4CCCA

Structure of mouse galactocerebrosidase with 4nbdg: enzyme-substrate complex
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
644
structure length
640
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GALACTOCEREBROSIDASE
publication title Structural Snapshots Illustrate the Catalytic Cycle of Beta-Galactocerebrosidase, the Defective Enzyme in Krabbe Disease
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 218
structure length 640
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4cccA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4cccA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4cccA01
3ARPA 5D30A 4CN1A 1SZEA 2CLFA 1OFEA 2ISWA 4MY1A 3NDYA 1L6YA 4A22A 2J6XA 2OSYA 5CPTA 4AZ6A 1AG1O 1S5TA 2WMGA 3CZEA 3UNDA 4H8UA 3ZQ9A 1F6PA 1R30A 4PFMA 1B2YA 3VIPA 1B9BA 2CESA 4UTTA 4CU6A 5ABEA 4MDOA 3QOMA 1HJWA 4UOZA 2QPSA 2WANA 1SR9A 2EXOA 5A6MA 1C92A 3W88A 2A1YA 2GJXA 3JRKA 5D8WA 5AC4A 1BVZA 4D1IA 1VZWA 1W3TA 3VMNA 3TW6A 3AIBA 4PMNA 3WNOA 4WOZA 3WF0A 1CXKA 1BQCA 3TP4A 2A3HA 2OT0A 3U5UA 1CTNA 2Y63A 2H8XA 4YXGA 5D2YA 1OT2A 1IF2A 1IXQA 1W5QA 1WB0A 1KFEA 2YJQA 1F7BA 3L4XA 3W38A 3I7QA 1H0IA 3CGTA 4GUFA 1JVNA 1F5ZA 3ZS4A 1A5BA 1I2NA 2A6LA 3THAA 1XYFA 4Q32A 5F1VA 4Z08A 4HOXA 4QHZA 3KAOA 2WLYA 4MLJA 4HA4A 3EWUA 1MYRA 3QC3A 3S2CA 3U7VA 3E0IA 3CWNA 4WSJA 3VIOA 4CU8A 2H6RA 4AD0A 1UR2A 1Q3NA 1BLIA 2WJZA 3RK8A 3QR3A 2HS6A 4CN6A 3M43A 4LNYA 4LXFA 2F8QA 3L9CA 1GTEA 4U2YA 2QCGA 2VENA 3LRLA 3WK1A 4PC8A 4TUFA 3RIKA 4AAJA 1WDSA 2ZUVA 1C8XA 2VTFA 2H3BA 2VOMA 2CBJA 3W1MA 4L4OA 2W92A 1E51A 3O2LA 3ZR6A 1DJNA 3TAOA 1BYCA 2BFGA 2W62A 4OBTA 2GJPA 3N19B 3NJ3A 1C9DA 1JD7A 2BWGA 5G4EA 4QAWA 2J7DA 1QR7A 4HU0A 3U75A 1WE5A 5BXPA 4W8BA 1N8FA 2V9DA 2C3ZA 4GIAA 4O14A 1ZNNA 4X22A 4AD5A 2VRJA 5HDRA 4NJHA 4IXXA 3GXIA 3AZSA 4C1LA 1TZ7A 3QFEA 3IGXA 2GSJA 3NMBA 4CU7A 3N18A 2TRSA 4BWLA 3OZPA 2VRKA 1B30A 1EB3A 5G5IA 2G3MA 1AK5A 2ZXQA 4C7GA 1UD8A 1ADOA 3CWOX 4FXRA 3G1AA 1HO4A 1FFQA 1HJQA 1MEIA 4PUDA 3CPUA 2BHYA 1V3JA 3UETA 5C2XA 2UV8G 1JCNA 3PF3A 3ATZA 4M7TA 1W3JA 2DZSA 3ABOA 5D8ZA 1A53A 4MJ2A 4EVZA 4Y90A 2EO7A 2NXHA 4TVUA 4QJ1A 4E2DA 3WK3A 1LG1A 3A4WA 1P0NA 1UUMA 2WKGA 2C13A 3LEMA 1TTPA 3L4ZA 3CUHA 3OA5A 4UTMA 2HS8A 3EDJA 3INPA 3DHDA 5KZMA 2V3EA 4NJGA 4YL2A 1DQWA 2QJIA 1DJQA 5TBOA 2PWFA 3MSGA 3WL0A 2RKXA 3LV5A 2QEZA 4UNKA 3C2EA 2WXDM 1NEYA 5HQEA 3W74A 2Y89A 4U28A 1Y7VA 3PG8A 5KZDA 1QI2A 2A7RA 4K7YA 4RE4A 5TQLA 3L21A 4I7WA 2E9LA 4QLJA 4DWSB 5BXTA 3CZJA 2WNQA 3ZOAA 3A5FA 4N02A 2XPKA 1GVIA 5FF3A 3A21A 1CZ1A 2YL9A 4WKFA 3W72A 3VX1A 3WDIA 2I14A 1WXJA 4JDYA 1Z42A 4JTTA 1I1XA 2YDSA 3ARTA 3VKKA 4P7RA 4ZE4A 5G2HA 4UTJA 1CW2A 1KV8A 2FIQA 3IAPA 3BCFA 3LDVA 5A5WA 1LM1A 4JY8A 3PZUA 2ZX7A 5ABFA 3FW6A 1LBMA 3WNKA 3GNOA 3P74A 3RJXA 1QHZA 4UR9A 3LBCA 1VHNA 1KCKA 3VGDA 2Z6JA 4J28A 1ISYA 4POCA 2YL5A 4ZE5A 3FA5A 1ZAIA 4GE8A 1FCUA 1VEOA 3P82A 5JBFA 4KKXA 2V5CA 4WQ6A 2Y24A 2X8RA 3W2MA 3M0ZA 2Y7DA 1Z48A 4M80A 4W7UA 4XV0A 4N9BA 1W1ZA 5EFFA 1SW0A 3TC6A 5K4XA 1JCYA 4FIQA 4M56A 5HR6A 3CM4A 3SW6A 4UC5A 3VNZA 1H7NA 1HX0A 5HWNA 1OHLA 3C6CA 4M82A 3MUZ1 4EKJA 2GK1A 3L68A 4CUCA 1UUQA 3WMCA 2C1HA 4DO4A 2Z2UA 1KFLA 5KMYA 3GKAA 3BLEA 2VKZG 1LROA 1YHTA 1TMQA 3T55A 3BPWA 2ADEA 5FEXA 4H04A 3A5VA 2DSVA 1SUXA 4EWND 3NA8A 2V5LA 1PPIA 1ZJAA 3TH6A 1TREA 2BS9A 2CKSA 5CPOA 7A3HA 4OE7A 2P1FA 1UR9A 4R53A 1KA9F 3WDRA 3TXVA 4JFWA 3VE7A 4V2XA 5AHNA 1PL9A 4LRTA 1YQ2A 2NT1A 4W9TA 3VGFA 2BTMA 1BTMA 3PIJA 3B04A 1B3WA 2DZTA 1H41A 3RF9A 1PAMA 3W9ZA 2VR4A 5A8MA 1RPKA 4AB4A 3EMZA 5JBDA 1KW1A 1A5CA 1V7YA 1F73A 2VCCA 1EIXA 1BYBA 4ONVA 3U7BA 4B16A 3QGVA 5BCAA 1G69A 5D38A 3FYPA 5A6BD 2D23A 3CIVA 4AMCA 3UG4A 2F61A 4KRTA 2E3ZA 1B3VA 3MBDA 3UWVA 1TR1A 1KXQA 3UGGA 2CLIA 2Q8XA 3WD1A 2JKAA 1KWKA 4FK9A 3LM7A 1UD2A 1LYXA 5E93A 3IGSA 1EX5A 4O4WA 1TQXA 2R8WA 5AHEA 1Q6CA 2A3EA 2CCRA 4M8UA 1YYAA 3DI1A 3GDBA 1X8FA 4QDMA 4AZZA 4H41A 3EXRA 1C3FA 1PV8A 2VZSA 3BV4A 1GYNA 3IVTA 3VD4A 4O11A 3A6OA 1W2PA 4MAVA 3L0GA 1XCWA 1TPFA 2RGMA 2YDQA 4CD4A 4UUIA 3OLEA 3ZJ7A 3SIMA 4O0KA 3CHEA 3DYMA 2OCZA 2XN1A 1GG0A 3NZRA 5HXMA 4UTTC 2GJRA 1IGSA 1KTNA 2ZA1A 2OXBA 1W3IA 1UWQA 1ME7A 1W91A 3L4YA 4JL2A 1XKYA 1TSIA 4A29A 3SCSA 3ARUA 3NYDA 3WNMA 3WF3A 1OX4B 4HKPA 4UR7A 2CXGA 1GHSA 1UH4A 4CLMA 1E4LA 2Z1BA 2FJKA 4NU7A 4TOQA 3G24A 2E77A 3HGOA 1OT1A 4NZCA 5HOSA 1EEPA 1WA3A 4GUJA 1UKQA 5F4XA 1KB3A 5E09A 3HBKA 2A7PA 3WKZA 1SFJA 5A8NA 4A21A 2EEXA 1JZ3A 4JNMA 3GKFA 2EPMX 3NQCA 4BF9A 3LHWA 1ZJBA 1J4EA 1G7VA 1N82A 1V3LA 2EPOA 4YHEA 5D9OA 3SUSA 2BZNA 4AXNA 3UWUA 3WDPP 4JYFA 5D2XA 1DWJM 4X0NA 1BWLA 1V0LA 3GAKA 4Y9AA 3W1AA 3PVFA 4K8HA 4ZL1A 2C7FA 5CPLA 2DT1A 3RM4A 1RQEA 5KZEA 1CYGA 3SUTA 4BS0A 2PWDA 5EMYA 1BAGA 4B1MA 3EX1A 1E1EA 2RHGA 4PMDA 4PTMA 3W7CA 3W7KA 2VOTA 5LHFA 4MB5A 3LOTA 3MANA 1QDSA 3MMTA 3G6MA 3VGBA 3GK0A 3NO5A 4Z2GA 4GUGA 3CUGA 3WNNA 3LMYA 1WDQA 1AW2A 1LRNA 2A4AA 2QUVA 2ZUUA 1EH9A 3W2UA 3LCHA 1CWYA 1UKOA 1KQZA 4QAIA 1TTIA 4DUWA 2X0YA 4AZ7A 2PI6A 3GBDA 3ARZA 3W26A 1W1YA 1DP0A 4UTUA 3W27A 1ECEA 3PBVA 3G0XA 4D2JA 4H4IA 1O6IA 2IQTA 3EBVA 1Y0EA 4RZ6A 4YLWA 3QW3A 3R8RA 2WMKA 5LGZA 2A3BA 1JQXA 1NOFA 2C18A 1M7PA 1XH2A 5D2VA 4WY0B 4BWLC 3D3AA 2DH2A 2RGLA 3UZJA 4RXFA 1H7OA 3S42A 5D32A 3V75A 4QLLA 3WNPA 5FEWA 2Z1KA 2ZRWA 3PUDA 4FNQA 1OSEA 2ZRUA 3SCWA 3M5XA 3N14A 4AZCA 1H7RA 4KWUA 2E5CA 4AEEA 3UWWA 4LYQA 3IIVA 1KCLA 2ZUWA 1PVNA 4H6KA 1CBGA 3ZSSA 1RVGA 1LDCA 1MQQA 2QHAA 4XTDA 1QPKA 1UWTA 3VMOA 1CGWA 1R7OA 2ABBA 3AIRA 2QJHA 4D6EA 1HKMA 4DM1A 5C71A 2ZZ7A 2B4GA 5BRQA 3WFZA 3W84A 2Y70A 1E0XA 1HKIA 5EFDA 2FLIA 5DY2A 3P7YA 4GO8A 4JTKA 4FHAA 4HOWA 5BROA 1R7AA 2VEMA 3N9SA 1QMLA 4F9JA 2J88A 1QFEA 3CIXA 3B03A 3CH9A 4S2BA 2AAAA 4PMZA 3WDQA 1VPXA 1TPDA 5D37A 1YDOA 4YHGA 4NQ1A 1KBBA 3L2IA 1ISZA 3AS3A 2EPNA 3AZTA 3WF2A 1PS9A 4JTIA 4H8VA 4EE9A 5KEZA 1U33A 4FMVA 4JZ5A 1SSDA 3W7OA 1SSGA 3CHDA 1XCFA 3GXTA 1JF6A 1K9FA 3OSDA 5CSUA 1LTDA 4LS2A 4XBSA 2V2HA 4HPXA 1BYAA 1FUYA 4M29A 4AIOA 3O1NA 4A2RA 1JRCA 1YTDA 3MYPA 3SURA 1H11A 1XSJA 3RNDA 3QPZA 3SUWA 5IBXA 3UXAA 5C54A 2J78A 3KFTA 3UZ5A 2V5BA 3NQVA 4XKYA 4P8WA 4WUIA 1OK4A 1ISXA 1KR1A 3MI2A 3F4VA 4NX5A 1OINA 3NCOA 1WCGA 1HF6A 3MUY1 3T78A 3L4WA 4KH2A 2E68A 1Q6RA 3LPPA 1JYVA 4N9DA 1V02E 1B1YA 5GNZA 5GQBA 4OV4A 3STCA 4MKNA 3G1HA 1V08A 2FPVA 1EP3A 1H50A 1QNOA 4LYPA 4WSKA 1J18A 4HN4A 2X1TA 3M41A 1TRIA 1J01A 3C2FA 4UQDA 3QF0A 5H2ZA 1EWEA 3EEGA 3UYCA 3WH5A 4BCEA 3D0CA 1SFLA 1FP9A 1BVNP 1TPH1 2PE4A 1KM5A 1L6SA 3D5HA 3CHVA 3W82A 3KX6A 3DC0A 5A6LA 1VLIA 1DVJA 2YXGA 1GZGA 2UY3A 2WHKA 4LWWA 1V0MA 5IM51 3CEPA 3BG3A 3C2OA 1HL9A 1VEMA 2W91A 4JKKA 2NWSA 2OWWA 1WDRA 1VBRA 4Z1AA 2UY4A 1OD0A 3NM3A 4H2CA 4JL1A 1IXPA 3NL3A 4UMBA 4I7UA 3WJXA 2V3FA 1EP1A 3AQUA 3USBA 2EAWA 1UJPA 1SO3A 3WUBA 1K03A 4MZ1A 1QCWA 4JYDA 4O1BA 2ISSA 2O7SA 1XUUA 4TTGA 2CIPA 4HXCA 4UCFA 4PMVA 3OG3A 3RO8A 1NQ6A 1O4UA 5AFDA 3GXFA 1VIWA 3BLIA 1ODZA 1QW8A 1PIIA 3FY1A 2EGZA 1TPVA 4ZQOA 3VINA 4BI6A 4E2BA 3BG5A 4E38A 1DTUA 3VIMA 4CQAA 3BH4A 4YPJA 4UTFA 5KZ6A 2OYKA 4HOZA 3IRDA 2HISA 3I3EA 1TE1A 3MMDA 3HPZA 5CZ0A 1JR1A 4P61A 3QHMA 2J7GA 4HIBA 4CNNA 1E15A 4HNNA 2YDAA 2V30A 2ZZ2A 1OFDA 2GQ9A 5FKCA 4E0CA 1L2UA 3G1SA 5DY3A 4UTWA 3TK7A 3KEHA 1B3XA 1BG4A 1WP6A 4DEFA 3KVMA 2Y5EA 3O63A 3TJLA 4GQRA 1G5AA 2YLAA 1VGAA 1KFKA 3LTSA 2IUZA 2OSXA 2ZUSA 4WY0F 3FNDA 1QAPA 2XFWA 3S5NA 2AMGA 3N15A 5CPMA 2GJNA 2WNZA 3PZTA 4LYRA 4M6VA 1PIFA 1FBAA 2QF7A 1HJXA 1TQJA 4GXMA 4WZHA 3L4TA 3UG5A 4MUZA 2WW5A 3AIQA 3EYPA 1GWJA 4J27A 1LL7A 5DLCA 4L4LA 1Y9MA 1GW1A 2VRQA 2YBUA 2A3CA 1WDWA 4IPNB 3M5ZA 1TPUA 3BARA 2JIEA 4Q22A 2QCMA 4OQVA 2E8ZA 1NAL1 3Q2DA 1FDJA 2X1RA 1R85A 3MUXA 5I3GA 4PH6A 2OT1A 1E0VA 2VXNA 1CIUA 3O6DA 1HKJA 4CCCA 4NUWA 1UR1A 1UWUA 5CPSA 1F6KA 2EF9A 1W8SA 1GEQA 2ZDRA 3NL6A 4KMQA 1FH9A 3DFOA 3W2JA 1H1YA 3FLUA 3PBUA 3FJLA 2BY1A 3UR7A 1VAHA 1TPEA 5BW6A 2GPTA 3SFKA 3W75A 5FEPA 4KGJA 3PAJA 3WMBA 2FGZA 4K7VA 2V38A 1H5YA 4FFHA 1EA0A 3HG2A 4OHQA 2EKCA 2JGYA 1UZ1A 2Y8VA 2A85A 3DFNA 1K7XA 4HMEA 4TO8A 5G4WA 1W3NA 4OWGA 1F4AA 4O15A 1M6JA 1I2RA 5E0FA 5I6SA 1XD1A 3QPYA 3PS7A 4I9AA 1MQPA 2VFHA 3KWXA 4M1RA 2E8YA 5G1TA 1JXJA 1LOLA 2VO5A 6ALDA 1V0NA 3MHGA 5HBFA 3GNNA 3SIZA 3S6DA 4AWTA 1UYQA 4NNCA 2GVGA 3PHAA 1PE1A 7TIMA 2J7HA 2A2IA 3P61A 1QPNA 1QVBA 5DN1A 4JN6A 2FDMA 3S5QA 4NVTA 1I75A 4O0ZA 3TA6A 1RPXA 5CSSA 4KWWA 4HT3A 3VIIA 4IX2A 3W1LA 3DECA 4UFJA 4PL2A 5HULA 5DT5A 4M24A 3W1NA 6TIMA 3NQ6A 5AYIA 1W1PA 1TVNA 3IANA 1WOBA 2H3DA 5F2LA 2WVTA 1K7FA 3QH2A 1K02A 1AQMA 1KFWA 2FB2A 3NPWA 2QCFA 3QMRA 1KM1A 1NP0A 2VC9A 2VCBA 1DBTA 1SZNA 3O15A 1HUVA 2WMIA 4NXSA 1EXPA 2G96A 3PC0A 5D03A 1MXDA 3EWZA 4NNAA 2Y6ZA 4DPQA 2C0AA 3LIGA 1T96A 5BRBA 1TG7A 1EIBA 4X9SA 1U5JA 3MI3A 3W1PA 1GPWA 1E6ZA 3W76A 1KXTA 1JUBA 2JBMA 2X0HA 3KHJA 1E5JA 2CHOA 3ARQA 4ZZ9A 1JUEA 5I24A 1ZALA 5F4WA 2VMFA 2C14A 1XC6A 3EWBX 2NUWA 4JY9A 4J3SA 2GDUA 1LF1A 4LGXA 5LA0A 3BGGA 1OIFA 3PIGA 4MB1A 3HG5A 3PTQA 1JXKA 1W5PA 3T0AA 1OFOA 1H3GA 1V03A 1XH1A 3GNDA 1W56A 4TMCA 3II1A 5BYWA 4Y6GA 3VVGA 3RWKX 1K9EA 3WD4A 3VTRA 2Q3RA 5BWFA 1NARA 2TPSA 2VNCA 2QJGA 4DF1A 2ZWYA 4GPNA 3CEUA 1V6XA 5FCZA 3SJ3A 3M07A 2DSWA 4DM2A 3LCXA 4QM1A 4NF7A 4O8RA 4MVAA 3SCTA 3MJYA 3O9NA 3U8GA 5IBXC 2NW0A 2AAMA 1JZ4A 4AEFA 1E4NA 1ZBWA 3LHTA 1GQJA 4GI8A 4O16A 1XYZA 3LERA 1F2JA 2DSUA 2WMHA 4WXYA 4C7DA 4PCTA 4AMAA 2X30A 2I1OA 2WQPA 1UD3A 4WF7A 1KBKA 2Y7GA 2YFNA 1HXJA 3VIKA 2EBNA 2VZVA 1XBXA 3OIXA 2VVSA 2ZBTA 3L5AA 5FI8A 4NX0A 5IXEA 3KZSA 4N9CA 4HTYA 1JRBA 2QDHA 3S5YA 3FIGA 3ZSTA 5FF7A 3ZM8A 4RV8A 5DT7A 4NJIA 1BG9A 4ACYA 1LG2A 1VH7A 4AF0B 5ABHA 3R89A 4JTGA 1WV2A 4FLRA 5CJ5A 4ZMGA 1L6WA 4UMCA 2VZTA 4HNUA 1E0WA 1M53A 3TIMA 3AS0A 4PMYA 3WH9A 4FO4A 3OEXA 1HNYA 3PUEA 4N6EA 1E56A 4PTVA 2QAPA 2X2GA 4OOZA 1JAKA 1ZCOA 3K1DA 4D6JA 3QOKA 1PJ9A 1C91A 1V02A 3BLPX 2PRMA 3RFAA 1QNPA 3MSDA 3KF3A 1IIHA 1HL8A 3ZFHA 2ZE0A 1KXHA 1V3HA 1MEWA 3TTSA 3WENA 1JCLA 4UR8A 5F2GA 5BXSA 1Q6FA 4O28A 3THDA 2ZXAA 5ABTA 3PBWA 4WD0A 5FF0A 2HMCA 3UD6A 1ZAHA 3PZOA 4HMDA 3BO9A 4PCFA 1QBAA 2CNCA 2PB1A 2X1IA 4HPGA 1UWIA 4UXDA 4J3TA 5TD4A 3RDKA 3W29A 1AL8A 1EDGA 2XVGA 1H09A 4JHZA 4ML4A 1MVYA 5EB8A 5DELA 1QPOA 1QBBA 3VIGA 3N73A 4NXKA 1B57A 5E0CA 1B90A 4FNTA 1VLWA 4N4QA 1W9BM 2BY2A 1FWSA 3WH7A 4JKMA 1H61A 1M7OA 2XHYA 1WPCA 4GZIA 1AVAA 1OJXA 4YMZA 3W71A 1KR0A 2V3GA 3PN8A 5E70A 2JKEA 1B4EA 3CUIA 2JE8A 3G3DA 1MXSA 1GVFA 1UBSA 4ATLA 2A21A 4UTWC 4AZIA 2YA1A 2QLYA 2D24A 4MLRA 2ZA3A 2F7FA 3GXDA 2E5BA 3OVPA 5F7UA 1XXXA 1YTEA 1J2WA 3B8SA 4L4PA 3JR2A 3FKRA 1MFUA 3VO0A 3KVLA 1M04A 3W1RA 1W9PA 3O07A 4OT7A 1WYIA 4LUIA 3RMEA 1TIMA 1K8ZA 3W6LA 3NNTA 4NT0A 3M44A 3S1VA 3W7DA 3IVSA 2CBVA 5K9XA 4LVDA 3SY5A 1US2A 3PULA 4UCGA 4PODA 4IISA 5LZLA 1VJIA 1CGUA 1OFBA 4C1KA 1G4SA 1MW1A 4ZEPA 4IUOA 2NV2A 3AROA 3ANYA 8A3HA 2XM1A 1EOKA 1XH0A 4LVGA 5AYXA 1UHVA 2W61A 2PRHA 3DFPA 3EX6A 5I79A 2E5DA 4LOCA 4D6IA 3HG4A 2GVJA 2RFGA 2VVNA 4RE3A 2CBIA 2XN0A 2VX4A 3C2VA 4GZEA 3W07A 4HSNA 1CGXA 3M5YA 2KZHA 3DAQA 2FB3A 4RR4A 1YPFA 1YXCA 3E49A 2AC1A 4MADA 4W5ZA 1MW2A 2QMJA 4PSRA 3GXNA 2WYSA 1I8JA 3T2PA 5IFPA 1TTQA 3Q58A 3TXZA 3G18A 2DJXA 4XKYB 4LW7A 4O19A 3STGA 4A4AA 1DWIM 2UY5A 4OIFA 5MHBA 1UA3A 3WELA 2XVKA 2ESCA 1LOSA 2XGIA 5AHMA 4UQ9A 4E4PA 3IAQA 3LHUA 3EX4A 1WBJA 1E55A 4EF8A 4AC1X 5K9DA 3C8FA 1CLVA 2EJ1A 5FD0A 1VYSX 2PWHA 4O54A 2G3JA 3KXQA 3AXHA 4GUIA 4ZQMA 4IUGA 1QHPA 3TW7A 5FIPA 3AMDA 3W7MA 4TMBA 3FAXA 4UMAA 2GVLA 3HMCA 1DOSA 3P60A 3C4UA 1VCVA 5FEZA 3P81A 3P62A 3W2LA 3TSBA 5FESA 1H4PA 1JNDA 1K6AA 3CZGA 1OGBA 5JBEA 1B31A 2BX7A 3H53A 2J9XA 2NLIA 1MXGA 5D02A 2CKRA 3W1XA 5FMCA 2ADDA 2W66A 5G2WA 1GVYA 5EL1A 3CLMA 3SC7X 4KFPA 2YW3A 1EDTA 1ZBKA 3MS8A 4H7VA 1KFBA 4K8EA 4AEOA 4HP5A 4C7FA 1TA3A 2NXGA 1CENA 4DUXA 2DH3A 1FCQA 3L0NA 1LJYA 3IJ8A 1GQNA 3I65A 4MJMA 2J7FA 1NFBA 5FL0A 3SGUA 2CLKA 2C6QA 3QRHA 4Y7EA 3DH7A 1TPB1 3LCLA 3TMQA 4EIVA 2WVVB 3VD3A 3ZR4A 2EPLX 4J3XA 5E6YA 5M03A 4HNVA 4FXSA 1E5NA 3AMCA 1WQ5A 1VEPA 1W9VA 2XN2A 1TMHA 4GC4A 2JK2A 2ZRZA 4DBEA 1FDZA 3WNLA 7CGTA 3OGRA 5D9NA 3DZ1A 3BAYA 5A69A 2W0UA 3PWAA 1E6SM 3CU2A 3M6YA 4UQAA 1EOMA 5DO8A 2CERA 3NL2A 3GYEA 4JAWA 4PMQA 1DHPA 1OK6A 4PUEA 4IMFA 3STEA 3S8HA 4DWSD 4FNSA 1J0IA 2A0NA 5BMWA 3LB0A 4CQ8A 1Z44A 1OIMA 1FWWA 3QQ1A 2J7BA 1VYPX 2QCDA 5A8PA 1G6CA 1GUVA 2BY3A 4CD5A 5E9AA 3W87A 3UG3A 4UFMA 4O4VA 3O06A 5A8QA 1D3HA 1H1ZA 1DKWA 1UKPA 3C56A 3H3LA 4UFKA 2ZIDA 3WJZA 3NSNA 3MHUA 1CXIA 3MP5A 3MKKA 1D3CA 3ARWA 4NSBA 1FY6A 3NSMA 2DQXA 2D0FA 3RLVA 3LI0A 4PTXA 1J12A 3TAKA 3SECA 1OYAA 5HWMA 1E43A 2D0GA 1Y9GA 1YDVA 2X16A 3AJXA 1Q4NX 1WAWA 4H3DA 1QWGA 2VELA 3NDOA 3O8AA 4X9YA 3A4XA 3M7SA 3G1FA 3AMLA 3WD0A 2YPIA 4B9YA 1IV8A 4Q4KA 4RCXA 1YXDA 3VIFA 1KFCA 4Z1DA 4OV9A 1GHRA 1ZL1A 3A4AA 2A3AA 3MUAA 4ZXOA 2JEQA 2J62A 1PX8A 5DMYA 2G97A 1TO3A 3EKZA 4AHPA 2D1ZA 3NGJA 3NZ1A 3AYSA 3P5YA 3TR2A 1KQYA 3AHTA 3ZR5A 2NXIA 5LGXA 1DWGM 2BV9A 2DEPA 5EY5A 3EX2A 1BTCA 2W63A 5I3FA 1ZU8A 3CC1A 1R8LA 3J7HA 4O1AA 3TCEA 2R91A 1H7WA 3NL5A 1QI0A 1AMKA 3W70A 2E9BA 3ARSA 1MW3A 2CZEA 1T8XA 1FCVA 1PZ3A 4YCPA 3AS1A 4ZENA 2CLEA 3OLGA 1C93A 2PBGA 2DIEA 4HPHA 4UTLA 2VR5A 5LA2A 4HA1A 4XWUA 1OGGA 2B31A 2Y85A 3HOJA 3N3MA 2WCSA 1GVOA 1LBFA 1YXYA 2GOUA 2W6RA 1EGZA 1F74A 1NWRA 1ODUA 4MB3A 4OKDA 4OJYA 3RU6A 1JFHA 3LCWA 2E4TA 1TCMA 1R2SA 2WNWA 3U57A 1GCYA 2PC8A 2XUCA 4M7SA 2WV8A 1CNVA 2FPTA 3A23A 1OYCA 3NUKA 1RD6A 2VFEA 3WDJA 4BI7A 2AEZA 5DXYA 1WO2A 4JTEA 4M5PA 1VFUA 1TRDA 4PMUA 4LTSA 1GORA 1UWSA 4ICNA 3AO0A 2DT0A 3ZO9A 1VR6A 4JIQA 4K39A 1E71M 2CLMA 3IVUA 4QNEA 3LLDA 3G6LA 3MMWA 4Z0JA 1I45A 5CZKA 2XSBA 1O95A 2VURA 2WMFA 1E73M 2JALA 5I77A 4O50A 3W28A 2G95A 2P10A 2XIBA 3PZQA 1UB3A 1UH2A 2I9EA 3WBAA 4NJJA 3CBWA 5EBAA 5IHSA 4E8DA 3MHFA 4QSHA 5AB3A 4J3UA 3MP4A 3GB6A 2QCLA 1B0IA 2CU0A 1GT8A 3GDKA 4WOQA 3S1XA 2YFOA 5EKYA 1YPIA 2GFTA 3BG9A 2WLZA 3QMSA 1DQXA 5EMUA 1E70M 3EDDA 4O12A 1KBJA 4JQTA 4YWIA 3W1UA 4Z2IA 4JTHA 4E8CA 1FX6A 1SW7A 1MWOA 4MZYA 2BXZA 2EHHA 2WOQA 3O05A 3HGRA 4L4MA 1H2JA 1YTKA 2J79A 1D9EA 4OBRA 3LHYA 3K4DA 1U83A 3ZT7A 2WZEA 1LLZA 3R5EA 2A7NA 1ST8A 2ZZ4A 1GOKA 4CCEA 3BVJA 1DHKA 1UA7A 3DENA 3WEMA 4FF7A 3HG3A 3WFLA 5DXXA 2JF7A 4FNPA 3PB2A 4YN5A 2ZX6A 5HUPA 3IIPA 3EXSA 4RZ5A 4RE2A 3LBMA 3OHIA 2X05A 4P2VA 4MYXA 5G1YA 1YLVA 5D05A 3M47A 3MW7A 5C6MA 5C5YA 5C55A 3DHPA 2YIHA 5I78A 4AD1A 1A5AA 4PSPA 1DWHM 4OGZA 1E1FA 4BA0A 4LUJA 1H7PA 5HPOA 3NXFA 1C8YA 5KSWA 4AIUA 4V27A 1Q45A 5BMXA 2V2DA 3SCPA 3IEBA 1JCXA 3PZIA 2LLEA 4I7VA 4KFNA 1K3UA 4CNOA 4MOZA 1HG3A 4Z2LA 2OWCA 3HF3A 2XVPA 2D3LA 1ZJIA 3Q94A 3HJEA 1TPC1 2JKPA 2WVUA 3C61A 2WBKA 1KM0A 2YGYA 5I3JA 1BGGA 3DHUA 1OFRA 3I3BA 3MUIA 4JFVA 3W22A 1H7XA 4Z1BA 3U2OA 1ZHAA 2DP3A 1G1YA 2O9OA 3K8MA 1OF8A 5CSYA 4BQ5A 2PRLA 1ICQA 1GOMA 3WDHA 2G8ZA 3MO7A 5DFAA 1G01A 3TSMA 2WPBA 2XVLA 2PF0A 2O9PA 3VDAA 1O60A 2GJXB 3KVKA 3AOFA 3ECQA 3VDHA 2RDWA 1UZ4A 3PZMA 3HMJG 1JDDA 1LLWA 3CB8A 4KFOA 4A3YA 3CT7A 5EPDA 4QITA 4UTIA 5F2IA 2FHFA 3TU9A 2JF6A 1KGXA 5ANNA 3THCA 4IQLA 3EB2A 1NH6A 2E1DA 2QAFA 4MYAA 3A22A 2ABAA 1PHQA 4WJEA 2WWDA 1VENA 3N17A 3TTYA 2QQVA 3VD7A 4QP0A 1TCDA 4HZ6A 1V5XA 4P7NA 4TU1A 5BOOA 4MJ4A 3NEVA 4U3AA 4FF5A 2J4GA 5A1AA 4AIEA 4H8HA 4DWSA 1FXPA 1GJPA 3W73A 3TMLA 3GBEA 4IPLA 4FIRA 3E12A 5K7JA 2O9TA 4E2OA 1Q6DA 1XGZA 1OFAA 3DU0A 4AW7A 2DDXA 4D1JA 1FQ0A 3UGHA 2B7OA 4W5UA 3EXTA 5LNRA 3BSHA 7TAAA 2ZFAA 3N34A 3LXBA 4MIMA 4GXPA 1V3MA 3PUOA 3W7QA 1CLXA 2ATMA 1JG9A 3K46A 3GNRA 1W3HA 4BK9A 3OVQA 3KRUA 1FH8A 2YDRA 3BK0A 1I4NA 2J7CA 3AJ7A 3WQ6A 1XC4A 4TTUA 1GPFA 3WY1A 2YSWA 1W32A 4W8AA 5A6BA 5U7SA 1MSSA 1E6PA 1ML1A 3WQWA 4D6CA 1SYTA 3I7RA 3YPIA 2FPYA 4DF0A 3BW3A 3AXXA 3WUGA 4R33A 1L9WA 2CLLA 3AFBA 3VOCA 2XFYA 3JS3A 4WKAA 3W7EA 3EDKA 4AZBA 1J5TA 1OWQA 2V3DA 1KM6A 1HTIA 2WNNA 3HIJA 3M7WA 4O52A 5D33A 4W85A 4IGHA 3BW4A 4JX4A 2DZWA 5LNUA 1K8YA 3HPSA 4JEQA 2YL8A 3RMJA 3R2GA 3L66A 3DBPA 4LS1A 1OABA 3F5LA 1VQTA 4S2CA 1WDPA 3TUUA 5D9MA 2ZZ3A 4CD8A 4G1KA 1VBUA 2PWEA 3O6YX 1NOWA 5A6AA 2J47A 2YW4A 3W2NA 1OX6A 1FA2A 1H49A 1ZBVA 1CGVA 2VUYA 4K36A 3GH5A 2C8NA 4XBKA 1L8NA 3GZAA 3POCA 4PEEA 1ZB5A 5FMBA 5D9PA 3W81A 1KTCA 3OG2A 1HT6A 1V3IA 1H0GA 2R14A 4ATDA 3WBEA 1W5OA 3AIUA 3SSJA 4P8XA 1KM2A 3QHNA 4PEKA 5HNNA 4XZBA 3IJ7A 4BFAA 2C15A 3BAJA 3T0DA 8TIMA 1GOOA 3TROA 3AMKA 1IIGA 2GJLA 2Q8ZA 4DQWA 1NWUA 3A9IA 4U4MA 1J10A 1CX9A 2J25A 5CG7A 3TFCA 3MV01 3CIWA 4LPCA 4CD7A 1XBZA 5AHLA 3CHCA 1RV8A 3HU7A 2E0PA 2AEYA 3SCUA 3LF7A 3DFTA 3T4CA 5ABFB 4U3CA 2ZX8A 4ZQCA 2DT3A 1A47A 1M7XA 1AQHA 4JIEA 5CGMA 4DXVA 1WZMA 2QCHA 4CN4A 5I3KA 1LL6A 1BSIA 5I3DA 3NVTA 3I68A 1TPWA 4LV9A 2QQWA 1OBAA 5C70A 4LC8A 3IIOA 5M17A 2BVTA 2WCGA 3ZJ6A 4QISA 4IMGA 1XSKA 3NYZA 5AC8A 4XUGA 5G2IA 3L65A 4D6HA 2ZUMA 3WMSA 1XHGA 5GNXA 3LX9A 4CQ9A 4B1LA 3CUFA 3NQDA 3MP3A 1S5WA 5I3HA 2FH6A 4O17A 3VILA 1W5MA 3GLCA 3TV8A 4GZJA 3TA9A 4QFUA 4UNLA 3DFSA 6A3HA 5H91A 5T26A 2GK1B 3O6AA 4PMRA 3DFQA 3W37A 2V82A 4J9JA 4J7RA 1EUNA 1GNXA 3U14A 1OX4A 3VM5A 1CPUA 5FKBA 3SCVA 3WD2A 3MBFA 1W1VA 3TKFA 2OYMA 1UKTA 3E96A 4JFSA 2QMKA 1NSJA 2B7NA 2NT0A 5JIWA 2AOSA 3HB9A 4Y8FA 1TYGA 4R7JA 1R2RA 1EHAA 2WM0A 3B9DA 4RL3A 5HWJA 4RLIA 1QO5A 3GVGA 2ZUNA 4DO5A 3H55A 2VL4A 1GYLA 1GVQA 4IMCA 3CMGA 5E6ZA 2QF8A 3SUUA 1XRVA 3O16A 3L2LA 4AD4A 2VI0A 1BPLB 3NSXA 3EWXA 3M46A 3OLIA 4D71A 2R94A 3S0CA 1JYXA 3W7IA 3SGZA 2NZLA 4FNUA 1QOPA 4IOTA 4MNKA 4MPQA 4S3KA 5IDIA 3FFSA 1JIBA 2AQWA 1KLYA 4LS0A 4NJKA 3ZIZA 4MTVA 2JGQA 4JS3A 1G4TA 3NPUA 2WSPA 2VX6A 1B3YA 2YZRA 3SCQA 3H54A 2YCEA 4W8LA 1KLZA 2J9ZA 2DORA 1DORA 3WQ4A 1W3KA 1W2VA 1CI1A 2W79A 1VS1A 3WJWA 5FF4A 3O6CA 2GUYA 2WCAA 2VEIA 2WWCA 5LSMA 4AWEA 4MB4A 1OVDA 4O13A 2V8ZA 2XGBA 1TV7A 2RDUA 3I7SA 1E6QM 1HVXA 3FKKA 3WSUA 2C19A 3QSRA 4FLQA 3OBAA 1EWDA 1I2PA 1T0OA 3G3MA 9CGTA 3UERA 1D7FA 3VNYA 3VDCA 1SZFA 5CPNA 2CHNA 2V0TA 4MAZA 4CGTA 2B7QA 5J5RA 2MANA 5I2UA 1Q6QA 3GYCA 5A8OA 3AHYA 4MY9A 3NQAA 1NWSA 3ZJ8A 6TAAA 1JZ7A 4WY0A 4B5NA 3F03K 1ITCA 3S9YA 4JDBA 3CLWA 4AYSA 4HZ7A 1Y4WA 1DWAM 1JAEA 2BXYA 3LXAA 3GH7A 3ARRA 4QCEA 2GQ8A 5TIMA 4URIA 3TTQA 3WEOA 3C0JA 1EPXA 4N42A 5CGQA 5M3WA 1ZAJA 4IPIA 2ZOXA 3EDEA 3BXWA 4FFIA 3TQ0A 2AGKA 2DPEA 3VUPA 4CCDA 1FWTA 4KWVA 2J9YA 4B3LA 4BQ3A 1VYRA 2CZFA 3OLDA 1RQHA 4LX4A 4P7OA 2WHJA 3T2OA 5BRPA 1GTHA 1TFVA 1W31A 3W7RA 4F9DA 1XCXA 3PY2A 3NR0A 1QOXA 4M19A 4ADSA 5DCBA 3APGA 3OGVA 3L0KA 1M03A 3QEZA 1KM4A 3TE9A 5CKSA 3P67A 5A6JA 1U30A 4DWSC 2ZXDA 3BC9A 2BSLA 1BEUA 2WC7A 3UWZA 4O10A 2DZUA 3EMCA 5EYWA 1VFMA 2Z1SA 4UZUA 2VJXA 4ZQNA 2QPUA 3VIHA 3AIEA 3VDBA 3NPXA 2WHLA 1P4CA 1IXNA 1PBGA 1X1ZA 3QYQA 4X3ZA 4PRWA 1P0KA 1GVRA 3T09A 4Q33A 1HJSA 5CQ1A 2WB5A 4ACZA 5AHFA 5IFTA 2TYSA 3LHVA 1IT0A 3VGHA 2FGLA 5FOOA 5E0KA 4ALDA 2P0OA 2X09A 4HSOA 4PYSA 1KFJA 4FLOA 4UFHA 1I1WA 5CGTA 2OYLA 1PCKA 1JYNA 2GDVA 3W2KA 3EX3A 1EDQA 3LRKA 2PBOA 3WQ5A 4CD6A 2CZDA 1MEHA 4QNWA 2XYLA 3VPLA 1NP2A 4KRUA 5HINA 4EANA 3K30A 1FOBA 4PMXA 4FX6M 3LPFA 2DSKA 1C90A 1R47A 4JTUA 2J74A 2NUXA 2ZTKA 5DEZA 1W5NA 3VD9A 1NF7A 4P8VA 4XQ6A 4O18A 1S46A 3ZWTA 1KV5A 3BCDA 3A24A 3QSTA 3VFLA 1E4MM 2D20A 5AY7A 4UOJA 5A2AA 4AZCB 1JJKA 3FXYA 2G5WA 4A2SA 2D73A 5D4YA 1DL3A 5K4ZA 3G8EA 1CEOA 4U2ZA 4JXCA 4RXGA 3UQNA 3GAYA 3KVJA 1J0KA 4AZHA 4TVCA 4Z2JA 1US3A 4BQ2A 3E02A 5GVJA 2VEKA 4ML9A 4RX0A 1UD4A 3RLUA 2DGAA 1CXEA 1W9UA 1KM3A 4FLSA 3WH6A 2A5HA 4HNTA 4NRRA 3KF5A 2G3IA 4GI6A 3WN6A 1OFQA 3WF1A 2HVMA 3CO4A 2XM2A 1JCMP 3I6RA 4BZYA 1QI4A 3HGJA 4JKLA 1OGSA 4O1CA 3B4UA 3W7HA 1U2YA 3CPRA 2BVYA 2FHCA 1GQIA 2PC4A 3W7PA 4XX6A 2A6NA 3GDLA 4MJZA 2D0HA 1XI3A 4MNLA 2ZWZA 4EK7A 2PURA 3CZKA 2BLEA 5DCDA 1R86A 5AOUA 2Y7FA 2XFRA 4EAMA 3U6WA 3S5OA 5LNWA 1P1XA 3M16A 1ITXA 3LCFA 2YX0A 2O7QA 4P8UA 4WIWA 4W84A 1LWJA 1PX3A 3RCNA 1C29A 1OX5A 1QOQA 3G1XA 1J0ZA 3GM8A 4HZ8A 3FN9A 1Q6GA 3N04A 3LPGA 4QQ3A 4IMDA 3WQVA 3ZWSA 4F66A 1X1NA 1G9HA 1QW9A 3DYOA 2VC6A 3EMQA 2XQRA 4Z1CA 3UY7A 1J9YA 3EWWA 2CW6A 4GI9A 1UQYA 1AW5A 4RK8A 1ZFJA 1RZMA 1LBLA 2Z0IA 2B7PA 3ABSA 2ZX5A 4UQEA 1UOKA 1HIZA 2CZ5A 4LRSA 3T2QA 3T44A 1XV8A 2VFFA 4JHOA 3WL1A 3AIVA 3PG9A 3UEQA 1WAUA 5I5RA 4OBSA 4PL1A 4OUEA 4JTLA 5AHIA 1WOAA 5EBUA 3CHFA 1G67A 2FTPA 1HP4A 4S1FA 3LDRA 1JNEA 2ZXBA 4N4PA 4B15A 4D6DA 2J24A 1QNSA 3N11A 1TV8A 3W0KA 1LZOA 4N9EA 1R46A 1ICSA 4D6GA 1XD0A 4AWUA 5KINA 2OSWA 1C7SA 1XBVA 2J8GA 2J75A 4TXEA 2WSKA 3IIZA 1B4KA 4AHOA 4FFFA 1KWGA 3CMJA 1MW0A 2XG9A 4LVFA 3JUGA 4CVUA 3RM8A 2VT0A 1HJVA 3OIHA 4Z0SA 1UKSA 2D2OA 5L6UA 3AXIA 3IJ9A 1W9DM 3G0SA 3GH4A 3PBYA 3PTMA 1SPQA 3NQGA 4IM4A 2NWRA 4EF9A 3MU7A 3W53A 3KOFA 3CTLA 4WX2A 1WKYA 2CBUA 3UESA 1BHGA 2JFEX 2BY0A 2O92A 3ZJKA 1ALDA 3TQKA 3NIYA 1XBYA 2QCCA 1E72M 1K9TA 5HUOA 2TMDA 1JZ5A 4NRSA 2BXVA 3ZT6A 3MI6A 1WZLA 4IWWA 2WSRA 2JEPA 2VQTA 1H60A 3G1YA 1OD8A 3F5JA 3FOKA 3LHZA 3UCQA 3VX0A 1BWKA 5AYYA 3K4AA 4MPKA 5K3VA 3CUJA 3UR8A 2W67A 4QCFA 3DKJA 4GNJA 2ZA2A 1EQPA 1SMDA 4D6FA 4Z2HA 2XIIA 4JTSA 3DXIA 3NAVA 1XM3A 2RDTA 3NG3A 5L9FA 4M6QA 3LXCA 3UPWA 1J0HA 3BW2A 1QHOA 2CEQA 4ZXLA 1W2TA 5LA1A 4QLKA 4BR1A 5AC7A 1XSIA 3GNPA 3K8LA 1PIGA 3WK2A 5A3HA 2IXVA 1FDYA 1EO7A 4WLCA 4ZQPA 2E6AA 4ZFMA 4IXHA 1OM0A 3ABRA 1VFFA 2D22A 3I3DA 1NF0A 3FAWA 4JCLA 2YOCA 3EWYA 1ISVA 1RQBA 5DBTA 1ZBCA 1E6RA 4B9ZA 2OLHA 1M01A 1A3HA 3LI1A 1XDLA 3G1VA 1EA9C 4XZ9A 1FFRA 2QUUA 2O9RA 3KRSA 1BF2A 2J8FA 3ABQA 2YL6A 3LCIA 4GFSA 4F8XA 1UH3A 2OZ0A 1YADA 4FX8A 1Q6EA 4JX5A 3SR7A 3TC7A 1AMYA 2J27A 2QKFA 1TTJA 2IXUA 1B3OA 4PN2A 2E6DA 1BYDA 3TDFA 2TAAA 5I0DA 3TONA 2V2CA 1QNQA 1L0PA 3NQ8A 2W4XA 3W24A 2CLOA 1NVMA 5E1QA 2ZTJA 1EUAA 3IIXA 4FNRA 3EDFA 5A8GA 2J7EA 4TVDA 3EKLA 1F05A 4NZFA 1MFVA 4JICA 5A2CA 5LKYA 1CECA 3NM1A 5LHEA 3SEPA 1JZ2A 3BLFA 3FJ6A 4JIPA 4HA3A 4MY8A 2GQAA 2QCNA 1K8XA 4JX6A 4K68A 3VD5A 4BF7A 1JDAA 1PEZA 3DHFA 3UY8A 3FEMA 3S1WA 4NI3A 2Y8KA 4DUVA 8CGTA 3WK0A 2WZHA 2VFGA 1A5SA 2ZZ6A 3G0UA 3QJAA 3L5MA 1V6YA 4AY1A 2ZYFA 5ABGA 3W23A 4MFEA 3QQ0A 4IJBA 2C0HA 1FH7A 5D2WA 1DV7A 1UG6A 3OZOA 2Y7EA 1JDCA 3L67A 1UQZA 5K9CA 3W3OA 3IV3A 1RP8A 4N0RA 3N2MA 1XUZA 3AYRA 5CG0A 1A50A 1VRDA 1SO6A 4QIUA 5DF0A 3B0UX 2EQDA 4RKAA 3VCRA 2ZRYA 3QZEA 5HPCA 1D2KA 1J0YA 2OWXA 5FK7A 3HPXA 5CSRA 4YCOA 2F84A 4V28A 4LU0A 2E9MA 3GTNA 3WD3A 2WMJA 1OFPA 3GX9A 3AHVA 3BAKA 4UFIA 1O5KA 4O57A 3UWYA 4J3VA 2QCEA 3LLFA 3PZVA 2V81A 2VFIA 2Q3OA 4ORMA 3RILA 1S3HA 3CQ0A 4UTHA 4JR5A 3GIYA 1HP5A 1OB0A 3M5VA 4IMEA 1CXLA 3ATYA 5CPQA 1J0JA 4MFDA 2WMIB 4UNIA 4TX9A 1Q6OA 1JF5A 3NDZA 4AF0A 4JGDA 1UR8A 1VJSA 1ZS2A 1PHWA 1RD5A 1ME9A 1DEDA 1VJZA 1UCWA 2V5DA 2X2YA 3ALGA 3MMUA 2Y61A 1JULA 4RJEA 2WPGA 1SW3A 3NQ2A 1X6NA 3VU2A 4AD2A 1ICPA 4GQQA 2G4FA 3WF4A 2ISVA 1V0KA 1QNVA 2CFFA 1Z32X 1MQRA 3W7JA 3SCNA 1SMAA 3B9EA 1W54A 4KGLA 1LQ0A 4MNMA 4D72A 1JGIA 3DKLA 2UWFA 1Q6LA 2FFCA 3NQEA 1BGAA 4P7LA 1SO5A 3TQVA 4JCMA 1UYPA 3F5KA 2QQUA 3SZ8A 1X7FA 5D2TA 4JYEA 1HKKA 2Q8LA 4AH7A 2WVSA 2BHZA 5HNRA 5EA9A 1CGYA 3VM7A 2BVDA 5JIPA 1MO0A 1TJPA 4GRSA 2X1UA 4LV4A 4GO9A 1VHCA 5IHRA 1UR0A 1W1TA 2B0MA 3N9KA 4A3HA 1GOQA 4XTIA 3PBGA 5HJLA 3S6TA 1XDMA 3OGSA 3VGEA 3UPBA 1T99A 1UASA 3TSDA 1HJUA 4CVWA 2VFDA 2FQIA 1K9DA 4WK9A 3WEZA 5FL1A 2YYUA 4W89A 1LRTA 1XFBA 3C3NA 4AWSA 4R34A 3BGAA 3HGSA 3AIWA 4WKHA 4U33A 3FYOA 1ONRA 4CKQA 5FK8A 1SU5A 2XJ7A 1VRXA 2CWNA 1OF6A 1GONA 1V3KA 1F4HA 2E6FA 3VGGA 3AMGA 1X6LA 3F1QA 5DCEA 5DBUA 4LY8A 3IMMA 1TB3A 4DBDA 1WZKA 2HSAA 3BAXA 5KITA 1ISWA 1H5VA 1H51A 4ATWA 4W87A 2ALDA 1R2TA 4PTNA 3WJYA 3VIJA 2XTKA 4GJ1A 3TJXA 3PSWA 2GVYA 4XUYA 3NQFA 1FXQA 4NZJA 4OU1A 2F2HA 3GDMA 5AC6A 4U5KA 2FDSA 5LYRA 4UTKA 3W1QA 1WNOA 3LIHA 4UFLA 4RZ4A 3F4WA 3P84A 3GXMA 4ACZB 1E4IA 4W86A 5K2ZA 4JTFA 1EP2A 2YA0A 2BNJA 2WHMA 1GQKA 1VF8A 2DSZA 3C2RA 1HO1A 1LCOA 1TJRA 1KXVA 4UOQA 1C8QA 1FP8A 3POHA 1NM9A 2ZZ5A 3NQ7A 3N2XA 3QHOA 2VQUA 1IZJA 5J5DA 1UD6A 1FHDA 1W0MA 4W7VA 3QMTA 1FCBA 4ADUA 5AN7A 3CTTA 5HR7A 4PMOA 3TX9A 3OVRA 3LTYA 4JD4A 4LQ1A 3WUFA 4FEZA 2YR1A 3W6YA 3G22A 1CXFA 1TUXA 1JL8A 1CDGA 1JFXA 3B9AA 3LPOA 4W93A 1P5BA 1GJUA 3BAWA 1X6UA 2VX7A 1ZENA 1CGTA 3G1DA 4MZ8A 1W3LA 1HVQA 5AYBA 4S3JA 1N7KA 3ARVA 1J11A 5M5DA 2X1SA 1VCFA 2H90A 1RP9A 2WKLA 5KTLA 4MNJA 4PBGA 3M9YA 3DYPA 1SQ7A 4UQBA 1QNRA 1V6VA 1WBHA 1ZY9A 1RH9A 1KTBA 1ESWA 2H8ZA 3HO8A 3W83A 4U31A 5A95A 5A6KA 4Z2KA 1G94A 3LTPA 3BSGA 1LLOA 3W6MA 5CZSA 3FS2A 2QV4A 2QUTA 3NPVA 2C16A 3OBKA 1LP6A 3GXPA 4ZVJA 3VE9A 4IX0A 1JI1A 3K8KA 3T08A 3AHXA 3MV11 4W7WA 2EPHA 2WKJA 5D04C 1E6XM 4X0VA 1I2OA 2QR6A 1QO2A 3C52A 5ECUA 4UZSA 3LGEA 4FFGA 3KRZA 1S5VA 4UIOA 2Y2WA 3NOEA 1GOXA 4BI5A 2Y4SA 1G7UA 3WIJA 2CYGA 4DPPA 4ZQRA 1GJWA 1W37A 1V6WA 1JZ8A 3ARYA 1EO5A 3LV6A 4DO6A 4CNPA 1VCGA 1G0CA 3PZGA 3W1TA 1UUOA 5AYZA 3BMWA 1I2QA 4PA8A 2E6YA 1LRQA 4LVAA 3MWAA 3R12A 2DT2A 2WVVA 3RPMA 1HL2A 4ADTA 1O7AA 2WC4A 1JCJA 2WSYA 1F76A 5CXPA 4O1DA 1E3XA 1R87A 2EPKX 5F1UA 1PX4A 3L4UA 1GG1A 1H63A 1IZKA 1EQCA 3WJSA 5A94A 4JFUA 1O5XA 3W4RA 3N9RA 3FHAA 3PTKA 3U5YA 2E09A 3FHQA 1UWRA 5GNYA 1H62A 2ZRXA 3F4NA 3N13A 2YKKA 3QW4B 3ALFA 5A6SA 1VC4A 2DJLA 1UD5A 1SO4A 2WSQA 4OZOA 1AL7A 1OG0A 4N6FA 5CZTA 4EOUA 1HN1A 4WXZA 3W7NA 1PZ2A 1W9XA 2VZUA 3L2MA 4GKLA 2NSXA 1TV5A 3GDRA 4OOUA 3VMPA 4W88A 1X1OA 1LL4A 5FKYA 4TR9A 1N55A 5HMSA 3KL0A 4AISA 3PSVA 3HN3A 5A2BA 2NX1A 4XZWA 3SI9A 4U5IA 4DELA 1QI5A 3OB8A 2CITA 5I3IA 1M5WA 3BAIA 3PR2A 5BNKA 2ZUTA 3AISA 3B05A 3NQMA 3AICA 1RR2A 3W7LA 1OCQA 3UGFA 1JD9A 2ZZ1A 2FHBA 3TOPA 1K7EA 4FB7A 3HBLA 5CLWA 5JUVA 1WX0A 1JZ6A 3IGUA 1HFBA 3THQA 2PCQA 2XWDA 2YA2A 3BLKA 4JFTA 3T0BA 4JTJA 4AZGA 3HQ1A 1G4PA 2NX9A 4IPJA 2XWEA 3G8RA 2Z6IA 4AHQA 1UR4A 3P8JA 1Z41A 3N12A 3BGJA 3PM6A 1AW1A 1TA3B 1WZAA 3S5ZA 2ATSA 3STFA 1CXHA 3W86A 4ORIA 3KE0A 3PZ9A 5AC5A 2WC3A 4EQVA 3P8IA 2YYTA 5D09A 2PWGA 3BMVA 1BFNA 4R5EA 5FIXA 1C7TA 2OX1A 1BKSA 3WFAA 1NOUA 3DGRA 2UY2A 2XSAA 4X2RA 3WUEA 1MZHA 4HMCA 3TNOA 1FHLA 3OA3A 5LNVA 4K38A 2CETA 3CZLA 4M6PA 4O53A 1E6NA 6CGTA 2VEPA 1GOIA 2DZXA 5U4NA 1JUKA 4LC6A 1E9LA 4PTWA 3ZT5A 5C8BB 4J3WA 2WZIA 3LDKA 4P7QA 1JQVA 4GUHA 2WK2A 2CLHA 3KL5A 4FX7A 4K37A 4LT9A 3A47A 3ZMRA 4N2YA 3E9AA 1GOWA 2QCDB 2VX5A 1LOQA 2YLLA 4GBUA 1JYWA 1LORA 2DZPA 1GVSA 2GUUA 5LNSA 3KL3A 1O94A 5GPRA 1D3GA 5F4SA 2ZX9A 3LRMA 4BQ4A 1FWRA 1GQLA 4Y96A 1C8VA 2WBGA 3LCGA 3QM3A 4TIMA 4WJXA 1YDNA 3PB0A 1KBIA 4GWEA 3UWQA 1B3ZA 2D3NA 4XB3A 3IK2A 3GR7A 2NX3A 2VCAA 3GR8A 3P5ZA 4HHPA 3RM9A 4AZ5A 2Y62A 3AZRA 3VI2A 1E40A 3HJZA 2YBTA 3S1UA 1QPRA 2DZVA 2XVNA 2NV1A 3E1F1 4GINA 2WAGA 3WH8A 3ARXA 2ZCGA 3DI0A 3RJYA 5I23A 5BXRA 4HU8A 1VFOA 3UXDA 3TFXA 3V1PA 2XFFA 4F79A 5CZJA 5FF2A 3R13A 2OJPA 3W25A 4AXKA 1H1NA 3Q37A 1FWNA 5CLTA 5SWUA 4LVBA 2ZRVA 2J77A 3WQ8A 1JI2A 2QDGA 4Q7NA 2FH8A 3MYOA 3T40A 4AVFA 2NUYA 4DF2A 1DWFM 2JIWA 1KGWA 3VNDA 4M81A 2TSYA 1B9ZA 3W7GA 2DIJA 1KGUA 3M1ZA 1P6WA 3U1XA 1OYBA 1SR0A 2RH9A 2HTMA 3LFIA 1QPQA 3AHZA 2ZICA 2W5FA 1THFD 1SFSA 1IXOA 2DU2A 4HPJA 1EHNA 3M6DA 4B3KA 3W85A 3GDTA 3B0PA 4AD3A 3SUVA 4K6AA 3ELFA 3SCOA 3B06A 4TX6A 1AQ0A 4A3UA 1LWHA 3AS2A 3AI0A 2WO5A 1E3ZA 1VB9A 4NNBA 1QI3A 5FMDA 4TX8A 1SZGA 3PZNA 3L4VA 1NWTA 2VZOA 3A3HA 3TTOA 5F2MA 3P80A 3VKJA 1GZJA 3T7VA 1ME8A 4UQCA 2ZQ0A 4R27A 2G3NA 4MDPA 2BHUA 1PCWA 2G41A 3L5LA 2OMAA 4PCSA 3SCRA 2Y88A 3B8DA 3B0VC 1V6UA 3CZ8A 1TVPA 2E40A 1G4EA 3N1AA 3GZ3A 2CPUA 3MO4A 1XL9A
chains in the Genus database with same CATH superfamily
2PAEA 1SZEA 4H7CA 4XO6A 1JH5A 1H8TB 3L2HA 4AZ6A 1HJFA 1BMV2 3B94A 2XJVA 4H8UA 4PFMA 1RVF3 3KV4A 1B9BA 4KWLA 2CESA 1WW5A 1KITA 1HJWA 1J59A 2WANA 4GQ0A 3LEIA 4QJ4B 3W88A 5AC4A 1BVZA 2H6CA 3AIBA 3WNOA 3WF0A 4PGLA 1QDOA 2O8QA 1CXKA 1PB0A 3QTGA 1JPIA 1ENRA 1CTNA 3S3GA 3I8TA 4AWDA 3E6EA 5D2YA 1IXQA 1W5QA 3I7QA 4GUFA 4K9SA 4XISA 3SXWA 2G9GA 4MKSA 1XYFA 1S1PA 4J2MA 5F1VA 4MLJA 3EWUA 5E16A 3E0IA 3HEIA 2H6RA 3NGFA 1BSLA 1AL0G 2QJMA 4CN6A 1RUI1 1OUSA 2CBJA 3ZMNA 4XZLX 4L4OA 3W1MA 2X7WA 1DJNA 3S57A 2W62A 1TWDA 4RGAA 3N19B 1JD7A 1JDFA 1W0OA 3ZPYA 3EB7A 3A4JA 4JQ4A 4MWAA 1WE5A 3NQBA 2SLIA 5TAOA 1XIHA 3SCHA 1N8FA 4BE3A 3UJQA 5F3CA 5FZBA 5KXBA 1W6TA 4AX7A 3HNYM 2YCIX 3URAA 1A5MC 5HDRA 2E63A 3H7RA 1TZ7A 1PTAA 1VPQA 3IGXA 1ZYBA 3NMBA 2JD4A 3OZPA 3QY7A 4PUDA 1R093 1V3JA 5C2XA 6XIMA 3PF3A 3ATZA 4D7YA 5AVAA 2JDUA 1WKFA 4MG2A 2BG5A 2EO7A 4Y90A 4TVUA 3S2JA 1LG1A 1Z78A 1N3OA 1RUNA 2C13A 3L4ZA 3I2JA 4UTMA 2GH2A 1XLMA 2V3EA 2PWFA 4YL2A 2QJIA 1XR2A 5HCFA 3PG8A 5KZDA 4RE4A 4DWSB 2E9LA 4QLJA 3CZJA 1RXFA 3ZOAA 1YO8A 4N02A 2FVKA 2AZ5A 1A8MA 4QPYA 3VX1A 3WDIA 4JDYA 1Z42A 2XIMA 1ENSA 5JCTA 5G2HA 3SM0A 2YFZA 3BCFA 2ILMA 3PZUA 2FD8A 3VXGA 3WNKA 3WQBA 3I4IA 3WUDA 4IP7A 3LBCA 3ASIA 1JOJA 3VGDA 4J28A 4JQAA 4GE8A 3P82A 2R24A 4A6OA 3W2MA 1YRZA 2PDIA 4XABA 4W7UA 4O8AA 3TC6A 4FIQA 1EAH2 3SW6A 3VNZA 3G7DA 3PVBB 3GG7A 4EKJA 1NQDA 2OQ6A 1UUQA 1UMYA 3PPHA 1Y5WA 2OZJA 1LCLA 1KFLA 5KMYA 3ZFFC 2R1MA 3PJQA 5GLZA 1YHTA 3BLEA 3T55A 3BPWA 4XQWA 1PM7A 1ZJAA 2D6KA 2CKSA 2FTWA 1WMEA 1UR9A 2P1FA 5A3TA 3OU8A 3TZNA 3CJIA 1FKWA 4JFWA 3VE7A 2NT1A 4LRTA 4QX2A 2BTMA 1BTMA 3PIJA 2DZTA 3VAVA 5JQ9A 1KW1A 3H2MA 1KRCC 1W6OB 1EJTC 3SY1A 1EIXA 2W39A 1E5RA 4NIDA 3U7BA 5ABJA 3BTZA 1RUC2 4JHTA 4CP2A 2D23A 1AHSA 4AMCA 1V6JA 1N47A 2YU2A 1KXQA 2CLIA 1SLBA 4F0HA 1NFGA 3V0AB 1LYXA 4C6BA 3FJ4A 1F5JA 1EX5A 5AHEA 1TQXA 4M8UA 1YYAA 3Q65A 2VXRA 3EXRA 2VZSA 4YWSA 1GYNA 1H2MA 4KW2A 2KX9A 2YDQA 4GNKB 4XQ4A 4LA2A 3ZJ7A 1V70A 1L6GA 1AR82 4K3ZA 1QU0A 3ZXAC 4LAZA 3NZRA 3T4VA 1KEXA 4CEWB 1KTNA 4XFFA 1TSIA 3SCSA 2PCEA 3NYDA 4QEHA 3WF3A 4UR7A 3FBMA 1JHJA 1KDKA 4CLMA 1DLCA 3U2CA 3N4AA 3MJMA 4NU7A 4TOQA 3G24A 4LEQA 2E77A 3ZYZA 2VYOA 3P2VA 1IHIA 4GUJA 5E09A 3HBKA 2A7PA 1GFF2 3AP6A 4CQBA 4A21A 4Y24A 3VZLA 2AR6A 5D2AA 2ISFA 3GKFA 3LHWA 1ZJBA 1J4EA 3NQCA 1XSQA 1N82A 1AR93 1QIQA 4YHEA 5D9OA 3SUSA 5BNQA 4DRSA 4JYFA 1W2UA 1UF2C 1DWJM 1UZWA 7ENLA 1YBQA 1UP3A 1S39A 1RQEA 5KZEA 3MT1A 4CCNA 3SUTA 1GUIA 2PWDA 1UWWA 3FJSA 3P3PA 1E1EA 5LHFA 4MB5A 3ACGA 2D2GA 3G6MA 2YC4A 2IVJA 2CU5A 3W2UA 5A32B 4M0NA 1RBAA 4QAIA 4DUWA 1W1B1 1HDKA 1MZRA 1BBT1 2J22A 5FZKA 3W27A 1ECEA 4WM7B 4D2JA 4H4IA 3ID7A 1O6IA 3EBVA 4RZ6A 4YLWA 2WMKA 1M3UA 2A3BA 1ENQA 1HQTA 4QDPA 1UW8A 3H9AA 2DH2A 1B35C 3Q8EA 3S42A 5D32A 1PIV3 5FEWA 5F3EA 3VHOA 3SCWA 1TWSA 2FFIA 3OPZA 1XW8A 4DJEC 1TMF3 1XQNA 2CV6A 2QGHA 4XTDA 4Z17A 1O4ZA 3W21A 4RDVA 4YVSA 3WFZA 1E0TA 3CXOA 4HVQA 4Y9MA 2FLIA 1U12A 1JU3A 2GC2A 2W87A 3RN6A 4JTCA 4AU0A 3MIBA 2VEMA 5E8AA 5FY9A 1YDOA 4YHGA 1ISZA 1W99A 2F38A 5G1MA 3ZLIA 3AS3A 2F6XA 1W8OA 2R1BA 1FNZA 4RNJA 1DJYA 4H8VA 4JTIA 1U33A 4JZ5A 3SQSA 1HIXA 2C9AA 1SSDA 1XCFA 1K9FA 1E5SA 1JF6A 3GXTA 4JGZA 4XBSA 4AIOA 1BYAA 2BP6A 5IBXA 1J84A 5C54A 3QR1A 3ITVA 2YCLA 3TWBA 2OIIA 4NX5A 1J1LA 1OINA 7REQB 1WCGA 3MUY1 4Y4YA 3H7UA 3K75B 1DXIA 2P5NA 4LB3A 2D6NA 5GNZA 1ACCA 1TME3 4MKNA 1XYAA 4RHV1 3G1HA 1EP3A 3ME2A 4LYPA 3GBFA 2IXJA 4WSKA 2DTYA 4HN4A 2X1TA 1CX4A 3C2FA 1FHVA 4BCEA 1JUIA 1SFLA 4W50A 2XDVA 1IR2A 3CHVA 5CAZA 5A6LA 3DL3A 1DVJA 2YXGA 4N7QA 2UY3A 1ZTVA 2HXUA 3C2OA 1K77A 2NWSA 3MKCA 2DVBA 2Y26A 1I60A 3C0QA 2INEA 4HSHA 4Z1AA 1OD0A 5FJOA 4LR4A 3ILRA 2NQZA 5T5OA 3QC0A 4UMBA 4I7UA 3WJXA 4KCVA 1SO3A 4GOAA 3SAZA 4TTGA 1JBCA 4E3TA 3RO8A 3DG6A 3ONBA 1PIIA 2EGZA 1RUF3 1TPVA 4ZQOA 4E2BA 3PJYA 4YPJA 3BH4A 4UTFA 1RC6A 2HWD2 4S23A 2OYKA 4DLFA 2PS2A 2HKXA 5CG9A 1W04A 3M0XA 3QHMA 2J7GA 4HIBA 1FV2A 1OKOA 2WYFA 2YDAA 2V30A 1BYHA 4NWVA 1BRLA 2PEVA 3VDDC 3N7MA 1UZYA 3DCPA 3O1SA 3NL1A 1PZ8A 2HWC2 2QT3A 2YZ5A 2OO6A 4GQRA 2EA7A 1ASJ3 5H6HA 4NILA 2OSXA 1QAPA 4C0BA 4LYRA 2AMGA 2GJNA 2WNZA 4M6VA 3AX4A 1PIFA 4GXMA 1HRV3 4WZHA 3FMGA 3LYEA 1RHCA 1Y9MA 2YBUA 3NNGA 1Y43B 4XZIA 1R85A 2X1RA 1ELSA 5JSOA 3OBTA 2R6OA 1CIUA 1UWUA 4CCCA 1SJDA 4NUWA 2QIWA 1W8SA 3PLQA 3PNUA 1FH9A 1FWHC 2BY1A 3PUGA 3UR7A 1P0BA 1QQP3 2BERA 1LECA 3SFKA 3CUZA 5FEPA 3I2KA 3GIPA 4GVGA 2HZGA 2C71A 3HG2A 4OHQA 1UZ1A 1XP3A 3DFNA 1K7XA 1TWIA 4O15A 4LIVA 1M6JA 3LGDA 4AGGA 1XD1A 3OTRA 3QPYA 1MQPA 2JB4A 4W6YA 3GHUA 3H0OA 2B45X 5G1TA 1JXJA 1LOFA 2AL1A 1QOSA 2VO5A 1V0NA 3GNNA 3SIZA 2WT1A 3S6DA 4S2FA 1VRH1 2ZE3A 3G5EA 3ORWA 4NNCA 2WZR2 1PE1A 1RCXB 2J7HA 1YNPA 1VAVA 2FDMA 4JN6A 5DN1A 3H1WA 1RPXA 4KWWA 4HT3A 4GCAA 4IX2A 3DECA 1QXRA 4QD2A 4XFIA 5HULA 5DT5A 1MNZA 3MPGA 3AYCA 6TIMA 3NQ6A 2D2JA 1UYZA 5AYIA 4B4RA 2H3DA 3NPWA 2CWXA 3QCWA 3EOOA 1FX5A 2G96A 5D03A 4UBGA 4AFYA 3EQEA 4B4FA 1T96A 4X9SA 4CCKA 1ULEA 1LGBA 3LQGA 2JBMA 3ARQA 5FZLA 1JUEA 5F4WA 4NAEA 2XU2A 4ICMA 4JY9A 4J3SA 3RPQA 4DXXA 2J1UA 4LGXA 3HQRA 5M1TA 3PTQA 2FZ1A 3T0AA 1H3GA 2RM21 2DFAA 5EMKA 4S3FA 2POTA 3JD71 1WBFA 3RWKX 3WD4A 3VTRA 3KCJA 2QUOA 3CHXA 2QJGA 2OOGA 1YWKA 4GPNA 2W94A 1RUG2 2RUSA 4WM8B 3V18A 2JKXA 2EJAA 4O8RA 3OCPA 3T4HB 4M0XA 3MJYA 3A9BA 5EV7A 3QBQA 3SCGA 5E5CA 1E4NA 3W5NA 2VMCA 4GI8A 4LLFA 3LERA 4O16A 4WXYA 4C7DA 4J5NA 3AZZA 3R7MA 2WQPA 4PCPA 1KBKA 2YFNA 4GULA 3RI8A 1C8NA 2AQOA 3WP4A 3IARA 4NX0A 2VEFA 3HOBA 4E27A 2JG8A 3KRBA 4PMJA 3ZSTA 4AEKA 4B5UA 3MF9A 5B4NA 4ACYA 1BG9A 1RAKA 1C4RA 5ABHA 1WV2A 4FLRA 4XAYA 5I7GA 3WZ1A 4GCXA 1M53A 4XURA 3JQWA 2DYCA 4CEYA 3AB0A 1A34A 3K1DA 2QJVA 1PJ9A 3ZFHA 1KXHA 1CVNA 1V3HA 1XLJA 4UR8A 2IQDA 4QDWA 2QYGA 3OGGA 5SV8A 4WD0A 3GF6A 3UD6A 1UZ0A 4HMDA 4JVAA 2X1IA 2VNOA 1UWIA 2G0WA 3WLUA 4ML4A 2XR4A 3VL9A 4QGNA 5EB8A 2VZPA 5DELA 1QBBA 1XNCA 4LHLA 3N73A 4NXKA 3BIWE 3B8UA 2PA7A 1J5SA 1W9BM 1R3YA 1H0BA 4AVVA 3R0DA 4GZIA 4F48A 3W71A 5FA5A 1B4EA 2JE8A 2R073 2VM8A 3G3DA 1GVFA 4URTA 1UBSA 4UTWC 5I8YA 1XRUA 3ERPA 3VO0A 4L9YA 1C8M3 1PDZA 3OUHA 3JBG2 3MVIA 3RMEA 1TIMA 4AE2A 4DO0A 2FTYA 3NNTA 3M44A 3W7DA 3IVSA 2ZGSA 1US2A 2CBVA 5K9XA 5BNOA 3P5BA 4PODA 3PL0A 2DUQA 3KQRA 2YB4A 2EIEA 4FPFA 1QJX1 4ZEPA 4GYKA 1V6MA 5KHIA 3A0KA 2VGIA 2XM1A 1EOKA 3ZFGA 2ZGPA 3DFPA 5AFBA 4F0RA 2RG4A 3M3CA 4AX6A 4D6IA 5JOXA 2GVJA 2XJSA 2VVNA 2VEGA 3KHBA 4GZEA 2KZHA 2QNKA 2CXEA 3TTEA 4RR4A 1L6FA 4MG4A 4XXPA 1E9IA 3E49A 1MW2A 1IG3A 3IDCB 5A7WB 2DJXA 4A4AA 4Y9OA 1DWIM 2UY5A 3THUA 5MHBA 1UA3A 4QG8A 5AHMA 3OF1A 4EF8A 4BHPA 5EXOA 2DF7A 4PULA 1NYWA 1LHWA 4O54A 4XIOA 4GUIA 4OTKA 3W7MA 1UOJA 1O8PA 3HMCA 3KCYA 3P60A 1H4PA 1VCVA 3P81A 5FESA 5AC93 3FJNA 2BX7A 4WVZA 4Q8MA 4D9PA 1WGPA 2CKRA 1PO12 2W66A 3VBFB 4MX3A 1D8WA 2A3LA 4P7LA 1ODNA 4KFPA 4H7VA 1KFBA 5J7MA 3B97A 1O1ZA 1IR1A 3VBHC 1P0DA 3OGJA 1BKZA 1SG3A 4D7TA 1NFBA 1H1MA 3SGUA 4UBHA 3QRHA 5T8GA 3DH7A 3LCLA 4EIVA 2FDKA 3PJTA 3ZR4A 5E6YA 4HNVA 1KBLA 3HN1A 4LEJA 4DO7A 1CAUA 4NN0A 5FR3A 1FDZA 1GK8A 7CGTA 1FATA 3AKSA 5IDZA 3BAYA 1UJQA 3M6YA 2O4MA 1EOMA 3I2IA 2CERA 4KETA 4JAWA 5GZGA 4IMFA 3MF6A 1POV0 4ASMB 3LB0A 3ETPA 1PVXA 2X41A 1VYPX 4OUIA 2BY3A 2BOJA 3W87A 1IHMA 5IW0A 4UFMA 4O4VA 3O06A 2XGXA 2OEMA 3R1ZA 3NJYA 1YJLA 4YYOA 3MHUA 3KVBA 2XUEA 1B09A 3MP5A 3KGZA 1ZPTA 3AWNA 3NSMA 1PTGA 2HEYF 1E43A 2PDNA 1EV11 4BDVB 3I6EA 1QWGA 3H8RA 1DQ5A 2D3RA 2WQ8A 4MHRA 3GVRA 2RJKA 1IV8A 2JDMA 1KD0A 3KOZA 1CIWA 3O1MA 2XIJA 4RCXA 1KFCA 1ZL1A 2LM3A 2J62A 1YCIA 3S47A 1PX8A 4IH3A 2G97A 1TO3A 3EKZA 3S6PA 1RALA 3AYSA 4KEMA 1KQYA 5DDJ2 3P5YA 1QJEA 3N3HA 2BV9A 2NXIA 2W63A 4CCJA 3J7HA 1W6PA 1R8LA 3KV9A 2A3YA 1H7WA 5FJKA 3W70A 1WUVA 3V5CA 1MW3A 4LO4B 1EJWC 4UBPC 4IEPA 4HPHA 2VR5A 4XWUA 2B31A 3N3MA 1VB2A 2LW8A 5DAWA 3X29B 4M3CE 1GVOA 2GOUA 1EGZA 1ODUA 5FJJA 4UW6A 4MB3A 4BY3A 2E4TA 3KHDA 1TCMA 1R2SA 5BNPB 4BPZA 2GLKA 2MNRA 4D69A 1GCYA 2PC8A 3ZZ1A 1XINA 2XUCA 4XUQA 1OYCA 3NUKA 1D7PM 4BMBA 4GB33 1GBGA 4QG9A 1GORA 3WCSA 2BGSA 1UWSA 2DT0A 4ICNA 3ZO9A 3CQKA 4K39A 2G50A 4Q8VA 3MMWA 3VK5A 1OA2A 4OHWA 5CZKA 2XSBA 1E73M 3RJ2X 2IW0A 4GX8A 3PZQA 1P7TB 1OC7A 3NURA 1XJAA 5C0QA 1S2CA 2PLJA 2PP3A 3WBAA 3PUHA 2WJEA 4BOWA 2HYXA 4RR3A 1VFTA 3VBUA 5L73A 4LUTA 1W2OA 4GA8A 5ENLA 1SQ4A 1F15A 5EMUA 4O12A 1A6CA 2Y6KA 1Z69A 4MZYA 3U4AA 3O05A 4XF9A 2WOQA 3C86A 2PDQA 4Y1XA 4CDUA 3Q9OA 3LHYA 5FZ0A 4HPKA 1LLZA 1KKRA 4CCEA 3DENA 1EJXC 4RFRB 1P6CA 4WV8A 4FNPA 2ZX6A 1IS6A 4ZKTB 3EXSA 1F35A 3N35A 2QXWA 2BVVA 4XVEA 3OYXA 3KZPA 3DHPA 4WEVX 4AD1A 4Z2WA 1A5AA 1E1FA 5IVVA 1LQ2A 1H7PA 3NXFA 1YNAA 3TYBA 3GVVA 1HXS2 2XVPA 4IFOA 2D3LA 1XNTA 4IP4A 2JKPA 3NOYA 5JOZA 1S0EA 2YGYA 3MUIA 4JFVA 3LWCA 1H7XA 4Z1BA 3U2OA 2O9OA 2ENRA 3K8MA 1Q56A 3KT1A 1PGW1 4Z07A 4TXWA 3SJNA 1GOMA 3WDHA 5DFAA 3KD4A 2EIDA 2XVLA 2O9PA 3VZXA 1O60A 3KVKA 2AACA 2D5HA 2CTVA 1UZ4A 2RDWA 3HMJG 1MZEA 2DVDA 4C6DA 4ICCX 2XB6C 3PNAA 3I2HA 2RV9A 4N43A 4KWSA 5ANNA 5LBCA 3EB2A 5IVFA 2YGLA 3A22A 4ZY9A 2ABAA 4WJEA 2XUMA 3VD7A 1TCDA 4HZ6A 1V5XA 3N2BA 5BOOA 4H9ZA 1XPGA 1GJPA 3W73A 4QX5A 3E12A 2O9TA 1Q6DA 1EPZA 2MUCA 2POZA 2PTMA 2DDXA 4D1JA 2Z4FA 2B7OA 2K46A 4Y5Z0 2I16A 2BOFX 2ZFAA 3N34A 1F3EA 1P43A 3LZ3A 3PUOA 4QX0A 2RDSA 4R9CA 3GNRA 2YDRA 1FH8A 3OVQA 4QSFA 1VAMA 1XC4A 1GPFA 1AYM2 3JW7A 1LEMA 1QJU1 3WQWA 4MWAB 4D6CA 3I7RA 3ZXKA 2NLRA 3AFBA 3VOCA 4JTRA 4TLFA 3MUCA 3B01A 1PGL1 3RRAA 1J5TA 1KM6A 1HTIA 4W85A 3S9IA 3GHSA 2YL8A 2VG9A 4R4XA 3Q8FA 1CLKA 1OABA 3RLGA 4CD8A 4G1KA 2PWEA 3LOBA 1JOPA 1QJY3 1Z7S3 4K36A 3GH5A 2PP0A 1M4WA 1L8NA 4K3UA 3I54A 4I5XA 4NYUA 5CG8A 4LITA 1K5MC 2YB7A 2Q4SA 4NP7A 4P8XA 3SSJA 1KM2A 3IJ7A 3BCWA 3WP6A 2C15A 4YW5A 3BAJA 2RDXA 3KBWA 3W58A 1G9DA 3ZYHA 5HCBA 1GOOA 1IIGA 4DQWA 1JXNA 2VULA 1VBGA 4A7YA 1F5FA 1CX9A 4C1NA 3VOGA 2Y0OA 4FAMA 1Q2SA 4KWKA 2AEYA 1PTDA 1TQ5A 5FYTA 3LF7A 1UMHA 5A3MA 3K1GA 1EYEA 2DT3A 1A47A 3ZIWA 4HHHA 1AQHA 4UW3A 5I3KA 3J9SA 1BSIA 3I68A 1TPWA 1IT7A 1NG0A 4LC8A 3E0VA 5M17A 2BVTA 1IQ8A 1EP0A 1L7RA 4KEUA 5AC8A 4XUGA 4H6QA 3EB3A 4D6HA 2ZUMA 5F9TA 4H83A 5GNXA 3LX9A 1H8TC 4M3CA 3CUFA 4PIXA 4GYFA 5I3HA 1K8CA 4DI8A 3VILA 5H9RA 4COUA 2HJPA 4GZJA 4QFUA 1AF9A 4LKEA 2RMU2 3ME3A 4DXSA 3VM5A 5FMOS 1CPUA 4Z1YA 2A6ZA 2A70A 1RUE2 3LE0A 1XIMA 3MBFA 3L9JT 3T9PA 3TKFA 1RJRA 1UKTA 2B7NA 2Z7KA 5JIWA 3TRSB 1PNGA 4R7JA 1BCXA 2Q6ZA 4LAMA 3B9DA 3TYDA 5HWJA 4YYCA 4UT5A 3CJIB 2ZUNA 4MGIE 2VY0A 3VKFC 2SFPA 5LIWX 1GYLA 3CMGA 2QF8A 4AD4A 3L2LA 4LO5B 4N8MA 3SGZA 2NZLA 4IEWA 1QOPA 2Y8UA 4EACA 5ABJB 2NLYA 4S2HA 3OTFA 1GOHA 4JS3A 3NPUA 5G04L 1O5UA 1EBHA 3SCQA 1KLZA 1DORA 3WQ4A 3H4XA 1ZRQA 2HBVA 1CI1A 2NQ5A 1VS1A 3WJWA 1MEC2 3T0CA 5LSMA 1LTEA 2Z29A 3SDOA 4DBSA 4IICA 2RDUA 4ZGYA 1HVXA 2OG9A 4H19A 3ZMOA 3BVCA 1AZDA 3G3MA 3TAYA 3UERA 4R9OA 4AG0A 5CPNA 2CHNA 2B7QA 2MANA 5FQ0B 5A8OA 4YZ1A 4OFGA 3B0XA 4LJHA 3KMHA 4AYSA 4JDBA 3VOHA 2WWUA 1MRAA 3ARRA 4URIA 3TTQA 3C0JA 5M3WA 1ZAJA 4IIDA 3EDEA 3HPAA 3TQ0A 3AMQA 1VYRA 2CZFA 4P7OA 1RQHA 1AR72 2IKGA 3URNA 2WHJA 5BRPA 2VVFA 2HWF2 2J1VA 5EPAA 3CO2A 3AKRA 4XF3A 4MVTA 3OGVA 2PLV1 2E7QA 5CC5A 3TE9A 1YBQB 5CKSA 1NCQB 4C65A 4DWSC 4E4UA 2WC7A 3UWZA 5LBFA 1CR7A 2ZA9A 4K1WA 1F2NA 1TJ0A 3VDBA 1P4CA 1X1ZA 2VMIA 3CQJA 3QYQA 1P0KA 4ZO8A 2GGHA 4ACZA 4FP1A 5AHFA 1OLME 5IFTA 3VN4A 2FGLA 4Q0SA 1T8QA 4ALDA 5FOOA 2D93A 4UFHA 2H6BA 5C9AA 1EDQA 1AD1A 3HNMA 5CFDA 4GGHA 4KRUA 1GYMA 3AMHA 1VP6A 4EANA 3WW1A 3K30A 3LPFA 4IGPA 1C90A 2NUXA 1QOOA 3VD9A 1NF7A 1Z8AA 4REQA 4O18A 2FDFA 2JDYA 1TNFA 1KV5A 1UPPA 3LAGA 4Q4V1 4S3CA 1E4MM 1RK6A 1BBT3 1DYOA 5IYYA 1JJKA 4A2SA 2XONA 3QKZA 4UB9A 1CEOA 3ABXA 4JXCA 4AZHA 4TVCA 3FWEA 1D4M2 1US3A 1AXZA 4BQ2A 3CL1A 2BB0A 1CPNA 3KWSA 3THTA 3RLUA 2P3KA 3EMRA 4XAAA 3UU0A 1CXEA 1KM3A 4YVSB 2A5HA 2RS31 1OFQA 5ACA1 4XVDA 3WLLA 1WMXA 3AU6A 1JCMP 3NWRA 3V0UA 3P3NA 4ZSTA 3RDIA 1U2YA 4LORA 1ZRIA 4XX6A 3GDLA 2D0HA 2PURA 3STPA 2BLEA 2Y7FA 3BTXA 3A4UA 2O8OA 1ITXA 4P08A 2XH4A 4C6EA 1GWLA 4WIWA 3TZFA 4W84A 3RCNA 4EZHA 2Z4GA 1J0ZA 2VAUA 5KBFA 4IMDA 3WQVA 3ZWSA 3U4SA 4L65A 3VNLA 4Z1CA 2NPIA 1H1IA 5D1IA 1UQYA 1AW5A 1ZFJA 2YCLB 1LBLA 4UQEA 3ABSA 3ENRA 2R041 2R32A 2LTNA 4LRSA 1J3PA 3T2QA 3GC4A 2OODA 1N1TA 1DIOA 2VFFA 3U2ZA 3RUBL 1WLCA 1GWMA 1YFYA 5T3NA 5EBUA 3FYYA 4EN0A 4E9KA 4CEWC 2XPJA 4B15A 4KQ7A 3W0KA 1Z0HA 4KI5M 5KINA 1ZRDA 1XBVA 2J8GA 9XIAA 2GNDA 4MXWA 1QH6A 1M9HA 3NV2A 3MB9A 4CVUA 4LVFA 3FHIB 2VT0A 5J1XA 3PPGA 4X6QB 3G0SA 4M4RA 3OBRA 4RHV3 1VFLA 3PTMA 2HVOA 3MU7A 3W53A 3RVHA 2XGZA 2ZHNA 5HJXA 3ZJKA 3ZDSA 1ALDA 2R1LA 5IJRA 4CDXA 1ADSA 2BXVA 3HV8A 4Q8WA 3G1YA 1OD8A 3FOKA 4WR3A 5FZ4A 2QDEA 5AYYA 3UR8A 4ZO7A 5K3VA 2ZA2A 2QULA 1SMDA 4JTSA 1XIDA 4M6QA 5LA1A 3QLQA 4Q4Y1 1CAXA 2AGTA 1XSIA 4WM7C 4MMWA 2XBO1 4H9MA 1BRLB 5JXQA 1EO7A 1OM0A 1VFFA 4DZAA 3I3DA 4K21A 4JCLA 1ISVA 1RQBA 2BP1A 2BBFA 5J48A 1VMHA 3HFTA 4QDSA 2HPIA 1A3HA 1IEQA 2O9RA 2OLHA 3LI1A 2VOVA 4JTAA 3O1TA 2YL6A 3LCIA 1UH3A 2PA6A 2OZ0A 1ENXA 4COZA 1YADA 4NKCA 1Q6EA 4LBUA 4LANA 1TTJA 2IXUA 1B3OA 4MSVA 3TONA 2W4XA 1GSLA 3VKBA 1XRTA 4FNRA 2J7EA 5CEWA 1MFVA 1BMV1 4JICA 5A2CA 5CCZA 1CECA 3TOYA 3BDKA 4D6SA 4IP5A 2XLAA 1VJ2A 3WD5A 2ES3A 4LUSA 3D0JA 1K8XA 4BF7A 3WP5A 4NI3A 1OA3A 5B80A 1BKHA 3V36A 1KDMA 1S2TA 2EXIA 4CRQA 4PT6A 3S46A 4MFEA 3QQ0A 1H2KA 1DV7A 4PUKA 1UG6A 2Y7EA 2HE8A 3ZYJB 2XSXA 1UQZA 4TYSA 5EJ3A 4NAFA 1EBGA 4XO7A 3AYRA 5CG0A 4AUBA 2VGFA 5CFCC 4RS5A 1VRDA 4U2AA 3LS9A 4RKAA 4BMEA 2ZRYA 2BJSA 1D2KA 2OWXA 5IRPA 5CSRA 2VD9A 1R9YA 2E9MA 3GVWA 3GTNA 4LU0A 3WD3A 2YPJA 4UFIA 1O5KA 3SLIA 3LNPA 1VRH3 4I0WB 2VFIA 3RILA 1W8WA 1S3HA 2IXIA 3CQ0A 4JR5A 4UTHA 1XIGA 4LF1A 3TN91 1CXLA 3ATYA 3CDZB 4FPKA 1Q6OA 1JF5A 1RHI2 4AF0A 1UR8A 3FLTA 1IWBA 3ALGA 1UCWA 1OQDA 2Y61A 1DIEA 1T7LA 4RJEA 1ICPA 1FPN2 2WQZC 1V0KA 4NAEB 1RJPA 1LJ7A 3USUA 2C1GA 1W54A 4XK2A 3C8NA 1HRI2 4YTSA 5IVYA 4IE6A 5JR7B 2FFCA 4NI8A 5C9RA 1U0AA 1SO5A 4Q7BA 4XMIA 4M01A 3BL3A 4AH7A 4LT5A 2ZEZA 1XOYA 2WNEA 3WQ7A 1CGYA 2G4IA 2XH0A 1DLLA 1TJPA 4GRSA 4NL1A