4CCCA

Structure of mouse galactocerebrosidase with 4nbdg: enzyme-substrate complex
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
644
structure length
640
Chain Sequence
b'GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GALACTOCEREBROSIDASE
publication title Structural Snapshots Illustrate the Catalytic Cycle of Beta-Galactocerebrosidase, the Defective Enzyme in Krabbe Disease
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 218
structure length 640
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4cccA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4cccA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4cccA01
3VM5A 2ALDA 2CYGA 4AW7A 1R86A 3DAQA 1J18A 3PIJA 1BGAA 4J27A 3PB2A 4CD4A 5HBFA 1QPNA 1OK6A 1SR0A 5CJ5A 4O10A 5FMCA 3IEBA 4ACZB 1L0PA 3PIGA 5LGZA 2PF0A 3KEHA 4UFKA 4HSNA 3OLGA 5JIWA 3GYEA 5ANNA 3WEMA 2W4XA 5HDRA 1YTEA 3TKFA 1ZBKA 5A69A 4IPJA 1W9XA 4C7FA 3N2XA 4DWSB 3M5XA 3WNPA 1EQPA 1V08A 2PWFA 1CDGA 3LERA 2E6AA 2YX0A 4GUJA 4MZ8A 2GJRA 2OYLA 3UG3A 4W8AA 1RQEA 3TIMA 1EUAA 4ZQPA 2X30A 4NX5A 1PHWA 5MHBA 3KXQA 1NWRA 3AS1A 4DEFA 5D32A 2PI6A 1TFVA 5GQBA 2ZZ7A 5EYWA 1XDMA 4MLJA 4GNJA 2HSAA 3FOKA 1OFRA 1WOBA 1J0JA 1JVNA 3W87A 2UY5A 3THCA 3DYMA 1SUXA 2W67A 3F4NA 4AMCA 3MWAA 1QNVA 2XVPA 2BWGA 3TW7A 3W7KA 2NV1A 3BW2A 5CZ0A 2XFFA 2ZA2A 3UGHA 4CCDA 3SY5A 2CLKA 2WVTA 5FI8A 1JR1A 3CZGA 5F2IA 5LZLA 2QPUA 2WC7A 2C18A 4PTXA 1YPFA 2X8RA 5BXRA 2NUXA 3TA6A 3MANA 1R85A 4B1MA 4NXKA 3I7RA 3W9ZA 2J77A 1E6PA 1GOIA 4QDMA 3WL0A 1ZJIA 1MQPA 1KBIA 3QHNA 4A3UA 4AHPA 1TG7A 3CHDA 1G7UA 3KE0A 2ADEA 4PL2A 3A6OA 3U7VA 2G97A 2V38A 3SCRA 4D1IA 4PSRA 3W6MA 5BRQA 1W32A 4UNIA 3I3EA 1S5VA 2O9TA 2VQTA 1KLYA 1Q45A 3M07A 1TJRA 3BMVA 3KL5A 3WUGA 3TSDA 3VILA 4CKQA 2UV8G 1VJSA 2Y7FA 4TX9A 3CLWA 2Z2UA 3PC0A 5DLCA 1XHGA 2JFEX 2W91A 2YBUA 4CD5A 4Z0JA 3MSGA 1JXKA 1J0IA 1R7AA 2UY2A 3EX6A 3AI0A 2OT1A 3L5MA 4PA8A 3WENA 4LUJA 2OJPA 1UKTA 4OJYA 3TH6A 3WJYA 4PFMA 3NM3A 4MFDA 1YLVA 1UD8A 2ZZ2A 1OG0A 3W1QA 1SZGA 3EX4A 2B31A 3A24A 2RGMA 3AZRA 4HMEA 3TQVA 5DELA 4U3CA 3ZT6A 4CVUA 2C7FA 4JDBA 1BYDA 2DSZA 3LI0A 1OT1A 3CIVA 4PMDA 1KXHA 5CZSA 1XH0A 2VENA 1IT0A 1TPB1 4GQQA 1TA3B 5I79A 2FTPA 3TXZA 3K8LA 5GNXA 1VZWA 5G4EA 2XIIA 2XTKA 1JYVA 4YLWA 1DVJA 1SU5A 1ZB5A 4HA3A 3RCNA 4BZYA 2H8ZA 4HNTA 2O9OA 2YBTA 1NVMA 4U2ZA 3STGA 3VIGA 3WUBA 5LA2A 5D9MA 3W2NA 1WP6A 5D9OA 3F03K 4MB3A 1KBJA 4RLIA 4X0NA 2I14A 3OEXA 5D2WA 5A2AA 1W8SA 3VNZA 3LI1A 3IJ8A 2BLEA 2ZX7A 4GC4A 1DWFM 4GQRA 4AZGA 1V5XA 3W7EA 1X6NA 3S6TA 4UCGA 3THQA 3CHCA 4J28A 3BC9A 3RIKA 2V9DA 4WLCA 1S5TA 4J3UA 1P5BA 5KZMA 4ONVA 4AHOA 1N7KA 1KBBA 3DECA 2FQIA 3WUEA 1RQHA 4JX6A 1UBSA 4OT7A 3HF3A 3UPBA 4AWSA 2PWEA 1W2VA 3CC1A 4KRUA 1WDPA 1DP0A 3W7IA 3AHXA 3QH2A 3FFSA 4W87A 2NUYA 3AICA 4FFFA 1VEOA 2ZYFA 2ATSA 2WBGA 3O2LA 2A85A 1HKKA 1EOMA 3NL6A 3LCIA 1HIZA 1NP0A 1QOQA 5EMYA 3L9CA 2FHFA 4PTVA 1W9PA 3NYDA 1L8NA 1G0CA 3NQAA 2J62A 3TNOA 2VCAA 4PMRA 3TK7A 6ALDA 1TTQA 3BLEA 2X2YA 3WQ8A 3M41A 3SUTA 1H50A 2WNWA 1OX5A 4QQ3A 2A3EA 1DTUA 4YN5A 1AW2A 4EKJA 2WJZA 3SGZA 2YDQA 1I2RA 1Y4WA 5G2WA 1OGBA 1IGSA 5D2XA 1VB9A 1V0MA 1ZS2A 6A3HA 3QF0A 4PMUA 3BW3A 3CZJA 3LDKA 1V0KA 3FN9A 1HL2A 1IXQA 2ZRVA 3W85A 4PTMA 3W1AA 3UWZA 2BNJA 3UR7A 2CU0A 3DGRA 4AZ7A 1RR2A 1W91A 3CO4A 1SSGA 1IXPA 3T78A 4DM2A 2VFIA 2V0TA 1SFLA 3WUFA 1GOXA 2D73A 4A3HA 3O16A 2ESCA 2BY3A 3UNDA 5K4ZA 1B31A 3MV11 4J3SA 2ZA1A 3I65A 2VRJA 1Z44A 4ZMGA 4H8HA 4MJMA 3L4YA 3VGDA 2EGZA 1OYAA 1AK5A 1Z41A 3BLFA 3EWZA 3MI2A 1CXHA 4QP0A 5EBUA 2DZSA 2GJNA 1D3HA 1US3A 2VR4A 7CGTA 1K7FA 3TFXA 2XFYA 1DEDA 4O1CA 3PZIA 2RFGA 5FMDA 5HWJA 3SJ3A 1D3GA 5E1QA 4AEOA 4EVZA 1TV7A 3B0UX 1XUZA 5KITA 5FIXA 1KFBA 1JZ5A 3W71A 2VC6A 3LTYA 4BQ2A 4JCLA 3AHZA 2NXHA 4NNCA 2YDAA 2VRKA 1Z48A 2EO7A 3NL2A 4JIPA 4HZ8A 4MB4A 1MXDA 1NOUA 1TVNA 2C8NA 4IQLA 3MO7A 4U3AA 3KRZA 1H0IA 1B3VA 4HPJA 1JRCA 3WH6A 1XBYA 4XUYA 2VT0A 1WO2A 3CTLA 2J7GA 2J4GA 3CHFA 1R87A 2A5HA 1JUKA 4M81A 3W38A 5G5IA 1JFHA 5DXYA 4Z1DA 1H7NA 4JN6A 5CZKA 1LQ0A 1BGGA 1HN1A 2W5FA 5A8GA 2QCDB 1VYPX 4LVGA 3W7GA 2J9ZA 3W6YA 1TTJA 1CGTA 1IZJA 2GK1A 3Q37A 1JGIA 1LP6A 5TIMA 1JG9A 1OD0A 4H2CA 3FLUA 1ME7A 4ML9A 3TDFA 4JFWA 3M44A 4DF2A 4AHQA 3LDVA 2E8ZA 2OMAA 1TRDA 3UQNA 1CXEA 1WDSA 3AIWA 3W1TA 5DCDA 3WD4A 4Z2JA 1W1ZA 4NVTA 8CGTA 5DMYA 4FNTA 4RK8A 4Z2GA 4AF0B 4DO5A 1Q6FA 3ARYA 1KB3A 4WQ6A 1E3ZA 2QHAA 4P7QA 1KFEA 4M7SA 1VRXA 3IJ7A 1G5AA 2CBUA 3W7NA 2VX6A 4LV9A 2X0HA 1E9LA 1UR9A 2O9PA 2R14A 3C3NA 2Q3RA 1B4KA 4JFSA 4Z1CA 1SYTA 1U83A 3GNPA 1OSEA 2IXVA 3VDHA 1WZKA 1G6CA 2FB3A 4MYAA 3JS3A 5DEZA 3OA5A 3PZMA 4QJ1A 1MXSA 1H1YA 4DPPA 5FESA 1EIBA 4UNKA 4D71A 5LYRA 3PUOA 2YFOA 1DORA 3G0XA 1W3JA 4FLOA 1I2NA 1KWKA 3HGJA 3LEMA 4PUDA 1TV5A 3GTNA 4NRRA 4JZ5A 4E8DA 5LA0A 4YXGA 5AOUA 1VCVA 2WSKA 3UYCA 3U5UA 4O1BA 1OABA 1GW1A 2OLHA 2HS6A 4DO6A 2BXYA 3M5VA 1WA3A 2XN1A 4S1FA 1PCKA 3BSHA 4I7VA 1XRVA 3LB0A 4U28A 1J2WA 3WF4A 4LWWA 3WQ6A 3P81A 3OA3A 4O4WA 2GJLA 2JK2A 3G8RA 1C93A 5FKYA 3UESA 3NQ8A 1UUOA 2TAAA 3WD1A 3HG3A 1UH2A 3C6CA 5K3VA 3MUIA 4LW7A 2WMFA 4NNAA 1SZEA 3MI3A 1E6NA 3RWKX 1O5XA 2ABAA 2VFDA 5AHLA 5A8OA 4W84A 1HF6A 4RV8A 1J4EA 4NZFA 4AXKA 4R34A 3BGGA 1CW2A 3NDOA 4FIRA 1ISZA 1UWUA 3WF2A 2PC8A 1E5NA 4UQDA 1W56A 3EEGA 5D2VA 4Z2KA 2VCCA 3R13A 4JTUA 2XVGA 4O4VA 7A3HA 3VIIA 5A8MA 1W5QA 2PWDA 3VFLA 1Q6GA 5D2YA 4B5NA 3UGFA 3CHVA 5KSWA 5FMBA 2CCRA 1PHQA 4UTTA 1UYPA 4XTDA 2QPSA 2WNQA 1QO2A 2C16A 1NM9A 3MUAA 1JZ7A 1UASA 4H04A 2QCGA 5F1VA 4UOQA 4Y6GA 1KGXA 2YDRA 2ISWA 1CBGA 3LIHA 1W31A 4BWLA 5D38A 1PE1A 3BG5A 4H3DA 2Z0IA 1V3HA 4GZEA 3K1DA 4M56A 4B15A 2QJHA 1ODZA 3AOFA 1OBAA 1VPXA 2CLLA 4JNMA 3RF9A 2V81A 3MI6A 4Q22A 3TONA 5BWFA 3W2UA 2Y61A 5DY2A 3VKJA 3S2CA 4DXVA 3ALGA 5BRPA 1YPIA 1UWIA 1K3UA 3NNTA 3THDA 4EE9A 5HPOA 5A8QA 2ZZ6A 5A6KA 1AVAA 1G67A 4JY9A 1E72M 2I1OA 4FNQA 1I4NA 5D4YA 5FD0A 4D2JA 1MXGA 3CPRA 2ZUUA 4M6QA 1FH9A 3W1NA 3GX9A 4FF7A 2C3ZA 3GDBA 3QMSA 2Y8KA 3W07A 2CBJA 3VD9A 2WSPA 1Z42A 2P10A 1EPXA 1O60A 2G96A 4OWGA 3WMSA 3GDKA 3WNMA 1PX8A 4MY9A 2WZEA 3VIJA 5D04C 4FFGA 4MOZA 1QNPA 3QC3A 2ZBTA 3S9YA 2FPYA 2WM0A 1XM3A 3D3AA 1ISYA 2ZUWA 4DPQA 3T09A 3DU0A 3NIYA 1HVXA 4ACZA 4DM1A 3G6LA 4CGTA 4TX6A 3G0SA 1JAKA 1LF1A 4OKDA 4UOZA 1GVIA 3TA9A 4PBGA 1SW7A 3LPGA 2I9EA 4QLJA 2DSVA 3MMDA 2W79A 2QF7A 4DWSA 5FK8A 2D23A 2NXIA 2FGLA 2J8GA 3BGAA 4UTLA 2WHMA 3AS2A 1XBXA 1MSSA 3QYQA 1XD1A 3Q94A 3LLDA 3DKLA 3M5ZA 4ORMA 4B9ZA 1Q6QA 2DU2A 3G8EA 4XBKA 3INPA 1P4CA 4NUWA 4X3ZA 5C55A 2X09A 2DZWA 3W6LA 3UPWA 3N11A 3P62A 4M24A 2QUTA 1G7VA 3CB8A 2G41A 3EDDA 1RPXA 2PE4A 1C8YA 1J12A 1OWQA 2B7PA 1C29A 2B7OA 2C19A 4KFPA 1FA2A 3DYOA 1S5WA 2GUYA 3CUJA 3ZS4A 2Y4SA 4GI8A 4M1RA 1EP3A 1OGSA 3VIOA 4AZIA 2H3DA 5BXSA 5I5RA 1YXDA 3HIJA 1OFAA 2ZX8A 3AXXA 4E2BA 3EWWA 3OBKA 5TBOA 2E4TA 3IJ9A 1W1PA 3NSNA 3EDJA 4PTNA 5CPTA 3SCSA 4R5EA 4WK9A 1VCGA 2O9RA 1RH9A 5A3HA 2QCLA 5CPOA 1MZHA 4FX8A 4IXHA 4L4LA 4NI3A 4D72A 2NT0A 1PEZA 1W9VA 5E0KA 1TQXA 3N2MA 5CGMA 1NP2A 3VIHA 5HINA 2WLZA 4AWTA 4Y9AA 1XFBA 2VC9A 5HUOA 3F1QA 3T2PA 3KAOA 1V6WA 3O6AA 4LY8A 4O50A 4EIVA 3CUIA 3ABQA 3LBCA 2EBNA 3K4AA 4EF9A 4OIFA 3SCOA 4WY0F 5CGQA 1F05A 2LLEA 2EF9A 3N13A 3N9RA 3U2OA 3LV6A 4MLRA 1HJWA 4P7OA 3CIXA 3T0DA 3M7WA 2FB2A 1LDCA 1H2JA 3SCVA 1GVFA 3AS0A 1GOKA 4YL2A 1TIMA 3AMLA 3F5JA 1T99A 3BCFA 2BXZA 1LLOA 5CQ1A 4JX4A 2AOSA 2C6QA 4QAWA 3GZ3A 1JZ8A 2FLIA 1C8XA 1V0NA 4S3JA 1JYNA 2ZUTA 3SEPA 2YSWA 3KVJA 3O63A 1XYZA 3UWYA 4UZSA 5D9NA 2QEZA 1UKQA 4MNMA 1MVYA 4RKAA 5JIPA 1E4IA 1TA3A 4HXCA 1JCMP 3AZTA 4B9YA 1CENA 3GDRA 2YFNA 3OVPA 4A29A 2DT3A 4GRSA 3SI9A 1HJVA 3TQ0A 4MZ1A 5D02A 1E4NA 2YA1A 3EKZA 3DYPA 4XZ9A 4JEQA 4HMDA 5C6MA 2V5LA 5F4WA 4MPQA 1H7OA 1HJXA 5EL1A 2E9BA 3HPSA 3FW6A 1LLZA 3AROA 4C7DA 3N1AA 4WXZA 4QCFA 1VJIA 2D3LA 4PMYA 4W7VA 1RP8A 4XB3A 4AZCB 1VJZA 2X2GA 3BH4A 1Q6OA 1G4SA 3QQ1A 1JNDA 1F4HA 4H41A 1WAUA 4CQ9A 1QDSA 2G5WA 3OLEA 5CPQA 1VS1A 3OLDA 4F9DA 5AY7A 3FJLA 1MW3A 1DWAM 1WKYA 1AQMA 5A8PA 3ZQ9A 1UJPA 1XD0A 4IPNB 3SIMA 1M04A 3M43A 4GI9A 3ANYA 3W7CA 3W88A 3AMCA 3C2VA 1B3WA 2H6RA 5IXEA 3LRMA 2RDWA 4LOCA 3FHQA 4QSHA 5AYIA 2V5DA 4YWIA 1WNOA 1TPFA 3H55A 5CLWA 1MWOA 2CWNA 1DJQA 1TCMA 2RDTA 4ZQNA 5I78A 5C8BB 1OFQA 5ABTA 1P1XA 1IV8A 1Q6CA 3MUXA 1HNYA 4J7RA 3W25A 4Z2IA 4QLLA 3CIWA 2Y89A 5F4SA 1Q3NA 4JD4A 1QI4A 4AEFA 1VIWA 4LYRA 5A6SA 2ZRWA 3O6YX 1SO5A 3ABOA 4JDYA 1TVPA 1NAL1 4ZQOA 4HMCA 3VIFA 4HOXA 2GVYA 2ZXQA 3W1LA 4JTLA 2D0GA 4JKKA 3HJEA 5IDIA 1D9EA 1E55A 1OB0A 1GYLA 4C1LA 1BG4A 3M1ZA 2JALA 5I3IA 2XJ7A 3IAPA 5KMYA 3PM6A 3WF0A 5FEZA 7TIMA 4O28A 2A21A 3G1YA 1GONA 1UWQA 3QOKA 5BXPA 2A7NA 1VYRA 3CLMA 1KW1A 1W54A 5A6BD 1H5YA 3NL5A 4IX2A 4LC6A 1EA0A 1X1NA 2X05A 1QNRA 4IMCA 1AMYA 4JHOA 3TMQA 2E9MA 3W2MA 5DT5A 1K7EA 2BHUA 4CN6A 2V2CA 1DQWA 3KL0A 1LJYA 3L21A 2V3GA 4UFJA 1V0LA 5JBEA 4MY1A 2XFWA 4GUIA 3A5FA 3ECQA 1FWSA 2TPSA 4P7LA 3CUFA 2J78A 4DBDA 2CZEA 3KX6A 4CU6A 1KWGA 2E6DA 3E1F1 1XUUA 3HGOA 3O15A 2VEPA 2OZ0A 4MYXA 1Q4NX 3OVRA 1GG0A 3IIVA 4UFLA 5CKSA 1BPLB 1W3LA 3B9DA 2VEIA 2GJXB 1XV8A 3NL3A 1DWGM 2V5CA 1R2TA 5IFTA 3C2RA 1JZ4A 2Y62A 4YCOA 1QO5A 1RD6A 1KFCA 2CZ5A 3C56A 4WKFA 1FCQA 4ZZ9A 2V3FA 4R33A 3DHUA 3LBMA 2ZUSA 4C7GA 1ICQA 1UD2A 3QSRA 2WSQA 1UWTA 5BXTA 1J01A 1SQ7A 5AHNA 2C13A 4K6AA 3AJXA 3P84A 4AD4A 3PBUA 4TUFA 4UMCA 3VX0A 1QPRA 2EEXA 3WN6A 5HMSA 4O19A 5I3JA 4AZZA 3EX3A 1KR1A 1RV8A 4K8HA 1KBKA 1XI3A 3OB8A 3C61A 1JD9A 3FAWA 1FDYA 2DT0A 3ELFA 4N9BA 2ISSA 1OCQA 2QCDA 1A5CA 2RKXA 1CGWA 2BVDA 3IGSA 4JTKA 5HOSA 4UTKA 3NPUA 2VVNA 2GFTA 4FIQA 3B03A 2UWFA 1M03A 1W2PA 1PL9A 2JKEA 4RCXA 1PJ9A 4LT9A 1HKMA 1JUEA 3F5KA 1C9DA 3LCLA 4D6FA 1W5PA 5F2MA 1QI5A 1V3MA 3VKKA 2WPGA 4ZE4A 2EPKX 5HWNA 1E51A 3S8HA 4RZ6A 5LNUA 2QCEA 4AF0A 2HISA 2W61A 3QMTA 2VRQA 3AQUA 3H53A 3W72A 5DCEA 5D37A 1W1VA 4M80A 2W63A 5LNVA 4HU8A 3C2OA 4HP5A 2GQ9A 4JL1A 1QNQA 3VDBA 1FX6A 4UQ9A 2D1ZA 1K8XA 2TSYA 3TROA 3VGFA 1JAEA 2DT1A 4AY1A 1K6AA 3EDKA 4LQ1A 3W27A 3N9KA 3G1XA 1ZFJA 3ZT5A 2QCMA 3QEZA 1OFOA 2VKZG 2Y2WA 1KLZA 4LVBA 2Z1SA 3PZGA 4V2XA 5A2BA 1I45A 4NJGA 4WOZA 2QUVA 1PIFA 2WKGA 3ARPA 3TP4A 2GPTA 3LFIA 1RPKA 3CZKA 1H60A 1A5BA 1BYBA 1E6ZA 1J5TA 3IK2A 3WIJA 1KM6A 1JYXA 1A53A 4P61A 4PMOA 4JHZA 5KZDA 3JUGA 5HNNA 1B0IA 3A4AA 3KVMA 3R5EA 3QOMA 4AH7A 3W70A 4L4MA 1KM1A 3SSJA 1GCYA 4GUHA 1R2SA 1SW3A 4K36A 4MIMA 1GVQA 4JIEA 2D0FA 3TSMA 2WMHA 4CN4A 1JUBA 3OVQA 3WFLA 4GKLA 5K9XA 3AXHA 2ZZ3A 4XX6A 4N9EA 3GB6A 1FY6A 4J3XA 2AGKA 4LV4A 3TJLA 4JL2A 4OBSA 8A3HA 3SCUA 3VD4A 2MANA 3EDEA 3W76A 4RE2A 4UXDA 1K7XA 1T8XA 3LHVA 2QMKA 3TTOA 3RLVA 2CW6A 2A4AA 4Y90A 5BMWA 2CLEA 3NQEA 3WMCA 1XCXA 3FNDA 5H91A 2ZXBA 3CEPA 4UTJA 1T0OA 3HG2A 4TR9A 3N73A 3GH7A 2E40A 5FKBA 3WJZA 4U31A 5CXPA 3WNOA 2RGLA 1D2KA 2ZE0A 3IIOA 4WX2A 4ADTA 1ML1A 1V3LA 3W2LA 3LPPA 5L9FA 1UUMA 2GVJA 2CXGA 3O05A 1WZMA 4QNEA 1UUQA 4MZYA 2YJQA 3VI2A 1H4PA 3WH5A 3SW6A 1XH1A 2XM2A 2VFGA 2YLAA 3WEOA 1CI1A 4B3LA 2Y63A 4IJBA 2CZDA 3VDCA 5CZTA 3POCA 3NYZA 3IGUA 1J10A 5BMXA 2OWWA 1JI1A 5DO8A 5CZJA 4ADUA 2NT1A 1LYXA 2WZHA 5DBUA 2CIPA 1BQCA 1JFXA 4O57A 4O0ZA 1UH4A 1OGGA 2OWXA 3ZOAA 2P1FA 4UQBA 3TCEA 4UTFA 2VFEA 4JFUA 3WQWA 4E8CA 3QM3A 6TAAA 3GZAA 3HO8A 4OV4A 4N4PA 3Q2DA 1VAHA 3GAKA 2YA2A 4D6CA 5A6MA 4CD7A 1FCVA 4PCTA 1WBJA 2DT2A 1XH2A 1T96A 5I6SA 2XUCA 2GDVA 5CPNA 2YOCA 1JF6A 3CGTA 3AO0A 4F79A 1QNOA 3K8MA 3RM8A 5BYWA 3LCXA 4LVFA 2WWDA 1LOLA 1H63A 4PMNA 4KMQA 4HPGA 1WZAA 2OT0A 3VO0A 3UWUA 1IZKA 1MFUA 2DJLA 3MMTA 4U2YA 1L6YA 3RMEA 3ZJ8A 4A2SA 1ZHAA 3LTPA 1WAWA 1ME9A 2NWSA 1US2A 3UCQA 4MFEA 3NPWA 1K02A 2V30A 3EXRA 3S5YA 1XC6A 2VI0A 4W8LA 1JZ3A 3RPMA 5ABEA 2ISVA 4A2RA 1H7XA 2W6RA 3AIBA 1ISVA 1I2QA 3CMJA 3PUDA 1JCXA 3DI1A 4M82A 5I3HA 1BVZA 3A5VA 3BO9A 1L9WA 1GOQA 3HU7A 2XWEA 1MYRA 4UUIA 2JGQA 1TREA 1AG1O 4E2DA 1NQ6A 4PL1A 2C0HA 1EX5A 5A5WA 1OIMA 3DZ1A 4WOQA 1WQ5A 3BLIA 1ME8A 2V2DA 1D7FA 1EDGA 1XL9A 3GXFA 4GO8A 4FNRA 1XDLA 4MPKA 3R2GA 3QRHA 2QCFA 1FCBA 2QQUA 5M3WA 1KQYA 4HSOA 4M8UA 2C15A 1YTKA 3EX2A 4JTGA 5FF2A 4OBRA 2DSWA 4URIA 1UH3A 3W83A 1UWRA 3A23A 3LF7A 4R7JA 3G1VA 5F7UA 5DY3A 2CERA 1VENA 4PRWA 3P60A 2WMKA 5GPRA 4GUGA 1EP1A 1OX6A 2WNZA 1G4PA 2ZRUA 4PUEA 3DHFA 1ZAIA 4TMBA 2YL8A 1AL7A 5AFDA 1KGUA 3PWAA 3TAKA 3L4ZA 4RL3A 2O92A 3WH9A 3BG3A 2CFFA 3LLFA 1E0WA 2QKFA 2C1HA 3P5YA 3EDFA 2WCSA 5IHRA 1DHPA 4PMQA 1FFRA 1DL3A 1AQ0A 4B1LA 1HTIA 3OIXA 1HL9A 3NQDA 2VUYA 3MUZ1 4W86A 3DFSA 2BTMA 3FS2A 3K8KA 1HXJA 4MB1A 4ATWA 1YADA 2V3DA 4FFHA 1SFSA 3QPYA 4QFUA 4NNBA 3OZPA 1W3NA 2E1DA 3H54A 1B3OA 1YDNA 2V8ZA 3TOPA 3HMCA 2JBMA 4LUIA 3VE7A 1TV8A 4UTHA 5K4XA 4M29A 3WDJA 3BSGA 4QITA 3GNNA 1VR6A 3B9AA 1M01A 2J25A 3A21A 4R53A 3DHDA 3UWVA 3UXAA 1YYAA 1OVDA 1XCWA 5HPCA 3LM7A 3UR8A 4S2CA 3BAKA 3EYPA 5U7SA 3FKRA 1I1XA 2EPLX 4PCSA 3W7PA 3MO4A 4O0KA 4POCA 2J8FA 3IMMA 1F6PA 1QPQA 4W5UA 1BYAA 2WC4A 4AD0A 4HN4A 3RK8A 3P74A 1UR0A 3WQVA 3LPOA 3RMJA 1LZOA 4MTVA 1QBBA 3AYSA 4N0RA 3CQ0A 1V6XA 4CD8A 1UOKA 3POHA 2HTMA 3G1HA 1HVQA 2QUUA 2EXOA 4PYSA 4TOQA 3NAVA 3BAXA 5E6YA 4IPIA 1VEMA 1ZBVA 1KM4A 1DWIM 1MQRA 4W7UA 5A94A 1VFOA 5EMUA 4BS0A 3NPXA 3NQCA 3VIMA 1KV8A 5JBFA 2QAFA 1TTPA 1E71M 1H3GA 4AZCA 3GDLA 1YXCA 5LNRA 5A1AA 2J47A 2Y7DA 3BAJA 3CPUA 4PN2A 4W93A 1FDZA 2TMDA 4LTSA 3V1PA 3W7DA 4UNLA 3LXAA 2Q8LA 1C92A 1EDQA 3RM4A 1JI2A 2ZRXA 1WXJA 1A3HA 3O6DA 1V3IA 4MJZA 1K9DA 2EJ1A 2ZRZA 2HS8A 3LXBA 2XM1A 3USBA 3W1XA 2E6FA 4AIOA 1H62A 3PTQA 4FLQA 4HTYA 3GKAA 2VOTA 1YXYA 1KFKA 1SPQA 1H41A 1TMQA 3VDAA 7TAAA 4W89A 1E56A 4XQ6A 3W1UA 4NU7A 3U5YA 2RHGA 2DP3A 3TQKA 2ZCGA 1TB3A 4CU7A 3GXMA 3AJ7A 3T4CA 1OK4A 5ECUA 3L4UA 1VYSX 1ST8A 2BXVA 2E5BA 3O8AA 1THFD 5BOOA 1BLIA 3UEQA 1MFVA 1QPOA 3G22A 2FPTA 3P5ZA 3HQ1A 5GVJA 3TFCA 3U14A 2BHZA 3IANA 4GZIA 3VUPA 2Y6ZA 1HT6A 3TTQA 1M5WA 2PC4A 1QHOA 3U6WA 2QAPA 2AAAA 2H3BA 4IISA 5LHEA 4FLSA 4JFTA 2WWCA 2ZICA 3DH7A 4HIBA 1CXLA 1PS9A 3MSDA 4N9CA 3GKFA 5AYYA 1CXFA 4BA0A 1FDJA 1GOWA 1E6XM 2GQAA 1B3XA 1FBAA 2VL4A 4KFNA 2CPUA 3ARTA 4LXFA 3RFAA 3B9EA 5C70A 2C14A 5CSYA 1OYBA 5L6UA 1H1NA 2BY2A 3MHUA 2BS9A 2X1IA 3W4RA 3N19B 1BAGA 1TR1A 1QAPA 3ZIZA 4O11A 3M9YA 2EKCA 1Q6EA 3GR8A 5LA1A 5LNSA 2QJIA 3BW4A 1O6IA 2YDSA 3B05A 4AWEA 2VEMA 1GT8A 1E6QM 2DSUA 3PZUA 5G1YA 1HJQA 3OG2A 1RP9A 4UTUA 4O54A 4FHAA 1W2TA 3JR2A 1QR7A 3PAJA 4BK9A 1E1EA 4GXPA 3WDPP 4Q4KA 4OGZA 3QZEA 4N9DA 5TQLA 1JDAA 4Y96A 2GJXA 1TZ7A 3R8RA 4UMBA 4FX7A 3KF3A 2GOUA 5A2CA 2J9YA 3VD7A 1DQXA 5E0CA 3WKZA 1NWTA 1QBAA 2BFGA 3S42A 3BLKA 1R46A 3NSMA 4KGJA 4FXSA 4Z1AA 3B4UA 2WW5A 1BEUA 1ONRA 3AXIA 4A21A 1P0KA 5DN1A 1C8QA 3W37A 4XWUA 5I2UA 4DBEA 1OFEA 4Z2HA 5AC7A 3NQ2A 1GG1A 1WPCA 2XN0A 2G8ZA 2J7CA 2GVLA 5KZ6A 2F8QA 1Q6DA 2WXDM 4DUXA 1ITXA 1A5AA 1JJKA 3E12A 3OLIA 2FIQA 2ZX6A 1LOSA 2NX1A 4FMVA 4BCEA 1L2UA 3CM4A 4UR7A 3MU7A 5D30A 3ZWTA 3NZ1A 1DBTA 5D03A 3MMWA 2YZRA 3L4TA 4CCEA 1EO7A 3O9NA 3L0NA 1N8FA 3PVFA 3QPZA 1UG6A 5FF7A 2VMFA 3OGRA 3P80A 2WVVA 2NLIA 1XSJA 2CITA 2G3NA 4K68A 4CLMA 1FHDA 4NJHA 1PIIA 2WK2A 1K9FA 4GZJA 1TPDA 4O15A 1V02E 3WH8A 5A8NA 2YYTA 2Y8VA 1X8FA 1J0YA 1OD8A 3K46A 3NQFA 3UXDA 2V2HA 4DWSD 1LTDA 1JDCA 3SECA 1X6UA 1F76A 3N17A 3U8GA 3P8IA 2ZXAA 3N15A 3UG4A 2DGAA 3WSUA 1HO1A 1ZAJA 3OG3A 1ISWA 5EBAA 3WD2A 5LGXA 3QSTA 1UZ4A 3WBAA 2X16A 2Q3OA 1GOMA 1PX4A 1UKOA 1G01A 1GZJA 3CZ8A 4LYQA 3WL1A 2WMIB 1H61A 1HX0A 3N9SA 1WDQA 1YDVA 4QIUA 5K9DA 2A3HA 3C8FA 5E09A 4BFAA 1B57A 3EWBX 1DV7A 3R12A 3EWUA 1ODUA 4WSKA 4U4MA 3FHAA 4C1KA 4EK7A 4ZQMA 2VXNA 1LBLA 4YHGA 3UETA 1B4EA 1JQVA 4N6EA 5K2ZA 3WJWA 3GNDA 2WPBA 4KWWA 2QCNA 1IF2A 1UKPA 2D20A 3VMPA 3U1XA 2WV8A 3B04A 3YPIA 4HOZA 1TQJA 1TPH1 3CUGA 4ZXLA 2WQPA 5KINA 2B0MA 3II1A 4XV0A 3E96A 2AEZA 5KEZA 1ISXA 3L4WA 3W24A 1FQ0A 3I3BA 4JKLA 4QLKA 5ABFB 4LS2A 4NXSA 3APGA 1TUXA 1FHLA 4AIEA 3QQ0A 1ZJBA 2XG9A 3ARQA 5AC5A 1TJPA 1DKWA 3WD3A 5U4NA 3I6RA 4JKMA 1E0VA 4WJEA 1TTIA 3KWXA 3G24A 3VCRA 4FXRA 4JGDA 4X22A 1QI3A 1VFFA 4KRTA 2WCGA 1CECA 1S46A 3MUY1 5HR6A 1G69A 1C8VA 4IX0A 1C3FA 1GEQA 4EANA 5LKYA 1CPUA 1LWJA 3PY2A 4AC1X 2FH6A 3UY8A 3WNLA 3UZJA 2CBIA 5BNKA 4JTFA 4XKYB 1MW1A 3GXNA 4O13A 1E73M 3TXVA 5K9CA 3AIUA 3F4VA 2WSRA 3G3DA 3DFTA 5FEWA 3W23A 5A6LA 3P8JA 2DZTA 3IVTA 3WELA 1IIHA 4K7VA 4D6HA 4K39A 3KOFA 3IGXA 6TIMA 1ZU8A 4CU8A 2FJKA 4KKXA 1JRBA 1S3HA 1AW1A 1QOXA 4BI7A 1GHRA 1R7OA 1H7WA 1CXIA 2VNCA 3OGVA 3PBVA 3CEUA 2G3MA 3SCNA 4PTWA 1CIUA 1CEOA 3EBVA 3GR7A 1UR4A 4HPHA 3EKLA 2O7QA 2X0YA 3ATZA 1OJXA 5J5DA 2F61A 3HB9A 4CQAA 2W92A 3LRKA 4WSJA 2DIJA 3P67A 1UQYA 4UIOA 1JCLA 3UD6A 4ZVJA 1B3YA 4LS0A 1F7BA 3RDKA 4U5IA 4A22A 3DC0A 3QHOA 4CCCA 1NF0A 3L5AA 4ZE5A 2NW0A 4Q7NA 3NDYA 1EQCA 5EPDA 3W0KA 5I23A 2JF6A 1UZ1A 3PBYA 3TTSA 2AAMA 3PTKA 3W82A 1E1FA 3GDTA 1RZMA 1FP8A 1N55A 3BPWA 1QI2A 1WZLA 1AQHA 3S1VA 2XHYA 3S5QA 2DSKA 3DKJA 3U7BA 4TVCA 3LGEA 3MBDA 3DFPA 2G95A 4FFIA 3UWWA 3W7RA 1LM1A 1CLVA 1VBUA 2EPOA 3PZNA 4E4PA 2BY1A 2FDMA 2VR5A 5HR7A 5D9PA 4WF7A 3LIGA 5AB3A 2FGZA 3N3MA 1GUVA 1SZFA 4G1KA 5C5YA 1JL8A 1O7AA 4BQ5A 4ACYA 3MMUA 3SUSA 2WMGA 5EA9A 3M6DA 3EWXA 3LX9A 2PBOA 3NCOA 1BHGA 1ZL1A 2CLMA 2YL6A 1H0GA 4AZBA 3AIEA 5AHEA 1NOWA 3EX1A 4NJIA 3WK3A 1C7TA 2GSJA 2ZIDA 3GM8A 1FFQA 3VTRA 2PWHA 1RD5A 1XCFA 1FWWA 3GDMA 4WIWA 2PBGA 3CMGA 4YMZA 1SZNA 1PX3A 5D8WA 3GBEA 1AW5A 2D2OA 4OV9A 1GZGA 4AYSA 2E6YA 4O1AA 2X1RA 3WEZA 1NWSA 2QQWA 2E3ZA 1K9TA 4AVFA 4P8WA 1XYFA 4OU1A 4MDPA 2W62A 4IUGA 4AZHA 2DZXA 3G3MA 5G1TA 3T2OA 2B4GA 2CESA 1JDDA 4JTHA 2CHNA 3BAIA 4HU0A 5HULA 3NM1A 4N42A 3IRDA 4ZENA 3NO5A 5DXXA 3FJ6A 1KCKA 1CYGA 2YW4A 2R91A 4LVAA 1K8YA 1UD3A 5M17A 2PRLA 3LHWA 1JXJA 1FH8A 2JEPA 1K9EA 4PCFA 4UFMA 3MYOA 5H2ZA 2A7RA 4GIAA 3AIRA 2JF7A 2XIBA 1E43A 5TD4A 3IVSA 2CETA 5I3GA 4BQ4A 1U2YA 3SCPA 4JTJA 4IMFA 4JS3A 1TCDA 3NOEA 2NUWA 4W88A 4FX6M 3HGRA 4LRSA 1A5SA 3VGEA 1BTCA 4BF7A 4TTGA 2PWGA 1TE1A 3MHGA 2E09A 2Z1BA 1UWSA 4AIUA 1NOFA 4RZ5A 4AISA 2E68A 3TW6A 1E15A 3BMWA 4HZ6A 1W0MA 2EPMX 3ZR6A 3W81A 3W7QA 2VCBA 1SO6A 4GUFA 2ZFAA 3LCGA 2J7BA 4M7TA 2VFHA 2J79A 2PB1A 4ZQCA 4DF0A 4MADA 1H7PA 1WCGA 1EIXA 2Q8XA 3ARUA 2WO5A 3ABSA 2VX5A 4D6IA 1KM5A 4W9TA 4W7WA 4X0VA 4MB5A 1UYQA 1UA7A 4Y7EA 4IMEA 2FHCA 2XPKA 4JTTA 1GQJA 4O14A 2CKRA 5AC6A 1V7YA 1QVBA 3KRUA 4UCFA 2DZPA 3AMKA 4GBUA 3W2KA 3LDRA 4O18A 2BZNA 1UHVA 4GPNA 2GDUA 1J0HA 2J75A 1KFJA 5C54A 2WVVB 4UC5A 1PZ2A 5CPSA 1NF7A 3T55A 2XFRA 1VHNA 3BAYA 1Y9MA 3S5ZA 4RJEA 4RXFA 2RDUA 1BWLA 1NH6A 3WY1A 2CHOA 3FY1A 4AD1A 5D8ZA 4HA4A 4Z0SA 1GNXA 3ZT7A 5J5RA 4UQEA 3TMLA 5CPLA 1H1ZA 1H5VA 1ZNNA 3PS7A 3VVGA 3WD0A 1H51A 3W1MA 1KR0A 1TPUA 1MW0A 4CNPA 1TPWA 1FH7A 1M6JA 3FYOA 1H7RA 4LX4A 3ARZA 3NR0A 4IOTA 1VLIA 4FNUA 1GORA 3PN8A 1E4LA 1A50A 4J3VA 2IQTA 3LCHA 2VX7A 2QCHA 5AYXA 3QW3A 2XVLA 2A2IA 4BI5A 4PH6A 1E6SM 3NQVA 4QM1A 1B90A 1M7OA 2YW3A 5KTLA 3NSXA 1ITCA 2WCAA 1MO0A 2CBVA 1YTDA 1CGUA 4R27A 4TXEA 2NSXA 2WVUA 4ZEPA 3VNDA 3SC7X 1WOAA 1OIFA 3LHTA 3DFQA 4JY8A 1WDRA 2FDSA 2VFFA 1QPKA 1JQXA 2XWDA 5E70A 3FYPA 3W53A 3N12A 4EAMA 1DOSA 4XUGA 1R30A 3ZJ6A 4EQVA 2DZUA 4MVAA 5DCBA 4BF9A 1QW9A 4N6FA 5F2LA 3GNRA 1BWKA 5G2IA 5D05A 1G1YA 2RH9A 3NMBA 2OCZA 3DBPA 3T40A 2XYLA 3DFNA 3L4VA 3SURA 3VOCA 2AQWA 2IXUA 5CGTA 3NG3A 4JTIA 3N14A 2A1YA 1EWDA 1VRDA 3QFEA 5EFFA 1KFWA 2ABBA 2PRMA 2HMCA 4GE8A 3PSVA 3TU9A 5JUVA 3DFOA 1G4TA 1W3KA 3HPZA 3HOJA 4Y8FA 2Y5EA 4V28A 1FWNA 3SUVA 3RNDA 1ADOA 2D22A 4P8UA 1X1OA 3G1FA 4GFSA 1FCUA 3UY7A 4DUWA 1W3IA 1OT2A 3FA5A 1Y0EA 3WJSA 1LOQA 3B8DA 4RE4A 4TO8A 2ZZ5A 2J27A 5HNRA 4L4PA 1TYGA 4JYFA 1GQIA 2VQUA 1BFNA 4QHZA 1KTBA 3LCWA 4NF7A 5AHIA 4W85A 3FEMA 4AWUA 1UQZA 2WZIA 1O4UA 5F4XA 3WK2A 2ZA3A 1OX4B 4MAZA 3PHAA 4GJ1A 2WKLA 2W66A 2OYMA 1TMHA 2WHJA 2F84A 4S3KA 2XSAA 4AD2A 5HWMA 4P8VA 3VD5A 1R2RA 1JZ6A 3I3DA 3H3LA 2ZZ1A 1YQ2A 2J7FA 1U30A 5G2HA 1ALDA 2NX9A 4HOWA 1P0NA 3K30A 1VGAA 2YLLA 5EKYA 4PMXA 4W5ZA 5GNZA 4JFVA 1NWUA 3T08A 2WLYA 5BRBA 3L0GA 5FF0A 3C2EA 1GPFA 3C0JA 1IIGA 3A22A 4N02A 4UTWC 5AC8A 2ZTJA 2ATMA 2R8WA 1PPIA 3GYCA 3U57A 2EQDA 3FKKA 3IIXA 4JTSA 3PZVA 3VM7A 3WH7A 4B3KA 3VIKA 4F9JA 2DZVA 2Y85A 2H8XA 1GYNA 4WXYA 3CH9A 2QR6A 5FL1A 3AIQA 1GHSA 1VEPA 5A95A 4X9SA 4RXGA 1EUNA 2WB5A 1EEPA 5SWUA 4LNYA 1LLWA 4LS1A 3PZOA 4NRSA 2OSYA 3VGBA 2WOQA 1XSKA 2Q8ZA 4O12A 4MY8A 1WBHA 3O6CA 1VQTA 3STCA 1J0KA 3GXDA 4E2OA 1KM3A 3GLCA 3SIZA 1UR1A 3VPLA 2YYUA 2X1UA 4PODA 1PCWA 8TIMA 2OSXA 2C0AA 3VINA 2BV9A 1HKJA 3PG8A 4IWWA 4OBTA 5AHMA 3KZSA 4P8XA 4LVDA 2OX1A 3M47A 1KTNA 3HG5A 3CTTA 3OZOA 3W73A 9CGTA 1W3HA 2YPIA 5I24A 3TAOA 2NWRA 4DELA 1ICSA 1UD6A 2ADDA 2ZUVA 1V6VA 1K8ZA 3NPVA 3S5OA 1SMAA 1CX9A 1VFMA 3EMZA 4IM4A 4ML4A 3VGGA 3NDZA 3OHIA 4OHQA 4DF1A 3TSBA 1EGZA 2QDGA 2X1SA 2ZZ4A 4M6VA 1TPC1 4L4OA 5A6AA 1C91A 3EB2A 1W9DM 4HA1A 5C71A 1E4MM 1J0ZA 2WMIA 1QFEA 2E77A 3E0IA 1SO3A 1KTCA 3IV3A 4CQ8A 1BF2A 3LHZA 4AD5A 2XSBA 3EXTA 5CG0A 4UFIA 1MW2A 1I1WA 2A6NA 4LC8A 1V3JA 3CHEA 5DF0A 1QNSA 4HZ7A 2GQ8A 2A6LA 3MKKA 4WY0B 4MAVA 3QMRA 4WKAA 2VEKA 5CSSA 3W3OA 2NV2A 2ZX9A 2OWCA 1PBGA 3HGSA 4K38A 3K4DA 4K7YA 1KXQA 1FXPA 6CGTA 3SUUA 3W7OA 3L67A 3MP5A 1XGZA 1QWGA 4UZUA 3ZSTA 4MKNA 3DENA 1HG3A 1YHTA 3W7HA 1DHKA 3BGJA 1V3KA 5CG7A 4FEZA 3F5LA 1V6UA 5ABFA 1KQZA 3PG9A 1CLXA 4MDOA 4YHEA 5IHSA 4J3TA 1LL4A 1FUYA 4TIMA 1UR8A 2VZVA 1O94A 2J9XA 3GH5A 4CNOA 3AHTA 4ZQRA 4HNUA 1JCNA 3GXIA 3CZEA 2WSYA 1TRIA 1YDOA 4XZBA 1U33A 3RILA 4O17A 1BVNP 1BSIA 1CGXA 2B7QA 1JF5A 4UTIA 3FIGA 3G0UA 1W9UA 4RR4A 3KF5A 2Y24A 1F4AA 3GBDA 3EMQA 3L68A 3TTYA 4XBSA 1GPWA 2DJXA 1WYIA 3LTSA 4JYEA 3W2JA 4XKYA 2WBKA 4I7WA 1LG1A 2WANA 3THAA 2ZRYA 2Z6JA 4S2BA 2A3AA 2QJGA 2Y88A 5I0DA 1VFUA 4TTUA 4QAIA 1O95A 1M7PA 1UR2A 3CU2A 3TJXA 2V3EA 2DH2A 3OBAA 3MP4A 3VE9A 1U5JA 3PF3A 1EOKA 1LBFA 1CZ1A 3VMOA 5A6JA 1LBMA 4ATLA 2JKPA 2VOMA 5EY5A 1GJWA 5FEXA 4V27A 2OSWA 4N2YA 2HVMA 1JYWA 2XN2A 4WUIA 3A9IA 3ZSSA 1BTMA 3WDRA 5KZEA 2WVSA 3W7MA 1XXXA 1JULA 1B1YA 2D0HA 5E9AA 1WX0A 3GK0A 4LU0A 1W3TA 4H8VA 2ZXDA 4NSBA 3ARWA 1VH7A 1ECEA 4NZJA 1GTEA 2EAWA 2NX3A 4ICNA 3W29A 1IXOA 1GWJA 3KRSA 2H90A 2ZWZA 1HJUA 1OF8A 1JIBA 3AMGA 4D6DA 2J6XA 4GXMA 4NX0A 3UZ5A 3WBEA 3BK0A 3LRLA 3VMNA 4KH2A 3LHYA 3TX9A 4P7NA 4WJXA 1B9BA 1ZCOA 1LL7A 1X6LA 3SFKA 3GAYA 1OFPA 4IUOA 1JD7A 1F73A 4XTIA 1D3CA 4H4IA 2Z1KA 3VGHA 2YXGA 5CSUA 1VLWA 3P7YA 1B30A 2ZX5A 4JCMA 1OFBA 1OFDA 4HHPA 4KWVA 4MNLA 1OF6A 3L2LA 1B2YA 3SZ8A 3BV4A 4HT3A 4ATDA 5EB8A 2CLFA 1BYCA 3KVKA 2Y7GA 1GOOA 1KA9F 2DEPA 3GNOA 2DDXA 2CLHA 4LGXA 2YL5A 3WDQA 1KCLA 5HXMA 3EWYA 3VX1A 4ZFMA 3NJ3A 2DIEA 3AHVA 3TUUA 5M03A 4AEEA 5HJLA 2EPHA 3L65A 2P0OA 4JX5A 3BAWA 1VC4A 3AFBA 1QW8A 4LYPA 1HUVA 3T7VA 4N4QA 3U75A 5BW6A 3NA8A 3W7JA 1SSDA 2J7HA 3WQ4A 2YCEA 4O16A 5I3FA 5I77A 1XKYA 3M0ZA 3LXCA 1NARA 4IGHA 3A3HA 3B0VC 1W1TA 3R89A 1VBRA 4MJ2A 1CXKA 4F8XA 3W75A 3O1NA 2QLYA 3AMDA 1R47A 5AN7A 4O8RA 3LMYA 4ALDA 3FXYA 3WK0A 5DT7A 1B9ZA 1AL8A 1BKSA 2R94A 2CKSA 2E9LA 3ZO9A 1E5JA 4TX8A 3SCWA 3CZLA 2OXBA 4KFOA 3QGVA 4ADSA 1W37A 3ATYA 1LL6A 1DWJM 3EMCA 3VNYA 2PCQA 1H11A 2F2HA 1GVYA 1QOPA 2CZFA 4IMDA 4MNJA 4U33A 3M16A 4XZWA 5T26A 2OYKA 1EDTA 4O53A 2YL9A 2FFCA 4LRTA 2G3JA 4Q33A 2BX7A 1ZJAA 3AZSA 1SFJA 4MJ4A 4AZ6A 2JIEA 4LPCA 2VVSA 5JBDA 3TC7A 3W28A 4AAJA 3HBLA 2JGYA 4UQAA 1FOBA 4YPJA 3TE9A 3W1RA 3NUKA 3PZTA 5FK7A 1SO4A 2PRHA 5DFAA 3RJXA 4EWND 3I7QA 1E6RA 2ZDRA 4NT0A 3B8SA 2VZSA 4J3WA 4ZXOA 1E0XA 3N34A 3BLPX 3M6YA 4F66A 3GIYA 4Z08A 3I7SA 1EA9C 4Z1BA 3M46A 4OOUA 1ESWA 4PMZA 4JIQA 4GINA 2NXGA 1H49A 2G4FA 2YIHA 5F2GA 4UQCA 4D6GA 3J7HA 3CBWA 3ZJ7A 1Q6LA 5AC4A 3RO8A 1LRTA 3NZRA 3TV8A 1VHCA 2A7PA 2XVNA 2F7FA 4NZCA 2BY0A 4KGLA 1ZAHA 3KL3A 1WV2A 1X7FA 3G1AA 1VF8A 3RU6A 2BSLA 5DBTA 2JKAA 4H6KA 4O52A 3UERA 5AYBA 3PBWA 1W5MA 1PVNA 2J24A 3SCTA 2XQRA 4I9AA 4M6PA 4CN1A 3W86A 2WYSA 4D6EA 3TR2A 3G6MA 4HNVA 3STEA 3N04A 4FK9A 2BVTA 1B3ZA 3PB0A 3AISA 4AB4A 3MYPA 3O07A 1W1YA 1QMLA 2Y70A 3UWQA 1V03A 3RLUA 4CD6A 3HBKA 3EXSA 1JNEA 1NSJA 1KGWA 1R8LA 3DI0A 3W74A 4HKPA 2ZOXA 1Y7VA 3F4WA 3JRKA 1E40A 1FWRA 1QHPA 3PULA 1HP5A 3ALFA 2QCCA 3BVJA 4DO4A 1K03A 1HJSA 1FXQA 1G4EA 2EHHA 1C90A 3MBFA 3ZMRA 1GQNA 5CSRA 3B06A 5FEPA 4IPLA 3WDHA 1UB3A 1XBZA 4O1DA 3AIVA 5FKCA 3L66A 2QMJA 4K37A 3G1DA 1TPEA 2QF8A 3AHYA 2J88A 4BR1A 2ZQ0A 1TO3A 1Z32X 2FH8A 4OUEA 4IMGA 2TYSA 3C52A 5CPMA 1KXTA 4JQTA 3QW4B 3ARXA 1Y9GA 1J11A 1UD4A 4A3YA 3M7SA 2E0PA 5I3KA 5LSMA 3CUHA 4D1JA 4I7UA 5ABHA 1WB0A 2YR1A 3AYRA 3RJYA 5K7JA 1GTHA 1M53A 4RX0A 3WJXA 5IM51 3WFAA 4WD0A 4ZL1A 3AS3A 1MQQA 2EPNA 3OGSA 4MNKA 3W26A 3MHFA 2YGYA 2AEYA 4X9YA 1MEHA 3SR7A 2ZUMA 3KVLA 3IIZA 4ORIA 3HJZA 4NQ1A 1PIGA 5FL0A 2CNCA 4AZ5A 4UTTC 3HN3A 4WZHA 4JICA 1HL8A 1FP9A 2CLIA 2GJPA 3BARA 3A47A 4IXXA 2VTFA 1MEIA 4UOJA 2AMGA 2BHYA 1KV5A 3E02A 3DXIA 2QDHA 1LROA 3NQMA 1SMDA 4BWLC 2WAGA 4JR5A 4UR9A 3CT7A 3WFZA 1ZALA 2JEQA 3T2QA 4UR8A 1LCOA 4PEEA 1IXNA 4TVUA 3GXTA 2UY4A 2VZTA 3BXWA 1OX4A 3OIHA 3ZWSA 1NEYA 4UFHA 3CWOX 1CGYA 3A4XA 1CGVA 2QV4A 2Z6IA 1RVGA 1CWYA 1HFBA 2NZLA 3Q58A 4FO4A 1EH9A 3S5NA 1LG2A 3HG4A 3IIPA 3W22A 3S1WA 1V02A 2FHBA 2D3NA 4AXNA 2DQXA 1KM2A 3S1UA 2AC1A 2DORA 2G3IA 1W5OA 3KHJA 4B16A 4HPXA 1AMKA 2V5BA 1EXPA 4TU1A 1N82A 1ZBCA 1OYCA 1QCWA 2KZHA 4FF5A 1ZY9A 1GVSA 2GK1B 3RM9A 3T0BA 2VZUA 1OINA 3W1PA 3NQGA 1EP2A 3L0KA 4X2RA 4TVDA 4PMVA 1UD5A 1LRQA 3QJAA 4W8BA 3ZR5A 2D24A 2VZOA 5IBXA 1X1ZA 4AD3A 1NFBA 3MP3A 1ICPA 1O5KA 2VELA 2ZTKA 3PBGA 2J7EA 2CLOA 5F1UA 2E8YA 5CLTA 1EB3A 2VO5A 3FAXA 4OQVA 3V75A 3BG9A 5BCAA 1F74A 3UGGA 2WNNA 3WK1A 4JTEA 3DHPA 3MV01 1J9YA 1E70M 3PUEA 2ZUNA 1KFLA 3S6DA 2WHLA 3M5YA 3WMBA 5E6ZA 3WNKA 2BVYA 4JXCA 5FF4A 1LORA 4OOZA 4DWSC 3LOTA 3QR3A 1XBVA 3NEVA 5E93A 1PAMA 1HKIA 3B0PA 2YKKA 4H8UA 3ZM8A 4PC8A 5E0FA 1OHLA 2DH3A 5EFDA 3MJYA 4CVWA 1F2JA 1W5NA 3NQ6A 2VJXA 4RE3A 4BQ3A 2J7DA 3ARSA 3D0CA 2O7SA 3WQ5A 1GVOA 5IFPA 4UMAA 2XVKA 2CEQA 3G1SA 2JIWA 1DJNA 1SR9A 1XC4A 1EO5A 1QI0A 5FF3A 3T44A 1E3XA 1G9HA 3IAQA 5ABGA 3CWNA 3PR2A 2PURA 5LNWA 2TRSA 1EWEA 3PSWA 3P61A 1JZ2A 4DQWA 1WE5A 2UY3A 3NXFA 2QQVA 3ABRA 3E9AA 4M19A 1I2PA 4PEKA 3PZ9A 4P7RA 3LV5A 3GVGA 4GWEA 3TC6A 3VIPA 5D2TA 5GNYA 3C2FA 1GVRA 4D6JA 3BCDA 3G18A 3HMJG 3LHUA 4NJJA 1TPVA 4HNNA 3S1XA 5AHFA 5M5DA 3D5HA 3IVUA 2VURA 4FNSA 1W9BM 1SW0A 1JCJA 3L5LA 1G94A 3E49A 1GQLA 1PZ3A 2ZWYA 3W7LA 3A4WA 3PTMA 4FNPA 4BI6A 4E38A 1GJPA 1CTNA 4U5KA 1HO4A 5FIPA 2JE8A 4PSPA 1UA3A 2DPEA 1XSIA 4GI6A 4EOUA 3ARVA 3STFA 3QHMA 4WY0A 5A6BA 1C7SA 4UTMA 3NVTA 5BROA 3W84A 4JAWA 2IUZA 2A0NA 5AYZA 1CNVA 1FWTA 1UKSA 3WF1A 4WKHA 5I3DA 2Y7EA 2YA0A 4MUZA 5HUPA 2WHKA 1ZBWA 3NGJA 3P82A 5G4WA 2E5DA 3ZJKA 1F5ZA 3I68A 1TSIA 2X1TA 1GQKA 4QISA 3GH4A 5FOOA 3L2IA 2GUUA 3KFTA 3C4UA 3VU2A 4KWUA 1F6KA 1P6WA 5D33A 4H7VA 3LCFA 2WMJA 3MW7A 1H09A 2XGBA 4RZ4A 5FCZA 2FPVA 3T0AA 3MS8A 4QCEA 1L6SA 1EHNA 4Q32A 1LRNA 1UCWA 1M7XA 4TMCA 1WDWA 5IBXC 2GVGA 1A47A 2A3CA 3ARRA 4OE7A 1I2OA 4AMAA 4OZOA 4K8EA 1KXVA 4CUCA 4DUVA 1JCYA 1DWHM 3S0CA 4FLRA 1ZENA 4NJKA 4FB7A 1BG9A 1I75A 2WC3A 3L2MA 1MEWA 3UG5A 3VD3A 1LWHA 3HPXA 1OM0A 4Z2LA 4YCPA 2VX4A 5D09A 3NQ7A 2B7NA 2E5CA 3ZFHA 2V82A 3LPFA 4A4AA 3OSDA 4EF8A 1EHAA 2WKJA 4JYDA 2W0UA 2J74A 3SCQA 5C2XA 4M5PA 4QNWA 4E0CA 1VCFA 1QHZA 3GXPA 4CNNA 3PZQA 3WF3A 2XGIA 3ZR4A 3SUWA 3WNNA 4J9JA 5HQEA 3WDIA 1GJUA 3N18A 3SGUA 2A3BA 1Q6RA 4P2VA 1I8JA 5LHFA 1HP4A 3L4XA 1PV8A 1L6WA 1RQBA 1V6YA 4GO9A 3O06A 4UTWA 1KM0A
chains in the Genus database with same CATH superfamily
2J1AA 2CYGA 3SRDA 3DAQA 3AM2A 4FPHA 1NG0A 4Q29A 2QGHA 4P9YA 5FFOC 4O10A 5FMCA 1AJ0A 2R1BA 3WEMA 4UBGA 5HDRA 3EAUA 3H3ZA 1E9YB 4ZZ5A 5FMOS 1W9XA 2ANUA 4CCOA 3M5XA 3WNPA 3V0UA 1CDGA 2YX0A 3RPDA 4FAGA 2OYLA 3BIEA 1RQEA 3TIMA 3KUMA 1PHWA 1NWRA 1FWFC 1UWWA 4JTQA 4BQWA 5LW9A 4GNJA 1WOBA 1J0JA 2MUCA 1OLMA 1JVNA 3W87A 3RMYA 3TEYA 2W67A 2ZTNA 2JJ6A 1LOCA 3PURA 5A6TC 2ZA2A 3UGHA 3EB4A 3SY5A 4RFRB 1QOSA 2WVTA 1JR1A 5LZLA 1YPFA 2X8RA 1F31A 2NUXA 1Y9QA 3I7RA 2ZEZA 3WL0A 4PRTA 3H7UA 2G97A 4DJFA 3JB8A 2DQWA 1XIDA 1W9WA 3M07A 4HZMA 3WUGA 1OHFA 2PN5A 1VJSA 4DZAA 2Y7FA 3CLWA 2Z2UA 1LULA 3PC0A 4CD5A 5LXEA 1FNYA 1J0IA 4RD7A 1RJ7A 2OT1A 1NXD1 4PA8A 1GK8A 2R063 4LUJA 3TH6A 4Y9MA 4WBBA 2ZZ2A 3DDMA 3HIFA 1K5MB 1BVP1 4DFSA 1VD6A 2RGMA 3AZRA 1R3SA 3TQVA 1KXGA 3ZT6A 4PMDA 1H8TC 4JDBA 3LI0A 3CIVA 4W8JA 3QLLA 5CZSA 3NL1A 1XH0A 3J8F3 5IOBA 4FOYA 2ZX2A 5GZGA 3EOUA 4JC1A 1FOD3 2FDHA 2Q8CA 5ANQA 1S39A 1IS4A 3EPOA 4ES4A 4BZYA 4HNTA 4BLIA 2O9OA 4HKOA 2W87A 1EXBA 2WL1A 5LA2A 1KBJA 3OEXA 5A2AA 1D4M2 3VNKA 2BLEA 4GQRA 3S6TA 1X6NA 3W7EA 1S55A 4UCGA 1QATA 4WLCA 2UWAA 3UKNA 3WLMA 1N7KA 3DECA 3QVQA 2QQNA 4K7JA 4IIHA 1XYMA 4KRUA 1F9KA 3JBG3 1GV9A 2PTYA 2FVLA 1Q8OA 1ECQA 2ATSA 4UI9L 3ZFGA 2ZYFA 4QQHA 2A85A 1HKKA 1XU2A 1DPMA 3LCIA 1HIZA 4HHLA 4CEYA 4MSSA 5EMYA 3VZNA 2FHFA 4L97A 3FL7A 4LAZA 1SCRA 3TK7A 4MUVA 3KWSA 2K46A 1AR81 1OKQA 2A70A 3WG3A 2PD9A 4YN5A 1AW2A 3SGZA 1I2RA 4KERA 1Y4WA 1VRH1 3KVBA 5D2XA 4PMUA 3BW3A 3QY8A 1V0KA 2ISFA 3UR7A 2CU0A 3U0HA 1SSGA 1IXPA 2KXLA 1EAH3 3WUFA 1GOXA 1AZ1A 1ZQ5A 2ZA1A 4ZMGA 4MJMA 3L4YA 1OYAA 1Z41A 4KBXA 4AF9A 3DG6A 1D3HA 2WNVA 4LBNA 3AP9A 1D3GA 5E1QA 4HVXA 4HVRA 1IE7C 3B0UX 2GC0A 5I93A 4ASKA 2PDMA 4BQ2A 3AHZA 4NNCA 4YTSA 4IQPA 2YDAA 4GCXA 3QQWA 1Z48A 2EO7A 4JIPA 1NIUA 1NOUA 4IQLA 4U3AA 3CH0A 1H0IA 1B3VA 3AVRA 4XUYA 2VT0A 3CHFA 3MDPA 1YW1A 4H8NA 5DXYA 4AC7C 3ZPYA 1IZCA 1UC5A 1H8TB 1NAEA 4US5D 4PE8A 1VYPX 2C4XA 4WM7A 1CGTA 4IPPA 5TIMA 3UV9A 1NCQB 1BVWA 1ME7A 1HXS2 1Q5MA 3SN0A 5KHGA 3WD4A 5DCDA 4RA0A 4C91A 3B00A 1XYNA 5FJIA 4NIAA 3FUQA 1Q6FA 3FEQA 3ROUA 1VRXA 3IJ7A 3OO2A 1VP5A 4LV9A 3TYAA 1B4KA 2IVJA 2NV9A 1QXJA 3GNPA 1HKWA 2IXVA 1AODA 3NZGA 4Y24A 3CASA 5DEZA 1A5MC 1MXSA 1H1YA 1OOPA 4DPPA 4P9GA 4MYEA 4UNKA 5LYRA 3PUOA 1DORA 4P9XA 4HBKA 1C28A 4QX4A 4PUDA 3UXIA 3T0TA 1MS9A 4NRRA 1UIPA 4QPIC 4JZ5A 2JDNA 3QV7A 1U12A 2PLCA 2R16A 2WSKA 4BMEA 4O1BA 4W4QA 2HS6A 2BXYA 3M5VA 3R4IA 3BSHA 3WXPA 4ZO8A 1GQGA 1W28A 1DIDA 4LWWA 5KHKA 4QXCA 1OQ1A 1L6GA 3UESA 1FYUA 4XO7A 3MUIA 4LW7A 2WMFA 4L7ZA 4LF1A 5HMFA 5A8OA 4EPBC 1HF6A 3H2CA 5DG2A 1Y43B 4R34A 3BGGA 4Q26A 5JR2A 4MGZE 1W56A 2UU8A 3R13A 4QKNA 1UOFA 3BVCA 4RDZA 1QRQA 3VFLA 1B54A 4AEKA 4B5NA 4HPNA 5FZGA 5HANA 4X63A 1PHQA 3UA4A 1RY8A 4XTDA 2WNQA 2C16A 1JZ7A 4IH3A 4HKLA 1UU5A 4BCUA 4CXWA 3B0XA 3OPZA 1M3UA 3LIHA 4BWLA 1PE1A 4GZEA 3K1DA 3GALA 2QJHA 4ZU5A 2IVIB 3AOFA 1GGOA 2CLLA 2V81A 3GG1A 2Y61A 3VKJA 3S2CA 4DXVA 3P2VA 5BRPA 1YPIA 3THDA 4NE9A 1GSLA 1ND2B 1O1HA 2ZZ6A 2GNMA 3M0XA 1E72M 3K3NA 2VQAA 1V51A 1D0HA 1I4NA 4JGYC 1MXGA 4M6QA 1FH9A 1XE0A 5DUUA 2HWE1 2C3ZA 3QMSA 2PQSA 2WSPA 3S5SA 1Z42A 1O60A 4OWGA 1Y65A 4TN7A 1R3QA 2XJVA 2NM1A 2C1IA 4S3AA 5E89A 2WZEA 2P37A 1QNPA 3GRIA 3S9YA 2FPYA 3D3AA 3WG2A 1AJOA 1KKRA 3JZVA 3WV6A 4DM1A 4F0LA 2BNNA 4TX6A 3INAA 3G0SA 1JAKA 3SQLA 2D98A 2PTMA 2DSVA 2QF7A 4ES9A 1MS3A 4D7TA 4TSVA 1MSSA 3QYQA 3EA3A 1LGNA 4B9ZA 5A1LA 4XBKA 3HR9A 4J4KA 3SISA 3N11A 1TME3 3D4KA 2QUTA 4QPIB 4QX1A 3F4CA 2G41A 3HPNA 5E16A 1C8YA 2DU0A 3S30A 3NV3A 3LEPA 1U0AA 1TZOA 4KFPA 2ACSA 1S5WA 3MA8A 1UMIA 1JDFA 3CUJA 2EAAA 1WLWA 3VIOA 2JDHA 1XYCA 5I5RA 2ET1A 2P3ZA 3IJ9A 3NSNA 1W1PA 4PMJA 3SCSA 4WK9A 2O9RA 4M3PA 3KCCA 5F32A 2QCLA 2XBO1 4IXHA 3U11A 3VHOA 4D72A 2NT0A 2XJQA 4BLJA 4DUOA 1NP2A 5HINA 4Y9AA 3KAOA 1V6WA 3O6AA 1WKDA 3K4AA 4M51A 1U5YA 3ENRA 5FZAA 4Z82A 3N9RA 2BRTA 3LV6A 3U2OA 2QBXA 3CIXA 4DBUA 4Q5OA 1LDCA 1NY72 1VE0A 2RM21 3USZA 2UY9A 1UP0A 1TIMA 1ZZ9A 3F5JA 1K5MA 2BXZA 2DFBA 3XINA 4U10A 3LS9A 4NZ3A 1BEV3 4S3JA 3A12A 1DG6A 3KVJA 1EEXA 3O63A 4KI5M 4JX0A 3KQ4B 2VMHA 2ZZQA 5JIAA 5LATA 1JCMP 3C7FA 5FZDA 2VZQA 4AFCA 1CENA 3GDRA 3OVPA 2UYBA 4GRSA 5D02A 4MZ1A 3DYPA 4XZ9A 5C6MA 2V5LA 4MPQA 1HJXA 5EL1A 1LLZA 1KRMA 4J3ZA 4JGYB 4QCFA 3U9IA 1RP8A 1YLLA 2PHTA 3VZZA 4M6UA 4LPLA 1F4HA 1JNDA 4EXQA 5CPQA 1OF3A 1MNSA 3OLDA 3VKFC 4GLEA 1WKYA 3WDWA 1VBE1 4NIIA 1UJPA 4DJEC 3SIMA 1O5RA 4IGOA 2BOEX 3M43A 1YRZA 1R1A1 2H6RA 4XZMX 3DEMA 3FHQA 4DEQA 2V5DA 4LBJA 3H55A 5J04A 4D69A 4NL1A 1V6KA 5I78A 5ABTA 4I02A 3WMLA 4Z2IA 4FSJA 4QLLA 4K1ZA 3CIWA 1OD3A 4XG1A 2FMDA 4YTRA 5FSDC 3WUBA 1TVPA 3ABOA 4JDYA 1NAL1 2D7FA 1EJVC 1Z9AA 2GVYA 2ACRA 3HZ3A 3E38A 2D0GA 3NEHA 4JKKA 1MUWA 3N25A 1HZYA 1OB0A 3IAPA 2XJ7A 1LQAA 4QXIA 5H9SA 4KEVA 5AC92 5KMYA 5KR7A 5C4WC 5FEZA 3QOKA 1Q43A 3TJ4A 5DANA 1ZZ8A 1TE6A 4IX2A 1X1NA 1GBGA 4IMCA 4I01A 3HQOA 1QKQA 1DQWA 3L2YA 2V3GA 4UFJA 1V0LA 3NKTA 3ECQA 4I0AA 4P7LA 2J78A 2UBPC 3LZ5A 3MY9A 2VEPA 2OZ0A 3ZKUA 3OVRA 5GM0A 3BI3A 2LROA 2FZ2A 4JIRA 1DWGM 2V5CA 5IFTA 1JZ4A 2PFWA 3SLIA 1KFCA 4R33A 4CDQC 3DHUA 4C7GA 5H9QA 1UWTA 1SHWB 2WSQA 3QSRA 5BXTA 4Y5Z0 1UYYA 4DLMA 3P84A 2B39A 2Q1ZB 1O3TA 4TUFA 4UMCA 3VX0A 1BXCA 2WC2A 2WS93 5HMSA 4O19A 5I3JA 2Y26A 3PP7A 4O0QA 3NKGA 4K8HA 3N9PA 4IT1A 3FWEA 1KBKA 4E4SA 3OB8A 4QG9A 1H8TA 2PZ0A 3C61A 1JD9A 3FAWA 3ELFA 4C6KA 4N9BA 1A5CA 3IGSA 4UTKA 2ZGTA 2C71A 2GFTA 3B03A 1NCQA 1C4RA 1W2PA 4RCXA 1QXPA 3F5KA 4LT9A 1JUEA 4JQRA 4D6FA 4MGYE 1V3MA 3VKKA 3MI8A 4ZE4A 2EPKX 3GTXA 1BD0A 4RZ6A 5FJTA 1NZIA 2WM1A 2HISA 4XACA 2VRQA 3QMTA 3N6QA 1BRLA 4AVCA 4DYJA 1AD4A 1VPHA 4CDUC 1X33A 2GQ9A 1K8XA 1JAEA 2DT1A 1K6AA 2FTYA 3W27A 1S2EA 1OA4A 3PZGA 4LVBA 5A2BA 3B5LB 4NJGA 4NHMA 2QUVA 2WKGA 1NDYA 4B5TA 4R85A 2GPTA 3LFIA 1RPKA 3WIJA 1VRBA 1A5BA 1BYBA 1E6ZA 3IK2A 4B2DA 4P61A 1B0IA 3A4AA 2D2HA 1YQ5A 2PLJA 3O5SA 3N9MA 2MEV2 3A4JA 3W70A 3ITTA 3SSJA 1R2SA 1SW3A 2C5DA 1GVQA 4AVVA 2D0FA 1YFUA 3TSMA 1NCRC 4H14A 4XX6A 2I7GA 2E26A 4N9EA 4BHPA 1FY6A 4LV4A 5C4WB 3WX7A 2MANA 4F2BA 4RE2A 2VQ0A 3BJFA 2QMKA 3LHVA 3UR5A 4DJFD 4Y90A 1F8IA 1OA3A 2PSNA 5BMWA 2CLEA 3V1HA 4GMEA 4XQDA 5H91A 1RUD3 2KAUC 3GH7A 2Z79A 3QPEA 2ZE0A 1HN0A 3ZYRA 2OZJA 1ML1A 4WM8C 3FA3A 3LPPA 1UUMA 2CXGA 4QKBA 4QNEA 1H4PA 5A70A 2XM2A 2Y63A 4IJBA 2D6KA 2CZDA 3L7RA 5CZTA 4OHVA 4S3BA 3A7QA 4XQ4A 1JI1A 1QWRA 4EXBA 2WWUA 3ABXA 2WZHA 2YC0A 5FP3A 1BQCA 1EC9A 4O57A 1UH4A 4QGCA 3NNFA 3ZOAA 4CDQB 2ZHLA 2BGOA 4UQBA 3TCEA 4UTFA 2VFEA 2PFHA 4JFUA 2FDIA 4E8CA 3QM3A 2VM8A 3GZAA 3HO8A 5A6MA 3GAKA 3LY0A 2Z1VA 4CD7A 2OODA 1DQ4A 1ND2A 3I2JA 4PDWC 5CA6A 4PCTA 1QQP2 5TSWA 1UOJA 3O1VA 2PU1A 1T96A 3O1PA 2XUCA 2GDVA 2YOCA 4FPSA 1U22A 1JF6A 2LTNA 2V67A 3QZAA 3AO0A 2VR2A 4Z42C 2P4EA 4LE3A 4RFT0 3K8MA 4KWOA 1N2VA 3JD72 4LAMA 3RM8A 5BYWA 2WWDA 4PMNA 1NQDA 4FXGB 4HPGA 1WZAA 1IZKA 1XPWA 2JG8C 2DJLA 3MMTA 3MIFA 4U2YA 1OXCA 4IE0A 3RMEA 4A2SA 4K3UA 1CLKA 1ME9A 5GJNA 1AX2A 1J1TA 3NPWA 1A0CA 3PNAA 1XC6A 4Y8EA 3MW2A 5JH2A 1SZBA 3EOEA 4CDUB 3DI1A 4LBQB 1GOQA 2XWEA 1MYRA 3J7NA 2JGQA 4H01A 4UUIA 3KS6A 1J83A 1UN1A 1GZWA 3S7IA 5FZ4A 1WQ5A 1ME8A 2XONA 1XL9A 2C91A 3GXFA 4GO8A 4FNRA 1XDLA 2Y8UA 2FGBA 1WW5A 4I0BA 2ZC1A 2QQUA 2C15A 4WVXA 4QPIA 5C2GA 4LXLA 4OBRA 2JKXA 2DSWA 1UH3A 3A23A 4ZY9A 4R7JA 3G1VA 1AJ2A 1VENA 5DZGA 2HNEA 3P60A 2VNRA 1GWMA 5EQUA 5T50A 2VAUA 2VZPA 1NCRB 3DHFA 1ZAIA 4QHRA 1IWAA 1MZ6A 4IQDA 1AL7A 4HQVA 3B9IA 2EIDA 5FZOB 4AL9A 3TAKA 3L4ZA 3MC5A 3IJ6A 1DHPA 3G2GA 4PMQA 4CCKA 1FFRA 1R9ZA 3KGZA 1HL9A 1AQ0A 3NQDA 3GHRA 2BTMA 1HXJA 2P8BA 1QNYA 1YADA 4QFUA 1SFSA 3QPYA 2PDNA 3V36A 3OZPA 1W3NA 4WM8B 2V63A 5FZMA 4FT8A 3MPBA 3W01A 1PNFA 4UTHA 4Z1YA 3WDJA 4QITA 3ZMOA 3JZUA 1ZRRA 2O4QA 2VWTA 3P93A 1YYAA 5HPCA 4Z17A 2YU1A 1G6NA 1O68A 2OVUA 2C6SA 4ZTYA 1JYCA 4O0KA 4POCA 2J8FA 4W5UA 4I3PA 1E0UA 4WDUA 3IIIA 4AI8A 2DIKA 4HN4A 1UR0A 3RK8A 4ASMB 4MTVA 3AYSA 4N7UA 1G8WA 4PDWB 4L5ZA 1UOKA 3N4EA 3JUUA 2EXOA 2QUUA 4PYSA 5T91A 3BAXA 4X8NA 1ZBVA 4IPIA 4J1OA 5HCFA 2XL9A 4JGYA 2OZ8A 1MQRA 5A94A 5EMUA 4JRLA 1KV8A 1H3GA 4FPCA 5LNRA 2JG8B 3UJFA 5CFCC 4PN2A 3RM4A 4KCWA 1JI2A 5C2CA 1A3HA 1V3IA 4NPRA 5JMCA 1B35C 4G8TA 4HTYA 1XR2A 2VOTA 1YXYA 1KFKA 3I3QA 1RALA 1T7LA 4W89A 1W8WA 4XQ6A 3U5YA 1WMXA 5T9CE 3TQKA 2ZCGA 4C65A 3GXMA 5DRCA 1VYSX 2BXVA 4PFHA 3UEQA 1UPPA 4QDRA 3E6BA 3P5ZA 3QY7A 2NQ5A 2BVVA 1HT6A 5IYYA 2PC4A 3TTQA 2QAPA 2HEWF 1NA1C 3DH7A 3TOJA 4HIBA 4P14A 1MR5A 1GMMA 3KHDA 1TR9A 1PO9A 1E6XM 1B3XA 3Q8FA 3SN1A 2VL4A 1GYKA 4LXFA 2BGQA 5C70A 2C14A 3BZJA 3W4RA 2W94A 1BAGA 2WRAA 3VBUC 4HNCA 5LNSA 1TIWA 2Y6KA 3IJDA 3MWCA 1O6IA 4E3VA 3MKCA 4AWEA 1GT8A 1D4M3 2RDRA 3PZUA 1HJQA 3OG2A 1QU4A 4O54A 4FHAA 3JR2A 4Q4KA 1PDYA 4EE2A 5CBJA 1JHNA 3AB0A 3BOPA 2O0TA 4C1WA 5T5PA 4UMBA 4MWAC 3KF3A 1REEA 2WYFA 3BTNA 1DQXA 3WKZA 5B80A 3PJXA 4KGJA 3SSZA 4Z1AA 2RS51 3B4UA 3B02A 4A21A 4ERAA 5FZ9A 5I2UA 4DBEA 2VUNA 2XN0A 2ZKLA 1Q6DA 3PUQA 1A5AA 3E12A 2PLV1 1T6MA 3OLIA 2ZX6A 2NX1A 4EROA 4UR7A 3RN6A 1RUG1 2QZRA 3RLGA 1DBTA 5D03A 3MMWA 2YZRA 4CCEA 1EO7A 2BP1A 4GNKB 1JN2P 1IS3A 2VMFA 3P80A 2NLIA 4K68A 2GAUA 2WZTA 1WCKA 4PUWA 1TPDA 2Z7KA 3BSMA 1X7NA 3WH8A 5A8NA 2YYTA 1LHUA 1Y5VA 2OQ6A 1JDCA 3SECA 4MGSA 3P8IA 5EMLA 1QJY3 3CQIA 5BU9A 4DJEA 4RGKA 5IRPA 3WD2A 1B35B 1KJLA 3NJVA 1UYXA 1GOMA 2AQVA 1R082 1UKOA 4DQAA 1G01A 1KNWA 3MSYA 2ORZA 2K0GA 2PTDA 3C0LA 1DQ2A 4LYQA 3WL1A 2WMIB 3V7PA 1WDQA 5CFDC 2A3HA 2NMOA 1Q8AA 1ULCA 1YNAA 1B57A 2I9UA 1AYN1 1DV7A 1NDVA 2UWBA 3FHAA 1CN1A 3LGRA 4ZQMA 1LBLA 5CJMA 4E4HA 1B4EA 1OG6A 3GNDA 3ILFA 3U1XA 1TQJA 1ODNA 2RVAA 1TPH1 1NA1B 5KINA 4CXYA 5JR7B 1DE5A 3ONBA 5KHJA 2RS31 3VBRC 4DB7A 5C4WA 3W24A 4KRZA 4XIKA 1O3RA 1DHKB 4JKLA 4XCAA 5HCBA 3KV6A 1HXS3 1ZJBA 4XDPA 2R1LA 3I6RA 1O1ZA 2N7GA 2QNKA 4LAUA 3OPTA 3PJWA 4FXRA 4JGDA 3H0OA 4Q6JA 5L36A 1CECA 1S46A 5HR6A 3GHNA 1C8VA 1IHIA 3RHGA 1X8CA 1Y5WA 3KB5A 1KBLA 3UZJA 5BNKA 1MW1A 4XKYB 4O13A 2Z00A 1GW9A 3U2ZA 3W23A 1L7QA 1V9U1 3WELA 1ZGDA 4LO6B 1A5OC 4K7VA 2FYMA 2Y60A 3KOFA 3NQHA 4YM3A 2FJKA 4KKXA 2J8TA 3WG1A 1UC4A 1OSGA 3OGVA 4BZ4A 1CXIA 2G3MA 2WZ8A 2H0BA 5BNNC 2VC7A 1UR4A 4HPHA 1DYKA 2X0YA 2RMU2 5J5DA 2W92A 2YB1A 2DIJA 1COV2 2XPJA 2I07B 1B3YA 4CXXA 1F7BA 4LS0A 3DC0A 4ZE5A 4CCCA 1NF0A 2NW0A 1RYYA 4GWMA 3ITOA 1YEWA 4NHXA 3PTKA 1RZMA 1UR3M 1QI2A 1WZLA 2XXZA 4QJ4B 4TVCA 5JXQA 1PMIA 1CLVA 1VBUA 4U2AA 4E4PA 2BY1A 5HR7A 3AXMA 4WF7A 2F2KA 2FGZA 4XXAA 1RUC1 5LY2A 4BQ5A 1K42A 4ACYA 3SUSA 4NZ4A 3GC2A 4CDUA 2WMGA 4AI3A 1BHGA 1ADSA 1ZL1A 2Q01A 2YL6A 4AZBA 3AIEA 1SFNA 3UXKA 2PGFA 3WK3A 1WUEA 3GM8A 2OS2A 1FOD1 1RD5A 1FWWA 3GDMA 2XH2A 2PF8A 4WIWA 3T05A 1SBEA 1PX3A 2L9LA 5D8WA 4AYSA 1UZZA 4OV9A 2XDVA 2E6YA 3VKNA 2NQJA 4O1AA 2X1RA 1MNZA 4XZHA 1OC6A 3WQ7A 4GACA 1XYFA 4OU1A 3T2OA 2Z24A 2CESA 2CHNA 4JTHA 4GH4C 2JDUA 1XIFA 1KD0A 4CEXC 2DCTA 1K9EA 2I16A 1U5HA 3MYOA 5H2ZA 3VBRB 2A7RA 4BQ4A 1FRBA 1RHI2 4JTJA 4IMFA 3WLTA 1CWPA 1OLME 3VDDC 3OYXA 3KCXA 1GQPA 1E15A 4HZ6A 4UW3A 5C5TA 2QDEA 1AF9A 2PDHA 3ZR6A 4RS5C 4EPDC 4XJUA 3VOFA 2DW6A 5I7GA 2YPJA 2CSGA 3LCGA 3ICJA 5DG1A 4MADA 4C60A 2Q8XA 3ARUA 2C1FA 2AQOA 4Y7EA 1UA7A 2OLSA 1EAH1 1ITUA 1DJIA 4JTTA 4XIAA 3LZ3A 3KRUA 4HNLA 2DZPA 1UHVA 3LDRA 4GPNA 2BZNA 3CL7A 3TTEA 2J75A 1KFJA 3I7DA 1L6FA 3EPMA 1XNDA 2XFRA 2GVEA 4IGPA 2R041 2AKZA 1PM4A 1BWLA 1TJ1A 2CHOA 4AD1A 3T81A 5D8ZA 4PDWA 4XZIA 2HWC2 1GNXA 3ZT7A 5J5RA 2VXJA 4UQEA 3O1TA 1OVSA 2PDYA 1DIKA 4XJWA 3N2CA 3WD0A 1TPUA 1MW0A 4XO6A 1TPWA 1GP6A 5I09A 2JG8A 1L3JA 3PN8A 1E4LA 1K4HA 1SJDA 1F61A 2IQTA 3LCHA 3K13A 3DF0A 2Z4GA 5I02A 1VB2A 3C7HA 3ZYJB 1MO0A 5FBJA 2GDQA 1Q2SA 3MHZA 4R27A 2NSXA 3IZOA 3SC7X 1WOAA 1OIFA 4FXFA 1GP4A 4IL7A 1APNA 2VFFA 1QPKA 1JQXA 4L9ZA 5GJMA 4ISQA 3N12A 4EAMA 2PHWA 1HDKA 1WMFA 3AMHA 4MVAA 2E9QA 2D2GA 1N3OA 3GNRA 5F2LA 5G2IA 2GQ3A 2XYLA 5J1XA 4S3DA 3CO2A 3VOCA 3NG3A 3N14A 2J1TA 3ACHA 5EFFA 2J1RA 4A6OA 5JUVA 4FR1A 2J1SA 2TEPA 3HPZA 1VPQA 2BVBA 4Y8FA 2ZABA 4GH4B 3SUVA 3RNDA 2ZPXA 3R4DB 4GFSA 4DUWA 3FA5A 1Y0EA 3WJSA 1JU4A 1F15A 3KCOA 2ZZ5A 1FV2A 3LE0A 4I9TA 4NRQA 4NF7A 4W85A 3S1GA 4AWUA 1NOVA 1O4UA 4MAZA 3VDDB 2VDGA 4XABA 4GJ1A 2W66A 2OYMA 2XSAA 5FYTA 2YDEA 1YIXA 4BWOA 2OEMA 4RS5B 1JZ6A 1R2RA 3H3LA 2ZZ1A 5JOXA 2NX9A 2VWSA 4HOWA 4O9GA 4JHTA 1P0NA 1PIV1 3R7MA 4KESA 4X6RB 4PMXA 1RMU2 4W5ZA 3T08A 5FF0A 2Q5TA 4UTWC 5FZ0A 2ATMA 5FCCA 2VGFA 2LUWA 4QX5A 3FKKA 3TN5A 7PTDA 2WZR1 2PGRA 3CH9A 1GYNA 4IP5A 4WXYA 2QR6A 4RXGA 5XIAA 4ZSTA 1ITQA 4W6XA 1LLWA 4LS1A 3CMFA 4NRSA 4E8GA 3NNLA 2OSYA 3VGBA 5A33B 1ZVFA 3N3HA 4LBMA 4HTBA 5AZ1A 4R9BA 2BOFX 3ST7A 2B9VA 3O6CA 1VQTA 3GXDA 3O0KA 5HNUA 4PQ9A 2OZ3A 3VINA 1WUVA 2WLQA 3GXUA 3ZDVA 4IQJA 3KZSA 1Q8SA 1JUHA 3HG5A 5EYYA 5A6QA 3GBWA 5C3QA 1XLDA 3TAOA 1UD6A 2IQ0A 4Q8NA 2VNOA 4AVTA 4LULA 1B35A 4NG3A 2WMIA 1QFEA 3EA1A 1KTCA 4AD5A 1O4YA 1T2XA 3H1MA 4AHYA 1XRTA 2A6NA 5DF0A 1OUXA 1FAYA 4HZ7A 2PDWA 2A6LA 2O4MA 3I2IA 4WKAA 2VVFA 3Q8CA 4Q4Y2 4M4RA 1W6QB 4S2DA 4QQLA 4XFHA 1NA1A 3SUUA 1QWGA 3UBPC 1DHKA 3F5LA 1V6UA 1KQZA 2D44A 1X36A 1WCQA 4FPLA 1LL4A 1QJX3 4XF4A 4AR2A 2BWCA 1IKQA 4N7QA 4CNOA 3DPRC 4D0QA 4Q7BA 2VEFA 2VNVA 2RS13 4UTIA 1LOFA 1X38A 3WDUA 4DN1A 1IQAA 1F4AA 2Y24A 3GBDA 2REQB 3L68A 1LHWA 4YHGA 1YO8A 4JYEA 3JU9A 4XKYA 3W2JA 3I97A 1LG1A 2ZRYA 3LQGA 4NWWA 3CKHA 1UR2A 4NZ5A 3CU2A 3OBAA 5JOWA 3PF3A 1CZ1A 3VMOA 5A3UA 1JPMA 2HWGA 4WZCA 2QW5A 4N2YA 3KTSA 1YBQB 5A3PA 3ZSSA 3RJRA 5KZEA 2WVSA 1C8M1 4CSWA 5J09A 2D0HA 2R1DA 4LY4A 4S2HA 1EJ7L 3I2HA 3ARWA 1ECEA 4NZJA 1PTGA 4IGQA 4KW2A 2EAWA 4ICNA 4SLIA 3AP4A 2RJGA 2ZEYA 3KRSA 1REQB 1OF8A 3AMGA 3WLNA 2J6XA 4GXMA 4NX0A 1RUJ3 3VMNA 3LRLA 2ODOA 3MT1A 1W17A 1IGWA 2BOIA 3HT1A 5JI7A 1AYM2 3GAYA 3HQNA 1BEV1 4IEZA 4IUOA 1D3CA 2AUYA 4MH0E 2XGXA 5JSPA 1ENSA 1OFBA 1OFDA 4HHPA 2ZEWA 4MNLA 4JCKA 1B2YA 4OUMA 4GYJA 2R24A 5EB8A 4ATDA 2DEPA 3KVKA 4XFGA 2DDXA 5LB6A 2DCKA 2QZ3A 5HXMA 4FXJA 5HXVA 4G4FA 4IV1C 4AEEA 2V73A 1DTNA 3L65A 1Z89A 3CS2A 3ENLA 1VC4A 2GOKA 4DRVA 4JX5A 5FXVA 3WDYA 3WUCA 1R3TA