4CCCA

Structure of mouse galactocerebrosidase with 4nbdg: enzyme-substrate complex
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
644
structure length
640
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GALACTOCEREBROSIDASE
publication title Structural Snapshots Illustrate the Catalytic Cycle of Beta-Galactocerebrosidase, the Defective Enzyme in Krabbe Disease
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 218
structure length 640
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4cccA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4cccA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4cccA01
1OHLA 2CNCA 3WF2A 4DBEA 4I7WA 5AHEA 4HT3A 3GTNA 3EWWA 1F2JA 1KBJA 2PURA 3M5YA 4ZZ9A 2V2HA 2EXOA 4LUIA 1KM5A 1OM0A 4UQEA 3W7JA 2BY0A 3TK7A 3W24A 4P2VA 3VPLA 3UGGA 4AYSA 2XWDA 6CGTA 4KGLA 2Y62A 3IIXA 1HL9A 4R53A 3MI3A 2A3CA 3OBKA 1E4MM 2ZRZA 1ZAIA 1KM1A 2EQDA 3L67A 1CZ1A 4AWTA 3QSTA 1SQ7A 1US2A 5A1AA 4HTYA 3IRDA 2WHLA 2WVVA 1GVYA 2I14A 3F5KA 3N9RA 3ZM8A 4O12A 2FHCA 3OIXA 1J01A 4AD1A 4M1RA 1UWIA 1E43A 3EBVA 1XD1A 1IIGA 3DHFA 2GVYA 1LLOA 2RHGA 1K7XA 1KW1A 1NOWA 1ISWA 2J6XA 1QO5A 3GAKA 3DECA 5E6YA 8A3HA 3NL2A 2JKAA 5HMSA 3SY5A 3HMJG 4E4PA 4XBSA 3L4VA 2P0OA 1KWGA 4PEEA 3U8GA 4CN6A 4F8XA 2WSQA 1X1OA 3QJAA 1Y4WA 3NQAA 3ZR6A 4M6VA 3BCFA 4W86A 1J18A 4LPCA 3L66A 4KFOA 3B9DA 1NFBA 5I78A 2C0HA 3OVPA 4HNUA 3ZJ8A 1QVBA 2GJNA 4TIMA 5TIMA 4DPPA 4JTSA 4MVAA 5D37A 2VRKA 4OE7A 2W66A 5K4XA 1JCLA 4O28A 1SO6A 1LOQA 5AFDA 1FUYA 3NJ3A 4MAZA 5IFPA 2AEZA 1S5TA 2A4AA 5BRBA 2A7PA 3N18A 1GVQA 3PG9A 2DT2A 3APGA 4O53A 5EBAA 2WJZA 1N7KA 1WQ5A 3ABRA 1CXFA 4NZFA 3LMYA 2E68A 3AHVA 2CESA 4URIA 5FKBA 1HNYA 3NIYA 2VJXA 3IANA 2X05A 2PBOA 1VFUA 3BCDA 3SCQA 1GVIA 1V6XA 4ZQCA 2B7QA 4JN6A 5LNVA 3W25A 2E09A 1LORA 1KGXA 4UR7A 1CDGA 4TXEA 3P74A 3AXIA 1ONRA 3TTYA 1GWJA 4JY9A 1D3CA 4IMFA 2CKRA 3BLIA 4FX6M 2DIEA 4UUIA 3EDFA 2CBUA 3W7EA 5A6BD 1J11A 1D7FA 3UWZA 1WZMA 1WZKA 5KZDA 3W88A 2PWEA 1JUEA 2VC9A 2WB5A 4ZQRA 4WOQA 4LVGA 2R14A 4OU1A 4JDBA 2Y8VA 1CW2A 4O1BA 4Z08A 4IPIA 2ZZ1A 3I65A 1UWUA 1ZJAA 2VI0A 1WAWA 1XC6A 2C15A 4IM4A 2FHBA 3CWOX 2AMGA 1C91A 4CKQA 4JAWA 3LDVA 2Y24A 2C0AA 3HPZA 5BCAA 1JZ3A 5AYXA 5G2IA 1OSEA 1WDQA 3QH2A 2XFWA 1CIUA 3NNTA 2PBGA 5CGTA 3O9NA 4MUZA 3A22A 3O05A 1JAEA 1V02E 1GQIA 1WDRA 2XJ7A 2AAAA 1XCFA 1NOUA 4BR1A 4LS1A 2XVKA 4S3KA 3OVRA 5KTLA 2WANA 1BG9A 3MYPA 3QGVA 4AZBA 4PRWA 3PHAA 4RKAA 2GSJA 5D8ZA 5D2WA 2GQ8A 3EWZA 1EPXA 2ZX7A 4GUGA 3OB8A 1UD3A 3MMTA 3C61A 4Z2LA 1KXQA 2BLEA 1UR4A 3IMMA 5FF4A 4LY8A 3WEMA 4I7UA 1FCQA 4JYEA 3AO0A 1FOBA 2WVTA 1BWLA 4ZXLA 3QC3A 1UOKA 1MWOA 4M8UA 4NX5A 2VKZG 5EYWA 5J5DA 5M3WA 2PWDA 4QLKA 5FF7A 3WF4A 2PWHA 4AISA 3W7DA 1HT6A 5K7JA 1RPKA 3W84A 2HISA 2V2CA 4W93A 2NV2A 5CPSA 4TVDA 3W4RA 1W9XA 1GOMA 3BXWA 1H7WA 1W37A 3W1LA 3L2IA 3R5EA 2Z0IA 1OB0A 3C0JA 2QMKA 3KXQA 5A8OA 4N4QA 4HPXA 1JQVA 3PTKA 4A3UA 2NWSA 2ZFAA 2ZZ4A 4RJEA 4N02A 4UTIA 1TCDA 3IGSA 5LGZA 1OGBA 1YDNA 3ECQA 2FGLA 4WK9A 4WF7A 2DSVA 3AIQA 4AEEA 2A0NA 2QCDB 5DXYA 4AD2A 3G8EA 1F76A 1QPKA 3THDA 1B3YA 1XKYA 2X0HA 3WNKA 3NSNA 4BWLC 2QCLA 4MJ2A 1TV7A 3GXTA 2YFNA 1TPDA 2DGAA 2VX5A 3NSMA 4NRSA 1LG1A 4NJHA 1OFOA 2Y88A 4YPJA 3QM3A 4HPGA 3SCRA 4KFPA 1ICQA 1ZAJA 3SGZA 3PF3A 4FF5A 3GNPA 3OLIA 3BW2A 1XCWA 2Q8XA 1OG0A 5A6BA 4MAVA 2WAGA 2XFRA 4EAMA 2F7FA 1QI5A 2VEIA 1H60A 2ATSA 1C8XA 1NEYA 1CXKA 2EJ1A 3BLKA 3E1F1 3C2VA 3C2FA 2ZTKA 4B1LA 3TTQA 2J7DA 2A2IA 4EF8A 3TP4A 1SW7A 3QYQA 4MADA 1CXLA 5FI8A 1JULA 4MPQA 2YW4A 2V3FA 3TAOA 5E93A 3NDZA 1QOQA 1QPOA 1J2WA 1OJXA 3IVSA 3TCEA 1W56A 1GONA 2VFDA 2X0YA 4XBKA 1L9WA 3S0CA 1F4AA 5I3FA 5HULA 1M01A 3WJYA 2GDVA 2MANA 2WKLA 2WXDM 4TTGA 2WVSA 4RZ6A 4MOZA 4H8UA 3BG5A 1Q6RA 5CPMA 1VFOA 1TPC1 3G1YA 1P5BA 5EKYA 2XM2A 4HPHA 1FXPA 4UNKA 3KX6A 3SCNA 4Z1CA 2X8RA 4CD4A 3EXTA 1NH6A 1GHSA 3GXFA 3MWAA 4LGXA 4MJZA 3S8HA 1DP0A 1W9UA 3WH5A 4CCCA 2G96A 3M43A 3WQ8A 4BQ5A 1QFEA 3O07A 1DVJA 4Y9AA 3CC1A 5KINA 3PULA 5AB3A 4MTVA 4GI9A 2E8ZA 4C7GA 1TA3B 2XIBA 3UYCA 1VJZA 3POCA 5FKYA 3FYPA 3WSUA 4EIVA 2PI6A 4WSJA 5JIPA 1ICPA 4XZ9A 2BZNA 1R86A 5AYBA 1X6LA 1JD9A 4KKXA 3W71A 4Z2IA 4NU7A 5L6UA 1U83A 2Q8LA 4UTWA 4TUFA 3ZJKA 1K02A 1K8ZA 4IXXA 4H41A 1V3KA 3W2LA 4RZ4A 4NNBA 3OGSA 3CU2A 3A3HA 1F4HA 3SGUA 3WMCA 1ZY9A 1XXXA 2FDSA 3A4XA 3DHUA 3IEBA 2QDHA 4M7TA 5D30A 3RK8A 2BHZA 1BYBA 3B8SA 3OLDA 2H90A 5A8GA 3M7SA 1VPXA 2Z2UA 3LRKA 5DCBA 5I6SA 2VMFA 3VGHA 4QIUA 4F9DA 3TNOA 3MO4A 4GO8A 3TIMA 5CPLA 3TROA 3VD5A 1RV8A 1BFNA 1C93A 2H6RA 3P5ZA 1W3LA 2VCCA 1KTBA 5CXPA 5DFAA 3EXRA 5HR6A 1K9TA 3RDKA 4IMEA 2J9YA 4UTMA 4AC1X 3ALFA 4HSOA 2JGYA 1HJUA 2VCAA 4DO5A 1UCWA 1L0PA 5AC5A 2O9PA 1UD4A 1WBHA 3MHFA 4FNQA 3LTSA 1FCUA 3GNNA 3GYCA 5A8NA 3DI0A 1EWDA 1I45A 3ZR5A 5AYIA 4PL1A 2DEPA 3GB6A 2D20A 1GYNA 1W5QA 3HMCA 1BEUA 1SU5A 1HKKA 4HXCA 4O18A 5C54A 1SYTA 2D2OA 1PIGA 3AS2A 2YYTA 4PBGA 5A2CA 3PY2A 3W27A 3QW4B 2ZRVA 1AVAA 3P67A 1GHRA 2YL6A 1KR1A 1JI1A 4GI6A 5F2MA 2DT0A 1HJWA 5HUPA 1KCKA 1JXKA 4X0NA 3N14A 4PMVA 2QCEA 5E09A 1YDVA 2JEQA 2ZA3A 5AYZA 3FN9A 3MSDA 3W2MA 1SO5A 5LZLA 2VFEA 3O2LA 1HL2A 1W9BM 3BW3A 2HS8A 2PC4A 1WAUA 3LBCA 4X3ZA 3AIRA 2DZSA 3NQMA 1PBGA 3M41A 4R33A 4R34A 2ZZ5A 4PC8A 3QPYA 2NT0A 3KRUA 3FA5A 4IMDA 1WCGA 1JRBA 2ZQ0A 1FXQA 2QDGA 3F1QA 3VE7A 3W1MA 1EHNA 1UR9A 4CCDA 1ITXA 1NQ6A 5HOSA 1K7EA 1PE1A 1W5MA 1J12A 1AW2A 1V3LA 5A6KA 1JUBA 3LCGA 5DBTA 2O92A 1GT8A 2B7OA 2DSUA 3SCPA 1HXJA 3W87A 2A21A 1J9YA 1G0CA 4UTTC 3BO9A 2EPMX 1ZAHA 3GR8A 5TQLA 1BGGA 2WBKA 5A94A 3NR0A 1HN1A 3STEA 3OEXA 3OZPA 5C70A 2DU2A 2C16A 2IQTA 4L4LA 4Q22A 4LQ1A 1THFD 4LV9A 5IBXC 3MI6A 3GH7A 1E1FA 2XN0A 3EDEA 4M80A 1WX0A 2ZXAA 5KZMA 5ABEA 3GH5A 1YXCA 2DJLA 5KMYA 4AZIA 1E73M 4TX8A 2C18A 2CFFA 4WQ6A 3TJXA 3ZJ7A 1W1ZA 3PTMA 4AF0B 2Y7GA 2YOCA 3N11A 4ZMGA 2V38A 3W2JA 2DSZA 1VEPA 1UZ1A 3T09A 3DFQA 3FHQA 3UR8A 1QPQA 1Q3NA 2C1HA 3MI2A 4O1AA 4PTWA 5CZSA 3ARWA 3SCTA 3LDKA 3M1ZA 4B9YA 3W7RA 2Y2WA 4GZJA 2D3NA 1NAL1 3K8KA 3GIYA 5HPOA 1XYFA 2CLOA 2V82A 3NQFA 3GM8A 1EQPA 3PB0A 1K9EA 2Y85A 3DHPA 3L4TA 4OUEA 4YHEA 4QFUA 4UCGA 1HTIA 2J24A 1NARA 2V5CA 1RZMA 1LM1A 2ABBA 4JTGA 3AS0A 4JGDA 3UWQA 2OSWA 3N2XA 3Q58A 1PIFA 2IXVA 2WC4A 1KM4A 1HP4A 2D24A 1H7OA 3R12A 3QRHA 3CLMA 4GRSA 1JFXA 2BXVA 4AWUA 2WW5A 1LJYA 1PS9A 1QWGA 3KL3A 5EB8A 4JYDA 5I3HA 4U33A 3F4NA 4NJIA 4Z1AA 3L65A 3MUAA 3GBEA 1GJWA 2BY1A 2G4FA 2E6DA 1HJQA 1LTDA 2X1RA 2YL8A 3PZGA 3STGA 3QW3A 5FK7A 2VXNA 2WSRA 4MB1A 1V3JA 2VTFA 3M07A 1H49A 3WUBA 4QISA 2E77A 4NZCA 3T2QA 4NRRA 3NQGA 4JQTA 4FHAA 4UR8A 1YHTA 3MV01 1W31A 4HNVA 2C6QA 4O57A 1I2OA 3WQ4A 2WHJA 1Q6FA 3OVQA 3NUKA 1E6XM 5I5RA 4WLCA 1HFBA 4V2XA 4BFAA 4Y7EA 2D73A 3BH4A 4FF7A 1C8VA 5BOOA 1ISZA 1OFRA 2FLIA 2J8FA 2G95A 3T4CA 4J28A 2HVMA 3GDRA 2WWDA 3THCA 3ELFA 5FKCA 1HO4A 3G3MA 1TR1A 1TTQA 3GR7A 1OFQA 3B03A 2ZUUA 2JFEX 4D6CA 1B90A 4WKAA 4MKNA 3G1FA 3W07A 3VDHA 3WIJA 1HX0A 1CGWA 1F74A 5A6MA 3ARXA 1GVSA 1J0YA 4K39A 2QHAA 4IXHA 2YR1A 4OGZA 1SUXA 5SWUA 2BXZA 1UKSA 1LROA 3WUFA 4NSBA 1WE5A 1E6RA 1C8YA 1DKWA 4KWWA 1EO7A 5CPNA 4C7DA 1UKPA 4JFTA 3UEQA 2V3DA 3W53A 2XN2A 7TAAA 2X1SA 3OG3A 4AB4A 3UG5A 3KE0A 2J77A 3STCA 2FH8A 3M6YA 4IGHA 4NQ1A 2V3GA 4HA3A 2FJKA 4HZ6A 4RE4A 3IIZA 1CECA 1H0IA 5FF3A 4NX0A 5ANNA 2QCNA 1PAMA 4LWWA 3RMJA 1I4NA 3HO8A 3THAA 1E9LA 4HZ7A 3JUGA 2X1IA 4RE3A 2R8WA 5FESA 2DORA 1SPQA 1XDLA 4WY0B 3IJ9A 4AZCA 4JHOA 1JYXA 5U4NA 3VKJA 1QI2A 3G1XA 3LIHA 3PBUA 3BG9A 3L4WA 4PYSA 2HSAA 3L0KA 1EIBA 2WK2A 1JDAA 3TV8A 4QSHA 4AD3A 2QJIA 4JICA 1TRIA 3C6CA 5D8WA 1JD7A 3M0ZA 5BRPA 4UR9A 1JZ2A 3ZO9A 3NOEA 2X1TA 1I2QA 3VMPA 5LHEA 1W3NA 1W1YA 3ABQA 1J0ZA 2O9OA 4JFSA 1B3OA 4NI3A 1HKIA 4ML4A 1E51A 5F4WA 1BPLB 4QHZA 2DZPA 1ZU8A 2GVLA 1Q6QA 3G1HA 3MMUA 4PCFA 4FB7A 4XZBA 4AHOA 3ZJ6A 2OYKA 4FXSA 3CZKA 3MW7A 4O1DA 3I3DA 4QITA 2YBTA 1VJIA 3LHWA 4NJJA 3B0UX 2AEYA 1OWQA 2E4TA 2DZWA 4W5ZA 3SUVA 1SO3A 3LERA 3WD0A 1V08A 2J27A 1JZ7A 1RD5A 2NW0A 3M7WA 4H8VA 1Q6OA 1E6NA 2JIWA 1VEMA 1H62A 2DQXA 4PMRA 1CXHA 4JFUA 5K3VA 4OBSA 3SCWA 4V28A 1TO3A 4JTLA 5AHNA 1N82A 3ZOAA 4HU0A 1L2UA 1FH7A 3VD4A 4FFIA 3AICA 4QLLA 4DUXA 1EDGA 4P7LA 3K1DA 3L5MA 1ZBKA 3H3LA 4GBUA 4OQVA 1OYCA 3W22A 4AIEA 4GQQA 2D23A 1X1NA 4LVAA 3EB2A 1HJXA 1QR7A 2WHMA 3WKZA 3NQDA 1LOLA 2G41A 3EYPA 4AZ7A 1AMYA 2GJXA 4A2SA 3AZTA 4U2ZA 1CPUA 5D2YA 3C56A 4OBTA 2DPEA 2OCZA 4W9TA 1E6ZA 3L5LA 1GEQA 3N19B 1PV8A 4JL2A 1H5YA 1B9ZA 1JCYA 1VH7A 2YDRA 1JF5A 3AMGA 4FIRA 4OBRA 3M46A 4QP0A 3TSBA 5I23A 1Q6DA 5A2BA 3NZRA 1M7OA 1W54A 3MYOA 1DV7A 2YXGA 3UWYA 3AOFA 3OIHA 4A4AA 3VIOA 4DWSC 3W81A 2PB1A 1RQBA 3NDOA 1XCXA 3BMVA 4ML9A 1JCMP 1Y9GA 1V5XA 2WSKA 3SW6A 1DJQA 1ST8A 4J3TA 4AXKA 7A3HA 1TPFA 1CBGA 3GYEA 1UYQA 4JKLA 2YDAA 1J10A 1TZ7A 6TAAA 1OK4A 4JY8A 5F4SA 1GTHA 1E4NA 2J88A 2WMFA 2ZICA 3W1QA 2CCRA 2ZZ2A 1NP0A 1XFBA 2NWRA 4A22A 1GOKA 4BA0A 3VE9A 4QCFA 2OWCA 3NQ8A 4MY8A 1XH2A 2BHYA 1HP5A 1B1YA 4YWIA 4XKYB 4X22A 4MNMA 5F1VA 1QBBA 4NT0A 3JR2A 3P8IA 1R85A 1RVGA 2ZBTA 1Z44A 4D6EA 3LCXA 1XM3A 3NQ2A 3R13A 3MUIA 1YADA 1LRTA 2XSAA 3W85A 3PUOA 2D22A 4AZ6A 5HWNA 4O50A 3NXFA 5DY2A 1M5WA 4W7VA 2QKFA 2Q8ZA 4IWWA 3EEGA 5BWFA 4FNPA 2QPUA 3VMNA 4IOTA 2E3ZA 2GQAA 3PUEA 3DU0A 3F5LA 4PMQA 3VCRA 5FIXA 3WEOA 1O95A 4J3WA 5BXRA 3ARPA 5AHFA 1DWJM 2VNCA 1QO2A 1W2PA 4GUFA 4ATLA 3NO5A 3CBWA 1VYRA 1LBFA 2ISWA 3M5VA 1FH8A 3QMTA 1YXYA 1G6CA 4PL2A 1S46A 2W5FA 2FB2A 3CUJA 3AIEA 2G8ZA 1KLYA 3HJZA 4XUGA 4YL2A 3ZWTA 5LHFA 2E9BA 1EUAA 1VCVA 1X1ZA 3LXCA 3O8AA 2FDMA 2WMIA 2ZX5A 3K4DA 3MKKA 4RZ5A 3IIVA 3UWVA 1MSSA 2TRSA 4M6PA 2NX3A 1XDMA 1EQCA 5D32A 3W23A 3W2NA 1WNOA 1FWRA 4K6AA 1NSJA 3NSXA 5HWMA 4FNUA 4X0VA 1A47A 1E3XA 1HUVA 1A5BA 3CWNA 3CUHA 3POHA 3RMEA 4DWSB 5LNWA 3RPMA 1XUUA 3VINA 2OSXA 3UPWA 1G4SA 1W5NA 3A5VA 3KVJA 2IUZA 3EDJA 3N12A 1OFBA 4PTNA 4BQ3A 5A8PA 3WL0A 2FHFA 3A4AA 4CQAA 3SURA 4MYAA 2JEPA 3NPWA 2W63A 4XTDA 3LTPA 1N8FA 3WJWA 3DKJA 4GIAA 1DWAM 1H1ZA 2J47A 2CBIA 1IXNA 4Y6GA 4NF7A 3G22A 4EK7A 3GDLA 3VIGA 3CHDA 3WQVA 2YKKA 2TYSA 1Y9MA 4ADTA 2XYLA 1P0KA 3I7QA 3UR7A 1LF1A 4E8CA 3ARRA 4J7RA 2YSWA 4B15A 3SUTA 3DBPA 2EAWA 1E1EA 5JBEA 2VEKA 2QJHA 4U28A 1OFPA 2TSYA 2CYGA 1UH2A 1IGSA 3I7RA 2DH3A 2E6AA 5IXEA 2GUYA 2CIPA 3CTLA 5EY5A 2W79A 4Q32A 3W70A 4EKJA 5DBUA 4UIOA 2NV1A 5CG7A 1KFKA 3W7KA 4PSRA 3W38A 3B9EA 3FEMA 3LPFA 2AAMA 1FY6A 3D3AA 2XFFA 3VIHA 4E2DA 4UFHA 1DORA 4W8BA 4P7NA 4HN4A 3T08A 1HF6A 4W85A 2NXIA 2BNJA 3GXDA 4CCEA 1A50A 3BGJA 3L2LA 2A6NA 1KM3A 3MS8A 5KZEA 1W3TA 5F4XA 3W29A 1YLVA 2RFGA 3LEMA 2E9LA 1QBAA 2UY2A 3L4YA 2VQTA 4QLJA 2FFCA 5C5YA 4UZSA 3HGJA 3GXPA 2JIEA 5D9PA 4DPQA 1PIIA 1VR6A 1XBZA 3PZUA 1K03A 4ZXOA 1TREA 4B3KA 5U7SA 4F9JA 2EKCA 5C8BB 3VGEA 4N9CA 1PX3A 1KBKA 2XWEA 2ZRWA 3EX3A 3DFPA 1UD5A 2WYSA 4B9ZA 2GOUA 1CGVA 2GJRA 2YYUA 3LX9A 1GZJA 5A8QA 4KRUA 1CGUA 3TFXA 4YCPA 2ZUVA 3WK2A 1HKJA 1QNRA 3FLUA 2Y63A 5DLCA 4OZOA 1JFHA 3MHUA 1W9DM 3M6DA 3S6TA 1GVFA 2Y89A 3CB8A 4K38A 3ZWSA 2QJGA 3P61A 3T40A 1O6IA 1UA7A 1W3IA 3AHXA 1XBXA 3PC0A 3WH6A 1FCVA 5I77A 1O94A 1G94A 8CGTA 2NT1A 1DJNA 1MQRA 3U14A 2R94A 2EF9A 4LT9A 1RH9A 5FF0A 1H1NA 1Q6LA 2P10A 2WMJA 2VT0A 2EPHA 1W3KA 3PN8A 4J27A 3T7VA 1QNVA 3W1NA 1Q45A 2PE4A 5CSRA 4DO6A 2ZXBA 1JAKA 3GZAA 4UTWC 5A95A 4M81A 1NOFA 3SCSA 1F6PA 3O06A 1R46A 2GPTA 4IMGA 4PUDA 1O5XA 1W3JA 2WBGA 1FWNA 2H3BA 4PCTA 2XTKA 1VFMA 2ZE0A 5E0CA 3WNNA 3W3OA 4JX4A 2O9TA 3HGOA 4TU1A 2W4XA 3GNDA 1GZGA 4CD5A 1QNSA 1R2SA 2A7RA 5F7UA 4MYXA 5IM51 1UUQA 4GO9A 3G0UA 3PSVA 1IIHA 3A23A 3C2EA 3LXBA 4CD6A 1ADOA 2VFIA 3PBWA 1BWKA 5HNRA 3BMWA 3CZJA 2YA1A 3TH6A 5IHRA 4IMCA 1GOXA 1VZWA 5LSMA 1V02A 4Y8FA 5I3DA 3DFTA 3SCUA 4YN5A 2CLKA 4UNIA 4JIQA 1JDDA 4N9BA 5AC8A 3FW6A 3LCWA 5ABHA 5DMYA 3PZVA 1G4EA 3EX6A 1A5CA 4N9DA 3I7SA 4ORMA 1ZENA 3VI2A 5MHBA 3W1XA 4JHZA 4UQ9A 4GE8A 5A2AA 1HIZA 5DCDA 1V6YA 1BHGA 2A3BA 4HNTA 5A6LA 1KFEA 4HZ8A 5FL0A 1LP6A 3W74A 2YZRA 4JX5A 2JBMA 3I3BA 4Q33A 4PMYA 5A6SA 1R7AA 3VDCA 1FFQA 3ZSSA 2VX7A 2YBUA 1WOBA 1ZCOA 3KVLA 3RJXA 4K8EA 3WQWA 1EHAA 3C4UA 2V81A 2YCEA 2Y8KA 1VLWA 4D6JA 5HR7A 1XH0A 4HMEA 1TPEA 1U2YA 4LYQA 1EDQA 3S1VA 3LCLA 5D38A 3PB2A 2C8NA 4IPNB 1KFJA 4LYRA 3RNDA 4C1KA 4O16A 1G67A 4O17A 4AVFA 4W84A 4LS0A 2XFYA 3P80A 5A6JA 1XD0A 5E9AA 3BGGA 1KXTA 4JTIA 4JX6A 1GG1A 4GXMA 2QV4A 2ZA2A 2X09A 4KMQA 3S1XA 4W7WA 2F84A 3E9AA 1GG0A 1VGAA 2Z6JA 2FQIA 3MBDA 3SC7X 5G1TA 3GDBA 1DOSA 3ARQA 4CNOA 1EP3A 4R7JA 2AGKA 3BLEA 3ATZA 5TD4A 2XQRA 2TMDA 4N4PA 4EWND 4WUIA 2XG9A 3DFOA 1EEPA 2OWWA 3LHZA 3CHEA 4MFEA 3IGXA 2EPOA 2ATMA 4S3JA 5K4ZA 3W1TA 1ZJBA 1KXVA 2WNNA 2WQPA 1D2KA 3ARVA 3EDDA 4XZWA 3K8MA 5FMDA 5HBFA 3PAJA 3PIJA 5GNYA 5H2ZA 4GNJA 1JNDA 1Y0EA 1W2VA 1FP9A 4UQBA 4M7SA 2QF7A 2E1DA 1EH9A 2DH2A 3N17A 3OSDA 1CEOA 1U33A 3FJ6A 3G1DA 2NUXA 2QCDA 4HIBA 1KA9F 1I1XA 2XVLA 2NX1A 2JKEA 3BAJA 1E40A 4FIQA 3CEUA 3LRMA 1W5PA 2GQ9A 3G0SA 3BAYA 2E0PA 4D2JA 4CVWA 3ARTA 1VLIA 3EMZA 2C3ZA 4OOUA 1FDJA 4AHPA 3RIKA 2VL4A 2V0TA 3MUY1 4ICNA 1XH1A 1KFBA 3WN6A 4U5KA 2XN1A 4RLIA 3FOKA 5M5DA 3A9IA 5D9NA 3WQ5A 1AW5A 3TW6A 1WDWA 3M47A 1B31A 1OFAA 2IXUA 2WNWA 1CWYA 3CH9A 3CMJA 4CU8A 3KWXA 4MFDA 5E1QA 4TOQA 2YGYA 4WKHA 2CZDA 1GVRA 3LCIA 4PODA 3W1AA 1HJVA 5J5RA 2CBJA 5GNZA 5EMUA 1K9DA 5D33A 3AHYA 3A21A 3EX2A 1WP6A 1VJSA 2VX4A 3GDTA 1FDZA 4PA8A 4TVCA 1KQZA 1NWSA 3AFBA 3QOKA 4JL1A 4JIEA 1XYZA 3E0IA 2CLEA 1VFFA 3I68A 1P6WA 1C92A 2CITA 3AZRA 3A4WA 3CUFA 2WLZA 1CYGA 3RLVA 4TX9A 4QAWA 3LOTA 1ZBCA 1W1VA 1KM0A 5HPCA 2J4GA 3ATYA 1JL8A 1LLWA 1GVOA 3DYPA 1BAGA 2Y7DA 1B3ZA 1TCMA 2UY4A 1OCQA 3HB9A 1PZ3A 1YTKA 1K8XA 4MY1A 3VGDA 1SSGA 4RK8A 2EBNA 2J25A 1JG9A 1JCXA 4GUIA 3CZEA 5CJ5A 1KFCA 3G24A 3MU7A 3DXIA 1TA3A 4TR9A 1V3IA 5CZJA 2YDSA 3RILA 3II1A 1TPWA 3HQ1A 4XB3A 1UYPA 1J0IA 1UBSA 2X30A 1WDPA 2E8YA 5FMCA 3C2RA 4FK9A 2JF7A 2YIHA 1KGUA 1AW1A 1DBTA 2J78A 2Y7EA 3TOPA 3VD7A 5FEWA 1BVNP 4MNLA 1Z42A 5AHLA 3NEVA 4RXGA 3KL0A 3WBEA 3Q2DA 4UCFA 1JZ5A 4UQDA 1VRDA 4AIUA 4MNKA 5A3HA 1LZOA 1S3HA 2YFOA 3BLFA 5HUOA 4F79A 4QDMA 2BY2A 2J74A 5D02A 4BWLA 5CSUA 3GVGA 3QFEA 4Q4KA 2WPBA 4S2BA 3MBFA 4JXCA 4KH2A 2YA0A 2J9ZA 1UJPA 1DQWA 3CHCA 4GKLA 2VO5A 3AS1A 4P7OA 1EX5A 1TPH1 2G3MA 4X2RA 2A3EA 4LRTA 1SZNA 5F2GA 1T99A 3FKRA 3SI9A 1UWSA 3KL5A 2NUWA 3O6CA 4Z0SA 3TC6A 5GVJA 2C19A 4NZJA 1Q6GA 1PL9A 2QUTA 3HGSA 3AYSA 3PZOA 4M56A 5JBFA 1G5AA 2Z1BA 3PTQA 4MPKA 3CO4A 3LHYA 4CLMA 2J8GA 5A5WA 4GQRA 3WFZA 2BSLA 2DT3A 5AY7A 4AZZA 2AQWA 3A47A 3VKKA 3VU2A 1UKQA 1WB0A 1H7PA 3S5QA 3IK2A 1V6UA 4JKKA 3NQCA 2VOMA 3FYOA 3VOCA 4A3HA 1NVMA 3MMDA 2Y70A 4HPJA 5D04C 4ZQMA 3HPSA 3LDRA 1XV8A 1FX6A 4UOJA 1G4PA 2VZTA 1M7PA 3TW7A 3CIVA 1UUOA 4FLQA 1EA9C 4Z2JA 3ZQ9A 1JZ6A 5LA1A 1V6WA 2XVPA 4O4VA 5TBOA 1H4PA 2VR4A 1R2RA 3WNOA 4H8HA 4YLWA 4FO4A 4W7UA 4BI7A 1CI1A 2J7CA 2B7NA 3UETA 2BXYA 4N0RA 3AIWA 5CPOA 2G3IA 1PHQA 2CWNA 4AD0A 3LCFA 5T26A 1UH3A 4DUVA 2V9DA 4PTMA 4UTJA 4O11A 1ME7A 2WCGA 1QHPA 1H3GA 1T0OA 4W89A 4BQ4A 3VIFA 4Z2GA 1OIFA 2A1YA 1GQLA 3CMGA 3DGRA 2X1UA 3W7OA 1QPNA 4YHGA 5A69A 2DZVA 5AN7A 1VQTA 3VTRA 3DZ1A 3W37A 1QW8A 1W9PA 3WNPA 5I0DA 2B0MA 3AHTA 2EEXA 2QAPA 5JUVA 2UV8G 5D05A 4QM1A 4XUYA 3RJYA 4WY0F 1MQQA 4LUJA 3VIKA 3QOMA 5AYYA 3B4UA 2WSYA 3W7IA 4NNAA 3N04A 4HA1A 3CEPA 4AF0A 4B3LA 5FMBA 1E0WA 4KWUA 4UTFA 4GJ1A 3VNDA 1BQCA 1LBMA 1R8LA 1H63A 2PRLA 4ONVA 3GDMA 3CLWA 1ME9A 4H3DA 5LNRA 4OV9A 4LX4A 3WJZA 4J3VA 2WC3A 5LYRA 3OG2A 2HMCA 3F4VA 4TO8A 1WO2A 1U5JA 3M5ZA 2XVNA 1A5AA 1H50A 5G4WA 2FPTA 3PIGA 2J9XA 1UWTA 4DXVA 3LM7A 3DKLA 4M82A 3WD3A 2BS9A 2VR5A 3CQ0A 6TIMA 1W32A 3KEHA 4Z2KA 4LRSA 3HJEA 2RDTA 7CGTA 3BPWA 3TXZA 5D09A 2E5DA 1IT0A 1GQJA 1VCFA 4WJEA 2XGBA 4JKMA 1VYPX 3TQ0A 3CUGA 1TJRA 4FNRA 3VDAA 4HHPA 4N9EA 2FIQA 1W1TA 3SUWA 3HG3A 3WUEA 3SCOA 1H7RA 3NPXA 3PZTA 1TUXA 1IZJA 3WF1A 2ZOXA 1KLZA 1J0KA 1J0HA 4ZE4A 2RGLA 3NM1A 3RO8A 1GPFA 3CTTA 4JFWA 4M5PA 2Y5EA 3WEZA 3PM6A 3UPBA 2BFGA 3TTSA 2C7FA 3B8DA 4AH7A 3WDPP 3U57A 2E40A 3C8FA 5DCEA 1DTUA 1X7FA 4RXFA 1KB3A 3STFA 1DHKA 1RPXA 1MFUA 4AY1A 2CZEA 3WD4A 1EUNA 3B9AA 1JF6A 3AYRA 3DAQA 1G7VA 4JZ5A 5FEXA 3IGUA 2DIJA 3AMKA 4ZQPA 2VCBA 3UD6A 3SUUA 4UTTA 3FJLA 4JCMA 4GFSA 5D2TA 4H2CA 3RU6A 1MW3A 1V0NA 2I9EA 4JTJA 5C71A 2OMAA 2V8ZA 4K37A 1OT1A 3HN3A 3NCOA 1OK6A 4O14A 4DF2A 5IBXA 1V03A 3LV6A 3PG8A 1K6AA 1GW1A 1W1PA 3ZS4A 4IPLA 3QZEA 3TFCA 2OJPA 5K2ZA 1E3ZA 1EIXA 1GUVA 1E4LA 4OWGA 3T78A 1MFVA 2J7FA 3C2OA 3RF9A 3W7NA 2GJXB 4D6GA 1HVQA 5BROA 1XBVA 1XUZA 1TPUA 4TVUA 1UKOA 1AQ0A 3BSHA 1K7FA 2A5HA 1G4TA 4ALDA 3TJLA 3ZFHA 3OHIA 3ALGA 1JYWA 1US3A 3H53A 1R47A 1X6NA 3KRZA 5HJLA 2QPSA 3FIGA 4AMCA 4NJKA 1JCJA 4HOXA 2DZXA 4FX7A 1MW0A 1WZLA 1MVYA 3ARZA 3Q94A 4QJ1A 3QHMA 5BRQA 4G1KA 4NXSA 3PZIA 4LW7A 2D0HA 1SZFA 2VOTA 3D5HA 2VVNA 3S1WA 4AW7A 4WZHA 2B31A 4UOQA 2WO5A 3EWBX 4ADUA 4D6HA 3W6LA 1H61A 1FWTA 4WY0A 1D3GA 3TA6A 2CHNA 3RWKX 4FMVA 4TMCA 1LQ0A 5CPQA 3WUGA 2UY5A 3CZGA 2NXHA 3OA3A 3S5YA 3W7HA 1GQKA 5FCZA 4ZL1A 4WXYA 4P7QA 3LTYA 1OINA 5I3JA 1JUKA 2FH6A 3EX1A 4P8XA 4CNNA 4CUCA 1SW0A 1CGXA 2W92A 2ZUWA 1XGZA 1Q6EA 1PX4A 5ABGA 2DSWA 1ZALA 1C9DA 5FF2A 2WNQA 3JRKA 5F2LA 2TAAA 3ANYA 3MUXA 1OX4A 4UQCA 3RM8A 3P8JA 1JI2A 4D6FA 4QQ3A 3KVMA 3DYMA 2V2DA 2YPIA 3GKAA 2WNZA 4PFMA 5GPRA 1NWRA 3F5JA 4R5EA 5FD0A 4KWVA 2VVSA 4H6KA 4POCA 2D0FA 4MB4A 1PHWA 4HSNA 3HG5A 3CHVA 3U2OA 1I1WA 1XL9A 3GH4A 4HU8A 3BLPX 5LNSA 3BAKA 1FWSA 1LG2A 5D2XA 3N3MA 3FAXA 3MUZ1 1OFDA 1ZJIA 1CLVA 1KXHA 4LVDA 1K3UA 2YJQA 4UQAA 2ADEA 2H8XA 2E5BA 4AMAA 3AXXA 5AHMA 1E5JA 5AC6A 1NF7A 1ISVA 1EDTA 4RL3A 1R87A 3AISA 1YDOA 2PWFA 4N2YA 2DP3A 3GZ3A 2FGZA 3W83A 1DWGM 3PR2A 3AQUA 4UFMA 1GTEA 3SFKA 3TKFA 3NL3A 1LBLA 4U2YA 4CVUA 4UTHA 1VF8A 4UFIA 4IPJA 3USBA 3WELA 1W2TA 2ISVA 3FKKA 4MDOA 1YPFA 2H3DA 3NG3A 3GDKA 1B3WA 1WXJA 3BARA 2E9MA 1TV5A 1UB3A 3IIPA 4DO4A 1OBAA 3S1UA 3S9YA 4IX0A 1ISYA 4PCSA 3WH8A 2VURA 5BMWA 1PZ2A 2GK1A 4CU6A 4HMDA 2OSYA 3CPRA 4MZ1A 1FQ0A 3ZR4A 1GORA 1SW3A 2WVVB 1V0LA 1UWRA 4DWSD 2YW3A 4O52A 1MXGA 2EO7A 3L21A 2ZYFA 3N1AA 1ZNNA 1H7XA 3WH7A 1MZHA 1KBIA 3NA8A 1TTJA 4MLJA 3H55A 4UXDA 2EHHA 3W7CA 4JCLA 2BVDA 4V27A 5K9DA 4B1MA 3KAOA 3TC7A 4LC6A 5I3IA 3N13A 3LRLA 6ALDA 1GOIA 4ACZA 3DHDA 3N2MA 2VZUA 2W0UA 3NPVA 2NUYA 1UD8A 3GK0A 2ADDA 4YMZA 4QNEA 2WCAA 2Z1SA 4M24A 4MLRA 4GWEA 2CHOA 2WOQA 1L8NA 3BAIA 7TIMA 1RQEA 4Q7NA 2V5LA 1XRVA 4S2CA 5LGXA 1V3HA 3U7VA 2VEPA 4MZYA 3T44A 2NLIA 2EPLX 3MP3A 1DQXA 3W82A 1LRNA 1XI3A 5CLTA 2Y7FA 4AEFA 3W2UA 2W91A 4BQ2A 1BSIA 2QAFA 5DELA 1XSJA 3DFNA 3B06A 3UQNA 1TSIA 5HXMA 1E0XA 2XHYA 1HVXA 4JDYA 1OF8A 5BXPA 3GNOA 3VGGA 3LV5A 2ZCGA 3SR7A 3HF3A 1UQZA 4KRTA 1JIBA 2WHKA 4XKYA 3IIOA 3S6DA 1NP2A 2WM0A 3VGFA 4WKFA 1OD8A 2XVGA 4JTUA 2QMJA 1IF2A 2ZA1A 4UMAA 1M53A 3WNLA 2EPNA 2JKPA 3THQA 4JTKA 2NSXA 1YYAA 2PCQA 5F1UA 3O15A 4MJMA 1XSIA 4BK9A 5CQ1A 1J0JA 3ARYA 4JS3A 5ABFA 2VEMA 3MV11 3NM3A 4I9AA 3E02A 3W72A 4HMCA 3MANA 2CPUA 2V5DA 5G4EA 2DJXA 1TG7A 2UWFA 1UASA 1UUMA 3KZSA 2R91A 3QMSA 1MXSA 2J7GA 3NVTA 2CZFA 3AIBA 1B3VA 1W3HA 1MEIA 3TU9A 1C90A 2VQUA 3PZ9A 3WD1A 2RKXA 2UY3A 5EPDA 1BGAA 3NMBA 3L2MA 4RX0A 1WDSA 1SMDA 4UOZA 1E4IA 2NZLA 4WD0A 1DEDA 1FA2A 3TSMA 3WFLA 2A3HA 2WPGA 3O63A 3W7LA 1TVNA 3G0XA 3G1SA 3QEZA 4MNJA 1HL8A 1JJKA 4BZYA 3L68A 1W91A 2WMGA 4PSPA 1YPIA 2CLMA 5FOOA 1XBYA 3A6OA 1B4EA 1GPWA 4UTUA 5AHIA 3NQVA 5LNUA 2F8QA 4DWSA 3N15A 2QCGA 2OT0A 1JNEA 5I79A 3WK3A 4K36A 3VNYA 2XIIA 3UY7A 1UD2A 4I7VA 1LDCA 2NXGA 1UA3A 3OLGA 4FFGA 2OX1A 3UNDA 3W73A 3WQ6A 2ZZ6A 3WDQA 1GNXA 1LWHA 2OT1A 3D0CA 1A3HA 2CEQA 1TMQA 1P0NA 2GVGA 3PZQA 2ZRUA 1CXEA 3TA9A 2P1FA 5LKYA 4EQVA 1I8JA 4Y90A 1CLXA 1ODUA 2VRQA 4MY9A 1V3MA 3AIUA 2WV8A 4Z1DA 3O6DA 5DN1A 2CU0A 1P1XA 3VNZA 2JGQA 2QQVA 1ZBWA 1SFLA 2B4GA 1E6QM 1QOPA 5KITA 3W1PA 3W7MA 4EVZA 3GLCA 2WCSA 3WMSA 2YLLA 1J5TA 2VFGA 1DL3A 3QF0A 2H8ZA 3UZJA 3SEPA 1JZ8A 2WKGA 4BF7A 4WIWA 1TTIA 3LHVA 4GC4A 4ATDA 4GZIA 1M6JA 5CPTA 3SSJA 4HA4A 4W8LA 1Z48A 3BGAA 3GAYA 3VX1A 1JGIA 1BYAA 1E0VA 1W8SA 3MO7A 3MP4A 1LL4A 1OF6A 4O4WA 1F73A 3PUDA 5L9FA 1VB9A 1TVPA 3IVTA 4TMBA 1GJPA 5CGMA 4N42A 4U31A 4GI8A 5IDIA 3K30A 1QW9A 3W6YA 3LBMA 1FWWA 1QNQA 2ZZ7A 3VIMA 5CKSA 1H2JA 1RR2A 1W0MA 1HJSA 1V0MA 2A3AA 3VDBA 2J7BA 1UZ4A 2DSKA 2VX6A 1CGYA 2ZX6A 4LNYA 3W6MA 4R27A 3UY8A 1FH9A 4DELA 1UHVA 3P81A 5IFTA 2Z6IA 1MW2A 2JALA 2X2YA 1E6SM 3VD3A 5HDRA 5KZ6A 1XHGA 3VILA 2EGZA 5AC4A 3IJ8A 1IXQA 5D9OA 1I2RA 1TB3A 4MIMA 3G6LA 3KRSA 1H0GA 1RP8A 3UGFA 3GXNA 4ZVJA 3GBDA 3ZT5A 2ZX9A 4RE2A 3N73A 3LI0A 3G8RA 3OA5A 1ZHAA 3T55A 1JR1A 1B3XA 1WV2A 3VIIA 5DY3A 5C6MA 4ZQOA 4IUOA 2B7PA 2W62A 3AMCA 4NJGA 1ZS2A 3EMCA 1RP9A 1C29A 2A7NA 4K7YA 5JBDA 3U1XA 3U7BA 4K7VA 1N55A 2JE8A 5FL1A 1QPRA 4P61A 3VFLA 2WZHA 4P7RA 3BAXA 4W88A 1TQXA 4OKDA 3WDIA 2C14A 4IJBA 4O13A 3LLFA 3LB0A 3SECA 1E6PA 1ODZA 4D1IA 1WZAA 4AXNA 4QNWA 2V3EA 2OYLA 3B05A 4PMDA 4UTKA 1CNVA 4PTXA 3FAWA 3QQ0A 2BX7A 5I24A 2CW6A 1R2TA 1B4KA 2FB3A 4RV8A 1Q6CA 3TTOA 4BCEA 3TDFA 1C7TA 4E0CA 1KFWA 3UWWA 3P82A 3GXIA 4J3XA 2BTMA 4LVFA 4UMBA 3WNMA 1KWKA 3NL5A 3VX0A 3W7PA 2PC8A 1OABA 2AC1A 1UR0A 2CZ5A 3TXVA 3PWAA 1GCYA 3CPUA 1DHPA 3ZT6A 3UXDA 1PX8A 3NQ7A 3GX9A 4WOZA 4MJ4A 1Y7VA 4AD5A 1S5VA 2ZDRA 2W6RA 4DUWA 1Z32X 1KM2A 4YXGA 2ZRYA 5EMYA 3W28A 1KFLA 3SCVA 3SIZA 2FPVA 4M6QA 4Z1BA 2PWGA 3UWUA 3PZMA 2YX0A 2X16A 3KHJA 3W75A 2VFFA 1H41A 1GOQA 2GDUA 2RDUA 4XX6A 2ESCA 1WKYA 2NX9A 2VRJA 3WBAA 1DWFM 4PUEA 1QI3A 1VIWA 3B0VC 3ABSA 1CTNA 3OLEA 4ZENA 1TPVA 3WY1A 3AS3A 1R30A 5CZ0A 1NM9A 4HOZA 4FX8A 4PMOA 4UFKA 1VAHA 3FFSA 3NL6A 3WL1A 3NPUA 3F4WA 1BKSA 1VRXA 3IAQA 2D0GA 1CXIA 4U3AA 1G69A 1ZFJA 4CQ9A 4JFVA 3W1RA 3IV3A 4OV4A 1O5KA 3MMWA 4QCEA 3LLDA 2PRHA 1ZB5A 4AZ5A 4D1JA 1E56A 1H1YA 2ZX8A 1BLIA 5EFDA 3WJXA 5GNXA 1AMKA 1F6KA 4OHQA 2D1ZA 1ITCA 5M03A 3BK0A 4WSKA 1VBUA 2QUVA 4DF0A 1OFEA 5HWJA 2WSPA 1H11A 3W86A 3IVUA 2OYMA 1AQHA 3LHUA 2ZUTA 2AOSA 3UERA 5D9MA 2QEZA 1F7BA 2DT1A 1VHNA 3AROA 4E2OA 1AL8A 4CGTA 1CGTA 1IXOA 3LFIA 2EPKX 2XPKA 3WJSA 1E70M 2JF6A 3WMBA 3BW4A 3BAWA 3S5NA 4LOCA 1KV5A 3TX9A 3WDHA 4X9YA 2QCHA 3E96A 3L5AA 3CUIA 2CLIA 1OIMA 1I75A 1W9VA 3DH7A 2QQUA 1VBRA 4NXKA 1CENA 3OZOA 3NAVA 3UXAA 1JZ4A 1VYSX 4FNTA 1LL6A 3PS7A 5CG0A 4ZEPA 1PJ9A 4K68A 1EB3A 4W5UA 1EA0A 3FXYA 4PEKA 5D2VA 4FEZA 1MQPA 4OIFA 3VO0A 3UZ5A 3GNRA 4CU7A 5M17A 4O8RA 2Y4SA 3HBKA 3P5YA 5C55A 3MHGA 5CZKA 3I6RA 2FPYA 4M19A 1UD6A 4DF1A 3ARUA 3MJYA 3L4XA 1J4EA 3NZ1A 4H04A 2GJLA 4A29A 5DEZA 3WDRA 1SFJA 3UCQA 1Z41A 1EP1A 4U4MA 2ZXQA 4UFJA 4L4PA 1H5VA 5ABTA 3EWXA 3AI0A 3LXAA 4DQWA 2YLAA 4UZUA 5I2UA 3CIWA 1UR8A 1VC4A 3PVFA 1C8QA 1GOWA 2CLLA 1PPIA 5DT7A 3W1UA 1JYVA 2QCCA 1F5ZA 1JQXA 3KF3A 1TMHA 2WKJA 3NYZA 1QI0A 2CETA 3AHZA 4P8VA 2QUUA 3M16A 4LXFA 3RM4A 3HPXA 1OX5A 1ISXA 3AXHA 3AIVA 4JTFA 1M04A 4PMNA 5BW6A 3BSGA 4W87A 4AIOA 3EWUA 2BVTA 5DO8A 5FIPA 1MEWA 3WF3A 2O7QA 4LTSA 1QOXA 2WWCA 3OGVA 3T2PA 3ZIZA 4EANA 5K9CA 3TR2A 1HKMA 1QCWA 4BF9A 3TMQA 3TMLA 4DEFA 2OZ0A 2ZTJA 3LPPA 3ZMRA 4GPNA 3RFAA 5A8MA 1KM6A 1QHOA 3E12A 1YTEA 1JRCA 1OT2A 3T0AA 2CBVA 2A6LA 3MSGA 3G6MA 4H7VA 3WF0A 4A21A 2ABAA 1QAPA 1FP8A 2PRMA 1BTCA 5DXXA 1A53A 4NUWA 5F2IA 1I2PA 1DWIM 1KGWA 1LYXA 3RM9A 3W7QA 3OBAA 4M29A 4UFLA 1JYNA 3V1PA 1BYDA 2CXGA 4CN4A 3R2GA 3W2KA 2DDXA 1KQYA 5BMXA 2J62A 1F05A 3W26A 3K8LA 2ZWZA 2Q3OA 3R8RA 1H09A 2J7EA 1UKTA 4OOZA 1SR9A 5E0FA 3HG2A 9CGTA 2QCMA 3S5OA 1BYCA 1LRQA 1TE1A 2G3NA 3LF7A 4J3SA 1OVDA 3DFSA 2WZEA 5KSWA 3A24A 4N6FA 2I1OA 2VELA 4YCOA 4AZHA 1X6UA 2FTPA 3HGRA 4E2BA 1VENA 4XTIA 5D03A 3TUUA 1FBAA 2E5CA 3AJXA 3U6WA 3B04A 3H54A 4O10A 4O0KA 2JK2A 4EOUA 1KR0A 5EL1A 1ZBVA 4O15A 1MEHA 2D3LA 4GUHA 4DM1A 3YPIA 1EP2A 3K46A 4IISA 4X9SA 5I3GA 4ORIA 4Z2HA 4JEQA 1B30A 4JTTA 2J75A 3WD2A 1QHZA 1C3FA 2DZUA 3DI1A 3B0PA 1OYBA 4LVBA 3QMRA 4MB3A 5DF0A 3EKZA 1D9EA 2ZUMA 3OGRA 1SZGA 2ALDA 1FFRA 3BG3A 5H91A 2YL5A 4AD4A 3ZT7A 2XSBA 4CNPA 4C1LA 4MB5A 1B2YA 1KBBA 4J3UA 4P8WA 4L4MA 4CN1A 2ISSA 5KEZA 2BY3A 2BVYA 1KV8A 2J79A 4WX2A 5EBUA 1S5WA 4FXRA 5G5IA 2RGMA 3AZSA 3U75A 3NDYA 4PMZA 1SO4A 1FDYA 1TPB1 1XSKA 5BXSA 3LGEA 4LC8A 4PTVA 4Y96A 4O19A 2QLYA 3S2CA 4KGJA 2W61A 2WZIA 3VM5A 3AJ7A 1CX9A 3O16A 1ICSA 4JD4A 3LPOA 1OYAA 4AZCB 1LLZA 2ZUSA 3U5UA 1MXDA 3G1VA 2G5WA 5GQBA 3INPA 4IX2A 1E55A 4Z0JA 3FS2A 5FEPA 4OJYA 5E6ZA 1G7UA 4GXPA 3P60A 1T8XA 1EWEA 1WYIA 3O6YX 4E38A 2F61A 4FLSA 4TTUA 2RH9A 3FNDA 3E49A 1DWHM 5CSSA 4PMUA 4N6EA 1NF0A 1G9HA 1NWTA 3SUSA 2OWXA 4JTHA 1ZL1A 1SSDA 4B5NA 3ARSA 1YQ2A 1FHLA 4W8AA 3NGJA 4D71A 4EE9A 1JVNA 4F66A 3WK1A 5FEZA 1JDCA 1K9FA 1TIMA 3G1AA 2GJPA 3TQVA 3N9KA 4HKPA 4PN2A 3LCHA 1TYGA 5C2XA 3VVGA 4AWEA 3T2OA 4B16A 1FHDA 1VS1A 4JTEA 3TAKA 4XWUA 3S5ZA 2YA2A 3NQ6A 2VZVA 2QCFA 1I2NA 3O6AA 1KTCA 4GUJA 2QQWA 1OGSA 3HU7A 5BXTA 3PBVA 1AL7A 3W7GA 2WVUA 1GOOA 3DC0A 3PSWA 2O9RA 3SZ8A 3I3EA 5D4YA 3NQEA 3MP5A 3CT7A 1IV8A 4HOWA 3TONA 2O7SA 1MW1A 1OD0A 2G3JA 1LCOA 2CERA 2OXBA 2Y6ZA 3VD9A 2BV9A 1IZKA 3GXMA 1TTPA 2ZXDA 5DT5A 3G3DA 3RCNA 3VUPA 2WMKA 2PF0A 3BC9A 1SZEA 4U3CA 1KTNA 1E71M 3AMDA 3EXSA 3UESA 4ADSA 4NVTA 4BI6A 5JIWA 4J9JA 5HQEA 3CIXA 1V6VA 5FK8A 3CM4A 3ABOA 2XGIA 5HNNA 3R89A 4TX6A 4LS2A 3WFAA 4D6DA 3L9CA 4FNSA 5K9XA 4UTLA 3TE9A 1K8YA 2TPSA 4E8DA 3DENA 2KZHA 1JCNA 5AOUA 2XUCA 4GINA 4AEOA 3AMLA 1UWQA 5LA2A 4RR4A 4P8UA 1WOAA 3GKFA 1AQMA 3LIGA 3HIJA 4PMXA 2Q3RA 4LV4A 1U30A 3WDJA 3CHFA 4OT7A 4U5IA 4O54A 1UH4A 3SIMA 4EF9A 1A5SA 3EWYA 1X8FA 1MO0A 2ZIDA 3IJ7A 1TJPA 1KCLA 3C3NA 1RQHA 3T0DA 4JNMA 3EKLA 1V7YA 3QSRA 1OX4B 3C52A 5G2HA 2QR6A 4S1FA 1TFVA 3P62A 3N34A 2Y61A 5E0KA 3NYDA 2YDQA 3CZ8A 3A5FA 3P84A 3LI1A 4HNNA 1SFSA 1EOMA 3VIJA 4CD7A 4ZFMA 5A6AA 1YTDA 3BV4A 4FFFA 2WLYA 4NNCA 4XQ6A 4FFHA 1QMLA 2V5BA 3K4AA 1O60A 5G1YA 3P7YA 1UR1A 1V0KA 2ZWYA 1FCBA 4AAJA 5I3KA 3WENA 4DBDA 2BHUA 2XM1A 2CLFA 2LLEA 1R7OA 5EFFA 1WBJA 5G2WA 2CLHA 4JYFA 2VZOA 1PCKA 1UG6A 5BYWA 1SMAA 1D3HA 1Q4NX 2QF8A 3L4ZA 4MDPA 2J7HA 4PH6A 3LPGA 3W0KA 1VHCA 3KFTA 3PBYA 1GJUA 1UR2A 4WXZA 2W67A 3EX4A 4FLRA 3QPZA 4AHQA 3M9YA 3Q37A 6A3HA 3KOFA 4JIPA 4O1CA 3SJ3A 5CLWA 1GYLA 2GFTA 4D6IA 5EA9A 3EDKA 4AWSA 4A2RA 1VEOA 2OLHA 2WC7A 1P4CA 3KVKA 5E70A 1LOSA 2GK1B 4ACYA 3QQ1A 1OGGA 1EO5A 1L6SA 1WPCA 5CZTA 2ZRXA 4A3YA 4XV0A 1PVNA 1MYRA 2WMHA 1QNOA 3G18A 8TIMA 5CSYA 1EGZA 1AK5A 1G1YA 5ECUA 3QHOA 1ESWA 4IUGA 1XC4A 4BI5A 1BF2A 3CZLA 4MZ8A 3JS3A 2VFHA 3UG3A 1TQJA 1LWJA 3WK0A 3O1NA 5AC7A 4ACZB 1ME8A 1H7NA 2HS6A 1L6YA 3L0NA 3DYOA 5IHSA 1WA3A 4RCXA 3UG4A 3VIPA 2DZTA 4O0ZA 1PEZA 1B9BA 4ATWA 2VUYA 2VC6A 3M44A 4HP5A 4L4OA 1L6WA 3M5XA 4DM2A 2WMIB 4CD8A 1M03A 4H4IA 2RDWA 2HTMA 1QDSA 5CGQA 1UQYA 1W5OA 2E6FA 1AG1O 3FY1A 1O4UA 1JXJA 1LL7A 3L0GA 4ZE5A 1NWUA 3VM7A 3VGBA 3HOJA 1PCWA 2C13A 2BWGA 1SR0A 3BVJA 1BG4A 1EOKA 3N9SA 1G01A 3FHAA 4GZEA 2X2GA 1RD6A 1QNPA 2Z1KA 3EMQA 4IQLA 4UC5A 2ZZ3A 3IAPA 3J7HA 3QR3A 1YXDA 3S42A 3T0BA 4C7FA 3PBGA 2ZUNA 3KF5A 4UNLA 3W9ZA 1B57A 1EXPA 1B0IA 3L4UA 1HG3A 3PZNA 1O7AA 5BNKA 2A85A 1H51A 2VENA 3CGTA 1T96A 1GQNA 1BVZA 4AZGA 1C7SA 3U5YA 3HBLA 4JR5A 3RLUA 2VZSA 1VCGA 5LA0A 3UGHA 3TQKA 1M7XA 1OX6A 3F03K 4FLOA 2F2HA 1TV8A 5ABFB 1ML1A 4QAIA 1TRDA 2G97A 3TSDA 1QI4A 4BS0A 3HG4A 4ZQNA 1E72M 2E6YA 1ALDA 4UMCA 5HINA 4LU0A 4WJXA 1HO1A 1E5NA 3LHTA 3QHNA 4KFNA 2CKSA 4CQ8A 2V30A 2YL9A 1IXPA 3V75A 1E15A 4D72A 3ZSTA 4LYPA 3VMOA 3W76A 3WH9A 2GVJA 1BTMA 2GUUA 1ECEA 4K8HA
chains in the Genus database with same CATH superfamily
3WF2A 4YTQA 1OQEA 1AR82 1OC6A 1RUI3 4A6GA 2HWB1 4XUQA 5C9WA 2Y62A 1NDZA 1R3RA 3H2CA 2A3CA 3OBKA 2ZRZA 1M68A 4HTBA 3CO8A 5LIKX 4HHMA 1SQ7A 3NZGA 3R4UA 3F5KA 1H30A 3CAVA 5FZ8A 3GQYA 1J01A 2GUBA 1UWIA 1E43A 1IIGA 3DHFA 3FGCB 4FPHA 2K9ZA 2PA6A 1QO5A 1RUC1 3NL2A 2G3FA 4E4PA 3HMJG 1RVF3 4PMJA 4XBSA 4PEEA 2QV5A 3U8GA 4F8XA 4M3CA 1IZ3A 1V70A 1Y4WA 1ZYBA 1S2AA 3MKCA 3QJAA 4LBRA 4M6VA 4N7QA 1SJBA 2WYFA 1WMFA 1R1A3 5I78A 1NFBA 4TV6A 3WSOA 4HNUA 1QUMA 1XB9A 4KI5M 2VRKA 3LA4A 3MY9A 4XF1A 1SO6A 1LOQA 3KCJA 1EUTA 2AEZA 1XE0A 5T5PA 4XABA 5F5AA 3QV8A 4L6DA 1CXFA 4NZFA 3LMYA 1O4ZA 4A6SA 5JZGA 3IANA 3BPSA 1QWKA 6XIMA 3W25A 3OY8A 1LORA 4Y22A 1KGXA 4TXEA 4HD5A 3P74A 3GFXA 4XD3A 2R063 1CX1A 3BLIA 5J8LA 1NE6A 2ZAHA 1NX9A 1WZMA 3W88A 2FDIA 4E4ZA 3VBFA 2RS12 4WOQA 4LVGA 2R14A 4CCNA 2Y8VA 3WLMA 2OGJA 4GLEA 4AQ2A 3ITGA 3NQHA 1ZJAA 3BALA 5LWBA 1XC6A 3BOLA 5A7WA 4FBFA 3MI8A 4NRPA 2Y24A 1JZ3A 4DXRA 1S2WA 1OSEA 3OD0A 1IPKA 1ZREA 5CGTA 5EIYB 5CA6A 4NILA 1JAEA 1FKXA 1GQIA 1JN2P 1Z7S3 4LS1A 2WANA 4Y20B 2R041 4RKAA 2FVMA 3EWZA 3OB8A 1UD3A 1RINA 1KXQA 2BLEA 1LAJA 3FVDA 2HPMA 1PDYA 1AQFA 3LD8A 3J8F2 4IE5A 4YZ3A 4AVVA 5T52A 1J6PA 2WVTA 1XYNA 1DLCA 4NX5A 3QTPA 3NOYA 5FF7A 1AODA 2MHFA 2PWHA 4AISA 1RPKA 4JBRA 2V2CA 4W93A 4B5WA 1MRQA 5LEJA 3M4FA 3WZ1A 3BXWA 1H7WA 1TX0A 3L2IA 4REQB 3R5EA 1JQVA 5A6TC 2XL7A 1WDDA 3QY7A 4XAFA 1H1IA 1TCDA 4C1NB 5LGZA 1SLCA 1UY3A 2ANUA 2ID4A 4WF7A 1TMF1 2JD4A 3POIA 2A0NA 3G8EA 1F76A 2X0HA 3WNKA 4BWLC 2QCLA 1TV7A 1QJY1 3NSMA 2PDJA 3L2HA 2Y88A 3N2BA 4KFPA 1ZAJA 4FF5A 4NZ3A 3OLIA 1OG0A 1WBLA 2QVSB 5CKMA 4AOCA 2WAGA 4MAVA 4EAMA 2Y33A 1C8XA 2DCZA 4FPJA 2ZTKA 4AGVA 2A2IA 5I03A 3TP4A 4MADA 2OS2A 1SW7A 3QYQA 2WSVA 4MPQA 3TAOA 3TYEA 1TV3A 1QPOA 1OJXA 1LGBA 1GONA 2X0YA 2VFDA 1GOGA 3S0CA 1XRUA 2WKLA 5HULA 4NIHA 2WXDM 4TSVA 4AEDA 2ACUA 4GCXA 5CPMA 2XM2A 3QYSA 4I2OA 4Z1CA 4DJFD 2R071 1D4VB 4A7YA 5C5TA 3ZN5A 5A7QA 1GHSA 2R7EB 4IV3A 5IVCA 4Y9AA 1LWIA 1IS4A 3W01A 3ENRA 5AB3A 1W90A 2E8ZA 4IGOA 3POCA 4ZB0A 5FKYA 4H7ZA 4EIVA 2GWGA 4WSJA 2XUEA 2I17A 4Z2IA 4NU7A 3T0TA 4UTWA 3PUHA 3ZJKA 1K8ZA 1XPGA 1S5MA 1YI9A 1HV1A 3W2LA 5FZ6A 2FGBA 5FPVA 1OKOA 3A4XA 1KKOA 3ID7A 3DHUA 3IEBA 3R94A 3B8SA 3MHZA 1E0TA 4IERA 4WR3A 3QV6A 1H6YA 1C4RA 4AEMA 1RV8A 1W3LA 5DFAA 5H9PA 5CXPA 3EXRA 3RDKA 4XXAA 4ZOBA 2VCAA 4HJWA 1LKNA 1UD4A 2WNUA 1ZBA1 1EJXC 1QDOA 3MIFA 3DI0A 1EWDA 1I45A 1QQP1 4PL1A 4QQUA 1K6WA 4HXCA 3HQUA 3QCWA 1C5HA 3GG0A 4MLOA 3PY2A 2ZRVA 1AVAA 1GHRA 4I3GA 2DT0A 2GMEA 5E09A 5ACA1 5AYZA 2D93A 1SO5A 4Y8EA 4EPBC 1BQGA 3ZYFA 1POKA 3B9OA 3O2LA 1HL2A 4LCSA 5CJMA 2PC4A 5IT6A 1PBGA 3FSTA 3E0FA 2NT0A 1ZZ9A 4IMDA 1JRBA 3GTFA 3VE7A 4CCDA 1YIPA 1NQ6A 2PAEA 1K7EA 3RAOA 1JUBA 5DBTA 1GT8A 2JG8C 2DSUA 2PGFA 3WELA 5TQLA 3GR8A 3TQPA 2IXKA 5A94A 3WLLA 3AU6A 2PHLA 2HBXA 4A35A 4DQAA 2C16A 2VXJA 2AYHA 3GH7A 5IAVA 3NV1A 2ZXAA 1BBT3 1FWDC 3GH5A 2B9UA 2RR13 1R081 4AZIA 4P14A 3H21A 2CFFA 3GXUA 1UPIA 4JX0A 5AECA 2A3WA 4QGLA 1K5MC 5DN2A 3U78A 4EPEC 2ZCWA 3DFQA 1ZSXA 3UR8A 1J58A 1KKRA 3MI2A 5MKGA 2NZ9A 3ACHA 4B9YA 1EPVA 2BU9A 2Y2WA 4GZJA 1KRMA 3DF0A 2WJDA 3SSZA 4Q0SA 2R30A 2CLOA 1XPWA 1W1A1 2R24A 2V82A 4P9IA 1EQPA 3PB0A 4R9BA 4HVQA 4XD4A 1YC61 2BBAA 4XZPA 2V5CA 4UCGA 3T3YA 4GWJA 1J1LA 4JTGA 3R4DB 2OSWA 3ZFFA 1PO22 3Q58A 4YM0A 4HYWA 3R12A 3CLMA 4GRSA 3VDGA 1LJYA 5FYZA 1AZ1A 4U33A 1W9FA 2BMBA 3F4NA 4Z1AA 1GJWA 3BCWA 1QJU1 2ZTNA 4DJDA 5FK7A 2SFPA 3M07A 2VTFA 4NZCA 1IGOA 4LKEA 4NRRA 3NQGA 5FPLA 3MV01 1YHTA 2C6QA 3LEGA 1I2OA 1Q6FA 3H7RA 3UZXA 2CC0A 5I5RA 3KOXA 1N3PA 7REQB 4BFAA 3J9SA 1OG6A 1ISZA 5BOOA 1EV11 2G95A 3T4CA 3EZ4A 4IFRA 3GDRA 3GRIA 3CV2A 1J8VA 3ABZA 4WKAA 3VDHA 1EGVA 3W07A 1HX0A 5A3TA 4K39A 2QHAA 3MICA 2YR1A 1SUXA 4YLZA 1LROA 1E6RA 5CPNA 1IHMA 4HLTA 2VY0A 4NP7A 2VMCA 3ZSKA 4AB4A 4A3XA 3UG5A 3FSUA 1PUDA 3KE0A 4YVVA 2Q71A 5A1LA 2FH8A 3STCA 4IGHA 4HA3A 2V3GA 4H7LA 1H0IA 1PAMA 3OHMB 5T91A 3KM8A 4HZ7A 1T7LA 3LNPA 3N4AA 3O7OA 3CV7A 4WY0B 3IJ9A 3ZKYA 1UYXA 5H9SA 4Q29A 1MUCA 1GZTA 4XZUG 2HLEA 4BWOA 5FY4A 4PYSA 4IP5A 1EIBA 5G05L 4JICA 2QJVA 3TEWA 1JD7A 5BRPA 4QQOA 1JZ2A 1PKYA 3ZO9A 2X1TA 3H2MA 1I2QA 3VNIA 5LHEA 1W3NA 1QRQA 3MUCA 1J0ZA 4MGQA 4QJ3B 5F4WA 1RUH2 1H6XA 2GVLA 3G1HA 2NM1A 2RDNA 3MMUA 1V9U1 4JAAA 1LT7A 2HXUA 1ULOA 3PJYA 3CZKA 3I3DA 2WS91 3GCWA 2VTXJ 1H8VA 2PDCA 1OA2A 1SO3A 3LERA 2QE3A 2J27A 1Q6OA 3R7MA 4LO6B 2DQXA 4PMRA 4JFUA 1H8TB 4MOAA 2DUPA 4V28A 1TO3A 4PT6A 5AHNA 2ZOEB 3VD4A 3BPZA 3U2ZA 4P7LA 4ZHNA 1Q13A 3H3LA 1CIYA 4OQVA 1OYCA 5FZAA 4AIEA 4GQQA 5RUBA 4Q26A 5LBBA 3TN91 2OFJA 3B3DA 4YARA 3C56A 1IWAA 2OCZA 4GH4B 1E6ZA 4DAFA 3RX3A 2VNGA 1PV8A 2ZDSA 3E0VA 2DZBA 1H5YA 4K8FA 1AZDA 1JCYA 2XDFA 2YDRA 4I6VA 1XIFA 3TSBA 5HCHA 4DXTA 5FTTC 4L8QA 1W2AX 1LHNA 3NZRA 3S5SA 3UWYA 3AOFA 3VIOA 2CAUA 3W81A 2PB1A 3B8VA 1XCXA 3NDOA 4K9SA 1CPNA 2WSKA 4LBLA 1ST8A 4J3TA 1URXA 1AXYA 4JKLA 1UYQA 2X5IA 3UPMA 3D0SA 3GHMA 4E4HA 4GWMA 2ZZ2A 1NP0A 2NWRA 1GOKA 4LEFA 2OWCA 4QCFA 4BPZA 9XIAA 1HP5A 3V36A 2IKIA 3DL3A 3SRKA 4YYOA 1U1HA 2AACA 2WWJA 5F6LB 4NWWA 4IEXA 3Q8AA 2NN8A 1Z44A 3LCXA 2VAUA 3MUIA 4GMEA 4NKCA 3VBFC 3S7IA 3NNGA 4I0BA 3PUOA 1AUYA 4QPGB 2QKFA 4FNPA 2WFF3 2GQAA 3PUEA 3HT1A 5BXRA 1XIGA 5FXZA 3F95A 4I9TA 2BBFA 3EXUA 3ME2A 3QMTA 3I59B 1YXYA 2W5FA 2E32A 4CDUC 2IXJA 3CUJA 2XMLA 2PTXA 3HJZA 5LHFA 3VIKA 3PVOA 4X61A 1X1ZA 3O8AA 1QTWA 1A8DA 3IIVA 2VVEA 4RUBA 2B5HA 2FHRA 2TRSA 1EQCA 1ZZ7A 2B81A 4CA9A 2L9LA 2ZA9A 1HQLA 4YFWA 4H3WA 4QQ2A 5HWMA 3SQSA 1A5BA 4C0BA 4DWSB 4XUPA 3RPMA 1XUUA 1EEXA 3UPWA 1G4SA 2YU2A 4BQ3A 1UOGA 3TN5A 1ZBE3 4FOVA 1MDLA 4H9UA 3SURA 4MYAA 1LU2A 3NPWA 1HX6A 4CQAA 2W63A 3LE0A 5GM0A 3TB0A 5CJNA 4P9WA 5LASA 1IXNA 1RHI1 1YYNA 3VIGA 2TYSA 3NJXA 3UR7A 1LF1A 1BK1A 2BW8A 5JBEA 2VEKA 4KBXA 4U28A 4M6UA 2CL2A 2QNEA 3V0AA 4YW2A 2VDHA 4AGGA 2W79A 3W70A 5CG7A 3W38A 3D3AA 3EOUA 5C3PA 3R4SA 1DORA 4HN4A 3A4UA 3GXDA 2YC0A 3BGJA 4ZO7A 3QR1A 3MS8A 2LROA 3D4KA 5KZEA 1XQLA 3CL8A 2G37A 2RFGA 4D6QA 3LEMA 1KITA 1QBAA 4OHYA 1MS5A 3L4YA 4FXKB 4I8YA 2FKPA 3POEA 5AFBA 3GXPA 3VKCA 4DPQA 1PIIA 4GQ7A 1K03A 2QPXA 4F9JA 2OOFA 3V3WA 4EROA 2OB3A 4N9CA 5J36A 4AEDC 3MSYA 3MLKA 1UXZA 5E88A 1UD5A 1FKWA 1CGVA 4B9ZA 3SH4A 3O1SA 2GJRA 1G9AA 4DXZA 4KRUA 2DCKA 4UWDA 1XYBA 2ZUVA 3TFXA 4YCPA 3H2AA 1SQ4A 2I45A 3FLUA 5DLCA 2BZDA 4YW4A 3S6TA 1MS4A 1GVFA 3CB8A 4K38A 3ZWSA 3P61A 3WH6A 3AHXA 5FJJA 4YGDA 3WBYA 4ZA0A 1YO8A 3R6IA 1RH9A 5FF0A 1FPN3 2CGPA 2P10A 2WN3A 2VT0A 2EPHA 1W3KA 4IMAA 4E9KA 4J27A 3TR9A 4BQYA 2B4KA 1XIEA 3ZYPA 4WGHA 3W1NA 5CSRA 3R0RA 4LAUA 4UTWC 4M81A 2D98A 3T4WA 3WDXA 2GPTA 4IMGA 5CBLA 1UOZA 2WBGA 2WJFA 5T8GA 5TF0A 2ICSA 2ZE0A 3W3OA 4AWDA 2O9TA 2J13A 2PLV2 4LUSB 1ULGA 3PJXA 2BRTA 5FZ0A 1QNSA 1SJCA 3R11A 1MEC2 1UN1A 3G0UA 2BERA 2INEA 2VFIA 5HNRA 1BWKA 2ZHLA 5DUXA 3VBOB 2YA1A 3TH6A 1GOXA 2Z1VA 3SDOA 5EWSA 1O5QA 3FUOA 1V02A 5LSMA 2NQHA 4PRTA 3V0BA 3N6JA 1RAKA 1W0OA 3RZJA 4JIQA 2J1TA 1A49A 5CBIA 1BVVA 3U2EA 4UQ9A 1HIZA 5DCDA 1V6YA 4LAMA 5A6LA 4BE3A 4K1YA 3QFWA 1R7AA 5A6SA 3VDCA 1FFQA 3THUA 1UBPC 4M51A 1ZCOA 3KVLA 1SDDB 2XJRA 3O0WA 3K2OA 5FZOA 3C4UA 2ENRA 5HR7A 1A4LA 3I2GA 1JOBA 5GLVA 3LCLA 2C8NA 4LYRA 5D38A 5T5JA 1UPMB 4O16A 4AVFA 1XD0A 3LWCA 3DN5A 2YGLA 2AGSA 2X09A 2ZA2A 3S1XA 3A3XA 4S3DA 1OLRA 3MBDA 3GDBA 3SC7X 5ABJB 5FLIA 3OQEA 4N4PA 4EWND 4WUIA 3DFOA 1EEPA 5C4WC 1W03A 3DPRC 1TWWA 1UF2C 5K4ZA 3W1TA 5CAKA 4AF9A 2I5GA 1I9CB 1REDA 3PAJA 3ZSJA 3PIJA 2NLYA 5H2ZA 1W2VA 1G9FA 1VJ2A 2QF7A 2DH2A 2E1DA 4LAZA 2NUXA 2AZ5A 3K75B 4HVXA 4L0PA 2XVLA 1I1XA 4GZ9A 1E40A 5CISA 4AEJA 4FIQA 2GQ9A 1SJAA 3W58A 4D2JA 1GP5A 3T1LA 4CVWA 1AJ0A 3RIKA 4A8RA 1JU3A 4F0MA 2CZVA 4L9XA 2V0TA 3MUY1 3RLHA 2XN1A 1HKWA 2AMXA 5D9NA 3WQ5A 1AW5A 2IXUA 3M47A 1OFAA 4CU8A 1U5IA 4GVIA 3LOIA 3NXLA 4PGLA 4S3CA 4PODA 3LCIA 4FOYA 5GNZA 3AHYA 2PF8A 3PJTA 4AVOA 3GDTA 3KBWA 3QOKA 5L7OC 3E0WA 3GBGA 4RHV3 1P6WA 1C92A 2CITA 4LTAA 5C3RA 3NKTA 2YBPA 1KM0A 3S9IA 2P53A 3ATYA 4JPGA 3VA8A 5I06A 3SCHA 3CJIA 3RXZA 1D0GA 1QJX3 4COWA 1NIUA 1HRV3 1OCQA 1KC7A 1YKWA 1YTKA 3Q45A 1SSGA 1BVWA 2EBNA 3NSTA 1XRFA 1KFCA 5CJ5A 4KIEA 3RILA 3II1A 1TPWA 3ZMNA 1XBFA 4E2GA 1J0IA 3UFYA 5T55A 3C2RA 2WZTA 3B02A 3VUOA 5XIMA 2J78A 3XISA 1Z42A 2XR4A 3NEVA 3Q2DA 1HRI1 4UCFA 1CAVB 2QDNA 4LBOA 1XGEA 5FMOL 3R25A 5IYYA 4QDMA 2BY2A 3SRFA 4CEYB 4JXCA 4QPIC 2JDPA 1H4HA 2Y0FA 5AKQA 1DQWA 1PGW1 4P7OA 2A3EA 5A70A 4R4XA 4Z0SA 4GIRA 4HVOA 1ZRFA 1WA6X 2Z1BA 3NURA 4P5UA 2VHLA 4MPKA 3CO4A 3KBSA 5A5WA 4PUKA 2VR2A 2DT3A 2AQWA 3X29B 2ZMLA 1UKQA 1H7PA 3S5QA 2PDHA 3TVAA 4JKKA 2YZ4A 1WMDA 1X82A 3AMHA 1V8EA 2VOMA 3FYOA 4ZQMA 3LDRA 3GYDA 2VZTA 2BDRA 2JIGA 1NY1A 4XPVA 3TW7A 1W05A 2XSXA 5LA1A 1V6WA 1P6BA 4MG4A 2VR4A 3WNOA 1R2RA 2VOWA 1CI1A 3BU7A 2B7NA 2K0GA 5FZBA 3KV9A 3UR5A 4RFRB 5CFCC 4AD0A 4M0NA 4DUVA 4P9JA 2V9DA 1VMFA 3HT2A 2WCGA 1T0OA 4W89A 4Z2GA 4H9YA 4RQPC 3DGRA 2ZHKA 3W7OA 1QPNA 4YHGA 5AN7A 5HV0A 4MVTA 3DZ1A 4YG0A 4FQ4A 1R9XA 5BNOB 3HD8B 2HWE1 2UV8G 3MZNA 4ISRA 4WY0F 3ISIX 4NYYA 4XIOA 3B4UA 3TW9A 2WSYA 1RITA 4YTTA 4AYUA 3I4EA 1OD5A 2UWBA 3CEPA 4GULA 4AF0A 4KWUA 5FMBA 1UO9A 3GC5A 3CNYA 1BQCA 1R8LA 1H63A 5DG2A 2PRLA 4ONVA 4LOTA 3MIDA 1R1ZA 3XINA 4LX4A 2WC3A 3QLDA 5LYRA 3RQ0A 3TTEA 2J42A 1A5AA 1LEDA 3I7DA 3W5MA 2FPTA 1UWTA 2J9XA 5G4WA 2VNOA 5AC91 1M3UA 2HWD1 2RJLA 1VPYA 4M82A 3WD3A 3E2VA 1AR71 4K8GA 2VR5A 6TIMA 3IIAA 4O1FA 4Z2KA 3KCCA 2RDTA 3BPWA 3R0DA 4XQDA 3S30A 1A5LC 1IT0A 2BFUS 3ES1A 2PP0A 2X5IC 2NP0A 3SCFA 3NPXA 3PZTA 1IZJA 3K1GA 1J0HA 1J0KA 3RRXA 3NM1A 3RO8A 1GPFA 4JFWA 3TTSA 3KT4A 2RHPA 2IW0A 1DHKA 2CZEA 3WD4A 1EUNA 3AYVA 4O1EA 4WM8A 1J79A 3HQPA 2A1XA 4UXAA 2HK1A 3IGUA 1NQKA 4UTTA 1IEVA 1WW4A 5FYBA 4GFSA 4H2CA 4GK8A 1V0NA 4XXPA 5C71A 3LBOA 1W6NB 4K37A 4LUYA 3I49A 2DTWA 3RZLA 1FNYA 1XNAA 3MW3A 2XBO3 3QZEA 1QHDA 2WJSA 5B7YA 1EIXA 2J7FA 1T6BX 5KHKA 3RF9A 2A3YA 1PM7A 4AI3A 5BROA 1XBVA 3COTA 4PE8A 2V69A 1AQ0A 2VECA 1K7FA 2AGTA 3TJLA 3OHIA 2BG5A 4DEQA 1TV4A 3H53A 5MF5A 3VYLA 4IEYA 4AMCA 1SPPA 2ZPXA 2DZXA 4FX7A 4FPGA 1MW0A 3ARZA 1RUF3 3Q94A 4K2SA 5T3NA 4G1KA 1VBJA 1CZVA 3PZIA 4QMAA 2B31A 4UOQA 4EPKA 2WO5A 3OZYA 4XF9A 1S0DA 5JH2A 4XJ8A 3W6LA 1D3GA 4RE0A 3RWKX 2YHJA 2R1MA 3OA3A 2VM8A 2HWC1 4GB32 5FCZA 2FMNA 4P7QA 3GS6A 1Y7BA 3C7OA 4XDPA 4P8XA 4IJCA 4CNNA 1L7QA 1XGZA 5ABGA 3PPFA 2DSWA 1POJA 1C9DA 3QPEA 4CTEA 4BKNA 2IXIA 4KT2A 3ANYA 3MUXA 3JBG1 2OZJA 1QEXA 4X8PA 5DDJ1 4QQ3A 3DYMA 3GKAA 4YRDA 3VDDB 2WNZA 5FD0A 3ZXFA 5HATA 3BICA 4H6KA 2D0FA 4HB7A 3GHUA 3CHVA 3GALA 3U2OA 4DB7A 3ASIA 1JUHA 3U37A 1RUD1 1TVLA 3BLDA 1E5HA 2ET1A 5LNSA 3BAKA 1FWSA 3WLRA 5D2XA 2QJMA 1OFDA 1ZJIA 4KCVA 1CAWB 3FBYA 3KT1A 1K3UA 1P7TB 3E97A 4LOSA 3NGFA 3RR4A 4GABA 4DYEA 2QBXA 4AMAA 1QY4A 1E5JA 1WWYA 4N43A 3AMNA 4CNSA 1LULA 3SY8A 4U2YA 3JZUA 5BU6A 4IEQA 1Q8VA 1CN1A 3IMNA 1AF9A 1YPFA 2H3DA 3NG3A 1B3WA 3IPWA 4HCDA 5C9AC 1WXJA 3BARA 3WYZA 2Z4GA 4C6LA 1OBAA 1UB3A 1NFPA 3QVQA 4PCSA 4IX0A 3WH8A 1TME3 2OZTA 1PZ2A 3APBA 5H8UA 1OADA 1SW3A 1UWRA 1MXGA 2YW3A 2ZVRA 3N1AA 1H7XA 3WH7A 1MZHA 3CWHA 3HA1A 2FDJA 3H55A 3RCMA 2JIJA 2EHHA 3W7CA 5ANQA 4E2QA 8XIAA 5I3IA 1GOIA 4Q2FA 2R32A 3N2MA 2JG9B 2W0UA 4P5HA 1UD8A 3P0WA 3SISA 2WCAA 4LH8A 3RVHA 4GWEA 2VMDA 2BDQA 2VDIA 3IARA 1JOJA 4IE7A 1E9ZB 4Q7NA 3RG0A 4S2CA 3QACA 2NLIA 1ZPTA 1XI3A 4BQ2A 4CDQA 4F7ZA 1XSJA 3DFNA 1R5YA 3FE5A 1HVXA 4D94A 1DFQA 5BXPA 3HF3A 3N29A 3VKMA 1JIBA 3S6DA 2GL5A 3VKNA 1SZRA 2QMJA 5FZKA 3WNLA 1G86A 4M3CE 1X33A 3LA7A 3OOQA 3THQA 1YYAA 5F1UA 3O15A 4EV0A 2P3YA 5FV3A 4J3ZA 5CQ1A 2DCYA 4JS3A 2VEMA 3MV11 2H0BA 3W72A 1MR5A 2QUMA 2GP5A 2CPUA 2V5DA 3LU2A 1TG7A 3GVVA 3KZSA 5LK7B 2J7GA 3NVTA 5JI7A 1B3VA 1GNZA 3MVTA 1W3HA 3U4XA 3PZ9A 1GZ9A 3WD1A 1UIKA 4L6OA 1WDSA 1SMDA 1J93A 1F9CA 3IUHA 3TSMA 1XE7A 2RDRA 2WPGA 3F4CA 3W7LA 3GUWA 4AK3A 1U12A 4Q4V2 1JJKA 1YBQB 3M2MA 1YPIA 3UU0A 2XWBB 5LY2A 4E4DX 1IS5A 1S2UA 5LCWL 2QCGA 4I5UA 3WK3A 3JB4C 3VNYA 2WNEA 4PDWB 3OLGA 1LDCA 4FFGA 2F17A 2VUDA 4RW5A 1YRRA 1LWHA 1HJFA 1A3HA 2CEQA 3FGCA 1TMQA 1P0NA 2GVGA 2XJVA 3OOXA 3TA9A 5LKYA 1ODUA 5K4LA 1CLXA 1I8JA 4Y90A 4MY9A 3AIUA 1W1IE 2WV8A 3IJDA 2BOFX 2BGPA 2I5QA 1A0DA 5GJMA 3VNZA 2JGQA 1WXYA 2B4GA 2HYKA 1QOPA 4FVVA 5KITA 1JTZX 4CEWB 3GLCA 3M3IA 4OFCA 2H8ZA 1GP6A 2AREA 1JZ8A 2W3JA 4GFIA 3WP3A 3LHVA 4GC4A 3OGJA 1M6JA 1MS1A 2R9RA 4HA4A 5LZ6A 3HIFA 4W8LA 1OZMA 1W6QB 3BGAA 1CZTA 3WQFA 4GNVA 1JGIA 1BYAA 1STMA 2RS13 1QXPA 2PD5A 4F2BA 1B54A 1VB9A 2FDGA 4QQPA 4TMBA 5CGMA 4U31A 1IT7A 3VZMA 3OBZA 4KU7A 1Q7MA 2XQXA 1L3JA 2A7AA 1CQ9A 4MYEA 3C5QA 2A3AA 1UZ4A 4Y9MA 2GGHA 3EEZA 1CZSA 1TMF3 4A44A 3BTXA 3VHRA 1YNQA 4XFCA 4UW3A 2G9GA 2V5YA 3P81A 1H2KA 2C1GA 1DQ0A 2X41A 2Z7GA 1AX0A 3S2NA 3AZXA 4L99A 2B46X 4HSJA 2HVNA 1I2RA 1TB3A 1H0GA 3CJIC 3UGFA 5A6YA 2ZX9A 3KZPA 2ZEYA 2GC2A 1JR1A 1DQ2A 1B3XA 4EWEA 2VEGA 3VIIA 3S9ZA 3OZMA 4GY7A 3AMCA 4NJGA 1X8EA 3WUDA 4AHYA 5FL1A 4GC3A 2WZHA 2C71A 5T5LA 2XH4A 3BAXA 4HNCA 3BTZA 3NNFA 2YZ5A 2C14A 2PQSA 4SLIA 5FPUA 3GG7A 1WZAA 4AXNA 2WZ8A 1PIV2 4FPCA 1VD6A 1VRH2 4E6MA 3EGJA 3U2CA 3KHBA 4OI0A 3TTOA 1YHFA 1WW5A 1C7TA 3B7MA 4GBDA 4J3XA 1KWKA 3WNMA 4B7EA 3NL5A 2PC8A 1OABA 3MFCA 4NVPA 2ZBJA 3EPOA 3LG3A 5FAJA 1S2BA 3PK7A 3NQ7A 2C9KA 2H0VA 1Z32X 3OP2A 4DRSA 3W28A 2ZRYA 3AZWA 2PWGA 3KHJA 3W75A 1Q43A 1T6GC 2BWAA 3O0VA 4ONUA 1GOQA 2GDUA 3JB8A 4XX6A 2ESCA 2NX9A 3KW3A 3M3OA 1DWFM 4PUEA 3FYYA 3ABSA 3OLEA 1R30A 5CZ0A 4HOZA 4WJ8A 4A05A 1YRZA 4COUA 1G69A 1ZFJA 4JFVA 3W1RA 5DQ0A 2D7FA 2V4AA 2WABA 3B8IA 4DY1A 3WJXA 4K40A 4F2UA 2EJAA 3W86A 2HJPA 4KEMA 2OYMA 2ZUTA 4W4ZA 3UERA 1OKQA 1RL3A 2P8CA 1AL8A 1QQP3 3KTSA 3SRDA 1IXOA 1GWMA 1FX5A 4ZOEA 1VLNA 4QEEA 4GY0A 3MLLA 3BAWA 1EF2A 4X63A 1KV5A 2KXLA 4KWKA 3S5NA 4L7ZA 4QDSA 1I75A 5KETA 4QKDA 5FZEA 4FNTA 1VIZA 1C8NA 2XH2A 2PLJA 5APAA 2KR2A 2IVIB 4PEKA 2VTXA 5AZ0A 3MYXA 4P9XA 2PDGA 3LSBA 3I6RA 2VOXA 2VP8A 4M19A 3U0ZA 1AR63 3CV1A 4DF1A 3MJYA 3VBSB 3V1HA 3NZ1A 5DEZA 4R85A 1IPJA 3T07A 3UCQA 1Z41A 2Q09A 1EP1A 4UFJA 3ZVIA 2WRAA 1DDLA 3V64A 3CIWA 1C8QA 3SCGA