3N36A

Erythrina corallodendron lectin mutant (y106g) in complex with galactose
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
242
structure length
242
Chain Sequence
VETISFSFSEFEPGNDNLTLQGASLITQSGVLQLTKINQNGMPAWDSTGRTLYAKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGGGYLGIFNNSKQDNSYQTLGVEFDTFSNQWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILHAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFQASLPETND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lectin
publication title Modification of the sugar specificity of a plant lectin: structural studies on a point mutant of Erythrina corallodendron lectin.
pubmed doi rcsb
source organism Erythrina corallodendron
molecule tags Sugar binding protein
total genus 51
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2010-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3n36A00
2ZHMA 2VXRA 3MPPG 1NXD1 3WG3A 1KJRA 2D3RA 3NWKA 3WZ1A 4AWDA 4K21A 2WJSA 2EXHA 3W58A 2A5ZA 4LBQD 4PBOA 1QF3A 1QGLA 1LGNA 3OBRA 4BMBA 1KITA 2TEPA 4XILA 2LALA 1SCRA 2A6ZA 1I3HA 1QOSA 3C2UA 3HN1A 1GV9A 4XOGA 2DU0A 3ZSLA 3JUUA 1D0HA 2V5YA 3OBTA 1Q56A 3A0NA 1HQWA 2P34A 3APBA 4RL7A 5JOZA 1W6OB 4PF5A 4FPYA 3USUB 1FATA 3R05A 3PVEA 3AZVA 4FPKA 2GMMA 3B3QE 5GZFA 2ZKNA 3SNMA 3V0AB 2FHRA 2YY1A 3AYDA 3WCRA 4FPFA 1YYNA 1QDOA 2A71A 2OVUA 2NMOA 2VW2A 5JOYA 1G9DA 1N3OA 3AJZA 3AP9A 1LHUA 2D6MA 2JE7A 2JKBA 2ZGNA 1AF9A 2NN8A 1N1VA 3LSDA 5IK8A 1YO8A 1LHOA 1JBCA 1DQ4A 1N3PA 1V6KA 1VALA 5T5LA 4DRVA 2OW4A 4LBMA 1APNA 3AP6A 1LENA 2CWMA 4UW4A 1MS1A 4YM3A 4BOWA 4PQ9A 1AJKA 5GLUA 2GN3A 1VLNA 1W6NB 1UZYA 3AYCA 4YM0A 1MZ6A 3AP5A 1GSLA 2E53A 2R0HA 4LBQB 5GLVA 2AH2A 4K1ZA 1G9FA 4W65A 2GNDA 3AP7A 3OYWA 3WDWA 2A3WA 3WOGA 1CR7A 4XXAA 1YRZA 2E6VA 3M2MA 1VIWB 1AXZA 3AP4A 4YW5A 3ZXKA 2I2SA 1WUVA 2V73A 4GALA 4YG0A 2ES3A 1KDKA 4M3CA 2YV8A 3N7KA 1AVBA 4Y20A 2ZGLA 3WDUA 1JW6A 3NV1A 2W68A 1ENQA 2AUYA 1JN2P 4CTEA 4AGVA 1SBDA 2ZGSA 3AXEA 4FPCA 4NO4A 1MACA 1ULCA 2PHFA 4Q2FA 3ZSMA 3OPZA 3INAA 1KJLA 1W6PA 1W0OA 1WCSA 1KDMA 4AVSA 3BTAA 3FUQA 1QKQA 1WD4A 5JOXA 3V65A 3UJQA 1W6MB 1MS9A 1LOFC 1CIWA 1LODA 3BOPA 1LTEA 1CONA 1JXNA 3ZXLA 1MS3A 1LOGA 3N7MA 4LBKA 3O5SA 1V6MA 1F5FA 2ARXA 1ZA4A 4Q27A 1S0IA 4AGGA 5F9TA 2R16A 2C9AA 4GKXA 1QOTA 1O4ZA 5CNAA 3DUIA 4FP3A 1KRIA 2EALA 1CPNA 1HQLA 4YZ1A 5EXOA 2WNEA 1LCLA 1LOBA 2W39A 4U2AA 1ULFA 5T5OA 1A78A 3PJQA 1LEMA 5H9RA 4ZKTB 3AZXA 4R9CA 4XMIA 4FP2A 2NYYA 5DUWA 5KXCA 1FAYA 1DQ1A 4XJAA 1W6NA 1WBFA 5FRAA 3PVNA 1GYKA 1LHNA 1PZ8A 2XB6C 3RG0A 3ZXEA 1WW7A 2PELA 3O0WA 2EIGA 4FOWA 2D6PA 4XJZA 1WW5A 5E88A 2JDZA 1SLLA 1UPSA 4Y22A 3M3QA 4GWMA 4IQPA 2DVBA 5DG1A 2LTNA 1OFSA 1JHNA 2B7YA 2UWBA 2WKKA 3QLQA 4K1YA 5DUUA 1JYIA 4YFWA 1JUIA 3WVJA 4CZSA 3U4XA 1HKDA 2ZGTA 5F5QA 3SH3A 4Q1PA 1W6QA 3OYWB 2D3PA 1IKQA 3I8TA 1CVNA 1QOOA 3N35A 1LOAA 2D6OX 1KQRA 4ATEA 4YZ2A 2UWCA 3V0BA 1S0CA 4Q8LA 3UJOA 4YFZA 4M3CB 3WV6A 3OJBA 4Y20B 3VKMA 3ZSKA 2ZABA 1DQ5A 2GN7A 2SLIA 1R1ZA 4ISQA 1VAMA 3NV3A 1DLLA 4LBLA 4LBJA 1W6PB 1WD3A 2CY6A 1DYPA 2WT2A 4JCKA 3V64A 3ILRA 2EXKA 1H9PA 1UL9A 2ZBJA 1DGLA 1Q8OA 1V6JA 3BODA 5T52A 4FPOB 4ISRA 1Q8QA 2JJ6A 3B9CA 3RQ0A 5IK4A 4ASMB 4GA9A 3FUOA 3IMNA 1WLCA 1ULDA 3VKNA 3ZXJA 2ZHLA 5SV8A 3D5OA 1UKGA 1V00A 4DS0A 2DVGA 3B01A 1LHVA 5GZGA 5KXBA 3N36A 3FFZA 5JDBA 4FQZA 1DIWA 1ENSA 2SBAA 3TB0A 3M1HA 4BQ1A 1Y7BA 1LEDA 5H9SA 3VKOA 2ZGRA 3N7LA 3VV1A 3QCWA 1YI7A 2AENA 2XG3A 4Y26A 1BJQA 1UX6A 2KM2A 2Q5TA 2DV9A 4YGBA 5GLTA 1A3KA 2DWRA 1LHWA 4L8QA 4YW3A 3JU9A 1LJ7A 4XBLA 1RINA 4FVVA 1UMZA 2DU1A 1IS6A 2ZZJA 5DZFA 3D6EA 3WDVA 1AXYA 2WQZC 4U36A 1XQNA 1ULEA 1GZ9A 5T50A 2P3JA 1MR5A 2A75A 4FQ4A 4UW3A 2D44A 4Y1XA 2ARBA 5JMCA 2D6KA 1J1TA 1PZ7A 2W52A 5GZCA 1MVQA 4Y1VA 1AX0A 2EXIA 1Q8SA 4FPLA 2EXJA 1IS3A 3WDTA 4D69A 4Y22B 1LESA 2D6NA 4M3CF 2CYFA 2UWAA 2UU8A 4XDQA 1MZ5A 4XTMA 3FLPA 3O12A 5IK5A 3B69A 5GZEA 1DQ2A 2GNBA 2CNAA 3A4UA 3NV4A 4Y1ZA 2PHXA 1FNYA 4P14A 1W0PA 1G9AA 1N1SA 2VUAA 2WSUA 1LOEA 1W6QB 3T1MA 1MS4A 2DYCA 1DYKA 4YG3A 2GMPA 2DTYA 1DBNA 1BZWA 4YZ3A 4XJ8A 2YROA 5E8AA 3V0BB 3SISA 2VY0A 3AZWA 4YGCA 2ZA9A 4FPJA 2H0BA 5EYYA 3AJYA 1WW4A 2GNTA 4R9DA 4JC1A 4UW5A 3VKLA 1SBFA 1G7YA 2AYHA 2ZAAA 3FBYA 2PHTA 2VW1A 3HR9A 2WT0A 3I4IA 4XMAA 3W59A 3PVOA 2A6VA 1MS0A 3SH5A 2AGSA 2UURA 4XZPA 5HCAA 5IK7A 2D3SA 1LGCA 2DUPA 5BYNA 4UW6A 4BLIA 4TYSA 2ERFA 3AFKA 4YGEA 2OUJA 1A8DA 3D4KA 2R0FA 4I30A 5H9QA 2A7AA 1SLCA 2NZ9A 3R4SA 4FPGA 3UK9A 3N7JA 5T5JA 3MW3A 3WHTA 2E7QA 4DPNA 2W08A 1DQ6A 4Y1UA 1ENRA 1AXKA 1AJOA 2ENRA 3GALA 4Y1YA 3ZVXA 1LGBA 1ULGA 1FX5A 2DUQA 3AK0A 4Z8BA 2E7TA 2DVDA 1UZZA 3O0XA 3VUOA 1GLHA 1V6NA 3L2YA 5T54A 1C1FA 2P2KA 1ONAA 1YIFA 3TAYA 1GKBA 1MVEA 2D7FA 4NOTA 2JE9A 3WLUA 4AVVA 4XE9A 2G4IA 1WBLA 1LU2A 2BQPA 1IOAA 1EPWA 5EYXA 4R9BA 1C1LA 4AYUA 1IS4A 1WLWA 3ILFA 2DURA 1H9WA 1N1YA 2DTWA 3MW4A 3UL2A 3CNAA 4H55A 3LCPA 3N3HA 4DFSA 1Z0HA 1N47A 4GWNA 3H0OA 1DFQA 3HMYA 4PCRA 3WDXA 5GM0A 3RSJA 3WUDA 2YZ4A 4WVVA 3T2TA 3M3EA 1SLIA 1DHKB 5FREA 3WG2A 1BQPA 3R4UA 5DG2A 2P3KA 3ZPYA 1DQ0A 2DVFA 1HDKA 1SBEA 1Z78A 2JD4A 3ZYRA 1BXHA 1FNZA 1DZQA 1AX1A 4P9WA 4XJUA 1V6LA 1JYCA 4XHXA 5GALA 1LOFA 3WUCA 3ILNA 1V6OA 4M01A 3MEPA 1V6IA 2GDFA 4YM2A 1QNYA 1S1AA 1RITA 2A3XA 5GLWA 1MS8A 2PHUA 1S0DA 3A0KA 3AZYA 1UAIA 1NLSA 2EF6A 1N1TA 1TEIA 2ZGQA 3WDYA 2A6XA 4C1WA 5GLZA 3SLIA 1WLDA 2AREA 4HANA 1I1EA 2P3IA 2E51A 2ZMLA 5LK5A 3SH4A 3IN9A 5JVVA 5L73A 4DQAA 1LOCA 1G9BA 1SACA 2A6WA 3DGTA 2CTVA 2ZGOA 4YM1A 5HCFA 5DUVA 5DZGA 1GNZA 2WLQA 3PMEA 2VW0A 2GALA 3OY8B 1F31A 2R1BA 2Z42A 4MYEA 4YGDA 1FV3A 2FMDA 4FPEA 4GXLA 1D2SA 4XHBA 2D43A 2A6YA 3KM5A 3WNXA 1U0AA 3FLTA 3GNEA 1G8WA 4XXPA 5IT6A 3IM0A 3Q9OA 4BMEA 4M3CE 1N3QA 1FYUA 3LSEA 4LBOA 1CN1A 3SITA 1GZWB 2R1DA 4YW2A 1S0GA 4YW4A 2NMNA 3WHUA 2AR6A 3AXDA 4XBNA 4FPHA 5DZEA 3ENRA 2PHRA 1F9KA 1Q8PA 1S0JA 1ZM1A 1RIRA 3AYAA 5KXDA 2YMZA 2ZGMA 4XJ9A 5CA6A 4WV8A 3IPVA 1LULA 1QDCA 4XYXA 3RMXA 5E89A 1Q8VA 4Q26A 3POWA 1GBGA 5CAZA 4AVTA 5JOWA 4XIKA 4XIOA 3ZSJA 4Q8KA 1CPMA 4ZXKA 2A70A 3NV2A 3RMYA 4BM8A 1G9CA 2JECA 1OQ1A 1LU1A 1SFYA 1S0BA 4Y24A 4WVWA 1GZCA 2NP0A 3IKWA 1QMJA 4YLZA 1C4RA 1IKPA 1GICA 1CJPA 2DVAA 2RHPA 1H30A 3OGGA 3O0VA 2ZMNA 1SLAA 4WZFA 4HL0A 4LBNA 4YG6A 2YXSA 5GZDA 3WCSA 1C57A 5DUXA 5AVAA 5IUQA 1WW6A 4SLIA 3OY8A 3WG1A 4XJWA 3AX4A 1YXWA 3ZYPA 1W6OA 3ATGA 2ZGUA 4P9XA 4BPZA 3USUA 3AYEA 1FV2A 1OKQA 1PZ9A 3WG4A 4GKYA 1UN1A 1SCSA 3M3OA 2VH9A 1HLCA 2CL2A 2OUHA 4RA0A 5T55A 5JLVA 3V0AA 1VAVA 2NM1A 1GZWA 1AX2A 1AZDA 2ZACA 4TZDA 3RRDA 4P9YA 1SLTA 4R9AA 1S0FA 1MS5A 1G86A 3MW2A 1URXA 4XBQA 4F83A 3ASIA 1S0EA 2D6LX 1CESA 3T1LA 3RS6A 4DRRA 1LECA 1QNWA 3FLRA 4ATFA 2A3YA 1SLBA 4KBBA 2ZHKA 2CWSA 2WT1A 3POYA 4FOQA 5GJ6A 5CB7A 2ZHNA 4FOVA 4C1XA 4OZXA 1O4YA 5T5PA 3B00A 4ITCA 4CRQA 1JOJA 3M3CA 5KXEA 4LBQA 3POSA 4BLJA 4K20A 4M00A 4JRAA 4AGRA 4PBPA 2R49A 1CQ9A 2HYKA 4Q1RA 4YW1A 2GNMA 4YZ4A 1X50A 2EAKA 3BIWE 2GMEA 5CBLA 2DUOA 3IPVB 1BYHA 2VU9A 4YZ5A 5EWSA 2C5DA 2P37A 5DXDA 1BKZA 3AZZA 3ZXFA 1GNHA 2ZGPA 3KQRA 4FOYA 2ZGKA 2ZMKA 1GANA 5H9PA 2PHWA 1IS5A 1B09A 4XTPA 5HCBA 1QU0A 1W6MA 3VKFC 2WSVA
chains in the Genus database with same CATH superfamily
1B35B 1MQTA 5HPOA 4B8EA 2HWE1 4AWDA 2VVDA 2FDKA 2JG9A 5FY5A 2EXHA 5JPMB 3O1MA 3RI8A 4Y5Z0 3VBRB 4P00B 1MZFA 1LGNA 3DPRA 3OBRA 1KITA 4BMBA 4XILA 3BVCA 4XABA 1YUDA 4N9IA 4ET7A 4AVBA 3HN1A 1I3HA 4XOGA 5LA0A 1GV9A 5BNOA 1QJU2 1TMF3 2OT7A 3OBTA 3FN9A 2VZQA 2VTFA 2AEYA 4CP2A 3APBA 1CJDA 1JYTA 1W6OB 2WWUA 4FPYA 1XNTA 4XUNA 3TWIA 5HXMA 5FMDA 4CSWA 3UYJA 3R05A 3FBMA 3IDEA 3PU3A 5J3UA 3KV6A 3OPWA 3PU8A 2ZPXA 1OMIA 3ZLIA 3HNMA 2ZKNA 1TZOA 3SNMA 2YPJA 2YBSA 2OYZA 3WCRA 4CEYB 3L2HA 1UIJA 4FPFA 4LA3A 3WQ1A 1QXPA 2WR9A 4GB32 3ZYGA 1DGRA 2P3YA 2Z4FA 3JZVA 4CXWA 1LHUA 2JKBA 2JE7A 4XFHA 1PO22 4YSFA 2VQ0A 4CCOA 4NPRA 1EYBA 1RUE2 1V6KA 4Z2AA 5JZGB 5F8PA 1HB2A 3GZEA 1W2UA 2O1QA 4YRDA 1PVC1 2WFF1 2XMLA 1JZ4A 3PUQA 5D8AB 2Q1MA 4HSJA 1YJLA 2XBO3 4QX7A 1X7NA 5A3PA 2DCJA 1REEA 3EHKA 2GN3A 5IHRA 1UZYA 4BQ2A 1YFXA 3AP5A 3I7DA 2E53A 4HT1T 3CL1A 3HQUA 1G9FA 3AP7A 3OYWA 2OZJA 3N9PA 1LB2A 3SC7X 1UY0A 1RL3A 4YW5A 5BNNC 1WUVA 4XAAA 1UOJA 3J8F2 2Z2SB 5FO9B 1YQCA 2GC0A 4A7YA 4C90A 4KGGA 1ODMA 1RUC1 3WDUA 4M0HA 3GZTB 5A7NA 2E26A 1JOPA 1ENQA 3I2IA 1C3HA 2P6CA 4LOTA 3SHRA 1SBDA 3ZSMA 1QHDA 2WNUC 4NO4A 4QXBA 4YNIA 4AGVA 4CEWB 1VRH1 2PA7A 3INAA 4V2VA 3T0BA 1W0OA 1WCSA 2I45A 2ZZQA 3RZGA 3EBRA 2RMU2 5FZCA 5FZFA 1PIV1 1WD4A 4HSLA 1FT9A 1LOFC 1CIWA 1LODA 3BOPA 2WQ8A 3ZR6A 5BNPA 1MQTB 1CONA 5C3QA 1LOGA 1SEFA 2JG9B 4LBKA 5DDJ1 4AGGA 5L7OC 2ARXA 1ZA4A 1S0IA 4IE7A 4GKXA 4ASKA 3DPRB 5F5CA 1DDLA 1ALYA 1OLME 3DUIA 1Q5OA 3MUZ1 4FP3A 4JAAA 4DOUA 4LORA 5BNOB 1YWKA 1WCKA 1KRIA 4JVAA 4EZHA 3E1F1 5EXOA 2RDQA 2GP3A 1O6UA 2JDAA 4LHNA 1LCLA 2YUEA 1F2NA 4XUPA 4OUSA 5T5OA 3ELNA 1TQ5A 1EV12 1U5YA 3PJQA 4BQ3A 4E27A 1CAWA 2BW8A 5IATA 1ACCA 1OH4A 2I07B 2ZS6B 1RHI3 1FAYA 1OXCA 3EO6A 4EJRA 2J1EA 3POBA 3I2DA 5LBCA 3RJRA 1GYKA 4NRMA 3VGIA 1X82A 1PZ8A 3RG0A 4MZUA 1HJGA 1WW7A 4A7KA 5F5IA 3WF4A 2D6PA 3VN4A 4CCJA 1E5RA 1W3VA 1VMJA 5E88A 4EQVA 4QX8A 2W5FA 2DVBA 4O7XA 1YFYA 2LTNA 1DYOA 2ILMA 3H3ZA 5FP9A 1OFSA 4EWAA 3QLQA 2B7YA 4S2FA 5FY4A 4AFMA 3AMNA 1K42A 4YFWA 4UOJA 2VZ1A 2ZGTA 4QAWA 3ZSEA 2ZJCA 2JIJA 3SH3A 2BUKA 4Q1PA 1OA3A 3GF6A 2JE8A 3OYWB 3UGHA 4AF9A 1QOOA 3NAPA 2CGNA 4D7SA 4ATEA 1PO12 2UWCA 1QJZA 3GJAA 1S0CA 2B4KA 4CDWA 1PX3A 2VR4A 4JKMA 4LPLA 3WQ0A 1UCXA 1FMD2 4L92A 2SLIA 1NA1C 1RXGA 1CAXA 3WSOA 5EJZB 1V70A 3T08A 5FMOS 4QKDA 4ZPIA 4BB3A 3NV3A 3BU0A 1WD3A 1DYPA 4IW3A 4JGYA 3V64A 3LFMA 5ABJA 4D6SA 2EXKA 1RYYA 1DGLA 1Q8OA 1V6JA 3BODA 4NHXA 4ISRA 4QKBA 3B9CA 3FE5A 2Q8CA 5BNPB 3C7HA 4ASMB 4MOAA 5AC91 1JZ3A 1ULDA 2Y33A 3ZPOA 3ACIA 1XYPA 1GQGA 2QQNA 4GIQA 1JMUB 4P9IA 1UKGA 1V00A 3AL6A 4HK9A 3RGBA 3U14A 3W9AA 3B01A 4QPYA 5KXBA 2QNKA 2DCTA 3FFZA 4LOSA 1QJX2 5FMCA 3M1HA 4BQ1A 1U5ZA 1LEDA 1Y7BA 1IQDC 1LR5A 1YEWA 4OI0A 3HN3A 4CDQA 2J22A 3N7LA 3OF1A 3QCWA 3VV1A 3NNFA 2I74A 3R4DB 1BJQA 2QFEA 2DV9A 2W46A 3VBOC 4L8QA 2J1AA 1CAWB 1LJ7A 4FFIA 4NUBA 1JODA 4GJYA 3IAQA 4QMAA 5EPAA 5DZFA 3USSA 3UKVA 1RVF2 4WM8A 4FTSA 3HOBA 3CJXA 1BMV1 1RMU2 1J1TA 4L2NA 3MIEA 1ASJ3 2Q8EA 5GZCA 1POV0 1NXMA 4UF0A 1QIQA 3WW4A 4BIFA 4IEWA 4OI1A 2EXJA 1IS3A 3WDTA 1TMF1 3I3DA 4FTBA 2CDOA 1LESA 2ZEYA 1QJY2 3GDBA 4LLOA 3FLPA 3B69A 3HD8B 1ZRDA 2GNBA 5LY2A 1XNCA 3D3AA 2CNAA 2ORZA 4AEDA 3CKHA 4A3XA 1VBB2 4AL9A 1CX1A 3UGFA 4KI5M 3I2OA 2Q1ZB 2D97A 4DNYA 1KS4A 3NAPB 1I5ZA 1DYKA 3AL5A 3WT3A 4JQTA 4WM7B 5FK7A 2YROA 4NJ4A 5FUPA 1J3RA 2V5DA 4CDWB 3AZWA 3TN92 2JDMA 4YGCA 2Q0AA 3DECA 3PVBB 3J7LA 4KG8A 3VKLA 3THCA 2VMCA 3HR9A 2WT0A 1F5JA 1WMEA 4XMAA 4Q5OA 3PVOA 5FKBA 3W59A 5FPZA 2OQ6A 3NNMA 1MS0A 2XBO1 3K4ZA 1ST8A 1SPPA 4JGYB 5BYNA 2YU1A 2OX0A 5ABJB 5IK7A 1JS9A 2ERFA 2ARCA 5DAVA 2KA3A 2WZEA 4YGEA 5LEJA 2WIIB 5FZGA 3PIJA 3MW3A 2E7QA 2CHHA 1JZ8A 4CDUA 2RJKA 2G9ZA 1ENRA 1UU6A 2VO5A 3OB8A 4IESA 4Y1YA 3PHMA 1LGBA 4QGMA 4HVQA 4Z8BA 1BVP1 1PGW1 2E7TA 4ES9A 1UZZA 1H2MA 3LA7A 3O0XA 4D7TA 5D2AA 2V4VA 3E5QA 5FXVA 4A6OA 1V6NA 1UU5A 4CDQB 3CQOA 2P2KA 1XXNA 3H50A 5FP7A 3MIGA 4UFKA 3POGA 5BXXA 2D7FA 1XU2A 2XJTA 3WLUA 4AVVA 4YARA 2VCMA 2D98A 1TME2 4MH0E 1C1LA 2LM3A 4AYUA 4O9EA 3ILFA 3VDDC 2JDHA 2HKXA 4H55A 1EP0A 4KL1A 2Y6HA 1X33A 4GWNA 1DFQA 1H8TC 4PCRA 4QQLA 5F1RA 2XGXA 3TRSB 5GM0A 3VDCA 5KHGA 5C71A 1HJFA 1K5MA 4MUVA 5J09A 1ULPA 3M3EA 4KU7A 2WBKA 3CBNA 3HBZA 2W1WA 4TN7A 3DKQA 4UF0B 5FLIA 1NY71 5K8SA 2P4EA 4N53B 2VUDA 5DG2A 4DZGA 4L97A 2MNGA 4Y5SA 4ARYA 2Y8KA 2DVFA 5EP9A 5FP8A 2Y34A 4XZUG 1AYN3 2C6SA 1UXXX 1FNZA 4ZS3A 2PLV3 5C5UA 3BTYA 3RZKA 1C5HA 1V6LA 1W8OA 4QPGC 2W94A 1XYNA 5GALA 5JR7B 4AEDB 3KF3A 1W8WA 2JG8C 2WA3A 4MGZE 1RHI1 3MEPA 5M0TA 1QNYA 1S1AA 1HV0A 1RITA 5GLWA 3H8OA 1MS8A 2PHUA 3GXUA 4AR2A 3VHNA 1UAIA 4AFDA 3JQXA 1W3XA 2Q30A 1N1TA 1TEIA 2X09A 4W4ZA 5FFOC 4OHVA 4JKLA 4C1WA 4E2QA 1J3PA 2VZRA 2UY8A 1XJAA 4DQAA 1HQNA 4IEOA 2A6WA 5CU1A 4XETA 1ZBE3 3PNAA 3PTRB 1SPPB 1UPIA 3IB3A 5DUVA 5DZGA 1RUJ3 2GALA 2V09A 3OUJA 5A3WA 2Z42A 4BH9A 4C0HA 5C8CA 1CGPA 4F7ZA 2J1UA 2YFZA 1TE1B 4I3PA 1OD5A 1F4AA 2XVGA 3N9MA 4QB1A 3S30A 2QUOA 1J59A 4CDUB 4AEJA 4XXPA 3IM0A 3Q9OA 5KBFA 1O59A 4AHYA 1LAJA 4XUOA 4LBOA 3RWKX 3UETA 4GZ9A 4RGGA 3VBUA 4YW2A 3LOBA 1S0GA 4JDMA 2BJSA 2AR6A 4XBNA 1EAH3 4FFFA 4ARXA 2RJ2A 5FLHA 2IXCA 2X5IC 1ZRRA 4RGKA 5LA9A 5BV6A 3DF0A 4PDWA 4XJ9A 1RGSA 1QEXA 1D4M3 4WV8A 2WFPA 4EROA 2HWC3 4KGQA 4L11A 4QGNA 4LE3A 4IV3A 5JR2A 5LRSA 1YIPA 4QQPA 4XIOA 5ANNA 2XKOA 1AR82 1YHFA 4B3NA 4Q8KA 1CPMA 4EN0A 5FAXA 4BM8A 2JECA 1K5MB 1HXS3 1T6GC 1S0BA 1YJKA 2WL1A 4IEUA 1W8FA 2QQUA 1XNKA 4V2WA 4WVWA 4W6XA 1QMJA 4YLZA 3HBKA 1C4RA 2ID4A 1IKPA 2RM23 2ETEA 4CCMA 5JAXA 5JIAA 2XDVA 1H30A 2J42A 3D0SA 3OGGA 1GWLA 3JBG2 2H0VA 1ZZCA 5CIRA 2VTXA 4IEPA 1KXGA 5SV5A 5KHKA 2MEV2 1W8UA 2WO1A 3IZOA 4HL0A 2YXSA 5A7WA 3WCSA 3H3LA 1W8HA 5ACA3 4DXSA 1NQDA 3MIFA 3OY8A 3LD8A 2GC3A 5FPAA 5FYSA 1CAUA 3BI3A 1Y9QA 4QD2A 1PM4A 4LKDA 4R4ZA 2ZKLA 3SMHA 1L3JA 1NCRA 2ZGUA 4NIGA 3MUY1 5F39A 4W6WA 1ASJ1 2R7EB 4J25A 5T55A 1ND3B 2CL2A 5F2WA 1JZ6A 3ON7A 4CDXA 3UGGA 5C3PA 3V0AA 2NM1A 4XFAA 1ZZ6A 2W87A 4PIYA 3VD7A 3I49A 1U5IA 1DGWX 3S0MA 1O5UA 1W2AX 4R9AA 1T2XA 2HWE2 2GH2A 3MW2A 3WNLA 4GMP3 5C8CB 3T2OA 1ODNA 3ASIA 3VBHA 3H8XA 1LECA 1QNWA 2WNVA 4EN7B 2CAUA 1IZ3A 3RYPA 2DBNA 5FZDA 4AFBA 5K7PA 1YLLA 3GCWA 4GH4B 3MDPA 1WMDA 3VBUB 2VL4A 3KB5A 3PIGA 4PI0A 5A7SA 2QQVA 4CRQA 4CA9A 1Q3EA 2YBKA 1AR93 3KQ4B 2PAKA 4M00A 4LJHA 4JRAA 4PBPA 2R49A 2RS13 2DDUA 4YZ4A 4PDWB 3RDIA 3VZMA 2GMEA 4QGLA 3U07A 3HNBM 4I0AA 4YZ5A 4QQ2A 5L9BA 5EWSA 3J7NA 3MFCA 1GNHA 4IV3B 5FY1A 3KQRA 2C0ZA 2LS6A 3VB9A 5FMOL 4XF9A 3ITQA 5H9PA 1RJ7A 5A3TA 1NLRA 1OOPA 4KU8A 5JXJA 1PVC2 2WFF2 4FT8A 5HCBA 4LE4A 1RUI3 2OKXA 1NXD1 3HQRA 1ZRIA 2A5ZA 2JX9A 2VVEA 3WNKA 2ZX3A 4PBOA 1QGLA 4TWTA 4IUGA 2CDPA 2ZEWA 2LALA 5A7WB 2A6ZA 3C2UA 4O61A 4HONA 2W92A 3JUUA 2IFWA 4COUA 3SCFA 1D0HA 5G04L 2V5YA 4EN8B 5I93A 5DQ0A 5F3GA 5CISA 2MHFA 1HQWA 4XF3A 1RUC2 1NCRB 2MPFA 5BNQA 1YQ5A 1FATA 4LA2A 1V0AA 3PVEA 4FPKA 3ZFGC 1K12A 4CDXB 1VRH2 5FKCA 3B3QE 1IPKA 5GZFA 1LRHA 4D6RA 1OA2A 5EJ3A 3V0AB 4MLOA 1D2QA 2BTVC 3AYDA 3VLBB 5FXXA 1PIV2 1NZIA 1QDOA 2A71A 2E7AA 1ZVFA 2OVUA 1AYN1 3OOXA 2PLV1 3KT4A 2OZ6A 3ZYHA 2BVVA 3I54A 2ZGNA 1AF9A 5LEKA 2JDYA 3LSDA 3THTA 3WF0A 1YO8A 1I9RA 1LHOA 1JBCA 1DQ4A 2BGOA 2XH6A 3L9JT 3DYOA 5DDJ2 5T5LA 2OW4A 4LBMA 3VBHB 5FBZA 1L7RA 2WNVB 2VUCA 4UW4A 1OUXA 4QX3A 2DFCA 4H7LA 2OXBA 4YM3A 1GP5A 2R32A 4UT5A 4BOWA 1A8MA 5GLUA 2PXJA 1AR63 1SDWA 3AYCA 4YM0A 1DZTA 1MZ6A 4QX5A 1SFNA 2XQXA 3LDBA 5J98B 3LA2A 4HMZA 4XXAA 1J3QA 1H2KA 1YRZA 2GSYA 3JQWA 1AL0G 2JEMA 5CVRA 1ZBE1 5BUVA 3N9OA 4HG6B 1AXZA 2IC1A 1UQXA 4RS5C 4K8RB 1QQP3 2ES3A 4EN6B 1RUJ1 1UYPA 1V9U3 2PYTA 2VGDA 1HX6A 1AVBA 1Y43B 1GU3A 3NV1A 3PDQA 5CFDA 4CTEA 4FPCA 4I3GA 1ULCA 1QJFA 2PHFA 3M8LA 4AVSA 1ZREA 3BTAA 3FUQA 1OOPB 1QKQA 3V65A 2YC4A 2XWJB 4QPWA 1MS9A 3KHBA 3WF2A 4LK6A 1ZNPA 1XYOA 1UZ0A 3I2JA 1EAH1 4OUEA 3KMHA 3TNPB 3RWNA 3NJZA 4BQWA 3A21A 3N7MA 5A7QA 5IFPA 4IL7A 3C3VA 2C9AA 4BK5A 5E1RA 4DB5A 2HWB3 1D4M1 1VMHA 5K9YA 3GBWA 4W6YA 2RE9A 1SQ4A 1VJ2A 5D1IA 2H6CA 2HWC1 2EALA 1CPNA 1C5IA 2XLFA 3N9LA 3O1TA 3C7GA 3H42B 2WNEA 1ZBA2 2W39A 4Q4X3 4S2DA 3HAGA 1A78A 1QJEA 3AMMA 3AZXA 1STMA 1HXS1 2PN5A 4KWLA 2NYYA 3GYDA 3RVHA 5KXCA 4CUBA 1DQ1A 4XJAA 4COVA 2RM21 5FRAA 3PVNA 3SCHA 2F4PA 1YQ2A 2VQAA 1GUIA 1UY1A 4ZU7A 5AVPA 5A32A 5ACA1 5AC92 3DXUA 2VZOA 4IDZA 1WW5A 3DCQA 2JDZA 3POJA 2XJRA 4Y22A 2BDRA 2Y60A 5A33A 4XFGA 2K9ZA 3ZYBA 5K0UC 5DG1A 1OT5A 4AFAA 4KWJA 5CFCC 1VMFA 2UWBA 3BGAA 4IE6A 4NMIA 4QX2A 3U4SA 2XVLA 1UMIA 3WVJA 4CYDA 2XUMA 5F5QA 3K46A 5BNNA 5JXIA 3H8RA 4PHZA 2DBIA 1VB4A 2D3PA 4XF4A 3I8TA 1CVNA 3N35A 1LOAA 3LFIA 2D6OX 3NNLA 2P1BA 5FO7B 3VHPA 5FPXA 5FJKA 2BWCA 3I2KA 2WO3A 4ZS2A 1X9PA 3UJOA 4YFZA 1DLCA 1AYM3 2WNUA 4IGQA 3WV6A 2D5HA 1O91A 3VKMA 4GMP1 5I8SA 5CFDB 1O3RA 1BMV2 1VAMA 3OGRA 2WWJA 2O8OA 2QQPA 3CJIC 5IFTA 3MYXA 1J58A 2RJLA 4LBJA 4LBLA 5A80A 3ZMOA 2DFBA 2WNOA 5FYMA 1TMF2 2EVXA 3DYPA 2ZBJA 4PIXA 2VTXJ 3OGSA 5T52A 3HT2A 5L7OA 1OQEA 5KC6A 1Q8QA 2VMFA 5IK4A 5A3MA 2O14A 1AR91 4JHTA 2X8KA 2ZX0A 1WLCA 3FUOA 3IMNA 3POFA 1OUSA 3TEYA 3LEMA 2RS11 3H3UA 4DS0A 4DEVA 4R52A 5GZGA 4A6SA 1GMMA 3QH6A 5JDBA 4FQZA 2SBAA 1ENSA 3O1UA 5FY7A 4WVMA 2FCTA 4XUQA 1RUOA 3VKOA 2ZGRA 2Q1FA 4JRLA 2XG3A 4Y26A 5F7UA 2KM2A 4E4ZA 1C28A 4XBLA 4FVVA 4H3WA 1UMZA 4A44A 1RUI1 3WDVA 2WQZC 4TXWA 4IGOA 4XEZA 2XBO2 5I0TA 1OH3A 5L36A 1BEV3 1ULEA 2P3JA 2VZSA 1MR5A 3LEKA 4UW3A 4Y1XA 4Q29A 2D44A 1H4GA 4RR3C 5C3OA 1PZ7A 2W52A 4DO0A 1MVQA 5A32B 3BOWA 3I3MA 1M4WA 2EXIA 4FSJA 1Q8SA 4Y22B 4HOOA 5A33B 3FHQA 2PHLA 1PGW2 2B45X 2WS93 3O1SA 1E5SA 1W8ZA 5FYZA 3O12A 5GZEA 1SZBA 1PK6C 1RUF3 5EJ1B 2HEYF 4I2OA 1JYWA 4JX0A 3K51A 1K3IA 5BNNB 2VUAA 1LOEA 3E6DA 5DAPA 1MS4A 4OHWA 1CZTA 4LULA 1NX9A 3KV5A 4GQ7A 3ZO0B 1DBNA 1NA1A 4BYYA 4XJ8A 5BY5A 3LE0A 1EUTA 2LW8A 2VY0A 3LQCA 2WNUB 3EYPA 2VNOA 2ZA9A 3FFQA 5F37A 3AJYA 4UW5A 4CU6A 4AK3A 4MGIE 2JENA 1SBFA 2K46A 3LGRA 5IVYA 5C33A 3VL8A 3MPBA 2VW1A 3ORJA 2P17A 2BOJA 2VCBA 2A6VA 1J83A 3WR0A 1LGCA 2DUPA 1BVVA 2VM9A 1NY72 4Z1VA 3RZMA 4FBFA 1AR61 1MZEA 4FCAA 4TYSA 5L7OB 5IVJA 4X6RB 1XRUA 3D4KA 3UK9A 4I30A 1SLCA 2W1SA 3P6BA 1PNGA 1VRBA 1ND2C 3M7AA 4GWJA 4ORFA 1Y9GA 2W08A 2XJUA 2VZUA 4OYUA 3GALA 3HNYM 1ZZBA 4JV4A 2ZX2A 5FYVA 1RHI2 1QQP1 1FX5A 1V9U1 3AK0A 2Y0OA 5A3UA 2Q8DA 2RS53 1XE8A 2QDRA 3VBOA 4WVMB 4BHPA 3TYJA 3VUOA 3L2YA 1ND2B 2WO2A 4JHZA 2ARAA 3TAYA 5APAA 5B2GB 4NOTA 4ZXEA 4CCCA 2RDNA 4E2GA 4I02A 4LXLA 3ZFFC 1WBLA 2BQPA 2IXLA 4COYA 5JXHA 1R083 3IDCB 4NHYA 1DGRN 4HVRA 2WO7A 4P9GA 3N4MA 1RUNA 4QQOA 1RB8G 1WLWA 3UL2A 3ME2A 2QQOA 5LWBA 4UBGA 3N3HA 1WKYA 1N47A 1H2LA 1FOD3 3H0OA 4CCDA 3ZYIB 1H2NA 4LTAA 2HWB1 3I2HA 4WVVA 3EQEA 4HK8A 4WM7A 1UY4A 2GU9A 4IEZA 2BEOA 4BWOA 3WX5A 2P3KA 1ZBA1 3ZPYA 4AQSA 3CDZB 5CYYA 2JD4A 2QQMA 4Q4X1 4SBVA 2QTWB 2XHKA 3MLJA 4P9WA 4AHXA 4XJUA 2EA7A 1S55A 4XHXA 3AMQA 1WMXA 2R063 1V6OA 3FMGA 2UY9A 3BPZA 2GDFA 1UY3A 2PQSA 1JU3A 4IEQA 3JCIA 2IVIB 4E4SA 4MGYE 3ZOIA 1S0DA 3AZYA 3BU7A 4ZONA 5A6QA 1NA1B 4D0QA 3ETQA 4V1PA 4AHWA 4PF1A 4B7KA 4UXAA 4AE2A 3CF6E 3T09A 3SLIA 2Q8OA 3WNNA 3FX3A 1NKGA 4LIVA 4P9JA 5LK5A 1W2NA 4RFT0 3BKZA 1PVXA 4QPIC 3DGTA 2ZGOA 5FTTC 2WDBA 4LHLA 4NPMA 1GNZA 2WLQA 3I2FA 4LR4A 5G05L 2ET7A 2Y6LA 1F31A 4MYEA 1DG6A 4MSVA 3VBSC 1D2SA 5FLJA 4COZA 4CCLA 2D43A 3WNXA 5KHJA 2K2SA 1U0AA 2VMDA 3LEIA 1E57A 1ULOA 3GNEA 3LWCA 3PTYA 4BMEA 5LA2A 1JZ2A 2A1XA 1N3QA 1NCQC 4LUKA 4CP9A 1AYM1 2R073 4OQ8A 1CN1A 5KWRA 3SITA 4B7EA 3TEXA 1GZWB 3JB4C 3WEZA 4YW4A 3VBOB 4GJZA 3WHUA 4WBBA 3AXDA 4K9SA 4FPHA 4NAOA 4A41A 1HRV3 2V72A 3K2OA 4QB6A 2VOXA 4MGKE 4MADA 2H6BA 2PAEA 1ASJ2 1ZZ7A 5IYYA 3AYAA 4XFFA 3VDDA 1XNAA 4N53A 2YMZA 4B1LA 2ZGMA 5I0SA 5I91A 1LNSA 3OEBA 3IPVA 3HJRA 4MGQA 1H8TA 1AL23 1RTVA 3ST7A 5E89A 1Q8VA 4NRQA 4Q26A 4JKKA 5IW0A 2UYBA 4AVTA 1BBT3 4ONUA 3MZHA 3I97A 1OF4A 2VBDA 5I0DA 3QACA 1OD3A 3WNPA 4TLFA 2GC2A 5FZ3A 1SFYA 1PGL2 1H0BA 4DINB 1OSGA 4TSVA 3FHAA 5JXGA 4RD7A 2X05A 2QJVA 2XJVA 4MXVA 3IKWA 4QPGA 3VHOA 4W8JA 4AFCA 5C3RA 4AG4A 1CJPA 2JG8A 1CX4A 4CVUA 5A1LA 3D82A 2J1RA 4DUXA 4IXLA 2KXLA 2ZMNA 2ORXA 4WZFA 5EV7A 4FO9A 5FZOA 2WZ8A 2VOKA 2PFWA 4YG6A 1GQPA 4YVSC 1C57A 5DUXA 2YDEA 5IUQA 2VECA 4QM8A 4B4PA 2AC1A 2BOIA 2VCCA 3WG1A 3ZDSA 1BEV1 4K40A 3U10A 3PUSA 3W5MA 2QBXA 4NHMA 3QBQA 4P5YA 3T4VA 2CV6A 3P3PA 4BISA 1OPOA 2JDNA 4BZ4A 3RZZA 1SCSA 2IXKA 1DCSA 3M3IA 1HLCA 3M3OA 1VPHA 5JLVA 2B9UA 4I01A 3C7OA 1VAVA 3IBMA 3POIA 3OBAA 5E6HA 5FJHA 1XC6A 4H7MA 1AZDA 2WS91 2XJQA 4TZDA 5FPLA 2RV9A 3VZJA 5C9AC 1SLTA 2YBPA 1RUF1 1WA4A 5FR3A 1MS5A 2YG0A 2XLAA 4M0NA 1OFNA 2D6LX 1COV3 3T1LA 3AKSA 3RS6A 3FLRA 3IT8A 4PQQA 4ATFA 4X6QB 4Z07A 3WNOA 3K77A 3I3QA 2XUEA 3BB6A 4KBBA 5EZWA 2F17A 2Y6FA 1O8SA 2WT1A 3POYA 1FPN3 4FOQA 4XFIA 4CP9B 4C1XA 1UXZA 3FC0A 1IG0A 4WZCA 2X5IA 4DEQA 1JOJA 3M3CA 2JICA 3POSA 1C8NA 5A70A 4K20A 5HCHA 5DABA 4AGRA 3CU7A 1JHJA 1CQ9A 3QH7A 1O5LA 3WQBA 4AVCA 2CAVA 3VDDB 2IFRA 3VD3A 1X50A 5F2SA 4CCEA 5CBLA 3MI8A 3T30A 1JZ7A 3IPVB 1BYHA 2RS33 2VU9A 1H8TB 3LKJA 3LPGA 5IVCA 1AYN2 2CGOA 2JB8A 2P37A 3LEGA 2PLV2 4QQHA 3TBDA 4E9KA 1DF0A 3RYKA 3BTXA 4FOYA 3ZKUA 2IXHA 3MFAA 3U78A 3NKTA 5A1AA 2PHWA 1NYWA 1IS5A 2VBBA 3IMMA 4XTPA 5JPNB 2BYVE 1QU0A 4OLLA 2RS51 4KMQA 2WSVA 3WY6A 1PMJX 2VXRA 1PNFA 2WYFA 5A3NA 4XCBA 5L9VA 2CGPA 5FPBA 4QPGB 1KJRA 1LKNA 3NWKA 4QX1A 5C7GA 1RUH3 2VNRA 1ND3A 2WJSA 2JG8B 5KHHA 1VBE3 5LZ6A 3GHMA 5IWFA 5FZOB 4PI2A 3DYMA 4DXZA 1R081 1SCRA 1KD7A 2VMEA 3VZLA 1ZBE2 1NT0A 2DU0A 4QHBA 2B5HA 1Q56A 4KBZA 4UFHA 1RUJ2 3SEEA 2VNVA 4RL7A 5JOZA 1FOD1 1O7FA 1XB9A 4TLGA 4INDA 4YVWC 2E31A 1UYZA 4JTOA 3LIHA 4GH4A 4QDRA 2OS2A 1ZYBA 2AACA 1UZWA 4CPBA 1MEC3 2FHRA 2YPDA 1GOHA 2YY1A 4IETA 2ZEZA 3W20A 5IAXA 3VDBA 1VBD3 2VW2A 5JOYA 4P5HA 4N90A 4BQXA 1N3OA 3AJZA 3AP9A 2KR2A 1EAH2 2NN8A 5IK8A 3TOJA 2R061 1N3PA 1VALA 5DAXA 2O0OA 1QH6A 3AP6A 2CWMA 4XFBA 1W28A 5IVVA 5JCTA 4MV2A 1D4M2 1VBC3 4XFCA 2WN3A 5AFBA 1EPZA 1REFA 3MV01 1RUG3 2HWC2 1VLNA 1W6NB 2WA4A 2X5IB 3BTZA 1GSLA 2R0HA 5T5JA 3OEAA 2AH2A 3WDWA 4W65A 1OQDA 1GWKA 2WAAA 2A3WA 4HFSA 1HB4A 4QT6A 5JSPA 2E6VA 5JMOA 3M2MA 1CAVA 5D21A 3ETPA 5LCWL 1VIWB 1GNYA 1HXS2 3EXUA 3ZXKA 5K4LA 2PTMA 1WWYA 2V73A 4YG0A 4CPBD 1KDKA 2CSGA 2JB4A 3JD73 4M3CA 4CP0A 5KC5A 4Y20A 4EZ4A 2ZGLA 2RM22 2J1SA 3DEMA 5ISLA 2BNOA 4ZZ5A 3KSCA 1JN2P 1XNBA 2HWF3 1TNRA 3AXEA 4Q2FA 4AI8A 1MACA 3UNPA 2LROA 1JI6A 3ZFEC 4UI9L 1W6PA 5ACA2 4FFHA 5F3EA 4XQ4A 3GBGA 2R071 3J4UH 3UJQA 3VBFC 2C1FA 1UF2C 3FHIB 2TUNA 4HBNA 4Q4V3 3O1PA 1JXNA 4BA6A 1MS3A 2QE3A 3ZDVA 1HRV1 3QD6A 2N7GA 2XKPA 5F3IA 5FYUA 5F9TA 4NIIA 2R16A 1C8M3 3U37A 4XC9A 4MG2A 5FYYA 1RUD3 1QOTA 1X36A 2W95A 4MO3M 5CNAA 4QXKA 5FZ0A 3F2ZA 3NVCA 2OQ7A 1AL21 5JUVA 2WYSA 2WUHA 1GR3A 4GWIA 1UIKA 1BBT1 4NRPA 3ZXAC 3R0RA 1UY2A 3OSDA 4U2AA 3ZFGA 4I09A 4MHUA 3RZHA 1TVGA 5H9RA 4AOCA 5DAWA 1Q43A 3C7FA 4D94A 3OUIA 3JXSA 3PMSA 4R9CA 3O1RA 3WF3A 4Q4Y3 3UKTA 3F95A 4BK4A 4NVPA 1WBFA 2GH8A 3OGJA 5JSRA 2TNFA 3ZXEA 5FQ0A 4N43C 1AR92 2VMGA 4RYDA 2EIDA 3CHXA 2QCSB 1AR73 2XPJA 1UYXA 4FI9A 1BHGA 1R1A3 1UPSA 2JD9A 2RS12 4PLMA 4IE4A 2FMYA 3KLSA 4GWMA 3LAGA 4FAGA 2J1VA 3BALA 2WKKA 4K1YA 1JYIA 1JUIA 3U4XA 1HKDA 2BERA 4S2GA 4IEYA 4MGSA 1ZZ9A 4Q0SA 1W6QA 3MIHA 3ZM8A 4AI0A 1IKQA 3A23A 4LQRA 5C6CA 3ZXGA 1CAVB 1KQRA 1H1IA 4YZ2A 1IHMA 1RUI2 4M3CB 3NL1A 2VXJA 3NW4A 1US3A 4Y20B 1R093 1R1ZA 5J36A 1UOGA 4OHYA 2P5BA 3WQ7A 1W6PB 4JCKA 2CY6A 2WT2A 3OBZA 2QKDA 1FPN1 3ILRA 4EWEA 2YGLA 1EY2A 1W03A 1JUHA 1UL9A 3ABZA 2RDSA 2JJ6A 4N9HA 4XQDA 3RQ0A 3CEWA 4Y4RA 2G1MA 3EB7A 3Q8CA 4GA9A 5FYHA 5FXWA 5C5TA 3VKNA 4IV1C 3B94A 4HXCA 1YNAA 4A3ZA 1HRI3 2ZHLA 3D5OA 5IVFA 2DVGA 1A6CA 1H6XA 3N36A 1UX7A 4OHXA 1DIWA 5A7OA 2RS31 3TB0A 4CE8A 5KHIA 5FV3A 5C4WC 2LUWA 1YI7A 2AENA 5FY8A 4YGBA 5FY9A 2RR13 5GLTA 3ZFGB 1A3KA 1LHWA 4EV0A 2CU5A 2Y6JA 3BUCA 2NQYA 2HJIA 4OMDA 2BVBA 1K5JA 2ZZJA 1IS6A 4NWWA 1W39A 3D6EA 1AXYA 2G9FA 3LDKA 2HH9A 1XQNA 1POV3 2DCYA 2QZ2A 3PUAA 1YQ8A 4BQ5A 5A1FA 1RUH1 3Q8FA 1AR62 2FZ2A 2A75A 4FQ4A 5I8YA 1VBE1 3RI9A 4OCTA 4N8MA 4P08A 5FQ0B 1NLQA 4A45A 2PMWB 1OVSA 2R30A 4G9SB 1HB3A 5CFCA 1AX0A 4FPLA 4PLNA 5FZEA 4RHV3 3S6PA 3U11A 4D69A 4DIQA 2D6NA 3O1OA 4M3CF 2CYFA 1UWWA 1QQP2 3AB0A 1W9YA 1V9U2 2BZDA 2UU8A 5FOBB 4XDQA 4UFLA 5F5AA 4D7YA 4DY5A 1DQ2A 1KS5A 1UKRA 5E16A 2E33A 1FXZA 4KWKA 4Y1ZA 5F6LB 2PHXA 1FNYA 2HBUA 1W0PA 2WQ4A 4P14A 4RS5B 4OHZA 3RNSA 4EN9B 1W6QB 2Y6KA 2RDRA 1MEC1 1W9SA 5GKAC 5CZKA 3ES4A 4QU2A 4YG3A 1VBD1 3NQHA 5E8AA 3MV11 3THPA 4E4DX 3FJSA 1WGPA 2YB7A 3H1WA 5A7PA 4FPJA 3CJIA 1YFUA 2GNTA 4R9DA 2VC9A 1G6NA 1Z7S3 2YHJA 3KD4A 2ZAAA 3ACHA 3FBYA 2PHTA 3G6JB 3SCGA 2WZPP 2HWB2 1VBC1 4GULA 3B93A 3SH5A 3N9QA 2R043 4XZPA 3K3NA 4C91A 1ZA7A 2D3SA 2VUJA 5HCAA 2QQWA 1RUG1 4JDOA 4UW6A 4BLIA 4YPJA 2IZWA 3AFKA 2W47A 4OZOA 2HWD3 2R0FA 4JGZC 3AKPA 2A7AA 2NZ9A 4FPGA 4Q4X2 4RQPC 3ROUA 1Y3TA 3WHTA 4NAMA 3U0ZA 5KR7A 2QQKA 1DQ6A 2WZR3 3BCWA 4Y1UA 2FDHA 4QXCA 1AJOA 1AXKA 1IPJA 2ENRA 2G9GA 3ZMNA 3ZVXA 3C7EA 1QH7A 3MF6A 4QX0A 3JD71 4LHKA 5J48A 2DVDA 3K48A 1VBA3 5LBEA 4ZZ8A 4A42A 4N7UA 1GLHA 2ET1A 1SMVA 1UO9A 2HWF1 3NJYA 4E4HA 2FCUA 4EYUA 4E8CA 3IIAA 5TSWA 1GKBA 1MVEA 3K3OA 1MPXA 2EIBA 3CIHA 5FO8B 2X53S 3HT1A 1YI9A 1HW5A 1IOAA 3POEA 4R9BA 4UYBA 3WP6A 1OLMA 1IS4A 4Q4V1 1OF3A 3MW4A 4RR3A 1H9WA 1N1YA 2DTWA 2JDKA 3WINE 5DMYA 3LCPA 5EHDA 2XVKA 4E8DA 4N7IA 5J7MA 1UW8A 4F3JA 1NE6A 1C8M1 3WDXA 3RSJA 5B4XA 1VP6A 1ENXA 1RUD1 5K0UB 1H4HA 1GOGA 5FUNA 3T2TA 5EQUA 1SLIA 3LZZA 5CFCB 1NE4A 4Z2WA 1WMFA 4Q4W3 1X9TA 1PK6A 1T6BX 3WG2A 4NROA 4NHLA 1O8PA 5ERLA 1AYM2 1DQ0A 5A6YA 2ZXQA 4QXHA 1HDKA 4RGAA 4A4AA 1BXHA 2B9VA 3E5UA 3H8UA 2AEZA 1B35C 1AX1A 1DZQA 1VR3A 2VZTA 3KZ4C 1A34A 2ATFA 1LOFA 2TBVA 3WUCA 2EICA 3ILNA 5FYCA 4M01A 1W90A 3VBRC 2ZX1A 1V6IA 4HKLA 4NIDA 4NIAA 4AEMA 4O9GA 4Q4Y1 5FY0A 2LRPA 3A0KA 1OPMA 4D3WA 3DKWA 3NMBA 3SXWA 5JWPA 5FZ7A 2W3JA 4QWNA 1NLSA 3E5XA 2XQRA 3TEZA 2ZGQA 3CJIB 2JDUA 3D8CA 3WDYA 4C8DA 1AR71 2A73B 5GLZA 1WLDA 2AREA 4HANA 4LO8A 3T2QA 3ZX7A 1W2TA 2P3IA 1R1A1 4AAPA 3SH4A 5L73A 1G9BA 1SACA 1CIYA 3ZIWA 2CTVA 5FZKA 1QJU3 4YM1A 4M4RA 2IXIA 1ND2A 3PMEA 2JKXA 3KS7A 4XF1A 4CEYC 2B8MA 4BQ4A 3OCPA 4DUWA 2FMDA 3K4AA 4FPEA 2YC2A 4GXLA 4XHBA 2BBAA 3KM5A 4NR1A 4CU7A 4AQ6A 2XJSA 4I0WB 2R6QA 4UAPA 5JZGC 4AZZA 1J84A 2BV4A 4Z82A 3LSEA 3Q8EA 2BFUS 1BEV2 5D8AC 4GB33 3JB8A 2NMNA 2ZOEB 3BYWA 5LK7B 1R091 4PT6A 1PO23 3ZFFA 1RUE3 3WNMA 4A7ZA 1S0JA 3AMHA 1O3TA 1RIRA 1UU4A 2BGCA 4OUMA 4DMIA 3AKRA 1GWMA 3LA3A 3S57A 5KXDA 4NIHA 5CA6A 4J6GA 2D93A 4MXWA 4FAHA 4LO4B 4AW7A 2WS92 3RMXA 4RR3B 3ALQA 4BXSV 3POWA 4NHKA 1GBGA 5CAZA 4K7JA 1RUF2 3ZIXA 5JOWA 4XIKA 1HRI1 1GZTA 4ZU4A 2IVJA 2Y64A 4HETA 5FPUA 2A70A 2Z79A 3M70A 3SEPA 1G9CA 4AXOA 4C0BA 4CEWC 1OQ1A 3WW2A 1LU1A 1W8TA 3J8F3 4Y24A 1PMIA 1PK6B 2XR4A 3NKGA 5A3OA 2DVAA 1IG3A 2B39A 2RHPA 1QY4A 2RR11 1NG0A 4HN0A 4LIUA 4URAA 4IEVA 3O0VA 1MQTC 1SLAA 3WF1A 5FZMA 2B46X 4LBNA 2JG9C 5GZDA 5F3CA 3S7EA 1XSRA 2RMU3 1US2A 4SLIA 1UOFA 3DPRC 1POV1 2BGPA 4XJWA 3ZYPA 4P9XA 5BNOC 4BPZA 4META 3J9SA 3USUA 1UNBA 1FV2A 1OKQA 4ES8A 4BE3A 2HEVF 1JYVA 4GKYA 4QPIA 1UN1A 4Q0UA 1BK1A 2OUHA 2VG9A 3C8XA 1F4HA 4RHV1 1AHSA 1K45A 3X29B 1GZWA 1AX2A 5JIUA 3ZN6A 2Z5WA 1XOYA 2C26A 2RS52 4X8NA 5FUIA 3RRDA 3VBSA 1W04A 2Q4SA 4Y4YA 1G86A 1GP4A 1YQ6A 5FK8A 1EV13 2ZEXA 1NCQA 4K3UA 1S0EA 1CESA 3ECQA 3U75A 1W9TA 2XL7A 4IEXA 1REDA 2A3YA 4PLOA 3ZN4A 1JTZX 3ZR5A 1R082 1SLBA 2JIGA 3AFGA 4GMP0 1RJ8A 2CWSA 4AI2A 5GJ6A 5CB7A 4FOVA 4OULA 4BQYA 4OZXA 2J7MA 1WLTA 2EAAA 3VL9A 3B00A 2XOMA 1Z7S1 3J7HA 1WCQA 4LBQA 4QKNA 4BU2A 1FOD2 3ZFFB 3P5BA 5IVEA 3GM8A 4LUMA 2VQTA 3PL0A 2FDGA 2HYKA 4YW1A 1R64A 2R041 2EAKA 3BIWE 3R6SA 4B4RA 4MXWB 2BWAA 2DUOA 1DGWA 2HWD1 2BBVA 3D0JA 5BPXA 5FZ1A 4CXYA 1ZRCA 4B4QA 3AZZA 3H7JA 3ZXFA 2WZR1 2ZMKA 1GANA 2QQJA 2R062 1SDDB 3IAPA 5DAQA 5HV4A 2GP5A 1W6MA 1PO13 3TNQA 3VKFC 1VBA1 2ZHMA 3MPPG 2VNGA 3GHNA 5CG8A 1BLZA 1IGOA 1FMD3 3WG3A 2D3RA 3WZ1A 1O3SA 4K21A 4YVSA 3W58A 2XJPA 4LBQD 3ACGA 2YFUA 1QF3A 4QDQA 5BNPC 5FBJA 4RFRB 3IWZA 3NNGA 2TEPA 3E6BA 2ADEA 3THDA 1SFPA 1QOSA 1OBNA 1VE0A 2PAMA 3ES1A 3S7IA 3ZSLA 4CU9A 4AEKA 3A0NA 3Q8AA 4NN0A 2P34A 3HPNA 5LY1A 2OPWA 3VZOA 4PF5A 4HKOA 3USUB 5A3LA 1D4VB 4QPIB 1IPSA 3AZVA 3MGUA 4A2UA 4F8AA 4Q4W1 2XLGA 5C9AA 2GMMA 3M4FA 2BRTA 3RZLA 1QJX3 4QKFA 2R072 3ZN6B 1YYNA 3SKVA 1E5IA 2NMOA 3VBSB 4X8PA 5C70A 1G9DA 3NJXA 2D6MA 4J1WA 1S4CA 4ZY9A 2B42B 1N1VA 4IE5A 1HRV2 3B9IA 3CO2A 5LASA 1NCQB 4DRVA 1OVPA 3RYRA 1APNA 1LENA 3MLKA 3A22A 3V56A 3AVSA 1MS1A 1I6XA 3MICA 3KVBA 4LO6B 4W50A 3KT7A 1PMHX 3GCXA 1RVF3 1AL22 4PQ9A 2W91A 2V4AA 1S2KA 1AUYA 2FZ1A 2FCVA 1RMU3 2DCZA 1BBT2 4KH9A 4LBQB 5GLVA 2XONA 4K1ZA 2GNDA 4IERA 3WOGA 1CR7A 2JDPA 1UMHA 5A6ZA 3I3BA 1QJU1 2BP6A 3AP4A 1CZVA 2WN2A 2I2SA 3NNJA 1P8JA 2P6HA 2WLPA 4GALA 1QJY3 2VZPA 2YV8A 3NJVA 2VQUA 3N7KA 1XE0A 3NAPC 1HV1A 3T0DA 1JW6A 3BIEA 2W68A 4WM7C 2AUYA 1JU4A 4CDWC 2ZGSA 2BNNA 4Y3OA 1YFWA 1VBB3 3OPZA 4FFGA 1KJLA 1U12A 5CKMA 2JXAA 1KDMA 3ZN5A 3DXTA 5JOXA 1W6MB 3URFA 4GB31 4QDSA 2J1TA 2VVFA 5HI0A 3GJBA 3LPFA 3O1VA 1ZX5A 2K0GA 1LTEA 1PO21 4JGYC 4NE9A 3TN93 1XU1A 3ZXLA 5ABJC 1RUE1 4IGPA 4YVSB 3O5SA 1V6MA 1F5FA 2FDJA 4Q27A 4KQ7A 4XURA 1W06A 3GBFA 5FPVA 1VB2A 1QWRA 4M4PA 1CAXB 2VZVA 1SG3A 3GGLA 1NZCA 5I0RA 1ZZ8A 1O4ZA 5J37A 1ZRFA 2QDNA 5I0UA 1F15A 1RXFA 2DF7A 1I5PA 5LBFA 1WCDJ 2XWBB 2Z69A 5L19A 3W5NA 1HQLA 4YZ1A 2WABA 4YVWA 4PJYA 5DN2A 1LOBA 3OD4A 3S5QA 5T3NA 1ULFA 1LEMA 4LEJA 4ZKTB 1COV2 4CDQC 4BDVB 4NWVA 4XMIA 1WCUA 2WINB 3NO8A 4FP2A 5DUWA 3J8F1 1JOBA 4D8MA 3RZJA 5C9AB 3T2PA 3W21A 1W6NA 5FZ9A 1FPN2 1EUUA 3B5LB 1NQJA 4GAZA 2GAUA 2W1QA 4HN1A 3WD5A 3FWEA 4AAXA 3LF7A 1SHWB 4O65A 1LHNA 2VBPA 2XB6C 5CKNA 2PELA 3O0WA 3H1MA 2EIGA 4FOWA 1DZRA 4WM8C 4XJZA 5JSOA 5LA1A 2RMU1 4HVOA 1SLLA 5FWJA 1TME3 3M3QA 5FP4A 3O14A 4IQPA 3MHZA 1JHNA 2RS32 5DUUA 5J1XA 4XDOA 4OFGA 1KEXA 3OPTA 4N53C 5LATA 4AHZA 4CZSA 4LO7A 2BNMA 4QM9A 4WM8B 3VD4A 1WA6X 2W1UA 1JH5A 1W2OA 3T0AA 2YYOA 2VD7A 3GZAA 3KVAA 4UFIA 2OPKA 4AEDC 2VOVA 3BPSA 3V0BA 4Q8LA 4CCNA 3IIIA 4XAEA 1XE7A 3OJBA 1OA4A 3CLPA 3ZFEA 3ZSKA 2ZABA 1DQ5A 1EV11 1RUH2 2GN7A 5DPNA 1POQA 4ISQA 1VBE2 2FQPA 3MIBA 4XCAA 2QQLA 3VBFA 1JYXA 4JDNA 1CD3G 1DLLA 4TTGA 2FDIA 5I8TA 1BCXA 2ADDA 1KFXL 1KFUL 1H9PA 2WRAA 3H7YA 3VHRA 4FPOB 3K4DA 3MF9A 1H6YA 1BK0A 3UT0A 3AKQA 2W2IA 2VPVA 3ZXJA 5SV8A 1D0GA 2HLEA 1W05A 2AZ5A 1LHVA 3I2GA 3T4HB 5F6KA 3LOIA 1H8VA 4P02B 1MEC2 1U5XA 3HQXA 3WXPA 3KCYA 4CDUC 2L9LA 4RN5A 5IVBA 1VBD2 3E97A 2BFUL 1H1AA 1HB1A 1OURA 3MLLA 5FZ4A 5H9SA 2GC1A 1O4TA 1OLRA 4YVWB 5FDBA 1UX6A 2Q5TA 2DWRA 4YW3A 1CZSA 3VD9A 2WWSA 1GFF2 2YGMA 3JU9A 5EIYB 1RINA 1H1MA 1O3QA 1PO11 2DU1A 4S2HA 4XDPA 1VBC2 4Q0VA 4QHZA 5F32A 3AVRA 4U36A 5JI7A 1FMD1 4N43A 1GZ9A 4G3YC 5T50A 2JWPA 3K75B 5FIXA 1RUG2 5CKQA 3KT1A 3NRUA 3P1IA 4ZU5A 3UESA 5JMCA 2ARBA 2Y38A 4BJ0A 1JZ5A 2C9KA 3VZNA 2D6KA 2RVAA 3A7QA 4PIZA 1X8EA 4Y1VA 1UZVA 4QB2A 3EMRA 4LK7A 1FI2A 2D5FA 3QOPA 2UWAA 3G7DA 5FZLA 1K5MC 2VMHA 3JD72 3WP4A 1MZ5A 4XTMA 5LW9A 3IDAA 4LNVA 2QQIA 5FZAA 5J96B 3E6CC 1OI6A 5FWEA 3A4UA 2HWF2 3DN7A 3NV4A 1AR83 1G9AA 4HZFA 1N1SA 2WSUA 3T1MA 1QJX1 2DYCA 4R4XA 1DP0A 2GMPA 2DTYA 1BZWA 3CZUA 3FL7A 3HEIA 3KCCA 4YZ3A 3WW3A 4I0BA 3SISA 3HIFA 4Q4V2 2YC0A 4YW7A 3V0BB 4XW3A 3WW1A 3J26N 2OA2A 2H0BA 2D40A 2UYAA 5EYYA 4AI9A 1WW4A 5AFEA 3ZFEB 4JC1A 2C24A 4DY3A 5CEHA 2AYHA 1G7YA 3JBG3 4XACA 1JYNA 5FOJB 2MEV3 3I4IA 1C8M2 4YW6A 3NSTA 3VBFB 2FDFA 1RUD2 4CP1A 1ND3C 2AGSA 2UURA 4OQ9A 1RVF1 2VOWA 4IV1A 3U1XA 3VZKA 3OD0A 2E63A 2OUJA 2YU2A 1RMU1 1A8DA 5FXZA 5H9QA 5IK5A 3KCXA 3R4SA 3N7JA 3P3NA 3MBWA 4UBHA 3UV9A 4DPNA 5LB6A 2FBEA 5C8CC 4KNCA 5C4WA 4IE0A 1ULGA 2DUQA 1QJY1 4HKWA 3ZYJB 4G4FA 4E2SA 2Y0IA 2ZAHA 4Q4Y2 2HEWF 4GH4C 2HWE3 3KHCA 4DXTA 3OTFA 4OI2A 5T54A 1C1FA 3VBUC 1ONAA 5FZHA 1YIFA 1VBB1 3DV8A 5IAVA 2JE9A 1AR72 4FXGB 4UFJA 4XE9A 2G4IA 1LU2A 1R1A2 2IWGB 2O8QA 3LB9A 1EPWA 5EYXA 4EWDA 4RSUA 2PHDA 2DURA 2DCKA 4R8HA 3TN91 1CWPA 4PDWC 3CNAA 4N43B 3OUHA 1IQAA 4DFSA 5HV0A 1HIXA 1Z0HA 4AI1A 1NUKA 4XUTA 4H2AA 4RS5A 2BPA2 3LIGA 3HMYA 3O7OA 4OMCA 3RJ2X 2G19A 2QVSB 2E32A 2YZ4A 4IV3C 3WUDA 3AC0A 4CUGA 3KV9A 2ZX4A 1DHKB 2HBTA 2VCAA 4L0PA 5FREA 1BQPA 3R4UA 4Y5TA 4MVTA 1Z78A 1SBEA 2BU9A 2X29A 3KF5A 3ZYRA 1COV1 4YWAA 1RC6A 3KWVA 3AM2A 1R092 1JYCA 3I59A 4YM2A 5EFUA 4BXFA 3UKNA 3VDAA 1PVC3 2WFF3 2A3XA 4LKEA 4CUCA 1PGSA 1TG7A 3SQOA 5HBAA 2OIIA 2EF6A 2KD7A 1J1LA 1QXJA 2VZ3A 5FP3A 4BIOA 2A6XA 4HPKA 2XXZA 3EJKA 2F6BA 1HRI2 3MO4A 1NCRC 2E51A 2ZMLA 1W9WA 3IN9A 4QU1A 5JVVA 1I1EA 1LOCA 1TME1 4LO5B 4JGZA 1W9FA 4RQPA 5HCFA 4CDXC 3ZKYA 3KV4A 2VW0A 1NAEA 1W0NA 4GD4A 4IV1B 3OY8B 5FYIA 2R1BA 1RUC3 3J7MA 1CAUB 4YGDA 4COWA 1FV3A 2RR12 4JQRA 2E9QA 2WC2A 3WP5A 4XPVA 2A6YA 1PGL1 3DL3A 3FLTA 4QHOA 5IT6A 1G8WA 4K8FA 1VRH3 4CUAA 5B4NA 1M06G 4M3CE 4AI3A 3VBHC 1GP6A 1FYUA 4ASLA 5C4WB 4XQWA 3ACLA 3AMPA 1PIV3 2WNVC 3PUHA 1YC61 1GOFA 1PM7A 2R1DA 1UD1A 1XPWA 3PURA 5DZEA 5K0UA 2NPIA 4ZHNA 3CZJA 3OG2A 3ENRA 2PHRA 5DDJ3 1F9KA 3T3YA 1Q8PA 1E5HA 1VAKA 1ZM1A 3PUIA 4AVAA 4EE2A 1OC1A 1L7QA 1WZXA 4FTEA 4RHV2 2VE1A 1LULA 1QDCA 1QXRA 1UOBA 2VAUA 4XYXA 2PQQA 4YYOA 1YCIA 1HN0A 2WAOA 2FD8A 5CADA 4D6QA 3ZSJA 2HYXA 2Y6GA 4ZXKA 3NV2A 3S5AA 4LT5A 3RMYA 1XNDA 3WP3A 5FYBA 4UFMA 4Q0QA 4XF0A 4MGTA 1B35A 4MHRA 3OGVA 4Z92B 2VOTA 1GZCA 1XSQA 3B7MA 5LBBA 5LRRA 3VD5A 2NP0A 5JI9A 1OOPC 3RFRA 1GICA 2X10A 1DU3D 3VBRA 4HLTA 4Y33A 2VULA 1Z7S2 2XHNA 1OLQA 1S2EA 3I59B 4LMFA 1W8NA 4OVEA 3KGLA 5AVAA 1W99A 1WW6A 4FXKB 3CMGA 4UWDA 1XBFA 2R042 2ZTNA 4BCUA 1OHFA 2W0XA 4CCKA 3AX4A 1YXWA 4XVHA 3B02A 4LKFA 1W6OA 1GQHA 5FMBA 3ATGA 4MX3A 2HWD2 4OI4A 3AYEA 1OKOA 3WG4A 1PZ9A 3ACFA 2RG4A 4L9BA 5ANQA 4URTA 2VH9A 1X8MA 2WZR2 4HPKB 4KG0A 4LKSA 4RA0A 5FZ8A 4JTNA 3TEWA 3KGZA 4CEYA 2ZACA 2QZ3A 4JGZB 3LDRA 4Q0PA 4LLFA 1L7LA 1VBA2 3Q8BA 4JZRA 3H1YA 3I3EA 4P9YA 1HN1A 4RQPB 1S0FA 5FZIA 5L9RA 4CU8A 3PJYA 3HWJA 1ZBA3 1URXA 2F4LA 3N9NA 1AR81 4LITA 2VMIA 1D7PM 3MIDA 4XBQA 4KWUA 4F83A 5JZGA 3ZYFA 5FZBA 4K6BA 1F35A 5IJRA 4DRRA 4H14A 5CG9A 3ZXDA 5D8AA 4CXXA 5C8WA 2ZHKA 2GZWA 2IXJA 2ZHNA 3BN6A 1TNFA 3AKTA 1O4YA 5T5PA 3SKJE 4ITCA 5KXEA 3JBG1 2W9XA 4BLJA 2MEV1 1S2BA 3H9AA 5AC93 2XL9A 1UYYA 3PLQA 1PHMA 3FZ3A 2IUWA 1NOVA 3HVDA 4NPLA 2NLRA 4DUVA 1KGYA 1Y9MA 4Q1RA 5FCCA 4J1XA 4B1MA 2GNMA 4B29A 4Q4W2 4P9LA 4L99A 3IDBB 4AQTA 1F8VA 3RPQA 5HXVA 2VJXA 2C5DA 5DXDA 4LHSA 1Y4WA 1BKZA 5FYTA 4CEWA 4AQ2A 2ZGPA 2Y26A 4WVZA 2ZGKA 2EIEA 1PX4A 3GZUC 2C4XA 5CFDC 5FZ6A 1B09A 2ZCWA 5C3SA 1AJKA 4DXRA 5A6XA
chains in the Genus database with same CATH topology
1B35B 1MQTA 4B8EA 2HWE1 4AWDA 2VVDA 2JG9A 2EXHA 5JPMB 3RI8A 4Y5Z0 3VBRB 1MZFA 1LGNA 3DPRA 3OBRA 1KITA 4BMBA 4XILA 1YUDA 4N9IA 4AVBA 3HN1A 1I3HA 4XOGA 1GV9A 5BNOA 1QJU2 1TMF3 3OBTA 4CP2A 3APBA 1CJDA 1W6OB 4FPYA 3TWIA 3R05A 3FBMA 3IDEA 5J3UA 2ZPXA 1OMIA 3SNMA 2ZKNA 2YPJA 2OYZA 3WCRA 4CEYB 3L2HA 1UIJA 4FPFA 4LA3A 3WQ1A 1QXPA 3ZYGA 4GB32 1DGRA 3JZVA 1LHUA 2JKBA 2JE7A 4XFHA 1PO22 4YSFA 2VQ0A 4NPRA 1EYBA 1RUE2 1V6KA 5JZGB 1W2UA 2O1QA 4YRDA 1PVC1 2WFF1 5D8AB 2Q1MA 4HSJA 1YJLA 2XBO3 1X7NA 2DCJA 1REEA 3EHKA 2GN3A 1UZYA 1YFXA 3AP5A 3I7DA 2E53A 4HT1T 3CL1A 1G9FA 3AP7A 3OYWA 2OZJA 1LB2A 1RL3A 4YW5A 5BNNC 1WUVA 5FO9B 3J8F2 2Z2SB 2GC0A 4A7YA 4C90A 4KGGA 1RUC1 3WDUA 4M0HA 3GZTB 1ENQA 1C3HA 3SHRA 1SBDA 3ZSMA 1QHDA 2WNUC 4NO4A 4YNIA 4AGVA 4CEWB 1VRH1 2PA7A 3INAA 1W0OA 1WCSA 2I45A 2ZZQA 3EBRA 2RMU2 1PIV1 1WD4A 4HSLA 1FT9A 1LOFC 1CIWA 1LODA 3BOPA 5BNPA 1MQTB 1CONA 1LOGA 1SEFA 2JG9B 4LBKA 5DDJ1 4AGGA 5L7OC 2ARXA 1ZA4A 1S0IA 4GKXA 3DPRB 1DDLA 1ALYA 3DUIA 1Q5OA 4FP3A 4JAAA 4DOUA 5BNOB 1YWKA 1WCKA 1KRIA 4JVAA 5EXOA 4LHNA 1LCLA 2YUEA 1F2NA 4OUSA 5T5OA 3ELNA 1TQ5A 1EV12 1U5YA 3PJQA 4E27A 1CAWA 2BW8A 2I07B 2ZS6B 1RHI3 1FAYA 3EO6A 4EJRA 3I2DA 3RJRA 1GYKA 3VGIA 1X82A 1PZ8A 3RG0A 4MZUA 4A7KA 1WW7A 2D6PA 3VN4A 5E88A 2DVBA 4EWAA 1YFYA 2LTNA 3H3ZA 2ILMA 1OFSA 3QLQA 2B7YA 4S2FA 4AFMA 3AMNA 4YFWA 2ZGTA 3ZSEA 2ZJCA 3SH3A 2BUKA 4Q1PA 1OA3A 3GF6A 3OYWB 4AF9A 1QOOA 3NAPA 2CGNA 4D7SA 4ATEA 1PO12 2UWCA 1QJZA 1S0CA 4CDWA 3WQ0A 1UCXA 1FMD2 4L92A 2SLIA 1NA1C 1CAXA 1V70A 5FMOS 3NV3A 1WD3A 1DYPA 4JGYA 5ABJA 3V64A 2EXKA 1DGLA 1Q8OA 1V6JA 3BODA 4ISRA 3B9CA 3FE5A 5BNPB 4ASMB 5AC91 1ULDA 1XYPA 1GQGA 4GIQA 4P9IA 1UKGA 1V00A 4HK9A 3W9AA 3B01A 4QPYA 5KXBA 2QNKA 2DCTA 3FFZA 1QJX2 3M1HA 4BQ1A 1U5ZA 1LEDA 1Y7BA 1LR5A 4OI0A 4CDQA 3N7LA 3OF1A 3QCWA 3VV1A 2I74A 3R4DB 1BJQA 2QFEA 2DV9A 3VBOC 4L8QA 1CAWB 1LJ7A 4QMAA 5DZFA 3USSA 3UKVA 1RVF2 4WM8A 4FTSA 3CJXA 1BMV1 1RMU2 1J1TA 4L2NA 3MIEA 1ASJ3 5GZCA 1POV0 1NXMA 4BIFA 3WW4A 4IEWA 4OI1A 2EXJA 1IS3A 3WDTA 1TMF1 4FTBA 1LESA 1QJY2 4LLOA 3FLPA 3B69A 3HD8B 1ZRDA 2GNBA 1XNCA 2CNAA 4AEDA 4A3XA 1VBB2 2Q1ZB 2D97A 4DNYA 1KS4A 3NAPB 1I5ZA 1DYKA 3WT3A 4WM7B 2YROA 1J3RA 4CDWB 3AZWA 3TN92 4YGCA 2Q0AA 3PVBB 4KG8A 3VKLA 3HR9A 2WT0A 1F5JA 1WMEA 4XMAA 3W59A 3PVOA 5FPZA 1MS0A 2XBO1 4JGYB 5IK7A 5ABJB 5BYNA 2ERFA 2KA3A 4YGEA 5LEJA 2WIIB 3MW3A 2E7QA 4CDUA 2RJKA 4IESA 1ENRA 1UU6A 4Y1YA 3PHMA 1LGBA 4QGMA 4HVQA 4Z8BA 1BVP1 1PGW1 2E7TA 4ES9A 1UZZA 1H2MA 3LA7A 3O0XA 4D7TA 3E5QA 1V6NA 1UU5A 4CDQB 2P2KA 1XXNA 3H50A 3MIGA 5BXXA 2D7FA 1XU2A 2XJTA 3WLUA 4AVVA 4YARA 2D98A 1TME2 4MH0E 1C1LA 2LM3A 4AYUA 4O9EA 3ILFA 3VDDC 2HKXA 4H55A 1EP0A 4KL1A 1X33A 4GWNA 1DFQA 1H8TC 4PCRA 4QQLA 5F1RA 2XGXA 3TRSB 5GM0A 5KHGA 1K5MA 4MUVA 5J09A 4KU7A 3M3EA 5FLIA 1PGL2 3HBZA 1NY71 5K8SA 4N53B 5DG2A 4DZGA 4L97A 2MNGA 2DVFA 1AYN3 1FNZA 2PLV3 1C5HA 1V6LA 4QPGC 1XYNA 5GALA 5JR7B 4AEDB 2JG8C 2WA3A 4MGZE 1RHI1 3MEPA 1QNYA 1S1AA 1HV0A 1RITA 5GLWA 1MS8A 2PHUA 3VHNA 1UAIA 4AFDA 3JQXA 2Q30A 1N1TA 1TEIA 5FFOC 4OHVA 4C1WA 4E2QA 1J3PA 2UY8A 4DQAA 1HQNA 4IEOA 2A6WA 5CU1A 4XETA 1ZBE3 3PNAA 5DUVA 5DZGA 1UPIA 1RUJ3 2GALA 2V09A 2Z42A 4BH9A 4C0HA 5C8CA 1CGPA 4F7ZA 1TE1B 4I3PA 1OD5A 2XVGA 3S30A 2QUOA 1J59A 4CDUB 4AEJA 4XXPA 3IM0A 3Q9OA 5KBFA 4AHYA 4LBOA 3VBUA 4RGGA 4YW2A 3LOBA 1S0GA 4JDMA 2AR6A 4XBNA 1EAH3 5FLHA 2IXCA 2X5IC 1ZRRA 5BV6A 3DF0A 4PDWA 4XJ9A 1RGSA 1D4M3 4WV8A 2WFPA 4EROA 2HWC3 4KGQA 4L11A 4QGNA 4LE3A 4IV3A 5LRSA 1YIPA 4QQPA 4XIOA 2XKOA 1AR82 1YHFA 4B3NA 4Q8KA 1CPMA 4EN0A 5FAXA 4BM8A 2JECA 1K5MB 1HXS3 1T6GC 1S0BA 1YJKA 2WL1A 4IEUA 1XNKA 4WVWA 4W6XA 1QMJA 4YLZA 1C4RA 2RM23 1IKPA 2ETEA 5JAXA 5JIAA 1H30A 3D0SA 3OGGA 3JBG2 2H0VA 1ZZCA 5CIRA 5SV5A 4IEPA 1KXGA 5KHKA 2MEV2 4HL0A 5ACA3 2YXSA 3WCSA 1NQDA 3MIFA 3OY8A 2GC3A 1CAUA 1Y9QA 4QD2A 4R4ZA 2ZKLA 3SMHA 1L3JA 1NCRA 2ZGUA 4W6WA 1ASJ1 5T55A 1ND3B 2CL2A 4CDXA 3V0AA 2NM1A 4XFAA 1ZZ6A 4PIYA 1U5IA 1DGWX 3S0MA 1O5UA 4R9AA 2HWE2 2GH2A 3MW2A 4GMP3 5C8CB 3ASIA 3VBHA 1LECA 1QNWA 2WNVA 4EN7B 2CAUA 1IZ3A 3RYPA 4AFBA 5K7PA 1YLLA 4GH4B 3MDPA 1WMDA 3VBUB 3KB5A 4CRQA 1Q3EA 1AR93 2PAKA 4M00A 4JRAA 4PBPA 2R49A 2RS13 4YZ4A 4PDWB 3RDIA 3VZMA 2GMEA 4QGLA 3U07A 4I0AA 4YZ5A 4QQ2A 5EWSA 3MFCA 1GNHA 4IV3B 3KQRA 2C0ZA 5FMOL 4XF9A 5H9PA 1RJ7A 1NLRA 1OOPA 4KU8A 2WFF2 1PVC2 4FT8A 5HCBA 4LE4A 1RUI3 1NXD1 2A5ZA 2JX9A 2VVEA 2ZX3A 4PBOA 1QGLA 4TWTA 2LALA 2A6ZA 3C2UA 3JUUA 2IFWA 4COUA 3SCFA 1D0HA 4EN8B 2V5YA 5I93A 2MHFA 1HQWA 4XF3A 1RUC2 1NCRB 2MPFA 5BNQA 1FATA 4LA2A 3PVEA 4FPKA 3ZFGC 4CDXB 1VRH2 3B3QE 1IPKA 5GZFA 1LRHA 3V0AB 1OA2A 5EJ3A 4MLOA 1D2QA 2BTVC 3AYDA 3VLBB 1PIV2 2E7AA 1QDOA 2A71A 2OVUA 1ZVFA 1AYN1 2PLV1 3KT4A 2OZ6A 2BVVA 3I54A 2ZGNA 1AF9A 5LEKA 3LSDA 3THTA 1YO8A 1I9RA 1LHOA 1JBCA 1DQ4A 2XH6A 3L9JT 5DDJ2 5T5LA 3VBHB 2OW4A 4LBMA 5FBZA 2WNVB 4UW4A 2DFCA 4H7LA 4YM3A 4BOWA 2R32A 1A8MA 5GLUA 1AR63 1SDWA 3AYCA 4YM0A 1DZTA 1MZ6A 4QX5A 1SFNA 5J98B 3LA2A 4HMZA 4XXAA 1J3QA 1H2KA 1YRZA 2GSYA 3JQWA 1AL0G 2JEMA 5CVRA 1ZBE1 5BUVA 1AXZA 2IC1A 4RS5C 1QQP3 2ES3A 4EN6B 1RUJ1 1V9U3 2PYTA 2VGDA 1HX6A 1AVBA 1Y43B 3NV1A 5CFDA 4CTEA 4FPCA 4I3GA 1ULCA 2PHFA 3M8LA 4AVSA 1ZREA 3BTAA 3FUQA 1OOPB 1QKQA 3V65A 2XWJB 1MS9A 1ZNPA 1XYOA 1EAH1 3TNPB 3KMHA 3RWNA 3NJZA 3N7MA 4IL7A 3C3VA 2C9AA 5E1RA 4DB5A 2HWB3 1D4M1 5K9YA 3GBWA 4W6YA 2RE9A 1SQ4A 1VJ2A 5D1IA 2H6CA 2HWC1 2EALA 1CPNA 1C5IA 2XLFA 2WNEA 1ZBA2 2W39A 4Q4X3 4S2DA 3HAGA 1A78A 3AMMA 3AZXA 4KWLA 1HXS1 2PN5A 2NYYA 3GYDA 5KXCA 1DQ1A 4XJAA 4COVA 2RM21 5FRAA 3PVNA 3SCHA 2F4PA 2VQAA 4ZU7A 5AVPA 5A32A 5ACA1 5AC92 1WW5A 2JDZA 2XJRA 4Y22A 5A33A 4XFGA 2K9ZA 5K0UC 5DG1A 4AFAA 4KWJA 5CFCC 2UWBA 2XVLA 3WVJA 4CYDA 2XUMA 5F5QA 5BNNA 1VB4A 2D3PA 4XF4A 3I8TA 1CVNA 3N35A 1LOAA 5FO7B 2D6OX 5FPXA 3VHPA 2BWCA 3UJOA 4YFZA 1AYM3 2WNUA 3WV6A 2D5HA 1O91A 3VKMA 4GMP1 5I8SA 5CFDB 1O3RA 1BMV2 1VAMA 2O8OA 2QQPA 3CJIC 3MYXA 1J58A 2RJLA 4LBJA 4LBLA 3ZMOA 2DFBA 1TMF2 2EVXA 4PIXA 2ZBJA 5T52A 5L7OA 3HT2A 1OQEA 5KC6A 1Q8QA 5IK4A 5A3MA 1AR91 2X8KA 2ZX0A 1WLCA 3FUOA 3IMNA 2RS11 3H3UA 4DS0A 4R52A 5GZGA 3QH6A 5JDBA 4FQZA 2SBAA 1ENSA 4WVMA 1RUOA 3VKOA 2ZGRA 4JRLA 2XG3A 4Y26A 2KM2A 4E4ZA 1C28A 4XBLA 4FVVA 4H3WA 1UMZA 1RUI1 3WDVA 2WQZC 4XEZA 5I0TA 2XBO2 5L36A 1BEV3 1ULEA 2P3JA 1MR5A 4UW3A 4Y1XA 4Q29A 2D44A 1H4GA 4RR3C 1PZ7A 2W52A 1MVQA 5A32B 3BOWA 1M4WA 2EXIA 4FSJA 1Q8SA 4Y22B 5A33B 2PHLA 1PGW2 2B45X 2WS93 3O12A 5GZEA 1PK6C 1RUF3 2HEYF 4I2OA 3K51A 5BNNB 2VUAA 1LOEA 3E6DA 1MS4A 4OHWA 4LULA 4GQ7A 3ZO0B 5BY5A 1DBNA 1NA1A 4BYYA 4XJ8A 2VY0A 2WNUB 3FFQA 2VNOA 2ZA9A 3AJYA 4UW5A 4AK3A 4MGIE 2JENA 1SBFA 3LGRA 5C33A 3VL8A 3MPBA 2VW1A 2P17A 2A6VA 3WR0A 1LGCA 2DUPA 1BVVA 1NY72 4Z1VA 4FBFA 1AR61 1MZEA 4FCAA 4TYSA 5L7OB 4X6RB 1XRUA 3D4KA 3UK9A 4I30A 1SLCA 1PNGA 3M7AA 1ND2C 4ORFA 2W08A 2XJUA 3GALA 4JV4A 1ZZBA 2ZX2A 1RHI2 1QQP1 1FX5A 1V9U1 3AK0A 2Y0OA 2RS53 1XE8A 2QDRA 3VBOA 4WVMB 4BHPA 3TYJA 3VUOA 3L2YA 1ND2B 3TAYA 5B2GB 4NOTA 4E2GA 4I02A 3ZFFC 1WBLA 2BQPA 2IXLA 4COYA 1R083 3IDCB 1DGRN 4HVRA 4P9GA 3N4MA 1RUNA 4QQOA 1RB8G 1WLWA 3UL2A 3ME2A 4UBGA 3N3HA 1N47A 1H2LA 1FOD3 3H0OA 3ZYIB 1H2NA 4LTAA 2HWB1 4WVVA 3EQEA 4HK8A 4WM7A 2GU9A 4IEZA 2BEOA 4BWOA 3WX5A 2P3KA 1ZBA1 3ZPYA 4AQSA 2JD4A 4Q4X1 4SBVA 2XHKA 3MLJA 4P9WA 4AHXA 4XJUA 2EA7A 1S55A 4XHXA 3AMQA 2R063 1V6OA 3FMGA 2UY9A 3BPZA 2GDFA 4IEQA 3JCIA 4E4SA 4MGYE 1S0DA 3AZYA 3BU7A 1NA1B 3ETQA 4V1PA 4AHWA 4B7KA 4UXAA 4AE2A 3CF6E 3SLIA 2Q8OA 3FX3A 4P9JA 5LK5A 4RFT0 1PVXA 4QPIC 3DGTA 2ZGOA 5FTTC 4LHLA 1GNZA 2WLQA 4LR4A 2ET7A 1F31A 4MYEA 1DG6A 4MSVA 3VBSC 1D2SA 5FLJA 4COZA 2D43A 3WNXA 2K2SA 1U0AA 3PTYA 1E57A 3GNEA 3LWCA 4BMEA 1N3QA 1NCQC 4LUKA 1AYM1 2R073 1CN1A 5KWRA 3SITA 4B7EA 1GZWB 3JB4C 4YW4A 3VBOB 3WHUA 4WBBA 3AXDA 4K9SA 4FPHA 1HRV3 2VOXA 4MGKE 2H6BA