1XU1A

The crystal structure of april bound to taci
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
137
structure length
137
Chain Sequence
KHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine, hormone/growth factor receptor
molecule keywords Tumor necrosis factor ligand superfamily member 13
publication title Structures of APRIL-receptor complexes: Like BCMA, TACI employs only a single cysteine-rich domain for high-affinity ligand binding
pubmed doi rcsb
source organism Mus musculus
total genus 29
structure length 137
sequence length 137
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2004-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1xu1A00
5KC6A 4QPYA 4KGGA 2JG9B 1TNRA 2Q1MA 1ALYA 2HEYF 3AB0A 2JG9A 3URFA 4QQLA 4QQPA 1RJ8A 3QBQA 3ME2A 1O91A 4OUMA 1OQDA 2Z5WA 3FC0A 4KGQA 1D0GA 1OQEA 2JG8C 5CIRA 4MXWA 4EN0A 1I9RA 2E7AA 5BNQA 4E4SA 4QQOA 5L19A 1JTZX 4OULA 3TYJA 1TNFA 3K51A 4HT1T 5HBAA 4TWTA 2WNUC 1DU3D 1C3HA 2RJKA 2WNVC 3WD5A 2AZ5A 1PK6C 4G3YC 1KD7A 4MXWB 2R32A 4N90A 4J6GA 2JG8B 4RSUA 1IQAA 3MI8A 2X29A 3L9JT 1JH5A 1WCKA 2HEVF 2JG8A 4D7YA 4TSVA 5KC5A 1XU2A 2RE9A 3TWIA 4GIQA 1U5YA 2R30A 3B9IA 3V56A 4G4FA 1A8MA 2WNUB 1XU1A 2WNVB 1DG6A 3QD6A 2Q8OA 1RJ7A 4QQ2A 2ZPXA 5KWRA 1S55A 1PK6B 4MSVA 2WNUA 3B94A 4DOUA 2WNVA 3K48A 1U5XA 4MXVA 2KA3A 4KG8A 1PK6A 1U5ZA 3B93A 2RJLA 1OSGA 2JG9C 2R6QA 2OIIA 1C28A 4OUSA 1GR3A 2TUNA 4F3JA 2QE3A 4QQHA 1KXGA 2QDNA 5L36A 2TNFA 4DB5A 3LKJA 4NN0A 2HEWF 1D4VB 4E4DX 3ALQA 3IT8A 5TSWA 2ZJCA 1D2QA 2O0OA
chains in the Genus database with same CATH superfamily
5JOYA 3I7DA 1ZA7A 4K8FA 5CKMA 1G9CA 3H1YA 3IBMA 4RFT0 4N9HA 2OA2A 1YQ8A 4HPKB 3C2UA 4IDZA 1BCXA 5IT6A 2VCCA 4CEYA 1DLCA 2MNGA 1ZA4A 2WZR3 3QBQA 2YZ4A 4AI2A 4BXSV 2WZR1 3KCYA 2WWUA 1W0OA 2W52A 4I09A 2SBAA 1OQEA 2LS6A 4P9JA 3WHUA 5LBBA 2NM1A 1UPIA 5JIUA 1K3IA 3AXDA 3OUHA 2JICA 5A7WA 2J1TA 4Z8BA 4XUQA 2WQZC 3MIHA 5IVYA 4CDQB 2Q8CA 3BKZA 1PO13 2ETEA 3WCRA 3TAYA 1CAUB 4FQZA 4LO5B 2R063 2WZR2 4XTMA 1L3JA 1AR63 1PO11 1OOPA 2VMDA 3WNKA 1O3TA 3JB4C 2ORXA 2R061 3VL8A 3BUCA 1YFWA 4CCEA 4AVTA 1REFA 4IV3A 4QDRA 5C3RA 1HDKA 5DZGA 3WINE 3BTXA 1IQDC 2HWB3 5ANNA 5FPBA 4BK5A 2A5ZA 1EUUA 2QDRA 2GZWA 4N90A 2HWB1 5A3OA 5A1FA 1GP5A 5A1AA 4XOGA 5BNPA 1Q3EA 1OPMA 2VQTA 1W03A 3OUIA 1PO12 5ABJA 3LCPA 4XHXA 4LORA 4NIIA 4Z2AA 4BCUA 1QEXA 4UXAA 2R062 3RI9A 5F9TA 3W20A 4FOYA 3UKTA 4NRPA 4XDOA 1AR62 1CPMA 1WW5A 1OA3A 1ASJ1 2B9VA 3T4HB 1AYM3 1AX2A 2Y6HA 2HWB2 1SZBA 4N43C 5F39A 1DIWA 1JMUB 4XF3A 4AGGA 4CCOA 4FAGA 4NROA 1AYM1 2GC3A 4U2AA 1BMV1 2MEV3 3CO2A 3ZFEC 3HNYM 1W6MA 5DG1A 1MEC3 1ZZ8A 3E5XA 4XAEA 2EIDA 1L7RA 4WVMB 4NAMA 4P9WA 2W08A 3WR0A 1MEC1 4Y5TA 3KGLA 4YNIA 1ZBE3 4XIKA 3T2QA 1O7FA 1PMIA 1H8TC 1JBCA 3D82A 3DL3A 1XSQA 2VUCA 5JDBA 1ZBE1 1AYM2 3WW1A 4FQ4A 1BMV2 2ARAA 4YZ1A 3POSA 2VH9A 2ZGSA 2VG9A 5ANQA 4FP2A 4DEVA 1YRZA 2MEV2 4CP2A 4LE3A 5D8AA 5H9RA 4P9XA 4N43B 2HKXA 3WDXA 2B39A 4S2FA 1MEC2 4ASLA 4BWOA 2FDFA 4LT5A 1G86A 4XFBA 1OD3A 1S0GA 2PAMA 4HK9A 5LK5A 5JI7A 2DU0A 1DZTA 3DUIA 4MOAA 1ZBE2 4OZXA 4A3XA 4YSFA 3E6BA 4K8RB 1GZWB 4M00A 3WQ0A 2TEPA 1W99A 2XBO3 4NO4A 3FBYA 3ACGA 4GQ7A 1ENXA 1H8TB 3GXUA 2XBO1 2OW4A 1V6OA 3K3NA 1HKDA 3BN6A 5EZWA 2ZEYA 1OFNA 3U07A 5JOZA 1NLQA 3IKWA 5FYYA 2JD4A 2IXJA 1DQ4A 2VULA 4ORFA 4QXBA 5FPLA 3EBRA 4AI3A 1CPNA 3MV01 2DCJA 3H8OA 5FMCA 2XBO2 3POWA 5IVBA 1WMDA 5CISA 5D2AA 2XB6C 4A42A 1V6IA 5FY8A 4K21A 5KBFA 2RS33 3M4FA 4NAOA 2DTWA 4R8HA 3WOGA 3H8XA 4XUPA 1SLIA 4GZ9A 2RS31 1SLTA 3CNAA 3R4SA 4NPRA 5CFDC 3FFZA 3ZFFC 2KXLA 3NKTA 5C5TA 4E4HA 3FE5A 4KG0A 3PLQA 4RL7A 3WQ1A 1JHNA 2JD9A 1KQRA 3KHBA 1ULCA 4PQ9A 3VB9A 3ZKUA 4CU8A 2RS32 2D6KA 4IEXA 4LQRA 1F5JA 4NHKA 1CX1A 5CADA 5HXMA 3F2ZA 3RFRA 4Q8KA 4OQ8A 3MZHA 1S0EA 1QH7A 4BMBA 1NXD1 2R32A 3W21A 1LHNA 1UZYA 3J7LA 4OHVA 5IW0A 2EIEA 2H6BA 5A7NA 4DRRA 4UW3A 3RNSA 4CYDA 3N3HA 5CB7A 4LO4B 5CFDB 1AX1A 4DEQA 5JPMB 2YB7A 4FFFA 3ZFFB 4KMQA 3FMGA 4AFDA 2WABA 1HV0A 2P3KA 4QB6A 5IFTA 3OYWA 1QXPA 2WFPA 1R083 3VD7A 1RHI1 2R0HA 2VNRA 4O9EA 4UFLA 2NMOA 2R30A 3KF5A 5C3QA 1CAWA 1R081 2ATFA 1QKQA 3VDAA 5BNNC 5AFBA 4IEYA 5LEJA 3VBUC 1UY1A 1K5JA 1OVSA 1TEIA 3CLPA 3I3MA 3UNPA 5DAWA 1PZ7A 2WIIB 1WCQA 1IS4A 3AL6A 1MR5A 4HMZA 4NHLA 1MS0A 4Z2WA 3LGRA 4IGOA 2A3YA 1S2BA 2QVSB 3H1MA 4YGCA 4AQSA 3R4DB 1R082 2CSGA 2D3SA 2D97A 2QQKA 4MLOA 5FJKA 3BU0A 5LRRA 1JI6A 5H9SA 1Z7S2 1SCSA 3CIHA 4BPZA 1ND3C 3A4UA 2UWCA 3WG2A 1LOBA 2EXHA 3AMNA 5EP9A 1NA1A 4L0PA 3WCSA 2CL2A 5A32B 2F6BA 4BK4A 5BV6A 1ND2C 1PZ8A 2HBTA 3I2GA 1LOAA 2PQQA 2R043 2VPVA 2YROA 5BNNB 2PHRA 5C7GA 3VBUB 4W50A 4MVTA 3K4DA 1VAKA 3ES4A 1ZRCA 2R041 2P3JA 2CAUA 4NR1A 1JYTA 4K20A 1RXGA 5L36A 1DGLA 4HVRA 1DHKB 3RWKX 3JCIA 1CX4A 4XBNA 3ETQA 2VU9A 4C0HA 1YQ2A 4R9CA 3IT8A 5L7OA 2DFBA 1MACA 4AR2A 4UF0A 5LASA 1YQ6A 2R1BA 1TVGA 4WM8C 4DINB 3PU3A 3OCPA 2C4XA 5BPXA 5FQ0A 2D5HA 3CJIA 4GA9A 1ULPA 2YPJA 1UMHA 1TNRA 3RJ2X 4BQ3A 1ZRFA 3HBKA 4UBHA 4W8JA 4XUOA 1ND2B 1W9FA 2JIJA 1FYUA 1UZ0A 4CCKA 4HXCA 1NQJA 2ZOEB 4BQXA 3OSDA 2XDVA 1OXCA 1RIRA 4CUBA 3OD4A 5C33A 3KT1A 3DV8A 3AP6A 4LITA 4CCCA 2WDBA 4QPGC 4X6QB 3U0ZA 4LBJA 3AXEA 1QHDA 1JODA 3FC0A 5FY0A 2GP5A 2BNNA 2VBDA 4BHPA 1DQ0A 1LGBA 1CZSA 1LECA 3FLPA 1JYVA 4PT6A 5FK8A 4NIAA 5BNOC 2AEZA 1WA6X 3HT1A 2IXLA 5DG2A 3AP7A 1LAJA 1O4YA 4FVVA 3ZIXA 5ISLA 1MZ6A 4IE7A 5JMCA 4YLZA 4ARYA 3N9PA 2ZGPA 1OLQA 5KXCA 3VBRA 5JSOA 2GC2A 5T50A 1PGSA 3FFQA 2H0VA 3RSJA 1J3RA 3BIEA 4GD4A 3WP4A 2VW2A 4R9BA 1UY3A 2CU5A 5H9QA 3T0BA 4FFHA 2OQ6A 4MYEA 4XUTA 4C8DA 4OCTA 4QPGB 1W2NA 1LR5A 1MVQA 5EFUA 4OQ9A 5I0RA 2Y38A 4QU2A 5A3TA 3C7FA 2FMDA 4JGYA 2GNBA 4AK3A 2WR9A 3G7DA 5T54A 3DKWA 4QM8A 4WZCA 5BNOB 3CF6E 5JSRA 1I1EA 1WCKA 2WS93 2ZEZA 3C3VA 3QOPA 4D0QA 4LULA 3DEMA 1IG3A 1W6NA 4QX1A 2WS91 1HQNA 4PJYA 2G19A 3LEKA 4QX5A 4WVVA 1ENRA 3D5OA 2VZSA 2WNEA 4UW5A 5FP4A 3WZ1A 4GWMA 3WNMA 1DF0A 1KDKA 4QXHA 4A41A 4KQ7A 4YWAA 1OKOA 2XUEA 1OMIA 1V6NA 3M3CA 3ZSEA 4MSVA 4LKSA 2RM23 4EWAA 3TEZA 5LRSA 4K3UA 4DO0A 3AP4A 3RWNA 5IVFA 2RM21 2WS92 4MADA 5KXDA 5JMOA 1QOOA 4KG8A 1A78A 1LGNA 1UOGA 3H42B 1ZRRA 4RR3C 4OVEA 5D1IA 1ODMA 2C24A 2W2IA 2DUOA 4U36A 3W9AA 3KCCA 1LHVA 1O4ZA 2K46A 4I0WB 4AWDA 1VR3A 5AVPA 2RM22 5JZGA 1M06G 4QX8A 2UU8A 3VKLA 1Y9MA 1IS6A 5E8AA 1SBFA 1SDWA 4XMIA 4W65A 4FOVA 4HONA 5HCHA 3O1TA 3A7QA 4LK6A 4Y1VA 1GWMA 1W05A 1YQCA 5TSWA 1LNSA 5DUUA 4RR3B 3LPFA 2IXCA 4PDWA 3WNLA 4CDUC 2RHPA 1LKNA 2PLV2 3LEIA 1F2NA 2E33A 3C7OA 3NKGA 1XNAA 5FZMA 4KGGA 4XAAA 2YBSA 3AP5A 3BYWA 4SBVA 3VBHC 2V72A 4HG6B 3GNEA 3VD4A 3RDIA 2VUJA 4OFGA 4QGNA 1E57A 4MGSA 1MQTC 1GNHA 1IG0A 2GP3A 1WLTA 4QQLA 2P1BA 1UKRA 3JXSA 5APAA 4YW2A 3ZSMA 4DUWA 4IESA 5KXBA 2HH9A 4M3CE 4AXOA 1OF4A 4JX0A 3OGVA 2EXJA 5HV4A 3I4IA 2V4VA 1XE0A 2XJUA 5EIYB 2VZ1A 4HKWA 2ZX3A 4D3WA 1Z78A 4CDUB 4AFAA 3FWEA 3QH6A 3RZJA 4E4SA 2VCAA 5GZCA 4MUVA 1VB2A 4B7KA 3VBHB 1KEXA 4FOQA 4Y5Z0 2D3RA 1WCDJ 2NPIA 1GICA 2CV6A 1O59A 3QLQA 2JENA 3MGUA 3OY8B 1QDCA 4TWTA 3SKVA 1MQTB 3VBFA 1GUIA 1C3HA 2VMEA 3THDA 2LUWA 1DYPA 4JVAA 1HQWA 1PX3A 4IE6A 1MZEA 3MIFA 4Y4YA 4OI0A 4A7YA 2J1SA 4MXWB 3I97A 1H0BA 4HZFA 4XCBA 1EP0A 2ZMKA 2FDHA 1IPKA 2VOXA 1EY2A 3WW3A 2X29A 1VLNA 4XE9A 2XHKA 5C4WC 4FT8A 1UY2A 2UYAA 2FZ1A 1C1LA 4QKDA 2A71A 5A33A 4EZHA 4ZHNA 3I2OA 5IK5A 3RRDA 1GU3A 2VZ3A 5EWSA 1B35A 1CAVB 5FZCA 1W9TA 2JDMA 3N9LA 3MW4A 5G04L 4AQ2A 4EWEA 3WDWA 4GALA 4Q0VA 3GBWA 1RXFA 1YI9A 2W87A 3GYDA 2OZ6A 4XYXA 5FYHA 5K0UC 1RJ7A 1ENQA 1WZXA 5A7OA 4QPIA 4COUA 1BBT3 4K1ZA 1IS5A 2ENRA 1RB8G 2CHHA 1BBT1 1ZZ9A 2ZHNA 1VRH3 3K4AA 2FDGA 4QHBA 4UWDA 4CXWA 1VRH1 2E31A 3OG2A 3H7YA 1XNDA 3IMNA 1YYNA 3W59A 4QB1A 2B4KA 3DPRA 2VJXA 3V0AB 5C8CB 2X5IC 3THCA 1BBT2 3BALA 1PO23 1GR3A 2AR6A 3AJZA 5K0UB 3LZZA 3VBOC 4KWLA 1D2SA 4XACA 3SCGA 4DY5A 1UN1A 4YZ2A 1PO21 2W1QA 3P1IA 2BW8A 5CKNA 3QH7A 2JB4A 3ILRA 4QQHA 4YW7A 4DXSA 3KVAA 4NN0A 5T52A 4FPGA 4PLNA 1N1TA 3J7NA 4XEZA 5DMYA 1XNBA 1RUG3 2R073 1JZ2A 1H1AA 1RUG1 1LGCA 2R071 5LW9A 2W68A 4ZU5A 4AL9A 5FZ8A 2ZJCA 3O14A 1SQ4A 1NZIA 3PVOA 2VMFA 1PO22 3AJYA 5FZ1A 3KMHA 4JGZC 3T2PA 4D6RA 4XJZA 5EPAA 5F2SA 1F15A 4B7EA 1W3XA 2X5IB 2E7TA 1DZRA 1YCIA 1IKPA 3ZIWA 3VBOB 3PUSA 2DTYA 2G4IA 4OHWA 5CVRA 4D69A 1RUG2 2R072 4A6OA 2ZAAA 4LUMA 4PI0A 4Q2FA 4ZS3A 3UGFA 4AE2A 5IVCA 3ITQA 4NPLA 2CWSA 1FMD1 3HAGA 3D8CA 2XLFA 2GNMA 5D21A 4HBNA 4B1MA 3T30A 5FO9B 4HETA 4LKDA 2G9FA 4Q27A 4C91A 1Q8SA 3S5QA 1WLWA 4UOJA 1POQA 4JGZB 4Z07A 1ACCA 5F5CA 1C5IA 5JXJA 2BRTA 1QJZA 3OGGA 1I6XA 3W58A 3BIWE 5FZEA 4XURA 5IHRA 1T2XA 1IPSA 2FQPA 4N53A 1O5UA 1VAMA 4YVWA 2J1VA 4D8MA 4DY3A 5CG8A 2CGPA 4JQTA 4F83A 3UKVA 3USUB 3GHMA 3LAGA 4TLGA 1AX0A 4Y20B 5CG9A 3OEAA 5CZKA 4Q0QA 3WP3A 1E5IA 2OX0A 5JOWA 2YV8A 3VBSC 5JLVA 1PIV3 3T0DA 2FD8A 1YI7A 5LK7B 2RDNA 4YZ3A 4QX7A 2XVGA 4GJYA 4ZXEA 1PIV1 2EAKA 1MS1A 1C8NA 3GM8A 4K40A 2JIGA 3TOJA 1XNTA 1N1YA 4AI9A 3H50A 1RL3A 3H0OA 5E89A 4OHZA 4QKFA 3VDDB 1SBDA 1WLDA 3IB3A 1SBEA 2D93A 1OC1A 3TEWA 3TNPB 3NMBA 1XU1A 4HL0A 3PJQA 2ZGMA 1CD3G 1WMEA 1DG6A 4K1YA 4XJ9A 2YFUA 4Q0UA 3ON7A 4HVOA 4Y26A 3UYJA 5I93A 5JUVA 1LOFA 1PIV2 4OMDA 4PI2A 2YMZA 3NV4A 4LBQD 4UFMA 5HXVA 1JZ6A 3K48A 1RUE3 4MXVA 2XG3A 4GH4A 4QAWA 2EXIA 2H0BA 2YG0A 1RUE1 4PLOA 4A6SA 3LSEA 1DDLA 2DWRA 3V65A 3W5MA 4XVHA 2ZGOA 1N1SA 3DYPA 4RFRB 3ZXAC 5I8TA 5HV0A 3LPGA 3MPPG 1V00A 5AVAA 3H8RA 3M3QA 4CEYC 1AHSA 1KGYA 4CCNA 1QJX3 2Y26A 3U37A 3P3PA 2WO2A 1LOCA 3DN7A 4KI5M 4CZSA 2TUNA 1N3QA 1ULGA 1QJX1 1SFPA 2VZOA 2ZGKA 1RUE2 1UMZA 1UU5A 2RV9A 2BP6A 3HNMA 3LEGA 5CKQA 3SNMA 2IXKA 1JU3A 2PFWA 2R49A 1KXGA 3I2IA 4KU8A 5E6HA 5FZBA 3MHZA 4DFSA 1HB3A 2IVJA 2P6HA 5J3UA 4BA6A 1G9AA 2NLRA 4LBQA 2JDZA 3CJXA 4OUEA 2H6CA 3AZZA 2QQVA 2WT1A 3TNQA 2WSVA 1QJX2 1V9U3 3GZAA 4XF9A 5F8PA 3ZN6A 1FPN3 2BVBA 2HWF3 1OOPC 4QPYA 2WZ8A 3J4UH 1YLLA 1O3RA 1F8VA 1V9U1 2Q1MA 3AKPA 1FPN1 2XUMA 3PHMA 1LHWA 2HWF1 1CIYA 4CSWA 4IV3C 4CDWB 5FJHA 3A0NA 1O3QA 3I54A 2D44A 5FPVA 1PVC3 3PUHA 4MHUA 3RPQA 3ZYGA 3WNOA 1LEDA 1REDA 3ZKYA 5JSPA 3BI3A 1BJQA 3N9OA 5FYSA 5BNPC 2VNGA 4FXGB 1PVC1 4NE9A 2OKXA 2NMNA 3THPA 3UESA 3RZLA 4FCAA 2WA4A 4AI1A 1PGW1 2VOTA 2DBIA 4N8MA 5A7WB 5ABJC 1V9U2 2BZDA 3LDRA 2WYSA 1NCRA 1NUKA 2HWF2 3FJSA 3A23A 2Z4FA 3OUJA 1JOPA 1UOJA 2Q4SA 3GZTB 3AKSA 5DDJ3 2J1EA 2JECA 1SDDB 5FBZA 3VZJA 4AEDA 1JS9A 4YZ5A 2VVDA 1OOPB 4W6YA 1PVC2 3MW2A 5DDJ1 4IW3A 1OF3A 4LOTA 2XL7A 3HN3A 1PGW2 3N7JA 3NNLA 4IV3B 5HBAA 3PL0A 5J96B 4AVCA 5A6YA 5C5UA 2ZKLA 1CAXA 4H7LA 3RGBA 2Q0AA 1XNCA 2ERFA 5DUXA 3BVCA 5LB6A 5ABJB 1GNYA 5DDJ2 3WW2A 2QZ2A 1IGOA 3AMMA 3TB0A 2PHFA 3ZXDA 2AC1A 2YY1A 4JV4A 4D7TA 1BZWA 1W6PB 1D4M3 1RUC3 4IQPA 5EXOA 1LRHA 4XIOA 3OGRA 1SG3A 3SKJE 1N3OA 5D8AC 2B8MA 4JRAA 1HIXA 4QXCA 3RVHA 1VRBA 1RUC1 4TSVA 2QQIA 4J1WA 4L11A 4Y33A 3NJYA 2RG4A 4GIQA 2QQLA 2DV9A 1W6MB 4YG3A 5B4XA 4YYOA 4LBOA 5G05L 3ATGA 3LD8A 2UWAA 3WF4A 4BISA 1JUIA 5FIXA 4Y1XA 5IK7A 1AR61 3AVRA 3FUOA 3HNBM 3VL9A 2QTWB 3FLRA 1D4M2 1GQHA 1RUC2 2WNVA 4Y4RA 5FXWA 1AXKA 5FZOB 4AI8A 2EXKA 2G9ZA 4CA9A 5DAXA 3R05A 2DCKA 2BGPA 1TME3 5J36A 1W3VA 2RJLA 4AOCA 2N7GA 1TME1 4MGKE 5DUVA 4S2HA 5FOBB 3INAA 2EIGA 5FYMA 1GYKA 1O8PA 1ZM1A 1RMU3 5HCBA 1S2EA 5LY2A 1HN1A 5DZFA 4B29A 4LTAA 1JYCA 1RMU1 3EHKA 3TRSB 3WDUA 3JQWA 3WUDA 3CZUA 1DP0A 1HQLA 3H3UA 3ZSLA 2FMYA 1VMJA 1SLLA 4QM9A 1TME2 2MEV1 5B4NA 2HEWF 5FY4A 4K9SA 2AGSA 2VGDA 3NRUA 4E4DX 3WEZA 3O1PA 5FZLA 4FTSA 4PQQA 4JDMA 3PIJA 4BU2A 1DZQA 3DF0A 4CEWA 3ZYHA 2VTXJ 2DCYA 3BOWA 3KS7A 4ONUA 4ASMB 4XJ8A 2K9ZA 2D6MA 2PYTA 5KC6A 3M3EA 5FFOC 1V70A 3PMEA 4JKLA 5FZDA 1RMU2 2EVXA 2WN3A 4WVZA 3LA3A 1QJY3 2RVAA 4CDQA 1ZZ7A 5EJ3A 2CY6A 4LA2A 5C3PA 3POYA 3RMXA 2I45A 4QMAA 1CAUA 3T2TA 2YFZA 4EN8B 4XBQA 1HB1A 2LALA 3ZFEB 5IATA 1QH6A 2PHDA 3ME2A 4LBNA 4RN5A 1T6GC 1FV2A 2BYVE 4LKFA 2CDPA 1C1FA 3M1HA 1KFUL 2XJRA 4P9LA 4EN7B 2ZGRA 5CIRA 2BPA2 3DCQA 3D0SA 1GZ9A 1PM4A 1XNKA 4Q8LA 2V73A 1JOBA 4FO9A 2ZMLA 4CCLA 1W28A 1QJY2 2BWCA 3ABZA 5F3EA 4GULA 5L19A 3WHTA 1JZ3A 3ZR6A 1NG0A 4FPEA 4CCDA 1VP6A 2VCBA 3CL1A 5FK7A 3BPZA 2J7MA 2KR2A 4P5YA 3VHPA 1ZREA 4BMEA 3MDPA 2ZX1A 4O7XA 2QJVA 3ZSJA 4XCAA 3USSA 1PNGA 1R1A3 2VY0A 2XLGA 3PUAA 3RMYA 4XFAA 3WD5A 4L97A 1R1A1 1IPJA 2GSYA 1LOGA 1SMVA 2AZ5A 1NOVA 5J1XA 4NHMA 5C9AA 4KBZA 4W6XA 1KS4A 3OYWB 3KF3A 2F17A 1YNAA 1NA1C 3AK0A 1LJ7A 1DQ5A 3MUY1 4E8CA 1JH5A 1G9FA 2A73B 4Q4W3 1J3PA 2A6VA 1CAWB 4FFIA 5FZIA 4BQYA 2ZMNA 4C1WA 2JG8A 4P02B 4X8PA 1Y4WA 1R1A2 2PAKA 1WKYA 2ZZQA 4Q4W1 1C5HA 3S6PA 3PIGA 5LATA 1QMJA 1UX7A 3B00A 3ZYPA 2WLPA 4A4AA 5FOJB 3V56A 4G4FA 4TN7A 5A3LA 1S2KA 1UPSA 4ISQA 3POBA 5A7QA 3J7MA 1RUH3 4AW7A 2JDYA 3A22A 2ZX4A 4ZZ8A 3AZVA 4Q0SA 5L7OC 4I0BA 1RUH1 3ASIA 2WNUA 1BQPA 3B69A 3LDBA 4QHZA 1LOEA 5LA9A 2EICA 2VE1A 4Q4W2 3HT2A 4NWVA 3U75A 3ZDSA 3CJIC 5C70A 4ITCA 2W1UA 1XYNA 3ECQA 4KWKA 3B93A 4ZONA 1SACA 5EYXA 4I02A 3MIDA 3ILFA 1ULDA 2G9GA 3T0AA 4IEVA 3VKOA 5IWFA 3ZN5A 3THTA 1QJFA 1OD5A 2P6CA 5FYCA 4UFHA 1RUH2 3OB8A 2ZGLA 3NQHA 1YJKA 4JHTA 1Z7S3 5FZ0A 2GN3A 2OVUA 2UY9A 1V6LA 3PMSA 5FAXA 4YVSA 1STMA 1Z7S1 3AP9A 5LBEA 5L7OB 2BTVC 3KV6A 2DCTA 4TZDA 4LBLA 3UKNA 1CJPA 5FLJA 2QQMA 2VMGA 3FUQA 4MGIE 5FMOS 5FQ0B 3WT3A 3CJIB 3R0RA 3IN9A 3OPTA 5KHHA 5J09A 3MYXA 5T5JA 4FPOB 4MGTA 3RZHA 3EO6A 1P8JA 2ES3A 3VBRC 1NY71 4WM7A 4B4QA 1NCQA 3RYKA 1MS9A 2G1MA 5EYYA 2HLEA 3SLIA 4R4XA 1AJKA 2CTVA 3T1LA 3I49A 4FPHA 5F7UA 4PBOA 4JQRA 4AI0A 1W0PA 3DYOA 1DFQA 1QXJA 4JGYC 3GZUC 1MPXA 3ORJA 1H9PA 2JDHA 5F5IA 1NY72 2C6SA 3OTFA 1AZDA 3I59A 3PURA 3O0XA 1D0GA 1QIQA 1D7PM 3AYCA 4BYYA 1URXA 3KQRA 4LXLA 5GLWA 5BY5A 2VNOA 1I5ZA 2W0XA 3VBRB 5JOXA 1QU0A 1X36A 1YIFA 1ND3B 2XH6A 1QQP3 4ES9A 4K6BA 3Q9OA 4LBMA 3RI8A 1QQP1 2OUJA 4HT1T 4YG0A 3RYRA 4DIQA 5CNAA 2DFCA 3Q8CA 3LE0A 4JGYB 3VZKA 1HLCA 4Q0PA 2GNDA 4Y1YA 4JKMA 3NJXA 3M8LA 1S0DA 1CR7A 1KD7A 1UZVA 3CKHA 5C3OA 4LIVA 2ZABA 4EV0A 5J37A 1WD3A 3AL5A 1QQP2 1ZZBA 1W6NB 3HR9A 2YBKA 2BWAA 3E6DA 1H2MA 2NQYA 1OUSA 5FZ6A 3RYPA 4M3CA 4RQPA 4WM8B 2ZZJA 4E2QA 1HB2A 1RUF3 1X7NA 5GLZA 3Q8FA 5JZGC 2D7FA 1DYKA 4YM0A 3ZPOA 1W8FA 1KITA 5F3GA 1RUF1 3NAPA 1PZ9A 1UAIA 1OURA 3VGIA 4HSJA 1A8MA 1WBLA 4XF1A 2LROA 5I8SA 4B4PA 5F3IA 4UBGA 2ILMA 3KT4A 4MX3A 4V1PA 4DQAA 1JZ4A 1OLRA 4MGZE 3KB5A 4PDWC 1W9SA 4LHLA 1RGSA 3ZYIB 4UAPA 3HIFA 1RUF2 5A3WA 4ZS2A 2YU1A 2HBUA 4YFWA 5EV7A 4IUGA 2O1QA 2Q5TA 2R16A 1QXRA 2NN8A 2PHUA 4KU7A 4F7ZA 3B3QE 5JZGB 2ZAHA 2O8OA 5DXDA 5KR7A 1DGWA 2DVAA 2RMU3 4Q4X3 2J22A 1BVP1 4DXTA 5E16A 1O3SA 2RMU1 4Q4X1 4O61A 3ENRA 5F2WA 1A34A 4XF4A 4IEWA 3ZFGA 3AZWA 2QE3A 1DBNA 2GALA 2XR4A 5EHDA 3O1UA 1XRUA 1H9WA 1AVBA 3E5QA 3DECA 4A45A 3LKJA 4PDWB 5GZGA 3TEXA 4COVA 1B09A 4UFIA 2X8KA 4YZ4A 3I2HA 3Q8BA 3U78A 4AFCA 1VIWB 4AFMA 2RMU2 4Q4X2 1WCSA 3KV5A 5FZKA 1Y7BA 1UQXA 2GNTA 2IUWA 1CZTA 3SISA 3VBFC 1OUXA 4Z1VA 4Y22A 2BU9A 4O9GA 1W8UA 5KHKA 1AR73 4KNCA 2JX9A 2BQPA 1NLRA 4QHOA 4F8AA 2PLV3 3OEBA 3O0WA 1AR71 4MG2A 1QOTA 1R1ZA 2B45X 2B5HA 4ZU7A 2PLV1 1HRV3 4NWWA 4XC9A 3JBG3 2V09A 1R093 2D40A 5FO8B 1GWKA 3AMQA 2ARXA 1O91A 1H2NA 1XSRA 1A3KA 1HRV1 3ZSKA 4CP1A 1SFNA 3JBG1 1R091 4LKEA 4BB3A 2OQ7A 1JXNA 4BLJA 4CUAA 4BZ4A 1XYPA 1VALA 2WJSA 3KT7A 5J98B 3SH3A 3K2OA 3MLLA 4WVWA 4FPCA 3ZDVA 1B35C 2Y34A 2YC2A 4GKYA 1LEMA 1YFXA 1AR72 1BK0A 2VZUA 5FCCA 4IV1A 3AFGA 3Q8EA 2XJTA 3B02A 3RG0A 3WP6A 3X29B 5GZDA 1AYN3 5IK8A 1JTZX 1TNFA 1WW7A 3ES1A 1HRV2 2D6OX 4QPIC 3JBG2 1AYN1 1CZVA 1R092 2W94A 3OOXA 4KH9A 2HYXA 4BLIA 1BVVA 3QCWA 1X33A 3H1WA 1HRI3 5KHJA 1ZZCA 2A70A 2BGOA 3ZN4A 4FPYA 2VZTA 5L9RA 4BQ1A 3VDBA 1LODA 3BU7A 3I2FA 3JD73 3WF2A 4A2UA 4DS0A 4Y1ZA 2WYFA 2PHTA 3O12A 5A33B 3JD71 3MIGA 3K75B 5JVVA 3ZR5A 3MI8A 3O5SA 3KWVA 3WG4A 3M2MA 4CUGA 4E2SA 1AYN2 1VBC3 1BK1A 1PHMA 1YFYA 3DPRC 4RYDA 1QGLA 3NJZA 2BFUS 3A0KA 4EN6B 1VBC1 2Y6KA 1FXZA 5BYNA 5FPUA 5LY1A 3UT0A 4M01A 4WZFA 4FTBA 1HRI2 1UO9A 3TWIA 3O7OA 3MF9A 1SHWB 1V0AA 2WN2A 3NV3A 3BB6A 4L8QA 4M4RA 4QPIB 5A3NA 4P00B 5C6CA 1W2OA 4EYUA 4ZU4A 3JD72 1ZRIA 2V5YA 2XPJA 2QZ3A 1RUNA 1RUOA 1JOJA 2NZ9A 2VAUA 3QD6A 4KWJA 4AVAA 4MHRA 2ZPXA 3LA2A 4QWNA 3SXWA 2P3IA 1VBC2 2XL9A 4CP9A 3B94A 3FHIB 1F31A 2VVFA 2D98A 4S2GA 4XXAA 1VBD3 4GWJA 1UOBA 2W1WA 1JZ7A 1LU1A 2ZGUA 2JE9A 4I30A 2JEMA 1PK6A 2DDUA 1VBD1 1GWLA 2XQXA 3AKQA 2FZ2A 1US2A 1YXWA 3HQUA 2XHNA 5CFCA 4AF9A 4BDVB 1OSGA 5I0SA 2WQ4A 2OZJA 3O1MA 1YFUA 1QNYA 1YIPA 1RVF3 2WSUA 5T3NA 1FOD3 4L92A 3POFA 3RZGA 4EE2A 1RINA 3LEMA 1RVF1 4I0AA 4LK7A 4E4ZA 5CBLA 1FOD1 4NMIA 4B3NA 1W8TA 3E97A 1VBD2 2P34A 4FPLA 4L9BA 3H3ZA 2YPDA 4JCKA 1UMIA 2VR4A 1LESA 4MH0E 1DQ2A 3MICA 4HVQA 3A21A 2EIBA 5JI9A 2Q1FA 4LO6B 4BQWA 3WNXA 1DLLA 2WT2A 1F4HA 2E9QA 4NHYA 4QX2A 4YG6A 2PQSA 1D4VB 2C1FA 1QJEA 2GMPA 1GZTA 4Q29A 1RUJ3 3BCWA 1RVF2 1AL23 1FOD2 5C4WB 2FDKA 4ZY9A 2BBVA 1RUJ1 2YYOA 4QGMA 4N53C 1AL21 3WF0A 4YVWC 2XJPA 4EROA 1W2AX 2WLQA 3WUCA 3ZMOA 5JIAA 1X8EA 1X50A 5AC93 4E2GA 1GFF2 2JG9A 5AC91 3RZMA 1IZ3A 3NNGA 2IFWA 2ID4A 2ZGNA 4XJAA 3KZ4C 1C8M3 1RUJ2 4PF5A 2PMWB 4OUMA 1JZ8A 1OQDA 1AL22 3C7GA 2WO3A 5GLTA 1RUI3 3SC7X 1C8M1 3IM0A 3RQ0A 3UL2A 4IGPA 3E5UA 4OZOA 4MXWA 1RUI1 4EN0A 5IFPA 4TXWA 4RA0A 1I9RA 3MEPA 4KWUA 1DGWX 1MS5A 1SLAA 2I74A 5AC92 4GKXA 4N53B 1V6JA 2AACA 2O8QA 1W2TA 4HN1A 1K42A 1OLME 4ZZ5A 1UX6A 1S0FA 1FATA 4B8EA 3EJKA 2W46A 1GANA 2XVLA 1LOFC 3OBTA 1FAYA 1C8M2 2CDOA 5FP8A 4M4PA 2F4LA 5FXVA 1Z0HA 3WF1A 3ZPYA 2ARCA 1RUI2 2D6NA 4XZPA 4GH4C 5FP9A 4CDXA 3S5AA 2ZCWA 3HVDA 2WUHA 4RGKA 5F37A 3KVBA 2Z69A 4YW5A 5H9PA 1PMJX 3LB9A 2R0FA 5EJ1B 5IUQA 3CHXA 1ODNA 3WP5A 3ZYBA 3L9JT 5F5QA 1UOFA 3N36A 3LDKA 4BIFA 2Z42A 4UT5A 4DPNA 3PUQA 3VD9A 4JDNA 3TBDA 3AYDA 5FMOL 2QFEA 2E53A 1RUD2 4HN0A 2RS13 2EF6A 3GF6A 3AFKA 3K3OA 2RR13 3LFMA 3OGJA 2RS11 4IE0A 4QPWA 5FZ9A 5C8CA 4GH4B 2Y8KA 1FI2A 4CRQA 1H30A 4UYBA 4IEPA 3TN93 1QY4A 1DCSA 2C5DA 4K7JA 4XQ4A 3TN91 1W6OB 1QOSA 2DUPA 2E51A 5CYYA 1A8DA 3NVCA 3FL7A 1XPWA 1E5SA 5A7SA 2RS12 4I01A 2VQAA 4NPMA 2XQRA 1RTVA 2RR12 3I2DA 5T5OA 3ZMNA 3IPVA 5L73A 1Q8OA 1OBNA 3MW3A 3RS6A 4XF0A 3B5LB 3TN92 1WMXA 3VLBB 3B7MA 1O5LA 1EPZA 4XETA 4XHBA 5FYVA 4LBQB 1PX4A 4HOOA 1WBFA 1NCRC 4GB33 3ETPA 5LCWL 2WFF3 2TNFA 4GB31 2JDAA 1CONA 4R52A 3ZN6B 2WFF1 4RS5A 4KL1A 4M0HA 4AEDC 3AYEA 4DZGA 1LTEA 1QJU3 2BVVA 3MF6A 2WINB 3VBSB 4MV2A 5A80A 2EALA 3DXTA 5M0TA 3IDEA 1T6BX 1QJU1 1FNZA 4HSLA 1ZX5A 3H3LA 5EQUA 2GAUA 4FXKB 4NJ4A 3D6EA 4MZUA 1XC6A 1VMFA 2ADEA 3EB7A 4GMP0 4IEQA 4ZPIA 4CVUA 3RZKA 4AVVA 4GB32 4A7ZA 2WFF2 2KM2A 2WWJA 2K2SA 2DVDA 3HD8B 2WO7A 1Y3TA 1Q8PA 4WBBA 1REEA 1C4RA 4YW1A 4GWNA 1NCRB 3NL1A 1GOHA 2Y0IA 1QJU2 2VOVA 4N7IA 5I91A 2RDSA 4X8NA 1US3A 3NV1A 1ZYBA 3AMPA 4RHV3 3UETA 3PTRB 4AEDB 5FR3A 4FTEA 1JYNA 2ZXQA 1AXZA 1NXMA 2VZRA 4RHV1 1CESA 2AUYA 1W6QA 4XFGA 1OH3A 3ZYJB 4BJ0A 4CU7A 4EN9B 4FAHA 3NNMA 1XOYA 2YDEA 3I3QA 3WSOA 1AUYA 3AM2A 3O1RA 1W9YA 1TG7A 2O14A 4QQOA 2A3WA 2WC2A 1JU4A 1Y43B 4O65A 4OULA 4CPBD 3HMYA 4AEJA 1UL9A 2B42B 3K51A 3CEWA 4CEYB 1PVXA 4META 2P2KA 2OXBA 2RJKA 1Y9QA 2YGLA 4RHV2 3VDDA 2WNVC 1GBGA 1PM7A 1UWWA 4XFIA 4OHYA 1VBA3 2WAAA 1ST8A 1WA4A 1VBA1 3KQ4B 1SPPA 1HJGA 3VKMA 1ZVFA 2KD7A 4I3PA 1JW6A 5FZ3A 4OHXA 2GMMA 4FPJA 1YJLA 4N7UA 4HK8A 1OVPA 1S4CA 4AEMA 3TEYA 2ET1A 4BH9A 2D6LX 2A6ZA 4YM3A 2JWPA 1UIKA 4AEKA 4IXLA 2XKPA 2W39A 3S57A 3U1XA 4CPBA 1DYOA 1I5PA 4FFGA 1VBA2 1L7LA 3UJQA 4AVBA 4ET7A 2XKOA 3JUUA 5JPNB 1AJOA 2CNAA 2WNVB 4ATFA 1G7YA 4LHNA 1AF9A 5A1LA 5BNPB 4LA3A 1UD1A 1YUDA 3LSDA 2Q1ZB 2I2SA 4CEWC 1K5MA 2OUHA 2WL1A 4Q5OA 4S2DA 2OT7A 3HPNA 4CTEA 2ZHLA 1U5ZA 3IIIA 5FYUA 3V0BA 5GZEA 3OGSA 2XGXA 2W3JA 4CDQC 4W4ZA 4YGBA 3SEPA 2YU2A 3K4ZA 4P9IA 1D4M1 3CBNA 3P3NA 1BXHA 2D6PA 3IDAA 4QDSA 1J1TA 2GC0A 2GDFA 4NRQA 4ATEA 1VAVA 3MO4A 1KS5A 5A3UA 1H6YA 3L2HA 2Y6JA 5IK4A 2E7QA 4BQ5A 1BYHA 3JB8A 2GH8A 2VD7A 2W5FA 5T5LA 4CDWA 3F95A 1F4AA 4MGQA 4MO3M 4QX0A 5FUIA 4CEWB 4NOTA 1NYWA 2EAAA 2W1SA 1NE4A 5FY1A 2ZS6B 3M3OA 3O1OA 3OJBA 1S0IA 1GOGA 4JKKA 2ORZA 2Y64A 1K12A 1J58A 1GP6A 2JDKA 5FREA 2X05A 1WLCA 2E26A 2VXRA 5D8AB 1LB2A 3OBZA 2W47A 3JZVA 1YHFA 2HWC3 3DKQA 4AHYA 5DQ0A 2QQUA 4JRLA 3WDYA 1CWPA 4E9KA 1QDOA 3EMRA 3B01A 3H7JA 2HWC1 2BFUL 4P9YA 1Q43A 4ZXKA 5C9AC 2YUEA 4J1XA 4UW6A 5LBCA 2ZGQA 1KJLA 4LMFA 3T08A 3WDVA 4DNYA 2TBVA 4HPKA 3WW4A 3HEIA 3N7KA 1W8NA 3P5BA 2Z5WA 2VUDA 3MBWA 4DXRA 1E5HA 4NVPA 3POIA 3ZX7A 2DVGA 2JG8C 1TZOA 4GXLA 1LHOA 4XUNA 4IERA 4Q4V3 3VZNA 1RYYA 2ARBA 3N9MA 2HWC2 2IXHA 1ASJ3 4Q4V1 1VJ2A 5ACA3 2ADDA 1W6PA 1DGRA 1NX9A 2A6WA 4A3ZA 2BUKA 2XXZA 3GDBA 5FBJA 3ZXGA 4UW4A 5ACA1 3LWCA 3AYAA 1EAH3 4QKBA 4XFFA 5FZAA 1IKQA 3AMHA 3V64A 2WNUC 3BTYA 5C9AB 1EAH1 1QJY1 4DMIA 4HANA 1HW5A 3GHNA 3D0JA 4QGLA 4Q4V2 4FOWA 4G3YC 3B9CA 4QXKA 2VW1A 3ZM8A 1ASJ2 1SLBA 2JG8B 3AKTA 5LA2A 2WO1A 5ACA2 4LLFA 2X10A 5FZOA 3PVNA 4JTOA 1AR93 1F35A 5A6QA 4FI9A 3LOBA 2XWBB 1POV0 3U10A 3WQBA 1EAH2 1AR91 3VZMA 4TTGA 1UXZA 3LQCA 4YVSC 1JHJA 5FUPA 3VD3A 3VHNA 2WKKA 1F5FA 1W06A 2MHFA 2DVFA 4Y24A 1XYOA 2WNUB 3S30A 1W04A 1OT5A 2XJSA 5LBFA 2HWE3 3NWKA 1WD4A 2XLAA 1EUTA 5DAQA 1AR92 2VTFA 1H6XA 2HWE1 2VNVA 3RZZA 5GKAC 1J83A 2V4AA 2IXIA 5DPNA 2LTNA 3MFCA 4WM7C 3VHOA 4A44A 4HKOA 3I2KA 1NCQC 2VZVA 4JC1A 1JUHA 3FHAA 2A1XA 4WVMA 4PIXA 5A7PA 2D43A 3SMHA 3FZ3A 4COYA 2P4EA 4AYUA 1J84A 2R1DA 4YVSB 1WGPA 3WLUA 4C1XA 4GJZA 2OIIA 5GLUA 4LJHA 1D0HA 4Q26A 2HWE2 1NLSA 2DURA 1UU4A 4YW3A 2J42A 3P6BA 4LLOA 4J25A 1W0NA 4PF1A 2DF7A 4Z82A 5F32A 4XW3A 3N4MA 4BQ2A 2Y6FA 2Y60A 5FKBA 2OPKA 2YBPA 3MUZ1 4N43A 5F3CA 2ZA9A 2ZGTA 4AHWA 3IDCB 1UYPA 1YC61 4Z92B 3ZFEA 2PN5A 1OH4A 2Z79A 3ZXEA 2QCSB 1NE6A 3ALQA 4WM7B 3I3EA 1NCQB 1NA1B 2UYBA 1JYWA 4OMCA 1GZWA 3ZOIA 1F9KA 2JXAA 4URTA 2ZHMA 2QBXA 4YM2A 5LWBA 1H8TA 1WMFA 3IDBB 3BGAA 3U14A 1ALYA 4AQ6A 3I3BA 2QKDA 2VMIA 2FCUA 2LRPA 3Q8AA 4SLIA 3H9AA 3WXPA 5HI0A 5BXXA 2W95A 3I59B 1ONAA 3OF1A 4IEUA 4H7MA 5T55A 1ZRDA 2AREA 1UY4A 1OFSA 2GMEA 2SLIA 5GZFA 3ZYFA 1XE7A 2BJSA 4JDOA 4JTNA 4ES8A 1IHMA 3EXUA 2AYHA 1W2UA 2PAEA 4UF0B 4KGQA 1IOAA 5IVJA 5FPAA 4RQPC 4D6QA 3GBGA 2XJVA 1Q8VA 2F4PA 1H2LA 2BERA 4LR4A 4FP3A 3C7EA 1RHI3 4TLFA 4YGDA 1J1LA 2E7AA 3NAPC 2VC9A 2UY8A 3ZO0B 4AHZA 3D3AA 4D6SA 2VTXA 3SH4A 4CP0A 2HWD3 2A3XA 2VO5A 2UURA 3TYJA 4YRDA 5ERLA 3U4XA 3T3YA 4CE8A 2HWD1 5IVEA 2WQ8A 1WUVA 1G8WA 2VMHA 5A3PA 1UU6A 4NIDA 3I8TA 2XWJB 4OI4A 2RS53 3GJBA 3EYPA 4RGGA 3UGHA 5FY9A 1GLHA 1ZNPA 4XFCA 2RS51 1RHI2 5FWEA 5I0TA 3WG1A 3WF3A 4EWDA 5J48A 4M3CB 4RQPB 4J6GA 4IE5A 4RSUA 2IZWA 1BLZA 4XQDA 3R6SA 3GCXA 1S0CA 2HWD2 3IAPA 1H8VA 4YW6A 3BTZA 3NAPB 4XPVA 2HEVF 5FO7B 4LNVA 4EQVA 4QT6A 4INDA 5KC5A 1SFYA 1XU2A 4L2NA 5F6LB 3VKNA 1BKZA 2GC1A 4OLLA 5CFDA 4M3CF 1U5YA 3ZFGC 1G9BA 1GMMA 2RS52 1ZBA3 1X9PA 1XXNA 3NSTA 2QNKA 1NAEA 3HOBA 3ZFFA 4CU9A 2QUOA 2Y0OA 1YWKA 1ZBA1 4W6WA 1R64A 2WT0A 2JE7A 1S55A 3ZXJA 1QWRA 3I3DA 4DOUA 2JDNA 4KBBA 4DUVA 5JXIA 2CGOA 4LO7A 2VXJA 3POJA 3JU9A 4LHSA 3E6CC 1NQDA 3HBZA 3UV9A 2R042 4XJUA 2BGCA 3ACFA 3PUIA 1ZBA2 5FMBA 3S7IA 5A6XA 3SHRA 3J8F3 3C8XA 1XBFA 2Y6LA 4M0NA 1YO8A 2JB8A 3ZFGB 5KHIA 2PA7A 5FZFA 3T09A 3J8F1 2CWMA 1W90A 3VZOA 1VPHA 3VKFC 5GM0A 5A32A 1H4HA 1CQ9A 2PHLA 5BNNA 1UNBA 3AZXA 5FZ4A 3VBUA 2QQNA 4X6RB 1MS4A 3QACA 3VHRA 1EYBA 4LOSA 1HN0A 3LOIA 4GMP3 3KCXA 4XXPA 1APNA 4IV1C 4V2VA 3J8F2 4Y22B 1COV3 4GMP1 1VBB3 1GSLA 2FDJA 2P17A 1VBE3 1D2QA 1KJRA 1COV1 2O0OA 3KV9A 1VBB1 1Q8QA 1VBE1 1H2KA 3AVSA 5I0UA 1ND3A 3M70A 4URAA 1AXYA 2BV4A 3RJRA 5FZ7A 3NJVA 2IVIB 4NIGA 4AHXA 1ND2A 2PHXA 5FY7A 2W91A 1GQPA 4PIZA 1LCLA 2DBNA 1COV2 5FLIA 2VBBA 1QF3A 1VBB2 3O0VA 1VBE2 2ZX2A 3E1F1 3J9SA 4IV1B 3JQXA 1TE1B 2UWBA 3FLTA 5FXZA 4EJRA 1PNFA 4I3GA 1XE8A 1N47A 2WNOA 2ZHKA 2YC4A 3K77A 3PJYA 5FLHA 5K4LA 5LA1A 2ZEXA 4I2OA 2J1UA 3EQEA 1MZ5A 2AEYA 1UYYA 2Y33A 4BOWA 1LU2A 1K45A 3WG3A 4R9AA 4Y1UA 3UJOA 4DRVA 3PTYA 2CGNA 5K8SA 2JKXA 1HXS3 1H1MA 1WWYA 2A6XA 4H55A 2FBEA 4LUKA 4UFKA 4WM8A 5FMDA 5IJRA 4B4RA 3WQ7A 2FCTA 5FYZA 5JR7B 1WCUA 1HXS1 1H4GA 1MVEA 3BTAA 2VZQA 5C8WA 4HFSA 1HJFA 5FY5A 1UW8A 2P5BA 3IAQA 1PK6C 2ZEWA 5T5PA 2YGMA 2C0ZA 3R4UA 3LIHA 5F6KA 5CFCC 1LENA 1IQAA 1GKBA 2BNMA 4QPGA 5JXGA 1HV1A 3NNJA 2P37A 4QDQA 3WY6A 5L9BA 1HXS2 5JXHA 1SCRA 1UYZA 1ZZ6A 3KGZA 4G9SB 1J3QA 1Y9GA 2C9KA 2WAOA 1GOFA 4LPLA 5FYTA 3VBFB 4D7YA 2WRAA 5LZ6A 5BNOA 4RGAA 3GJAA 3I2JA 3OD0A 2BOIA 5DUWA 1N1VA 3SH5A 1W9WA 3VN4A 4CP9B 2BEOA 4IETA 1UZZA 2IFRA 3H8UA 5KHGA 3GALA 1VMHA 2VM9A 1WW4A 2Q8OA 3N35A 1KRIA 3HJRA 1OLMA 2IWGB 1PK6B 1OKQA 1FX5A 3CDZB 4QKNA 3ZLIA 2J1RA 1HRI1 4YM1A 2BNOA 4BM8A 1N3PA 5CFCB 2KA3A 1OQ1A 4UI9L 3ZXLA 1JZ5A 4FPFA 3FBMA 3G6JB 1B35B 5FV3A 5A70A 4AG4A 3LFIA 4Q1RA 1KDMA 3FHQA 5F5AA 1S1AA 4OI2A 1W8HA 2JG9C 3OPZA 3SCHA 3SQOA 5C3SA 5FP3A 2VECA 4C90A 3LF7A 3ACLA 4OUSA 4Q1PA 3M3IA 5K9YA 3GCWA 3POEA 1UKGA 4LHKA 5CEHA 1UF2C 3BPSA 3O1SA 1OPOA 1V6KA 2R7EB 4NHXA 5K7PA 4Y5SA 4CUCA 2AH2A 4E8DA 1CVNA 1MZFA 2RDRA 2DUQA 3CMGA 3PDQA 3CQOA 3DXUA 2ZTNA 1NZCA 1E5RA 1ULEA 3GZEA 4YFZA 2VCMA 1W8WA 3DPRB 1S0BA 4QU1A 2PXJA 3NNFA 2XJQA 3BODA 4H2AA 4LE4A 5FYIA 5GALA 3UK9A 4COZA 2JG9B 5JWPA 4P14A 2XMLA 3S0MA 4YGEA 4RR3A 2AENA 2HEYF 3PVEA 3T2OA 4CDXC 4FSJA 3C7HA 4AVSA 4NUBA 5FUNA 1X9TA 4P9GA 1JYXA 1GQGA 1G6NA 4B1LA 5IYYA 4HLTA 3ACIA 2B7YA 4XDQA 3SEEA 4EZ4A 4JHZA 2CYFA 2IC1A 2FCVA 1YQ5A 3ILNA 4XFHA 5CU1A 3PU8A 5FZGA 2B46X 4BE3A 1MS3A 4P5HA 5J7MA 4ASKA 2GH2A 5DABA 4LO8A 1FNYA 1EPWA 3MFAA 4JZRA 4IE4A 5BUVA 4AZZA 1GV9A 4PIYA 1U0AA 1ULFA 4PCRA 4GAZA 4BIOA 5B2GB 4DUXA 2WBKA 4H3WA 4CDUA 5C8CC 1UY0A 4CDXB 4Y3OA 2L9LA 2QQOA 3VDCA 2VUAA 2YC0A 1DU3D 4MGYE 3VBHA 2Y6GA 2PELA 2A6YA 1RITA 4OYUA 1L7QA 3OY8A 1POV3 2YXSA 1KFXL 1MQTA 2NYYA 2OYZA 1GZCA 4ZKTB 1POV1 1M4WA 1TQ5A 1G9DA 3MIEA 1CIWA 2DU1A 2ZX0A 3KD4A 3AZYA 3M7AA 1CGPA 3KM5A 3N9NA 1SLCA 4H14A 4HKLA 1A6CA 2JDPA 3PVBB 4YVWB 2EA7A 3HQRA 2RE9A 3IMMA 4XQWA 2CAVA 3WV6A 4XILA 5CA6A 1NKGA 2RJ2A 1DGRN 2XVKA 3PNAA 3WNPA 1WW6A 4XABA 2K0GA 5FXXA 4LIUA 3N7MA 4QB2A 3WX5A 1CAVA 1VRH2 5FKCA 4AGRA 5JCTA 2JDUA 4RS5C 1DQ1A 3BOPA 1RUD3 5HCFA 2Q8DA 4CU6A 2DCZA 2VZPA 2RDQA 4PLMA 4QD2A 5LEKA 3HN1A 4Q4Y3 3VD5A 1RUD1 1RC6A 3MIBA 1U5XA 5DAPA 4FBFA 4YARA 2C26A 4L99A 4Q4Y1 4XMAA 5GLVA 3ROUA 3IPVB 5E88A 3ZXFA 4COWA 3K46A 3MV11 3MPBA 5E1RA 4DXZA 2OS2A 4D94A 5C71A 4UFJA 4AAPA 3NV2A 5AFEA 3O1VA 1QNWA 3FX3A 4XDPA 3GBFA 3IZOA 2Q8EA 5C4WA 5SV8A 3VUOA 2C9AA 5SV5A 5DN2A 4YW4A 3OBAA 4R9DA 3KV4A 4Q4Y2 2BOJA 2NP0A 4RS5B 1FMD3 1UYXA 2E63A 3WNNA 4CCMA 1YEWA 3V0AA 2RR11 3ACHA 3WDTA 3VV1A 2QQJA 3KSCA 2FHRA 3DGTA 5K0UA 3KHCA 2Z2SB 4ISRA 4XBLA 3ZXKA 4DB5A 5JAXA 5I8YA 1HX6A 3SITA 3D4KA 4WV8A 4IGQA 4XJWA 3IIAA 1LULA 1W8ZA 1OA4A 2Q30A 4P08A 3MLJA 3LIGA 5FRAA 1NT0A 5FP7A 1U5IA 2DVBA 3VDDC 1FMD2 4AAXA 2P3YA 2MPFA 4BQ4A 2VOKA 3AB0A 4QX3A 4AQTA 1XB9A 2VL4A 3URFA 3CU7A 4N9IA 4QQPA 4LBKA 1XJAA 2VVEA 2X5IA 1RJ8A 4IEZA 1UIJA 1Q5OA 1MS8A 1W6QB 2WA3A 3VBOA 2X09A 3VZLA 2BDRA 1FV3A 3U4SA 2BBAA 2W92A 5F1RA 2VW0A 5FDBA 4C0BA 1VB4A 3APBA 5BNQA 1C57A 2VQ0A 4BXFA 3MLKA 4OI1A 3NO8A 1S0JA 1UZWA 2VQUA 5CAZA 2DYCA 2WZPP 3AKRA 5FPXA 3ELNA 4JGZA 4GWIA 5DZEA 4TYSA 1K5MC 2W9XA 1HB4A 1SPPB 3W5NA 4JAAA 5I0DA 2QQWA 1LHUA 5HCAA 2VOWA 5FWJA 1CJDA 1IS3A 2QQPA 1JYIA 3T4VA 5IAXA 5HPOA 1DQ6A 1OA2A 1U12A 2A75A 1X8MA 3T1MA 3KLSA 3SCFA 2XOMA 5IVVA 3USUA 3OPWA 4XTPA 1H1IA 4Y20A 4ARXA 5L9VA 4E27A 5A3MA 3J7HA 4XZUG 4RD7A 2LW8A 1W6OA 2PTMA 2HJIA 4YPJA 3ST7A 1PMHX 2I07B 2JE8A 2JKBA 1OHFA 4CDWC 1CAXB 2VBPA 1JN2P 2V5DA 3B9IA 3CZJA 1ENSA 2FDIA 1K5MB 2E6VA 2ZACA 3POGA 4CCJA 3IWZA 1UXXX 2X53S 1W8OA 3OBRA 4QQ2A 3UGGA 4FPKA 5KWRA 1BEV3 3J26N 1UCXA 1AR83 2OPWA 4D7SA 5KXEA 3V0BB 1BEV1 2JJ6A 5FTTC 3AX4A 4AFBA 1BHGA 1AR81 2YHJA 4LEJA 1O8SA 2B9UA 1EV13 4PBPA 1Q56A 3DYMA 3U11A 4CXXA 2VMCA 1OI6A 3ZVXA 5IAVA 5FPZA 1CN1A 1EV11 3WVJA 2GN7A 1TMF3 3VBSA 3FN9A 1AL0G 2A7AA 3HWJA 3NW4A 5LA0A 2J1AA 2R6QA 3GGLA 4IEOA 2D3PA 1TMF1 1J59A 2ZKNA 2LM3A 1VE0A 5FZHA 3N7LA 4IL7A 2E32A 1BEV2 1C28A 1V6MA 3HQXA 5FYBA 3S7EA 2GU9A 1W39A 1AR82 2D5FA 1PGL1 5JR2A 4F3JA 2ZBJA 1X82A 1O4TA 5EJZB 1GP4A 3LA7A 1EV12 2QDNA 3ZYRA 1FT9A 2XONA 1ULOA 2WWSA 4NRMA 5DAVA 2PHWA 1XQNA 3L2YA 1FPN2 2ET7A 3AC0A 4CXYA 1TMF2 4AGVA 4R4ZA 1GNZA 2HYKA 2WZEA 1O6UA 4A7KA 4NIHA 4V2WA 1I3HA 1SEFA 5A6ZA 4PHZA 1PGL2 3N9QA 5GJ6A
chains in the Genus database with same CATH topology
5JOYA 3I7DA 4K8FA 1G9CA 3H1YA 3IBMA 4RFT0 4N9HA 2OA2A 4HPKB 3C2UA 1BCXA 5IT6A 4CEYA 2MNGA 1ZA4A 2WZR3 3QBQA 2YZ4A 4AI2A 2WZR1 3KCYA 1W0OA 2W52A 4I09A 2SBAA 1OQEA 3WHUA 4P9JA 2NM1A 1UPIA 5JIUA 3AXDA 2JICA 4Z8BA 2WQZC 3MIHA 4CDQB 1PO13 2ETEA 3WCRA 3TAYA 1CAUB 4FQZA 4LO5B 2R063 2WZR2 4XTMA 1L3JA 1AR63 1PO11 1OOPA 1O3TA 3JB4C 3VL8A 2R061 1YFWA 4AVTA 1REFA 4IV3A 1HDKA 5DZGA 2HWB3 2A5ZA 2QDRA 2GZWA 4N90A 2HWB1 5BNPA 4XOGA 1Q3EA 1OPMA 1PO12 5ABJA 3LCPA 4XHXA 5F9TA 4BCUA 4UXAA 2R062 3RI9A 1AR62 4FOYA 3UKTA 1CPMA 1WW5A 1OA3A 1ASJ1 1AYM3 1AX2A 2HWB2 4N43C 4AGGA 1DIWA 4XF3A 4FAGA 1AYM1 2GC3A 4U2AA 1BMV1 2MEV3 3CO2A 3ZFEC 1W6MA 5DG1A 1MEC3 1ZZ8A 3E5XA 4WVMB 4P9WA 2W08A 3WR0A 1MEC1 3KGLA 4YNIA 1ZBE3 4XIKA 1O7FA 1PMIA 1H8TC 1JBCA 3D82A 3DL3A 5JDBA 1ZBE1 1AYM2 3WW1A 4FQ4A 1BMV2 4YZ1A 3POSA 2VH9A 2ZGSA 2VG9A 4FP2A 1YRZA 2MEV2 4CP2A 4LE3A 5D8AA 5H9RA 4P9XA 4N43B 2HKXA 3WDXA 2B39A 4S2FA 1MEC2 4ASLA 4BWOA 4LT5A 1G86A 4XFBA 5LK5A 1S0GA 2PAMA 4HK9A 5JI7A 2DU0A 1DZTA 3DUIA 1ZBE2 4OZXA 4A3XA 4YSFA 3E6BA 1GZWB 4M00A 3WQ0A 2TEPA 2XBO3 4NO4A 3FBYA 4GQ7A 1ENXA 1H8TB 2XBO1 2OW4A 1V6OA 1HKDA 5EZWA 1OFNA 3U07A 5JOZA 3IKWA 2JD4A 2IXJA 1DQ4A 2VULA 4ORFA 3EBRA 4AI3A 1CPNA 2DCJA 2XBO2 3POWA 1WMDA 2XB6C 1V6IA 4K21A 5KBFA 2RS33 3M4FA 2DTWA 4R8HA 3WOGA 1SLIA 2RS31 1SLTA 3CNAA 3R4SA 4NPRA 5CFDC 3FFZA 3ZFFC 2KXLA 3NKTA 3FE5A 4KG0A 3PLQA 4RL7A 3WQ1A 1JHNA 1KQRA 1ULCA 4PQ9A 2RS32 2D6KA 4IEXA 1F5JA 4NHKA 5CADA 4Q8KA 3MZHA 1S0EA 1QH7A 4BMBA 1NXD1 2R32A 1LHNA 1UZYA 4OHVA 2H6BA 4DRRA 4UW3A 3RNSA 4CYDA 3N3HA 5CB7A 4LO4B 5CFDB 1AX1A 5JPMB 4AFDA 3ZFFB 3FMGA 1HV0A 2P3KA 3OYWA 1QXPA 2WFPA 1R083 1RHI1 2R0HA 2VNRA 4O9EA 2NMOA 2R30A 1CAWA 1R081 2ATFA 1QKQA 5BNNC 4IEYA 5LEJA 3VBUC 1TEIA 3CLPA 1PZ7A 2WIIB 1IS4A 1MR5A 4HMZA 4NHLA 1MS0A 4Z2WA 3LGRA 2A3YA 1S2BA 2QVSB 3H1MA 4YGCA 4AQSA 3R4DB 1R082 2D3SA 2D97A 4MLOA 5LRRA 5H9SA 1Z7S2 1SCSA 4BPZA 1ND3C 3A4UA 2UWCA 3WG2A 1LOBA 2EXHA 3AMNA 1NA1A 3WCSA 2CL2A 5A32B 2F6BA 5BV6A 1ND2C 1PZ8A 1LOAA 2PQQA 2R043 2VPVA 2YROA 5BNNB 2PHRA 3VBUB 4MVTA 1VAKA 3ES4A 1ZRCA 2R041 2P3JA 2CAUA 4NR1A 4K20A 5L36A 1DGLA 4HVRA 1DHKB 3JCIA 1CX4A 4XBNA 3ETQA 2VU9A 4C0HA 4R9CA 3IT8A 5L7OA 2DFBA 1MACA 2R1BA 4WM8C 4DINB 3OCPA 5BPXA 5FQ0A 2D5HA 3CJIA 4GA9A 2YPJA 3RJ2X 1ZRFA 1TNRA 4UBHA 1ND2B 1FYUA 1NQJA 2ZOEB 1RIRA 3OD4A 5C33A 3KT1A 3DV8A 3AP6A 4QPGC 4X6QB 3U0ZA 4LBJA 3AXEA 1QHDA 3FC0A 2BNNA 4BHPA 1DQ0A 1LGBA 1LECA 3FLPA 5BNOC 3HT1A 5DG2A 2IXLA 3AP7A 1O4YA 4FVVA 3ZIXA 1MZ6A 5JMCA 4YLZA 2ZGPA 1OLQA 5KXCA 3VBRA 5JSOA 2GC2A 5T50A 1PGSA 3FFQA 2H0VA 3RSJA 1J3RA 3WP4A 2VW2A 4R9BA 5H9QA 4MYEA 4QPGB 1LR5A 1MVQA 5EFUA 5I0RA 2Y38A 4QU2A 2FMDA 4JGYA 2GNBA 4AK3A 3G7DA 5T54A 3DKWA 4QM8A 4WZCA 5BNOB 3CF6E 5JSRA 1I1EA 1WCKA 2WS93 3C3VA 3QOPA 4LULA 1W6NA 2WS91 1HQNA 4PJYA 4QX5A 4WVVA 1ENRA 3D5OA 4UW5A 2WNEA 3WZ1A 4GWMA 1DF0A 1KDKA 4KQ7A 1OMIA 1V6NA 3M3CA 3ZSEA 4MSVA 2RM23 4EWAA 5LRSA 4K3UA 3AP4A 3RWNA 2RM21 2WS92 5KXDA 1QOOA 4KG8A 1A78A 1LGNA 1ZRRA 4RR3C 4OVEA 5D1IA 2DUOA 4U36A 3W9AA 3KCCA 1LHVA 1O4ZA 4I0WB 4AWDA 1VR3A 5AVPA 2RM22 5JZGA 1M06G 2UU8A 3VKLA 1IS6A 5E8AA 1SBFA 1SDWA 4XMIA 4W65A 4FOVA 4Y1VA 5TSWA 5DUUA 4RR3B 4CDUC 2IXCA 4PDWA 2RHPA 1LKNA 2PLV2 5KHKA 1F2NA 3NKGA 4KGGA 3AP5A 4SBVA 3VBHC 3GNEA 3RDIA 2VUJA 4OFGA 4QGNA 1E57A 1MQTC 1GNHA 1WLTA 4QQLA 1UKRA 4YW2A 3ZSMA 5KXBA 4IESA 4M3CE 4AXOA 2EXJA 3I4IA 2XJUA 4HKWA 2ZX3A 4D3WA 1Z78A 4CDUB 4AFAA 3FWEA 3QH6A 4E4SA 5GZCA 4MUVA 1VB2A 4B7KA 3VBHB 4FOQA 4Y5Z0 2D3RA 1WCDJ 2NPIA 1GICA 2CV6A 3QLQA 2JENA 3MGUA 3OY8B 1QDCA 4TWTA 1MQTB 3VBFA 1C3HA 2LUWA 1DYPA 4JVAA 1HQWA 1MZEA 3MIFA 4Y4YA 4OI0A 4A7YA 4MXWB 1H0BA 4HZFA 1EP0A 2ZMKA 1IPKA 2VOXA 1EY2A 3WW3A 2X29A 1VLNA 4XE9A 2XHKA 5C4WC 4FT8A 2UYAA 2FZ1A 1C1LA 2A71A 5A33A 5IK5A 3RRDA 5EWSA 1B35A 1CAVB 3MW4A 4AQ2A 4EWEA 3WDWA 4GALA 4Q0VA 3GBWA 1YI9A 3GYDA 5K0UC 2OZ6A 4XYXA 1RJ7A 1ENQA 4COUA 4QPIA 1BBT3 4K1ZA 1IS5A 2ENRA 1RB8G 1BBT1 1ZZ9A 2ZHNA 1VRH3 4QHBA 1VRH1 3H7YA 1XNDA 3IMNA 1YYNA 3W59A 3DPRA 3V0AB 5C8CB 2X5IC 1BBT2 3BALA 1PO23 1GR3A 2AR6A 3AJZA 5K0UB 3LZZA 3VBOC 4KWLA 1D2SA 3SCGA 4DY5A 4YZ2A 1UN1A 1PO21 2BW8A 3QH7A 3ILRA 4QQHA 4NN0A 5T52A 4FPGA 4PLNA 1N1TA 4XEZA 1XNBA 1RUG3 2R073 1H1AA 1RUG1 1LGCA 2R071 2W68A 4ZU5A 2ZJCA 3O14A 1SQ4A 3PVOA 1PO22 3AJYA 3KMHA 4JGZC 4XJZA 4B7EA 2X5IB 2E7TA 1DZRA 1YCIA 1IKPA 3ZIWA 3VBOB 2DTYA 2G4IA 4OHWA 5CVRA 4D69A 1RUG2 2R072 2ZAAA 4LUMA 4Q2FA 4AE2A 2CWSA 1FMD1 3HAGA 3D8CA 2XLFA 2GNMA 4HBNA 5FO9B 4HETA 2G9FA 4Q27A 4C91A 1Q8SA 1WLWA 4JGZB 4Z07A 1C5IA 1QJZA 3OGGA 1I6XA 3W58A 3BIWE 2FQPA 4N53A 1O5UA 1VAMA 4YVWA 4DY3A 5CG8A 2CGPA 4F83A 3UKVA 3USUB 3GHMA 3LAGA 1AX0A 4Y20B 5CG9A 4Q0QA 3WP3A 5JOWA 2YV8A 3VBSC 5JLVA 1PIV3 1YI7A 5LK7B 4YZ3A 2XVGA 1PIV1 2EAKA 1MS1A 1C8NA 4K40A 3TOJA 1N1YA 3H50A 1RL3A 3H0OA 5E89A 4OHZA 3VDDB 1SBDA 1WLDA 1SBEA 2D93A 3TNPB 1XU1A 4HL0A 3PJQA 2ZGMA 1CD3G 1WMEA 1DG6A 4K1YA 4XJ9A 4Y26A 4Q0UA 5I93A 4HVOA 1LOFA 1PIV2 2YMZA 3NV4A 4LBQD 5HXVA 3K48A 1RUE3 4MXVA 2XG3A 4GH4A 2EXIA 2H0BA 4PLOA 1RUE1 1DDLA 3LSEA 2DWRA 3V65A 2ZGOA 1N1SA 3ZXAC 5I8TA 3MPPG 1V00A 5AVAA 3M3QA 4CEYC 1AHSA 1QJX3 2Y26A 3P3PA 1LOCA 3DN7A 4CZSA 2TUNA 1N3QA 1ULGA 1QJX1 2ZGKA 1RUE2 1UMZA 1UU5A 3SNMA 2IXKA 2PFWA 2R49A 1KXGA 4KU8A 4DFSA 5J3UA 4BA6A 1G9AA 2NLRA 4LBQA 2JDZA 3CJXA 2H6CA 3AZZA 3TNQA 2WT1A 2WSVA 1QJX2 1V9U3 3GZAA 4XF9A 3ZN6A 1FPN3 2BVBA 2HWF3 1OOPC 4QPYA 1F8VA 3J4UH 1YLLA 1O3RA 1V9U1 2Q1MA 3AKPA 1FPN1 2XUMA 3PHMA 1LHWA 2HWF1 4IV3C 4CDWB 3A0NA 1O3QA 3I54A 2D44A 1PVC3 3RPQA 3ZYGA 1LEDA 1REDA 5JSPA 1BJQA 5BNPC 2VNGA 4FXGB 1PVC1 2NMNA 3THPA 4FCAA 2WA4A 4AI1A 1PGW1 5ABJC 1V9U2 1NCRA 2HWF2 3FJSA 5JOXA 2Q4SA 3GZTB 3AKSA 5DDJ3 5FBZA 2JECA 3VZJA 4AEDA 4YZ5A 2VVDA 1OOPB 4W6YA 1PVC2 3MW2A 5DDJ1 2XL7A 4IV3B 1PGW2 3N7JA 5HBAA 5J96B 4AVCA 2ZKLA 1CAXA 4H7LA 2Q0AA 1XNCA 2ERFA 5DUXA 5ABJB 5DDJ2 3WW2A 2QZ2A 1IGOA 3AMMA 3TB0A 2PHFA 3ZXDA 2YY1A 4JV4A 4D7TA 1BZWA 1W6PB 1D4M3 1RUC3 4IQPA 5EXOA 1LRHA 4XIOA 1N3OA 5D8AC 2B8MA 4JRAA 1HIXA 1RUC1 4TSVA 4J1WA 4L11A 4GIQA 2DV9A 1W6MB 4YG3A 4YYOA 4LBOA 3ATGA 2UWAA 1JUIA 4Y1XA 5IK7A 1AR61 3FUOA 3VL9A 3FLRA 1D4M2 1GQHA 1RUC2 2WNVA 1AXKA 4AI8A 2EXKA 3R05A 2DCKA 1TME3 5J36A 2RJLA 2N7GA 1TME1 4MGKE 5DUVA 4S2HA 5FOBB 3INAA 2EIGA 1GYKA 1ZM1A 1RMU3 5HCBA 5DZFA 4B29A 4LTAA 1JYCA 1RMU1 3EHKA 3TRSB 3WDUA 3JQWA 3WUDA 5JCTA 1HQLA 3H3UA 3ZSLA 2FMYA 1SLLA 4QM9A 1TME2 2MEV1 2HEWF 4K9SA 2AGSA 2VGDA 4E4DX 4FTSA 4JDMA 1DZQA 3DF0A 4CEWA 2DCYA 3BOWA 3KS7A 4ONUA 4ASMB 4XJ8A 2K9ZA 2D6MA 2PYTA 5KC6A 3M3EA 5FFOC 1V70A 3PMEA 1RMU2 2EVXA 4WVZA 3LA3A 1QJY3 4CDQA 1ZZ7A 5EJ3A 2CY6A 4LA2A 3POYA 3RMXA 2I45A 4QMAA 1CAUA 3T2TA 4EN8B 4XBQA 2LALA 3ZFEB 1QH6A 2PHDA 3ME2A 4LBNA 1T6GC 1FV2A 2BYVE 1C1FA 3M1HA 1KFUL 2XJRA 4P9LA 4EN7B 2ZGRA 5CIRA 2BPA2 3D0SA 1GZ9A 1XNKA 4Q8LA 2V73A 4FO9A 2ZMLA 1QJY2 2BWCA 4GULA 5L19A 3WHTA 1NG0A 4FPEA 1VP6A 3CL1A 3VHPA 3BPZA 1ZREA 4BMEA 3MDPA 2ZX1A 3ZSJA 2QJVA 3USSA 1PNGA 1R1A3 2VY0A 2XLGA 3RMYA 4XFAA 3WD5A 4L97A 1R1A1 1IPJA 1LOGA 1SMVA 2AZ5A 2GSYA 1NOVA 4NHMA 5C9AA 4W6XA 1KS4A 3OYWB 3AK0A 1YNAA 1NA1C 1LJ7A 1DQ5A 1JH5A 1G9FA 2A73B 4Q4W3 1J3PA 2A6VA 1CAWB 2ZMNA 4C1WA 2JG8A 4X8PA 1R1A2 2PAKA 2ZZQA 4Q4W1 1C5HA 3S6PA 1QMJA 3B00A 3ZYPA 2WLPA 5FOJB 3V56A 4G4FA 5A3LA 1S2KA 1UPSA 4ISQA 4AW7A 1RUH3 2ZX4A 3AZVA 4Q0SA 5L7OC 4I0BA 1RUH1 3ASIA 2WNUA 1BQPA 3B69A 1LOEA 4Q4W2 3HT2A 4NWVA 3ZDSA 3CJIC 4ITCA 1XYNA 3ECQA 4KWKA 3B93A 5FPXA 1SACA 5EYXA 4I02A 3MIDA 3ILFA 1ULDA 2G9GA 3VKOA 4IEVA 3ZN5A 3THTA 1OD5A 1RUH2 2ZGLA 1YJKA 1Z7S3 2GN3A 2OVUA 2UY9A 1V6LA 3PMSA 5FAXA 4YVSA 1Z7S1 3AP9A 5L7OB 2BTVC 2DCTA 4TZDA 4LBLA 3UKNA 1CJPA 5FLJA 2VMGA 3FUQA 4MGIE 5FMOS 5FQ0B 3WT3A 3CJIB 3R0RA 3IN9A 5KHHA 5J09A 3MYXA 5T5JA 4FPOB 3EO6A 2ES3A 3VBRC 1NY71 4WM7A 4B4QA 1NCQA 3RYKA 1MS9A 5EYYA 3SLIA 1AJKA 2CTVA 3T1LA 4FPHA 4PBOA 4JQRA 4AI0A 1W0PA 1DFQA 1QXJA 4JGYC 3GZUC 1H9PA 1NY72 3OTFA 1AZDA 3I59A 3O0XA 1D0GA 3AYCA 4BYYA 1URXA 3KQRA 5GLWA 5BY5A 2VNOA 1I5ZA 2W0XA 3VBRB 1QU0A 1X36A 1YIFA 1ND3B 2XH6A 1QQP3 4ES9A 4K6BA 3Q9OA 4LBMA 3RI8A 1QQP1 2OUJA 4HT1T 4YG0A 3RYRA 5CNAA 2DFCA 4JGYB 3VZKA 1HLCA 4Q0PA 2GNDA 4Y1YA 3M8LA 1S0DA 1CR7A 1KD7A 2ZABA 4EV0A 5J37A 1WD3A 1QQP2 1ZZBA 1W6NB 3HR9A 2BWAA 3E6DA 1H2MA 2NQYA 3RYPA 4M3CA 4RQPA 4WM8B 2ZZJA 4E2QA 1RUF3 1X7NA 5GLZA 5JZGC 2D7FA 1DYKA 4YM0A 1KITA 1RUF1 3NAPA 1PZ9A 1UAIA 3VGIA 4HSJA 1A8MA 1WBLA 4XF1A 5I8SA 4B4PA 4UBGA 2ILMA 3KT4A 4MX3A 4V1PA 4DQAA 1OLRA 4MGZE 3KB5A 4PDWC 4LHLA 1RGSA 3ZYIB 3HIFA 1RUF2 4YFWA 5EV7A 2O1QA 2Q5TA 2R16A 1QXRA 2NN8A 2PHUA 4KU7A 4F7ZA 3B3QE 5JZGB 2ZAHA 2O8OA 5DXDA 1DGWA 2DVAA 2RMU3 4Q4X3 1BVP1 5E16A 1O3SA 2RMU1 4Q4X1 3ENRA 4XF4A 4IEWA 3ZFGA 3AZWA 2QE3A 1DBNA 2GALA 1XRUA 1H9WA 1AVBA 3E5QA 3LKJA 4PDWB 5GZGA 4COVA 1B09A 2X8KA 4YZ4A 4AFCA 4AFMA 1VIWB 2RMU2 4Q4X2 1WCSA 1Y7BA 2GNTA 3SISA 3VBFC 4Z1VA 4Y22A 4O9GA 1AR73 4KNCA 2JX9A 2BQPA 1NLRA 4F8AA 2PLV3 3O0WA 1AR71 1QOTA 1R1ZA 2B45X 2B5HA 4ZU7A 2PLV1 1HRV3 4NWWA 3JBG3 2V09A 1R093 2D40A 5FO8B 3AMQA 2ARXA 1O91A 1H2NA 4CP1A 1A3KA 1HRV1 3ZSKA 1SFNA 3JBG1 1R091 4BLJA 1JXNA 4BZ4A 1XYPA 1VALA 2WJSA 3KT7A 5J98B 3SH3A 3MLLA 4WVWA 4FPCA 1B35C 4GKYA 1LEMA 1YFXA 1AR72 5FCCA 4IV1A 3AFGA 3RG0A 2XJTA 3B02A 3WP6A 3X29B 5GZDA 1AYN3 5IK8A 1JTZX 1TNFA 1WW7A 3ES1A 1HRV2 2D6OX 4QPIC 3JBG2 1AYN1 1R092 4BLIA 4KH9A 1BVVA 3QCWA 1X33A 3H1WA 1HRI3 5KHJA 1ZZCA 2A70A 3ZN4A 4FPYA 4BQ1A 1LODA 3BU7A 3JD73 4A2UA 4DS0A 4Y1ZA 2PHTA 3O12A 5A33B 3JD71 3MIGA 5JVVA 3MI8A 3O5SA 3WG4A 4E2SA 3M2MA 1AYN2 1VBC3 1BK1A 1PHMA 1YFYA 3DPRC 1QGLA 3NJZA 2BFUS 3A0KA 4EN6B 1VBC1 1FXZA 5BYNA 4M01A 4WZFA 4FTBA 1HRI2 3TWIA 3O7OA 3MF9A 3NV3A 5C6CA 4L8QA 3BB6A 4QPIB 4ZU4A 3JD72 2V5YA 2XPJA 2QZ3A 1RUNA 1RUOA 1JOJA 2NZ9A 3QD6A 4KWJA 4AVAA 2ZPXA 3LA2A 3SXWA 2P3IA 1VBC2 2XL9A 3B94A 3FHIB 1F31A 2VVFA 2D98A 4S2GA 4XXAA 1VBD3 1LU1A 2ZGUA 2JE9A 4I30A 2JEMA 1PK6A 1VBD1 3AKQA 2FZ2A 1YXWA 5CFCA 4AF9A 5I0SA 1OSGA 2WQ4A 2OZJA 1YFUA 1QNYA 1YIPA 1RVF3 2WSUA 5T3NA 1FOD3 4L92A 1RINA 4I0AA 1RVF1 4E4ZA 5CBLA 1FOD1 4B3NA 3E97A 1VBD2 2P34A 4FPLA 4L9BA 3H3ZA 4MH0E 4JCKA 4R4XA 4HVQA 1LESA 5AFBA 1DQ2A 3MICA 5JI9A 4LO6B 3WNXA 1DLLA 2WT2A 2E9QA 4YG6A 1D4VB 2C1FA 2GMPA 4Q29A 1RUJ3 3BCWA 1RVF2 1AL23 1FOD2 5C4WB 2BBVA 1RUJ1 2YYOA 4QGMA 4N53C 1AL21 4YVWC 2XJPA 4EROA 2WLQA 3WUCA 3ZMOA 5JIAA 1X8EA 1X50A 5AC93 4E2GA 1GFF2 2JG9A 5AC91 1IZ3A 2IFWA 2ZGNA 4XJAA 3KZ4C 1C8M3 1RUJ2 4PF5A 4OUMA 1OQDA 1AL22 5GLTA 1RUI3 1C8M1 3IM0A 3RQ0A 3UL2A 3E5UA 4MXWA 1RUI1 4EN0A 4RA0A 1I9RA 3MEPA 1DGWX 1MS5A 1SLAA 2I74A 5AC92 4GKXA 4N53B 1V6JA 2O8QA 4HN1A 1UX6A 1S0FA 1FATA 4B8EA 3EJKA 1GANA 2XVLA 1LOFC 3OBTA 1FAYA 1C8M2 1Z0HA 3ZPYA 1RUI2 2D6NA 4XZPA 4GH4C 4CDXA 2ZCWA 4YW5A 2Z69A 5H9PA 3LB9A 2R0FA 5IUQA 3WP5A 3L9JT 5F5QA 3N36A 4BIFA 4DPNA 2Z42A 4JDNA 3TBDA 3AYDA 5FMOL 2QFEA 2E53A 1RUD2 4HN0A 2RS13 2EF6A 3GF6A 3AFKA 2RR13 3OGJA 2RS11 5C8CA 4GH4B 1FI2A 4CRQA 1H30A 4IEPA 3TN93 1QY4A 2C5DA 4K7JA 4XQ4A 3TN91 1W6OB 1QOSA 2DUPA 2E51A 1A8DA 3NVCA 2RS12 4I01A 2VQAA 1RTVA 2RR12 3I2DA 5T5OA 3ZMNA 3IPVA 5L73A 1Q8OA 3RS6A 3MW3A 4XF0A 3B5LB 3TN92 3VLBB 3B7MA 1O5LA 1EPZA 4XETA 4XHBA 4LBQB 1WBFA 1NCRC 4GB33 2WFF3 2TNFA 4GB31 1CONA 4R52A 3ZN6B 2WFF1 4RS5A 4KL1A 4M0HA 4AEDC 3AYEA 4DZGA 1LTEA 1QJU3 2BVVA 3MF6A 2WINB 3VBSB 4MV2A 2EALA 3IDEA 1QJU1 1FNZA 4HSLA 1ZX5A 2GAUA 4FXKB 3D6EA 4MZUA 4GMP0 4IEQA 4AVVA 4GB32 4A7ZA 2WFF2 2KM2A 2K2SA 2DVDA 3HD8B 1Y3TA 1Q8PA 4WBBA 1REEA 1C4RA 4YW1A 4GWNA 1NCRB 3NL1A 4N7IA 2Y0IA 1QJU2 2VOVA 5K9YA 5I91A 4X8NA 3NV1A 1ZYBA 3AMPA 4RHV3 4AEDB 4FTEA 1AXZA 1NXMA 4RHV1 1CESA 2AUYA 1W6QA 4XFGA 3ZYJB 4EN9B 4FAHA 2YDEA 1AUYA 3AM2A 4QQOA 2A3WA 2WC2A 1Y43B 4OULA 3HMYA 4AEJA 1UL9A 2B42B 3K51A 3CEWA 4CEYB 1PVXA 4META 2P2KA 2RJKA 1Y9QA 2YGLA 4RHV2 3VDDA 2WNVC 1GBGA 1PM7A 4XFIA 4OHYA 1VBA3 1WA4A 1VBA1 3VKMA 1ZVFA 4I3PA 1JW6A 4OHXA 2GMMA 4FPJA 1YJLA 4N7UA 4HK8A 4AEMA 2ET1A 4BH9A 2D6LX 2A6ZA 4YM3A 1UIKA 4AEKA 4IXLA 2XKPA 2W39A 1VBA2 3UJQA 4AVBA 2XKOA 3JUUA 5JPNB 1AJOA 2CNAA 2WNVB 4ATFA 1G7YA 4LHNA 1AF9A 5BNPB 4LA3A 1UD1A 1YUDA 3LSDA 2Q1ZB 2I2SA 4CEWC 1K5MA 2OUHA 2WL1A 4S2DA 4CTEA 2ZHLA 1U5ZA 3V0BA 5GZEA 2XGXA 4CDQC 4YGBA 4P9IA 1D4M1 3P3NA 1BXHA 2D6PA 4ATEA 1J1TA 2GC0A 2GDFA 1VAVA 1KS5A 3L2HA 5IK4A 2E7QA 1BYHA 3JB8A 2GH8A 5T5LA 4CDWA 4CEWB 4NOTA 1NYWA 2EAAA 1NE4A 2ZS6B 3M3OA 3OJBA 1S0IA 1J58A 5FREA 1WLCA 2VXRA 5D8AB 1LB2A 3JZVA 1YHFA 2HWC3 4AHYA 4JRLA 3WDYA 4E9KA 1QDOA 3B01A 3H7JA 2HWC1 2BFUL 4P9YA 1Q43A 4ZXKA 5C9AC 2YUEA 4J1XA 4UW6A 3WDVA 2ZGQA 1KJLA 4DNYA 2TBVA 4HPKA 3WW4A 3N7KA 2Z5WA 4NVPA 3ZX7A 2DVGA 2JG8C 4GXLA 1LHOA 4IERA 4Q4V3 3VZNA 2ARBA 2HWC2 2IXHA 1ASJ3 4Q4V1 1VJ2A 5ACA3 1W6PA 1DGRA 2A6WA 2BUKA 3ZXGA 5ACA1 4UW4A 3LWCA 3AYAA 1EAH3 4XFFA 1IKQA 3AMHA 3V64A 2WNUC 5C9AB 1EAH1 1QJY1 4DMIA 4HANA 1HW5A 3GHNA 3D0JA 4QGLA 4Q4V2 4FOWA 4G3YC 3B9CA 4QXKA 2VW1A 1ASJ2 1SLBA 2JG8B 3AKTA 5ACA2 4LLFA 3PVNA 4JTOA 1AR93 3LOBA 2XWBB 1POV0 3U10A 1EAH2 1AR91 3VZMA 4YVSC 3VHNA 2WKKA 1F5FA 2MHFA 2DVFA 4Y24A 1XYOA 2WNUB 3S30A 2XJSA 2HWE3 3NWKA 1WD4A 2XLAA 1AR92 2HWE1 3RZZA 5GKAC 2IXIA 2LTNA 3MFCA