4CCCA

Structure of mouse galactocerebrosidase with 4nbdg: enzyme-substrate complex
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
644
structure length
640
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords GALACTOCEREBROSIDASE
publication title Structural Snapshots Illustrate the Catalytic Cycle of Beta-Galactocerebrosidase, the Defective Enzyme in Krabbe Disease
pubmed doi rcsb
source organism Mus musculus
total genus 218
structure length 640
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4cccA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4cccA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4cccA01
3FHAA 4P7RA 2VX5A 1SO4A 4AC1X 1PBGA 3HPZA 4W5ZA 5ABEA 3TKFA 5BWFA 3DFSA 1W5OA 3RK8A 5U4NA 2RGLA 3BLFA 1XGZA 2FB3A 2X0HA 4FFFA 2VKZG 3WF2A 5CSUA 4RK8A 3C6CA 1CGYA 3PZQA 1PX4A 3G1HA 4BWLA 2QF8A 2ZX6A 3ZMRA 2C19A 4PL1A 2J7HA 3RJYA 2ZDRA 3BGGA 2WSPA 5D4YA 3HGSA 5IM51 3VX0A 1DWAM 2BLEA 4HU0A 3MSGA 2NLIA 4FXSA 4P2VA 3TQKA 1B3ZA 2IXVA 1DKWA 2PI6A 1QI4A 1TJRA 1K6AA 1HKJA 2XWEA 2VEMA 4XTIA 1UD6A 3N1AA 1WO2A 2YDQA 3JUGA 2A3EA 4IX2A 4H2CA 2BNJA 3GDRA 1NP2A 5C71A 3NQ6A 1UD2A 1V02A 1M53A 1W9VA 4BK9A 1ZAHA 4JTIA 1BYCA 2WBKA 5LSMA 4M1RA 3AMDA 1KB3A 4CQAA 1EH9A 4D72A 4H8HA 3AHYA 1A3HA 1OT2A 5CPLA 1UD3A 4ZZ9A 1JQVA 4JHZA 4AIUA 3BAKA 2WHLA 4O0KA 2DGAA 2HS6A 4MY9A 5F4WA 4RLIA 4NI3A 1M7PA 1OCQA 4FNUA 4MZ1A 5LHEA 2X09A 3GH7A 1DL3A 1SZEA 1V6WA 5AC4A 4BZYA 1JZ3A 2VOTA 1I2QA 4LNYA 3OSDA 2H8ZA 1I2NA 3FS2A 4JEQA 1GVYA 1V03A 1QOXA 5G2HA 1KFWA 1VJZA 5A6AA 1SZGA 2CLOA 1TPFA 2J88A 3C61A 3QR3A 1GQIA 1HJVA 1B3VA 4PL2A 4TTUA 1I1WA 1W32A 2ABBA 4OWGA 4OZOA 1MW2A 1FP9A 4M56A 3LPOA 1FXQA 1UQYA 3L2LA 4JIEA 4ATLA 4UTFA 1F05A 2FLIA 5CG7A 4HPGA 4MKNA 4ML9A 1C3FA 1OFBA 2PURA 1OINA 2FHCA 8A3HA 2I9EA 5AHEA 3C52A 4FK9A 4UTWA 4HOZA 4OV4A 4LS0A 2FHBA 1SMAA 4O1BA 1H7NA 2EGZA 2JE8A 2ZE0A 4MFDA 2WZHA 5HULA 4LVGA 4EVZA 1GONA 1C8QA 3TFXA 2JEPA 2V3EA 4MVAA 1LROA 3MHUA 3LHVA 2RDWA 3L5MA 1J0IA 5D02A 4RZ4A 4LYQA 3IGUA 5HUPA 2ZXDA 2FIQA 4UMBA 4TVCA 2YFNA 5K2ZA 3EMCA 3M07A 1N55A 1NQ6A 1TRDA 2G5WA 1HP5A 4W7VA 4NXSA 3C3NA 5A95A 3LTSA 3WEMA 3IRDA 3UG4A 1K8XA 1QPOA 1TTJA 4MB5A 4JYFA 2UY4A 2CLHA 2ZX7A 2VFEA 1PAMA 4MTVA 1XYZA 4CGTA 1XH2A 3OLDA 3LPFA 2P10A 3TQ0A 5CGTA 1ME7A 3F4NA 5D2VA 1MQQA 4MFEA 4AZCB 4X0NA 3B0VC 3OLGA 1GOOA 1WBHA 2E6YA 3DHDA 4AMAA 3UXDA 1R47A 1JAEA 3W84A 4EIVA 3SCQA 3MWAA 2FQIA 3FIGA 1PHQA 3IAQA 3GR7A 3P8JA 2GVYA 4AD0A 3NNTA 3GLCA 3L65A 2WMIA 3HOJA 3EWXA 4LPCA 4LRSA 3JS3A 3CPUA 1VYPX 3L4VA 3WUEA 1CX9A 3DENA 1ZCOA 2EXOA 3G3MA 1H5VA 3AMLA 2QLYA 1LYXA 4LUIA 5HQEA 5DEZA 1E55A 1LWHA 3W2JA 2W79A 1FH7A 1PPIA 3IK2A 1XD0A 1G94A 1UUMA 2EEXA 3SUWA 1R87A 5FI8A 1WAUA 3MI2A 1UR8A 3PTMA 1LOSA 2EO7A 4R27A 4J27A 1C8VA 2E8YA 2V3DA 2D0GA 2A21A 6CGTA 1UYPA 3VD5A 3KFTA 4YWIA 5BMWA 5AHLA 2JFEX 4WY0B 1YYAA 1CENA 3RF9A 3KL0A 3QOKA 3DAQA 4HSNA 3LTYA 3LOTA 3SCNA 5I79A 1X1NA 3VMOA 1D7FA 3ABSA 4EWND 4R34A 5A94A 3LI1A 3LBCA 4RZ6A 2ZZ5A 3IVSA 4ZFMA 1YLVA 3CT7A 1K8ZA 1GPWA 1HJSA 3O05A 3IJ7A 1FH9A 4NNCA 4XUYA 2YW3A 5M03A 1D3GA 1YTEA 5AC8A 5FK7A 2QCDA 1GOIA 1OABA 3VNDA 3AYRA 1TMQA 3W53A 4WSJA 4W7UA 4IUOA 3RCNA 1TIMA 1IXQA 3WF0A 1TPWA 1ZL1A 4W86A 2YOCA 3ZFHA 4PBGA 2CLEA 5DN1A 1DQXA 1E6RA 2VRKA 1QDSA 1G9HA 4NRSA 3AYSA 1FWRA 2VQUA 2VR4A 3TAOA 4DO6A 1TPB1 1XDMA 2WMKA 2ADEA 3RO8A 2E5CA 1SU5A 3LHWA 3RLVA 5ABFA 2QHAA 4DWSD 2D73A 2YLAA 3N13A 4UQCA 5BYWA 2WV8A 4A22A 1V0KA 2GJRA 1I45A 4HA4A 3LCGA 2J7GA 5BXSA 4QNWA 4PCTA 1V0NA 3QW3A 3KVLA 3ZT5A 2CERA 1VCGA 1N8FA 1UA3A 1HX0A 3F5KA 1KTNA 2CLFA 1L6SA 4RE4A 4E8CA 3P62A 3TOPA 3U5UA 5A6KA 5AY7A 2WB5A 4FFIA 2RKXA 1V5XA 1H61A 3QSTA 5AHIA 3NL5A 1CXEA 3IGSA 1NWTA 1O5KA 3OLIA 3NIYA 2OZ0A 1US3A 3U5YA 3OGSA 3TV8A 4ZE4A 1K9TA 3PTQA 1FY6A 1R46A 1LL4A 2B31A 3EYPA 5I6SA 1UKPA 4ICNA 3LIHA 5HNNA 3W72A 8TIMA 1J12A 3ZT7A 3AJ7A 4GFSA 1VEOA 1QNRA 3PSVA 3L4YA 1U2YA 3GNDA 4ACYA 1E56A 4NXKA 1M6JA 4QLJA 4TMBA 3E12A 5D30A 4EANA 3WFAA 5A8OA 3G1SA 5HBFA 3ARZA 3NAVA 2YA0A 1H63A 3N14A 4CCEA 3IIXA 4P8UA 4PC8A 4TU1A 3QMRA 3B03A 2YZRA 1VH7A 2FDMA 3D5HA 4PRWA 3JRKA 2ZWYA 2YDSA 2PWGA 1L6WA 3U6WA 1HT6A 2V38A 5LNSA 3LCXA 3A4WA 1VHNA 4H6KA 4ZXOA 5F1UA 4OUEA 3UG5A 1ADOA 5A69A 4WOZA 1EO5A 2Z1KA 2YPIA 3HG2A 3IEBA 3W7GA 3GX9A 4A29A 1W1TA 4JKMA 1LDCA 4GZJA 3SUVA 3VOCA 3WFZA 4ATDA 3SJ3A 4D6IA 5AN7A 3NQGA 2BY1A 3ARRA 2YR1A 2F2HA 1E9LA 3RWKX 1V02E 2GJNA 3Q37A 3EEGA 4EF9A 2QCEA 1QI3A 1QPKA 4IPLA 1XRVA 4PN2A 4RE3A 3W1AA 2A7NA 1TPC1 1YDOA 2CBUA 1HL9A 2V2CA 5F2IA 4B15A 1GQKA 3ZT6A 1FDJA 3HG5A 1XSJA 3KL5A 3B04A 3WMBA 2UY3A 3ZWTA 1NSJA 1C8XA 5K9DA 2A7PA 1WP6A 1B4KA 1RD5A 3DHPA 2Q3RA 3W1UA 2RGMA 1V6UA 2TAAA 4JIQA 1ESWA 1KGUA 1GJPA 4JDBA 4WJEA 3W23A 5I3DA 5I0DA 1GG0A 1JAKA 1X6UA 2E9MA 5K4ZA 1WB0A 3PZVA 1B3XA 4CU6A 2J25A 2C13A 2DIJA 5HWNA 4UTMA 4OIFA 1SW7A 4PYSA 1QNPA 1XBXA 4HNUA 1CLVA 4IMDA 3W7DA 3WDRA 2OJPA 4O15A 2YLLA 1P6WA 4U5IA 3W82A 5IHSA 3VIFA 1ICQA 4JNMA 4IMGA 4ADSA 2W5FA 2X1RA 4JS3A 1GOMA 1K03A 1R7OA 1GVIA 3ARTA 3POCA 2B7NA 1TQJA 4HPXA 4PFMA 3UPBA 4M7SA 1RP9A 2FGZA 3BW2A 2WMHA 2DZTA 4GBUA 5CPOA 4GZIA 4DBEA 1CGUA 3NEVA 1KM2A 1HIZA 3TUUA 1UR1A 1VRDA 2Y7EA 1JYVA 1Y4WA 3JR2A 3PVFA 5G5IA 4JTSA 4JFSA 3H55A 1AMKA 2P0OA 1EA9C 4O14A 5KITA 3EDFA 4HA1A 2ZXQA 4XX6A 1ZBKA 3A21A 4CD5A 4FNQA 3WNNA 4RJEA 3BG5A 3ZO9A 1FFRA 3RJXA 3MANA 4O18A 3F1QA 2ZRWA 3NR0A 3TC7A 2BX7A 3T7VA 2QKFA 4HMCA 3RMEA 4GE8A 3FYPA 4LTSA 1OFDA 4HIBA 5LNRA 2XWDA 1VJSA 4M81A 3ZJKA 3VDCA 3POHA 3VNYA 3MUIA 1DWJM 1QAPA 3WMCA 2GK1B 4UZUA 4HHPA 2BTMA 2QUTA 3S5YA 3BLPX 1FHLA 4NX0A 2WNWA 5GNYA 1SMDA 2O7SA 2XN0A 9CGTA 4GUJA 4N9CA 4AD3A 1JRBA 1JXJA 3KF5A 2VQTA 1GQNA 2XJ7A 1SZNA 4W7WA 3WNOA 2CXGA 4JX4A 1QW9A 4IJBA 1F7BA 1W3KA 3LF7A 1UZ4A 5D9MA 1RQHA 2QCFA 3WD2A 2O7QA 3W7PA 5FK8A 2QJGA 2CLKA 3MP5A 1M04A 4FLSA 3VIJA 2FGLA 3A4XA 4OU1A 4GXPA 2J7DA 1JI1A 3WMSA 3C2FA 3NL2A 1V7YA 4UQEA 1M03A 5HJLA 1GTEA 3O6YX 4WX2A 3FKKA 1VBUA 3K1DA 2VC9A 4UTTC 4UNKA 4JTEA 5C8BB 1SO6A 4ZQCA 1KWGA 1NWSA 4RXGA 4C7FA 2GQ8A 4CU7A 1OFQA 2DEPA 3WH6A 4H3DA 2C8NA 3WY1A 1MO0A 1Z42A 3PF3A 1GHRA 2XIBA 3N9KA 5D32A 3QPYA 3N73A 3W3OA 3CUGA 2HTMA 3CPRA 3OB8A 3QH2A 1S3HA 1CGXA 1UR4A 3MI6A 4QP0A 2V5LA 1K7FA 3WN6A 1W0MA 3HMCA 3K8KA 3QEZA 1GJWA 3CMJA 1TO3A 3S1UA 1GYLA 1RPKA 1Z32X 4H41A 3KRSA 2V3FA 4UR8A 1W9UA 4W93A 3ZWSA 4W88A 2E6FA 3CU2A 4HNTA 5TIMA 1BVZA 3MJYA 2IQTA 2FB2A 3I3BA 1JDCA 5AHFA 3W1PA 4AAJA 4BFAA 3AJXA 4FIQA 5AHNA 4DF1A 4JDYA 1JYXA 1J0KA 1K02A 2QCCA 1ZS2A 3SW6A 4H7VA 2XFYA 3G0SA 3CUHA 1X7FA 1XFBA 3W7QA 1TPH1 1VR6A 4LU0A 1Q4NX 3D3AA 3W26A 4JTJA 4EK7A 5FD0A 3INPA 2Y89A 4E0CA 1YTDA 1KCLA 1V0LA 1LTDA 3ATYA 3NG3A 5GQBA 3EX2A 2CWNA 4O13A 1K9FA 4UFMA 3P81A 4Z0JA 1J5TA 4BI7A 3MV01 3SUTA 4PMOA 5BRBA 1BVNP 5G4WA 3S5QA 5C2XA 2TRSA 5F4SA 2JGQA 4P7LA 1LLWA 2PC8A 3MKKA 5JBDA 4AD2A 3CIXA 1PCKA 3GBDA 3SCUA 4O54A 3CHFA 1JF6A 1KV8A 1CYGA 2XFFA 3OIXA 1H2JA 5CSSA 4Z1CA 1C7SA 3N15A 2E6DA 1ZNNA 2ZTKA 5FIPA 1G7UA 2PCQA 3DHFA 3MMDA 4FLRA 4W5UA 2QDHA 3G0UA 1JNEA 1CXLA 5I3KA 3GDKA 3NDZA 3O8AA 3QW4B 3S5NA 4XZ9A 3FYOA 4JKLA 1LLZA 1UJPA 4TX8A 1H62A 3PS7A 2QJHA 3W0KA 1JUEA 1TV5A 1OK4A 2A0NA 1QPNA 5K9CA 4O52A 5K4XA 1KLZA 2XFRA 4O4VA 3C8FA 1P5BA 4AZHA 4JFWA 1B4EA 3A5FA 3BLIA 3T0DA 3SFKA 3THDA 2CLMA 3C2VA 3BAYA 2OWWA 1MWOA 1H1ZA 3ZQ9A 1JF5A 1OK6A 5FEPA 2VUYA 1V0MA 3LV6A 3OEXA 3MW7A 1SFSA 4AIEA 2H3BA 4A21A 4IPNB 2ZZ1A 4WKAA 1B3OA 1WX0A 4TTGA 3WDJA 1TREA 3GNNA 2A4AA 3CB8A 4AWUA 3TCEA 2NWRA 5DY2A 3WEZA 1ZENA 4JTGA 2W4XA 1J2WA 1OFAA 4W8LA 1JCJA 3CLMA 2QR6A 1UUOA 4Z2GA 3TJXA 3TXVA 1WNOA 2XVGA 3BGAA 4CQ8A 4AZ7A 1H41A 3HJZA 4NNBA 2Q8LA 7TAAA 1TYGA 4DUVA 5G2IA 1JCYA 5F4XA 1ECEA 3TQVA 1R7AA 2DZXA 2ZX9A 1GOKA 5CLWA 1UWQA 3VKKA 1R85A 4WY0A 3OGRA 1V6YA 4KFNA 4FIRA 1JXKA 4TUFA 3S6DA 2BVTA 1VEMA 4NUWA 3KX6A 2DT3A 1V3HA 3O6CA 4X9SA 2ZUSA 3ZSTA 3T78A 4MY1A 1LJYA 2BHZA 3SSJA 1PIGA 5D2TA 2DIEA 2JF7A 2WNZA 1JD7A 2D24A 1W3JA 5IBXC 3PTKA 4K68A 1KTBA 3SGZA 3PBWA 3AS0A 4L4LA 5DXYA 5E0KA 3AQUA 2GUYA 1EEPA 2EBNA 2AEYA 2QAFA 1LQ0A 3GNRA 1UD5A 3WD3A 2VZUA 3O6AA 4ZENA 1IXNA 3N18A 2WWCA 5AC7A 3Q58A 4K7YA 2C14A 2GFTA 4J3UA 3PG8A 3HJEA 1H7RA 3QQ0A 3MUAA 4V2XA 5CZJA 2DT0A 4GQRA 5A6SA 3VIOA 3MV11 4YL2A 4CKQA 1OIMA 2G8ZA 3VMNA 2CNCA 4O10A 1X6LA 1V3IA 1WV2A 1HUVA 1XUUA 3USBA 1VYRA 3KRUA 4WKHA 1FWSA 3W83A 4B9YA 1A5AA 4C7DA 3U7BA 3H53A 2YJQA 3CTTA 3G0XA 3BG3A 4O11A 2EJ1A 1K3UA 2VOMA 1JRCA 5BOOA 1CGVA 2YBUA 3BSHA 3FFSA 3MBDA 1V08A 3PY2A 4QM1A 3MUZ1 2NV1A 5DBTA 2J9XA 1E5NA 1AL7A 3PZNA 3OVQA 4MY8A 3W22A 1BFNA 1QHOA 2Q3OA 1VRXA 3UEQA 1GWJA 4U33A 2AOSA 3N2XA 1AQ0A 3J7HA 4KFPA 4XZBA 3AMKA 1XBVA 1OIFA 1Z48A 2ZZ3A 1BWKA 2ZZ6A 3L0GA 3OHIA 1E0VA 2ZUTA 3LCWA 1DV7A 1I8JA 3L0NA 1SR0A 5HPOA 2D20A 4MJ4A 2Y85A 2VNCA 3WD0A 3K8MA 4AB4A 3W28A 4HOWA 4UQ9A 4DBDA 3HGOA 2Q8ZA 5FF4A 5E70A 3W7LA 2VZOA 3AIWA 5FKCA 5J5DA 3LLDA 2PRHA 1HXJA 1BWLA 2WNNA 3WUBA 1HJUA 2DH3A 5I78A 1G7VA 1AG1O 2Y70A 5A2AA 3G3DA 3PIGA 2ZRVA 4O50A 3QHNA 2QV4A 3SUSA 1EWEA 5LKYA 1E5JA 2QUUA 2WSRA 1PX8A 3VGDA 3NGJA 1E6ZA 3AIEA 1EIXA 4UTLA 3AXIA 2J27A 4P8XA 1JDAA 2ZX5A 1SW0A 3G6LA 1X1OA 2Z2UA 1YQ2A 3U75A 3WK1A 1TA3B 2ZBTA 5LGZA 4NJJA 2BXYA 1GEQA 2YL6A 5F2MA 3N34A 1GORA 1WKYA 1ZJAA 3LX9A 2ZX8A 4BF7A 4AHPA 1OJXA 2WPBA 1ZBVA 1O60A 1MEHA 4JYEA 1LWJA 2RFGA 5EPDA 1JD9A 4X0VA 4PUDA 5HWMA 1DOSA 3WJYA 4GPNA 3KL3A 4HXCA 4DM2A 3LMYA 4HPHA 4GUGA 4MOZA 1W54A 5ABTA 2VT0A 2JGYA 1L6YA 3S1WA 2VFGA 3CZKA 1JCLA 3AHTA 3GXPA 4NNAA 4FF7A 3DYOA 4CD4A 1C92A 3NMBA 3QRHA 4P61A 2CCRA 3PB0A 3AHVA 3ZR5A 1W91A 1JUKA 3G1AA 1QI2A 2Z6IA 1HO1A 2H8XA 5GNZA 2DJLA 3R12A 4D6HA 3BGJA 2VFIA 3AHXA 3O07A 5I3FA 2XVKA 1A5SA 5FOOA 3W1MA 1CZ1A 2CPUA 1ZJIA 2BVDA 1GVSA 4GINA 3VDBA 1FCVA 4W8BA 3VIPA 1YDVA 1EDGA 2QMKA 3KVMA 4DF0A 1XCWA 4GNJA 4HTYA 3NSNA 3W88A 4UR9A 4V28A 1FWWA 4Z08A 2ZCGA 4CD6A 1OG0A 5DT7A 3G1YA 4PTVA 3NOEA 1VBRA 1I75A 1DP0A 2CZEA 4B9ZA 1OM0A 3HMJG 4PMUA 1G4PA 3UESA 4CD8A 5M5DA 3TK7A 3UWVA 4S3JA 2ZA2A 2Q8XA 3OBKA 2VI0A 1F6PA 2DSVA 5AYBA 3NQDA 1KW1A 2ISVA 3BPWA 5T26A 5CSRA 4DELA 1C90A 2F84A 1F76A 3BMWA 3BLKA 5BXRA 2VMFA 2GK1A 2DZUA 1SZFA 1W1ZA 2X1UA 1KXTA 4GIAA 3WIJA 1P4CA 4W8AA 4AZ5A 5D33A 1JZ8A 1W3LA 3L21A 3TC6A 4E4PA 1GHSA 2EPLX 3ABRA 4RKAA 5DF0A 2E4TA 2VVNA 4U5KA 3O15A 3TH6A 4X2RA 4K37A 3UG3A 4Y96A 3K4AA 3M41A 2VFDA 4U4MA 1CDGA 2E5BA 4PH6A 1IZKA 1VFMA 3SR7A 4R53A 3AMGA 2XN2A 3TU9A 4KGLA 2WLZA 3ABOA 3STEA 1E73M 3GVGA 4FLOA 3LFIA 1HTIA 1NF7A 2D1ZA 1MW3A 2R91A 3GM8A 1EX5A 2DZSA 2ADDA 2IXUA 3LHYA 2PRMA 2QQUA 2X1SA 3DU0A 3AO0A 3IIOA 4JCMA 2XIIA 5BNKA 4AEEA 1FBAA 1Y9MA 2ZTJA 2GPTA 5EBUA 3QYQA 2J7CA 1DWFM 2OYKA 1C9DA 1QW8A 3DI1A 1UWSA 1KQZA 3WH7A 3WNLA 3NYZA 1FOBA 1E4MM 1ONRA 4IOTA 5I3IA 5FEWA 3N11A 1VAHA 3QHMA 1E0WA 4JTTA 3ZSSA 1DHPA 2PBOA 3BH4A 3U1XA 1DWHM 4Y90A 2VO5A 3LERA 4U2ZA 5A6LA 1XC4A 4AEOA 3K4DA 2YCEA 1UCWA 4TX9A 3R8RA 2WM0A 1EWDA 2B7QA 5A6MA 1ICPA 3W1RA 2V2HA 4PA8A 2WHKA 3PZUA 5DY3A 4UTWC 1GPFA 3KAOA 4IUGA 2IUZA 2V82A 1Y7VA 3WD1A 2V0TA 5HNRA 4LYPA 2V5BA 3WD4A 1EHAA 3ZJ8A 4CN6A 1KM5A 2ZA3A 3EX6A 1VFFA 1S5TA 5FF0A 3VIIA 1GQLA 2VEKA 3ATZA 2CBIA 1W2TA 4MNJA 2FHFA 3KRZA 1JFXA 1ZU8A 3MMUA 5IHRA 1P0KA 4BQ2A 1W5NA 4DPPA 1VJIA 2JBMA 2YA1A 4LX4A 3RDKA 5FMBA 3T0BA 1UUQA 3STFA 2OT0A 1Q6GA 5A6JA 4MADA 3AMCA 3CZGA 4CCCA 4D6JA 2E6AA 5AFDA 4LXFA 1QNOA 1L0PA 3CUFA 2WXDM 4QQ3A 1MEWA 3G8RA 2QJIA 1FQ0A 1E0XA 1M01A 2VRQA 2JK2A 3CIVA 3GR8A 4J3XA 3TNOA 2QF7A 1FFQA 5F1VA 3GDBA 2EQDA 3UWWA 3MU7A 1AL8A 3SUUA 2JKPA 5KTLA 3NSMA 5KZMA 2BFGA 7CGTA 3WH5A 1KBKA 3H54A 1K9EA 5DBUA 4RCXA 3I7RA 2WVTA 1XBZA 3HPSA 4MUZA 3DYPA 2O9OA 3BARA 3NQVA 5CPTA 1XKYA 3SCVA 1MFUA 2GSJA 4V27A 1BKSA 4HT3A 4O17A 1J0ZA 2YYUA 2C7FA 2A6NA 4NJGA 3SCPA 2VX7A 3OG2A 3S2CA 3UZJA 1YDNA 3P67A 4QHZA 4MYAA 1OVDA 3AISA 3UYCA 3DKJA 4QCFA 4B5NA 5CPMA 5AYZA 3D0CA 4TR9A 3NXFA 1ISVA 3W4RA 2ZWZA 5EFFA 3F5JA 3KF3A 2Y7DA 3PZMA 3CO4A 4NSBA 4MB1A 5I23A 1LBMA 4ZXLA 2H90A 3SCTA 4UTIA 1KFLA 3ELFA 3GIYA 1TTPA 2XVLA 1CW2A 1G5AA 4WZHA 2QQVA 4KRUA 4RX0A 4O57A 4N0RA 4HOXA 1ML1A 2CW6A 3DFPA 1WDSA 3IAPA 4J3VA 3TSDA 1MFVA 3BG9A 3KZSA 4Z1DA 5FMCA 3W7IA 2HMCA 3CHEA 4TO8A 1I4NA 2ZRXA 2G41A 5KZDA 3TSMA 2O9RA 2E77A 2BSLA 4IXHA 1H7WA 1IT0A 1OGGA 1VFUA 4BR1A 3MSDA 3THCA 1HJQA 5C70A 1VCFA 3P5YA 1MVYA 3HU7A 1WDQA 4PMVA 3P5ZA 3W1XA 4NZJA 5LYRA 3CC1A 1KBIA 1QNVA 1CEOA 1H60A 3BMVA 5A6BD 1WYIA 3LGEA 4CN4A 3EWWA 3CZLA 1CI1A 1LCOA 2X16A 2ZRUA 3S1XA 1QNQA 5FL0A 4FX7A 4GUFA 1LRQA 3TONA 2XHYA 3WJSA 1G6CA 3DFOA 3MO7A 1UWUA 2WCGA 3UWQA 1D2KA 3TJLA 2WKJA 1DTUA 4X9YA 3AOFA 4YHGA 5G1YA 3T4CA 1J0JA 3CGTA 4UFJA 1CWYA 5BXPA 3VGGA 5JBEA 1W9BM 2BWGA 1HG3A 1HN1A 3STGA 5I77A 3NCOA 1SO3A 5H91A 3PULA 4MB4A 4CUCA 1B30A 2WOQA 4P8WA 4AIOA 4QNEA 2ZUMA 1Z44A 5JUVA 1H0IA 1G1YA 2ZZ2A 3GH5A 3L5AA 1E15A 3T2QA 1WDPA 2X1IA 4N9EA 2O9PA 7A3HA 4LYRA 3S1VA 3C4UA 1DBTA 4LVFA 3WDHA 1KFEA 1L2UA 1TMHA 2Y88A 4XBSA 4XWUA 3IGXA 2D0HA 1H51A 1QWGA 3CTLA 4K38A 4ORMA 3T55A 2R8WA 4O8RA 1T8XA 2W92A 2X2YA 4AEFA 3G8EA 4AYSA 4IMFA 3QQ1A 2D22A 1BTCA 5I24A 4W89A 3G6MA 5A2BA 5HXMA 2Y4SA 2PWHA 3EXSA 4JFTA 4FEZA 5KMYA 2QCHA 3W1TA 2ZRZA 2A3CA 4FMVA 3VM5A 4I9AA 3PBUA 1JIBA 2C1HA 4M24A 4BCEA 4KRTA 4DWSC 1O5XA 2F8QA 1O4UA 3VIKA 1VGAA 5FIXA 1KFJA 1K7EA 3TAKA 3WJZA 3HG3A 1CNVA 2E5DA 3UETA 3RPMA 3TR2A 5I2UA 1FX6A 4WSKA 1Q6QA 2YL9A 3MUY1 5FL1A 1GG1A 2B7OA 3VI2A 4EOUA 2D2OA 3V1PA 4C1KA 2V5CA 2XGIA 3W1QA 4H8VA 4UOJA 4W87A 4PCFA 2YDAA 1TRIA 3NQMA 1KCKA 5E6YA 1JULA 1TJPA 4WKFA 1V3JA 4OKDA 3SURA 1H4PA 2PE4A 4GO8A 3P84A 4OJYA 4LV9A 1HO4A 3NPVA 1BG9A 3TA9A 1TA3A 3LB0A 5BXTA 5D38A 3ECQA 2A3BA 2Y5EA 3VIMA 3CQ0A 1KBJA 2NX3A 2RDTA 4O4WA 1QFEA 3AZRA 2XQRA 4JTLA 1OWQA 1H1NA 5TD4A 3NQ2A 4B3KA 3QFEA 4IWWA 1SYTA 2RH9A 5HWJA 1TE1A 1VZWA 3W81A 2CHNA 5KZEA 4CD7A 1FDZA 1KV5A 3AIRA 2C0AA 4LS2A 1XM3A 4M6QA 4HNVA 1BG4A 1JZ6A 2OT1A 4BS0A 3EXTA 3C2OA 5FF7A 3WNKA 3DH7A 1G69A 4N02A 1ISWA 3VMPA 1OX4A 2J74A 2GVJA 5CZ0A 3PBGA 1Y9GA 1YTKA 4QISA 3SCSA 1JZ5A 4FNTA 1KM6A 1TFVA 2BHUA 5FESA 1GYNA 5D05A 1ICSA 4FX8A 1MYRA 1MXSA 1WE5A 4DQWA 2I14A 2A85A 2DSWA 4LV4A 4RR4A 1E72M 2WZEA 3WK3A 3FXYA 3I3DA 3MHGA 2XTKA 1AW2A 4AVFA 4JIPA 5AC5A 5C6MA 1OYAA 3PAJA 4EQVA 4UTTA 3M5ZA 3PR2A 2HISA 1KGXA 4CLMA 1F2JA 3MBFA 3NQEA 2WMGA 5HMSA 3FAXA 4HP5A 2C18A 4JTFA 1LF1A 1TUXA 2WK2A 1NOWA 4LVAA 2UY5A 4X22A 3CZ8A 1H50A 3HGJA 3B9AA 4XV0A 1NVMA 3Q94A 1EQPA 4CCDA 1RZMA 4O1CA 5I5RA 1NH6A 4P7NA 1OGBA 2EKCA 2NUXA 2FJKA 4KWWA 4OGZA 4G1KA 2DSKA 5BCAA 3AZTA 4NRRA 2GJPA 3VPLA 4FXRA 2FH8A 1A5CA 1KWKA 6TIMA 3E96A 3WL1A 3VM7A 2J8FA 2C15A 1LOLA 4M19A 4XZWA 3UNDA 6TAAA 4GZEA 3T2PA 1XBYA 1LRNA 2BHYA 5IDIA 4UR7A 3P8IA 3VINA 3EDEA 1WBJA 3GAYA 5DELA 2YIHA 1WZLA 4JFVA 3NSXA 3STCA 1B3WA 1NARA 2V9DA 3O1NA 1NWRA 1UOKA 4UCFA 3HIJA 3ZOAA 4AXNA 1PIFA 2WANA 3R89A 2WO5A 4MPKA 1BQCA 1KLYA 3W7EA 2J9YA 4UFIA 3LCIA 3QZEA 4LVDA 4LVBA 3I3EA 4FFGA 5H2ZA 3NPWA 4IPIA 4EE9A 4URIA 1IXPA 3F4WA 3GDLA 3GXNA 3L5LA 2PF0A 4QDMA 4CU8A 1UG6A 1JZ2A 3SCRA 1Q6DA 1EP1A 4JY8A 2FDSA 4IISA 1HJXA 4Z2KA 3IIVA 2ZZ4A 3HO8A 3AS1A 1B0IA 1QVBA 4GRSA 4RV8A 1SR9A 2DT1A 3NL3A 1TVNA 3UGFA 4RE2A 3LCLA 2PB1A 1J11A 3BC9A 2UY2A 4PTXA 5EFDA 4A3UA 1G0CA 2A1YA 2DQXA 4FNPA 4EF8A 3BAXA 3TTQA 3W37A 2PBGA 3QGVA 1IXOA 4Q4KA 1R30A 4O16A 2AMGA 4UZSA 1A50A 3WQ8A 4ONVA 3NPUA 4J9JA 3CZJA 1MZHA 3G1XA 5D2WA 3WJWA 1H0GA 2CZFA 2W67A 4RL3A 1W9XA 2ZUWA 2YYTA 1FCQA 1RQEA 5K9XA 2E40A 3BAWA 3VD4A 4M7TA 2X30A 4HPJA 3DFQA 4NZCA 5A8PA 2VFHA 3ARQA 2YGYA 2ATSA 1JZ4A 5ABGA 3W7OA 2HS8A 3G24A 4PODA 3NM1A 3VE7A 4UTUA 3OZOA 4JL2A 2CHOA 4H4IA 4Y6GA 3P80A 2ZYFA 4Y9AA 1OGSA 1VEPA 4GI6A 1W3IA 4LT9A 5CZKA 2Y7GA 1W56A 1G67A 1DJNA 1WXJA 3EDJA 2Y2WA 4OT7A 3S5OA 3NVTA 5FEZA 3VGEA 2JALA 5TQLA 2GQ9A 1U5JA 1U33A 1EUAA 4Y7EA 1UWRA 2V8ZA 2ZICA 4M82A 3GDMA 4NJKA 2VURA 2J47A 3S9YA 3O16A 4JZ5A 4PSRA 5CPQA 3W07A 2EHHA 4DM1A 5MHBA 4JCLA 4AWEA 2CEQA 2TMDA 1CECA 1PIIA 2X1TA 1A53A 3Q2DA 3TXZA 5LNVA 1BYDA 1PE1A 1ISZA 3U8GA 2VZTA 1H5YA 4JTHA 1B2YA 1PZ2A 1W1PA 3GXTA 2J7BA 1AQHA 3W76A 2XPKA 4C7GA 3GK0A 1FWTA 1US2A 1XH1A 3MP4A 2J78A 2E09A 4CNPA 5A8QA 2EF9A 3N19B 1OD0A 5E93A 3W6MA 3G18A 2VVSA 2V30A 1KQYA 3T08A 3GB6A 5LGXA 1HFBA 4UTJA 1E43A 1Q45A 1NF0A 3NM3A 5IBXA 5DFAA 2ALDA 4QITA 1HVXA 4CNOA 5F2GA 3GBEA 3FJLA 1R86A 3B9DA 1AQMA 2G97A 1EIBA 4XQ6A 2GDUA 2VZVA 4H04A 1THFD 2FPYA 1MQPA 4LOCA 1DWGM 4DO5A 2GQAA 3P60A 2OXBA 3W87A 1HL8A 1N82A 3UPWA 1QI5A 4WJXA 5IFTA 4FB7A 1E70M 1I1XA 2NX9A 4IX0A 4UOQA 1Q6RA 1LOQA 2FPVA 2PRLA 2C0HA 4N9BA 5BW6A 3LCHA 1E6SM 2CBVA 3FAWA 2DJXA 2I1OA 3GYEA 5C54A 2GUUA 1BPLB 3LHUA 1T96A 4K6AA 1QHZA 3AXXA 4AWTA 3TROA 3IV3A 5LNWA 4UOZA 2UWFA 4CNNA 3W7JA 3SCWA 4GKLA 1OFOA 4NU7A 1KFCA 2W61A 3A3HA 3HBLA 1V3MA 1JR1A 3R5EA 3WBAA 4M5PA 4Z2IA 1YXCA 5M3WA 1TB3A 4XKYB 5D9OA 1C93A 4JX6A 3W1LA 1XYFA 3UR7A 2QEZA 2VRJA 4PMZA 5CPSA 3W27A 3NQFA 5A8GA 3W2UA 5L6UA 2VL4A 5ANNA 1TPUA 7TIMA 1H1YA 3RM4A 3WQWA 2BS9A 1EP3A 4DEFA 3ARUA 1QBAA 3CZEA 3N12A 4J28A 4M80A 4BQ3A 4QSHA 2E1DA 2OSYA 3NQCA 4NQ1A 2AGKA 2OSWA 3WFLA 2BY0A 4E2DA 1GNXA 2X05A 5JBFA 1Q6CA 3BXWA 3QOMA 4XTDA 4Z2LA 4AD4A 2W62A 1EOKA 3QSRA 4NZFA 2NZLA 3IVUA 1M5WA 1TSIA 4HMEA 4DWSB 4ZL1A 4M29A 3T2OA 1FCUA 4L4OA 3RNDA 3NA8A 1PEZA 3MMWA 3YPIA 2RDUA 4UQAA 1EOMA 3NL6A 1YHTA 5LA1A 1E1FA 3W75A 4ZE5A 3L4XA 3DC0A 3M6YA 3VKJA 1G4TA 3AIBA 3M46A 3PZTA 4JAWA 1O95A 4O28A 1WOAA 4OE7A 2OWXA 3QPZA 1ZHAA 5KZ6A 3UXAA 1Q6FA 1GZGA 2AQWA 5DT5A 2QCMA 2AC1A 4DXVA 4U2YA 3WF1A 2DZVA 1OBAA 3L4TA 3C2RA 1W3HA 2VEIA 1TPEA 2C6QA 2V5DA 2ZRYA 3TW7A 3ARPA 4NF7A 2WCSA 4AMCA 5D8ZA 3U14A 3B06A 3QMSA 3W6YA 4UIOA 1KFKA 3LRKA 1E4IA 3KE0A 3BCDA 3LHTA 3L68A 1PL9A 4M6VA 3DFNA 3B8DA 5L9FA 1OD8A 3MO4A 1SQ7A 3HBKA 3CHVA 4UFKA 1IF2A 3EX3A 2AAMA 1P0NA 4FO4A 3VILA 5DCEA 2PWFA 3VGBA 3NDOA 1JCXA 3W2KA 4D6CA 2VTFA 3HPXA 4D1JA 1UWIA 2NT0A 1FA2A 4CQ9A 2EPHA 3UWZA 4AISA 2E0PA 2W91A 5JIPA 3G1VA 3KVKA 2QPSA 4CVUA 4D6EA 1H11A 4Z1AA 2CIPA 4UNIA 3ARVA 4BI5A 5BROA 1RV8A 2CU0A 2H3DA 3CUJA 1QMLA 1R2SA 4FX6M 4K39A 1SSGA 3MI3A 3UQNA 3VUPA 3IJ9A 4N2YA 4I7UA 2OLHA 2TPSA 3UY8A 3GYCA 1KR0A 2PC4A 4PMQA 3B0PA 1OX4B 2WCAA 2HSAA 3LCFA 5AYXA 4YXGA 4LGXA 3W86A 3T09A 2LLEA 2NSXA 3SECA 2E68A 3B8SA 4F66A 1G01A 3VDHA 2H6RA 5TBOA 4WK9A 4K36A 2J8GA 1C7TA 3OGVA 4BQ5A 1E4NA 4TIMA 3ABQA 2NUYA 4S2CA 1B90A 4S2BA 3M5YA 1FH8A 3O9NA 4KGJA 4Q7NA 1B31A 1R8LA 4E2OA 5CJ5A 4N4QA 1W31A 1F4AA 1ISYA 1UASA 1ZAJA 3MMTA 4UTHA 3AFBA 3CH9A 3EDKA 4GO9A 3DXIA 4LS1A 4MLJA 4S3KA 1KM1A 4U3AA 4MJMA 4UQBA 1TPVA 4E2BA 1E6PA 3CLWA 2BXVA 1OFRA 3E02A 3IMMA 1B9BA 3BAJA 4IPJA 4OOUA 3VTRA 1PX3A 4GUHA 1LZOA 5EKYA 5E9AA 3UERA 1GOXA 1W37A 4H8UA 3CEPA 4WD0A 4QLLA 2F7FA 2DU2A 3E1F1 1KTCA 3PC0A 1LRTA 2B7PA 2JIWA 1MEIA 3SGUA 5D09A 1AMYA 2ABAA 3M1ZA 1FP8A 1ME9A 4QJ1A 1EA0A 1HVQA 2OYLA 4YCOA 4PSPA 3W29A 4F9JA 1J01A 4PMNA 6ALDA 4IQLA 1KGWA 1F5ZA 4OHQA 1VQTA 1U30A 5EMUA 3AROA 1RH9A 1LL7A 5GNXA 3W6LA 5LHFA 5BRPA 1OF8A 4N6FA 5E0FA 1E3XA 2XYLA 4A2RA 3WH9A 1W5PA 2WPGA 2CYGA 4O1AA 1S5WA 3L0KA 1RQBA 4WUIA 5CXPA 2PWDA 4QAWA 1L9WA 1W8SA 4BWLC 2B4GA 3DFTA 1LM1A 4ZMGA 1BGGA 3W70A 1GQJA 4AY1A 4AZIA 4TVDA 3PBVA 1W3TA 2VC6A 4L4PA 5I3GA 3OG3A 3NDYA 2ISWA 5D8WA 5I3JA 1E6NA 4Z2JA 5E1QA 4J3SA 2X2GA 1TV7A 4JFUA 5DXXA 2F61A 3NO5A 1PVNA 4PCSA 1CLXA 4W85A 3LXAA 1IIGA 1OX5A 2CITA 3VVGA 4Z0SA 5A8MA 5EY5A 2C3ZA 2DZWA 3WKZA 3W2NA 4IGHA 4UMAA 1OB0A 1MXGA 2UV8G 2B0MA 3LXBA 3UY7A 1E3ZA 4UFHA 2J62A 1J9YA 3B05A 3N2MA 4U3CA 4JQTA 1QHPA 3DI0A 2VX6A 1KM4A 4AHOA 4A4AA 1SO5A 3MUXA 5G4EA 1JFHA 5CG0A 1SSDA 1E40A 5CPNA 1Y0EA 4ZQNA 1HNYA 3N17A 4HZ6A 3EMQA 1AW1A 3HGRA 3CHCA 3NZRA 1XDLA 1XI3A 1L8NA 1VIWA 3SCOA 3UZ5A 5AYYA 4OV9A 4P7QA 1GTHA 4LWWA 1V3KA 1QR7A 5CZTA 3FEMA 3P7YA 2ZXAA 2AEZA 3RM9A 3W73A 3II1A 4D6DA 5IXEA 3N9RA 5DCBA 2WWDA 1JG9A 2YW4A 4J3TA 1HP4A 5E09A 3CM4A 3ALGA 5HUOA 3W85A 2VCBA 4GJ1A 1PS9A 2NXGA 1BYAA 1Q6EA 3ARXA 4AZZA 1CGTA 3WSUA 3TTSA 4F8XA 4LC8A 4HZ8A 1RVGA 5D37A 4ZQPA 5ECUA 4R7JA 5HDRA 3NQAA 3TA6A 2CESA 2XSAA 3LDVA 1UKTA 1OX6A 2JIEA 2W63A 1QOPA 4GI9A 5AYIA 2J75A 1FUYA 1C29A 4UXDA 1ZY9A 3KHJA 2NX1A 3FN9A 3T40A 1Q6OA 4YLWA 2GJLA 1C8YA 3RFAA 3VD7A 2Y61A 2G3NA 3VU2A 5CLTA 5FMDA 3U2OA 4YMZA 2VFFA 2JKEA 1M7OA 3CWOX 2ZFAA 5A8NA 2VXNA 3PZIA 5D2YA 2WKGA 4MNMA 3GAKA 1JYNA 1LL6A 2ESCA 3ZJ6A 3VGFA 2D3LA 2AAAA 2WVUA 5FKYA 3UR8A 3VGHA 1JJKA 3LEMA 2ZZ7A 1HKKA 2EPKX 3EWZA 4BI6A 4WXYA 3NYDA 3GNOA 4PUEA 2YA2A 4D71A 1ZALA 1OFEA 5M17A 3W25A 3SIZA 1E51A 3W2LA 1D3CA 1WZKA 2ZIDA 4UTKA 4E8DA 4JGDA 4LC6A 2FPTA 3M43A 3GDTA 3P82A 1UR0A 1WOBA 1YPFA 1ZBWA 3ARWA 5KEZA 3KVJA 1RP8A 1RR2A 1GOWA 1J10A 1EQCA 3GZAA 1IIHA 3LLFA 5CZSA 1UKQA 4QLKA 4MAZA 2A2IA 1UH3A 1G4EA 3G22A 4P8VA 3FHQA 3QJAA 3MP3A 4NVTA 4JX5A 2QCGA 2WC3A 5AC6A 1DEDA 2VJXA 4TVUA 1A5BA 1KA9F 1B9ZA 1EUNA 1XSIA 4A3YA 2ZQ0A 1UKOA 3HF3A 2ZUVA 5EB8A 1KXHA 4MZ8A 2QPUA 2QQWA 2G95A 3CMGA 5BMXA 3CWNA 4K8EA 2EAWA 1OFPA 1BEUA 2Z6JA 2RHGA 1GVQA 3G1FA 3HG4A 2NT1A 2EPOA 2YL5A 5D9NA 1XSKA 5BRQA 2D23A 1B1YA 3LPGA 4QFUA 4ACZB 5HR6A 5F7UA 3M5VA 5CGQA 4LY8A 4KKXA 2GJXA 2HVMA 2J7FA 1UH2A 2WLYA 2YBTA 3PHAA 3AZSA 1BTMA 1IGSA 1QPRA 2WSYA 3UGHA 4FNSA 1RD6A 3PWAA 3I65A 3TIMA 4WOQA 3WJXA 3IJ8A 1ST8A 3BLEA 5CKSA 2ATMA 3AIVA 3LPPA 1Q3NA 4EAMA 3G1DA 1V6XA 4PTMA 1B57A 3W7MA 3QMTA 4MB3A 1XD1A 1H7PA 1VCVA 3O63A 2WC7A 1NOFA 3ZR6A 2TYSA 1S46A 4J3WA 3TX9A 3ZM8A 3LHZA 2WSKA 2E3ZA 3LRMA 3N3MA 4Q22A 4FHAA 2CLIA 3EXRA 2WMFA 4MNLA 3M47A 2Y8KA 5FKBA 2C16A 2XM1A 2DZPA 4KH2A 4D2JA 2EPMX 2BXZA 3BK0A 1EP2A 4R33A 1IZJA 1MSSA 2A5HA 4ALDA 2JKAA 4JY9A 1KM0A 3TFCA 2CKRA 2G3IA 4UUIA 3CHDA 4HA3A 3I68A 1W5QA 1R2TA 4XKYA 4PMXA 1MQRA 3WDQA 4TX6A 3NQ8A 4AD1A 1XCFA 1R2RA 3KWXA 1UHVA 1ISXA 3E0IA 1H3GA 4AZ6A 2YKKA 3VE9A 3WF3A 1LG1A 4LW7A 1LBFA 4OQVA 1ZB5A 1W9PA 4UQDA 1QOQA 3W7CA 4O0ZA 1XCXA 3WL0A 1KR1A 1CXFA 4KMQA 1SPQA 4D1IA 4HKPA 2D0FA 1NFBA 3M5XA 3GKFA 1SUXA 3BO9A 4XBKA 3UWYA 3A5VA 1MW0A 1ZBCA 1X6NA 4MLRA 5J5RA 5HINA 1EPXA 3PUOA 4KFOA 3WDPP 1O6IA 1MXDA 4HSOA 4AD5A 1VB9A 1W1YA 2KZHA 3DKLA 3S8HA 8CGTA 1JGIA 4DWSA 5CSYA 3F4VA 5D03A 4W84A 3AS3A 1TCMA 4MIMA 3THQA 1EXPA 1EDQA 2O92A 4QIUA 1M7XA 3TE9A 3ARYA 1LLOA 3EKZA 4K7VA 3DGRA 1QI0A 1WQ5A 4F79A 2CBJA 3VDAA 4MDPA 3RILA 2WBGA 3LV5A 2J4GA 1ITCA 2W66A 1W1VA 3DHUA 1V6VA 2QDGA 4JHOA 3T0AA 3PZOA 2WVVB 3PM6A 1QCWA 5DLCA 1A47A 1GOQA 1QBBA 4TOQA 3VNZA 4M6PA 1W2PA 4ZVJA 1NP0A 4Y8FA 1E71M 3TSBA 4JD4A 2BY2A 2VCCA 4U31A 2YFOA 4OOZA 4WXZA 5A6BA 4C1LA 2P1FA 1GVRA 2YXGA 2EPNA 1VHCA 4PMYA 3W71A 3EX4A 1WA3A 4HNNA 4ZQMA 5EBAA 5IFPA 5HOSA 2J79A 4YHEA 3NZ1A 2BZNA 3M44A 5F2LA 1MW1A 1G4SA 4JTUA 3AXHA 4OBTA 1V3LA 3SC7X 1QO5A 1X8FA 1YADA 2JF6A 2OX1A 1OT1A 2VELA 3VFLA 1BSIA 1FXPA 2O9TA 3KEHA 1EGZA 4MJZA 4BQ4A 3WNMA 1XXXA 3S0CA 1UZ1A 3RMJA 5LA2A 1TV8A 5HR7A 4B16A 3QF0A 1TZ7A 2J77A 4WLCA 1BGAA 2E9LA 3C0JA 1EB3A 2WQPA 1CBGA 3OIHA 4O19A 2DSZA 1RPXA 4CVWA 2OCZA 2WNQA 2QMJA 3DYMA 1CGWA 1HKIA 2WVSA 1W9DM 3L67A 6A3HA 1CTNA 3TTOA 3EDDA 3P61A 2NXIA 3LBMA 4N6EA 4W9TA 4FFHA 3GH4A 3QC3A 3SY5A 1UWTA 4N42A 3R2GA 3RLUA 1TTIA 3AICA 1EHNA 4AH7A 1HJWA 3EWBX 2CLLA 3IVTA 3W2MA 3W7HA 1O7AA 2ZOXA 3SIMA 3TTYA 4ORIA 1LORA 2GVLA 4IMCA 4AF0A 4NJIA 1LBLA 1GVFA 3OA3A 1H49A 4B3LA 2VCAA 3L4ZA 3PB2A 1HF6A 3CBWA 3PUEA 3H3LA 4LQ1A 5AB3A 2GDVA 2XN1A 4N9DA 2CKSA 3S42A 1LG2A 1JCNA 1QNSA 2G3MA 1DORA 3APGA 1KXQA 3I7SA 2R94A 4RZ5A 4YN5A 3GXMA 3ARSA 1ALDA 2A3AA 3AIUA 1H7XA 1UKSA 1SFLA 4QCEA 1ZAIA 1UYQA 1NM9A 3KXQA 4MYXA 2W0UA 4AWSA 1NAL1 1CXIA 3VX1A 1JI2A 4MZYA 3W24A 3WF4A 4I7VA 2XVPA 3L2MA 1DWIM 2R14A 3A4AA 1UH4A 3R13A 3GXFA 3VIHA 3L2IA 2CETA 5EA9A 2XGBA 3VIGA 5A2CA 1WDRA 4AXKA 4O53A 4Z2HA 2E8ZA 2X8RA 2WSQA 4U28A 5CQ1A 4NT0A 1B3YA 1UD8A 2OSXA 2YL8A 1YXDA 4NJHA 1FDYA 2NV2A 1WZMA 3WNPA 2GOUA 4KWVA 2YX0A 1QPQA 1LP6A 2Y63A 4WQ6A 3CEUA 1KXVA 3QHOA 3MHFA 1YPIA 1OYCA 2J9ZA 3EB2A 5A5WA 1D3HA 2V3GA 2ZUNA 3N04A 3C2EA 1UQZA 3PIJA 1IV8A 2WC4A 1WDWA 4JN6A 4O12A 5FEXA 4KWUA 2ZUUA 3WQ4A 5I3HA 3WUFA 3UGGA 2MANA 2V81A 4ZQRA 3T44A 4WY0F 3L66A 3O6DA 4FNRA 3PN8A 5ABHA 1VFOA 1NEYA 4P7OA 3UWUA 1JNDA 4JYDA 4TXEA 2OYMA 3K30A 4J7RA 2A3HA 1AVAA 3NUKA 3BW4A 4RXFA 3FKRA 2DH2A 3AIQA 3KOFA 1D9EA 3GNPA 4WF7A 2XSBA 3WELA 2J24A 3NPXA 3WH8A 1K8YA 1DHKA 1E1EA 5G2WA 1O94A 3PSWA 1WCGA 2WMIB 4JXCA 4E38A 1ITXA 3GZ3A 3UD6A 3ZR4A 1XV8A 3FY1A 4UMCA 3FW6A 3WQVA 1AW5A 5K7JA 3LXCA 3IIZA 4X3ZA 2CZDA 3A6OA 4ML4A 4M8UA 3EX1A 2DT2A 2WHJA 3GXDA 3VD3A 1FCBA 3OLEA 1UB3A 1TTQA 1BF2A 4ADUA 4JL1A 1GW1A 1F4HA 2E9BA 2PWEA 1JZ7A 5D9PA 3ZJ7A 4DUWA 3ZS4A 4ZEPA 5G1TA 1ZJBA 4PEEA 3AHZA 3N9SA 2VEPA 2OWCA 1PZ3A 4IM4A 2CFFA 4FLQA 2J7EA 3W38A 4JTKA 1DJQA 2XG9A 3THAA 1J4EA 1QO2A 2NWSA 4HMDA 3HN3A 2XVNA 3W9ZA 4CN1A 5D2XA 3TW6A 2G3JA 1GT8A 5LZLA 2NXHA 4XUGA 1EO7A 1GZJA 2BY3A 4B1LA 4MPQA 3PBYA 4BA0A 4JICA 3B4UA 2WYSA 5SWUA 4O1DA 1K9DA 2WZIA 2WJZA 4L4MA 2J6XA 1AK5A 5FF3A 1GUVA 1TPDA 4OBSA 5E0CA 1K7XA 3TMQA 4BF9A 1FHDA 3LDRA 2YSWA 5GVJA 3CUIA 1DQWA 3WDIA 3E9AA 4AZCA 3WENA 2QCDB 3FJ6A 1UR9A 5HPCA 3LTPA 3LDKA 2DPEA 3WBEA 3SI9A 4AZBA 3GKAA 3VD9A 1ODZA 1ZFJA 4JKKA 1BHGA 2VR5A 2XUCA 3K46A 4AZGA 5C55A 2GJXB 5CGMA 3IANA 4AHQA 3EWUA 1OYBA 3U7VA 3LRLA 4GXMA 1CXKA 3I7QA 2WMJA 4K8HA 2VZSA 1Q6LA 3SZ8A 1CIUA 1I2PA 5ABFB 1E6XM 1WPCA 3F03K 2NUWA 3WQ5A 2X0YA 1SW3A 3A47A 1XUZA 3MYPA 5GPRA 3RM8A 3W7KA 2DP3A 1CXHA 3EKLA 4NX5A 1XC6A 3K8LA 5KINA 2FH6A 3M7SA 4PTNA 2CZ5A 1JYWA 2GVGA 3M0ZA 5DO8A 3FA5A 5JIWA 1GCYA 5EL1A 4UFLA 5FCZA 5DMYA 4XB3A 3WK2A 2Y8VA 3L4WA 3M6DA 3RIKA 3AS2A 4A3HA 4YPJA 3W7NA 1T0OA 4GQQA 4N4PA 1XH0A 1S5VA 4LUJA 2Y62A 1VLIA 2XFWA 4FF5A 1UA7A 3S5ZA 1HL2A 3WK0A 3A23A 3ZIZA 1FWNA 4AW7A 2VX4A 3S6TA 2BVYA 1I2RA 3M16A 1KBBA 1ME8A 1PV8A 2G96A 2TSYA 1OSEA 2WHMA 3GTNA 4ACZA 2W6RA 3BCFA 3PZGA 1WZAA 3O2LA 2Y6ZA 4PTWA 3B0UX 1WAWA 1KFBA 2QCNA 2V2DA 3W1NA 1H09A 3A9IA 1XHGA 3BW3A 3B9EA 4Q33A 1ODUA 4UNLA 1VYSX 3PZ9A 4LRTA 3F5LA 2NW0A 3TMLA 3C56A 3WQ6A 2QAPA 3WEOA 4GUIA 2YDRA 4S1FA 1GJUA 1JVNA 3EWYA 3M7WA 4MNKA 4PMDA 5FF2A 5K3VA 1SFJA 1JL8A 1Z41A 4WIWA 1JCMP 2FFCA 1PHWA 3LIGA 5EMYA 4OBRA 1OF6A 1EDTA 2ZA1A 1VENA 5A3HA 3EBVA 3A22A 5U7SA 4F9DA 3FOKA 3L9CA 3BV4A 4UC5A 3DBPA 3U57A 2OMAA 4I7WA 3V75A 3IIPA 1NOUA 1W2VA 3WUGA 2Y7FA 2WW5A 1W3NA 4DUXA 3BSGA 1I2OA 1KM3A 3TP4A 4PMRA 1F6KA 1N7KA 1UR2A 2ZXBA 3FLUA 2VENA 3HQ1A 4ADTA 1F73A 1W5MA 3E49A 4GWEA 5D04C 2JEQA 1H7OA 3LI0A 5AOUA 4IXXA 1UD4A 1XL9A 5AHMA 4PEKA 1GVOA 2A7RA 3NQ7A 1OHLA 5EYWA 4EKJA 3EMZA 3TDFA 4MAVA 4POCA 2ISSA 2Z0IA 2XM2A 4MJ2A 3VO0A 3NJ3A 1VLWA 3OZPA 1JDDA 3OVPA 3VCRA 5LNUA 4GI8A 4D6FA 1BYBA 3P74A 1P1XA 4UCGA 5C5YA 1E4LA 1F74A 2WKLA 4A2SA 5KSWA 3ALFA 4R5EA 1TQXA 4MDOA 1TG7A 2FTPA 4DO4A 3BVJA 3OVRA 4QAIA 1PJ9A 1UBSA 1VPXA 3W74A 2QUVA 1VS1A 2D3NA 1DVJA 3FNDA 3PG9A 2Y24A 3M9YA 4JR5A 1TCDA 4ATWA 3O06A 1TVPA 4B1MA 3HB9A 4TMCA 1E6QM 2DSUA 1CPUA 1VF8A 4GC4A 5DCDA 3ANYA 2BV9A 4D6GA 1X1ZA 1YXYA 4DF2A 1C91A 3W7RA 4HZ7A 2WVVA 3GXIA 4DPQA 1VC4A 3LM7A 2WAGA 3AI0A 1JQXA 2Z1SA 3CIWA 1TR1A 3DECA 5E6ZA 1J0YA 3MYOA 2A6LA 2G4FA 1BAGA 1U83A 1PCWA 4AF0B 1HKMA 5LA0A 3MS8A 3DZ1A 3QM3A 3RU6A 1BLIA 2DORA 2Z1BA 3I6RA 4ZQOA 4YCPA 3OA5A 4Q32A 4IMEA 2DDXA 1JUBA 3L4UA 4HU8A 4Z1BA 3A24A 3OBAA 4HN4A 2QCLA 1J0HA 5A1AA 1T99A 3PUDA 3SEPA 3BAIA 1NWUA 3UCQA 1J18A
chains in the Genus database with same CATH superfamily
3FHAA 1BKZA 3MZ2A 1W5OA 3RK8A 1XGZA 2FB3A 2VKZG 1PX4A 2BTVC 2IQ0A 2ZX6A 3ZMRA 2RUSA 4XW3A 2ZDRA 2WSPA 4TLFA 3HGSA 3VX0A 1DWAM 4RHV2 2BLEA 4HU0A 1FHVA 3MSGA 3TQKA 1DKWA 2IKGA 1OKQA 1F8VA 1TJRA 4XXPA 4ERIA 2VEMA 4JQ4A 4DJFC 5IVVA 2YDQA 1YE4A 2A3EA 1O4ZA 4J1OA 1AX2A 5AFBA 1Y7BA 4IEYA 3NQ6A 2BYVE 3ALQA 3V64A 1M9HA 1XNAA 1RUSA 2RHPA 1W9VA 3EAUA 1BYCA 3RZZA 3ZYHA 5DZFA 2JE9A 4CEYC 2YU2A 1UD3A 4YTUA 4ZZ9A 1JQVA 3H4XA 3ZXGA 4I5UA 1HRV3 3GNXA 2HS6A 4NI3A 1OCQA 4FNUA 2MNRA 4MZ1A 2VUNA 1AR61 5LHEA 1I1EA 1SZEA 5AC4A 2VOTA 4QXCA 1XIEA 2PZ0A 1V03A 1VJZA 4JEQA 5G2HA 5FZOA 3VBSC 3MKVA 2HPMA 2J88A 1IPSA 1HJVA 1B3VA 4PL2A 1W32A 3S9IA 1FP9A 4M56A 1FXQA 3OPWA 4ATLA 2GALA 2QGHA 3PJYA 1C3FA 1OINA 4ZO9A 4UTWA 1NDYA 3V0TA 3ES7A 1H7NA 1NXMA 4O1BA 4EVZA 3TFXA 2VMCA 2V3EA 1LROA 3WX7A 1LODA 2OZTA 1Y43B 3ME2A 1J0IA 4LYQA 1J93A 4UMBA 1EUTA 3WO8A 2F6KA 4GQ7A 1HP5A 1TRDA 4W7VA 3SEEA 2OB3A 4HPNA 3LTSA 2UWCA 3UJSA 1K8CA 1XR2A 2IZWA 4GB31 1E1CA 1TTJA 5K0UB 2EALA 4DMIA 2ZX7A 5C7VA 2VFEA 1XYZA 4CGTA 4YW5A 5CGTA 3RLGA 2VMIA 5FY8A 2XBO3 4X0NA 3OLGA 1WBHA 1JAEA 3W84A 4EIVA 3SCQA 2CGNA 3PJWA 3D0SA 3GF6A 1VE0A 3WUEA 4HL0A 4LRSA 3IIAA 1VYPX 1SLIA 1W2AX 1WW6A 4Z1YA 3AMLA 1XYBA 2JDUA 1LYXA 4LUIA 5DEZA 4W6XA 5HQEA 4DLFA 1YXWA 3IK2A 1IWAA 4R9OA 2EEXA 3SUWA 4B7EA 2G19A 3PTMA 2X10A 3GG0A 1LOSA 4ZOAA 2V3DA 2A21A 2VVDA 1VJ2A 4BYYA 4YWIA 3VHNA 2HWB3 5BMWA 3B8UA 4WY0B 3KL0A 2F4LA 5HCFA 3C0QA 3E6CC 4HSNA 3G77A 5HATA 5I79A 1S4CA 1F35A 3VMOA 3ABSA 4R34A 3ZFGC 5A94A 4Y1ZA 3CJIC 2PEVA 3IJ7A 3QZAA 1VBC1 2XU2A 2PDHA 2QV5A 1BK0A 1GYMA 1AXKA 4QJ4B 1D3GA 2QCDA 5D2AA 5KHIA 4JNYA 2D2GA 4YYFA 1OABA 1NQDA 1TMQA 1J96A 2VRKA 5DN1A 2HBTA 3FJNA 3OD0A 1G9HA 3P2VA 3AYSA 2E53A 3TAOA 3MCNA 3KTXA 2JX9A 2WMKA 1D4M3 3ZYRA 2D73A 2IXIA 2VHLA 2YLAA 4DJDC 3H8XA 1RXGA 3ES8A 4UQCA 3F2DA 3IT8A 1S2CA 4CPBD 1V0KA 3OEAA 2GJRA 1I45A 4GIYA 4HA4A 3MDUA 1PDYA 3SCFA 5C8WA 4QNWA 1N2VA 3KVLA 4QJ5B 1VCGA 1HX0A 4RE4A 3KOWA 3P62A 4DJEC 2WJSA 3U5UA 1O59A 1W9TA 4GMP0 4AX7A 4I3PA 2VZQA 5AHIA 3ZDSA 1O5KA 2NQLA 2OZ0A 3U5YA 3IPWA 5A6BD 5I6SA 1K9TA 2WFF3 1FY6A 2R1MA 3PTQA 1S2UA 1UKPA 4H6EA 2NVCA 3ZT7A 1W2UA 1VEOA 1QNRA 3WCSA 3PSVA 3L4YA 3N9QA 1U2YA 2A79A 3GJAA 4PI0A 1E56A 3S46A 4FPOB 1M6JA 1UY0A 4TMBA 2AACA 2GH2A 1IS5A 2R0HA 2Y64A 3NAVA 4CP9A 5JI7A 2YA0A 4A6SA 3IIXA 1Y9QA 3O5SA 1ZA7A 3QMRA 3LWCA 4JIIX 3BTNA 5KWRA 1HT6A 3LCXA 2WZR2 4CPBA 1VHNA 3GQYA 1FNZA 4ZXOA 1VMJA 5A69A 2ANUA 4RUBA 1KNWA 4PIXA 4UT5A 5H9RA 4WOZA 3HG2A 4N7QA 3IEBA 3W7GA 4BU2A 1DJHA 3UZYA 1W1TA 2DY3A 1HW6A 1SCRA 5BNOB 3CYJA 3NQGA 2F2HA 3RZGA 1V02E 5F2SA 1QPKA 3EEGA 4GIEA 3MUCA 4FP1A 3O7UA 1TPC1 3QACA 3WMBA 2UY3A 2A3WA 4X8PA 1WP6A 1B4KA 1L3JA 4PQQA 2RGMA 1S0IA 3R0UA 5MKGA 4JIQA 2FDKA 3FX4A 3SCGA 5CA6A 5I0DA 4FSJA 4JDBA 4WJEA 1W8WA 5BUVA 2E9MA 3PZVA 2C13A 2DIJA 1M65A 4UTMA 2FVKA 4PYSA 1QXJA 4P08A 2HWF3 4IMDA 3WDRA 4U5IA 2YLLA 5AC92 2NN8A 3USSA 1ICQA 3VIFA 4JNMA 1PWLA 4JS3A 4H7CA 3ARTA 4LY4A 5C9AB 5JOWA 2FGZA 3T8QA 3UPBA 4GBUA 5A3OA 4GZIA 3JCIA 3WCRA 1VRDA 2Y7EA 4YJ5A 1JYVA 1CIWA 4TZDA 1A34A 1AMKA 3EDFA 3H55A 3N4EA 4MWAC 3V18A 4YNIA 4GABA 3MW2A 3KVBA 1PIV1 4RJEA 4AGGA 3RI9A 4JTCA 1FFRA 4RGKA 3RJXA 4LO4B 3TN6A 4S2DA 3N6QA 4O18A 3NR0A 3TC7A 1DIEA 4CDUC 3U4FA 2QKFA 4L2NA 4DXKA 5A3UA 2XWDA 4HKWA 1VPYA 3POHA 3UGRA 3WMCA 2JICA 4UZUA 2BTMA 4HETA 2PUZA 2WNWA 3POWA 3DFYA 2O7SA 2PAMA 4GUJA 1YPXA 3SKVA 4J40A 3WNOA 4IJBA 4GYPC 1I6NA 5D9MA 3WD2A 5I00A 1M04A 2FGBA 1TME1 2I74A 4B4PA 4OU1A 3IWZA 4A7YA 1TJ2A 3U07A 5G4HC 1V7YA 1VBUA 4WX2A 2VC9A 1ZSXA 5H9SA 3GHRA 3ITCA 4ZQCA 1RA0A 2NQZA 3PUGA 4C7FA 2ZGQA 4QE4A 1MO0A 5D32A 4H6QA 1GVEA 1UR4A 3GXUA 2V5LA 4A3XA 1W0MA 5FAJA 2W3JA 5GZFA 4YGDA 1RPKA 2OX4A 1W9UA 1XISA 2JG8C 4YTTA 1P8JA 3ZWSA 5LZ6A 3CF6E 5TIMA 2OX0A 3D6EA 2ZGUA 3I3BA 4Q4X2 2IQTA 5AHNA 4FIQA 3BLLA 1CJPA 5DUXA 2QCCA 4Q8OA 2XFYA 1XFBA 3W7QA 1VR6A 4D94A 4JTJA 1PMJX 1RUOA 3INPA 2FDIA 3NG3A 4JGYA 4MZUA 3WG2A 4PMOA 3ONCA 4ARYA 5G4WA 3S5QA 4CDWB 5C2XA 1SPPB 4UF0A 5FZ7A 5FRAA 1VBE1 2PC8A 2ZMKA 4AD2A 3CIXA 3SCUA 2WWJA 4FOQA 3CHFA 1R0MA 3RRXA 5TAOA 1GSLA 1H2JA 4E3TA 2E6DA 3I3MA 1ZNNA 2ZTKA 4W5UA 2X0SA 4WZCA 3NDZA 1K5MA 3FA4A 1X96A 4LHSA 3QW4B 4XZ9A 4JKLA 2IPWA 1UZ0A 1ALYA 2QS8A 4XEZA 3W0KA 2QCSB 5K9CA 4O52A 1KLZA 1KCXA 3C8FA 2R6OA 4HB7A 3BLIA 2CLMA 2OEMA 1MWOA 3GG1A 1JF5A 1BQPA 4D7SA 3E5UA 2EKGA 3OEXA 4AIEA 2H3BA 1DYOA 3WDJA 3CB8A 2NWRA 2W4XA 3KCJA 2WDBA 3VBUC 5EYXA 2QR6A 1UUOA 5DUWA 3BGAA 1WNOA 2IW0A 3TXVA 4F40A 1H41A 3GW3A 1RC6A 1GKRA 4NNBA 4AI2A 1W06A 4DUVA 1JCYA 4CRQA 3TQVA 1R7AA 2HVNA 1RUJ1 1GOKA 3H4GA 1R85A 4RS5A 1V6YA 4META 1HZYA 4XILA 4S2HA 4ES8A 1VEMA 2BVTA 3KX6A 4M4PA 3O6CA 3AP6A 4MY1A 1LJYA 2OOFA 1PIGA 3M3OA 2DIEA 5D2TA 2WNUA 4BE3A 1P6BA 3PLQA 5IBXC 1KTBA 4LAKA 4B2DD 5E0KA 4LKSA 1LHOA 2QAFA 3WD3A 1F3EA 3O6AA 2WWCA 3U37A 3Q58A 2C14A 2VR2A 3QQ0A 4AHZA 1IKPA 5CZJA 5A6SA 2H0VA 1LU2A 1P0DA 3MV11 4RNFA 1SLAA 3B00A 2G8ZA 3VMNA 4KWSA 4O10A 2PHDA 1LHUA 1HUVA 1D0HA 3KRUA 4LBKA 1EGMA 4A35A 4C7DA 4EWAA 1OC5A 1DQ0A 3H53A 2YJQA 3G0XA 4O11A 2EJ1A 2VOMA 1JRCA 3MGUA 4K7JA 2PTDA 4B4FA 1ZP4A 3PZNA 3W22A 4UAPA 1QHOA 1XKJA 1QNYA 2VMEA 2AOSA 3QZ6A 1VAKA 2MEV3 3WLMA 5FP8A 1Z48A 2ZGTA 1FMD1 3MEPA 1MRAA 4M3CA 1HXS3 1UIKA 1QKQA 4HOWA 4UQ9A 5E70A 2VZOA 4B29A 3U2CA 2PRHA 3WUBA 4AAXA 1T6GC 4HVQA 2CWSA 1UKGA 1QJEA 4YS1A 3PIGA 1K42A 2ZRVA 2I7GA 3ZXKA 1VIZA 1E5JA 1PX8A 2WSRA 4JEJA 2HBUA 4YVSA 1VFTA 4NZ4A 2ZX5A 2QDEA 3TWBA 1RUH3 2Z2UA 3VB9A 1TA3B 3WK1A 2ZBTA 5CBIA 3HMYA 2BXYA 2X41A 1KQRA 1EV13 4JGZA 3GC2A 2P8BA 4C8DA 5F2MA 4FQ4A 1ZJAA 1EV12 2ZX8A 4BF7A 1OJXA 1O60A 1CAUB 1MEHA 2ZX3A 4H14A 1PGL2 4BY3A 2TNFA 1DOSA 3WJYA 3LMYA 2XLAA 2VT0A 4KT2A 3NL1A 3S1WA 3E2SA 3AHTA 4NNAA 2WABA 4XC9A 1XICA 1IHMA 3W01A 3EOUA 3NMBA 4L5ZA 3PB0A 2QQ6A 4XQ4A 3NO1A 2DF7A 5IATA 5G1MA 4JQAA 4URAA 6XIMA 3AUOA 4RD7A 3MF6A 4WHBA 3LY0A 5IK4A 4LHKA 5I3FA 3WHTA 1HN0A 4KEVA 4GWMA 1A4LA 2CPUA 4GYKA 1WCDJ 2ACRA 2BVDA 1FCVA 3VIPA 2DVFA 3GTIA 4EPDC 3KVMA 2QIWA 4DF0A 4MOAA 3MFAA 4V28A 5IWFA 1FWWA 3RS6A 1PVC1 4I0AA 5F5CA 1WLDA 2ZCGA 4Z08A 4PTVA 5BNNA 1I75A 1XGDA 2CZEA 1KC7A 1OM0A 3TK7A 1RUI1 4CE8A 5J48A 3OBKA 5AYBA 2GP5A 4CQCA 2ISVA 5T26A 4IEVA 1MEC1 1C90A 1DZQA 4DELA 4WRHA 3IJIA 5E6HA 2GK1A 4DO7A 1SZFA 1W1ZA 2X1UA 1KXTA 4GIAA 3WIJA 4AZ5A 1H9PA 4LBRA 4N9IA 3M4FA 2E4TA 2VVNA 2ARBA 1UC4A 3OUIA 4K37A 3K4AA 3M41A 1IZKA 4LHLA 5FY7A 1J3PA 3TU9A 4LK6A 4FLOA 1MW3A 1BQGA 1EX5A 2DZSA 1M4WA 2PRMA 3K4WA 5BNKA 4AEEA 2VGIA 3UNTA 2IC1A 3GWQA 1D2SA 2ZTJA 2DVDA 2F4PA 5EBUA 1QF3A 5DG1A 1C9DA 1QW8A 2OYKA 3DI1A 3WH7A 1KQZA 3NYZA 5I3IA 2OGYA 5FEWA 4WVZA 1DWHM 5A6LA 3K4DA 1VRH3 2EVXA 1M3UA 2YCEA 1UCWA 4TX9A 4Z2AA 2B7QA 1S1RA 2K46A 1PGSA 2ATFA 5HJYA 1OURA 3J7LA 4IUGA 1UOJA 2PAEA 2V0TA 3QKEA 2V5BA 3WD4A 4CN6A 2Q1MA 4F48A 1W6QB 2ZC1A 2MNGA 3EX6A 2WNVA 3GW0A 4LAMA 4JPGA 2VEKA 4MNJA 2B81A 2FHFA 2PU1A 2D3SA 1VBD3 4A8NA 3IJ6A 3GZTB 4I02A 3STFA 3AMCA 3CZGA 3ZFGA 4D6JA 5AFDA 2HWD1 4HHHA 1AJOA 1EJTC 1L0PA 3CJIA 1E0XA 2WXDM 3E38A 2VRQA 3CIVA 2FBEA 2X7WA 3TNOA 3POYA 1FFQA 4XZHA 4M4RA 2P37A 4LBMA 1DZTA 2ZGOA 4RCXA 3I7RA 2XWJB 5I09A 3DYPA 4TWTA 1XBZA 3VNLA 2VEFA 2O9OA 3NQVA 2DVBA 1MFUA 3FX3A 1TX2A 2WN2A 4V27A 2Y6KA 4O17A 3KSCA 2YYUA 4MKSA 4A8IA 1UW9A 4NJGA 4F0KA 1YDNA 1VBJA 3RJRA 4QXHA 5G04L 3AISA 4B5NA 4NG3A 5AYZA 4C0BA 3NXFA 3AVRA 1ISVA 3E3HA 3SQMA 4V1PA 2Y7DA 3CO4A 1ZZ6A 2P0IA 1LBMA 3GGLA 3F7JA 1IEVA 1NT0A 3GIYA 2MPFA 4DJEA 1ASJ2 1ADDA 1SDWA 1ML1A 5A32A 3IAPA 4J3VA 1GYKA 1ITQA 4FXKB 4JIHA 1OH4A 4CDXC 1GZ1A 3ZFEC 4H01A 4Z1DA 3VCCA 5F1RA 2VYOA 2ZRXA 5JR7B 2O9RA 3VZLA 4L9ZA 1K70A 1W6TA 1OGGA 4K20A 3MSDA 4LA2A 1HJQA 3P5YA 4PMVA 3P5ZA 5HNTA 5LYRA 3F95A 3NV4A 2XH6A 1LCOA 2GDFA 2HLEA 1QNQA 5FL0A 1LRQA 3TONA 5DZEA 2XHYA 3WJSA 4GISA 3CU7A 3D82A 1OZMA 3DFOA 3MO7A 2ZKMX 3V35A 4A7ZA 2K9ZA 3TJLA 3QGAC 1DTUA 4LK7A 3T4CA 1JOBA 1CONA 3KGZA 4KIEA 5H9QA 5T50A 5I77A 4H55A 5I07A 3PULA 2J1EA 1B30A 1UP3A 4NAFA 2GGIA 2C91A 2ZUMA 3T2QA 4KBBA 1WDPA 1MQTA 4GX9A 2O9PA 4LYRA 3S1VA 4WBBA 4COYA 2ZGKA 1L2UA 1TMHA 4XBSA 4XWUA 2RMU1 1H51A 3M70A 2X2YA 2ZVRA 1NA1B 2W92A 4XDPA 1T8XA 4MKVA 1BYHA 3RZJA 2OKOA 5IDZA 1BTCA 3KBWA 1KDMA 3ZMOA 3KRBA 4H8NA 3C7HA 5E16A 3SITA 5HXMA 1XLEA 5KMYA 2YXXA 2A3CA 4WM7C 3VM5A 4XZUG 3Q67A 1NQJA 2HWE1 1O5XA 1R093 1W8HA 4UWDA 4XF4A 1E9ZB 3HQRA 5JMCA 4WVXA 3RPMA 5I2UA 1JW6A 1FX6A 1Q6QA 3FFQA 4P9WA 3V1PA 1ZZBA 4H8VA 4GWNA 1TRIA 4XD3A 5FLIA 5LB6A 5CBLA 4UW6A 1H4PA 1SFNA 2VD7A 3P84A 4LV9A 4BM8A 1H0BA 2Y5EA 3WLJA 4CDUA 2I16A 3VIMA 1KBJA 2WJDA 3VBHB 3AZRA 3ITLA 1Y8BA 3QFEA 2BERA 3W5MA 2PGEA 4QM9A 1UMLA 2RH9A 4PCNA 4YZ5A 4Q8NA 1ND2B 4YVWB 5JQ9A 1COV3 3GNEA 1PM4A 5FA5A 1BG4A 2FCTA 1R9YA 1COV2 2VWTA 4BS0A 5FF7A 3DH7A 3VMPA 4JIRA 1LOAA 3LOBA 4XKMA 1FRBA 4Y24A 4FNTA 4KH9A 1A8MA 5JWPA 4FX8A 1MXSA 2I14A 2DSWA 4LV4A 4KESA 1M1BA 3WK3A 2Q09A 3I3DA 1YLLA 3GTXA 3PAJA 4XYXA 3ZVHA 1YC61 3M5ZA 5AVHA 2DUZA 1RUE3 3FAXA 3MBFA 1WLTA 5CAKA 4JTFA 4IG2A 1ADSA 3FE5A 2PDCA 4O9EA 3CZ8A 4XV0A 2DIKA 1NVMA 3Q94A 4HSHA 1XNTA 4OGZA 2DSKA 4G1KA 5BCAA 3VPLA 4HKLA 1T41A 2VQ0A 1A5CA 4HK9A 1BMV2 4G2DA 3E96A 3WL1A 3BPZA 2JG8A 2C15A 4XZWA 5AZ0A 3UNDA 1BCXA 3CAKA 5IDIA 5JH2A 4UR7A 3EDEA 2YIHA 3GAYA 5DELA 4RR3B 1WZLA 3NSXA 3O1TA 3STCA 1W0OA 2PS2A 1XE0A 3R89A 4MPKA 4N43B 3LCIA 3UR2A 4FFGA 2VMDA 3NPWA 4XJAA 3K77A 1EP1A 2DFCA 3UKNA 2PQSA 2OPWA 2PU0A 4LA3A 1B0IA 5JLVA 2VBBA 3AB0A 1SR9A 4JN7A 1SFYA 3KBSA 3NL3A 1PVXA 2L9LA 3NV3A 2PB1A 4PTXA 5EFDA 4YM3A 4A3UA 2BEOA 1JH5A 4EF8A 4IFKA 4CTEA 1IXOA 4O16A 3G1XA 5FYMA 3UJQA 2W67A 1H0GA 3WJWA 2RR12 1REDA 3I59A 1TUFA 3R79A 5A8PA 1HKDA 2ATSA 2HS8A 4PODA 3NM1A 3QR0A 2CHOA 4Y6GA 4Y9AA 3BCWA 2XH2A 2CHHA 2VUAA 2QE3A 4OT7A 3PJXA 4YW4A 4YM0A 5TQLA 1U33A 3WLTA 3UZXA 1WLWA 3P93A 3VYLA 1UZZA 2VURA 3GDMA 3VBUA 3I6EA 4NJKA 4MO3M 4ET7A 4DM1A 2EHHA 4I9JA 1X8EA 5MHBA 2AKMA 2D7FA 3VDDA 3GIPA 4NZ3A 4PBOA 1B2YA 2XPKA 1EYEA 1FWTA 3MP4A 5A8QA 1PHMA 2P5BA 4CNPA 3B8WA 4QE1A 2EF9A 3N19B 4UBPC 1OD0A 3W6MA 4F4RA 5K0UC 3QV8A 5LRRA 3FHIB 5F6LB 4UTJA 4YSFA 5IBXA 2ALDA 4NAMA 5L9RA 2HWGA 4MLOA 2Q71A 4CNOA 3CMFA 1YNYA 3GBEA 1R86A 3B9DA 4CCZA 2HROA 4XQ6A 2VZVA 4C1XA 1OQ1A 2FPYA 5F37A 3EB7A 3VHRA 3P60A 1HL8A 2Y60A 4WJXA 2J6VA 1MZRA 1POKA 1Q7ZA 2NX9A 2CBVA 5BW6A 1E6SM 1N3QA 3FAWA 3GYEA 5C54A 1GQPA 3A3WA 1AYN3 1C8M2 3IV3A 3O1MA 2J7MA 1PGW2 3SCWA 1OFOA 4NU7A 3F2ZA 1JR1A 3R5EA 4Z2IA 4CSWA 5M3WA 3TR9A 4ERAA 4PLOA 4PMZA 2VRJA 5L6UA 4EJRA 5J36A 1BSLA 1H1YA 1N8IA 3RM4A 2W68A 4GAZA 3VC5A 3I2GA 4DEFA 2XLFA 5I0TA 4J28A 2VC5A 1OCNA 4UXAA 2IUWA 3NQCA 5H9PA 1IEXA 2DSZA 1OEPA 2BY0A 2Z26A 1OFSA 1WGPA 3BXWA 3QOMA 4I9MA 4Z2LA 4NZFA 3IVUA 1M5WA 4HMEA 1CCWB 5T3NA 3T2OA 1P6CA 3SQSA 4L4OA 1V9U1 3JZUA 4QX0A 3M0KA 2HJPA 3MMWA 1G8WA 1NY72 4EWJA 1NE4A 1YHTA 3MIGA 1FOD2 1WOAA 4JHMA 1Q6FA 3REQA 4REQA 2AC1A 2OTDA 4U2YA 2DZVA 4HMZA 1W3HA 2VEIA 3C2RA 4GH3A 1OC7A 3ARPA 4G9PA 3U14A 3B06A 3OP2A 5T52A 4LITA 3ST7A 1E4IA 4UBGA 1UZDA 1PL9A 4HJFA 5L9FA 3MO4A 1SQ7A 1P0NA 1J3RA 1KS4A 2PWFA 2P88A 1LOGA 3HPXA 2O0OA 3ASIA 2P53A 4AK3A 3T1LA 1XQLA 3MY9A 3UWZA 2E0PA 3KVKA 1M68A 4QEHA 1FWAC 4D6EA 2CIPA 3JBG1 4XMAA 1QMLA 4FX6M 1SSGA 3IJ9A 2XJVA 1CB7B 4I7UA 2OLHA 2PPGA 3GYCA 2V72A 4ASMB 5GLTA 1OX4B 2WCAA 3LCFA 3VDHA 2ZEXA 2H6RA 5TBOA 1C7TA 1VMFA 1B90A 2NUYA 3M5YA 4Q7NA 2VVEA 2WS93 4E2OA 3V0BA 1ISYA 1UASA 4UTHA 2PMWB 2A3YA 3CH9A 4GO9A 2V63A 2ZHMA 3DXIA 1GANA 3U78A 5BNOC 4MJMA 1UYYA 1E6PA 5FZHA 3CLWA 2BXVA 1OPMA 1B9BA 1LZOA 4FPGA 3UERA 3OJGA 1LGNA 4PE8A 3GZEA 3NTYA 2B7PA 3PMSA 1WMFA 2ABAA 1FP8A 5M2FX 1ME9A 2REQB 1HVQA 3T3YA 1ODMA 1ZRQA 2RS51 6ALDA 5J1XA 1F5ZA 1U30A 1LL7A 1A0DA 5E0FA 2XYLA 3GFYA 4PCRA 1S5WA 1SDDB 2PDMA 2PWDA 4QAWA 4BWLC 2B4GA 1LM1A 1WMXA 1GQJA 4BJHA 3PPGA 3PUHA 5C9AC 1NX9A 1RY0A 3PANA 4CEUC 3NDYA 1J1TA 5D8WA 5I3JA 1E6NA 3KOXA 3VBOA 5E1QA 4ZPIA 4YVXA 1TV7A 5F9TA 3FXGA 1SJAA 3USUA 1CLXA 2YBKA 4HA0A 1AZDA 2DZWA 2VGDA 5FXXA 4IGHA 2EG8A 2UV8G 3LXBA 1DYPA 4DZIA 3DI0A 5B4XA 1UY4A 3MUXA 3V0UA 1JFHA 2GWNA 5CG0A 1SSDA 1HNYA 3N17A 3LE0A 4HGXA 1RUF1 3EMQA 5CFDA 1XI3A 1WMDA 3SCOA 1VBA1 3UZ5A 1G86A 4L8QA 1TWZA 3S2NA 1POV1 1V3KA 1DGWX 3OF1A 4O1FA 5CZTA 4Q29A 3W73A 3II1A 3UYIA 1Z7S2 3LD5A 2ISDA 1GP6A 1R1A2 2XUMA 4QXIA 1HP4A 3R11A 1L6GA 3W85A 1AR93 1PS9A 4IGOA 4F8XA 2DZAA 3CV1A 4QSFA 3IKWA 3NNMA 1UKTA 1XPGA 2RJLA 1TMF2 7REQB 4QMAA 4GKXA 4UXDA 5E9XA 3KHJA 1I9RA 5F3GA 4FO9A 1SLBA 1Q6OA 2PMQA 1A49A 4O65A 5CLTA 1RCXB 3NURA 1E0UA 2VXNA 5D2YA 2RJ2A 1BK1A 1JYNA 2PA7A 2CWXA 2DU1A 4UW4A 2D3LA 3L2HA 5L9VA 5FKYA 1HKKA 4JHTA 2R073 2GC1A 3NYDA 3MICA 4C6EA 2R072 4PUEA 1ZALA 2EG7A 2BGOA 1Q43A 3QV7A 4DY3A 4QE5A 3BOWA 5C6CA 1UPMB 4QLKA 5TF0A 4GHRA 1TWWA 2XL9A 2VPVA 2PFHA 3G22A 3FHQA 5JPNB 4NVTA 4JX5A 2WC3A 1TE6A 1QTWA 2HEVF 5A7OA 1B9ZA 2PTZA 2GZXA 3TZFA 4Y9NA 3E2RA 1KXHA 2VXRA 4CDXA 3ZFEA 2FZ8A 4K8EA 4L56A 4HHMA 3AYAA 4AF9A 1OFPA 3U3HA 2RHGA 4KQNA 3SH3A 2LTNA 1MUMA 1QY4A 3M5VA 5CGQA 4LY8A 3K3NA 2YBTA 1RHI2 1ZRRA 3JXSA 3OOXA 3Q8BA 4QX1A 3PHAA 3AZSA 4GJJA 1QPRA 1RD6A 3ZYFA 3TIMA 3WJXA 1ST8A 3ACFA 5IK7A 4QG6A 4Q4V1 1B57A 3FDKA 3QMTA 3SLIA 1H7PA 3OQEA 2ONEA 1S46A 3OBTA 4K1YA 5C3QA 4IEWA 2B45X 1OI6A 3A4JA 2E3ZA 5DAQA 5AVAA 1MUCA 1RUG3 1EYWA 2W1QA 3RGBA 3ZN6B 4GKTA 2OVLA 1EP2A 5F2WA 3BK0A 4DXXA 4P5HA 3IPVB 1YX1A 1MSSA 3CHDA 2JKAA 4HA3A 3ORWA 2BBVA 4NSBA 4K3ZA 4XKYA 4HMNA 4PMXA 1MQRA 3NQ8A 3BICA 3PUQA 1EKOA 3KWXA 5BNPA 1V6OA 3THPA 4AZ6A 4L0PA 1S0GA 2D44A 1LG1A 4LW7A 1LBFA 1ZB5A 1YHFA 4NWWA 3OTRA 1W9PA 1QOQA 4XHBA 4XAGA 1AJKA 4LBQD 1CXFA 4HKPA 1XLKA 1SUXA 4XBKA 3A5VA 4L11A 1X6NA 5HINA 4WM7A 1MXDA 2FZ1A 1YI7A 8CGTA 3S8HA 5CSYA 3F4VA 2E7AA 4W84A 3AS3A 2PTWA 4MIMA 3HBZA 1EDQA 1TJ0A 4QIUA 1M7XA 3E6DA 4K7VA 3DGRA 3H2NA 4XIKA 1QI0A 1F5JA 4F79A 3S6PA 2O14A 1QJWA 3TC3A 2JECA 3LV5A 2J4GA 1Q2RA 4PHZA 4AX6A 3VBRA 1YNPA 1GZWB 1AFSA 1VPQA 2W66A 3DC8A 4Q4MA 4JHOA 1VBB2 1REQA 1NP0A 3TSBA 2QTWB 4JD4A 4RDVA 4WXZA 1UY1A 4ZOCA 1GVRA 1VHCA 4PMYA