1XU1A

The crystal structure of april bound to taci
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
137
structure length
137
Chain Sequence
KHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor ligand superfamily member 13
publication title Structures of APRIL-receptor complexes: Like BCMA, TACI employs only a single cysteine-rich domain for high-affinity ligand binding
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine, hormone/growth factor receptor
total genus 29
structure length 137
sequence length 137
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2004-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1xu1A00
2O0OA 2TNFA 2Z5WA 1A8MA 1KXGA 1OQDA 4OULA 3L9JT 4KG8A 3K48A 1TNRA 2WNVC 4OUMA 1O91A 5CIRA 1JTZX 1S55A 3ALQA 1D4VB 3V56A 1RJ8A 2WNUA 1D0GA 3IT8A 4OUSA 4TSVA 2R6QA 2HEWF 3TYJA 4DB5A 1IQAA 1KD7A 3B94A 5KC5A 4QQLA 3B9IA 1JH5A 2WNUB 4EN0A 2ZJCA 5L19A 2JG8A 4QQHA 4QQPA 4F3JA 4N90A 4NN0A 2AZ5A 2X29A 5L36A 1PK6B 1U5ZA 3QBQA 2QE3A 2JG9A 4DOUA 1XU1A 4KGQA 4MXWA 1PK6C 2OIIA 2RJLA 1ALYA 2QDNA 1OQEA 2JG8B 5HBAA 1WCKA 1C3HA 3FC0A 4E4DX 4HT1T 2WNVA 4TWTA 1OSGA 2JG9B 2RE9A 2HEVF 2TUNA 4MXWB 2E7AA 4QQOA 3B93A 5KWRA 1RJ7A 2HEYF 3K51A 2WNUC 2RJKA 2ZPXA 4KGGA 2WNVB 1U5XA 3AB0A 4G3YC 3MI8A 4GIQA 1C28A 1TNFA 1U5YA 3WD5A 5TSWA 3TWIA 4RSUA 2R30A 5BNQA 4QPYA 1GR3A 1I9RA 4E4SA 2JG8C 3QD6A 1D2QA 2KA3A 5KC6A 3ME2A 4J6GA 2R32A 2Q1MA 4MXVA 4QQ2A 4D7YA 2JG9C 3LKJA 2Q8OA 3URFA 1DG6A 1PK6A 1DU3D 4G4FA 1XU2A 4MSVA
chains in the Genus database with same CATH superfamily
3HNYM 3UKTA 1QJX3 1B09A 1QXJA 4UFIA 1CAVB 5I0TA 2OYZA 4AEDA 1W6QB 1IPJA 4Q2FA 4IGOA 2NMNA 5LASA 4YSFA 4XJ9A 2GNTA 2WWJA 4QB1A 4UAPA 4MGTA 3MW3A 4JGYA 4EZHA 1ZX5A 4MG2A 2WNVC 5FZ3A 1UCXA 3ABZA 5I0UA 1GWLA 5JSOA 3NVCA 5KXDA 1AR91 4Q4W3 4WV8A 2Y64A 4IEOA 2OX0A 3J7NA 4ORFA 3VBOB 5LWBA 2W92A 4A45A 4JQRA 2RS12 4YVWA 3WW2A 5LA9A 1QJX2 2OQ7A 3D0JA 2UYBA 3DN7A 1NQJA 2YUEA 1VBA3 2JDAA 1PZ7A 4BIFA 5GZCA 2PAEA 3O1OA 4TLGA 3SNMA 1ZZ6A 2WO3A 1AVBA 4QPGC 2IFWA 5B2GB 4Q0PA 3GZTB 2DV9A 2RR13 3JQXA 3POFA 4XFAA 2BTVC 3WDYA 2VTXA 4GQ7A 4Q4W2 3WNKA 2QQUA 1H2KA 2LTNA 5CFDB 3H8OA 2YY1A 4AVAA 3N9QA 4A7KA 4HVQA 3ZXJA 2IXLA 5C3PA 3MZHA 4QMAA 4JC1A 5GLWA 3VBHA 3NJXA 4ES8A 3OSDA 1MEC1 2PN5A 4CU8A 2GH2A 2XJTA 5FWJA 1VBA2 3RZLA 3OJBA 1F5FA 4COVA 1RB8G 2AR6A 5A3MA 5ACA1 1HB3A 1YCIA 3PHMA 4AQ6A 5IK8A 2RR12 3WNLA 2AGSA 2PFWA 2UWCA 4WVZA 1DFQA 1X36A 1ZZCA 2VCMA 3IPVA 3P3PA 1D4M1 2OIIA 5F7UA 4HONA 1F8VA 3I2OA 2ZAAA 3BTZA 2PELA 4N53B 3T2QA 3BIWE 3AKTA 1UZYA 1HXS1 3A22A 3INAA 1DQ1A 1YI7A 4QX8A 2WT1A 1UY3A 3OYWB 2YBPA 3KQRA 2RMU3 4HPKB 5EV7A 2E33A 4Y20B 1JZ3A 3IBMA 2B46X 3ZYJB 1LULA 2BNOA 2JB8A 4NOTA 4A7ZA 3WP3A 4NHKA 2ZX2A 1ZYBA 1JN2P 2H6BA 4SLIA 1U0AA 4M3CF 4LK6A 2UYAA 1APNA 4LKSA 1NAEA 5A6YA 4W6YA 1UMHA 1QQP3 3PMEA 4L92A 5IATA 1QH6A 2LM3A 4QXHA 2Q0AA 1EV13 2NMOA 1UY0A 4CRQA 1VPHA 3AVSA 2WNVB 1W28A 3RMXA 1LGBA 5I8SA 5BUVA 2AUYA 3BN6A 2J1RA 1FXZA 1NYWA 2R073 2MPFA 4LR4A 3RQ0A 1OD3A 2PAMA 4CCNA 3W59A 3WP6A 1RUD1 3E6DA 4LBQD 2BZDA 1H8TA 1ZBE2 3P5BA 4PHZA 2ZKLA 4B1LA 5FJHA 4RGKA 4B8EA 3FUQA 1VRH3 1GR3A 5K4LA 3KGZA 4E2QA 1CR7A 5K7PA 2R0FA 1KFXL 4QPGB 3O1VA 1ONAA 4P02B 3FHIB 1EV12 4YZ3A 1YWKA 5FYUA 4A6SA 2RDNA 3VD9A 3CQOA 2DCKA 2PHLA 4ISRA 1HJGA 1ZZ8A 4W8JA 1H30A 2JG9C 2VZTA 2ZAHA 3CLPA 1NCQB 5AVPA 3DXUA 1PO11 2H0VA 2VBBA 2GSYA 3MW2A 1TQ5A 4LKFA 5IWFA 3T2OA 3VL9A 4AGRA 1NA1A 4EWEA 3VKOA 1RMU1 4FPJA 3T08A 1VRH2 2TNFA 2VZVA 1UW8A 2GDFA 2XHNA 5A7WB 4DMIA 2LS6A 5DAPA 4QPWA 3KHBA 3FJSA 4DXTA 1VBE3 1GYKA 3UV9A 1BXHA 2JE7A 3LSDA 4RL7A 5T5LA 1NLRA 1W6OA 1UXZA 1YC61 4YZ4A 4HK8A 5FZHA 5HI0A 3E6BA 1CX1A 1XOYA 1WLTA 4UOJA 2D5HA 1PGL2 3CL1A 3O14A 4LHNA 1D0GA 2WABA 4AVSA 3DKWA 4XMAA 1LHNA 5A7PA 2W52A 2PQQA 1FV2A 3KMHA 5HCFA 3WX5A 2P3IA 3FUOA 3ASIA 4JRLA 2SBAA 3RGBA 1VBE2 1HV1A 4IEUA 5F5IA 2D97A 3VZKA 1GZWA 4JHZA 1WLCA 3PU3A 4QPIA 1J84A 3SEPA 3TRSB 4GWNA 2WA4A 2P3KA 2WLPA 4NHMA 1S0GA 4UF0A 1LOAA 4BU2A 2ES3A 3WUCA 4Z2WA 3JQWA 1PX4A 3D6EA 3MUZ1 3K4DA 5FY4A 4CU9A 1L7LA 1VRBA 3KM5A 1XYNA 4MVTA 3PNAA 2BBAA 5DMYA 4YYOA 2V72A 2VOWA 3AFGA 2BOIA 1N1YA 1MS5A 2P6HA 3CJIA 5CISA 2ZGTA 3AYDA 2VD7A 1OQEA 2XJVA 4JDNA 3LPFA 4DUWA 1AYM1 4CA9A 2IXIA 4HANA 3T3YA 5DN2A 3NJVA 2JG9B 3SH5A 3LAGA 5JZGA 1JXNA 1MS1A 2WNEA 3O1UA 3ON7A 3J4UH 4YM3A 1LOEA 2E7TA 4PDWC 3VHPA 5DG2A 5IT6A 1VMHA 1HRV3 2WS93 1LOGA 2P5BA 1YNAA 3TB0A 3B93A 1W8NA 1GICA 1DF0A 1SCSA 1SZBA 4Q0QA 5FXXA 5ACA2 1K5MA 4CCCA 5EYYA 3SITA 3VDDB 2GNBA 3ZSLA 1NKGA 2A6XA 4LULA 5A7QA 3CZUA 4H7LA 4XFBA 1D4M2 5FZAA 4AZZA 1K42A 2GMPA 1M06G 1H9PA 2HWD1 1HXS2 1UIKA 1H2MA 2FBEA 2QQOA 2D43A 5F5QA 1TME2 1UQXA 3OG2A 5D8AA 1K3IA 3QH6A 1QIQA 3R4SA 1O5UA 1V9U3 4NR1A 5FYYA 3D3AA 1SLBA 4IEPA 2C1FA 5F3GA 2VZ3A 4CU6A 1JZ7A 1H4GA 2ZKNA 1QJEA 1O4YA 3URFA 3A7QA 1QJU1 3ELNA 3LD8A 2WQ4A 2GP3A 4IEWA 1NCRC 3M1HA 2YV8A 4K20A 4PIZA 1UY1A 1Y9QA 4LHSA 2QQJA 5DZFA 2YROA 1CWPA 4BDVB 1QOSA 2JDZA 3PURA 5C3QA 3DGTA 1V9U2 5IFPA 4I0AA 4Z92B 1RUG1 3QOPA 4YNIA 3THPA 1N3QA 2E26A 2WWUA 1O5LA 4E4HA 3VBFB 5FZCA 2XLFA 4WVMA 1PNGA 1S2BA 2V4AA 5EZWA 3WVJA 5JR2A 4XXAA 2VCBA 4FBFA 1NZIA 2BDRA 1COV1 1VBB1 4OUSA 1RUE2 4TSVA 5BNPA 3WOGA 3TAYA 4GALA 1PMIA 3GBGA 4XABA 3LEIA 1V6NA 3TYJA 5JCTA 3Q9OA 4ZU7A 3LEMA 1AR63 2FMYA 4CCMA 4PDWB 5FV3A 2CWMA 2G9ZA 4BWOA 4I0WB 4IV1A 5FLJA 5K0UA 3NRUA 4GZ9A 1QJY3 1CZVA 4FQZA 4KBBA 2D93A 3Q8FA 2VOXA 1DQ6A 3CIHA 3NAPA 4J1WA 2ZX1A 5A3UA 4NPMA 3MFCA 5GLUA 2CTVA 3NNFA 5GZFA 5LBFA 2QE3A 1JUHA 4DOUA 3MF9A 4PLNA 1KITA 1AR62 3BODA 2CGOA 2IXHA 5FYZA 5FZBA 3JCIA 1F35A 3PU8A 2E9QA 2P4EA 3NKGA 4NE9A 3RVHA 3JD71 4XUQA 1GMMA 1Z7S1 1LHOA 1QJY2 4CUGA 2DDUA 5FK7A 5HXVA 5LCWL 4NWWA 3GJBA 4QB6A 5CKMA 2LRPA 5C3OA 4LBQA 1LODA 4YW6A 1ND3C 4N9HA 3QCWA 2H6CA 1X7NA 1W6QA 4CP9B 2R043 1NCRB 4A44A 5BNNA 1LU1A 3LOIA 2BYVE 3N7JA 1HX6A 2DVDA 3BALA 1VE0A 1AL0G 3DUIA 1C8NA 1MZ5A 1XC6A 5FKCA 4CP2A 4XOGA 5KHKA 5KXBA 1FPN1 3B5LB 1QXRA 3CU7A 4Z82A 3NL1A 1YXWA 3M3IA 1BYHA 1J1LA 4LBJA 4ZONA 4YW3A 4E2GA 5FZIA 3R05A 4FPFA 3UYJA 3O0XA 1XNTA 3T1LA 2VU9A 1YQCA 1TMF2 2J1TA 3FLPA 5CKNA 4HSLA 3ILRA 3GM8A 3IZOA 4JDOA 4A7YA 4BQXA 3UESA 4ATEA 2AH2A 2CGNA 1D7PM 1WCUA 3OEAA 5FZOA 2JDMA 1C8M1 1T6BX 2CAVA 3E1F1 5FRAA 3DYOA 3BKZA 3VD3A 5L9BA 1QY4A 3ZDVA 3ZYPA 4LQRA 3C7OA 1W06A 4C0HA 5JOWA 4K1YA 3LE0A 1OA2A 2JG8C 4EN9B 2JJ6A 2Y6KA 3FLRA 1WLWA 5FYCA 4OQ9A 2D6MA 1W6MB 4IGPA 2L9LA 2WKKA 1N47A 3ACGA 4N8MA 5A7NA 5J48A 2YDEA 4NPRA 3ZFFC 3AC0A 4GH4C 3SH3A 4CU7A 4AI2A 3AFKA 4HSJA 1KJRA 1SLLA 1F4HA 1UF2C 3PUQA 5C8CA 1GP4A 1OXCA 1URXA 4WM8A 3AYCA 4CXYA 1N1SA 1W3XA 5F5CA 5JSRA 2Y6FA 5FZ1A 3RI8A 1X33A 3VD7A 3ZIXA 3S30A 2WFF3 1GP6A 4KG8A 1OT5A 5F3IA 1O3SA 2EF6A 4OHXA 5DG1A 1OBNA 4RQPC 1S55A 4XMIA 5IVJA 3K3NA 2GC3A 1XSQA 2WL1A 4HPKA 3V56A 5JSPA 5FY7A 1IPKA 3NJZA 1PVC1 1RUJ3 1G7YA 1MZFA 4HVOA 2ETEA 4Q26A 3KQ4B 4HETA 5KHIA 4I01A 1W9SA 3PVBB 1UY2A 1O3TA 1ZRDA 1LHUA 1X9TA 2B5HA 5C4WA 5DZGA 4QXKA 4XQDA 4ASMB 3POIA 3B94A 4GB33 2VQAA 4FFHA 1DGRA 4CEWA 4CSWA 1GP5A 5F8PA 4DQAA 4IE6A 4BK4A 4DIQA 4IEQA 5IVCA 1Q3EA 5AC93 1CAUB 3SLIA 5JAXA 4RGGA 2FDFA 4OUEA 1VBC1 3SEEA 3UGGA 4XDPA 4Q4X3 5DAXA 1RUG2 2QQNA 4N90A 1ND2A 3AJZA 3I3BA 3KV4A 4PLOA 4XF0A 5KXEA 4YLZA 3U78A 1BMV1 4MADA 2YGMA 3MFAA 3N35A 1V00A 3KCXA 2WZ8A 3USUB 2Q4SA 4DB5A 3EJKA 4BXFA 1XNBA 4GULA 1STMA 1MVEA 1G9FA 1I6XA 4P08A 4YG3A 1DZRA 5AC92 1OH4A 1VIWB 1OA4A 2JG8B 1NCQA 4HKLA 2N7GA 1MQTC 1KRIA 3E5QA 4M0HA 4Q4X2 5DZEA 2OVUA 2JKBA 3FC0A 2C26A 4HT1T 4JCKA 5IVYA 1ENQA 3HOBA 4OCTA 4O7XA 4A41A 2CL2A 5FMBA 3ZFFB 4XF1A 4GH4B 3VKFC 3VBSC 2QFEA 3AYEA 3M70A 4H55A 4M3CA 1AJOA 4XXPA 2CV6A 3L2YA 5T5JA 2LALA 3B9CA 1BBT3 2BWCA 4XUTA 2Q8DA 4AI3A 4BXSV 2B8MA 2WAOA 2FCTA 3ZN5A 3LF7A 4PJYA 2WQZC 4RR3A 5FXWA 5JPMB 1RVF3 2ZBJA 4K8RB 4FFIA 4G3YC 4BLJA 3CZJA 2A3YA 4KNCA 4RQPB 4BH9A 1CJDA 3ZR5A 1C28A 1OLME 5HCAA 2X10A 2VOTA 4K1ZA 3FN9A 3N9NA 4XURA 3ZFEC 4N9IA 4ZZ5A 3BB6A 1JOPA 3B01A 3LZZA 4CTEA 1BBT2 1JYWA 5BNQA 3RDIA 2OW4A 1NX9A 3WG4A 3KLSA 3WG3A 2VZOA 1FNZA 1CAWB 2X5IA 2PHDA 4CDWA 1NUKA 3AKPA 4Y26A 1AR81 2R32A 1V6OA 4P9WA 2D6KA 3T4VA 1IZ3A 4QQ2A 3SISA 4COUA 1ASJ1 1ODNA 4QAWA 4P5HA 3NV2A 3CF6E 1O8PA 3RFRA 4DY5A 3M4FA 5IVVA 4ZZ8A 4R4XA 2GNMA 3AMHA 1TE1B 1POV0 4XFCA 4OZOA 4KWUA 4ARXA 1XU2A 4E4ZA 2ADDA 3AZWA 4Y22B 4DXSA 2O0OA 2YFUA 4C1WA 3IIAA 1W05A 5A3PA 4UFJA 5JOXA 1FOD2 4E9KA 5IVEA 1UYYA 1ZRIA 3TNQA 2R7EB 1MR5A 3HN3A 2BGCA 4QHZA 2XKOA 1O91A 2VPVA 3MICA 2QVSB 1Y7BA 3A0KA 3AP5A 2Z79A 3AKRA 5I93A 2W47A 4PF1A 4RHV3 3MV11 4YVSC 3ZMOA 4AXOA 4MO3M 4DY3A 4L2NA 3SCFA 5IVBA 1MQTB 1AR71 1S2KA 2HWB3 3OPZA 3BCWA 5LATA 2PHXA 5FP7A 2DCZA 3RZZA 4FP2A 5C6CA 4MV2A 4FCAA 2ZHMA 1IQAA 3ZSMA 5FZLA 1DQ2A 5DDJ1 4BYYA 1DYOA 1Y9MA 2BFUL 1BEV3 3PL0A 1ZVFA 3QLQA 2DU0A 4AVTA 5C9AB 3VDDA 4AW7A 1O4TA 2PHUA 4RHV2 3POSA 2QCSB 2YB7A 3RWKX 5ANNA 4QKBA 3EQEA 1PHMA 1ENRA 3WR0A 2HWB2 2BNMA 3POBA 2VZUA 4I09A 4YGCA 3LGRA 4L97A 3T4HB 5L36A 1OOPA 5EJ3A 4K7JA 1GOFA 1PK6B 3QBQA 2HLEA 2KR2A 4NMIA 1X9PA 3D82A 4UW6A 4XUOA 1QEXA 2BPA2 1GKBA 3ZFEB 3V0AB 3N9LA 3MIGA 1IS3A 5J1XA 3H42B 4BQ3A 4AI8A 4FOWA 3OUIA 1GANA 4QX1A 4UBGA 3ZYIB 4EROA 2I07B 4BCUA 3U4XA 3IKWA 4ZXEA 3B02A 3HWJA 5ISLA 5H9PA 4C90A 4JGZC 2VQUA 2WZR1 3P1IA 3I49A 5J96B 1LNSA 4RD7A 4FTEA 2I45A 1UMIA 1UD1A 2DYCA 1V6JA 4XUNA 2OS2A 3M3QA 4X8PA 4M00A 1W0OA 1RC6A 2EAKA 2WN3A 3JU9A 1WCQA 3KCYA 5EFUA 1V6LA 5A7OA 3J7LA 1EAH1 3CNAA 1VBC2 5CYYA 1C4RA 4O65A 1BK0A 2E63A 4EQVA 2WNUC 2XVKA 3VBFA 4MGKE 1UYXA 1I5PA 2EA7A 4BHPA 1CPMA 1IG0A 1B35C 2ZS6B 3KCCA 2JIJA 4YZ5A 4EV0A 4ARYA 3OBZA 5FYBA 2A7AA 4MGSA 3WF0A 1ULEA 4Q1PA 2Z2SB 1TNFA 3VZLA 2K0GA 4YVSB 5IHRA 5A33B 2XL9A 4I0BA 4IGQA 1YJKA 1PIV1 2RS51 4RSUA 4AYUA 1I5ZA 2G9GA 1UKGA 3H1WA 2RG4A 3WW3A 2ZGOA 4LUMA 2JD9A 4R52A 4RN5A 4XFGA 5F5AA 4Q4V1 4CCDA 2HWC2 2RS33 1BJQA 1MVQA 2CDPA 3DECA 3ECQA 1VAMA 4P9XA 3BVCA 4QU1A 3RS6A 3MW4A 2RMU1 1NQDA 1EY2A 4LBNA 1UZVA 2D6PA 3HMYA 1TVGA 5DQ0A 1ZBA2 1S0CA 4XJ8A 2VE1A 1DU3D 5FYMA 1GOGA 4KU7A 3HIFA 4CDQC 5KHGA 5BNOB 3H3UA 1AXZA 5T54A 2W5FA 4XF9A 2C9AA 1A8MA 2W39A 4FXGB 1QQP1 1OQDA 2E31A 1RUNA 4OLLA 5FZ7A 3VHOA 1PMJX 2W3JA 3VV1A 4AQSA 4K9SA 2R071 1JTZX 4PBPA 4XZUG 3TN91 1FT9A 3VKNA 3VZMA 4JGZB 4GWJA 3O5SA 1IQDC 5KBFA 5LRSA 4F83A 1AR82 2K2SA 4XHBA 3KV6A 2IXKA 3GCXA 3H8UA 4CDXC 3RPQA 2YG0A 4FXKB 4FVVA 1ULFA 1OQ1A 4FPEA 3WF3A 1RUC3 3AX4A 2Z42A 5BYNA 4EN8B 2ZGLA 2XVGA 4CCJA 1SFYA 1JYTA 3GGLA 2WNUB 2Y8KA 1UOFA 5FIXA 4CUCA 1OPOA 5DUWA 5LEKA 1SDWA 5A3TA 2GC2A 2VOVA 4QKNA 5C70A 1O3RA 2XH6A 4NN0A 3B7MA 5A80A 3VHNA 1L3JA 4HOOA 1RINA 2EIGA 1LRHA 5GM0A 5JIUA 1ST8A 2ZGNA 2C4XA 2J7MA 4DINB 1W2AX 3O1PA 3BU0A 1DBNA 1N1TA 3DL3A 4OMDA 2JDNA 3VGIA 1RUC2 5KR7A 2OZ6A 4ONUA 1DGWA 3J8F1 4KGQA 4X6QB 1A8DA 1ZRCA 5IJRA 3IDAA 1JMUB 4KQ7A 3FL7A 1OPMA 2VUCA 3HNMA 4XFFA 1BHGA 3ZFGC 1ZRRA 4MX3A 2VMGA 4JV4A 2JECA 2GC1A 2JICA 1AX1A 2DURA 2FDHA 2NLRA 1CIYA 1J58A 2B9UA 2WJSA 3KT7A 3PUHA 4XE9A 5G04L 2GH8A 2VUDA 3HQRA 3AZYA 3VBRA 2MHFA 4TTGA 3AP6A 1SFPA 1WBFA 1FMD3 4IERA 3WEZA 1WD3A 1Y3TA 2BP6A 2IC1A 4CDQB 4MXWB 4TYSA 5BPXA 3M8LA 4BPZA 1SFNA 2VMDA 1HW5A 5FWEA 4BQ5A 4Y1UA 2IWGB 4XF4A 3SXWA 3LQCA 3UKNA 5JVVA 4D7TA 3WNPA 3U0ZA 1ENXA 1S0JA 4A42A 3THTA 3TEXA 4YARA 1F31A 1YFWA 2IFRA 4XETA 1FMD2 2FZ1A 2QQWA 3J9SA 3WHTA 2VW1A 3K4ZA 3FFZA 3DPRC 3WP4A 3R0RA 2HWF1 2OKXA 3POJA 2W9XA 3LB9A 1SLTA 4NPLA 1W0NA 4QPYA 1REFA 2ID4A 5GJ6A 1YQ2A 1UAIA 4CDXB 5FQ0A 2DVFA 3AKSA 1NE4A 3OUHA 1ZBE3 1WWYA 1UYZA 4LO4B 3ZN6A 4IXLA 4I3GA 3WDUA 1DYPA 1RUI3 4A3ZA 3IDEA 2EIBA 1BZWA 4AVVA 4KG0A 3KF5A 4FQ4A 3MYXA 1W9FA 3W9AA 3DCQA 3PUAA 5FY8A 1DYKA 2W1WA 1HRV1 2WS91 4G4FA 3N9OA 4XJZA 4EZ4A 3NW4A 2W08A 5AVAA 1LB2A 4MHUA 3AP7A 1SPPA 1L7RA 2QQIA 3E5UA 2ZHKA 1R1A1 2BV4A 2ZHLA 5ANQA 3CHXA 5C33A 3RI9A 5FZKA 4M4RA 1RUI2 2HWE1 1NE6A 4OUMA 3WNXA 4EN6B 3AZZA 3ZFGB 3PUIA 4ZU4A 2QTWB 3TNPB 3N9PA 4QM8A 4V2VA 3ZXGA 5J37A 3OF1A 1W6NB 3EB7A 4A3XA 4PQQA 4S2FA 1W3VA 3IT8A 3BTYA 4Y1YA 1JYIA 2VZQA 3THDA 5L7OA 1ULOA 2R6QA 3EO6A 1PMHX 5JWPA 1UU6A 2VQ0A 4Y33A 1YQ8A 4C8DA 4AR2A 4ET7A 4P5YA 1KDKA 1HRI1 1QKQA 3PIGA 4W6WA 4KI5M 1W8ZA 1WA4A 4P00B 1ZM1A 3ETQA 4LLFA 5KHHA 1G86A 2DWRA 4R9DA 1IKPA 3N9MA 4YM2A 2P3JA 1GWMA 5FFOC 1SLCA 5FYIA 1D0HA 1PM7A 3JUUA 3ZN4A 2WUHA 5EHDA 5FZEA 1R081 5LB6A 3ILFA 5GLTA 4CDUC 1SBDA 4LO8A 2VXRA 1CIWA 1L7QA 5F6LB 5FPLA 1X8EA 3OBTA 2GZWA 4IV3A 4E8CA 2CNAA 5E6HA 2VY0A 3MIBA 4IETA 3LDBA 4XAEA 3DPRB 3ITQA 2ZA9A 2OPKA 2DUPA 2R061 1W0PA 1FV3A 2XVLA 1ENSA 4LBOA 2BERA 2VH9A 1J3QA 4XFIA 4RS5C 4UW4A 5DABA 3ACFA 3ETPA 2VO5A 3LEKA 4LPLA 1ULDA 3IDBB 4DEQA 1IHMA 1WBLA 2JXAA 2ZGUA 5F32A 2ARXA 4ISQA 4KMQA 3DEMA 2W0XA 1W6PA 1JODA 4QM9A 5EWSA 5A1LA 4MZUA 1WW6A 3R4UA 4D6SA 4FTBA 4AFDA 5EXOA 1REDA 2QQLA 4UFMA 5FLHA 2NYYA 5FMCA 3T1MA 3R4DB 5K8SA 3W58A 1RJ7A 2HEYF 3WNMA 1AR92 1J59A 3L2HA 1W8WA 2YC2A 1JZ4A 2MEV1 2ERFA 1DCSA 3V64A 4FPKA 3WDTA 1XSRA 3J8F2 1SMVA 1W2OA 4WZCA 1MEC3 4H3WA 4INDA 4C0BA 2XOMA 1RITA 2QNKA 4S2GA 2CGPA 2DF7A 5GZGA 1E5SA 5ACA3 4FPOB 3T0DA 2NM1A 2PYTA 4BK5A 3OEBA 3WT3A 1S0IA 2ET7A 2XKPA 2R0HA 3AL6A 4HKWA 1AL21 4LEJA 1OD5A 1D2SA 1XE0A 2ARCA 2ZEZA 5FBJA 3ZMNA 5C9AA 2HBUA 5A3WA 1D4M3 2VMHA 5A6XA 2P37A 5KC6A 5A3OA 1QDCA 2X8KA 3M7AA 4MXVA 4R9BA 4JKKA 4YWAA 1HXS3 1PGW1 1MEC2 1QXPA 1TME3 3NV1A 1E5HA 2YYOA 3IB3A 3O7OA 4ZHNA 3WG1A 1JU4A 3ZIWA 1MS9A 1AYN1 1PK6A 2XJRA 4SBVA 1HB1A 2R041 2VULA 3RG0A 1XNCA 1NLSA 4MSVA 4AEMA 4D6QA 3D5OA 3ZPYA 4CDUB 3MUY1 3UK9A 1M4WA 1Q8OA 1QDOA 1JZ8A 3V0AA 1JYNA 3PVEA 1EYBA 5FLIA 3WXPA 4D3WA 4EN7B 5J98B 3H8XA 4OULA 4QX2A 4QD2A 1A6CA 4C91A 3L9JT 4BIOA 2DCTA 3FWEA 4Y1VA 5LA1A 1A78A 5CEHA 4DXZA 2FDGA 2EIDA 1D4VB 5L73A 5CG8A 2HBTA 4ITCA 1LGCA 1R64A 4RS5B 2BBVA 1GFF2 1DQ4A 1RUD3 5JLVA 2VZ1A 3HD8B 5FUIA 1EUTA 3AMPA 4XF3A 5ERLA 1VJ2A 3CMGA 2WNOA 2XBO1 2JEMA 2ZEYA 5JI7A 4MOAA 3USSA 1C1FA 2XG3A 1MS4A 1MZ6A 3E6CC 2XWBB 1RUE3 2QBXA 4D69A 5FK8A 5ABJA 4KWLA 1WLDA 5EPAA 5E8AA 5E89A 3UGHA 2E32A 3B9IA 4XTPA 2AC1A 3I4IA 4CEYC 1RUD2 4A2UA 1SLAA 3NSTA 1W90A 2R16A 3EBRA 3WW4A 1DP0A 1PX3A 2XWJB 3VBUC 2ZX4A 1U5ZA 2VM9A 3ES4A 1LJ7A 2VZPA 4MLOA 4R8HA 5LBEA 1O4ZA 1JW6A 3C7HA 2WFF1 2EXJA 1JYCA 2V73A 4K3UA 1XU1A 4D6RA 4WM7C 1WMFA 2VGDA 4LBMA 2PLV1 3UNPA 4GAZA 1DGLA 2QJVA 2ZACA 4N43A 1RHI1 4QKFA 4CCLA 4BQ2A 2PHFA 2QDNA 5JOZA 1PO12 2VW2A 3WF2A 1GQPA 1OLRA 2KXLA 1CQ9A 1WCKA 4XDOA 3WINE 4AEDC 1RMU2 4FOQA 2ZCWA 5BNOA 1OSGA 5CFCA 5AFEA 1GZCA 1FATA 1PGSA 2JWPA 2O8OA 1OURA 3LDRA 5IW0A 5JXIA 3KS7A 4YW1A 3VD4A 5FREA 1JHNA 3RYKA 1LOFA 2HEVF 1FAYA 4JGYC 2WT2A 1V0AA 5FY0A 4GB31 4XC9A 5SV5A 4P9LA 3OUJA 1VB2A 1F2NA 1R082 1GWKA 4U2AA 1BVVA 1WA6X 2PA7A 3FBYA 2BNNA 5C5TA 2DVGA 2VQTA 3AJYA 5FPZA 5FZ9A 2ENRA 2RJKA 4AOCA 4QU2A 3ZOIA 3GXUA 5APAA 4FOYA 2D3SA 4YVWC 5B4XA 2VUAA 4WZFA 2DU1A 4LK7A 4AFMA 4QGNA 5H9SA 3MI8A 1SDDB 3KD4A 2YFZA 5FYVA 4W6XA 3S7IA 3U11A 2XDVA 3POEA 3K46A 1U5YA 1Q8VA 4DRVA 2DFBA 1E57A 3D4KA 3AMMA 2ZX3A 1TMF3 3I8TA 2SLIA 1JU3A 1VBD1 1CAVA 5IVFA 1W9YA 2VG9A 3P6BA 4L11A 2WO7A 1E5IA 1XNAA 4QWNA 3VBHC 1W2TA 4J6GA 2TEPA 4GKYA 4JTNA 1AYM3 1MS0A 5FZ4A 4Z07A 2CHHA 4Q0SA 5A32B 4CEYB 2Q1FA 3AP9A 1V6MA 4LA2A 3V0BB 3VBOA 1SQ4A 2I2SA 3OGSA 2YPDA 2A5ZA 3VBUB 3PJYA 2ZZJA 1IPSA 1WZXA 1NOVA 2JIGA 2XJPA 4FPHA 3ZXKA 5FO9B 1KXGA 2CDOA 3I2IA 4IW3A 3DYMA 4XBNA 4WVVA 2P2KA 2XLAA 1RVF1 3ZXFA 1KDMA 3O1RA 4Z2AA 1A3KA 1AYM2 2PHWA 5GALA 2JX9A 5HXMA 1R091 1QH7A 4HK9A 1ZA7A 3IAPA 4FAHA 3FLTA 3GZEA 5CFDA 4PI0A 5GLZA 4IEVA 3O1SA 3ACIA 3M3CA 2GAUA 1ZRFA 4HFSA 4LIUA 2HWD3 5FZ6A 2P3YA 4ZS2A 5FXVA 5LY1A 1KS4A 4DUVA 5LEJA 4JGYB 1WKYA 3JBG1 1QWRA 3IAQA 4CXWA 1AJKA 1PO21 3UJOA 5T50A 5KXCA 4UI9L 4LKEA 2QQKA 3ZYHA 1JH5A 2BFUS 1H8TC 4GJYA 4GWIA 1XNDA 4YVWB 2A6YA 2NP0A 4N53A 1UOGA 2JE8A 2OA2A 5EQUA 5DPNA 1O7FA 4EJRA 4BZ4A 2HWD2 4XQWA 3GHNA 1H1IA 3ACLA 2JDUA 3OYWA 1QMJA 3K75B 1NY71 4Y20A 5G05L 4URAA 3WDVA 1YLLA 5FZDA 3WQ1A 1C57A 1RUG3 4AQ2A 1ULPA 1P8JA 2CSGA 1ND3B 2FCVA 3G6JB 3JZVA 1H1AA 1UIJA 4W65A 1HQWA 1QJU2 4FOVA 3ZKUA 3UGFA 1NA1C 1XPWA 3VBHB 2VVFA 1COV3 1DHKB 2JDKA 4KBZA 2OUJA 1UU5A 2RM21 2WNVA 3MIHA 1TZOA 4TWTA 5JMCA 4FPYA 1H2NA 1W03A 5M0TA 4LHKA 3AK0A 4QXCA 1NLQA 4COYA 1N3OA 2J1UA 4YW2A 1AUYA 2TUNA 3BPZA 4NRQA 3P3NA 1UN1A 1BEV1 4JVAA 5A1AA 4GXLA 3A21A 3MDPA 3MHZA 5FZ0A 3MF6A 3TOJA 3KT1A 2XL7A 4QPGA 2XLGA 1COV2 1VBB2 2BRTA 5LZ6A 3JXSA 2B7YA 1GU3A 1JUIA 4AEJA 2E6VA 1OVPA 2J22A 2UURA 3M3OA 1UX6A 4ZS3A 2A75A 3RMYA 3U37A 4B4PA 4BE3A 4BQ1A 4CZSA 3VB9A 2VTFA 1JZ6A 4HL0A 2BJSA 1U12A 2GN3A 3AVRA 3KVBA 5HCBA 3ZXEA 5K9YA 2R30A 1CESA 3J7MA 2DCJA 1SG3A 2YZ4A 3Q8CA 3JD73 4QPIC 4UXAA 2A6WA 3ZYFA 4LT5A 1HQNA 5A7WA 2VBDA 1Z7S3 4KL1A 4TXWA 5FYSA 1G9BA 2DTWA 3ZR6A 1QOTA 2VJXA 3S57A 1UL9A 3KZ4C 1W39A 2UY8A 3C7FA 4LXLA 4HXCA 1I3HA 1XJAA 1AX0A 4GMP1 3GJAA 1H8TB 1KGYA 1OMIA 2A1XA 4JAAA 5FP4A 5BV6A 1K5JA 3CJIC 5FMDA 2VC9A 3I2GA 4Y5TA 5A70A 3JD72 3BTXA 2RDQA 3M3EA 1S0BA 1Z7S2 2VMCA 3AL5A 4NAMA 5FPBA 5LA2A 3SCHA 4AK3A 5HPOA 3RZKA 2O1QA 4ES9A 2WZEA 3RYPA 3K48A 4QGMA 5JZGC 1FOD3 4XCAA 4FT8A 3ALQA 4FPGA 3U4SA 3I2DA 1NA1B 2HKXA 4HZFA 4QX7A 4AG4A 2VVEA 4ZKTB 3LIHA 1W8TA 1C8M3 3IWZA 4XAAA 5J09A 4NIGA 1UZZA 1FPN2 5GZDA 5FP3A 5FY9A 1RUF1 2RS31 3H7JA 2CU5A 3C2UA 1K5MC 1GV9A 1KD7A 3M2MA 5CKQA 3VDBA 2K46A 1WD4A 1W6OB 4P9JA 3RZJA 3AKQA 4AWDA 4YW7A 2AEZA 1RXGA 4S2DA 4CP1A 3NO8A 3BOWA 4GD4A 3X29B 3RRDA 1G9CA 4PT6A 4EN0A 3UL2A 2Y60A 1POV3 1SBEA 2EICA 5E16A 2Z4FA 4Q4Y1 3SCGA 1C8M2 1XB9A 5D8AC 1F5JA 1JOBA 2JG9A 2CWSA 1OFNA 4OQ8A 1RUH1 3FMGA 1GZ9A 3WDWA 3H3ZA 4AHXA 1G9DA 4ASLA 2G9FA 1GZWB 3MBWA 4YG6A 5A6ZA 3GBWA 2PTMA 4LO7A 5F6KA 4QPIB 5IUQA 1V70A 3VBSB 5F37A 3AP4A 3IIIA 2YBSA 2G4IA 5E88A 4FPCA 2C0ZA 3PMSA 4UF0B 1PVC3 4HG6B 3S5QA 5F2WA 3RZMA 4B4RA 5CB7A 2OQ6A 4Q8LA 1PM4A 4BLIA 3W5NA 1CPNA 4Q0VA 5A6QA 3H1MA 3IM0A 4NAOA 1QNYA 2RS11 4I02A 2Y0OA 3CJIB 1QJX1 1GUIA 2YHJA 2ZMNA 1QJFA 1ZNPA 2WO2A 1J3RA 3A4UA 4UYBA 1DDLA 2BEOA 4MGZE 4AFAA 3MIFA 4LJHA 4OFGA 5BNPC 4M3CE 1UMZA 1RYYA 1VBC3 2A73B 1PVC2 1BLZA 3KT4A 3NNLA 4QB2A 3AB0A 5H9RA 3ZKYA 4BB3A 4GIQA 4XZPA 5JZGB 1JZ2A 2KM2A 3NKTA 1Q43A 4Q4W1 1GSLA 1EPZA 1W9TA 3U75A 1HN0A 5LBCA 2VECA 4NJ4A 5SV8A 2IVJA 1H2LA 3H8RA 4IV1C 1J83A 4RFRB 1VBA1 5FPAA 4JHTA 5K0UC 3GZAA 3GNEA 2IVIB 4A6OA 4PF5A 5FZMA 1K5MB 2RR11 2WBKA 2QZ3A 5FXZA 3NAPC 3ME2A 4YZ2A 2JDHA 1LHWA 2ZX0A 1AXYA 5DUUA 2OUHA 3IMNA 4JQTA 2HWC3 2W87A 5D2AA 3TEWA 1F4AA 2W2IA 4GMP0 1BMV2 1YYNA 3BOPA 4QT6A 4UFLA 4IE5A 5BY5A 1X50A 1WMEA 4JKLA 3WP5A 4I30A 2Z5WA 5D8AB 1ZBA3 3AXDA 1GZTA 1SCRA 2PMWB 4QDRA 2WDBA 4RA0A 5F3EA 3BI3A 4PDWA 3MPBA 3E97A 2GMEA 1QOOA 3ST7A 3N7MA 4LLOA 1IKQA 5FCCA 4BOWA 5J7MA 5L9RA 1OC1A 4HN0A 4AQTA 1E5RA 3K77A 4A4AA 2YPJA 2O14A 2W68A 2ADEA 2DBIA 2VUJA 4Q1RA 5BNNC 3I59B 2EIEA 3LOBA 2NZ9A 2VZRA 2HEWF 2J1VA 4IEYA 4URTA 2H0BA 4YM0A 2ZGKA 4NIIA 5EJZB 1ZBE1 1S0EA 2YC0A 3OPWA 4IDZA 1CN1A 3F95A 3N36A 1H1MA 1AR83 5FJKA 5FZFA 4WVMB 4P14A 2F4LA 1ASJ3 1DQ5A 1W8FA 2WFPA 1YIPA 2GP5A 3AZXA 3FX3A 4OI0A 5L19A 1EV11 1EP0A 5IAVA 2VMFA 2YMZA 4BMBA 4HBNA 5J3UA 3SKVA 1UOJA 2WYFA 2ZZQA 3WZ1A 1FI2A 5IK7A 4X8NA 4LBLA 4TLFA 5C7GA 4QX5A 2VAUA 5LY2A 3WF4A 3CBNA 1HJFA 1OF3A 4CP9A 2WAAA 1NCRA 5FYTA 1VRH1 4IV1B 1BCXA 2WA3A 5K0UB 1W2NA 1CGPA 3I2KA 1ACCA 1ASJ2 1ALYA 4XYXA 1NT0A 2XUEA 3AZVA 3T0AA 3WQ7A 5A32A 1X82A 1OLQA 5LA0A 2PHRA 3O0WA 4AFCA 1WW7A 5C8CC 3UETA 4WM8C 1FYUA 1Q8PA 1YFXA 3WF1A 5FDBA 1C5IA 3LWCA 4B4QA 4CE8A 5EIYB 4R9AA 1QU0A 4IEZA 1OVSA 1VMFA 4FAGA 1PGL1 3HQUA 3TEZA 1B35B 5EYXA 3OY8B 4ZY9A 3MIDA 4UWDA 3H9AA 2E7AA 5KWRA 5DDJ3 2PXJA 2Y34A 4AAXA 3OGJA 1UPIA 1ZZ9A 3IDCB 3WNNA 3R6SA 1VBE1 5FYHA 1DGWX 5A1FA 4IE7A 4LBQB 1AR72 1W6MA 2QDRA 1JYXA 2ZGRA 1W8UA 2VCCA 4WBBA 3BGAA 1YRZA 5C4WC 1IS5A 5DAQA 1QJZA 1UYPA 1ZZ7A 4MYEA 1BVP1 5BNNB 3Q8EA 2J42A 1MPXA 5JPNB 2Q8CA 4AHYA 4CEWC 5IFTA 5DDJ2 1GNHA 5C8WA 2K9ZA 4N7UA 3ORJA 1XE8A 4PCRA 2UU8A 3AXEA 1EPWA 2PQSA 1YHFA 4IQPA 4Q29A 1JYVA 3FBMA 3WHUA 4LHLA 4MGQA 2WZR3 3BTAA 3LEGA 4NHYA 1ND2C 2LUWA 5CVRA 4HKOA 1S0DA 5FUNA 4BQ4A 2FCUA 4IEXA 2Q8OA 4D7YA 2B39A 3N4MA 4ATFA 5FZOB 3H3LA 2ZGPA 2EAAA 3I3QA 3POWA 3VDAA 3HR9A 5IYYA 1H4HA 2HJIA 1EAH3 5D21A 1WW4A 1ND3A 2D5FA 1CZSA 1NCQC 3A0NA 4ZXKA 1Y4WA 2CY6A 3KV5A 2WZR2 5JXJA 4LO5B 2R1DA 2A71A 2DVAA 4NUBA 4YRDA 1H6XA 3MLJA 1RJ8A 1V6KA 2JKXA 1TG7A 1CAUA 5LW9A 1N3PA 3ZXLA 5C8CB 1PIV3 2RS53 4WM8B 4LE3A 1EAH2 1GNZA 5I91A 1W04A 2JDYA 4YW5A 4XCBA 1HB2A 1UU4A 2O8QA 4E8DA 4Q4V3 3BYWA 4RR3C 4UBHA 1US3A 2DTYA 3USUA 4FSJA 2KD7A 2GU9A 4E27A 1ZZBA 1TME1 4OYUA 2E53A 3ROUA 1J3PA 1W9WA 3POYA 1AXKA 4UW3A 4Q8KA 2JG8A 5FY5A 4QQPA 3OGRA 1PIV2 3JB8A 2RS52 3T09A 3VL8A 4FFGA 4L0PA 2X29A 1VLNA 3H0OA 4O61A 5DAWA 5C4WB 1YFYA 2V4VA 2TBVA 4Q4V2 4UT5A 3ZFFA 2X5IC 5CNAA 4GH4A 5EJ1B 4HN1A 1O8SA 1OFSA 3QACA 4CDWC 3BIEA 4HMZA 3GYDA 2BGOA 2V09A 2Y6HA 4CEWB 3PUSA 1AF9A 1UX7A 1GNYA 2RMU2 5BXXA 3AMQA 1V9U1 2ZMLA 3TN93 4LTAA 4F7ZA 3KB5A 4CP0A 1YQ6A 5HBAA 5JUVA 4I2OA 1ND2B 4GWMA 4AF9A 3AYAA 4UFHA 3TBDA 4RQPA 5LRRA 2BUKA 4UFKA 5JXGA 1QQP2 3ACHA 1O6UA 1RUE1 1Z0HA 2J1SA 4OI4A 4PIYA 4XVHA 3OD0A 5HV0A 2E51A 1XYOA 4AE2A 4IUGA 4ZU5A 1H9WA 4M01A 2JDPA 3HAGA 2R072 1LHVA 1OUSA 3TN92 1Z78A 1SACA 4AI9A 2VNVA 4IE4A 1CAWA 4KGGA 4NO4A 3DV8A 1HKDA 2GMMA 1LEDA 2QQVA 4LOSA 4XACA 1T6GC 1YI9A 2DBNA 2EXKA 3FFQA 1AR93 2VZSA 4QX3A 3AM2A 4XEZA 4XDQA 5JIAA 3SH4A 4M3CB 3WD5A 1RGSA 2D6LX 2PHTA 2VMEA 3DYPA 1GLHA 3N3HA 4Y22A 3J8F3 4L9BA 4NVPA 4C1XA 3VDDC 4CYDA 4TZDA 1AX2A 3HQXA 1AR61 5I8YA 3Q8BA 3I3EA 2ZGMA 3O0VA 4MH0E 4RR3B 3J7HA 1JOJA 2D3PA 4W4ZA 4DS0A 4NWVA 1OOPC 5FAXA 1DLCA 1Q56A 1QJY1 1WCDJ 2J1EA 4NHLA 3A23A 4OHWA 1RL3A 4Y5Z0 2JE9A 1MQTA 4JX0A 4DPNA 3RZGA 2EXIA 2P6CA 1YQ5A 4RYDA 4TN7A 2ZEWA 4QGLA 2Q8EA 3RSJA 1GQHA 2X5IB 4CDWB 3VBSA 1CAXB 2BU9A 2MNGA 2D6OX 4OVEA 4BMEA 4EYUA 3EHKA 3ZPOA 4Z8BA 3PDQA 3W5MA 3LFMA 2EXHA 2RDRA 2R1BA 1GBGA 4P9IA 2GN7A 5T52A 1TMF1 2PAKA 3LA3A 3NWKA 2HWF3 4XUPA 2HYXA 1WW5A 2W91A 4BJ0A 4H2AA 5C71A 4CVUA 1DQ0A 3VBFC 1LTEA 2XHKA 1VB4A 3T2PA 5I0RA 2G19A 3ILNA 4H7MA 2DUQA 2WR9A 4YGEA 1PVXA 3OTFA 2UWAA 3ZFEA 1WCSA 4X6RB 4NHXA 3WUDA 4ASKA 5I8TA 3N7KA 2P34A 4GJZA 4YZ1A 3PIJA 4F8AA 2ZXQA 4XHXA 4YW4A 2AACA 3WV6A 3MPPG 2HH9A 4QQHA 3OBRA 2HWF2 1A34A 2C6SA 3NNGA 4YGDA 3CEWA 4FTSA 2FDJA 1G8WA 5HCHA 5HV4A 4CPBD 2YU2A 4L8QA 1DGRN 4J25A 1R1A3 3RYRA 3I3MA 1LESA 5J36A 5FPXA 2HWE3 1YIFA 2FDKA 2JB4A 2VXJA 2XMLA 2WQ8A 1HRV2 2WS92 2I74A 4QKDA 3LCPA 1C3HA 1OOPB 2IXJA 5C5UA 4M4PA 5T3NA 4AEKA 4CUAA 5I0SA 3VN4A 1HRI3 1PO13 5F2SA 3C7GA 4YVSA 4DUXA 5A33A 1REEA 1R1A2 2FQPA 3APBA 4KU8A 3VD5A 3DKQA 4AHWA 1RMU3 2HWE2 1RTVA 3OD4A 2F4PA 1UZ0A 2DUOA 2NQYA 1US2A 2OXBA 4MHRA 5JMOA 2VNGA 1AZDA 1QGLA 2BQPA 2WT0A 3ES1A 1TEIA 4JKMA 1G6NA 2C5DA 3E5XA 1R083 3I59A 1OKOA 1OA3A 3BU7A 2VW0A 3WQ0A 3S5AA 4PLMA 3OOXA 1LR5A 3OGGA 3H50A 1HRI2 4XPVA 3PVNA 2ZTNA 3I7DA 3KF3A 1RUJ1 2YBKA 3MEPA 2WN2A 4JZRA 4D0QA 2F6BA 2XXZA 2R063 5FPVA 1FNYA 4B3NA 1BK1A 1NXMA 1I9RA 4L99A 4XW3A 3JB4C 4LUKA 3C8XA 1D2QA 2A6ZA 4OMCA 3MLKA 3T30A 2DCYA 3KWVA 4U36A 2C9KA 3HVDA 2GALA 2ZGSA 1S2EA 4XFHA 5FMOS 5AC91 5CA6A 5CU1A 3VDCA 4FO9A 3ZLIA 4JGZA 4Q4X1 3HT1A 5FOBB 2VNRA 5LBBA 2VNOA 2WLQA 4XBQA 3ZYGA 2V5DA 2R062 3CKHA 1U5IA 4LO6B 5FO7B 3WNOA 1XQNA 1EUUA 4QDQA 5LK7B 1OI6A 2C24A 2DFCA 3LSEA 1F9KA 2ZHNA 2MEV3 1W8OA 5CIRA 2Q30A 2YC4A 5DUVA 3D8CA 3VBRC 3ZSJA 3O1TA 2NN8A 1RIRA 2Y38A 4KWKA 1XBFA 1VR3A 3PTYA 2XONA 2Y6LA 3UT0A 2WNUA 1R1ZA 4J1XA 4QHBA 1B35A 2YGLA 4KWJA 3OY8A 5DXDA 1F15A 1UO9A 3OB8A 2XGXA 3D0SA 5FP9A 4DO0A 5C3RA 2FD8A 3ZSEA 1PZ9A 5IAXA 2XUMA 1AL23 4AI0A 2W1UA 1LU2A 2BGPA 4LA3A 4BQYA 2BVBA 2WIIB 2X53S 3VUOA 4O9GA 4E2SA 4PQ9A 1C5HA 1DZQA 1BBT1 1IG3A 1Q5OA 2RHPA 2IXCA 2MEV2 4AAPA 3ZO0B 4QDSA 1S0FA 2A3WA 3WY6A 2A6VA 1UOBA 1CZTA 1KEXA 3ZX7A 1XNKA 1AYN3 3K4AA 3KGLA 4DXRA 1I1EA 4WM7B 3KSCA 1CONA 3MIEA 5JOYA 2VBPA 2XQXA 2AZ5A 2ORXA 4IE0A 2AEYA 4LBKA 5EP9A 3RJ2X 1LOBA 4QX0A 4LKDA 4XBLA 1AL22 3ZXDA 2HYKA 3WW1A 3K3OA 1SEFA 3S0MA 4V1PA 2A3XA 3VKMA 4AEDB 2B4KA 2E7QA 4AL9A 4CDQA 4MXWA 1FOD1 1PGW2 3EMRA 4XIOA 3HPNA 2ILMA 5DUXA 1DZTA 3U1XA 2F17A 1AYN2 2R042 3NNMA 4M0NA 3ZYBA 4E4DX 4JTOA 1H0BA 3NNJA 2XBO3 1QJU3 3I2FA 5FP8A 2RE9A 4COZA 2Y6JA 3MO4A 5CZKA 4CCOA 2X09A 4Y5SA 2P17A 1DLLA 3MV01 4B29A 1K45A 1QF3A 4NIDA 2QUOA 1KQRA 4MGYE 4YM1A 4FP3A 4OI2A 1OLMA 4CDXA 1POV1 4XJAA 5L7OC 1S1AA 2ARAA 3LA7A 5D1IA 3LFIA 4AI1A 3MGUA 3VLBB 1Q8QA 3VBRB 1OKQA 2XBO2 4RHV1 3HNBM 1VMJA 4HVRA 5FTTC 1W2UA 1UKRA 2HWB1 5TSWA 3TWIA 5FBZA 3WG2A 1VBB3 2GC0A 3F2ZA 1JHJA 1V6IA 1T2XA 4AFBA 3H1YA 2PLV3 1WMXA 4EWDA 1RHI3 2CYFA 1YJLA 5FR3A 1GQGA 2ZMKA 3RNSA 1XE7A 4Q27A 1QHDA 2B9VA 2FZ2A 1HLCA 1XXNA 3IPVB 2B45X 2G1MA 2NPIA 1DIWA 1N1VA 3OGVA 3WCRA 4IV3C 3ZFGA 3O1MA 3NQHA 2AREA 1HB4A 4FPLA 5IK5A 2D6NA 1W6NA 2WFF2 4F3JA 1POQA 2IZWA 2RV9A 3HBZA 4P9YA 1VP6A 3S6PA 1SBFA 2D40A 4PIXA 2PLV2 1LCLA 1UWWA 1GOHA 2VVDA 4PI2A 3PLQA 5FQ0B 1RHI2 4DFSA 5T5OA 2VCAA 1HV0A 3ZN6B 3CDZB 1HN1A 2QQPA 4LORA 3LA2A 3SQOA 2XPJA 2Q1ZB 2QQMA 3WCSA 1RUJ2 4CXXA 4UW5A 2YXSA 2VR4A 3C7EA 3EXUA 3BUCA 1MS3A 3K2OA 4OHYA 1JBCA 5FMOL 2RDSA 1H6YA 3RJRA 3DXTA 1CX4A 4CPBA 4GB32 1JS9A 2Y33A 1SPPB 1CVNA 1LKNA 3FE5A 2WINB 1J1TA 3OBAA 1VBD3 5F3CA 3NJYA 3OCPA 1UXXX 5T55A 2V5YA 3VZNA 3DPRA 1ZA4A 2BVVA 4JDMA 3ZVXA 5IK4A 1UNBA 2WZPP 4QQLA 3FHQA 2HWC1 1FPN3 1Y43B 4OHZA 3DF0A 3ENRA 4GKXA 4B7EA 3HN1A 1LGNA 5L9VA 1KFUL 3W21A 3W20A 1ULCA 5L7OB 4BISA 5FZ8A 4Y24A 3I2JA 3ZYRA 3C3VA 4OZXA 4CUBA 5C9AC 1ZBA1 3SHRA 1VBD2 4OI1A 1UY4A 1LAJA 3FHAA 4Y1XA 2VOKA 2XQRA 3GHMA 4R9CA 1LECA 3WLUA 4YG0A 4S2HA 4Y4YA 4LMFA 4XQ4A 4D8MA 2DVBA 2ARBA 2D7FA 1PK6C 1R093 2RJLA 1QNWA 5CBLA 4DRRA 3SC7X 1BKZA 1LEMA 4XJWA 3ZSKA 1SHWB 1VAKA 2A70A 4XTMA 1YFUA 2WYSA 4HLTA 4IV3B 1MZEA 3SMHA 1PNFA 3PVOA 2X05A 1NXD1 3H7YA 1RVF2 3JBG3 4QQOA 1CAXA 3B00A 2UWBA 3KHCA 1PO23 1R092 4NRMA 3VHRA 3J26N 3K51A 3HBKA 3TEYA 2WC2A 4Y4RA 2ZPXA 1SLIA 4NROA 4H14A 4K21A 2WWSA 4BQWA 1U5XA 2RJ2A 1S4CA 1W6PB 2ATFA 3GZUC 4EE2A 2QZ2A 1CD3G 5DAVA 4NIHA 1OHFA 2UY9A 3ZDSA 4Y1ZA 5A3LA 3U14A 4CCKA 3MLLA 1IS6A 3JBG2 5ABJC 3GBFA 2ZEXA 1LENA 4CDUA 2JD4A 1G9AA 2FDIA 4RGAA 3VZJA 1PO22 2LROA 3I54A 5LK5A 4B7KA 2ZGQA 3QD6A 1RUC1 1WMDA 2RVAA 2AENA 3O12A 1O3QA 4V2WA 4LNVA 2Q1MA 2ZABA 2WRAA 2W1QA 1JI6A 2OPWA 2RM23 3GDBA 4Z1VA 2WSVA 3I97A 1IGOA 4NRPA 1DG6A 4AHZA 2D98A 3OPTA 3UKVA 5KHJA 4RS5A 1NY72 4D7SA 4YFZA 1IOAA 3WDXA 5B4NA 1MS8A 3Q8AA 2D44A 1RUOA 1H8VA 4COWA 1PZ8A 1K12A 1VAVA 4N43C 5F1RA 4K40A 4N7IA 4MUVA 4LITA 4XJUA 4P9GA 3IN9A 1O59A 5E1RA 2BWAA 2EALA 2OT7A 4LOTA 2AYHA 3ATGA 1MACA 2ET1A 2LW8A 5GKAC 3U07A 4DNYA 4FFFA 1C1LA 1TNRA 3V65A 3GALA 5BNOC 4PBOA 5CFCC 1OH3A 1NG0A 2RM22 2WSUA 4FI9A 2GNDA 4IL7A 1W8HA 1LOFC 4K8FA 4QXBA 3THCA 5CAZA 3LDKA 5FO8B 2W94A 2Z69A 1HDKA 3I3DA 2J1AA 4O9EA 2Y26A 2VMIA 1BEV2 3HT2A 3POGA 5FPUA 4XILA 3ZM8A 2XJSA 4WVWA 1Y9GA 4BM8A 2FHRA 1FMD1 5JDBA 4YGBA 3HEIA 2XJQA 3KVAA 2WO1A 5FKBA 4AGGA 1Q8SA 2BOJA 5CADA 3PTRB 3B3QE 1HQLA 2XR4A 5KC5A 5JXHA 2W46A 1VALA 2EVXA 1KJLA 3LIGA 4Q0UA 1YUDA 5AFBA 3T0BA 1WUVA 2QKDA 4AVBA 3GCWA 2ZJCA 4D94A 4GMP3 2OZJA 1ODMA 3I2HA 4K6BA 1IS4A 3IMMA 3WQBA 4QHOA 1LOCA 3PJQA 1YEWA 2XJUA 5JI9A 2ORZA 1WGPA 5H9QA 3WSOA 5C3SA 1X8MA 3SKJE 3BPSA 1XYPA 3N7LA 1FX5A 1UPSA 5ABJB 1ZREA 3QH7A 3RWNA 3FZ3A 3LPGA 5GLVA 3NMBA 3VKLA 4KH9A 1JZ5A 5A7SA 1NZCA 3CJXA 1RXFA 2YU1A 3VBOC 1RUI1 4EWAA 4DEVA 3AMNA 3KV9A 5CG9A 2ZOEB 3T2TA 5T5PA 1BQPA 4IESA 2W1SA 1W99A 4DZGA 2R49A 5F39A 4LIVA 2D3RA 5BNPB 1RUF3 4LE4A 4AGVA 3EYPA 4N43B 2Y0IA 2Q5TA 4Y3OA 4B1MA 1ULGA 2IUWA 3G7DA 3U10A 4I3PA 5CFDC 2Y6GA 5FUPA 3UJQA 4JRAA 1AHSA 5I0DA 1UZWA 5CFCB 4Q4Y3 3GF6A 4G9SB 2VL4A 3B69A 3RZHA 5GZEA 4OHVA 4AVCA 4CCEA 1RUF2 2RS32 1RUH3 3NAPB 4RFT0 4BA6A 4CEYA 3V0BA 2B42B 2VTXJ 2W95A 3VZOA 1AR73 3NV3A 4Q5OA 3VBUA 1OUXA 4GA9A 1HIXA 4E4SA 2FMDA 1OF4A 2BW8A 4YFWA 3CO2A 2KA3A 4META 4N53C 5JR7B 4YPJA 2CAUA 5FY1A 4NIAA 5A3NA 2P1BA 1CJPA 4WM7A 2XB6C 4Q4Y2 3ZXAC 1YO8A 3LKJA 3NV4A 4ZPIA 2JENA 4MGIE 4W50A 4R4ZA 5F9TA 5FOJB 1RUH2 3HJRA 5FZGA 3S7EA 1KS5A 4XIKA 1XRUA 2RS13
chains in the Genus database with same CATH topology
3UKTA 1QJX3 1B09A 1QXJA 5I0TA 1CAVB 2OYZA 4AEDA 1W6QB 1IPJA 4Q2FA 2NMNA 4YSFA 4XJ9A 2GNTA 3MW3A 4JGYA 1ZX5A 2WNVC 1UCXA 5I0UA 5JSOA 3NVCA 5KXDA 1AR91 4Q4W3 4WV8A 4IEOA 4ORFA 3VBOB 4JQRA 2RS12 4YVWA 3WW2A 1QJX2 3D0JA 2UYBA 3DN7A 1NQJA 2YUEA 1VBA3 4BIFA 1PZ7A 5GZCA 2PAEA 3SNMA 1ZZ6A 1AVBA 4QPGC 2IFWA 5B2GB 4Q0PA 3GZTB 2DV9A 2RR13 3JQXA 4XFAA 2BTVC 3WDYA 4GQ7A 4Q4W2 1H2KA 2LTNA 5CFDB 2YY1A 4AVAA 4A7KA 4HVQA 3MZHA 3ZXJA 2IXLA 4QMAA 4JC1A 5GLWA 3VBHA 4ES8A 1MEC1 2PN5A 2GH2A 2XJTA 1VBA2 3OJBA 1F5FA 4COVA 1RB8G 2AR6A 5A3MA 5ACA1 3PHMA 1YCIA 4AQ6A 5IK8A 2RR12 2AGSA 2PFWA 2UWCA 4WVZA 1DFQA 1X36A 1ZZCA 3IPVA 3P3PA 1F8VA 1D4M1 2OIIA 2ZAAA 2PELA 4N53B 3BIWE 3AKTA 1UZYA 1HXS1 3INAA 1DQ1A 1YI7A 2WT1A 3OYWB 3KQRA 2RMU3 4HPKB 5EV7A 4Y20B 3IBMA 2B46X 3ZYJB 1LULA 2BNOA 4NOTA 4A7ZA 3WP3A 4NHKA 2ZX2A 1ZYBA 1JN2P 2H6BA 4SLIA 1U0AA 4M3CF 2UYAA 1APNA 4W6YA 1QQP3 3PMEA 4L92A 1QH6A 2LM3A 2Q0AA 1EV13 2NMOA 4CRQA 2WNVB 3RMXA 1LGBA 5I8SA 5BUVA 2AUYA 1FXZA 1NYWA 2R073 2MPFA 4LR4A 3RQ0A 2PAMA 3W59A 3WP6A 1RUD1 3E6DA 4LBQD 1H8TA 1ZBE2 2ZKLA 4B8EA 3FUQA 1VRH3 1GR3A 3KGZA 4E2QA 1CR7A 5K7PA 2R0FA 1KFXL 4QPGB 1ONAA 4YZ3A 3FHIB 1EV12 1YWKA 4ISRA 2DCKA 2PHLA 1ZZ8A 1H30A 2JG9C 2ZAHA 3CLPA 1NCQB 5AVPA 1PO11 2H0VA 3MW2A 2GSYA 1TQ5A 3VL9A 4AGRA 1NA1A 4EWEA 3VKOA 1RMU1 4FPJA 1VRH2 2TNFA 1UW8A 2GDFA 4DMIA 3FJSA 1VBE3 1GYKA 3UV9A 1BXHA 2JE7A 3LSDA 4RL7A 5T5LA 1NLRA 1W6OA 4YZ4A 5FOBB 4HK8A 5HI0A 3E6BA 1WLTA 1PGL2 2D5HA 3CL1A 3O14A 4LHNA 1D0GA 4AVSA 3DKWA 4XMAA 1LHNA 2W52A 2PQQA 1FV2A 3KMHA 5HCFA 3WX5A 2P3IA 3FUOA 3ASIA 4JRLA 2SBAA 1VBE2 1HV1A 4IEUA 2D97A 3VZKA 1GZWA 1WLCA 4QPIA 3TRSB 4GWNA 2WA4A 2P3KA 2WLPA 4NHMA 1S0GA 4Z2WA 1LOAA 2ES3A 3WUCA 3JQWA 3D6EA 3KM5A 1XYNA 4MVTA 3PNAA 4YYOA 2VOWA 3AFGA 1N1YA 1MS5A 3CJIA 2ZGTA 3AYDA 1OQEA 2XJVA 4JDNA 1AYM1 2IXIA 4HANA 2JG9B 3SH5A 3LAGA 5JZGA 1JXNA 1MS1A 2WNEA 4YM3A 3J4UH 1LOEA 2E7TA 4PDWC 3VHPA 5DG2A 5IT6A 1HRV3 2WS93 1LOGA 1YNAA 3TB0A 3B93A 1GICA 1DF0A 1SCSA 4Q0QA 5ACA2 1K5MA 5EYYA 3SITA 3VDDB 2GNBA 3ZSLA 2A6XA 4LULA 4H7LA 4XFBA 1D4M2 2GMPA 1M06G 1H9PA 2HWD1 1HXS2 1UIKA 1H2MA 2FBEA 2D43A 5F5QA 1TME2 5D8AA 3QH6A 3R4SA 1O5UA 1V9U3 4NR1A 1SLBA 4IEPA 2C1FA 1H4GA 2ZKNA 1O4YA 3URFA 1QJU1 3ELNA 2WQ4A 4IEWA 1NCRC 3M1HA 2YV8A 4K20A 4PIZA 1Y9QA 5DZFA 2YROA 1QOSA 2JDZA 3DGTA 1V9U2 4I0AA 4Z92B 1RUG1 3QOPA 4YNIA 3THPA 1N3QA 1O5LA 3VBFB 2XLFA 4WVMA 1PNGA 1S2BA 5EZWA 3WVJA 4XXAA 4FBFA 1COV1 1VBB1 4OUSA 1RUE2 4TSVA 5BNPA 3WOGA 3TAYA 4GALA 1PMIA 3GBGA 1V6NA 3TYJA 5JCTA 3Q9OA 4ZU7A 1AR63 2FMYA 4PDWB 2CWMA 4BWOA 4I0WB 4IV1A 5FLJA 5K0UA 1QJY3 4KBBA 4FQZA 2D93A 2VOXA 1DQ6A 3NAPA 4J1WA 2ZX1A 3MFCA 5GLUA 2CTVA 5GZFA 2QE3A 1JUHA 4DOUA 3MF9A 4PLNA 1KITA 1AR62 3BODA 2CGOA 2IXHA 3JCIA 2E9QA 3NKGA 3JD71 1Z7S1 1LHOA 1QJY2 5HXVA 4NWWA 4LBQA 1LODA 1ND3C 4N9HA 3QCWA 2H6CA 1X7NA 1W6QA 2R043 1NCRB 5BNNA 1LU1A 3LOIA 2BYVE 3N7JA 1HX6A 2DVDA 3BALA 3DUIA 1AL0G 1C8NA 1MZ5A 4CP2A 4XOGA 5KHKA 5KXBA 1FPN1 3B5LB 1QXRA 3CU7A 4Z82A 3NL1A 1YXWA 3M3IA 1BYHA 1J1LA 4LBJA 4YW3A 3R05A 4FPFA 3O0XA 3T1LA 2VU9A 1TMF2 3FLPA 4HSLA 3ILRA 4JDOA 4A7YA 4ATEA 2AH2A 2CGNA 1C8M1 2CAVA 5FRAA 3ZYPA 1QY4A 4C0HA 5JOWA 4K1YA 1OA2A 2JG8C 4EN9B 2JJ6A 3FLRA 1WLWA 2D6MA 1W6MB 2WKKA 1N47A 5J48A 2YDEA 4NPRA 3ZFFC 4GH4C 3SH3A 4AI2A 3AFKA 4HSJA 1KJRA 1SLLA 1UF2C 5C8CA 1URXA 4WM8A 3AYCA 1N1SA 5JSRA 3RI8A 1X33A 3ZIXA 3S30A 2WFF3 4KG8A 1O3SA 2EF6A 4OHXA 5DG1A 4RQPC 1S55A 4XMIA 2GC3A 4HPKA 2WL1A 3V56A 5JSPA 1IPKA 3NJZA 1PVC1 1RUJ3 1G7YA 1MZFA 4HVOA 2ETEA 4Q26A 4HETA 5KHIA 4I01A 1ZRDA 3PVBB 1O3TA 1LHUA 2B5HA 5C4WA 5DZGA 4QXKA 4XQDA 4ASMB 3B94A 4GB33 2VQAA 1DGRA 4CEWA 4DQAA 4IEQA 1Q3EA 5AC93 1CAUB 3SLIA 5JAXA 4RGGA 1VBC1 4Q4X3 1RUG2 4N90A 1ND2A 3AJZA 4XF0A 4PLOA 5KXEA 4YLZA 1BMV1 2YGMA 3MFAA 3N35A 1V00A 3KCXA 3USUB 2Q4SA 3EJKA 1XNBA 4GULA 1MVEA 1G9FA 1I6XA 4YG3A 1DZRA 5AC92 1VIWB 1OA4A 2JG8B 1NCQA 4HKLA 2N7GA 1MQTC 1KRIA 3E5QA 4M0HA 4Q4X2 5DZEA 2OVUA 2JKBA 3FC0A 4JCKA 4HT1T 1ENQA 2CL2A 3ZFFB 4XF1A 4GH4B 3VKFC 3VBSC 2QFEA 3AYEA 3M70A 4H55A 4M3CA 1AJOA 4XXPA 2CV6A 3L2YA 5T5JA 2LALA 3B9CA 1BBT3 2BWCA 4AI3A 2B8MA 3ZN5A 4PJYA 2WQZC 4RR3A 5JPMB 1RVF3 2ZBJA 4G3YC 4BLJA 4KNCA 2A3YA 4RQPB 4BH9A 5HCAA 1CJDA 1C28A 4K1ZA 3ZFEC 4N9IA 3BB6A 3LZZA 3B01A 4CTEA 1BBT2 5BNQA 3RDIA 2OW4A 3WG4A 3KLSA 3WG3A 1FNZA 1CAWB 2X5IA 2PHDA 4CDWA 3AKPA 4Y26A 1AR81 2R32A 1V6OA 4P9WA 2D6KA 1IZ3A 4QQ2A 3SISA 4COUA 1ASJ1 4DY5A 4P5HA 3NV2A 3CF6E 3M4FA 4R4XA 2GNMA 3AMHA 1TE1B 1POV0 4XFCA 4E4ZA 1XU2A 3AZWA 4Y22B 2O0OA 4C1WA 3IIAA 5JOXA 1FOD2 4E9KA 3TNQA 1MR5A 2BGCA 2XKOA 1O91A 2VPVA 3MICA 2QVSB 1Y7BA 3A0KA 3AP5A 2Z79A 3AKRA 5I93A 4RHV3 4YVSC 3ZMOA 4AXOA 4DY3A 4L2NA 3SCFA 1MQTB 1AR71 1S2KA 2HWB3 3OPZA 3BCWA 2PHXA 3RZZA 2DCZA 5C6CA 4FP2A 4MV2A 4FCAA 2ZHMA 1IQAA 3ZSMA 1DQ2A 5DDJ1 4BYYA 2BFUL 1BEV3 3QLQA 1ZVFA 4AVTA 2DU0A 5C9AB 3VDDA 4AW7A 1O4TA 2PHUA 4RHV2 3POSA 2QCSB 3EQEA 1PHMA 1ENRA 3WR0A 2HWB2 2BNMA 4YGCA 4I09A 3LGRA 4L97A 5L36A 1OOPA 5EJ3A 4K7JA 1PK6B 3QBQA 4UW6A 3D82A 2BPA2 1GKBA 3ZFEB 3V0AB 3MIGA 1IS3A 4AI8A 4FOWA 4EROA 1GANA 3ZYIB 4UBGA 2I07B 4BCUA 3U4XA 3IKWA 3B02A 3HWJA 5H9PA 4C90A 4JGZC 2WZR1 5J96B 4RD7A 4FTEA 2I45A 1UD1A 2DYCA 1V6JA 4X8PA 3M3QA 4M00A 1W0OA 1RC6A 2EAKA 3JU9A 3KCYA 5EFUA 1V6LA 1EAH1 3CNAA 1VBC2 1C4RA 2E63A 2WNUC 2XVKA 3VBFA 4MGKE 2EA7A 4BHPA 1CPMA 1B35C 2ZS6B 3KCCA 4YZ5A 4EV0A 2A7AA 1ULEA 4Q1PA 2Z2SB 1TNFA 3VZLA 2K0GA 4YVSB 5A33B 2XL9A 4I0BA 1YJKA 1PIV1 2RS51 4RSUA 4AYUA 1I5ZA 2G9GA 1UKGA 3H1WA 3WW3A 2ZGOA 4LUMA 4R52A 4XFGA 4Q4V1 2HWC2 2RS33 1BJQA 1MVQA 3ECQA 1VAMA 4P9XA 3RS6A 3MW4A 2RMU1 1NQDA 1EY2A 4LBNA 2D6PA 3HMYA 1ZBA2 1S0CA 4XJ8A 1DU3D 4KU7A 3HIFA 4CDQC 5KHGA 5BNOB 3H3UA 1AXZA 5T54A 4XF9A 2C9AA 1A8MA 2W39A 4FXGB 1QQP1 1OQDA 1RUNA 4OLLA 3VHOA 3VV1A 4AQSA 4K9SA 2R071 1JTZX 4PBPA 3TN91 1FT9A 3VKNA 3VZMA 4JGZB 3O5SA 5KBFA 5LRSA 4F83A 1AR82 2K2SA 4XHBA 2IXKA 3H8UA 4CDXC 3RPQA 4FXKB 4FVVA 1ULFA 1OQ1A 4FPEA 1RUC3 3AX4A 2Z42A 5BYNA 4EN8B 2ZGLA 2XVGA 1SFYA 2WNUB 1OPOA 5DUWA 5LEKA 1SDWA 2GC2A 2VOVA 1O3RA 2XH6A 4NN0A 3B7MA 5JIUA 3VHNA 1L3JA 1RINA 2EIGA 1LRHA 5GM0A 2ZGNA 4DINB 1DBNA 1N1TA 3DL3A 3VGIA 1RUC2 2OZ6A 4ONUA 1DGWA 3J8F1 4KGQA 4X6QB 1A8DA 1ZRCA 4KQ7A 3ZFGC 1OPMA 4XFFA 1ZRRA 4MX3A 2VMGA 4JV4A 2JECA 2GC1A 2JICA 1AX1A 2DURA 2NLRA 1J58A 2B9UA 2WJSA 3KT7A 4XE9A 2GH8A 3AZYA 3VBRA 2MHFA 3AP6A 1WBFA 1FMD3 4IERA 1WD3A 1Y3TA 2IC1A 4CDQB 4MXWB 4TYSA 5BPXA 3M8LA 4BPZA 1SFNA 1HW5A 4Y1UA 2IWGB 4XF4A 3SXWA 3UKNA 4D7TA 5JVVA 3U0ZA 1ENXA 1S0JA 3THTA 4YARA 1F31A 1YFWA 2IFRA 4XETA 1FMD2 2FZ1A 3J9SA 3WHTA 2VW1A 3FFZA 3DPRC 3WP4A 3R0RA 2HWF1 3LB9A 1SLTA 4QPYA 1REFA 5GJ6A 1UAIA 4CDXB 5FQ0A 2DVFA 3AKSA 1NE4A 4LO4B 1ZBE3 3ZN6A 4IXLA 4I3GA 3WDUA 1DYPA 1RUI3 3IDEA 1BZWA 4AVVA 4KG0A 4FQ4A 3MYXA 3W9AA 1DYKA 1HRV1 2WS91 4G4FA 4XJZA 1LB2A 3NW4A 2W08A 5AVAA 3AP7A 3E5UA 2ZHKA 1R1A1 2ZHLA 5C33A 3RI9A 1RUI2 2HWE1 1NE6A 4OUMA 3WNXA 4EN6B 3AZZA 3ZFGB 4ZU4A 3TNPB 4QM8A 3ZXGA 5J37A 3OF1A 1W6NB 4A3XA 4S2FA 3IT8A 4Y1YA 1JYIA 5L7OA 2R6QA 3EO6A 5JWPA 1UU6A 2VQ0A 1KDKA 1HRI1 1QKQA 4W6WA 1WA4A 1ZM1A 3ETQA 4LLFA 5KHHA 1G86A 2DWRA 4R9DA 1IKPA 4YM2A 2P3JA 5FFOC 1SLCA 1D0HA 1PM7A 3JUUA 3ZN4A 1R081 4CDUC 3ILFA 5GLTA 1SBDA 4LO8A 2VXRA 1CIWA 5F6LB 1X8EA 3OBTA 2GZWA 4IV3A 2CNAA 2VY0A 3MIBA 4IETA 3DPRB 2ZA9A 2OPKA 2DUPA 2R061 1W0PA 1FV3A 2XVLA 1ENSA 4LBOA 2VH9A 1J3QA 4XFIA 4RS5C 4UW4A 1ULDA 3IDBB 1IHMA 1WBLA 2JXAA 2ZGUA 2ARXA 4ISQA 2W0XA 1W6PA 4QM9A 5EWSA 4MZUA 1WW6A 3R4UA 4FTBA 4AFDA 5EXOA 1REDA 5FLHA 3T1MA 2NYYA 3R4DB 5K8SA 3W58A 1RJ7A 2HEYF 1AR92 1J59A 3L2HA 2MEV1 2ERFA 3V64A 4FPKA 3WDTA 3J8F2 1SMVA 4WZCA 1MEC3 4H3WA 4INDA 4C0BA 1RITA 2QNKA 4S2GA 2CGPA 2DF7A 5GZGA 5ACA3 4FPOB 2NM1A 2PYTA 3WT3A 1S0IA 2ET7A 2XKPA 2R0HA 4HKWA 4LEJA 1AL21 3ZMNA 1OD5A 1D2SA 5C9AA 1D4M3 2VMHA 2P37A 5KC6A 1QDCA 2X8KA 3M7AA 4MXVA 4R9BA 1HXS3 1PGW1 1MEC2 1QXPA 1TME3 3NV1A 2YYOA 3O7OA 3WG1A 3ZIWA 1MS9A 1AYN1 1PK6A 2XJRA 4SBVA 2R041 2VULA 3RG0A 1XNCA 1NLSA 4MSVA 4AEMA 3D5OA 3ZPYA 4CDUB 3UK9A 1M4WA 1Q8OA 1QDOA 3V0AA 3PVEA 1EYBA 5FLIA 4D3WA 4EN7B 5J98B 4OULA 4QD2A 1A6CA 4C91A 3L9JT 4BIOA 2DCTA 3FWEA 4Y1VA 1A78A 4DXZA 1D4VB 5L73A 5CG8A 4RS5B 4ITCA 1LGCA 2BBVA 1GFF2 1DQ4A 1RUD3 5JLVA 3HD8B 3AMPA 4XF3A 1VJ2A 2XBO1 2JEMA 5JI7A 3USSA 1C1FA 2XG3A 1MS4A 1MZ6A 3E6CC 2XWBB 1RUE3 4D69A 5ABJA 4KWLA 1WLDA 5E8AA 5E89A 3B9IA 4XTPA 3I4IA 4CEYC 1RUD2 4A2UA 1SLAA 3NSTA 2R16A 3EBRA 3WW4A 2XWJB 3VBUC 2ZX4A 1U5ZA 3ES4A 1LJ7A 4MLOA 4R8HA 1O4ZA 1JW6A 2WFF1 2EXJA 1JYCA 2V73A 4K3UA 1XU1A 4WM7C 1WMFA 2VGDA 4LBMA 2PLV1 4N43A 1DGLA 2QJVA 2ZACA 1RHI1 2PHFA 2QDNA 5JOZA 1PO12 2VW2A 2KXLA 1OLRA 1CQ9A 1WCKA 3WINE 4AEDC 1RMU2 4FOQA 2ZCWA 5BNOA 1OSGA 5CFCA 5AFEA 1GZCA 1FATA 1PGSA 2O8OA 3KS7A 4YW1A 5FREA 1JHNA 3RYKA 1LOFA 2HEVF 1FAYA 4JGYC 2WT2A 5SV5A 4GB31 4P9LA 1VB2A 1F2NA 1R082 4U2AA 1BVVA 2PA7A 3FBYA 2BNNA 2DVGA 3AJYA 5FPZA 2ENRA 2RJKA 4QU2A 4FOYA 2D3SA 4YVWC 2VUAA 4WZFA 2DU1A 4AFMA 4QGNA 5H9SA 3MI8A 3KD4A 4W6XA 3S7IA 3U11A 1U5YA 1Q8VA 4DRVA 2DFBA 1E57A 3D4KA 3AMMA 2ZX3A 1TMF3 3I8TA 2SLIA 1VBD1 1CAVA 2VG9A 4L11A 3VBHC 4J6GA 2TEPA 4GKYA 4JTNA 1AYM3 1MS0A 4Z07A 4Q0SA 5A32B 4CEYB 3AP9A 4LA2A 1V6MA 3V0BB 3VBOA 1SQ4A 2I2SA 2A5ZA 3VBUB 3PJYA 2ZZJA 2XJPA 1NOVA 4FPHA 5FO9B 3ZXKA 1KXGA 4XBNA 4WVVA 2P2KA 2XLAA 1RVF1 3ZXFA 1KDMA 1A3KA 1AYM2 2PHWA 5GALA 2JX9A 1R091 1QH7A 4HK9A 4FAHA 3FLTA 5CFDA 5GLZA 4IEVA 3M3CA 2GAUA 1ZRFA 4HFSA 2HWD3 1KS4A 5LEJA 4JGYB 3JBG1 1QWRA 1AJKA 1PO21 3UJOA 5T50A 5KXCA 1JH5A 2BFUS 1H8TC 1XNDA 4YVWB 2A6YA 2NP0A 4N53A 2OA2A 1O7FA 4EJRA 4BZ4A 2HWD2 4XQWA 3GHNA 1H1IA 3ACLA 3OYWA 1QMJA 1NY71 4Y20A 3WDVA 1YLLA 3WQ1A 1C57A 1RUG3 4AQ2A 1ND3B 3G6JB 4W65A 3JZVA 1H1AA 1UIJA 1HQWA 1QJU2 4FOVA 1NA1C 3VBHB 2VVFA 1COV3 1DHKB 2OUJA 1UU5A 2RM21 2WNVA 3MIHA 4TWTA 5JMCA 4FPYA 1H2NA 4LHKA 3AK0A 4COYA 1N3OA 4YW2A 1AUYA 2TUNA 3BPZA 3P3NA 1UN1A 1BEV1 4JVAA 4GXLA 3MDPA 3MF6A 3TOJA 3KT1A 2XL7A 4QPGA 2XLGA 1COV2 1VBB2 2B7YA 1JUIA 4AEJA 2E6VA 2UURA 3M3OA 1UX6A 3RMYA 2A75A 4B4PA 4BQ1A 4CZSA 4BE3A 4HL0A 1U12A 2GN3A 5HCBA 3ZXEA 5K9YA 2R30A 1CESA 2DCJA 2YZ4A 4QPIC 4UXAA 3JD73 4LT5A 2A6WA 1HQNA 4KL1A 1Z7S3 1G9BA 2DTWA 1QOTA 1UL9A 3KZ4C 1W39A 2UY8A 1I3HA 1AX0A 4GMP1 1H8TB 1OMIA 5BV6A 4JAAA 3CJIC 3JD72 3M3EA 1S0BA 1Z7S2 3SCHA 4AK3A 2O1QA 4ES9A 3RYPA 3K48A 4QGMA 5JZGC 1FOD3 4FT8A 3ALQA 4FPGA 3I2DA 1NA1B 2HKXA 4HZFA 4AG4A 4ZKTB 2VVEA 1C8M3 3IWZA 5J09A 1UZZA 1FPN2 5GZDA 4DB5A 1RUF1 2RS31 3H7JA 3C2UA 3M2MA 1K5MC 1GV9A 1KD7A 1WD4A 1W6OB 4P9JA 3AKQA 4AWDA 4S2DA 4CP1A 3NO8A 3BOWA 3X29B 3RRDA 1G9CA 4EN0A 3UL2A 1POV3 1SBEA 5E16A 4Q4Y1 3SCGA 1C8M2 5D8AC 1F5JA 2JG9A 2CWSA 1OFNA 1RUH1 3FMGA 1GZ9A 3WDWA 3H3ZA 4AHXA 1G9DA 4ASLA 2G9FA 1GZWB 4YG6A 3GBWA 2PTMA 4LO7A 5F6KA 4QPIB 5IUQA 1V70A 3VBSB 3AP4A 2G4IA 5E88A 4FPCA 2C0ZA 3PMSA 1PVC3 4B4RA 5CB7A 4Q8LA 4BLIA 1CPNA 4Q0VA 3H1MA 3IM0A 1QNYA 2RS11 4I02A 2Y0OA 3CJIB 1QJX1 2YHJA 2ZMNA 1ZNPA 1J3RA 3A4UA 1DDLA 2BEOA 4MGZE 4AFAA 3MIFA 4OFGA 5BNPC 4M3CE 1UMZA 1VBC3 3KT4A 2A73B 1PVC2 5H9RA 3AB0A 5JZGB 4GIQA 4XZPA 2KM2A 3NKTA 1Q43A 4Q4W1 1GSLA 1EPZA 2VECA 5SV8A 1H2LA 4IV1C 1VBA1 5K0UC 3GZAA 3GNEA 4PF5A 1K5MB 2RR11 2QZ3A 3NAPC 3ME2A 4YZ2A 1LHWA 2ZX0A 1AXYA 5DUUA 2OUHA 3IMNA 2HWC3 4GMP0 1BMV2 1YYNA 3BOPA 4QT6A 5BY5A 1X50A 1WMEA 3WP5A 4I30A 2Z5WA 5D8AB 1ZBA3 3AXDA 1SCRA 4RA0A 4PDWA 3MPBA 3E97A 2GMEA 1QOOA 3ST7A 3N7MA 4LLOA 1IKQA 5FCCA 4BOWA 5J7MA 4HN0A 4AQTA 2YPJA 2W68A 5BNNC 2VUJA 4Q1RA 3I59B 3LOBA 2NZ9A 2HEWF 4IEYA 4URTA 2H0BA 4YM0A 2ZGKA 1ZBE1 1S0EA 2YC0A 1CN1A 3N36A 1H1MA 1AR83 4WVMB 4P14A 1ASJ3 1DQ5A 2WFPA 1YIPA 3AZXA 3FX3A 4OI0A 5L19A 1EV11 1EP0A 2YMZA 4BMBA 4HBNA 5J3UA 2ZZQA 3WZ1A 1FI2A 4X8NA 4LBLA 4TLFA 4QX5A 1NCRA 1VRH1 4IV1B 1BCXA 2WA3A 5K0UB 1CGPA 1ASJ2 1ALYA 4XYXA 3AZVA 3WQ7A 5A32A 1X82A 1OLQA 2PHRA 3O0WA 4AFCA 1WW7A 5C8CC 4WM8C 1FYUA 1Q8PA 1YFXA 5FDBA 1C5IA 3LWCA 4B4QA 4R9AA 1QU0A 4IEZA 4FAGA 1PGL1 1B35B 5EYXA 3OY8B 3MIDA 3H9AA 2E7AA 5KWRA 5DDJ3 3OGJA 1UPIA 1ZZ9A 3IDCB 3R6SA 1VBE1 1DGWX 4LBQB 1AR72 1W6MA 2QDRA 2ZGRA 4WBBA 1YRZA 5C4WC 1IS5A 1QJZA 1ZZ7A 4MYEA 1BVP1 5BNNB 5JPNB 4AHYA 4CEWC 5DDJ2 1GNHA 5C8WA 2K9ZA 4N7UA 1XE8A 4PCRA 2UU8A 3AXEA 1EPWA 1YHFA 4IQPA 4Q29A 3FBMA 3WHUA 4LHLA 2WZR3 3BTAA 1ND2C 2LUWA 5CVRA 4HKOA 1S0DA 4D7YA 2Q8OA 4IEXA 2B39A 3N4MA 4ATFA 2ZGPA 2EAAA 3POWA 3HR9A 1H4HA 2HJIA 1EAH3 1WW4A 1ND3A 2D5FA 1NCQC 3A0NA 4ZXKA 2CY6A 2WZR2 4LO5B 2R1DA 2A71A 2DVAA 4YRDA 3MLJA 1RJ8A 1V6KA 1CAUA 1N3PA 3ZXLA 5C8CB 1PIV3 2RS53 4WM8B 4LE3A 1EAH2 1GNZA 5I91A 4YW5A 1UU4A 2O8QA 4Q4V3 4RR3C 4UBHA 4FSJA 2DTYA 3USUA 2GU9A 4E27A 1ZZBA 1TME1 2E53A 3ROUA 1J3PA 3POYA 1AXKA 4UW3A 4Q8KA 2JG8A 4QQPA 1PIV2 3JB8A 2RS52 3VL8A 2X29A 1VLNA 3H0OA 5C4WB 1YFYA 2TBVA 4Q4V2 3ZFFA 2X5IC 5CNAA 4GH4A 4HN1A 3QACA 1OFSA 4CDWC 4HMZA 3GYDA 2V09A 4CEWB 1AF9A 2RMU2 5BXXA 3AMQA 1V9U1 2ZMLA 3TN93 4LTAA 4F7ZA 3KB5A 4CP0A 5HBAA 4I2OA 1ND2B 4GWMA 4AF9A 3AYAA 3TBDA 4RQPA 5LRRA 2BUKA 1QQP2 1Z0HA 1RUE1 4OI4A 4PIYA 3OD0A 2E51A 1XYOA 4AE2A 4ZU5A 1H9WA 4M01A 3HAGA 2R072 1LHVA 3TN92 1Z78A 1SACA 1CAWA 4KGGA 4NO4A 3DV8A 1HKDA 2GMMA