3N36A

Erythrina corallodendron lectin mutant (y106g) in complex with galactose
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
242
structure length
242
Chain Sequence
VETISFSFSEFEPGNDNLTLQGASLITQSGVLQLTKINQNGMPAWDSTGRTLYAKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGGGYLGIFNNSKQDNSYQTLGVEFDTFSNQWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILHAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFQASLPETND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Lectin
publication title Modification of the sugar specificity of a plant lectin: structural studies on a point mutant of Erythrina corallodendron lectin.
pubmed doi rcsb
source organism Erythrina corallodendron
total genus 51
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2010-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3n36A00
2WNEA 5F9TA 1G9FA 2UU8A 1KJRA 3AZZA 3MW2A 1F31A 3M3QA 2Z42A 1DZQA 1HKDA 2EXIA 2NYYA 4CZSA 2YXSA 1W0PA 3N36A 3WCSA 3N7JA 4FPFA 4Q2FA 1S0EA 5HCAA 1I1EA 3AP5A 1AZDA 3B01A 3W59A 1AXZA 1J1TA 4M3CE 4AVTA 1ZA4A 1VLNA 1DQ4A 3FBYA 4YZ2A 4LBLA 2WQZC 3B3QE 1C1FA 4YW1A 1ENSA 2D6KA 2WKKA 3IPVB 2RHPA 1DYPA 3PVNA 2D6LX 1QF3A 1ONAA 3M1HA 4WVVA 1JHNA 1DQ2A 2ZGKA 1APNA 3ZSKA 3AK0A 4WV8A 3I4IA 1MS5A 4U2AA 3V0AB 2KM2A 3ZSLA 1LESA 4C1WA 2BQPA 1ULFA 3IMNA 5CBLA 2UURA 2DWRA 3T2TA 2A7AA 5JMCA 3AYDA 3WG1A 1AF9A 1D0HA 1GKBA 3AJYA 3AYAA 4FPEA 4Y1VA 3VKFC 2VW1A 1LOGA 4DQAA 4XMIA 4FP3A 3N3HA 3O0XA 1ULEA 3AFKA 2VH9A 4XE9A 5AVAA 3MEPA 1MVQA 1QGLA 2JDZA 3WDUA 3ZXKA 1LHWA 4Y24A 1V00A 1SACA 1WBFA 2E7QA 4Q8KA 4YGBA 3MPPG 3VKLA 5JLVA 1LGNA 1WUVA 4FOYA 3USUB 4Z8BA 2JD4A 1GZ9A 1MZ5A 2V5YA 2DTWA 2E53A 1Q8VA 2JE7A 4UW5A 1V6NA 4XHBA 3R4SA 3VKNA 4YM0A 1EPWA 5E88A 1WD3A 2GN7A 3SLIA 1AVBA 3WNXA 5H9RA 3IPVA 1VAMA 2E7TA 2D7FA 3FLPA 1AJOA 1Q56A 4K1YA 4YZ1A 4ZKTB 1AX2A 4FPJA 1N1VA 2OW4A 5T5PA 1HDKA 1SBFA 3FUQA 4M3CB 1R1ZA 1VIWB 5CNAA 1URXA 1IS3A 1WD4A 3POWA 1SLLA 4FPGA 2NN8A 4R9BA 5DZGA 4DS0A 4XJWA 3H0OA 3V65A 2VUAA 2DUQA 3LSDA 4YM3A 3AP9A 4BPZA 3WLUA 1QNYA 2A3WA 2ZGNA 1YRZA 1UAIA 3I8TA 3M2MA 3MW3A 4YGEA 4YM1A 1ULGA 4FVVA 4BM8A 2A6ZA 2EIGA 4TZDA 4GWNA 2GMMA 1UL9A 3POSA 3SH3A 1LODA 2NMOA 2C5DA 4GKXA 3SNMA 3AX4A 4GXLA 3RG0A 2W52A 3IN9A 1C57A 5FREA 2ZBJA 2P2KA 1LJ7A 1A3KA 1AJKA 1V6JA 2C9AA 3ILFA 4H55A 1QDCA 3N7KA 3USUA 2PHXA 4AGGA 4FOWA 1OQ1A 1SCSA 2D6MA 2E6VA 2ZABA 1LTEA 3ZXLA 3B00A 1D2SA 1SLTA 5H9SA 1GZCA 2D44A 4XBNA 3B69A 2YY1A 1GNZA 1MS0A 3RMYA 3T1LA 2P34A 2A70A 1WCSA 1W6NA 1MR5A 4XZPA 5GLWA 5GZDA 3UJQA 2ZGSA 1CN1A 1JYIA 5F5QA 1CPNA 2YMZA 4Y20B 3AZWA 4ITCA 1RINA 4M3CF 4ASMB 3FLTA 1YIFA 2DV9A 1DFQA 4L8QA 4FOQA 1LOFC 1LU2A 2LALA 1ULDA 1N47A 4FQ4A 5DZEA 1KJLA 2YZ4A 1W6MB 4XBQA 2AENA 2OVUA 2ARXA 4IQPA 4R9DA 3RS6A 3HN1A 1ENRA 1LOEA 1OFSA 2CYFA 3INAA 4BMBA 3OYWB 4AGRA 5EYYA 1AX0A 4Y22B 3ZXJA 4C1XA 1W0OA 1V6IA 4P9XA 1LOAA 3TAYA 3RSJA 3KQRA 1KDKA 5T52A 3W58A 3O0VA 4BLJA 1DQ6A 5GLTA 3WV6A 1KRIA 1LOFA 4GWMA 4LBJA 4YFWA 1WW4A 4BQ1A 2XG3A 1HLCA 1LECA 5DG1A 5LK5A 3WHTA 2WT2A 4YW2A 1Q8PA 2A6WA 3AZVA 4Q27A 4YGDA 1GNHA 1LGCA 1GSLA 1G9AA 3R05A 4K1ZA 4LBMA 5GZFA 1SBDA 4FP2A 1W6OA 4XTMA 5EYXA 2D3PA 5GLZA 1LHOA 1GZWB 2DYCA 2W08A 3N7LA 2ZACA 2CWMA 2WT0A 5EWSA 3SH5A 5IT6A 5HCFA 4JC1A 4GKYA 1N3OA 4Y20A 4FOVA 2CL2A 1MZ6A 2NM1A 5CB7A 1QNWA 1IS6A 3LCPA 4RA0A 2GNTA 5DG2A 4ISRA 3WDXA 2W39A 2ZGPA 4MYEA 4LBQA 4FQZA 2P3JA 1V6OA 4HANA 1V6MA 5IUQA 1CQ9A 2CY6A 4BMEA 1F9KA 1V6LA 5GZEA 3DGTA 3ZVXA 1UN1A 1MS1A 3BOPA 3VV1A 4LBNA 2DTYA 1V6KA 4RL7A 2PHTA 5GALA 1SLAA 1WLDA 3PMEA 2AREA 4Y1YA 5JOWA 4KBBA 2R16A 3FLRA 3AXEA 3OY8B 3N7MA 4AWDA 1BKZA 3RRDA 4Y1XA 5JDBA 4AVSA 3ZYRA 1DBNA 3ZSJA 1JW6A 2TEPA 4P14A 2PHRA 3SITA 1B09A 2AGSA 2W68A 4YLZA 4CRQA 2YV8A 4YW3A 4ATEA 1DHKB 2ENRA 1GV9A 1GZWA 4ISQA 1O4YA 3NV4A 1MVEA 1GICA 1UPSA 3SH4A 4FPHA 2GMPA 1WW7A 2PHWA 2ZMKA 4SLIA 4UW4A 4NO4A 4LBOA 4WVWA 1JXNA 1C4RA 1WBLA 4M3CA 2D6PA 2GMEA 2CTVA 4CTEA 3A0NA 5T50A 1G86A 3V0AA 3AJZA 1QMJA 1IOAA 1WW6A 1HQLA 1I3HA 3OGGA 5IK4A 3M3CA 1SLCA 2H0BA 3VKMA 4BOWA 4UW3A 3UK9A 3POYA 4TYSA 2A75A 5DZFA 2NP0A 2ZA9A 4M00A 4DRRA 1BYHA 2CWSA 2A6YA 4Q26A 4YG0A 1A8DA 5GLUA 1ULCA 4Q1PA 5DUWA 1DYKA 1LOBA 3UJOA 4PBPA 1FV2A 1IS4A 4BLIA 5JOYA 2D6NA 1PZ9A 3V0BB 3OY8A 4R9AA 4K21A 1GLHA 1G7YA 1Q8OA 2D3RA 4FPKA 4WZFA 4YFZA 1MS9A 1Z0HA 5GLVA 2DU1A 5KXBA 2A3YA 3IKWA 2GNBA 2ZGUA 4P9WA 1Y7BA 4XJUA 2DVFA 1CESA 2EXKA 1GBGA 2WJSA 3HMYA 1JBCA 3FUOA 2DVBA 1FV3A 1W6QB 4W65A 3RQ0A 3ZXEA 3ASIA 1LEMA 2XB6C 1MS8A 4GA9A 2ZHNA 1IKPA 2OUJA 4M01A 1LHVA 4PCRA 1F5FA 4FPCA 2SLIA 2WSVA 5BYNA 1LULA 5IK8A 2A71A 3UL2A 2V73A 1UX6A 1DQ1A 3WDVA 2JECA 1MS3A 1Q8QA 4XDQA 1G9DA 1FNZA 4XXAA 2NMNA 1C1LA 2PHUA 3ATGA 3WG4A 1X50A 1CVNA 3WDYA 5KXDA 2JKBA 1RIRA 3ILRA 1LHNA 1S0DA 2FMDA 2UWBA 4AGVA 2DVDA 2ZGQA 4XXPA 2ARBA 1KQRA 4YG6A 5DUUA 3V0BA 1IKQA 1FATA 4YM2A 1HQWA 3WDWA 1BZWA 3B9CA 2LTNA 1Z78A 2ZAAA 3M3OA 2SBAA 3AYCA 3NV1A 5HCBA 2R1DA 4XJ8A 1WLWA 3CNAA 3FFZA 4PBOA 2ERFA 5H9QA 2Q5TA 3ILNA 4Y26A 1IS5A 5KXEA 3IM0A 1SLIA 3WG3A 5T5OA 2YROA 1YXWA 4Y1ZA 4XIOA 1FNYA 2ES3A 1DGLA 3N35A 2VXRA 1UKGA 5T5LA 3M3EA 1G9CA 2A5ZA 3A4UA 3Q9OA 4XIKA 1PZ7A 4XJAA 3WOGA 1NLSA 1H9WA 1S0FA 1W6MA 1CONA 1AX1A 2A6XA 3LSEA 1JN2P 1OKQA 2GDFA 2DVAA 5KXCA 1A78A 3OYWA 1UMZA 3D6EA 4Q1RA 2ZGOA 4Y22A 1JUIA 2WSUA 3O5SA 3PJQA 5DUVA 3U4XA 1SCRA 2ZGTA 1VALA 1N3QA 4YZ4A 3ZXFA 1W6PB 1S0CA 5CAZA 5T54A 3MW4A 3V64A 2ZGLA 4XILA 3AP7A 3PVOA 3WZ1A 1S0IA 3ENRA 3GALA 3GNEA 1U0AA 3AXDA 1CIWA 4GALA 4UW6A 2G4IA 3APBA 2ZGRA 2EF6A 3AYEA 3JUUA 1AXYA 1JOJA 1XQNA 1BXHA 3TB0A 4AVVA 3WUCA 4DPNA 3WCRA 2ZGMA 4XYXA 4D69A 1S1AA 3BIWE 4LBQD 2E51A 1QKQA 1FYUA 2ZMLA 1YYNA 3OBRA 1CJPA 2DUPA 5FRAA 2ZZJA 4PQ9A 3HR9A 2VU9A 4XTPA 1MACA 2GNMA 5DUXA 5E8AA 2D6OX 2D43A 1PZ8A 4XMAA 4NOTA 2D3SA 4FPLA 3ZPYA 1LEDA 1Q8SA 2AR6A 2WT1A 4JCKA 3OPZA 3AZXA 4FPYA 2R0FA 3C2UA 4FPOB 5IK5A 1TEIA 3KM5A 2UWAA 3WUDA 4YGCA 4XBLA 2DUOA 2WLQA 2P37A 3RMXA 1LGBA 1QDOA 1W6NB 2EAKA 1LOCA 5T55A 1BJQA 2GNDA 1BQPA 2P3KA 4P9YA 5JOXA 3NV3A 3ZSMA 1SBEA 1SLBA 3NWKA 4DFSA 1W6PA 1GYKA 2ZHLA 1LU1A 3QCWA 2VY0A 1H9PA 4U36A 2DVGA 2DU0A 1G8WA 4YG3A 4K20A 5GJ6A 1VAVA 1RITA 2HYKA 2I2SA 4ATFA 3AZYA 3D4KA 2DURA 1LENA 1S0BA 2AUYA 1ENQA 2B7YA 3AP6A 3JU9A 3O12A 2P3IA 5CA6A 1GANA 1N3PA 1DIWA 4XJ9A 3WG2A 2ZKNA 5JOZA 5GZCA 1LHUA 1N1SA 1H30A 3PVEA 2A6VA 2AYHA 2VW2A 1SFYA 2EXHA 3O0WA 3WDTA 2R49A 1CPMA 3AP4A 3SISA 2PELA 1UZYA 3L2YA 1QOSA 3OJBA 2ZMNA 3A0KA 3BTAA 2GN3A 1JYCA 2GALA 2ZHKA 3NV2A 1DLLA 1AXKA 4PF5A 5EXOA 4YW5A 3ZYPA 5IK7A 5GM0A 5H9PA 3OBTA 2VW0A 5JVVA 1DQ5A 5E89A 4Y1UA 3BODA 3T1MA 4AYUA 1W6OB 4YW4A 1N1YA 2FHRA 3VUOA 1S0GA 3R4UA 1LCLA 4LBKA 1WW5A 1CR7A 1MS4A 4I30A 2OUHA 4XJZA 3DUIA 1FAYA 2R1BA 5SV8A 4XHXA 1FX5A 1DQ0A 3WHUA 2R0HA 1QOOA 5T5JA 2AH2A 2EXJA 2EALA 1S0JA 4ZXKA 4XOGA 4HL0A 1YI7A 1YO8A 3D5OA 5L73A 2UWCA 1NXD1 1G9BA 1QU0A 1O4ZA 4LBQB 4YZ3A 4F83A 4JRAA 5GZGA 4YZ5A 1ZM1A 2CNAA 2JJ6A 2ZHMA 1QOTA 3VKOA 2A3XA 2JE9A 4OZXA 1WLCA 1UZZA 3QLQA 1KITA 1W6QA 4Q8LA 4DRVA 2NZ9A 5DXDA 1N1TA 4R9CA 3WVJA 2PHFA 1KDMA
chains in the Genus database with same CATH superfamily
2IXJA 3J8F3 3J9SA 3WR0A 3UKNA 3E97A 3RI9A 1DZQA 2EXIA 2NYYA 2VC9A 4CP0A 2RR11 2FCUA 5I0UA 2Z79A 4A4AA 2ZEYA 3N7JA 4FPFA 4BQ4A 4RQPA 3I2GA 1ZZ7A 2QZ2A 5DABA 2WFF1 2J1UA 3W59A 1AXZA 4M3CE 3DV8A 1UU4A 1FT9A 2XGXA 3FBYA 4YZ2A 2WQZC 3B3QE 1AL21 1W8HA 2NQYA 1YCIA 5IHRA 1XNKA 2XJPA 1ZBE2 3PIJA 2AC1A 2RHPA 1DYPA 1VB2A 2XQXA 3PVNA 4MH0E 3U4SA 2VMDA 4QXBA 2ZGKA 4YVSC 4C8DA 3B93A 3DKWA 4WV8A 3KF5A 4CUBA 3TEZA 2KM2A 2I74A 4YVWA 2VUDA 4XFBA 2BQPA 4NIHA 5CBLA 2E32A 3VDAA 2XLAA 5FYCA 3AYDA 1GWKA 4WM7B 3WG1A 5HBAA 4UYBA 5F37A 1AR63 4I2OA 1D0HA 3MPBA 2BFUS 3AJYA 4FPEA 1QIQA 3AL6A 2VW1A 1F4AA 1LOGA 4CDUC 3RZJA 5A7WA 3N3HA 1ULEA 3VZKA 3O1PA 3JZVA 1RYYA 3U1XA 5FOBB 1AR83 3MEPA 2IVIB 4ASKA 3ZXKA 3WDUA 4JTNA 5K7PA 4OHYA 1V00A 2WAOA 1SACA 1VBE2 1PO23 2VZRA 4G4FA 2FCTA 4LXLA 2BOIA 1WUVA 5JXIA 2OQ7A 3USUB 1CWPA 1MEC2 4Z8BA 1Z7S1 3PU8A 1PGL1 3LDRA 2E53A 1Q8VA 2BFUL 3R4SA 3VKNA 4BWOA 3IWZA 4YM0A 4XETA 3SLIA 1VRH2 4IGOA 4Q5OA 3WEZA 5JWPA 1C8M1 5FY8A 3WNXA 4W6YA 4CDQB 5AFBA 4N9HA 4QX2A 2VVDA 3FLPA 4I09A 1JMUB 1Q56A 3WNOA 4HMZA 2OYZA 1W8WA 1N1VA 2B5HA 1JZ2A 1HDKA 2VQTA 2R073 2E26A 1AYM1 2QTWB 4M3CB 3KZ4C 1VIWB 4HLTA 5LBBA 1URXA 1RXFA 3POWA 4FI9A 4PQQA 4R9BA 5JI9A 1L3JA 4S2FA 2VUAA 5LEKA 4YM3A 2P17A 3K2OA 5C9AA 3AP9A 1QNYA 2ZGNA 3I8TA 1GWLA 2VTXA 2Y8KA 2QJVA 4V2WA 4YM1A 4CDXA 2A6ZA 4JX0A 5JI7A 2W91A 1I5ZA 4BISA 4I3PA 1AYN1 3AX4A 4OUMA 5IVCA 1EUUA 5FPBA 3RG0A 1WCUA 5FMCA 1VPHA 4JGZA 1Q3EA 2WS93 2C4XA 2XXZA 4GAZA 5FBJA 5FREA 4XDPA 2WYFA 4NRQA 1ACCA 2P2KA 1V6JA 1A3KA 3N7KA 4MOAA 3USUA 3PIGA 4IDZA 4NHKA 5FYYA 5JIUA 3ZO0B 1UPIA 1JYWA 1OQ1A 3ITQA 3PUAA 1OLQA 1LTEA 5CKMA 3OBAA 4DZGA 2WLPA 3B00A 5JIAA 5H9SA 4X8NA 4CCOA 1RMU2 2D44A 1XC6A 3B69A 2YY1A 1GNZA 1MS0A 1QJY1 3KS7A 3T1LA 1O3SA 4ARYA 1MR5A 1WCSA 2RM23 5GLWA 4CDQA 3VDDB 4ZHNA 3UJQA 4LLOA 3N9NA 3VD5A 1ZRIA 2WYSA 1CN1A 2BP6A 3KV9A 4LO6B 4J6GA 5F5QA 1DGRA 3BOWA 3VD9A 2FDHA 1PIV3 4ITCA 1REDA 2CAVA 2BTVC 2PTMA 4M3CF 3NQHA 2XJSA 4M3CA 1RUF3 1DFQA 2VMHA 4L8QA 1LU2A 2LALA 1VBB1 3OEAA 4K9SA 3OD0A 4QPGC 3TEWA 2HWB3 1NX9A 1VBA1 4IEYA 2AENA 4EV0A 5C8WA 1JYNA 1RUC2 5IYYA 2WRAA 1LOEA 5C5UA 2NLRA 2YB7A 4GMP1 5FLHA 4B8EA 1AX0A 2VOVA 5DPNA 1F5JA 1W0OA 2P1BA 1GFF2 3H3UA 3IZOA 3RSJA 1KS5A 2ARAA 1RUG1 2RR13 3KQRA 5T52A 3ACLA 3PUSA 5EIYB 1DQ6A 4PDWA 5FXWA 1OOPC 4ZY9A 2WFF3 2B4KA 1Q5OA 2VNRA 3NAPB 3N9MA 4MHRA 4LBJA 3WV6A 4IGPA 4CEYC 5A3UA 1OD5A 1LECA 5E16A 3WHTA 1JS9A 1Q8PA 1SEFA 2W1SA 4UFMA 5J1XA 1ZZBA 2WINB 5FY0A 2Y6JA 3BUCA 4B7EA 3H42B 1GNHA 2JDAA 2C0ZA 2GP5A 4K1ZA 2GZWA 5GZFA 4DUWA 1HB2A 2D3PA 1GZWB 2DYCA 1UY3A 4BQ3A 4QHBA 3N7LA 1WGPA 1GU3A 2HEWF 4TLGA 1HJGA 1R081 5EWSA 5HCFA 3SH5A 4GKYA 3VBHA 2VZ3A 1MZ6A 2NM1A 2YC0A 2Y0IA 4IL7A 1ZBA2 2CHHA 2P6HA 3K4ZA 4QM9A 3RI8A 4UFIA 3WDXA 2W39A 1BMV1 3JD71 1KGYA 1QJZA 4AFBA 3MF6A 5HPOA 3FHAA 1V6OA 1CQ9A 1OA3A 1BCXA 5F39A 3VZJA 4AHXA 1UN1A 3BOPA 3TWIA 2QQPA 4LBNA 4Q4Y1 4C0HA 4EWEA 2HWE1 2DTYA 1V6KA 2PHTA 3D8CA 1Z7S3 1ZRRA 3P3PA 1BVVA 5FZAA 5I0TA 3U0ZA 4KBBA 5A3LA 4N43B 1OQDA 5BNQA 3HJRA 1BKZA 3CIHA 4HZFA 1H4HA 1C8M3 2F4LA 3K75B 1NCQB 1JW6A 3AMMA 2TEPA 4IW3A 3THTA 2PHRA 3ZSJA 4EYUA 1XXNA 4WM7C 4FSJA 4YLZA 4CRQA 4IEWA 4MXVA 4GMP0 4XDOA 2YC2A 5TSWA 4EN6B 1AYM3 3IDEA 2Z4FA 1GZWA 3IT8A 4IV3A 1HRI1 1X9PA 1UYYA 4RN5A 3KCYA 4L2NA 1UPSA 3NJXA 4QPIA 3SH4A 1O59A 4Y33A 2MNGA 5ACA1 2W0XA 2BGCA 1JU4A 4NPMA 3NVCA 2BBVA 1JXNA 2W87A 1ZNPA 5E6HA 3ZFEB 5APAA 3N9OA 2E31A 4QQ2A 3A0NA 5T50A 1AR62 1RXGA 1IOAA 3KMHA 4HPKA 1F4HA 1W9SA 1AYN3 5IK4A 2H0BA 2VZ1A 3VKMA 1KS4A 4UW3A 3UK9A 1RHI1 1RUNA 4AQTA 1AR82 5DZFA 4D0QA 3S6PA 3OUHA 2CWSA 1ENXA 1W8ZA 2A6YA 2BBAA 1PO22 4Q26A 4YG0A 4CDQC 1TQ5A 1ULCA 4QU1A 4BCUA 4QX1A 4RD7A 1PHMA 5A1LA 3U10A 1LOBA 2XWBB 4SBVA 1PZ9A 4XFGA 5FZGA 2VR4A 1QJY3 1GLHA 1VJ2A 1QH6A 1PNGA 5A3OA 5FMOL 3E5QA 4C0BA 4NIDA 2D93A 1STMA 1CGPA 5KXBA 1JODA 5F5IA 4QPWA 2R072 1VBB3 3FHIB 2KA3A 3EJKA 3FUOA 4B4RA 5FY9A 4GJZA 4HVQA 1ASJ2 3TEXA 1LEMA 1VBA3 5C3OA 2ZHNA 2RJ2A 3AKQA 2OUJA 5DAPA 4N9IA 1LHVA 1J58A 2VOWA 5CIRA 1NY71 3K3NA 3LPFA 2BNMA 2A71A 1UY1A 4GMP3 1EAH1 4COVA 4QGNA 1UX6A 1XU1A 2JEMA 4LKSA 5A1FA 5EFUA 1O3RA 1LR5A 1RUG3 1G9DA 2FDIA 1FNZA 3ACHA 4CU8A 4Q0UA 1DCSA 3PDQA 4A41A 2CDPA 3CF6E 4JGYC 2WS92 2WZR1 2JKBA 1RIRA 2OQ6A 1RUH3 1V0AA 2FMDA 4I3GA 3LEMA 3VDDC 5T3NA 3ZYJB 4AEDB 1OA2A 3BPZA 1NZCA 1B35B 5AC93 4YG6A 3KHCA 1FATA 4YM2A 3WSOA 3PUIA 1YQ8A 1HQWA 3I3BA 3B9CA 2ZAAA 2PMWB 3AYCA 5FYMA 3DYPA 5HCBA 1WCQA 2QQWA 2RDQA 2RM22 3CNAA 5CFDA 3FFZA 4QT6A 1R083 1GR3A 2VTFA 4AVCA 1PIV2 2Q5TA 5B4XA 4XAAA 3W20A 4QHOA 1SLIA 1GOGA 1RUF2 3GM8A 3HIFA 3LAGA 4PI0A 2EIEA 2ES3A 1W9FA 1DGLA 1WLTA 2VXRA 4QU2A 2BGOA 4X6QB 3M3EA 1G9CA 3NAPC 5L9RA 1OBNA 2OPKA 4XIKA 2RE9A 2E7AA 4ARXA 4XJAA 3K3OA 3WOGA 3K48A 4BXSV 5IWFA 3M3IA 3ZDSA 1CONA 1AX1A 5FMDA 3ZMOA 1J3QA 3JQXA 3ZOIA 2W46A 2HWE3 5IFPA 3LSEA 1UW8A 5D8AB 4OFGA 2RR12 2WFPA 3J4UH 5IVEA 3EMRA 3E6DA 2PA7A 5LA2A 3LEKA 4Y22A 2WFF2 3HQUA 2J1RA 4DY3A 1WCDJ 4WM8A 3SCHA 2VZOA 4XUTA 1RTVA 1AL22 1SCRA 4CDWA 4I01A 1OC1A 3ZXFA 3TN91 5A33A 5CAZA 3ABZA 2E9QA 2XJVA 3V64A 2ZGLA 1OUXA 1OFNA 3PVOA 2GH2A 3GALA 2WO3A 5L9VA 1EP0A 2OA2A 4W6XA 4AEMA 4P00B 2CGPA 4BU2A 3APBA 3BU7A 3AYEA 4IUGA 5ACA3 3POEA 1AXYA 4O65A 2WL1A 1KFXL 4UT5A 2BYVE 4RS5B 5LB6A 1PVXA 2VOTA 1QKQA 1YYNA 2JG9B 1MZFA 3CO2A 4Z2AA 2VCMA 4HK9A 4UXAA 4IE4A 1RHI3 4N43C 2VUJA 5FDBA 4IETA 3PJYA 3BPSA 2D3SA 4FPLA 3ZN6B 3KT1A 1EUTA 1Y3TA 1POQA 3C7OA 1NCQC 2CU5A 3EB7A 4IV1B 1HB4A 2W92A 3N9LA 4RGAA 4Y3OA 3S5QA 3AZXA 3OD4A 3C7HA 1IG0A 4E4DX 1Z7S2 2TNFA 5F2SA 1PGL2 1DZRA 4YGCA 4XBLA 2DUOA 2VULA 4N53B 3DPRA 1BJQA 2GNDA 1CAXB 1SBEA 1C8M2 1SLBA 2YG0A 3RPQA 3HNBM 1GYKA 5J36A 1LU1A 3JQWA 2OX0A 2ZX2A 4NPRA 3UYJA 3ZFEC 1OKOA 3QCWA 4LA3A 2VY0A 3B7MA 3LFIA 5C8CB 4U36A 4AQ2A 1US3A 3CKHA 1AYM2 2JENA 4K20A 2HWC1 1A8MA 5FO7B 2VJXA 3AZYA 4QDRA 5KBFA 3D4KA 3NJZA 5LEJA 3JU9A 2AUYA 2CDOA 3AP6A 4XPVA 1Y4WA 4LO8A 3PTRB 4OI4A 2BU9A 1EAH3 5EQUA 1SZBA 2JG9A 2VTXJ 4QB1A 5GZCA 1H30A 3IAQA 3PVEA 4WBBA 2A6VA 1H6XA 1QWRA 1AYN2 2VW2A 1CX4A 1O5UA 4RYDA 1W3XA 2R49A 4XCBA 2MEV1 3AP4A 2PELA 2WZR3 1UZYA 3HT2A 3ES1A 5FP8A 3WQ0A 4IV1A 3ACGA 2ADDA 2QDRA 3BTAA 3GBGA 1JYCA 2WDBA 3NV2A 3FHQA 4YW5A 2ZCWA 2J42A 3I2FA 5H9PA 1GQHA 4N90A 2LRPA 2WO7A 3BODA 3T1MA 2X8KA 4A7ZA 1N1YA 4N53A 2DDUA 3R4UA 1LCLA 4X8PA 4ZS2A 1K3IA 3GZTB 1DDLA 1QJY2 3W5MA 1UYPA 1UMIA 3ZYIB 1FX5A 3LFMA 3GHNA 1QOOA 2EALA 2FZ2A 1C3HA 1NQJA 2W47A 3RVHA 4LK6A 4EZHA 4HSLA 3QH6A 1JU3A 1RUJ1 5L73A 1UO9A 1OLME 1VBB2 2WR9A 1G9BA 1J3PA 1VE0A 4YZ3A 1UY0A 1VBA2 1IZ3A 3LOIA 4HKWA 4JAAA 4B1MA 1QOTA 5JR7B 3VKOA 1K5MA 1YLLA 2A3XA 2UY8A 1EPZA 3JBG1 2BGPA 4AEDC 2UYBA 2BWCA 4DRVA 3BKZA 1N1TA 4NJ4A 3WP5A 4LHLA 1UY2A 1B35C 1KDMA 4YARA 3VBRB 1KEXA 3S7IA 3ZYHA 4D7TA 1RUG2 4GULA 4KU7A 1OI6A 4BDVB 1F2NA 4CP9B 4LKDA 1PK6A 1F31A 3SC7X 5DAQA 4A3ZA 3A21A 3BTXA 4XCAA 3UGHA 4CZSA 2GH8A 4FXGB 2I45A 5HCAA 3M4FA 1I1EA 1AZDA 5LBCA 1YFYA 4BA6A 4IGQA 4COWA 4EN0A 5C4WB 1K42A 5FZCA 4FFGA 5CFCC 4URTA 3ZIXA 2QFEA 1ENSA 2VAUA 3IPVB 3AMPA 1K12A 4MZUA 1K45A 1R082 2JXAA 5D1IA 3M1HA 1UWWA 3HEIA 1APNA 3POFA 1UOFA 3AK0A 5FKCA 5LASA 3I4IA 3BGAA 1LESA 2VMFA 1AR71 3UNPA 1W9YA 3OOXA 5D8AC 3T2TA 5LRSA 3I49A 1BMV2 2WNUB 3JD72 4H2AA 2W1QA 4HG6B 5F5AA 5L19A 3RDIA 3MV11 2YGMA 4DQAA 3PU3A 3O0XA 3C3VA 3AFKA 1WKYA 3OUIA 4Q4Y2 4V2VA 1QGLA 2HWE2 3ZIWA 5J37A 1AL0G 1WBFA 5A7SA 4YVSA 2K0GA 4YGBA 1D2QA 3I2KA 3MPPG 5JLVA 1YC61 4S2GA 4UAPA 3KCCA 5IJRA 5JSOA 4CE8A 4NWVA 2V5YA 4KI5M 3HBKA 5LA9A 2J1SA 2XJTA 2JE7A 4UW5A 4Q4V1 2VZTA 1CIYA 1GWMA 4K40A 1EPWA 2Y6HA 4RS5C 1ZYBA 4W6WA 1WD3A 2BZDA 4XAEA 5GKAC 4QQOA 1AVBA 2JG9C 4CDUA 5I91A 5LBEA 3IPVA 2E7TA 1HRI2 2G9ZA 2P3YA 3VHOA 4RFRB 4MGSA 2OW4A 2Y38A 5ACA2 3CZJA 4URAA 5F8PA 1R1ZA 3LA3A 3RGBA 3BTYA 5CNAA 1XE0A 1ALYA 2XKPA 1SLLA 1FMD1 4DS0A 4LKEA 5FOJB 1JOBA 3LSDA 2DUQA 4QXCA 4QGMA 1BLZA 3OGSA 3TNQA 1UIJA 1PGW1 5BXXA 2A3WA 2XUEA 3MW3A 1UAIA 3TBDA 3RJRA 4FVVA 4BM8A 2MEV3 1RHI2 1VR3A 4TZDA 4GWNA 4LPLA 1UL9A 1W8TA 1YHFA 2C5DA 3VD4A 1J84A 5FP7A 4YSFA 4V1PA 5FUPA 4EJRA 5FZFA 3UKVA 1UIKA 5DAVA 2ZBJA 5EZWA 4IXLA 3I54A 3OG2A 4PT6A 3T08A 5C8CC 2ET7A 1BEV1 1S4CA 4QPGB 4LO7A 4AI8A 1SCSA 5FBZA 4ZONA 1SPPA 4R52A 3ZXLA 5FCCA 2P4EA 1V9U1 2HYXA 3AFGA 4NMIA 5A32B 2WO1A 3R4DB 3URFA 1K5JA 1H4GA 2P34A 1W2TA 2FBEA 2YBPA 3FMGA 2B8MA 2VNVA 3MIBA 2XJUA 2RG4A 4PLMA 5GZDA 3VL8A 4N7UA 3RJ2X 2FDFA 5FJHA 1CPNA 1EY2A 4ET7A 1YEWA 2DCZA 1H2MA 4Y20B 3U75A 1RINA 4ASMB 4QKNA 1D7PM 4XZUG 1LOFC 1NZIA 4A6SA 4HN0A 1NY72 5FZ6A 4GB31 3JBG3 1FPN1 3Q8FA 1EAH2 4FFFA 3PHMA 1NT0A 4Q4X1 3VGIA 4R9DA 4QDQA 5CYYA 1W9WA 2ID4A 4WVZA 2O8OA 4BMBA 3WNNA 3JXSA 3OYWB 4O7XA 3NL1A 4JKMA 5FP3A 5EYYA 5FY1A 2DCKA 1BK1A 2WZR2 3KF3A 3UGFA 1LOAA 4KGGA 4BYYA 4P9JA 3W5NA 3KLSA 2K46A 2XVKA 1A34A 5FPVA 4CXWA 3LZZA 1WW4A 2Y6FA 4QPGA 3ZN5A 4BQ1A 4DIQA 4F3JA 3H1YA 1PX4A 5DG1A 4INDA 3GCWA 4D6SA 2WT2A 4YW2A 4MHUA 3HBZA 1QJFA 1TMF1 4NHXA 4PF1A 1GOFA 5C3QA 3J7HA 4GIQA 2W1WA 2TUNA 3R05A 4FP2A 4QPYA 4XTMA 5GLZA 1W3VA 5KC6A 2OIIA 2W08A 2GC1A 1AR73 4OQ8A 3VBRC 4Y20A 2XL9A 5C71A 1OOPA 5LA1A 4JV4A 4BE3A 2JKXA 4QDSA 3G7DA 3J7LA 3NMBA 1IS6A 5DG2A 2GNTA 4CEYA 1XSRA 4ISRA 3AKSA 4Z92B 4LJHA 3KV4A 2FZ1A 2FD8A 4FQZA 1WWYA 3CEWA 4NVPA 5FZOB 5IUQA 4AXOA 4OCTA 5C4WC 2QUOA 1F9KA 1V6LA 3MUY1 1MPXA 5GZEA 3ZXDA 4DUVA 2ATFA 4GWIA 1G6NA 1J1LA 1OSGA 4NHYA 4AI9A 1DF0A 5BNPB 4COZA 1R091 1SLAA 3PMEA 3KCXA 2R16A 3FLRA 4E2GA 4Q4V3 2AACA 3TN92 4LEJA 3LB9A 4FCAA 3KV5A 5JDBA 2C9KA 4L99A 1W04A 1DBNA 2Q1MA 3MIGA 1H2NA 4P14A 2AGSA 2GC2A 2WNUC 5FXXA 3J26N 4YW3A 5FLJA 1DHKB 4CA9A 1GV9A 1BBT1 4OHWA 3O1UA 1FMD3 4AAXA 4TLFA 1GICA 4JKLA 2VO5A 1IG3A 2GMPA 2XWJB 3WQBA 4IE0A 4N7IA 3S5AA 1UU5A 4LBOA 1QJEA 3H7YA 4WVWA 1WBLA 2LS6A 4YWAA 2D6PA 5AVPA 1YNAA 2GMEA 2VCCA 1ASJ3 2UYAA 4MGIE 3POBA 3AJZA 4XQDA 4FAHA 5KHIA 2VG9A 1I3HA 1U5YA 2IXCA 2BDRA 2Q30A 2XL7A 5SV5A 4CVUA 1SDWA 2JE8A 1T2XA 2QQJA 2RJLA 4HVRA 4TYSA 4QXKA 4WM7A 3ZN4A 4BOWA 4MO3M 1HV1A 1NYWA 1CX1A 4Q0VA 1NLRA 4DRRA 3GZEA 1TZOA 4K3UA 4EWDA 3WF3A 1BEV3 5GLUA 5A3PA 2QQUA 1X9TA 3VZNA 5BNPA 4JHZA 3UJOA 2PLV1 4UFHA 4PJYA 4QKBA 2D6NA 1V9U3 2B9VA 2LW8A 3HOBA 4JTOA 2LM3A 2XJRA 1HXS1 4YNIA 2WWSA 2PN5A 1HJFA 4E4SA 2OS2A 5FZDA 4FPKA 4WZFA 2XUMA 3BIEA 3GYDA 5GLVA 2WO2A 5FQ0B 2DU1A 3THDA 4UF0B 1QY4A 2RS31 4XJUA 4DEVA 4JGYB 4ZZ5A 4S2DA 2DVFA 2A1XA 4LQRA 4XFAA 2EXKA 1Y9QA 4N8MA 3HMYA 1JBCA 4W65A 3RQ0A 1W6QB 4GB33 2XB6C 1MS8A 2JDUA 2JDHA 4PIXA 4KBZA 2GC0A 4LOSA 1COV1 2VUCA 5FR3A 3MI8A 4A45A 4IERA 1LULA 3WNLA 5IK8A 1HRV1 2MEV2 3CDZB 2V73A 5JXGA 2JECA 2W9XA 3QH7A 4D6RA 5D2AA 4ES8A 3AKPA 4TXWA 1Q8QA 1XNBA 4XXAA 4OLLA 3ATGA 2PHUA 1NE6A 2HWD1 1H8TB 4IE7A 5AFEA 3JB4C 5FLIA 3ILRA 1S0DA 2UWBA 3I2OA 4HKOA 4Y5Z0 1UXZA 2XVGA 3EXUA 2C26A 1H8VA 4XXPA 1UQXA 2I07B 2QQLA 2XMLA 4JDMA 1TMF3 1OF3A 1ULPA 1LAJA 3VD7A 4H3WA 3WDWA 1DU3D 4YW7A 4P02B 2J1VA 5I0DA 4EZ4A 3NV1A 4DXTA 1AL23 3OBZA 4HK8A 5FY5A 2GAUA 5LW9A 3PVBB 1RUJ2 3NNJA 4XF9A 5D21A 5H9QA 2IUWA 4AR2A 3LGRA 3ILNA 4BH9A 4JGYA 1IS5A 3D3AA 5F1RA 3NKTA 1YQCA 1Y43B 4WZCA 5T5OA 3IB3A 3I2JA 4QKDA 3VDDA 3VLBB 3RZHA 1FNYA 3PNAA 1E5SA 3JBG2 5A70A 4D3WA 3NKGA 2A5ZA 5KR7A 1L7RA 3Q9OA 1PZ7A 4QXHA 2V72A 1MQTB 3AB0A 2OPWA 3H9AA 2GDFA 2DVAA 1R093 2V4VA 5KXCA 5JMOA 4FTSA 1DLCA 2VBBA 1A78A 1DG6A 3IIIA 4XFHA 5JZGC 1XOYA 1VMFA 3V56A 2WSUA 2VOKA 2YC4A 3FZ3A 4TN7A 4E4HA 4XF0A 1VALA 3S7EA 4MUVA 4LE3A 4YZ4A 1S0CA 3NAPA 5T54A 5JXHA 3MW4A 2XQRA 4XEZA 3WQ7A 4HBNA 1BBT3 1XB9A 3GNEA 3W9AA 3WZ1A 1QJX1 4WVMB 3AXDA 3O14A 2D40A 4GALA 1NE4A 3T09A 3I2IA 1AR72 4NRPA 3JUUA 3NRUA 1LNSA 1PO11 1BXHA 2X09A 1X7NA 5FZHA 3WUCA 2ARCA 2HKXA 2ZGMA 4XYXA 4OUSA 5BNOB 4D69A 1S1AA 1OT5A 3BIWE 2E51A 1WA6X 1CAUB 1W06A 2QDNA 1ST8A 2YUEA 1EV11 2DUPA 3MIHA 3OBRA 5BNPC 3IMMA 2OT7A 4PQ9A 2VU9A 2QE3A 3E6CC 4XTPA 3WF2A 1MACA 1VRBA 4P5HA 2VCAA 4A7YA 4AK3A 1VMJA 4NOTA 1WMDA 4UFKA 3ZPYA 5J96B 5JAXA 3OTFA 2AR6A 2WT1A 5FMOS 4FPYA 4MXWB 2PLV3 5IK5A 1TEIA 4BJ0A 3RMXA 4Q4V2 1W6NB 2EAKA 4OMCA 4AQ6A 3WW3A 3OUJA 3NV3A 5KWRA 1HV0A 3LE0A 4CU9A 2IC1A 1PM4A 4DUXA 4N43A 4UBGA 4AAPA 5DDJ1 2C24A 2RS33 3FE5A 3J7MA 5EJ3A 1H9PA 4OI2A 2DVGA 1UY4A 2DU0A 4EQVA 4B4PA 2VOXA 3H1MA 4M0NA 2RDNA 2WZEA 4IE5A 1NCQA 2J1EA 1FMD2 2I2SA 3ELNA 3RWNA 1BVP1 3SHRA 1WCKA 4ATFA 2CV6A 2DURA 1RL3A 1COV3 1SHWB 1LENA 2B7YA 4K8RB 2GP3A 1ENQA 1NCRB 1PGW2 1TNRA 2P3IA 2YPJA 2YFUA 3SEPA 3VBUB 1ZRFA 2F4PA 5BNOA 4XJ9A 5J3UA 1HRV3 1ODNA 4MADA 5JOZA 1ZX5A 4LOTA 3MUZ1 3OCPA 4O61A 1N1SA 5FXVA 1UF2C 3ZKUA 2Y33A 1XNTA 4LA2A 1ND3B 4LR4A 4XVHA 1SFYA 4IEVA 3WF0A 2Y64A 1CPMA 3IIAA 5I0SA 4B7KA 2HWD3 3SISA 3ZFEA 2AEZA 2E63A 1GNYA 3H1WA 3R0RA 2AEYA 1QHDA 3OJBA 4AL9A 3BCWA 3EO6A 2GN3A 2VPVA 2QQOA 2YGLA 1WZXA 2ZJCA 1BEV2 4GJYA 1SMVA 5EXOA 3ZYPA 3HWJA 4BZ4A 5IK7A 1EYBA 1REEA 4MXWA 5GM0A 2B42B 3EQEA 3OGVA 5A6YA 3I3DA 2OKXA 1YQ5A 4AYUA 2Q8DA 1W6OB 1V9U2 4YW4A 2FHRA 4DEQA 1S0GA 4LBKA 1WW5A 1CR7A 1MS4A 4XJZA 3ZPOA 3DUIA 1FAYA 2R1BA 5SV8A 3AMQA 4XHXA 5I8YA 4AEKA 3WF1A 5FY4A 3E1F1 5FZMA 1AUYA 1D4M1 5A1AA 3FC0A 1NLQA 1JYXA 3H8UA 4XOGA 2J7MA 4HL0A 4A6OA 1YI7A 3MLJA 4GB32 1OHFA 3BALA 4LBQB 1FPN2 4F83A 4JRAA 5GZGA 4Q4X2 3T2OA 4YZ5A 3VBUA 1NCRA 3S0MA 3WW2A 1H8TC 5LATA 2JJ6A 2DCTA 4RR3B 3BB6A 1W2AX 1WLCA 3SQOA 1KITA 4P9LA 5CFCB 2BW8A 1CAVB 3MIDA 1HB1A 4KMQA 1XYOA 3WVJA 2PHFA 3CJIB 2R041 3JD73 1DP0A 5F9TA 4EWAA 2UU8A 5JPNB 4S2HA 3MW2A 5FZKA 3N9QA 5A3NA 4R4XA 1TG7A 5K9YA 4IESA 4PHZA 4W50A 1OVSA 1ZVFA 3KWVA 4UBHA 2V5DA 4Q4Y3 4Y5TA 2YXSA 1H2KA 1W0PA 2JDPA 4LIVA 2KD7A 3N36A 4LTAA 4Q2FA 4DOUA 2JG8B 1DGWA 1H1MA 1S0EA 1AR91 3VBSB 1IPSA 1JYVA 3AMNA 3AP5A 1TMF2 1RJ7A 2XHNA 3B01A 5DN2A 3TNPB 1J1TA 2YU1A 4LKFA 2UY9A 3F95A 1WMXA 2QCSB 4AVTA 1VLNA 3C7GA 4LBLA 4GWJA 4AEDA 1C1FA 5C6CA 2ET1A 3DKQA 3WP6A 1QJX3 2D6KA 2L9LA 1B35A 2Q8CA 4OHVA 5FZBA 1DQ2A 1PO13 2EAAA 2TBVA 1MQTC 2X5IB 3V0AB 3KSCA 3ZSLA 3VZOA 1HRI3 3WY6A 4PIZA 3IMNA 1EV13 1QXRA 2UURA 2DWRA 3WX5A 2ZZQA 1RUI1 5FYBA 4AW7A 4O9EA 4ES9A 4QWNA 2O0OA 1XE7A 5F3GA 4Y1VA 3AYAA 3O1RA 2VVEA 4HSJA 2J22A 3LEIA 3VKFC 4DO0A 5CFCA 3LF7A 1CAVA 3ZFGB 2H0VA 5I93A 4FP3A 1XBFA 1E57A 2VH9A 4NR1A 3CJIA 2ZEZA 3QACA 3CBNA 1OH4A 1QH7A 1LHWA 4Y24A 5F5CA 5LBFA 4LE4A 1KFUL 1R092 1SQ4A 1ZZ9A 3MIEA 4NUBA 2RMU1 2PYTA 4Q8KA 4DNYA 2P5BA 3VHRA 4FFIA 3VKLA 1LGNA 3DCQA 3O7OA 2W3JA 3I59B 2BUKA 2CGOA 1MZ5A 3GJBA 2DTWA 1RC6A 4GQ7A 2R30A 5D8AA 4A2UA 1V6NA 3UV9A 5L36A 3VBOB 5HXMA 5DDJ3 2ZX4A 2YDEA 3GZUC 5BNOC 5E88A 2GN7A 1WMFA 2HBUA 2EA7A 3KQ4B 3KVBA 1BBT2 4K1YA 5H9RA 1CZSA 2D7FA 1AJOA 2LROA 4IEUA 4ZPIA 5FP9A 1AX2A 2ILMA 1T6GC 5T5PA 1SBFA 1IS3A 1WD4A 3IDBB 3T3YA 1GZTA 1W90A 4CCCA 1Y9MA 3H0OA 4OHXA 1H2LA 5JXJA 4CXYA 2YFZA 2VGDA 3M2MA 1YRZA 4DMIA 3ZFFB 4LIUA 1ULGA 1NXMA 3GBFA 4A7KA 3MYXA 3G6JB 3GGLA 4RHV1 4RS5A 2Y6LA 2GMMA 2WAAA 1LODA 5IATA 3SKVA 4HKLA 2BEOA 5BNNB 4CUCA 3TEYA 5K8SA 1C57A 1C5IA 5FYSA 1VBC1 2WNVB 2R7EB 3AKTA 3P3NA 4CU6A 2PLV2 2XKOA 1AJKA 3ZN6A 4ORFA 1S55A 5FZ1A 1QDCA 1HXS2 3I59A 4EROA 3VDCA 3KGZA 2D6MA 2E6VA 3DYOA 4QQLA 1ZRDA 1OH3A 4MV2A 4AI1A 2DF7A 5A6QA 1D2SA 1SLTA 4QQHA 2BRTA 1NCRC 3VBUC 2WUHA 4XBNA 1D4M3 3EYPA 2GU9A 2A70A 5EV7A 2RS32 3KD4A 3JB8A 5FZEA 3I2HA 3H3LA 2ZGSA 1IQDC 1CAXA 1FOD1 4QD2A 3ROUA 4KNCA 1ND3C 2QQVA 3D82A 1JYIA 3P6BA 3FJSA 1ND2C 1XU2A 2YMZA 1U5XA 1W39A 4XURA 5LY2A 1JZ7A 5LWBA 1COV2 5CVRA 1OPMA 5DZEA 5C8CA 2XBO1 3F2ZA 1JZ3A 1W6MB 1HRV2 4XBQA 3ACFA 4LO5B 1W28A 3ECQA 1JZ8A 1W03A 2OVUA 1DYOA 5C5TA 2R043 4H7MA 1ENRA 2CYFA 3ES4A 3INAA 3POJA 4UFJA 4AGRA 2G9GA 2K2SA 3HQXA 5FY7A 2HWD2 4CEWB 5FUNA 1D4VB 4C1XA 3TAYA 1V6IA 4HFSA 4XFFA 2IXHA 3W58A 4R4ZA 1UZWA 4BLJA 3ORJA 1XYPA 3SCGA 1AR93 5FYVA 1NA1C 3CQOA 1V70A 4K6BA 3TRSB 5A7NA 1LOFA 1O5LA 4GWMA 4Z2WA 1YQ6A 1IGOA 2XG3A 3NJVA 1HLCA 4XF1A 4HXCA 2FDKA 4MX3A 1ZZCA 3MLKA 3AZVA 5BPXA 4CCEA 4YGDA 2EIDA 1G9AA 3L2HA 5FYZA 4EN9B 3TN93 1I5PA 1SBDA 4RR3C 3VZMA 2PAEA 3MFCA 3GCXA 5EYXA 1ZRCA 1ZZ6A 2B9UA 3O1VA 1LHOA 4HT1T 5E1RA 3UESA 4IEQA 2G9FA 2IFWA 1OURA 1WMEA 2ZACA 3TYJA 2ADEA 4E27A 3CJIC 4JC1A 4L97A 1N3OA 1RUI3 2CL2A 4GH4B 5CB7A 2XHKA 3LCPA 2Q0AA 4A44A 5K0UB 5KC5A 1BK0A 3ZXAC 1W05A 2ZGPA 2JG8C 4OYUA 4DINB 2HBTA 2P3JA 4UOJA 3VBSC 5J09A 3J8F1 2RS51 2ZX0A 1CAWB 5FZIA 4HANA 1V6MA 3HVDA 2FDJA 2CY6A 3KT4A 4BMEA 4DB5A 5LCWL 3T2QA 1F15A 3VV1A 3NNGA 5ANNA 1E5RA 2ZTNA 3QD6A 4RL7A 2RJKA 2YU2A 3FWEA 3VBRA 2EIBA 4Y1YA 2AREA 2ZOEB 5JOWA 3VBFB 4CP9A 3VHPA 3OY8B 4QM8A 4LLFA 4AWDA 2X5IC 5FZ0A 1VB4A 3RRDA 3VHNA 4AVSA 1JZ5A 3ZYRA 2VQ0A 3HN3A 4E2QA 3AVSA 1J59A 5HCHA 1HB3A 1QJX2 4G3YC 5ABJB 5IW0A 4ZU5A 2ZAHA 3LQCA 4GZ9A 5C4WA 4ATEA 1PO12 3MFAA 3ZFGC 3NV4A 4JQTA 4AI0A 1MVEA 1X36A 4FPHA 2JWPA 2HWC3 4MGYE 3LIHA 1EV12 3B02A 4CCJA 3T0AA 1C4RA 2GSYA 4OMDA 5A6ZA 2CTVA 4RHV3 1G86A 2JDNA 2PHDA 1QQP1 3A22A 5K0UA 3I7DA 1H1AA 5CU1A 4OZOA 1PMIA 1HQLA 3ZLIA 4CP2A 1UX7A 1VP6A 1SLCA 3M3CA 4XQ4A 1CAWA 2JB4A 2WNUA 2A75A 2WQ8A 3VBOC 1PX3A 2NP0A 5HXVA 1A6CA 5ISLA 1OLMA 1O8SA 2CAUA 1OF4A 4Y5SA 4ONUA 1DYKA 5DMYA 4BLIA 1NOVA 5C3RA 4CCDA 3OY8A 4R9AA 5FK7A 3T0BA 4LT5A 5CKQA 5DDJ2 3WW1A 3CJXA 1G7YA 1Q8OA 4J25A 5KHKA 2D3RA 2DBIA 4YFZA 1FOD3 1X8EA 3IKWA 4P9WA 3THPA 3ZFFC 2F6BA 1Y7BA 3BI3A 3GXUA 5FUIA 1OLRA 2W95A 2WJSA 4AHZA 2D97A 1FI2A 2DVBA 1FV3A 3OPWA 3ZXEA 1RUJ3 2XBO3 2JICA 5BNNC 4GA9A 5FMBA 2H6BA 2W5FA 4PCRA 1F5FA 2WNVC 2A73B 4FPCA 2XJQA 3NW4A 2Y6KA 1QJU1 3ZYGA 1LB2A 1O3TA 3S30A 1UOGA 3WNPA 1DQ1A 3CHXA 2Y0OA 1MS3A 2RV9A 4DY5A 3NNLA 4I0AA 4LMFA 1S2EA 4FBFA 3LEGA 2PXJA 4PLOA 4RQPB 4LUMA 1GP6A 2ETEA 4KWUA 1LHNA 4AGVA 2DVDA 2ZGQA 4IEOA 2QKDA 4J1XA 3FFQA 4NIIA 3U07A 1R64A 3O1SA 1FXZA 5FWJA 5LZ6A 4E2SA 4YW6A 3AM2A 1GQGA 3A23A 1W2OA 4QX3A 4AE2A 2ZXQA 2VNOA 1D4M2 1BZWA 4XFIA 3KB5A 2LTNA 1Z78A 2N7GA 2SBAA 1NUKA 4YVWB 3ALQA 2R1DA 3LA7A 1WLWA 4PLNA 2JDMA 5A32A 3K4DA 2VZPA 1YJLA 5KXEA 5JZGB 2QBXA 2V4AA 4CEWC 2HWB1 1REFA 4BIFA 2YROA 3MBWA 4Y1ZA 3WT3A 4XIOA 3GBWA 3VN4A 1XNDA 5A7WB 4H7LA 2XPJA 2Y34A 1H0BA 1UKGA 3B9IA 4JDOA 5CISA 1YJKA 3H8XA 2RS53 3A4UA 2R042 1RVF1 1LKNA 4NAOA 3C8XA 4KG0A 1H9WA 2D98A 3FX3A 1W8FA 2X05A 2A6XA 3HNMA 5FPZA 5FPXA 2IFRA 1PMJX 4ZS3A 1U5IA 3OYWA 2MHFA 1UMZA 1AR92 3D6EA 4RGGA 2ZGOA 3MGUA 1E5IA 3O5SA 4AFMA 5B2GB 2QNKA 5DUVA 3U4XA 4LO4B 3MO4A 3AL5A 4D6QA 1N3QA 3O1TA 4Z07A 4GH4C 2BWAA 3KV6A 3ZSEA 3I2DA 1IQAA 3AP7A 5K0UC 4P9GA 1S0IA 3ENRA 4AFDA 3RZGA 3VDBA 2CSGA 4FFHA 4J1WA 2G4IA 4UW6A 5C9AB 3HT1A 3ZXGA 2ZGRA 2EF6A 5I0RA 5CG8A 2ORXA 4TTGA 4O9GA 5FYUA 1JOJA 2DCJA 4W8JA 1RUI2 1XQNA 3LWCA 4CDXB 5JZGA 4DPNA 2VBDA 3WCRA 3E5XA 3IDCB 4FO9A 4H14A 4JZRA 2WC2A 3NJYA 1QQP3 1FYUA 2ZMLA 2DFBA 1CJPA 3WF4A 5FRAA 4AHYA 1O7FA 1L7QA 3HQRA 4JGZB 2YBKA 4QKFA 3VBFC 4RFT0 1NQDA 5A3MA 1PZ8A 4XMAA 1RJ8A 4MGQA 1LEDA 1X33A 2RMU2 2VQUA 2VZVA 3OPTA 4JCKA 2WBKA 3OPZA 5A80A 5ABJC 1US2A 3C2UA 4FPOB 4MLOA 5FZOA 3K51A 3UKTA 3WD5A 4L0PA 2Z69A 3Q8BA 4Q4W1 3MV01 4CP1A 1HIXA 2P37A 5FZ8A 4UWDA 2HWF1 1QDOA 3OGRA 3ON7A 2VECA 3KT7A 5JOXA 3ZSMA 4XC9A 2WA3A 4DFSA 2BPA2 1RGSA 1XNAA 5L7OC 3SEEA 4E8CA 4NWWA 3NSTA 3VD3A 5EJ1B 3O1MA 1GP4A 3AVRA 3KGLA 1W2NA 2CGNA 2R061 1RITA 2JDYA 4L92A 3M8LA 1XYNA 2HWC2 4OQ9A 2HLEA 3D0JA 2FCVA 1QJU3 2RDSA 4LK7A 2VMIA 3WG2A 1LHUA 1LRHA 2WQ4A 2XDVA 1UZVA 3PTYA 1FPN3 2BVBA 4RHV2 4XUNA 4Q4X3 4K8FA 5A7OA 4F7ZA 4NHMA 2AYHA 2EXHA 3H7JA 3O0WA 3WDTA 4PDWB 3MLLA 1M4WA 3IDAA 3L2YA 1PNFA 1VBC2 4XABA 5IVJA 1PMHX 5DAXA 3OSDA 2GALA 3J7NA 4PF5A 5FZLA 3ST7A 3U37A 3MIFA 3X29B 4XQWA 5JVVA 1DQ5A 1PVC1 4Y1UA 1MZEA 5FZ3A 3W21A 3R6SA 3VUOA 3M70A 5FIXA 2OUHA 4UFLA 1BHGA 3WHUA 3CU7A 1U12A 2WZ8A 3LA2A 4XUOA 3VBHB 1VMHA 2AH2A 1FOD2 2EXJA 2F17A 3ZX7A 4AOCA 3EHKA 4BQYA 5DQ0A 2J1TA 4ZXKA 2YBSA 1Q43A 1ZZ8A 3RYRA 3WP4A 2UWCA 1NXD1 2QQIA 3WNKA 1QU0A 5FQ0A 1POV1 1OA4A 2XBO2 2XOMA 4RQPC 4UF0A 5F6KA 2VNGA 3T0DA 1ZM1A 2B39A 2ZHMA 3AMHA 1RVF3 4LORA 4YYOA 2JE9A 1UZZA 1W99A 1X82A 1W6QA 4BK4A 3MF9A 4Q8LA 2NZ9A 1RUE1 3HAGA 3WQ1A 4R9CA 1SG3A 3UGGA 2WSVA 4Y4RA 2IXLA 1HQNA 2WNEA 1G9FA 3POGA 5KHGA 5F7UA 1KJRA 3AZZA 5KHJA 1JYTA 4ZU4A 4NIAA 1RUH1 3M3QA 5A3TA 2Z42A 4YVWC 1HKDA 3GHMA 4AI3A 3WP3A 3WCSA 5AC91 2VL4A 2Q8EA 2YHJA 3DXUA 4CPBA 1H8TA 2XH6A 4YPJA 3THCA 3T4VA 5EP9A 3DECA 4P5YA 3VB9A 1ZA4A 1QXPA 2RS11 4IV3B 2QQKA 1DQ4A 4LHSA 1OQEA 1XPWA 3UT0A 4QPIB 2W2IA 4YW1A 2WZPP 2WKKA 3GJAA 4NE9A 4Q0QA 4LHNA 2Y26A 1JHJA 2D6LX 1QF3A 1ONAA 2XONA 4HN1A 3WW4A 4LITA 1JHNA 4WVVA 1W8NA 3KVAA 3ZSKA 4AQSA 1C5HA 1MS5A 4U2AA 5FKBA 1CZTA 4Z82A 4FXKB 5FYIA 3H8RA 2ZEXA 2FMYA 4C1WA 4HPKB 1W9TA 1DGRN 1ULFA 1I9RA 2FDGA 1YFXA 2A7AA 5JMCA 5F32A 1AF9A 2WA4A 3J8F2 1GKBA 4QQPA 2RS52 3RFRA 2C1FA 3PLQA 4XMIA 4F8AA 1PM7A 4QX5A 2VMEA 4XF4A 4XE9A 5AVAA 3ZM8A 5CKNA 1MVQA 1JI6A 2JDZA 3IAPA 3BYWA 3QOPA 5A3WA 2E7QA 1QXJA 4Q4W3 1MQTA 3RZKA 2HWF3 4FOYA 1POV0 3LDKA 5C3PA 5JSRA 3HPNA 5C9AC 2HEYF 2JD4A 1GZ9A 1O8PA 4B3NA 4QX8A 1OMIA 5KHHA 3MDPA 4XHBA 4CDXC 5FFOC 1HXS3 3M7AA 2Q1FA 5ERLA 3OB8A 2K9ZA 5BY5A 2R063 1VAMA 4XW3A 4ZKTB 3WINE 4JGZC 4YZ1A 4FPJA 4Q0PA 3FUQA 5CADA 5JR2A 4FPGA 2NN8A 5DZGA 1YFUA 4WVMA 4XJWA 3V65A 3RYKA 5F3EA 1QQP2 4M0HA 4BPZA 4CCNA 3WLUA 4HONA 1YFWA 4YGEA 4KU8A 4A42A 5IFTA 2VD7A 2EIGA 3PUQA 3FL7A 3POSA 1Y9GA 3SH3A 1CAUA 1J83A 2NMOA 3Q8EA 4GKXA 4R8HA 3RYPA 3SNMA 4GXLA 1OPOA 4HETA 2W52A 3IN9A 5FZ7A 4AF9A 1ND2B 1T6BX 2EICA 1PVC3 4ASLA 4NHLA 2PAKA 1LJ7A 3USSA 2C9AA 3ILFA 4H55A 4AGGA 2PHXA 1C8NA 4FOWA 3ZR5A 2ZABA 4DXSA 1ODMA 5CFDB 2P6CA 4AEJA 4KH9A 1GZCA 1GUIA 4KWLA 1JUHA 2Q1ZB 3RMYA 1W6NA 2DCYA 3DEMA 1RUD1 4XZPA 5I8SA 3ZYBA 3LOBA 2PFWA 4OULA 4AFAA 1I6XA 3T4HB 1POV3 5JPMB 1R1A1 4PDWC 1IPJA 3AZWA 3POIA 3FLTA 3ZYFA 1YIFA 2DV9A 1NA1B 4OHZA 4FOQA 1VAKA 4FQ4A 4CYDA 1ULDA 1N47A 3U14A 3NNMA 1KJLA 1QJU2 2YZ4A 3DXTA 4MVTA 1RUE3 4E4ZA 2PQQA 1VBD1 2VZSA 4CCLA 3RS6A 2ARXA 4IQPA 3T2PA 1YUDA 5HV0A 3HN1A 1OFSA 1TME1 3HD8B 4L9BA 4LHKA 4Y22B 3ZXJA 1AHSA 4C91A 4P9XA 1O3QA 3BTZA 1XNCA 3EBRA 4WM8B 3PMSA 1F35A 1KDKA 1ND3A 3VBHC 3O0VA 1ND2A 4CDWB 5A33B 4P08A 5GLTA 1KRIA 4MGTA 2VZQA 4YFWA 4IEXA 3HNYM 2RS13 2KXLA 3A7QA 3OF1A 2PQSA 5LK5A 5HV4A 3RZMA 2A6WA 5FK8A 4Q27A 4IE6A 4QGLA 4BQ5A 1RB8G 4L11A 1LGCA 1GSLA 4EN7B 2OZ6A 4LBMA 3H50A 4NPLA 4BHPA 1W6OA 1XSQA 2WWUA 1GQPA 1ZBE1 4YRDA 3B94A 1P8JA 3ZKYA 4FT8A 2CWMA 2HWB2 2WT0A 3PUHA 1QEXA 5IT6A 1HN1A 2OXBA 4FOVA 2VCBA 3K46A 4UI9L 5FZ4A 4AFCA 4BK5A 4COUA 3P1IA 5FPAA 2BNNA 1NA1A 1QNWA 3U11A 2WWJA 4RA0A 1RVF2 5A7PA 1UKRA 4X6RB 1CD3G 4PIYA 4MYEA 4LBQA 3I3EA 3KHBA 1NKGA 5BV6A 4RR3A 1YWKA 1JZ6A 3ZVXA 3DGTA 4IV3C 2WN3A 1MS1A 2E33A 2W1UA 1E5HA 3RNSA 4NROA 4QPIC 2QZ3A 3DPRB 4GD4A 4CPBD 2X53S 5GALA 2G1MA 1WLDA 1VBE1 5G05L 1H1IA 2IZWA 4RGKA 3AXEA 2ZX3A 3N7MA 1MEC1 2IXKA 4B29A 4KL1A 4Y1XA 1O4TA 1SFNA 1XJAA 2JG8A 3SITA 1B09A 3VBSA 2W68A 3AC0A 2VZUA 2YV8A 1HW5A 2Q4SA 2JB8A 3ETQA 4K7JA 1VRH1 2O14A 1GMMA 2YYOA 5J48A 2ENRA 1YI9A 2QVSB 2R32A 3MZHA 3C7FA 4ISQA 4P9IA 1O4YA 2DFCA 1NG0A 1JZ4A 4KGQA 1WW7A 2PHWA 2ZMKA 4SLIA 4UW4A 4NO4A 3O1OA 2VBPA 2MPFA 5CZKA 3WXPA 3PURA 3CMGA 2X5IA 4CTEA 3V0AA 4XACA 2D5FA 1QMJA 2WN2A 2XLFA 2RDRA 1WW6A 3OGGA 1CZVA 2JIGA 2AZ5A 2Q8OA 2JX9A 3POYA 3RWKX 5J7MA 3ACIA 2ZA9A 4M00A 1BYHA 4D8MA 5IVFA 2BNOA 1UYZA 3GDBA 3ZFGA 1A8DA 4Q4W2 4Q1PA 5DUWA 2HWF2 1S2KA 4BQXA 4QB6A 4PBPA 1FV2A 1IS4A 1J3RA 5JOYA 1RUOA 3V0BB 3E5UA 4OI1A 1IHMA 4MG2A 4K21A 1WA4A 1SFPA 3SKJE 3C7EA 3LPGA 2XLGA 4LNVA 1RUD3 4G9SB 2PAMA 2NPIA 2ZKLA 1MS9A 1Z0HA 2O1QA 4QX0A 4B1LA 1RMU1 4JRLA 1ZREA 2O8QA 2A3YA 2R062 2GNBA 2KR2A 2ZGUA 3ZMNA 1R1A3 4CUAA 1SDDB 2ORZA 2R6QA 3VBOA 5B4NA 5FPUA 4NIGA 1K5MB 1CESA 4M4PA 1GBGA 1OXCA 3BU0A 1W0NA 4XFCA 4FTEA 2EVXA 1KXGA 3ASIA 2PHLA 1UU6A 5IAVA 4QHZA 2QQNA 1IKPA 1VBD3 3BN6A 3ME2A 4M01A 4LULA 5FV3A 2SLIA 5BYNA 5FZ9A 5A7QA 1TME3 3DN7A 5IAXA 2V09A 4QAWA 1PK6B 3UL2A 4JVAA 4NN0A 4AVAA 3CZUA 2ZS6B 5LA0A 1U5ZA 3WDVA 1L7LA 3L9JT 4MGZE 1RUC1 5L9BA 3SXWA 5F3CA 5CG9A 5CFDC 5FO9B 4XDQA 3LDBA 3ZFFA 2NMNA 1C1LA 1X8MA 2XR4A 3WG4A 1X50A 3RZLA 1CVNA 2D5HA 1OD3A 3WDYA 5KXDA 2W94A 1PVC2 4QB2A 1C28A 4QX7A 5FP4A 4JDNA 4KQ7A 3Q8CA 2ARBA 3DYMA 2HJIA 2HEVF 4EE2A 5BNNA 5C70A 5IVBA 3IBMA 4I0WB 5C7GA 4BQWA 1KQRA 3VL9A 2GC3A 5LY1A 5DUUA 3V0BA 2WNVA 1IKQA 2G19A 2J1AA 3NNFA 4HVOA 3M3OA 5FYHA 3ZR6A 1ZBE3 3WNMA 4E9KA 4XJ8A 1UXXX 3RZZA 4PBOA 4FAGA 2ERFA 1YQ2A 4OUEA 1UNBA 2B45X 4Y26A 4CSWA 2VM9A 3IM0A 4PI2A 3WG3A 5JSPA 2Y6GA 4KWKA 3SMHA 4TWTA 1YXWA 4CXXA 4WM8C 2BV4A 3N35A 3BVCA 4CDWC 1RUE2 1ZBA1 5T5LA 2JDKA 4C90A 4DXRA 3FN9A 1CJDA 5A6XA 2IWGB 3D0SA 3NO8A 5C3SA 4YVSB 1NLSA 5C33A 2VE1A 4TSVA 3I3MA 4KWJA 1S0FA 1W6MA 3FBMA 4Q29A 1RUH2 3S57A 3K77A 2X10A 1JN2P 1O91A 1OKQA 4MSVA 4AZZA 3I3QA 1DZTA 1VBE3 2QQMA 3K4AA 4Q0SA 2LUWA 2OZJA 1TVGA 3Q8AA 1ZA7A 5FWEA 5AC92 3B5LB 3LKJA 3E6BA 2RMU3 4Q1RA 4B4QA 4CEWA 1JUIA 1MEC3 1OVPA 3GF6A 1W2UA 2WABA 2DBNA 5DAWA 4CDUB 2WNOA 2RS12 3PJQA 1TNFA 2ZGTA 3VZLA 5IVYA 3OEBA 1W6PB 1KD7A 1PGSA 2X29A 2YPDA 5F6LB 3MICA 4D7YA 1VRH3 1W8OA 4XILA 5JCTA 1YIPA 1UZ0A 4CUGA 1UYXA 1U0AA 2ZPXA 1CIWA 4BIOA 2C6SA 4COYA 4M4RA 2ZX1A 3JCIA 5I8TA 4NAMA 1F8VA 3CLPA 3TB0A 2VXJA 4AVVA 4D7SA 3DF0A 1O6UA 1M06G 4LBQD 3DPRC 5FJKA 1NAEA 2Y60A 4E8DA 1UMHA 2XVLA 2ZZJA 1D0GA 3HR9A 2BERA 1AR61 5CEHA 2GNMA 5HI0A 4GH4A 5DUXA 5E8AA 5L7OB 2D6OX 2D43A 3N4MA 4OVEA 3TOJA 3U78A 1Q8SA 4JHTA 5FYTA 3H8OA 2RVAA 2WIIB 1AR81 1SPPB 2R0FA 4KG8A 4XUPA 4AHWA 4CCMA 1UCXA 2IVJA 2BJSA 1GOHA 3KM5A 1VBC3 1PO21 2UWAA 1JTZX 5EHDA 3WUDA 5FTTC 2WLQA 4MGKE 3ETPA 1LGBA 3H3ZA 5T55A 2ZEWA 1LOCA 5EJZB 4HOOA 5FPLA 4ZU7A 2FQPA 5LK7B 1BQPA 2P3KA 4P9YA 1RMU3 3NWKA 5FO8B 1ULOA 1W6PA 3SCFA 1GP5A 1XE8A 3MHZA 3VBFA 2ZHLA 4BB3A 4ZZ8A 5IVVA 3GZAA 1UOBA 4AVBA 1G8WA 4IV1C 1HX6A 4YG3A 3PL0A 5GJ6A 1VAVA 2HYKA 5ABJA 4JQRA 1S2BA 2JIJA 1S0BA 2R071 1DGWX 3O12A 5CA6A 5K4LA 1JOPA 1GANA 1N3PA 1UOJA 3QBQA 4N53C 5FAXA 1ASJ1 1DIWA 5G04L 2ZKNA 1JH5A 2BOJA 2BVVA 2VMCA 2IXIA 4CU7A 1RUC3 5F2WA 5ANQA 2VMGA 5F3IA 1TE1B 4Z1VA 4CCKA 3T30A 4A3XA 4RSUA 5L7OA 4Y4YA 3CL1A 4IEZA 3UETA 1W8UA 3LD8A 1QOSA 2ZMNA 3A0KA 4BQ2A 4D94A 2ZHKA 4NRMA 1DLLA 1AXKA 3P5BA 2B46X 5J98B 2WS91 5FXZA 2VQAA 3OBTA 2VW0A 2HH9A 4BXFA 4I02A 4ZXEA 5E89A 4DXZA 5BUVA 1K5MC 4AG4A 2Z5WA 4META 4I30A 1UD1A 2JD9A 1RUD2 1DQ0A 2H6CA 2R0HA 4I0BA 5M0TA 5T5JA 1S0JA 2Z2SB 1OOPB 3OGJA 1R1A2 1PK6C 1XRUA 4JKKA 4IEPA 1H6YA 1HN0A 2RM21 3LIGA 1IPKA 4CEYB 1YO8A 3D5OA 4EN8B 3I97A 4LUKA 4XUQA 3DL3A 4XF3A 1PIV1 3AKRA 1O4ZA 4OI0A 1ZBA3 1VBD2 5JUVA 1RUF1 2CNAA 4W4ZA 2VVFA 4AI2A 4OZXA 5EPAA 4FTBA 4QMAA 1TME2 3QLQA 5LRRA 3ZDVA 5DXDA 1OUSA 3N9PA
chains in the Genus database with same CATH topology
2IXJA 3J8F3 3J9SA 3WR0A 3UKNA 3E97A 3RI9A 1DZQA 2EXIA 2NYYA 4CP0A 2RR11 5I0UA 2Z79A 3N7JA 4FPFA 4RQPA 1ZZ7A 2QZ2A 2WFF1 3W59A 1AXZA 4M3CE 3DV8A 1UU4A 1FT9A 2XGXA 3FBYA 4YZ2A 2WQZC 3B3QE 1AL21 2NQYA 1YCIA 1XNKA 2XJPA 1ZBE2 2RHPA 1DYPA 1VB2A 3PVNA 4MH0E 2ZGKA 4YVSC 3B93A 3DKWA 4WV8A 2KM2A 2I74A 4YVWA 4XFBA 2BQPA 5CBLA 2XLAA 3AYDA 4WM7B 3WG1A 5HBAA 1AR63 4I2OA 1D0HA 3MPBA 2BFUS 3AJYA 4FPEA 2VW1A 1LOGA 4CDUC 3N3HA 1ULEA 3VZKA 3JZVA 5FOBB 1AR83 3MEPA 3ZXKA 3WDUA 4JTNA 5K7PA 4OHYA 1V00A 1SACA 1VBE2 1PO23 4G4FA 1WUVA 3USUB 1MEC2 4Z8BA 1Z7S1 1PGL1 2E53A 1Q8VA 2BFUL 3R4SA 3VKNA 4BWOA 3IWZA 4YM0A 4XETA 3SLIA 1VRH2 5JWPA 1C8M1 4CDQB 3WNXA 4W6YA 5AFBA 4N9HA 2VVDA 3FLPA 4I09A 1Q56A 4HMZA 2OYZA 1N1VA 2B5HA 1HDKA 2R073 1AYM1 4M3CB 3KZ4C 1VIWB 4HLTA 5JI9A 1URXA 3POWA 4R9BA 1L3JA 4S2FA 2VUAA 5LEKA 4YM3A 2P17A 5C9AA 3AP9A 1QNYA 2ZGNA 3I8TA 2QJVA 4YM1A 4CDXA 2A6ZA 5JI7A 1I5ZA 4I3PA 1AYN1 3AX4A 4OUMA 3RG0A 4JGZA 1Q3EA 2WS93 5FREA 2P2KA 1V6JA 1A3KA 3N7KA 3USUA 4NHKA 5JIUA 3ZO0B 1UPIA 1OQ1A 1OLQA 1LTEA 4DZGA 2WLPA 3B00A 5JIAA 5H9SA 4X8NA 1RMU2 2D44A 3B69A 2YY1A 1GNZA 1MS0A 1QJY1 3KS7A 3T1LA 1O3SA 1MR5A 1WCSA 2RM23 5GLWA 4CDQA 3VDDB 3UJQA 4LLOA 1CN1A 4LO6B 4J6GA 5F5QA 1DGRA 3BOWA 1PIV3 4ITCA 1REDA 2CAVA 2BTVC 2PTMA 4M3CF 2XJSA 4M3CA 1RUF3 1DFQA 2VMHA 4L8QA 1LU2A 2LALA 1VBB1 4K9SA 3OD0A 4QPGC 2HWB3 1VBA1 4IEYA 2AENA 4EV0A 5C8WA 1RUC2 1LOEA 2NLRA 4GMP1 5FLHA 4B8EA 1AX0A 2VOVA 1F5JA 1W0OA 1GFF2 3H3UA 3RSJA 1KS5A 1RUG1 2RR13 3KQRA 5T52A 3ACLA 1DQ6A 4PDWA 1OOPC 2WFF3 3NAPB 1Q5OA 2VNRA 3WV6A 4LBJA 4CEYC 1OD5A 1LECA 5E16A 3WHTA 1Q8PA 1SEFA 1ZZBA 2WINB 4B7EA 1GNHA 2C0ZA 4K1ZA 5GZFA 2GZWA 2D3PA 1GZWB 2DYCA 4QHBA 3N7LA 1WGPA 2HEWF 5EWSA 3SH5A 1R081 5HCFA 4GKYA 3VBHA 1MZ6A 2NM1A 2YC0A 2Y0IA 4IL7A 1ZBA2 4QM9A 3RI8A 3WDXA 2W39A 1BMV1 3JD71 1QJZA 4AFBA 3MF6A 1V6OA 1CQ9A 1OA3A 1BCXA 3VZJA 4AHXA 1UN1A 3BOPA 3TWIA 2QQPA 4LBNA 4Q4Y1 4C0HA 4EWEA 2HWE1 2DTYA 1V6KA 2PHTA 3D8CA 1Z7S3 1ZRRA 3P3PA 1BVVA 5I0TA 3U0ZA 4KBBA 5A3LA 4N43B 1OQDA 5BNQA 1BKZA 4HZFA 1H4HA 1C8M3 3THTA 3ZSJA 1NCQB 1JW6A 3AMMA 2TEPA 2PHRA 1XXNA 4WM7C 4FSJA 4YLZA 4CRQA 4IEWA 4MXVA 4GMP0 5TSWA 4EN6B 1AYM3 3IDEA 3IT8A 1GZWA 4IV3A 1HRI1 3KCYA 4L2NA 1UPSA 4QPIA 3SH4A 5ACA1 2MNGA 2W0XA 2BGCA 3NVCA 2BBVA 1JXNA 1ZNPA 3ZFEB 4QQ2A 3A0NA 5T50A 1AR62 1IOAA 3KMHA 4HPKA 1AYN3 5IK4A 2H0BA 3VKMA 1KS4A 4UW3A 3UK9A 1RHI1 1RUNA 4AQTA 1AR82 5DZFA 3S6PA 1ENXA 2CWSA 2A6YA 1PO22 4Q26A 4YG0A 4CDQC 1TQ5A 1ULCA 4BCUA 4RD7A 1PHMA 3U10A 1LOBA 2XWBB 4SBVA 1PZ9A 4XFGA 1QJY3 1GLHA 1VJ2A 1QH6A 1PNGA 5FMOL 3E5QA 4C0BA 2D93A 1CGPA 5KXBA 2R072 1VBB3 3FHIB 2KA3A 3EJKA 3FUOA 4B4RA 4HVQA 1ASJ2 1LEMA 1VBA3 2ZHNA 3AKQA 2OUJA 4N9IA 1LHVA 1J58A 2VOWA 5CIRA 1NY71 2BNMA 2A71A 4GMP3 1EAH1 4COVA 4QGNA 1UX6A 1XU1A 2JEMA 5EFUA 1O3RA 1LR5A 1RUG3 1G9DA 1FNZA 4Q0UA 3CF6E 4JGYC 2WS92 2WZR1 2JKBA 1RIRA 1RUH3 2FMDA 3VDDC 4I3GA 5T3NA 3ZYJB 4AEDB 1OA2A 3BPZA 1NZCA 1B35B 5AC93 4YG6A 1FATA 4YM2A 1HQWA 3B9CA 2ZAAA 3AYCA 5HCBA 2RM22 3CNAA 5CFDA 3FFZA 4QT6A 1R083 1GR3A 4AVCA 1PIV2 2Q5TA 1SLIA 1RUF2 3HIFA 3LAGA 2ES3A 1DGLA 1WLTA 2VXRA 4QU2A 4X6QB 3M3EA 1G9CA 3NAPC 2OPKA 4XIKA 2RE9A 2E7AA 4XJAA 3WOGA 3K48A 3M3IA 3ZDSA 1CONA 1AX1A 3ZMOA 1J3QA 3JQXA 2HWE3 3LSEA 1UW8A 5D8AB 4OFGA 2RR12 2WFPA 3J4UH 3E6DA 2PA7A 4Y22A 2WFF2 4DY3A 1WCDJ 4WM8A 3SCHA 1RTVA 1AL22 1SCRA 4CDWA 4I01A 3ZXFA 3TN91 5A33A 5CAZA 2E9QA 2XJVA 3V64A 2ZGLA 1OFNA 3PVOA 2GH2A 3GALA 1EP0A 2OA2A 4W6XA 4AEMA 2CGPA 3APBA 3BU7A 3AYEA 5ACA3 1AXYA 2WL1A 1KFXL 2BYVE 4RS5B 1PVXA 1QKQA 1YYNA 2JG9B 1MZFA 3CO2A 4HK9A 4UXAA 1RHI3 4N43C 2VUJA 5FDBA 4IETA 3PJYA 2D3SA 4FPLA 3ZN6B 3KT1A 1Y3TA 4RGAA 1NCQC 4IV1B 3AZXA 3OD4A 4E4DX 1Z7S2 2TNFA 1PGL2 1DZRA 4YGCA 4XBLA 2DUOA 2VULA 4N53B 3DPRA 1BJQA 2GNDA 1CAXB 1SBEA 1C8M2 1SLBA 3RPQA 1GYKA 5J36A 1LU1A 3JQWA 2ZX2A 4NPRA 3ZFEC 3QCWA 4LA3A 2VY0A 3B7MA 5C8CB 4U36A 4AQ2A 1AYM2 2JENA 4K20A 2HWC1 1A8MA 5FO7B 3AZYA 5KBFA 3D4KA 3NJZA 5LEJA 3JU9A 2AUYA 3AP6A 4XPVA 4LO8A 4OI4A 1EAH3 5GZCA 2JG9A 1H30A 3PVEA 4WBBA 2A6VA 1QWRA 1AYN2 2VW2A 1CX4A 1O5UA 2R49A 2MEV1 3AP4A 2PELA 2WZR3 1UZYA 3HT2A 3ES1A 3WQ0A 4IV1A 2QDRA 3BTAA 3GBGA 1JYCA 3NV2A 4YW5A 2ZCWA 5H9PA 1GQHA 4N90A 3BODA 3T1MA 2X8KA 4A7ZA 1N1YA 4N53A 3R4UA 1LCLA 4X8PA 3GZTB 1DDLA 1QJY2 3ZYIB 1FX5A 3GHNA 1QOOA 2EALA 2FZ2A 1C3HA 1NQJA 4HSLA 3QH6A 1RUJ1 5L73A 1VBB2 1G9BA 1J3PA 4YZ3A 1VBA2 1IZ3A 3LOIA 4HKWA 4JAAA 1QOTA 5JR7B 3VKOA 1K5MA 1YLLA 2A3XA 2UY8A 1EPZA 3JBG1 4AEDC 2UYBA 2BWCA 4DRVA 1N1TA 3WP5A 4LHLA 1B35C 4YARA 1KDMA 3VBRB 3S7IA 4D7TA 1RUG2 4GULA 4KU7A 1OI6A 1F2NA 1PK6A 1F31A 4CZSA 2GH8A 4FXGB 2I45A 5HCAA 3M4FA 1I1EA 1AZDA 1YFYA 4BA6A 4COWA 4EN0A 5C4WB 5CFCC 4URTA 3ZIXA 2QFEA 1ENSA 3IPVB 3AMPA 4MZUA 1R082 2JXAA 5D1IA 3M1HA 1APNA 3AK0A 3I4IA 1LESA 1AR71 5LRSA 5D8AC 3T2TA 1BMV2 2WNUB 3JD72 5L19A 3RDIA 2YGMA 4DQAA 3O0XA 3C3VA 3AFKA 4Q4Y2 1QGLA 2HWE2 3ZIWA 5J37A 1AL0G 1WBFA 4YVSA 2K0GA 4YGBA 1D2QA 3MPPG 5JLVA 4S2GA 3KCCA 5JSOA 4NWVA 2V5YA 2XJTA 2JE7A 4UW5A 4Q4V1 4K40A 1EPWA 4RS5C 4W6WA 1ZYBA 1WD3A 5GKAC 4QQOA 1AVBA 2JG9C 4CDUA 5I91A 3IPVA 2E7TA 1HRI2 3VHOA 2OW4A 2Y38A 5ACA2 1R1ZA 3LA3A 5CNAA 1ALYA 2XKPA 1SLLA 1FMD1 4DS0A 5FOJB 3LSDA 2DUQA 4QGMA 3TNQA 1UIJA 1PGW1 5BXXA 2A3WA 3MW3A 1UAIA 3TBDA 3RJRA 4FVVA 4BM8A 2MEV3 1RHI2 1VR3A 4TZDA 4GWNA 1UL9A 1YHFA 2C5DA 4YSFA 4V1PA 4EJRA 3UKVA 1UIKA 5EZWA 2ZBJA 4IXLA 3I54A 5C8CC 2ET7A 1BEV1 4QPGB 4LO7A 4AI8A 1SCSA 5FBZA 4R52A 3ZXLA 5FCCA 1V9U1 3AFGA 5A32B 3R4DB 3URFA 1H4GA 2P34A 2FBEA 3FMGA 3MIBA 4PLMA 2B8MA 5GZDA 2XJUA 3VL8A 4N7UA 3RJ2X 1CPNA 1EY2A 2DCZA 1H2MA 4Y20B 1RINA 4ASMB 1LOFC 4HN0A 1NY72 4GB31 3JBG3 1FPN1 4Q4X1 1EAH2 3PHMA 3VGIA 4R9DA 4WVZA 2O8OA 4BMBA 3OYWB 3NL1A 5EYYA 2DCKA 1BK1A 2WZR2 1LOAA 4KGGA 4BYYA 4P9JA 3KLSA 2XVKA 3LZZA 1WW4A 4QPGA 3ZN5A 4BQ1A 4F3JA 3H1YA 5DG1A 4INDA 2WT2A 4YW2A 3HBZA 1TMF1 4GIQA 3R05A 2TUNA 4FP2A 4QPYA 4XTMA 5GLZA 5KC6A 2OIIA 2W08A 2GC1A 1AR73 3VBRC 4Y20A 2XL9A 1OOPA 4JV4A 4BE3A 3G7DA 1IS6A 5DG2A 2GNTA 4CEYA 4ISRA 3AKSA 4Z92B 2FZ1A 4FQZA 3CEWA 4NVPA 5IUQA 4AXOA 5C4WC 2QUOA 1F9KA 1V6LA 5GZEA 3ZXDA 2ATFA 1G6NA 1J1LA 1OSGA 1DF0A 5BNPB 4COZA 1R091 1SLAA 3PMEA 3KCXA 2R16A 3FLRA 4E2GA 4Q4V3 3TN92 4LEJA 3LB9A 4FCAA 5JDBA 4L99A 3MIGA 1DBNA 2Q1MA 1H2NA 4P14A 2AGSA 2GC2A 2WNUC 3J26N 4YW3A 5FLJA 1DHKB 1GV9A 1BBT1 4OHWA 1FMD3 4TLFA 1GICA 2GMPA 2XWJB 4N7IA 1UU5A 4LBOA 3H7YA 4WVWA 1WBLA 5AVPA 2D6PA 1YNAA 2GMEA 1ASJ3 2UYAA 4MGIE 4XQDA 3AJZA 4FAHA 5KHIA 2VG9A 1I3HA 1U5YA 2IXCA 2XL7A 2Q30A 5SV5A 1SDWA 2RJLA 4BOWA 4WM7A 4HVRA 4TYSA 4QXKA 3ZN4A 1HV1A 1NYWA 4Q0VA 1NLRA 4DRRA 4K3UA 4EWDA 1BEV3 5GLUA 5BNPA 3VZNA 3UJOA 2PLV1 4PJYA 2D6NA 1V9U3 4JTOA 2LM3A 2XJRA 1HXS1 4YNIA 2WWSA 2PN5A 4E4SA 4FPKA 4WZFA 2XUMA 3GYDA 5GLVA 5FQ0B 2DU1A 1QY4A 2RS31 4XJUA 4JGYB 4S2DA 2DVFA 4XFAA 2EXKA 1Y9QA 3HMYA 1JBCA 4W65A 3RQ0A 1W6QB 4GB33 2XB6C 1MS8A 4PIXA 2GC0A 1COV1 3MI8A 4IERA 1LULA 5IK8A 1HRV1 2MEV2 2V73A 2JECA 3QH7A 4ES8A 3AKPA 1Q8QA 1XNBA 4XXAA 4OLLA 3ATGA 2PHUA 1NE6A 2HWD1 1H8TB 5AFEA 3JB4C 5FLIA 3ILRA 1S0DA 2UWBA 4HKOA 4Y5Z0 2XVGA 3EXUA 4XXPA 1H8VA 2I07B 4JDMA 1TMF3 3WDWA 4H3WA 1DU3D 3NV1A 1AL23 4HK8A 2GAUA 3PVBB 1RUJ2 4XF9A 5H9QA 3LGRA 3ILNA 4BH9A 4JGYA 1IS5A 5F1RA 3NKTA 4WZCA 1Y43B 5T5OA 3VDDA 3VLBB 1FNYA 3PNAA 3JBG2 4D3WA 3NKGA 2A5ZA 3Q9OA 1PZ7A 1MQTB 3AB0A 3H9AA 2GDFA 2DVAA 1R093 5KXCA 4FTSA 1A78A 1DG6A 4XFHA 5JZGC 3V56A 2WSUA 2VOKA 3FZ3A 4XF0A 1VALA 3S7EA 4MUVA 4LE3A 4YZ4A 1S0CA 3NAPA 5T54A 3MW4A 4XEZA 3WQ7A 4HBNA 1BBT3 3W9AA 3GNEA 3WZ1A 1QJX1 4WVMB 3AXDA 3O14A 2D40A 4GALA 1NE4A 1AR72 3JUUA 1PO11 1BXHA 1X7NA 3WUCA 2HKXA 2ZGMA 4XYXA 4OUSA 5BNOB 4D69A 1S1AA 3BIWE 2E51A 2YUEA 1CAUB 2QDNA 1EV11 2DUPA 3MIHA 3OBRA 5BNPC 4PQ9A 2VU9A 2QE3A 3E6CC 4XTPA 1MACA 4P5HA 4A7YA 4AK3A 4NOTA