4CCCA

Structure of mouse galactocerebrosidase with 4nbdg: enzyme-substrate complex
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
644
structure length
640
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Snapshots Illustrate the Catalytic Cycle of Beta-Galactocerebrosidase, the Defective Enzyme in Krabbe Disease
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords GALACTOCEREBROSIDASE
total genus 218
structure length 640
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4cccA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4cccA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4cccA01
1JI1A 3F1QA 1QHPA 3TC6A 5AHFA 3UQNA 2Z1SA 4MY1A 3K8LA 1XSJA 4WK9A 5F2GA 1XKYA 2W91A 3W7QA 2BNJA 2E4TA 2YOCA 3HO8A 2A4AA 4JQTA 3VIPA 1H1YA 1LLWA 1GORA 2VCCA 4LWWA 4Z2JA 2QCCA 4HOXA 4UFJA 2P0OA 4LRTA 3NDOA 1LWHA 4MJ2A 2YXGA 5HWMA 1XH0A 3W24A 4L4LA 3WL1A 3U6WA 3T44A 1I75A 3SCNA 3PTMA 3AMDA 2EHHA 4AZ7A 1WV2A 4PFMA 1J01A 1W1PA 3F5JA 3M46A 5D2YA 4PUDA 1B30A 2R91A 1UKPA 5E9AA 1LRNA 2D22A 3P67A 4O4WA 3W23A 1HL9A 3POHA 4PMXA 2DU2A 1ZAIA 1O5XA 3KE0A 4PYSA 4DWSC 4K6AA 1ZAHA 5EYWA 3WD3A 3CT7A 1TUXA 3LMYA 5BXPA 3EKZA 1W3JA 2G3JA 4CNNA 2XFRA 4FLOA 3UG4A 3WFLA 2CZFA 3FA5A 3HQ1A 3O8AA 4MOZA 4WUIA 4EWND 1HP5A 3BAIA 4RE4A 3MO7A 2UY5A 5BOOA 2YA1A 3I6RA 5K7JA 1DHPA 2YCEA 1ZY9A 1PV8A 3F5LA 1G69A 4W8LA 1E3XA 4IPNB 3IIPA 1CXKA 3KZSA 3NYZA 6ALDA 5EA9A 1BYAA 3IIXA 3FAXA 2WMGA 3HF3A 3N3MA 3WK1A 3CTTA 3HG2A 4NX0A 1YXDA 2AEYA 2CKSA 4ATWA 2D0FA 4WKHA 3PB2A 4N42A 3VNZA 5G4EA 3UWQA 1M04A 2ZUTA 5D2WA 1MVYA 2YL8A 2J9ZA 5I3DA 1WXJA 5F2MA 3KVLA 2JKEA 1NWTA 3PZQA 4UMAA 3E49A 4M6VA 3L4VA 4M82A 4UNKA 4J3WA 1GPWA 4Q4KA 1UA3A 4CQ8A 3GDRA 4LQ1A 1R85A 1TE1A 2DIJA 1K3UA 4FLQA 2X1RA 3PB0A 1XSKA 2DT0A 2OYKA 2GJRA 3A9IA 2FH8A 3KEHA 2NLIA 3MMWA 1UD6A 2WMHA 3MMUA 4QDMA 2Y7GA 3IJ9A 3SCVA 4CKQA 3W2KA 4N4PA 4OJYA 4H8HA 2WOQA 1TPWA 3T09A 4QCEA 4AD3A 4O57A 3FKRA 4AAJA 3S0CA 3S1VA 2CLLA 4U31A 5D9PA 4C7FA 4E0CA 2ZFAA 3IV3A 1XD1A 3UGFA 1HFBA 1K8XA 1WOAA 3W86A 3AHZA 3TP4A 2EGZA 3DFOA 5D2TA 3V75A 4DELA 4GO8A 3NPXA 3MI6A 5FCZA 1BVZA 4W9TA 1G01A 1DOSA 4EOUA 3PHAA 2TRSA 4N4QA 3GNRA 1VR6A 4Y96A 4JR5A 3TONA 3S2CA 1QPOA 2G41A 2JGYA 1VFUA 1WBJA 4AIOA 1OF6A 3E1F1 1E1FA 4CCDA 3TC7A 4UQAA 3FOKA 4GC4A 1UQYA 3AHYA 5A8QA 4ZQOA 3CIWA 2WMIB 4OOZA 2V2DA 4OZOA 1HUVA 5GNXA 4RL3A 1PJ9A 1I1XA 2E9BA 3GAYA 5D37A 3SUSA 1SW7A 3HGJA 4UZSA 1B9ZA 1G94A 4TMCA 3WJSA 1W1YA 3N17A 1TVNA 4KRUA 4IPLA 1WAUA 3LCGA 5CPNA 1FX6A 2VQTA 3NQ2A 5FIPA 2Q8LA 3CZEA 1MXSA 1WO2A 3EWYA 1BLIA 3ZJ7A 4A3YA 4U5IA 1OGSA 2MANA 3PSVA 2YL6A 2D20A 4EAMA 4N9BA 1IT0A 1FY6A 3QHMA 3U7VA 1E0VA 3NMBA 3H53A 4A22A 4PEEA 3LGEA 3WK2A 1LROA 4OHQA 2ZTJA 2GUYA 3QJAA 5CGQA 3BLFA 1WB0A 4OBSA 3W88A 3SCOA 3ABOA 3MI3A 5E93A 1EO5A 2VR4A 5AC5A 3SIZA 3MYOA 4ACZA 1UWRA 1TPFA 3MW7A 2DT1A 4TTUA 2R8WA 4HKPA 1KM5A 3GNOA 4KWUA 2QAFA 3LDVA 3W38A 1OFPA 4GZJA 1ICQA 2F84A 1XI3A 4M8UA 1PHWA 1U2YA 1D3HA 1A5AA 2V5BA 1X1ZA 1D7FA 3K46A 2WLZA 1KFWA 4NNBA 4ADSA 1SZGA 2DJXA 4X9SA 1W31A 3IVUA 4UTTA 1FOBA 1MW3A 5D9MA 3VFLA 2BXVA 2C7FA 2GJPA 2X1IA 5K3VA 1UOKA 3AHXA 1W37A 3BLEA 1ISXA 1GUVA 1ZBWA 2OXBA 1B3XA 1OD8A 2GJLA 4PH6A 2UV8G 4AWTA 8TIMA 4S1FA 1GHSA 1TJPA 4X2RA 2J4GA 1GWJA 2A85A 2PC8A 3W81A 2Y2WA 1Z32X 4EF8A 3FW6A 3UCQA 4W5UA 3AIEA 3NQ6A 3LERA 1E6QM 3LBMA 1ECEA 2WVTA 1KLZA 1QPKA 4AEOA 5AB3A 1Q6FA 3O6YX 4DPQA 2C19A 1E6XM 3N04A 1GQNA 1SZNA 4JTLA 4R33A 2WSKA 1GONA 3WNKA 2VC6A 5A8GA 4C1LA 2ZTKA 3K30A 3SCQA 3DHDA 1W91A 1TG7A 1E3ZA 4ZMGA 1TPB1 4NUWA 2X09A 1RQEA 4PODA 3DHFA 3NZRA 1Q45A 3HMCA 3HG3A 2OT0A 4Y90A 2B0MA 1WE5A 2J27A 2QMJA 1E6RA 3IIOA 3CTLA 1RPKA 3NA8A 3PTKA 3MP5A 3N2XA 1SMDA 4O1BA 1FCUA 1NAL1 3GB6A 4XBSA 1XBXA 2QJGA 1RD6A 3ARPA 1GOOA 3GM8A 3ZO9A 1LP6A 2DSUA 3KAOA 3LRMA 2OLHA 2AC1A 5IBXC 3GYCA 1VC4A 1AMYA 3CQ0A 4PMRA 3QH2A 4AF0B 3ZOAA 1ICSA 1Q3NA 3WJWA 1ISWA 4J28A 3UWWA 1E6SM 3LIGA 3OGSA 3VNYA 2O7QA 3TMLA 4ORIA 4NJKA 1CGVA 2VEPA 4PMVA 5E70A 3PG8A 4D6DA 1HXJA 4UTWA 1RV8A 3VE7A 3P82A 3ZT6A 2A0NA 1EQCA 6A3HA 3M6DA 2A7PA 4OGZA 5HXMA 1MYRA 3LV5A 2HS6A 4LW7A 3QPYA 4K8EA 5H91A 4S3JA 1KTBA 1OFAA 3ABRA 4BR1A 2VZOA 4W86A 1TQJA 2ZRUA 3KVMA 4UCFA 2WZIA 2DEPA 1ZAJA 1GVIA 1K9DA 3DFSA 2D1ZA 2YIHA 1TIMA 4BI5A 1TA3B 2TYSA 1OFQA 4LNYA 1SU5A 3THQA 3TV8A 1XXXA 3RLVA 1V3IA 3M0ZA 2D24A 5J5DA 4GI8A 4UOZA 2XN1A 4O18A 3KOFA 1B0IA 1GVQA 4CCCA 1E15A 5I78A 3RMEA 3NL5A 2XGBA 1I2NA 4PTVA 2XFWA 4M80A 2WHLA 1JDAA 1HJXA 3CO4A 2CZEA 3GTNA 2CWNA 2XHYA 2V3FA 3BMWA 3CHVA 3EWWA 4LUJA 1J11A 3CHCA 4AD5A 5LYRA 2PRHA 4IJBA 4MPQA 2DT2A 5G5IA 1XCXA 3TCEA 1EEPA 4Y6GA 2ADEA 3S6TA 3MSDA 3A5FA 4GIAA 4XWUA 1AK5A 4M19A 3CLMA 3A5VA 4BF7A 4EE9A 3W1NA 1V6WA 5A5WA 1VAHA 3IJ7A 3M43A 1HJSA 1A47A 2CBUA 1EA9C 1I2QA 2Y62A 2XYLA 4PC8A 1CECA 2CEQA 3VILA 4I7UA 3VD9A 5HINA 5HPCA 1HNYA 4M81A 4KFPA 2W0UA 2TAAA 3NQFA 5A8OA 2WKJA 3GAKA 1SFJA 4FO4A 1VLWA 3AICA 4AD4A 4RK8A 5CXPA 4F66A 1GQLA 1C29A 3NOEA 1QOXA 1KBJA 1LM1A 2V3GA 1AL7A 3DFNA 4EK7A 1UWUA 4GUHA 1RD5A 5EKYA 1A5BA 1WZKA 1A5CA 3FJLA 1C7SA 1EIBA 1KQYA 1JD7A 2DDXA 4JNMA 3AZRA 1VFMA 2UWFA 3BCFA 3M47A 4ZE4A 2WANA 5A8NA 4RCXA 2YDQA 8CGTA 4YCPA 4TVUA 3TSDA 4B3LA 1AMKA 1VIWA 1JAEA 3ZQ9A 1R46A 4QITA 4FNSA 2O9OA 2WPGA 2OJPA 4AD2A 8A3HA 1P5BA 1V08A 3W7EA 1KFJA 3TA6A 2QF8A 3VIOA 1E0XA 4WY0F 5ABFB 1SSDA 3P84A 2B31A 1H09A 4PCFA 4FEZA 1YYAA 2FFCA 1JCLA 1QPQA 3C2RA 3CB8A 1XCFA 5AC6A 3ARUA 4GKLA 4F79A 4WF7A 3EX4A 3B05A 3JS3A 4ALDA 1Z42A 4ICNA 5LA0A 3A3HA 3P74A 4D6CA 2CETA 1HG3A 2WNNA 5C5YA 3VE9A 1W9XA 3S1UA 4NZFA 2XPKA 1NOWA 2ZRWA 2Y88A 3W6YA 4JL1A 1J4EA 2CZDA 1G0CA 2OSYA 1TMHA 3NM1A 1G4SA 4O54A 3GXDA 1V0LA 4MDPA 5E6YA 3C2FA 1QCWA 2W62A 4UR7A 3RFAA 1X6UA 3K8MA 3LCWA 2WMKA 1F74A 5BRBA 2C13A 3W1AA 4FIRA 3CHFA 1KV5A 2DZWA 3NSXA 3BLPX 1ME7A 1VJIA 3N12A 1Y7VA 4FLRA 2J75A 4QLLA 1PEZA 3UR8A 2ADDA 4JTFA 3TUUA 4P8XA 4LS1A 1NP0A 1VJZA 2ZIDA 1ODZA 7CGTA 1PX3A 1MXDA 3SUUA 3T2QA 3VD4A 3ABSA 4PMZA 3GDBA 1UR1A 3M6YA 1NF0A 4IMGA 2W66A 3E12A 3NSMA 4P7NA 3LPPA 2QUTA 1HKMA 3AYSA 3STCA 4JDBA 3WQVA 3SZ8A 3FKKA 3MUY1 3VM7A 4UXDA 4AMCA 1CXLA 1TPC1 3O06A 4GZEA 3W7HA 2XWDA 3WH9A 1LL7A 1CXFA 2PE4A 3VI2A 3K4DA 3LFIA 1YTKA 5HBFA 1WQ5A 5G1TA 1T0OA 4JS3A 1C3FA 2J88A 3M9YA 3MV01 4MNKA 2PWHA 3E0IA 3CUIA 2CZ5A 3WDHA 2ATMA 3KL0A 4CD7A 4LVFA 1V3MA 2VX4A 3LHZA 1JNDA 5CGTA 3WQWA 5I3JA 2EPLX 5U4NA 4FXSA 4K68A 4CU8A 3VX0A 1Y0EA 1JZ8A 1FH8A 1CGTA 3WBEA 1R30A 4XZWA 3SCUA 5A6BA 1RH9A 3O16A 4PN2A 3BSHA 3S5YA 2E40A 4X9YA 1ZS2A 2ZUSA 1W56A 3CWOX 3CEPA 3PZUA 5FK8A 1IIGA 3S5NA 4QAIA 1UWIA 5HNRA 2X0HA 1UZ1A 3GZ3A 1IV8A 1A5SA 1E6ZA 1NQ6A 3VIJA 2Y5EA 1IZKA 1QO2A 3C0JA 5JBDA 1V3JA 4NRRA 2A6LA 2Y70A 1HJQA 4NNCA 3GDKA 5D9OA 3GDTA 2YYTA 5JIWA 2XVLA 5HWNA 4HMEA 2F61A 1YPFA 2FLIA 2BY2A 4O11A 1N7KA 2QDHA 1KFEA 2V2CA 2NWSA 1SR9A 4NJHA 1E40A 2DZTA 3K1DA 5F7UA 4M6PA 3FIGA 4AIUA 1DORA 3U57A 2XQRA 2GVYA 3SR7A 1E6NA 2C0HA 1V6XA 2RGMA 2ZZ3A 3NPVA 2ZUWA 4XUYA 3W4RA 2ATSA 3STFA 1QVBA 4IXXA 1UD5A 2E8ZA 3I7SA 3P8JA 1UH4A 1WAWA 3O2LA 4MLJA 1FCQA 1SZFA 1W9PA 2ZXQA 3UGGA 2HTMA 3LRLA 3WMBA 4WX2A 2J6XA 1K8ZA 2JF7A 3EWZA 2BX7A 3EYPA 4MFDA 3AHTA 3PZMA 3R2GA 5LA1A 2VX5A 2FB2A 2H3DA 5FMDA 1MO0A 4LUIA 5AC7A 4D6HA 3F03K 2YZRA 1LL6A 2C15A 2RFGA 1KXQA 1BYBA 1NOUA 1NWSA 1BYCA 3W22A 2CKRA 2D3NA 2DZUA 2EPNA 5TIMA 2WC3A 1VHNA 3GDMA 1SMAA 2OYMA 3EDKA 3N2MA 5A94A 1E0WA 4Q7NA 2I14A 5FK7A 1HVXA 4PMQA 1UR8A 3C8FA 4V2XA 3VGFA 1E73M 3BAXA 3AJ7A 2F7FA 2WWCA 3AISA 1XBZA 4RLIA 4E8DA 5HULA 2DJLA 5CZTA 1EHAA 4U2ZA 4CN1A 1FWWA 1GW1A 4UOQA 1BTCA 2BTMA 4L4PA 5BMWA 2GQ8A 5D03A 3Q37A 4UQDA 2FHCA 3B9DA 3W1UA 4JTEA 5CQ1A 1EUAA 1GTEA 1WCGA 1KGWA 3W0KA 1W54A 3MP3A 1KXVA 1JR1A 3G24A 1D3GA 1MWOA 2W92A 3TTOA 3C56A 3QPZA 4AYSA 1SSGA 4LC8A 2BV9A 5FL0A 2ZUUA 1W5NA 2QR6A 5LNRA 1AVAA 1JQXA 2ZQ0A 1BAGA 3PS7A 4ZQNA 5U7SA 4QCFA 3B04A 4JTJA 4UQCA 5LKYA 4CU7A 1SO5A 1PZ3A 1CXEA 1UH2A 3VUPA 4AW7A 2ISVA 3JR2A 3EXSA 2Z0IA 1V3HA 4AISA 3B8DA 4JICA 4TTGA 1ZJAA 3BGJA 4MY9A 4JY8A 3ZM8A 3AIVA 5FESA 4IM4A 3W37A 1GOMA 2CERA 1M7OA 2WMIA 2JKPA 1F5ZA 1RP8A 3CIXA 1GG0A 5ABEA 4P8UA 4BQ3A 3WDRA 2DSWA 3AMKA 4U3AA 3EKLA 2ZZ7A 1V02E 2YA2A 3LIHA 2E6DA 5LNVA 3T55A 4R27A 5I77A 7TIMA 1QW8A 3CHEA 3O6CA 4O1AA 1GNXA 5AYXA 5F4WA 2NZLA 4RV8A 5K9DA 4HTYA 3LBCA 1PBGA 2V9DA 3FYPA 1WDQA 1S46A 1DVJA 5ABGA 4GQQA 2EPMX 5CZKA 1L6YA 5FEPA 3OLDA 3KRSA 5C8BB 1NF7A 3LXCA 3TAOA 4E2OA 1NWRA 1N55A 4XZBA 4JIQA 4UTLA 5FF4A 5AYZA 1OJXA 4RZ4A 1D2KA 2CBIA 3EEGA 3QMTA 3ZR5A 5HDRA 4MJZA 1CWYA 5AFDA 1YXCA 3NR0A 2C14A 4MLRA 2Q3RA 4WOZA 2CCRA 3QHOA 1CTNA 3BPWA 3VU2A 2C16A 3IAPA 4AD1A 1THFD 3DKJA 2Y24A 1AL8A 4EF9A 3L4XA 1GT8A 1TVPA 4K7VA 3MMDA 3H55A 4J3VA 3L65A 5JUVA 4B1LA 2EBNA 1K8YA 3FXYA 2X1UA 4I7VA 1I2OA 4JFUA 4ZQRA 2G5WA 5AN7A 1CNVA 4CQAA 4D6GA 3KF3A 1X7FA 3AZSA 4EANA 1O6IA 4M56A 1PAMA 1VB9A 4IMDA 3EDDA 5EB8A 1TV5A 5L6UA 1OCQA 1XHGA 3GK0A 2YGYA 4ZVJA 3CHDA 1V0KA 2NUXA 1ISVA 5GPRA 3DECA 4GE8A 3ZS4A 2BVDA 1WDSA 1TTQA 3W84A 4URIA 2YBUA 1VHCA 3Q58A 3DFPA 3PTQA 4F9JA 5D8ZA 4CVUA 4ZQCA 1BGGA 2FHBA 5DLCA 3OA3A 2QUUA 2WBGA 1LG2A 1UG6A 3OB8A 4AEEA 1TPVA 1TTJA 1JG9A 1JUKA 4H2CA 3NNTA 4FK9A 2CHOA 4W8AA 3QSTA 5J5RA 1B3VA 2E77A 2TSYA 3FHAA 2GOUA 4LV4A 3CUHA 4JFSA 4JHOA 2WHMA 4A4AA 3KF5A 3BO9A 4OT7A 3W2NA 5I3GA 4LGXA 3E9AA 2V5DA 2VO5A 2VFFA 4O28A 1OFEA 3PZTA 6TAAA 1CDGA 4JTTA 1JJKA 4QAWA 4POCA 1NOFA 1XH2A 1E1EA 2RDUA 4IISA 2J8FA 1JYVA 4OQVA 3NQ8A 4UTHA 1KLYA 3I3EA 3J7HA 3QM3A 5D32A 3UYCA 1OINA 3AMGA 1LBMA 1Z48A 4WKFA 1GQJA 3HGSA 4Y8FA 5FF0A 4MADA 4U5KA 3GLCA 1TV8A 5KZ6A 1JVNA 3NPUA 2NT1A 4BI7A 1JXKA 4QHZA 1EWDA 4LYQA 2WVSA 4KKXA 5HJLA 3W6MA 3L4UA 2RGLA 3ATZA 2W63A 1ISZA 3ARXA 3EXRA 1XYZA 3L68A 2WVVB 5CPLA 3LHVA 2XUCA 4YMZA 2WLYA 3WSUA 3T0BA 1JZ6A 4MB5A 3MUXA 4WZHA 1JYXA 4XTIA 3PBUA 3A4XA 1FDZA 4P2VA 4PTMA 1F05A 3RM8A 2XVPA 3G1DA 4AMAA 2J7FA 4BS0A 2H8ZA 2GVLA 3WJZA 5D2VA 4A29A 1US2A 3T0DA 4W7UA 3GNDA 4CGTA 1EPXA 3WD2A 2NXHA 4XBKA 4UCGA 1QR7A 3A47A 3YPIA 2Y61A 4MJMA 4XUGA 2JIEA 2VENA 4ZXOA 2J47A 5HR6A 1H60A 3QOKA 2GJXB 3ZJKA 1EWEA 1XDMA 4MVAA 1W5OA 3TXVA 3BAWA 1X1OA 5KZEA 2BVTA 2A3EA 1YXYA 5LGZA 2E68A 5AYYA 5BXTA 3W2LA 2P10A 1Q6OA 3CZLA 4F9DA 4NNAA 3BMVA 2NXIA 1C92A 3RM4A 3TROA 1WDRA 4XKYA 2QCMA 3QFEA 4ONVA 2PWDA 3GXNA 2VCAA 2CXGA 2FPYA 1YHTA 2OWWA 1DV7A 1NSJA 1RZMA 3UPBA 2CHNA 5HUOA 2JALA 1SO4A 3NQVA 3VMPA 1C9DA 4BWLC 1QNRA 4AHOA 2WW5A 1GVYA 3AS3A 1QOQA 1QPRA 1JULA 3LM7A 3B0PA 2WKGA 3EDJA 3VD5A 3WDPP 3N14A 2VZUA 4QLKA 3NL2A 1P6WA 3RM9A 1PZ2A 4F8XA 1NEYA 3W9ZA 1GOWA 3ZR4A 3DBPA 3AIQA 3TFXA 3W7GA 4IUGA 4CNOA 3SY5A 3GYEA 4HIBA 3VKKA 1QFEA 3TQ0A 3ZMRA 1OYBA 2Y7EA 3G0SA 1N82A 4P7OA 3FLUA 4FNQA 3LI0A 5DELA 4TMBA 2E3ZA 1QNSA 1KB3A 3QQ0A 1NH6A 1OT2A 3UY7A 4UTTC 3THAA 3BLIA 3OG3A 3W1RA 5LGXA 2WYSA 2PWEA 2X05A 1S5WA 4CLMA 4W7WA 1EIXA 1MFUA 2EPKX 4WOQA 1UA7A 3OA5A 3AJXA 4WJXA 4YN5A 1Q6LA 2YYUA 2XVGA 3G1HA 3PBVA 3WUEA 4CUCA 3OGRA 3L67A 3WUFA 1UWQA 4E38A 4CVWA 1KV8A 4TVCA 1OABA 1W0MA 4GNJA 3TH6A 4O19A 5SWUA 4AZBA 3RF9A 2JIWA 4BFAA 1B31A 3NDZA 2C3ZA 1J0HA 3M41A 3STGA 1H3GA 2BY3A 1UUMA 3MANA 2WO5A 3W7PA 2CPUA 5EMUA 3F4VA 4Q22A 5C70A 5CGMA 1W9UA 2WNZA 5DY2A 3W70A 3WH7A 3M5YA 1LOLA 4UTIA 4W89A 2EAWA 1O7AA 4U4MA 3QW4B 1TQXA 1DP0A 4HNNA 2V5CA 5G4WA 4EIVA 3TR2A 2D2OA 3ECQA 4O13A 3L5MA 4NRSA 5BXSA 4D6FA 1BGAA 3LCIA 1VBUA 1H50A 1XDLA 3L0NA 1JCJA 4AEFA 3ANYA 3T4CA 4B16A 3W85A 3OZPA 1KA9F 3CIVA 4O8RA 1EGZA 3PZNA 3RJYA 2ZZ6A 3WNNA 4GUIA 1J0IA 1HTIA 3W73A 3SFKA 3AXHA 2NXGA 1W5PA 3NSNA 3RO8A 3NL6A 3VIKA 4B1MA 5JBEA 1OIMA 4PTNA 2FDMA 1QI2A 2VL4A 1OX4A 1PIFA 3VMOA 4UFHA 2H90A 3NQCA 4GBUA 5I3HA 1UD2A 3M07A 5F4SA 2TMDA 3S6DA 4AH7A 3WUGA 3MSGA 3FHQA 3VIFA 1QWGA 3BH4A 2QUVA 1XBVA 4UOJA 1H0IA 3WD1A 2B7NA 2WSRA 1DBTA 2CLMA 6TIMA 5EFFA 4H41A 5BRQA 3WNMA 3BGAA 4OIFA 3LHUA 1CZ1A 3AS1A 1E5JA 2J7EA 3PBWA 1HO1A 1JI2A 3TKFA 1VS1A 1YADA 2JGQA 1EOMA 4UFIA 1UJPA 1U33A 2WMJA 4OBRA 2WCAA 2LLEA 1XV8A 3II1A 2HSAA 4GUFA 1GVSA 4HPJA 5CPMA 2ZWZA 4A3UA 2V30A 1QI4A 2A3HA 4P8WA 1R7AA 4K38A 1ODUA 3PZOA 4LOCA 1LZOA 4JEQA 1J0JA 3AIWA 5FI8A 3GH4A 2A3BA 5A6AA 1UCWA 1WOBA 1VYRA 2ZDRA 2XSAA 3ARTA 3PBGA 3HB9A 1TB3A 1J2WA 3CC1A 3N15A 3WY1A 2AAAA 4MB3A 2CW6A 3PR2A 5IM51 3T7VA 3OGVA 4P7LA 3AMCA 1TTPA 1ZFJA 4N9EA 5IXEA 1CENA 2YFOA 1OB0A 1K7FA 3C3NA 5I23A 3ELFA 1B2YA 5BXRA 3PIJA 1XCWA 2ZX8A 2QV4A 2IQTA 4TX8A 4FMVA 1KBBA 2VQUA 2YBTA 1OGBA 1V3LA 3ZWTA 3WELA 5BRPA 1KGXA 3MS8A 5I3FA 1E5NA 1EUNA 3VM5A 5HWJA 4J27A 4MB1A 1L2UA 4HZ6A 4PL1A 4CD4A 3M5ZA 2XSBA 3VD7A 3GXPA 2B4GA 3C61A 2XM1A 2RHGA 5FF2A 4DUWA 3W87A 5DEZA 3G1XA 4CNPA 5F2LA 2NT0A 4AZZA 1BKSA 2QPUA 1GOIA 4HHPA 4O12A 1W1ZA 2GVGA 4QP0A 2A3AA 1OHLA 1ZNNA 2A7NA 2BLEA 1B4KA 2E5BA 4OE7A 3ZWSA 1L8NA 1F6KA 3UWYA 1WKYA 3SECA 3TAKA 1UYPA 1X6NA 3W28A 3OHIA 1VYPX 3UXDA 4I7WA 1K9EA 4QIUA 3WQ5A 1O95A 2ZRZA 4RZ5A 3WK0A 4W93A 4X0NA 1OFDA 2ISSA 5TQLA 2G4FA 5CG0A 1JCMP 1H1NA 1QNOA 1OK4A 1F4HA 1PPIA 4AHPA 4JL2A 4LS2A 4ZL1A 5DO8A 1OF8A 4WXZA 3MMTA 5CZ0A 4B15A 2VR5A 1DHKA 1VRXA 4O0KA 3WD0A 5CSRA 5AYIA 2VOMA 1GQKA 3ARSA 2J62A 4WSJA 4DM1A 3AFBA 2GPTA 2BY0A 1XGZA 2O9TA 4BCEA 3LDKA 3LCLA 4PUEA 1VQTA 1TCMA 5DMYA 1DL3A 2YLAA 2QJHA 1RVGA 2VKZG 4B5NA 3EWBX 5A3HA 4LVDA 1V6UA 1QPNA 3VVGA 3S5OA 2Y7DA 3U75A 3IGUA 5C6MA 1JF5A 1OFBA 1QHOA 4S2BA 3OG2A 2W6RA 4ZQPA 4Z2GA 4UZUA 3B0VC 3LEMA 2VELA 4LU0A 5GNYA 3DI1A 1BWLA 4Q33A 4FHAA 4O16A 1QHZA 3SGUA 1V0MA 3PAJA 2ZUMA 3CZ8A 1CBGA 1HT6A 3R13A 3OLEA 1M7PA 5K4ZA 2E6YA 1Q6QA 1V7YA 1ZJIA 3MI2A 1OBAA 3L4WA 1AQHA 3IAQA 4P7RA 7A3HA 4WY0A 4M24A 2OX1A 3TQKA 2DT3A 3N18A 3NGJA 2BXZA 4MPKA 4NSBA 3G8EA 3WF2A 4V27A 3CH9A 1TMQA 1CXHA 2BWGA 3BW3A 5EPDA 3TIMA 2DQXA 4JFWA 4O50A 2ZOXA 3SUVA 3WUBA 4JAWA 1SUXA 4XB3A 1BQCA 1MQRA 3G6MA 4GUGA 1W2VA 4AVFA 3PWAA 5KZMA 4U28A 1K9FA 4AZ6A 5CPSA 1SO6A 5IFPA 4IMCA 1FH7A 5BW6A 3THDA 2C18A 1TO3A 1US3A 2J7BA 3VIIA 3W7RA 3PC0A 3FN9A 4BK9A 3PZGA 5DT5A 1C8VA 3WF1A 1TCDA 1Z44A 1NM9A 2X8RA 5E0KA 3S5ZA 1U30A 1TFVA 4HU8A 4OUEA 3VDCA 3BAYA 5CSUA 1XBYA 1XRVA 3E02A 3K8KA 3AI0A 3CBWA 2O7SA 4PTXA 5I2UA 1UQZA 5MHBA 1JCXA 4IOTA 1T8XA 2QCGA 3NQDA 1HN1A 3GR8A 1MFVA 4A3HA 3MWAA 1H7RA 4HU0A 2VFGA 3ARQA 3AXXA 1T96A 1GTHA 2QQUA 3SW6A 3DYOA 2J9YA 4GWEA 1CXIA 1GHRA 4W85A 3U5UA 4PEKA 3TSMA 1IZJA 2YDSA 4U3CA 1P0NA 2C6QA 3NEVA 2NUWA 4YCOA 2Y63A 1O60A 3QR3A 4N0RA 2D0GA 4W84A 3DYMA 5I5RA 2O92A 3G1VA 1CLXA 2A3CA 3VGHA 2XWEA 4UFKA 1M03A 2OT1A 3G1YA 3UY8A 1TZ7A 1LTDA 1W32A 1KTCA 1WDPA 1GEQA 2BHYA 3WMSA 2JE8A 4O0ZA 3GIYA 2WC7A 4KMQA 1GJWA 4JX4A 1GVFA 1L6WA 5F2IA 1F2JA 1UR0A 2J7HA 4AHQA 5TD4A 3SCRA 1E72M 1Y4WA 2BY1A 1S3HA 2XGIA 4QFUA 3G18A 1H41A 4AZ5A 1F76A 3IANA 1DJQA 3AS0A 3EX2A 2VFIA 3KX6A 3OLGA 4O14A 5LHFA 4UFLA 1J18A 2WC4A 1H63A 2G3NA 4IMEA 4BWLA 1LDCA 4GFSA 1QAPA 1UB3A 3TNOA 4AIEA 3KXQA 4YHGA 2UY2A 3BARA 5KTLA 1L9WA 3WBAA 1RP9A 3QZEA 4A2SA 1ZBCA 1J0YA 1MEHA 3Q94A 1F6PA 3VGDA 1BVNP 4MAVA 2QCFA 1ZENA 4DPPA 1N8FA 3VNDA 1KGUA 2UY4A 1Q6RA 1KW1A 2W5FA 1G6CA 4PMOA 3ZSTA 3VD3A 1FDYA 5FKCA 3W82A 1TPEA 4HNUA 3O1NA 2GJNA 4DO4A 2FGZA 4ZQMA 3UWUA 3MU7A 4OBTA 1LG1A 2QCEA 2V38A 3HN3A 1WX0A 3RWKX 3B8SA 3L21A 3KWXA 3R8RA 2VURA 4QQ3A 3W1LA 4ACYA 5FMBA 2X1TA 4N6FA 1V3KA 4UQEA 4OKDA 1KFKA 1IXPA 3L2IA 4L4MA 5DXYA 3TTQA 2XN2A 1V6YA 4ZENA 3TTSA 4EKJA 2JF6A 3IVTA 1H7XA 4E2DA 1R2TA 5A6KA 1QBAA 2H6RA 2ISWA 4W87A 4X3ZA 2EPOA 1YPIA 2R14A 3BG5A 4MFEA 5IBXA 4AZGA 2G3IA 3RU6A 1HJUA 3ALFA 2NWRA 3V1PA 1JGIA 1AQMA 3WNPA 6CGTA 3W74A 2V0TA 1FWRA 2B7QA 1FFRA 3AIBA 4HMDA 3TDFA 3NCOA 3E96A 5FKYA 1UYQA 3W7CA 1TPDA 3O63A 1W5MA 3M5XA 1CW2A 2GVJA 3HMJG 3D0CA 1YLVA 3FEMA 3W6LA 3CPRA 1B3WA 1K6AA 4KGLA 3WNLA 4AXNA 5EL1A 1UBSA 5G2HA 2PRLA 5K9CA 1FUYA 1JFXA 3SCSA 1FWSA 1VEMA 4NI3A 1UKQA 3AHVA 4KRTA 1V0NA 2VT0A 2Y7FA 3WEOA 2J77A 2Y4SA 1I8JA 3LHWA 2YKKA 3WF3A 4UUIA 3QOMA 2XVNA 2GQAA 4PRWA 1GPFA 4WXYA 4JYDA 4H3DA 3L2MA 1G7UA 4FIQA 3HGOA 2Y85A 4UMCA 2DSVA 4WD0A 3H54A 1JDDA 2ZBTA 1KFBA 2CU0A 4P7QA 4AWUA 3RCNA 4EVZA 3MKKA 3VTRA 3OEXA 3ARVA 3UEQA 3QC3A 2E1DA 5KZDA 3LCXA 1J0ZA 2VNCA 5LSMA 2GFTA 3KFTA 2RH9A 3GVGA 5TBOA 4M7TA 1EDGA 4CD6A 1ZHAA 5AHNA 1BG4A 2JEQA 5FF7A 3WH5A 3RPMA 5AHLA 1WP6A 1M01A 2GDVA 3CZGA 2JK2A 3PSWA 5E0CA 4IXHA 1MQQA 2QQVA 2NV1A 3N19B 3QW3A 5E1QA 1WZLA 1WBHA 4UTMA 3LPOA 3I7QA 3R12A 3HJZA 2W4XA 3M7SA 1JZ5A 5A6MA 3AROA 3PM6A 4MUZA 4MYAA 1FH9A 1JNEA 3W7OA 3ARRA 4DQWA 1F4AA 2CLOA 3MHUA 3BV4A 5CZJA 1VFOA 3GXIA 4IX2A 5A2AA 3BG3A 3VGGA 2GK1B 2GJXA 2V2HA 5JIPA 3BK0A 2I1OA 2Z1BA 1W8SA 2CLFA 3SGZA 3LLDA 5FKBA 1IXOA 2G8ZA 1EDTA 1MEIA 3P62A 1FFQA 1C93A 2FJKA 3LX9A 2NX3A 5D05A 1LL4A 1UR2A 4D6JA 3FFSA 3VDBA 1H7WA 4QJ1A 4ADUA 1TRDA 3NQMA 4JXCA 2G95A 5EY5A 4R5EA 4W5ZA 3BW4A 1E6PA 2V3DA 5A6SA 3MV11 3DYPA 4CN6A 4O52A 2CIPA 4LTSA 1NP2A 1ZBKA 3S42A 2IXVA 3RNDA 2W61A 3MUAA 3WFAA 4JCLA 5HOSA 3PY2A 3VMNA 3O05A 2ZICA 3L9CA 2E6AA 3LCFA 3G1SA 4JTGA 4UTJA 2XM2A 1Z41A 3QMSA 3WF4A 2ZZ2A 1QNPA 1VGAA 2CLIA 4UNLA 3WL0A 4IWWA 1H2JA 4FFGA 1IXQA 1IIHA 4MKNA 1X1NA 1J0KA 2OCZA 5E0FA 1EP2A 1H11A 3P61A 2E5CA 1MW2A 5CLTA 3TW7A 2ZXDA 1DKWA 4PMDA 1ZALA 4R34A 1AG1O 1I2PA 1E71M 3VO0A 4HSNA 2YX0A 5K9XA 2NW0A 1LBLA 3G6LA 5E6ZA 2WQPA 5KMYA 1UKSA 3PBYA 3HU7A 4UQBA 2FTPA 5FF3A 1HP4A 2WPBA 2GSJA 2DSKA 4XTDA 3OVRA 2ZX5A 2NSXA 3G22A 3CMJA 3L4TA 4YXGA 3NAVA 2YFNA 3G1AA 1G5AA 4UTFA 2HS8A 3O15A 4MTVA 1ICPA 2JEPA 4OV4A 4DWSD 2XG9A 2C0AA 5IDIA 2Z6IA 4MZ8A 5DBTA 3ARZA 3W25A 4WQ6A 5C71A 3VDAA 4H4IA 4QNWA 1D9EA 3G3DA 4G1KA 3TK7A 1CYGA 2VUYA 3OZOA 5A95A 1H5YA 3STEA 3W53A 1CGXA 3BCDA 1EXPA 3UXAA 3F5KA 3IRDA 4HSOA 3W75A 2NX9A 2D3LA 4DF1A 2JKAA 2EEXA 4BQ4A 3LOTA 1KM6A 2VJXA 4HOWA 3DU0A 1UKTA 3IGXA 1DWFM 1TSIA 1W3KA 1OFOA 4K8HA 4LS0A 2DIEA 1DQXA 4HP5A 3T2OA 4PMYA 1W3IA 3T2PA 3WDQA 3P7YA 3GNPA 3QF0A 4GXPA 3ZSSA 3C2OA 4NJIA 2EF9A 3B03A 1ZU8A 5IHRA 4FNTA 2Y6ZA 3DZ1A 4WJEA 3WH6A 3F4NA 3WENA 1BWKA 5ANNA 2OMAA 4CN4A 1VFFA 5F1VA 3LXBA 2QKFA 3ARWA 1PL9A 1YQ2A 5M03A 3SCTA 2VEMA 1CEOA 1VCFA 1FP9A 5DFAA 1W1TA 4JFTA 2J79A 5ABHA 4O17A 3L5LA 5DXXA 1QI5A 2HISA 5ECUA 3GR7A 3CUJA 3JUGA 2G3MA 4LVAA 1XFBA 2VX7A 3I3BA 3VOCA 3SEPA 4BI6A 2DP3A 3CM4A 3S8HA 3WNOA 5D09A 2YW4A 4ZFMA 1TR1A 1E4NA 1CPUA 5M3WA 4M6QA 2XIBA 2QCDA 4NF7A 3L5AA 4JIPA 1EQPA 1J5TA 3DH7A 4ML9A 2JFEX 5D9NA 1K03A 4IPIA 1E4LA 3POCA 1VLIA 3DFQA 2XN0A 1Q6GA 3FYOA 1PIGA 3RK8A 1KBIA 3KHJA 4NX5A 3TJXA 2EJ1A 4UMBA 3FAWA 1BTMA 2O9RA 4X22A 2VI0A 3CWNA 3MHFA 3CLWA 4H6KA 1UD4A 3T0AA 3VINA 3WKZA 2V5LA 4JYEA 3SUTA 1UASA 2VFDA 3T08A 3EWUA 1IXNA 1JRBA 4NZJA 1OK6A 3B0UX 2WVUA 1CGYA 2J7GA 3G1FA 2QDGA 5GNZA 5D30A 4ADTA 1HVQA 1YDNA 2E9MA 3CZKA 3W1QA 4HPHA 3NPWA 3PUOA 1CGUA 1M5WA 2QHAA 2VZSA 3QHNA 5A6LA 4TOQA 4LV9A 3EX1A 1OT1A 2ESCA 2ZXBA 3EWXA 4BZYA 4IX0A 1LLZA 1HJWA 3RMJA 3N9KA 3W71A 3BAJA 4LYRA 3THCA 4FFIA 3WEZA 1WA3A 5DCBA 1VEPA 2YL5A 1SR0A 1HKIA 3GZAA 4GXMA 2C1HA 4ZZ9A 3VKJA 2PURA 5D04C 3KVKA 1XC6A 3U7BA 2QCDB 4K37A 1JF6A 3GXMA 2OSWA 4XKYB 1X6LA 5FEWA 2VC9A 4X0VA 3L0GA 1PIIA 1H1ZA 1MW0A 1AW2A 1KCLA 4JYFA 3RLUA 3H3LA 5C55A 1FWNA 1GZGA 3LHYA 3LTSA 1HO4A 3U8GA 3PN8A 3W27A 2EXOA 1R2SA 3PUDA 3MUZ1 5D2XA 4WLCA 3UWZA 1JIBA 5D02A 3LRKA 4H04A 2DZVA 2YA0A 1GVOA 5EFDA 3WJYA 2UY3A 4MNLA 1BG9A 1PCKA 1SPQA 3L4YA 2A1YA 4AWEA 3PVFA 1CX9A 3JRKA 1OYAA 1UD8A 2XTKA 3W7KA 3WD4A 4FB7A 1TRIA 5I79A 4ZEPA 1SFLA 4H8UA 3GKFA 3SURA 2QLYA 3UGHA 1BSIA 1FP8A 1PX4A 4JTKA 1WZAA 3W83A 4UTWC 4Z1CA 1EHNA 2EQDA 1D3CA 3DI0A 4Z08A 4HOZA 5IHSA 2VEKA 1PHQA 3HIJA 1A50A 4TU1A 4U33A 5BYWA 1RQBA 3W7JA 4MIMA 5AHIA 4Z1AA 3QGVA 4CQ9A 4XQ6A 4K7YA 5FEZA 1VH7A 3OLIA 1ONRA 3C4UA 1EA0A 4Z2HA 1B1YA 3NVTA 1JYWA 1KBKA 4JTSA 5AYBA 4NT0A 4JD4A 5HPOA 1FCVA 1OFRA 3NQAA 3PF3A 3GH5A 3A21A 3AO0A 2XFFA 3VX1A 1SW0A 3MBFA 1UKOA 4NVTA 3MHGA 3S5QA 1K7XA 3LTPA 2J7CA 4YLWA 2CLKA 1KM3A 4ML4A 1YTDA 1LJYA 5AC8A 1JDCA 3NL3A 4YWIA 3BVJA 3MJYA 1GOXA 4KWVA 3TQVA 3G0UA 1SQ7A 3MYPA 1KQZA 3PZ9A 1QO5A 2PRMA 2ZRXA 5BWFA 3G8RA 5LNSA 4CD5A 1IF2A 5AOUA 4C1KA 2OZ0A 5DY3A 1UD3A 4PMNA 4JX6A 5CKSA 1HF6A 4TUFA 5AHMA 1CIUA 1OG0A 1FXQA 3BG9A 2E8YA 1JXJA 4DWSA 3ZJ6A 4YL2A 4D71A 2ZX6A 4Z0JA 4PCTA 4K39A 1EO7A 3C52A 1EP1A 3NJ3A 2Q8ZA 2FPVA 3VPLA 4P8VA 3OSDA 5HQEA 1FQ0A 3P5YA 3UZ5A 4JCMA 2CNCA 2VTFA 1VPXA 4GI6A 3LHTA 1JRCA 2FPTA 1E56A 1HX0A 3LI1A 1B4EA 4RXFA 2Z2UA 4CU6A 1GCYA 5CG7A 2YL9A 4JTUA 2CBVA 5L9FA 1VF8A 4D72A 3EB2A 4HXCA 4AWSA 4AF0A 1JL8A 4M7SA 1I1WA 1Q6DA 5CSSA 3EBVA 4MDOA 7TAAA 5M5DA 1U5JA 1ST8A 5LNWA 2J74A 1UWSA 3NM3A 1I2RA 1WPCA 1M7XA 2EO7A 2YR1A 2ZZ5A 4CCEA 1JZ4A 2R94A 1DWAM 4ZE5A 5LNUA 3KL3A 2QCLA 1OSEA 2GK1A 4IUOA 3TXZA 2X2YA 4TVDA 4HNVA 3IVSA 4DM2A 3HGRA 1MQPA 5LA2A 3M16A 2C8NA 4JY9A 2B7OA 1KWKA 3M44A 3AOFA 2QAPA 3S9YA 1GJPA 3W1PA 3OBAA 1W1VA 4FX8A 2NV2A 3BSGA 1ISYA 3O07A 3RILA 2VZTA 4GQRA 3SUWA 1SO3A 4TX6A 2J25A 3ABQA 1B3OA 1K02A 5C54A 1BF2A 2WM0A 3NUKA 2Q8XA 4IMFA 4KWWA 1FBAA 2WWDA 4Z0SA 4EQVA 1TREA 4KFNA 3NXFA 4FNRA 3K4AA 2YW3A 1DJNA 1VCVA 1HKJA 1KXTA 4HZ7A 2XJ7A 4OV9A 1V5XA 1R87A 5GQBA 4WY0B 2V8ZA 5CPOA 3NQEA 1CLVA 1VRDA 3TU9A 1O5KA 1IGSA 3A24A 1GOQA 1DQWA 1W3NA 1JCNA 1SYTA 3WQ8A 4IPJA 3HPSA 1ADOA 4MNJA 3HG5A 4DBDA 1JQVA 1ML1A 4MJ4A 3B06A 2FDSA 1BHGA 1HL8A 3A4WA 4GPNA 1G67A 4PBGA 2H3BA 4UR8A 3AXIA 2W79A 4HA4A 3U14A 3W7NA 4BF9A 3SIMA 3DXIA 3TA9A 1R86A 1R47A 3N9SA 5D4YA 4RR4A 3LTYA 2AEZA 3HPZA 1W9DM 2AGKA 3B4UA 2F2HA 4QLJA 4RXGA 1R7OA 4D6IA 3SCWA 2WSQA 3HG4A 1ME9A 3IJ8A 5DT7A 4OU1A 3BGGA 3LCHA 4O1CA 1JFHA 4C7DA 4AC1X 2ZUNA 2CFFA 4XX6A 2Z6JA 3DAQA 3A23A 4UC5A 1OM0A 2VMFA 1QBBA 3ALGA 3LLFA 2ABBA 2WMFA 3CPUA 4FX6M 3I68A 5ABFA 3BC9A 2V82A 1FDJA 1JUBA 2AQWA 2WCGA 4LX4A 1L6SA 4DO5A 5EMYA 4YPJA 2OYLA 2QEZA 3W7IA 1E9LA 3N73A 5I6SA 2KZHA 1C91A 4NU7A 5FMCA 4N9DA 3BXWA 2VXNA 3UWVA 1V03A 1E51A 3LV6A 3W76A 3BLKA 2P1FA 4JGDA 3LF7A 3N1AA 4H8VA 3P8IA 2RDWA 1PS9A 4PL2A 2VZVA 4MY8A 3WDIA 2PF0A 1XUZA 2Y89A 1GOKA 1KR0A 3AIRA 4Y7EA 1O4UA 1ESWA 3PIGA 1OD0A 1H62A 5CPQA 1DWGM 3D5HA 3MBDA 4BQ2A 1JUEA 4O15A 2QPSA 2QF7A 3W26A 2D73A 1JZ2A 2ZWYA 3L4ZA 4HMCA 2BHUA 2Y8VA 1FA2A 2FH6A 4OWGA 3OVPA 2CLEA 3NIYA 4TX9A 5KSWA 3WN6A 4AZCA 1QW9A 4GUJA 1R2RA 2WK2A 5HNNA 3I7RA 1W3TA 3EX3A 3CZJA 4LY8A 3W29A 5K4XA 3W1MA 1BYDA 1P0KA 1GQIA 1YDOA 5AY7A 2CLHA 3RIKA 3KVJA 4UTUA 3L2LA 4UNIA 2O9PA 4ATDA 2AMGA 1KFCA 2YSWA 4E4PA 4J7RA 4FFHA 2DZSA 3GNNA 1B90A 3IEBA 1L0PA 2AOSA 1U83A 1DWHM 4WKAA 1NVMA 1TV7A 1JZ7A 3HBLA 5FD0A 5C2XA 2FIQA 1DWIM 1LF1A 3I65A 1FWTA 4PA8A 3C2EA 2WNWA 1SW3A 4A2RA 2IXUA 1ZBVA 1JZ3A 3PG9A 3W1XA 5CPTA 4DF0A 4LVGA 3APGA 4ORMA 4NXSA 4HA3A 4WSKA 2DORA 1JYNA 4D6EA 1PE1A 4K36A 2WZHA 4TXEA 1HJVA 1WDWA 3LXAA 5DCEA 3LB0A 1QI0A 1W9VA 3RDKA 2VFHA 3QSRA 2BXYA 3PZVA 1JCYA 1QDSA 2XFYA 1G4EA 1TA3A 2PC4A 1F73A 3T40A 1PX8A 2BSLA 3UETA 4HPGA 1VCGA 4JTHA 2E0PA 4LRSA 3MP4A 1TTIA 3EXTA 4O1DA 1OVDA 2AAMA 2DZXA 4R7JA 2WCSA 4J3TA 4LXFA 3RJXA 1PVNA 5M17A 1LOSA 5FOOA 3OBKA 1EDQA 1UH3A 3W72A 1I45A 1XYFA 4JKKA 3P81A 3AQUA 4FX7A 5I0DA 1WYIA 1MXGA 2DPEA 1AW1A 1C8YA 4RJEA 1VJSA 3IK2A 2A2IA 1ITXA 2ZXAA 4DXVA 4J3UA 1XL9A 4FNPA 4ATLA 3SC7X 1YDVA 3CUGA 4HPXA 4PSRA 1FHDA 1VENA 3QMRA 1XC4A 4JX5A 2E09A 5FEXA 5CZSA 4N02A 4Z1DA 1W3LA 4GI9A 3VIGA 5CJ5A 4JHZA 3DHUA 1QI3A 1CGWA 3DKLA 2A7RA 4MZ1A 2ALDA 3VIMA 1MW1A 4AZIA 4C7GA 2X2GA 1G7VA 2B7PA 1I4NA 1TJRA 5CSYA 2BS9A 3A4AA 1E4MM 4BQ5A 4ZXLA 4E8CA 3N9RA 1G4PA 1O94A 1ITCA 3FJ6A 4Z1BA 2JBMA 5E09A 1ALDA 1HL2A 1B3ZA 2DH2A 2J7DA 3FY1A 2WBKA 5AHEA 3WMCA 2CITA 2X30A 1LRQA 3ZFHA 4R53A 1H51A 1UR9A 3W7DA 3WIJA 1AQ0A 3DFTA 4MNMA 2V81A 3EMCA 1NARA 4M5PA 3G0XA 1E43A 1OGGA 2RKXA 4DWSB 1OX5A 2Z1KA 5LZLA 4GO9A 3SCPA 1S5VA 4HT3A 3OIXA 3PULA 3ARYA 4KH2A 4MB4A 2E6FA 4UR9A 3W1TA 5A8PA 4V28A 2YDRA 2ZZ1A 1QOPA 1JD9A 1S5TA 4N9CA 4JZ5A 3O9NA 2E9LA 1H5VA 3LPGA 3WDJA 3DC0A 5KEZA 5G2WA 2A21A 4LVBA 4PSPA 1VBRA 3PUEA 4FLSA 1LCOA 1QNVA 4GJ1A 2V3EA 1OYCA 1WNOA 1ME8A 2BZNA 3ZJ8A 1EB3A 1UUOA 2W67A 3AYRA 5DN1A 1KXHA 1VZWA 4TIMA 3MO4A 3OVQA 4W88A 1T99A 2BFGA 3W2JA 2QJIA 1SZEA 4IGHA 3CEUA 4GRSA 4N6EA 5K2ZA 1UZ4A 1A3HA 3LPFA 3WK3A 1J10A 4FF7A 3S1WA 1Q6CA 1KWGA 2GUUA 3W2UA 1E55A 2WV8A 3TJLA 2A5HA 3L66A 3F4WA 4D1IA 2GQ9A 3WQ6A 1P1XA 1K9TA 4W7VA 5AC4A 1GVRA 2WSYA 2ZRVA 4ACZB 1A53A 5D8WA 2PB1A 5A6JA 2BHZA 2OWXA 3NO5A 2D0HA 1Y9GA 4HZ8A 2X1SA 4DEFA 2ZCGA 2WXDM 4JTIA 3UNDA 4JKLA 4RE3A 1LOQA 4AZCB 4Z2KA 2ZA1A 1BPLB 2WKLA 1AW5A 2WJZA 3W7MA 1B57A 4DUVA 3USBA 3KRUA 4UQ9A 2XIIA 9CGTA 3UR7A 1VYSX 3S1XA 2DZPA 3O6AA 1C90A 1P4CA 1LBFA 1OWQA 2ZZ4A 1RQHA 3N34A 4LT9A 3B9AA 4L4OA 4FFFA 1ZJBA 3WFZA 5D33A 2VRJA 3AZTA 4WIWA 2VRQA 3W3OA 1J9YA 2BVYA 3GBEA 4O4VA 1Y9MA 2H8XA 1QNQA 3UESA 2ZE0A 3ZIZA 3CMGA 4B9ZA 5JBFA 4JFVA 4DO6A 2J9XA 2WNQA 1DWJM 4RKAA 3UPWA 4Z2IA 4IQLA 3VIHA 3EX6A 1HKKA 2QMKA 1FXPA 3INPA 3N11A 2YJQA 2D23A 4KFOA 1H4PA 1W9BM 1GG1A 1DEDA 3UD6A 2OWCA 5G1YA 1C7TA 5HUPA 1H0GA 5FIXA 3TTYA 3DGRA 4QSHA 2J78A 4W8BA 4BA0A 3GX9A 4PMUA 1WZMA 4XV0A 2VFEA 5F4XA 2VCBA 3UZJA 4J3SA 4NXKA 1EX5A 1PCWA 3NDYA 3R5EA 3PZIA 3SI9A 3TW6A 4FNUA 2XVKA 1KM0A 2I9EA 2WHJA 1H7NA 2WVVA 1EP3A 4P61A 2FGLA 2FHFA 1KR1A 3ATYA 2VVSA 1W3HA 3QRHA 3FS2A 4HA1A 3ZT7A 2GDUA 3U1XA 3SJ3A 1MEWA 1XM3A 3U2OA 1HIZA 4LPCA 4CD8A 4RX0A 1JAKA 1XD0A 4HN4A 1OX4B 3GXFA 2FB3A 2ZX7A 1LORA 2ZX9A 2G96A 4XZ9A 1H7PA 3M5VA 5LHEA 1X8FA 2DH3A 2WAGA 4S2CA 1M6JA 3KRZA 3TFCA 1LLOA 1Q6EA 1OX6A 2X16A 5H2ZA 3EDFA 3VDHA 3Q2DA 1ZCOA 2HMCA 2TPSA 5A8MA 4RZ6A 5GVJA 1J12A 1UWTA 2PBGA 4JKMA 1GYLA 4TO8A 1UHVA 2EPHA 3IIZA 3A6OA 2QQWA 1NWUA 4KGJA 3WQ4A 4J9JA 1KM1A 3I3DA 4AY1A 2ZRYA 1KTNA 1OIFA 4B9YA 3NYDA 3VGEA 3IGSA 3W7LA 1YTEA 3CGTA 5CLWA 4JIEA 3IMMA 1K7EA 1KM2A 1CI1A 3GDLA 3NQ7A 4UFMA 3P80A 4LC6A 4DF2A 3AS2A 3DHPA 1R8LA 4AXKA 5DF0A 4NQ1A 2RDTA 5I3IA 2WZEA 5A1AA 5I3KA 5F1UA 5BMXA 3EMZA 3WEMA 1LQ0A 1E4IA 1E70M 3GKAA 5BNKA 3EDEA 4O53A 4PTWA 2PCQA 1GZJA 1ZB5A 1GYNA 1H7OA 3HPXA 1BFNA 2G97A 3P5ZA 5T26A 3GXTA 4NJGA 1W2PA 3B9EA 3QEZA 1C8QA 4GZIA 4JN6A 2QCNA 3T78A 1LWJA 4O10A 1SFSA 1EOKA 4B3KA 4AD0A 1LYXA 4LYPA 4JDYA 3GBDA 3BAKA 3L0KA 3OIHA 3AIUA 2CESA 3TX9A 5IFTA 5HR7A 2YDAA 4FXRA 4QISA 4Q32A 2OSXA 1KCKA 3QQ1A 2PI6A 3R89A 3P60A 5KINA 3EMQA 3BW2A 4D1JA 1V6VA 1MZHA 4DBEA 5EBAA 2F8QA 1FHLA 3WJXA 2X0YA 3NQGA 4OOUA 2CBJA 3D3AA 4MAZA 4QM1A 2ZA2A 3HJEA 4U2YA 3U5YA 5EBUA 3ZT5A 5ABTA 3TSBA 4FF5A 3MUIA 4I9AA 3A22A 2EKCA 2VEIA 1W2TA 1KM4A 5G2IA 2WSPA 4TR9A 4DUXA 3LDRA 2IUZA 3GH7A 4UIOA 1W5QA 2E5DA 4Y9AA 1UUQA 2YLLA 1RPXA 4UTKA 4PCSA 4MYXA 1Q4NX 3WF0A 2DSZA 2ZYFA 5A2BA 3C6CA 2YPIA 5DBUA 3FNDA 1DTUA 3NG3A 4AZHA 4D2JA 3W2MA 4M1RA 1M53A 5DCDA 4J3XA 1ZL1A 2PBOA 1XH1A 1VEOA 3HBKA 2NUYA 1RR2A 4M29A 4AB4A 3CU2A 3M7WA 5KITA 3UG5A 4HNTA 2HVMA 2J8GA 5HMSA 1H49A 4NZCA 4S3KA 1TPUA 4QNEA 5A6BD 1B3YA 2ABAA 5I24A 3TE9A 1BEUA 3W07A 2Q3OA 1KFLA 4N2YA 1G1YA 1TPH1 3TMQA 2CYGA 2FQIA 2WB5A 3N13A 3VGBA 4Z2LA 1EH9A 1QMLA 1TYGA 3O6DA 4E2BA 1C8XA 2QCHA 4NJJA 1FCBA 1GJUA 3M1ZA 1V02A 4RE2A 1G9HA 3G3MA 2WHKA 1F7BA 2PWFA 3IIVA 4YHEA 1XSIA 3SSJA 2VVNA 5A2CA 3QYQA 2VX6A 1B9BA 1UR4A 3UERA 5BCAA 3TOPA 2VOTA 4MZYA 3ZR6A 1H61A 2A6NA 1NFBA 5BROA 5A69A 4A21A 2ZA3A 3VCRA 2NX1A 3CUFA 1G4TA 2DGAA 5FL1A 4GINA 2J24A 2ZUVA 5D38A 3UG3A 4H7VA 3DENA 3NZ1A 3AMLA 1MSSA 1XUUA 3HOJA 2Y8KA 2PWGA 1LRTA 3WH8A 3C2VA 3KL5A 2VRKA
chains in the Genus database with same CATH superfamily
3RI9A 2WM1A 4Q4X2 3UQNA 2Z1SA 2BGQA 3K8LA 3AYVA 4WK9A 3DOPA 3C3UA 5F2GA 1XKYA 4QBXA 2E4TA 4JQTA 5B2GB 4REQB 3VIPA 3LNPA 1FWGC 4Z2JA 2HWD1 1UNBA 1VP6A 4OUMA 5CYYA 2PGFA 2LTNA 4J3ZA 3H24A 3SCNA 2EHHA 2D2JA 5EWSA 2E7TA 2VMIA 3LA4A 4PUDA 1UKPA 3U4XA 3P67A 4YW1A 4EZ4A 1DYOA 4QGMA 2DU2A 4AXOA 4Q8VA 1P6BA 1YEYA 3KE0A 4DWSC 1ZAHA 1AL22 2WNVA 5T5PA 1TUXA 4QX0A 5BXPA 3WFLA 3UG4A 2YFUA 2CZFA 4MOZA 4B4RA 1HP5A 4RE4A 1CONA 4PUJA 4XK2A 1WLWA 3TLLA 3W02A 5K7JA 1DHPA 5BV6A 1PV8A 3F5LA 5JOYA 3IIPA 5CAZA 3NYZA 3B69A 2VZPA 2VC5A 3CV7A 4GX9A 2PGEA 3WK1A 4FOJA 5IVFA 2AEYA 4WKHA 3IIAA 2QGHA 3SRHA 3PB2A 2ZADA 5G4EA 2ZUTA 3UWQA 5D2WA 3T8QA 4MO3M 4LO7A 4EROA 3GTFA 4MGYE 4XW3A 1HJGA 4IF2A 4UMAA 3E49A 2QQ6A 4UNKA 4J3WA 4Q4KA 3PTRB 2DIJA 5IK8A 3KEHA 1A5LC 1XIIA 5C9ZA 4N4PA 4JDNA 3T09A 2WOQA 1HW6A 4H8HA 4OJYA 4QCEA 4DBWA 4AAJA 1JN2P 4C7FA 4E0CA 2CC0A 2VULA 2ZFAA 4E3TA 2YBKA 4MUVA 5F5QA 3BTXA 1HFBA 3TP4A 3W86A 3DFOA 3V75A 4WVMB 3D3FA 3JVAA 5F2WA 1KKOA 1BVZA 4W9TA 2YBSA 3Q8AA 2TRSA 4DAFA 3GVQA 3NO3A 3ACIA 3AKPA 3GWQA 1G6NA 1QPOA 3NV2A 2G41A 5LY1A 3H23A 4AIOA 3MEPA 5FZDA 2GMPA 1E1FA 1UZZA 4YZ2A 1J93A 4GC4A 1AL23 2NV9A 5H1WA 1PJ9A 3SADA 1LOEA 4YVXA 1W8HA 3GG7A 4LOSA 3KS7A 1TVNA 3OZMA 4IPLA 4KRUA 1ZBA1 2PDUA 5CPNA 1FX6A 3R10A 3ZKYA 3CZEA 2Q8LA 2E63A 1JOJA 3ZIXA 3EWYA 3ZJ7A 1PXGA 3H70A 1OGSA 4MGIE 4GYPA 1VBC2 4EAMA 4D6QA 5LCWL 5K0UC 2GSEA 3U7VA 4A22A 2B46X 3LGEA 1LROA 2HNHA 1XLJA 2GUYA 3APYA 3DDMA 3SKVA 3QJAA 3SCOA 2QJJA 3GU9A 2VR4A 5E93A 5AC5A 1OADA 4JOMA 1UWRA 3MW7A 3AM2A 4NL1A 4CNTA 1AR82 1RHI2 1KM5A 3NJXA 3GNOA 3KBWA 3LDVA 1ICQA 1D2QA 2F84A 1U2YA 4ASKA 2D93A 1X1ZA 1V9U2 1KFWA 2WLZA 4ADSA 2DJXA 4X9SA 3L2YA 3S2MA 3IVUA 2HJPA 2C7FA 2XJVA 2X1IA 3SQSA 4HMZA 3IJDA 1ZBWA 4EX4A 1B3XA 5EIYB 2GJLA 8XIAA 5FV3A 1GHSA 1TJPA 1GLHA 2J4GA 4XMIA 4PB3A 4AVNA 1Z32X 4W5UA 4NKCA 4GC3A 1E6QM 3HQUA 2Q09A 2C19A 2WO3A 2ZGTA 3Q8EA 1E6XM 2HROA 2HWE1 1GONA 4LKFA 1YLLA 4C1NA 4C1LA 1O59A 2QYGA 1UJQA 4AR2A 3DHDA 4NUWA 3H4GA 1Y65A 2TUNA 2OT0A 1DQ4A 2J27A 4XBQA 1EZ2A 4O1BA 2CLPA 3GB6A 3V3WA 2A75A 3ARPA 1GOOA 2GLKA 3M64A 3ZO9A 7REQB 1W6PB 2VBDA 2OLHA 3KAOA 2AC1A 1H9WA 4PMRA 3LIGA 1W9TA 1ACCA 4NJKA 1HXS3 1HXJA 4D6DA 4NJ4A 3VE7A 3WP3A 3O0WA 3M6DA 4OGZA 2UYAA 1MYRA 1OHFA 3VNJA 4K8EA 5H91A 1J3PA 4W86A 2H6BA 4Y20B 4QG9A 2WZIA 2XHNA 4ITCA 1ZAJA 2BOEX 4Q8LA 1TA3B 4ZR8A 1S4CA 3POSA 1V3IA 3M0ZA 4EN8B 4UOZA 4O18A 1ULDA 1PO21 1GVQA 4W4QA 1XIMA 3EQEA 3NL5A 2XGBA 2DUXA 1TVGA 3H1YA 2D40A 4M80A 2WHLA 4YRDA 4YG0A 2XHYA 4URAA 2V3FA 3CHCA 1N1SA 2PRHA 3S6TA 3G6JB 1AK5A 3SAZA 3CLMA 6XIAA 2NQJA 1V6WA 2QZRA 4XIMA 4HJFA 2Y62A 4PC8A 1CECA 1XF0A 4NHVA 5FJIA 2O4QA 1DQ0A 2Y5SA 4FO4A 1SFJA 2FZ2A 1VLWA 4AD4A 1H8TC 1IG0A 1QKQA 5RUBA 4XZIA 5C8CB 3FFQA 1C29A 1PMIA 3CMFA 1KBJA 1V6IA 2OGYA 2V3GA 1AL7A 3DFNA 5AVHA 1UWUA 3VLBB 2ZHLA 1KQYA 1JD7A 5E16A 1OOPC 3VBHC 4QXHA 1VFMA 1COV3 4ZE4A 1W2UA 3SY1A 4GY1A 1TNFA 4XC9A 1APNA 1CB7B 1R46A 4QITA 4FNSA 4AD2A 1RVKA 1P5BA 5TSWA 2J1EA 3EB3A 3TA6A 3VIOA 1NA1C 4IFOA 4WY0F 3SQLA 3UXKA 3NSTA 1ZA7A 2R32A 1QPQA 2W52A 1MR5A 4OULA 3JS3A 5FYSA 3E5QA 1W6QA 2NZ9A 5HI0A 1Q8JA 3MVTA 2FDKA 1QU4A 4ALDA 1CAVB 3B8TA 3P74A 2HWF3 3E5PA 1Y3TA 4Z82A 5I8SA 1W9XA 3FV9A 1EXBA 3VE9A 1AR62 2OZ6A 2XB6C 3H4WA 3F2ZA 4AEJA 4LUKA 3OTFA 3VGIA 3C2FA 1QCWA 1X6UA 4RQPA 4MZUA 2WMKA 4ASLA 3W1AA 2DZWA 3BLPX 1VJIA 2XR4A 1PEZA 2GQ3A 3TUUA 4FXJA 4LS1A 4FA3A 3SUUA 3M6YA 3NV4A 3OF1A 2W66A 3E12A 1K3IA 2QUTA 3SXWA 2G0WA 5J1XA 5A33B 3B0XA 3SZ8A 3NNJA 3Q67A 4DZGA 2P6HA 1TPC1 1H2LA 4GZEA 2XWDA 3WH9A 1LL7A 1Z7S3 3K4DA 2F4LA 4HG6B 3EB4A 3CZUA 3IZOA 5FJJA 5FY7A 5G1TA 2F6XA 2TEPA 1ZVFA 2J88A 3M9YA 2PWHA 3E0IA 1UMIA 2CZ5A 2ATMA 4CD7A 5CGTA 5I3JA 4K68A 4XUTA 3H6OA 1TNRA 4GLEA 3VHOA 4XZLX 4XIKA 5F37A 4PN2A 1HLCA 3S5YA 3NZQA 4BOWA 1K8CA 4RD7A 2DZBA 1ZRIA 2ZUSA 1C5HA 4Y3OA 4GJJA 1XQKA 2Z25A 3HZ3A 3GZ3A 3ILNA 4MWAC 1HB2A 1A5SA 5AECA 1L7QA 1IZKA 3UP8A 3N7MA 3C0JA 5JBDA 4NRRA 2IWGB 2PF8A 3OVGA 3C0QA 5FRAA 3GDKA 3GDTA 1TE6A 2WDBA 3MFCA 1MI3A 3FJNA 1TWZA 2HKXA 1SR9A 1E40A 4NJHA 1WZXA 3K1DA 3URFA 3ZXJA 1LU2A 3S2NA 4LFYA 3E6EA 3U57A 5CC7A 1VKFA 2PWVA 1QVBA 1UD5A 3I2OA 4IXXA 1Y9QA 3L9JT 4META 3UJQA 1UP2A 2E8ZA 3O2LA 4HNOA 2WWJA 4MLJA 4CDWA 4I90A 5DUUA 3EYPA 2L5HA 4WX2A 3EWZA 4HJWA 4DUOA 3PZMA 5LA1A 2VX5A 2H3DA 4DOUA 5FMDA 1MO0A 4LUIA 2YZRA 3E97A 4KWJA 4JZRA 1W06A 1NOUA 2PDKA 4KI5M 1VHNA 1C57A 1SMAA 3E2SA 6REQA 1E0WA 1VRH1 1TMLA 5FK7A 1PWLA 4V2XA 3GCWA 5F5AA 3KBMA 3VGFA 4YU1A 3NNMA 1E73M 3BAXA 4DJEA 2F7FA 3A3XA 4D6RA 4E8DA 2DJLA 4C6MA 4U2ZA 2VE1A 4ZOEA 4AYUA 5CBIA 4JTQA 1W8TA 1MZEA 3VHRA 4HSJA 4JTEA 4DRVA 5JIUA 3JD71 2OPJA 1EUAA 3CJIC 3FL7A 3MPBA 4HK8A 3MP3A 1JR1A 1YNYA 4N9HA 3C56A 2BV9A 1YJKA 3ST7A 1W5NA 2QR6A 4JQAA 1H6XA 3PS7A 3S0MA 5JIAA 1YBQA 2R1MA 4K1WA 1CXEA 3MW2A 1FOD1 3JR2A 3EXSA 2Z0IA 2VBPA 3CUZA 3ZN6A 5FPAA 3BGJA 4LANA 3W37A 1M7OA 2JKXA 4P8UA 3WDRA 1QJU1 4C1WA 1LUCB 3LIHA 3DG6A 4R27A 1QJY1 4I9JA 1VJ2A 3O6CA 1LUCA 3EOLA 2E53A 3M7AA 5K9DA 1AR71 1PBGA 2O55A 3AX4A 1LQAA 1OKOA 1ULFA 2EPMX 1ND3A 5FEPA 3OLDA 1HV0A 1ZYBA 2ZEXA 3TAOA 1N55A 4D8LA 3CHXA 1PKYA 5FLHA 1OJXA 4LITA 2GC3A 3IGHX 1D2KA 3ZYPA 3EEGA 3QMTA 1P1MA 1YXCA 1RMU3 1VB4A 2PHLA 2C14A 1ENXA 2Q3RA 4JTAA 4NHYA 4Y5Z0 3BPWA 1KCXA 5ABJC 4GQBA 1TJ1A 2Y24A 4EF9A 1TVPA 3MMDA 2G50A 4J3VA 1XW8A 3L65A 1SZBA 4B1LA 4OUIA 2G5WA 3VBOA 5AN7A 2PHRA 1O6IA 1PAMA 3EDDA 2Z4FA 1OI6A 3UL2A 1JMUB 1TV5A 5L6UA 1FX5A 3ACGA 4ZVJA 3MIGA 2G19A 2NUXA 1ISVA 3EAUA 4IV1B 3DECA 4RGAA 2Y6FA 4GE8A 5E6HA 2YZ5A 5GZDA 3W84A 2GNTA 1IT8A 1WCSA 3DCPA 3CO8A 4ZQCA 3TYDA 5DLCA 3OA3A 4Y24A 5BNOB 1TPVA 2BBVA 1JUKA 1YXWA 2KXLA 1G9FA 2CSGA 2CHOA 3QSTA 3CQJA 5J5RA 2HBXA 4LV4A 1KXGA 2WHMA 1RUH3 3KF5A 3W2NA 1W1B1 3E9AA 3CL8A 2XH7A 1OFEA 1OLME 1JJKA 1U5IA 1IWAA 4C6BA 3KCXA 4IL2A 2Z2BA 2J8FA 2FDGA 3J7HA 3AMGA 1XE0A 3I2FA 1GQJA 3HGSA 1H9PA 1OA2A 3CS2A 3KM8A 4LK7A 4ATFA 3CL6A 3NPUA 3T0TA 4QHZA 3GY1A 4KKXA 3W6MA 3L4UA 2PTDA 5CPLA 2J22A 3HEIA 4RE0A 4CEYB 4MB5A 1UWWA 5FXZA 5AFBA 1XOYA 3RM8A 4NILA 3E3HA 2HWD3 2GVLA 4FPLA 4W8JA 4W7UA 1OUXA 3GNDA 3WD2A 5K4LA 4GX8A 3QCWA 2NMNA 3YPIA 5DUWA 4YM3A 1FWHC 4ZXOA 2J47A 1YDYA 2ZEYA 5HR6A 1XDMA 3AC0A 3TXVA 1YNAA 4H83A 2A3EA 2NQ5A 5LGZA 2P10A 1Q6OA 3LCPA 3RM4A 2QCMA 1A4MA 4ONVA 3RVHA 3MDUA 2NQHA 1WLDA 2CXGA 4Q8PA 3VCCA 3ZXFA 2CHNA 1FWEC 3NQVA 4IDZA 4JTNA 5T52A 1QPRA 1JULA 3LM7A 1REQA 1RJPA 4CP1A 3B0PA 3EDJA 1GVEA 1O66A 3VD5A 4IP4A 2I56A 3D6NA 5M2FX 3HQRA 2O4MA 1VFHA 4IV3A 4FBFA 2R82A 4QLKA 5T54A 3RM9A 3VDGA 1NEYA 4OYUA 4IUGA 3W9ZA 3AIQA 1RUC3 3LBOA 4CNOA 1OC5A 3SY5A 1QFEA 2K2SA 2X8KA 3V5OA 3ZMRA 1AR72 2Y7EA 3G0SA 4P7OA 1R0MA 4FNQA 3RLHA 3LI0A 1E9IA 5JPNB 1NH6A 4P00B 1G9BA 3BLIA 3W1RA 5LGXA 2X05A 1S5WA 2FYMA 1TWDA 1IS3A 4MXWB 4QHBA 2RDRA 4DJFC 3AJXA 1OVSA 4JDOA 1GZTA 2XVGA 1Q6LA 3PBVA 3MUCA 3U2ZA 5T5JA 2E7FA 3L67A 1XPGA 3TH6A 2OEMA 3ZFEA 5JMUA 2PAEA 4AZBA 3RF9A 1H4HA 3NDZA 1PO9A 2BY3A 1UUMA 3W7PA 1AF9A 4XABA 1GUIA 2WAOA 1LOLA 3M5YA 5FZFA 2EAWA 3ID7A 3HN1A 4U4MA 4RS5B 3QW4B 5EYXA 2V5CA 4MH0E 5JXIA 2XKOA 3GHNA 2D2OA 3TR2A 1W0NA 5BXSA 4D6FA 3WXPA 1BGAA 2O0OA 1VBUA 1H50A 1XDLA 1QOSA 1JCJA 5H9SA 4ZZ5A 4B16A 4YZ5A 3OZPA 3ZYRA 3UXIA 3RJYA 5HQLA 3PZNA 4S3GA 4GUIA 2JD4A 2TBVA 4P9LA 3SFKA 3VIKA 3W73A 2X29A 1CX1A 3NL6A 4PTNA 4OUSA 3O1TA 1QI2A 2OZ3A 2B81A 2AMXA 3M07A 3NQCA 3S6DA 3P2VA 1S3TC 3HNMA 1QWGA 3BH4A 2XJRA 3ZXWA 2B7NA 3ZFEC 3WNMA 2WSRA 4H41A 3BGAA 3LHUA 1HO1A 5FCCA 1JI2A 4M4RA 3TKFA 5JH2A 1VAKA 1DJYA 1U33A 2LLEA 4R4XA 5CPMA 3VC6A 2ETEA 2CTVA 1KO0A 1K45A 2A3BA 3N7KA 1AX2A 1AXZA 3WY1A 3IPWA 4Y1ZA 2AAAA 3PR2A 1NCQC 1UZDA 3T7VA 3MKVA 1POV0 1PHMA 4N90A 5BY5A 1TTPA 1ZFJA 1ZZMA 2YFOA 3POIA 5CB7A 3HBZA 3C3NA 3EJKA 1VP5A 2XDVA 4QWNA 1H1IA 2BWCA 2YBTA 3ZWTA 4FCAA 3WELA 2VR2A 3MS8A 5I3FA 3GZUC 1EUNA 5HWJA 2JXAA 3KOZA 1FYUA 1L2UA 2DUQA 1BVVA 4LKDA 3VD7A 2DCKA 4Q26A 2B4GA 3OPZA 3TYCA 4AVCA 4HMNA 5F2LA 5KHJA 2QPUA 4R9BA 4RS5A 2R1BA 3GGLA 4D7TA 1OHLA 1ZNNA 2A7NA 2BLEA 1B4KA 5I7GA 2QPXA 5M0TA 1EJWC 3MT1A 4IHCA 4W6XA 9XIAA 3TAKA 5GLVA 3OHIA 4ISRA 1K9EA 1U12A 1O95A 1W1A1 2ZRZA 4X60A 2PAMA 2ISSA 1LENA 1JCMP 4J4KA 2Z79A 1PPIA 4LS2A 3R4DB 4B15A 5HAOA 1VRXA 5CSRA 5AYIA 2VOMA 3WV6A 2J62A 3FUOA 4NI8A 4ZBCA 2G9FA 1VBJA 1XGZA 3OY8A 2YXOA 4D69A 1A4LA 4PUEA 4LO6B 1VQTA 1XQNA 3V5CA 3BV7A 1DL3A 2Z2AA 3B8IA 2QJHA 5B7ZA 3X29B 4YLZA 2Y7DA 4O8AA 4ARYA 1OFBA 4JEJA 4XFCA 4G8TA 4NZ4A 3B0VC 2VY0A 1CB2A 3HJRA 3V56A 4Q33A 4RNHA 4ZOBA 1V0MA 3VKMA 1QY4A 3CZ8A 1HT6A 3OCPA 2ZGPA 1M7PA 1Q6QA 4Q7IA 2FQPA 1OBAA 1RALA 1ZJIA 3L4WA 4M24A 4DIQA 1POQA 4IP5A 3N18A 4MPKA 3ES7A 5T91A 2DQXA 4PJYA 4O50A 1B09A 3BZGA 3SUVA 4JAWA 1RBOB 1BQCA 4Q0UA 3G6MA 1W2VA 1SO6A 5IFPA 4QEHA 1WA6X 3THDA 2C18A 3W7RA 2I7GA 1TCDA 1NM9A 4JV4A 2X8RA 4EP8C 4QE4A 1U30A 4YW5A 3R0DA 4OUEA 3BAYA 1WD4A 1UPSA 5KHGA 3CBWA 3H8RA 2YPJA 1T8XA 3M0YA 4H55A 2CHHA 3NZPA 3GG8A 4JQ1A 2VFGA 3ARQA 5F6KA 3O1UA 2J42A 2QQUA 4M3CB 2DURA 2HWGA 4YCOA 4QR6A 3H3ZA 2OPKA 4BK5A 4CEWC 4I5XA 3RCYA 1RCQA 5BOEA 1TZ7A 4XF9A 2JE8A 4TLGA 4V2WA 4G7FA 3AKQA 4Q4X3 2V72A 1GVFA 2K9ZA 1CZSA 2FZDA 4AHQA 3SCRA 4INFA 4K8RB 5PTDA 4YVWC 2PCEA 2OLAA 1S5MA 1DJQA 3AS0A 1H63A 4IMEA 3UR5A 1LDCA 4GFSA 1RUNA 1QAPA 4QPGA 3LU2A 4BWLA 4FSAA 2E31A 4QM9A 3KXQA 1XPYA 1RP9A 5C9RA 4BU2A 2PDJA 2WS93 1ZBCA 3PVEA 1J0YA 3AP7A 1F6PA 3Q94A 1W8NA 1BVNP 3VBOC 3R05A 2J66A 2ZGNA 1KW1A 2W5FA 4CP2A 1G6CA 2PHXA 2QQOA 1FDYA 4YNGA 1W6PA 2POTA 2O14A 4OBTA 2JG9B 2V38A 4JQ4A 2GP3A 2FCUA 3RYPA 1J96A 1QXJA 3KWXA 2VURA 4QQ3A 4ACYA 3KV4A 5FMBA 2X1TA 1ONAA 1V3KA 2GMMA 3SMHA 4B8EA 1IXPA 2WSUA 9XIMA 4L4MA 3D46A 2HDJA 3TTQA 2XN2A 3TTSA 4G4FA 3ONBA 3R6IA 3R6SA 2H6RA 5JI9A 1QJY3 2QJVA 4X3ZA 4MFEA 2P4EA 3COTA 1NCQB 5EFUA 1IGOA 4XSLA 4AG4A 3E74A 3ALFA 1N1TA 2NWRA 2VCMA 3V1PA 1AQMA 2V0TA 4HMDA 5FY0A 3E96A 3LENA 2WQ8A 1T6BX 3W7CA 2X53S 1YLVA 3FEMA 3W6LA 1NIUA 3VKAA 2QS8A 1UBSA 2HPIA 4AXNA 1VEMA 3H3UA 4NI3A 4DIAA 3WEOA 2J77A 4JTCA 3I3QA 5AC92 2E25A 2Y4SA 1I8JA 4Q4Y3 3LHWA 3RLGA 3U11A 2H0BA 2GQAA 5A3OA 2XG3A 3L2MA 1N3OA 5BWAA 1I60A 4H8NA 4UMCA 3H54A 2ZBTA 1KFBA 2CU0A 3ZVHA 2BV4A 4QGCA 3QFWA 2P17A 3HVDA 1XRFA 3LNMA 3RCNA 3K75B 4N7UA 3NRUA 3ARVA 4L5ZA 4Q4W2 3OYXA 2QTWB 4CPBD 3KFTA 3GVGA 2A6WA 2HV5A 2W1SA 1EDGA 1PGSA 5AHNA 1DJXA 4MV2A 3LGGA 4BQYA 2DFBA 2PELA 2VVDA 5E0CA 1MQQA 2NV1A 1CZVA 2WS91 1WZLA 5E1QA 4UTMA 3LPOA 3NVCA 3AROA 1E5SA 3PM6A 4MYAA 1HRI3 4AFBA 5JIPA 4LSBA 5XINA 1L3JA 3LLDA 1WCQA 4Q6XA 2G8ZA 5T5OA 2RDXA 2B39A 4TXWA 1C93A 2YC0A 4EN0A 1LL4A 2NX3A 3CJIB 4S39A 3FMGA 1N8IA 1H7WA 3WLUA 1V0AA 4YGDA 2NP0A 4JXCA 2DQWA 4W5ZA 1E6PA 1TUFA 1CPMA 2XH4A 4O52A 4CN6A 1POKA 3S42A 2W61A 3MUAA 3L9CA 4JHTA 2XM2A 1W28A 1GOFA 1SHWB 5JXJA 4Y9MA 1IXQA 2VP8A 2ZHMA 2DDUA 2ZXDA 2VBBA 2OPWA 3HMYA 3D5OA 4XDPA 5FO9B 3VO0A 2FCTA 2YX0A 5K9XA 4NIGA 3JB8A 1B5TA 1UKSA 4UQBA 5KMYA 1OC1A 2FTPA 4C1NB 1POJA 2DSKA 3OVRA 1LTEA 1H8TB 2ZX5A 4Y1VA 2NSXA 3CMJA 3L4TA 4YXGA 1PGW2 2JDUA 2VZ1A 4ZU7A 2GZXA 5IK5A 2QNEA 1UZ0A 1CYGA 4H4IA 1TMF3 2VUYA 1V79A 1LOAA 2GN7A 1H5YA 2Q5TA 3BCDA 2WYFA 4CPBA 1EXPA 3F5KA 3VKBA 4US6A 4HSOA 3W75A 3AMPA 1DIEA 1SVDA 1EYEA 4HOWA 3SFWA 1DWFM 3ROUA 4PUKA 1OFOA 4K8HA 4LS0A 2P1BA 3T2OA 3J7LA 1QQP3 2ZZJA 2UY8A 2C26A 4GXPA 1ITUA 3QF0A 4DJDA 3C2OA 1ZU8A 4OQ9A 2DVUA 2V5JA 8XIMA 3WHUA 4CDUC 3EPMA 5ANNA 2HWC3 1FMD3 1PL9A 1D7KA 5CFCB 4ZXEA 1FP9A 3U4SA 1W1TA 4JFTA 4JGYB 1NLQA 3L5LA 3JUGA 4LVAA 2HK1A 2Q8DA 3DPRB 3VOCA 4GVIA 4BI6A 1RGSA 2OQYA 3CM4A 3WNOA 1ADSA 2XL9A 5T8GA 1TR1A 2I2SA 3HWJA 3L5AA 1IS4A 3FSUA 2W1UA 2ZTNA 2F2KA 4E6MA 2INZA 4W50A 1E4LA 4WSHA 2ICSA 1R092 5C0QA 2PXJA 1BK1A 2NLYA 4UMBA 1SACA 4PIZA 1UD4A 3VINA 2V5LA 2QUOA 1A3WA 2Y33A 3SUTA 1VPHA 2BVBA 4AQLA 1R9ZA 1IXNA 1JRBA 1XIDA 3UW6A 1OK6A 1A34A 1RSCA 5ANQA 4UI9L 1UZWA 3L23A 1CGUA 3PUOA 1M5WA 4ZS3A 4TOQA 3AZZA 1QNYA 1DJIA 3AYDA 3B9CA 4CP0A 3H8UA 4LYRA 2YL5A 2VXJA 5EP9A 3PU3A 2PURA 3ZYGA 3JD73 1FWBC 1POV1 1OC7A 4YTRA 4X0VA 3IACA 4DNYA 1KCLA 4GYFA 3H3LA 4RV3A 8RUCA 4Y22A 1R3VA 3UWZA 5ECVA 5D02A 1ENSA 3LRKA 1YE6A 4H04A 3KQRA 5C3QA 3WX7A 1V6MA 4RNFA 4MNLA 3R0KA 1TZZA 1REFA 1V51A 1VPYA 1R3TA 1SFTA 3WD4A 3W7KA 5I79A 2SBAA 1SFLA 4H8UA 2QLYA 3UGHA 1EJVC 3BURA 4JTKA 2EQDA 4UTWC 1AL21 5JR7B 4Z08A 4HOZA 1SJAA 4TU1A 1RQBA 5FEZA 1ONRA 3C4UA 4NAMA 3W00A 2R073 3HURA 4Z2HA 1UPIA 1B1YA 1S2KA 3NVTA 4NT0A 1YYNA 3VX1A 3NQAA 1XIFA 2XFFA 3AO0A 2WA4A 4LA3A 3CV6A 3KT7A 1OOPA 4JRLA 4NVTA 3CAWA 4HLTA 3LTPA 2CLKA 2A71A 3EHKA 1W6TA 1YTDA 5AC8A 3TQVA 4MLOA 1KQZA 1SQ7A 4WVVA 2PHFA 1ENQA 3G8RA 3WSOA 4CD5A 1AFSA 5AOUA 1UD3A 3B97A 2Z4GA 4JX6A 1EKOA 1WA4A 3K2OA 1WLCA 2WT1A 1R3RA 2E8YA 3ZJ6A 2PEVA 1LT8A 2Q8ZA 2YMZA 1MZ5A 3U0HA 3OSDA 4JCMA 5HQEA 3P5YA 1FOD3 5GKAC 1JRCA 4GAZA 4QTGA 4JN7A 2WN2A 3BPZA 2YB7A 3N3HA 2CBVA 3N25A 4HXCA 4MDOA 4F0LA 1I2RA 3IMNA 1XIEA 3NTYA 4G1NA 1M7XA 5J8LA 2ZZ5A 4CCEA 4AEDC 3EA1A 1DWAM 2G3FA 4ZE5A 3KL3A 2QCLA 1OSEA 1NDYA 1UPPA 3QXBA 3GR4A 4HNVA 3IVSA 2E32A 4LR4A 2C8NA 1XP3A 4JY9A 4C6IA 3M44A 5CU1A 3M0IA 4H9YA 5H6HA 1Q8SA 2KAUC 3UZXA 1X97A 3RILA 2VZTA 2J25A 1K02A 2Q8XA 3C8XA 2YW3A 4K7JA 3GW0A 4HZ7A 1QJY2 4H9MA 4WY0B 5CPOA 1N1VA 4HN0A 1GOQA 1IGSA 3CT2A 1W3NA 5BXTA 1JCNA 6XIMA 4IPJA 4H6RA 4MNJA 4OHZA 4AF9A 2NYYA 4GPNA 3NJVA 2W79A 4B5XA 5CAHA 1R47A 5D4YA 2AEZA 5FP9A 2AGKA 4QLJA 1R7OA 1RK5A 3SCWA 2QDEA 2WSQA 3HG4A 5BOFA 5FY5A 1DQUA 4JDMA 2YB4A 3T3YA 3B4YA 1MS1A 3ALGA 3W59A 1OM0A 5FUIA 1VBHA 3MDPA 3CPUA 4FX6M 1UY1A 5ABFA 5DUVA 2WRAA 5SV8A 3BC9A 2AQWA 5EMYA 1RY8A 4YPJA 2OYLA 1GICA 3VZLA 4HGXA 2KZHA 4NU7A 5FMCA 4XSMA 4D6SA 1E51A 1V03A 3LV6A 1G9DA 4H8VA 3LF7A 2H9AB 2RDWA 1PS9A 4MY8A 3BOLA 2PF0A 5CC3A 1M06G 4F2TA 5FZ9A 3AMMA 1GOKA 5JPMB 2Z7KA 3AIRA 2ZGRA 1J2BA 4XHXA 1ESWA 3PIGA 1OC6A 1OD0A 2ZGLA 5I0UA 1H62A 5CPQA 4L56A 1IR2A 1WBLA 4BQ2A 1JUEA 3W26A 3F7JA 1JZ2A 5DAXA 4D7SA 1DXIA 4OWGA 4D9PA 2CLEA 4K1YA 5REQB 3CZJA 3CU7A 4P9WA 1V70A 4TSVA 3DXTA 4KERA 4UTUA 4ATDA 4WEVX 3E38A 2AMGA 4E4PA 2YSWA <