4CCCA

Structure of mouse galactocerebrosidase with 4nbdg: enzyme-substrate complex
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
644
structure length
640
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Snapshots Illustrate the Catalytic Cycle of Beta-Galactocerebrosidase, the Defective Enzyme in Krabbe Disease
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords GALACTOCEREBROSIDASE
total genus 218
structure length 640
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4cccA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4cccA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4cccA01
1OFRA 4LV4A 4JFSA 3R89A 3VI2A 5HR6A 3GNOA 3MMUA 4ADTA 3AMDA 3KOFA 5GVJA 4TMCA 1JL8A 4HPJA 4UQCA 5IXEA 3FYPA 4GZIA 2ZX7A 1DORA 4CCCA 2FHBA 1KWKA 2ZUNA 4AC1X 5F4XA 1XD0A 2CIPA 4LT9A 4MY8A 5FF0A 5G5IA 2XVNA 1XI3A 2VFEA 3IJ8A 3QOMA 2VEIA 1C29A 1FP9A 3NQMA 5ABEA 2WCSA 1VYRA 3BAWA 2D22A 3GNRA 3DKJA 5M17A 1KFEA 5DY3A 2QAPA 4W5ZA 3EYPA 1GQKA 3TH6A 4NX0A 4WXYA 5BMWA 3DYMA 4HXCA 2QCMA 2JALA 3WDQA 1LOSA 5KZEA 4TMBA 1RV8A 3IAQA 2XFWA 2ZXAA 2OZ0A 5L9FA 3VILA 3ZO9A 1W9BM 3FKKA 1UYPA 2TMDA 4F9JA 3VX1A 4AMCA 3NDYA 4HNUA 3LV6A 2QF7A 1UKQA 1HJUA 2GSJA 4N6FA 1WZMA 4O1DA 2VEMA 3GB6A 3G0UA 3N34A 1EOMA 3WKZA 1JZ4A 2QLYA 2WSQA 3WEZA 2BY3A 2ABBA 5D37A 3O8AA 3L4WA 3UETA 4B9ZA 1Z42A 2Q8XA 3AMCA 3JUGA 3OIHA 3WD2A 3DFSA 3MMTA 3G24A 3CT7A 1OF8A 4EVZA 2B0MA 3MSDA 2YPIA 3WDRA 5A6MA 5BXRA 1EP1A 5LZLA 3LIGA 3P84A 1KLYA 3KAOA 3W6YA 4JHOA 4EK7A 3BW4A 4BI6A 2D20A 1I2PA 2X16A 4Q32A 3P8JA 2DPEA 3G6MA 3RM9A 2ZFAA 1I2OA 1GVQA 3W37A 2FLIA 1I1WA 4PN2A 1OD8A 2X0YA 3OLIA 4ACZA 1HKMA 4D6GA 2H8XA 4JS3A 4TX9A 3PBWA 1I75A 1NWRA 4D71A 2C0HA 4EF9A 1AMKA 1VFFA 1ZAJA 4JFWA 3M44A 1PCKA 1UUQA 1JCLA 5DY2A 1OX4B 1UWQA 1T99A 3LV5A 3RJYA 3L4UA 3W7JA 2W63A 4ZFMA 1LWHA 1V08A 2X0HA 3PSWA 1JAKA 1ECEA 1UBSA 1JCNA 1OB0A 3K1DA 1YXYA 1TO3A 2NLIA 3TV8A 4GQQA 1LZOA 3ZR6A 1SZEA 2A6NA 1FDYA 1B1YA 3C2FA 3G6LA 2W62A 4PFMA 4JTEA 2J88A 1SZGA 2QCLA 3IAPA 5EFFA 2OXBA 2VO5A 4U31A 3ZT7A 3S5ZA 1O6IA 2WVUA 3RLVA 1W3TA 2A3EA 3TNOA 1M7XA 3IK2A 3QC3A 1XGZA 1TFVA 1RQBA 2JFEX 4P7QA 1E9LA 4O17A 2VOTA 1GZJA 5AC5A 4FEZA 2WNWA 2DZWA 3CHFA 1UD5A 1UWTA 5D02A 4Y90A 2CLHA 3A5VA 1E73M 1QPRA 1V6VA 1G7VA 4W5UA 1KM4A 5I3GA 5SWUA 4BR1A 3NUKA 2E6DA 2GVGA 4DEFA 2WW5A 3L4ZA 1IZKA 1G7UA 3L21A 4HPXA 4CNPA 1OABA 1MQRA 2W66A 3VKKA 2QEZA 3E96A 1MQQA 2ZZ1A 3EDJA 3MANA 4ZZ9A 2D0GA 2VX4A 3GDTA 4PRWA 4D1IA 3AI0A 1MEHA 1UOKA 4O8RA 4O0ZA 3ZJ8A 1ZBWA 2GQ8A 4J3WA 1OHLA 1KFBA 1TR1A 4WK9A 2HSAA 3LI1A 5HR7A 3EMQA 3WSUA 1JUKA 5E0KA 4ATDA 3NQAA 5I23A 2OWXA 3B04A 2Y24A 1F73A 5C8BB 1JZ8A 1OFDA 4QP0A 5G2HA 3MMDA 4R34A 1PZ3A 3OZPA 4LGXA 2VR5A 4A29A 3H55A 2NX3A 4ICNA 1SQ7A 1WDWA 5CPNA 3C2OA 2J25A 4CN1A 3UWYA 3DFTA 1H7NA 3EXSA 4N6EA 1J10A 4UTLA 1GHRA 1W5MA 4Z2LA 4MZ1A 2YLAA 5LNUA 3CU2A 4N9CA 1BEUA 1MXGA 2ZX8A 1W1ZA 2GUYA 3GZAA 3L4VA 1QHPA 4JHZA 4B5NA 2DIEA 5IBXC 4UZUA 3EB2A 4RE4A 3WY1A 4B3KA 4ALDA 5A6BD 1HP5A 1CEOA 2WC4A 3DC0A 2FB3A 2WCAA 5M3WA 1ZHAA 1R46A 2A6LA 2X1TA 4R33A 2W0UA 3SCWA 3NO5A 3UXDA 3W6MA 4DQWA 3HIJA 2DQXA 1H7PA 5D8WA 2YR1A 1TYGA 2OWCA 2V0TA 4GNJA 1N8FA 4IM4A 1RQHA 4O16A 3MJYA 3TMLA 2ZRWA 3P7YA 1OX6A 2B7NA 3ARWA 1T0OA 4PH6A 1GW1A 2EQDA 2PWFA 4Z2IA 1B30A 4MTVA 2IXVA 2VJXA 4AD0A 3VINA 1PEZA 4YWIA 1FCBA 3L2IA 1L0PA 1MYRA 2ATSA 1UR2A 5FKYA 3BAYA 2BLEA 2G5WA 2D2OA 2YDAA 1FUYA 1QFEA 2WNZA 4WY0A 3CQ0A 5AC7A 1L6SA 2FFCA 5AHMA 2NSXA 3IANA 5A8OA 3UG3A 1SZNA 4CN4A 1QR7A 1QNOA 2PBOA 3PG8A 5FF2A 2J7BA 3BCFA 2BHZA 3PVFA 3VD4A 3TSBA 4HNNA 5BMXA 1ST8A 4AY1A 4LVGA 3SZ8A 4FF7A 1KWGA 1EPXA 1MXSA 4O1CA 1JZ2A 1CI1A 2DSZA 3LCFA 3NQDA 2ZUVA 1ISVA 1ODZA 2XGIA 4QAWA 4Q4KA 4PCTA 4M8UA 1ZAIA 1EXPA 1E6RA 2B31A 1FXPA 2BX7A 5U7SA 2NT0A 2BHYA 5E09A 2WPGA 2CU0A 3CHVA 4AHPA 5A8MA 4M19A 3PZTA 3VD5A 2Z1BA 4H41A 1H61A 4BF7A 5HINA 3WN6A 3F1QA 3QPZA 3SR7A 1V3JA 4FHAA 1CZ1A 1W54A 3M1ZA 1AW5A 1J0YA 4LXFA 4M6PA 2WJZA 3WNMA 2YL6A 4GZEA 5IFTA 5A94A 1BG4A 2VC6A 5BW6A 3GDKA 3GR8A 4QISA 4W8LA 4F9DA 1YPFA 4WKHA 3K46A 3WJXA 4AAJA 3O6DA 4AZBA 4BQ4A 2EXOA 3SSJA 5AC8A 1JZ6A 3IIZA 2GOUA 1LQ0A 2CLLA 4W7VA 3CHCA 4HKPA 3TQKA 4AF0B 4UTKA 1LL6A 2EPOA 3HBKA 3QGVA 3VGGA 4CVUA 5D2XA 3GYCA 5FMDA 1W5NA 3Q2DA 4UXDA 1F2JA 4O1BA 3AS0A 1BPLB 3LIHA 3VNYA 6A3HA 4CQAA 3HMJG 3QQ1A 4O15A 3OHIA 2VFIA 2YKKA 4E4PA 1WBJA 1NWUA 2ATMA 2ZRVA 1QMLA 1X1ZA 5K4ZA 2WVVA 1HNYA 4UFMA 3NAVA 3NGJA 3P81A 2C8NA 2ZUWA 3NSXA 3S6DA 4WSKA 4UQDA 1CIUA 1KTNA 3PBVA 1KCKA 2D3NA 1CBGA 2CBIA 2ZXQA 5KTLA 1DWGM 1FH7A 3AS3A 3NQ8A 1W9XA 3UWZA 3GXFA 3FJ6A 3L68A 3E12A 1XBYA 1Q6OA 1V7YA 6TAAA 5F2LA 3ARZA 3M46A 4OOUA 2DORA 4GO8A 5GNZA 1SSGA 1XDLA 1CXEA 1W0MA 5G4EA 2CBJA 4JTFA 1D3CA 3VIHA 3UEQA 5HQEA 1US3A 2Z2UA 1FHLA 2IXUA 3BW3A 3QW3A 4GUGA 5BCAA 4O4VA 2WHLA 2WWCA 3NPXA 3TCEA 2O9PA 2WC3A 2ISVA 5G2IA 1QBBA 1UUMA 2WCGA 3N9RA 4MJ2A 5CQ1A 4ML9A 3SY5A 4M24A 3S1WA 4JIPA 2G3MA 3ARYA 3LPGA 4UTJA 3FKRA 4LPCA 2WXDM 1K6AA 3C61A 2LLEA 3WFZA 2EAWA 4AF0A 5F4SA 4RX0A 2WVSA 5HWMA 4JN6A 4W7UA 3VNDA 1VFMA 2D23A 4DELA 1UH2A 5JBDA 4AD1A 2G97A 3W1RA 2ZQ0A 4QSHA 4XWUA 5DXYA 2VRJA 2E3ZA 2UY4A 3KRZA 3GH7A 2D1ZA 3S5QA 5TIMA 1WDPA 1B2YA 2VC9A 1K02A 2YA2A 2BY0A 2JEQA 3AS2A 5FIXA 2QUTA 2NXIA 3NR0A 3PM6A 2EPNA 1UWSA 3TJLA 5EY5A 3WIJA 5D30A 1V5XA 3ECQA 2QJGA 4JCLA 4W7WA 2X2YA 1E1EA 1LF1A 4TR9A 1LLWA 2V38A 3GBDA 3W2KA 3WQ8A 1IXNA 1SW7A 2F8QA 4O11A 1JNEA 4AVFA 3HG3A 3AHXA 4UOZA 1FX6A 3MBDA 2RFGA 5C55A 1ESWA 2WZEA 1NWSA 2AEYA 1TPVA 3FS2A 3VGFA 2FGLA 4EOUA 3CUIA 1WA3A 4AMAA 1W5QA 4AWTA 4H8VA 5I3HA 1MW1A 3WK2A 1I2RA 3FHQA 3TOPA 1KGWA 4Q7NA 4E8CA 4M29A 4RE2A 3BSGA 4GI9A 3IVSA 1W9UA 5AHNA 4PMQA 4LVFA 3PC0A 1Y4WA 4PMDA 4KWVA 3UNDA 4GUJA 3B8DA 2OSXA 4JFVA 4WOZA 3VGDA 2WSRA 3O1NA 1WAWA 5F1VA 1B3VA 3IJ7A 3CM4A 2QCHA 3W87A 1LG2A 1ZBVA 4R7JA 2Y8KA 4XUYA 1R2SA 4YMZA 3SCOA 3UXAA 4CQ9A 1E43A 2Y70A 2FHCA 3RPMA 4GI6A 3GK0A 2A7NA 2VRKA 4PMRA 1EQCA 1OINA 2VXNA 3LHVA 3B03A 1SPQA 3S9YA 4XBSA 1EIBA 4FLOA 3ABSA 1KXVA 1C7TA 1KXHA 3TU9A 4WF7A 4NT0A 1E6NA 3PULA 1V3HA 1J0IA 7TIMA 4OBTA 3OLDA 1W9VA 1XYZA 4N4QA 2G8ZA 4W8BA 1GOKA 5HWJA 3N9SA 2VL4A 2WYSA 2XVKA 1Z48A 2RH9A 4RZ5A 5DCBA 5D9OA 5A8NA 5AYZA 1MFVA 1WNOA 3F4NA 2PCQA 3W76A 1ZY9A 1W2PA 2ZXBA 1IIGA 3NZ1A 1E5NA 4JTGA 3HPZA 3W24A 1PX4A 5F2IA 3B9EA 3VX0A 2C3ZA 2BFGA 5EMYA 5FL1A 3W38A 3ZT6A 3CB8A 3W1MA 1FBAA 4U28A 3A21A 1QI5A 1U83A 2X1UA 3LCHA 1J18A 1QI0A 3UZ5A 2A2IA 3RK8A 1JFHA 2O9TA 2A7PA 4NNAA 2F84A 1B4KA 2VELA 3GAYA 4LOCA 4MIMA 4PTMA 3WDHA 3AROA 3VIOA 3WH9A 1K7EA 4LS0A 4BFAA 1V3LA 4XUGA 4A3UA 5I3DA 3R12A 3C56A 4S3JA 2B7PA 4GXPA 3A4WA 4NXSA 1VGAA 3DFPA 5J5DA 2EHHA 3N1AA 4CUCA 3BVJA 1E15A 3KRUA 3G0XA 1JIBA 1QW8A 1R2RA 1SW3A 2VRQA 3MHUA 2WLYA 3WMSA 4W9TA 3WF3A 3UG5A 3LDKA 3LRMA 3AZSA 2DZPA 3SCPA 1Q6RA 3SIZA 3W3OA 3TQ0A 1J0KA 1CGWA 1W3NA 5H2ZA 3W2UA 2VT0A 1H7XA 1KM1A 3QEZA 3T0BA 4HOZA 1W3KA 1PJ9A 5CZKA 3M43A 3HPXA 1X1NA 3DH7A 3NQEA 4RV8A 4H7VA 1JRCA 3FLUA 4MNMA 4YXGA 4JY8A 3GYEA 4DBEA 5IDIA 4NF7A 1XSKA 4TVDA 2NW0A 3OSDA 4BQ2A 3L2MA 3U7VA 2A3AA 4ACZB 3I65A 1SO3A 2H90A 5FD0A 3SCQA 2C16A 1UA7A 3TTYA 4J9JA 1VHCA 1WP6A 3KFTA 7A3HA 3P60A 4TUFA 1YADA 2WMIA 3ATZA 4GWEA 2YBTA 3TTSA 2QHAA 1FP8A 3BLPX 1GPWA 1IGSA 4PEKA 4XZ9A 3W22A 3WH6A 2GPTA 4OU1A 3TSMA 3W72A 1UR8A 2JKEA 1TVPA 3MUY1 1G5AA 1VJSA 3WEMA 3LHYA 3RIKA 1I2NA 1PX8A 1UH4A 4A4AA 1TB3A 4D6HA 1YHTA 5HDRA 2DT1A 3U1XA 3B0PA 5G2WA 3DFNA 2OYKA 5AHEA 4E38A 1UD4A 1PIGA 4UTWC 2VZSA 3WNOA 2FH6A 3SIMA 3GXNA 4S1FA 1TRIA 4NQ1A 1KM2A 5ABFB 3PSVA 2G96A 1E56A 2AC1A 4AZ7A 4X22A 1OG0A 5DF0A 4BWLC 5F2MA 5AHFA 5E0CA 5LSMA 1E72M 2Z6IA 3M16A 4JEQA 1XDMA 2B7OA 2GQAA 5L6UA 5CSSA 1UR0A 4OKDA 2V82A 2OMAA 3THAA 4L4PA 4W88A 1WDSA 2XM1A 5I3JA 3M0ZA 1KQZA 3C3NA 3BLEA 4OHQA 1TTIA 3EDEA 3R5EA 1DWJM 2WM0A 3S6TA 4UFHA 1MVYA 1DVJA 1XHGA 2ESCA 3C2VA 1G4SA 4ZVJA 1WDRA 4P61A 2TAAA 3VUPA 3CTLA 4AWEA 1JXKA 3W1UA 2HMCA 4K39A 3ABQA 5C71A 2AEZA 4KFOA 2CXGA 4YHGA 2CLFA 1QO5A 1TCDA 1JGIA 4OWGA 3QH2A 5BWFA 3HBLA 4JFTA 1GQIA 5BRPA 3BC9A 1JQXA 4BF9A 1JXJA 3L5LA 3P5ZA 1H7WA 3UR7A 8CGTA 2YGYA 1QPNA 4O28A 3W81A 3TAOA 5DCDA 1T96A 2ZRYA 2E6FA 3GX9A 3T0DA 3VU2A 4O0KA 1VF8A 1XBZA 3PTQA 3O05A 4RKAA 4LYPA 2V3EA 3CHDA 4FNTA 2B7QA 3NQFA 4ORMA 5A6SA 1H60A 2I14A 3C2RA 3EX3A 1V6UA 4U5IA 1BWKA 2GJNA 2YXGA 4MZYA 3YPIA 3DECA 1N7KA 5AOUA 1EIXA 1LRTA 4AZCA 5DBTA 4W93A 2YJQA 3CWNA 1GNXA 2UY2A 3WF2A 4IUOA 2ZUUA 3E02A 3W2LA 1YDNA 2CKSA 5CPTA 2PWDA 3CLWA 2A4AA 7CGTA 1B3ZA 3AXXA 2CETA 3UGGA 3WUFA 4UQBA 1M01A 4ML4A 1B4EA 5A3HA 2VX6A 3NZRA 1NF7A 4UMAA 2PURA 1OGSA 1E4IA 3BGAA 1OFOA 2GJRA 1VYSX 4X0VA 1TPC1 2ABAA 5H91A 3U2OA 1VHNA 4DWSB 4HHPA 1FHDA 3RJXA 1EWDA 2QJIA 3WJZA 5LHFA 1V6XA 3OA5A 3RWKX 5I2UA 1IXPA 2HVMA 3SECA 1GONA 2YDRA 2YL5A 1FA2A 4MPKA 8TIMA 2V2HA 4FIQA 1R87A 3BH4A 1TPB1 4UTMA 3GR7A 3R13A 3EWYA 4N9EA 2WHJA 5HWNA 1R86A 3QZEA 4QITA 1JZ3A 4NX5A 4FF5A 4LRSA 5FKBA 2NXGA 3PIJA 4UFKA 5C54A 3KVLA 2YFOA 3N9KA 2JKPA 1XCFA 3PWAA 3TFXA 1JDCA 2GVYA 1XCWA 5EBAA 3P5YA 3S5NA 4UTWA 3W84A 1ZL1A 4UC5A 3EMCA 3SURA 3PBGA 2ZWYA 2XN2A 1F4AA 4W89A 3S5OA 1J0ZA 3UY8A 3WF0A 1VLWA 1VEOA 3B4UA 1VJZA 3LFIA 3E1F1 1V6YA 2C0AA 3VM5A 2J77A 1E4MM 1H5YA 3ZFHA 3L4XA 4LU0A 2YW3A 1A5BA 1EA9C 4IOTA 1UJPA 1KV5A 1VYPX 2H8ZA 1U5JA 4MPQA 4D72A 5ABFA 1M04A 1LTDA 4K8HA 1CPUA 1VR6A 2BZNA 4DM1A 3HMCA 1KR0A 1TTQA 3WQWA 5KEZA 2C15A 4CU6A 1CGVA 2YW4A 5FK7A 3BO9A 3QQ0A 1XSIA 3EWBX 4LQ1A 3LMYA 2RKXA 3WQ4A 2ZDRA 4GUHA 2PRLA 2WVTA 3IJ9A 3GNNA 4K68A 2CLOA 1LDCA 3C2EA 1ZAHA 4MADA 1AG1O 2WNNA 1DQWA 4FFFA 4PL2A 3S5YA 1F4HA 1GJWA 1VEPA 2YDQA 5CZSA 4NRRA 3WH8A 3UG4A 1U33A 2J47A 1JCYA 3WD0A 2EF9A 4GC4A 1JDDA 2WANA 4UQEA 4BS0A 4DWSA 4I9AA 4PEEA 5EFDA 3VO0A 2WQPA 1FY6A 2WMGA 5C2XA 2ZUTA 1XC6A 5CSRA 5HJLA 1RZMA 2WAGA 1HKKA 1KCLA 3G0SA 1WB0A 4ZQCA 3W7EA 3CBWA 1OD0A 4CCEA 3SUTA 1H62A 4D6JA 3E49A 4IPLA 3GDMA 3GKFA 2WV8A 5D9PA 3WD3A 5A8GA 1NOUA 2VENA 2YSWA 1S46A 4W87A 3A3HA 3RDKA 3MP4A 1R7AA 3N15A 1DHKA 1TG7A 1LROA 2I1OA 3IGSA 4X0NA 4IUGA 4AIUA 3HB9A 4M80A 3WDPP 4AZGA 1G01A 4HPGA 4P7NA 1MZHA 3KX6A 1YTEA 1FWRA 1UHVA 2CWNA 2QF8A 4TVCA 3TROA 3T2OA 2QCFA 1HUVA 5EPDA 1UKTA 4X2RA 5LHEA 3W29A 1GVYA 3DI0A 1ONRA 5C5YA 4POCA 3NL2A 1BF2A 5KMYA 3EDFA 2OYMA 4UCGA 3S1VA 2W6RA 1RP9A 2Z1KA 5CLTA 3FXYA 2TYSA 1CDGA 2QQWA 3PZUA 1B31A 3CTTA 3TA6A 3VKJA 4IMFA 4PTNA 1VAHA 2CFFA 4AWSA 3OA3A 1W5PA 4X3ZA 1DWHM 1YDVA 3NNTA 2HS6A 1VBUA 1MWOA 3GBEA 1OX4A 4C7GA 1C3FA 4LUJA 1TTJA 2RDUA 3W7KA 3ARXA 2IQTA 3FAXA 1NOWA 4PMNA 1GEQA 2WBKA 3N18A 1RVGA 3UD6A 1JYVA 3G1VA 3B0VC 4DXVA 4UTTC 1UD6A 3MYOA 1HP4A 4AEEA 4OE7A 3F5KA 3AIWA 4JKMA 4N0RA 2BY1A 4GINA 5I6SA 2FPVA 2BXVA 4JDBA 4U5KA 3STCA 4DPQA 3F4WA 3O2LA 2BXYA 3VIKA 1CYGA 2JKAA 3F5JA 4MNKA 4TX6A 2WZIA 4UR9A 3M41A 4GRSA 4GUFA 1S3HA 1WCGA 3RM8A 3BV4A 1V3IA 1A5AA 1D3HA 2UV8G 2BVTA 4KRTA 2EPMX 5D8ZA 1AW2A 4QCEA 5HUPA 4P8VA 2OWWA 3HGJA 1V0MA 4UFLA 4E2OA 4K6AA 1Z32X 3CC1A 1XH2A 3PG9A 2VQTA 4JTHA 1LJYA 4FNUA 4TVUA 4QLLA 2J9XA 4YCPA 1V02A 3GXDA 3QSRA 3AS1A 3KRSA 1TPWA 3AO0A 3NPWA 4A21A 1XRVA 4NVTA 3HJZA 2XWDA 2WVVB 4E2DA 4HMCA 1XH1A 2J9ZA 3ZQ9A 1E0XA 3LB0A 3SC7X 3W27A 4MFDA 4BQ5A 2YYTA 4CQ8A 4Z1AA 4AD2A 1D2KA 3B06A 3W28A 1QPOA 1VH7A 4HOWA 1UD8A 3HO8A 4Z2GA 1ZFJA 3W6LA 4E0CA 4JL2A 1O5KA 3O6YX 1H7OA 3BPWA 1V3KA 1EP3A 2VFDA 3G1HA 1E70M 1H1YA 3GDLA 4MFEA 3NDZA 3SCNA 1F76A 5AN7A 2V5DA 3EWWA 3STEA 3MS8A 3PZGA 3TW6A 1KM6A 1CWYA 4OV9A 4Q22A 3GM8A 3RO8A 1ISZA 2Y63A 1UR4A 2XHYA 3HF3A 1GJUA 5CPMA 3KL0A 1PIIA 1K9DA 4DO4A 5FESA 2VEPA 3ZT5A 3O16A 1N55A 3WK0A 1KXTA 3GH5A 3LM7A 4BK9A 4ZQOA 4PYSA 4JXCA 3LHZA 4WJXA 3FN9A 2IUZA 4IPJA 1BYBA 2I9EA 3O6CA 1SO5A 2EEXA 3VVGA 4ATWA 3BLIA 5LNRA 3JRKA 4HMDA 3FAWA 4MLRA 4BI7A 5E6ZA 3CIWA 1F6KA 3U8GA 1AQHA 1A47A 3KE0A 1TMQA 3KWXA 1E0VA 4P7RA 1OFEA 1G4PA 5D2WA 2F61A 2J8GA 1K9FA 2GK1A 2C7FA 2ZA1A 1SR0A 5KZ6A 1BHGA 2VCCA 2XFRA 1XD1A 1W2VA 1WE5A 1GYNA 2VZOA 1Y9GA 3ARUA 3QOKA 4MNLA 1GHSA 1ZB5A 4KH2A 4CD4A 4LUIA 4QLKA 4U3AA 1L6YA 3QW4B 4JTUA 1NARA 1VPXA 1WAUA 4HSNA 3SI9A 1KM3A 2X09A 3BLKA 3M47A 1VFUA 2G4FA 4HA3A 4UZSA 5ECUA 1Q6FA 4JTJA 3VTRA 1CGTA 3TAKA 1H1ZA 4PCFA 4NRSA 4TTUA 3W7PA 3IMMA 3FJLA 1OSEA 2QCCA 5AYBA 3U75A 5KZMA 1IXOA 1FWSA 2BY2A 4W84A 2JF6A 3OEXA 3ZSTA 1W31A 2AQWA 1J0JA 3NMBA 2ZUMA 2ZXDA 1XM3A 1XUUA 3U6WA 1B9ZA 3W25A 3PR2A 3SCUA 1NM9A 3NOEA 1L6WA 4QNEA 1AQ0A 3GNPA 3U14A 2ZRUA 3BLFA 2FB2A 1I2QA 2PWGA 1KBKA 3GXMA 1P4CA 1EH9A 1JD9A 1M7PA 3A4XA 1JD7A 3U5UA 5F7UA 3DFOA 3G8EA 1TSIA 1XYFA 4AW7A 4D6CA 5M03A 1H50A 3I7QA 1ZS2A 2J8FA 3W83A 2CERA 2XVPA 5FEPA 4FNRA 3O06A 4GFSA 2D3LA 5LYRA 2QCDA 3ZM8A 1H1NA 4NJIA 2CZEA 3PZOA 2NZLA 3KZSA 1LBFA 1ZENA 5CGTA 3QJAA 1GQJA 3WL1A 2PBGA 1O95A 4ONVA 4O54A 1SR9A 1JR1A 3ABOA 2A3BA 1UD2A 3CLMA 4X9YA 1TIMA 2C13A 4QJ1A 2E6AA 1Q6DA 5CPQA 3FNDA 4UOJA 3DBPA 5TQLA 4D6DA 3MP5A 4LC6A 2ZCGA 3BG3A 1OFPA 3C6CA 4UTUA 4UIOA 1DJNA 5IFPA 1Q6CA 1ZJBA 1ICQA 2BSLA 1G6CA 1KW1A 4IMCA 4ZMGA 1CXIA 3N12A 1Y9MA 1ZALA 2ZZ6A 3LI0A 4NJHA 5IM51 3GDBA 3W82A 2WKLA 3ZSSA 1TTPA 5LKYA 2EJ1A 1PBGA 1HX0A 3VMNA 4JCMA 4ACYA 3MMWA 3AHVA 2VMFA 2FQIA 1KB3A 4MY9A 2Q3RA 3BCDA 2YX0A 3NYDA 1B3OA 3UWVA 4M5PA 3OGSA 1KGXA 4CU8A 1MSSA 2JK2A 4UTFA 4C1KA 1ZBCA 3SW6A 1SYTA 4HN4A 1P1XA 3U5YA 1JZ5A 4JZ5A 2WMJA 1FOBA 4ORIA 3L4TA 4KWUA 1WXJA 2GUUA 2ZZ4A 3ANYA 4JTSA 2UY5A 5D2YA 3H3LA 1GQNA 3G3DA 5HUOA 3PZQA 4CD5A 3L4YA 4L4LA 3O9NA 3VM7A 4TTGA 1TPEA 3LDRA 3LCXA 5A1AA 3QR3A 3QHNA 1DQXA 4ZQNA 5FF7A 3B9AA 3GAKA 3K4AA 1QPKA 1C90A 1OGGA 4NZFA 4JGDA 1E6ZA 1BGAA 2QPUA 5DEZA 2FTPA 3OLEA 3KVMA 3SGZA 3M5XA 3PZMA 4NI3A 4IISA 1HL9A 2OT0A 3LCLA 2YL8A 4B16A 3OBAA 2O7SA 3FIGA 5G1TA 1CX9A 2C14A 1KTCA 1RD5A 1BFNA 1F05A 4FXSA 1RQEA 3JR2A 3M5VA 4MB3A 3DI1A 4MJZA 2DGAA 2PF0A 1ISXA 4AZCB 5LGXA 1G1YA 2UWFA 4UQ9A 5CGMA 3ZR5A 2JBMA 1PS9A 1UD3A 3MWAA 1Y0EA 4BWLA 1SZFA 5DXXA 3J7HA 2XG9A 4QFUA 3TA9A 2XUCA 4CD6A 4RZ6A 5A6LA 2WMIB 2Y5EA 3S1XA 1Q4NX 1DEDA 4S2CA 1CLVA 4RK8A 3RFAA 2J27A 4JR5A 4AEFA 2FJKA 2NT1A 4RXGA 4WY0F 3T4CA 2GDVA 2ZWZA 2YYUA 2PI6A 1QDSA 4JKKA 3OIXA 4UNIA 1PPIA 4CKQA 3DYPA 1FWNA 3ZS4A 3NQ2A 3WEOA 1H2JA 1C8VA 2NWRA 2CW6A 4CD8A 5DO8A 2ZX6A 4QDMA 3L0KA 2JIWA 4V28A 1K03A 1TPH1 1OIFA 3CHEA 2Y85A 2GJXB 1HIZA 1C92A 1FQ0A 3PBYA 2ZTJA 4PC8A 3T78A 1GOWA 1H11A 1Y7VA 3RU6A 2AMGA 2CBUA 4P7LA 4Z2KA 4HIBA 5FK8A 1OGBA 1RP8A 3DHPA 1AQMA 4DPPA 4KGJA 2FPTA 2E77A 5E9AA 4MY1A 3CZJA 1JI2A 1GT8A 3RILA 1TQXA 1GG0A 3L67A 1BAGA 1XV8A 4NXKA 3LHWA 3G1DA 2AOSA 1HVXA 3NQGA 4K7VA 4UNLA 4QLJA 4H4IA 4E8DA 1U2YA 2OX1A 1HKIA 2VZVA 1B3YA 3M5YA 3QMSA 3LRLA 3MUXA 3L5MA 2EKCA 4U3CA 4O4WA 2TRSA 4PMOA 5CJ5A 3AHYA 3Q94A 2ZBTA 4AZZA 3FY1A 1Q6LA 4HU8A 2PRMA 1KGUA 1QOQA 3KHJA 4HSOA 3LOTA 5CZJA 2V9DA 1JCJA 1GCYA 4MAVA 4OZOA 4U2YA 3ZJ7A 3P62A 1BVZA 5E93A 1SU5A 2ZOXA 2DSUA 3CUFA 4MLJA 1HFBA 5KSWA 1W3IA 2R94A 2ALDA 1OWQA 4HNTA 4F8XA 3SEPA 1X6LA 3BGGA 3HGRA 5I3KA 6ALDA 3WNLA 3SUUA 4IPIA 1DOSA 4UMBA 2NV1A 4I7UA 2VZUA 2X1SA 3MUZ1 3PZIA 5G4WA 3UZJA 1D7FA 1HVQA 1B3XA 2WK2A 4PSRA 1GVOA 1J9YA 1EWEA 2Y89A 3CIVA 7TAAA 4XB3A 2QUVA 5CZ0A 2X30A 1FWTA 1R47A 1MFUA 3W7OA 1EUNA 1ICPA 5F2GA 2R8WA 4CU7A 5AHLA 5JBFA 3MV01 4Z1BA 4AZ6A 2C1HA 1JG9A 4PUEA 4AIEA 4NJGA 2XSBA 3VE7A 3WUGA 2W61A 3VD7A 1GZGA 1KXQA 5E0FA 3GZ3A 1K3UA 1AL8A 3PTKA 9CGTA 3LF7A 1G69A 1CW2A 1UASA 3RCNA 1DV7A 2Z1SA 3VOCA 4D1JA 3KL3A 2ADDA 2V5LA 4HNVA 2G3IA 1EA0A 3LRKA 4Z0JA 1BSIA 2PB1A 3ALFA 3AYRA 4PTWA 1HJWA 5A6JA 4JNMA 5D9MA 5EL1A 1SSDA 3G1YA 1FFQA 2WHKA 4J3XA 6CGTA 3QFEA 4IMEA 3C8FA 1FXQA 3ZJ6A 4OOZA 4WXZA 1SMAA 5HBFA 4HU0A 5CPOA 2CHNA 3B8SA 3SCSA 4DM2A 1G94A 5FI8A 2UY3A 3MYPA 2V30A 1WYIA 5HULA 1P6WA 1R7OA 2J7EA 4PODA 1YYAA 3S2CA 5HPCA 4ZQMA 2G3NA 2NV2A 4PMYA 1SFJA 2A5HA 2G3JA 4NNBA 4G1KA 2E0PA 3NSNA 5GQBA 1SFLA 2VI0A 1VRXA 3W7HA 4U2ZA 3TUUA 1W2TA 4LS2A 3PB2A 3IIXA 5K9XA 1JAEA 1FCUA 4AH7A 2XSAA 1W5OA 1V6WA 2CLMA 3AOFA 3F4VA 1ITXA 4WSJA 1UA3A 4FX8A 2DIJA 2MANA 4PCSA 3WMCA 3MU7A 1BLIA 3W0KA 2JGQA 1QOXA 3AFBA 2ZE0A 3PUEA 4NZJA 4MYAA 4J3VA 3WNNA 1OFBA 3PHAA 1E6SM 3VIJA 4H8HA 3ARPA 2Z6JA 4IX0A 1JI1A 3OVRA 2H3DA 3CMGA 3VNZA 3IRDA 2NX9A 3WDJA 2XYLA 1H0IA 4TXEA 2VVSA 5AYYA 2RGMA 5AY7A 4CLMA 1EEPA 1ME8A 3W7RA 1TPUA 1OVDA 4MJMA 3AIBA 1TQJA 3THCA 1M6JA 1GOQA 2E9BA 1B57A 4MNJA 1PE1A 3VE9A 1E6QM 4WKFA 5GPRA 4M81A 2AGKA 5CGQA 4M6QA 1C93A 1CGUA 2DH2A 3ARQA 4MZ8A 5U4NA 3W1NA 1UQYA 3LPPA 2FIQA 4A3YA 4H04A 2DT0A 1VFOA 4UQAA 4AD4A 2EPHA 3TXZA 4LYRA 3AYSA 5GNXA 2V2DA 3SJ3A 3CEUA 5CZTA 2ZA2A 4LC8A 3UWUA 4Y7EA 4AZ5A 2J7HA 2DT2A 2J9YA 4M56A 1JZ7A 3W1PA 4JYEA 2D73A 2QCNA 3W7QA 3P74A 1YXCA 4BA0A 1CXFA 1MW2A 5DT5A 5GNYA 3WF4A 3NYZA 1QWGA 1B90A 3CZKA 4WQ6A 4BI5A 3DAQA 3M07A 4KKXA 4MDOA 3SFKA 3M6DA 3QHMA 3GXTA 2DDXA 2YLLA 1E71M 1X7FA 3OG3A 4E2BA 5AC4A 2E4TA 3EXRA 1G4EA 3TC6A 3W7MA 1WKYA 2ZICA 3M7SA 4FLQA 1EB3A 4B1LA 2BV9A 1EDTA 2QMJA 3OGVA 4QM1A 1CXHA 4B3LA 4V27A 1KA9F 3N19B 4DUWA 1WBHA 4EE9A 3VD9A 2A7RA 4LRTA 2CEQA 3BSHA 4GZJA 2W67A 3APGA 1X6UA 3RF9A 4UOQA 4OUEA 3OG2A 1VJIA 1US2A 4W86A 4ZXOA 2BS9A 5A2BA 1ODUA 5A5WA 1VCVA 1VQTA 3B9DA 4N9BA 3I3EA 1WX0A 1W8SA 1BQCA 5JIPA 3BGJA 3LEMA 4AEOA 1W3LA 2CBVA 5FEWA 2QQVA 3AZRA 3BG9A 1XCXA 1TRDA 5D04C 3LHTA 4AIOA 4JD4A 2X1IA 3ARRA 4ZE4A 2DEPA 5AFDA 3W70A 1QHOA 1LLOA 4S2BA 4TX8A 3LX9A 2YA0A 2C19A 2OT1A 1KFCA 1SFSA 3T7VA 5LNVA 2DJXA 2E5DA 2BXZA 4YHEA 4GI8A 1KQYA 1C8XA 3VGEA 5D05A 4IXHA 3H53A 1CNVA 5D09A 3MO4A 3GKAA 1TUXA 1GVSA 1ZJAA 4Z08A 5LGZA 3I3BA 3W1QA 5KZDA 5TBOA 3KL5A 2ZIDA 4OGZA 2O92A 3CPRA 2QKFA 4R5EA 1WZLA 2WSYA 5FCZA 5CXPA 2WHMA 4M7TA 3QM3A 1HJSA 2WOQA 1UWRA 2NX1A 3BMVA 3MI3A 2FPYA 1K7XA 4FX7A 4FNQA 1VCFA 2NUXA 4NSBA 4YCOA 3LXCA 3FYOA 4H3DA 3R8RA 3WK1A 1JNDA 2W4XA 3PN8A 3STFA 2CHOA 3G1AA 3K8KA 4P8WA 2CKRA 3PUDA 3CGTA 5I24A 4IQLA 2XN0A 3K30A 4ZEPA 3HJEA 1OIMA 2GFTA 2H6RA 5DMYA 2D0HA 5JIWA 3W2MA 1GJPA 3ZMRA 4D6FA 2BWGA 1ISWA 4Z2JA 1M7OA 3IEBA 3WELA 2QUUA 3TONA 3VIPA 4F79A 4J3UA 3TKFA 3MUIA 3PZVA 3LCGA 4DBDA 1C91A 1K7FA 4JAWA 3WQVA 3MHFA 2WMKA 3L9CA 1NVMA 5ABGA 2OSWA 3THDA 5BXPA 5A6AA 3CWOX 1UKOA 2Y7EA 2YOCA 3WH5A 1H4PA 4P8XA 1KFJA 1LLZA 4A2SA 1VEMA 5I78A 5K9DA 1KTBA 1J11A 1I45A 2O7QA 3VGHA 5CG0A 4KMQA 4HPHA 1GORA 4O10A 4AB4A 1JDAA 1I1XA 1V02E 4V2XA 3Q58A 2QQUA 2ZX9A 4JX6A 1MEWA 3W23A 3MSGA 4JQTA 5FMCA 4DO5A 1XFBA 2CPUA 1VZWA 4RXFA 1LWJA 1TA3B 4MOZA 4PMVA 2XGBA 1XC4A 4OJYA 4Z0SA 1S5TA 1MW0A 1B0IA 4TOQA 4UTIA 3S1UA 4DO6A 2VFHA 2BNJA 1M53A 2JGYA 2C6QA 1V0KA 3AIUA 3LHUA 1MO0A 1F74A 3M7WA 4WX2A 3W7GA 1NWTA 1R8LA 1LORA 4Y6GA 5J5RA 1C8YA 2XWEA 1KR1A 2W79A 4K36A 2QV4A 1DP0A 1K9TA 1TV5A 5K3VA 1LP6A 2QR6A 4GE8A 5C70A 3HOJA 1UH3A 5D2VA 3SCTA 1XXXA 3FFSA 3NQ6A 1MW3A 5A6BA 1JCXA 2E5BA 2X05A 3DHUA 5BROA 4XKYA 3U57A 1PHQA 2JF7A 1UUOA 1ISYA 1IZJA 3OZOA 5DBUA 2W5FA 5JBEA 3W2JA 3OB8A 1QW9A 1OBAA 2XVLA 3TX9A 3NIYA 3DKLA 4LS1A 2XJ7A 1W9DM 3MBFA 1NP2A 3IVTA 3PBUA 3VCRA 5CKSA 2F7FA 1QHZA 1LM1A 4FB7A 2P10A 2H3BA 2WSKA 4IGHA 1ZCOA 1OM0A 3G1XA 1E51A 3N14A 3MW7A 1YQ2A 4ZE5A 4IMGA 3T2PA 3VIGA 4FK9A 1XH0A 2YA1A 3SGUA 2P0OA 2Y2WA 1GOOA 5IHRA 5K2ZA 1E55A 3L0GA 4GPNA 5I3IA 1W3JA 3UCQA 3WF1A 2GVJA 3EEGA 3V75A 4FNSA 4PL1A 3HQ1A 4NZCA 3BG5A 3HPSA 3B05A 3CIXA 4EQVA 3KVKA 4LWWA 2XIIA 3UERA 2J7FA 3POCA 2ZRZA 2Y7GA 1DBTA 1K8XA 1JCMP 4JY9A 3ATYA 1E0WA 3CEPA 1UZ1A 2VUYA 3AQUA 3C0JA 2F2HA 3TFCA 3WH7A 1O7AA 2XPKA 3UR8A 1JFXA 1JUBA 4LYQA 5LA2A 2FHFA 3W1XA 2PC8A 1SMDA 2DP3A 2RDWA 4PMXA 1KFLA 3GDRA 4JX5A 1EDQA 1ITCA 2CLKA 2PE4A 1PIFA 4TU1A 4N42A 4WUIA 5K4XA 4MB1A 1J2WA 1WOAA 2CZ5A 4RR4A 2CYGA 4IX2A 4Y8FA 2VX5A 4Y9AA 2NUYA 4B1MA 3P8IA 1TJRA 1YTKA 3MP3A 3VFLA 4N4PA 2VOMA 4K7YA 1NEYA 3WNKA 2GJXA 1BTCA 1FCQA 1HL8A 1A5SA 1JRBA 3AIQA 3U7BA 3NPVA 4DF2A 3N2XA 4BZYA 1QNRA 1PAMA 3CMJA 3ELFA 4AHQA 3UYCA 1O60A 1UR9A 3S8HA 5FF4A 2G41A 1D3GA 4O18A 1EQPA 1GVFA 2J79A 4N2YA 4OQVA 3RNDA 1TCMA 3KXQA 3TXVA 3HN3A 3MI2A 4PA8A 4AD5A 5A8PA 4FLSA 4C7FA 1TZ7A 2QMKA 4CVWA 3NQVA 3A5FA 3CZEA 1OT1A 4AWUA 1EGZA 2D0FA 2WBGA 3T09A 3CO4A 3NEVA 3ABRA 1UKSA 3K8LA 5LNSA 1OCQA 3FHAA 1KLZA 4XTDA 3T44A 4N9DA 1JYWA 4J3TA 3BK0A 1Q6GA 4RZ4A 4CNNA 4JICA 2BVYA 3LGEA 1HKJA 3EDDA 3NQCA 2J78A 3ARVA 1DWAM 4IMDA 1LOQA 2OYLA 2OCZA 2YZRA 5I3FA 2OSYA 3DENA 2VCAA 4HZ8A 3NPUA 2ZRXA 1FH8A 5A2CA 1DKWA 3AIRA 4YN5A 3VPLA 1BYAA 3VGBA 4UTHA 3PTMA 1X8FA 3L66A 1AK5A 4GUIA 3WMBA 3TR2A 1KFKA 3L5AA 4LVAA 4XKYB 3QMTA 3ARTA 4FNPA 4P2VA 1ML1A 3BMWA 3DZ1A 4M1RA 5A2AA 3VMPA 4KGLA 4JDYA 1TPDA 3HG5A 3EWZA 1TJPA 1Q6EA 3D3AA 1E4LA 3I3DA 3SUSA 2FDMA 4PMZA 1HN1A 2P1FA 1H41A 3W86A 3BAJA 4DF1A 1UYQA 3TIMA 1J4EA 1HF6A 3LTPA 3PY2A 5K7JA 1ALDA 4AISA 4W85A 3QYQA 5ABHA 1UKPA 4UTTA 1GVIA 1NFBA 1N82A 2WKGA 2EPLX 3FW6A 3E0IA 1AMYA 2WC7A 1M5WA 1SO4A 5CPLA 4PSPA 4LY8A 3TE9A 4HP5A 4RLIA 3A9IA 4AXNA 4JYDA 3RLUA 1KV8A 2ZTKA 2EBNA 3N3MA 4RE3A 2WO5A 2ZYFA 1W1TA 1GTHA 5G1YA 3G22A 3MI6A 2E5CA 1PV8A 1HG3A 2Q8ZA 3IGUA 4HZ7A 2YIHA 2DZXA 3E9AA 1NQ6A 5FL0A 1ME7A 4TO8A 3UWWA 1SW0A 1K8YA 1NSJA 3BARA 4DUXA 2E8YA 2WWDA 3ALGA 3N17A 3WFLA 4WIWA 2VCBA 3OVPA 5AB3A 2PRHA 3BAIA 3AXHA 1GG1A 4MJ4A 3IIOA 3EX4A 2Y7DA 3W7CA 2EPKX 1JJKA 3ZWSA 4EANA 2Q3OA 4U33A 5EB8A 3AICA 1LOLA 2YBUA 2FDSA 1ZBKA 1BGGA 4S3KA 4M6VA 4PTXA 1IF2A 3DHFA 3IV3A 1LBLA 2QCGA 3WJSA 5KITA 2XFYA 3NM3A 6TIMA 1V0NA 1ZU8A 2E1DA 1Q45A 1KBIA 1BG9A 4U4MA 4QAIA 1EDGA 4J3SA 2E68A 1HO1A 4WY0B 3O15A 3FA5A 2E9LA 4KWWA 2Y6ZA 2Y4SA 2O9RA 2V3FA 2QDHA 3STGA 1ICSA 4JTIA 4HA1A 1QAPA 2DSWA 1G67A 4IJBA 3GH4A 4RCXA 2A3HA 3NJ3A 3LDVA 1G4TA 4DWSC 3TQVA 4GJ1A 2J7GA 1L9WA 4LX4A 2PC4A 2ADEA 1GOXA 1E3XA 3OVQA 1W9PA 5DELA 3IVUA 2G95A 2QDGA 3LTYA 3VDHA 3CUHA 3CPUA 1L8NA 1FCVA 2DZUA 3P82A 3L2LA 3CUJA 3LTSA 5JUVA 3AXIA 4AYSA 1QPQA 1IT0A 3W74A 4B15A 2AAMA 3PZNA 2ZUSA 4H2CA 1DJQA 4MVAA 3INPA 4GKLA 3O63A 3POHA 3NL5A 4O12A 2J62A 4WJEA 2JIEA 4GBUA 1OFAA 4R27A 3EWXA 5CSYA 3ZR4A 4FFHA 2HS8A 4IPNB 2A1YA 3W1AA 3VD3A 2WMFA 2ISWA 1UZ4A 1LG1A 2XQRA 1VCGA 1EHNA 4FFGA 1CGYA 4J28A 3LBMA 1EO7A 2VURA 1L2UA 5A95A 2NWSA 5F1UA 3WNPA 2OJPA 3T40A 4OT7A 3W26A 5D4YA 3C52A 1H51A 3AJXA 5F4WA 3B0UX 3AHZA 1FH9A 4BCEA 3USBA 3WFAA 4ATLA 3M5ZA 1F6PA 4D2JA 1C7SA 5IHSA 1LBMA 4D6IA 3PIGA 4CCDA 3TDFA 1XUZA 4NJKA 1IV8A 5KINA 2W91A 1C9DA 1HXJA 4URIA 4W8AA 2TSYA 4OV4A 3DFQA 5D03A 2GK1B 5DT7A 2VR4A 5LA0A 3UY7A 3VIMA 1J0HA 1SUXA 4XZBA 1E4NA 1QCWA 2DSKA 1BVNP 3N11A 4WZHA 1G9HA 5BOOA 2YCEA 3UGHA 3T2QA 3W71A 2WKJA 4FFIA 3JS3A 1V3MA 4O57A 3LCWA 4EF8A 3EXTA 2QAFA 1RPXA 1GOIA 1LRQA 3BXWA 2EO7A 1F7BA 4XBKA 5C6MA 2DZSA 4O50A 4JTTA 1A3HA 1O4UA 5D2TA 2Y8VA 2VQUA 3WBAA 2A0NA 4EIVA 5BRBA 1CECA 1ADOA 3WD4A 5FMBA 4JX4A 1CXLA 4MYXA 5E1QA 1UWIA 1HL2A 5FOOA 4WD0A 1J01A 3EKLA 2XIBA 2WNQA 2V3DA 2CESA 1C8QA 1OYBA 1W1VA 2VX7A 4JIQA 2Q8LA 3RMJA 2CNCA 2VZTA 1JUEA 5EA9A 5D33A 4ZL1A 4XQ6A 4WLCA 1RR2A 3I6RA 1P0NA 3TMQA 3I68A 3MV11 4DF0A 4M7SA 3PAJA 3BW2A 3AMLA 1PX3A 3HG2A 3DYOA 3RMEA 8A3HA 3GXPA 1VC4A 1RD6A 3QHOA 5I79A 3VIIA 3D0CA 2QCDB 4JIEA 2ZZ5A 4LTSA 4HTYA 4Q33A 3KF3A 3VIFA 3ZOAA 4NUWA 2D24A 2Z0IA 5FEZA 3V1PA 5A6KA 3UPWA 3H54A 2DT3A 3W07A 3AIVA 1FWWA 1P5BA 1K8ZA 2OLHA 3K8MA 2WLZA 3O07A 3IIPA 4UNKA 2PWHA 1J5TA 1LYXA 2GJPA 1M03A 3PUOA 3PZ9A 5EMUA 3TJXA 1HJXA 4Z1CA 1QNQA 1PVNA 1TE1A 1UQZA 1H49A 1CXKA 3G1FA 4H6KA 2EGZA 4UMCA 4I7WA 1OX5A 1UR1A 2BTMA 2Y62A 4PMUA 2E6YA 4PBGA 3CZ8A 1VB9A 4ZXLA 4EWND 1QNSA 3K4DA 4MDPA 1TV7A 4KFPA 4WOQA 4YLWA 3SUWA 4O1AA 1CGXA 4AZHA 3CH9A 3T08A 3T0AA 3II1A 2J24A 3KEHA 2DJLA 4F66A 1BYCA 2HISA 5FEXA 3VDCA 3WDIA 2WZHA 5BNKA 2FGZA 4DUVA 4HOXA 3EDKA 4B9YA 4WKAA 3BAKA 3EKZA 3AJ7A 2ZX5A 5LNWA 3W1LA 1EHAA 1R85A 3VDBA 2WPBA 4O19A 1KBJA 3EWUA 2V5CA 4FMVA 4HA4A 3EX6A 3A4AA 3PF3A 3WQ6A 1P0KA 1QI4A 3LCIA 4FXRA 1V03A 1BYDA 4IWWA 1GUVA 1JF5A 3AHTA 1E6XM 3QSTA 1H0GA 4CN6A 1THFD 1IXQA 1TMHA 4QCFA 2JEPA 1I4NA 1E1FA 5HMSA 1WPCA 2GVLA 4RL3A 5A69A 5EKYA 4MB4A 3DXIA 4JFUA 3TK7A 4HMEA 1XL9A 3ARSA 4M82A 3WBEA 1NH6A 3LXBA 3WUBA 3RM4A 3AMKA 1WZKA 5DFAA 3W75A 1XKYA 4P8UA 1LL7A 4O52A 2VTFA 2A85A 3A23A 5FIPA 3THQA 3NDOA 4LV9A 4NU7A 3TW7A 5ANNA 2VFGA 3UESA 1GQLA 1PL9A 3HGOA 2WSPA 2R14A 3L0NA 2V81A 1CENA 2PWEA 5AC6A 2RGLA 3IGXA 4AXKA 1UWUA 2RDTA 4CNOA 1RH9A 5IBXA 3NCOA 2ZA3A 4UR7A 3OGRA 3SCRA 4HT3A 4UFJA 2GJLA 5AYXA 2GDUA 1X6NA 1EOKA 4K38A 3QF0A 3W7NA 1TREA 2QCEA 2A21A 3GTNA 2Y7FA 2J75A 1NOFA 5HXMA 3MO7A 1QBAA 4ZQPA 5DN1A 1W91A 1VBRA 4PUDA 3W85A 1VS1A 4K37A 5HOSA 3W9ZA 4A3HA 2DZTA 3WJWA 1E5JA 1HJQA 4L4OA 1KM0A 5EBUA 4LW7A 2NXHA 2X1RA 2V8ZA 3NG3A 3AISA 1R30A 5I77A 1HJVA 1JQVA 3G18A 5I5RA 2V5BA 4FLRA 4GIAA 1YTDA 2WB5A 4O14A 2E9MA 3A24A 3LBCA 3M9YA 2BVDA 5BXTA 3MHGA 4MB5A 3NVTA 3CZGA 3G8RA 3SUVA 2CZDA 2X2GA 2KZHA 1QNPA 5CLWA 3M6YA 1QOPA 3Q37A 2V3GA 1BWLA 4IXXA 1OT2A 1W32A 3TP4A 3ZIZA 3LLDA 3AMGA 4I7VA 1HTIA 3LPFA 2BHUA 5CPSA 3KF5A 3I7SA 1W37A 3HG4A 3L65A 3CUGA 1B9BA 1JYXA 1WQ5A 4KRUA 3W2NA 1H5VA 2J74A 4GXMA 3WJYA 2CCRA 3N04A 1PHWA 3N13A 5HNNA 1VIWA 1T8XA 2TPSA 3OBKA 3SCVA 4GO9A 1A53A 2HTMA 4FIRA 1WDQA 4OBRA 1O94A 1S5WA 4O13A 2ZZ7A 3AIEA 2NUWA 2ZZ2A 1OK6A 4AZIA 2YDSA 1TPFA 1QVBA 2Y88A 3LPOA 5CSUA 3NL3A 3EX1A 2W92A 4AD3A 5K9CA 1UG6A 3W88A 3OLGA 4KFNA 3GXIA 3GVGA 1HT6A 4FO4A 5TD4A 4XX6A 1H7RA 4YPJA 1W1YA 3G1SA 3R2GA 4YL2A 1GOMA 1HO4A 3VMOA 5E6YA 1FDJA 3IIVA 3GLCA 1GTEA 1DHPA 1AL7A 5D38A 1I8JA 3S42A 3WK3A 1CLXA 2WMHA 1CTNA 3W73A 2E8ZA 3CZLA 3HU7A 3FEMA 1KFWA 3NL6A 2E40A 4NJJA 2J7CA 5BYWA 1TV8A 2C18A 5BXSA 1AW1A 1OYCA 2VEKA 1K9EA 1VENA 4UCFA 3QPYA 3A6OA 2XFFA 2A3CA 5M5DA 2YL9A 3F5LA 1ZJIA 3I7RA 3WL0A 4D6EA 1G0CA 4XV0A 1QNVA 3ZWTA 3G3MA 4N02A 1GPFA 2Y61A 2RHGA 3LERA 2AAAA 3NM1A 2CITA 2R91A 3NSMA 4J27A 1MEIA 1XBXA 2V2CA 2VNCA 1Q6QA 1WV2A 4C7DA 3F03K 4GQRA 2VVNA 5DLCA 4J7RA 5ABTA 2ISSA 3UWQA 4FX6M 2X8RA 3A22A 3S0CA 1U30A 1WOBA 4MAZA 2VKZG 4O53A 3NXFA 4H8UA 5T26A 1EP2A 1EX5A 2JE8A 1XSJA 1YDOA 3KVJA 2E09A 1SO6A 2QPSA 3W1TA 5E70A 1IIHA 2DU2A 1FFRA 1GYLA 3TC7A 3MKKA 1JVNA 1O5XA 1VLIA 5FF3A 3W7LA 2J6XA 1MXDA 1WZAA 2CZFA 1DL3A 1F5ZA 4K8EA 4EAMA 4MUZA 1ZNNA 2CLEA 1A50A 1Z44A 2YFNA 2GQ9A 1H63A 1E3ZA 5LA1A 1BKSA 1D9EA 3N2MA 2DSVA 3P61A 1LCOA 1AVAA 1OYAA 4X9SA 1E40A 1QI3A 3TSDA 4XTIA 4A22A 3T55A 5DCEA 2XM2A 1OFQA 3C4UA 1EUAA 3PS7A 1KM5A 2ZZ3A 1JULA 3TTQA 3LXAA 5BRQA 3EMZA 3P80A 4PTVA 3NQ7A 1YXDA 4OBSA 4MKNA 4UUIA 1PZ2A 1Z41A 3N73A 1BTMA 4AHOA 1NAL1 1MQPA 1UCWA 4Z1DA 3DGRA 4A2RA 3W53A 1RPKA 3DU0A 1R2TA 3P67A 1W1PA 4JL1A 3QMRA 5AHIA 1DWFM 1JF6A 4JKLA 3EBVA 5HPOA 2DZVA 4UFIA 3EX2A 2CLIA 3WD1A 4ZENA 1DWIM 1V0LA 1GVRA 5EYWA 5HNRA 1DTUA 3TTOA 4UR8A 5AYIA 4QHZA 1Q3NA 4EKJA 1S5VA 1QO2A 1GWJA 1NP0A 5CG7A 3QRHA 1H09A 4P7OA 4JTKA 2DH3A 4R53A 5D32A 5D9NA 4LVDA 3W4RA 4CD7A 3DHDA 1TA3A 1OF6A 4DWSD 2QJHA 1OJXA 3MUAA 3O6AA 1JYNA 3VDAA 3UQNA 4Z2HA 3GNDA 3PB0A 2XN1A 4C1LA 1ME9A 3A47A 5I0DA 1YPIA 1NF0A 1KBBA 1QI2A 1WO2A 5A8QA 1H3GA 4JYFA 1X1OA 3D5HA 1W3HA 1TVNA 4CGTA 2J7DA 1LRNA 1A5CA 5MHBA 4QNWA 4BQ3A 4Y96A 2B4GA 3GIYA 1FDZA 4L4MA 1OK4A 2XVGA 2FH8A 1J12A 4ZQRA 3BAXA 4ADSA 4OIFA 1YLVA 3UGFA 3NA8A 2O9OA 4TIMA 3AZTA 5FKCA 3FOKA 3WUEA 4JTLA 1VRDA 4QQ3A 1LL4A 1PCWA 2J4GA 1XBVA 3HGSA 1B3WA 3UPBA 4LNYA 4RJEA 3W7IA 3WENA 4NNCA 4QIUA 1W56A 2XTKA 3W7DA 4ADUA 1EO5A 3ZJKA 4HZ6A 3LLFA 3WQ5A 1E6PA 1UB3A 4LVBA 4XZWA 2VFFA
chains in the Genus database with same CATH superfamily
4WM7A 3M0KA 5F5AA 3VI2A 1W6NB 1QXPA 3AMDA 3S2NA 2XZ9A 4YRDA 5GVJA 3D46A 4K21A 1IE7C 3ONBA 5C4WB 1BVP1 5C4WC 2RG4A 1DORA 4ARXA 2ZUNA 3M4FA 4QXCA 2OYZA 4LT9A 3RS6A 4MY8A 1YQ6A 2XVNA 4M4PA 4H6RA 3FUQA 5ABEA 2YBSA 4EYUA 4Z1YA 3GNRA 5DY3A 1UW8A 4NASA 4W5ZA 3EYPA 3KCYA 4G7EA 5BMWA 5DUUA 4HXCA 4XW3A 5L19A 3FFQA 3CQOA 3IAQA 4TMBA 5L9FA 5DANA 5LXXA 3TYDA 4NP7A 1AF9A 4E4UA 4DOUA 1UKQA 2QF7A 1HJUA 2GSJA 4N6FA 3UCCA 4LY4A 5A7WB 2QLYA 4CDWC 2ABBA 1SFYA 3O8AA 4B9ZA 3UETA 1Z42A 1XU1A 4F48A 1LNSA 3ETPA 1OF8A 2YPIA 1EP1A 1MS0A 2G9ZA 4NAOA 5FJPA 2PWVA 2X16A 4Q32A 3G6MA 3RM9A 2ZFAA 3RDIA 2XUMA 2VMDA 2FLIA 1OD8A 1YFXA 3OLIA 1HKMA 1HB3A 4LR4A 1W2AX 2XXZA 2C0HA 3WLRA 4EF9A 3CJIA 1RUH3 3TEZA 1ZAJA 3AZZA 3HFTA 4CCZA 5FY9A 1OX4B 1T99A 3L4UA 2GZXA 3PSWA 1NCRB 1UBSA 2OKOA 3K1DA 1YXYA 4GQQA 1REDA 1PXGA 1M1BA 1R5YA 3WT3A 4IW3A 3ZT7A 2WVUA 3CJXA 1TX0A 3IK2A 3QC3A 1XGZA 1E1CA 4O17A 1OMIA 2DZWA 3C0QA 1P0EA 3NO3A 3SRHA 5D02A 2CLHA 4W5UA 4XSMA 1KM4A 5SWUA 3P0WA 3L4ZA 1CAUB 2W66A 1VKFA 1HRV3 2XDFA 2QEZA 4XZMX 3NXLA 1UYZA 2VUJA 2IZWA 4FQ4A 3UKTA 2XSXA 1LKNA 1DLCA 3GDTA 4AVOA 4D1IA 1Q8VA 5FPAA 4C8DA 1JYTA 3TYZA 4KNCA 1MEHA 1UOKA 3ZJ8A 7XIMA 4OHWA 1SG3A 1K4GA 2XH2A 1WMXA 4AVVA 5I23A 3F7JA 1OFDA 1V6LA 4ASKA 2CLPA 4XK2A 4A29A 1HN0A 1Z3NA 4ICNA 3WQEA 2J6VA 2YXOA 4ZB0A 5J36A 3ZZ1A 1VALA 2J25A 2QUNA 2YYOA 5CFDA 3LEPA 1PVXA 4MZ1A 2YLAA 5LNUA 4N9CA 1D7PM 5JH1A 4KT2A 2GUYA 3GZAA 2ZGLA 2ZA9A 4RFRB 2UYBA 4RE4A 4B3KA 4A3XA 4ALDA 4Q4OA 4CPBA 1UU4A 5AZ0A 4JQ1A 3NL1A 2XBO2 4YZ2A 4R33A 3T3YA 4PCPA 2W52A 3DKWA 3TYUA 1NJJA 4IL7A 5FAXA 2E7AA 4Q4Y2 1N8FA 1RQHA 3VBFC 1UZHA 1OCBA 3B8IA 4XUPA 3ARWA 1T0OA 3IPWA 1ONEA 4C60A 4IFKB 4H7LA 3N6JA 4DJFA 3K13A 4ZU7A 1UR2A 1FCBA 3IDBB 3KV6A 3L2IA 5FKYA 4GOAA 2WNZA 3CQ0A 4EWDA 3IANA 5A8OA 4ATFA 1ALYA 3CK5A 3PG8A 3WLTA 3VD4A 5LK7B 3SZ8A 1WA4A 4FF7A 3Q65A 4C1NA 2CWMA 1MXSA 1KWGA 1A0EA 3LCFA 1K45A 2ZUVA 3NQDA 4QAWA 5FO7B 1EXPA 5EYYA 1KKRA 2Z4GA 4O9EA 2NT0A 5E09A 5U7SA 2CU0A 1FHVA 2Z1BA 4BF7A 3F1QA 4FHAA 1W54A 3M1ZA 4M6PA 1DZTA 3LB9A 4GZEA 2VXRA 2VC6A 4IE5A 1RHI2 3U9IA 2YCLA 3RGBA 3E5PA 3O6DA 3TW9A 1EFZA 4M3CB 1LQ0A 4CP9A 2CLLA 2HJPA 3R0KA 4P9LA 4AF0B 1LL6A 2EPOA 5D2XA 3MIDA 3TRSB 1IR2A 1VBA3 3VNYA 5FBZA 3PTRB 4CQAA 3HMJG 1R1A1 4O15A 1YUDA 2HNEA 1RTVA 4E4PA 4IEWA 5EJ3A 1NWUA 3KTSA 5M1TA 5FLJA 5CFDB 3NSXA 2JEMA 3NGJA 2ZUWA 5F3CA 1F8MA 4WSKA 5JSRA 2NMNA 1S0DA 2GU9A 2R072 1KCKA 2V6AA 4IGMA 1CBGA 4US5A 1DWGM 3AS3A 3GXFA 3RR4A 2FYMA 2RS12 5DZGA 3E12A 1KCZA 4GO8A 5G4EA 3UXKA 3UEQA 1W6OA 1US3A 3ATGA 3QW3A 4GUGA 1NE4A 2WWCA 5A3PA 4CDWB 4A42A 1QU4A 3S30A 2VMEA 2H6CA 3SITA 4XUNA 1W8FA 4FAGA 1KRIA 4M24A 2WRAA 1HQNA 4UTJA 4L8QA 3FKRA 4RYDA 2R1PA 5DZFA 4XVEA 1S39A 2I57A 4DNYA 2D23A 4DELA 3AUJA 4AD1A 2G97A 2VULA 1S2VA 2BG5A 3W1RA 2ZQ0A 4DVOA 2UY4A 4GJYA 4QMAA 3NAPA 3KRZA 2AYHA 2VC9A 2YA2A 4C6IA 2BY0A 2JEQA 2HNHA 3NR0A 3WCSA 2EPNA 1GZTA 3WIJA 2XWJB 4JCLA 4JAAA 1T8QA 3GG7A 4TR9A 1LLWA 4RUBA 2F8QA 4O11A 4XVHA 2HV5A 3HG3A 4AVFA 4UOZA 2HYXA 1ZBE2 3IS4A 2WZEA 1ESWA 1S2CA 1NWSA 1VBGA 5CB7A 3FS2A 1CVNA 1DZQA 4EOUA 1C5HA 4PUMA 1LOGA 5FZBA 1W28A 1H6YA 1W5QA 4AWTA 1XJAA 1UMIA 3TWIA 3WK2A 1KGWA 1FXZA 4F3HA 4O7XA 3IVSA 1W9UA 5AHNA 1PMJX 4PMDA 3MLLA 2OSXA 3B8DA 4BHYA 3VGDA 4WOZA 3BOWA 4PDWC 3VBFB 3OCPA 1B3VA 5D9NA 3VBUC 4B4RA 3SCOA 1E43A 4M6UA 4ES8A 4PMRA 3EWCA 1OINA 5E6HA 1WW7A 4MHUA 3LHVA 1W6PA 4NROA 3B03A 3SQMA 3MSYA 3ABSA 5EXOA 4NT0A 4P9XA 5FYIA 4Y24A 4OBTA 3DXUA 4N4QA 3QKEA 1QDCA 2GC1A 5D9OA 5AYZA 1WNOA 3R1ZA 5JI9A 3ZSLA 3W76A 3NZ1A 1E5NA 3G6JB 5F2IA 3B9EA 4PI2A 5EMYA 3W38A 4R4XA 3MW2A 3ZT6A 3W1MA 1QI5A 1U83A 2NQLA 2O9TA 1JFHA 1H2LA 2VELA 3ZYHA 5DG1A 1JOJA 1V3LA 3A3XA 2JICA 4A3UA 1OY0A 2WT0A 3R12A 4GULA 4GXPA 3NNMA 3A4WA 3N1AA 4CUCA 1QW8A 3G0XA 1BQGA 3WMSA 4HMNA 1FAYA 1AR63 3UG5A 3LRMA 3PBMA 1VBA2 2XIMA 3H22A 3LU2A 4HK5A 3VKLA 1W3NA 4I8DA 4A3QA 5H2ZA 4HN1A 3HAGA 2BDQA 1PJ9A 3DH7A 4TWTA 3GD6A 3NQEA 1JRCA 2PTWA 4DBEA 4Y4RA 4NF7A 5LA9A 3L2MA 3U7VA 1SO3A 2H90A 5CKMA 5FXWA 4YJ5A 1M68A 1VHCA 4MF4A 3KFTA 1OF3A 2WNUC 3LA4A 4V1YA 3H8UA 2QQMA 2PHXA 2YBTA 3BOLA 1M4WA 2NQHA 1J96A 2E6VA 1GOHA 4DQAA 3W72A 1UR8A 3CUZA 2ZTNA 4D0QA 5AECA 1VJSA 2DF7A 1PX8A 5FBJA 4JTDA 3RIKA 2FDHA 1FRBA 1XR2A 4MGSA 2OYKA 4E38A 3N6QA 2V4VA 2FH6A 4QPIC 4S1FA 5FZ4A 1UAIA 3ISIX 5CG8A 1BF6A 1E56A 4JNZA 1IG0A 1NY71 4X22A 5DF0A 4BWLC 4OHYA 4L80A 4I02A 5DG2A 2HJIA 1XDMA 2B7OA 4FS9A 1OA4A 2OMAA 3T1MA 4I9JA 1C8M3 1ULEA 1FMD2 1WDSA 4GYJA 3NURA 2RR11 3EDEA 3R5EA 3LD5A 4UFHA 2CC0A 3ZXFA 2VOVA 2TAAA 4P61A 4H2HA 1QOTA 4EPBC 5C71A 4KFOA 1IS3A 2WZ8A 4QXKA 4YHGA 2YC4A 2FDIA 5CC7A 4FXJA 3CT2A 3E2SA 3I2KA 5BRPA 3C7GA 1JQXA 1JXJA 3P5ZA 3U48A 4LUSB 1DGWX 4GA9A 3W81A 3TAOA 4OHVA 1QJU2 2E6FA 3GX9A 3VU2A 1XBZA 3SNMA 3S46A 4RKAA 3O5SA 4I90A 1DE6A 3NQFA 5A6SA 4LO7A 3EX3A 2IQ0A 3KCJA 3KWVA 4MZYA 2HBVA 1N7KA 4AFCA 1EIXA 4W93A 3UJRA 3CWNA 4IUOA 2Q1ZB 2ZUUA 4LBJA 1YDNA 5EMKA 7CGTA 5BOFA 2V63A 1P6CA 2SBAA 4LORA 2BOGX 2PURA 2Z1VA 6PTDA 2ABAA 1BZWA 1NYWA 5H91A 1V6JA 2NP0A 4WZCA 3N29A 3VZJA 2O55A 3TNPB 1EWDA 3WJZA 3WW2A 3EA3A 5LHFA 3OA5A 2YDRA 1GONA 5AKQA 1F3XA 2WZMA 5FJOA 2TUNA 3BH4A 2GP3A 3OJBA 3GR7A 1S0CA 3R13A 4ATEA 2XZ7A 3EWYA 3D0SA 4QITA 4I0AA 1GGOA 4LRSA 3VBUA 3RRAA 4MGKE 1XCFA 1XCWA 3DX5A 3W84A 4HK7A 3SURA 4AE2A 1F4AA 4E4SA 1VLWA 1AH0A 2WS92 2C0AA 4XIMA 1AL22 3OP2A 1H5YA 3ZFHA 3I2HA 2R7EB 3PDQA 4AGRA 1EA9C 1LT7A 4IOTA 3POYA 1U5JA 4D72A 1ZLPA 1JTZX 3MVTA 4K8HA 1VR6A 1UKGA 3HMCA 2C15A 4IH3A 2YW4A 2Y5SA 5JVVA 3EWBX 5F3EA 2RKXA 3IIIA 1REQB 2PPGA 2WVTA 1IWPA 3ZFEC 4XVDA 3H70A 3RX4A 3M3EA 1DQWA 4PL2A 2YDQA 1OQFA 4Q4W2 1T2XA 2E9QA 4E2QA 1JCYA 1YNPA 1JDDA 4BS0A 2DVDA 4HJWA 4PEEA 5EFDA 4O1FA 2WMGA 3GFXA 5CSRA 5HJLA 4FP3A 1RZMA 3OBRA 5A7QA 1RUD1 3G0SA 4XAZA 3VL9A 4D6JA 3ZYFA 3E49A 2WV8A 5A8GA 1NOUA 2VENA 2YSWA 5DQPA 4IP7A 3RDKA 1BEV2 2VZRA 1X9TA 1LROA 3QCWA 4CP9B 3B0XA 2BQPA 4AGVA 4IUGA 3WDPP 1G01A 4P7NA 2CWNA 5GJ6A 4QXBA 5J7MA 2QCFA 2PA6A 4X2RA 1TJ2A 1TIWA 3QR1A 1IQDC 3S1VA 2QGHA 2DUOA 3E0LA 3WBXA 2TYSA 3RYRA 3PZUA 3TA6A 4URTA 4PTNA 1VAHA 1VBUA 1I5ZA 3GBEA 1BK0A 4LUJA 1CJDA 2RDUA 1JI6A 2QE3A 4NWWA 1NOWA 3NZPA 1J1TA 2ZPXA 4DXVA 2RVAA 1XINA 1G9FA 4AEEA 2DVUA 4OE7A 3URNA 3AIWA 4JKMA 1AR82 2FPVA 1ENQA 3GG0A 3CB3A 1EGVA 4DPQA 5T50A 4ZHNA 3O2LA 4EPKA 1CYGA 1CAVA 3F5JA 4MNKA 4C5ZA 4GUFA 4HZMA 4LYKA 2KM2A 4HSJA 2EPMX 3PPCA 3L23A 4B5UA 3WDYA 1AW2A 8RUCA 4EN0A 4AEMA 1QJFA 1K70A 2J9XA 4YCPA 3KRSA 1PGW1 3SY8A 5JWPA 1KJRA 2LM3A 2ORZA 3STPA 3VKFC 5AC93 3LB0A 3TZFA 3AVSA 2Z79A 5ERLA 4BQ5A 4AD2A 3B06A 1LOBA 1QJU1 4LXLA 2BP6A 1DLLA 4JL2A 5EGRA 1O5KA 1QOSA 1SBEA 4I0WB 5IWFA 1H7OA 4XZHA 4X2PA 3URAA 1EP3A 4FTEA 2VFDA 1FMD3 4KRZA 4OI1A 2V5DA 3VBRA 1A49A 2WN3A 3NV1A 4XFCA 3GM8A 3RO8A 4MWAE 5FTTC 3HF3A 2Y38A 1QXJA 5CPMA 1N1TA 3MW3A 2OFJA 1AH3A 3UA3A 3DG7A 5C3OA 4ZQOA 3VHNA 1BYBA 5EIYB 3NZQA 1HXS1 3FAWA 2ZGNA 4MLRA 2G4IA 1AQHA 4GMP3 4LJ3A 1Q5MA 3KE0A 4P7RA 1E0VA 1OFEA 1H9PA 2GK1A 5KZ6A 5KC6A 2O0TA 1W2VA 1WE5A 4YG0A 3RYSA 3ARUA 3QGKC 4CD4A 4BB3A 4QLKA 1QDOA 4QQLA 1L6YA 1OZMA 2W3JA 1VPXA 3H2EA 3RQ0A 1VFUA 4HA3A 4UZSA 5GZGA 1JODA 1GEHA 1Q6FA 4JTJA 1CGTA 4TTUA 4GX8A 1YEYA 1VIZA 3QQWA 1OSEA 5AYBA 2QCCA 3U75A 3UW6A 1FWSA 3ZPOA 4AGGA 3IJQA 3OD0A 5FZIA 1J0JA 1W31A 4Q8MA 1NM9A 3NOEA 1TME3 1S0JA 2QZ2A 2YG0A 1I2QA 2ALRA 2VR2A 3GXMA 1P4CA 4IQDA 1C28A 3A4XA 3U5UA 5F7UA 4AW7A 1XYFA 3G8EA 1G86A 4D6CA 3PTDA 3FGCB 5I0TA 3J26N 2J8FA 2VGGA 2W9MA 1OURA 4Q4Y3 1Y7BA 4U10A 4DJDC 1OFSA 1SJDA 2CZEA 4LE3A 4FOYA 1ZENA 3OEBA 2PBGA 2XBO3 1Y43B 1SR9A 4O54A 5FZOB 4GJJA 3NJXA 1UD2A 4X9YA 1TIMA 4QJ1A 5CPQA 5TQLA 2DW7A 3MP5A 1UC5A 2B42B 2WWJA 4UIOA 5IFPA 1Q6CA 2D40A 1ZJBA 5FJTA 5H1WA 4NZ4A 2BSLA 1RINA 2VNGA 3FJNA 2R062 3GDBA 3W82A 1VD6A 4NJHA 1UY3A 5GM0A 2VGFA 1KQRA 4YTRA 2OPWA 3BALA 5LKYA 1RK6A 4Y5SA 1HX0A 3VYLA 4ACYA 3MMWA 2C6SA 3AHVA 2VMFA 3DPRA 4FO9A 4UW6A 2FQIA 1KB3A 2Q3RA 4QX0A 1G7YA 2YX0A 1B3OA 2RR13 3OGSA 1KGXA 2R1BA 5J1XA 1MSSA 4C1KA 3U5YA 2WMJA 1FOBA 4KWUA 1WXJA 1ULOA 1R3SA 2GUUA 4BK4A 1YNQA 4JTSA 4LBUA 3TYEA 4L4LA 3LCXA 1AX2A 3B9AA 3I2JA 4ZQNA 3RI8A 2GSHA 1QJY2 3BTAA 1UYYA 1B35C 1OGGA 1AR73 1E6ZA 3QV9A 1BGAA 3OEAA 3THTA 3PZMA 5A7NA 2GN7A 1HL9A 5A32B 3KOWA 3R0DA 2NMOA 3MDWA 1KTCA 1RD5A 1PIV1 3CL1A 4CDXC 4FXSA 1RQEA 3JR2A 1MS8A 1ISXA 1CZTA 5FYMA 4Q4X3 3OBTA 4UQ9A 4QQUA 5CGMA 1UD3A 2XJRA 2VBDA 3GS6A 4O1EA 4C6DA 3H7YA 3KS6A 1CLVA 4KEVA 4DBWA 1S2WA 4KEZA 3P14A 3KS5A 4FI4A 5C3QA 2ZWZA 2X40A 4XIAA 1QDSA 4PLMA 2ACQA 1OCJA 4CKQA 1ECQA 3UZYA 3DYPA 3KV5A 1EC7A 1H2JA 4DS0A 5KHJA 4Q6XA 4N7QA 1EAH3 5DO8A 4QDMA 2PHFA 1OIFA 1OKOA 2GJXB 4O9GA 1C92A 3PBYA 1DE5A 4PC8A 2RDSA 1QT1A 3MVIA 1WBLA 3OYZA 5E9AA 3CZJA 3OODA 2AOSA 4Q8VA 4K7VA 4QS6A 2VNOA 2IFRA 4QLJA 1Q2SA 3KQRA 2OX1A 4XETA 3UV9A 1B3YA 4C5YA 3N9LA 3M5YA 3QMSA 5XIMA 3HPFA 3L5MA 4U3CA 5T52A 2TRSA 5CJ5A 4BHPA 5IRPA 1QOQA 5CZJA 2VNVA 1GCYA 2V9DA 4IV3A 4A7ZA 5DAVA 1BVZA 4D7SA 2DSUA 3CUFA 1DYSA 1NDZA 3U2EA 2IC1A 2ALDA 4HNTA 1X6LA 3WNLA 6XIAA 4DJEC 3SUUA 4K20A 2VZUA 2IWGB 1CAWB 2VMIA 2YC2A 4P08A 4GQBA 1HVQA 1D4M1 1UZWA 4XB3A 4COYA 3WW1A 2NQYA 4AQ2A 5CZ0A 5CYYA 5CEWA 1MFUA 1SFPA 2R8WA 4G7FA 3O1OA 2C1HA 3OY8A 1KFXL 1KXQA 5E0FA 3OUJA 3GZ3A 3SDOA 1MEC3 3LF7A 1BJQA 4HT1T 1DV7A 4GB32 3AP7A 3KL3A 3REQA 3PPHA 3I2OA 4B5WA 6REQA 4GABA 5LK5A 6CGTA 3ZJ6A 3OTRA 5CPOA 2Z2BA 3B01A 4LAUA 4M00A 2BUKA 1G94A 3SQSA 1TUFA 2HBTA 2KR2A 2BERA 5HULA 4PODA 1YYAA 2NV2A 4GMP1 4PMYA 3NSNA 5GQBA 4L92A 4GQ0A 3TUUA 2D2GA 3IIXA 5EP9A 1MZFA 1FCUA 1IEQA 1UU5A 1E1CB 2K2SA 2D6OX 4FX8A 4AIBA 4Y9PA 4JIIX 1ITUA 2WO3A 3W0KA 2JGQA 1QOXA 3AFBA 4FA3A 2ZE0A 1J3RA 3WNNA 1OFBA 5HI0A 1E6SM 4I3PA 4H8HA 4IX0A 3J4UH 4ZO9A 2QDRA 1JPHA 3M0XA 2RGMA 3THCA 1EEPA 3W7RA 3QTGA 2VOKA 2E9BA 5TNVA 1CAVB 3GC4A 4ISQA 3VHOA 2P76A 5GPRA 1VLNA 3FDGA 4M81A 5CGQA 2ZEWA 3AMMA 4ICCX 3W1NA 1UQYA 3LPPA 2QPXA 3ANUA 4A3YA 1VFOA 2Q1FA 2EPHA 4LYRA 5FOBB 2OGJA 4NHLA 2DT2A 3O1RA 4AVSA 2D73A 2QCNA 1DQ1A 4BA0A 4ONUA 4GD0A 3WF4A 3URQA 1SACA 4KKXA 4MDOA 4Q0SA 3QHMA 2HWD2 2DDXA 3GWQA 4ZTXA 3OG3A 4PLNA 1RBOB 1XLBA 4FLQA 3TC6A 1WLCA 3KZ4C 4B3LA 5K0UC 3BSHA 4GZJA 4LRTA 2UY8A 1X6UA 3BODA 4OUEA 4ZXOA 1US2A 2PDCA 3B94A 4G8TA 1RK5A 2CWSA 1VCVA 4N9BA 4GALA 2WZR1 1XLIA 3LYEA 1NXD1 4AEOA 3LEMA 3LK6A 5FEWA 3VNJA 2CGNA 3GJAA 1XCXA 3RAOA 1TRDA 5D04C 3LHTA 4AIOA 4Q8QA 3KM8A 3WQCA 5IOBA 2RS51 1RUH2 3R4DB 2F6UA 1QHOA 1TELA 5L9BA 1VE0A 2YA0A 2C19A 1KFCA 3WG6A 3ZFFA 5LNVA 2E5DA 2E7QA 2EJAA 1TWWA 5HJYA 4LO6B 1Q8OA 1SPPA 4WGXA 3H53A 3MO4A 3LSBA 3ELNA 4XPVA 4COUA 1UKRA 1MUWA 1E5RA 2ZIDA 4OGZA 2FVKA 3BOFA 2VAUA 3CPRA 4NYUA 4LCQA 2QKFA 5C9ZA 5FCZA 3J7MA 5T5PA 5BNPB 4M7TA 5IYYA 1UWRA 2NX1A 3BMVA 4FX7A 2IMRA 2H9AA 2NUXA 5C3SA 3LXCA 1ONAA 3W5MA 3G1AA 3PUDA 3JCIA 5I24A 3ON7A 1UPIA 2Z2SB 1XX1A 4ZEPA 4XFBA 1OIMA 4K3ZA 5CFCB 2AL2B 2D0HA 4N53C 3CASA 1UMLA 3E0VA 4QG9A 3WELA 2QUUA 1RUJ3 3WQVA 3MHFA 3THDA 5A6AA 5BXPA 2Y7EA 5JPMB 5CISA 2YOCA 1KFJA 1VBC3 1WCKA 3N9PA 3LKJA 2WM1A 2PP3A 1J11A 5F2SA 2YBPA 1GORA 4IETA 1TVLA 3MA8A 4Q6JA 2QQUA 3SMHA 3RZLA 2ZX9A 4KBZA 1GQHA 1ND2B 5GLUA 3W23A 2A3YA 3MSGA 4DO5A 4E2SA 1S5MA 1VZWA 4B4PA 4GYPC 2AUYA 2I56A 5F1RA 2E63A 2Q0AA 2SFPA 2W39A 3VBHC 4Y9MA 2YXSA 2CL2A 4NRPA 3UYIA 1QK0A 3LHUA 1MO0A 1UIJA 3TWBA 1F74A 3UJOA 1QRQA 1ZYBA 4Y6GA 1W3XA 2W79A 2QV4A 4K36A 3BYWA 3V0UA 1CGPA 5FQ0A 4XAFA 1UH3A 5D2VA 3SCTA 4CDUA 1MW3A 3DHUA 5BROA 1F6YA 3AK0A 4GVHA 3OYXA 1ISYA 2WN2A 5DBUA 2R16A 1MVQA 3S83A 1OBAA 1GZCA 4Q8TA 2Q8CA 4RGGA 3TX9A 4R9OA 3B93A 3PANA 5CKSA 4XFIA 4IGHA 1ZCOA 1E51A 3N14A 5IAVA 4IMGA 2YA1A 1E55A 4JQ4A 5JLVA 1W3JA 3OZYA 5I3IA 3EEGA 3NJZA 3V75A 3KHBA 4PL1A 3BTYA 2XHKA 3B05A 2XIIA 4NPMA 4BKNA 3CQHA 2ZEXA 1DBTA 4YM3A 5JZGC 1E0WA 1UZ1A 2VUYA 3RYKA 3FDKA 3WH7A 2XPKA 3UR8A 5L73A 1FHUA 3S47A 2PC8A 1KFLA 1EDQA 2PE4A 2PP1A 1N2VA 4WUIA 1J2WA 2CYGA 3B40A 1YBQA 1VRH2 1DXFA 4OYUA 1G9BA 2GMEA 2ZGQA 2BASA 3FL7A 2VOMA 1NEYA 4KI5M 1FCQA 1DF0A 3AIQA 4DF2A 2VEFA 4YS1A 1W0OA 3ABXA 3WP3A 1PAMA 3RRXA 2GSEA 1ND2A 1D3GA 2VMHA 1K1DA 1A5UA 1WDDA 2J79A 3RNDA 3HN3A 5IT6A 3WY6A 5BNNA 1EPVA 2P6HA 5JXHA 4FLSA 4TV6A 1HV0A 1ZRDA 4IIGA 3A5FA 3OOXA 4CVWA 4AWUA 4W4QA 3ABRA 4BXSV 1OCQA 1LHUA 4K6BA 4HKWA 4N9DA 4QKFA 1I1EA 4L9ZA 1HKJA 3ARVA 4A7YA 5ACA2 3Q8CA 3NQBA 4XZUG 4IV3B 3V0SA 4HZ8A 1FH8A 3AIRA 3VPLA 2WT2A 3DFYA 1T6BX 4FALA 5IK5A 1X8FA 5FV3A 3L66A 4GUIA 3WMBA 2B9VA 3L5AA 4LVAA 4XKYB 3NV2A 2VC5A 2PDGA 1RMU1 4MG4A 1YEWA 1G8WA 4K8FA 5A2AA 3VMPA 4KGLA 1TPDA 5HANA 3SUSA 4DF1A 2WQDA 3PY2A 1X36A 4HNCA 2VDGA 1VBC1 4B29A 1GVIA 3H3ZA 1N82A 2HEWF 2Z69A 1M5WA 1XIJA 4PSPA 4HP5A 2OLAA 4H9XA 1ZBA3 3QD6A 3ZKYA 4AXNA 1RVF3 2RS53 3EO6A 3S5SA 2ZTKA 4IEZA 1W1TA 4CP2A 5G1YA 4HN0A 3AYEA 1HG3A 2BVBA 2PDYA 4HLTA 2YIHA 5FL0A 4HTBA 4WDXA 3UWWA 3GFZA 1K8YA 2E8YA 3WFLA 4WIWA 3BJSA 5AB3A 5GLVA 1X98A 2AQVA 3AXHA 4MJ4A 3M3OA 2Z00A 4RZBA 3ZWSA 2OW4A 4LBQB 3U2CA 4NPLA 1XLAA 4S3KA 4LBKA 4RHV3 3ORWA 3K4ZA 4PTXA 1V77A 1IF2A 1LOEA 3DHFA 5ECVA 2A6YA 5BPXA 5JXGA 3B69A 4OQ8A 1RXOB 6TIMA 2YB1A 1DIEA 1PVC3 1BG9A 4U4MA 4QAIA 5DDJ3 3VBSC 3O15A 2JDKA 2Y4SA 1PK6A 1VMJA 1W03A 2VTXA 3IPVB 4F83A 1ICSA 4Q3MA 4IJBA 3NJ3A 3M64A 3WW4A 4GJ1A 4KBXA 2BNOA 3NAPB 3WUDA 4HU3A 4E4HA 3LTYA 4JV4A 3CUHA 1L8NA 3P82A 5L7OC 2DZUA 3OPWA 3I59A 3K2GA 4AYSA 1QPQA 5CJMA 3SFWA 1KRMA 1V7AA 3R43A 4QB1A 4G7EB 4WJEA 1H6XA 2JIEA 1AL0G 1W99A 1XP3A 2D3SA 4UBPC 3B4YA 3WLKX 1Z8AA 1GSLA 1UZ4A 4BEUA 2XQRA 1VCGA 3AZXA 4FFGA 1CGYA 2BGOA 1AYN2 1O66A 2K9ZA 2CYFA 1EO7A 2VURA 2YXXA 1RUI3 3JBG1 4ENLA 2OJPA 4OT7A 3B0YA 3W26A 3THUA 4FPHA 3AJXA 3O7UA 1C7SA 4H2AA 3M5ZA 3MT1A 4YVXA 5IHSA 1LBMA 4D6IA 2W91A 1XUZA 5BU9A 5KINA 5JOWA 1ACCA 3W21A 3DFQA 1RUC1 2D5HA 3UY7A 4LEJA 1E4NA 2OZTA 5A3TA 1N1YA 3N11A 3ITQA 3W71A 2WKJA 4ZSTA 2HWC3 1V3MA 4O57A 3SBFA 2V69A 3HV9A 1PVC1 4CCJA 4XBKA 1XSRA 2XPJA 4UW4A 1WKDA 2XH0A 5FPBA 4IGQA 3DV8A 4Q4V2 2Y6FA 4H8NA 3WLQA 5GLWA 2VQUA 3AXMA 4F4RA 1VPYA 4GH4C 5BWAA <