA 4ITCA 2Z2SB 2C24A 2BVBA 3MUZ1 4LQRA 4AEMA 1ULEA 2VZSA 3FC0A 1QDCA 1RUE1 3LEMA 3DN7A 2J7MA 3GJBA 5B4NA 4OCTA 4XJ8A 5J36A 5HCHA 5LCWL 4Q26A 5KHHA 4FT8A 5GLUA 1UQXA 1KFXL 1LHVA 1NCRC 1YFXA 5A70A 1HX6A 1KXGA 3BYWA 5BNNC 3PIGA 4K6BA 1BMV1 3OG2A 1B09A 1JUIA 1KDKA 5FZ8A 3O14A 1CVNA 2LALA 4Q4Y1 1GQPA 1P8JA 3FFZA 5JXJA 1ST8A 1W39A 4AFAA 5A6YA 3GHNA 1LRHA 1J3QA 4QQHA 3FX3A 1XNAA 4GD4A 4B4PA 3N35A 1PVC3 3K2OA 4XCBA 2ORZA 2IVIB 3KQ4B 4CDQC 3IMNA 2R30A 5DAVA 4AE2A 2QBXA 4D7SA 5CA6A 3A23A 1OQDA 4JDNA 3LA3A 1YQ8A 4FFHA 4Q29A 4YFZA 2FZ2A 3RJRA 4QXHA 4CDWA 3VBOA 3SCFA 1CZTA 2DYCA 4IV3A 1QJX2 4LOSA 3HQXA 2CDOA 1F5JA 2XH6A 3OBZA 2WKKA 2A3XA 5F2WA 5FPAA 3VKOA 5CKNA 2R0FA 1AX1A 2EVXA 4FPYA 5KXBA 1W3VA 3KWVA 1X8MA 3QBQA 4P9WA 1UIJA 4FI9A 3W58A 1DYOA 5JSRA 1IS3A 2K46A 1DP0A 3OBRA 3AZZA 5AC91 4H2AA 2PMWB 2RS33 3JUUA 2V73A 2E32A 4ZU7A 1TE1B 4HANA 1Q8PA 2UYBA 4FOQA 1BBT2 2WQ4A 3BIWE 3GZUC 3AXEA 2EAAA 4YM1A 3HEIA 3QCWA 5LWBA 1VBB1 2HLEA 5I0RA 1JYCA 1ZZBA 3URFA 3O1OA 2VM9A 1YIFA 3PVNA 2D44A 2FCUA 2GSYA 3PUSA 1XE8A 4KBZA 1HQNA 1S0JA 3WP4A 1BEV3 2WABA 1XPWA 4Y4YA 4CU8A 5IAXA 1QJU3 2ZX2A 1QNYA 1OLQA 1OD5A 1RUI2 1V6MA 2IZWA 3PMSA 4BQ1A 5KHJA 5IFTA 3RS6A 1F31A 2ES3A 1AYM2 2CU5A 1PMHX 3BTXA 4FXGB 5A1LA 4Y1VA 5AFEA 1ALYA 4K9SA 1YQCA 2CL2A 4P5YA 1J1LA 3WW1A 4OUEA 3WW3A 2UWAA 3ZSLA 1MZ6A 2Z42A 2OUJA 4OLLA 4XQWA 2ZX4A 2YC0A 3ZYGA 2VU9A 1MQTC 5K4LA 3SKVA 3D0SA 1SG3A 4NPMA 1Q8VA 1LOGA 4XQDA 5KC5A 3NNLA 5EQUA 2O8OA 2P5BA 4UFJA 3DKWA 4UFMA 4XABA 3GGLA 5GLVA 1O5LA 4HN0A 5D8AB 1EAH2 4C8DA 2EXJA 1T2XA 1X9TA 3HNYM 2WR9A 4Y5Z0 5E1RA 2MHFA 1JHJA 2X5IA 5DXDA 4OHXA 3AZXA 3TB0A 4AEDA 3CQOA 4S2GA 1YUDA 1OLRA 3IWZA 5L9VA 4YSFA 4WM7B 1CIWA 3DKQA 1PO11 4KGGA 5C9AA 1VBA1 5ACA2 1WCKA 1H30A 4GJYA 2AEYA 5LB6A 5LK5A 5CVRA 4WVMB 5L36A 4COZA 2N7GA 5H9RA 1DZRA 2RM21 3OJBA 1WBLA 5A1AA 1HN1A 3WHUA 1GNZA 1UU5A 4CEYA 2PHWA 5GM0A 1S0EA 1GMMA 2NM1A 3ETQA 4BXSV 4FQ4A 5B4XA 1Y4WA 2YROA 3GHMA 1NCRB 4RQPC 2B45X 2Q8EA 1C4RA 4B4RA 2WO3A 1CJDA 1NLSA 2VOVA 5BNNB 1XYPA 4UOJA 1LEDA 2ZMNA 4QPWA 4P9LA 5LBCA 1H2KA 1YO8A 2EXHA 5LRRA 5JSOA 2IUWA 2XQXA 1YRZA 2Y6KA 5DDJ3 1G7YA 4XF9A 1POV0 2XWBB 3VDAA 2Y26A 1LOCA 1GNYA 2Q8DA 3EYPA 3M3OA 3GZAA 1KJRA 5FUNA 3WG3A 3AJYA 1X82A 3S7EA 2O8QA 2GMMA 2XHNA 4Z2AA 5L7OC 3I3BA 4AL9A 4CDQB 5K0UA 2DCKA 4PQ9A 3CJIA 1L7LA 1RHI3 2CV6A 2WO2A 2ZACA 1JZ5A 5J48A 2TUNA 5LBBA 1R091 3N4MA 1FMD2 1UYXA 2KD7A 5FFOC 3ZMOA 2Z79A 4BMBA 4Z8BA 1GYKA 2VQ0A 1R1A1 4IV1A 4FTEA 1J59A 1H8VA 4FPGA 3O1VA 3R4SA 3RMXA 1GICA 3ZPOA 1UIKA 4IE5A 5FP4A 4E4HA 1HKDA 4Z92B 1O8SA 4MGTA 2BDRA 3CBNA 3J9SA 1JU4A 2RJLA 3B00A 4WV8A 2IXIA 4JQRA 3JD72 4LHLA 2JEMA 3WNLA 1OA4A 3EBRA 3I2KA 4UFLA 1Y9QA 4HVOA 5M0TA 1MS3A 2HWB2 1E5RA 2R6QA 3AZYA 3LFIA 5FYHA 1W8UA 4AI3A 1LULA 2BOJA 3N9NA 2E26A 2W95A 5HCFA 3KGLA 4CSWA 1SPPA 5C6CA 1DG6A 2XGXA 3LKJA 5LA9A 1WUVA 2W91A 1HN0A 1TZOA 1US2A 5I8YA 2WS92 4HPKA 3BN6A 5FWJA 3QLQA 4H55A 3OB8A 4X6RB 2I74A 1WD4A 3NAPC 3POBA 2MPFA 4J1XA 1A3KA 2FCVA 4B1LA 5A32B 4W6XA 4AGVA 4WM8A 3WDVA 1O4YA 2A1XA 3VHNA 1W9YA 1GSLA 4XAAA 4XFGA 1ENXA 2QQMA 4NE9A 4BMEA 1N1VA 1H4HA 2HWC3 2P2KA 4N43C 4QHZA 2ZGQA 4C1XA 1VBE2 2XR4A 3AP5A 4IL7A 5EZWA 4QB6A 1CZSA 4KWLA 3AP6A 4P9GA 1U5XA 2PAEA 1RUOA 2B4KA 1AJKA 4GXLA 3G7DA 4ZU5A 5FZCA 4CCJA 4FPOB 4M00A 1W0OA 1E5SA 5A6QA 2ZGTA 2VXJA 3I54A 2DCZA 4KU7A 1MQTB 2ENRA 1QNWA 3I2OA 2WFF3 1V6NA 1GWKA 3BPSA 4ET7A 3BGAA 4FPKA 4RD7A 4YGEA 3PJYA 3CO2A 3VZOA 4XBNA 4FOVA 2PLV2 3SH4A 5HV4A 3S0MA 2B5HA 3OEBA 1N1YA 1CD3G 1UPIA 1CIYA 2D43A 3E5XA 3CHXA 3RI9A 3ZR5A 1IOAA 1IQAA 3ECQA 4MHRA 3UK9A 2YZ4A 4E2QA 3AP7A 2GH2A 1UZVA 2WN2A 5LATA 1JZ8A 4FTBA 1AF9A 1R083 3ZIWA 5KC6A 4JV4A 2X05A 1PVC1 4Y22B 3LDKA 4HVQA 3ZFFA 3DGTA 4WZCA 1AXKA 3TN93 4C0BA 3TEXA 1PGL1 2K2SA 1Y43B 3N9MA 4RQPB 1A8MA 2QTWB 3DYPA 1GU3A 1AXZA 1O59A 1AR63 3O5SA 1A6CA 4LKFA 4I02A 5JVVA 3ZXLA 4TWTA 2R1DA 3HWJA 3NV3A 5BPXA 4Y1ZA 1LOFA 1QKQA 2J1RA 3P6BA 2XBO3 1HDKA 4XZUG 4NHXA 2PHLA 4GULA 3MYXA 2HEWF 4BM8A 5L7OB 4LO7A 2AEZA 3ZN5A 1RJ7A 2P3IA 2A6VA 2WJSA 3SHRA 4Q8LA 3WXPA 4PBOA 3OGSA 4FOYA 4R8HA 5F6KA 3T0BA 2B42B 2RS31 2BEOA 4DNYA 1OUXA 3QD6A 1QIQA 5I8TA 5GLWA 3BUCA 3I59A 1WKYA 2R043 2FMYA 1LR5A 1DQ6A 1W6PA 5FLJA 5T55A 4ASMB 3RZGA 3I3DA 4XFAA 4YGDA 5JI7A 3UGHA 2WDBA 4QMAA 3CMGA 1VBD2 4ZXKA 1BYHA 1JOPA 1VPHA 1RC6A 2VQAA 1V9U3 1S2EA 1WMFA 1BEV1 1NY71 4AOCA 2EXIA 4CP9A 2VZRA 1QJU1 1QGLA 2G9ZA 3DXTA 4RL7A 5FWEA 4NIGA 2D6NA 5F5QA 2XHKA 1OA3A 1V00A 2V09A 4JCKA 4XUPA 1O3SA 5DMYA 3POEA 3N9LA 1XSRA 2A5ZA 3HQRA 3USSA 3VUOA 5FYZA 4JGYC 3ZYPA 2C9KA 1LTEA 4D6RA 1G9FA 2VTXA 4D8MA 2R49A 1L3JA 1RUJ2 4NRQA 3NAPB 1NLRA 2VNGA 4JHZA 1SBDA 4RS5C 1ULFA 1MPXA 5DG1A 2W1UA 4DPNA 4EN9B 3A4UA 3I97A 4R9AA 4Q0SA 4XILA 1FT9A 4BK5A 4GH4A 1CQ9A 5CKQA 3GBFA 1E57A 4XEZA 2RS13 4NWWA 4N9HA 1CX1A 4ASLA 1Z78A 5IVEA 2BBVA 1WGPA 3N9OA 4N43B 4L92A 5FXZA 3IIAA 1S0IA 2HJIA 1OOPA 1HXS3 2VMGA 5DN2A 3WNKA 3FHAA 3ZKUA 1ZBA2 4CCCA 2CGOA 4HSJA 4ZXEA 2E7AA 4YW4A 2BNMA 1WLWA 4AZZA 1PGW1 4OMCA 4QAWA 3G6JB 1REDA 4R4ZA 1SFYA 4AGGA 2ADDA 4OQ9A 4OZXA 3RMYA 2ZX3A 1VALA 2CNAA 3DF0A 2D5FA 3B69A 4RHV2 4QQOA 3RRDA 3SITA 2W9XA 1XE0A 1W8WA 2XJUA 3EB7A 4XJAA 1RTVA 4MV2A 5FYMA 5FY1A 4ZONA 2ZXQA 3NW4A 3MFAA 1ULDA 4Q27A 1W0PA 2BTVC 4Y20B 3UT0A 3LEIA 2WINB 4XJ9A 5KHKA 5CB7A 5DDJ1 2B7YA 2CAVA 4HONA 2E63A 2W2IA 3F95A 3UL2A 2NLRA 1IS4A 3JBG2 1UMHA 4NUBA 3BOPA 3IDEA 3BB6A 1JOBA 2YHJA 4DY3A 5CISA 3KM5A 2ZEZA 2D5HA 2P17A 3ZSKA 1GZTA 3IM0A 5IVYA 1RHI1 2ETEA 4QX2A 4XXAA 4YW2A 3PUHA 4R9DA 3E5UA 3TEWA 3MIGA 3K3NA 1XU2A 4CDUC 5IYYA 2FHRA 1AHSA 2LROA 1MEC3 2JD9A 4YW5A 2VJXA 1EV12 4R52A 4LJHA 3TNPB 2ZHLA 3OBTA 4KQ7A 4B3NA 4QB2A 1FI2A 3CKHA 5IVCA 4LKEA 3LA2A 1XXNA 3M2MA 5FMOL 2NQYA 3HD8B 4N7UA 5FAXA 1JYWA 1AR92 4NROA 4FXKB 2QCSB 4WVZA 1CWPA 4B8EA 1EYBA 2PTMA 5FO9B 4QT6A 4TN7A 3LOIA 4XFHA 4OQ8A 2FQPA 4K8RB 2C5DA 4P9YA 5FZ6A 4XPVA 2VPVA 4GB33 1GP5A 2OVUA 4YZ5A 4XJZA 3E97A 1QEXA 4IEWA 4QKFA 4AR2A 1MZEA 4FBFA 2OA2A 2A6WA 1SBEA 4LORA 4MGKE 5HPOA 2BJSA 3AZVA 4AI9A 2DDUA 4OZOA 1JZ7A 2C6SA 1C5HA 5LY2A 1V6OA 3ZOIA 3BIEA 4EWAA 1W99A 1EUUA 1HJGA 4M3CF 5FY0A 3WF0A 2WWUA 4NRPA 1N47A 4FSJA 2PXJA 3AFKA 5IT6A 2IVJA 3TEZA 1GP4A 2ZHMA 2Q8OA 2AACA 2WNUC 4ISRA 1G9CA 1S0DA 4BWOA 3RZHA 4LT5A 3D3AA 2QNKA 5CZKA 1H9WA 1POV3 1AR83 4LULA 2GP5A 2HWC1 1HRV3 2YPDA 3DPRC 3WDWA 2XL9A 4ES8A 1OPOA 1LOAA 3BU7A 4A44A 5JUVA 1F4AA 4K20A 1ULCA 3VKFC 5JZGC 3VZNA 4JGYB 1Q56A 2VVFA 4NRMA 2ARCA 3FUOA 5JIAA 2WNVC 1KDMA 5KBFA 4NOTA 4E2SA 2ZGRA 3KCYA 3OUHA 3PLQA 1Q8OA 3WHTA 4RS5B 4AI2A 4B7EA 1H1MA 3GCWA 2BQPA 2R7EB 2WFF1 1NOVA 3PVEA 4HFSA 4JQTA 3I2GA 1EY2A 4AHZA 2YXSA 3NKTA 2Q1ZB 1D2SA 1V6JA 3LCPA 1Z0HA 2PYTA 3FHQA 2V4VA 2X53S 2P3JA 2NZ9A 2YDEA 5C8WA 1JS9A 1RUC2 3S7IA 1UZWA 2VBBA 5DUXA 3K48A 1W8HA 4PIXA 4L97A 1DQ2A 4YYOA 5FYYA 4D7TA 1A78A 2DUQA 5JAXA 4Y4RA 4COYA 5JSPA 4TZDA 3O1MA 1TME3 1W8TA 3NJVA 1GZWB 2QE3A 2HWD2 4XJWA 1UY4A 1R081 2ZMLA 2OYZA 3MZHA 1GV9A 1FX5A 1O5UA 3RQ0A 1YIPA 1UKRA 1RYYA 3JXSA 1QMJA 3CDZB 3NKGA 4OUSA 3PURA 5CEHA 3TN91 4IE0A 2JG8A 4Q0PA 5F3EA 2D3PA 4WM7A 4ZU4A 5FP7A 4TXWA 1ZX5A 2D6KA 5FXXA 4ZS2A 3UGGA 1AR61 4YW7A 1I6XA 5FXWA 4WVMA 4CZSA 5IW0A 3HN3A 3AC0A 4FFIA 5LASA 3UETA 4BH9A 3E6CC 4DUXA 1C57A 2BWAA 2XBO1 2YU2A 2FDHA 1PM7A 4OFGA 2OQ7A 1B35C 4Y33A 4YW1A 1W8NA 4ARYA 4BA6A 3TRSB 2F4LA 2TNFA 1YQ6A 1NCRA 3RGBA 3CF6E 1X33A 4Z82A 5F5AA 5BNNA 4URTA 2WZR3 3PNAA 2IC1A 2CYFA 5FZHA 4NHYA 4R4XA 4CCLA 3BKZA 3ZFEC 4Q4Y2 4CDUB 1ULPA 1ENQA 4HZFA 2GAUA 4F7ZA 2R041 1Q43A 4U36A 5FPBA 5CAZA 1K5MA 4IE4A 3T1LA 3GYDA 1HIXA 1W6NB 2ZGPA 5FO8B 2Y64A 1W28A 3K4DA 2VZVA 4CDQA 4QX7A 1SLBA 3AYEA 1UY3A 2D6MA 4DQAA 2PHRA 1TVGA 3DECA 3ZN6B 1H8TA 2BNOA 1V9U1 2VD7A 4W4ZA 2OZJA 1W6QB 3KV9A 4LK6A 3SKJE 4GMP0 4QXKA 4IESA 3ZX7A 2VVEA 3IPVB 4NR1A 5A3MA 2FD8A 2J42A 3V0BB 4IEUA 3HQUA 5GZCA 4QX3A 1D0GA 1JU3A 5C3QA 4HK9A 4XHXA 4KWKA 1SDDB 4BQ5A 4SLIA 3ZXJA 5E8AA 3ZYHA 4F3JA 2VTFA 5IUQA 1W9FA 3MIEA 1QXPA 3OYWB 2JECA 4KG0A 4QPYA 1WMEA 4YGCA 1LGCA 4O9EA 1RUH3 3ZSEA 2VMDA 3T3YA 5FCCA 2Z5WA 4UAPA 4EJRA 3W21A 4B7KA 2W3JA 3GF6A 4TYSA 1QJFA 3W5MA 3VV1A 2RS11 3M4FA 2FDIA 2WNUB 1ZNPA 4M0HA 1QJY3 1CN1A 3AMPA 2HKXA 4RGAA 3H9AA 3P3NA 4NHMA 2BZDA 3DPRB 4AQSA 3KT7A 2YC4A 4BYYA 3W59A 4DUVA 4UF0A 5JZGB 4AEKA 4EN7B 1VBB2 5GKAC 4BB3A 5FZIA 4LIUA 1DQ4A 1WLTA 3IT8A 4D7YA 5A32A 1CAXA 2WNVB 3ALQA 3O12A 1G8WA 2WN3A 3ZPYA 1NZIA 3R0RA 2G1MA 3O1TA 1LOBA 4IW3A 3ZFGB 1RUF3 4XFBA 4QX1A 1GQGA 1REEA 5F9TA 4XF0A 3U4SA 2I2SA 4NIHA 2XL7A 4YG0A 5IHRA 1SEFA 5FPXA 2B39A 4EYUA 4PF5A 1O6UA 2JDAA 1MQTA 5T50A 4Q4W2 1AVBA 2VMHA 2E7TA 3B9IA 2W1SA 3GM8A 3LSDA 1AR72 3OF1A 5A7QA 1PM4A 2VL4A 3AMNA 3HPNA 3WDYA 1JH5A 1WCDJ 1AUYA 3V64A 4AVAA 2KM2A 1ASJ3 2P3KA 3AP9A 3MLJA 4JGZA 2PHTA 1NCQC 2Q30A 3HAGA 4FFFA 2K0GA 4E8CA 2CGPA 3HBKA 3SLIA 2JDKA 4XZPA 3MV01 1UU4A 4QXCA 4ZS3A 3H3ZA 1VP6A 3IBMA 1SLLA 1HV1A 4GWNA 2F4PA 2GZWA 4XVHA 4YFWA 5FOBB 1H6YA 2PHXA 3N7JA 2HBTA 3AMQA 2JKXA 3ZXEA 5LA1A 1YLLA 3VKMA 1U5YA 3RZKA 1GNHA 4FPFA 2PHFA 4GKYA 3UYJA 1L7RA 4L11A 1GBGA 1WZXA 4M01A 4C90A 1NA1C 2JIJA 1PO12 1Y9GA 1ZBE2 1STMA 1MEC1 1VBA2 3MIDA 4LBQB 5BNPC 1JZ2A 3ZN4A 2B8MA 4M0NA 2YFUA 2ZX0A 4Y22A 1UWWA 4CCKA 1VE0A 2RM22 4XFCA 1ODMA 1V6LA 1VLNA 1ZZ8A 2EIDA 2Y6HA 1D4M3 2J22A 4JDMA 1B35B 4RGGA 2PFWA 1PO22 3UJOA 4E8DA 4CCNA 3IB3A 2J1AA 2VG9A 5HBAA 3TAYA 2D3RA 4OHZA 4RQPA 3EHKA 3WDXA 1N3PA 1JUHA 3NVCA 3QH7A 4FOWA 2CDPA 4WVVA 3UKTA 4AI8A 3HOBA 4GB31 1W9TA 5IWFA 1FNZA 3ZFEB 1FMD3 3ABZA 1GQHA 2J1UA 4BE3A 4CRQA 2QQNA 2UY9A 3WP6A 4A2UA 2BFUS 4BK4A 2QDRA 4Y24A 1KJLA 1W2TA 1QF3A 1O8PA 3WEZA 3ETPA 5L7OA 2D97A 1SHWB 4HN1A 2IFWA 3B3QE 1NYWA 1F15A 1S1AA 4LBQD 4IGOA 1RINA 5DZGA 1ND2B 1KRIA 2QQWA 3H7JA 4UFIA 2ERFA 4LBMA 3N7KA 2YU1A 1TNFA 5FIXA 5J37A 2TEPA 3DXUA 1W2AX 4XFFA 1R1A2 2DTYA 2HWB3 2VR4A 4HL0A 4LHKA 1POV1 4P14A 1AR81 2VW0A 3J8F3 5A33B 1HRV1 3BALA 3VDBA 3QACA 2B9UA 4R9BA 2DVDA 1GZ9A 5F5CA 3I2IA 5F8PA 4N53C 3VBSC 2JDZA 2Y33A 5HI0A 2RV9A 3VD9A 1YYNA 5A3OA 3WF3A 3RWKX 1HRI2 2PQQA 1OSGA 1W03A 3ELNA 1YFUA 3FLRA 4L99A 4QPIA 4XDOA 4AW7A 1I5ZA 4Q4V3 3OUIA 2EA7A 4GALA 2PN5A 1OQ1A 1JODA 2WSUA 3GCXA 4IERA 4MX3A 1VMFA 5BNOB 1YC61 1Q8QA 1ZZ7A 4I01A 2DVAA 4XACA 2E9QA 1X9PA 5F32A 5FRAA 3CEWA 2QQOA 2XJVA 2NYYA 4DRVA 2A71A 4DS0A 4DZGA 1DGWA 2TBVA 4AG4A 2VNVA 1TME1 1O91A 1AX0A 4XCAA 2EIEA 1W6MB 3ZXFA 5FKBA 3ZYFA 4IEQA 2WWJA 4N43A 3U14A 4AVCA 4ASKA 4DEQA 2F6BA 5FMDA 1BVP1 1HV0A 4I2OA 5ABJA 4LO8A 4BQ2A 4ZY9A 5FREA 2H6CA 3RNSA 1COV3 5KWRA 5KR7A 2PLV3 4NMIA 4MUVA 4CDXC 5G04L 5FZDA 4NIAA 2OPWA 4AYUA 3ASIA 4P9IA 4D69A 1F5FA 4TLFA 5CU1A 2XJPA 3MIHA 4AHXA 4K21A 1PMIA 1M4WA 4UT5A 3IDAA 4LA3A 1DCSA 4E27A 4CCDA 4OI2A 4LPLA 1LHWA 1NCQB 1OVSA 4BIOA 4PBPA 1ONAA 3RPQA 1PIV3 1FATA 2W39A 1SFPA 3WQ0A 5C7GA 4QGMA 1YI7A 4C1WA 3MF9A 4E9KA 1NE4A 1UZ0A 3F2ZA 3HNBM 1RXFA 2WZR1 2R072 3QOPA 3WZ1A 3OUJA 4BQXA 5LEJA 4Y20A 3AM2A 1S0CA 3EJKA 1NA1B 4MADA 4M3CB 1RMU2 3AKPA 3VBOC 4D6SA 2Y38A 1DIWA 1QJX1 2DV9A 2JENA 1PZ7A 4UFKA 5DAPA 5FXVA 1FOD3 3C7EA 1YEWA 4NIDA 4BQWA 5EPAA 1W9WA 5EV7A 2XVGA 1BHGA 4QD2A 5F6LB 4INDA 2D93A 1G6NA 1URXA 4MHUA 1H1AA 3KQRA 4RR3C 4S2FA 3NWKA 1WD3A 2EXKA 4KU8A 2Z69A 4JX0A 4NWVA 1PGL2 3E5QA 1AZDA 4WVWA 5DAWA 1UU6A 1I9RA 4AHYA 4CUAA 2ZEYA 3I2JA 2D98A 1S0GA 4PLOA 4XAEA 1J3PA 4UW4A 3ACFA 1LU2A 3M7AA 2P4EA 4XUQA 4CPBD 4LO5B 5JR7B 2FBEA 4YVSA 5FBJA 2NP0A 3JQXA 2JB4A 5BXXA 3HJRA 3U11A 5JR2A 1UN1A 4PCRA 4Y26A 4ATEA 4CCEA 3LA7A 2WWSA 3ITQA 1RUH1 1KFUL 3MBWA 3PUAA 5FY9A 3KHCA 4UBHA 3RSJA 3WQBA 3L2YA 2RS32 2D6OX 5FPZA 2WC2A 1QQP2 3L2HA 1RUD3 2A6XA 1QJY1 1NXD1 1SCSA 1N1TA 1XSQA 5C4WC 1LGNA 3GNEA 1VRH3 2HEYF 3LOBA 1QJZA 4A41A 2R16A 3AKTA 1DLCA 1IG0A 2IFRA 3VBSB 2XOMA 2YGLA 2OKXA 3MICA 4OMDA 1XNDA 1BEV2 4JRAA 1NY72 5SV5A 4OI4A 4M4PA 1QJU2 1DHKB 4YRDA 2Q4SA 3GBGA 1BCXA
chains in the Genus database with same CATH topology
1RUF1 4XMIA 2HEVF 4AFBA 4E4SA 3IDBB 5GJ6A 4PDWA 1YJLA 4KWJA 2ZA9A 1LHNA 1UW8A 1RVF2 2JG9A 3SH5A 2AZ5A 1V6IA 5CADA 3ROUA 1QH6A 4GMP3 1PVXA 1ZVFA 2X5IC 4RS5A 4CP0A 3VDDC 4OHYA 4AEDC 3D4KA 4YVWA 2GMEA 1LB2A 1ASJ1 1MS0A 2ARBA 4COUA 2GC3A 2C0ZA 2X29A 4D94A 1C8M2 4C0HA 3N7LA 1XYNA 1C1LA 3KD4A 4LO6B 2QVSB 1IPKA 4LBOA 1OFNA 4QHBA 2ZABA 4LE4A 1GZWA 4CDXB 4JTNA 1PGW2 4JTOA 2P37A 5K9YA 3M3IA 1YFYA 4K1ZA 1ND3C 3CJXA 5GZEA 1UAIA 1D4M1 4Q0UA 3JBG3 1CGPA 2W52A 4AVBA 3RWNA 5FO7B 2AH2A 4A7KA 3HT1A 1G9AA 1BZWA 5K0UC 2R32A 1GLHA 3UKNA 3VKLA 3FBMA 1WLCA 1FMD1 2ZAAA 1W6OB 4AFMA 5DDJ2 3VBOB 4IV1C 3LAGA 3FLPA 5CIRA 1LCLA 4LBLA 3UJQA 1CR7A 2A6ZA 1DGLA 3WDTA 5DUUA 4RR3B 4A7ZA 3WT3A 1RHI2 3HIFA 4SBVA 1VR3A 3ZIXA 1D2QA 1PZ8A 2YYOA 4G4FA 4OHWA 4CDUA 1OA2A 2HWB1 3C2UA 3J8F1 4LUMA 1AYN2 4XYXA 1FPN3 1W6NA 2LM3A 3B5LB 2JKBA 4OHVA 1AXYA 4J6GA 5T52A 4AVSA 1PZ9A 1RUG2 3FUQA 3VHPA 5BNQA 1W6QA 4FPHA 3H8UA 1D4VB 4K7JA 1Q3EA 5GZDA 3VZKA 1LESA 2RR13 1BXHA 1XE7A 4Q4V1 3IPVA 3ZXAC 4FPCA 3V0BA 1ZREA 1PHMA 5CFCA 2ZGSA 3HBZA 1Y7BA 3B01A 2EALA 4YNIA 5C4WB 3CL1A 3OYWA 2WA3A 3R4DB 1QOSA 4G3YC 5KXEA 3BOWA 3WP3A 3ZDSA 5FDBA 1SDWA 4NO4A 4AF9A 2WNUA 2BW8A 2ZMKA 3ZSJA 2HWC2 3DPRA 3KMHA 3VBHC 2CWSA 5FTTC 3MI8A 3N7MA 3AP4A 4QM8A 5JCTA 5JZGA 3RZZA 2CWMA 3JQWA 5L19A 3U10A 1COV1 4XOGA 2XWJB 3RG0A 2WNVA 2PLV1 2GDFA 4W65A 2GC2A 5JOZA 3FBYA 3JZVA 4H7MA 1FV2A 4Y1XA 2UURA 2X5IB 3VDDB 4UXAA 5K8SA 2WFF2 3VBRC 1IKPA 2XKOA 4XETA 3DL3A 2AENA 3LGRA 2HWD3 4TSVA 4N9IA 3ATGA 1PIV1 2HWF3 1FXZA 3ZFFC 4IEOA 2PELA 4MSVA 5EYXA 1MS8A 4QM9A 1DU3D 3JB4C 1VB4A 4ATFA 4EN6B 1DGWX 3BTAA 2GN7A 1FOD1 4LEJA 5LRSA 1CONA 1ND3B 2JX9A 1UMZA 1PK6C 2D7FA 1LOFC 1V70A 2VNOA 5DG2A 3TN92 2VH9A 4LBKA 1TNRA 2NN8A 4DB5A 2GNBA 1FAYA 3IN9A 4LBQA 3MW2A 3TBDA 4Z1VA 1TEIA 5K0UB 4ES9A 1AR62 1JBCA 2DU0A 4OULA 5HCBA 5B2GB 1OPMA 2ZX1A 1VBC3 2XBO2 1B35A 4K3UA 5DZFA 1O4TA 3HR9A 5DUVA 5JDBA 3RYKA 1RGSA 3AKSA 1F2NA 1UCXA 2RS52 1KD7A 4IETA 3WD5A 2VUAA 1RITA 3ZFEA 3AYCA 1CX4A 4JVAA 1RUD1 2OW4A 4EWDA 2R042 1AL23 4QQ2A 1VRH1 5AVAA 1J3RA 5JPNB 4FAGA 1ENRA 2KXLA 4E2GA 5JI9A 1VAVA 1HLCA 2B46X 1ND2A 2RMU2 4P9XA 3D82A 1XQNA 2ARXA 5C8CC 4HPKB 1TMF2 1V9U2 5CBLA 1RL3A 1QY4A 5H9QA 5A33A 3BODA 1FNYA 3D6EA 2BYVE 1UZZA 2CGNA 3NSTA 4K40A 4AQ2A 4CP1A 3LWCA 4HETA 4CEWC 1WCSA 4GMP1 4Q1PA 1YXWA 2GU9A 1DQ0A 1U5IA 2ET1A 3PVOA 1GANA 4JC1A 4XF3A 5EXOA 3SISA 5BNOA 5GZGA 2VXRA 2RS12 4H7LA 1HW5A 2MEV3 4Q4X2 1VJ2A 5K7PA 1C8NA 3VBHB 4YGBA 1C5IA 1HXS2 1WMDA 3U07A 1Z7S2 2Q1MA 2Y0IA 2QZ3A 5I93A 1BKZA 3H1MA 2YPJA 2OIIA 2ZGUA 5AVPA 5T54A 1D0HA 3V56A 5D8AA 2PAKA 4FTSA 3MIFA 2HWE2 3WG4A 1W6MA 4W6YA 2R062 4I0BA 3L9JT 3MW3A 1WLDA 3LSEA 3VBRB 2AUYA 3P3PA 2IXHA 1DYKA 2XLAA 4NPRA 1DYPA 2XPJA 1H4GA 4XE9A 5KXDA 3JBG1 4XXPA 1RUE2 4MXWB 1IGOA 3ZFFB 1CAWB 1JOJA 2GMPA 1ZBE3 4IEYA 4X8NA 1OKQA 4FO9A 1BMV2 2PAMA 1AL0G 3OGJA 1MVQA 1SMVA 3AMMA 3AJZA 4AK3A 1SFNA 4E4ZA 1PK6B 1N3OA 4FPJA 1C3HA 2YGMA 4H14A 1SACA 1DQ1A 2GC1A 3EO6A 3POYA 3BCWA 4IEPA 1AR91 1WW4A 5KXCA 2VVDA 1QJX3 1J58A 1BK1A 1PO23 1ULGA 3M3QA 2AR6A 4G9SB 2VUJA 1VAKA 3CLPA 4DXZA 1MEC2 3USUB 3SMHA 5FQ0B 1LOEA 3RDIA 2E6VA 1CAUB 1FPN1 3O0XA 5LK7B 2EF6A 5CNAA 1CESA 1KQRA 3FE5A 3PJQA 4LR4A 4OVEA 4FCAA 4Y1YA 2IWGB 3KT1A 3I59B 4HKWA 2YUEA 1EPWA 4FP3A 2ZJCA 2VGDA 2IXJA 5D1IA 1QU0A 2RR11 4FQZA 4BOWA 5CFDC 1BBT3 1MS4A 4GB32 3OY8B 2NMOA 4RA0A 4IEZA 2JE9A 2XB6C 2YV8A 2ZOEB 4D3WA 1VAMA 4I0AA 5T5JA 1MS9A 2XUMA 1YWKA 2BGCA 3H1WA 4HK8A 5AC92 4KGQA 4K8FA 5JOXA 2A3YA 3VL8A 2ZBJA 4MVTA 4XF4A 5C8CB 2A3WA 1RUI3 2VECA 5J3UA 1DDLA 1HRI3 3R4UA 1AYM3 2KA3A 1O7FA 1AR82 1YI9A 1HRV2 2ZGNA 1O3QA 2GALA 4X8PA 1WBFA 3SCGA 4S2HA 3E6BA 1UD1A 3ZXGA 5JWPA 2DFCA 3D5OA 4MH0E 2WL1A 4CEWB 5LEKA 1QXJA 1EAH3 1QH7A 1GZCA 2E51A 2HWD1 4DOUA 4HMZA 1SLTA 1QHDA 1LGBA 2HWF1 3AKRA 4FPEA 4PJYA 3VBFC 4YLZA 2XVKA 4YM2A 4XIOA 3WQ7A 1LECA 2PA7A 4BCUA 3TWIA 3NV1A 4C91A 1MZFA 5ACA3 1JW6A 1QOTA 2JG8C 3FZ3A 4PLNA 4UW3A 4IEVA 3ME2A 1DZQA 4R9CA 5IK4A 3FLTA 3ES1A 3MPBA 3LZZA 3NV4A 3MF6A 3NL1A 3WINE 1JTZX 3D0JA 1LHOA 5EYYA 2OZ6A 4MYEA 3SH3A 1ZA4A 4AVTA 4LO4B 4XJUA 2BFUL 3OPZA 4KNCA 2VY0A 2VW1A 3H0OA 3AYDA 2LTNA 4CDXA 3T1MA 3JCIA 3VZMA 2R073 5GALA 3UV9A 1DFQA 3FMGA 4YZ4A 1U12A 4EWEA 4A7YA 1VBC1 2DUOA 5F1RA 1RMU3 1LODA 1NE6A 3M70A 4Q2FA 5GZFA 5KHIA 1K5MC 2AYHA 2ZKLA 3TNQA 1FYUA 1PGSA 3LB9A 4DFSA 5J7MA 3M1HA 1N1SA 2WZR2 4E4DX 3MGUA 1H8TC 2OUHA 3N36A 1W6OA 3OTFA 2QZ2A 1ZYBA 3JB8A 1Y3TA 3WQ1A 1M06G 1LEMA 2VMIA 1AL21 2BVVA 2H0BA 2D3SA 3HMYA 3JD73 1O3TA 4NHKA 1R092 4UBGA 2ZCWA 4RR3A 3POSA 2E7QA 3WX5A 3ENRA 2DURA 5I91A 1JXNA 2NPIA 2CAUA 1SLIA 4XTPA 5JOWA 1OHFA 1CAVB 2JD4A 2GNTA 4HBNA 5CFDB 1PNFA 2WS93 1UF2C 3JU9A 3U0ZA 3GBWA 1QQP3 3VHRA 2WFPA 4COVA 3V65A 1DLLA 2DUPA 3UKVA 3M3EA 3THPA 2ZKNA 3B9CA 1IZ3A 1RUH2 2BWCA 2DVGA 1EP0A 4L9BA 4LHNA 4QQLA 5FLIA 4WBBA 3AFGA 1VBE3 4NHLA 2MEV1 1QOOA 3NAPA 4YW3A 1QJY2 4I09A 3VHOA 3T2TA 4QPGC 5C4WA 3RI8A 5L73A 3R6SA 3ILRA 1LU1A 3MLLA 3RYRA 3VBUC 2IXKA 3MPPG 3AK0A 3E6DA 3WY6A 3AYAA 2QUOA 1RVF3 4P9JA 4XDQA 2UWCA 3WW4A 4Q4W1 1UX6A 1AR71 1RUF2 3HT2A 5I8SA 1G9DA 4JGZC 3PTYA 1SQ4A 4BZ4A 4CYDA 3NJZA 4WZFA 2VOKA 1MVEA 2I07B 5HCAA 3R05A 3VBFB 1APNA 2BUKA 3FHIB 2UU8A 3HN1A 1C8M3 2D6LX 3VDDA 3SNMA 1XNKA 2GC0A 2WQZC 3V0AB 1LKNA 1XRUA 2OPKA 2JG8B 1ASJ2 1DZTA 1JN2P 1ZBE1 1XNBA 3FWEA 4U2AA 4DRRA 4AXOA 3PMEA 2XJTA 3CNAA 4YARA 1ENSA 1J1TA 5T3NA 1ZRDA 2E53A 4AI0A 4CDWC 5BNPB 1H9PA 2RHPA 2Y0OA 2ZHKA 1S2KA 1SLAA 1PO21 3OD4A 4IV3C 1AJOA 1REFA 4META 1PVC2 2QJVA 3AZWA 1HQLA 4X6QB 2GH8A 4AFCA 3ES4A 4DY5A 1ND3A 3WR0A 3AXDA 4EN0A 2O0OA 2O1QA 1D4M2 4QU2A 3ZYJB 2XJSA 2YMZA 1K5MB 1R1ZA 2R0HA 3APBA 5E89A 2VW2A 3ZXDA 3WG1A 3AMHA 5KHGA 4I3PA 1BBT1 2A73B 3I2DA 1MS1A 1H8TB 1PNGA 4XMAA 3KS7A 2QDNA 3FFQA 1I3HA 1AYN3 2CY6A 2VOXA 2W68A 1VBD3 4XQ4A 3AX4A 2WSVA 4QX5A 5IK8A 4I3GA 1GKBA 1RUI1 1RUG3 4XFIA 1HRI1 2C9AA 3B94A 4HLTA 1AYM1 4HKLA 4N53B 4P5HA 4MGYE 1N3QA 3J8F2 3MLKA 4QPIC 3WDUA 3ZYRA 3H7YA 1MACA 4AQTA 5CG8A 1S55A 4V1PA 1RUJ3 1W2UA 2XLFA 4ORFA 4FAHA 1H1IA 1KITA 3I8TA 3A0NA 3ZXKA 4AFDA 4JGYA 3B93A 1H2MA 1XYOA 2DVFA 2DF7A 4Q4V2 3N3HA 3O0VA 1S0FA 1CAXB 1EAH1 2ZS6B 3ZVXA 1QWRA 5FBZA 3VGIA 1F8VA 4BLJA 1ZBA3 2DVBA 2Q5TA 4PIZA 4A3XA 1Q8SA 2G4IA 4QPGB 5T5PA 1LHUA 4OI0A 2H0VA 5ABJC 5C9AC 3VBUB 1RIRA 2A75A 3WW2A 3A0KA 5ACA1 1OFSA 5IK7A 1UL9A 4W6WA 2ZHNA 5I0TA 4CEYC 4RHV3 1YJKA 3MW4A 3ZMNA 3OCPA 3VBHA 5J98B 1C28A 1X50A 3ILFA 3OGGA 1DQ5A 1T6GC 4JGZB 4YG3A 1COV2 1X8EA 4BLIA 5EWSA 1G9BA 3S6PA 3EXUA 4NN0A 4LNVA 5TSWA 3H1YA 4Q8KA 2ZGMA 5GLTA 2AREA 5GLZA 2C1FA 2R071 1NG0A 3VBRA 1H0BA 2A70A 1ZZ9A 2LUWA 1RMU1 1OQEA 1ZRFA 1IS5A 1V6KA 3CJIC 1PIV2 4MXWA 1U5ZA 1CAWA 4CDWB 1EV13 4IV3B 3GALA 4QGLA 5SV8A 4LBJA 4HVRA 4KG8A 3BPZA 3ZO0B 5AFBA 1IKQA 1AR93 1FOD2 3JD71 3KSCA 2WNEA 1PK6A 3INAA 4GWMA 5JPMB 1DBNA 3K51A 5DUWA 4YVSC 3SCHA 4COWA 3KGZA 2XJRA 2DU1A 3USUA 1S0BA 5FQ0A 3AKQA 2RS53 1CAUA 2HYKA 2WS91 5H9SA 3ZN6A 1YFWA 4AI1A 4XTMA 4YZ2A 2UWBA 3MFCA 1O4ZA 3I7DA 1QQP1 3EQEA 1OI6A 1MR5A 2RJKA 2ZAHA 3RYPA 4K1YA 4WM8C 2RMU3 2XVLA 3O7OA 2WZPP 2ZGLA 3OY8A 1TMF3 4KBBA 1VBE1 3OD0A 5JLVA 1RUD2 3TOJA 4GIQA 4QPIB 2FZ1A 2SBAA 2ATFA 1VRH2 3ACLA 1FV3A 1RJ8A 2JICA 5BV6A 4QGNA 3J26N 4PDWC 2DWRA 5C8CA 5HXVA 4ZKTB 4Q1RA 1RVF1 4XBLA 2GN3A 2JG9C 2MNGA 2VOWA 3THTA 4N90A 4IXLA 4Y1UA 5T5LA 1CJPA 1TQ5A 2ZPXA 3WCRA 3KB5A 4YVWC 1RUC3 3PHMA 4I30A 1G86A 5EFUA 3VZJA 2GNMA 1WW7A 1BQPA 2QKDA 4UW5A 1ZZCA 4Q4X3 3ZFGA 1UKGA 1WW5A 3AB0A 4AEDB 4LE3A 2NMNA 3DV8A 4CEWA 1Z7S3 5ABJB 1C8M1 5C9AB 3WCSA 3MEPA 2WLQA 2XKPA 4BIFA 5J96B 1JHNA 2HWE3 3M8LA 3WP5A 2R063 5BUVA 5I0SA 4CEYB 1H2NA 3IDCB 3Q9OA 1SBFA 4LLOA 4AGRA 1AX2A 1CPNA 1R082 2QFEA 1LJ7A 4FP2A 4HKOA 2ZGKA 3IKWA 2WT0A 3MDPA 3MIBA 1IHMA 3VZLA 3ZYIB 4DMIA 1RUE3 4IQPA 5BYNA 1O3SA 1Q5OA 1QDOA 3ST7A