4AFCA

Crystal structure of subtype-switched epithelial adhesin 1 to 6 a domain (epa1to6a) from candida glabrata in complex with galb1-3glc
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
228
structure length
228
Chain Sequence
ASKDPTTFPLGCSPDITTPKKGLSMELYSYDFRKKGSYPCWDAAYLDPNYPRTGYKSHRLLAKVDGVTGNINFYYHATKGCTPQLGHLPASYNYPKPLTMTNFTMLLYGYFRPKVTGFHTFTISADDLLFVNFGAGNAFDCCRRDSSADHFGNYQAYAIWGSKTAKDELTVHLDAGVYYPIRLFYNNRDNDGALSFTFKTESNENTVSDFSEYFFSLDDTEEGCPGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords EPA1P
publication title Structural Basis for Promiscuity and Specificity During Candida Glabrata Invasion of Host Epithelia.
pubmed doi rcsb
source organism Candida glabrata
total genus 58
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4afcA00
4COZA 4CP2A 4CP0A 4AI2A 4AFCA 4GQ7A 4A3XA 4AHYA 2XJPA 4AFBA 4LHNA 4AHZA 4COVA 4AHWA 4LHKA 4COWA 4COYA 2XJRA 4AHXA 4AI1A 4AF9A 2XJQA 4ASLA 2XJSA 4D3WA 5A3MA 4LHLA 2XJTA 5A3LA 4AI3A 2XJVA 4AFAA 2XJUA 4COUA 4CP1A 4AI0A
chains in the Genus database with same CATH superfamily
1ZRIA 1GOGA 1ZZ9A 2MEV1 2W87A 5DAQA 3SC7X 4PIXA 1KS4A 1UMHA 2X53S 4BLIA 2V72A 4LIVA 1Z7S3 5G04L 3ZXFA 5I0RA 4KWUA 1CAXA 1G7YA 2R062 4RGAA 1GZTA 1SFNA 2R32A 3BIEA 2CTVA 3KMHA 2WZPP 3NV2A 2FMDA 2B42B 2ZX2A 3AJZA 1HRV2 3DXUA 3MLLA 1CVNA 5LCWL 2BUKA 4UBHA 5IVVA 4C90A 1K5MC 1AYM1 3BTYA 3FZ3A 1W28A 1TVGA 4RA0A 2HYKA 2J1UA 4Z1VA 3A7QA 4QB1A 2ZEXA 3C7HA 4NIHA 3B02A 3HVDA 4NJ4A 2P6CA 3AZVA 2YMZA 5A3OA 2XPJA 5E8AA 3TEWA 4FOVA 1C8M2 1RUJ2 4BXSV 4LIUA 4A2UA 1ODMA 1TG7A 1CN1A 2JENA 3UKTA 4AI2A 2I2SA 2WBKA 2CY6A 4C8DA 3FL7A 1WMDA 3VGIA 1HQLA 3KZ4C 5FY1A 4LBOA 5A70A 3MF6A 1W9SA 3VBRB 5DABA 3ILNA 4Q0QA 2Q8DA 1XSRA 5EWSA 1YCIA 3J7HA 3M7AA 3N35A 4ASLA 4V1PA 1OUXA 2GAUA 4WBBA 2IXJA 1AX0A 3U4SA 1E5RA 5FZOA 4AAPA 2IXLA 5FZ4A 4BQ4A 3HBZA 4KWJA 4XJ8A 4DOUA 3TWIA 3GZEA 4TN7A 4NHKA 3USUA 2VAUA 1O3TA 4HOOA 4PBOA 4QAWA 4UW6A 1DQ5A 3ZSLA 4F8AA 1DIWA 2EF6A 1JMUB 1RUF3 4BM8A 1SPPA 3TAYA 2WFF2 1JS9A 3BPSA 5IHRA 2R1DA 2NZ9A 3ZXGA 3GNEA 1REDA 2Z79A 5T5LA 4BZ4A 1UOJA 3UJOA 3SLIA 5CFDB 3J7MA 1ND3C 3ITQA 1WLTA 3SCFA 4AVVA 2XH6A 1AR93 2WNVB 2YGMA 4QT6A 3ZOIA 3AMHA 3NNJA 4G3YC 5F3CA 3ZFFA 5FPXA 1AJKA 3ZX7A 4KL1A 1VIWB 3WQ7A 1EYBA 4XAAA 3AKRA 5EXOA 3WNXA 4A6SA 4EWAA 5AC93 4NHYA 3ZFEB 3MV01 5JSRA 4CTEA 1AXZA 1Z7S2 2XBO3 1COV1 2YZ4A 1XU2A 3TEYA 3OY8A 3HBKA 1UXZA 4LKEA 2E33A 1F5JA 4LKDA 1RUE2 1NCRA 3AP9A 2Q30A 3O14A 1QF3A 5CFDC 4WM8B 1NUKA 1OURA 1ULDA 3DXTA 1GNZA 4M4RA 1G9BA 2QQNA 2W1SA 3RFRA 4AAXA 2D6NA 2EXIA 2WL1A 3UGGA 1OFNA 3OSDA 5LK5A 1FMD1 3WG1A 1ALYA 2PXJA 1WLWA 4CCJA 2BOJA 3PUAA 5GZGA 4HVQA 1JYCA 1POV0 4QHBA 4Y1YA 1AYN1 3KSCA 1C8NA 2ENRA 5FP8A 1IG0A 4JDOA 1W6MA 5T5JA 2G1MA 3P5BA 4QXCA 4FBFA 4S2GA 1A8DA 1E5IA 1F31A 1N47A 2K46A 2TEPA 1WW6A 2EAKA 5K8SA 1Q8SA 5CYYA 3TRSB 4YW1A 2JICA 4E2GA 1SLCA 1SLAA 4FVVA 1FNZA 4WM8C 2P5BA 2WJSA 1GZWA 1RMU3 3JD73 1JYXA 4HN0A 3LEGA 2RS32 4IEWA 4COVA 2ZGLA 4A41A 1CGPA 1YJKA 3WCSA 1POQA 4FPFA 4Y4YA 4COWA 3VUOA 2A3WA 4XJZA 1KFXL 1O3QA 2G4IA 4Y1UA 1NA1A 4ITCA 1OA4A 4LULA 3O1TA 2QQUA 4AVAA 1BQPA 4LHLA 4B7EA 3RWNA 5K0UB 2NMNA 2VUDA 3AYAA 5FZKA 3NAPB 3PTRB 2ADDA 4KG8A 2WWUA 4CPBA 1S2KA 5T5OA 1UKGA 3R4DB 3WNMA 5FZ3A 1VRBA 3AKSA 2ARAA 4RHV3 4YZ4A 4LBKA 3H42B 4Q0SA 2AENA 2KXLA 1DF0A 2XVLA 2JKXA 3RZJA 3AMMA 4N7UA 2OZ6A 3O5SA 1J83A 2D6KA 4P08A 2VTXA 3FUQA 1H8TB 4WVVA 1VBB3 5FZEA 1D7PM 1GZCA 4K9SA 3WUDA 4DY5A 1DGRA 2DF7A 3OCPA 1QOOA 2DVFA 3NMBA 3K51A 4JX0A 5CFCA 2VE1A 3RJRA 5C6CA 3ILRA 2QQOA 1OBNA 2EIBA 4OHZA 1GWLA 1QKQA 2E6VA 4FXKB 4K1YA 4N43A 1JUHA 3UL2A 5LA0A 4P9XA 3PIGA 1DU3D 2WDBA 4Q4Y3 2DCTA 1LOAA 5G05L 2BDRA 4W4ZA 2GNMA 5D8AA 1HB4A 1MQTA 3MLKA 5HV0A 2OX0A 3B93A 5FBJA 3SH5A 1ZA4A 4CEYB 4D0QA 2O1QA 1RUG1 1G9CA 1FT9A 2VCCA 2ZX1A 3RDIA 4PI2A 2PHWA 3RQ0A 1R1ZA 1C28A 3WDYA 3N36A 4Y20A 5ACA1 1W8ZA 2MPFA 2RJKA 1W8TA 1RVF1 1BEV2 3WCRA 2YG0A 2E63A 1JYNA 4I09A 2A73B 4GB31 3ZR6A 2YDEA 4A42A 2GNBA 2XHNA 3MW3A 2Y0IA 4D94A 4XABA 5FUNA 4BIFA 1UMZA 1EV11 3D8CA 3BOWA 3NKGA 3JBG2 5FZ9A 4QGLA 1UWWA 3N4MA 4BH9A 3BUCA 1N1TA 4ZXEA 3VHNA 4FQZA 5J96B 4CEYC 4HKWA 3CHXA 1W9FA 5LK7B 1DDLA 4YFZA 4QX2A 5KHHA 3C7GA 1R1A3 4K1ZA 1JU3A 2UURA 4CDQB 3W5MA 2V5YA 1LOGA 1W3XA 2YY1A 4YW5A 1QNYA 3AL5A 3H9AA 1WMFA 2RM21 2VOKA 3GCWA 3JQWA 4KH9A 5F2WA 4XUPA 4AHWA 1UY4A 5IVBA 1QNWA 3ZXKA 1EP0A 1X7NA 1UYZA 4XC9A 1PM4A 3PUQA 1X50A 2YBKA 1ST8A 2BOIA 1D0HA 5DAPA 3ABZA 5H9PA 3C8XA 4GKYA 3VKFC 4RHV2 5AVPA 2YROA 1E5HA 5L36A 3H3UA 5A7OA 4U2AA 4NIIA 5APAA 2HEYF 2HBUA 4UXAA 1MACA 5I8TA 3V0AB 4COZA 1VBB2 1W6NA 4LOTA 3WNLA 2I45A 2W1WA 3ES1A 1BXHA 3DEMA 1VRH3 2LS6A 3WVJA 2WAOA 3HJRA 1OHFA 2XJPA 3OF1A 3CDZB 1IZ3A 1WBLA 2OUHA 4PLOA 3ZMOA 3LFMA 4ZHNA 1ZZ8A 2IWGB 1VAKA 5LA1A 2WLPA 4LO6B 3LF7A 4UFIA 4JKLA 4PHZA 1BLZA 3NO8A 4Q4Y2 5D21A 4B3NA 3ZXDA 1W6QB 2PHRA 4XJWA 3P3PA 1PVC1 2XJSA 5H9RA 2JG9A 4LT5A 4AQ2A 3VBUB 1YLLA 4MZUA 1NQJA 3WLUA 1UZYA 3AKTA 3KGLA 4P02B 4PI0A 1F2NA 4YVWC 1EAH1 4DUVA 1WA4A 1O4ZA 3FJSA 3G6JB 4YNIA 4OMDA 3KCCA 2GP5A 4XFHA 3WF0A 4UFMA 4DUWA 4XZUG 1KGYA 4RR3A 5FDBA 5AVAA 4XXAA 1A34A 1LGNA 1LGBA 4MX3A 5DN2A 4CDWA 2VW0A 2JECA 3HOBA 3IB3A 3CBNA 3KQ4B 1H1MA 3DF0A 4NPRA 5C5TA 2R061 2VL4A 2FDGA 2AZ5A 5LWBA 1DGLA 2R041 4N9HA 2QJVA 3A0KA 4PT6A 3VBUC 3POWA 2DUQA 5HCBA 1IS6A 2HH9A 1OMIA 2P3JA 1KDMA 1R1A2 2ATFA 4Q1PA 4CZSA 5FPUA 5E89A 4ORFA 3ZN4A 2B45X 3MI8A 2Q4SA 3POIA 2PHFA 1YC61 3LEMA 3NRUA 1Q56A 1AF9A 3EBRA 4I0WB 2WZ8A 5GLTA 2HEVF 4P14A 1ZBE3 4HG6B 4XUNA 1U0AA 5F6LB 4FOQA 1RL3A 4JHZA 4JGYC 5A7SA 3F95A 4A7KA 2DV9A 3HN1A 4LKSA 1HDKA 1R081 4Q0UA 4EN6B 1W6OA 3OGVA 4IL7A 2GH8A 2W95A 2HYXA 2WT1A 4AVSA 5JIUA 4D8MA 4B7KA 3CMGA 3EJKA 1N1YA 2W94A 1BHGA 1LHWA 1DGWA 2JD4A 4Y1ZA 2NP0A 1LEMA 5HXVA 3WX5A 2VQAA 1PGW2 1VBE3 4DXRA 3E1F1 4EN8B 1R091 2P4EA 2D43A 1DFQA 5FXXA 3VL8A 3VZMA 5C5UA 2PLV1 2A3YA 1LB2A 4U36A 5L9VA 2OZJA 2QKDA 3C7FA 4JQRA 2EA7A 4DQAA 1OT5A 3THCA 4A7YA 3OPZA 4Y1VA 5FZGA 2BFUL 4AEDA 2R7EB 3KVBA 3LDRA 4FO9A 1FOD3 2F17A 2LROA 2HWE3 3B94A 4YZ1A 1GFF2 3J8F2 4A3ZA 4YW3A 4AHXA 2VXRA 4TLFA 2Y6GA 3U14A 2E51A 5CB7A 2DFCA 3VDDB 3URFA 1D4M2 3ATGA 5FXVA 3M1HA 2E53A 4WZFA 1LAJA 1XOYA 3WW2A 4KG0A 3AP7A 4R52A 4FOYA 3TBDA 2NYYA 3I2HA 1UCXA 3CU7A 4ZONA 3DGTA 5GZDA 3VZJA 4P9YA 3VBRA 3S0MA 2KM2A 4A44A 5FY9A 1LESA 2O8QA 3BB6A 1PMHX 1C5HA 1YRZA 4CP0A 3K77A 1QGLA 3T4HB 1UY0A 4P9LA 4MHUA 5IK5A 2ZX0A 1HX6A 4ZU7A 1W8HA 2MHFA 1A8MA 3POFA 4AGRA 4JRLA 3USUB 4GIQA 4PLMA 1RINA 4NPMA 3U78A 3N9OA 3WQ0A 3NWKA 1MS4A 1ZBE2 3HD8B 1RC6A 5DDJ3 5IFTA 1SPPB 1W8FA 3A22A 5IVEA 3LWCA 5T3NA 1CPNA 2QZ2A 2WNVA 1IKQA 3LA3A 2VCMA 1YFYA 4TLGA 2NM1A 2VM9A 1PGL2 1RUC3 1ND2A 2OW4A 5C4WA 3GM8A 3GBWA 4G4FA 3GGLA 2TBVA 3H1WA 4DO0A 3WF1A 3M2MA 5JXIA 3ZFEA 5DUWA 1WA6X 2Z69A 4ISQA 2QZ3A 2D6OX 4UW5A 5J7MA 3GJAA 3CL1A 3H1MA 4O9EA 1LHVA 2VULA 2VMFA 1KRIA 2K2SA 1OH4A 1NX9A 3M3CA 2QE3A 3AMNA 3BOPA 1H1IA 2VUJA 5DZEA 3WT3A 3A4UA 1O4YA 2HWF1 1S4CA 3OY8B 3WINE 1PX4A 3U10A 3BU0A 3S7EA 3U11A 3K3NA 1NCRB 3CQOA 3W58A 5F5IA 2RR13 5DXDA 1RUF1 1TMF3 3ON7A 1XNCA 4MGSA 2HWE2 1SFYA 3LZZA 1STMA 1LU1A 3ZFFC 5FZ1A 3HQRA 4YSFA 3I2IA 5F8PA 3H8RA 4QKDA 4Y4RA 1AR91 5FWJA 2P3IA 3I97A 4YFWA 3WF3A 1OKQA 1XNAA 3OTFA 4IE7A 3ST7A 3ZXLA 1W04A 4J1WA 1RHI1 4UW4A 2JWPA 3SEPA 1W6MB 3MYXA 4DXSA 2RJLA 5AC91 5I8YA 2BPA2 2EICA 2W08A 2ZGNA 3BTAA 4K21A 4RL7A 2VNOA 2CNAA 1NCRC 1H2NA 1JYTA 2XBO1 2W2IA 3KF5A 4S2DA 1XPWA 1JOBA 3I3EA 3T2PA 4XXPA 1H0BA 5H9SA 3T1LA 1PIV3 3WDTA 2BGPA 3N9NA 1GQPA 1K12A 4RSUA 1OF3A 4YM0A 3H0OA 1PO22 3QCWA 1NZCA 4NRMA 4ZZ8A 5FP7A 3B9IA 2P34A 1NA1B 3HNBM 4K20A 3RS6A 1TME1 2Y8KA 3LEIA 5K0UA 4AHZA 2DUPA 4P9WA 1AX2A 3S7IA 5DDJ2 5I0DA 2VG9A 3SXWA 1V9U3 2QQIA 4LBQA 4RFRB 4AG4A 5F7UA 3WW4A 1JZ8A 2WT0A 3I3DA 3M3EA 2UU8A 5FMOL 1ULGA 1W6PA 5IFPA 1UOBA 1RUC2 4HZFA 2QQWA 1S0GA 2BEOA 5FPBA 3NSTA 1H8TA 3N9LA 3U75A 3WEZA 3RYRA 2W9XA 3OUIA 1KJRA 1VAMA 3JD71 4BQ3A 1RMU1 5GLVA 4QX7A 1PNFA 4QQ2A 5DG2A 4EE2A 1OFSA 1NA1C 2RMU2 5FYMA 3WP3A 1XXNA 5CFCB 2HWC1 1U5IA 2WZR2 4Q0VA 5KR7A 1J59A 2V5DA 4X8NA 1RB8G 1BBT2 1S0JA 1VBC3 4N43B 2IXCA 4URTA 2WKKA 1H2MA 1P8JA 4UBGA 3WDUA 4GMP3 2FD8A 4YRDA 3B69A 5FAXA 1XSQA 1KITA 2BZDA 3HN3A 4IV1A 2CYFA 1UKRA 5D8AB 1MQTB 2E26A 3FC0A 4LQRA 1ZBA3 4XBLA 3PVEA 4FPYA 5FY0A 3HWJA 3PL0A 5FRAA 3TN92 1GU3A 1QQP3 4Y20B 3V65A 1JZ3A 2YBPA 3I8TA 2BGOA 4B4QA 3FBYA 4XOGA 2VZQA 2ADEA 3KGZA 5CFCC 1O59A 1Y4WA 1VBB1 5FV3A 1UAIA 3IIIA 5FCCA 1LCLA 1LR5A 2VBPA 4N43C 3WDXA 4Z2WA 1N3PA 4FTSA 1TZOA 4AL9A 1OXCA 4HETA 4EJRA 3IN9A 2G9ZA 2J7MA 1WKYA 4NVPA 1SZBA 1O5LA 5D8AC 5FZFA 1MQTC 3K4ZA 4RYDA 4Q4Y1 2VTFA 4ZS2A 2WA3A 4CDQA 1JZ7A 4BJ0A 2BVVA 3T0DA 2R16A 3KWVA 2ET1A 4LO5B 2GN7A 2AYHA 1KEXA 2VZRA 3AKPA 1W0NA 2D98A 1W8WA 1V9U2 2DBNA 3U1XA 4DEQA 3HMYA 3OOXA 2HWD1 3I2GA 2IXHA 1TNFA 3WNKA 5BNNA 4TYSA 1IQDC 3D3AA 4BK4A 5FO9B 4IE4A 4RQPB 3V0AA 1CIYA 3BVCA 3J4UH 5EZWA 3RG0A 5BUVA 4G9SB 2IFRA 2GC0A 1DZTA 2ILMA 4CXXA 5C8WA 4P5YA 2ID4A 2BQPA 4AW7A 4XE9A 3UETA 1ULCA 5F32A 1ASJ3 1JOJA 2ZHMA 1HRV3 2OXBA 3LIGA 1R1A1 3L2HA 3KV9A 2WUHA 3BKZA 3ALQA 5FZBA 1VBC2 1WCQA 3RNSA 5LY2A 1WCSA 2JG8A 5HCFA 2IUWA 4JDMA 2ZJCA 2ARBA 4Q2FA 5A3WA 2A6ZA 5JDBA 3OD0A 4IETA 2B5HA 2E9QA 3D82A 4HPKA 4AR2A 2CAVA 5T5PA 1PZ7A 2WIIB 5CU1A 3ZDVA 1C8M3 3MW2A 4NHXA 2D7FA 3KHBA 4K7JA 3JB8A 3MGUA 1C5IA 2AR6A 2VXJA 1N1VA 2ZPXA 5BXXA 4AI8A 4KI5M 1S2EA 4XW3A 4XJUA 1QEXA 4GXLA 5DUXA 4ZS3A 4AEMA 4OQ8A 1VRH1 1YJLA 3KQRA 3MHZA 5FP9A 1RIRA 2P1BA 4FTEA 4JKKA 2JG9C 1HRI2 1YQ5A 3VD9A 1H2LA 3MV11 3T1MA 1T6GC 5LEKA 2WN3A 2NQYA 1LOCA 3VL9A 1F5FA 1PM7A 1UU6A 2QTWB 3SHRA 2UY9A 2VVEA 3SITA 3UGHA 3WG4A 3POJA 3T2OA 5K7PA 1ULOA 4JCKA 1W90A 1H1AA 3OUHA 2WFF3 4RR3C 5I93A 2QQKA 4LLOA 5FPZA 4R9DA 3U07A 2Z2SB 4CDWC 1V6JA 3ZR5A 5CEHA 2VZ3A 4XF0A 2WQ4A 1W6OB 2YB7A 4AZZA 1ZRCA 4IDZA 2XUMA 5FZAA 1GSLA 3C2UA 2SLIA 3ILFA 3M8LA 3ETQA 2C6SA 1RYYA 4YW4A 4EN7B 5CVRA 2YC4A 5KC6A 4AFBA 4UW3A 2FHRA 4L99A 1XYOA 1QOSA 4R9AA 4DXTA 1ASJ2 1U5XA 2YV8A 1UZZA 3N9PA 2IVJA 3SKJE 5CISA 1YWKA 1QIQA 1RUE3 4PIYA 3AP6A 5DG1A 4OYUA 4W6XA 1J1TA 3S5AA 5I0SA 1IS4A 3RYPA 4KBBA 2CGNA 2BTVC 1QY4A 1HXS2 1JTZX 3VBSA 4AEDB 4AFDA 3ZXJA 3VDDA 3LB9A 3THDA 4MGQA 5KXEA 1GOFA 4YM3A 4OHXA 3SKVA 5CG8A 1O3SA 3LA7A 1HJFA 3U4XA 3CF6E 1WCDJ 3LA2A 1UYXA 3DPRB 4LUMA 3ZO0B 4BQ1A 1WW5A 2J1TA 4Q8KA 4L9BA 1U5YA 4XFGA 2VW2A 1GICA 3N7LA 2XJRA 1XYPA 2R0FA 1VBE1 3H3LA 1GANA 1I9RA 3VDCA 4RD7A 4XQDA 4KU7A 1OQ1A 2A70A 2RS33 4NMIA 3O1RA 5A32A 4AEDC 1I3HA 4QPYA 2ZGSA 4QXBA 4XFAA 5JLVA 5DUUA 4WV8A 1OA3A 1HKDA 2RS13 3VHPA 1G9AA 2VUAA 3AVSA 1FOD1 1ULEA 2HWE1 1BK1A 4IGQA 5C8CA 5A7QA 3IDEA 5A3NA 2VMHA 2XXZA 2VVDA 5CKQA 4HK8A 5CKNA 4HT1T 3ZSEA 3VBRC 5ABJA 1JYIA 2NN8A 1BMV2 2VPVA 1RUOA 5LEJA 2VMDA 4Y33A 4F7ZA 3KT4A 3UESA 3SCHA 3ZYPA 1ND2B 3OBTA 1AZDA 4XILA 4H14A 5C4WB 4NHLA 4CCOA 5EYXA 5HCHA 2JIGA 3PU8A 2WQZC 3FLPA 3VLBB 4FFIA 1PGSA 2P6HA 1GP4A 5EHDA 1HV0A 4M01A 1XJAA 4IGPA 2JB4A 4Z07A 4YG6A 1GR3A 2VCAA 2F6BA 2E7TA 5E6HA 3LPGA 3DKWA 4KNCA 2EAAA 5FZMA 1O7FA 2XWJB 4MO3M 1FPN2 1HN1A 4YGDA 5KHGA 3GHMA 3PIJA 2WNVC 4SLIA 5DDJ1 5FZ8A 1J3RA 1D0GA 2BNOA 4Y5Z0 4AF9A 4WZCA 5C4WC 4M0HA 5EFUA 3A21A 3T4VA 4NIAA 1W0PA 3JCIA 4QX0A 4TXWA 4K8RB 2ZHNA 3VBFA 3ZFEC 5EPAA 1BEV3 5JOZA 4I3PA 2V09A 1YQ2A 1DHKB 1WZXA 3IT8A 2BNMA 2K9ZA 4Q29A 3ZYGA 1C4RA 2KR2A 3GHNA 1H8VA 3R6SA 1NG0A 1ZZBA 1S55A 3MIEA 4TZDA 4EN9B 2WR9A 1CJDA 3JBG3 4MVTA 2VQ0A 1LOFA 2J1SA 4QWNA 3CLPA 5EQUA 4LE4A 5FOBB 3EMRA 3EB7A 4Q26A 4GWIA 1U12A 2W92A 2CGPA 3TNPB 3FX3A 1PO12 2BP6A 4HL0A 4JHTA 2OPWA 2C9KA 2PFWA 4H2AA 1KXGA 3T2QA 2JD9A 4C91A 1DZRA 2RS12 2RR11 5LA9A 3BTZA 4P9JA 2ZAAA 1TMF1 4XCBA 1VBD3 2J42A 4IEUA 4KWKA 3KV6A 5FK8A 1AR62 3ZFGA 5LRRA 3U0ZA 3H8OA 1HV1A 1POV3 1Z0HA 4HSJA 5FZDA 4ATFA 4IEVA 5LBCA 2X05A 2VZSA 3I49A 2JB8A 4XUQA 4Y24A 1T6BX 5L9RA 4D69A 4LBQB 4XVHA 2JX9A 4LJHA 1XE8A 2GNDA 4QXKA 3WNPA 3ZYHA 4LK6A 5A3PA 1US2A 1W6PB 2VR4A 4TWTA 4NRQA 4KGGA 5JMOA 4OI4A 1AXYA 3MEPA 1W2AX 2LW8A 2WS92 4XUTA 4QX3A 4GAZA 4IE5A 5K4LA 1J1LA 4RFT0 1RUI2 1PIV1 4XPVA 5C3RA 4AVTA 1A78A 4CVUA 4IV3B 4Q4X2 4OVEA 3SMHA 1JU4A 3OBRA 4L0PA 5K0UC 1SG3A 3FHAA 5LB6A 2HWB1 1G9FA 4Y26A 1OPOA 1EUUA 1AR72 2A6YA 3NAPC 1JOPA 4QMAA 3PNAA 1Y9GA 4Q4V2 1NY72 3NNMA 1ONAA 5JCTA 1MEC2 2JDYA 5FXWA 2FDKA 1O5UA 4ASKA 1MS8A 3PUHA 4IV1B 1ZYBA 1QOTA 3I3BA 4QPIA 3WDWA 1XNDA 2AGSA 2CHHA 3ASIA 3NNFA 1H8TC 4HFSA 3VBHA 1JZ2A 3CNAA 4YGBA 3PUSA 2NLRA 4O61A 4IEOA 3KHCA 1WLCA 5HCAA 4NAOA 2WSVA 4I30A 1GKBA 1AVBA 5F5AA 4XURA 1CWPA 1QJU2 3KD4A 1QH7A 3MFCA 1DYOA 2J1RA 1SHWB 2ZGKA 2Q0AA 3LIHA 1WWYA 4BWOA 1FAYA 1PZ9A 1VBC1 4IV1C 3WHTA 4D7SA 1S2BA 4GMP1 3HEIA 4GD4A 1I5ZA 5DAXA 4LHNA 4XYXA 1QJY2 1VBD2 2ORXA 4QXHA 4OZXA 4J1XA 4L97A 3OPTA 3AFKA 2GC3A 3M70A 3OGGA 2VMIA 3OD4A 1ZBA1 2BERA 1OD3A 4CDUA 1QQP1 2VU9A 4CU7A 1IG3A 4MXWA 2B46X 4IEYA 4OI0A 4COUA 4RQPA 1NXMA 2GNTA 4LNVA 5BNNB 1XC6A 1H4GA 1YQCA 4ZZ5A 2YU2A 2W0XA 4XJAA 1H30A 3MFAA 3ELNA 2VJXA 3UT0A 4QDQA 4CDQC 3ORJA 1VBA1 1IKPA 4Q4W3 1BK0A 1W2UA 4XFFA 2XL9A 5IWFA 2WYSA 3H8XA 3QH7A 2X5IA 4BOWA 1ZZ7A 1SLBA 1HLCA 3I54A 3R4SA 5FZIA 4WVMA 2P3KA 4ZXKA 2E32A 1VLNA 2BU9A 4B8EA 4H7LA 5A3UA 4BMBA 3OYWB 4I0BA 4XDPA 2V4VA 2JG8B 4XFIA 3OGSA 3MIBA 2DUOA 1Q3EA 5BNNC 2G19A 4Q8LA 2R49A 3J8F3 5BPXA 4CUCA 1HQNA 1MZ6A 2I07B 4DXZA 4HPKB 2D97A 3VV1A 1D4M3 3H50A 2VOTA 1OVSA 5A7PA 4XZPA 3O7OA 3DYPA 4DEVA 1X9TA 4M00A 2GH2A 3J26N 1VB2A 3W5NA 4CCMA 2ARCA 2PAEA 2QQLA 5KBFA 3SISA 1ASJ1 2WABA 1LEDA 1HRV1 1IS5A 4KQ7A 4BPZA 3THPA 4B4RA 2OS2A 2JG8C 3HQXA 4CCEA 2RS52 4QGMA 3RPQA 3WP6A 2Z4FA 2RHPA 4RS5A 4N90A 5FZLA 4IQPA 1QJX2 2B8MA 1J84A 1UO9A 3HAGA 3RMXA 2ZGRA 2VECA 2X29A 2O8OA 4NROA 3O12A 2Q8EA 5A6YA 2CWSA 3WF2A 4UWDA 2R0HA 2VD7A 2XMLA 2YYOA 3IDAA 4E8DA 5KHKA 1UU4A 4CUGA 1C8M1 1RUJ1 2Y0OA 2MEV3 1XBFA 1DYKA 1I5PA 1RUD3 3PU3A 3WG3A 5IK7A 1IS3A 4YLZA 4ARXA 2R072 1W9WA 5FY8A 5JXGA 2XKPA 1RUH3 3GBGA 4GALA 5FO7B 2EIGA 4CPBD 2XG3A 5J09A 1WGPA 2GN3A 3L9JT 1FXZA 3KF3A 3ZIXA 2ZTNA 2Q1ZB 4CUBA 4CDXB 4HKLA 1DYPA 2W3JA 4OHYA 3OBAA 4QD2A 3SQOA 1AYM3 2HLEA 4L92A 1CJPA 1XB9A 4Q4W2 3WNOA 1JHNA 1YFWA 4RN5A 5GM0A 1QXRA 1CZVA 4CRQA 1N1SA 1ZREA 2DU1A 4LBMA 3TB0A 2OQ7A 3T09A 3WSOA 2GC2A 5J3UA 3FMGA 1PMIA 4QKFA 3RI8A 2WFF1 1DP0A 1K45A 1GOHA 2EIEA 4XF9A 3WOGA 2WNEA 5A6QA 3VBSB 1BMV1 1DZQA 1CAVA 4QB2A 1DQ6A 4XFCA 3AZWA 5A7NA 5JZGA 1PK6B 3DPRA 5F37A 2BBAA 2FMYA 2W46A 5I91A 3ACLA 4JV4A 1XYNA 2B9VA 4BHPA 4EROA 3SEEA 3O1PA 3AC0A 1E57A 1SBDA 3VD3A 4F3JA 4NWWA 1GV9A 4JZRA 5C71A 4MGYE 4PIZA 1Z7S1 3CJXA 4GKXA 5D1IA 2D40A 1F4AA 3NVCA 4NHMA 3VD7A 5HPOA 1XE0A 3HT1A 4XACA 1WUVA 3JQXA 3V0BB 1UXXX 1RUE1 3P1IA 4RGGA 2Z5WA 5A32B 2QDNA 1W8NA 4DZGA 4OMCA 4OFGA 3VBSC 5HXMA 5FZ6A 1FATA 5M0TA 2BW8A 2QUOA 1PO23 2ARXA 2C1FA 3IWZA 4JTOA 4WVWA 4XETA 3VDDC 4S2FA 3PMSA 1A3KA 3MIDA 1VMHA 5FFOC 5L7OB 5DPNA 1UX7A 1NOVA 5C8CB 1H9WA 1LGCA 2A5ZA 4L8QA 3I2DA 1EPZA 4IE6A 1FI2A 1REEA 4PCRA 2MEV2 4QHOA 1RUD2 5FPVA 5FYCA 5LA2A 2XR4A 3VZOA 3SH4A 4UFHA 2XLFA 1Q5OA 1WD4A 2CSGA 2ETEA 1RUH2 2WA4A 1GWKA 4QQLA 5FYUA 5ABJB 1OC1A 5GLWA 2WWSA 2FBEA 4JKMA 4UYBA 3ACIA 3T30A 1APNA 4EWDA 5KWRA 4QX5A 2XLGA 2XVKA 4AXOA 1HB3A 2Y34A 4XDOA 3ZSKA 1W0OA 1G8WA 1Y3TA 2JDNA 1AYM2 2WRAA 1BYHA 3HR9A 4Q5OA 4XUOA 2RS31 3IMNA 1LHNA 4FCAA 5BNPA 2RMU3 3J7LA 1SLLA 1YFUA 5CKMA 3WV6A 2WZR3 1V70A 3VBOB 2VOXA 5C8CC 4B4PA 1BBT3 4I02A 2EVXA 2IXKA 2XJTA 2OQ6A 4NWVA 5F5QA 5JSOA 4B29A 3O1VA 5A33B 3ZKYA 3M4FA 2A6WA 2VOWA 5ABJC 4LLFA 2F4LA 5FZ7A 4HONA 4A7ZA 1E5SA 1REFA 4LA2A 5BY5A 5FKCA 1O8PA 1W8UA 5FR3A 1TEIA 2E31A 5D2AA 4DUXA 3IMMA 3H7YA 3LPFA 3MICA 1GP5A 4XTMA 5EJ3A 3TN93 4A45A 1RXGA 1XQNA 1HQWA 3PLQA 3LSDA 3VBFB 4IUGA 5JR7B 1ZRFA 3KS7A 5C3SA 2GC1A 2TUNA 3RJ2X 2JDPA 4V2WA 5A3MA 3JZVA 1OLMA 2RDSA 2EXJA 5J98B 3ZN6A 1YHFA 1GLHA 4FP3A 2Y6LA 4URAA 3ZYJB 5I8SA 1GUIA 2Y6HA 5JI7A 1MZEA 4RGKA 3R4UA 1SCRA 4K3UA 2PMWB 4ZPIA 5T50A 3U37A 2DFBA 4P9IA 3VBFC 5GLZA 3M3OA 3PTYA 1HN0A 2CV6A 2VNVA 3ZFGB 4PQ9A 4A6OA 2F4PA 4D7TA 1YFXA 5JVVA 5LRSA 1CIWA 4CP9A 4B1LA 4XDQA 1UY1A 1Y7BA 1OH3A 1H9PA 4Y5SA 1SBEA 3UV9A 1BEV1 3DV8A 5C3QA 5JPMB 2OVUA 2Y6KA 3MLJA 3RZZA 1LOFC 2I74A 3IDBB 1OLRA 4MGTA 4AFAA 4CSWA 1COV2 1IGOA 3TEXA 1DQ0A 1PMJX 3PHMA 4YWAA 4UF0B 5KC5A 3JBG1 4FPHA 3BI3A 2DCYA 2WO3A 5C7GA 4UFLA 4LBNA 3WF4A 4CYDA 3HIFA 4QKBA 5DAWA 4IV3A 1F4HA 1YI9A 4JTNA 3ZFGC 1AUYA 3A0NA 1LOBA 1MS0A 3N7KA 4Q0PA 5FYZA 2C9AA 5IYYA 2ZGUA 3CKHA 3K48A 1YQ6A 4NRPA 3I2FA 1TNRA 2D3SA 3HQUA 4P9GA 3RSJA 3DYMA 5F5CA 1H4HA 4ET7A 1FMD2 2IFWA 3PVOA 3OPWA 1POV1 4XMIA 5EV7A 3IKWA 1AYN2 3ME2A 3POYA 4QQPA 1JN2P 1X82A 2BV4A 2P3YA 4GH4B 4QX1A 1V0AA 1C1LA 4QPIB 2B7YA 2D3RA 4RHV1 1EV13 4Y22A 3VBHB 3VKMA 2BJSA 1JHJA 3PVBB 3W21A 4AE2A 2XHKA 4XF4A 1F8VA 1XNKA 3AZXA 1VALA 3E6CC 3WHUA 3S6PA 1JUIA 4K6BA 4YGEA 4OUMA 3UGFA 2EXKA 1JW6A 1OLME 5I0UA 3T0AA 2D3PA 1NYWA 2WINB 4UAPA 2DTYA 4FPJA 3EYPA 1ODNA 1NCQB 1HRI3 3PJYA 1UIJA 4META 2ZMLA 5LW9A 1D2QA 2ZCWA 4MUVA 3WW3A 2ZMKA 4MOAA 5T54A 3POSA 5KHIA 3IAQA 1UMIA 1GMMA 4QPIC 1OQDA 3WQBA 1NLSA 3VZLA 2VMCA 4Q1RA 3VBHC 3RZGA 4IEXA 2VY0A 4JGZA 3ZSMA 1VE0A 3SH3A 4PLNA 3ZXAC 5F9TA 5KXDA 2VZ1A 3EO6A 3I59B 1U5ZA 2PTMA 3B3QE 2BWAA 4AHYA 4CDUB 4FXGB 2EXHA 4IXLA 4PJYA 2VGDA 3AM2A 1FV3A 3BALA 3KCYA 5B4XA 5FP4A 1CX4A 4MXWB 2JE7A 1W9TA 3D0SA 3E6DA 4FP2A 2AEZA 4XBNA 5CZKA 2L9LA 3INAA 1BVP1 2Q1MA 3RMYA 3FWEA 1NXD1 1KJLA 4ZU5A 2ZHLA 3IPVB 4Q27A 4L11A 2IC1A 2X5IB 3AYEA 1JYVA 4ISRA 4YGCA 2ZS6B 4ES8A 1RUG2 1WW4A 4YM2A 1EAH3 4WVMB 5FOJB 4CDUC 1BKZA 3ECQA 3OYWA 5IT6A 5ACA2 1RVF2 1PX3A 1ULPA 4YVSB 5FWEA 5FYYA 5FZHA 2GMEA 1HXS3 3PVNA 5FYSA 1V6IA 2WQ8A 1MZ5A 4RQPC 5FPLA 4CCDA 1J3PA 3CJIA 1JZ6A 3QOPA 3S5QA 1EV12 3AP5A 3R05A 2J1EA 2GP3A 5EP9A 4I0AA 4N7IA 1TE1B 2R043 1B35B 3AZYA 3IAPA 1F35A 3ETPA 1R64A 2X5IC 4FT8A 2YPJA 1LODA 2PN5A 3LKJA 3WDVA 4B1MA 2FCVA 2VH9A 3VZNA 4K40A 4Q4W1 2ZOEB 4N8MA 1PGW1 2QNKA 3E97A 5EJZB 2XOMA 5J37A 2N7GA 4MGIE 2P2KA 5L73A 1YI7A 5JOWA 2QQPA 2LTNA 2BBVA 4N53A 2RM22 3MUZ1 4XFBA 2SBAA 1O6UA 1DLLA 4RS5B 2ZGPA 2O14A 3VN4A 2DYCA 1OI6A 5FMCA 3VDAA 3ES4A 3AL6A 4OCTA 2C5DA 2D6MA 1C1FA 2WZEA 2HJIA 2QFEA 4J25A 4JGYA 1XNTA 3J8F1 4LPLA 3I7DA 4EQVA 1JXNA 1S0FA 2BYVE 5JXHA 5FXZA 1KS5A 4ES9A 1D4M1 4FPLA 2OKXA 1DG6A 4IEZA 4LBQD 4WM7A 3ZYIB 3D5OA 4KBZA 1CPMA 1WMEA 5FMDA 4QU1A 4CE8A 1MVEA 1YQ8A 4OHVA 3B00A 1BVVA 1EY2A 5DZGA 4Y3OA 4CDXA 3K75B 4BXFA 4RS5C 3AXDA 1CQ9A 4LBJA 1EUTA 3KV4A 5F2SA 3DL3A 3VD4A 2A71A 2AC1A 1PVC2 5FTTC 1JZ5A 1DLCA 1VB4A 1I6XA 3ZYBA 1H6XA 1K5MB 3NQHA 4IESA 1W03A 3M3IA 1EAH2 5DAVA 1ZM1A 3V56A 1UYYA 1FPN3 4FPOB 4LMFA 1V6KA 5BNOA 1PVXA 2C0ZA 1ZBE1 4QX8A 1X9PA 3T08A 3D6EA 5CNAA 1UF2C 1KDKA 1IOAA 1NE6A 1RUD1 1ZX5A 1XE7A 4AQTA 3P3NA 5FP3A 3F2ZA 4FPEA 4D6RA 1QJZA 2NMOA 5AFEA 4AVBA 1RUH1 3AYCA 1PK6A 1PGL1 4R4XA 2WT2A 2ZA9A 5A7WA 5CADA 1CAVB 4DFSA 2R042 1SACA 5C3PA 5JZGB 3RGBA 1RUNA 3GYDA 1HJGA 3QH6A 5FREA 5JOYA 3KV5A 5LBEA 4E4HA 3K2OA 4Z2AA 3BPZA 5J48A 1W39A 1UPSA 3V0BA 4LXLA 1K42A 5FYHA 1W99A 3OUJA 4IW3A 4AK3A 1EPWA 1PO13 4JQTA 2QBXA 3NJZA 4EWEA 1H6YA 4CP1A 1DQ1A 4M3CF 1M4WA 2O0OA 2ZGQA 4XMAA 2ET7A 3THTA 5A6ZA 1R082 2J22A 2D6LX 1AR63 2MNGA 3AZZA 5L7OA 5FY7A 2XQXA 5GALA 1UOFA 1C3HA 2BNNA 2HEWF 5FJKA 5JZGC 3DPRC 3FFZA 3ZDSA 1MS5A 2QCSB 5JR2A 1OSGA 3OGRA 2GMPA 2CWMA 4BQ5A 1ND3B 5JOXA 3IM0A 4NR1A 4D3WA 5TSWA 1Q43A 2PHLA 3WZ1A 1CAUB 3DUIA 1L3JA 2ZMNA 3FN9A 1R092 1Q8OA 3ZXEA 3ZSJA 3NNGA 2Y38A 1V6LA 3BODA 4AI3A 2PLV2 3OBZA 2DBIA 2HWF3 3UYJA 3VZKA 1ZA7A 2Y26A 4PBPA 2WS93 2VZVA 1RUI3 5DQ0A 3H8UA 5ANQA 2LUWA 4Q4X3 3VBOA 1Q8PA 5BNPB 5HI0A 4HMZA 4LO4B 4YG0A 3O1UA 5FLJA 1PO21 1Y9QA 1GZ9A 2P37A 3PUIA 5A33A 1AR73 3M3QA 3S30A 3UKVA 5BYNA 2ES3A 2VTXJ 2V73A 4LOSA 4Q4V3 2XB6C 3RZHA 2ZACA 4BB3A 4BU2A 1MEC3 3Q8AA 2H0BA 1HB2A 1KFUL 2UYBA 2JIJA 2XLAA 4NPLA 5JUVA 2XUEA 4NIDA 1RHI3 3MO4A 2CGOA 3Q8BA 5GKAC 1ND2C 5C33A 3C7EA 2AACA 1AL0G 4IEPA 4W8JA 4BDVB 4IEQA 4ZU4A 5B4NA 4FOWA 3DCQA 2XJVA 1X8EA 5SV8A 1SDDB 1QMJA 4E9KA 1RUC1 2ZABA 3K4DA 4BISA 2ZKLA 1UW8A 3EXUA 1AL23 5LZ6A 2JKBA 2WNUA 5GZFA 3WXPA 2PHUA 3LEKA 5BNPC 2VQTA 5KHJA 1UPIA 4AFMA 1QJU3 3LDKA 5FYIA 4OI1A 3AP4A 2ZBJA 4OQ9A 1W06A 4JC1A 4X6QB 5FBZA 1HB1A 1MPXA 4R9CA 2RMU1 4XF3A 3WP4A 3WR0A 2DWRA 2C26A 2WZR1 4HK9A 3ZN6B 4M3CA 1TME3 1BBT1 3ZLIA 2B39A 5JXJA 1YIFA 1UZ0A 5GLUA 3VD5A 5GZEA 1Q8QA 4QPGA 4CCLA 5A3TA 3I2OA 1RXFA 3QD6A 1NKGA 1QJY3 3ZMNA 4C1WA 4W65A 3T3YA 3MZHA 1SDWA 5IK8A 5F6KA 4YZ5A 4BQXA 1UL9A 3KLSA 5IAXA 4XEZA 3FE5A 1GP6A 2JDUA 3HNMA 3TN91 5C9AA 3FLRA 4CCKA 2CAUA 3POGA 1UU5A 1X33A 3Q8CA 4HN1A 3RYKA 4CU6A 3LE0A 4CP9B 5I0TA 1S1AA 3AB0A 3IBMA 4OUSA 1N3QA 2C4XA 3WNNA 2Y33A 1OUSA 3CZUA 1MS9A 4UF0A 2PQSA 1G86A 2FQPA 1SQ4A 4MYEA 2VBBA 2HWC3 5J1XA 1LECA 1KQRA 2HWF2 4XCAA 5JI9A 3MBWA 4MADA 3BCWA 2WC2A 3LCPA 2Q1FA 1FX5A 2VCBA 2R30A 1RUF2 1VMJA 4EN0A 5CAZA 2D6PA 1AXKA 2KA3A 3UJQA 2WO7A 4CEWA 2BGCA 4M0NA 1IPJA 3ACFA 1CZSA 4QDRA 3VKOA 3O1OA 2QQJA 2JEMA 4IGOA 5FYTA 5LATA 1OVPA 2W39A 3ZPYA 1PHMA 1AR92 3FBMA 2NPIA 2R1BA 1JODA 4P5HA 3HNYM 4GH4A 1V9U1 4DMIA 4E4DX 1RHI2 5KXBA 1RITA 1VR3A 2WSUA 5AC92 4PDWA 2Y64A 3AMQA 3B7MA 4AI9A 4ARYA 4XAEA 3I4IA 5FYVA 4XIKA 5C70A 3NJYA 4Y22B 3TNQA 2J1AA 2XBO2 2Q5TA 2DCKA 3KB5A 2HKXA 4NN0A 4QKNA 1AL22 1NQDA 2YU1A 2DVAA 1W9YA 2IVIB 3D4KA 4IV3C 1BJQA 1QJFA 2CDPA 1ENSA 1DQ2A 5A3LA 5FUIA 3N9QA 3BN6A 1VMFA 3K3OA 4HKOA 4PQQA 4YW6A 2EIDA 1W8OA 4HVOA 4YW2A 1QDCA 1NAEA 4AI0A 1NCQA 2PELA 1QDOA 1WMXA 1MVQA 2VMEA 2VUCA 1Z78A 1GYKA 1CONA 1SLTA 2RS53 1W2NA 1TME2 3MUY1 4UT5A 2PAKA 3ACGA 4M3CE 2PQQA 2G9GA 1QJX3 3JB4C 1X36A 2A6VA 3E5XA 3MDPA 4JRAA 2ERFA 3VKNA 5CA6A 3UK9A 1CESA 1CAWA 2WLQA 1W3VA 3ZYFA 2HWD3 2UWBA 2FDFA 1BCXA 3MPPG 2BRTA 2HBTA 2JDMA 4CA9A 3I59A 3GZAA 4JGZB 1V00A 2JDAA 1SBFA 4GWNA 4AOCA 4BE3A 3O0WA 1L7LA 2OT7A 2FDIA 1C57A 2R073 3LD8A 4MGKE 5L19A 3JD72 1RMU2 3RZLA 1YUDA 2VMGA 5FUPA 4MG2A 4IERA 4A4AA 3Q9OA 4XTPA 2UWCA 2ZZQA 4AGVA 2HWC2 2W1UA 3B5LB 3MIFA 5BV6A 1PNGA 3I2JA 2YGLA 2A75A 1V6OA 4I3GA 3ZPOA 3IPVA 4DPNA 4E2QA 4AQ6A 1HRI1 1IHMA 5L9BA 3GDBA 4XF1A 2PHTA 2ZX3A 1AR83 1NZIA 1O8SA 2JXAA 2OIIA 2W47A 4JGZC 4C1XA 1D4VB 1GQGA 1S0EA 1JH5A 2QDRA 4FFHA 2XWBB 4QM8A 3E5QA 5E88A 2DVGA 3VB9A 4IE0A 4YVSA 3J9SA 3ZM8A 4AEJA 1QJEA 4FAGA 3TOJA 2RDQA 3O0VA 4X8PA 4BYYA 1CD3G 3B9CA 2AH2A 2JDKA 4SBVA 4YVWB 2VNRA 3QBQA 1URXA 1OOPA 3I3MA 3JXSA 3CJIB 4QQHA 3CEWA 1I1EA 2ORZA 3LOBA 1B35A 3AXEA 3MIGA 3E6BA 1LNSA 4MXVA 3ZIWA 2DTWA 4LR4A 4HLTA 3OB8A 1LOEA 4LEJA 1BZWA 2A6XA 4DIQA 5EIYB 3E5UA 4XBQA 2ZGOA 4GJYA 3WW1A 3GJBA 1ZVFA 1XRUA 2GU9A 4AVCA 1DBNA 2DDUA 3RI9A 3MF9A 3D0JA 2RDNA 3WY6A 4R9BA 1DQ4A 2W91A 1CZTA 1KD7A 2X10A 3MW4A 4WVZA 3DN7A 4N53B 2QQMA 1UD1A 3W9AA 2TNFA 5K9YA 3K46A 3CJIC 3J7NA 1K5JA 2HWD2 4E4ZA 1ZZ6A 1HXS1 1ENQA 4W6YA 4DY3A 3JU9A 3VHOA 1HIXA 4JGYB 4GQ7A 4NUBA 3WG2A 2A1XA 2XGXA 3NNLA 1K3IA 4QDSA 2PYTA 5E1RA 3RRDA 1S0CA 5FQ0A 1LU2A 3KM5A 5FPAA 1TQ5A 1UOGA 3WD5A 3LQCA 4WM7B 4YM1A 2CDOA 3OGJA 4DINB 5HV4A 4GULA 1FNYA 2PA7A 5BNQA 4FFGA 4N53C 5LASA 4C0BA 2W52A 4LBLA 2JJ6A 4Z8BA 3GZUC 5FLHA 2VBDA 3CIHA 4E8CA 4MHRA 2AREA 3AMPA 1AR82 1K5MA 1NE4A 1RGSA 2VOVA 1L7QA 4E27A 1ACCA 1G9DA 4FSJA 2FZ1A 1YNAA 2H6CA 4MH0E 1ENXA 1XNBA 4NO4A 3BYWA 4V2VA 3GCXA 4QB6A 5FY5A 5IATA 4PF1A 4LTAA 4UFKA 3FLTA 4WM7C 5BNOB 3AJYA 4XIOA 1GWMA 4YYOA 1J3QA 2Z42A 4TSVA 1NT0A 4CDXC 5IVCA 1ZNPA 3O1MA 4BCUA 5E16A 1S0DA 1VRH2 2RE9A 2YC0A 5A1FA 4NE9A 4XJ9A 1CAXB 5A7WB 3O0XA 1DCSA 4FQ4A 3Q8EA 3CZJA 1UNBA 4LK7A 3IIAA 5CBLA 5CG9A 1O3RA 4FTBA 3N7JA 2LM3A 1LULA 1IPSA 1YXWA 2RG4A 3POEA 4YG3A 4BQ2A 4CU8A 4BA6A 1MZFA 4JDNA 4O9GA 2VQUA 2ZX4A 4UI9L 5IVJA 5IVFA 2ZGTA 4Z92B 3RWKX 2VW1A 4OLLA 1LHOA 2LALA 5BNOC 2H6BA 1MS3A 4LORA 2LRPA 5FO8B 3KT1A 3PDQA 4XQWA 1FPN1 4GWJA 3DECA 2VZOA 5B2GB 1ZRRA 1ZZCA 3NV3A 1QH6A 1PK6C 1RJ7A 3P6BA 4ZY9A 2YBSA 4S2HA 3BTXA 1OQEA 3DKQA 5KXCA 1G6NA 2WYFA 2Y6FA 4GJZA 1CX1A 3H1YA 1GNHA 1AJOA 1WLDA 3NL1A 5F3GA 4C0HA 1ND3A 4HXCA 5DMYA 3H7JA 3IDCB 1GQHA 4AGGA 3TEZA 1CAUA 3X29B 3L2YA 3BIWE 2XVGA 2VVFA 5F3EA 1COV3 1UZVA 5JWPA 3LDBA 3H3ZA 5FZOB 1V6NA 5CIRA 4L2NA 4YZ3A 1OF4A 5H9QA 2W68A 2PHXA 3HT2A 4COYA 1QXPA 3Q8FA 1MR5A 2OPKA 5A80A 3I3QA 1XU1A 1PO11 5IK4A 1QXJA 5L7OC 5FK7A 5FJHA 2ZGMA 1VAVA 3APBA 1MS1A 2X8KA 5JIAA 4AEKA 2RS11 3FFQA 2ZEYA 1UZWA 1UIKA 3GZTB 5CFDA 1AR61 2XJUA 1FMD3 5IW0A 1N3OA 1SCSA 3AKQA 5FMBA 2PAMA 2WFPA 5ANNA 3NV1A 1AYN3 3WQ1A 1B09A 2YFZA 3IZOA 2ZEZA 4OUEA 2H0VA 1FV2A 4BQWA 4CP2A 2DU0A 2ZHKA 2GSYA 3ZFFB 4YZ2A 2ZXQA 3CO2A 4HSLA 1WBFA 4XHXA 5LBFA 3EQEA 1NLQA 1SFPA 1VBE2 2XKOA 4CUAA 4LA3A 4FI9A 1YYNA 2DCJA 2RV9A 5FZCA 2WNUB 2AEYA 2ZKNA 3ZKUA 4QM9A 3VBOC 5AFBA 2BWCA 2WS91 4BLJA 4NIGA 1OA2A 4WM8A 3OG2A 2ZZJA 1RUI1 3JUUA 4ONUA 1LENA 4Q4X1 2OYZA 1SMVA 5J36A 4QPWA 4CXYA 1S0BA 5ISLA 2YHJA 3MPBA 3NV4A 1FOD2 4LHSA 3N7MA 4M3CB 1AR71 4DRVA 1LTEA 5FLIA 3VDBA 2GALA 1ENRA 1NY71 2OA2A 3LOIA 4Q4V1 5F39A 4QPGB 1J58A 3RVHA 1MEC1 4UOJA 3OEAA 2FCUA 2FDHA 1O91A 4CU9A 1FYUA 3WUCA 5GZCA 2WNUC 1IQAA 4TTGA 4HVRA 2DVBA 4AI1A 4D6SA 4DNYA 5FKBA 5C9AB 1RJ8A 2VZPA 2ZEWA 2DURA 3G7DA 4FPGA 4E2SA 1UY3A 1AL21 3K4AA 2CU5A 4K8FA 1GZWB 1Y43B 3PJQA 5FZ0A 4BQYA 5JMCA 1QJU1 5FIXA 3ACHA 5IJRA 2BFUS 2R6QA 2HWB3 2FZ2A 3PMEA 4QPGC 4CXWA 3FUOA 1NLRA 2EALA 2V4AA 4H7MA 4O7XA 5IVYA 5LY1A 1Q8VA 4UFJA 1VP6A 3GF6A 4FPCA 5FY4A 1YEWA 2WAAA 3NAPA 2Q8CA 4DS0A 4LHKA 3VKLA 4GMP0 1RUG3 1JBCA 1QJY1 1VBD1 1WD3A 2E7QA 4CEWB 5C9AC 2PHDA 4J6GA 1LHUA 1QU0A 5ACA3 1RVF3 3T2TA 1L7RA 1SLIA 4I2OA 3LAGA 4GZ9A 3ENRA 4ATEA 4GB33 1W05A 3T0BA 4AWDA 1SEFA 1W2TA 4PF5A 3ROUA 2P17A 4CCCA 1UYPA 4KU8A 5T52A 4R8HA 5IUQA 2XL7A 1O4TA 2A3XA 3AVRA 4PDWB 4YW7A 2FCTA 4JVAA 4QU2A 2KD7A 5EYYA 2WO1A 3GALA 4AQSA 2DVDA 4LO7A 5F3IA 2D5HA 5T55A 4BMEA 2Q8OA 4Y1XA 5FYBA 3QACA 4YPJA 1DGRN 2D93A 3C7OA 4ASMB 4CEWC 1ZRDA 2RR12 3WP5A 4ZKTB 1TMF2 1UN1A 4CEYA 4EZHA 1S0IA 2RM23 4OHWA 4F83A 2JDZA 3AFGA 4OI2A 4GH4C 4LUKA 4CCNA 3QLQA 4Y5TA 3S57A 2XQRA 4O65A 4PDWC 1WCKA 3AX4A 3OEBA 2VO5A 4BIOA 1CAWB 2AUYA 3PURA 4R4ZA 5A1AA 3O1SA 3B01A 4E4SA 4D7YA 3KCXA 2W1QA 3NKTA 4P00B 3NJVA 3KVAA 4HANA 1US3A 2FDJA 3BU7A 5JAXA 4MGZE 1JI6A 5GJ6A 2K0GA 1VBA3 3GBFA 3MIHA 5JPNB 5LBBA 4GWMA 1NCQC 1PIV2 3SNMA 1PZ8A 2Y60A 2XJQA 1D2SA 4OZOA 5F1RA 4HBNA 2HWB2 2WNOA 2YXSA 3UNPA 3W20A 1DGWX 3FHIB 2RS51 1PVC3 4H3WA 3V64A 1LJ7A 2IXIA 2WO2A 3AYDA 1YIPA 1QJX1 2XDVA 1OLQA 1JZ4A 3UKNA 5DZFA 2IZWA 4NAMA 4D6QA 2C24A 4DB5A 2VZUA 1WW7A 3LFIA 5SV5A 4AYUA 2UY8A 5EJ1B 4GA9A 1T2XA 3RZKA 4Z82A 4YVWA 1YO8A 4GB32 3AK0A 3I2KA 4LE3A 2QVSB 1QHDA 2R071 3C3VA 3ZYRA 1UQXA 1OOPB 1IPKA 1W6NB 2RDRA 2R063 5HBAA 4MSVA 2OUJA 5DUVA 2WWJA 1M06G 1X8MA 3OJBA 4EZ4A 1CR7A 1OKOA 1RTVA 2B9UA 4FFFA 2QQVA 2X09A 1W6QA 5A6XA 2GDFA 5ERLA 3DYOA 2D44A 1H2KA 1LRHA 3VBUA 3A23A 2W5FA 1LKNA 1AR81 4JAAA 1QWRA 4QGNA 4X6RB 2JG9B 1HW5A 1ULFA 1AX1A 2RJ2A 4YVSC 4A3XA 1GBGA 1VJ2A 4N9IA 4M4PA 5FMOS 4W50A 2GZWA 4DRRA 1ZBA2 4YARA 2VNGA 2JE9A 4XHBA 1RUJ3 4FAHA 5C3OA 1R083 1QQP2 1OOPC 3LSEA 3GXUA 3RZMA 2XONA 3FHQA 1B35C 1UY2A 4FPKA 4RR3B 4QHZA 2JE8A 2UYAA 4LITA 4LO8A 4XQ4A 1VPHA 3USSA 4CDWB 2UWAA 3HPNA 2YUEA 2VC9A 4QQOA 5IAVA 3N3HA 5JSPA 2G9FA 2DCZA 2VZTA 2YFUA 1GNYA 1JYWA 1F15A 4KWLA 5FQ0B 1VBA2 1V6MA 3NW4A 4MV2A 2A7AA 1R093 2BVBA 3KT7A 2Y6JA 3POBA 1A6CA 4OULA 4AFCA 2YPDA 1OD5A 4H55A 2PLV3 2D5FA 2JDHA 2RVAA 1WCUA 3N9MA 1F9KA 3R0RA 4KGQA 4MLOA 2YC2A 1W2OA 4W6WA 3BGAA 1AHSA 4EV0A 1OPMA 2B4KA 2E7AA 3ZVXA 4NOTA 3ZN5A 3LGRA 2GMMA 4BK5A 3NJXA 3W59A 4INDA 4I01A 3EHKA 1Y9MA 5A1LA 1UX6A 4KMQA 3TYJA 2CL2A 2WN2A 2ZAHA 4LKFA 4EYUA 3SCGA 3VHRA 2J1VA
chains in the Genus database with same CATH topology
1ZZ9A 2MEV1 4PIXA 1KS4A 4BLIA 2X53S 1Z7S3 3ZXFA 5I0RA 4RGAA 1CAXA 1G7YA 2R062 1SFNA 2R32A 2CTVA 3KMHA 2WZPP 3NV2A 2FMDA 2B42B 2ZX2A 3AJZA 1HRV2 3MLLA 1CVNA 2BUKA 4UBHA 4C90A 1K5MC 1AYM1 3FZ3A 4RA0A 2HYKA 4Z1VA 3B02A 3AZVA 2YMZA 2XPJA 5E8AA 4FOVA 1C8M2 1RUJ2 4A2UA 2JENA 1CN1A 3UKTA 4AI2A 2I2SA 2CY6A 1WMDA 3VGIA 1HQLA 3KZ4C 4LBOA 3MF6A 3VBRB 3ILNA 4Q0QA 5EWSA 1YCIA 3N35A 3M7AA 4ASLA 4V1PA 2GAUA 4WBBA 2IXJA 1AX0A 2IXLA 3HBZA 4KWJA 4XJ8A 4DOUA 3TWIA 1O3TA 4NHKA 3USUA 4PBOA 4UW6A 1DQ5A 3ZSLA 1DIWA 2EF6A 1RUF3 4BM8A 3TAYA 2WFF2 2R1DA 2NZ9A 3ZXGA 3GNEA 1REDA 2Z79A 5T5LA 4BZ4A 3UJOA 3SLIA 5CFDB 1ND3C 1WLTA 3SCFA 4AVVA 2XH6A 1AR93 2WNVB 2YGMA 4QT6A 3AMHA 4G3YC 3ZFFA 5FPXA 1AJKA 4KL1A 1VIWB 3WQ7A 1EYBA 3WNXA 3AKRA 5EXOA 5AC93 4EWAA 3ZFEB 5JSRA 4CTEA 1AXZA 1Z7S2 2XBO3 1COV1 2YZ4A 1XU2A 3OY8A 1F5JA 1RUE2 1NCRA 3AP9A 2Q30A 3O14A 1QF3A 5CFDC 4WM8B 1ULDA 1GNZA 1G9BA 2D6NA 2EXIA 2WL1A 1OFNA 5LK5A 1FMD1 3WG1A 1ALYA 1WLWA 5GZGA 4HVQA 1JYCA 1POV0 4QHBA 4Y1YA 1AYN1 3KSCA 1C8NA 2ENRA 4JDOA 5T5JA 1W6MA 4FBFA 4S2GA 1A8DA 1F31A 1N47A 2TEPA 1WW6A 2EAKA 5K8SA 1Q8SA 3TRSB 4YW1A 2JICA 4E2GA 1SLCA 1SLAA 4FVVA 1FNZA 4WM8C 3JD73 2WJSA 1GZWA 1RMU3 4HN0A 4COVA 2RS32 4IEWA 2ZGLA 1CGPA 1YJKA 3WCSA 4FPFA 4Y4YA 3VUOA 4COWA 2A3WA 4XJZA 1KFXL 1O3QA 2G4IA 4Y1UA 1NA1A 4ITCA 1OA4A 4LULA 4AVAA 1BQPA 4LHLA 4B7EA 3RWNA 5K0UB 2NMNA 3AYAA 3NAPB 4KG8A 1S2KA 5T5OA 1UKGA 3R4DB 3AKSA 4RHV3 4YZ4A 4LBKA 4Q0SA 2AENA 2KXLA 1DF0A 2XVLA 3AMMA 4N7UA 2OZ6A 3O5SA 2D6KA 4WVVA 3FUQA 1H8TB 1VBB3 1GZCA 4K9SA 3WUDA 4DY5A 1DGRA 2DF7A 3OCPA 1QOOA 2DVFA 3K51A 5CFCA 5C6CA 3RJRA 3ILRA 4OHZA 1QKQA 2E6VA 4FXKB 4K1YA 4N43A 3UL2A 1JUHA 4P9XA 1DU3D 4Q4Y3 2DCTA 1LOAA 2GNMA 5D8AA 1MQTA 3MLKA 3B93A 3SH5A 4CEYB 1ZA4A 2O1QA 1RUG1 1G9CA 1FT9A 2ZX1A 3RDIA 3WDYA 2PHWA 3RQ0A 1R1ZA 1C28A 3N36A 4Y20A 5ACA1 2MPFA 2RJKA 1RVF1 1BEV2 3WCRA 2E63A 4I09A 2A73B 4GB31 2YDEA 2GNBA 3MW3A 2Y0IA 4D94A 4BIFA 1UMZA 1EV11 3D8CA 3BOWA 3NKGA 3JBG2 4QGLA 3N4MA 4BH9A 1N1TA 3VHNA 4FQZA 5J96B 4CEYC 4HKWA 5LK7B 1DDLA 4YFZA 5KHHA 1R1A3 4K1ZA 2UURA 4CDQB 2V5YA 1LOGA 2YY1A 4YW5A 1QNYA 3H9AA 4AHWA 1WMFA 2RM21 2VOKA 3JQWA 4KH9A 1QNWA 3ZXKA 1EP0A 1X7NA 1X50A 1D0HA 3VKFC 5H9PA 4GKYA 4RHV2 5AVPA 2YROA 3H3UA 4U2AA 2HEYF 4UXAA 1MACA 5I8TA 3V0AB 4COZA 1VBB2 1W6NA 2I45A 3ES1A 1BXHA 1VRH3 3WVJA 1OHFA 2XJPA 3OF1A 1IZ3A 1WBLA 2OUHA 4PLOA 3ZMOA 1ZZ8A 2IWGB 1VAKA 2WLPA 4LO6B 4Q4Y2 3NO8A 4B3NA 3ZXDA 1W6QB 2PHRA 4XJWA 3P3PA 1PVC1 2XJSA 5H9RA 2JG9A 4LT5A 4AQ2A 3VBUB 1YLLA 4MZUA 1NQJA 3WLUA 1UZYA 3AKTA 3KGLA 4YVWC 1F2NA 1EAH1 1WA4A 1O4ZA 3FJSA 3G6JB 4YNIA 4XFHA 3KCCA 4RR3A 5FDBA 5AVAA 4XXAA 1LGNA 1LGBA 4MX3A 4CDWA 2VW0A 2JECA 1H1MA 3DF0A 4NPRA 2R061 2AZ5A 1DGLA 2R041 4N9HA 2QJVA 3A0KA 3VBUC 3POWA 2DUQA 5HCBA 1IS6A 1OMIA 2P3JA 1KDMA 1R1A2 2ATFA 4Q1PA 4CZSA 5E89A 4ORFA 3ZN4A 2B45X 3MI8A 2Q4SA 2PHFA 1Q56A 1AF9A 3EBRA 4I0WB 5GLTA 2HEVF 4P14A 1ZBE3 5F6LB 1U0AA 4FOQA 1RL3A 4JGYC 4A7KA 2DV9A 3HN1A 4EN6B 1HDKA 1R081 4Q0UA 1W6OA 4IL7A 2GH8A 2WT1A 4AVSA 5JIUA 4B7KA 3EJKA 1N1YA 1LHWA 1DGWA 2JD4A 4Y1ZA 2NP0A 1LEMA 5HXVA 3WX5A 2VQAA 1PGW2 1VBE3 4EN8B 1R091 1DFQA 2D43A 3VL8A 3VZMA 2PLV1 2A3YA 1LB2A 4U36A 2OZJA 2QKDA 4JQRA 2EA7A 4DQAA 4A7YA 3OPZA 4Y1VA 2BFUL 4AEDA 4FO9A 1FOD3 2HWE3 3B94A 4YZ1A 1GFF2 3J8F2 4YW3A 4AHXA 2VXRA 4TLFA 3VDDB 2E51A 5CB7A 2DFCA 3URFA 1D4M2 3ATGA 3M1HA 2E53A 4WZFA 3WW2A 4KG0A 3AP7A 4R52A 4FOYA 3TBDA 2NYYA 1UCXA 3CU7A 5GZDA 3DGTA 3VZJA 4P9YA 3VBRA 3S0MA 2KM2A 1LESA 2O8QA 3BB6A 1C5HA 1YRZA 4CP0A 1QGLA 4P9LA 5IK5A 2ZX0A 1HX6A 4ZU7A 2MHFA 1A8MA 4AGRA 4JRLA 3USUB 4GIQA 4PLMA 1RINA 3WQ0A 3NWKA 1MS4A 1ZBE2 3HD8B 1RC6A 5DDJ3 3LWCA 5T3NA 1CPNA 2QZ2A 2WNVA 1IKQA 3LA3A 1YFYA 1PGL2 2NM1A 1RUC3 1ND2A 2OW4A 5C4WA 3GBWA 4G4FA 3H1WA 2TBVA 3M2MA 3ZFEA 5DUWA 2Z69A 4ISQA 2QZ3A 2D6OX 4UW5A 5J7MA 1KRIA 3CL1A 3H1MA 4O9EA 2VULA 1LHVA 2K2SA 3M3CA 2QE3A 3AMNA 3BOPA 1H1IA 2VUJA 5DZEA 3WT3A 3A4UA 1O4YA 2HWF1 3OY8B 3WINE 3U10A 3S7EA 3U11A 1NCRB 3W58A 2RR13 5DXDA 1RUF1 1TMF3 1XNCA 2HWE2 1SFYA 3LZZA 1LU1A 3ZFFC 4YSFA 1AR91 2P3IA 4YFWA 1OKQA 4F8AA 3OTFA 3ST7A 3ZXLA 4J1WA 4UW4A 1RHI1 1W6MB 3MYXA 5AC91 2RJLA 5I8YA 2BPA2 2W08A 2ZGNA 3BTAA 4K21A 4RL7A 2VNOA 2CNAA 1NCRC 1H2NA 2XBO1 4S2DA 4XXPA 1H0BA 5H9SA 3T1LA 1PIV3 3WDTA 4RSUA 4YM0A 3H0OA 1PO22 3QCWA 1NZCA 3B9IA 2P34A 1NA1B 4K20A 3RS6A 1TME1 5K0UA 4AHZA 2DUPA 4P9WA 1AX2A 3S7IA 5DDJ2 2VG9A 3SXWA 1V9U3 4LBQA 4AG4A 3WW4A 2WT0A 3M3EA 2UU8A 5FMOL 1ULGA 1W6PA 1RUC2 4HZFA 1S0GA 2BEOA 3NSTA 1H8TA 3RYRA 1KJRA 1VAMA 3JD71 1RMU1 5GLVA 1PNFA 4QQ2A 5DG2A 1OFSA 1NA1C 2RMU2 3WP3A 1XXNA 5CFCB 2HWC1 1U5IA 2WZR2 4Q0VA 1J59A 4X8NA 1RB8G 1BBT2 1S0JA 1VBC3 4N43B 2IXCA 4URTA 2WKKA 1H2MA 4UBGA 3WDUA 4GMP3 4YRDA 3B69A 5FAXA 1KITA 4IV1A 2CYFA 1UKRA 5D8AB 1MQTB 3FC0A 1ZBA3 4XBLA 3PVEA 4FPYA 3HWJA 3TN92 5FRAA 1QQP3 4Y20B 3V65A 3I8TA 4B4QA 3FBYA 4XOGA 3KGZA 5CFCC 1VBB1 1UAIA 5FCCA 1LCLA 1LR5A 4N43C 3WDXA 4Z2WA 1N3PA 4FTSA 4HETA 4EJRA 3IN9A 4NVPA 1O5LA 5D8AC 1MQTC 4Q4Y1 2WA3A 4CDQA 2BVVA 2R16A 2ET1A 4LO5B 2GN7A 2AYHA 3AKPA 2D98A 1V9U2 3HMYA 2HWD1 2IXHA 1TNFA 5BNNA 4TYSA 5FO9B 4RQPB 3V0AA 3J4UH 5EZWA 3RG0A 5BUVA 4G9SB 2IFRA 2GC0A 1DZTA 2ILMA 5C8WA 2BQPA 4AW7A 4XE9A 1ULCA 1ASJ3 1JOJA 2ZHMA 1HRV3 1R1A1 3L2HA 3ALQA 1VBC2 3RNSA 1WCSA 2JG8A 5HCFA 4JDMA 2ZJCA 2ARBA 4Q2FA 5JDBA 2A6ZA 3OD0A 4IETA 2B5HA 2E9QA 3D82A 4HPKA 2CAVA 5T5PA 1PZ7A 2WIIB 5CU1A 1C8M3 3MW2A 2D7FA 4K7JA 3JB8A 3MGUA 1C5IA 2AR6A 1N1VA 2ZPXA 5BXXA 4AI8A 4XW3A 4XJUA 4GXLA 5DUXA 4AEMA 1VRH1 1YJLA 3KQRA 1RIRA 4FTEA 2JG9C 1HRI2 1H2LA 3T1MA 1T6GC 5LEKA 2NQYA 1LOCA 3VL9A 1F5FA 1PM7A 1UU6A 3SHRA 2UY9A 2VVEA 3SITA 3WG4A 5K7PA 4JCKA 1H1AA 2WFF3 4RR3C 5I93A 4LLOA 5FPZA 4R9DA 3U07A 2Z2SB 4CDWC 1V6JA 4XF0A 2WQ4A 1W6OB 1ZRCA 2XUMA 1GSLA 3C2UA 2SLIA 3ILFA 3M8LA 3ETQA 4YW4A 4EN7B 5CVRA 5KC6A 4AFBA 4UW3A 2FHRA 4L99A 1XYOA 1QOSA 4R9AA 1ASJ2 1U5XA 2YV8A 1UZZA 1YWKA 1RUE3 4PIYA 3AP6A 5DG1A 4W6XA 1J1TA 5I0SA 1IS4A 3RYPA 4KBBA 2CGNA 2BTVC 1QY4A 1HXS2 1JTZX 3VBSA 4AEDB 4AFDA 3ZXJA 3VDDA 3LB9A 5KXEA 4YM3A 4OHXA 5CG8A 1O3SA 3LA7A 3U4XA 3CF6E 1WCDJ 3LA2A 3DPRB 4LUMA 3ZO0B 4BQ1A 1WW5A 4Q8KA 4L9BA 1U5YA 4XFGA 2VW2A 1GICA 3N7LA 2XJRA 1XYPA 2R0FA 1VBE1 1GANA 1I9RA 4RD7A 4XQDA 4KU7A 1OQ1A 2A70A 2RS33 5A32A 4AEDC 1I3HA 4QPYA 2ZGSA 4XFAA 5JLVA 5DUUA 4WV8A 1OA3A 1HKDA 2RS13 3VHPA 1G9AA 2VUAA 1FOD1 1ULEA 2HWE1 1BK1A 5C8CA 3IDEA 2VMHA 2VVDA 4HK8A 4HT1T 3ZSEA 3VBRC 5ABJA 1JYIA 2NN8A 1BMV2 2VPVA 1RUOA 5LEJA 4F7ZA 3KT4A 3SCHA 3ZYPA 1ND2B 3OBTA 1AZDA 4XILA 4H14A 5C4WB 4NHLA 5EYXA 2WQZC 3FLPA 3VLBB 1PGSA 1HV0A 4M01A 4Z07A 4YG6A 1GR3A 2F6BA 2E7TA 3DKWA 4KNCA 2EAAA 1O7FA 2XWJB 1FPN2 4YGDA 5KHGA 3GHMA 4SLIA 2WNVC 5DDJ1 1J3RA 1D0GA 2BNOA 4Y5Z0 4AF9A 4WZCA 5C4WC 4M0HA 5EFUA 1W0PA 3JCIA 2ZHNA 3VBFA 3ZFEC 1BEV3 5JOZA 4I3PA 2V09A 1DHKB 3IT8A 2BNMA 2K9ZA 4Q29A 3ZYGA 1C4RA 3GHNA 1H8VA 3R6SA 1NG0A 1ZZBA 1S55A 3MIEA 4TZDA 4EN9B 1CJDA 3JBG3 4MVTA 2VQ0A 1LOFA 3CLPA 4LE4A 5FOBB 4Q26A 1U12A 2CGPA 3TNPB 3FX3A 1PO12 4HL0A 2PFWA 1KXGA 4C91A 1DZRA 2RS12 2RR11 4P9JA 2ZAAA 1TMF1 1VBD3 4IEUA 1AR62 4KWKA 3U0ZA 3ZFGA 5LRRA 1HV1A 1POV3 1Z0HA 4HSJA 4ATFA 4IEVA 4Y24A 4D69A 4LBQB 2JX9A 1XE8A 2GNDA 4QXKA 1W6PB 4TWTA 4KGGA 4OI4A 1AXYA 3MEPA 2WS92 1J1LA 4RFT0 1RUI2 1PIV1 4XPVA 4AVTA 1A78A 4IV3B 4Q4X2 4OVEA 3SMHA 3OBRA 5K0UC 2HWB1 1G9FA 4Y26A 1OPOA 3NAPC 1AR72 2A6YA 4QMAA 3PNAA 4Q4V2 1NY72 1ONAA 5JCTA 1MEC2 1O5UA 1MS8A 4IV1B 1ZYBA 1QOTA 4QPIA 3WDWA 1XNDA 2AGSA 3ASIA 4HFSA 3VBHA 1H8TC 3CNAA 4YGBA 2NLRA 4IEOA 1WLCA 5HCAA 2WSVA 4I30A 1GKBA 1AVBA 1QJU2 3KD4A 1QH7A 3MFCA 2ZGKA 2Q0AA 4BWOA 1FAYA 1PZ9A 1VBC1 4IV1C 3WHTA 4D7SA 1S2BA 4GMP1 1I5ZA 4LHNA 4XYXA 1QJY2 1VBD2 4OZXA 4J1XA 4L97A 3AFKA 2GC3A 3M70A 3OGGA 2VMIA 3OD4A 1ZBA1 4CDUA 1QQP1 2VU9A 4MXWA 2B46X 4IEYA 4OI0A 4COUA 4RQPA 1NXMA 2GNTA 4LNVA 5BNNB 1H4GA 4XJAA 2W0XA 1H30A 3MFAA 3ELNA 4CDQC 4Q4W3 1VBA1 1IKPA 4XFFA 3ZX7A 1W2UA 2XL9A 3QH7A 2X5IA 4BOWA 1ZZ7A 1SLBA 1HLCA 3I54A 3R4SA 4WVMA 2P3KA 4ZXKA 1VLNA 4B8EA 4H7LA 4BMBA 3OYWB 4I0BA 2JG8B 4XFIA 5BNNC 3MIBA 2DUOA 1Q3EA 4Q8LA 2R49A 3J8F3 5BPXA 1HQNA 1MZ6A 2I07B 4DXZA 4HPKB 2D97A 3VV1A 1D4M3 3H50A 4XZPA 3O7OA 4M00A 2GH2A 3J26N 1VB2A 2PAEA 5KBFA 3SISA 1ASJ1 1LEDA 1HRV1 1IS5A 4KQ7A 4BPZA 3THPA 4B4RA 5L36A 2JG8C 3HQXA 2RS52 4QGMA 3RPQA 2RHPA 4RS5A 4N90A 4IQPA 1QJX2 2B8MA 3HAGA 3RMXA 2ZGRA 2VECA 2X29A 2O8OA 3O12A 2CWSA 2R0HA 2YYOA 5KHKA 1UU4A 1C8M1 2Y0OA 1RUJ1 2MEV3 3WG3A 1DYKA 1RUD3 5IK7A 1IS3A 4YLZA 2R072 2XKPA 1RUH3 3GBGA 4GALA 5FO7B 2EIGA 2XG3A 5J09A 1WGPA 2GN3A 3L9JT 1FXZA 3ZIXA 2ZTNA 2Q1ZB 4CDXB 4HKLA 1DYPA 4OHYA 4QD2A 1AYM3 4L92A 1CJPA 4Q4W2 1JHNA 1YFWA 5GM0A 1QXRA 4CRQA 1N1SA 1ZREA 2DU1A 4LBMA 3TB0A 2GC2A 5J3UA 3FMGA 1PMIA 3RI8A 2WFF1 3WOGA 4XF9A 2WNEA 3VBSB 1BMV1 1DZQA 1CAVA 1DQ6A 4XFCA 3AZWA 5JZGA 1PK6B 3DPRA 2FMYA 5I91A 3ACLA 4JV4A 1XYNA 4BHPA 4EROA 1E57A 1SBDA 4F3JA 4NWWA 1GV9A 4MGYE 4PIZA 1Z7S1 3CJXA 4GKXA 5D1IA 2D40A 3NVCA 4NHMA 3HT1A 1WUVA 3JQXA 3V0BB 1RUE1 4RGGA 2Z5WA 5A32B 2QDNA 4DZGA 3VBSC 4OFGA 1FATA 2BW8A 2QUOA 1PO23 2ARXA 2C1FA 3IWZA 4JTOA 4WVWA 4XETA 3VDDC 4S2FA 3PMSA 1A3KA 3MIDA 5FFOC 5L7OB 1NOVA 5C8CB 1H9WA 1LGCA 2A5ZA 4L8QA 3I2DA 1EPZA 4PCRA 1FI2A 1REEA 2MEV2 1RUD2 3VZOA 3SH4A 2XLFA 1Q5OA 1WD4A 2ETEA 2WA4A 1RUH2 4QQLA 5ABJB 5GLWA 2WWSA 2FBEA 1APNA 4EWDA 5KWRA 4QX5A 2XLGA 2XVKA 4AXOA 3ZSKA 1W0OA 1G8WA 1Y3TA 1AYM2 3HR9A 1BYHA 2RS31 3IMNA 1LHNA 4FCAA 5BNPA 2RMU3 1SLLA 1YFUA 3WV6A 2WZR3 1V70A 3VBOB 2VOXA 5C8CC 4B4PA 1BBT3 4I02A 2EVXA 2IXKA 2XJTA 4NWVA 5F5QA 5JSOA 4B29A 5A33B 3M4FA 2A6WA 2VOWA 5ABJC 4LLFA 4A7ZA 1REFA 5BY5A 4LA2A 1TEIA 3H7YA 3MICA 4XTMA 5EJ3A 3TN93 1XQNA 1HQWA 3PLQA 3LSDA 3VBFB 5JR7B 1ZRFA 3KS7A 2GC1A 2TUNA 3RJ2X 5A3MA 3JZVA 2EXJA 5J98B 3ZN6A 1YHFA 1GLHA 4FP3A 3ZYJB 5I8SA 5JI7A 1MZEA 3R4UA 1SCRA 4K3UA 5T50A 2DFBA 4P9IA 3VBFC 5GLZA 3M3OA 3PTYA 2CV6A 3ZFGB 4PQ9A 4D7TA 2F4PA 1YFXA 5JVVA 5LRSA 1CIWA 4XDQA 1Y7BA 1H9PA 3UV9A 1SBEA 1BEV1 3DV8A 5JPMB 2OVUA 3MLJA 3RZZA 1LOFC 2I74A 3IDBB 1OLRA 4AFAA 1COV2 1IGOA 1DQ0A 3PHMA 5KC5A 3JBG1 4FPHA 2DCYA 4LBNA 4CYDA 3HIFA 4IV3A 1YI9A 4JTNA 3ZFGC 1AUYA 3A0NA 1LOBA 1MS0A 3N7KA 4Q0PA 2C9AA 2ZGUA 3K48A 4P9GA 1TNRA 2D3SA 3RSJA 1H4HA 1FMD2 2IFWA 3PVOA 1POV1 4XMIA 5EV7A 3IKWA 1AYN2 3ME2A 3POYA 4QQPA 1JN2P 1X82A 4GH4B 1C1LA 4QPIB 2B7YA 2D3RA 4RHV1 1EV13 4Y22A 3VBHB 3VKMA 3PVBB 4AE2A 2XHKA 4XF4A 1F8VA 1XNKA 3AZXA 1VALA 3E6CC 3WHUA 3S6PA 1JUIA 4K6BA 4YGEA 4OUMA 2EXKA 1JW6A 5I0UA 2D3PA 1NYWA 2WINB 2DTYA 4FPJA 4META 1NCQB 1HRI3 3PJYA 1UIJA 2ZMLA 1D2QA 2ZCWA 4MUVA 3WW3A 2ZMKA 5T54A 3POSA 5KHIA 4QPIC 1OQDA 1NLSA 3VZLA 4Q1RA 3VBHC 4IEXA 2VY0A 4JGZA 3ZSMA 3SH3A 5F9TA 4PLNA 3ZXAC 5KXDA 3EO6A 3I59B 1U5ZA 2PTMA 3B3QE 2BWAA 4AHYA 4CDUB 4FXGB 2EXHA 4IXLA 4PJYA 2VGDA 3AM2A 1FV3A 3BALA 3KCYA 1CX4A 4MXWB 2JE7A 3D0SA 3E6DA 4FP2A 4XBNA 3INAA 1BVP1 2Q1MA 3RMYA 3FWEA 1NXD1 1KJLA 4ZU5A 2ZHLA 3IPVB 4Q27A 4L11A 2IC1A 2X5IB 3AYEA 4ISRA 4YGCA 2ZS6B 4ES8A 1RUG2 1WW4A 4YM2A 1EAH3 4WVMB 5FOJB 4CDUC 1BKZA 3ECQA 3OYWA 5IT6A 5ACA2 1RVF2 4YVSB 2GMEA 1HXS3 3PVNA 1V6IA 1MZ5A 4RQPC 1J3PA 3CJIA 3QOPA 1EV12 3AP5A 3R05A 4I0AA 4N7IA 1TE1B 2R043 1B35B 3AZYA 4FT8A 2X5IC 2YPJA 1LODA 2PN5A 3LKJA 3WDVA 2VH9A 3VZNA 4K40A 4Q4W1 2ZOEB 1PGW1 2QNKA 3E97A 5J37A 2N7GA 4MGIE 2P2KA 5L73A 1YI7A 5JOWA 2QQPA 2LTNA 2BBVA 4N53A 2RM22 4XFBA 2SBAA 1DLLA 4RS5B 2ZGPA 3VN4A 2DYCA 1OI6A 3ES4A 2C5DA 2D6MA 1C1FA 2HJIA 2QFEA 4JGYA 3J8F1 3I7DA 1JXNA 1S0FA 2BYVE 1KS5A 4ES9A 1D4M1 4FPLA 1DG6A 4IEZA 4LBQD 4WM7A 3ZYIB 3D5OA 1CPMA 1WMEA 1MVEA 4OHVA 3B00A 1BVVA 1EY2A 5DZGA 4CDXA 4RS5C 3AXDA 1CQ9A 4LBJA 3DL3A 2A71A 5FTTC 1PVC2 1VB4A 1I6XA 1K5MB 4IESA 3M3IA 1EAH2 3V56A 1ZM1A 4FPOB 1FPN3 5BNOA 1V6KA 1PVXA 2C0ZA 1ZBE1 3D6EA 5CNAA 1UF2C 1KDKA 1IOAA 1NE6A 1RUD1 1ZX5A 1XE7A 4AQTA 3P3NA 4FPEA 1QJZA 2NMOA 5AFEA 4AVBA 1RUH1 3AYCA 1PK6A 1PGL1 4R4XA 2WT2A 2ZA9A 5CADA 1CAVB 4DFSA 2R042 1SACA 5JZGB 1RUNA 3GYDA 3QH6A 5FREA 5JOYA 3BPZA 5J48A 1W39A 1UPSA 3V0BA 4AK3A 1EPWA 1PO13 4EWEA 3NJZA 4CP1A 1DQ1A 4M3CF 1M4WA 2O0OA 2ZGQA 4XMAA 2ET7A 3THTA 1R082 2D6LX 1AR63 2MNGA 3AZZA 5L7OA 5GALA 1C3HA 2BNNA 2HEWF 5JZGC 3DPRC 3FFZA 3ZDSA 1MS5A 2QCSB 1OSGA 2GMPA 2CWMA 1ND3B 5JOXA 3IM0A 4NR1A 4D3WA 5TSWA 1Q43A 2PHLA 3WZ1A 1CAUB 3DUIA 1L3JA 2ZMNA 1R092 1Q8OA 3ZXEA 3ZSJA 2Y38A 1V6LA 3BODA 4AI3A 2PLV2 2HWF3 3VZKA 2Y26A 4PBPA 2WS93 1RUI3 3H8UA 2LUWA 4Q4X3 3VBOA 1Q8PA 5BNPB 5HI0A 4HMZA 4LO4B 4YG0A 5FLJA 1PO21 1Y9QA 1GZ9A 2P37A 5A33A 3S30A 1AR73 3M3QA 3UKVA 5BYNA 2ES3A 4Q4V3 2V73A 2XB6C 2ZACA 1MEC3 2H0BA 1KFUL 2UYBA 2XLAA 1RHI3 5GKAC 2CGOA 1ND2C 5C33A 1AL0G 4IEPA 4IEQA 4ZU4A 4FOWA 2XJVA 1X8EA 5SV8A 1QMJA 4E9KA 1RUC1 2ZABA 2ZKLA 1UW8A 3EXUA 1AL23 2JKBA 2WNUA 5GZFA 3WXPA 2PHUA 5BNPC 5KHJA 1UPIA 4AFMA 1QJU3 4OI1A 3AP4A 2ZBJA 4JC1A 4X6QB 5FBZA 4R9CA 4XF3A 2RMU1 3WP4A 3WR0A 2DWRA 4HK9A 2WZR1 3ZN6B 4M3CA 1TME3 1BBT1 2B39A 1YIFA 5GLUA 5GZEA 1Q8QA 4QPGA 3QD6A 1QJY3 4C1WA 3ZMNA 4W65A 3MZHA 1SDWA 5IK8A 5F6KA 4YZ5A 1UL9A 3KLSA 4XEZA 3FE5A 3TN91 5C9AA 3FLRA 2CAUA 4HN1A 1UU5A 1X33A 3RYKA 5I0TA 1S1AA 3AB0A 3IBMA 4OUSA 1N3QA 1MS9A 1G86A 2FQPA 1SQ4A 4MYEA 2HWC3 1LECA 1KQRA 2HWF2 5JI9A 3BCWA 2WC2A 3LCPA 1FX5A 2R30A 1RUF2 4EN0A 5CAZA 2D6PA 1AXKA 2KA3A 3UJQA 4CEWA 2BGCA 4M0NA 1IPJA 3VKOA 2JEMA 3ZPYA 2W39A 1PHMA 1AR92 3FBMA 2NPIA 2R1BA 4P5HA 4GH4A 1V9U1 4DMIA 4E4DX 1RHI2 5KXBA 1RITA 1VR3A 2WSUA 5AC92 4PDWA 3AMQA 3B7MA 3I4IA 4XIKA 4Y22B 3TNQA 2XBO2 3KB5A 2Q5TA 2DCKA 4NN0A 2HKXA 1AL22 1NQDA 2DVAA 3D4KA 4IV3C 1BJQA 1ENSA 1DQ2A 5A3LA 4HKOA 4YW2A 4HVOA 1QDCA 4AI0A 1NCQA 2PELA 1QDOA 1MVQA 3WP6A 1Z78A 1GYKA 1CONA 1SLTA 2RS53 1TME2 2PAKA 4M3CE 2PQQA 2G9GA 1QJX3 3JB4C 1X36A 2A6VA 3E5XA 3MDPA 4JRAA 2ERFA 3VKNA 5CA6<