3VGIA

The crystal structure of hyperthermophilic family 12 endocellulase from pyrococcus furiosus
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
270
structure length
270
Chain Sequence
KVLKIRYPDDGEWPGAPIDKDGDGNPEFYIEINLWNILNATGFAEMTYNLTSGVLHYVQQLDNIVLRDRSNWVHGYPEIFYGNKPWNANYATDGPIPLPSKVSNLTDFYLTISYKLEPKNGLPINFAIESWLTREAWRTTGINSDEQEVMIWIYYDGLQPAGSKVKEIVVPIIVNGTPVNATFEVWKANIGWEYVAFRIKTPIKEGTVTIPYGAFISVAANISSLPNYTELYLEDVEIGTEFGTPSTTSAHLEWWITNITLTPLDRPLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endoglucanase A
publication title Atomic resolution of the crystal structure of the hyperthermophilic family 12 endocellulase and stabilizing role of the DxDxDG calcium-binding motif in Pyrococcus furiosus.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 72
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vgiA00
1H1AA 5EJ3A 1BK1A 1H0BA 3AKSA 2BVVA 2F6BA 3ZSEA 2JEMA 3VZMA 1OA4A 1UU5A 1REEA 3VZKA 3WR0A 3VGIA 2DCKA 3MFCA 1T6GC 3B7MA 4HKLA 2DCZA 2C1FA 3WQ0A 2VG9A 4S2DA 3AMPA 1H4GA 3VL8A 1HV1A 1XYPA 1F5JA 3B5LB 3O7OA 3AKQA 2JENA 1XYOA 2QZ3A 2BWCA 1XNDA 4HKOA 1XYNA 3VL9A 4S2GA 4XQDA 1XNKA 1UU6A 1REFA 3VZLA 3LB9A 3VHPA 2VULA 3EXUA 3LGRA 2B42B 3WX5A 3HD8B 3VLBB 3RI8A 1OLQA 3VHNA 1AXKA 1W2UA 3MF9A 1M4WA 2DCJA 3VHOA 1C5IA 3VZOA 3VZJA 2D98A 4S2FA 1NLRA 1REDA 1UKRA 3WP4A 1H4HA 4NPRA 1KS4A 3MFAA 5K9YA 2BW8A 3AKPA 3WP3A 1HIXA 2VUJA 1H8VA 2B45X 2JICA 3WXPA 4IXLA 4H7MA 2QZ2A 1OA2A 3M4FA 1QH6A 3WQ1A 1QH7A 1YNAA 2Z79A 4XQ4A 1IGOA 1KS5A 5HXVA 4XPVA 1BVVA 3MF6A 1TE1B 2DCYA 4XQWA 2NLRA 1OLRA 5K7PA 2BWAA 3WP6A 4HK8A 1PVXA 3WY6A 3AMMA 3AMNA 1C5HA 2DFBA 3WQ7A 1ENXA 1OA3A 2B46X 3AMQA 3VZNA 3WP5A 1HV0A 1XNBA 2D97A 3AMHA 4HKWA 4S2HA 2VGDA 2NQYA 1XNCA 3AKRA 1BCXA 4HK9A 2DFCA 1XXNA 3RI9A 3WT3A 1UU4A 3AKTA
chains in the Genus database with same CATH superfamily
2GALA 1NQDA 1QJY3 2VMFA 2XONA 1FMD2 2IC1A 4RQPC 4WM7A 3RG0A 3VDBA 3ACGA 4XJ9A 1W6NA 5A7WB 4Y5Z0 4R8HA 4IV3C 2P3JA 2QJVA 1NA1C 1SBFA 2HWC3 4FFIA 2P3KA 3R4DB 4M4PA 5FP7A 1CX4A 4XYXA 2J22A 5HI0A 3C7HA 4MGKE 3I2OA 2VOXA 2XWJB 2OPKA 3CLPA 4AF9A 3MW3A 5TSWA 3O1OA 4BIOA 2VG9A 1DYKA 3WNMA 2VNOA 4C0BA 3THCA 1SCRA 2XH6A 3GGLA 5FCCA 1RHI1 2D44A 4CDWB 2PHUA 4LA2A 3H8RA 4QU1A 4QXBA 2VVEA 1WCUA 3ZYRA 1LOEA 2WBKA 4RS5A 2QTWB 4R52A 5CKQA 4TN7A 4N9IA 2SBAA 2GP3A 1CESA 1CAWB 1LGCA 5DAXA 5AFEA 2WQ8A 1WW6A 2VBDA 3E1F1 4HBNA 4CDUA 4RHV3 1ND3C 1DQ6A 4JV4A 3VBRC 1Q8PA 3VHRA 4RL7A 4A6SA 4QWNA 4BHPA 2A6XA 4A41A 4NHYA 4AFAA 2W5FA 3OYWB 5BYNA 4MV2A 4Q0QA 1YLLA 2EALA 1RXFA 5J7MA 1V6LA 5C8CB 3IDBB 1FMD1 2A73B 1T6BX 2IXCA 1V0AA 5DG2A 5FZLA 3WSOA 1RMU3 1G6NA 2W0XA 5FRAA 1AYM2 5GLTA 5JXIA 3ZFFB 3ZO0B 2P2KA 1E5IA 2AR6A 4TSVA 4YGBA 5GLWA 2YU2A 3LQCA 3O1TA 5FYCA 2D6OX 3O1UA 1UKRA 4RGKA 4ISRA 4EZHA 3AFGA 1S2BA 1H2NA 1JYWA 2QQJA 4E2SA 1CWPA 1J84A 2CWSA 5FO7B 3MDPA 3CO2A 2ZGLA 3CL1A 3A4UA 4K1ZA 5FV3A 2VM9A 4WBBA 4KWKA 1DF0A 2AUYA 2BFUL 2XJUA 5EJZB 5T5PA 1VBA3 2D3SA 3OGRA 5IWFA 1POV1 3CEWA 4H7MA 5FMBA 4PCRA 5DG1A 2VMIA 1QJU3 3ZFGB 4CCOA 4JTOA 1S0CA 4Y1ZA 4XQ4A 4D7YA 1EYBA 5BNPA 1R083 1S0JA 4XFBA 4URAA 3OY8B 1ZZ9A 2VR4A 5LEJA 4H7LA 5A33A 4YW5A 2Y64A 3KSCA 5JSRA 1QXPA 4CP2A 2RVAA 2VOVA 4JHTA 1N3OA 3WUCA 4FPHA 1BEV2 1OF4A 3KV4A 4OHZA 3WDYA 1TQ5A 4UW3A 1FI2A 2VMCA 3VKFC 4ZZ5A 2F17A 3VD9A 3KD4A 2NPIA 4IEQA 2PAKA 2VNVA 1AR93 4QGMA 3UGHA 3B94A 3L2YA 2VE1A 2D3RA 3AVSA 4QPGA 5EHDA 2E32A 3ASIA 2X05A 1RUH3 1AYM1 1HV0A 2D97A 3NWKA 5EWSA 2V5YA 4H2AA 2ZBJA 3NNJA 5BPXA 1WBLA 2XJSA 1IS5A 4ZONA 5FXWA 2ZX2A 4FSJA 2UYBA 1RUD3 4YW3A 3C7FA 1LHUA 1S1AA 5F1RA 1F4HA 5I0RA 1UU4A 2X5IA 4YGEA 5T5JA 1BK0A 2W39A 3LEIA 5LZ6A 4EROA 4BB3A 2HEVF 2RJ2A 4IETA 4UFKA 1OD5A 5FFOC 4FI9A 4AHXA 4CEWB 2GSYA 1W8OA 1OH4A 1WW4A 4I3GA 3K77A 4L11A 1DQ5A 1VBE3 4UAPA 5FZ6A 3ILRA 2A3XA 1LCLA 2W47A 3AZVA 1NY72 4MHRA 4NRQA 4XJZA 5JIAA 3ZMNA 4ORFA 4B1LA 4CDXC 1AZDA 4YARA 2D6KA 4BXFA 2WNUC 3SLIA 1VPHA 3BTXA 1ZRFA 1BBT3 4J1WA 4YFZA 3KHCA 1UAIA 1W8NA 1BEV1 1DU3D 1H8TC 5FYIA 4A45A 2A6ZA 1C57A 3A22A 4PDWC 5IVBA 1B35B 4P00B 4KGGA 5C7GA 3POWA 1JODA 1RUF3 2BJSA 2VMEA 3WD5A 1NZCA 4DS0A 4HOOA 4V2VA 3I49A 4CRQA 3FLRA 2YBPA 5L7OB 1QGLA 2ZGKA 4COZA 2IZWA 2VULA 3BOWA 2DUOA 4N90A 1JOPA 2XDVA 1RMU1 3P3PA 4YW7A 2ZMLA 3OF1A 3S30A 4IE4A 1V70A 3SH5A 1UOFA 3LKJA 3KQ4B 2UURA 4NMIA 3WINE 3T1LA 4QDQA 2GP5A 4LR4A 3USUA 2Q8OA 4MVTA 1MS3A 2VXJA 5FZ4A 4O7XA 4FXKB 3IB3A 4IE5A 1QNWA 2XVLA 3IPVB 3NVCA 3PL0A 4Q8LA 4AEMA 4CE8A 1I5PA 1A8DA 1NY71 5FUNA 1NXMA 3ZFEB 4FPCA 4BA6A 2CDPA 2XQXA 4Y22B 2ZXQA 4YGDA 4QD2A 3MHZA 4Z2WA 1V6KA 3JBG3 4UYBA 4MGYE 3K46A 5FPLA 3EYPA 3HNMA 2WAAA 4WVMA 1LHOA 1MQTC 1V00A 2ZGUA 3H0OA 2JDUA 1FOD3 4XXPA 1W04A 4TYSA 5A32B 3T09A 4LHNA 5LA1A 1A8MA 3OTFA 5D8AC 4XZPA 3HIFA 1X36A 2HKXA 1SLAA 2HWE3 1DDLA 1JYXA 3LIGA 5EP9A 1CAUA 5FO8B 1BVVA 4QPWA 4R9AA 4AEDC 4ASLA 3PURA 5FPXA 3DV8A 3UGGA 2BP6A 3PLQA 3HOBA 1Y9MA 5GZGA 2CAVA 2P6HA 4L8QA 4HFSA 1X82A 4XQWA 4E8CA 5LBEA 4XJWA 1WW7A 3IIIA 1W6MA 3NSTA 1IPJA 1RUH1 2IWGB 4Y5SA 3WNPA 4UFJA 3WY6A 1IKQA 4LBOA 4O61A 2VVDA 4EN6B 2YZ4A 2WA4A 3PUHA 3TNQA 1JBCA 3THDA 3MIDA 1Y43B 1QOOA 4YM0A 2Y6GA 3AZZA 4RGGA 3UESA 2ERFA 2E31A 5K8SA 4CU6A 1HN1A 2DBIA 3HQUA 5JCTA 4OYUA 1W9YA 1F2NA 1FATA 1Y7BA 2R0FA 3PVNA 2OIIA 4LBQA 2D40A 5T5OA 5DUXA 3E6DA 2VCMA 1RUC3 1KGYA 3VD3A 2Z4FA 2VNGA 1L7QA 3R05A 2HWF3 1PK6B 1NXD1 1PZ8A 1GZCA 1UL9A 2HBUA 4EN0A 5GZEA 1X8MA 1DGRN 1GANA 1N1SA 4KBZA 4XC9A 5JUVA 5C4WA 1GZTA 2PAMA 2RS52 3W9AA 1BBT1 3WR0A 4CPBA 3RJRA 1FV2A 1U5IA 3U78A 5F39A 1UOGA 3H1WA 4XFAA 3B7MA 1WA4A 3M3EA 1D4M2 4RQPB 4CCKA 4NIHA 3V65A 3J7NA 3LZZA 3M70A 2IUWA 3CIHA 4XJUA 2ENRA 4FPLA 1K42A 1BXHA 3FBMA 3FUQA 3VBUC 2A6WA 2MEV2 4N8MA 3POFA 1RUF1 1LB2A 5F6KA 3J7HA 4CDQA 4D6SA 3PMSA 2Q8DA 1QJX2 1PMHX 1WZXA 4AVCA 5J37A 1PNGA 1AR82 3E5XA 2H0BA 2BOIA 1LU1A 3V56A 1O3TA 4QXCA 4CCMA 2H6BA 1SPPA 3FC0A 1MS8A 4J25A 3AJYA 4LLOA 2Y6HA 3M7AA 3NKGA 3NMBA 5J36A 3VHPA 1GWKA 1RVF3 4G9SB 3NO8A 4LHLA 2J1EA 2PLV3 1NKGA 1EP0A 4IESA 4XF0A 2BNMA 2KD7A 2OX0A 2Q1MA 3TEYA 2IXHA 3RNSA 4QXHA 4JGZC 2J7MA 1ND3B 1XPWA 3VBHA 5KXDA 1REDA 1AJOA 3MLJA 4AI2A 1TZOA 1H6XA 5AVPA 2EIGA 1J83A 3Q8EA 4PQ9A 2GH2A 4Q4W2 2VVFA 4QGLA 1H2KA 4Q4Y2 3IM0A 3NQHA 1RUI2 5FY1A 4FPJA 3MBWA 4K20A 4AFCA 4GKYA 4QQPA 3JD72 4FTBA 1F31A 5JIUA 3N9OA 1GUIA 5JLVA 3H7YA 4OI2A 1WLDA 1QF3A 1ZRRA 2R063 3PVOA 2Z79A 2WO1A 1QJX1 1HRI2 4N43A 3VDDB 1KS5A 5APAA 1J3QA 4LITA 3N9PA 4LNVA 5EXOA 4Z8BA 1GICA 5L9RA 1CJDA 4Q0VA 1CD3G 1U5YA 1X33A 2IXKA 4YRDA 5F3EA 4BCUA 5C9AC 4Q5OA 3WCRA 1JYCA 2FDGA 3VUOA 1OLRA 2HWB3 1UIKA 5CFCC 2HYKA 2VECA 3ACLA 3U11A 5KXBA 3PUQA 1LOBA 5FLHA 3LPGA 2WZR2 5ANQA 2R043 2B46X 3CNAA 4P5HA 1RXGA 1Y9QA 1MS4A 1PZ7A 3IN9A 1ZYBA 5LK5A 3ZKUA 4AZZA 4BH9A 2TNFA 4FAGA 1RUC1 3AKRA 3RWNA 1UOJA 4A7KA 1RUG3 1AL0G 1KEXA 1NCRB 1XXNA 2HWF1 5ABJA 4XURA 3H1MA 3ACFA 3ZXEA 4DB5A 4BLIA 3F2ZA 2V73A 3RDIA 5D2AA 4XUTA 5A3WA 4Q4Y1 3WF4A 2RM23 5JZGA 3SH4A 1RUI1 1VRBA 1BLZA 3HBZA 3RZZA 4Q1RA 2BQPA 1HW5A 5DPNA 3NJYA 4ONUA 1XE8A 1Q43A 2VQUA 2Z69A 3NV1A 3WDTA 4AGGA 1OMIA 1EV12 2JDNA 2P37A 5FPUA 2WA3A 2DCKA 3HN1A 4R4ZA 2WZPP 2L9LA 4AEJA 1R1A3 3Q9OA 2KR2A 4LBKA 2EXIA 1TME3 1S0DA 2EF6A 3GCXA 5I93A 4S2DA 1K45A 2W94A 3MO4A 4WVWA 4EV0A 1CQ9A 1H4GA 3NW4A 4GH4A 3WHUA 3ZYFA 3C7GA 3R0RA 1WD4A 2RS32 1QNYA 4JDNA 1G9AA 4PBPA 2CAUA 5DAVA 1QDOA 3RZKA 4CDXB 4BISA 3VN4A 1NE4A 1UMHA 3ZXKA 2PLV1 3MEPA 2XBO3 3R4SA 4YZ2A 1IHMA 3BOPA 3WDWA 1GFF2 5HCAA 2D6LX 4NJ4A 4BMBA 2B42B 2PQSA 3RI8A 1NYWA 5FKCA 4PDWB 4AVSA 2GC3A 4MGIE 4GKXA 4JGYB 1O8PA 5A1AA 5B2GB 4OQ9A 2FDIA 1XB9A 4Q29A 2VAUA 5C8CC 1SCSA 3GALA 4Z92B 4HPKB 3PDQA 1W2OA 4QAWA 1EV11 4NPRA 1TMF3 1VP6A 1KS4A 1WMDA 2Y38A 2V72A 4HANA 2QFEA 3ENRA 3FWEA 3ZFFC 1VBD2 2GNBA 3B01A 4LBNA 3AXDA 3OJBA 3VD7A 5JMCA 1UZYA 3AKPA 3CZJA 4IEUA 4Q4X3 4YM2A 1OBNA 1IG0A 1O59A 2GDFA 3LDRA 1KITA 1IG3A 2K0GA 3HBKA 3SNMA 2EIEA 2FZ1A 4AI9A 1NOVA 2ADDA 2XJQA 4PLOA 4E4HA 3WF2A 3VBFA 3LSDA 5FPVA 3ZXFA 3J8F3 5HXVA 4AFDA 3IDCB 1FT9A 1H9WA 2YPJA 4YZ4A 3ZFGC 4XUOA 4ISQA 5GLZA 4BU2A 3W5NA 4JRLA 4LXLA 3S6PA 3A7QA 1W90A 4PF1A 4I3PA 1H2MA 5JOWA 3FN9A 3RMYA 3T4HB 1VRH3 2Z2SB 4AEDB 1EAH3 2ZKNA 4UFLA 5J3UA 4CSWA 4PI2A 5FY8A 3ZDSA 1YFWA 2RM21 2ZGQA 5FJHA 3RI9A 5JPMB 1PGW1 4HZFA 2JDMA 1W28A 4XDQA 5GJ6A 4DEQA 3VBRA 5FQ0B 5F2WA 2AEYA 2SLIA 3ELNA 4EWDA 1RUJ2 3MUY1 1GR3A 1S0GA 3KT4A 5JVVA 1CAXB 2NP0A 4NPMA 1RINA 2ARCA 4YG3A 1UU5A 2WN2A 1SLCA 4IW3A 3UJOA 4DZGA 3PU3A 1WCQA 2RV9A 3WCSA 1R1A1 4A3XA 1TME1 4CEWC 5FR3A 3SKJE 4AVAA 3AP4A 3CJIA 4K9SA 5FYVA 1O5LA 4D0QA 2DDUA 1RJ8A 4BYYA 3FX3A 5FZDA 3V0AA 3OBAA 2HJIA 3WF0A 5I0TA 1OKQA 3WW2A 4UF0A 2XHNA 2ARBA 2DUQA 3R4UA 3LFIA 1LRHA 5BNQA 5A7PA 2D93A 3KF3A 3U07A 3DN7A 5IHRA 2XBO1 1VAMA 1W6QA 1JZ3A 1GP6A 1WCSA 3ITQA 1OHFA 2A6YA 4P02B 1PIV2 2YXSA 1AJKA 5LEKA 1HXS3 4GAZA 5IFPA 1LENA 5IAVA 1S0IA 2ZEYA 4XFGA 5FK8A 2GC1A 1B35C 5I91A 4I0AA 3ZX7A 3KQRA 2UU8A 3V64A 1JXNA 1OD3A 2ZHLA 4XFFA 3VBUB 3GZEA 3OG2A 5BNOA 2BPA2 1O91A 4ZU5A 3AL6A 3LD8A 4W65A 3THPA 4GB33 1AXKA 2PHXA 3JQWA 1CVNA 4YYOA 5CEHA 4XAEA 4DY5A 1RUJ1 2AACA 3B9IA 4YVWA 4I01A 5F5AA 3WF3A 1W3XA 5FYMA 3C8XA 1UQXA 2ZGPA 4CZSA 3I4IA 4AI3A 5FP8A 4K3UA 1J58A 1CX1A 4A3ZA 1WBFA 2JKBA 3AP9A 2GH8A 5FAXA 5DUVA 1XRUA 4K1YA 3AP7A 2ZX1A 3MLKA 1MZ5A 3U0ZA 2KA3A 4R9CA 2UWCA 4GMP3 4MGZE 2B9UA 4DUXA 2FQPA 1OOPA 5IT6A 4C1XA 1ZA4A 2H6CA 1H8VA 1OFSA 1RL3A 2B45X 5A6QA 3GZTB 4XAAA 1OPMA 3OPWA 4R4XA 1DFQA 2JG8B 5BNPB 5LY1A 1VBB1 1LOGA 1QH6A 5IVFA 2XJPA 3VV1A 4XUPA 1DGLA 5A33B 1W6OA 5F5CA 4TLGA 3WDUA 4HETA 4XVHA 1O3QA 1PM4A 4RGAA 1EPWA 2ZX3A 1TE1B 2OVUA 4UXAA 4LE4A 1YHFA 1CR7A 3NV3A 1AR72 4QB6A 4N53A 3T0BA 2DVGA 1Q3EA 3TN93 1U0AA 1XE0A 5JAXA 4QX0A 1ASJ2 1Z7S2 4NWVA 3CBNA 4AQ6A 1VAKA 4M01A 2ZOEB 1AL23 5H9RA 5FUIA 1AX1A 2Y8KA 1DIWA 5FLIA 2NMOA 5FZAA 5C3RA 1ALYA 3PJYA 4IE6A 1PM7A 5J98B 2X8KA 4AYUA 5FP3A 4CP9A 4EJRA 4CCEA 4DOUA 4XF1A 4EN8B 4HKWA 1W9SA 3SH3A 4FBFA 1VLNA 3K75B 4NWWA 1D2SA 4BZ4A 3I97A 1DYPA 1RUE3 4KWLA 3S7IA 1UNBA 3GYDA 4E4SA 3A23A 4LBJA 4MLOA 1CZVA 4MX3A 4FPFA 4JKLA 3H8XA 2BV4A 1WLWA 1C1FA 1S0FA 3LSEA 5LB6A 1HJGA 4JAAA 2BVVA 3N9LA 3T2TA 4AHZA 1RHI2 3ACIA 2LS6A 2JX9A 3I3EA 3Q8FA 4DXZA 1VE0A 5IVVA 2WNVC 1NLQA 2MHFA 3MV11 3OSDA 1PK6C 5DN2A 2QCSB 1ENRA 2G9FA 2VJXA 4A6OA 3D6EA 4YFWA 4PIZA 4YM1A 2BFUS 4IGPA 2Y6KA 1JYIA 3W59A 4IEOA 3DF0A 5DAWA 4CUAA 3VBOA 1AR71 1OUSA 2WO7A 2VL4A 3MUZ1 4GA9A 3VL8A 2WNOA 3GXUA 1HV1A 2D5FA 2ZPXA 1YO8A 2NM1A 2QQKA 4IEVA 3FHQA 3T3YA 2VZVA 3GCWA 1UYYA 4FFGA 4UT5A 4LEJA 4XJAA 3LEMA 3Q8CA 1UX7A 3RZHA 1HXS1 1LESA 3AYDA 4IE0A 4GWIA 1LJ7A 2D5HA 1IZ3A 2RJKA 1XYNA 2DURA 1ACCA 1R093 5FZ8A 2XJTA 1MVEA 3LPFA 2G9GA 3BPSA 5JR7B 3VZLA 3GZAA 3LB9A 3CMGA 5D8AA 2PN5A 2YHJA 1J1LA 4GB31 1C8M2 3MIHA 3NAPA 3POJA 4HVRA 1ODNA 2BERA 2GC0A 2YGMA 3AZXA 4Q0UA 1U5ZA 3ZMOA 5HXMA 1OQEA 5LA0A 4LKDA 1HQLA 2BNOA 1UZ0A 3DPRA 4H3WA 2RS11 4NO4A 3DCQA 1OLME 4JKKA 4A7ZA 5FBZA 2QUOA 3AJZA 4Z1VA 1SFYA 4P9XA 2D98A 3WEZA 1PX3A 2R073 5H9QA 4CU7A 1UW8A 4EN9B 3NJXA 3PVEA 3DL3A 4OQ8A 3ZXGA 4ZKTB 4GMP1 1C8NA 4M3CA 4JX0A 4MXWA 2IFWA 1H4HA 4XABA 4C90A 3AYEA 4BQ5A 1K5MA 2EICA 4K8RB 4QHZA 5FPAA 5JSOA 2C9KA 2WZ8A 3FHIB 3MIBA 2JJ6A 3PTRB 4QDSA 2JICA 1YRZA 2VQTA 2BEOA 3ZN5A 5CBLA 4MZUA 1DZRA 1AR61 3HQXA 5JI9A 2JDYA 1YIPA 1W99A 3M4FA 1KJRA 3VD5A 1O3SA 1FV3A 2QE3A 1ULFA 4QMAA 3TEZA 1FXZA 3V0BA 5JOYA 3TN91 4UW5A 3W20A 2GNMA 4LIUA 2OUHA 3UT0A 2YROA 3M8LA 5LY2A 1QJY2 1ND2B 1LTEA 1SG3A 1GP4A 3H7JA 1JYTA 2UWBA 1C8M1 3DXUA 3VDDC 5K7PA 4MXVA 2VZSA 1NCQA 2ZHMA 5A1FA 3P5BA 5FMOL 2I2SA 2HWC2 1PZ9A 2WYFA 2D7FA 3B00A 4NRPA 4LHKA 5C3OA 4ZXKA 4HVOA 2RDNA 2VOKA 2ZACA 3ZR5A 3TEWA 1BQPA 1SFPA 4XFIA 3GM8A 4Y20B 5JOZA 2J1VA 3ZYPA 1O5UA 2A3WA 1GWLA 2AH2A 3I59A 4IV1C 2XJVA 4JZRA 5F3CA 2ZMNA 4F83A 3AP5A 4WM8A 4E2QA 2Z5WA 4E2GA 2Q8CA 1N47A 2K46A 1I6XA 3N35A 2ZAAA 1FYUA 4Y33A 4LUKA 5IK5A 1JU3A 3OBZA 3KWVA 3U4SA 2WT1A 1YC61 4OHYA 1NCRC 2WFF3 5EQUA 5I0UA 4EWAA 1XBFA 4CCLA 2JEMA 4QT6A 5E6HA 5CFDB 1VIWB 1AX0A 2LROA 2GN7A 4IEPA 5T54A 4RHV2 4DEVA 4HLTA 1COV3 5KHGA 1QMJA 2AREA 2VQAA 5FY5A 1DBNA 4R9BA 4B7EA 4FFHA 4URTA 5CU1A 4COVA 3VKNA 1VMFA 1QJY1 4P9YA 2FMYA 4C8DA 4IEYA 1GZ9A 2VOTA 1R1ZA 3BB6A 2ZGMA 1RMU2 1UXZA 3OB8A 1R091 3AXEA 2YYOA 3O7OA 5FZ7A 5BUVA 5F7UA 4KGQA 2HWC1 3RYPA 3TB0A 2BWCA 4O65A 4WV8A 4BK4A 3WF1A 3SC7X 3KV5A 4OVEA 1YQ8A 2ZGOA 3LA7A 5FY0A 4D7SA 1SLIA 2WSVA 1WCKA 3DYPA 4YM3A 3SHRA 1JTZX 1SFNA 3ACHA 3KT7A 4J1XA 4GD4A 4XHXA 5E8AA 5K0UA 3KGLA 1GZWB 1URXA 2BTVC 1ZNPA 5LK7B 3UYJA 4OMCA 4QKDA 4Y5TA 1YQ5A 2BBAA 2BBVA 3HD8B 5FYTA 1VBA2 3VLBB 4LT5A 5DDJ3 5C9AA 4Q2FA 1O4TA 2R071 1PHMA 1XNTA 4OULA 5M0TA 1QJU2 1HKDA 3VZJA 5FYSA 3OEAA 2VZ1A 2WAOA 1UF2C 3PNAA 3HVDA 3S0MA 1ULCA 4RHV1 4CEYA 3TYJA 4JGYC 5FWEA 4I0BA 1W8HA 1ZZ6A 1POV0 1XSRA 4O9EA 4A44A 3B3QE 4KMQA 2VH9A 5K9YA 3JUUA 5JWPA 1YJLA 3H9AA 4CXXA 1C4RA 1AR92 5IK8A 4DXTA 3CU7A 1WMEA 4OI0A 3TNPB 3KV9A 4LUMA 1RUH2 4N43B 4Z82A 1WKYA 4XBQA 2Q4SA 4NRMA 3UKNA 1IGOA 3BCWA 2YBKA 2V09A 3AL5A 1FPN3 1LECA 2WL1A 2X29A 4O9GA 5H9SA 1RUD2 1AVBA 3T2QA 5IYYA 2DVFA 3SCFA 1ZRDA 5CAZA 4DUVA 4XFHA 4ARYA 2ORXA 3ZXDA 4FQZA 5A7WA 1OSGA 4XW3A 1GKBA 1KXGA 1SBEA 3WDXA 4RR3C 3BVCA 3MPBA 3QACA 5FZCA 1VBA1 1S2KA 4FCAA 1VBE2 2A75A 5CIRA 5A3PA 5EV7A 1ENXA 1QJU1 3BALA 4ZHNA 3VZNA 1WLCA 1Q8SA 1R081 3VDCA 4ZU4A 4Y1VA 1JZ8A 4GQ7A 4LMFA 1BHGA 3IBMA 3ZN4A 3J9SA 2XJRA 1BBT2 1RJ7A 2IXJA 4CDWA 4L9BA 2WFF1 4YSFA 2FCUA 5CADA 3N9NA 1PMIA 1N1TA 4C0HA 3UV9A 1VMJA 5IVYA 1AR91 2F6BA 2LUWA 1X8EA 2VCBA 5T50A 3QLQA 5B4XA 3WNKA 3T0DA 4AHWA 2RS53 1YQ6A 2RR13 4WM7C 5K4LA 1QU0A 2IFRA 1S0EA 3IDAA 1RUF2 3RFRA 3SEEA 3W21A 4DPNA 2BRTA 1LULA 3JQXA 1D4M3 2RMU3 4LORA 1DGRA 3VKLA 3IZOA 2CGPA 3OYWA 3FUOA 1RUD1 3GBFA 3MFCA 3KZ4C 4M4RA 4JDMA 4XIKA 4B4QA 4DQAA 1QOSA 3RVHA 2FDFA 4B4PA 4CXWA 3CZUA 4GH4B 2MEV3 4H55A 3BTZA 3WLUA 4AW7A 5B4NA 1H1MA 2OZ6A 3OEBA 4LLFA 3S7EA 4EN7B 5FZGA 1GV9A 1X7NA 4YW4A 3ZFFA 2WDBA 1G9DA 2VZPA 2AGSA 2BYVE 3BKZA 2JENA 2WNVB 4W6XA 1HX6A 2VBPA 1VBE1 3IAQA 5BNNA 3TWIA 4QPIA 1APNA 3O1RA 4QQLA 1QHDA 3ST7A 2E51A 3I3DA 4BLJA 3PIGA 4LQRA 5JDBA 1OVSA 3M1HA 1U12A 3UL2A 4GALA 5DDJ1 2WQ4A 2FCTA 3JBG2 4MH0E 3ZOIA 2OKXA 3UGFA 1ZVFA 2XHKA 2XR4A 5FBJA 3W58A 4CDUC 5L9VA 4DNYA 2VMGA 2OQ6A 3ZFGA 2BGCA 2ADEA 1LEMA 4AGVA 3GJBA 3MF9A 4Y4YA 3MZHA 3OY8A 1J1TA 3S5QA 3ZYHA 2HWE2 3OUHA 1JMUB 5I8YA 4UFIA 4Q26A 5FZ1A 5FMCA 1V9U3 3WP4A 3NV2A 4META 4AI1A 4CU9A 4AOCA 4QM8A 3T1MA 1UPSA 1YYNA 2WS93 1PO13 3ZM8A 3WDVA 2CYFA 3FHAA 1HRV3 3IT8A 4M0NA 1ZBE3 3OD0A 2ZCWA 3WXPA 3VKOA 1HRI3 3ZYBA 1V6NA 4ES9A 3RQ0A 2PYTA 3H3ZA 2JG9B 4R9DA 1STMA 4FOWA 2VU9A 4KU7A 4Z07A 4XACA 1NG0A 3I2GA 2WR9A 2ZEZA 1W6PA 1WWYA 1BZWA 1YWKA 2JG8C 1MPXA 2WSUA 1RUC2 5BNPC 4NE9A 3UJQA 4BM8A 4CEWA 2HWF2 3AYCA 3JBG1 1UY0A 3FBYA 3ZIWA 4EWEA 4HXCA 4HK8A 5FZOB 4D94A 5FDBA 5JXHA 4ARXA 4UWDA 4FTEA 1FOD1 1V6IA 3D8CA 4BQWA 3N4MA 5KHHA 5J1XA 1LODA 4DRRA 1IS4A 3L2HA 3O14A 1F5FA 5FLJA 5HCFA 3IMNA 5I0SA 2VZ3A 4L97A 2HWE1 4LKSA 3LA2A 1GWMA 4FXGB 2FBEA 3N7JA 1AF9A 1XNCA 2NQYA 2G9ZA 2ZEXA 4JVAA 3H50A 1Y4WA 2YV8A 2C6SA 3JZVA 2J1UA 1S4CA 3ETQA 5FOJB 2R49A 4ASKA 5FWJA 2DTWA 3ILNA 2XVKA 1IS3A 2RR11 4ZXEA 1WCDJ 1B35A 5AVAA 4XDOA 2RG4A 2RMU1 3KLSA 2XUMA 3U10A 4CUCA 1XJAA 2D6PA 1LHVA 3QH6A 5IK4A 4D7TA 5FXZA 5L7OA 4MHUA 4B4RA 4IV1B 3WVJA 3V0AB 1ULPA 3ZFEA 1ZBA3 2CTVA 5C5TA 1YJKA 1RVF2 1CZSA 2C1FA 1I1EA 4YWAA 5CISA 2PLV2 3MW4A 4W6WA 2W68A 1W3VA 4XUNA 2RS33 4AL9A 4Y1XA 3KB5A 4K21A 1IKPA 1LEDA 4OCTA 5LASA 1DG6A 1DQ1A 1O6UA 2B7YA 1ZX5A 4KL1A 3K48A 5E88A 2CHHA 2W95A 2CGNA 1V6JA 2P3IA 2A70A 2VZTA 5DUWA 4BQYA 3IPVA 1ULEA 4NPLA 2VZQA 4DY3A 1DLLA 3VDAA 1MS9A 3ATGA 3HPNA 2EAKA 3PMEA 3POGA 1XNDA 2VPVA 3CF6E 2DVAA 1KJLA 3BN6A 1UU6A 1KDMA 4GULA 3MGUA 3TRSB 1GQPA 2H0VA 3K4ZA 2DVBA 3N7KA 4QX3A 1E5RA 1JZ6A 1UYZA 4FOQA 5BNOB 1W03A 3JU9A 3LCPA 4LULA 1ONAA 5FPZA 2FDHA 3ORJA 1QJEA 3CDZB 1CAVB 1IPKA 4IE7A 4YVSB 4QX2A 4IGOA 3HAGA 3SKVA 4YVWB 5FZIA 2R062 1A3KA 4Q4V3 5DAPA 1DQ2A 3WV6A 2QQNA 5ACA3 5AC93 1PO23 2VCAA 1C5IA 1IPSA 3VZOA 3FL7A 3MLLA 3FZ3A 4CUBA 2W52A 3BIEA 4UFMA 3HQRA 2ARXA 1VBD3 4OI1A 4E4DX 1PO11 2JE8A 2QDNA 3UNPA 1NAEA 3RWKX 1GLHA 1H1IA 1MACA 2WT0A 4LK6A 1CONA 1RVF1 3VBSB 2VTXA 2HWB2 4Y4RA 5D1IA 4K7JA 5E89A 5FREA 1XNAA 2PAEA 2E53A 4AGRA 5C6CA 5I8SA 1CGPA 5CB7A 2Q0AA 1OQDA 2OW4A 2XLFA 2YC2A 1GP5A 1GSLA 2R042 3SISA 1C3HA 3NRUA 3H3UA 4Y26A 1TNRA 1QH7A 4Q8KA 3GNEA 2VW1A 1H30A 4F7ZA 1GQHA 4Y1UA 3C2UA 5C70A 4FO9A 4N53B 4C1WA 3I2JA 1PK6A 4SBVA 5EYYA 2V5DA 1DQ4A 2JDKA 2WT2A 3KCYA 2RM22 4OHXA 1K5JA 1UIJA 5F8PA 4CP1A 1MZ6A 5EJ1B 1LOFA 1PGW2 2R0HA 1Q8OA 3RZGA 1QJFA 3H1YA 4AWDA 2OS2A 1ND2C 5DXDA 4DUWA 3MICA 1C5HA 1N1VA 2R061 4INDA 4AG4A 4BMEA 1RC6A 3PHMA 1SEFA 2Y34A 1XNBA 1DZQA 1CPMA 1OH3A 2IXIA 5FXVA 5ERLA 3ILFA 4RQPA 5G05L 1HB1A 3NKTA 2DFCA 1QQP3 1R1A2 3EB7A 3QBQA 3ZN6B 1TME2 4H14A 4I02A 3C7EA 1OURA 4IV3A 2XWBB 5LBBA 3T30A 2WYSA 1KFXL 2AC1A 1NA1A 1VBC3 2WUHA 3K3NA 4RR3B 3D0SA 4UBHA 5DZGA 3BU0A 4NIGA 5SV8A 3T0AA 3BUCA 2HWB1 3P3NA 4CCDA 5FZ0A 5LA9A 4JTNA 2A7AA 1SZBA 1AYN3 5GZCA 1ZZ8A 3MIFA 1OA4A 2R041 1ZBA1 5DAQA 3KT1A 3DECA 1HB3A 5LA2A 5A6ZA 1JZ4A 1UYPA 2XBO2 4P9LA 4AK3A 5FZMA 1HJFA 5C3PA 3W5MA 4BK5A 1RUG1 1ULOA 1NX9A 1QOTA 2YFUA 2QDRA 3AVRA 2YY1A 2VQ0A 5DUUA 5CFDC 4C91A 3BTYA 1UKGA 3EO6A 1HN0A 3KF5A 5L36A 4ZPIA 5FOBB 2B39A 2JIJA 3JB8A 3PUAA 2DV9A 4BQ3A 4DINB 4QKNA 1O7FA 5GLUA 2D3PA 4WM7B 2QQVA 1Q56A 4CCCA 3AK0A 3M3OA 1ND3A 1W6NB 3BGAA 1MEC3 5FZ9A 3K3OA 3AYAA 2WQZC 2JIGA 1SMVA 5A6XA 4CDQC 3LEGA 4NIAA 4QX1A 2O8OA 4N7IA 2GNDA 4W8JA 4Q4X2 4NAMA 4LOTA 1M06G 2VO5A 1JOBA 2PHRA 5AC91 5ACA1 1OFNA 1PO21 2WJSA 4IGQA 1A6CA 1UZWA 2Y6FA 3RYKA 2C9AA 5L9BA 3RSJA 3VHNA 3I2KA 4OFGA 1O4ZA 3A0NA 2C24A 3FLPA 3VDDA 1I3HA 3VHOA 5A3NA 3APBA 2XG3A 4XMAA 4OZOA 4RS5B 3J8F2 5F3IA 3IAPA 2NYYA 4MADA 1CZTA 4XHBA 1VBB2 1JI6A 3C3VA 1K5MB 1N3QA 2J1RA 1EUUA 3SEPA 5F5QA 4CDUB 3VBHC 5IVCA 5KHIA 2W46A 1ZZBA 3RJ2X 3IMMA 3ZSKA 3JCIA 4AQ2A 4ET7A 3GJAA 2B8MA 5H9PA 5A7NA 3NNGA 2CY6A 2HYXA 3X29B 4B29A 4QQOA 3WP3A 3WNXA 1UXXX 1NZIA 4P5YA 2PQQA 1ULDA 1DLCA 2HWD3 2OUJA 1W9WA 2O8QA 3V0BB 2W3JA 3WQ1A 1EAH2 1EUTA 2YC0A 1NCRA 4MO3M 3OD4A 1K3IA 2I07B 4F3JA 5E16A 4FOYA 1QWRA 1TMF1 1UPIA 2J1SA 4AAXA 4N43C 4D6RA 1VMHA 2PFWA 4AFBA 1PVC3 4LOSA 1PX4A 2NLRA 4Q4X1 5C3QA 2YG0A 5DZFA 3WG4A 2X09A 4EE2A 3ROUA 1VJ2A 2UY9A 5FZFA 3P6BA 4XF4A 2YUEA 2ATFA 5KXEA 4OHWA 1UZZA 2XUEA 1OA3A 3I8TA 3T2PA 1JYNA 1W0PA 4ZS3A 2PMWB 2ZAHA 1DGWA 5IJRA 4A7YA 2GAUA 4YGCA 3J8F1 4S2HA 3I59B 4HK9A 4GXLA 2JDZA 4XEZA 5HCBA 1BJQA 4DMIA 4NIIA 3WT3A 2ZHKA 2BUKA 2QBXA 3O0WA 1KQRA 2R1DA 1YFXA 3DYOA 1H1AA 1NLSA 4CPBD 1RHI3 4LIVA 4AXOA 1SDDB 5T5LA 2JKXA 3L9JT 1ZA7A 2YFZA 4GJYA 4CDXA 2BDRA 1VRH1 2K2SA 3POBA 2WNUA 2YBSA 1Z0HA 3USSA 1YI7A 2OA2A 3D5OA 1I9RA 3FE5A 3HWJA 1EAH1 1HXS2 3POSA 3OCPA 4FQ4A 5DZEA 3VB9A 3MIGA 1Y9GA 3IWZA 3KM5A 4A42A 1F9KA 2LM3A 1H8TA 4P9JA 1DZTA 3KS7A 2EIBA 2ZJCA 3O0VA 3PVBB 4PIXA 4PDWA 5EYXA 4PI0A 5F32A 3ECQA 5FXXA 4F8AA 4NIDA 2EXKA 4JGYA 3K51A 1FMD3 2X5IB 4G4FA 4GB32 3I7DA 1F5JA 3E5UA 4LO5B 2BVBA 1DP0A 2ZABA 4PF5A 4AAPA 2NN8A 3ME2A 4GH4C 4HPKA 3RYRA 1EY2A 3BYWA 2JWPA 2RS12 4S2GA 5CVRA 5J96B 3WZ1A 3ZYGA 2PELA 2G1MA 4FPGA 1E57A 3ZDVA 1LAJA 1XE7A 4KG8A 4DXSA 1G86A 5FMOS 4YW2A 5GALA 1CN1A 5GKAC 5FMDA 2EA7A 1I5ZA 1V6MA 4KQ7A 3DXTA 1HDKA 2RDQA 4OUSA 3AX4A 1H9PA 3BU7A 4P9WA 5A3OA 4OLLA 3ZIXA 1AR62 4FPOB 2ZA9A 2JB4A 3K2OA 2CNAA 1W2AX 2PHDA 3H8UA 5G04L 1NE6A 1YFYA 5FYZA 3ZYJB 4CTEA 4YZ1A 4DRVA 1MQTA 4BPZA 3N9QA 3TN92 4N9HA 4NVPA 2ZMKA 5KHKA 3POIA 4ATFA 2HWD1 1AL22 2FMDA 2JD9A 4DIQA 4CXYA 1A34A 2CL2A 1GU3A 4XTPA 4Y3OA 2VUJA 5A3TA 4LBMA 2UYAA 1UMZA 2ZHNA 2MPFA 2WWSA 4KNCA 5FPBA 4AEDA 1RTVA 1C1LA 1AYM3 1WLTA 2ZZJA 3D0JA 4PHZA 3MPPG 3LF7A 1PVC1 2JDPA 2TUNA 2BNNA 1SBDA 1RUE2 4XPVA 4V1PA 2RE9A 2UWAA 1D0GA 3MI8A 4AFMA 1UX6A 2JG9C 3VBFC 4AE2A 5FQ0A 2R6QA 3BI3A 3HMYA 3I3BA 4MG2A 2BOJA 2GNTA 4RN5A 2FDKA 1CAXA 2ILMA 2YU1A 1KD7A 3E5QA 2EAAA 4WVMB 1RITA 1HQNA 2DBNA 3IDEA 3PTYA 1S0BA 5LCWL 2CGOA 3N7MA 2JXAA 3FLTA 1SLBA 1L7RA 1RIRA 4GIQA 3WW3A 5CG8A 1XU1A 2VGDA 3WG3A 2CDOA 1OXCA 2J1TA 1JOJA 4KWUA 5J48A 1DGWX 1CAUB 4MSVA 1D0HA 4U36A 2LRPA 3OPZA 4YZ5A 5L73A 3S57A 3OBRA 2XLGA 1BEV3 1UN1A 3B93A 3AZYA 2A71A 1AL21 4K8FA 2I45A 3WNNA 1POQA 4JDOA 2Q30A 1W6MB 2C26A 4QB2A 1IOAA 4KH9A 3VZMA 1R092 2ORZA 1REEA 3I2FA 4WZCA 4E27A 3GBWA 1W0OA 1RB8G 3LDKA 3SCGA 2O14A 2VCCA 3VGIA 2P3YA 2OQ7A 4I2OA 2WFPA 1WMXA 1RUE1 4Q27A 4NOTA 3VBUA 1JUIA 3OOXA 4QXKA 4X8NA 1AUYA 2G19A 3LA3A 4LBQB 5JI7A 2JB8A 5KWRA 3HJRA 3CJIC 4IEWA 1UCXA 2PXJA 2KXLA 3NNMA 1SHWB 2VUCA 4M00A 1IS6A 5BNNB 2FZ2A 2VUDA 5A7OA 2ID4A 4QPIB 2QZ3A 2R072 1Q5OA 1HB4A 3QH7A 4QKFA 1XC6A 1S55A 3POEA 4GJZA 5DABA 1YUDA 3VL9A 1GMMA 2XMLA 3FFZA 4XQDA 4ZY9A 3UKVA 5C4WB 1YFUA 3T4VA 1AXYA 2JE9A 2MNGA 3NJZA 1X50A 1KDKA 3JXSA 2E33A 5FKBA 4TZDA 3PUIA 4D69A 4CU8A 5I8TA 1MZEA 2XL9A 2BGOA 2A6VA 1OT5A 3A21A 3WX5A 2WZEA 4LO7A 4JGZA 4TLFA 1JH5A 3RRDA 4E9KA 2JG8A 4LHSA 3DKQA 4GMP0 1YCIA 1LGNA 3RS6A 4CCNA 1QEXA 5J09A 3NJVA 2AYHA 4XF3A 5BNOC 1PNFA 1UO9A 3KVBA 2Z42A 4CDQB 1CIWA 1NLRA 1JW6A 1DYOA 4YVSC 2TEPA 4FT8A 4K6BA 4UW4A 4YVWC 1ST8A 2P1BA 1W05A 4L0PA 1D7PM 4Q0SA 1DHKB 3FJSA 2VBBA 1SPPB 2PA7A 2V4VA 2XOMA 4XDPA 5FYHA 4D8MA 5EFUA 4X8PA 5CNAA 2D6NA 2F4LA 3HNBM 1WD3A 2ZS6B 4UBGA 2W9XA 4IXLA 4COWA 3D4KA 3LE0A 5FO9B 1OOPC 3VBSC 2UY8A 3LOBA 4RFT0 4YG0A 3AC0A 1W6PB 5CYYA 4W4ZA 1GQGA 1YIFA 2E63A 3VBHB 3MF6A 1R082 5CFCA 4NN0A 1NQJA 3G7DA 4AI8A 5C3SA 4XETA 4XBLA 4QB1A 4LE3A 4XMIA 4BE3A 2QQLA 2BWAA 3G6JB 3WP6A 2WFF2 5D21A 5DMYA 4EQVA 2WLQA 4JC1A 2DCTA 5FY7A 4N53C 2RDSA 3KV6A 1DQ0A 3DUIA 3O1PA 2O0OA 2A3YA 5E1RA 2ZGTA 3QOPA 1MR5A 4L99A 1BMV2 1SLTA 1ZZCA 1COV2 4IUGA 2E7AA 1CIYA 1LGBA 1GBGA 3RMXA 2FD8A 3FMGA 5KR7A 4Y24A 3GF6A 2VD7A 3AFKA 3EJKA 3H8OA 2GN3A 2ZGRA 1QY4A 4XOGA 1UOBA 2W2IA 4U2AA 4W6YA 5HV0A 2VZOA 2R16A 3IIAA 2AENA 4I09A 1SQ4A 4MYEA 2XL7A 4HT1T 4LO4B 3Q8BA 5CG9A 5KBFA 4A2UA 2PTMA 5A7QA 5FY4A 3UK9A 3I2IA 5HBAA 1YXWA 2GMPA 3E6BA 3VZKA 4YW6A 1L3JA 2QQOA 1FX5A 3NV4A 3HR9A 2QQPA 4NHLA 1H6YA 1QXJA 3O5SA 5F6LB 3WQ0A 4AHYA 3SQOA 2XB6C 4CVUA 5ABJB 5A6YA 3K4DA 5DDJ2 2R7EB 2X53S 4FFFA 2G4IA 3SCHA 1CPNA 4COUA 1EPZA 4RA0A 1OC1A 1S2EA 1XU2A 4WVZA 5FYYA 3VBOC 2N7GA 3ABZA 2YC4A 2VMDA 4IL7A 3WNLA 5JZGB 1O3RA 1BMV1 2XPJA 4FP3A 1JN2P 4DFSA 1JZ2A 4FPKA 1CAWA 1COV1 1XNKA 1VAVA 1YEWA 4TXWA 3BODA 2OYZA 3LFMA 1P8JA 1BKZA 2O1QA 2GMMA 4P9GA 1G9CA 2WABA 4QX8A 1OLQA 3CKHA 4HVQA 5C8CA 2P4EA 5I0DA 1W2UA 3NAPC 5AFBA 1RUNA 4FPYA 1AX2A 1LOCA 3MW2A 2D6MA 1KFUL 4QGNA 4XZUG 1FPN2 3ZKYA 2Y6JA 1QJX3 4PJYA 2YMZA 3DYMA 4P9IA 4S2FA 3WUDA 3INAA 4HL0A 1AR83 3DPRC 5IAXA 1ND2A 2E26A 2BZDA 3J26N 1G8WA 1VB2A 3ZSLA 2ZGNA 1YQ2A 4QPYA 2Y0OA 2IVIB 1O4YA 2E9QA 2EXJA 2VW0A 4LPLA 4RS5C 4X6RB 4B7KA 1UY3A 2BW8A 3RPQA 1VR3A 1K5MC 2K9ZA 4PIYA 4E4ZA 2OT7A 2C0ZA 4Y20A 1FOD2 2HEWF 3BIWE 5IFTA 3WOGA 2PHFA 2V4AA 1GOGA 1GYKA 3K4AA 5IW0A 2WNEA 5T52A 3C7OA 1HB2A 3CJXA 4AR2A 4B3NA 3OGGA 2WKKA 3RZJA 3USUB 4Q4W3 4MGTA 2ETEA 2OZJA 4AEKA 4Q4Y3 5EPAA 5FP4A 1PVXA 1RUI3 5CFDA 2RJLA 2RR12 3AMMA 2Q1ZB 3JD73 4FOVA 2EXHA 2JDAA 2CU5A 3WQ7A 2B9VA 2GZWA 4I0WB 2Y6LA 1NCQC 1GNYA 1OVPA 2RMU2 2HBTA 1OUXA 3I3QA 4LK7A 1FPN1 4W50A 5IK7A 4XILA 5FYBA 5C5UA 2Y60A 2WINB 3M3IA 4IV3B 1VALA 4ITCA 3VBFB 1J3RA 1N3PA 1XSQA 2GMEA 3HN3A 4UW6A 1NA1B 5ISLA 4GWMA 3AMNA 3WQBA 4BIFA 4V2WA 1X9PA 4BQ2A 4CUGA 1FNZA 2WC2A 4DO0A 1BK1A 1W8ZA 3AKSA 4HONA 4XTMA 3MYXA 2ZX0A 2DU0A 4OMDA 4WM8C 3LDBA 3KHBA 2ZKLA 1UY1A 3OBTA 3ZSEA 4IQPA 4M3CE 5JR2A 4IDZA 2WZR3 4IERA 4B1MA 3LOIA 4MGSA 4QHBA 4L92A 1GZWA 1T2XA 4M3CF 3AB0A 3WG2A 3QCWA 2HH9A 1AXZA 2YB7A 4QKBA 2Q1FA 3LAGA 5FY9A 4QPGC 3OGSA 1ZZ7A 2GU9A 1J59A 3VBRB 4TWTA 2EVXA 3BTAA 1XYOA 3KMHA 2RS51 1OF3A 3HT2A 4AQTA 2JDHA 4IEXA 2AZ5A 3N9MA 5CKMA 2W08A 2X5IC 2E7QA 3I2DA 4QQHA 1V9U2 1D4M1 2VZUA 1JZ5A 2CV6A 1ZM1A 1RUOA 1EV13 1LNSA 3T08A 1JUHA 5C33A 1UD1A 1RYYA 2WS92 4OHVA 3CJIB 1PO12 4COYA 4BOWA 2ZZQA 2MEV1 3E97A 4BQXA 4XE9A 1HRV2 5K0UC 2R1BA 1ZBE2 1G7YA 1JS9A 1UWWA 4UF0B 4Q0PA 1LHNA 1AR81 2RHPA 5ANNA 3A0KA 3J7LA 2DCJA 3ES4A 4Z2AA 1WUVA 3OUJA 2QNKA 5A70A 3TBDA 1W6QB 4FAHA 5FZBA 4QHOA 4AQSA 1H2LA 2ZX4A 4PQQA 4UFHA 5IUQA 3Q8AA 1W0NA 1IQDC 3B69A 4Y22A 1UY4A 4CP0A 4CEYC 1DCSA 5FZ3A 1E5SA 4D3WA 2JECA 3D3AA 2R30A 4HG6B 4RFRB 4LA3A 5BXXA 4HSLA 2XKOA 2XKPA 3H42B 4RSUA 3KCCA 3POYA 4RYDA 5A32A 3KCXA 1UMIA 3T2OA 3N36A 3FFQA 1MS1A 2GC2A 3B9CA 4Q4W1 1V9U1 2A5ZA 2VOWA 4CYDA 3EQEA 4XXAA 5DQ0A 2FDJA 1ZRIA 2ZEWA 2B4KA 4OI4A 2WS91 3DGTA 3JD71 1GNZA 1LHWA 2W1WA 4YZ3A 5GM0A 3HEIA 1JHJA 2DU1A 4AVBA 4GWJA 2F4PA 1HRV1 3GHNA 1OOPB 1ZBE1 1G9FA 2VTXJ 1HRI1 1W8TA 5FZKA 5CA6A 3N7LA 3MV01 4LKEA 2BU9A 5FJKA 4QU2A 3I3MA 2RDRA 3JB4C 1NUKA 1OLMA 4OUMA 2HEYF 1ZBA2 1BCXA 1TVGA 2C5DA 4NAOA 4YPJA 4JHZA 3E6CC 1UY2A 1W6OB 5GZDA 3ON7A 3AKTA 3LIHA 1BYHA 1RUG2 3UETA 3S5AA 3PJQA 1Q8QA 3BPZA 2YDEA 4JQRA 2WNVA 3O1MA 1LKNA 4TTGA 2WZR1 4NUBA 3U4XA 4CDWC 3WW4A 1UYXA 3URFA 4KBBA 2QQUA 2WNUB 1QKQA 3I2HA 1B09A 3UKTA 3ZSMA 1N1YA 4LTAA 5C8WA 1W8FA 1QIQA 3GHMA 1H8TB 4UI9L 3TOJA 4MOAA 2X10A 1T6GC 3GZUC 4HKLA 2PHWA 3EHKA 5A80A 3RGBA 4CP9B 3ES1A 1C28A 2HLEA 2B5HA 4HMZA 3AP6A 5A1LA 4FPEA 2DTYA 2DUPA 2PHTA 3AMPA 4MGQA 4XFCA 4NHMA 2DVDA 5F5IA 3ZPOA 1W8UA 4Q4V2 4QQ2A 5AC92 2DYCA 3AKQA 5ACA2 1JZ7A 1PO22 2J1AA 1TNFA 1G9BA 1RUJ3 2IXLA 5T55A 2W1UA 3VKMA 2LTNA 2VTFA 5EIYB 4DXRA 2WN3A 3N3HA 4WZFA 2E7TA 5IVJA 1REFA 2E6VA 5BNNC 1MVQA 3ZLIA 1A78A 2J42A 3O0XA 4HSJA 4NHXA 4IEZA 4QPIC 3EMRA 4SLIA 4XJ8A 1F35A 2VC9A 2XQRA 2P5BA 2WWJA 5FIXA 2RS31 3WNOA 5C4WC 2FHRA 1V6OA 3ZVXA 4PT6A 3NNLA 4J6GA 5HPOA 2JG9A 2LALA 3VBOB 2VW2A 4XCAA 5LBCA 5T3NA 3R6SA 2XGXA 3AZWA 3CQOA 4XUQA 1QXRA 1WA6X 1VBB3 4XBNA 1GOFA 2VY0A 4BQ1A 2WLPA 1JU4A 3OUIA 1MS0A 1KRIA 2Y26A 1MQTB 1PIV3 5C71A 4E8DA 5LWBA 1U5XA 5LRRA 2XVGA 3ALQA 5FZOA 1TMF2 5D8AB 4NR1A 5F9TA 4PBOA 3U14A 3NAPB 1LU2A 4KG0A 4RD7A 3M3QA 1OKOA 1MZFA 3VD4A 4Q4V1 3PU8A 4X6QB 1O8SA 4Y1YA 4QX5A 4LO6B 3KVAA 3ZPYA 2P17A 3DPRB 2ZTNA 3O12A 4P14A 3O1VA 5CZKA 5IATA 1QQP2 1F15A 5A3UA 1VBD1 3F95A 2QVSB 1ZREA 2CSGA 3WHTA 4XF9A 5HV4A 1JYVA 1AHSA 1VBC2 3SXWA 4CA9A 2CWMA 1LOAA 4M3CB 4MXWB 4P08A 4PLNA 4UOJA 3WG1A 4B8EA 2QQMA 2TBVA 4K40A 1Y3TA 3GBGA 3RZLA 4ASMB 2FCVA 4FVVA 4ZU7A 4MUVA 5FTTC 4FTSA 2IVJA 1AYN2 2W1QA 3QD6A 1RGSA 2OPWA 2ZGSA 4L2NA 2C4XA 2P6CA 4IV1A 5A7SA 1PGSA 4LO8A 3WP5A 4JCKA 2W87A 3J4UH 4JQTA 4QPGB 4KI5M 1YI9A 1VRH2 2R32A 3DKWA 3ETPA 3J7MA 5F2SA 3OGJA 4LBLA 1W2NA 2P34A 3U1XA 2ARAA 1MS5A 3MIEA 2Y33A 2QQIA 3H3LA 3OPTA 1AR73 4LJHA 2WWUA 3EBRA 1H0BA 3GDBA 1ASJ3 1Z7S3 5EJ3A 2PHLA 4ES8A 5KXCA 4BWOA 1WGPA 3TAYA 2EIDA 1MEC2 1W8WA 4YNIA 5JXGA 5L19A 1NCQB 3LEKA 1XQNA 5SV5A 5BY5A 2NMNA 5LATA 1WW5A 2KM2A 5JPNB 5FZHA 3B02A 1UZVA 4JKMA 1W9FA 4LBQD 4AVVA 1US2A 3ZXLA 2W1SA 2JE7A 3CHXA 1QQP1 5LW9A 2XLAA 2DCZA 4NROA 5LBFA 5LRSA 1GOHA 1VBC1 1X9TA 1CAVA 2VMHA 5L7OC 4YVSA 1ODMA 4M0HA 3HT1A 3ZFEC 4WM8B 1XYPA 3B5LB 2WRAA 5GZFA 5FUPA 4LKFA 1ZRCA 4ZS2A 3ZXJA 4WVVA 5CKNA 2RS13 2VNRA 1AYN1 5FK7A 1BVP1 2JD4A 5ABJC 1FAYA 1W9TA 4HKOA 4BXSV 4BQ4A 1CJPA 1OI6A 1E5HA 2OXBA 3KGZA 1GNHA 1J3PA 4PLMA 1D4VB 4YLZA 3WW1A 4BDVB 4BJ0A 3VBSA 1SDWA 2ET7A 4ATEA 5IVEA 2DF7A 5A3MA 5JZGC 2W92A 3EXUA 3LGRA 1F8VA 4JGZB 4KU8A 1W39A 2YPDA 1FNYA 1PMJX 1TEIA 1Q8VA 2I74A 2LW8A 1HQWA 3THTA 2D43A 1NT0A 4HN0A 4N7UA 4A4AA 2HWD2 3DEMA 4G3YC 5JMOA 2ET1A 1PGL2 5GLVA 4EZ4A 1W2TA 1AR63 1MEC1 1PIV1 1M4WA 2VZRA 3PIJA 1W06A 4GZ9A 5F3GA 1SLLA 4I30A 2Y0IA 2QKDA 2YGLA 3IKWA 3ZYIB 4XIOA 4YG6A 2A1XA 4EYUA 5BV6A 3MFAA 1PVC2 4FP2A 2Q5TA 1F4AA 2WIIB 3LWCA 4AI0A 5K0UB 2AEZA 3TEXA 1C8M3 2XXZA 3PUSA 3HNYM 2VXRA 1HIXA 3M2MA 1HLCA 4KWJA 2VUAA 3U37A 5A3LA 4YW1A 2DWRA 2QZ2A 5C9AB 1OA2A 4QX7A 5JXJA 1YNAA 3U75A 4XCBA 2Q8EA 3ZN6A 1LR5A 1POV3 4JRAA 5FZEA 5CFCB 4Q1PA 5HCHA 5JSPA 3O1SA 5KC6A 3P1IA 4OUEA 1OQ1A 3ZSJA 4RR3A 4ZZ8A 2BGPA 1Z78A 4AVTA 1XOYA 5FYUA 4D6QA 4CEYB 2DCYA 5F37A 1SACA 1ENQA 4QM9A 1D2QA 1ULGA 4NHKA 3M3CA 1TG7A 5EZWA 1K12A 5JOXA 1IQAA 5FP9A 1QDCA 1OPOA 3RZMA 4GWNA 2DFBA 4OZXA 3D82A 1PGL1 4CCJA 5KC5A 2W91A 3AMQA 1US3A 1LOFC 3ZXAC 4QDRA 3NL1A 3SMHA 2QQWA 3AMHA 3I54A 1R64A 3AM2A 3NNFA 3SITA 1QJZA 1VB4A 1ENSA 1YQCA 2NZ9A 2WO2A 1L7LA 2ES3A 2WO3A 4HN1A 1JHNA 5KHJA 1ASJ1 1Z7S1 1WMFA 3ZR6A 3OGVA
chains in the Genus database with same CATH topology
2GALA 1NQDA 1QJY3 1FMD2 2IC1A 4RQPC 4WM7A 3RG0A 4XJ9A 1W6NA 4Y5Z0 4R8HA 4IV3C 2P3JA 2QJVA 1NA1C 1SBFA 2HWC3 2P3KA 3R4DB 1CX4A 4XYXA 5HI0A 4MGKE 2VOXA 2XWJB 2OPKA 3CLPA 4AF9A 3MW3A 5TSWA 4BIOA 2VG9A 1DYKA 2VNOA 4C0BA 1SCRA 2XH6A 5FCCA 1RHI1 2D44A 4CDWB 2PHUA 4LA2A 2VVEA 3ZYRA 1LOEA 4RS5A 4R52A 4N9IA 2SBAA 1CESA 1CAWB 1LGCA 5AFEA 1WW6A 4HBNA 4CDUA 4RHV3 1ND3C 1DQ6A 4JV4A 3VBRC 1Q8PA 3VHRA 4RL7A 4BHPA 2A6XA 5BYNA 4AFAA 3OYWB 4MV2A 4Q0QA 1YLLA 2EALA 5J7MA 1V6LA 5C8CB 3IDBB 1FMD1 2A73B 2IXCA 5DG2A 1RMU3 1G6NA 2W0XA 5FRAA 1AYM2 5GLTA 3ZFFB 3ZO0B 2P2KA 2AR6A 4TSVA 4YGBA 5GLWA 2D6OX 1UKRA 4ISRA 3AFGA 1S2BA 1H2NA 4E2SA 2CWSA 5FO7B 3MDPA 3CO2A 2ZGLA 3CL1A 3A4UA 4K1ZA 4WBBA 4KWKA 1DF0A 2AUYA 2BFUL 2XJUA 5T5PA 1VBA3 2D3SA 1POV1 3CEWA 4H7MA 4PCRA 5DG1A 2VMIA 1QJU3 3ZFGB 4JTOA 1S0CA 4Y1ZA 4XQ4A 4D7YA 1EYBA 5BNPA 1R083 1S0JA 4XFBA 3OY8B 1ZZ9A 5LEJA 4H7LA 5A33A 4YW5A 3KSCA 5JSRA 1QXPA 4CP2A 2VOVA 1N3OA 3WUCA 4FPHA 1BEV2 4OHZA 3WDYA 1TQ5A 4UW3A 1FI2A 3VKFC 3KD4A 2NPIA 4IEQA 2PAKA 1AR93 4QGMA 3B94A 3L2YA 2D3RA 4QPGA 3ASIA 1RUH3 1AYM1 1HV0A 2D97A 3NWKA 5EWSA 2V5YA 2ZBJA 5BPXA 1WBLA 2XJSA 1IS5A 4FSJA 2ZX2A 2UYBA 1RUD3 4YW3A 1LHUA 1S1AA 5F1RA 5I0RA 1UU4A 2X5IA 4YGEA 5T5JA 2W39A 4EROA 2HEVF 4IETA 4AHXA 4CEWB 1OD5A 2GSYA 1WW4A 4I3GA 4L11A 1DQ5A 1VBE3 3ILRA 2A3XA 1LCLA 3AZVA 1NY72 4XJZA 5JIAA 3ZMNA 4ORFA 4CDXC 1AZDA 4YARA 2D6KA 2WNUC 3SLIA 1ZRFA 1BBT3 4J1WA 4YFZA 1UAIA 1BEV1 1DU3D 1H8TC 2A6ZA 1C57A 4PDWC 1B35B 4KGGA 3POWA 1RUF3 3WD5A 1NZCA 4DS0A 4CRQA 3FLRA 5L7OB 1QGLA 2ZGKA 4COZA 2IZWA 2VULA 3BOWA 2DUOA 4N90A 5FFOC 3P3PA 1RMU1 3S30A 3ZFEB 2ZMLA 3OF1A 3SH5A 1V70A 3LKJA 2UURA 3WINE 3T1LA 4LR4A 2Q8OA 4MVTA 1MS3A 4FXKB 1QNWA 2XVLA 3IPVB 3NVCA 4Q8LA 4AEMA 1A8DA 1NY71 1NXMA 4FPCA 4BA6A 4Y22B 4YGDA 4QD2A 4Z2WA 1V6KA 3JBG3 4MGYE 4WVMA 1LHOA 1MQTC 1V00A 2ZGUA 3H0OA 1FOD3 4XXPA 4TYSA 5A32B 4LHNA 1A8MA 3OTFA 5D8AC 4XZPA 3HIFA 1X36A 2HKXA 1SLAA 2HWE3 1DDLA 1CAUA 5FO8B 1BVVA 4R9AA 4AEDC 4ASLA 5FPXA 3DV8A 3PLQA 5GZGA 2CAVA 4L8QA 4HFSA 1X82A 4XQWA 4XJWA 1WW7A 1W6MA 3NSTA 1IPJA 1RUH1 2IWGB 3WY6A 1IKQA 4LBOA 2VVDA 4EN6B 2YZ4A 2WA4A 3TNQA 1JBCA 3MIDA 1Y43B 1QOOA 4YM0A 3AZZA 4RGGA 2ERFA 5K8SA 5JCTA 2R0FA 1F2NA 1FATA 1Y7BA 3PVNA 4LBQA 2OIIA 2D40A 5T5OA 5DUXA 3E6DA 1RUC3 2VNGA 3R05A 2HWF3 1PK6B 1NXD1 1PZ8A 1GZCA 1UL9A 4EN0A 5GZEA 1X8MA 1DGRN 1GANA 1N1SA 5C4WA 2PAMA 2RS52 3W9AA 1BBT1 3WR0A 3RJRA 1FV2A 1U5IA 3H1WA 4XFAA 3B7MA 1WA4A 3M3EA 1D4M2 4RQPB 3V65A 3LZZA 3M70A 4XJUA 2ENRA 4FPLA 1BXHA 3FBMA 3FUQA 3VBUC 2A6WA 2MEV2 1RUF1 1LB2A 5F6KA 4CDQA 3PMSA 1QJX2 4AVCA 5J37A 1PNGA 1AR82 3E5XA 2H0BA 1LU1A 3V56A 1O3TA 2H6BA 3FC0A 4LLOA 1MS8A 3AJYA 3M7AA 3NKGA 5J36A 3VHPA 1RVF3 4G9SB 3NO8A 4LHLA 2PLV3 1EP0A 4IESA 4XF0A 2BNMA 2Q1MA 2IXHA 3RNSA 4JGZC 1ND3B 3VBHA 5KXDA 1REDA 1AJOA 3MLJA 4AI2A 5AVPA 2EIGA 4PQ9A 4QGLA 2GH2A 4Q4W2 2VVFA 1H2KA 4Q4Y2 3IM0A 1RUI2 4FPJA 4AFCA 4K20A 4GKYA 4QQPA 3JD72 4FTBA 1F31A 5JIUA 5JLVA 3H7YA 4OI2A 1WLDA 1QF3A 1ZRRA 2R063 3PVOA 2Z79A 1QJX1 1HRI2 4N43A 3VDDB 1KS5A 1J3QA 4LNVA 5EXOA 4Z8BA 1GICA 1CJDA 4Q0VA 1CD3G 1U5YA 1X33A 2IXKA 4YRDA 4BCUA 5C9AC 3WCRA 1JYCA 3VUOA 1OLRA 2HWB3 1UIKA 5CFCC 2HYKA 2VECA 3ACLA 3U11A 5KXBA 1LOBA 5FLHA 2WZR2 2R043 2B46X 3CNAA 4P5HA 1Y9QA 1MS4A 1PZ7A 3IN9A 1ZYBA 5LK5A 4BH9A 4FAGA 2TNFA 1RUC1 3AKRA 3RWNA 4A7KA 1RUG3 1AL0G 1XXNA 1NCRB 2HWF1 5ABJA 3H1MA 3ZXEA 4DB5A 4BLIA 2V73A 3RDIA 4Q4Y1 2RM23 5JZGA 3SH4A 1RUI1 3HBZA 3RZZA 4Q1RA 2BQPA 1HW5A 4ONUA 1XE8A 1Q43A 2Z69A 3NV1A 3WDTA 4AGGA 1OMIA 1EV12 2P37A 2WA3A 2DCKA 3HN1A 4R4ZA 2WZPP 4AEJA 1R1A3 3Q9OA 4LBKA 2EXIA 1TME3 1S0DA 2EF6A 5I93A 4S2DA 4WVWA 4EV0A 1CQ9A 1H4GA 3NW4A 4GH4A 3WHUA 3R0RA 1WD4A 2RS32 1QNYA 4JDNA 1G9AA 4PBPA 2CAUA 1QDOA 4CDXB 3VN4A 1NE4A 3ZXKA 2PLV1 3MEPA 2XBO3 3R4SA 4YZ2A 1IHMA 3BOPA 3WDWA 1GFF2 5HCAA 2D6LX 2B42B 3RI8A 1NYWA 4PDWB 4AVSA 2GC3A 4MGIE 4GKXA 4JGYB 5B2GB 4Q29A 5C8CC 1SCSA 3GALA 4Z92B 4HPKB 1EV11 4NPRA 1TMF3 1VP6A 1KS4A 1WMDA 2Y38A 3USUA 4HANA 2QFEA 3ENRA 3FWEA 3ZFFC 1VBD2 2GNBA 3B01A 4LBNA 3AXDA 3OJBA 5JMCA 1UZYA 3AKPA 4Q4X3 4IEUA 4YM2A 2GDFA 1KITA 2K0GA 3SNMA 2FZ1A 1NOVA 4PLOA 2XJQA 3VBFA 3LSDA 3ZXFA 3J8F3 5HXVA 4AFDA 3IDCB 1FT9A 1H9WA 2YPJA 4YZ4A 3ZFGC 4ISQA 5GLZA 4JRLA 3S6PA 4I3PA 1H2MA 5JOWA 3RMYA 1VRH3 2Z2SB 4AEDB 1EAH3 2ZKNA 5J3UA 3ZDSA 1YFWA 2RM21 2ZGQA 5JPMB 3RI9A 1PGW1 4HZFA 4XDQA 5GJ6A 3VBRA 5FQ0B 2SLIA 3ELNA 4EWDA 1RUJ2 1GR3A 1S0GA 3KT4A 5JVVA 1CAXB 2NP0A 1RINA 4YG3A 1UU5A 4DZGA 1SLCA 3UJOA 4A3XA 3WCSA 1R1A1 1TME1 4CEWC 4AVAA 3AP4A 3CJIA 4K9SA 1O5LA 4BYYA 1RJ8A 3V0AA 3FX3A 2HJIA 5I0TA 1OKQA 3WW2A 2ARBA 2DUQA 3R4UA 1LRHA 5BNQA 2D93A 3U07A 3DN7A 2XBO1 1VAMA 1W6QA 1WCSA 1OHFA 2A6YA 1PIV2 2YXSA 1AJKA 5LEKA 1HXS3 1LENA 1S0IA 4XFGA 2GC1A 1B35C 5I91A 4I0AA 3ZX7A 3KQRA 2UU8A 3V64A 1JXNA 2ZHLA 4XFFA 3VBUB 5BNOA 2BPA2 1O91A 4ZU5A 4W65A 3THPA 4GB33 1AXKA 2PHXA 3JQWA 1CVNA 4YYOA 4DY5A 1RUJ1 3B9IA 4YVWA 4I01A 2ZGPA 4CZSA 3I4IA 4AI3A 4K3UA 1J58A 1WBFA 2JKBA 3AP9A 2GH8A 5FAXA 5DUVA 1XRUA 4K1YA 3AP7A 2ZX1A 3MLKA 1MZ5A 3U0ZA 2KA3A 4R9CA 2UWCA 4GMP3 4MGZE 2B9UA 2FQPA 1OOPA 5IT6A 4C1XA 1ZA4A 2H6CA 1H8VA 1OFSA 1RL3A 2B45X 3GZTB 1OPMA 4R4XA 1DFQA 2JG8B 5BNPB 1VBB1 1LOGA 1QH6A 2XJPA 3VV1A 1DGLA 5A33B 1W6OA 3WDUA 4HETA 1O3QA 4RGAA 1EPWA 2ZX3A 1TE1B 2OVUA 4UXAA 4LE4A 1YHFA 1CR7A 3NV3A 1AR72 3TN93 4N53A 5JAXA 2DVGA 1Q3EA 1U0AA 1ASJ2 1Z7S2 4NWVA 4AQ6A 1VAKA 4M01A 2ZOEB 1AL23 5H9RA 1AX1A 1DIWA 5FLIA 2NMOA 1ALYA 3PJYA 1PM7A 5J98B 2X8KA 4AYUA 4EJRA 4DOUA 4XF1A 4EN8B 4HKWA 4FBFA 3SH3A 1VLNA 4NWWA 1D2SA 4BZ4A 4KWLA 1DYPA 1RUE3 3S7IA 3GYDA 4LBJA 4MLOA 4MX3A 4FPFA 1WLWA 1C1FA 1S0FA 3LSEA 3T2TA 4JAAA 2BVVA 4AHZA 1RHI2 2JX9A 4DXZA 2WNVC 2MHFA 1PK6C 2QCSB 1ENRA 2G9FA 3D6EA 4YFWA 4PIZA 4YM1A 2BFUS 1JYIA 3W59A 4IEOA 3DF0A 3VBOA 1AR71 4GA9A 3VL8A 1HV1A 2D5FA 2ZPXA 1YO8A 2NM1A 4IEVA 4LEJA 4XJAA 1HXS1 1LESA 3AYDA 1LJ7A 2D5HA 1IZ3A 2RJKA 1XYNA 2DURA 1R093 2XJTA 1MVEA 2G9GA 5JR7B 3VZLA 3GZAA 3LB9A 5D8AA 2PN5A 2YHJA 1J1LA 4GB31 1C8M2 3MIHA 3NAPA 4HVRA 3AZXA 4Q0UA 2GC0A 2YGMA 1U5ZA 3ZMOA 1OQEA 1HQLA 2BNOA 4H3WA 3DPRA 2RS11 4NO4A 4A7ZA 5FBZA 2QUOA 3AJZA 4Z1VA 1SFYA 4P9XA 2D98A 2R073 5H9QA 4EN9B 1UW8A 3PVEA 3DL3A 3ZXGA 4ZKTB 4GMP1 1C8NA 4M3CA 4MXWA 2IFWA 1H4HA 4C90A 3AYEA 1K5MA 5JSOA 3FHIB 3MIBA 2JJ6A 2JICA 1YRZA 3ZN5A 2BEOA 5CBLA 4MZUA 1DZRA 1AR61 3HQXA 5JI9A 1YIPA 3M4FA 1KJRA 1O3SA 1FV3A 2QE3A 1ULFA 4QMAA 3V0BA 1FXZA 5JOYA 3TN91 4UW5A 2GNMA 2OUHA 2YROA 3M8LA 1QJY2 1ND2B 1LTEA 3H7JA 2UWBA 1C8M1 3VDDC 5K7PA 4MXVA 1NCQA 2ZHMA 5FMOL 2I2SA 2HWC2 1PZ9A 3B00A 2D7FA 4LHKA 4ZXKA 4HVOA 2VOKA 2ZACA 1BQPA 4XFIA 5JOZA 4Y20B 3ZYPA 1O5UA 2A3WA 2AH2A 3I59A 4IV1C 2XJVA 2ZMNA 4F83A 3AP5A 4WM8A 4E2QA 2Z5WA 4E2GA 1N47A 3N35A 1I6XA 5IK5A 2ZAAA 1FYUA 4LUKA 2WT1A 4OHYA 1NCRC 2WFF3 5I0UA 4EWAA 2JEMA 4QT6A 5CFDB 1VIWB 1AX0A 4IEPA 2GN7A 5T54A 4RHV2 4HLTA 1COV3 5KHGA 1QMJA 2AREA 2VQAA 1DBNA 4R9BA 4B7EA 4URTA 5CU1A 4COVA 3VKNA 1QJY1 4P9YA 2FMYA 4IEYA 1GZ9A 4BMBA 1R1ZA 3BB6A 2ZGMA 1RMU2 1R091 3AXEA 2YYOA 3O7OA 5BUVA 4KGQA 2HWC1 3RYPA 3TB0A 2BWCA 4WV8A 4OVEA 2ZGOA 3LA7A 4D7SA 1SLIA 2WSVA 1WCKA 4YM3A 3SHRA 1JTZX 1SFNA 3KT7A 4J1XA 4XHXA 5E8AA 5K0UA 3KGLA 1GZWB 1URXA 2BTVC 1ZNPA 5LK7B 2BBVA 3HD8B 3VLBB 1VBA2 4LT5A 5DDJ3 5C9AA 4Q2FA 1O4TA 2R071 1PHMA 4OULA 1QJU2 1HKDA 3VZJA 1UF2C 3PNAA 3S0MA 1ULCA 4RHV1 4CEYA 3TYJA 4JGYC 4I0BA 1ZZ6A 1POV0 4O9EA 3B3QE 2VH9A 5K9YA 3JUUA 5JWPA 1YJLA 3H9AA 1C4RA 1AR92 5IK8A 3CU7A 1WMEA 4OI0A 3TNPB 4LUMA 1RUH2 4N43B 4Z82A 4XBQA 2Q4SA 3UKNA 1IGOA 3BCWA 2V09A 4O9GA 1FPN3 1LECA 2WL1A 2X29A 5H9SA 1RUD2 1AVBA 2DVFA 3SCFA 1ZRDA 5CAZA 4XFHA 3ZXDA 4FQZA 1OSGA 4XW3A 1GKBA 1KXGA 1SBEA 3WDXA 4RR3C 3MPBA 3QACA 1VBA1 1S2KA 4FCAA 1VBE2 2A75A 5CIRA 5EV7A 1ENXA 1QJU1 3BALA 3VZNA 1WLCA 1Q8SA 1R081 4ZU4A 4Y1VA 4GQ7A 3IBMA 3ZN4A 3J9SA 2XJRA 1BBT2 1RJ7A 2IXJA 4CDWA 4L9BA 2WFF1 4YSFA 5CADA 1PMIA 1N1TA 4C0HA 3UV9A 1AR91 2F6BA 2LUWA 1X8EA 5T50A 3QLQA 4AHWA 2RS53 4WM7C 2RR13 1QU0A 2IFRA 1S0EA 1RUF2 4DPNA 1LULA 3JQXA 1D4M3 2RMU3 3VKLA 1DGRA 2CGPA 3OYWA 3FUOA 1RUD1 3GBFA 3MFCA 3KZ4C 4XIKA 4JDMA 4B4QA 4DQAA 1QOSA 4B4PA 4GH4B 4H55A 2MEV3 3WLUA 4AW7A 1H1MA 2OZ6A 4LLFA 3S7EA 4EN7B 1GV9A 1X7NA 4YW4A 3ZFFA 1G9DA 2AGSA 2BYVE 2JENA 2WNVB 4W6XA 1HX6A 1VBE1 5BNNA 3TWIA 4QPIA 1APNA 4QQLA 1QHDA 3ST7A 2E51A 4BLJA 5JDBA 3M1HA 1U12A 3UL2A 4GALA 5DDJ1 2WQ4A 3JBG2 4MH0E 1ZVFA 2XHKA 3W58A 4CDUC 4DNYA 2VMGA 3ZFGA 2BGCA 1LEMA 4AGVA 3MF9A 4Y4YA 3MZHA 3OY8A 1J1TA 2HWE2 5I8YA 4Q26A 1V9U3 3WP4A 3NV2A 4META 4AI1A 4QM8A 3T1MA 1UPSA 1YYNA 2WS93 1PO13 3WDVA 2CYFA 1HRV3 3IT8A 4M0NA 1ZBE3 3OD0A 2ZCWA 3WXPA 3VKOA 1HRI3 1V6NA 4ES9A 3RQ0A 2PYTA 3H3ZA 2JG9B 4R9DA 4FOWA 2VU9A 4KU7A 4Z07A 1NG0A 1W6PA 1BZWA 1YWKA 2JG8C 2WSUA 5BNPC 1RUC2 3UJQA 4BM8A 4CEWA 2HWF2 3AYCA 3JBG1 3FBYA 3ZIWA 4EWEA 4HK8A 4D94A 5FDBA 4FTEA 1FOD1 1V6IA 3D8CA 3N4MA 5KHHA 1LODA 4DRRA 1IS4A 3L2HA 3O14A 1F5FA 5FLJA 5HCFA 3IMNA 5I0SA 4L97A 2HWE1 3LA2A 4FXGB 2FBEA 3N7JA 1AF9A 1XNCA 2NQYA 4JVAA 3H50A 2YV8A 3JZVA 3ETQA 5FOJB 2R49A 2DTWA 3ILNA 2XVKA 1IS3A 2RR11 1WCDJ 1B35A 5AVAA 2RMU1 3KLSA 2XUMA 3U10A 2D6PA 1LHVA 3QH6A 5IK4A 4D7TA 5L7OA 4B4RA 4IV1B 3WVJA 3V0AB 3ZFEA 1ZBA3 2CTVA 1YJKA 1RVF2 2C1FA 1I1EA 2PLV2 3MW4A 4W6WA 2W68A 2RS33 4Y1XA 3KB5A 4K21A 1IKPA 1LEDA 1DG6A 1DQ1A 2B7YA 4KL1A 1ZX5A 4E4SA 3K48A 5E88A 2CGNA 1V6JA 2P3IA 2A70A 5DUWA 3IPVA 1ULEA 4DY3A 1DLLA 1MS9A 3ATGA 2EAKA 3PMEA 1XNDA 2VPVA 3CF6E 2DVAA 1KJLA 1UU6A 1KDMA 4GULA 3MGUA 3TRSB 3N7KA 2H0VA 2DVBA 4FOQA 5BNOB 3JU9A 3LCPA 4LULA 5FPZA 1ONAA 1CAVB 1IPKA 4YVSB 3HAGA 4YVWB 2R062 1A3KA 4Q4V3 3WV6A 1DQ2A 5ACA3 5AC93 1PO23 1C5IA 3VZOA 3MLLA 3FZ3A 2W52A 2ARXA 1VBD3 4OI1A 4E4DX 1PO11 2QDNA 1GLHA 1H1IA 1MACA 2WT0A 1CONA 1RVF1 3VBSB 2HWB2 5D1IA 5E89A 4K7JA 5FREA 4AGRA 2PAEA 5C6CA 2E53A 5I8SA 1CGPA 5CB7A 2Q0AA 1OQDA 2XLFA 2OW4A 1GSLA 2R042 3SISA 1C3HA 3H3UA 4Y26A 1TNRA 1QH7A 4Q8KA 3GNEA 2VW1A 1H30A 4F7ZA 1GQHA 4Y1UA 3C2UA 4FO9A 4N53B 4C1WA 1PK6A 4SBVA 5EYYA 1DQ4A 2WT2A 3KCYA 2RM22 4OHXA 1UIJA 4CP1A 1MZ6A 1LOFA 1PGW2 2R0HA 1Q8OA 3H1YA 4AWDA 5DXDA 1ND2C 3MICA 1C5HA 1N1VA 2R061 4INDA 4AG4A 4BMEA 1RC6A 3PHMA 1SEFA 1XNBA 1DZQA 1CPMA 2IXIA 3ILFA 4RQPA 3NKTA 2DFCA 1QQP3 1R1A2 3QBQA 5L19A 3ZN6B 1TME2 4H14A 4I02A 4IV3A 2XWBB 1KFXL 1NA1A 1VBC3 4RR3B 5DZGA 3D0SA 4UBHA 5SV8A 2HWB1 3P3NA 4JTNA 2A7AA 1AYN3 5GZCA 1ZZ8A 3MIFA 1OA4A 2R041 1ZBA1 3KT1A 2XBO2 4P9LA 4AK3A 1RUG1 1QOTA 2QDRA 2YY1A 2VQ0A 5DUUA 5CFDC 4C91A 1UKGA 3EO6A 5L36A 5FOBB 2B39A 3JB8A 2DV9A 4DINB 1O7FA 5GLUA 2D3PA 4WM7B 1Q56A 3AK0A 3M3OA 1ND3A 1W6NB 1MEC3 3AYAA 2WQZC 1SMVA 4CDQC 2O8OA 4N7IA 2GNDA 4Q4X2 1M06G 2PHRA 5AC91 5ACA1 1OFNA 1PO21 2WJSA 1A6CA 3RYKA 2C9AA 3VHNA 3RSJA 4OFGA 1O4ZA 3A0NA 3FLPA 3VDDA 1I3HA 3VHOA 3APBA 2XG3A 4XMAA 4RS5B 3J8F2 2NYYA 4XHBA 1VBB2 3C3VA 1K5MB 1N3QA 5F5QA 4CDUB 3VBHC 5KHIA 1ZZBA 3RJ2X 3ZSKA 4AQ2A 3JCIA 5H9PA 2B8MA 4B29A 2CY6A 3X29B 4QQOA 3WP3A 3WNXA 2PQQA 1ULDA 2OUJA 2HWD3 2O8QA 3V0BB 3WQ1A 1EAH2 2YC0A 1NCRA 3OD4A 2I07B 4F3JA 5E16A 4FOYA 1QWRA 1TMF1 1UPIA 4N43C 2PFWA 4AFBA 1PVC3 2NLRA 4Q4X1 5DZFA 3WG4A 3ROUA 1VJ2A 2UY9A 4XF4A 2YUEA 2ATFA 5KXEA 4OHWA 1UZZA 1OA3A 3I8TA 1W0PA 2ZAHA 1DGWA 4A7YA 2GAUA 4YGCA 3J8F1 4S2HA 3I59B 4HK9A 4GXLA 2JDZA 4XEZA 5HCBA 1BJQA 4DMIA 3WT3A 2ZHKA 2BUKA 3O0WA 1KQRA 2R1DA 1YFXA 1H1AA 1NLSA 1RHI3 4AXOA 5T5LA 3L9JT 4CDXA 1VRH1 2K2SA 2WNUA 1Z0HA 3USSA 1YI7A 2OA2A 3D5OA 1I9RA 3FE5A 3HWJA 1EAH1 1HXS2 3POSA 3OCPA 4FQ4A 5DZEA 3MIGA 3IWZA 3KM5A 1F9KA 2LM3A 1H8TA 4P9JA 1DZTA 3KS7A 3PVBB 2ZJCA 3O0VA 4PIXA 5EYXA 4PDWA 4F8AA 3ECQA 2EXKA 4JGYA 3K51A 1FMD3 2X5IB 4G4FA 4GB32 3I7DA 1F5JA 3E5UA 4LO5B 2BVBA 4PF5A 2ZABA 2NN8A 3ME2A 4GH4C 4HPKA 3RYRA 1EY2A 2RS12 4S2GA 5CVRA 5J96B 3WZ1A 3ZYGA 2PELA 4FPGA 1E57A 1XE7A 4KG8A 1G86A 5FMOS 4YW2A 5GALA 1CN1A 5GKAC 2EA7A 1I5ZA 1V6MA 4KQ7A 1HDKA 4OUSA 3AX4A 1H9PA 3BU7A 4P9WA 4OLLA 3ZIXA 1AR62 4FPOB 2ZA9A 2CNAA 2PHDA 3ZYJB 3H8UA 4CTEA 1NE6A 1YFYA 4YZ1A 4DRVA 1MQTA 4BPZA 3TN92 4N9HA 4NVPA 2ZMKA 5KHKA 4ATFA 2HWD1 1AL22 2FMDA 2CL2A 4XTPA 2VUJA 4LBMA 2UYAA 1UMZA 2ZHNA 2MPFA 2WWSA 4KNCA 4AEDA 1RTVA 1C1LA 1AYM3 1WLTA 2ZZJA 3D0JA 3MPPG 1PVC1 2TUNA 2BNNA 1SBDA 1RUE2 4XPVA 4V1PA 2RE9A 2UWAA 1D0GA 3MI8A 4AFMA 1UX6A 2JG9C 3VBFC 4AE2A 5FQ0A 2R6QA 3HMYA 2GNTA 1CAXA 2ILMA 1KD7A 3E5QA 2EAAA 4WVMB 1RITA 1HQNA 3IDEA 3PTYA 1S0BA 2CGOA 3N7MA 2JXAA 3FLTA 1SLBA 3WW3A 1RIRA 4GIQA 5CG8A 1XU1A 2VGDA 1JOJA 5J48A 1DGWX 1CAUB 4MSVA 1D0HA 4U36A 3OPZA 4YZ5A 5L73A 3OBRA 2XLGA 1BEV3 1UN1A 3B93A 3AZYA 2A71A 1AL21 4K8FA 2I45A 4JDOA 2Q30A 1W6MB 1IOAA 4KH9A 3VZMA 1R092 1REEA 4WZCA 4E27A 3GBWA 1W0OA 1RB8G 3SCGA 3VGIA 4I2OA 2WFPA 4Q27A 1RUE1 3VBUA 4NOTA 1JUIA 4QXKA 4X8NA 1AUYA 4LBQB 3LA3A 5JI7A 5KWRA 3CJIC 4IEWA 1UCXA 2KXLA 4M00A 5BNNB 1IS6A 2FZ2A 4QPIB 2QZ3A 2R072 1Q5OA 3QH7A 1S55A 3VL9A 3WG3A 1YUDA 3FFZA 5C4WB 4XQDA 3UKVA 1YFUA 1AXYA 2JE9A 2MNGA 3NJZA 1X50A 1KDKA 4TZDA 4D69A 5I8TA 1MZEA 2XL9A 2A6VA 3WX5A 4LO7A 4TLFA 4JGZA 1JH5A 3RRDA 4E9KA 2JG8A 4GMP0