3IDBB

Crystal structure of (108-268)riib:c holoenzyme of camp-dependent protein kinase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
157
structure length
149
Chain Sequence
TRRASVCAEAYNPDEIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel isoform-specific interfaces revealed by PKA RIIbeta holoenzyme structures.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
total genus 37
structure length 149
sequence length 157
ec nomenclature
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3idbB01
5BV6A 2VQAA 4XFBA 3ES1A 4FAHA 3U0ZA 3MPBA 4D7TA 1JUHA 1CAXB 1J58A 5FQ0A 5I8SA 1CAVA 2ET1A 2OPKA 5JSPA 1I5ZA 5F1RA 5I0RA 3ETQA 3M3IA 3ROUA 4BHPA 1LB2A 2EA7A 4K8FA 4QGMA 3R6SA 1H1IA 1UIKA 2Q4SA 3DV8A 3TNPB 1ZZBA 4P9GA 4BH9A 4MGIE 1FXZA 3D0SA 5I93A 3LZZA 4PIXA 4JTOA 3S7IA 2B8MA 4META 4JTNA 5I0SA 3CF6E 5LEJA 1Q3EA 5JR7B 1IPJA 2K0GA 4F7ZA 2DCTA 2PAMA 3EJKA 4HLTA 1O5LA 2Y0OA 4HVRA 5I8TA 4ONUA 4QX5A 2OZ6A 1Q43A 4X6QB 3D82A 2UY8A 2EVXA 1DZRA 1ZRRA 3QOPA 4MGZE 5BPXA 3NKTA 4HZFA 2BYVE 2PA7A 1EY2A 3D0JA 1YUDA 1CAUB 1YLLA 1ZZ6A 5I0UA 1ZRCA 1YHFA 1WLTA 3PVBB 4MZUA 1IPKA 3UKVA 4XFGA 5J7MA 4TLFA 1X8MA 1DZTA 1XRUA 4AQ2A 4XF4A 1QXRA 1ZZ8A 1X8EA 3HIFA 2CGPA 4QGLA 3OF1A 2FMYA 4ZU5A 5CVRA 3U10A 4IEZA 4LA3A 4XEZA 3H1YA 4OLLA 4I3PA 4HSLA 2IXCA 4XFCA 3JZVA 3I7DA 1WA4A 1Q5OA 2OA2A 2GC0A 3S7EA 2D93A 2B5HA 1VR3A 4JV4A 1GQGA 2N7GA 3E6DA 1SFNA 5KHHA 4A2UA 3UKNA 1ZRFA 2QDRA 2K9ZA 1ZNPA 2XKPA 3FWEA 2BNNA 1X82A 3IIAA 2HJIA 2IXLA 3N4MA 4XF9A 4MGKE 1O3SA 3E5QA 3NL1A 4X6RB 4Q29A 4LUMA 4FBFA 3WW2A 1U12A 1PM7A 1J3QA 4HMZA 1O5UA 3OTFA 3RYPA 4WVZA 2PFWA 4IEXA 4LTAA 1YFYA 5KHKA 2V09A 3OCPA 5E1RA 5FCCA 4XFHA 4Z07A 5I8YA 2IXKA 3BCWA 1RC6A 4BYYA 4LLOA 2PHLA 3IDBB 2GU9A 1RL3A 3IDCB 2IXHA 4YSFA 4LUKA 1PMIA 1LR5A 2BNMA 4MV2A 4E2SA 4L11A 2H6CA 3SCFA 1O3QA 3CLPA 4AXOA 1OFNA 4IEVA 3DKWA 1XE8A 1XE7A 1I6XA 1EP0A 1UPIA 2GH2A 2GC1A 2QCSB 1QWRA 2UYBA 4MGYE 4B29A 3H3ZA 1QXJA 1H1MA 3FX3A 4Q0PA 4QM9A 1ZZ7A 5BUVA 3E6CC 4IERA 5JCTA 4O9GA 4Z82A 4KU8A 2D5FA 4WZCA 2IXJA 4R52A 2IXIA 1RUNA 3LOIA 3I59A 3E5XA 4KWKA 1OD5A 4QM8A 2Q0AA 4EV0A 3ACLA 4I02A 1LKNA 2KXLA 3MYXA 4IEPA 3B02A 2WFPA 3GBFA 2Q30A 2QNKA 4E2QA 4HN1A 3I59B 4PIZA 1RTVA 3L2HA 4BIFA 1EPZA 3RNSA 1L3JA 1DGWA 1UW8A 4KL1A 4OFGA 4I2OA 2Z69A 4HVOA 2OZJA 4I09A 3BB6A 2ZKLA 5CADA 2CAUA 1WGPA 4XETA 3NSTA 4HVQA 3FZ3A 5FPZA 1TQ5A 3RPQA 5EZWA 2Q1ZB 3KGZA 4R8HA 1OI6A 4RD7A 1O7FA 2BEOA 1Y9QA 2PQQA 3DL3A 4PIYA 1SEFA 3BALA 1ZREA 3H8UA 5J3UA 3NJZA 4EWDA 4LA2A 1VP6A 1J1LA 4QGNA 5KHIA 3M70A 3DN7A 2UYAA 2UY9A 3E6BA 4AVBA 5BY5A 1ZVFA 1ZZCA 4XF1A 1QY4A 4EWAA 1CAWA 3SMHA 3FHIB 3EQEA 5FLHA 1O4TA 4IESA 5LRRA 2BNOA 3KMHA 1ZZ9A 3OGJA 4FAGA 4MH0E 4UBGA 2D40A 2H0VA 4HBNA 3H7YA 4Q0UA 4XFAA 4KU7A 3OD0A 5CU1A 3CEWA 2OYZA 4N9HA 1CAWB 2XLFA 3HT1A 3I54A 1FT9A 1O3TA 3ST7A 3EBRA 1SQ4A 2F4PA 4AVCA 3SCHA 3RYKA 4YYOA 3PNAA 3SCGA 2XL9A 4D7SA 1O3RA 5AVPA 3MDPA 3RZZA 4Q0VA 4J1XA 1CX4A 1ZRDA 1NE4A 5C8WA 5T3NA 2IC1A 3H9AA 3H7JA 3WW3A 1UD1A 4KWLA 5KHGA 5J48A 3FJSA 1Y3TA 4YNIA 1NXMA 4MX3A 4IEOA 3G7DA 4ZU4A 3QACA 5FQ0B 2GZWA 4GULA 1NE6A 4EROA 1RGSA 2PTMA 2GC2A 4DINB 4FT8A 3RDIA 4WBBA 1YFXA 4YARA 3ELNA 3H50A 2MPFA 4LEJA 4Q0QA 3U11A 4IEQA 3H3UA 3SHRA 4AQ6A 4IEYA 5JAXA 4XFIA 3IWZA 2GC3A 4YRDA 1J3PA 3LWCA 3CJXA 3LAGA 3RYRA 4UBHA 1G6NA 3BU7A 4O9EA 1UCXA 1LRHA 4HN0A 4XFFA 3KSCA 3CL1A 2XKOA 1CAXA 2WC2A 2D5HA 2C0ZA 2PAEA 1UIJA 5HI0A 4IETA 3S0MA 2XLGA 4J1WA 3TNQA 3LA3A 4CYDA 2EAAA 3E5UA 5I0TA 1J59A 1VJ2A 4MUVA 3FE5A 5JSOA 3ES4A 4QMAA 4F8AA 3CO2A 2XHKA 4LULA 5BXXA 1GQHA 3H1MA 3SXWA 3WW1A 5I91A 2P17A 3KCCA 3KGLA 5KHJA 4IEUA 2XGXA 2ETEA 2E9QA 4KWJA 3EHKA 1HW5A 5D1IA 5FLJA 2ET7A 2XLAA 3C3VA 2QJVA 4AVAA 1X7NA 2MNGA 4IEWA 1YFUA 4N9IA 2PYTA 3HQXA 3H1WA 5JSRA 4L2NA 1ZX5A 1RUOA 3O14A 3UKTA 2GAUA 5FDBA 2PHDA 5E16A 1NZCA 4ORFA 4XF3A 3BPZA 2VPVA 2CV6A 3USSA 1V70A 3LA7A 5LEKA 1NYWA 2BGCA 2CAVA 2ZCWA 2XL7A 3IBMA 4UXAA 2B9UA 2VECA 3LA2A 3NVCA 4I0AA 4HSJA 3VHRA 1CAUA 5K8SA 1DGRA 1YFWA 1CGPA 1YWKA 3HT2A 5FLIA 2H6BA 4PJYA 4NVPA 5EFUA 1FI2A 5KBFA 2HKXA 2PAKA 3E97A 3WW4A 3EO6A 2I45A 2MHFA 3ZDSA 4I01A 2FQPA 1EYBA 4XF0A 1J3RA 5FPXA 4I0BA 3NW4A 4E2GA 5LRSA 4H7LA 4QXKA 2O8QA 3GYDA 5C6CA 2QVSB 3PLQA 4Q0SA 3FFQA 4ZU7A 4JVAA 2ATFA 1OMIA 4EWEA 2O1QA 1CAVB 2Z2SB 3MZHA
chains in the Genus database with same CATH superfamily
4NPRA 5BV6A 1N1YA 2VQAA 4YPJA 5JWPA 2XBO1 5KXCA 4C91A 1YQ6A 4NE9A 2CL2A 3SKVA 2DVAA 1V6KA 3VZNA 2WKKA 4ARYA 1CIWA 5CEHA 3NJYA 4UOJA 3WNOA 4DUVA 5FQ0A 2ARCA 3LFIA 2JE9A 3BIEA 1NXD1 1I5ZA 3MV01 1WMFA 4GMP0 2X09A 3J8F1 3D3AA 1UWWA 3I97A 1JUIA 4BOWA 4X8NA 4LBMA 2RS12 1W9SA 3VBFA 5A6QA 1YIFA 4QGMA 4K8FA 3T2PA 1OLRA 4Q8KA 3OD4A 1JMUB 5DZGA 1PX3A 4V2WA 2WT0A 4JRAA 1EUTA 1VE0A 1RUE3 1VBC3 4LHLA 5F32A 4AFCA 5FZ0A 4MOAA 2XJSA 4P9GA 2SLIA 3THPA 1WCUA 1YYNA 2ZGOA 2VNVA 3S5AA 2EIDA 3D0SA 2YHJA 3LIHA 4LBOA 3D4KA 5EPAA 4B7KA 2JG8B 2X8KA 4LO6B 2ENRA 2V5YA 3VBUB 2WDBA 2UWCA 1HN0A 3NO8A 5FZIA 1SLAA 1BQPA 2BVVA 1A6CA 1F15A 1QJU2 2JD9A 3CF6E 5HV0A 1D2SA 3ZFFC 5K0UB 1IPJA 2C6SA 4S2DA 2RMU1 5CNAA 3RZJA 2F4LA 4XZPA 4CUAA 1OPMA 2Y0OA 4AE2A 2W1WA 1NCQA 4AL9A 4QX5A 1JZ8A 3BUCA 4CU8A 4G4FA 4CU9A 3DXTA 2VUJA 2RR12 2UY8A 5ANNA 2DU1A 4DFSA 5AVAA 4QHZA 4Q1PA 1ZRRA 4N43C 4KNCA 5H9RA 5BPXA 3NKTA 2ZZJA 2BYVE 4ZS3A 1MS8A 1PM4A 5FZCA 4ZY9A 3W5MA 2JDYA 2VO5A 2NPIA 2ZX2A 3GGLA 5A70A 4Y22B 5F39A 4RGGA 4LLFA 5DMYA 1YUDA 3VBSC 1CAUB 2CSGA 3WF3A 1AVBA 4M00A 2BU9A 1ZRCA 1RUF1 3ENRA 4CPBA 1YHFA 1WLTA 1F4AA 3ZFGC 2HYKA 3SC7X 2VNRA 4P02B 1XNAA 2A75A 4M01A 2PLV1 5HXMA 1VAMA 1ZBE2 2Y60A 4CCOA 2G4IA 4Q5OA 2C9KA 4RYDA 5J7MA 4FXKB 1QIQA 2RDSA 4E8DA 3VDBA 4V1PA 1KS4A 2W52A 3GJAA 3WNXA 4FTBA 4RFT0 4AI0A 2X05A 1PIV1 3URFA 2D3RA 1VMHA 1QDOA 1VALA 4HL0A 4ES8A 1QXRA 5DZEA 3VLBB 5CG8A 1HRV3 4S2GA 3UL2A 1PGSA 2CDOA 2ZEXA 4QHOA 1URXA 2YC4A 2VUDA 4FPLA 4XEZA 1RYYA 2VY0A 4COUA 5HCAA 3AL6A 4KH9A 3TEYA 3A0NA 1VMFA 5IW0A 2QE3A 1ZBE1 2VZUA 2P6CA 2A1XA 4XFCA 1NCRC 4JGZA 1JBCA 2RJKA 4YZ5A 5JR2A 1PZ9A 2WR9A 1Q5OA 5DDJ3 4RQPB 4YW1A 4DXZA 1H9PA 2B5HA 1VR3A 1ZA7A 1GQGA 2N7GA 3T1MA 3UESA 3JU9A 1SFNA 2YC0A 1XNTA 4JQRA 2VTFA 4DZGA 2BRTA 2W9XA 3UJQA 3VL9A 3WLUA 3X29B 4C0HA 4ET7A 1ZNPA 3I3DA 2DU0A 1M06G 2GNMA 3FWEA 3ITQA 4FTSA 5AC93 1UQXA 3WEZA 1BBT3 2IXLA 2C24A 4XF9A 4YZ3A 5FPUA 4XPVA 1OQDA 4X6RB 3PUIA 2YG0A 5BNPC 4K3UA 3ZVXA 5EJZB 1K5MA 2DCKA 2Y6HA 4XQDA 5F5CA 4AZZA 4FBFA 3NAPC 1AJOA 3VDAA 1U12A 1AX1A 5F3GA 3N7MA 4IV1C 3USUA 1DQ0A 3WR0A 1X9PA 5A3LA 1KJRA 1IHMA 2WL1A 3BODA 1HJGA 1XB9A 1S0DA 2J1SA 2Z5WA 1YFYA 5KHKA 1W6OB 3OCPA 5A6XA 5E1RA 1EUUA 5CA6A 5DAWA 3JCIA 5C4WC 1DGRN 2VR4A 1JZ3A 2RS32 1LOFA 3V64A 4IW3A 3RZLA 3HEIA 2FDJA 2VNOA 5FJHA 4CCMA 4LUKA 1PMIA 2WNVA 2HLEA 1QMJA 3VHNA 3TEXA 5LY2A 3ZO0B 2CWMA 1IG0A 2ZS6B 3CLPA 3QH7A 2QQMA 1QDCA 2J1AA 2A3WA 1XE7A 1F4HA 2YPJA 4NIHA 3HAGA 3AVRA 3QLQA 3MV11 3FHAA 2GP3A 3ZIXA 1QWRA 5A6ZA 1WA6X 3PL0A 4XIKA 5FZGA 1COV1 2DV9A 2WNEA 1TE1B 3VL8A 3MIGA 4LBQB 4QPIA 3H3ZA 4M3CB 2R041 3WG3A 4DRVA 3FX3A 1H1MA 3CZJA 5C70A 5JOZA 1HIXA 1UY1A 2A6VA 4Q0PA 4QM9A 1ND3B 1ZZ7A 4COZA 3ILRA 5BUVA 1AL22 1J1TA 5FYMA 3WNMA 1UY4A 1GNHA 2PN5A 3NNGA 5SV8A 4CPBD 4CDUA 5LA1A 4YZ1A 1FPN1 4WZCA 4DRRA 2IXJA 1VRBA 1W6MB 2VVDA 2IXIA 3N7LA 1JOJA 1Z0HA 2BPA2 1UF2C 4LNVA 1PO13 1OD5A 3SQOA 2IZWA 1GNZA 2Q0AA 1IZ3A 1XSRA 1KFXL 4YWAA 5L9RA 3QD6A 4COWA 1CESA 3QBQA 1T6BX 2RDNA 1X9TA 5FYHA 3HWJA 2A6YA 2DUQA 3GBFA 3KT4A 4GZ9A 2DTWA 3THTA 4QXHA 3WG4A 4E2QA 3BI3A 3NMBA 2ZACA 4KBBA 3O7OA 4AI8A 1Y9MA 3FUOA 3NQHA 4YVSC 1HRV2 3AL5A 5F9TA 1OA3A 5FZHA 1DGWA 1OBNA 4OFGA 4ZXKA 4XJ9A 5T5JA 1LOEA 2JECA 3BB6A 4YG3A 2C5DA 1N1VA 3AJZA 1OPOA 2E26A 1GSLA 1LHWA 3OBZA 3C7HA 1WGPA 3V56A 3H8OA 3WG2A 4DB5A 2X5IC 1R092 4XETA 1CJDA 3NSTA 4HKWA 2BOIA 1W6OA 2QDNA 5A3UA 1OF4A 3RPQA 4Y5SA 1DCSA 5EZWA 4PF1A 3U37A 1AXKA 5LA2A 2Q1ZB 3VDCA 4Y1XA 3APBA 4LBNA 2D6OX 2VZ3A 1RITA 4N8MA 3ZIWA 3AFGA 4CVUA 1ALYA 1NQJA 1SEFA 1Z78A 4J25A 1ZREA 2FD8A 2P3KA 3H8UA 4MXVA 2A6XA 4EWDA 1SACA 2VMIA 1SPPB 1TZOA 4OHWA 5KHIA 4A4AA 1W6PB 2FCUA 4K6BA 1FNYA 1OSGA 3AP4A 3JBG3 2ZBJA 3AFKA 5FZ1A 1HJFA 2VQTA 2Y38A 3UJOA 4S2HA 2AYHA 5EYYA 3CKHA 3ZYJB 3TOJA 4B4RA 5BY5A 1QNYA 5FXWA 3ZFFB 5K0UC 1QY4A 2DCYA 2X10A 4ZZ5A 2GSYA 3AZZA 3ZSLA 1WLDA 1VMJA 1C57A 1O4TA 2BWAA 3POIA 4PBOA 3T0AA 3I2DA 1ZZ9A 3MW4A 5J09A 1SLCA 4FAGA 1WCQA 4MH0E 2BQPA 3CZUA 3H3LA 3LCPA 4MSVA 2C1FA 5KXDA 5K0UA 2YROA 1Q8QA 5CU1A 1KJLA 4K21A 2EIBA 3CEWA 2YV8A 3V65A 5FKBA 5KXEA 1AXYA 1IS5A 2JG9A 2ZX4A 3ST7A 3JBG1 1Q8PA 5FWEA 4LO4B 5G05L 3J7NA 4LBKA 4QU2A 3INAA 3SCHA 1SZBA 4AVCA 2WZR3 3B94A 1XQNA 4DS0A 3S5QA 3WHUA 1QQP2 3KV9A 4CP1A 5LY1A 2XL9A 2VBPA 4HETA 1UYYA 2XQXA 1QJZA 3BPSA 4H55A 1CZVA 1ODNA 3ZXGA 4XUNA 4FTEA 4L0PA 4QXCA 4L8QA 5ERLA 5EQUA 3RZZA 4ES9A 1BKZA 1S0FA 4IE4A 4LO5B 4Q0VA 4FSJA 3B5LB 3I3QA 1ZRDA 5FO9B 5FP7A 1R093 2OUHA 3WNKA 2DFCA 4NUBA 2WA3A 1UD1A 3WW3A 4A3XA 5KHGA 5E8AA 4QHBA 1QJU1 1Y3TA 5DAQA 1NXMA 1AR81 1VBD3 4MX3A 3WF1A 1GZ9A 3WSOA 5IFTA 3G7DA 3AMQA 3SEPA 2VG9A 1RVF1 3MHZA 4FP2A 1S4CA 2WUHA 4JKLA 1DHKB 2VW0A 2Q1FA 3TN92 2X5IB 4AYUA 1RGSA 5C9AC 3M4FA 2QQUA 2VMHA 4R9AA 1RUI1 1PHMA 3POGA 4BMEA 3RJ2X 3H50A 2NP0A 1H6XA 1XU1A 2CTVA 4EN7B 2B42B 3U11A 4AQ6A 2HWF1 1WLCA 2QZ2A 3ATGA 4IEYA 1WZXA 4NOTA 4Q4W2 2GC3A 4R9BA 1VBB1 2CWSA 4Y22A 1VAKA 5CYYA 3I2FA 5H9PA 4NHXA 5DAPA 3ZFGA 4NWVA 1MQTA 1SLIA 3LAGA 4JKKA 3SNMA 4BXSV 2WRAA 3FBYA 2ZEZA 3C7OA 2R7EB 3MLLA 3PIGA 3AVSA 4O9EA 5FMBA 3LEIA 3DYPA 4UFKA 4XFFA 5FUNA 1JZ2A 1CX1A 5FZDA 4YVWB 1W04A 1ZM1A 3OBRA 3U1XA 2W94A 1QU0A 3Q9OA 3WCRA 1G9FA 3VBUA 2R32A 4XJZA 3MIEA 1WWYA 4A6OA 2D6KA 2GMMA 4RSUA 4OHZA 1BJQA 3T4VA 4NPMA 1JOBA 4CDQB 1W6QA 3S0MA 4AGGA 4V2VA 5FAXA 4CYDA 2HWC2 2GDFA 5IVFA 3E5UA 1Z7S2 2AENA 2RM21 3MICA 2RM23 3VZJA 5C9AB 4HPKA 3AKPA 3LPGA 1J59A 4KBZA 1FPN3 5K4LA 2VD7A 3FE5A 3LE0A 2MEV2 4E4SA 4F8AA 3AZYA 3CO2A 4XDPA 1C8NA 3WW1A 4QX1A 1JU4A 4CEYC 2OQ7A 3KGLA 4CCJA 3U4XA 1RB8G 3P5BA 4ZKTB 2ETEA 2FBEA 2V4VA 2G1MA 2B46X 3GZEA 1E5RA 4P9IA 1O8PA 1UYZA 2BGOA 5JDBA 3LB9A 2AREA 1PGW2 1HW5A 1XYPA 2W08A 4COYA 3VZMA 1CPNA 4CCLA 2MNGA 1WW6A 1RHI2 4NRMA 1EAH3 2ZKNA 3K2OA 3DF0A 2V4AA 3MI8A 2WO3A 2CGOA 1QF3A 2R073 4XVHA 2NYYA 2E7AA 1REEA 5GALA 4DXRA 3RWKX 3AM2A 1S1AA 2NQYA 4OVEA 1RUOA 5FDBA 4YFZA 2PHDA 3OY8B 1LHOA 4AEDB 3MFAA 1NZIA 1RHI3 4LK6A 2QQWA 4DMIA 4DQAA 2R1BA 4YM1A 3OEAA 3WG1A 3A4UA 3LA7A 3WDVA 2KD7A 1NYWA 5JIAA 1ZRIA 4NIAA 1F35A 5DXDA 5FYSA 1HRI1 1QJEA 3IBMA 4YZ4A 1GZTA 1QH7A 3AX4A 1TME3 2FZ1A 3LEKA 3TWIA 3WCSA 3NVCA 4AGRA 4EE2A 4HSJA 5CISA 5LA0A 5A6YA 4EN8B 1U5ZA 1YFWA 2RDRA 4QAWA 4ZZ8A 3ON7A 3O1SA 3J9SA 3HT2A 3PUSA 4PJYA 3NNJA 3LOBA 3MW3A 4EQVA 5FZLA 1FI2A 2ZEWA 4DPNA 5F37A 2HKXA 3E97A 3KQRA 1JH5A 2VH9A 2D98A 2W39A 1JYIA 2AH2A 1BMV1 2I45A 3MGUA 2MHFA 1HB1A 4N7IA 1TG7A 3ZDSA 1LULA 4I01A 4XDQA 2FQPA 1EYBA 4B4PA 2VMEA 4DUXA 1J3RA 4GA9A 4PLMA 5T55A 2XBO2 1ULDA 5FPXA 1WD3A 3VKNA 4YGDA 3BU0A 4FPHA 5C71A 1LHUA 4UW5A 3ZM8A 3Q8CA 1RUJ2 3I2OA 3BTXA 1CPMA 3VBRB 4QXKA 3GYDA 3RJRA 5FP9A 3PLQA 3HBZA 4MGQA 4MG2A 3FFQA 2D6LX 3N9LA 2VL4A 2A3YA 3ZFEA 4WM8A 1N3PA 2WYSA 4NPLA 5DG1A 4GWNA 2JG8C 4XFBA 3OB8A 1N1TA 2E31A 3I2KA 4LQRA 4CUBA 3MPBA 3ME2A 2W1UA 1JUHA 4MO3M 2B39A 2WABA 1OHFA 2VZVA 2HWC3 4TXWA 1IS6A 2JB4A 3T0BA 3W20A 1UZZA 2XBO3 1BBT1 1CAVA 2J1UA 4Y33A 4C90A 3OUJA 4A42A 2R063 5F1RA 1IS4A 4ASKA 3CDZB 3ZYHA 5I0RA 3LFMA 4OMCA 1RUG2 3N7JA 4D69A 2VW2A 4N43B 3ETQA 4BLJA 3FBMA 1KRIA 1QJU3 1C8M3 4BHPA 3JUUA 1LB2A 4HOOA 1QJFA 2QKDA 4D0QA 1S0JA 2WQ4A 3KV5A 4R4XA 4D94A 5IAXA 3O1VA 2VMFA 4AWDA 3N9OA 4AVSA 1T6GC 2WN2A 5TSWA 1H1IA 3KV6A 1UIKA 3GZAA 1IGOA 2I74A 4P9LA 4UF0B 3TNPB 4CDUB 4Q4W3 4QPGA 1FXZA 2R062 3R05A 1OXCA 3OEBA 2ZHMA 4PIXA 4JTOA 4LIVA 3BTAA 4JGYC 4OYUA 3VZKA 2WZR1 2B8MA 4JTNA 4ZXEA 4MXWA 4QB1A 4CDWB 4XXAA 2J42A 3VKFC 4Y5TA 2VTXA 1ND2C 1N1SA 1UOJA 4LBQD 1Q3EA 1ULFA 5DABA 2K0GA 2YGMA 1RIRA 2ADDA 5T52A 2DCTA 2Y8KA 4RA0A 1VBD2 2ZMNA 5DAVA 1G86A 3EJKA 5LW9A 2X29A 5I8TA 4ONUA 5E89A 4XQWA 5FMDA 2IFRA 1FOD3 1OVSA 1GOHA 3VD4A 1F8VA 1PGL2 1MACA 1VBE2 2TEPA 2ZXQA 4GMP3 3CJIC 1G9DA 1ODMA 3B7MA 2HWF2 4JC1A 4AI9A 4RGAA 2OT7A 1W9TA 3GJBA 3MBWA 1EY2A 2EICA 3D0JA 3AXDA 5GKAC 1AR62 3IM0A 1A3KA 1S0CA 4XABA 4SBVA 2CY6A 4QX2A 3T09A 4DIQA 5C3QA 1E57A 1A8MA 3N36A 1GNYA 1PO22 1OD3A 3DKQA 4IV1B 4CXYA 3UKVA 1F31A 4L9BA 5F3EA 3WDXA 4TLFA 2DVDA 4NHMA 2RVAA 2WFF2 2WT2A 1XRUA 2EXKA 5FJKA 3PVNA 1COV2 3SH3A 4NHLA 1LOBA 1Y7BA 4GB32 1ZZ8A 1W2NA 4UT5A 2CGPA 4QGLA 3OF1A 3RS6A 1CZTA 2FMYA 3VN4A 1C1FA 4AAXA 4ZU5A 4WVMB 4M4PA 3CNAA 3A0KA 1LGBA 2ILMA 4FPCA 3U10A 5BNNC 1W2UA 4NRPA 3H1YA 3O5SA 2JIJA 1I3HA 2W92A 4N53B 4CEWC 5C8CA 4FFHA 2OKXA 2GH8A 3CQOA 3B3QE 5HCFA 1WA4A 4GH4C 4LKDA 5FPLA 5M0TA 1NCQC 2GC0A 2WIIB 4BLIA 4BK4A 4LE3A 3Q8FA 4HK8A 4UFHA 2CDPA 1UY3A 2AZ5A 5A1FA 1QXPA 4QPIC 1H8TA 3T3YA 2VTXJ 3DECA 1HV1A 4PCRA 3PURA 1ZRFA 4AHYA 1IS3A 4XUQA 4D6SA 3VD9A 1AYN2 2VJXA 5JXGA 2BNNA 1SFPA 3RMYA 5JOXA 1Q8OA 1BLZA 2ZGUA 1O3SA 4O65A 3RI8A 2WZR2 1OH4A 3KS7A 1C28A 4OULA 3BIWE 1D4M3 4LUMA 1GP6A 5IVJA 4RS5B 2DBIA 3WW2A 5AC91 1VBA2 4NWWA 2JE7A 2AR6A 3WHTA 4OZOA 1PK6A 4XTPA 2OVUA 4HMZA 1O5UA 3OTFA 3ETPA 4IE5A 2WNUC 3RYPA 4QDSA 1DYKA 3ZYFA 1LOFC 1AYM2 1MS0A 4WVZA 4A45A 3R4UA 1NX9A 5GZFA 5KXBA 2RR11 1I5PA 3THDA 4NJ4A 1HRI3 4XFHA 5FCCA 3TAYA 1WMDA 2IXKA 2CYFA 1RC6A 1YQCA 2HYXA 3BCWA 5FFOC 2PHLA 4BYYA 2JEMA 5LK5A 2A70A 2DUPA 3IDCB 4XUOA 4YSFA 2Q8CA 3F2ZA 4GKXA 1LR5A 4Q4V1 3K4ZA 5EIYB 1V6OA 1S0EA 2HWD1 2VZ1A 1W0OA 4KGGA 4LITA 4CU6A 5IWFA 5BNQA 3VV1A 1K5MC 4GH4A 5DZFA 4AF9A 1O3QA 1W6QB 1YC61 4AXOA 4PT6A 1OQ1A 3PUHA 4IEVA 1LGNA 4BMBA 3DKWA 4GXLA 1BHGA 2SBAA 2EXHA 3ZYRA 1EP0A 4U36A 4YVSB 1UPIA 2GC1A 3CBNA 4QX8A 4RL7A 3LF7A 3OUHA 4B29A 2YDEA 3AZXA 5LK7B 1ULEA 2Y33A 1RUF3 2VUCA 1JZ5A 3I49A 1H2NA 4WVMA 5FK7A 1RUJ1 1US3A 5JCTA 4O9GA 1NUKA 3AYCA 2EAKA 1XPWA 2D7FA 3NNLA 5T5PA 5FO8B 2JB8A 4MHUA 5L9BA 3LOIA 3I59A 3E5XA 5FZFA 4KWKA 3VD3A 1H2KA 3AP6A 3A21A 5FXVA 3K4DA 3TN93 4CCNA 4FOYA 4HONA 2WSUA 3WQBA 3ACLA 1LKNA 4NO4A 2YBPA 3B02A 1SCSA 2D97A 5L73A 1UL9A 3ECQA 2XPJA 2QNKA 4AI1A 1QQP1 1MZEA 1TMF1 2GNTA 4RHV1 2JDZA 2WWJA 3VHPA 1QJY3 3ZSJA 3L2HA 3WV6A 4NAOA 4FI9A 5L7OA 1W8TA 3K51A 3WDWA 3RNSA 3AZVA 3AP9A 1UMHA 1UW8A 3K48A 4KL1A 1HKDA 5J96B 2OZJA 2WLQA 1BVVA 2ZAHA 4QKFA 2KA3A 2OUJA 4W50A 1GBGA 1LTEA 2QQNA 5FR3A 5FY0A 4ZHNA 4TSVA 3LGRA 1UY2A 1I1EA 1RXGA 4I0WB 4CE8A 4BWOA 1XOYA 4YW7A 4JGYA 3U4SA 3WT3A 3KT1A 1YQ5A 5FPZA 4AFAA 4BQYA 2JWPA 1AHSA 3PU3A 3QCWA 2W0XA 1WW5A 5FBZA 2YU1A 4XOGA 1Y9QA 2PQQA 2ZZQA 3DL3A 5FO7B 2VQ0A 1BEV1 1O8SA 3SH4A 2HWD2 3LSDA 5FZOA 4YFWA 1CR7A 3BALA 1LHNA 4M3CE 3UGHA 4CDXC 4H14A 3CJIB 4TWTA 3WOGA 1S0GA 5L36A 3NAPB 4K20A 1W39A 5LASA 3WF4A 3MUZ1 4DEVA 3KF5A 4QPYA 2WAOA 1W3VA 4X8PA 4YW5A 1FMD3 1OH3A 3DN7A 1NT0A 3HN3A 5DUWA 1PVC2 1MS3A 2ERFA 2Z79A 3AYDA 5LBEA 2WNUA 4GWJA 4MVTA 2VZOA 2UY9A 1PGL1 3E6BA 2Y6JA 1YO8A 3ZKYA 5J37A 1ZZCA 4QPGB 4LO7A 1PNGA 1RUC1 1WUVA 3JQWA 1V6MA 2DUOA 4K40A 5FZEA 5FLHA 1MVEA 4IESA 4PDWC 4NN0A 5LRRA 2BNOA 3WDTA 1AR61 1RUH3 4ZPIA 3WINE 4TYSA 3AJYA 1LNSA 3K4AA 2JG8A 2YC2A 4P9YA 1DIWA 1AUYA 3H7YA 1QNWA 3POYA 4OUSA 3VKMA 4KU7A 4AEJA 3GALA 3GZTB 3ZLIA 2YFZA 2ZX1A 3VBOC 1CAWB 3HT1A 3I54A 3O0VA 4ASLA 2HWE1 4Y24A 3SKJE 1O3TA 2ZGLA 4BB3A 1OF3A 3AYAA 3EBRA 4LKSA 1SQ4A 2WNOA 3FLPA 2F4PA 3AP7A 1IQAA 3J4UH 3JXSA 2G19A 3ZXJA 2D44A 5FYTA 1AR82 3I2HA 4ATFA 3WP5A 1GR3A 3MF6A 2VUAA 1O3RA 2DYCA 2ZMLA 5C8CC 4AVTA 3MLKA 3U07A 2KR2A 1XYNA 3U75A 1HQNA 1U5XA 1ENRA 5FXZA 2LUWA 2VBDA 1CX4A 1R083 4XHXA 3I3EA 4G3YC 3T4HB 3ZR5A 1NE4A 2BFUL 1G9CA 1Y4WA 4D3WA 1S55A 1NAEA 3BYWA 1F5FA 2UURA 4N90A 4KWLA 2HWD3 4CXWA 5J48A 1MQTC 3FJSA 4YW3A 4KGQA 3O0WA 4EYUA 4GKYA 4IEOA 5EXOA 4ZU4A 2ID4A 1YQ8A 3B69A 3HQUA 3QACA 3A22A 4IE6A 4CEWA 2WSVA 2O0OA 1NE6A 1JXNA 1KITA 1LOGA 2PTMA 3HNYM 2GC2A 4LOSA 4EROA 5A1AA 5IK4A 4FT8A 4WM7C 3RDIA 4WBBA 1YFXA 1TME1 4BQWA 4M3CF 2MPFA 4AW7A 4EZ4A 4Q0QA 4AHZA 1PZ8A 2JDNA 4JKMA 5JAXA 2BW8A 2WYFA 4YRDA 2XWJB 4LBQA 4QPIB 4AK3A 1J3PA 3CJIA 4R9CA 3N9NA 2W95A 5CFDC 2E7TA 4IV3A 3USUB 4XUPA 1A8DA 2W46A 2Y64A 4UW6A 2WBKA 4EZHA 3ZMOA 4EN9B 1CJPA 2VU9A 3P6BA 5L7OB 2JD4A 1UMZA 2PLV2 1DYOA 4W4ZA 5FZ8A 2WC2A 4BPZA 3ZYPA 5JZGA 1QOTA 1LAJA 3MIFA 2WQ8A 2D5HA 4BA6A 3KV4A 2PAEA 2FDFA 1STMA 4IETA 2XLGA 3FLRA 1NA1A 4AEDC 2PLV3 1DQ4A 4XJWA 1CONA 3TNQA 4RS5A 3HPNA 4IQPA 4FOQA 1QHDA 5GLTA 2WNVB 5ACA2 4D8MA 1PGW1 3OYWA 3TYJA 3OOXA 5C5TA 1JZ7A 1VJ2A 2C4XA 1C4RA 3LKJA 3ES4A 4QMAA 2XHKA 2IVJA 5EP9A 5KHJA 4IEUA 1NY72 3LDRA 1U5IA 3MW2A 5GM0A 2PQSA 2AC1A 4FPYA 4LBJA 3RZMA 2RS51 1IOAA 2XONA 2PHWA 4KWJA 3EHKA 5A7WB 3AZWA 4YG6A 4CEYB 5JLVA 1AL21 2E51A 1VRH3 1ND3C 4LJHA 2JG9C 1GWKA 1N3QA 5FY1A 2ET7A 2XLAA 4AVAA 1BBT2 4IEWA 4Q4Y3 1N3OA 5FREA 3H1WA 1GZWA 4JDNA 1NLSA 1C8M1 1UOGA 1S2BA 3O14A 3VDDA 5E16A 1GV9A 1W2TA 1WMEA 4XF3A 1UN1A 3WXPA 1WCDJ 3IPVA 2WS93 3FC0A 5ABJA 2GN3A 3K46A 3P3PA 4DNYA 4Z1VA 2VPVA 4HT1T 2LW8A 3USSA 1IKQA 2R061 1UYXA 5C3PA 4Y5Z0 1APNA 3ZN6A 1WW7A 4CDWC 2ZCWA 2XL7A 1PK6B 3ACFA 5T5OA 2L9LA 1AR83 2EIEA 2LM3A 4RR3B 1PVXA 4UXAA 3RI9A 5IVEA 4TTGA 4RS5C 3LA2A 4I0AA 1HRV1 1OQEA 1CAUA 3ZSKA 5K8SA 1GUIA 3M3OA 4EJRA 2J7MA 3LSEA 4PHZA 4UFLA 5BYNA 5FLIA 4AQSA 1D4M2 1ASJ3 2BUKA 2R072 4RN5A 4NVPA 3O1OA 5EFUA 2I2SA 5H9QA 3ZFEC 1MEC1 2PAKA 5FYZA 4A7KA 3T30A 5DDJ1 5FZAA 4ATEA 4NRQA 3WVJA 3JD71 5GLWA 3WUCA 4GH4B 4PF5A 5IUQA 3U14A 4PQ9A 1R1ZA 4OUEA 4LKFA 2FCTA 1IPSA 1VBE1 3ZFEB 5IVYA 2XJPA 4HXCA 4E2GA 1B35A 3VKOA 3POFA 2XVLA 5LRSA 3NV4A 4JAAA 3VBSB 4Q0SA 4BQ4A 4CP9A 4ZU7A 1LHVA 5GLVA 1ND2B 1V6NA 4B1LA 3BKZA 2ZGTA 3FFZA 5ACA1 2K2SA 1AX0A 1CAVB 2DVGA 4FAHA 1VBB3 3U0ZA 2VZSA 2GN7A 2VZPA 3FHQA 2ZOEB 4D7TA 1W8UA 4ITCA 1CAXB 5FZ9A 3Q8BA 3THCA 2P37A 5FYUA 1DQ1A 4WVWA 1J58A 1OA2A 1MS1A 1SDDB 5I8SA 2ET1A 4GB31 1GKBA 2UU8A 1PO23 1AR73 5IK5A 5JSPA 1PNFA 1NA1B 2FDGA 3M2MA 1WBFA 1OOPC 4F83A 4Y20B 1OKQA 2VW1A 1YI9A 1RUE2 1BK0A 1QOSA 1VBC2 2XOMA 1MPXA 2JG9B 3M3IA 3NRUA 5FYVA 3ILNA 3ROUA 4A3ZA 2A71A 2P3YA 4Y1UA 1W2AX 1EV12 1OOPA 3KVAA 1R091 1LGCA 3PJQA 3R6SA 4JRLA 1EAH1 5J1XA 4CDWA 1MS9A 2BTVC 5GZEA 1VBD1 2QQIA 3DV8A 1ZZBA 3NV2A 2J1RA 3IDAA 1XNKA 4LO8A 4Q4Y2 4M0NA 1YQ2A 4MGIE 3B9CA 4QQ2A 1JTZX 3LZZA 3V0BA 5CZKA 1HXS2 3PU8A 4JGYB 3S7IA 3UV9A 4META 2YFUA 2WNVC 3ACHA 2WT1A 1BVP1 1MZ6A 5LEJA 4HKOA 3HBKA 2AACA 4O61A 3NAPA 5JI9A 4CEYA 3AKTA 3KHBA 2PAMA 1HB2A 5A7SA 2LRPA 3TEZA 3WQ7A 2OXBA 3WNPA 3M3EA 1OA4A 4HLTA 4HVRA 4LXLA 1W28A 1D4M1 1Q8SA 4YG0A 1L7RA 1RMU3 5D8AC 1Q43A 1EPWA 4M4RA 4URTA 4X6QB 4AR2A 2EVXA 1DZRA 2ZX0A 3I8TA 4FPFA 1AXZA 4OQ9A 1O59A 3QOPA 1W8FA 2BV4A 1HLCA 3FN9A 5GJ6A 4HZFA 1RUC2 1W99A 2WFF1 5A80A 2WFF3 3C7GA 2PA7A 4IV1A 1SBDA 5LBBA 3ASIA 3FL7A 1JU3A 3O12A 1ZZ6A 4MLOA 4XZUG 1MQTB 5BNPA 4XBNA 5I0UA 5HPOA 4UW3A 1HDKA 1MR5A 1KGYA 5F6LB 3PVBB 1IPKA 1UYPA 1XYOA 2R042 4PI2A 3RWNA 2TBVA 2VULA 2D3SA 2F6BA 4XE9A 1DZTA 5A33A 2HBUA 2P3IA 3S6PA 4LE4A 4XF4A 4AQ2A 3KLSA 3S57A 4XJAA 3C2UA 4C1WA 2YPDA 3TRSB 1UKRA 2A3XA 1VPHA 4JHTA 4W8JA 5JXHA 1YXWA 4HKLA 3R0RA 2P1BA 5F5IA 4GIQA 1US2A 5CVRA 3NV3A 4LA3A 2WS92 4BU2A 1AX2A 4E8CA 4OLLA 4I3PA 3AMMA 3HNBM 4YW6A 1W8OA 3MPPG 4HSLA 2DTYA 3WP4A 5IVVA 1G8WA 3JZVA 3I7DA 3ZXKA 4LBLA 2D3PA 4QQLA 2XG3A 2OA2A 3S7EA 1B35B 2D93A 1HB4A 4JV4A 4B1MA 3N9PA 4D6QA 4XUTA 3VGIA 5KHHA 4P00B 4CEWB 4A2UA 3NNMA 3A23A 4AOCA 3R4SA 5C4WB 2BWCA 2RV9A 2G9GA 1O91A 2PHTA 3IIIA 3IIAA 5ABJC 1TMF2 2HJIA 4RHV2 2RE9A 1KS5A 5F5QA 3N4MA 5KC6A 1DYPA 2WZEA 3E5QA 4LHKA 2NZ9A 4IXLA 2XH6A 4L92A 4AFMA 3W9AA 4HANA 1C8M2 3O1PA 2VOWA 1QJX3 1TMF3 4RHV3 2R0FA 1LJ7A 1PM7A 3LIGA 2Q8OA 5JI7A 1QQP3 4IGQA 4KG8A 4HK9A 5ACA3 1NLQA 5IJRA 2QQOA 1K45A 2PFWA 4PLOA 5D21A 4LTAA 2ZHKA 1K12A 5FMOS 4FPJA 3VZOA 2V09A 5F5AA 2LTNA 4AHXA 5C3RA 5IVCA 2RMU2 2BBVA 2JXAA 1UU6A 4Z07A 2RHPA 1KEXA 2E53A 5CB7A 1BYHA 3IT8A 4WM8B 4LLOA 4DEQA 5IT6A 2HEYF 3U78A 2GU9A 5A7NA 2H0BA 5A3TA 3DXUA 2W2IA 1VIWB 4Y4RA 2IXHA 3J26N 4YW4A 5EJ1B 3VDDB 2A6WA 5BNPB 5IHRA 4E2SA 4BCUA 4R9DA 5A3MA 5FP8A 3KM5A 2V73A 1MEC2 5ABJB 3OBAA 3WNNA 5FZ7A 1I6XA 1R1A3 3HMYA 1T2XA 4AEDA 4BQ1A 5J36A 1ZBA3 1PX4A 1ZBA1 2DFBA 3HR9A 1SLTA 3GNEA 4EN0A 1MZ5A 2Q8DA 2UYBA 4MGYE 2GNDA 3DPRC 4Y26A 3IN9A 1QXJA 5A7OA 2XJUA 3WQ1A 3BN6A 5BNOB 1XSQA 2D6PA 5A1LA 1FMD1 5L9VA 4IERA 2J22A 4QX3A 5FUIA 2WZPP 4Z82A 1UZWA 4ASMB 3POSA 4KU8A 2DBNA 5A3NA 3VB9A 2ZTNA 4PBPA 2D5FA 1D2QA 2HWB1 3MIHA 4R52A 2XJTA 1POQA 4P5YA 4QWNA 3I2GA 1OUXA 2QZ3A 4FPGA 2LROA 4QM8A 3QH6A 2HWE2 2PHFA 1YRZA 4I02A 2KXLA 3MYXA 4IEPA 2OW4A 2R1DA 3PHMA 2WFPA 5FK8A 4QDQA 4Q26A 1RUI3 4OHYA 5DUVA 1LOCA 3OYWB 4GWIA 2CHHA 2Q30A 3T1LA 1VAVA 1POV3 3I59B 2V72A 4HN1A 4AI2A 4YZ2A 4N43A 4FO9A 3OPTA 4Q27A 5FY8A 2VXRA 4Q8LA 5A32A 3ZXDA 1EPZA 1V00A 2EF6A 4CCKA 3K3NA 4AG4A 2RS53 2J1TA 3H42B 5C5UA 1UO9A 2Z69A 1FOD2 2GMPA 4NAMA 2Y6LA 4QKNA 2ZKLA 3P3NA 2CAUA 4XBLA 4UF0A 3JB4C 3OG2A 4YVWA 5C3OA 5CADA 3GDBA 1EAH2 4BQ5A 3D6EA 2XUMA 1GWMA 3N35A 1V6IA 1LOAA 1X33A 3T08A 5FYIA 3FZ3A 1JODA 1R082 2JJ6A 2VGDA 3VHOA 4UFJA 2Y6FA 2WO2A 4CDQA 1D4VB 4DY5A 1RUI2 3B00A 4OI2A 4LK7A 5EWSA 4R8HA 1OI6A 3IMNA 4TLGA 1O7FA 5C33A 1W90A 2BEOA 2VNGA 3VBHB 2DDUA 3SITA 4PIYA 4HPKB 4AEMA 4XJUA 3W59A 2WNUB 3R4DB 4MXWB 4O7XA 5A7QA 3O1MA 1Y9GA 3ZPOA 4L99A 2ARXA 5JMOA 2Z42A 4TN7A 5C4WA 2E63A 3S30A 2ORXA 1J1LA 5FYCA 4QGNA 5JOWA 3WX5A 2HBTA 1RUD1 4OUMA 3W58A 2XVGA 3MFCA 4LKEA 2HH9A 5K9YA 3VBSA 1OC1A 2VBBA 3GXUA 1G9AA 4XAEA 4MADA 1DLLA 5CIRA 2OS2A 1ZVFA 4IUGA 1Z7S1 4W6YA 1CAWA 4EWAA 5FXXA 5FKCA 2Z4FA 1D7PM 1EV13 2VZTA 3NJXA 4KMQA 5GLZA 4Z2WA 4B4QA 2DURA 2MEV1 1U0AA 2C9AA 3OGJA 3LQCA 1RMU1 4Y3OA 1UMIA 2D40A 2H0VA 4XXPA 4HBNA 4Q0UA 3KWVA 1PVC3 3OD0A 1PVC1 2WINB 3GZUC 2NN8A 3ACIA 4C1XA 4A41A 4OZXA 2XLFA 3ILFA 3LPFA 1QJX1 4H7MA 2GMEA 1C1LA 1BCXA 1XNBA 4Q4X3 5FYYA 5FYBA 3T2QA 1Q56A 2VM9A 2BZDA 3IKWA 5FRAA 3KCYA 3BOWA 1V6JA 5CFCC 1K3IA 3RGBA 1RJ7A 1Z7S3 2BVBA 4D7SA 1UU5A 5CG9A 1OUSA 5AVPA 3MDPA 4MGTA 4Q2FA 2FDKA 1OOPB 1AR92 4J1XA 4LPLA 2YUEA 2IVIB 4J6GA 3K75B 5DUXA 5C8WA 2IC1A 5FY9A 2EIGA 4CDQC 2JKXA 3H9AA 3H7JA 1H6YA 5FZMA 1ACCA 3D5OA 3CMGA 4OI4A 3VZLA 2VOKA 4Q4W1 2ZJCA 4W6XA 1GOGA 2AGSA 5FP3A 2VOXA 3EB7A 1NCRA 1ONAA 4JGZC 4G9SB 4Z92B 5FQ0B 2AUYA 3MLJA 1X50A 2XR4A 2ZGPA 1W8WA 1JYTA 5BNOC 3KT7A 2XHNA 1GMMA 1A34A 4GJYA 3T2TA 1VB2A 1G9BA 2EALA 5IVBA 2UWAA 1GP5A 3ELNA 2P2KA 4E4HA 5AFBA 5F7UA 5ISLA 1XE0A 3DGTA 3VUOA 4LEJA 4N53C 1SCRA 2B45X 3ZN4A 3HQRA 3MIDA 3SHRA 3DUIA 4XFIA 3VBFB 3RVHA 1W05A 4Q1RA 2RS13 4XC9A 4ISRA 1COV3 3OGSA 1NKGA 5B4NA 1WKYA 2DF7A 2VOVA 5G04L 3IB3A 5JZGB 3RYRA 1AZDA 4UBHA 3WF2A 1BMV2 1SPPA 4YVWC 1N47A 1G6NA 1DGWX 1H4HA 4BDVB 3L2YA 1LRHA 5FOBB 5CFDB 2EXIA 4QQPA 3SH5A 2R6QA 3HVDA 1YNAA 2ORZA 5D2AA 1ZA4A 3KSCA 4JQTA 4LIUA 5B2GB 3LDKA 2BGPA 4EN6B 3PUQA 4AVVA 4DO0A 1KFUL 4IV3B 1LENA 3WDUA 1W2OA 4KI5M 5HI0A 2E32A 5FTTC 2Q8EA 4AGVA 3KF3A 3BTYA 1K5JA 5T54A 2DVFA 5JPNB 3LA3A 1YJLA 1DU3D 1U5YA 2EAAA 3POBA 2C26A 5F8PA 5FY7A 4NIGA 4CUGA 3JB8A 5E88A 2RDQA 3AKSA 1SLBA 3DCQA 3GHMA 2A73B 1GZCA 3GCXA 2HWE3 1TNRA 1PK6C 4XCAA 4CDXB 4BQXA 4I3GA 1OLMA 2LS6A 3SXWA 4JGZB 3H1MA 4FFFA 4F3JA 4BM8A 3KCXA 2W1SA 4GQ7A 5FP4A 2P17A 3KCCA 5FZ6A 3O0XA 1UPSA 4QU1A 4W6WA 1V9U1 5EYXA 1SHWB 1H2MA 2ZHLA 1AYN3 1AF9A 5B4XA 1NLRA 4CU7A 1ASJ1 1RJ8A 4CA9A 2A6ZA 4PDWA 5DN2A 1FAYA 1RUG1 1QH6A 1H30A 3DPRA 5D1IA 4BZ4A 3IPVB 1R1A1 3C3VA 4C8DA 4N9IA 1WCKA 1HRI2 3POWA 3OGGA 3TB0A 2PYTA 3HQXA 3Q8EA 5JSRA 1W8ZA 4L2NA 1ZX5A 3MO4A 4FPKA 5JUVA 3ZMNA 3G6JB 4FVVA 3H8XA 2Y6KA 3AB0A 2GAUA 4LMFA 3OGVA 3UKTA 4K8RB 1JW6A 5FZ3A 2VZQA 2RJ2A 1OKOA 2ZEYA 3AMNA 1V6LA 5HXVA 2P5BA 4BK5A 3BPZA 1TNFA 1YEWA 2VVEA 4FQ4A 1ENXA 1K5MB 3ZN5A 2XJQA 2CV6A 3CHXA 4AAPA 4AFBA 4P9WA 1NQDA 2VQUA 4UFIA 1V70A 2ZGMA 1UXZA 4Y1YA 2BGCA 1SDWA 2CAVA 4NR1A 3C7FA 1DG6A 1RUG3 2VCBA 3N3HA 5DDJ2 5EHDA 1C5HA 1W3XA 5FPAA 2NMNA 2W68A 2VMDA 4PI0A 5CAZA 1H9WA 1DGRA 3PIJA 4OCTA 5IATA 1CD3G 1CGPA 5BNNB 1WCSA 3J8F3 1W0NA 4CCDA 1JYXA 2D6MA 5H9SA 4FPEA 4NHKA 5T5LA 1LEDA 4DY3A 3V0AA 3WP3A 1REDA 1GP4A 5JMCA 3M3QA 4NIIA 4URAA 4B8EA 1QEXA 1HV0A 4HG6B 1B35C 1R081 1UNBA 2VAUA 2WJSA 5LATA 1XNCA 1ZBA2 4XHBA 2GP5A 4QT6A 1ZBE3 1XNDA 5C8CB 4XF0A 1JI6A 1REFA 1HQLA 2DWRA 4Z8BA 5FBJA 1BEV2 1RUF2 4LT5A 2Y26A 1W8NA 4UFMA 3JD73 5FZOB 3RRDA 5IK7A 2JIGA 2VMCA 1PIV3 2BDRA 2O8QA 4KQ7A 3RMXA 3SLIA 5C6CA 4YM0A 5LBCA 1FATA 3CU7A 3RSJA 4UYBA 4JVAA 2VZRA 4COVA 2E7QA 2W5FA 4B3NA 2RJLA 2O1QA 4EWEA 2Z2SB 4XF1A 4FFGA 3T2OA 1Y43B 4QX7A 2DCJA 1BZWA 4BISA 3ES1A 2IFWA 2E6VA 3SISA 4XMIA 1EV11 3GF6A 3RZHA 4OQ8A 3KQ4B 4K7JA 2ZPXA 1R1A2 3RQ0A 5JOYA 5FUPA 1V9U2 3UGGA 2OPKA 1DQ2A 3MIBA 4BXFA 4BE3A 3KD4A 3GBWA 2BJSA 3ZOIA 4XDOA 3FLTA 1AYM3 4JHZA 3NV1A 3KHCA 1SLLA 4QPGC 2EA7A 5D8AB 5F3CA 1OLME 5A3WA 1S0BA 1OFSA 1CIYA 4GMP1 5FZBA 4Y20A 4AFDA 1IQDC 1HX6A 4YW2A 2ARAA 2Q4SA 2ARBA 3LEMA 1JZ6A 3ABZA 1PMHX 4BH9A 2D6NA 4QQOA 4P5HA 1GU3A 5I93A 2VCMA 4K1YA 1VBA1 2PHUA 2QBXA 3I3BA 4CUCA 1V9U3 2XB6C 4OHXA 4Q4X2 5A7PA 1DZQA 4A7YA 2R071 5I0SA 3IMMA 4ISQA 3POEA 1QJY2 5JR7B 2ZMKA 4IE7A 1UXXX 4XQ4A 5APAA 4F7ZA 3V0AB 2BP6A 4E27A 3M3CA 4JX0A 2A7AA 1O5LA 5CKNA 2J1EA 1JYCA 2P6HA 2RS31 2OZ6A 3LD8A 3NKGA 2WLPA 3ALQA 3D82A 3POJA 5FZKA 1HXS3 3I3MA 1KXGA 4MGZE 2ZGRA 1PO11 4LR4A 2BERA 4CTEA 2QTWB 4CZSA 3RZKA 3VD5A 1ULPA 4GB33 1A78A 1VBB2 2GNBA 4NMIA 3M7AA 2PELA 4WM8C 3AK0A 1IKPA 3PJYA 3WY6A 5HCHA 3VBRC 1YLLA 1LCLA 4NHYA 4IV3C 1FX5A 4AQTA 1RUC3 4XW3A 2ZGSA 2G9ZA 3HOBA 4MZUA 1W03A 1SBFA 2X5IA 4OI1A 4XFGA 4FOVA 1X8MA 2YYOA 1FMD2 1PZ7A 2YXSA 5T50A 5BNNA 1FNZA 4P08A 2VC9A 2VCCA 2IUWA 3N7KA 4TZDA 1LEMA 4E9KA 2JE8A 2R043 1X8EA 3HIFA 4IDZA 1NG0A 4UW4A 1DP0A 1JN2P 2RM22 2XXZA 1OVPA 2NM1A 2DVBA 4QQHA 4IEZA 4CRQA 3ZSMA 1BEV3 1RUE1 1VBC1 5A33B 2P4EA 3MEPA 4YGBA 2IXCA 1LECA 2PMWB 2WWUA 3WNLA 3H8RA 5D8AA 1RINA 1W6NA 2XWBB 1DBNA 3E6DA 1W9WA 4FCAA 1H0BA 1FYUA 4OHVA 1UOBA 2AEZA 4IL7A 3IAQA 3RZGA 1D0GA 3ZSEA 4Y1VA 3UKNA 4A44A 5IAVA 2WWSA 2JX9A 4CDUC 1JOPA 2K9ZA 2QDRA 2W91A 2XKPA 4FFIA 2WQZC 3WP6A 1WD4A 2YY1A 1X82A 4MGKE 1RHI1 3MF9A 1VLNA 3NL1A 1H8VA 4BQ2A 4CXXA 4Q29A 4WZFA 2YBKA 4XJ8A 2RR13 1D0HA 2TNFA 2VVFA 2V5DA 4PQQA 2J1VA 1AR72 3VBOA 3W5NA 3ZN6B 4LHSA 1POV1 1GYKA 2R0HA 2JDAA 1J3QA 5HV4A 5LBFA 2PHXA 5DQ0A 1XBFA 3VBHC 3ZYBA 4IEXA 1DFQA 3NNFA 1SG3A 3K3OA 4KG0A 5F6KA 2Y6GA 2XMLA 5ANQA 3WUDA 5I8YA 1TEIA 5DPNA 3AMHA 4RR3A 3IDBB 4GWMA 3L9JT 4S2FA 4FPOB 1RL3A 3BGAA 5AC92 2PHRA 2FDIA 3AP5A 4FQZA 3SEEA 1W9FA 2TUNA 3AXEA 3VKLA 2BNMA 4FXGB 3ZXFA 1UOFA 4MV2A 1XXNA 3GBGA 4L11A 2CGNA 2H6CA 4FP3A 2WA4A 3OPZA 3UYJA 3VDDC 1AJKA 4XYXA 3SCFA 3BVCA 1KDKA 1OFNA 1YCIA 4CDXA 3M1HA 4H2AA 1CQ9A 1XE8A 3MZHA 3BTZA 3AYEA 1W9YA 5FV3A 2GH2A 1RUD2 3I2JA 2QCSB 1QGLA 1UX7A 1C3HA 1UZVA 1JZ4A 4CP2A 4M0HA 1MZFA 1JHNA 3PTYA 3VBUC 4WM7B 3WF0A 2XDVA 4H3WA 4Q4V2 4E4ZA 1LODA 1ASJ2 5GZGA 1RUD3 4GJZA 3E6CC 2JICA 5LB6A 1NA1C 2BOJA 2HEVF 1PIV2 2JDUA 1DQ6A 1H1AA 1QKQA 1LU2A 4ZONA 4CP9B 2G9FA 3BOPA 3IDEA 3J7HA 1RUNA 2XUEA 1WMXA 4RGKA 2WS91 4DXTA 1J83A 4EV0A 1MEC3 2A5ZA 1FOD1 5JXIA 2P34A 1E5HA 1I9RA 1R64A 1E5SA 1OLQA 4YLZA 5L7OC 4XURA 1XU2A 4AEKA 1DGLA 1M4WA 2QFEA 3WDYA 5C9AA 1X36A 2R49A 1AR91 5K7PA 1H2LA 3K77A 2XJRA 4W65A 4PIZA 2XQRA 3ZXLA 1RTVA 5IYYA 3M8LA 3Q8AA 3P1IA 2JDPA 5IK8A 2OQ6A 2Q5TA 3B9IA 5FY4A 3ZYGA 2QQKA 4BIFA 2VXJA 3GM8A 1UAIA 1L3JA 5JIUA 3D8CA 1AYN1 4I2OA 4NROA 1IG3A 1YI7A 4HVOA 3VBOB 4I09A 5KR7A 1QOOA 1VRH2 4IGPA 5LZ6A 5JXJA 1W8HA 2YB7A 3AKRA 1ENQA 1K42A 3DPRB 1YIPA 2HWF3 3HD8B 1PMJX 4JCKA 2I07B 3OGRA 5DUUA 4HVQA 4OI0A 2VE1A 4DXSA 1JYVA 4U2AA 5SV5A 4Z2AA 1TQ5A 3UETA 3KZ4C 4QX0A 1UX6A 1F5JA 2NLRA 1AYM1 3KGZA 5HBAA 1AR63 1RUH1 3UT0A 4RD7A 4DUWA 2Q1MA 2B4KA 4Q4X1 1OURA 4YM3A 3VD7A 5AFEA 1VRH1 3TEWA 2DCZA 4MHRA 3CIHA 1GFF2 1S2EA 3ORJA 1JYNA 2R16A 2QQLA 3EMRA 5J3UA 3NJZA 2F17A 4LA2A 1VP6A 5A7WA 1ST8A 2YZ4A 1RXFA 3C7EA 4QB2A 3M70A 1UKGA 5FPBA 3VBHA 1GQPA 5LA9A 1ULOA 2UYAA 1BK1A 4FOWA 3PMSA 3VBRA 3WD5A 1RUH2 1O4ZA 4AVBA 2FDHA 3ZYIB 5DG2A 4GAZA 3ZPYA 3EXUA 2WAAA 1W06A 4C0BA 3PDQA 1PO12 2W1QA 1Q8VA 2YMZA 3SMHA 2KM2A 2VCAA 4BIOA 1F9KA 1VB4A 3FHIB 3EQEA 5CKQA 1W6PA 4RR3C 3KMHA 4CCEA 5HCBA 2BBAA 3GHNA 2RS33 4UBGA 2HEWF 2JDKA 3V0BB 2VOTA 4XFAA 2OYZA 1NY71 4K9SA 1DF0A 4UI9L 4N9HA 5JZGC 3W21A 4E4DX 1FT9A 1VBE3 4A7ZA 2ZGNA 3HN1A 3J7MA 4UAPA 2O8OA 1HN1A 4P9XA 3VBFC 3C8XA 2HWB2 3RYKA 4XILA 2OX0A 3WZ1A 4YYOA 4XAAA 4XCBA 3JQXA 4YVSA 3I4IA 4IE0A 2R30A 3PNAA 3SCGA 4GALA 2JDHA 5C3SA 2RS52 5A3OA 1L7QA 5FWJA 5KWRA 5EV7A 5LCWL 3HJRA 1NCRB 3T0DA 4QKDA 2FZ2A 1SMVA 1CWPA 1UZ0A 4XACA 3ZKUA 4LHNA 2ES3A 2ZABA 4QXBA 4XMAA 2BFUS 5T3NA 3N9QA 4YGEA 1GZWB 4K1ZA 2QQVA 1KD7A 1MS5A 1S0IA 2B7YA 1MS4A 3KVBA 2EXJA 4WM7A 1E5IA 4YNIA 5FPVA 3ZX7A 1DLCA 4AHWA 5J98B 3FMGA 3N9MA 1XJAA 5L19A 5JVVA 4JZRA 2GZWA 4GULA 4CCCA 4CSWA 3A7QA 2W87A 3KB5A 5FZ4A 4DINB 4P14A 5GZCA 4YARA 2LALA 3PTRB 4GD4A 1J84A 2WO7A 4IGOA 3LEGA 5A3PA 1UU4A 1RUJ3 2Y34A 4D6RA 5CFCB 3O1RA 2ADEA 4IEQA 4N7UA 3H3UA 4MYEA 1V0AA 2P3JA 3IWZA 2Y0IA 2QUOA 1XC6A 5I0DA 1AR71 4JDMA 1KQRA 1O6UA 1AR93 3LWCA 3CJXA 1H4GA 1SBEA 4M3CA 1RVF2 1DDLA 1WBLA 2XVKA 2HWC1 2VMGA 3PVOA 3J7LA 3BU7A 1UCXA 1W6NB 2IWGB 3B01A 1HQWA 4HN0A 3UK9A 3OUIA 1TME2 5CKMA 1NOVA 2FCVA 1AL0G 2W47A 3PMEA 1OT5A 4NIDA 3CL1A 2XKOA 1CAXA 1ULGA 1W6MA 3AMPA 1C5IA 1GWLA 1SFYA 3ZFGB 2ZHNA 1AL23 3IZOA 2D43A 2C0ZA 2B9VA 1GANA 1UIJA 1FV3A 2MEV3 3ACGA 4J1WA 1RMU2 1DQ5A 2JDMA 3O1TA 4WVVA 2JENA 5I0TA 1MVQA 2FHRA 1ULCA 4AI3A 5GZDA 5FY5A 3O1UA 2X53S 2YGLA 2HWB3 4MUVA 1B09A 5JSOA 1W0PA 2RMU3 3JBG2 1ND2A 3B93A 4PDWB 4LULA 5BXXA 1GQHA 3ZXEA 4A6SA 4DOUA 1WW4A 5I91A 2ZAAA 5DAXA 1ND3A 2ZA9A 2ZGKA 2XGXA 2CNAA 2WO1A 3OBTA 1BXHA 4LORA 2YU2A 1JS9A 5KC5A 1QJX2 2E9QA 4I30A 4ARXA 4PLNA 4B7EA 3PVEA 3RG0A 3I2IA 2QQPA 4HFSA 3EYPA 5FLJA 4YM2A 1CVNA 2QJVA 4QDRA 1CZSA 4XIOA 1F2NA 1X7NA 2OIIA 1NCQB 1YFUA 4WV8A 2QQJA 2E33A 2RS11 1FPN2 1GICA 3GCWA 4Y4YA 1CN1A 4XBQA 1TVGA 2OPWA 2FMDA 3DYOA 3ZDVA 4UWDA 5CBLA 3E1F1 3J8F2 1NZCA 4ORFA 4KWUA 4QD2A 3TBDA 4XTMA 5A32B 3TN91 5C7GA 1UY0A 3ZR6A 1O4YA 1KDMA 1POV0 4Q4Y1 1LU1A 2NMOA 1LESA 1RVF3 4QPWA 5GLUA 2XJVA 1UZYA 1P8JA 3OPWA 1YJKA 5LEKA 1G7YA 1GLHA 1HXS1 4N53A 4LOTA 2WZ8A 4D7YA 2WN3A 3OY8A 2ZGQA 2W3JA 4CP0A 3JD72 2B9UA 3OJBA 2VECA 5IFPA 5F2WA 3VHRA 1QJY1 5FMCA 4ZS2A 5BNOA 5FOJB 4RFRB 5CFDA 3AC0A 4OMDA 1YWKA 5FMOL 3WQ0A 1H8TC 2H6BA 1H8TB 1HB3A 2O14A 1FV2A 2RG4A 5EJ3A 5E6HA 5KBFA 2PXJA 3DYMA 1VBA3 3WW4A 3PUAA 5FIXA 4BJ0A 3DEMA 3EO6A 5JPMB 1JYWA 3OSDA 2UWBA 3NWKA 3FUQA 3RFRA 4Q4V3 4YGCA 3NJVA 2GALA 4INDA 5F3IA 4BQ3A 1S2KA 2K46A 4I0BA 2CU5A 1L7LA 3NW4A 5LWBA 4RQPA 1JHJA 3MUY1 4JDOA 5CFCA 4R4ZA 3UNPA 2JKBA 4H7LA 3AKQA 1WLWA 4L97A 3F95A 4QB6A 3ZXAC 2ZX3A 2QVSB 5F2SA 3IAPA 4P9JA 4MGSA 2AEYA 3HNMA 1ZYBA 2ATFA 1ENSA 4SLIA 3LDBA 3UGFA 3ZFFA 1OMIA 4RQPC 4QKBA 4Y1ZA 3H0OA 1GOFA 2YBSA 1PO21
chains in the Genus database with same CATH topology
4NPRA 5BV6A 1N1YA 2VQAA 5JWPA 2XBO1 5KXCA 4C91A 2CL2A 2DVAA 1V6KA 3VZNA 2WKKA 1CIWA 5FQ0A 2JE9A 1NXD1 1I5ZA 1WMFA 4GMP0 3J8F1 1JUIA 4BOWA 4X8NA 4LBMA 2RS12 3VBFA 1YIFA 4QGMA 4K8FA 1OLRA 4Q8KA 3OD4A 5DZGA 2WT0A 4JRAA 4LHLA 1RUE3 1VBC3 4AFCA 2XJSA 4P9GA 2SLIA 3THPA 1YYNA 2ZGOA 3D0SA 2YHJA 4B7KA 4LBOA 3D4KA 2JG8B 2X8KA 4LO6B 2ENRA 2V5YA 3VBUB 2UWCA 3NO8A 1SLAA 1BQPA 2BVVA 1A6CA 1QJU2 3CF6E 1D2SA 3ZFFC 5K0UB 1IPJA 4S2DA 2RMU1 5CNAA 4XZPA 1OPMA 2Y0OA 4AE2A 1NCQA 4QX5A 4G4FA 2VUJA 2RR12 2UY8A 2DU1A 4DFSA 5AVAA 4Q1PA 1ZRRA 4N43C 4KNCA 5H9RA 5BPXA 3NKTA 2ZZJA 2BYVE 1MS8A 2ZX2A 2NPIA 4Y22B 4RGGA 4LLFA 1YUDA 3VBSC 1CAUB 1AVBA 4M00A 1ZRCA 1RUF1 3ENRA 1YHFA 1WLTA 3ZFGC 2HYKA 2VNRA 2A75A 4M01A 2PLV1 1VAMA 1ZBE2 2G4IA 5J7MA 4FXKB 4V1PA 1KS4A 2W52A 3WNXA 4FTBA 4RFT0 4AI0A 1PIV1 3URFA 2D3RA 4ES8A 1QDOA 1VALA 4HL0A 5CG8A 1QXRA 5DZEA 3VLBB 1HRV3 4S2GA 3UL2A 1PGSA 1URXA 4FPLA 4XEZA 5HCAA 2VY0A 4COUA 4KH9A 3A0NA 2QE3A 1ZBE1 4XFCA 4YZ5A 1NCRC 4JGZA 1JBCA 2RJKA 1PZ9A 1Q5OA 5DDJ3 4RQPB 4YW1A 4DXZA 1H9PA 2B5HA 1VR3A 1GQGA 2N7GA 3T1MA 3JU9A 1SFNA 2YC0A 4JQRA 4DZGA 3UJQA 3WLUA 3VL9A 3X29B 4C0HA 1ZNPA 1M06G 2DU0A 4FTSA 2GNMA 3FWEA 5AC93 1BBT3 2IXLA 4YZ3A 4XF9A 4XPVA 1OQDA 4X6RB 5BNPC 4K3UA 3ZVXA 1K5MA 2DCKA 4XQDA 4FBFA 3NAPC 1AJOA 1U12A 1AX1A 3N7MA 4IV1C 3USUA 1DQ0A 3WR0A 5A3LA 1KJRA 1IHMA 2WL1A 3BODA 1S0DA 2Z5WA 1YFYA 5KHKA 1W6OB 3OCPA 5E1RA 5CA6A 3JCIA 5C4WC 1DGRN 2RS32 1LOFA 3V64A 2VNOA 4LUKA 1PMIA 2WNVA 1QMJA 3VHNA 3ZO0B 2CWMA 2ZS6B 3CLPA 3QH7A 1QDCA 2A3WA 1XE7A 2YPJA 3HAGA 3QLQA 3ZIXA 1QWRA 4XIKA 1COV1 2DV9A 2WNEA 1TE1B 3VL8A 3MIGA 4LBQB 4QPIA 3H3ZA 4M3CB 2R041 3WG3A 4DRVA 3FX3A 1H1MA 5JOZA 1HIXA 2A6VA 4Q0PA 4QM9A 1ND3B 1ZZ7A 4COZA 3ILRA 5BUVA 1AL22 1J1TA 1GNHA 2PN5A 5SV8A 4CDUA 4YZ1A 1FPN1 4WZCA 4DRRA 2IXJA 1W6MB 2VVDA 2IXIA 3N7LA 1JOJA 1Z0HA 2BPA2 1UF2C 4LNVA 1PO13 1OD5A 2IZWA 1GNZA 2Q0AA 1IZ3A 1KFXL 4COWA 3QD6A 1CESA 3QBQA 3HWJA 2A6YA 2DUQA 3GBFA 3KT4A 3THTA 2DTWA 3WG4A 4E2QA 2ZACA 4KBBA 3O7OA 4AI8A 3FUOA 4YVSC 1HRV2 5F9TA 1OA3A 4ZXKA 1DGWA 4OFGA 5T5JA 4XJ9A 1LOEA 2JECA 3BB6A 4YG3A 2C5DA 1N1VA 3AJZA 1OPOA 1GSLA 1LHWA 3V56A 1WGPA 3WG2A 4DB5A 2X5IC 1R092 4XETA 1CJDA 3NSTA 4HKWA 1W6OA 2QDNA 3RPQA 5EZWA 1AXKA 2Q1ZB 4Y1XA 3APBA 4LBNA 2D6OX 1RITA 3ZIWA 3AFGA 1ALYA 1NQJA 1SEFA 1Z78A 1ZREA 2P3KA 3H8UA 4MXVA 2A6XA 4EWDA 1SACA 2VMIA 4OHWA 5KHIA 1W6PB 4K6BA 1FNYA 1OSGA 3AP4A 3JBG3 3AFKA 2ZBJA 2Y38A 3UJOA 4S2HA 2AYHA 5EYYA 3ZYJB 4B4RA 3TOJA 5BY5A 1QNYA 3ZFFB 5K0UC 1QY4A 2DCYA 2GSYA 3AZZA 3ZSLA 1WLDA 1C57A 1O4TA 2BWAA 4PBOA 3I2DA 1ZZ9A 3MW4A 5J09A 1SLCA 4FAGA 4MH0E 2BQPA 3LCPA 4MSVA 2C1FA 5KXDA 5K0UA 2YROA 1Q8QA 5CU1A 1KJLA 4K21A 3CEWA 2YV8A 3V65A 5KXEA 1AXYA 1IS5A 2JG9A 2ZX4A 3ST7A 3JBG1 1Q8PA 4LO4B 4AVCA 4LBKA 4QU2A 3INAA 3SCHA 2WZR3 3B94A 1XQNA 4DS0A 3WHUA 1QQP2 4CP1A 2XL9A 4HETA 1QJZA 4H55A 3ZXGA 4FTEA 4L8QA 3RZZA 4ES9A 1BKZA 1S0FA 4LO5B 4Q0VA 4FSJA 3B5LB 1ZRDA 5FO9B 1R093 2OUHA 2DFCA 2WA3A 1UD1A 3WW3A 4A3XA 5KHGA 5E8AA 4QHBA 1QJU1 1Y3TA 1NXMA 1AR81 1VBD3 4MX3A 1GZ9A 3G7DA 3AMQA 2VG9A 1RVF1 4FP2A 1DHKB 2VW0A 3TN92 2X5IB 4AYUA 1RGSA 5C9AC 3M4FA 2VMHA 4R9AA 1RUI1 1PHMA 4BMEA 3RJ2X 3H50A 2NP0A 1XU1A 2CTVA 4EN7B 2B42B 3U11A 4AQ6A 2HWF1 1WLCA 2QZ2A 3ATGA 4IEYA 4NOTA 4Q4W2 2GC3A 4R9BA 1VBB1 2CWSA 4Y22A 1VAKA 5H9PA 3ZFGA 4NWVA 1MQTA 1SLIA 3LAGA 3SNMA 3FBYA 3VDDC 3MLLA 4O9EA 4XFFA 4YVWB 1ZM1A 3OBRA 1QU0A 3Q9OA 3WCRA 1G9FA 3VBUA 2R32A 4XJZA 3MIEA 2D6KA 2GMMA 4RSUA 4OHZA 1BJQA 4CDQB 1W6QA 3S0MA 4AGGA 5FAXA 4CYDA 2HWC2 2GDFA 3E5UA 1Z7S2 2AENA 2RM21 3MICA 2RM23 3VZJA 5C9AB 4HPKA 3AKPA 1J59A 1FPN3 3FE5A 2MEV2 4E4SA 4F8AA 3AZYA 3CO2A 1C8NA 3WW1A 4CEYC 3KGLA 1RB8G 4ZKTB 2ETEA 2FBEA 2B46X 4P9IA 5JDBA 3LB9A 2AREA 1PGW2 1HW5A 1XYPA 2W08A 4COYA 3VZMA 1CPNA 1WW6A 1RHI2 2MNGA 1EAH3 2ZKNA 3DF0A 3MI8A 2CGOA 1QF3A 2R073 2NYYA 2E7AA 1REEA 5GALA 3AM2A 1S1AA 2NQYA 4OVEA 1RUOA 5FDBA 4YFZA 2PHDA 3OY8B 1LHOA 4AEDB 3MFAA 1RHI3 4DMIA 4DQAA 2R1BA 4YM1A 3WG1A 3A4UA 3LA7A 3WDVA 1NYWA 5JIAA 5DXDA 1HRI1 4YZ4A 3IBMA 1QH7A 3AX4A 1TME3 2FZ1A 3TWIA 3WCSA 3NVCA 4AGRA 4HSJA 4EN8B 1U5ZA 1YFWA 3J9SA 3HT2A 4PJYA 3LOBA 3MW3A 1FI2A 4DPNA 2HKXA 3E97A 3KQRA 1JH5A 2VH9A 2D98A 2W39A 1JYIA 2AH2A 1BMV1 2I45A 3MGUA 2MHFA 4N7IA 3ZDSA 1LULA 4I01A 4XDQA 2FQPA 1EYBA 4B4PA 1J3RA 4GA9A 4PLMA 5T55A 2XBO2 1ULDA 5FPXA 1WD3A 3VKNA 4YGDA 4FPHA 1LHUA 4UW5A 1RUJ2 1CPMA 3VBRB 4QXKA 3GYDA 3RJRA 3PLQA 3HBZA 3FFQA 2D6LX 2A3YA 3ZFEA 4WM8A 1N3PA 5DG1A 4GWNA 2JG8C 4XFBA 1N1TA 3MPBA 3ME2A 1JUHA 2B39A 1OHFA 2HWC3 1IS6A 1UZZA 2XBO3 1BBT1 1CAVA 4C90A 2R063 5F1RA 1IS4A 5I0RA 1RUG2 3N7JA 4D69A 2VW2A 4N43B 3ETQA 4BLJA 3FBMA 1KRIA 1QJU3 1C8M3 4BHPA 3JUUA 1LB2A 2QKDA 1S0JA 2WQ4A 4R4XA 4D94A 4AWDA 4AVSA 1T6GC 5TSWA 1H1IA 1UIKA 3GZAA 1IGOA 2I74A 4P9LA 4CDUB 3TNPB 4Q4W3 4QPGA 1FXZA 2R062 3R05A 2ZHMA 4PIXA 4JTOA 3VZKA 3BTAA 4JGYC 2WZR1 2B8MA 4JTNA 4CDWB 4MXWA 4XXAA 3VKFC 1ND2C 1N1SA 4LBQD 1Q3EA 1ULFA 2K0GA 2YGMA 1RIRA 5T52A 2DCTA 4RA0A 1VBD2 2ZMNA 1G86A 3EJKA 2X29A 5I8TA 4ONUA 5E89A 4XQWA 2IFRA 1FOD3 1F8VA 1PGL2 1MACA 1VBE2 2TEPA 4GMP3 3CJIC 1G9DA 3B7MA 2HWF2 4JC1A 4RGAA 1EY2A 3D0JA 1AR62 3AXDA 5GKAC 3IM0A 1A3KA 1S0CA 4SBVA 2CY6A 1E57A 1A8MA 3N36A 1PO22 4IV1B 3UKVA 1F31A 4L9BA 3WDXA 4TLFA 2DVDA 4NHMA 2WFF2 2WT2A 1XRUA 2EXKA 3PVNA 1COV2 3SH3A 4NHLA 1LOBA 1Y7BA 4GB32 1ZZ8A 2CGPA 4QGLA 3OF1A 3RS6A 3VN4A 2FMYA 1C1FA 4ZU5A 4WVMB 3CNAA 3A0KA 1LGBA 2ILMA 4FPCA 3U10A 5BNNC 1W2UA 3H1YA 3O5SA 1I3HA 4N53B 4CEWC 5C8CA 2GH8A 3B3QE 5HCFA 1WA4A 4GH4C 1NCQC 2GC0A 2WIIB 4BLIA 4LE3A 4HK8A 2AZ5A 1QXPA 4QPIC 1H8TA 1ZRFA 4PCRA 1HV1A 4AHYA 1IS3A 1AYN2 2BNNA 5JOXA 3RMYA 1Q8OA 2ZGUA 1O3SA 3RI8A 2WZR2 3KS7A 1C28A 4OULA 3BIWE 1D4M3 4LUMA 4RS5B 3WW2A 5AC91 1VBA2 4NWWA 2JE7A 2AR6A 3WHTA 1PK6A 4XTPA 2OVUA 4HMZA 1O5UA 3OTFA 3RYPA 2WNUC 1DYKA 1LOFC 1AYM2 1MS0A 4WVZA 3R4UA 5GZFA 5KXBA 2RR11 3TAYA 1HRI3 4XFHA 5FCCA 1WMDA 2IXKA 2CYFA 1RC6A 3BCWA 5FFOC 4BYYA 2PHLA 2JEMA 5LK5A 2A70A 2DUPA 3IDCB 4YSFA 4GKXA 1LR5A 4Q4V1 1V6OA 1S0EA 2HWD1 4KGGA 1W0OA 5BNQA 3VV1A 1K5MC 4GH4A 5DZFA 4AF9A 1O3QA 1W6QB 4AXOA 1OQ1A 4IEVA 1LGNA 4BMBA 3DKWA 4GXLA 2SBAA 2EXHA 3ZYRA 1EP0A 4U36A 4YVSB 1UPIA 2GC1A 4RL7A 4B29A 2YDEA 3AZXA 5LK7B 1ULEA 1RUF3 1H2NA 4WVMA 1RUJ1 5JCTA 4O9GA 3AYCA 2EAKA 2D7FA 5T5PA 5FO8B 3LOIA 3I59A 3E5XA 4KWKA 1H2KA 3AP6A 3TN93 4FOYA 2WSUA 3ACLA 1LKNA 4NO4A 3B02A 1SCSA 2D97A 5L73A 1UL9A 3ECQA 2XPJA 2QNKA 4AI1A 1QQP1 1MZEA 1TMF1 2GNTA 4RHV1 2JDZA 3VHPA 1QJY3 3ZSJA 3L2HA 3WV6A 5L7OA 3WDWA 3K51A 3RNSA 3AZVA 3AP9A 1UW8A 3K48A 4KL1A 1HKDA 5J96B 2OZJA 2WLQA 1BVVA 2ZAHA 2KA3A 2OUJA 1GBGA 1LTEA 4TSVA 3LGRA 1I1EA 4I0WB 4BWOA 4JGYA 3WT3A 3KT1A 5FPZA 4AFAA 1AHSA 3QCWA 2W0XA 1WW5A 5FBZA 4XOGA 1Y9QA 2PQQA 2ZZQA 3DL3A 5FO7B 2VQ0A 1BEV1 3SH4A 2HWD2 3LSDA 4YFWA 1CR7A 3BALA 1LHNA 4M3CE 4CDXC 4H14A 3CJIB 4TWTA 3WOGA 1S0GA 5L36A 3NAPB 4K20A 1W39A 4QPYA 4X8PA 4YW5A 1FMD3 3DN7A 5DUWA 1PVC2 1MS3A 2ERFA 2Z79A 3AYDA 2WNUA 4MVTA 1PGL1 2UY9A 3E6BA 1YO8A 5J37A 1ZZCA 4QPGB 4LO7A 1PNGA 1RUC1 1WUVA 3JQWA 1V6MA 2DUOA 4K40A 5FLHA 1MVEA 4IESA 4PDWC 4NN0A 5LRRA 2BNOA 3WDTA 1AR61 1RUH3 3WINE 4TYSA 3AJYA 2JG8A 4P9YA 3VKMA 1DIWA 1AUYA 3H7YA 1QNWA 3POYA 4OUSA 4AEJA 4KU7A 3GALA 3GZTB 2ZX1A 3VBOC 1CAWB 3HT1A 3I54A 3O0VA 4ASLA 2HWE1 4Y24A 1O3TA 2ZGLA 3EBRA 3AYAA 1SQ4A 3FLPA 2F4PA 3AP7A 1IQAA 3J4UH 3ZXJA 2D44A 1AR82 4ATFA 3WP5A 1GR3A 3MF6A 2VUAA 1O3RA 2DYCA 2ZMLA 5C8CC 4AVTA 3MLKA 3U07A 1XYNA 1HQNA 1U5XA 1ENRA 2LUWA 1CX4A 1R083 4XHXA 4G3YC 1NE4A 2BFUL 1G9CA 4D3WA 1S55A 1F5FA 2UURA 4N90A 4KWLA 2HWD3 5J48A 1MQTC 3FJSA 4YW3A 4KGQA 3O0WA 4GKYA 4IEOA 5EXOA 4ZU4A 3QACA 3B69A 4CEWA 2WSVA 2O0OA 1NE6A 1JXNA 1KITA 1LOGA 2PTMA 4EROA 2GC2A 5IK4A 4FT8A 4WM7C 3RDIA 4WBBA 1YFXA 1TME1 4M3CF 2MPFA 4AW7A 4Q0QA 4AHZA 1PZ8A 5JAXA 2BW8A 4YRDA 2XWJB 4LBQA 4QPIB 4AK3A 1J3PA 3CJIA 4R9CA 5CFDC 2E7TA 4IV3A 3USUB 1A8DA 4UW6A 3ZMOA 4EN9B 1CJPA 2VU9A 5L7OB 1UMZA 2JD4A 2PLV2 2WC2A 4BPZA 3ZYPA 5JZGA 1QOTA 3MIFA 4BA6A 2D5HA 2PAEA 4IETA 2XLGA 3FLRA 1NA1A 4AEDC 2PLV3 1DQ4A 4XJWA 1CONA 3TNQA 4RS5A 4IQPA 5GLTA 4FOQA 1QHDA 2WNVB 5ACA2 1PGW1 3OYWA 3TYJA 1VJ2A 1C4RA 3LKJA 3ES4A 4QMAA 2XHKA 5KHJA 4IEUA 1NY72 1U5IA 3MW2A 5GM0A 4FPYA 4LBJA 2RS51 1IOAA 2PHWA 4KWJA 3EHKA 5JLVA 3AZWA 4YG6A 4CEYB 1AL21 2E51A 1VRH3 1ND3C 2JG9C 1N3QA 2ET7A 2XLAA 4AVAA 1BBT2 4IEWA 4Q4Y3 1N3OA 5FREA 3H1WA 1GZWA 4JDNA 1NLSA 1C8M1 3O14A 1S2BA 3VDDA 5E16A 1GV9A 1WMEA 4XF3A 1UN1A 3WXPA 1WCDJ 3IPVA 2WS93 3FC0A 5ABJA 2GN3A 3P3PA 4DNYA 4Z1VA 2VPVA 4HT1T 3USSA 1IKQA 2R061 4Y5Z0 1APNA 3ZN6A 1WW7A 4CDWC 2ZCWA 2XL7A 1PK6B 5T5OA 1AR83 4UXAA 2LM3A 4RR3B 1PVXA 3RI9A 4RS5C 3LA2A 4I0AA 1HRV1 1OQEA 1CAUA 3ZSKA 5K8SA 3M3OA 4EJRA 3LSEA 5BYNA 5FLIA 4AQSA 1D4M2 1ASJ3 2BUKA 2R072 4NVPA 5EFUA 2I2SA 5H9QA 3ZFEC 1MEC1 2PAKA 4A7KA 5DDJ1 4ATEA 3WVJA 3JD71 5GLWA 3WUCA 4GH4B 4PF5A 5IUQA 4PQ9A 1R1ZA 3ZFEB 1VBE1 2XJPA 4E2GA 1B35A 3VKOA 2XVLA 5LRSA 3NV4A 4JAAA 3VBSB 4Q0SA 4ZU7A 1LHVA 5GLVA 1ND2B 1V6NA 2ZGTA 3FFZA 5ACA1 2K2SA 1AX0A 1CAVB 2DVGA 4FAHA 1VBB3 3U0ZA 2GN7A 4D7TA 2ZOEB 4ITCA 1CAXB 2P37A 1DQ1A 4WVWA 1J58A 1OA2A 1MS1A 5I8SA 2ET1A 4GB31 1GKBA 2UU8A 1PO23 1AR73 5IK5A 5JSPA 1PNFA 1NA1B 3M2MA 1WBFA 1OOPC 4F83A 4Y20B 1OKQA 2VW1A 1YI9A 1RUE2 1QOSA 1VBC2 2JG9B 3M3IA 3ILNA 3ROUA 2A71A 4Y1UA 1EV12 1OOPA 3PJQA 1R091 1LGCA 3R6SA 4JRLA 1EAH1 4CDWA 1MS9A 2BTVC 5GZEA 1VBD1 3DV8A 1ZZBA 3NV2A 1XNKA 4LO8A 4Q4Y2 4M0NA 4MGIE 3B9CA 4QQ2A 1JTZX 3LZZA 3V0BA 3S7IA 1HXS2 4JGYB 3UV9A 4META 2WNVC 2WT1A 1BVP1 1MZ6A 5LEJA 4HKOA 5JI9A 3NAPA 4CEYA 3AKTA 2PAMA 3WQ7A 3M3EA 1OA4A 4HLTA 4HVRA 1D4M1 1Q8SA 4YG0A 1RMU3 5D8AC 1Q43A 1EPWA 4URTA 4X6QB 2EVXA 1DZRA 2ZX0A 3I8TA 4FPFA 1AXZA 3QOPA 5GJ6A 1HLCA 4HZFA 1RUC2 2WFF1 2WFF3 4IV1A 2PA7A 1SBDA 3ASIA 3O12A 1ZZ6A 4MLOA 1MQTB 5BNPA 4XBNA 5I0UA 4UW3A 1HDKA 1MR5A 5F6LB 3PVBB 1IPKA 1XYOA 3RWNA 2R042 2TBVA 2VULA 2D3SA 2F6BA 4XE9A 1DZTA 5A33A 2P3IA 4AQ2A 3S6PA 4LE4A 4XF4A 3KLSA 4XJAA 3C2UA 4C1WA 3TRSB 1UKRA 2A3XA 1YXWA 4HKLA 3R0RA 4GIQA 5CVRA 3NV3A 4LA3A 2WS92 1AX2A 4OLLA 4I3PA 3AMMA 4HSLA 3MPPG 2DTYA 3WP4A 1G8WA 3JZVA 3I7DA 3ZXKA 4LBLA 2D3PA 4QQLA 2XG3A 2OA2A 3S7EA 1B35B 2D93A 4JV4A 3VGIA 5KHHA