4CCCA

Structure of mouse galactocerebrosidase with 4nbdg: enzyme-substrate complex
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
644
structure length
640
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Snapshots Illustrate the Catalytic Cycle of Beta-Galactocerebrosidase, the Defective Enzyme in Krabbe Disease
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords GALACTOCEREBROSIDASE
total genus 218
structure length 640
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4cccA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4cccA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4cccA01
1TMHA 4AEEA 1E4LA 2ABAA 1FWNA 1YDVA 4NF7A 1T8XA 2PC8A 4K39A 1OG0A 1WV2A 4QNEA 4ADUA 4E2BA 1OABA 1K9TA 1VEMA 3NPUA 3K4AA 3L2LA 3OA5A 4D6IA 1VRDA 5CG0A 2ZUTA 4CCEA 3N11A 3A23A 4JKMA 4EE9A 2YL8A 1DQXA 1JQVA 2G5WA 2OX1A 1H0IA 3WF1A 1PZ2A 2ZXBA 5CGMA 3MSGA 4AHPA 1FDYA 2YDSA 2DH2A 1RP9A 3SUWA 2VX7A 3M5ZA 2CCRA 3OLIA 1KFEA 1LBLA 4TOQA 1GG0A 3WENA 2YDAA 3W2NA 3TC6A 1QBAA 1J18A 2DZXA 1XGZA 4Q7NA 5K9CA 4W89A 3VDAA 3CQ0A 3W7NA 1LM1A 4PCFA 3W28A 2XYLA 2ZWZA 1VB9A 1R7AA 2W67A 1KW1A 4O1DA 4PMOA 1KBIA 5FD0A 1VJIA 4KFPA 4PC8A 4POCA 3W87A 3G24A 2DIEA 3AYSA 1UASA 1US2A 3DI0A 2E6AA 4OBSA 2E9LA 1JR1A 1TPVA 3E49A 4W5ZA 1XRVA 4GRSA 3UY8A 1C92A 3ZT7A 1NAL1 4ZE4A 3ZJ8A 4KGJA 4PMNA 5JBFA 3F4NA 1D3CA 1UHVA 2DORA 1DEDA 4PL2A 1KQZA 1XCWA 4FNPA 3PZOA 1P0KA 2DJLA 3WD1A 1Q6CA 2O9PA 2F61A 1KFKA 3L4VA 1F4HA 4I7VA 3ZWSA 1YADA 2H8ZA 1UWRA 5HNRA 2QCHA 5D38A 3VM5A 2YL5A 3HGRA 4AZ5A 5I2UA 4EIVA 5AB3A 1SO6A 4CVWA 3C6CA 4AF0B 2QCMA 3MI2A 4U2ZA 2CU0A 1WDRA 4MY8A 1HO4A 5L6UA 3VGBA 1ZNNA 3BW2A 2VZOA 3EB2A 3T2PA 3WL1A 1PAMA 2X30A 3DENA 4ZQRA 5DMYA 1JCLA 3LHZA 5ABEA 3UG3A 5HOSA 3IGXA 2WM0A 3SCRA 5CQ1A 2V81A 3TCEA 4JZ5A 1YLVA 1OFAA 5I3IA 1HVXA 5D4YA 5D32A 5M5DA 1JCXA 4ICNA 1WPCA 4U5IA 3ZSTA 3FXYA 3N2XA 4CD5A 1R47A 4EAMA 4MZ8A 3M47A 3TTQA 3M43A 5AOUA 4AD3A 4MDOA 2J9ZA 3A5VA 4WSKA 1DWFM 3CZJA 3N17A 3MV01 3WF0A 3HPXA 4IXXA 1KR0A 1ADOA 3EKLA 5F4WA 2ADEA 2FGZA 1UWUA 5LNWA 4JKLA 3BSHA 4PN2A 4A29A 3I3BA 2CLIA 3VD4A 3R5EA 1L2UA 4B9YA 4HNUA 4JCLA 1KLYA 1AW2A 4C7FA 3VNDA 4FB7A 4QAIA 3WH7A 1UWSA 1E15A 2GJXA 4EF9A 3U75A 3C52A 1W5PA 1UD8A 1CLXA 4O4WA 3QEZA 1VENA 1ZFJA 1WB0A 3N19B 4W9TA 2B7OA 3ELFA 4FX7A 4D2JA 3GNPA 4AY1A 3P80A 1CDGA 5FOOA 4XB3A 1DL3A 1OCQA 3RO8A 3QMSA 4YXGA 1C7SA 3A4WA 1ZBCA 2G3IA 3W7LA 1ZAHA 1C8QA 5I3DA 5A6KA 2D3LA 3EWBX 5HJLA 2CHOA 2Y7DA 1KBBA 3N9KA 1LF1A 1FFQA 4C7GA 3TOPA 2RDTA 2JKPA 3IIZA 3GDTA 5HPOA 1D3GA 2J9XA 1EX5A 1ME7A 3QHOA 3UG5A 1PX8A 3LRMA 1V6VA 4FO4A 1MXDA 1CI1A 3ZT5A 1SW7A 3NA8A 3RFAA 1DJQA 4JFVA 3EDJA 1XCFA 1M01A 1EDTA 1E5NA 4M6PA 5ABTA 3IIXA 5K4ZA 2V5CA 4Y6GA 4NZCA 4DEFA 1J01A 3SZ8A 1LRQA 1XKYA 4UZUA 3LHTA 4LVBA 1NARA 1SYTA 2G97A 4D6DA 1VFUA 1WZLA 3ZJKA 1X7FA 4MB4A 3W24A 3HOJA 3PF3A 4E2DA 1BHGA 4PMRA 3GXTA 4H8VA 1JZ6A 1SFJA 2ZUNA 1OK6A 2ALDA 1CXFA 3OHIA 2B7PA 3T0AA 2W92A 1SSDA 2Q3RA 4FMVA 5EL1A 4HOWA 3QOMA 4O11A 4ZXOA 4YCOA 1BWKA 1KFBA 4UR7A 1CYGA 1YXDA 3UGFA 2YZRA 3A3HA 4V28A 1IGSA 4X22A 5FCZA 2VFIA 2QQVA 4CCCA 1BAGA 3IJ9A 3SCPA 1TV5A 1HJXA 3TIMA 1OYBA 2ESCA 1CGYA 1QI2A 2WVVB 1LL4A 5I6SA 4JIPA 3KRUA 1WYIA 4CQAA 4EQVA 5FIXA 3OBKA 1B31A 2QDHA 4TTGA 5IXEA 5C2XA 2WOQA 2PC4A 3EWZA 4P8WA 1FCBA 2VFGA 3EX1A 1HVQA 4TU1A 1CGVA 4GBUA 5K7JA 3HIJA 3S5ZA 4K7VA 4P8XA 2X1UA 2DT3A 1WXJA 3W25A 3QPYA 4MPQA 3TSMA 1VAHA 4K36A 3T2QA 5BW6A 3WK1A 3I7RA 1HFBA 4K38A 2NLIA 2DJXA 2KZHA 2DZSA 2RFGA 1U5JA 2CLLA 2VFFA 4L4LA 1O4UA 1IT0A 2XQRA 1JD9A 4U28A 3O16A 4MLJA 2DZWA 3UPBA 4JTFA 5F7UA 2BLEA 2V8ZA 2OLHA 4CU8A 1EOKA 4KFNA 3AJXA 2P10A 5IHSA 2FLIA 3C61A 2CETA 1YTDA 1YQ2A 4BI7A 3THQA 1ISYA 3ARXA 4RE3A 3A47A 2UWFA 2Z0IA 3UWQA 1J0JA 1VJSA 3HMCA 2ZTKA 6ALDA 1P1XA 1M03A 1OGBA 2GQ8A 3S42A 2GQAA 4MFDA 1CNVA 1VHNA 2WLZA 2ZXDA 1AW1A 3MO4A 5AYZA 4JTSA 2YW4A 3DH7A 4Z0JA 3DHUA 4XUYA 4W7UA 2Y88A 3VD9A 4AD0A 5A8NA 1IZKA 1EPXA 3AIEA 1H4PA 5AHLA 1XC4A 3NM3A 1JDAA 1F6KA 4UTLA 4BQ4A 2IQTA 5E1QA 3W7HA 3UR8A 3VX0A 5AHIA 4LS1A 3GDLA 5D37A 1HKIA 1TMQA 4DWSA 5BOOA 4N02A 1E4MM 3SI9A 1EO7A 3W27A 3UXDA 1H7WA 3BW4A 1TVPA 3F5LA 1KTNA 2Z1KA 9CGTA 3TA9A 1MQRA 1B4KA 3ANYA 4R7JA 2ZFAA 1K8ZA 5BXSA 3TSBA 1NFBA 1W8SA 5A8MA 1FH9A 4P8VA 5AN7A 4LYRA 1ZS2A 3EWUA 2XIBA 5D9PA 4PFMA 1H2JA 3FHQA 1TRDA 3L0KA 1B9BA 4AZZA 2QCNA 4JX4A 3W9ZA 3WNMA 3LMYA 2BY0A 5A1AA 1B4EA 3W2KA 2XSBA 3K30A 3LPOA 2ZX9A 1H09A 4MJ4A 4GZIA 1E3XA 1OGGA 3N12A 3NZ1A 5I5RA 5FI8A 5A6BD 4UNLA 1IXQA 3UWWA 2WCSA 3EMZA 4CGTA 1KM6A 4O28A 2XVKA 3CWNA 3FYPA 1ZHAA 4HSNA 4FF7A 2B31A 3LI1A 2E9MA 1WQ5A 4RL3A 1MYRA 3FIGA 1TZ7A 3LTPA 4D1IA 3W72A 3VDCA 3G22A 5AFDA 2OWCA 3EDFA 3SC7X 1XBZA 3HQ1A 1WX0A 3CGTA 1WDSA 1DWJM 3BV4A 2FIQA 3I7SA 2J78A 1M53A 3CHVA 4TX8A 2J9YA 1KR1A 4LT9A 1E6ZA 3TTSA 2V3GA 2F84A 4UTTC 3WFZA 4LW7A 4AZIA 1H61A 1PE1A 5FF3A 2W6RA 3K8LA 3IJ8A 4B16A 3L4ZA 3PBVA 1LG1A 1Q6GA 3W1QA 1VLIA 1I2QA 4TXEA 1TUXA 1H1YA 5KZ6A 2QQUA 1L8NA 2W63A 3W0KA 1P0NA 4TUFA 3QR3A 5KITA 3DAQA 1KFWA 3SJ3A 5HWNA 4P7LA 2VEPA 3AOFA 3S1WA 1G4SA 2QPUA 3M1ZA 2E40A 2VVNA 1CBGA 1ME9A 2E6YA 1EH9A 3WF4A 3TROA 1GQIA 3EX3A 1OBAA 3NQVA 3B0VC 3W1LA 4DWSB 4OV4A 1KCLA 5FEWA 5AYIA 3LHYA 3TV8A 1RD6A 3OLEA 1H50A 4AIEA 3PBGA 3GR7A 4FNRA 3AZTA 1J0YA 2OSWA 1B30A 2WHJA 4AXNA 3WN6A 2AMGA 2QCLA 3EEGA 3NDZA 3N1AA 4YHEA 4DWSD 3BCDA 2DPEA 5FL0A 2QAPA 1V5XA 1OFBA 4MZYA 1U33A 2VZTA 3GZ3A 4TMCA 3IJ7A 1YYAA 4Q4KA 1VHCA 4O17A 3UWYA 4JNMA 1V6UA 2A3BA 2YXGA 1IZJA 5ABGA 3W3OA 4K8EA 1LOSA 1C9DA 1JGIA 1W9BM 4GO9A 4UMBA 4LPCA 2V2HA 1KXHA 4AHOA 3BW3A 1MW2A 3MMWA 5U7SA 2BFGA 1AMYA 2WVTA 3LHVA 3QZEA 3WJWA 3EYPA 5IHRA 4JTUA 1BGAA 3G3MA 3T7VA 2VQUA 3S1VA 3HGOA 1CXHA 2GUYA 2EPNA 3FYOA 4QQ3A 1UUQA 4OZOA 1RZMA 2W0UA 4BI5A 3ZWTA 1GCYA 2WPGA 4UFIA 1XBYA 4O1BA 1KGUA 2EGZA 4WSJA 1UQZA 3ARTA 2PE4A 5ABHA 4H6KA 3WQVA 1W5QA 3L9CA 4AAJA 1KBKA 2VXNA 5FF2A 3W7CA 2G8ZA 2CZ5A 1RPKA 4K8HA 4N4PA 4FHAA 1KV8A 2GJXB 1AVAA 3PC0A 3BXWA 1UYPA 1CGTA 2WANA 3UEQA 3IIPA 4YLWA 3AO0A 5J5RA 2V3EA 4O0KA 4KMQA 4R53A 3O2LA 1P4CA 3W81A 5BNKA 4CD8A 3PZTA 2A21A 1F6PA 1K8YA 3P62A 3QMRA 2GJNA 5G1TA 2DU2A 4ORIA 2X8RA 3QHMA 1J10A 3VOCA 1H1ZA 4H7VA 4KWWA 4ORMA 1E6NA 2XN1A 1UQYA 4Z1BA 2Y89A 4EOUA 2G4FA 1SO3A 1FDZA 3DFQA 3WK2A 3WEZA 1GUVA 3T2OA 3KHJA 2V5DA 3L5MA 1MZHA 4MAZA 4K37A 2XGIA 1JXKA 4HN4A 2XFRA 4DUVA 3PZGA 3WFAA 3GAKA 4FLOA 3IVTA 2VRKA 2YCEA 2B0MA 3P7YA 2GJLA 3P5YA 4TTUA 1ECEA 4LV4A 3AS2A 3WNKA 3RU6A 3IANA 4IMEA 2ZRYA 3NL6A 1ISZA 1BYBA 1V3HA 1A3HA 1AQMA 3WUGA 1TSIA 3O6AA 3U5UA 4A3YA 4AEFA 4D71A 3N13A 5D03A 1LRNA 4FNUA 1E73M 4JIEA 2X16A 1XBXA 4GI8A 7A3HA 1O5KA 2FHFA 1XUUA 3RMEA 3O63A 5I24A 3ZR6A 5I78A 2E1DA 4N6FA 3NQFA 1G67A 4UTJA 1WDPA 1KXTA 3EXSA 3NQ8A 1TFVA 3NIYA 1XDLA 3UZ5A 5DBUA 2GVJA 1W9DM 7TIMA 4DO5A 1B90A 3TDFA 3SCVA 4NZJA 2WMKA 4OGZA 1VEOA 1R85A 4JYFA 3D5HA 3TU9A 3PN8A 4NRSA 2DT1A 1XD1A 1WP6A 2I9EA 3WY1A 3SGZA 5AC7A 4NNBA 1GWJA 3M9YA 3WQWA 5C5YA 1QHZA 4UFLA 4J3WA 1SQ7A 1R46A 1OFEA 1OVDA 3STGA 3BG3A 2WBKA 1GOXA 4CD6A 1LORA 2VC9A 3WD3A 1C90A 1R30A 2OJPA 4MLRA 4I7UA 1ICPA 4M80A 3IEBA 4S2BA 1SSGA 4UC5A 4UNKA 3DFOA 3HB9A 5FESA 3FLUA 4W88A 1I4NA 1W9UA 3SUSA 1TYGA 3U1XA 2CLEA 2V3DA 1H7NA 3F4VA 4KGLA 2WWCA 4W8BA 4WJEA 3FA5A 1OF6A 1W0MA 3V1PA 4HZ7A 4P8UA 3FS2A 1B3ZA 2EPKX 1EIBA 4D6FA 4F66A 2VKZG 1KTCA 5HUPA 4MNKA 5A69A 1UUOA 4JTIA 3H55A 3PVFA 4WQ6A 4JDBA 4Q33A 5HULA 4UTWC 4YMZA 3ARYA 1GVIA 3R8RA 4IGHA 3TQ0A 5CLWA 2X1SA 3L68A 4CLMA 2Z1BA 5FKCA 1A5SA 5A2AA 4D72A 1RVGA 3SCOA 4V27A 1EUAA 1NWUA 1YHTA 5A8PA 2GVLA 1W1YA 3S0CA 3FEMA 2R8WA 1TPWA 1J2WA 2QCCA 3G1VA 4WX2A 3TW7A 3VFLA 2DH3A 2VRJA 3VIHA 2NXHA 4MYXA 3WH5A 1CLVA 3ABSA 4NU7A 2NT1A 5IFPA 2V3FA 1FA2A 2OYMA 1SO5A 1KFCA 3WF3A 1R7OA 2ISWA 4TVDA 4OIFA 4DELA 1Q3NA 1G0CA 4AZ6A 3ZT6A 4O50A 1VIWA 2QV4A 3ECQA 1B1YA 2CBUA 1UR8A 1YPFA 3NAVA 3WBAA 2YR1A 3SIMA 4X9YA 2XVNA 5BMWA 4JTLA 1ITCA 4JFWA 3FJLA 1GQKA 1E71M 3AHVA 1K03A 3I3EA 2VL4A 3VIJA 4JTJA 2EPLX 5DY2A 3PUDA 2XFWA 3Q2DA 2ZXAA 4WJXA 1NF0A 3D0CA 2C7FA 3PZIA 4IMGA 1EQPA 1TA3A 4W8LA 1TV7A 1HL9A 4D6HA 3QGVA 1IXOA 1R87A 1HT6A 4ZVJA 3HPSA 1QNQA 5JBDA 4RZ6A 5HINA 2TMDA 2CHNA 1PS9A 5A6SA 1TPDA 4BWLA 3SUTA 1CGWA 3M5VA 4DQWA 4B9ZA 5EKYA 1KFLA 1G7UA 2WHKA 4EANA 3W38A 4IISA 4IM4A 1GVSA 4LGXA 2C3ZA 3WQ8A 3CIVA 1ALDA 5LGXA 4UQ9A 3HMJG 1UH4A 7TAAA 4NRRA 3KVKA 3GDRA 4IQLA 4RKAA 4AZGA 5LA1A 3N14A 1LL7A 3P82A 3BAXA 3MJYA 2BV9A 4MNLA 1RPXA 4LVFA 5E0KA 1L6SA 3ZR5A 1JFXA 4AYSA 2J27A 2BVYA 1NEYA 3S2CA 3LCFA 3EBVA 2OT1A 4HPJA 3W23A 4MB5A 5EFDA 3I68A 4UFHA 3WKZA 3WJXA 2WBGA 3W2JA 3NNTA 3LOTA 3AZSA 5F1UA 2J7DA 4AIUA 1RQEA 1L9WA 4WLCA 1MQQA 4AZ7A 5HBFA 3STEA 4PSRA 3SSJA 4EF8A 1DTUA 1XD0A 5HR6A 3AIUA 5F2IA 1EHNA 1KV5A 1U30A 4GIAA 4OJYA 1HJVA 1GVFA 1W32A 5ANNA 5LNUA 3QRHA 1CXLA 2YBTA 3HG5A 3VGDA 4NI3A 4NT0A 4V2XA 2XN2A 2FTPA 2EAWA 2J62A 1B3OA 3HU7A 2AC1A 2NX9A 4JTGA 4UMCA 5HXMA 1E40A 1WZMA 4TVCA 1D2KA 4AB4A 2CBVA 3B9DA 3LIGA 4IPLA 1W2TA 2HSAA 5CZSA 1TPEA 1CEOA 1XYFA 2ABBA 4UR9A 1HKKA 5F2GA 3PBYA 3GTNA 5G5IA 4JICA 3NEVA 1LTDA 4UNIA 1US3A 3BGGA 1BKSA 3DYOA 1HUVA 2WSQA 2ZDRA 4DM1A 4QM1A 1RR2A 5AC6A 4DF1A 2TPSA 1OFPA 4JTEA 4PMYA 2GDUA 3IGSA 2UY3A 3AFBA 4XBKA 4P7OA 1SMDA 2JIWA 3L2IA 3VD7A 4MUZA 1QI3A 3W74A 5G2IA 3VGHA 2H3BA 1IXPA 2VCBA 1SFLA 1R2SA 1YDOA 1UH2A 2XWEA 4Z2IA 4QCEA 4JEQA 1SMAA 3AMGA 1M7XA 4FFFA 3OZOA 3PTMA 4OOUA 4JGDA 4OUEA 4CD7A 2DZPA 1EB3A 2PRHA 5D04C 1LZOA 1BWLA 1KM1A 4ZMGA 1J0HA 2J7CA 3NJ3A 7CGTA 4Q22A 3KRSA 2GQ9A 3MW7A 3O6DA 4AMAA 1DQWA 2FJKA 4AEOA 1P5BA 3W22A 2AGKA 4CU6A 1JZ8A 2V9DA 4FK9A 3RNDA 3LXBA 4S2CA 5EY5A 1KM5A 2Q8XA 5GNXA 2WK2A 4H04A 2W61A 4MDPA 2WXDM 3UNDA 3BLEA 2DDXA 4UQCA 2VR5A 5D9MA 3O15A 3W4RA 5D09A 1TTQA 3W07A 2O7QA 3VE9A 1TPB1 2ZUWA 1WA3A 3AXXA 1UD5A 1ODZA 2E5DA 3ARRA 2VEMA 4LY8A 4NUWA 3LLDA 3RLVA 5G4WA 1OGSA 3BARA 3FOKA 5D2YA 3HG4A 5M3WA 4Y9AA 1OFRA 2TAAA 4IUGA 1TREA 2ZRWA 3MP5A 3PY2A 5E93A 5A6BA 2F7FA 1QNSA 1MWOA 3CUFA 4Z2HA 1QPRA 1P6WA 3IMMA 1Z32X 2E6DA 1JL8A 4JYEA 2Y7EA 2E5CA 3T0DA 5E6ZA 3RWKX 1FWTA 2CNCA 4AWSA 1XM3A 5D05A 5EPDA 2ZA3A 3APGA 4IMFA 4OQVA 4GKLA 3M6YA 3O06A 1VZWA 3NYDA 2PRLA 3MYOA 4Z2LA 2ZTJA 3P67A 3S9YA 2GVGA 4E2OA 2BSLA 3KE0A 1HJSA 3AI0A 4ZQCA 2XTKA 3OIXA 5CPSA 4NX5A 3AMCA 1V3JA 5JBEA 5G2HA 1LRTA 1VYPX 5I3KA 5TD4A 2Z6JA 3MP4A 4GUJA 2RGLA 4P7QA 3TQVA 1SZGA 3WD2A 2BVDA 4ZENA 1E4NA 4M6QA 5HQEA 3T4CA 1JZ2A 1H7XA 1G4PA 4UTKA 3CB8A 2OSXA 3IVSA 2ZRVA 2FB2A 4WOQA 4DWSC 2ZX8A 3ATYA 2CESA 4MAVA 4AZBA 5AHEA 2QDGA 2XM2A 4N0RA 3VIGA 1JYNA 4M6VA 2J7EA 1SPQA 1QDSA 4JYDA 1QW8A 2CBIA 4R34A 1YPIA 1UR4A 4A3UA 4J3XA 2DSUA 2ZUMA 4NJHA 2WAGA 4J3TA 2FGLA 2Q3OA 1WKYA 3KF5A 3N34A 5LKYA 3B8SA 2J79A 1XCXA 3HJEA 3NPXA 4FFGA 3ZIZA 1WAUA 1AQHA 3NZRA 2WKJA 3GKAA 3P60A 1UD3A 5LHEA 4CN6A 2WMIB 3QH2A 5FKBA 1MSSA 1O95A 1V0NA 3KL3A 4GQRA 4M29A 2QJIA 3FN9A 4ATWA 3KVMA 4C1KA 3M5YA 1KM0A 2PURA 1JDDA 2JFEX 1A5CA 1CTNA 1LBFA 3UG4A 1H7RA 3LX9A 4Z1AA 2YLAA 4CNNA 2B7QA 5K9DA 4X0VA 1H11A 3L2MA 3WMCA 1WCGA 1GPFA 4IXHA 2ADDA 3CZEA 3UERA 4Z2GA 2EKCA 2GSJA 1GZGA 1FCUA 1LOLA 3L21A 2WNWA 4JFSA 3QYQA 6CGTA 3F03K 2XSAA 1QPOA 2BTMA 4XZ9A 4WKAA 5ABFB 1GJUA 5LA0A 3LBCA 4B1LA 4ZQMA 4MB1A 3W53A 4MJZA 3EWXA 3BVJA 5AHFA 4UIOA 1QW9A 4LVAA 5IBXA 4LS2A 4AD2A 4YHGA 3DBPA 4FXSA 3HBKA 1VH7A 1UD6A 2VUYA 5SWUA 2CWNA 2ZZ5A 1OX4A 1H7OA 4J9JA 3G6MA 2WCGA 3OGSA 1E1EA 1GEQA 3W1NA 3WDHA 2WSKA 2CPUA 3WDJA 5HWJA 3UQNA 1ICSA 5I3JA 1E6XM 1GZJA 1I2RA 1HL8A 4UTHA 3A6OA 3CIXA 2WNQA 4S3KA 1X1ZA 5J5DA 4W7VA 4JN6A 1OFDA 2YL9A 3B06A 5CG7A 1F76A 3L5AA 3OIHA 3TX9A 1OD8A 4AWTA 2A3HA 3MMTA 2D20A 1B3VA 3L4XA 2CLFA 1PX4A 3MANA 4PTXA 3G1AA 3UR7A 3PM6A 2VENA 2J8GA 3WUEA 3T55A 3VIMA 4AWEA 2NUXA 1E4IA 3NQ6A 1CGXA 1NVMA 3ABOA 4Z1DA 1HIZA 5EB8A 3W6LA 1SW0A 1QPNA 1W2VA 1WDQA 5IFTA 1VGAA 3AMLA 1MXSA 2A7RA 2WSRA 1UZ4A 1C8VA 3W88A 2CKSA 1W5OA 4JL1A 2XN0A 3B4UA 4Z2KA 1J0KA 1W31A 2E8YA 5HWMA 1JUKA 2AQWA 5LNSA 3GXNA 3PG9A 2ZQ0A 5BCAA 1UBSA 3SIZA 3LF7A 2XVLA 3VGGA 3NSMA 3P81A 3CWOX 1C3FA 3ARPA 2QQWA 3ARUA 1BF2A 1MVYA 3CIWA 3SFKA 5GNZA 4JD4A 1HG3A 3GNOA 3NGJA 2EPHA 4LVDA 3AMDA 5LYRA 4JTHA 5KZEA 1TJRA 1ZB5A 4PTWA 3RPMA 8TIMA 1QWGA 3MMUA 4U31A 1PVNA 4BS0A 1UKOA 1THFD 1QO2A 3ZM8A 1FP9A 3W7JA 3KF3A 3NSXA 1QOXA 4W85A 2V38A 4PTMA 4QCFA 3J7HA 1LJYA 2O9TA 2YYTA 4WY0F 3R13A 1BYCA 4XTIA 1GOQA 1UD2A 1GVRA 4QLLA 4O54A 4QAWA 1FDJA 2R91A 1TCDA 3TQKA 4UCFA 2VT0A 1A5AA 2OCZA 1PV8A 3W1RA 1H5YA 1TPFA 4E4PA 1C8YA 1V3LA 1I1XA 4JX5A 2FHBA 5CLTA 1OHLA 2VX4A 4HPGA 1JXJA 4JAWA 5F4XA 3LBMA 3P5ZA 1FP8A 1V03A 1JUEA 3OVQA 3VGFA 2Z6IA 3I3DA 1VJZA 1UWIA 4N9EA 4ZZ9A 3G1YA 1V0MA 2VI0A 1GOOA 4X0NA 4PL1A 1H0GA 5CPMA 1LOQA 4PMUA 4OU1A 4ZE5A 4R33A 4HZ8A 4LUJA 2J7HA 4QP0A 1ISVA 1NH6A 2DSZA 3LXCA 2E68A 4I9AA 3T44A 1PCKA 2A5HA 1W2PA 2W66A 3F4WA 3M5XA 4CN1A 1QVBA 2EPMX 3W26A 4IX2A 2CBJA 3A22A 4FNQA 1SUXA 4WF7A 3VI2A 4L4MA 1DBTA 5KTLA 3WDRA 1CX9A 3NXFA 3LEMA 3W1MA 2A3CA 2E9BA 3CBWA 2J75A 2XPKA 1PHQA 3EDDA 3E12A 4HHPA 4O16A 4QSHA 1UKSA 4GC4A 2YA0A 3DFSA 4LOCA 4RZ5A 3LLFA 3VIOA 3E1F1 1JCYA 3QHNA 1TA3B 1KLZA 3H54A 2WV8A 2ZIDA 3CUGA 4J27A 1UR9A 2PWEA 5DN1A 4BI6A 4W7WA 2JEPA 2CLHA 2CZFA 2H3DA 2XIIA 5CPTA 1Z42A 4JDYA 3W29A 2C0AA 2PWGA 3VINA 1B2YA 4K6AA 1LQ0A 1ZU8A 3RJYA 1UWTA 2QKFA 3PR2A 4DBDA 3OSDA 2DEPA 1UUMA 2YL6A 2J24A 2ZRUA 1VRXA 4MOZA 2F8QA 1E72M 4U2YA 4W84A 4Z2JA 2O9RA 3IVUA 3NL2A 4RX0A 1BEUA 3SCTA 2A3AA 2QF7A 1B0IA 1CGUA 4RR4A 4DPPA 2J8FA 3WH9A 1ST8A 4UTTA 1EHAA 5CZTA 2E0PA 3GXPA 5D2XA 1KGXA 2VEKA 1UKQA 1XI3A 3BLPX 1GOKA 3EWWA 4URIA 3EXTA 1VS1A 5CSUA 3LM7A 2O9OA 3W82A 3UWZA 1TG7A 4RJEA 1XXXA 1JZ5A 1K9DA 3PWAA 2FB3A 1TE1A 3IIOA 1VFOA 3QSTA 4HKPA 4PUDA 3CZLA 3R2GA 4UOJA 2WJZA 3ABRA 2WWDA 1YDNA 4O1CA 4O13A 1H41A 1KGWA 1ZBWA 3WUFA 4MTVA 4YL2A 4JFTA 3LTYA 3NSNA 3WQ6A 1JYWA 2DT2A 2C1HA 3Q94A 1E6RA 1FHLA 1QNOA 1U2YA 4XZBA 1PPIA 1V6XA 1EO5A 3S5NA 3TK7A 1HKJA 2YIHA 1M6JA 3CMJA 4AZCA 3B9EA 1HXJA 4ACZB 5H91A 4AD1A 1E6QM 4GE8A 4PEKA 1CXEA 1M04A 3FHAA 3ZMRA 4AH7A 1XDMA 2IXUA 1NOWA 4OWGA 2OSYA 2ZUSA 4P7RA 2QUTA 4YCPA 1XH1A 3HPZA 2OYLA 2YGYA 2WSPA 1NP0A 3M16A 3BPWA 2VZSA 3WQ5A 4MJMA 3W73A 2V2CA 4NX0A 3NL5A 5KMYA 2IXVA 5A95A 4AF0A 1NP2A 3PZUA 1H62A 4PCSA 4WIWA 2ZZ2A 2WYSA 1JUBA 1JNEA 5M03A 3G0UA 3I65A 4JY8A 2WW5A 2X1IA 3RM8A 3UGHA 4CVUA 3QW3A 3OG2A 2J7FA 1V3IA 1C8XA 2W79A 4KKXA 3KVJA 2BY3A 3BAKA 3CUHA 1KQYA 1PIFA 1YTEA 2BZNA 3UWUA 1DOSA 3PUOA 4H4IA 5DY3A 3TFXA 3UZJA 1ODUA 5DO8A 3NG3A 4S1FA 3JS3A 4A2RA 4U33A 5CPQA 5I3HA 5AC4A 8CGTA 3MO7A 1OT1A 3RM4A 5K9XA 2G95A 2ZRXA 1JVNA 5D8WA 3CZGA 1R86A 2Y62A 2QCGA 1OWQA 3ABQA 3BK0A 1PHWA 3GNNA 1FHDA 5DEZA 5EFFA 3NO5A 3TAOA 2EHHA 1X1NA 2I1OA 4CKQA 2YSWA 4ACZA 4JQTA 3A4XA 4MADA 4GUGA 1QNVA 4LU0A 4HZ6A 1K7XA 4MNJA 5E9AA 3U6WA 5CSSA 1GPWA 3C2EA 1NWTA 2CLKA 4HU0A 3GZAA 4E38A 1BSIA 2P1FA 3AS3A 3EXRA 2WMFA 3DC0A 1Y4WA 3UWVA 4IX0A 4LRTA 2VNCA 1OFOA 3Q58A 5I79A 1ZENA 3QOKA 3DXIA 1B57A 1Y9MA 5TQLA 3T40A 3W7IA 4WUIA 1ISWA 2J25A 2PWFA 1E5JA 3S6DA 1E43A 1IIGA 1HKMA 1UKPA 5E70A 5ECUA 1GQLA 3LHUA 4FLQA 1Y7VA 3F5JA 2X2YA 6TIMA 4IPNB 2JKAA 3E9AA 3VKKA 3KX6A 1BTCA 2CIPA 3GBDA 3WBEA 3DU0A 4HPXA 4U3CA 1JI1A 5G4EA 1LDCA 2PBOA 2E77A 2ZX7A 1SR0A 5LNRA 2YFOA 1DWHM 1FH8A 4L4OA 4AD5A 5BXTA 1FOBA 1GQNA 1KM2A 3W1AA 1B3XA 1EXPA 5FIPA 3PTKA 4M8UA 1RQHA 3TTOA 3STFA 3CHEA 4ZXLA 3VTRA 5I77A 3UPWA 1BLIA 4W86A 4BF7A 1QO5A 2YA1A 2JEQA 3LI0A 1ITXA 1HL2A 3L67A 3N9SA 3W7MA 1GORA 1FWWA 1F74A 2FDMA 5LSMA 3AICA 3LTSA 3HGJA 2XGBA 5LGZA 3HN3A 4JR5A 3W84A 4DF0A 4HNTA 1X8FA 4A22A 1I2PA 1Z44A 2HISA 4D6GA 1L6WA 4DBEA 2BX7A 3B9AA 3LRLA 3G8RA 3G3DA 2WSYA 3GKFA 4LV9A 2VURA 3RCNA 5HR7A 2VQTA 2X0HA 4TVUA 4ZEPA 3LXAA 4OBRA 4LWWA 2WMHA 4JS3A 1X1OA 1GVQA 3B04A 1UA7A 3GB6A 2CLMA 2IUZA 3PZVA 2J6XA 3B0PA 4MY9A 3D3AA 1J0IA 2VZUA 4PUEA 3AIBA 1D7FA 1EP2A 3W7KA 4UOZA 1IIHA 1TRIA 4MYAA 3MS8A 5C71A 4RZ4A 1L6YA 3HG2A 3THDA 1KM4A 3N73A 3R89A 5DT7A 1VQTA 2G96A 4UXDA 4UQAA 1YTKA 1FFRA 1W1PA 3ZFHA 2WKLA 3PS7A 2XVGA 1TB3A 4F9DA 2JKEA 3WELA 3IIVA 3DFPA 4FEZA 2XWDA 4U5KA 4A2SA 1LP6A 2VX5A 3WUBA 4O1AA 3VD3A 1KBJA 4UTWA 4DO4A 2WCAA 4ATLA 2D22A 5FK8A 1GW1A 3QQ1A 1WZAA 2JK2A 5F2MA 4O18A 3K8MA 3U7VA 2G41A 3PZNA 3B05A 4XX6A 4AISA 4B15A 3PB0A 1EGZA 4ZQPA 1JAKA 1JULA 3OLDA 4F9JA 4L4PA 3LCLA 4QLKA 4ATDA 2MANA 3PIJA 1KM3A 1EDGA 4S3JA 1JYXA 3AIVA 3QQ0A 5CJ5A 2XHYA 1U83A 1EP1A 3R12A 5K4XA 1CWYA 3HO8A 1BFNA 1MW0A 1V0KA 4U4MA 5FEXA 4AHQA 3VNZA 2CZEA 1NQ6A 5CGQA 1VFMA 3GNRA 2H90A 3DHPA 4NVTA 5AHNA 4UUIA 4UZSA 2VCAA 3F5KA 1OX4B 4EWND 3CLMA 4O52A 3CUIA 5CPNA 1V6YA 5DT5A 2X05A 2QCDA 3W7OA 4OBTA 1H49A 1ONRA 1G01A 2YPIA 5AYXA 1TQXA 3BAJA 4JL2A 4MFEA 3PG8A 4GUIA 1I8JA 2BHYA 2GJRA 2YW3A 3VMPA 3SR7A 4OOZA 4CNOA 1YXYA 3W83A 1OINA 1WAWA 3GH7A 4ML4A 3OBAA 2A0NA 2NW0A 2FDSA 3OA3A 5TIMA 5F4SA 1V08A 3F1QA 1MEIA 2X1TA 3SCQA 1SZFA 5FF4A 1ZY9A 2QUUA 3M41A 3HJZA 1R2RA 4NNCA 5C8BB 1V3MA 3TUUA 1Q6FA 2FFCA 3OG3A 3KWXA 3LHWA 4N9BA 1T96A 2ZBTA 2J4GA 3PSWA 3KOFA 1RH9A 1FWRA 4Y8FA 3NDOA 3TXVA 3RILA 3O05A 4G1KA 1VC4A 2NXGA 4GXMA 3AISA 1XSJA 2X2GA 3WL0A 2QCFA 4HMDA 2WZEA 4IMDA 1QOQA 1JYVA 4MIMA 3LFIA 3P8IA 3RM9A 3LCXA 1Q45A 4HNVA 1TPUA 1VCFA 1NM9A 5EBUA 4LX4A 1OX6A 1WO2A 3G1DA 4JTKA 3W71A 1SW3A 3CPUA 1JNDA 3SUUA 3W2LA 3S5QA 4J28A 2NX1A 1FWSA 5C54A 4O57A 3TMQA 1S46A 2E09A 1HO1A 1NWSA 2DP3A 3M6DA 3GM8A 4H41A 4RXFA 1FCQA 1SR9A 3B0UX 4W8AA 3DYMA 5GQBA 4HMCA 3CTLA 1BG4A 8A3HA 4O53A 4JHZA 3TNOA 3JR2A 5DLCA 2VCCA 3EDKA 3CT7A 3CPRA 3G1SA 1UR2A 1J4EA 3CEUA 1UZ1A 2DSWA 1W1ZA 1WOBA 3W1XA 3SW6A 2CERA 3SEPA 3UESA 4GI9A 3TMLA 3VD5A 3MI3A 1LROA 4QISA 5D9OA 1TQJA 2Y63A 3G1FA 4D6JA 1WDWA 2X1RA 1ZBVA 5C55A 4JXCA 1CXKA 3PZ9A 3MWAA 2PCQA 3IGUA 3CZ8A 4GZJA 4PBGA 3FW6A 1BYAA 5C6MA 1UR1A 4HTYA 1I45A 2VFEA 1VYRA 2A7PA 1JFHA 1RD5A 2UY5A 1W9PA 4D1JA 2DSKA 3WQ4A 4GI6A 4Z1CA 2E6FA 3U2OA 4IPJA 4XWUA 3W7PA 2VOTA 3TW6A 3EDEA 2GK1B 1QHPA 2Y5EA 1BQCA 3PUEA 1GHSA 3UD6A 2CYGA 3S6TA 3MMDA 1EA0A 4E8DA 1ZJIA 3AYRA 5CZJA 3VX1A 2WZIA 3S1XA 4NQ1A 1QI5A 1UYQA 1X6LA 3VM7A 5JIWA 2EBNA 3AXIA 1HX0A 3TR2A 1JI2A 1HP4A 4B5NA 5AC8A 3H3LA 2YBUA 2A4AA 3NQDA 3W1TA 4BF9A 5I3GA 2ATMA 1FBAA 1VCVA 2CW6A 4X3ZA 1F2JA 1GYLA 5FF0A 3T08A 5KZDA 1CENA 1EOMA 2CEQA 3ZO9A 3QMTA 1CXIA 1KWKA 3WH6A 3WEMA 2J7BA 4ONVA 5EA9A 2JGQA 3TJLA 2Y7FA 1GJWA 1NSJA 2ZCGA 3QPZA 3CU2A 5C70A 1O6IA 1FUYA 2W62A 2YDRA 2TYSA 4OT7A 2WMIA 1OYAA 3WNPA 1JCNA 2WVUA 4ACYA 5CKSA 4PMZA 4K7YA 4FNSA 5CXPA 2A6NA 1XV8A 2WZHA 3SCWA 3PBWA 3AHTA 4P2VA 4CUCA 3QSRA 3N15A 2VO5A 1EDQA 1E0WA 3NL3A 2WKGA 4PSPA 3LCIA 1WE5A 3FJ6A 2BHZA 5BROA 4HA4A 4CNPA 4GWEA 4OHQA 2ZUUA 4O15A 1RP8A 5BXPA 3LV6A 4LNYA 4MPKA 5U4NA 2HMCA 3VCRA 4BQ5A 4OE7A 3W6YA 3LB0A 1DHKA 2BY1A 1BGGA 3USBA 2D0GA 5D8ZA 3MI6A 2A85A 5DFAA 4YPJA 4O14A 1PBGA 4BQ3A 1H7PA 1MFVA 4NJJA 2ATSA 1JAEA 4O10A 5G2WA 5A5WA 1BVZA 3BG5A 1GVOA 2D23A 5DCBA 4KRTA 4Y7EA 3AXHA 1V02A 3WFLA 2A3EA 1AL8A 1O94A 1JF6A 1Q6QA 1TPC1 1Y0EA 3BC9A 4AMCA 1QFEA 3TFCA 5A3HA 3N04A 2A7NA 3RF9A 4KRUA 1SZNA 4CCDA 3OLGA 1GOWA 2DIJA 3LDKA 4AC1X 3PTQA 5D2VA 2W5FA 3EMCA 2DZVA 3G0XA 1AMKA 2BY2A 5AC5A 1TR1A 3MSDA 2E5BA 1E1FA 4FX8A 3CO4A 1DORA 3W7GA 2NWSA 5D9NA 1JJKA 4EVZA 1PZ3A 3VPLA 3BH4A 1TO3A 1K7EA 1T0OA 2EO7A 3L5LA 3MYPA 4WKFA 3SURA 4ADSA 4N2YA 4NJGA 5CZKA 4PH6A 2XJ7A 1PCWA 3SUVA 3W1PA 1HJUA 3BSGA 4JHOA 4FLRA 4RV8A 4PEEA 1XSKA 3AJ7A 3W75A 5D02A 4R5EA 3MUIA 2D2OA 1VR6A 2WVVA 4CU7A 2CITA 4O12A 4WY0B 3LERA 3C2RA 5AYYA 3II1A 4UCGA 4XUGA 3FFSA 4MVAA 2FPTA 4WD0A 1S5WA 5DCDA 4FX6M 4AW7A 2V2DA 2WC7A 3VGEA 3VUPA 3BMWA 3MKKA 1NWRA 5LZLA 2NV1A 4TO8A 5MHBA 1E70M 3KRZA 3G6LA 1OIFA 4B1MA 5G1YA 3GNDA 3WH8A 2G3JA 5K2ZA 5FMBA 5GVJA 4GNJA 2NX3A 4KH2A 3BLKA 2EJ1A 2FPYA 4HIBA 2EQDA 2O92A 4E8CA 2V5BA 3W7DA 1CPUA 4D6EA 1B9ZA 3GXMA 4LRSA 1F73A 4A3HA 1UWQA 1DHPA 3W7RA 3LPGA 4O8RA 2ZE0A 1AQ0A 1M7OA 5IDIA 1G7VA 4M1RA 1VLWA 5HUOA 3L4YA 4HSOA 2XUCA 3A24A 3U5YA 2VFDA 4FF5A 1PIGA 1N8FA 1ISXA 1K6AA 2Q8ZA 5DXYA 3AIWA 2YYUA 3GVGA 4LS0A 1CZ1A 2ZUVA 3WJSA 4AVFA 3AS0A 4A21A 2C0HA 2J77A 5FF7A 1N82A 1J12A 3C56A 2VVSA 3VDBA 2Y2WA 4NZFA 2EF9A 2ZYFA 1A50A 1JF5A 3WDQA 1FX6A 1TPH1 2XFYA 2QMKA 3AHZA 3W2MA 1QPQA 4IPIA 4UFKA 2FQIA 2Y7GA 4BK9A 3OB8A 4J3VA 1FQ0A 3WJZA 1A47A 4GZEA 3CLWA 2QCEA 5CSYA 3VIKA 4K68A 4MJ2A 3I6RA 2ZA2A 1V6WA 1OK4A 4NXKA 2FH8A 4RLIA 3MHFA 3U8GA 5DBTA 3EX4A 3H53A 2R14A 4LTSA 3S1UA 1Q6LA 1PL9A 3NQMA 4KWVA 1I1WA 4CQ9A 2WLYA 5HPCA 1VCGA 2C13A 2YKKA 4N6EA 5A6JA 1TV8A 1QHOA 3IAPA 4GJ1A 5JIPA 1WOAA 2GFTA 1CECA 4N4QA 1J0ZA 3ARQA 1OIMA 1S5VA 4M24A 3GDBA 2BNJA 1WBJA 2C16A 3E96A 1W1TA 3L0GA 2DZUA 3P8JA 3M44A 1KXQA 2G3MA 2OWWA 1LYXA 3U57A 3TTYA 1W56A 4M81A 1C93A 3HF3A 2EPOA 2WMJA 3GYCA 3VIIA 3NQAA 1XL9A 1K8XA 1CIUA 3G8EA 3UGGA 2ZWYA 1QPKA 3KXQA 4FFIA 2OZ0A 3IAQA 4A4AA 1DWIM 3MUZ1 3K4DA 3WSUA 3A5FA 4B3KA 3A9IA 2JGYA 1X6NA 2D0FA 4PTNA 2D73A 1DJNA 4HNNA 2QLYA 3W7EA 5A2CA 2GPTA 1F5ZA 1TTJA 3CTTA 2ZXQA 5BRBA 4YWIA 2JF6A 5D33A 4P7NA 1BPLB 1E51A 1IXNA 3FKRA 4J7RA 4DPQA 2TSYA 4LC6A 3LDVA 2WC3A 1W3IA 1LBMA 3EWYA 1MW3A 1O7AA 1UH3A 1LL6A 1VPXA 3LGEA 1XFBA 1OJXA 1TIMA 3HGSA 3O07A 2B7NA 4UTMA 3OGVA 5BRPA 2PWHA 1AG1O 3GXFA 2WMGA 5I0DA 2QAFA 2ZZ3A 2QMJA 2GJPA 3DGRA 3WD0A 1HJWA 3LPPA 1GNXA 3CUJA 1C29A 3MUXA 3DFNA 5T26A 3VIFA 3FY1A 3LCHA 3VDHA 5FK7A 3ARWA 5CPLA 3NPVA 3OZPA 4LUIA 2Y70A 1A5BA 3UYCA 2I14A 3DFTA 1J11A 1XYZA 1O60A 2CFFA 1XBVA 4E0CA 1W3KA 2ZZ4A 4QHZA 1VYSX 4GINA 3U7BA 4AIOA 5EYWA 2A1YA 2WNZA 3FKKA 3O6YX 2XFFA 3QFEA 3IV3A 1ZAIA 5A8GA 1W9XA 5LHFA 5FL1A 1QR7A 1TVNA 3OGRA 4PMXA 3DECA 4N9DA 1GYNA 1TTIA 3M7SA 2WC4A 1G5AA 5A2BA 2E4TA 4JX6A 5I3FA 5E0CA 2NUWA 1C91A 5D2TA 1JRCA 2EEXA 2AEYA 4LXFA 4F79A 3NVTA 4TX6A 5A94A 4J3UA 4QNWA 2NSXA 2J88A 3BG9A 2RKXA 1S5TA 1ZJAA 3T78A 2VMFA 2XG9A 1OB0A 2OXBA 4WY0A 3TH6A 2JBMA 2FHCA 3PSVA 2Y85A 3PZMA 1W3TA 4H2CA 4N9CA 2DT0A 2WHMA 3SCNA 2J74A 4NSBA 4TX9A 1ESWA 1QOPA 2BWGA 4FIRA 1X6UA 4ZL1A 3BMVA 3MP3A 4OKDA 3SGUA 3THAA 2VJXA 4UR8A 3CHFA 3BAIA 3G0SA 1FH7A 1UB3A 2C8NA 3PIGA 1BG9A 6A3HA 4PODA 1K9EA 3WNNA 3ARSA 4XZWA 4NJIA 4H8UA 3NR0A 4PMVA 1DVJA 3AQUA 5E6YA 5D2WA 3CMGA 3TE9A 4QDMA 4M7SA 3UY7A 3GX9A 3TP4A 3G1HA 1PX3A 3WEOA 4B3LA 2QR6A 3PBUA 4MY1A 3WD4A 1H1NA 1EP3A 3RMJA 1G4EA 4FFHA 2GOUA 4GUHA 3LCGA 2FH6A 1C7TA 2YDQA 5BXRA 4PRWA 4TR9A 5IBXC 2GUUA 2AEZA 2AAAA 3NQGA 3ZS4A 2X09A 3AS1A 3FAWA 5EMYA 3WK0A 2VFHA 5BWFA 1EWDA 2YLLA 1JDCA 3RIKA 5IM51 3L0NA 3DI1A 1MXGA 3RDKA 4WK9A 2ZZ6A 1W37A 1QCWA 4UTFA 2ZZ1A 4FIQA 2ISSA 3WJYA 1G1YA 1S3HA 2C18A 1F4AA 1LCOA 5H2ZA 3UCQA 6TAAA 3GYEA 1JG9A 4RXGA 2E8ZA 1HNYA 1QNRA 3TONA 5CZ0A 3MV11 3U14A 1G94A 1GVYA 2GVYA 3VIPA 1EWEA 1XHGA 2QF8A 2YOCA 4AXKA 1SZEA 3KVLA 4PTVA 1FXQA 3NQEA 1TTPA 3NQCA 1VBRA 5E09A 4M5PA 1RQBA 4HXCA 3DZ1A 3W70A 1EA9C 3CC1A 4GPNA 1H63A 3IRDA 1MW1A 3EX6A 4QLJA 3AIQA 3VMOA 4DF2A 2JE8A 1F7BA 3W2UA 3NYZA 3LDRA 1UA3A 2G3NA 3AHYA 1LLOA 2QPSA 3POCA 3RJXA 3WMSA 1JCMP 1SO4A 1AL7A 3T0BA 3Q37A 1E6SM 4LYPA 2UY4A 2BS9A 2WVSA 5A8OA 4LVGA 3JUGA 4BQ2A 1O5XA 1W91A 4I7WA 1D9EA 4M82A 4LC8A 1XSIA 2PI6A 4FLSA 1UKTA 2HS8A 1SU5A 2BXZA 3IK2A 4WXZA 2PRMA 4XKYB 1GOMA 1K9FA 5AY7A 1E9LA 2BXYA 4J3SA 4BR1A 3P61A 1EIXA 4ADTA 5KEZA 5A6LA 4RK8A 1UOKA 4Q32A 1KTBA 3EMQA 3QM3A 1I2NA 1QI0A 2ZOXA 2AOSA 1EEPA 2GK1A 1NOFA 1LWHA 4IJBA 4DUWA 2BXVA 3MHGA 2EXOA 1CW2A 3HG3A 3WK3A 5ABFA 4W87A 3M0ZA 1BVNP 4QJ1A 1HP5A 4BA0A 3UXAA 5L9FA 2XM1A 4P61A 1R8LA 2YJQA 3BAYA 1Z41A 3VO0A 4CD4A 4HU8A 5TBOA 3SCUA 1VF8A 1AW5A 3ZJ7A 3SY5A 3NM1A 3LV5A 3N3MA 1Q6DA 4EK7A 5CGTA 3TA6A 3OVRA 3SCSA 1FCVA 1M5WA 3A21A 5I23A 3PZQA 3ZR4A 1N7KA 3W6MA 2RDUA 4QITA 2NWRA 3C3NA 3VVGA 1PIIA 4Y96A 3L4WA 2D1ZA 2DQXA 4LYQA 4OV9A 3FNDA 3GH4A 5FEZA 4IMCA 1W9VA 1Z48A 2PBGA 3KEHA 2ZZ7A 4ML9A 1H5VA 2OWXA 3LIHA 2ZA1A 5DXXA 1JD7A 3N18A 3G1XA 2OT0A 3DHFA 1E0XA 2OYKA 3VMNA 5F2LA 3NPWA 4O4VA 3CM4A 1B3WA 2WHLA 3M07A 2H6RA 3A4AA 3S5YA 4LQ1A 3BCFA 3GBEA 3GIYA 1QI4A 2O7SA 3AHXA 3AROA 3W37A 4NJKA 3JRKA 1H60A 2V30A 3GK0A 3BAWA 1B3YA 3G18A 2W4XA 4Y90A 2ZICA 1ZALA 4Z0SA 4X2RA 1QNPA 2GDVA 2X0YA 3V75A 1QBBA 1Q4NX 3MUY1 3NQ7A 4GQQA 3AMKA 1V3KA 1FY6A 4PMQA 2DGAA 4UOQA 3BLIA 2BHUA 4X9SA 4ZQNA 2UY2A 2ZRZA 1ZCOA 1HTIA 4BCEA 1LLWA 2QUVA 4GFSA 1W3JA 3C8FA 3C2VA 3ZSSA 2AAMA 2HVMA 4RE2A 1AK5A 3E02A 3L65A 1JZ3A 1OD0A 1NOUA 3I7QA 4XTDA 1HN1A 1VEPA 3MBDA 1EUNA 4NXSA 4HA1A 2CKRA 2YFNA 1LWJA 4EKJA 3L4UA 2NZLA 3INPA 5FKYA 3M7WA 3YPIA 1I2OA 2Z2UA 1IV8A 2Z1SA 2RH9A 1GG1A 4JKKA 3STCA 1QAPA 3DYPA 4XV0A 1TJPA 1GOIA 1BYDA 3KZSA 4DXVA 3KAOA 3MHUA 1V02E 1KWGA 5EBAA 1V0LA 3E0IA 5GNYA 4JIQA 1JIBA 1UR0A 5BRQA 4CN4A 5AHMA 3GAYA 2C19A 1MFUA 4H8HA 1J5TA 3TC7A 4ALDA 1KXVA 1YXCA 3OEXA 1I75A 4TMBA 3ALGA 4ZFMA 3ZOAA 2VELA 5HDRA 1G4TA 2WQPA 3L66A 5K3VA 1PEZA 4PYSA 1XH2A 2Y8KA 3DKJA 3CEPA 4FXRA 2PWDA 4MKNA 1GONA 1OM0A 2PB1A 4HOXA 5E0FA 1WBHA 3WDPP 3WMBA 4AD4A 3KFTA 3HBLA 1MEHA 1DWAM 3WNLA 1ZBKA 2V5LA 1J9YA 3SECA 1W5NA 2WNNA 2VR4A 1JRBA 3TKFA 3P74A 3W1UA 2NT0A 1D3HA 1GTEA 1R2TA 1E0VA 1XH0A 3WNOA 1Q6EA 2ZX6A 1W5MA 1K02A 3TAKA 2TRSA 3UETA 3ZJ6A 3ATZA 3C2FA 4D6CA 3O8AA 1OX5A 1HJQA 2ISVA 1W3NA 3PULA 2VC6A 3BO9A 2ZX5A 1VFFA 2CXGA 4TIMA 4DUXA 2VX6A 2D24A 1OFQA 1MQPA 2OMAA 4ZQOA 1RV8A 1F05A 5M17A 4UQBA 1OF8A 5HNNA 5KZMA 2Y4SA 3S5OA 1UCWA 1ML1A 1W3HA 3ZQ9A 1E6PA 2UV8G 3MU7A 5A6MA 1OSEA 2DSVA 5FEPA 2QJHA 3O6CA 4AZHA 4IUOA 2C6QA 3N9RA 5BMXA 1E55A 1H3GA 3CHDA 1G69A 4M56A 3NDYA 5KINA 2QHAA 4HT3A 1H51A 2LLEA 4U3AA 2NXIA 1IF2A 3LRKA 4O0ZA 4MB3A 2FPVA 2QEZA 1XUZA 4O19A 2PF0A 5EMUA 4JCMA 4HP5A 3B03A 4MZ1A 3WIJA 3NUKA 4JY9A 4UMAA 4BFAA 1GT8A 3ALFA 1ME8A 4UQDA 3GR8A 1ICQA 4RCXA 1N55A 3S8HA 1Y9GA 1FXPA 1OYCA 1G9HA 4FNTA 1W3LA 2Y24A 4GO8A 4UFJA 2B4GA 2Y6ZA 1GJPA 2C15A 4JTTA 2F2HA 5BYWA 2NV2A 2CLOA 1Q6OA 3ARVA 5FMCA 2QJGA 4Z08A 4QIUA 5F1VA 5A6AA 3VE7A 3VNYA 2A2IA 3VU2A 4XQ6A 1QMLA 4IOTA 3EKZA 4F8XA 1A53A 2P0OA 1E56A 4DO6A 1EQCA 5KSWA 2RHGA 1VBUA 2WO5A 3LPFA 4UQEA 3VKJA 3DKLA 3QF0A 4KFOA 5CPOA 4C7DA 4UTIA 1UG6A 2H8XA 2BVTA 4HOZA 4C1LA 5CSRA 1ZAJA 4UFMA 1KFJA 3C2OA 1WNOA 4N42A 3TXZA 4BWLC 2CZDA 1KCKA 2QCDB 1UD4A 5AYBA 4R27A 3L4TA 3GDKA 1Q6RA 1ZL1A 4WOZA 2XVPA 3GDMA 1MO0A 4YN5A 5JUVA 4GUFA 3BLFA 3GLCA 4AWUA 2JALA 4JFUA 4KWUA 5GPRA 4XKYA 4HA3A 4HMEA 4W5UA 1KB3A 4DM2A 1DKWA 1JQXA 3B8DA 3MBFA 3QW4B 4IWWA 1JCJA 2C14A 1NF7A 3TJXA 3T09A 1K7FA 1M7PA 5DELA 5DF0A 1GHRA 4GXPA 3PHAA 5A8QA 4UTUA 2VZVA 2YA2A 1WZKA 5LNVA 4M7TA 1BTMA 3LCWA 3DHDA 3MUAA 4WXYA 3W76A 3WF2A 1G6CA 2Q8LA 1V7YA 1DP0A 5D30A 1K3UA 2VOMA 3RLUA 3BGJA 3CHCA 3K46A 3VILA 3NOEA 2E3ZA 2Y8VA 4WKHA 3QJAA 2D3NA 3NQ2A 4MNMA 4CQ8A 3POHA 3M46A 3W85A 2J7GA 3O1NA 3WDIA 3ARZA 4PMDA 5HMSA 3QC3A 3RK8A 2VRQA 4NNAA 1PJ9A 4H3DA 4QFUA 3N2MA 1L0PA 3C0JA 3OVPA 2D0HA 2W91A 1HF6A 4XBSA 2V82A 2YX0A 2RDWA 3GXDA 1OT2A 1LLZA 3K1DA 3K8KA 2WB5A 1MEWA 1W54A 2DZTA 3EX2A 3C4UA 2Y61A 1XC6A 4W93A 3P84A 3W86A 3KL5A 3AZRA 4HPHA 2J47A 1JZ7A 3GH5A 4PA8A 4PCTA 3THCA 3W7QA 4RE4A 1ZJBA 2RGMA 3FAXA 3CH9A 3GXIA 3TSDA 1W1VA 3CZKA 5LA2A 3KL0A 4BZYA 1JZ4A 1UJPA 1E3ZA 2V0TA 3PB2A 4M19A 1GQJA 1KA9F 2A6LA 3PAJA 1LG2A 1DWGM 2HTMA 3O9NA 2R94A 1GTHA 5DCEA 3BGAA 1DV7A 2VEIA 3NMBA 4WZHA 1SFSA 1TCMA 2JIEA 3NCOA 2WPBA 1T99A 3AIRA 2HS6A 5FMDA 2JF7A 2VTFA 4AZCB 2NUYA
chains in the Genus database with same CATH superfamily
4IETA 4AEEA 1E4LA 4XD6A 1HIXA 2ABAA 1YDVA 2P88A 2XISA 1OABA 1VRDA 1WD4A 5JH1A 4YVWA 1DQXA 2FYMA 1XNBA 2XHNA 3A9BA 3MSGA 1FDYA 4JIIX 2A1XA 3WDTA 1RP9A 2QXWA 4XAFA 3M5ZA 3OLIA 4LF1A 5DRIA 1LBLA 5FYHA 1TJ2A 4ZO7A 1GG0A 2BGCA 2YDAA 1CZVA 4L80A 3W28A 4MV2A 2XYLA 2ZWZA 1R7AA 3BOPA 1KW1A 5AFBA 1KBIA 3RI8A 4A45A 4BISA 2WT0A 4POCA 4NRPA 3W87A 4E4UA 4L11A 3S30A 3KRBA 4OBSA 2E6AA 5CNAA 4YSFA 1JR1A 1EX1A 2YXXA 3UY8A 4S3GA 4JQ3A 3VUSA 2ERFA 4PMNA 3F4NA 4XAAA 2DORA 1WCDJ 3O0KA 3WD1A 2Q5TA 1YADA 1FWEC 1UIPA 1TME3 4AZ5A 3R10A 4EIVA 4KQ7A 2AKMA 4CVWA 1V6NA 4AF0B 3KGZA 4U2ZA 3GFXA 4MY8A 4V1YA 4B2DA 2QGYA 3DENA 2CHHA 1JCLA 5ABEA 3N4MA 5C3OA 3THTA 1OFAA 5I3IA 1HVXA 1WPCA 4ICNA 3FXYA 4GXLA 4CD5A 4EAMA 4MZ8A 3OGGA 3TTQA 3HNYM 5T5JA 3VBRC 5BNOC 3M43A 1HDKA 3TB0A 4A6SA 3O1RA 5BV6A 3CXOA 3WG6A 4M00A 1YIFA 4YZ4A 3UYIA 2IFRA 4LXLA 5C9AC 1DWFM 5JI9A 5FFOC 2ADEA 2FGZA 4K20A 5LNWA 4PN2A 5B80A 3WY6A 4B9YA 2VGGA 3VNDA 1IQDC 3U3HA 4CCZA 4CDQC 2GJXA 3CWHA 4LE3A 1M4WA 3C52A 1IQAA 4O4WA 1ZFJA 2BYVE 2XBO3 4EN0A 2E51A 3ELFA 4D2JA 2NQ9A 1Z8AA 1CDGA 3PJXA 1PGSA 1ONXA 4FTBA 3I97A 1OCQA 4S3FA 3A4WA 1C8QA 1O1HA 1XWYA 2D3LA 2CHOA 3IJIA 1GWKA 3IBMA 4AVBA 1FFQA 1R3WA 2R071 4UF0B 3UZZA 4KT2A 3DCPA 4MKVA 4AY8A 3IIZA 2VW0A 3H4XA 1XX1A 1ME7A 1FXZA 1MXDA 1KDKA 4IV3C 3WP4A 2WZR3 1EDTA 1E5NA 4M6PA 3IIXA 5K4ZA 2V5CA 4Y6GA 3MW2A 3SZ8A 3LHTA 3E5QA 1SYTA 2IMRA 3TEWA 2PELA 1OXCA 4D6DA 1RUE2 3GBGA 5I02A 3ZJKA 1ECQA 5LBEA 1X7FA 4MB4A 3UJFA 4ZA0A 1AL21 3ZX7A 4PMRA 1DXFA 4FT8A 3ZKUA 4PBPA 3WD5A 4DIQA 1YKWA 4YGEA 5EL1A 4C0HA 1BWVA 4ZXOA 1KFBA 1YXDA 1KDMA 3UGFA 4XDPA 3TNPB 2HWGA 3IJ9A 2PMQA 1TV5A 1HJXA 4NKCA 2MNGA 2OZJA 4ERGA 4HA0A 1X82A 5EFUA 4CQAA 4A8LA 4PDWB 5G05L 1VAVA 3R8GA 4MG2A 4XZLX 4TTGA 4IG2B 3NNJA 1NCQB 3A0NA 4HKWA 2Z79A 1FCBA 3S5ZA 1OLMA 1CONA 3W25A 1W6QB 1BRLA 1IQ8A 3VNKA 5BW6A 4ASKA 4GQGA 4J40A 1NQKA 1LB2A 3KWSA 2DZSA 4L4LA 1U5JA 2VFFA 1O4UA 1V6IA 3HD8B 1W8UA 4AI2A 3Q4DA 3TOYA 2BLEA 2OLHA 2V8ZA 3NNGA 1WLDA 4KFNA 2FLIA 2OEMA 3FXGA 5I09A 1A5NC 1H0BA 3ARXA 4RE3A 1VJSA 5BXXA 6ALDA 1P1XA 2GQAA 4CU9A 2WLZA 1AW1A 4R7WA 1A5OC 3DH7A 2RR11 3DHUA 2Y88A 3VD9A 1IZKA 5A7WB 1EPXA 2PGFA 2IQTA 2D6KA 3VX0A 2YBKA 5AHIA 1PIV2 1XFCA 3QV7A 4J2PA 5BOOA 2QKDA 4N02A 3W27A 3ETPA 1ZZ8A 3F5LA 3UXDA 4OUIA 1KTNA 5A3UA 4REQA 3TNQA 4Q0SA 4FTSA 2ZFAA 2GLKA 3AWNA 1H1IA 1R9ZA 1RUF1 4MF4A 2DFAA 1W1IE 4P8VA 4LYRA 5D9PA 2ZGUA 2WS92 1TRDA 1QWRA 3MDWA 2CGNA 3T6CA 4JX4A 3QKEA 4GH4C 3LMYA 5C3QA 2XSBA 4D94A 2ZX9A 2VR2A 3OOQA 5CH9A 1NFPA 1OGGA 3BURA 3NZ1A 5DRCA 4UNLA 3EMZA 3O12A 4C60A 4OHVA 1AZ1A 2ZAHA 1ZHAA 4FF7A 2E9MA 1WQ5A 1KEXA 5I07A 1I3HA 3BYWA 2ZKMX 2OWCA 1XBZA 2GMMA 5AVNA 2ZABA 3H6OA 4I6VA 1D4M1 2ZC8A 3TTSA 2A6VA 1PE1A 5A7SA 4AEMA 5F5QA 2CHRA 3W02A 2D5HA 1JUHA 2RS32 2PGEA 1P0NA 4D0QA 2BDRA 5EYYA 1F3TA 1SMVA 1UBPC 4WR3A 5JOXA 3AYVA 3MT1A 3TROA 1GQIA 3EX3A 1DLLA 1J3RA 3BLDA 4DWSB 3VZXA 3LHYA 1VMJA 3PBGA 3AZTA 5D21A 4AL9A 2OSWA 2D43A 2YXSA 3WN6A 2AMGA 4YHEA 3NDZA 3VHOA 4BF5A 3OPTA 4DWSD 4A7ZA 1OEPA 1V5XA 1QATA 4MZYA 3IJ7A 1YYAA 4K8RB 4OHXA 4JNMA 1HX6A 3ZOIA 4DPNA 3J4UH 1JGIA 5FZBA 1LOSA 4LPCA 4N43C 4C6EA 2EICA 2P6CA 1XLGA 1DIKA 5GZGA 2WVTA 2W3JA 4XFIA 3WJWA 3TW9A 3PURA 3HGOA 3E6EA 2OA2A 4OZOA 3PVBB 1GCYA 3G2GA 4FPGA 4O1BA 2EGZA 1DJXA 4H6KA 4RHV1 3WQVA 2GNBA 2XJVA 2G8ZA 2ZPXA 4K8HA 1X36A 4N4PA 4W6YA 4ZOEA 1UYPA 2WANA 3POEA 3HQNA 2V3EA 3ZFEB 4O0KA 3O2LA 3W81A 4O61A 2MPFA 5HA7A 2PLV2 4XTPA 4MGGA 2GAUA 3P62A 3QHMA 1H1ZA 4ORMA 1BVWA 2WFF3 2G4FA 2XN1A 5HV0A 4EOUA 4XFBA 3WK2A 3WEZA 5EJZB 1IS4A 1LGCA 2V5DA 4H9MA 1UOZA 2FZ1A 1AYN3 1U12A 3NV2A 1RUJ3 4KWKA 4OI1A 3VBSB 4D7SA 5HI0A 2VH9A 4P14A 4IMAA 3WFAA 2W0XA 3GAKA 2B0MA 2PGWA 3P5YA 2RHPA 3WNKA 1PO9A 3WUGA 1WUEA 1TSIA 3O6AA 4ISRA 2B39A 5D03A 1YIPA 2X16A 1ZNPA 1O5KA 1XUUA 2FHFA 4AU0A 5I24A 1GVEA 4N6FA 1GP4A 5EU9A 4UTJA 3UXIA 4YGBA 1WW5A 3NIYA 2GVJA 2NQYA 5KXDA 1VEOA 3EB4A 2IPWA 3VBHA 4HHMA 3TU9A 3P3BA 2FCTA 4Q8VA 1GZ1A 4AX7A 1XD1A 1W9TA 1TEIA 1GWJA 1DQ2A 3C0LA 1QHZA 4ATFA 2WBKA 3STGA 4FSAA 1H2LA 3FJSA 2DFCA 3RG0A 2OJPA 5FTTC 1ICPA 1PMHX 2TNFA 3IEBA 4S2BA 4UC5A 5C7HA 4BHPA 3GCWA 3HB9A 3SUSA 5HPCA 3LQCA 4J4KA 1T8QA 1PO22 1SLTA 1AR72 2DW6A 4F66A 2EPKX 4D6FA 1KTCA 3PBMA 3NSTA 3VLBB 4Q6XA 4Q33A 4YMZA 4NAEB 4AY7A 3L68A 1A78A 2OGJA 5FKCA 3NTYA 4D72A 4V27A 1NWUA 1YHTA 1G7YA 4Y20B 1W1YA 1O68A 2EALA 2P3JA 4DOUA 1CAVA 4CA9A 1CLVA 3ABSA 1ONEA 2NT1A 2Z29A 1LHWA 1KFCA 2ISWA 4OIFA 3GHMA 3SQSA 5GLTA 4DELA 2P3KA 4AZ6A 5FPUA 1VIWA 2QV4A 1B1YA 3DESA 1YPFA 3NAVA 4S2FA 2ZGMA 2Y0FA 2Y33A 2YR1A 1ND3B 5C3RA 3SIMA 4XK2A 4JFWA 5FZOA 3FJLA 1GQKA 3I3EA 1K03A 5FMOL 4JTJA 4L8QA 4XD4A 1X50A 3PUDA 4WJXA 1NF0A 2C7FA 3D0CA 4EZ4A 3R6SA 4Q7BA 5FOBB 1R87A 4NHLA 3KSCA 3LQLA 2CHNA 3ES7A 4F8AA 3F4DA 1HKDA 5EKYA 2WHKA 3W38A 2WO7A 4IM4A 1NTHA 4LGXA 4IJRA 1ALDA 4UQ9A 7TAAA 5LGXA 5LA1A 3KVKA 4AZGA 4HYVA 3JBG3 4LVFA 5ANQA 5E0KA 1E5HA 1Y5VA 1L6SA 3IRSA 2BVYA 3EB7A 1NY71 3EXUA 1NFGA 2JXAA 4UFHA 3W2JA 3RZJA 3BTNA 4C6CA 2FBEA 2XJUA 3STEA 2IVIB 4PSRA 1W8ZA 1RUI3 3S9ZA 2GP3A 1KV5A 1PVC3 2A6WA 3O1SA 5C3PA 2YBTA 3HG5A 4QX2A 3VGDA 3AB0A 1Q63A 4V2XA 2EAWA 1IKPA 4RZBA 2AC1A 2NX9A 4YW6A 1E40A 3S2JA 4XE9A 1UMZA 5HK4A 4LQRA 1IHIA 4IPLA 1XPGA 2HSAA 2ABBA 1Y9QA 4UR9A 1HKKA 3GTNA 3PBYA 5F2GA 2HWF3 3NEVA 1RUI1 4UNIA 4XW3A 3DYOA 1CJPA 2ZDRA 3TLQA 1ZBA2 2BERA 4FP1A 4ET7A 4DF1A 4FBFA 3KCOA 1WW7A 4PMYA 3AFBA 3ZXFA 4XZIA 4IJCA 4DZIA 1QI3A 3VGHA 3W74A 2PP0A 1SFLA 1ULCA 2YCLB 2YB7A 4ZZ8A 5LIXX 1OA3A 3KQ4B 2QBXA 1M7XA 3HQXA 3H8RA 4PUNA 4CD7A 2DZPA 4XJ8A 1EB3A 4G9SB 2PRHA 3NJ3A 3ZN4A 3KRSA 5I03A 2IS7A 3MW7A 4AMAA 4CU6A 2FJKA 3E3HA 4CEWA 1P5BA 2R1PA 5I0TA 3LXBA 1KM5A 2Q8XA 3KOZA 2CLPA 2WXDM 1HKWA 4IDZA 5D09A 1TTQA 3VE9A 2ZUWA 3LGDA 3VN4A 1A8MA 1UD5A 2ZGQA 1ODZA 2E5DA 5G4WA 3PFRA 1OFRA 3UT0A 2DUPA 1YFWA 1JU4A 3WQEA 2F7FA 1QNSA 3LGRA 1FMD1 4QDSA 1JS9A 2WS91 3NKGA 1FWGC 4WGXA 4JYEA 2Y7EA 5HCHA 1EC7A 1ASJ3 1FWTA 1XM3A 5D05A 3GXUA 3S4TA 2ZA3A 2I5GA 1AYN2 4IMFA 5MF5A 3O06A 3TRSB 3I6EA 2PRLA 1R9XA 1EFZA 4I5XA 4NRMA 2FHRA 3LYEA 4E2OA 2DURA 1S1PA 2BSLA 4Q8UA 2ZA9A 2VOXA 2W3ZA 5CPSA 3M0KA 3S6OA 5I3KA 1LU2A 2Z6JA 1DTNA 3JZEA 2RGLA 3MP4A 4GUJA 3SCFA 3OJGA 4M6QA 3T4CA 1JZ2A 2ON3A 3CB8A 4L1WA 3EEZA 4V33A 5FWJA 4YS1A 4AZBA 4JC1A 2KR2A 1ZUAX 3HQUA 2J7EA 3RJRA 4G7EA 4L1XA 3WLQA 1SPQA 1QDSA 4L99A 3ZXKA 1VJ2A 2ZX2A 4J3XA 4YTUA 2WAGA 3WQDA 1VPQA 1WKYA 3KF5A 5FP9A 5G1MA 4JOMA 2J79A 3HJEA 4TYSA 2MHFA 2WKJA 5JMOA 2EIBA 3GKAA 1UD3A 4LO5B 3N3HA 2WMIB 3TYBA 3FN9A 1RC6A 4J1OA 4C1KA 1KM0A 2JFEX 3MIEA 1H7RA 4XAYA 4FSJA 2B7QA 3WMCA 4X0VA 3L2MA 4GX9A 1FI2A 2NQ5A 2XOMA 2O4MA 1FCUA 1LOLA 2WUHA 2PTZA 3QYQA 1QPOA 5ABFB 4EP8C 2XLFA 5C5TA 2Q6ZA 2HWD3 3KCJA 4M4PA 1RAKA 1V70A 3TEVA 4AD2A 4MGZE 4FXSA 3RHGA 1VH7A 1UD6A 2CWNA 3G6MA 3OGSA 3E6BA 3VNIA 1GEQA 3WDHA 3S47A 4EX4A 1RUE1 2CPUA 5HWJA 3BJSA 3UQNA 1HL8A 5K9YA 3TJIA 1A0EA 1UN1A 2WNQA 2D6PA 1X1ZA 4N7UA 4WM8A 4W7VA 2GGIA 4CUGA 2YL9A 5CG7A 3VHRA 2FDFA 1OD8A 2XG3A 3L4XA 4WVVA 3UR7A 3K4ZA 2VENA 2J8GA 3COTA 4R4ZA 1S2KA 2PTWA 2NUXA 3NQ6A 1CGXA 4ZTYA 1WDQA 1VBA1 3ITQA 1VGAA 4GYFA 1RMU3 1LHVA 3CJXA 1W5OA 4DXZA 1XRFA 2E1WA 2XN0A 4ERIA 4Z2KA 2QE3A 1J0KA 3M4FA 3PHMA 1JUKA 2AQWA 5LNSA 3GXNA 4YNIA 3PG9A 5BCAA 4HHHA 4I9JA 3L9JT 1UBSA 3LF7A 5SV5A 5H8MA 1S1RA 5GNZA 4GG9A 3LSCA 5LIKX 1R5YA 5ACA1 5EJ1B 4LVDA 4UW5A 1TJRA 3RPMA 2HBVA 4NPLA 4U31A 1WWYA 1PVNA 1UKOA 1THFD 2UYBA 3ME2A 3WQGA 1QO2A 4LO6B 1W6OA 3N7MA 4GY0A 5KHKA 1LJYA 2OOFA 2PMWB 3UNPA 2X41A 3NV4A 4KESA 1FX5A 1GKRA 1AD4A 5FPLA 1COV2 4DWDA 3TQKA 2VT0A 3CKHA 2NQJA 1CWPA 1C8YA 2VX4A 4HPGA 3ZMNA 2OOGA 1FP8A 3P5ZA 2HWE1 1K5MB 2YB1A 2IXJA 1VJZA 4ZPIA 3CUXA 1JPMA 3G1YA 2QGHA 4Q0UA 1YQ6A 4PMUA 5CPMA 5GJPA 3AYCA 2XH2A 1REEA 3GR4A 1Q66A 4LUTB 2A5HA 3C3VA 1DE5A 4CN1A 4ES8A 3A22A 1R64A 3VI2A 3WDRA 5H9QA 5KTLA 3LEMA 1G9BA 3W1MA 4HANA 4BB3A 2J75A 2XPKA 3LEPA 3EDDA 3MQTA 4O16A 4GA8A 3LU2A 5F5AA 1TA3B 3ZFFC 1UR9A 5DN1A 2P2KA 2JEPA 2CLHA 2XIIA 1EGMA 3SBFA 2C0AA 4GLEA 3VINA 1B2YA 2P5BA 2QQMA 1CQ9A 1ZU8A 3VDDA 3CK5A 3VBFC 2AH2A 1D4M3 4D6SA 4HT1T 4ROPA 4NRQA 2DFBA 4KS0A 4Z92B 1OI6A 1K45A 5GLUA 1S2EA 1E72M 4U2YA 4W84A 2CY6A 3APBA 4RX0A 2R1KA 1PYMA 4IE7A 1Q3EA 4DPPA 3URNA 1W05A 4UTTA 4UW4A 3TTEA 5FZ3A 4LIVA 3CV2A 3OVGA 3VL9A 1GOKA 4URIA 4B4FA 1Q8QA 3EXTA 4AGVA 2O9OA 5JXHA 2P8CA 3UWZA 1JZ5A 1PKLA 2QZ3A 4H00A 1HB4A 1TE1A 1L7QA 1VFOA 3QSTA 4HKPA 1U5XA 3CZLA 1W6MA 2GP5A 2P4EA 3ABRA 2VMIA 2B81A 4JFTA 3A12A 1NXMA 1A34A 1AXKA 1UAIA 1U2YA 1PPIA 4Y8EA 3S5NA 1HKJA 4YVVA 2PS2A 1S2AA 3CMJA 2G3FA 4Q4V3 5H91A 4PEKA 3ZMRA 2QDDA 2IXUA 2OSYA 2ZUSA 4P7RA 2W08A 4YCPA 3WQ5A 3M16A 3BPWA 1RCXB 3NL5A 3P6BA 2Z5WA 4KBBA 5JSOA 3AZWA 1NP2A 3AXMA 1N1TA 3PZUA 3R6IA 5JIUA 1JNEA 5M03A 2X1IA 4CVUA 3QW3A 2FCVA 3IS4A 3BAKA 4KKXA 3HURA 3SISA 2GC0A 2JDPA 3AFKA 3E5UA 3QGAC 5J7MA 3TQPA 4YVSC 4U33A 3RR1A 1ZTVA 5I3HA 3FGCA 2UZ9A 5K9XA 2WABA 1Z9AA 1V6JA 2SLIA 2QCGA 1OWQA 2Y62A 2DBIA 1FHDA 1NY1A 1UXZA 5H9PA 3OU8A 4WVMB 4IE5A 2WL1A 4ACZA 2W87A 4GUGA 1RIRA 4GY1A 4LU0A 4MNJA 4EWDA 3U6WA 4XD5A 4YVPA 1CAWB 1GPWA 1XP3A 3C2EA 3BWWA 3GZAA 4E38A 2P1FA 1T5AA 3DC0A 4IX0A 3GC2A 1JYTA 3BMXA 1H9WA 1OFOA 3Q58A 5I79A 2NSOA 1B57A 1Y9MA 3W7IA 4HN0A 4EAYA 4Q7IA 1EZ2A 1GQLA 3E6DA 1KJRA 6TIMA 1E1CA 2ACUA 3M3EA 3KX6A 2HE5A 4U3CA 1JI1A 1OPOA 2WAOA 1SR0A 2MEV3 3BICA 2O56A 4H2AA 4DJFA 4UBHA 3MTWA 2ZTNA 3STFA 4W6WA 2I5IA 3VTRA 3UPWA 3CAVA 1QO5A 3GIPA 4O1EA 1ITXA 2HWC3 4P9YA 2FDMA 3AICA 3P3PA 3LTSA 2GH2A 5LGZA 1X8FA 3B40A 1I2PA 1Z44A 3P0WA 4DBEA 5C2CA 3G3DA 2BASA 2WSYA 4SLIA 3N2CA 2YZ4A 3RCNA 3B0YA 3AP7A 2VQTA 5HR7A 4OBRA 1MNSA 5FPXA 1FWIC 4QBXA 1DCSA 1XYOA 2Z69A 3FJ4A 5F8PA 4PUEA 1D7FA 3HG2A 2C9AA 3R89A 5B4XA 2QIWA 5DT7A 3BTXA 3WCSA 1W1PA 3ZFHA 3OBEA 4C0BA 3IIVA 3DFPA 4FEZA 4U5KA 4XBQA 1LP6A 2VX5A 4A2SA 1KBJA 2ZX0A 2I17A 2WCAA 3BIEA 3JZVA 4DO4A 4ATLA 4S38A 5FK8A 3QQ1A 1ND2A 5A3PA 4GB32 3K8MA 4O18A 3U7VA 5CFDC 4AISA 2IFWA 3QBQA 4N9IA 1EGZA 1RUSA 4F9JA 4G56A 4AFCA 4S2HA 3ZFFA 3ZLFA 3PIJA 1JYXA 1SJAA 3AIVA 5CJ5A 1U83A 1EP1A 3R12A 5K4XA 1BFNA 4GIYA 2ZX4A 5FEXA 1NQ6A 2CZEA 1Z7AA 5JR2A 3DEQA 4BZ4A 3DHPA 1QJX3 1AA1B 3TWBA 3I2JA 3F5KA 4EWND 4O52A 3T1MA 3ILNA 2X05A 3JB8A 1ONRA 1TQ5A 1QJY2 3LA7A 1TQXA 5HATA 1F3XA 1I8JA 1RHI2 4A3QA 2GJRA 4AE2A 1WMEA 4IT1A 1TME1 2XR4A 1MS1A 4GWNA 4LORA 3W83A 4QMAA 4INFA 2FDSA 3OA3A 4JGYA 3HJZA 1DIDA 1R2RA 2FFCA 1Z89A 1T96A 3RITA 1C28A 3DN7A 4AHXA 3H7RA 1VMFA 3ZSLA 4G1KA 2NXGA 4QXCA 4RE0A 1BXNA 3RM9A 4B2DD 2CSGA 1IWPA 4LX4A 3FYYA 2YU2A 1GNZA 4NILA 3TC3A 4AQSA 1W17A 3WLNA 3SLIA 4XTMA 3UKNA 3UFYA 3D46A 4O57A 1S46A 2E09A 3EPMA 3LD8A 2DP3A 1FOD2 4XJZA 1DIWA 3WO8A 4FZIA 2BOGX 2PDYA 1HQTA 4FR1A 3JR2A 5C8CB 2VCCA 3M3OA 4HPNA 3CT7A 5DLCA 1XJBA 1J4EA 2DSWA 4RFRB 1JEZA 1UZ1A 4PJYA 1WOBA 3I2FA 1HB3A 4QISA 1LROA 5D9OA 3DPRA 2Y63A 1RUF2 1WDWA 4JXCA 1CXKA 3PZ9A 2PCQA 4IL0A 5DG1A 3PPHA 2VBPA 2WWSA 1BYAA 1VKFA 1K70A 1JFHA 4D1JA 4IEZA 2YV8A 4GI6A 4BLIA 2E6FA 4Z1CA 3TW6A 2VZQA 3EDEA 2GK1B 1QHPA 1BQCA 4TQTA 1GHSA 1I5PA 4E8DA 1EA0A 5BNNA 2RR12 1XG4A 3OBRA 1X6LA 3TYAA 5FZ6A 4B5NA 2A4AA 3W1TA 4BF9A 4XC9A 1VCVA 5RUBA 5KZDA 2CEQA 3ZO9A 3QMTA 5JIAA 4YYFA 4Z82A 4NIHA 3O7OA 3VC6A 2PF8A 3CQJA 5C70A 1FUYA 2YGLA 1RVF3 1GOGA 2IC1A 5FZ4A 1UWWA 4B4PA 2H0VA 2V63A 3G7DA 1XV8A 4QWNA 2QNEA 2QJNA 3HPFA 4Q4W1 3WUDA 1X96A 1E0WA 1S2VA 2PQSA 3A0KA 3LCIA 1QY4A 4Y24A 2CYFA 4CNPA 3BQ6A 4MWAD 4OHQA 3WX7A 1RP8A 1M06G 4DJFC 1K8CA 2DVDA 4URTA 4BQ5A 3M2MA 3W6YA 1DHKA 1G9FA 2PLJA 1X97A 1RYYA 4XILA 3MI6A 5C9WA 4B4RA 3POFA 5F3EA 3CJIC 1MFVA 4B4HA 4Q4V1 4O10A 5G2WA 3VOFA 1LODA 3BG5A 4CZSA 5DCBA 4A3XA 2BJSA 4F0SA 1AJOA 4F0MA 2RDRA 1O94A 1UU5A 1TPC1 4AMCA 3MY9A 2Z28A 2GALA 2A7NA 3S2MA 1E0TA 4XF4A 1W99A 1TME2 1VP6A 1G9CA 1I9CB 5FCCA 1CT5A 3MSDA 1E1FA 3CO4A 5D9NA 2HXTA 4DAIA 1FATA 1RUC1 3UNTA 3L5LA 5GJMA 3SUVA 4W50A 3BSGA 1HGYA 4RV8A 4IGNA 1XSKA 4PEEA 4PDWA 1SCRA 4NP7A 4MXVA 5CFDA 3MUIA 5GZCA 4WY0B 4US5D 3C2RA 5AYYA 4UCGA 1NY72 5FBJA 2FPTA 3KTSA 1S5WA 3S2LA 1S0BA 2R072 3Q8BA 3IPWA 3BMWA 2IXLA 1LQ2A 2NV1A 3USUA 3G6LA 1RUF3 3GNDA 3WH8A 2G3JA 3TN3A 5FMBA 5JH2A 4B5UA 2FDHA 2EJ1A 2EQDA 2CDOA 4E8CA 4P9GA 2V5BA 2J8TA 3OYXA 4D8MA 5JOWA 1AYM3 4M1BA 2VUDA 1SBDA 3LPGA 4LKFA 3W7RA 2QS8A 4M1RA 2WT2A 3VB9A 4A7KA 3L4YA 5A3WA 1J59A 2XUCA 3A24A 4H7MA 3IB3A 1KCZA 5E9XA 5FREA 4IEOA 1R092 3AIWA 3AVSA 1B35C 3KHBA 4MMWA 1N82A 4XBLA 1F9KA 1QH6A 3WP3A 3VDBA 4R8HA 4OI2A 2ZYFA 1NELA 4MGIE 2ZGLA 1FX6A 1IS5A 3GD6A 3W2MA 4RQPC 1VRH3 3OB8A 2Y7GA 4IFRA 4BK9A 4AOCA 1J6OA 3VIKA 3EO6A 4K68A 3I6RA 2OIIA 4RLIA 1NLRA 5DBTA 2R14A 1ODMA 4D8ZA 4YRDA 4KWVA 1PL9A 2PYTA 3MF9A 3TEZA 1IWAA 2WLYA 3CL8A 4NHMA 2BNMA 2DV0A 4K1WA 1WOAA 2GFTA 1CECA 4M24A 4N4QA 5JIPA 1AR93 4E2GA 1S5VA 1RMU1 5D8AB 2EAAA 1Q8AA 4GKXA 1SZRA 3M44A 3U57A 1R3SA 2OWWA 4XDOA 2WMJA 3NQAA 4YTQA 3UGGA 5GALA 3V16A 5C9RA 2E7FA 2OZ0A 1A3XA 1DWIM 3MUZ1 1RY8A 3SH5A 2D0FA 1LOBA 3LNMA 4GH1A 4A8NA 3W7EA 2GPTA 3CTTA 3GG0A 2BBVA 1T6MA 2D2HA 3FKRA 4DPQA 3CV6A 4LC6A 1Q8JA 3EWYA 4JDOA 1BK0A 1UH3A 1LL6A 1VPXA 5A80A 1TIMA 3HGSA 4UTMA 4JCKA 3GXFA 5C9ZA 5I06A 2WMGA 3RPDA 2ZZ3A 2Q1MA 2R0HA 1YW1A 1GNXA 4EROA 3WLTA 3DN5A 3DFNA 4LMFA 1ITQA 2I16A 3VDHA 3AU6A 2PDWA 5CPLA 2DTWA 3GG7A 1W6PA 2R1LA 3DFTA 1OPMA 2DU0A 2CFFA 3G6JB 4A6GA 1W3KA 1VYSX 1PVC1 1OQDA 2Q8CA 5EYWA 2A1YA 4DN1A 4WDTA 3HT1A 1W9XA 2QNKA 5A8GA 5FL1A 2RDSA 1BD0A 3EGJA 3DECA 1GYNA 1TTIA 1I0DA 5I3FA 2HWC2 2NUWA 5FP7A 5D2TA 1JRCA 4GI4A 2AEYA 3VBSA 3NVTA 4TX6A 3R0KA 4Y9OA 4QDRA 1ZJAA 2Q0AA 5L7OA 1OB0A 4AQTA 1L6GA 2JBMA 2Y85A 2VC7A 3JQXA 4Q4X1 1QOPA 3H1MA 4HK8A 3CUZA 3G77A 4KGQA 3WDYA 3BAIA 1FH7A 3G0SA 3SFWA 2XXZA 2VWSA 1BG9A 1GWLA 1K9EA 1UPPA 2XL7A 4K40A 3WNNA 5L36A 4IP4A 4H8UA 4NJIA 5E6YA 1UZZA 4XHXA 5L9BA 5IVEA 1RK6A 4RHV2 4QDMA 5BOFA 2NQHA 2DVBA 1MZEA 5J37A 2CZVA 1DF0A 3WEOA 2C1IA 3O1PA 3PBUA 3WD4A 1H1NA 1REFA 1EP3A 1G4EA 2FH6A 2FFIA 2YDQA 1E5RA 3LCGA 4TR9A 2AAAA 3UJ2A 1VRH1 3NQGA <