1XU1A

The crystal structure of april bound to taci
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
137
structure length
137
Chain Sequence
KHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor ligand superfamily member 13
publication title Structures of APRIL-receptor complexes: Like BCMA, TACI employs only a single cysteine-rich domain for high-affinity ligand binding
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine, hormone/growth factor receptor
total genus 29
structure length 137
sequence length 137
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2004-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1xu1A00
2JG9C 4J6GA 2Q1MA 2AZ5A 2RE9A 3K48A 4KGGA 2WNUA 1WCKA 2JG9B 1DG6A 4G4FA 1XU2A 4KGQA 1PK6C 1XU1A 1ALYA 4KG8A 3AB0A 4D7YA 2HEYF 3FC0A 1PK6B 3MI8A 4DB5A 1KD7A 2ZPXA 4MSVA 2RJKA 2HEVF 1JTZX 2ZJCA 4RSUA 4N90A 4G3YC 4QQHA 5BNQA 2QE3A 1D2QA 2WNVA 4QQLA 3WD5A 1D4VB 4OUMA 2JG8A 5L19A 2RJLA 5KWRA 2HEWF 3LKJA 2WNUC 3QBQA 1TNRA 1O91A 2Q8OA 4TSVA 4F3JA 5KC6A 4QQPA 4QQOA 1S55A 2WNUB 4EN0A 1U5YA 4TWTA 3ME2A 2TUNA 4QPYA 1GR3A 1OQDA 1A8MA 1I9RA 2OIIA 1C28A 2E7AA 1TNFA 5HBAA 4MXWA 2R30A 1C3HA 2Z5WA 2TNFA 2WNVC 2JG8C 4E4DX 2R32A 3TWIA 3QD6A 4QQ2A 2JG9A 1D0GA 2X29A 3B9IA 4NN0A 2WNVB 2JG8B 5TSWA 2QDNA 3TYJA 1RJ7A 2R6QA 2KA3A 4GIQA 3URFA 5KC5A 1PK6A 5CIRA 3B94A 1OSGA 4E4SA 1U5ZA 4OULA 1OQEA 4MXVA 1KXGA 1IQAA 2O0OA 3B93A 3IT8A 4DOUA 3V56A 3K51A 5L36A 3L9JT 4MXWB 1RJ8A 1DU3D 3ALQA 1JH5A 4HT1T 4OUSA 1U5XA
chains in the Genus database with same CATH superfamily
1LOFC 4S2HA 5FUNA 2A7AA 3AYAA 2RDSA 1UIJA 2BFUL 3MZHA 3U4SA 1PZ9A 4LHKA 4AEMA 3AZYA 1RVF2 4B4RA 5FYBA 2WNUA 1CZTA 2ZEYA 1S1AA 3GBWA 3KGZA 1AXKA 2DCZA 1OHFA 2D40A 3ZN6B 4ZKTB 1CR7A 1UXXX 5FP3A 4HK9A 1GWMA 1O8SA 1QXPA 1N3OA 5FYYA 5KHJA 3VB9A 4IGOA 2YU2A 3LOIA 1TVGA 4QKFA 3S6PA 4IV1C 1UXZA 2QQLA 4WM8B 3E1F1 1RUC1 4CCDA 5C70A 3W58A 3BIEA 2BGOA 1QXJA 1SFNA 4I02A 4CEYC 4FPYA 1YLLA 2Z42A 3OGJA 3FL7A 4K9SA 3OPWA 3V0BB 3BOWA 1WW7A 2HEVF 5CG9A 4M4PA 2Y60A 1RXFA 2BBVA 1UZWA 1J1LA 3EYPA 2VAUA 5GLWA 4QQHA 4Q4Y3 4A41A 1WKYA 4YYOA 1BMV1 4QQLA 4HBNA 4AFMA 2Y6KA 3ACHA 1LHOA 2EIEA 3QH6A 4LOTA 5F3GA 1WA4A 1Y3TA 2CU5A 1QJX3 4XVHA 3CBNA 5FQ0B 3VDDC 3H8UA 4Y33A 2XB6C 3A21A 1XYPA 2W87A 4AI1A 3ZFEB 4E4ZA 3N9LA 4XF4A 2WT2A 3BYWA 4GXLA 1UCXA 2E7QA 1W0OA 3CLPA 3THTA 4FOQA 1WMDA 2BOIA 5FZEA 2VVDA 2FZ1A 4XXAA 4ORFA 4L92A 1MVEA 1LKNA 2BP6A 2QQIA 1UOBA 2XH6A 3MLJA 1CN1A 3WDWA 1WMFA 4URAA 4EWAA 2TEPA 3ECQA 2RS53 5A7WB 1HDKA 2PXJA 3VDAA 3ACFA 1XOYA 1MS9A 1SHWB 2ZAHA 4I0AA 2A6VA 2W47A 4FP2A 1COV1 4BXFA 3BGAA 4NHXA 4XCBA 1LGNA 5FZ7A 1NCRB 1UMIA 1V9U2 3DXTA 1RUC3 3PUAA 5FWJA 1WGPA 1R091 4CCJA 1RUI1 3OUIA 4AAPA 4CDQA 5K0UC 1N1YA 3KV9A 3L2HA 2BZDA 2DBIA 1UOJA 3IIIA 4UAPA 1RUJ1 4FI9A 1GP5A 1WZXA 3ZXDA 2RM23 5CIRA 5FY8A 2SLIA 2GALA 5D1IA 1POV1 3MV11 2CSGA 1PGL1 1W8HA 2WQ4A 1JZ4A 1WCSA 2OQ7A 3NV4A 5C71A 1H8TA 3PUHA 4JAAA 5FZOB 4Q4X2 5LBFA 3FHIB 5T5PA 2R062 2XG3A 4GJYA 2F4PA 5FZHA 1OFSA 1OQ1A 3H1MA 1UQXA 4JDNA 3KQ4B 1HRI1 3AMMA 4ZZ8A 1M4WA 3PVNA 3I2JA 3UGFA 5KXCA 1NCQC 1FNZA 4BOWA 3ZLIA 4XXPA 1DU3D 1SZBA 4RD7A 3VD5A 3ZXGA 4LBJA 5CVRA 1UZVA 5GALA 2D97A 3DGTA 3MYXA 4J6GA 3ZFGC 5K4LA 5C4WB 1JUIA 4J25A 2RMU2 2XBO1 1COV3 2VMCA 3LPGA 5FZMA 3OF1A 1GYKA 4QX7A 5FXXA 5T55A 1WMXA 4QPIC 1W99A 2VULA 3PMEA 4GB33 4S2DA 4COWA 5C8CA 1XU1A 4RHV3 4PDWB 4PI2A 1F9KA 5FFOC 3IBMA 5HXVA 3GYDA 1NE4A 1AL22 3C7OA 5BNNB 4AFBA 4AEDC 1ZRCA 2OUJA 1W3XA 3TN92 1RHI1 4LBMA 4NRMA 2W1WA 4JC1A 2A70A 3S7EA 4DO0A 4CU7A 2DVDA 2PMWB 1RUJ3 1WBFA 1YO8A 4XIKA 2WNOA 1W9WA 3V64A 1AZDA 4KWKA 3HIFA 4DUXA 2XGXA 1POV3 2HLEA 2YGMA 2MEV1 2ZEWA 4N90A 3VHRA 2J1AA 4K1YA 4LUMA 1VAVA 3O1SA 1XNDA 4Q0UA 4BQYA 1N3PA 2G19A 5BNOB 4A3ZA 4BK5A 4HKLA 4N53B 4CZSA 2ORXA 4W6WA 1ONAA 4QX1A 3A4UA 1APNA 2NMNA 4QX3A 4AOCA 3VBUB 1V00A 4IV3B 1BVVA 3C7EA 3B7MA 5F5AA 4COZA 1G7YA 1G9CA 4META 1H2NA 2J42A 3KT1A 4EN0A 4TWTA 4Z82A 1JU3A 2B9UA 4QX2A 1R1A2 2BRTA 3ES4A 2A3YA 3A0KA 2VTXA 4ZU5A 3SH5A 4KWUA 3AMNA 3ON7A 4D69A 5C7GA 4FXKB 3NAPC 4R52A 3RYKA 1K5MC 4CSWA 3SXWA 3M4FA 3RJ2X 3IIAA 5IVBA 4C0HA 1W8UA 3PMSA 3B00A 1UU5A 2NZ9A 1ZZ6A 2P6HA 3EJKA 3BPSA 4XJWA 1ZRDA 2R071 4GWIA 1RMU2 1RHI3 2F6BA 1Q43A 4O9EA 3IDBB 1S2EA 4ISQA 1PO11 1ULFA 5CFCC 3H3LA 1H9WA 4LLFA 5DAPA 5FBZA 5FPVA 2BDRA 2V72A 4QQ2A 4AQ2A 1OOPC 2VBDA 2GMEA 5A3PA 1AR73 5HCHA 4M3CA 3H1WA 4CXWA 1VBB2 1NA1A 1OA2A 4AVBA 4YGDA 1EUTA 3LQCA 4Q26A 4XBLA 4COYA 1CVNA 3DYPA 4LBQA 4QPGB 2KA3A 3LFIA 2VC9A 1HV1A 4XFCA 2BQPA 3HD8B 3UK9A 1IS3A 4IEOA 4L0PA 4FTSA 4MLOA 4RR3C 1WW6A 4QKBA 5HCBA 3MUZ1 1AR61 2X09A 5FP8A 1TMF3 2P3YA 4GKYA 3SITA 2ZMLA 4DRVA 5LB6A 4GH4A 4XE9A 5JZGC 3SCHA 4B7EA 3ZFFB 4CP2A 4XBNA 1WUVA 3OYWB 2FMDA 4NHMA 1OPOA 2VOKA 3IPVB 2D3RA 4LHLA 4DRRA 3PHMA 3VBRA 2JG9B 2R073 3I3BA 2V4VA 5EWSA 1HQWA 2DDUA 1GUIA 3AJZA 3WY6A 1ZX5A 2ZACA 4IEXA 2X5IA 1K42A 4MADA 5BYNA 3CL1A 1ENQA 2R1DA 1L3JA 1R64A 2WWUA 3S7IA 3NSTA 1N47A 2VR4A 2DVGA 4QKNA 4GULA 4PQQA 4U36A 3RWKX 3POJA 4V1PA 2OZJA 2DTWA 3SISA 1AJKA 3AP7A 4YW7A 4M3CE 3N9PA 4BZ4A 3AX4A 2LALA 1GFF2 3T09A 2VZTA 3R4SA 3WDUA 1W2UA 1GWLA 3I49A 2EA7A 4DQAA 4KBZA 1CD3G 1AR63 2RV9A 4UW6A 3V0AB 5LBEA 3T0DA 1D4M2 3WXPA 3ZDVA 5BPXA 4MGTA 1Q8VA 2BEOA 1EV11 5CADA 4N7IA 4XFFA 4R4XA 3VDBA 4MGSA 1DZQA 1QHDA 1NQDA 2UU8A 4FP3A 1ENSA 1I1EA 1NX9A 1RUD2 1P8JA 1YCIA 2RR12 1S55A 4P9GA 5FPUA 1U5YA 3CJIB 2JE9A 3H7YA 1H1AA 1IS6A 3MGUA 4QPYA 4CE8A 5FR3A 2DCJA 4D8MA 4XETA 4XFBA 3DECA 1A8MA 3LIHA 5FOJB 2LM3A 2QVSB 5FPLA 1HJGA 1YI7A 2XJUA 1OBNA 2WO1A 1CIWA 1YFWA 3KV6A 4NWVA 5FJHA 3ZYPA 1RINA 1YC61 4QMAA 1OURA 1PX3A 3AZZA 3HQXA 4BQ1A 4LNVA 1S2BA 3O0WA 5HCFA 1X8MA 4YVWA 5HI0A 2BVVA 4QB1A 1V6KA 4UFMA 1V6MA 2FDFA 5JLVA 4OHZA 1VBC1 2W94A 3LDBA 1BHGA 3C3VA 3WG2A 2XKOA 4CUCA 2RDRA 3ST7A 1SACA 2WO7A 5F5QA 1OLMA 3WUDA 4IGPA 4E4DX 1RVF1 5KHHA 4LIVA 2X29A 4HOOA 3UKNA 1YHFA 4IEZA 4YFWA 3WCSA 2NMOA 5C9AC 5FZFA 3KHBA 2JEMA 3IKWA 4CEWC 5GZEA 5IAXA 4LKSA 5D8AC 3VBSB 1DYOA 1Y9MA 4TYSA 1PK6A 1NZCA 1LR5A 2AYHA 3HAGA 5DUWA 5K7PA 1LEDA 5LBCA 2RS13 4CUAA 4QHZA 5BUVA 3ZSLA 1Y7BA 1LGCA 4W6XA 3E5UA 4WM7B 5E16A 2Q4SA 2PHTA 1IQAA 3R4DB 1CAUA 3VLBB 4P5HA 1GANA 1TE1B 3WP4A 5J98B 4NAMA 4UF0B 2D6OX 1BEV1 1ASJ2 4OHYA 4PQ9A 4QGNA 5A3WA 2V4AA 4FPOB 5I0RA 1IZ3A 1VPHA 1NG0A 1Y43B 4M3CF 2P3KA 1YQ2A 2ZCWA 3BALA 5FYHA 3T2PA 2JECA 2KM2A 1W06A 4Q0QA 4JKLA 4PIXA 2J1VA 1ND2A 3CEWA 2JXAA 5DUVA 5JSPA 3BKZA 4LK7A 1VBC3 3UV9A 1IOAA 4O9GA 4XDOA 1BXHA 4YM1A 3NMBA 3NQHA 1PNGA 3SHRA 2OA2A 1RVF3 1OI6A 1QOSA 1AHSA 2OS2A 3VBFC 1CAWA 4Q0PA 2FDGA 2WT0A 1LOAA 1S0GA 3IB3A 3GZUC 4IL7A 1JZ8A 1GZTA 2ARCA 3KB5A 1KEXA 4NIHA 2GNBA 1W05A 2VOXA 4RSUA 1LULA 1MQTC 2WSVA 4V2WA 4Y4RA 1V9U1 5A7PA 5F39A 3WNLA 2Z69A 3GXUA 1O8PA 1RUG2 2WS92 4PBPA 1J3PA 3BB6A 1F15A 4X6QB 3PVBB 3M1HA 4AI9A 3RZJA 1D4VB 2YBKA 2XVKA 3O0XA 1JXNA 2XLGA 3U4XA 4HG6B 2XWJB 2YPDA 3FX3A 5HPOA 2B42B 1BEV3 1PO22 3I2KA 4ITCA 1O3RA 1ND3A 1O91A 5DUUA 3H8RA 1G9DA 1CWPA 1ZA7A 2WO2A 2Q8EA 1AYM2 3KF3A 4WVMB 4MOAA 5IATA 5J37A 5CU1A 4A45A 3AYDA 1U5IA 4YARA 3A0NA 4CA9A 3H8OA 3POFA 1W8FA 2Y6JA 5JUVA 3RNSA 3N3HA 1AX2A 2XR4A 3AKSA 3PTRB 4XF1A 4NIIA 4Y1ZA 3K4ZA 1LOCA 2BUKA 3N9MA 3POSA 5CKQA 3FMGA 5ANNA 5CFDA 4AF9A 4YM3A 4YVSA 3SEPA 3ZN4A 5L7OB 2PQQA 3FLTA 2XVLA 2J7MA 3WHUA 1RTVA 1VALA 2PQSA 1WCDJ 3KCYA 3C7GA 4BCUA 2PYTA 1N1SA 2FDHA 5FP7A 4FQZA 2Q1FA 4RQPB 2E26A 3JB8A 3JD72 1W8OA 5FZGA 3RS6A 3NV1A 5FZDA 3DPRC 4XACA 3PVEA 2QQPA 2VM9A 2XJPA 3RDIA 2VZSA 3RZLA 1OF4A 1W6OB 4WVWA 3NNGA 2YBPA 2WAAA 1OH4A 2VZ3A 5LATA 3P6BA 1W6PB 3JXSA 1RJ7A 4W50A 2AEYA 2D6PA 1GICA 4LHNA 1EY2A 4UYBA 3MLKA 3W21A 1JZ5A 3O7OA 3T30A 1DGLA 1Q8SA 3BTAA 3AP9A 3DL3A 4KI5M 2HBUA 4XIOA 5LA2A 2FDJA 1BK1A 2P3JA 1FV3A 3D5OA 4FPCA 3Q8AA 5FYUA 4B4QA 1CAVA 3ZO0B 2GC3A 3ZSMA 2Y64A 2WZR2 5LEJA 2BBAA 4FQ4A 3ENRA 1ZBE2 4M0NA 3GDBA 5I8SA 5C6CA 5K8SA 5ERLA 4MZUA 1UX6A 5FY4A 5F37A 3PIGA 1IG0A 3U1XA 5FYVA 3MIFA 4YSFA 1UOFA 4EWEA 5LWBA 1VIWB 5FOBB 4QXBA 2VNRA 4NOTA 1QF3A 3PUQA 1JZ3A 1QJFA 4AHWA 3U37A 3RMXA 5C3QA 2ZKLA 5KXEA 1U5XA 1RUH2 1G86A 1FATA 4UFHA 4XDQA 4QXHA 4YNIA 4N43B 3WG3A 5EJ1B 2EIGA 1NKGA 3CIHA 5DUXA 1LHUA 2WLPA 2ZA9A 5C3PA 3OY8A 1WWYA 4RS5C 2AR6A 1UKRA 1CONA 4D7TA 2FCVA 1DHKB 5KHKA 3AZXA 1MPXA 3QCWA 3UGHA 1R1A1 3VD9A 2WQZC 2P2KA 4AK3A 1A6CA 3UNPA 4EWDA 5C33A 2C9KA 4DXSA 5JR2A 4CP0A 1BLZA 2ZGOA 3VBHA 1FOD2 1KD7A 2O14A 2UYAA 3AYCA 2V73A 5LRRA 1HRV2 2VMDA 4OUEA 3BCWA 5H9SA 4CCKA 1YIFA 3OBAA 5A32A 4IDZA 4IV1B 4QGMA 1G6NA 4JQTA 2UWCA 5F8PA 1ENXA 2ARBA 4CEYB 2EIBA 5BNQA 4HN0A 5BNPA 4NUBA 1UF2C 5T3NA 4XOGA 1QDOA 2BYVE 2JG8A 3VBOA 2VNVA 5I91A 2C0ZA 3WEZA 2FDIA 1MVQA 1VRBA 4QDRA 4UFLA 3WF2A 3ZXAC 1MEC1 1VBB1 3QBQA 3WP5A 1B35A 4FPGA 5A6XA 4YRDA 3ZYFA 3ETQA 5IJRA 1YXWA 1O59A 3OBZA 4AEJA 4A6OA 3GJAA 1LESA 4X6RB 4W6YA 4NHLA 3VDDB 4C1WA 3ZX7A 4QXKA 3ME2A 4CP9A 2I07B 1JMUB 5JI7A 5A6QA 3BN6A 4JGYC 2NQYA 5IT6A 4JCKA 2ZX3A 4XHXA 4XW3A 5FZIA 3DXUA 3WW4A 3DUIA 3RZMA 3KSCA 3CJXA 2ERFA 4AQ6A 1R1A3 5F2SA 5JXGA 2D93A 2ATFA 5T5OA 1JODA 1SLAA 4I01A 3QOPA 1O3SA 4E9KA 4Y1UA 3MF6A 5BY5A 3GBGA 3AYEA 2PAKA 2WNVC 1REDA 4LBLA 1TME1 3T1MA 4JZRA 1BCXA 4AI3A 4NIAA 1VMJA 3RJRA 1AR91 3QD6A 3N7MA 4AVTA 1QJZA 2R49A 2A6WA 4E8DA 3S57A 1AXYA 3ZN6A 3GZAA 4I0BA 2JDAA 4R4ZA 5L9BA 1UMHA 1UY0A 4CCEA 1VLNA 3LD8A 5K0UB 2CGOA 4WM8A 4XHBA 1W90A 4E2QA 3D6EA 3PNAA 4YG0A 1KITA 4XUOA 3ILNA 5KHGA 1MEC3 3V0BA 2QTWB 5LY1A 4XJ8A 4AVAA 2WUHA 1RUF1 1QJY2 3M70A 4CUBA 1XNKA 3ZIXA 4AZZA 2EAKA 3ES1A 3LB9A 1QOTA 3D3AA 3ZSKA 2W08A 2DCTA 2VW0A 2PHLA 3PU3A 3Q8BA 1AYN3 4AHZA 4MXWB 1VBD2 3WDXA 4BQXA 5FPBA 3JQWA 4CVUA 4FBFA 4D0QA 3ALQA 3N35A 5FQ0A 1D4M1 1FYUA 1MZEA 4QX0A 3MFAA 5FKCA 2CV6A 1Y9GA 4CTEA 5DDJ3 5G04L 1NCQB 3ZFEA 2GZWA 1YNAA 3ZDSA 3RYPA 5KXBA 4UXAA 2Q1MA 1SG3A 2RE9A 5FZLA 1AR82 3LZZA 4KMQA 4EV0A 1HB2A 1RUD1 2RR11 2QFEA 4P02B 3ZFGB 1TME3 5DQ0A 3NV2A 1MS0A 1CQ9A 1JZ6A 1OKQA 1AR93 4HK8A 4Q0SA 3WCRA 1GLHA 5LBBA 4QPIB 1GNYA 4JGZC 5A7WA 3AL6A 4AXOA 5I93A 4F83A 4ZY9A 4DY3A 5J96B 1J3RA 1QGLA 1JYIA 1T6GC 1IPJA 1HV0A 5FIXA 3PU8A 5FBJA 4AEDB 1NCRA 3ACLA 4HETA 5E1RA 2DWRA 1PIV3 4XF0A 3KCXA 3ZOIA 4B29A 1F2NA 3N9NA 3DV8A 5I0SA 1Q8OA 1QJEA 1R082 2V09A 3OD0A 4G3YC 2BWCA 3VN4A 4A2UA 4CDXC 4D7SA 1XJAA 2XJVA 4JKMA 2GC1A 1FXZA 3WDVA 1QJU3 4Q4V2 5JVVA 4IESA 3U0ZA 1EAH3 1HX6A 4YZ1A 3RZKA 1RUF3 2D7FA 2VUDA 3IMNA 4FOYA 2W52A 4ISRA 3ILRA 4Y5Z0 1G9BA 1XNAA 2NLRA 4AWDA 2EXKA 3D0SA 1JHJA 5JOWA 4M4RA 3AVRA 5J36A 3M7AA 4OI1A 4W8JA 4KQ7A 5FV3A 5T5JA 4Q4W2 1GZ9A 4NVPA 2GC2A 4URTA 4XUNA 4BYYA 1D4M3 1Z7S3 1BYHA 3ZXKA 3TOJA 4EZ4A 1DQ0A 5FZOA 1YJLA 2B9VA 1R1ZA 4Z1VA 2ZZQA 1OD5A 1UW8A 2HYKA 1VBA1 2K0GA 3NWKA 5FZ9A 1ENRA 4DMIA 5FLHA 5A3TA 1LTEA 2XWBB 3EB7A 1RUD3 5FTTC 2HWC3 3O1TA 1PVC1 2JD9A 3WLUA 4IE4A 4SBVA 1ASJ1 1FMD2 3NAPB 4TXWA 2D6LX 1K5MB 1C8M3 4CDWC 5JXJA 4E2SA 3C8XA 4GALA 3VD7A 5C4WA 2LUWA 5C3RA 2Q0AA 5M0TA 2XOMA 2PHRA 3SKVA 1PMIA 3VKMA 2WSUA 4ES8A 1HN1A 2WQ8A 4MH0E 4PDWA 2QJVA 4HKOA 2FCUA 5CYYA 5BNNA 5CFCB 2H0BA 1F5JA 4NAOA 2ZABA 1OOPB 1CZVA 4FTEA 4GIQA 3B9CA 2ZS6B 2Y6FA 5LA0A 1VMFA 2BNNA 1PVXA 2XL9A 3J7NA 2IFRA 4CXXA 2VMEA 2VQAA 4D6QA 4HONA 2GN3A 3BPZA 2CGNA 4Y1YA 4UI9L 3SNMA 4CDUC 1DDLA 3IDEA 2GU9A 4ET7A 3AVSA 1G9AA 4LA3A 1O5LA 1RUNA 5FY0A 2WFF2 2DURA 3POBA 2DCKA 2XQXA 4RR3B 4ES9A 5BNOA 1E5RA 2FHRA 3A22A 2WS91 3HOBA 3MUY1 3OB8A 3FWEA 3ITQA 4K8RB 2C26A 2WWSA 1VBA3 4N53A 2QDRA 3M3EA 4RL7A 4YWAA 1GNHA 1J84A 2AEZA 4IE5A 3OUHA 1CJPA 1OA4A 1YQ6A 2EICA 3VBUA 4IV3A 5DZFA 1FPN2 1PVC3 1SQ4A 1W8NA 5EV7A 4CCNA 1PO21 5JZGB 1ASJ3 5LRSA 2XJQA 1PX4A 3IMMA 4GWJA 3DYOA 2OKXA 1LHNA 2OZ6A 5A3LA 1QOOA 1UU4A 2QQWA 4KGQA 5FY9A 1ALYA 3ELNA 2GAUA 1X9TA 3USUB 2Y34A 4JRAA 4Y1VA 5A6YA 5AC91 1VRH2 3WNMA 5JOYA 3O5SA 3U10A 5CEHA 2ZMNA 3RRDA 1K12A 3RZHA 2ET7A 4IUGA 5D2AA 3K3OA 4BHPA 4XQWA 1NZIA 3WNPA 1LHVA 3NKGA 2E33A 2XMLA 4XJUA 1WW5A 4GWMA 1LOGA 5DZEA 1CX1A 2GNDA 3MW2A 3HVDA 1LOEA 5JI9A 4Q2FA 4BQWA 4IEQA 4QGLA 3MDPA 4K3UA 4YW1A 5LK5A 2X05A 3VL9A 5IVFA 4LT5A 4FAHA 2ARXA 1UD1A 1W8WA 4LUKA 2PTMA 2EXIA 3AMQA 2VNOA 3GF6A 1STMA 4LBNA 2DU0A 3ZYJB 3I2OA 4QPGA 4TLGA 1DLCA 2WAOA 3ZXFA 1R093 4Y4YA 4IE7A 1RUI3 2DFCA 4INDA 2EXHA 2V5YA 3J7LA 1OXCA 3O0VA 1D2SA 3GCXA 2W39A 4EROA 3T08A 3WF0A 1JYVA 4QB6A 1NE6A 1GV9A 4CCCA 2GDFA 2HWD2 4M0HA 2CWMA 1ZBE1 2DYCA 3M3QA 1XSRA 3KF5A 4NRQA 3AP4A 1OD3A 1L7RA 1W8TA 3ZYGA 1GNZA 1CZSA 3ZFFA 4BMBA 4PIZA 3KWVA 2BVBA 2ENRA 4Y22B 3OYWA 1X8EA 2W0XA 2QQNA 1JN2P 4A44A 5AC93 2YGLA 5JR7B 5FO9B 5A80A 1JYXA 3E5QA 1YFUA 1UKGA 1UN1A 2W1QA 1RUH1 1WLDA 4XFHA 1EYBA 1HRI3 2JDZA 3IPVA 1KDMA 3KT7A 5IW0A 3WDTA 4A3XA 1DGWA 4XDPA 3J9SA 4Q1PA 5DABA 4R9CA 2JG9A 4OI4A 4C1XA 2B7YA 1VBE2 1G9FA 2PLV2 3NW4A 4FFFA 4RYDA 3CDZB 1WW4A 5TSWA 1HIXA 2ZX2A 2CTVA 1OA3A 1URXA 2XBO3 4FPHA 3CNAA 1OT5A 3NRUA 1SEFA 4IW3A 4E27A 4UWDA 1UYZA 4NRPA 1W9FA 5C9AB 4E4SA 5FMDA 1FOD1 4CEWB 1U5ZA 4OULA 5D8AB 4EN8B 1ZZCA 2A6XA 3AXEA 5E8AA 3SKJE 3FN9A 2CAVA 5F3IA 1BJQA 1ODNA 2F17A 4DOUA 1YFYA 1LGBA 3C2UA 3W20A 3C7HA 3AZWA 3NJVA 4JDMA 2YU1A 1ZYBA 3AZVA 1MZ6A 4JKKA 3OGSA 4WBBA 4YG3A 3V0AA 1BBT2 5FP9A 4YZ5A 2ZEXA 5FYMA 5ABJC 1DZRA 2KR2A 5CBLA 2IXLA 2VZOA 4OUSA 5E6HA 4XUQA 2MEV3 1Z78A 1VAMA 2Y0IA 3UKVA 5F6LB 5EQUA 4LO8A 4XC9A 5C3SA 4GZ9A 3TEZA 1OMIA 1UOGA 1FAYA 3CJIA 1GOHA 4JHTA 4EZHA 2I2SA 2OW4A 2VBBA 4L2NA 1LAJA 1E5SA 1VAKA 2D44A 2WZEA 2Y6LA 4JX0A 2WR9A 5DMYA 1AXZA 4UW4A 4D7YA 1KRIA 5FY5A 1WD3A 1VR3A 3A7QA 4J1XA 3FBMA 3ATGA 5GLZA 5FMOS 3WT3A 2HWB2 3GBFA 5AVPA 5FRAA 3VBFB 4R8HA 2CGPA 3J7MA 3SQOA 1PHMA 1UY1A 2YFUA 3AMPA 4P14A 4UFIA 1MS3A 1RYYA 2UWAA 1KDKA 5T54A 1MQTB 5FCCA 4OUMA 2OT7A 2RJLA 5FYIA 5FUIA 4P9JA 3RWNA 4DUWA 3VBSA 2WNUC 1V6IA 1PO13 1SLTA 2PHWA 3E6DA 5EIYB 2R7EB 2XONA 1CPNA 3KD4A 3E5XA 3W9AA 1HLCA 4AGGA 2VZVA 5IFPA 3AFGA 1LECA 1MACA 3SC7X 2AREA 3MF9A 4LA2A 1GP4A 4WM7A 2UURA 2VZ1A 1W9YA 2PFWA 1JUHA 2NYYA 2PHDA 1QJY1 2W95A 3KV5A 2ZGRA 2G1MA 4A7KA 4UF0A 5CKNA 4W4ZA 3WSOA 5F9TA 2JDUA 3WF3A 3CO2A 5LZ6A 5GLTA 1KFXL 1VBD1 4ZU7A 1SLIA 1YQCA 2A75A 2YZ4A 3GHMA 4GAZA 4ARYA 3TNQA 1W04A 5A1LA 2G4IA 2OPKA 1UY2A 3MW3A 4A7YA 1K3IA 2WO3A 3VZKA 3OD4A 1AR81 2UY9A 4NMIA 2EF6A 2K9ZA 3UT0A 1YQ5A 3WOGA 2ID4A 4LE3A 3WF1A 3JZVA 3P5BA 4QX8A 3RZZA 5CG8A 3DPRB 1RB8G 2VUCA 1MS5A 3MPBA 2VGDA 5SV8A 3NJZA 3K3NA 1CIYA 3ASIA 1PZ8A 1H2KA 2GNMA 2VMIA 4QPWA 2JE7A 4XQDA 4AVCA 1WBLA 4UFKA 5FO7B 3SCGA 4L9BA 5JOXA 3KCCA 2BU9A 3J8F1 1DZTA 1BZWA 1ZBA1 1H2LA 2O0OA 3VV1A 3ZMOA 1O4ZA 1DQ6A 1R081 4K6BA 1UU6A 3NVCA 4N8MA 5A7QA 4L11A 2EIDA 1HB3A 4LLOA 1MS1A 3AMHA 1Y9QA 4H55A 4Q4V1 2DFBA 3I2IA 1ZZ9A 4Q4Y2 5I0TA 5J3UA 4QU1A 3U07A 1QJY3 1LNSA 2ZX1A 1GZCA 3GALA 3MIHA 4XEZA 5J1XA 3RZGA 2XKPA 3JU9A 4LKFA 4CDQC 1QJX2 1JBCA 1IGOA 4Z07A 2XXZA 1GZWB 2YUEA 3I3DA 1OFNA 1VBD3 5CAZA 4PI0A 4WVMA 3LEGA 3CHXA 2GP5A 4D94A 4MGKE 2CAUA 1EV13 2YMZA 3WG4A 4BDVB 3AB0A 2VG9A 2BTVC 2Y0OA 3N9OA 4HL0A 4RS5B 3VZJA 1AR83 2DBNA 1A78A 1U0AA 1H8TC 3ACGA 3FC0A 3K46A 3QACA 4WVZA 1PM4A 1UY3A 3K4DA 4RGAA 5L7OA 2RS52 4CUGA 1SBEA 1UX7A 2VE1A 5A3MA 2LTNA 3SCFA 1FMD1 3K77A 4K20A 3S5AA 2VY0A 1LU1A 3UL2A 2O1QA 2HKXA 5SV5A 1PMHX 1Q56A 4RQPA 4Q27A 4G9SB 4LORA 5LASA 1RUC2 3OBRA 1LHWA 3P3PA 4DPNA 5JIUA 1W6NB 2DVAA 1H0BA 1CPMA 1N3QA 2YBSA 1W6OA 3J8F3 1KGYA 1ZBA3 4QM9A 4X8NA 1GKBA 2ARAA 3I2DA 4Z2WA 1DQ5A 1F31A 3M2MA 3H3UA 2IXIA 4CYDA 1TZOA 1W6PA 3THDA 2JIJA 1A3KA 1D7PM 1NY72 1RL3A 4BH9A 4Q4V3 2Q8OA 3RG0A 3DKQA 4H14A 5C8CC 4TSVA 2XHNA 2RM22 1J58A 1GBGA 1W0PA 4F3JA 2NM1A 2FD8A 2JB4A 3AP6A 2HWE2 2OXBA 5EXOA 2R1BA 4CCMA 1SMVA 2WDBA 5J7MA 1GWKA 3I59B 3H7JA 3NKTA 2XLFA 4MUVA 4EQVA 4LO7A 4ATFA 2Z5WA 3LWCA 3NNJA 3OSDA 4NPRA 4JGYB 5DAQA 2IVIB 4L97A 1MZFA 1PGSA 3ACIA 2H6BA 1UYYA 1IQDC 2CYFA 4N43A 1H1MA 4KH9A 1KQRA 1SDWA 1CAXB 1FPN1 3VKLA 1QWRA 2BWAA 3WQ0A 1FMD3 1LOFA 1WCQA 3TWIA 3ZYHA 4MGIE 4DXZA 5FYZA 2I74A 3ZYRA 3LGRA 1XE8A 2WNVB 4DEVA 5IVVA 3WV6A 5DAVA 1DQ4A 1HQNA 5I8YA 2IUWA 4GB32 2ETEA 2QDNA 3T4VA 3PLQA 4RHV2 3K4AA 1F5FA 1C1FA 3DEMA 4Q4X1 2UY8A 1VRH1 2R061 4UFJA 1AX0A 4EN9B 2UWBA 3T0BA 2O8OA 1ULEA 1GQPA 4NROA 3OCPA 1FV2A 2IXHA 4YZ3A 2P4EA 3BUCA 5A3UA 1UZYA 3BODA 3VZNA 4FCAA 1RUJ2 4IV1A 5I0UA 3U14A 1XE7A 1KXGA 3IT8A 4HLTA 3FJSA 4QKDA 4CEYA 1SFYA 3WW2A 2B39A 1J3QA 1YYNA 2VXJA 3NNFA 3PJYA 5H9RA 2RMU1 2WZ8A 1DP0A 2AENA 4K40A 3MFCA 2FDKA 1S0IA 2QUOA 2J1UA 3SEEA 1NLRA 2RJ2A 4N9HA 1V9U3 4XMAA 4LITA 2K2SA 4UBGA 4XFGA 2TBVA 1MR5A 1NT0A 1JOJA 3KGLA 1AL21 4PBOA 3SH4A 1C8NA 3KS7A 3VDDA 2LROA 1WCKA 1NA1C 4NWWA 2VMFA 2ADEA 3OG2A 3TN91 5FMOL 2PN5A 2O8QA 1FPN3 3BOPA 2HWD1 2OVUA 2VJXA 2WL1A 5GZGA 1H4GA 2W1UA 4UOJA 5FZ1A 5I0DA 3TAYA 4HSJA 4OHXA 2ZGLA 3TB0A 5HCAA 1HJFA 2A3XA 3FBYA 3MI8A 4QHBA 4TZDA 1EUUA 1RUOA 3POIA 4Q4X3 1JZ2A 1W2OA 4JGZB 2ZGPA 1VRH3 2R063 5EFUA 4GH4C 5L9RA 3ZIWA 2JX9A 5FY7A 5EJ3A 1JOBA 3H42B 2C6SA 2VZPA 3VUOA 1OF3A 1DBNA 3E6BA 4AQTA 3WF4A 4L8QA 2VMHA 4I09A 1VBE1 2PLV1 4PT6A 2ZHKA 2R042 4CDXB 2HEWF 5EP9A 1GU3A 1AR72 5IHRA 3LKJA 5K0UA 4N7UA 2VCMA 3OEBA 3WR0A 1C5IA 1ULPA 1G8WA 2RMU3 3AP5A 5DAXA 3VBRC 1OPMA 4MG2A 3LDRA 1IPSA 2YROA 2E31A 2YB7A 2VW2A 2VBPA 5J48A 4QQOA 4I30A 1WLTA 2ET1A 4AFCA 5EJZB 2X5IC 1HB1A 4M01A 3UESA 1AL23 5A3OA 1NLQA 2B46X 3S5QA 4CPBD 1XNTA 4EN7B 4XMIA 1TNFA 1K5JA 1RMU1 1TMF2 3TN93 4BQ2A 5A1FA 4LO6B 3PVOA 4MXWA 2JB8A 2ZBJA 3SLIA 2OPWA 1SPPB 3LDKA 5GZDA 1GSLA 1BBT1 3H3ZA 5A33B 3GM8A 1XYOA 2TNFA 3MV01 1US3A 5F7UA 5KBFA 3WVJA 5JMOA 1NCQA 2WKKA 4E2GA 2D3PA 3FFZA 5FWEA 2QQKA 2VD7A 1V0AA 2EVXA 5H9PA 4CDWB 1U12A 1NUKA 2IFWA 1T6BX 4KBBA 1UIKA 4KWLA 3DF0A 3ZFGA 1FT9A 2JDYA 2PELA 4NHKA 5LA9A 1PZ7A 2D43A 2R072 2Y8KA 3IAQA 4BIFA 3GZTB 2AH2A 4LBOA 4H3WA 3TYJA 4QPIA 3S30A 1DF0A 2R6QA 2VPVA 3ZPOA 3B5LB 4FOWA 1SLLA 2WT1A 4H2AA 2RS32 5FZBA 4S2FA 1O4YA 2R0FA 1H9PA 4AEDA 1LRHA 3I97A 2HWB1 3Q9OA 4UW5A 1ZZ7A 5DG1A 5JDBA 1UO9A 3LSEA 4MXVA 2PAMA 3EXUA 3B93A 1RGSA 4IGQA 1F4HA 3N7JA 4YVWC 4P9XA 3ZYIB 4MGQA 1OUSA 4CDUB 1UY4A 2XLAA 4HPKB 3PUSA 1SBFA 4KL1A 5HV4A 2DTYA 4HT1T 2AUYA 4PIYA 4UT5A 1AR62 1RMU3 2ILMA 3MBWA 5CKMA 3WDYA 5FPXA 1RC6A 1SBDA 1W28A 5FZKA 5FK7A 1BBT3 5IFTA 3ZR5A 2WN2A 2P5BA 1SLCA 4GD4A 4P08A 1ST8A 2WYSA 1NOVA 5GM0A 4XILA 3ZR6A 1VJ2A 2W46A 4TTGA 5JSRA 1VBB3 1VB2A 2W2IA 2IC1A 1PK6C 2YDEA 1YI9A 4G4FA 4XCAA 3VKNA 2J1SA 3ZKYA 1VB4A 2J1TA 5JSOA 3CKHA 3EBRA 2DU1A 4ONUA 3ZKUA 4XTMA 4Z8BA 1O3TA 1RUE2 5KXDA 2FBEA 1ULGA 1F8VA 3NAPA 2YYOA 3JB4C 1K5MA 2ZX0A 4YW6A 5G05L 2XL7A 4JVAA 1QQP2 2PAEA 3PUIA 2VOVA 2ZGMA 2Z79A 4Q29A 2JD4A 4GMP0 3P1IA 1QEXA 4K1ZA 3FHQA 4OZOA 5DXDA 1KJLA 1E5IA 2GH8A 3LFMA 3POEA 4XFIA 4CRQA 3F95A 4P9LA 3WD5A 3GGLA 5FP4A 1O7FA 3OBTA 5CFCA 1QNYA 1K45A 1OOPA 1MZ5A 1ND2C 1QNWA 4CU8A 3S0MA 3AKQA 1XSQA 2ZEZA 2JKXA 4OLLA 3T4HB 4PJYA 1LOBA 4OI2A 4QQPA 5JCTA 3BTXA 4XYXA 4Y20B 5CZKA 2RS12 2VQ0A 2ZGTA 4R9AA 4O7XA 4DNYA 1OQDA 3HR9A 4Y1XA 5L73A 2MPFA 2ZOEB 3WX5A 4L99A 4RR3A 2E32A 3AKTA 2P3IA 4A4AA 3AJYA 1HXS2 2E51A 5DZGA 1UPSA 2B8MA 2VQUA 4O65A 1XYNA 1LU2A 5T50A 3R0RA 5C5TA 1C57A 4YM2A 3EMRA 1ZRIA 2HWF2 3THCA 2MNGA 5F6KA 1KJRA 5JZGA 4HVRA 2VW1A 1UL9A 3NV3A 4BPZA 3ETPA 3L2YA 2WABA 4Y26A 5C8WA 1DGWX 5K9YA 1JW6A 1IKPA 1LENA 2VO5A 3B69A 2DUPA 2L9LA 4PF5A 2F4LA 4LR4A 1V6JA 1ND3C 3JUUA 2A3WA 5FAXA 1VBC2 3D0JA 3O1UA 3USUA 4XABA 3MHZA 3I3MA 2VH9A 4BMEA 2RR13 3B94A 1OSGA 3AKPA 5FZ8A 3O12A 3T2QA 5ACA2 4MHRA 3D82A 5F3CA 5IVEA 2RS51 2WJSA 2RG4A 4XF9A 4XJ9A 1Y4WA 3BIWE 5CFDC 3LEIA 3LSDA 1M06G 4YVSC 1W6MB 2W9XA 4LE4A 5F3EA 1X33A 2RHPA 1W0NA 4DZGA 5HXMA 3MICA 2ZKNA 1XPWA 2BW8A 2D6KA 2LRPA 4P9IA 1XNCA 3VHPA 5JIAA 1NY71 4ASKA 2QQMA 1BEV2 4JTOA 4FO9A 5H9QA 3HJRA 5F32A 5ABJB 5IK8A 1ZM1A 2ZHNA 4KGGA 3GHNA 2RM21 1V70A 1IG3A 3NL1A 3H8XA 1W6QB 3NJYA 3ORJA 4R9BA 2E9QA 2HWE1 1XU2A 4CP1A 4LK6A 2YC4A 1ZREA 2P1BA 5E89A 3I2FA 3MIGA 2Q5TA 2VXRA 1MS8A 3OGVA 1H1IA 2A73B 2ZHMA 5C5UA 2WC2A 4AR2A 4BU2A 3I4IA 4Y22A 4HVQA 4HN1A 2GH2A 1RUG1 1EPZA 4QU2A 4A7ZA 1VE0A 3ZXJA 1A8DA 2UYBA 1GP6A 1JTZX 5IUQA 1H8VA 3OUJA 2C1FA 4FPKA 1CX4A 4Q0VA 4YLZA 4YZ4A 3TNPB 2QNKA 4S2GA 4OMCA 2QE3A 2YHJA 4WZCA 2QQJA 5JXHA 3HBKA 2P34A 1DIWA 4OCTA 1AYM1 2MHFA 4RFT0 5JAXA 5KWRA 3D8CA 3I2HA 1MS4A 4D3WA 3IZOA 4UW3A 4GB31 4GA9A 5KR7A 4LEJA 1SCRA 4RHV1 5FMCA 1OLRA 5T52A 2H6CA 2OQ6A 3K2OA 5C9AA 4YFZA 1X7NA 4NE9A 3HT1A 4I3GA 3ZN5A 2ZMKA 3FHAA 5GZFA 3RFRA 4CEWA 4DFSA 5D8AA 4ZZ5A 3M3CA 2WNUB 2QBXA 4P9WA 3OTFA 3FZ3A 2TUNA 1BVP1 4GKXA 4BB3A 1PGW2 4TLFA 4ZONA 3BVCA 5FY1A 4IEYA 3VBHC 4B7KA 4RFRB 3ZMNA 1HQLA 1REEA 2YY1A 2HWE3 4MYEA 4YGCA 4QDSA 4EJRA 2RVAA 3JD71 1T2XA 1W2AX 1W8ZA 2AC1A 4MVTA 4XAEA 3TEXA 3T2OA 5JOZA 2E63A 2XHKA 4RN5A 2W3JA 3HN3A 2ORZA 2QQVA 3SMHA 5BNPC 1OVPA 3HQUA 1SFPA 1RUG3 2JG8C 2WS93 3H9AA 3VBOC 1YFXA 1H6YA 1J83A 3WQBA 1B35C 1SCSA 4C8DA 2IWGB 4BQ3A 2GMPA 1Q8QA 1PO23 2WZR1 3BI3A 3FUOA 5CISA 2JE8A 1A34A 4XJZA 4BWOA 1AYM3 4HKWA 3LPFA 3OPTA 3LAGA 4WVVA 2RDNA 3G6JB 3ZPYA 4E8CA 3WHTA 4B1LA 2VECA 4LIUA 1PMJX 3ROUA 2WWJA 2A6ZA 1QDCA 3VBFA 1E5HA 3WQ1A 5LK7B 4Y24A 1OQEA 2Y38A 1WD4A 5GLVA 3VZLA 3KT4A 2ZHLA 3R4UA 2WINB 5FXZA 5LCWL 4IERA 5GZCA 2WA3A 1W2TA 1IHMA 5EHDA 1MQTA 3T3YA 3APBA 4XJAA 4OZXA 3J4UH 4KU8A 4BK4A 3UYJA 5DG2A 3MPPG 1I5PA 4DY5A 2R041 4C90A 2LS6A 5HV0A 1AR71 1J1TA 1YWKA 5FZ4A 4AHXA 5FXVA 1TG7A 1QXRA 3JD73 4JQRA 1F4AA 2ZGNA 4QHOA 4AI2A 3K48A 4XTPA 1YQ8A 4CDQB 4CU9A 5DN2A 3MIDA 3WUCA 4BM8A 3KM5A 5J09A 3HEIA 1YJKA 4WM8C 4ARXA 3SH3A 1HRV1 3DCQA 4DINB 2XQRA 1CESA 4W65A 3M3IA 2J1EA 2QZ3A 4MGZE 4Y5SA 2HEYF 1TMF1 2CL2A 4NJ4A 4XBQA 3LA2A 1ZRFA 4IETA 2WZR3 2XVGA 4FSJA 1F35A 1ZBE3 3AM2A 4P5YA 4V2VA 1QU0A 4IEVA 1REFA 3HT2A 4FAGA 4QB2A 1H8TB 1OUXA 5F1RA 4I2OA 5F2WA 4DIQA 3TEYA 4ZHNA 3Q8CA 4DXTA 2VL4A 3WNOA 2GMMA 2YPJA 3GJBA 4LOSA 3LE0A 3WP3A 1CGPA 1FNYA 3VKOA 3ZFEC 3CZJA 2DF7A 1RUH3 3ZXLA 1DCSA 1UWWA 2GNTA 3DPRA 1XRUA 4BLIA 1JHNA 1QIQA 2BGPA 1AJOA 5JPNB 4Z92B 3O1PA 2CNAA 4IEPA 3IWZA 1WA6X 5KC6A 2R043 2RS31 1H2MA 2ZXQA 3LA7A 1DQ2A 4UBHA 4C91A 4ZXKA 5IAVA 2XDVA 1MEC2 1OC1A 4HSLA 2JJ6A 4J1WA 5FUPA 1W9TA 2JDKA 5C8CB 2D6MA 2JENA 3ILFA 5FYSA 1I9RA 1JYTA 2KD7A 1S0JA 3A23A 4AL9A 1XNBA 2ADDA 3B02A 1FOD3 3O1MA 1NCRC 2X53S 5D21A 5AFEA 1V6LA 2R30A 3OPZA 2A71A 1ZZ8A 4LMFA 4YW5A 1HRV3 1AYN2 4RA0A 4HMZA 5L9VA 3CF6E 4PLNA 4P9YA 3WZ1A 2P37A 1OH3A 1GZWA 4IE6A 2BNOA 4ZU4A 4FPJA 1KS4A 5DDJ2 2Y33A 4FVVA 3POGA 2SBAA 2B4KA 2YXSA 4AAXA 4QM8A 2G9FA 1WLWA 4OVEA 4AW7A 4JDOA 4WZFA 3N9QA 1PNFA 2ZAAA 2OYZA 4BIOA 2OUHA 1ULOA 1YIPA 2IZWA 4NIDA 2DVBA 1TME2 4RS5A 2Q8DA 1S0FA 2ZX4A 4YGEA 1LODA 3TEWA 2CWSA 1WMEA 1AR92 4LQRA 1O6UA 4OFGA 1H30A 1JS9A 2VCAA 1UYXA 4GMP1 1RUE1 1IKQA 1AUYA 2QZ2A 2QCSB 3D4KA 3JBG2 4ZXEA 1OVSA 2LW8A 5IVYA 1I3HA 1QQP1 3LA3A 2CDPA 2W1SA 4YW4A 2P6CA 5FZCA 1PIV2 4OMDA 1GOFA 1DYKA 3UETA 2GP3A 2RS33 2W68A 3INAA 3T1LA 3V56A 1HKDA 4LKDA 5B4NA 1W6NA 2ES3A 4U2AA 4AVSA 4QX5A 3FUQA 4SLIA 1QJU2 3J26N 1IS4A 1CJDA 1EAH2 4COUA 5C4WC 4FFGA 1JH5A 2A6YA 4CXYA 1RUF2 2Y6HA 2DVFA 3N7KA 4N9IA 4BE3A 4OI0A 1C4RA 4LXLA 4JTNA 1LJ7A 3GCWA 3LCPA 3I3QA 1I5ZA 3THPA 2AZ5A 1ULCA 4PDWC 3VDCA 2VUJA 3F2ZA 3KV4A 3LIGA 5JWPA 2PA7A 3AL5A 5BNNC 2RDQA 4PLMA 2JICA 1Z7S2 2AGSA 2YV8A 4NIGA 3DN7A 1B09A 3I59A 5CB7A 2RS11 1KS5A 1DGRA 4M3CB 3H1YA 1NA1B 4EN6B 2VOWA 1AX1A 3MO4A 3EO6A 4LBQB 5FMBA 2VZRA 1HXS1 4JGYA 2DV9A 2HWC2 2ZPXA 2VCCA 4A6SA 4MX3A 5AFBA 5FDBA 2WYFA 2C24A 4HZFA 1C8M2 1CAXA 2HWF1 5BNOC 3HPNA 3LEKA 4GMP3 1RUE3 2VCBA 4N53C 3ZSJA 3WNXA 3BTZA 4AVVA 3KZ4C 2JDPA 4YM0A 4D6RA 3I8TA 2WNVA 4GH4B 1QQP3 4Q4W1 3KQRA 4IV3C 3VBUC 1E57A 2FCTA 4FPLA 5A6ZA 1JOPA 4BQ5A 3VD3A 5FREA 3BU0A 3TRSB 5IWFA 2XPJA 1JZ7A 1TNRA 4WV8A 4YPJA 5F5IA 4BISA 1X9PA 2YC0A 5DPNA 3TBDA 1YEWA 5EZWA 2P17A 2W5FA 2X8KA 1EP0A 1ZA4A 2B5HA 1GQHA 4EYUA 5ACA1 3VBRB 3NNLA 5DAWA 4BXSV 1SDDB 3K75B 2VUAA 3JCIA 4IQPA 5HBAA 4C0BA 2WLQA 3ABZA 1AVBA 2X5IB 4B4PA 2D6NA 2J1RA 1D0HA 1X36A 5FKBA 1VBA2 2EAAA 3U78A 5BXXA 1R083 2CY6A 4H7LA 3O1VA 4K8FA 4AI8A 1HXS3 4CPBA 4LBQD 4R9DA 1PVC2 4FXGB 2YC2A 1BMV2 3I7DA 4LBKA 1XBFA 3C7FA 3RMYA 2BPA2 2W92A 4QPGC 3KHCA 3B9IA 2HWF3 2G9ZA 4YW3A 1EPWA 4B3NA 1AL0G 4RGGA 3ZXEA 3I3EA 3PL0A 4BLJA 5LY2A 1UZ0A 1S0EA 2JDHA 2IXCA 2WNEA 1W3VA 1AF9A 2XJSA 2VVEA 4Q4W3 3IN9A 2ZGKA 4AGRA 5FYTA 4BQ4A 2D5HA 3PIJA 2NN8A 2WA4A 4I3PA 4Q8LA 2WFF1 4ZS2A 3UKTA 2IVJA 4JGZA 1VP6A 1V6NA 4M00A 5LA1A 1NLSA 1NQJA 2AACA 3HNBM 2JIGA 1UYPA 5EYXA 3ZFFC 4OYUA 5FLJA 3G7DA 3QLQA 3AFKA 5ACA3 2BOJA 3K51A 3NJXA 3M3OA 5FZ6A 5IK5A 3O1RA 1J59A 1UMZA 5L36A 2CDOA 3L9JT 1OLQA 1DGRN 2Z2SB 3LF7A 1QY4A 1COV2 1OLME 4CDXA 5JMCA 5FZ0A 5JPMB 3MEPA 1S0CA 1ZZBA 3EQEA 1V6OA 1BKZA 1QKQA 3PDQA 4GQ7A 4NR1A 4OHWA 4X8PA 4YVWB 5ISLA 2JG9C 3E6CC 2HJIA 4LO5B 1ACCA 4XAAA 1R092 2X10A 4FOVA 1SLBA 4H7MA 1RUI2 1UPIA 5E88A 3W5MA 1TQ5A 3N4MA 1DYPA 4ZPIA 4AE2A 3MIEA 3FE5A 1I6XA 5A7OA 1O3QA 1C5HA 2XUMA 4PCRA 2W91A 4I0WB 4RGKA 4KG8A 3RPQA 1QH6A 2Z4FA 1PGW1 2C4XA 3VGIA 2BFUS 4JRLA 4P00B 3WQ7A 1YRZA 4HANA 1DQ1A 2D98A 4XZUG 2VTFA 4MV2A 1PK6B 3WNKA 1SPPA 5A33A 3B01A 3MIBA 1Q3EA 4NHYA 4YG6A 2D3SA 4DB5A 2NP0A 1PGL2 1WLCA 1O5UA 4AFDA 2VTXJ 5A70A 4KU7A 2QKDA 2A1XA 4O61A 3ZVXA 2RJKA 5AC92 3X29B 1W39A 2ZJCA 1Q8PA 1FI2A 3I2GA 5GJ6A 3IDCB 1POV0 2WFF3 4JHZA 1CAUB 4E4HA 1HRI2 4CDWA 2BV4A 1Z0HA 2DCYA 4KG0A 1D2QA 3VZMA 1DFQA 5EPAA 2HH9A 3NO8A 2E53A 1XXNA 2VVFA 5FLIA 4PF1A 3UJQA 3HMYA 3RVHA 4ASLA 1L7QA 3CJIC 4FT8A 4Q8KA 1IS5A 2XBO2 1RITA 1PM7A 5FPZA 3E97A 3GNEA 3PJQA 3I54A 4XQ4A 1GOGA 1ND2B 4HFSA 4AHYA 2WZPP 4XPVA 5FXWA 2BGCA 1NXMA 4OQ9A 3OGRA 5ANQA 3VHNA 3AC0A 1HB4A 1L7LA 1US2A 4Y3OA 5A3NA 1UZZA 5KHIA 2E7AA 1XC6A 3KVBA 5A7NA 4CDUA 1RHI2 1HW5A 5LEKA 4LJHA 4Q1RA 4BJ0A 1CAWB 2CHHA 4HPKA 2E6VA 1DLLA 2N7GA 2PHXA 3OOXA 4COVA 3T2TA 1H6XA 4ZS3A 1JU4A 3HBZA 4HXCA 4LPLA 3CZUA 2ZGSA 3LOBA 4FPFA 2A5ZA 2MEV2 1UNBA 2DUOA 3LEMA 3RQ0A 5T5LA 4CCLA 1LCLA 2Q1ZB 3USSA 1W03A 2VZQA 1RIRA 2R32A 5IK7A 3BTYA 2WFPA 2HYXA 1UAIA 3V65A 4IE0A 3VBSC 4DS0A 2YG0A 1X82A 3KVAA 2QQOA 3PURA 4NN0A 5FZAA 1C1LA 1FX5A 1OKOA 4JV4A 3R6SA 3WG1A 3IM0A 1IPKA 2FMYA 1JYCA 2GN7A 2XUEA 4B1MA 1S0DA 5KC5A 3J7HA 2Y6GA 1ND3B 2YFZA 4TN7A 4FTBA 3POWA 4QAWA 4WM7C 3EHKA 5LW9A 3VZOA 3W5NA 2GC0A 4Q5OA 2HWD3 2BERA 3DKWA 3H50A 2JDNA 5F5CA 3RGBA 3Q8EA 2E7TA 4AEKA 2DUQA 5IK4A 5IYYA 1BK0A 1S4CA 3HNMA 3O14A 4XUTA 1W9SA 1LB2A 3AKRA 4K7JA 2OX0A 4Y5TA 5APAA 1ULDA 3CU7A 3FLPA 1RJ8A 3IAPA 3VKFC 5CFDB 5I8TA 4HVOA 4A42A 4YVSB 3N7LA 4FPEA 2IXJA 2VQTA 3VHOA 4B8EA 5FJKA 5A1AA 3P3NA 4AG4A 4DXRA 3WW3A 1PO12 2BNMA 2WBKA 4KNCA 4QD2A 1VBE3 2PLV3 3AK0A 5A7SA 1POQA 3FFQA 4Y20A 1GMMA 1DG6A 4NO4A 5BV6A 1XQNA 3H0OA 3HNYM 3M8LA 4NPLA 1JI6A 2BJSA 2VOTA 2WIIB 3HQRA 1X50A 4LO4B 4F8AA 3MW4A 4K21A 3ZM8A 1KFUL 1LEMA 2VNGA 2PHFA 3RI9A 1JYNA 3RSJA 4LTAA 5IVJA 3Q8FA 3T0AA 4MSVA 1AYN1 1CAVB 2I45A 2B45X 3HN1A 4GJZA 4MO3M 5B2GB 3FLRA 2ZTNA 3PTYA 1ODMA 4IXLA 2Y26A 4XUPA 3CQOA 5DDJ1 4Z2AA 3OGGA 3POYA 1XB9A 2WRAA 3UGGA 2R16A 3RI8A 5L19A 3U75A 2GSYA 1WCUA 4PHZA 4AFAA 5IVCA 4LHSA 2Q30A 1NYWA 3OEAA 4YW2A 4QDQA 4D6SA 4PLOA 1HN0A 2HBTA 2JWPA 4IEWA 3IDAA 2D5FA 1H4HA 2EXJA 2V5DA 4NPMA 3OY8B 5CNAA 5FO8B 5CA6A 2PHUA 5FYCA 4YZ2A 2R0HA 4MGYE 4EE2A 4QWNA 5B4XA 3JBG1 3RYRA 4BA6A 1GR3A 1S2KA 4XF3A 3VL8A 5EYYA 1QH7A 1W6MA 5L7OC 2FQPA 3QH7A 1PIV1 2C5DA 1C28A 2JDMA 2OIIA 2J22A 2FZ2A 2VMGA 5FPAA 1TEIA 4ATEA 1NAEA 5GKAC 2Q8CA 1ZNPA 3B3QE 4CCOA 1C3HA 1GQGA 2HWB3 3O1OA 4AYUA 4KWJA 1QJU1 3VBHB 3WINE 3WNNA 3ZSEA 1N1VA 4RQPC 1EAH1 3DYMA 2VU9A 4QT6A 4QXCA 4AI0A 3W59A 3UJOA 4LKEA 4XFAA 4YGBA 5A32B 4MHUA 4ASMB 4F7ZA 2XJTA 3MLLA 5FK8A 5ABJA 4OQ8A 2G9GA 4IEUA 1YUDA 2QQUA 1O4TA 4CU6A 2WN3A 1W6QA 5BNPB 5GLUA 1D0GA 1JYWA 4DEQA 4AQSA 2K46A 2C9AA 3KLSA 1RXGA 1Z7S1 2ZGQA 3U11A 2JG8B 2EALA 3VBOB 1EV12 3N36A 2XJRA 3R05A 1W2NA 3KMHA 1ZVFA 1B35B 3URFA 2NPIA 2JKBA 5FZ3A 4AGVA 3VD4A 1Q5OA 2ZGUA 3AXDA 2H0VA 2HWC1 5JXIA 3WP6A 2IXKA 4Q4Y1 4DUVA 4XZPA 1NXD1 1ZRRA 1N1TA 3GZEA 1C8M1 3JQXA 4FFHA 1S0BA 1BQPA 1QMJA 1VMHA 4CP9B 5C3OA 3WW1A 3OJBA 1QJX1 4LULA 2VZUA 2KXLA 4XURA 4GWNA 4N43C 3JBG3 3CMGA 2ZZJA 4FFIA 3HWJA 3NNMA 3ZYBA 3J8F2 1ZBA2 5AVAA 3BU7A 4OHVA 1XE0A
chains in the Genus database with same CATH topology
1LOFC 4S2HA 2A7AA 3AYAA 1UIJA 2BFUL 3MZHA 1PZ9A 4LHKA 4AEMA 3AZYA 1RVF2 4B4RA 2WNUA 1S1AA 3GBWA 3KGZA 1AXKA 2DCZA 1OHFA 2D40A 3ZN6B 4ZKTB 1CR7A 4HK9A 1QXPA 1N3OA 5KHJA 3LOIA 3S6PA 4IV1C 4WM8B 1RUC1 3W58A 1QXJA 1SFNA 4I02A 4CEYC 4FPYA 1YLLA 2Z42A 3OGJA 4K9SA 3V0BB 3BOWA 1WW7A 2HEVF 5CG9A 2BBVA 1J1LA 5GLWA 4QQHA 4Q4Y3 1BMV1 4YYOA 4QQLA 4HBNA 4AFMA 1LHOA 3QH6A 1WA4A 1Y3TA 1QJX3 3VDDC 5FQ0B 3H8UA 2XB6C 4AI1A 1XYPA 3ZFEB 4E4ZA 4XF4A 2WT2A 4GXLA 1UCXA 2E7QA 1W0OA 3CLPA 3THTA 4FOQA 1WMDA 2VVDA 2FZ1A 4XXAA 4ORFA 4L92A 1MVEA 1LKNA 3MLJA 2XH6A 1CN1A 3WDWA 1WMFA 4EWAA 2TEPA 3ECQA 2RS53 1HDKA 1MS9A 2ZAHA 4I0AA 2A6VA 4FP2A 1COV1 1LGNA 1NCRB 1V9U2 1RUC3 1WGPA 1R091 1RUI1 4CDQA 5K0UC 1N1YA 3L2HA 1RUJ1 3ZXDA 2RM23 5CIRA 2SLIA 2GALA 5D1IA 1POV1 1PGL1 2WQ4A 1WCSA 3NV4A 1H8TA 4JAAA 4Q4X2 3FHIB 5T5PA 2R062 2XG3A 2F4PA 1OFSA 1OQ1A 3H1MA 4JDNA 1HRI1 3AMMA 1M4WA 3PVNA 5KXCA 1NCQC 1FNZA 4BOWA 4XXPA 1DU3D 4RD7A 3ZXGA 4LBJA 5CVRA 5GALA 2D97A 3DGTA 3MYXA 4J6GA 3ZFGC 5C4WB 1JUIA 2RMU2 2XBO1 1COV3 3OF1A 1GYKA 5T55A 4QPIC 2VULA 3PMEA 4GB33 4S2DA 4COWA 5C8CA 1XU1A 4RHV3 4PDWB 1F9KA 5FFOC 3IBMA 5HXVA 3GYDA 1NE4A 1AL22 5BNNB 4AFBA 4AEDC 1ZRCA 2OUJA 3TN92 1RHI1 4LBMA 3S7EA 4JC1A 2A70A 2DVDA 1RUJ3 1WBFA 1YO8A 4XIKA 3V64A 1AZDA 4KWKA 3HIFA 2XGXA 1POV3 2YGMA 4N90A 2MEV1 3VHRA 4K1YA 4LUMA 1VAVA 1XNDA 4Q0UA 1N3PA 5BNOB 4HKLA 4N53B 4CZSA 4W6WA 1ONAA 3A4UA 1APNA 2NMNA 3VBUB 1V00A 4IV3B 1BVVA 3B7MA 4COZA 1G7YA 1G9CA 4META 1H2NA 3KT1A 4EN0A 4TWTA 4Z82A 2B9UA 1R1A2 3ES4A 2A3YA 3A0KA 3SH5A 4ZU5A 3AMNA 4D69A 4FXKB 3NAPC 4R52A 3RYKA 1K5MC 3SXWA 3M4FA 3RJ2X 3IIAA 4C0HA 3PMSA 3B00A 1UU5A 2NZ9A 1ZZ6A 3EJKA 4XJWA 1ZRDA 2R071 1RMU2 1RHI3 2F6BA 1Q43A 4O9EA 3IDBB 4ISQA 1PO11 1ULFA 5CFCC 4AQ2A 1H9WA 4LLFA 5FBZA 4QQ2A 1OOPC 2GMEA 1AR73 4M3CA 3H1WA 1VBB2 1NA1A 1OA2A 4AVBA 4YGDA 4Q26A 4XBLA 4COYA 1CVNA 4LBQA 4QPGB 2KA3A 4XFCA 1HV1A 2BQPA 3HD8B 3UK9A 1IS3A 4IEOA 4FTSA 4MLOA 4RR3C 1WW6A 5HCBA 1AR61 1TMF3 4GKYA 3SITA 2ZMLA 4DRVA 4GH4A 4XE9A 5JZGC 3SCHA 4B7EA 3ZFFB 4CP2A 4XBNA 1WUVA 3OYWB 2FMDA 4NHMA 1OPOA 2VOKA 3IPVB 2D3RA 4LHLA 4DRRA 3PHMA 3VBRA 2JG9B 2R073 5EWSA 1HQWA 3AJZA 3WY6A 1ZX5A 2ZACA 4IEXA 2X5IA 5BYNA 3CL1A 1ENQA 2R1DA 1L3JA 3S7IA 3NSTA 1N47A 2DVGA 4GULA 4U36A 4V1PA 2OZJA 2DTWA 3SISA 1AJKA 3AP7A 4M3CE 4BZ4A 3AX4A 2LALA 1GFF2 3WDUA 3R4SA 1W2UA 2EA7A 4DQAA 1CD3G 1AR63 4UW6A 3V0AB 1D4M2 3WXPA 5BPXA 1Q8VA 2BEOA 1EV11 5CADA 4N7IA 4XFFA 4R4XA 1DZQA 1QHDA 1NQDA 2UU8A 4FP3A 1ENSA 1I1EA 1RUD2 1YCIA 2RR12 1S55A 4P9GA 1U5YA 3CJIB 2JE9A 3H7YA 1H1AA 1IS6A 3MGUA 4QPYA 2DCJA 4XETA 4XFBA 1A8MA 2LM3A 2QVSB 1YI7A 2XJUA 1CIWA 1YFWA 4NWVA 3ZYPA 1RINA 4QMAA 3AZZA 3HQXA 4BQ1A 4LNVA 1S2BA 3O0WA 5HCFA 1X8MA 4YVWA 5HI0A 2BVVA 1V6KA 1V6MA 5JLVA 4OHZA 1VBC1 3WG2A 3C3VA 2XKOA 3ST7A 1SACA 5F5QA 3WUDA 4E4DX 1RVF1 5KHHA 2X29A 3UKNA 1YHFA 4IEZA 4YFWA 3WCSA 2NMOA 5C9AC 2JEMA 3IKWA 4CEWC 5GZEA 5D8AC 3VBSB 4TYSA 1PK6A 1NZCA 1LR5A 2AYHA 3HAGA 5DUWA 5K7PA 1LEDA 2RS13 5BUVA 3ZSLA 1Y7BA 1LGCA 4W6XA 3E5UA 4WM7B 5E16A 2Q4SA 2PHTA 1IQAA 3R4DB 1CAUA 3VLBB 4P5HA 1GANA 1TE1B 3WP4A 5J98B 2D6OX 1BEV1 1ASJ2 4OHYA 4PQ9A 4QGNA 4FPOB 5I0RA 1IZ3A 1Y43B 1NG0A 4M3CF 2P3KA 2ZCWA 3BALA 2JECA 2KM2A 4Q0QA 4PIXA 1ND2A 3CEWA 2JXAA 5DUVA 5JSPA 1VBC3 3UV9A 1IOAA 4O9GA 4YM1A 1BXHA 1PNGA 3SHRA 2OA2A 1RVF3 1OI6A 1QOSA 1AHSA 3VBFC 1CAWA 4Q0PA 2WT0A 1LOAA 1S0GA 3GZUC 4IL7A 3KB5A 2GNBA 2VOXA 4RSUA 1LULA 1MQTC 2WSVA 1V9U1 2Z69A 1RUG2 2WS92 4PBPA 1J3PA 3BB6A 4X6QB 3PVBB 3M1HA 1D4VB 2XVKA 3O0XA 1JXNA 2XLGA 3U4XA 2XWJB 3FX3A 2B42B 1BEV3 1PO22 4ITCA 1O3RA 1ND3A 1O91A 5DUUA 1G9DA 1AYM2 4WVMB 5J37A 5CU1A 3AYDA 1U5IA 4YARA 3A0NA 3RNSA 3N3HA 1AX2A 3AKSA 4XF1A 4Y1ZA 1LOCA 2BUKA 3POSA 3FMGA 5CFDA 4AF9A 4YM3A 4YVSA 5L7OB 3ZN4A 2PQQA 3FLTA 2XVLA 3WHUA 1RTVA 1VALA 1WCDJ 3KCYA 4BCUA 2PYTA 1N1SA 4FQZA 4RQPB 3JB8A 3JD72 2QQPA 3RS6A 3NV1A 3DPRC 3PVEA 2XJPA 3RDIA 1W6OB 4WVWA 1W6PB 1RJ7A 2D6PA 4LHNA 1GICA 1EY2A 3MLKA 3O7OA 1DGLA 1Q8SA 3BTAA 3AP9A 3DL3A 4XIOA 1BK1A 2P3JA 1FV3A 3D5OA 4FPCA 4B4QA 1CAVA 3ZO0B 2GC3A 3ZSMA 2WZR2 5LEJA 4FQ4A 5I8SA 3ENRA 1ZBE2 4M0NA 5C6CA 5K8SA 4MZUA 1UX6A 3MIFA 4YSFA 4EWEA 1VIWB 5FOBB 2VNRA 4NOTA 1QF3A 4AHWA 3RMXA 2ZKLA 5KXEA 1U5XA 1RUH2 1G86A 1FATA 4XDQA 4YNIA 4N43B 3WG3A 2EIGA 5DUXA 1LHUA 2WLPA 2ZA9A 3OY8A 4RS5C 2AR6A 1UKRA 1CONA 4D7TA 1DHKB 5KHKA 3AZXA 3QCWA 1R1A1 2WQZC 2P2KA 4AK3A 1A6CA 4EWDA 5C33A 4CP0A 2ZGOA 3VBHA 1FOD2 1KD7A 2UYAA 3AYCA 2V73A 5LRRA 1HRV2 5H9SA 3BCWA 5A32A 1YIFA 4IV1B 4QGMA 1G6NA 2UWCA 1ENXA 2ARBA 4CEYB 5BNQA 4HN0A 5BNPA 1UF2C 5T3NA 4XOGA 1QDOA 2BYVE 2JG8A 3VBOA 5I91A 2C0ZA 1MVQA 3ZXAC 5FPXA 1MEC1 1VBB1 3QBQA 3WP5A 1B35A 4FPGA 4YRDA 3ETQA 1YXWA 4AEJA 1LESA 4X6RB 4W6YA 4NHLA 3VDDB 4C1WA 3ZX7A 4QXKA 3ME2A 2I07B 5JI7A 4JGYC 2NQYA 5IT6A 4JCKA 2ZX3A 4XHXA 4XW3A 3WW4A 3DUIA 3KSCA 3CJXA 2ERFA 4AQ6A 1R1A3 2D93A 2ATFA 5T5OA 1SLAA 4I01A 3QOPA 1O3SA 4E9KA 4Y1UA 3MF6A 5BY5A 3GBGA 3AYEA 2PAKA 2WNVC 1REDA 4LBLA 1TME1 3T1MA 1BCXA 4AI3A 3RJRA 1AR91 3QD6A 3N7MA 4AVTA 1QJZA 2R49A 2A6WA 1AXYA 3ZN6A 3GZAA 4I0BA 4R4ZA 5K0UB 1VLNA 2CGOA 4WM8A 4XHBA 4E2QA 3D6EA 3PNAA 4YG0A 1KITA 5KHGA 3ILNA 1MEC3 3V0BA 4XJ8A 4AVAA 1RUF1 1QJY2 3M70A 1XNKA 3ZIXA 2EAKA 3ES1A 3LB9A 1QOTA 3ZSKA 2W08A 2DCTA 2VW0A 2PHLA 4AHZA 1AYN3 4FBFA 4MXWB 1VBD2 3WDXA 3JQWA 3ALQA 3N35A 5FQ0A 1D4M1 1FYUA 1MZEA 3MFAA 2CV6A 4CTEA 5DDJ3 1NCQB 3ZFEA 2GZWA 1YNAA 3ZDSA 3RYPA 5KXBA 4UXAA 2Q1MA 2RE9A 1AR82 3LZZA 4EV0A 1RUD1 2RR11 2QFEA 3ZFGB 1TME3 3NV2A 1MS0A 1CQ9A 1OKQA 1AR93 4HK8A 4Q0SA 3WCRA 1GLHA 4QPIB 4JGZC 4AXOA 5I93A 4F83A 4DY3A 5J96B 1J3RA 1QGLA 1JYIA 1T6GC 1IPJA 1HV0A 4AEDB 1NCRA 3ACLA 4HETA 5E1RA 2DWRA 1PIV3 4XF0A 3KCXA 4B29A 1F2NA 3DV8A 5I0SA 1Q8OA 1R082 2V09A 3OD0A 3VN4A 4G3YC 2BWCA 4A2UA 4CDXC 4D7SA 2XJVA 2GC1A 1FXZA 3WDVA 1QJU3 4Q4V2 5JVVA 4IESA 3U0ZA 1EAH3 1HX6A 4YZ1A 1RUF3 2D7FA 3IMNA 4FOYA 2W52A 4ISRA 3ILRA 4Y5Z0 1G9BA 2NLRA 4AWDA 2EXKA 3D0SA 5JOWA 5J36A 3M7AA 4OI1A 4KQ7A 5T5JA 4Q4W2 1GZ9A 4NVPA 2GC2A 4URTA 4BYYA 1D4M3 1Z7S3 1BYHA 3ZXKA 3TOJA 1DQ0A 1YJLA 1R1ZA 4Z1VA 2ZZQA 1OD5A 1UW8A 2HYKA 1VBA1 2K0GA 3NWKA 4DMIA 1ENRA 5FLHA 1LTEA 2XWBB 1RUD3 5FTTC 2HWC3 1PVC1 3WLUA 4SBVA 1ASJ1 1FMD2 3NAPB 2D6LX 1K5MB 1C8M3 4CDWC 4E2SA 4GALA 5C4WA 2LUWA 2Q0AA 2PHRA 1PMIA 3VKMA 2WSUA 4ES8A 4MH0E 4PDWA 2QJVA 4HKOA 5BNNA 5CFCB 2H0BA 1F5JA 2ZABA 1OOPB 4FTEA 4GIQA 3B9CA 2ZS6B 2BNNA 1PVXA 2XL9A 2IFRA 2VQAA 2GN3A 3BPZA 2CGNA 4Y1YA 3SNMA 4CDUC 1DDLA 3IDEA 2GU9A 1G9AA 4LA3A 1O5LA 1RUNA 2WFF2 2DURA 4RR3B 2DCKA 4ES9A 5BNOA 2FHRA 2WS91 3FWEA 4RL7A 2WWSA 1VBA3 4N53A 2QDRA 3M3EA 1GNHA 1CJPA 1OA4A 3VBUA 4IV3A 5DZFA 1FPN2 1PVC3 1SQ4A 5EV7A 5LRSA 5JZGB 1PO21 1ASJ3 2XJQA 1LHNA 2OZ6A 5A3LA 1QOOA 1UU4A 4KGQA 1ALYA 3ELNA 2GAUA 3USUB 4JRAA 4Y1VA 5AC91 1VRH2 5JOYA 3O5SA 3U10A 2ZMNA 3RRDA 2ET7A 4BHPA 4XQWA 1LHVA 3NKGA 4XJUA 1WW5A 4GWMA 1LOGA 5DZEA 2GNDA 3MW2A 1LOEA 5JI9A 4Q2FA 4IEQA 4QGLA 3MDPA 4K3UA 4YW1A 5LK5A 3VL9A 4LT5A 2ARXA 1UD1A 4LUKA 2PTMA 2EXIA 3AMQA 2VNOA 3GF6A 4LBNA 2DU0A 3ZYJB 4QPGA 3ZXFA 1R093 4Y4YA 1RUI3 2DFCA 4INDA 2EXHA 2V5YA 3O0VA 1D2SA 4EROA 2W39A 1NE6A 1GV9A 2GDFA 2HWD2 4M0HA 2CWMA 1ZBE1 2DYCA 3M3QA 3AP4A 3ZYGA 1GNZA 3ZFFA 4BMBA 4PIZA 2BVBA 2ENRA 4Y22B 3OYWA 1X8EA 2W0XA 5AC93 1JN2P 5FO9B 1KRIA 2YGLA 5JR7B 3E5QA 1YFUA 1UKGA 1UN1A 1RUH1 1WLDA 4XFHA 1EYBA 1HRI3 2JDZA 3IPVA 1KDMA 3KT7A 4A3XA 3WDTA 1DGWA 3J9SA 4Q1PA 4R9CA 2JG9A 4OI4A 4C1XA 2B7YA 1VBE2 1G9FA 2PLV2 3NW4A 1WW4A 5TSWA 1HIXA 2ZX2A 2CTVA 1OA3A 1URXA 2XBO3 4FPHA 3CNAA 1SEFA 4E27A 5C9AB 4E4SA 1FOD1 4CEWB 1U5ZA 4OULA 5D8AB 4EN8B 1ZZCA 2A6XA 3AXEA 5E8AA 2CAVA 1BJQA 4DOUA 1YFYA 1LGBA 3C2UA 3AZWA 4YG3A 4JDMA 1ZYBA 3AZVA 1MZ6A 4WBBA 3V0AA 1BBT2 4YZ5A 5ABJC 1DZRA 5CBLA 2IXLA 4OUSA 2MEV3 1Z78A 1VAMA 2Y0IA 3UKVA 5F6LB 4LO8A 1OMIA 1FAYA 3CJIA 2I2SA 2OW4A 4L2NA 1VAKA 2D44A 1AXZA 4UW4A 4D7YA 1WD3A 1VR3A 4J1XA 5GLZA 3FBMA 3ATGA 3WT3A 5FMOS 2HWB2 3GBFA 5AVPA 5FRAA 3VBFB 4R8HA 2CGPA 1PHMA 4P14A 3AMPA 1MS3A 2UWAA 5T54A 1KDKA 1MQTB 5FCCA 4OUMA 2RJLA 4P9JA 3RWNA 3VBSA 2WNUC 1V6IA 1PO13 1SLTA 2PHWA 3E6DA 3KD4A 3W9AA 1CPNA 3E5XA 1HLCA 4AGGA 3AFGA 1LECA 1MACA 2AREA 3MF9A 4LA2A 4WM7A 2UURA 2PFWA 1JUHA 2NYYA 2PHDA 1QJY1 2ZGRA 4A7KA 5F9TA 3CO2A 5GLTA 1KFXL 1VBD1 4ZU7A 1SLIA 2A75A 2YZ4A 3GHMA 3TNQA 2G4IA 2OPKA 3MW3A 4A7YA 3VZKA 3OD4A 1AR81 2UY9A 2EF6A 2K9ZA 3WOGA 4LE3A 3JZVA 3RZZA 5CG8A 3DPRB 1RB8G 1MS5A 3MPBA 2VGDA 5SV8A 3NJZA 3ASIA 1PZ8A 1H2KA 2GNMA 2VMIA 4XQDA 2JE7A 4AVCA 1WBLA 5FO7B 3SCGA 4L9BA 5JOXA 3KCCA 3J8F1 1DZTA 1BZWA 1ZBA1 1H2LA 2O0OA 3VV1A 3ZMOA 1O4ZA 1DQ6A 1R081 4K6BA 1UU6A 3NVCA 4L11A 4LLOA 1MS1A 3AMHA 1Y9QA 4H55A 4Q4V1 2DFBA 1ZZ9A 4Q4Y2 5I0TA 5J3UA 3U07A 1QJY3 2ZX1A 3GALA 1GZCA 3MIHA 4XEZA 2XKPA 3JU9A 4CDQC 1QJX2 1JBCA 1IGOA 4Z07A 1GZWB 2YUEA 1OFNA 1VBD3 5CAZA 4WVMA 4D94A 4MGKE 2CAUA 1EV13 2YMZA 3WG4A 3AB0A 2VG9A 2BTVC 2Y0OA 4HL0A 4RS5B 3VZJA 1AR83 1A78A 1U0AA 1H8TC 3FC0A 4WVZA 3QACA 4RGAA 5L7OA 2RS52 1SBEA 5A3MA 2LTNA 3SCFA 1FMD1 4K20A 2VY0A 1LU1A 3UL2A 2O1QA 2HKXA 5SV5A 1Q56A 4RQPA 4Q27A 4G9SB 1RUC2 3OBRA 1LHWA 3P3PA 4DPNA 5JIUA 1W6NB 2DVAA 1H0BA 1CPMA 1N3QA 3J8F3 1W6OA 4QM9A 1ZBA3 4X8NA 1GKBA 3I2DA 4Z2WA 1DQ5A 1F31A 3M2MA 3H3UA 2IXIA 4CYDA 1W6PA 1A3KA 1NY72 1RL3A 4BH9A 4Q4V3 2Q8OA 3RG0A 4H14A 5C8CC 4TSVA 2RM22 1J58A 1GBGA 1W0PA 4F3JA 2NM1A 3AP6A 2HWE2 5EXOA 2R1BA 1SMVA 5J7MA 3I59B 3H7JA 3NKTA 2XLFA 4MUVA 4LO7A 4ATFA 2Z5WA 3LWCA 4NPRA 4JGYB 4L97A 1MZFA 1PGSA 2H6BA 2CYFA 4N43A 1H1MA 4KH9A 1KQRA 1SDWA 1CAXB 1FPN1 3VKLA 1QWRA 2BWAA 3WQ0A 1FMD3 1LOFA 3TWIA 4MGIE 4DXZA 2I74A 3ZYRA 3LGRA 1XE8A 2WNVB 3WV6A 1DQ4A 1HQNA 5I8YA 4GB32 2ETEA 2QDNA 3PLQA 4RHV2 1F5FA 1C1FA 4Q4X1 2UY8A 1VRH1 2R061 1AX0A 4EN9B 2UWBA 2O8OA 1ULEA 3OCPA 1FV2A 2IXHA 4YZ3A 1UZYA 3BODA 3VZNA 4FCAA 1RUJ2 4IV1A 5I0UA 1XE7A 1KXGA 3IT8A 4HLTA 3FJSA 4CEYA 1SFYA 3WW2A 2B39A 1J3QA 1YYNA 3PJYA 5H9RA 2RMU1 4K40A 2AENA 3MFCA 1S0IA 2QUOA 1NLRA 4N9HA 1V9U3 4XMAA 4UBGA 2K2SA 4XFGA 2TBVA 1MR5A 1JOJA 3KGLA 1AL21 4PBOA 3SH4A 1C8NA 3KS7A 3VDDA 1WCKA 1NA1C 4NWWA 3TN91 5FMOL 2PN5A 2O8QA 1FPN3 3BOPA 2HWD1 2OVUA 2WL1A 5GZGA 1H4GA 3TAYA 4HSJA 4OHXA 2ZGLA 3TB0A 5HCAA 2A3XA 3FBYA 3MI8A 4QHBA 4TZDA 1RUOA 4Q4X3 4JGZB 2ZGPA 1VRH3 2R063 5EFUA 4GH4C 3ZIWA 2JX9A 5EJ3A 3VUOA 1DBNA 3E6BA 4AQTA 4L8QA 2VMHA 4I09A 1VBE1 2PLV1 2ZHKA 2R042 4CDXB 2HEWF 1AR72 3LKJA 5K0UA 4N7UA 3WR0A 1C5IA 3VBRC 1G8WA 2RMU3 3AP5A 1OPMA 2YROA 2VW2A 5J48A 4QQOA 4I30A 1WLTA 2ET1A 4AFCA 2X5IC 4M01A 1AL23 2B46X 4EN7B 4XMIA 1TNFA 1TMF2 1RMU1 3TN93 4LO6B 3PVOA 4MXWA 2ZBJA 3SLIA 5A33B 5GZDA 1GSLA 1BBT1 3H3ZA 1XYOA 2TNFA 5KBFA 3WVJA 1NCQA 2WKKA 4E2GA 2D3PA 3FFZA 2EVXA 5H9PA 4CDWB 1U12A 4KWLA 2IFWA 4KBBA 1UIKA 3DF0A 3ZFGA 1FT9A 4NHKA 2PELA 1PZ7A 2D43A 2R072 4BIFA 3GZTB 2AH2A 4LBOA 4H3WA 3TYJA 4QPIA 3S30A 1DF0A 2R6QA 2VPVA 3B5LB 4FOWA 1SLLA 2WT1A 2RS32 4S2FA 1O4YA 2R0FA 1H9PA 4AEDA 1LRHA 2HWB1 3Q9OA 4UW5A 1ZZ7A 5DG1A 5JDBA 3LSEA 4MXVA 2PAMA 3EXUA 3B93A 1RGSA 3N7JA 4YVWC 4P9XA 3ZYIB 4CDUB 2XLAA 4HPKB 1SBFA 4KL1A 2DTYA 4HT1T 2AUYA 4PIYA 1AR62 1RMU3 2ILMA 3WDYA 1RC6A 1SBDA 1BBT3 1SLCA 1NOVA 5GM0A 4XILA 1VJ2A 5JSRA 1VBB3 1VB2A 2YDEA 2IC1A 1PK6C 4G4FA 1YI9A 3VKNA 1VB4A 5JSOA 3EBRA 2DU1A 4ONUA 4XTMA 4Z8BA 1O3TA 1RUE2 5KXDA 2FBEA 1ULGA 1F8VA 3NAPA 2YYOA 3JB4C 1K5MA 2ZX0A 2XL7A 4JVAA 1QQP2 2PAEA 2VOVA 2ZGMA 2Z79A 4Q29A 2JD4A 4GMP0 4K1ZA 5DXDA 1KJLA 2GH8A 4CRQA 4XFIA 4P9LA 3WD5A 1O7FA 3OBTA 5CFCA 1QNYA 1OOPA 1MZ5A 1ND2C 1QNWA 3S0MA 3AKQA 4OLLA 4PJYA 1LOBA 4OI2A 4QQPA 5JCTA 4XYXA 4Y20B 2RS12 2VQ0A 2ZGTA 4R9AA 4DNYA 1OQDA 3HR9A 4Y1XA 5L73A 2MPFA 2ZOEB 3WX5A 4L99A 4RR3A 3AKTA 2P3IA 3AJYA 1HXS2 2E51A 5DZGA 1UPSA 2B8MA 1XYNA 1LU2A 5T50A 3R0RA 1C57A 4YM2A 2HWF2 2MNGA 5F6KA 1KJRA 5JZGA 4HVRA 2VW1A 1UL9A 3NV3A 4BPZA 3L2YA 4Y26A 5C8WA 1DGWX 5K9YA 1JW6A 1IKPA 1LENA 3B69A 2DUPA 4PF5A 4LR4A 1V6JA 1ND3C 3JUUA 2A3WA 5FAXA 1VBC2 3D0JA 3USUA 2VH9A 4BMEA 2RR13 3B94A 1OSGA 3AKPA 3O12A 5ACA2 3D82A 2RS51 2WJSA 4XF9A 4XJ9A 3BIWE 5CFDC 3LSDA 1M06G 4YVSC 1W6MB 4LE4A 1X33A 2RHPA 4DZGA 3MICA 2ZKNA 2BW8A 2D6KA 4P9IA 1XNCA 3VHPA 5JIAA 1NY71 1BEV2 4JTOA 4FO9A 5H9QA 5ABJB 5IK8A 1ZM1A 2ZHNA 4KGGA 3GHNA 2RM21 1V70A 3NL1A 1W6QB 4R9BA 2E9QA 2HWE1 1XU2A 4CP1A 1ZREA 5E89A 3MIGA 2Q5TA 2VXRA 1MS8A 1H1IA 2A73B 2ZHMA 2WC2A 4HVQA 3I4IA 4Y22A 4HN1A 2GH2A 1RUG1 1EPZA 4QU2A 4A7ZA 3ZXJA 1A8DA 2UYBA 1JTZX 5IUQA 1H8VA 4FPKA 2C1FA 4YLZA 1CX4A 4Q0VA 4YZ4A 3TNPB 2QNKA 4S2GA 2QE3A 2YHJA 4WZCA 2P34A 1DIWA 1AYM1 2MHFA 4RFT0 5JAXA 5KWRA 3D8CA 4D3WA 1MS4A 4UW3A 4GB31 4GA9A 4LEJA 1SCRA 4RHV1 1OLRA 5T52A 2H6CA 5C9AA 4YFZA 1X7NA 3HT1A 4I3GA 3ZN5A 2ZMKA 5GZFA 4CEWA 4DFSA 5D8AA 3M3CA 2WNUB 4P9WA 3OTFA 3FZ3A 2TUNA 1BVP1 4GKXA 1PGW2 4TLFA 3VBHC 4IEYA 4B7KA 3ZMNA 1HQLA 1REEA 2YY1A 2HWE3 4MYEA 4YGCA 4EJRA 3JD71 4MVTA 5JOZA 2E63A 2XHKA 5BNPC 3SMHA 1RUG3 2JG8C 2WS93 3H9AA 3VBOC 1YFXA 1B35C 1SCSA 2IWGB 2GMPA 1Q8QA 1PO23 2WZR1 3FUOA 4XJZA 4BWOA 1AYM3 4HKWA 3ZPYA 3LAGA 4WVVA 3G6JB 3WHTA 2VECA 3ROUA 2A6ZA 1QDCA 3VBFA 3WQ1A 5LK7B 4Y24A 1OQEA 2Y38A 1WD4A 5GLVA 3VZLA 3KT4A 2ZHLA 3R4UA 2WINB 4IERA