3IDBB

Crystal structure of (108-268)riib:c holoenzyme of camp-dependent protein kinase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
157
structure length
149
Chain Sequence
TRRASVCAEAYNPDEIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Novel isoform-specific interfaces revealed by PKA RIIbeta holoenzyme structures.
pubmed doi rcsb
source organism Mus musculus
total genus 37
structure length 149
sequence length 157
ec nomenclature
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3idbB01
2UYBA 3H1MA 3WW1A 4DINB 4LLOA 1DGRA 4IEYA 1VP6A 5FLIA 4QGMA 4XF4A 4QM9A 2D40A 4R52A 4WZCA 4OFGA 3I59B 2BNNA 2QCSB 1ZZBA 4FAHA 1J3QA 4IEUA 5J7MA 2WC2A 3RYRA 1VJ2A 2PAMA 1DGWA 3U11A 3H7YA 3HQXA 3RYKA 5LRRA 4J1XA 3I54A 2PHLA 1CAXB 5D1IA 1O5LA 4YYOA 1OFNA 2P17A 5I0RA 3M70A 2BGCA 5CU1A 3NW4A 3OF1A 1Y9QA 1ZZ9A 4LUKA 5I0UA 4ONUA 1I5ZA 1NE6A 4UXAA 1FXZA 2XL7A 1EP0A 1CAUA 4XFBA 3E5XA 1XRUA 4RD7A 4HZFA 4OLLA 1WLTA 3CLPA 2K0GA 2GC0A 4KWJA 1NYWA 3HT1A 1YFXA 3M3IA 3OD0A 2MHFA 1FI2A 1GQGA 1IPKA 2Z69A 1YHFA 3H8UA 3TNPB 3ETQA 1DZTA 1DZRA 3FHIB 1O4TA 2BNOA 4HBNA 4META 2ZKLA 4BIFA 5BY5A 4D7TA 4XF0A 4LA3A 2N7GA 4QGNA 1J3PA 2IXHA 1Q5OA 1TQ5A 3SCGA 2OPKA 3U10A 4XFGA 3H1WA 5FCCA 3PVBB 4XF1A 4IETA 4XFHA 4IEXA 5BV6A 5KHKA 4I01A 3E6CC 3EHKA 3MZHA 5FPZA 3PNAA 2OZ6A 3IDCB 3E5QA 2Y0OA 2GC1A 4Q0PA 3B02A 1YFUA 4HSLA 4YNIA 4MGYE 4HN1A 4YRDA 3FE5A 2Q4SA 3E97A 3D0SA 4I3PA 4ZU7A 2GC3A 4KU7A 2Q1ZB 3LOIA 4MGZE 1L3JA 1O3QA 2XLAA 2VECA 3NSTA 3DN7A 5I0SA 2VPVA 3WW2A 4LULA 3KSCA 3SHRA 4AQ6A 3S0MA 3U0ZA 3FFQA 2IC1A 3DL3A 2PQQA 2H0VA 1H1IA 2BYVE 5KHIA 4IEVA 3IWZA 3H1YA 2V09A 4FBFA 5JR7B 2XLGA 2Z2SB 4WBBA 4HVRA 1LKNA 3H9AA 4LEJA 5BXXA 4X6QB 4HN0A 3OCPA 3UKNA 3HIFA 3LA7A 3ACLA 3I59A 2HKXA 1UIKA 4Q29A 4PIYA 5I0TA 2KXLA 1YWKA 1VR3A 3IDBB 5FQ0B 3RZZA 2DCTA 3ST7A 4J1WA 4A2UA 2ETEA 4H7LA 5LEJA 1QXRA 2C0ZA 1LR5A 3SXWA 3EO6A 2XKOA 4HLTA 1EYBA 4KL1A 5FQ0A 1OD5A 4MV2A 1CAXA 3WW4A 2O8QA 3SMHA 4KU8A 1ZZ6A 3NL1A 4CYDA 3C3VA 1RL3A 4XFAA 1YFWA 5I93A 3IBMA 4N9HA 2MPFA 4QGLA 4LA2A 2PAEA 1O3SA 2EAAA 3NJZA 2MNGA 2XL9A 3FJSA 4HVOA 2IXCA 3IIAA 4AVAA 3H3UA 4Q0SA 3KGLA 4MUVA 3SCFA 4MX3A 5J3UA 3BALA 1SFNA 1UPIA 4E2GA 2D5FA 1Q3EA 3E6DA 1G6NA 5FLHA 1O3TA 2CV6A 3KMHA 4I02A 3G7DA 3LAGA 4NVPA 5JSPA 4O9EA 5E1RA 1X82A 4EWEA 4YSFA 2WFPA 3LA2A 3GBFA 2Q30A 3E5UA 2B5HA 1JUHA 1X8MA 1UW8A 5J48A 5AVPA 4Q0QA 5BUVA 3ES4A 2UYAA 4L2NA 2BNMA 5JCTA 3GYDA 4Z07A 4QM8A 2PYTA 3EJKA 1PM7A 4I2OA 3LZZA 2EA7A 2UY9A 4LUMA 4AVCA 4JVAA 1J1LA 4XF9A 5KHGA 4EWAA 1ZRRA 1UD1A 4PIZA 4ZU4A 4O9GA 1NE4A 3RPQA 1XE7A 3FWEA 4X6RB 3RDIA 3D0JA 4KWLA 4JTNA 4PJYA 3NKTA 4JV4A 3SCHA 1J3RA 1Q43A 3MDPA 4B29A 4EROA 2CAVA 3PLQA 5HI0A 1CAVB 3HT2A 1CGPA 1RUOA 5CVRA 3CEWA 3LWCA 2EVXA 2D5HA 3UKVA 5KBFA 3DV8A 4QXKA 1WGPA 3BB6A 4F7ZA 3USSA 1ZZ8A 3TNQA 4AXOA 3ZDSA 3O14A 1ZRFA 1RUNA 3D82A 5I91A 2O1QA 1CX4A 4I0AA 3LA3A 4MZUA 1QWRA 4HMZA 4XFIA 2PAKA 1V70A 1QY4A 3CO2A 5EFUA 5I8YA 1GQHA 3JZVA 4EV0A 4XFFA 1O7FA 3R6SA 4ORFA 5I8TA 5KHJA 1YLLA 4N9IA 1EPZA 4BYYA 1O3RA 2PTMA 4Z82A 3KCCA 2I45A 4MGIE 2GC2A 3NVCA 3UKTA 4KWKA 4E2QA 2IXJA 4R8HA 2QNKA 3ES1A 5CADA 3FZ3A 5FLJA 1ZX5A 2QJVA 4XETA 2XGXA 3VHRA 4AQ2A 1UCXA 2GZWA 2PA7A 5I8SA 1I6XA 4K8FA 4HSJA 3E6BA 2OA2A 1YFYA 1ZZCA 2D93A 1X7NA 5K8SA 4P9GA 1NXMA 2FQPA 2XLFA 4Q0VA 4GULA 5FDBA 4QX5A 3I7DA 1OMIA 1IPJA 5C8WA 1SQ4A 4JTOA 2PHDA 3OTFA 1CAUB 4FAGA 3BU7A 5BPXA 1RGSA 3BPZA 3BCWA 4I09A 5KHHA 1OI6A 1ZVFA 2H6CA 4MH0E 3S7EA 3ROUA 5LEKA 3CJXA 2B9UA 3KGZA 4YARA 3DKWA 3H3ZA 5T3NA 1LRHA 4FT8A 4UBHA 2ZCWA 1ZRCA 2BEOA 2CAUA 4IEOA 4UBGA 4IEZA 2UY8A 1U12A 3QACA 1ZREA 4ZU5A 4LTAA 1QXJA 2F4PA 2OZJA 4IEPA 4IEWA 2IXLA 2GH2A 1XE8A 4WVZA 1ZZ7A 2B8MA 4BHPA 4D7SA 3WW3A 3OGJA 1X8EA 1Y3TA 1RTVA 4PIXA 2XHKA 1RC6A 4EWDA 3ELNA 3MPBA 4Q0UA 5F1RA 4I0BA 3H50A 3N4MA 1HW5A 2GAUA 2E9QA 3RYPA 3EBRA 4QMAA 3L2HA 2FMYA 3S7IA 5JSOA 4AVBA 1ZRDA 1J58A 1WA4A 2GU9A 4BH9A 2H6BA 4HVQA 2QVSB 2ET7A 1H1MA 5FPXA 2IXIA 2K9ZA 3RNSA 4IERA 1ZNPA 3QOPA 1UIJA 2ET1A 2Q0AA 1CAWB 3CL1A 1NZCA 2IXKA 4XF3A 4XFCA 4L11A 2PFWA 1CAVA 3CF6E 3H7JA 4IEQA 2CGPA 1O5UA 5JSRA 3FX3A 1YUDA 1LB2A 1CAWA 4MGKE 2QDRA 4XEZA 1EY2A 1SEFA 2ATFA 2XKPA 2OYZA 5EZWA 3MYXA 1PMIA 4E2SA 4F8AA 1FT9A 5LRSA 4TLFA 5C6CA 5JAXA 2VQAA 5E16A 1J59A 4IESA 3EQEA 2HJIA
chains in the Genus database with same CATH superfamily
4GMP0 3WW1A 2VZVA 4CUAA 1YIFA 1RUD3 1DGRA 4GKYA 4IEYA 4K7JA 1PMJX 1VP6A 3M4FA 4WM7B 3BI3A 4XF4A 4EZ4A 1GANA 4R52A 2R041 4AHWA 2QCSB 1EAH2 3VD7A 3CJIB 5HCAA 4FAHA 4PT6A 3L9JT 2JG9C 3JQWA 2ZEXA 2VGDA 2ZOEB 3I97A 4L97A 4TWTA 1Q8SA 1W9FA 3U11A 3BVCA 4CDWC 3IDEA 2WQZC 1NXD1 1PZ7A 1AXYA 1NKGA 3WUDA 4CEWA 1COV2 1R092 5LRRA 5HV4A 1VBC1 1YQ2A 2GMMA 1AR71 3I54A 4GJYA 1DF0A 4Y22B 4Y33A 3U1XA 4CDQA 1IS5A 1UYXA 4A45A 2JEMA 4YYOA 2WN3A 4OCTA 5JI7A 4Y1UA 2F6BA 2IVJA 2Q8CA 2RS51 3VHNA 3U4XA 2WWSA 3GBWA 2VTXJ 4FPHA 4AAXA 3ZFGA 3ZXKA 1GKBA 4CCMA 5JXIA 2WA4A 4R4ZA 4MGQA 3WP4A 2RE9A 4LUKA 5LBCA 5IT6A 5DZEA 1QJU1 4NWVA 2BUKA 2VC9A 4X8NA 5BNOB 5T5LA 1RUG1 2A6VA 2JICA 1DYKA 4AFBA 1NE6A 3ZOIA 1RHI3 3MIFA 2Q5TA 4OQ8A 4RR3C 1HJGA 1Z7S1 3E5XA 4XFBA 4CCDA 1QXPA 4AHXA 1FPN3 1XBFA 5ACA3 3ZN6B 3M8LA 1H0BA 1W6QB 4GQ7A 1V9U1 1YFXA 4DNYA 3M3IA 3POBA 2AEYA 4BMBA 3OD0A 2MHFA 2OQ7A 4NWWA 2W9XA 5BNPB 3OGGA 3VHPA 4QKNA 1D2SA 3INAA 1LTEA 1IPKA 2A7AA 2LROA 1VBD2 2Z69A 3AYEA 3H8UA 3OG2A 1JYIA 4Y5Z0 2VVFA 4AGRA 4FXGB 3ETQA 4IE0A 5FO9B 5KXCA 2K2SA 2BBVA 3EYPA 3WXPA 1LEMA 3FHIB 1D4VB 4P9IA 4HBNA 4RGAA 5LA0A 4AYUA 3O1RA 3PUQA 4BXSV 2WT0A 3W58A 5FR3A 3AP6A 1UY1A 1JTZX 1M4WA 4RN5A 5IFTA 5J37A 4Q1RA 3P5BA 2HBUA 2G19A 4QGNA 5FO8B 3VBOA 4FPCA 5A80A 3VBSC 4IV3B 2JIJA 1VBA3 3VKMA 4DZGA 2HWD3 5F5IA 1W0OA 2PHUA 2OIIA 3BPSA 4PCRA 2ZGSA 2OXBA 4LHNA 2VG9A 4RHV2 2D6OX 3PVBB 1E57A 4WM8C 5CYYA 1PGL2 4MGTA 2LTNA 1S4CA 2I2SA 5BV6A 5KHKA 4I01A 4N53C 3EHKA 2FDGA 1F5JA 5FPZA 5CA6A 4BCUA 1DQ5A 4CU9A 3HAGA 4CUCA 1MVQA 3O0XA 5LA9A 4C8DA 1W2AX 4EN7B 3BTYA 3IDCB 5ANQA 3E5QA 5EXOA 5A33B 2J1AA 4Y1ZA 1RXGA 2GC1A 1MZ6A 1JHNA 1ND2A 3B02A 5FXVA 2IFWA 1PNGA 2WS92 3ACGA 3M3QA 3QH7A 4MGYE 3GJAA 2FCTA 5F37A 1MQTA 1XNDA 1V6LA 4AGVA 1XU1A 1CQ9A 1PX4A 2VU9A 1NLSA 1JOPA 4NRMA 2EIEA 3H0OA 3LOIA 1O3QA 5C3RA 2XLAA 1O8SA 3NSTA 4CCLA 5D21A 3FHQA 1UY4A 1LGNA 1RUJ1 1K5MB 1ENSA 3KF3A 5T50A 1GMMA 1KS5A 1HXS2 2R072 4Q4X1 3S0MA 5APAA 2WLPA 2IC1A 1AYN3 5GLUA 4CDXA 2ZZJA 3WY6A 4PDWB 5FY4A 5KHIA 3MFAA 4KBZA 4WVVA 4QDSA 1ODMA 3O1SA 3ZYPA 2F17A 2B42B 1AR92 1UZWA 4Y5SA 2XVLA 2V09A 5DZGA 4DRVA 4K9SA 1COV3 4FBFA 3PMEA 4LK7A 4CCNA 5A1AA 2Z2SB 4QX7A 4BQ3A 1W2TA 4HVRA 3PUHA 4QHBA 3JD71 5DDJ1 2P37A 4D3WA 1VRBA 3KF5A 2KR2A 5BXXA 2RR12 3UKNA 1BXHA 1OLQA 3LA7A 5FTTC 3WDTA 4AVTA 1NQJA 4CCJA 4BJ0A 2HKXA 4CE8A 4Y24A 3AYCA 3FLRA 4NMIA 2ZJCA 5I0TA 1VR3A 1MS0A 3WDVA 3ZYHA 3FUOA 1VAMA 2VUJA 3AP7A 4FTBA 4HT1T 3O1PA 5FMOS 1AX2A 5T52A 4Q4W2 5H9RA 1GWKA 2DBIA 1HN1A 2A71A 1CJPA 5FY9A 5FYBA 5JXJA 2V5YA 1EYBA 4Y22A 5FQ0A 3PTRB 1W6MA 3KV4A 4MV2A 3WW4A 4CU7A 1MS5A 3SMHA 5FBZA 2J1RA 2VOTA 3HN1A 3K4DA 3NL1A 1MEC2 1S0CA 3AFKA 1SLIA 4NE9A 2QFEA 1MACA 2QQLA 4N9HA 1PO21 4ATEA 5F2WA 3UETA 1O3SA 1W04A 3NJZA 1LECA 3FJSA 1DQ0A 2WO3A 4XDQA 2OQ6A 2WWJA 5BNOA 3BALA 4M3CA 4BISA 4DPNA 4NIGA 2VZ3A 2WT1A 1US3A 3JU9A 3NWKA 5IVYA 3K46A 4CDUA 3AKSA 5FAXA 3WUCA 5BNNC 2NMNA 3DUIA 2D5FA 4IV1B 1DLLA 3NO8A 2GP5A 2XBO1 3O1TA 2VO5A 4BZ4A 2R0HA 1W6QA 2QQKA 1GYKA 3LAGA 4AEMA 5A6ZA 2BBAA 4R9DA 2RS32 4O9EA 5JDBA 3LF7A 2ZXQA 3PU3A 3WLUA 1DU3D 3B5LB 3GBFA 2Q30A 2BU9A 4KGQA 3KV9A 2ES3A 2WFF1 3POFA 4RHV3 4PI2A 1LAJA 2WSVA 1T6GC 4YW1A 3OOXA 5CISA 5KXDA 4QXCA 4JX0A 4GB32 1RMU2 1W8OA 3ZXAC 3GYDA 3VZJA 3LOBA 1WWYA 1ASJ1 2W1QA 2D6LX 1CPNA 3POJA 1WKYA 4OI0A 1HRI1 3GF6A 2WS93 5HCFA 4I2OA 3LZZA 1TZOA 5FWEA 1JW6A 2UY9A 2YC0A 1GZWB 2P6HA 5T54A 4AVCA 3FBMA 4CPBA 5KHGA 5CG8A 3VZKA 4EWAA 1VBE2 3POEA 4RS5B 1SBDA 2O0OA 1IQAA 1UMIA 1CX1A 4ZU4A 1KFXL 4O9GA 3ZKYA 3Q8CA 2DVBA 1PO12 1G9BA 3LSDA 2A6ZA 2NPIA 2DFCA 2ZAHA 1HXS3 1Y43B 3SCHA 1OVSA 4NIAA 5LBEA 1DHKB 1LOFA 1L7RA 5FP8A 3VDAA 1HQWA 3ITQA 2ZEWA 3PLQA 4QPGC 3HBKA 1VMJA 4FPOB 3VUOA 2ZMKA 3CEWA 5CVRA 5FUNA 2BTVC 5LB6A 1V6MA 2VOKA 2TNFA 1JYVA 4BM8A 2BGPA 3VZNA 1AR93 5AVAA 5A70A 4F7ZA 1RVF2 3N7JA 1WMFA 3MW3A 4R9AA 3TNQA 4QB2A 4LBMA 3RMXA 5F7UA 5GLZA 4LBLA 1X33A 2DCKA 3WDUA 1VBB3 1FV3A 4GMP3 4D94A 1DQ2A 1F31A 2RMU2 1L7QA 2O1QA 5FZ0A 4C90A 2VZSA 4PBOA 3FLTA 2J42A 2YU2A 1FOD1 1BBT1 3PU8A 2PAKA 2UWAA 4GWJA 5A7SA 3SLIA 5FZ8A 5LW9A 3TOJA 3VBFC 2XJQA 3UT0A 2B39A 3WCSA 4XFFA 3FBYA 4O7XA 3P1IA 5CEHA 1O7FA 1JN2P 5JIUA 1UNBA 1B35C 4Q4W3 4KMQA 4PLMA 1KITA 5EYXA 4N9IA 2DVAA 1QH7A 2Z4FA 3W9AA 5CBLA 5A3MA 1REDA 1YQ5A 3UGHA 5L7OA 1C8NA 2FD8A 3T08A 3VBHA 1X9TA 5CIRA 1MS9A 4Q4V2 5FZ9A 4ZZ8A 1MEC3 1S55A 4CPBD 1BMV2 5FMBA 2IZWA 4OMDA 3A0NA 1DGWX 3D8CA 3OBZA 3J26N 1UKGA 3RQ0A 1ULCA 5CFDC 1G86A 3FZ3A 3LDBA 2NN8A 3WHUA 4RFT0 3WNPA 1C3HA 2WQ8A 1C5IA 4CU6A 1K12A 1XNBA 2P6CA 1VE0A 3AB0A 1SLCA 4XETA 1GWMA 2HWE1 3ZPYA 3RZGA 4PQQA 3K75B 1NA1A 4B8EA 1GP5A 2AYHA 1QNYA 2XUMA 1DZQA 2DCZA 3AZZA 4XVHA 3TRSB 4AQ2A 2GZWA 2PA7A 5I8SA 4DS0A 1JMUB 3DYPA 3E6BA 4A3ZA 4D6QA 4UWDA 2QTWB 1W8FA 4S2FA 4UYBA 2QKDA 4XBQA 2NP0A 2XXZA 3GGLA 3WT3A 5IK5A 4G9SB 2GMPA 2TUNA 2RS11 1WBLA 3ABZA 3TN92 1OMIA 4LPLA 2AACA 4R4XA 5C8CC 3WF2A 5C5UA 1R1ZA 5CFCB 5JXHA 4AL9A 2RS33 1UMHA 3KCYA 5DZFA 3GHNA 2DTWA 4HKWA 1CAUB 4D8MA 1OPMA 2R061 5BPXA 3RWNA 4N43B 4QB1A 3RGBA 3ZYBA 3WR0A 2GNBA 2WZR2 3I2IA 3NNJA 5KHHA 1OI6A 2IUWA 2W91A 3C7FA 2X05A 4QX3A 5FPLA 2NYYA 1AR82 1GNYA 1ND3C 4ISRA 3WF3A 3WNOA 2AUYA 4YARA 2R042 2RJLA 3AX4A 3Q8EA 4QPWA 1JYWA 4BIOA 4JZRA 3A21A 1JYCA 3UGFA 2ZCWA 2DURA 5FYUA 4GB33 1RMU3 1IS4A 2QQJA 2VVEA 3K2OA 3MO4A 5J09A 4XUNA 3USUB 5KXBA 3HWJA 1T2XA 4HKOA 1MPXA 5C7GA 5C9AC 4ZPIA 2GNDA 3PVNA 5SV5A 4E9KA 3RFRA 1CZSA 4ZU5A 4YGBA 2F4PA 2OZJA 3KWVA 5FFOC 4V1PA 4IEPA 1QF3A 4EQVA 2MEV1 2VW2A 4N53B 1VBC2 1AR72 4BHPA 2XG3A 1VBE3 2ZGTA 4NHYA 5JXGA 2W2IA 2VBDA 4QWNA 1OA4A 1TNFA 5C4WC 1PO13 4CP9B 4OHXA 2NLRA 2XHKA 5FZ1A 3ZXLA 4A7KA 4LITA 1OOPB 5F1RA 5IATA 1XNAA 1WW4A 1AF9A 1XSQA 2RS52 3PIGA 4AEDC 4TYSA 3MUZ1 3B01A 2E9QA 3WF0A 4JRLA 1RUE1 2Z79A 1QJU2 1G9FA 5EJ3A 1Y9GA 2FZ1A 3APBA 3L2HA 2Y6GA 4BQXA 4YW6A 2W0XA 3FHAA 5JSOA 1BK1A 2XJVA 3LIHA 5JZGC 4JHZA 2V73A 4CXWA 2Y6HA 1QDCA 2H6BA 4ITCA 4V2WA 4BH9A 4XUOA 1RVF3 2QVSB 4FFIA 1H1MA 1Z7S2 4RS5A 3J7HA 3D6EA 1YI7A 1NY71 4COYA 2IWGB 4IERA 2CL2A 4LIVA 3WVJA 1FYUA 1KEXA 2WL1A 2JECA 3TEWA 5FYIA 3GZEA 2DCYA 5FUIA 2ADDA 2DV9A 1XJAA 1WMXA 5FZCA 4N8MA 4L11A 2B7YA 2OT7A 2XPJA 4IEQA 5C3SA 1C8M1 3ACIA 3PIJA 5JSRA 5FUPA 2WAAA 4OHZA 3C7HA 1TG7A 2JG8C 4H3WA 1PVC1 2WNVC 1Q8QA 3MLLA 4JDNA 2XKPA 4IGQA 1ZYBA 5EHDA 3PJQA 3MYXA 1M06G 4GA9A 4UFIA 1MS8A 4ET7A 3ZIWA 5FZBA 1QNWA 4E2SA 4ZZ5A 2JG9A 3M3OA 3RZMA 3SEPA 1LOGA 2QQOA 1NLQA 2A5ZA 3AMQA 3R4UA 4Q4V3 1PZ8A 5FV3A 3ZSMA 1L7LA 4XAAA 4I0WB 2G9GA 3F2ZA 5DUXA 3HQRA 4CDWA 4FPEA 5FPUA 1RIRA 4AAPA 1BHGA 4YFWA 5E8AA 2Q8DA 1F15A 1YRZA 4SBVA 4QM9A 1PGW1 1DDLA 3I2JA 4AQSA 2ZHMA 1UWWA 2XHNA 4BQ2A 5AC92 1SACA 2FDJA 1OUSA 3UYJA 1QOSA 2BRTA 2XWJB 2WINB 1ZZBA 4E4HA 4LQRA 4E8CA 3LB9A 4QDRA 1AXZA 1HN0A 2FMDA 1S0BA 2Y34A 4IEUA 5F2SA 1F2NA 2CSGA 1CR7A 1D0HA 2QQMA 3R4SA 3U75A 2YZ4A 2PHRA 3RYRA 2HEVF 4WVWA 5F5AA 1DGWA 2J1TA 4TN7A 1V6KA 2WUHA 4AEJA 4DXRA 2ZGOA 4MHUA 1IGOA 4KNCA 4DUVA 1LOBA 1HV0A 1S0FA 2PHLA 2JWPA 1CAXB 4AOCA 5A3LA 5D1IA 5IJRA 5DPNA 1O5LA 1ZBA1 2P17A 1KDMA 2DCJA 4RQPC 5C5TA 3VDDC 5JMCA 1H2LA 2BGCA 2R043 1CIWA 4E4DX 2RDNA 1HB3A 2GH8A 4L0PA 3ZR6A 4BB3A 2R1BA 2V4AA 3E1F1 4NUBA 1Y9QA 1LOAA 1W8HA 3OUIA 2D6NA 4YFZA 4HPKB 5I0UA 2VNVA 1HV1A 2YPDA 3N7MA 5FZOA 4ONUA 4J6GA 4LE4A 4NIHA 3PMSA 2JD4A 3IDAA 1BQPA 4CCEA 4GD4A 3UNPA 1EUTA 4AI1A 1CAUA 3KB5A 3W5MA 1QJZA 1VBC3 1AR73 1XRUA 2DUOA 1QQP1 4YZ5A 3HNYM 5F5CA 4YW4A 1WLTA 3ILFA 3LFIA 4PLNA 2GC0A 4KWJA 1OA3A 2WZ8A 1FMD1 3AYAA 1H2MA 1RHI2 2RS53 4D7YA 4JGYC 4P02B 4UFHA 3ZYGA 1FI2A 4YWAA 5L9VA 3USUA 1YHFA 3VKOA 1LESA 4EN6B 4LNVA 4TZDA 3T3YA 4B1MA 2JIGA 1RUG3 1UQXA 1TMF3 1WLDA 1WD4A 2BOIA 1DZTA 4WM8A 5CB7A 2AREA 1OHFA 4WV8A 1W2OA 1UX6A 3NNGA 4META 4N53A 5BY5A 1JZ2A 1Z7S3 3KM5A 2DVGA 1ULEA 4XF0A 1H6XA 1WCQA 4OMCA 3AXDA 3M2MA 4XJZA 5E6HA 5FY5A 4H2AA 4C0HA 3HQUA 5FP9A 4EN8B 1V9U3 2YBKA 4K20A 1CJDA 5FPAA 2Q8OA 2OPKA 3K4ZA 4QHOA 3JQXA 3U10A 2E32A 5FK8A 1NQDA 1RUC1 2JKXA 2PXJA 3IZOA 5FOJB 4A3XA 4CCCA 5KWRA 5B4NA 3SNMA 2FHRA 2YUEA 1O4ZA 4ARYA 1SFYA 2RDQA 2V72A 1OT5A 3VKNA 3ILNA 1KDKA 1VBA2 2VMCA 2XBO2 3GCWA 3KQ4B 4OZOA 4UFKA 1NCRC 2HWD2 3RI9A 2BZDA 5ANNA 4HN1A 1UY2A 1DFQA 2Y33A 4LXLA 2Q4SA 3POYA 4INDA 3E97A 1H8TC 4CUBA 2BOJA 4I3PA 4XZUG 1TNRA 2GC3A 4OULA 4KU7A 5L9RA 2TEPA 1L3JA 4CDXB 3MW4A 1X36A 1ST8A 2QBXA 3TEXA 4FPGA 5FMOL 1ZA4A 5FYZA 5I0SA 3WW2A 4AI8A 5DAVA 3LCPA 2ARCA 1H2NA 2VNRA 4MYEA 4UW6A 4FTEA 1OH4A 5CFDB 3FFQA 3JBG1 1RJ7A 1TME1 2PQQA 2WAOA 4WVMA 3LDRA 5F3EA 2BYVE 1BEV1 2WDBA 4IEVA 2DUQA 4XBNA 3WDYA 2R16A 1UN1A 1H30A 3ZM8A 1IZ3A 2VZTA 4NROA 3EXUA 1SHWB 4P00B 1KQRA 5DUUA 4DXTA 3S5AA 4BWOA 1XYOA 3AL5A 2XLGA 4WBBA 1AYN2 3U14A 3BOPA 3OB8A 1I9RA 3OPTA 1ULDA 1VPHA 3NJXA 4N90A 1WLWA 3LD8A 1RUJ3 5C8CB 3OCPA 2W47A 4XHBA 3ZVXA 2VZRA 4Q4X3 4DIQA 4XQWA 4Q29A 4HONA 4PIYA 1W06A 2KXLA 4K1YA 3IDBB 5JLVA 5FREA 2YBSA 1Z0HA 2YC2A 1NLRA 1CN1A 2WJSA 5FQ0B 3ORJA 4XC9A 1W6MB 1XOYA 3N36A 4AR2A 1POQA 3RI8A 2ZPXA 5FKBA 4S2GA 4A2UA 4H7LA 2XJPA 2C0ZA 2XKOA 4AFDA 1SLTA 4KL1A 3OEBA 5BNNA 2JDNA 3LGRA 4K21A 4OUEA 1CAXA 4QQLA 5K0UC 1MZ5A 3JD73 1VRH1 4U36A 5DDJ3 5JUVA 5FXWA 3J9SA 2W68A 1RL3A 3AKQA 1S0DA 1T6BX 3HJRA 4M3CB 4BA6A 4A4AA 1TMF1 3MF6A 4CDUB 1FOD2 3A0KA 3ZMNA 5HXMA 1IKQA 5GZGA 3T2OA 4A44A 4CZSA 4FP3A 4YG3A 2YG0A 4PI0A 4AVAA 2IXCA 3BODA 4K3UA 4HPKA 3KGLA 4Q0SA 2H0BA 3SCFA 3T2QA 3KS7A 1SFNA 1OQDA 4L9BA 2GALA 1UZYA 4W50A 1JU4A 2WT2A 4MGSA 3RZLA 2Z42A 1H4GA 5FMDA 4I30A 2VNGA 3K4AA 5G04L 1GV9A 4OHWA 1SPPB 3E6DA 4AEDB 5FLHA 4ZS2A 4O65A 3T2TA 3IAPA 4GAZA 2Q1FA 1GICA 2WRAA 4Q2FA 3T0DA 2DU1A 4NVPA 3ZPOA 3N9OA 1PO23 5E1RA 2RDRA 1X82A 3VZOA 1TVGA 4K6BA 4YPJA 5F32A 2WFPA 1UY0A 3GJBA 3U78A 3OYWB 2ZMNA 4LOTA 4Q1PA 1JUHA 1X8MA 1UW8A 4FOWA 4IUGA 3WQ7A 5FZEA 2VQTA 4FP2A 3LE0A 4BQYA 3FFZA 3OJBA 5A7OA 5BUVA 2DVDA 3F95A 4OI1A 3UV9A 2VM9A 2XBO3 3IAQA 5DXDA 3AKRA 4QPGA 5D8AC 3DECA 5FZDA 3P3PA 3V65A 4QM8A 3VBUC 5LZ6A 3J8F1 4ASMB 1PM7A 4FFFA 2E31A 2RG4A 5GZCA 3ECQA 3AVSA 2VAUA 1FNYA 2ZABA 3ZIXA 4XUTA 2V4VA 1J1LA 4D6RA 1DQ6A 2W1WA 2E33A 2PHWA 1W6PB 2JB4A 1HX6A 3RPQA 3ZYJB 2WFF3 4LR4A 1GOHA 1W99A 3NNFA 3FWEA 3RDIA 2HEYF 3VD5A 4PJYA 2RJ2A 3NKTA 1SG3A 3K51A 1J3RA 1JZ7A 1Q43A 4LIUA 2HBTA 3VHOA 4Q5OA 4B29A 5JR2A 1SDWA 2CAVA 5HI0A 3R0RA 1MZEA 4FPFA 1CAVB 4JRAA 5JPNB 3THPA 1ASJ3 1RUOA 1DCSA 2XJRA 3LWCA 2B45X 3VBFA 4DXSA 1HRI3 1RITA 4Y4YA 3SITA 1QKQA 3T09A 4NHMA 1O8PA 1N1VA 2D5HA 3UKVA 5CG9A 3H3LA 4EN9B 1B35A 3DV8A 3WCRA 2MEV2 1AJOA 3GHMA 4CUGA 3GZUC 1V6JA 3ZN4A 1NCQB 2ZBJA 4FVVA 2RJKA 3B69A 3ZDSA 3O14A 1UZZA 4Q8KA 1RUNA 2QQUA 5EWSA 3R05A 3V56A 2A6XA 2CYFA 1APNA 1ZBE3 3BYWA 1WCUA 2UU8A 3KZ4C 1Y9MA 3RZKA 4ZY9A 5FZ6A 4XFIA 5CFDA 4AHYA 4ZHNA 1S0GA 3CZUA 3CO2A 1RUE2 2GP3A 2DVFA 3NNLA 1SMVA 5I8YA 1GQHA 1VBB2 5L7OB 4ORFA 3VBHB 4NPMA 4JKKA 3POSA 4GH4C 4QB6A 3WP3A 2EIBA 1EPZA 4BYYA 3OUJA 3KCCA 2I45A 1NY72 3M3EA 3K77A 3PHMA 4RGGA 4CRQA 3P6BA 4E2QA 4PF5A 2IXJA 1NA1B 3I2KA 2QNKA 3RSJA 5C8CA 5CAZA 2VXRA 2WABA 4NHKA 3ES1A 3W20A 1YEWA 2J1VA 3PL0A 1FOD3 1BBT3 2BFUS 2P3JA 2Y6FA 4XIKA 1W6NB 4ASKA 5ABJC 1QJFA 3QLQA 2QJVA 5JI9A 4AVSA 4ES8A 2ZGLA 2YV8A 2W1SA 1JI6A 5EJ1B 5T55A 1OF4A 2HYKA 1IHMA 2TBVA 5LY1A 1ND3A 4CXYA 4HSJA 4RA0A 2OA2A 4XURA 2QZ3A 5EP9A 1DIWA 1GBGA 5K8SA 4Z2WA 1NXMA 2YGLA 1WUVA 2FQPA 4LORA 4ISQA 4JGYB 3N9QA 1RB8G 4ZS3A 4YM0A 3CHXA 1QH6A 2FCUA 4GULA 5EQUA 5FDBA 1I3HA 2VUDA 4LO6B 3JUUA 1FATA 1IPJA 5C9AA 1A34A 5C8WA 2YBPA 3KV6A 4H14A 1REEA 4YVSB 1SQ4A 4JTOA 4MXWB 1GQPA 2PHDA 5JPMB 5A3PA 4LHKA 4CCKA 4XCBA 4FAGA 3BU7A 4ZXEA 5LA1A 3HMYA 1NOVA 1YJKA 3HD8B 4LHLA 1OVPA 2ZA9A 3BPZA 2HWE3 2DUPA 4RSUA 4HK8A 3T4VA 4W4ZA 4NHXA 3S7EA 5LEKA 1PGW2 3CJXA 5C4WA 3GCXA 4BDVB 1DP0A 2I07B 5T3NA 2CWSA 4AFMA 5J36A 4K8RB 1CESA 3WD5A 3RJRA 3ILRA 2XOMA 5IAVA 4AEDA 1R081 3I2OA 1SPPA 4H7MA 3CBNA 1ZRCA 2YFZA 4BMEA 2PN5A 3D5OA 1W0NA 1V6NA 1ZA7A 2RS13 1YQCA 3NJYA 3ZYRA 4PHZA 3WNKA 4TTGA 3RRDA 4A41A 1XE0A 1H9WA 3QACA 3BTZA 5JZGA 1QXJA 2WN2A 5K7PA 1UYZA 2YU1A 4IEWA 2IXLA 3AP9A 2R063 1XE8A 1ZZ7A 1CWPA 4H55A 3OYWA 2E7AA 4FO9A 5GKAC 3WW3A 1W39A 3PUIA 1ZBA2 1RTVA 4PIXA 5G05L 2JDUA 1NCRB 1PX3A 3AK0A 1RC6A 4HOOA 1YCIA 3ELNA 3W59A 4Q0UA 3I3EA 4I0BA 3KV5A 3WQ0A 1D4M1 4JAAA 1OXCA 4KQ7A 1UL9A 3A4UA 3BTXA 2EF6A 1XU2A 5DAQA 2YY1A 2RM21 3EBRA 4ASLA 3I4IA 4QMAA 2P2KA 1NG0A 1RJ8A 3C7EA 1PIV1 2HWF1 2EICA 1J58A 2VCMA 3AMPA 5H9QA 2JG8A 3H8OA 2GU9A 1ZBE1 2C4XA 3BGAA 2WNVA 3CQOA 5H9PA 1E5SA 2MEV3 4CEYC 4DXZA 4COUA 5FPXA 2NM1A 2BPA2 1W6PA 4JQTA 1QQP2 4NOTA 4XE9A 3KT1A 3QOPA 1PK6B 1UOFA 3T0AA 4XTPA 5FOBB 1FAYA 1H1AA 1LJ7A 3FL7A 3LKJA 2WYFA 4Q4Y1 3CL1A 2A3WA 4BQWA 1NZCA 1FMD2 2ZEZA 1F9KA 1EAH1 2JB8A 1AL21 3NRUA 4XF3A 4XFCA 3CMGA 1OH3A 4EN0A 4HKLA 2EXKA 1CAVA 2CWMA 3CF6E 2CGPA 1RUE3 1S0IA 3N7LA 1LB2A 1YUDA 4NO4A 1CAWA 2YFUA 4XUQA 2C9KA 3VDCA 2JG9B 1XNTA 3KHBA 2D98A 2ATFA 1YC61 2OYZA 3WSOA 5EZWA 1R091 3WQBA 1NCQA 3FUQA 3OBTA 2E6VA 4CDWB 3MLKA 4XTMA 5FZGA 3OBRA 3OGVA 3RJ2X 3MI8A 3TB0A 4QXBA 4D6SA 4A42A 1W05A 2EXIA 4YM1A 4YVWC 4Z2AA 5C6CA 2JE8A 5FP4A 5A7QA 4YZ2A 1UOJA 3MW2A 5E16A 3MGUA 1SZBA 4NJ4A 4BQ1A 1AX0A 5JOYA 2UYBA 2P5BA 1C8M3 2GDFA 3GNEA 4IGOA 4JDMA 5FY1A 1AYM1 1ND2C 1RUC2 3WG4A 3HOBA 1JU3A 4DINB 2VW1A 2EAKA 5K0UB 5F6LB 1MQTC 1BZWA 2D40A 4TXWA 1PVC3 2R6QA 4QPYA 1YYNA 2YB7A 4WZCA 1UOGA 2ZX2A 4Y1YA 5GJ6A 5GM0A 3AFGA 3VDDA 1R1A3 1K5JA 3B94A 1V0AA 1GUIA 2L9LA 5DAXA 5F8PA 3ZXGA 4KGGA 2NZ9A 3CIHA 1LHWA 2OX0A 1RUH1 3T4HB 4QPIC 1KD7A 2KM2A 3H42B 4RR3B 2DTYA 3LEMA 3FC0A 3LFMA 4HG6B 1AHSA 4EJRA 2WC2A 1CZVA 5F9TA 1VJ2A 4QKFA 4AI3A 4CP2A 1MS4A 1W8ZA 3AL6A 4B7EA 3H7YA 3V0AA 1W6NA 1LEDA 5J1XA 4XJAA 3RYKA 4BXFA 2HWB1 4A6OA 4PBPA 2HEWF 2YXSA 1VBD1 1GLHA 3QH6A 1OFNA 5F5QA 4QT6A 3M70A 1QJEA 1LHOA 2VOXA 3UJOA 1OFSA 5FZOB 1XSRA 2A6YA 4LOSA 1QEXA 2B9VA 5SV8A 3OF1A 1RUF1 2VBBA 4WM7C 5IUQA 2EXHA 2X53S 4JGYA 1TME2 1DYPA 2ENRA 1LOEA 2VOWA 1CD3G 5JOXA 2C9AA 1BEV2 4LJHA 5A3WA 3I2DA 1LCLA 2R1DA 1I5ZA 2ZX1A 3LEGA 4YVSA 5HCBA 1YO8A 3CJIC 4MXWA 3VB9A 4LHSA 3WG1A 3ON7A 5FK7A 2PLV1 5JVVA 4DUXA 1S2BA 2W08A 1A6CA 2UWBA 4HZFA 1QU0A 3DXTA 2IFRA 5T5PA 3VBSB 5HBAA 5IVVA 1ZBA3 1W8TA 1ULFA 2K0GA 5D8AB 1KFUL 3VBUB 5EJZB 4C91A 4MOAA 1WW7A 4WM8B 1P8JA 3GDBA 3KVAA 1PGSA 3SQOA 3HEIA 1LU2A 4C1XA 3BIEA 2XDVA 1LOCA 2VMDA 5FYVA 3DKQA 3BTAA 2Y6KA 5DAPA 4P9XA 1PZ9A 1W8UA 4BLIA 2WR9A 3ATGA 4P5HA 1AR61 1HIXA 3Q8AA 4OQ9A 4M3CF 3U4SA 1RXFA 2IVIB 4LK6A 1DZRA 2Z5WA 1O4TA 1POV1 2BNOA 3A7QA 4M0NA 4QX2A 4DEQA 2ZKLA 4BIFA 2ORZA 2JXAA 4NIIA 1QQP3 4LBJA 3MIDA 4YG0A 5T5OA 5BNOC 1OLME 1W0PA 1GOFA 3KCXA 1NCRA 2WA3A 1EPWA 4OUSA 1FMD3 1RUG2 1U0AA 1TMF2 5FZIA 4Q26A 2D44A 1RUI1 3NV2A 2IXHA 1Q5OA 1TQ5A 1UMZA 2E51A 3PURA 1JH5A 1H8TA 4QD2A 3SCGA 1S0JA 2QDNA 1Y4WA 3H1WA 4OI4A 2WNUC 1HQNA 1LHUA 3THCA 3AVRA 4XF1A 4IETA 4XFHA 2W39A 3PVEA 3S5QA 2JDYA 5BNPC 1V9U2 1DG6A 1W90A 3E6CC 1KXGA 1JBCA 4FSJA 1CONA 5FZ7A 2FDIA 5DQ0A 1PK6A 3JXSA 2RR11 1UZ0A 4YRDA 4HSLA 1HB4A 3PTYA 3FE5A 4RYDA 5BNQA 1NT0A 1OSGA 1LGBA 3D0SA 3TWIA 1R1A1 1UXXX 4LO7A 1GZTA 4XIOA 2Q1ZB 4IL7A 4MGZE 1UU5A 1RUC3 3AMMA 2VECA 1S0EA 4MADA 3AMNA 1OLRA 4WVMB 1EUUA 4OHYA 1QDOA 3DN7A 3VKFC 3ZYFA 1N1SA 2VPVA 4IV3C 3J7LA 2QQPA 2KD7A 3SHRA 2LW8A 4QU1A 1DGLA 3U0ZA 2PHFA 3DGTA 3EB7A 1QJX1 1S1AA 2K46A 3NMBA 3VLBB 2J1EA 3DL3A 2CDPA 2XONA 4Q8LA 5LK7B 3HR9A 2FCVA 2H0VA 1H1IA 2GNMA 1J1TA 3Q8FA 4XYXA 3ZSEA 1DLCA 1W9TA 2WO2A 3J8F2 4IQPA 2ZX4A 1Q8VA 3VV1A 4UFJA 3THDA 5I0DA 5LBFA 2A6WA 4TLGA 3KQRA 3JB4C 4FPJA 1YIPA 3AKTA 3O0WA 4JKMA 4DMIA 4BQ4A 2JD9A 4LBQB 5K0UA 1JS9A 4LEJA 5IYYA 4NIDA 4X6QB 4SLIA 4HN0A 5EV7A 1UAIA 2VZUA 3ACLA 1YNAA 4OHVA 4QXHA 3SH5A 3ZSLA 1IKPA 1UIKA 3KT7A 2R49A 4FCAA 1YWKA 3JBG3 4FPLA 5A3UA 4GWNA 1TME3 4KI5M 5BNNB 1WCDJ 4XILA 3RZZA 2LM3A 2DCTA 1K5MC 2VTFA 4RR3A 2E63A 3RWKX 1BEV3 3LIGA 1WMEA 5H9SA 1DGRN 5A3OA 1RUJ2 4QDQA 1QXRA 4GZ9A 4LLFA 1LR5A 2ZGUA 3SXWA 3I3BA 4Q4X2 5IK8A 3EO6A 4HLTA 2ZS6B 1UX7A 4BE3A 1Q8OA 4PDWC 1C4RA 2VZPA 5JOZA 5JMOA 2O8QA 5FPBA 5FXXA 1OPOA 1Y7BA 3VZMA 2XJUA 2WO7A 2XB6C 4CYDA 1A78A 3AZVA 2ARXA 4XFAA 1I1EA 4PQ9A 4IGPA 4V2VA 5FYYA 1OURA 4M0HA 4QHZA 5FP7A 4AVVA 1KJRA 1SLAA 2ADEA 5FRAA 5A7PA 4OYUA 2EAAA 2MNGA 3NV1A 3H3UA 3BOWA 5DDJ2 3JD72 4MX3A 5J3UA 4KH9A 5C3PA 1UPIA 4C0BA 2E7TA 1SBEA 4LBOA 2VCBA 3D4KA 4E2GA 4UI9L 4MXVA 2PHXA 5DG2A 1N3OA 1G6NA 4YZ4A 5T5JA 3J7MA 3VBSA 3WV6A 1VRH3 2D97A 2PQSA 1BJQA 1ODNA 1U5ZA 5D8AA 3KMHA 1JZ6A 3TYJA 3VBUA 4YZ1A 3VBRC 1OD3A 1CVNA 2A70A 2CHHA 2A3XA 1JZ4A 3K3NA 2BDRA 1ENXA 4YSFA 5GALA 3FN9A 1OKOA 2PELA 3ACHA 4A7ZA 2ZGPA 3IKWA 4CEYB 1VMHA 1JODA 2B5HA 2D7FA 4AWDA 1QGLA 5LWBA 2GNTA 4QPGB 1GOGA 2OW4A 2VZQA 3SH3A 1TE1B 2VOVA 4QQPA 4MG2A 4XPVA 1PO22 4Q0QA 2EIGA 1Z78A 4NAMA 1Q56A 3MPPG 4DB5A 2HH9A 4L2NA 2CDOA 2BNMA 3IIIA 5D2AA 4YGCA 4Z07A 3U07A 4D69A 4OVEA 2PYTA 2WWUA 2RMU1 3EJKA 3ZR5A 3BU0A 4IV1C 3DEMA 4YGDA 4LKEA 4CVUA 3LEIA 4JCKA 5LK5A 2D3SA 1REFA 4ZKTB 1I5PA 1WLCA 2B46X 2G4IA 1ZRRA 1UD1A 3VGIA 1GZCA 1HRV3 1GNZA 5A3NA 1XE7A 5B2GB 1XPWA 3IN9A 1W8WA 3VBFB 1LHNA 1K42A 4KWLA 1U5YA 1UKRA 4JV4A 5BYNA 5HCHA 2ZX3A 3NQHA 3IPVB 3MDPA 5F6KA 1R082 1K3IA 1B35B 2WNOA 2WQ4A 4EROA 2VE1A 4URAA 5FZFA 3WNMA 3ZLIA 3M7AA 3I2FA 2WFF2 4UF0B 4HL0A 4QKBA 3N9LA 3J8F3 4JGZC 5LY2A 5KBFA 4NPLA 3LPGA 4QXKA 2YYOA 1WGPA 3BB6A 3ETPA 4GH4A 3USSA 5K4LA 2BFUL 2ZGKA 3WINE 4AXOA 2BWAA 1ZRFA 1VALA 1O4YA 1H9PA 5A3TA 1ASJ2 2LRPA 5FZ4A 1XYPA 2SBAA 1HRI2 1UZVA 5I91A 4XDPA 2BERA 5IHRA 1GZ9A 4AE2A 2I74A 3BN6A 4RS5C 5DUVA 4HMZA 2BW8A 1EV13 1V70A 1QOTA 1V6OA 5DABA 2FBEA 3IM0A 2RM22 4WZFA 2BGOA 3TN91 4DFSA 5GLVA 5EFUA 5C3QA 4EV0A 1PIV2 2HWF2 2X09A 5CKMA 2B4KA 3DPRC 2ZHLA 1ZBE2 1YLLA 4Y20B 4S2DA 1A8DA 1OBNA 4UOJA 3GBGA 1O3RA 3MF9A 2AZ5A 2X29A 2V5DA 3DYMA 2WZR1 3MV11 4NHLA 1VLNA 3MLJA 4LBQA 5FO7B 5AFEA 3NVCA 1AR81 4HANA 4KWKA 2WZPP 4Q4Y2 3UKTA 4R8HA 1ZM1A 3CZJA 5L19A 3ZFEC 1N1YA 1IG3A 2XWBB 1ND3B 1AL22 1ZRIA 4KBBA 2DF7A 5FLJA 1HB2A 2HWC3 3BUCA 3RZJA 1XB9A 1ZX5A 3O1OA 2VW0A 1UXZA 2XGXA 1H8VA 4NN0A 4M4PA 3VHRA 3WG2A 1QJY1 2C1FA 1PM4A 3B93A 5LA2A 4AW7A 4GWMA 3OBAA 5J96B 1QMJA 4K8FA 5FJHA 5C9AB 2VL4A 2FDFA 1ZZCA 3BIWE 5CKNA 5LBBA 3KVBA 4MO3M 4E8DA 4YLZA 4Y1VA 1BBT2 3B00A 5A1LA 2JDAA 4Q0VA 1OLMA 3NAPC 3ASIA 1UU4A 5FY8A 4QX5A 1GP4A 2Y38A 4XQ4A 3ZFFC 2LUWA 4B3NA 4DQAA 2PHTA 2G1MA 1ALYA 5IW0A 1WZXA 5C4WB 4XABA 3C7GA 4U2AA 4A7YA 2Y64A 1O6UA 4AFCA 1XYNA 1AYM2 2C24A 2GMEA 3BCWA 5CZKA 5FYTA 4I09A 4XJ8A 5IWFA 3W21A 4L8QA 2H6CA 4MH0E 2WKKA 3AMHA 3ROUA 5HXVA 2B9UA 2Q8EA 3DKWA 2J1UA 3PUSA 1LRHA 1VMFA 5JZGB 1ONAA 4UBHA 3OY8A 3M3CA 5C70A 1G9CA 2FDHA 2NMOA 1RUH2 4QAWA 2DDUA 2CAUA 4FOYA 2HWE2 4C1WA 5IK4A 5J98B 1HRV1 4UBGA 4UAPA 1STMA 2WNUB 1U12A 5EYYA 4XUPA 5AFBA 4B4QA 1ENQA 4CSWA 3W5NA 2HWB2 2B8MA 4LBQD 4CEYA 5FY7A 3I2GA 4XBLA 3OEAA 4XDOA 1FV2A 4QQHA 5CFCC 4LO5B 4DO0A 2RS12 4LBKA 3MIGA 1N3PA 2EXJA 5FZLA 4EWDA 4P9YA 3MPBA 2P3IA 3WX5A 1H2KA 2OKXA 4N43C 2QQVA 3VN4A 2JG8B 1RUF2 1N47A 1RYYA 4IXLA 1R083 1IS6A 2WLQA 2WNVB 2A75A 2GAUA 2R062 3WZ1A 1S2KA 1AVBA 5A7WA 3ACFA 2VR4A 4KG0A 3OGSA 2XQRA 2FMYA 3S7IA 1ZRDA 4AVBA 1XXNA 4E27A 4XHXA 1D0GA 2JDHA 2QQIA 4NR1A 1JOBA 1KS4A 5IVFA 2W1UA 1SCSA 4HVQA 2D6KA 1W28A 2ET7A 5M0TA 5HPOA 1OC1A 2PLV2 1EV11 2K9ZA 5CNAA 4RFRB 5A1FA 1ZNPA 4M4RA 4NPRA 1BVVA 2OS2A 3K48A 5GZFA 2ET1A 4HXCA 1CAWB 5DUWA 4YVWA 1V6IA 1KRIA 2HLEA 3NV3A 3AYDA 3SH4A 3MBWA 5AC91 5IVJA 3IPVA 2VY0A 1D4M3 5EIYB 2VD7A 1O59A 4QU2A 3IT8A 2A3YA 2ERFA 2PFWA 4K40A 2RM23 1JYNA 1O5UA 1RUD1 1SFPA 3FX3A 4UFLA 2YDEA 2AC1A 4UF0A 1OOPC 2R30A 2UWCA 1PIV3 2HWF3 4G3YC 3NKGA 4Z8BA 5KXEA 1US2A 1AR62 4XEZA 3MEPA 1EY2A 3MIHA 5B4XA 2VXJA 2XVGA 4ATFA 2GSYA 2YMZA 2CTVA 4HK9A 4BK4A 2HWC1 1PVXA 5GLTA 3IB3A 4FPYA 4F8AA 5A32B 4QPIA 4TLFA 2P4EA 4Q4Y3 1SLLA 3RMYA 4P14A 4RL7A 5FZKA 1RUI2 2VQAA 2X5IC 5A6YA 1MS3A 1EAH3 1GP6A 1AL23 2KA3A 3AZXA 3GXUA 4RQPB 4XZPA 3EQEA 3VDDB 3KHCA 3RG0A 1J59A 1FX5A 3OGRA 4P9JA 3ZYIB 4AEKA 3H1MA 2J22A 3N7KA 1AUYA 2CGOA 1YXWA 3JB8A 4LLOA 1UOBA 5FLIA 4QGMA 1X50A 4BLJA 3ZN5A 1B09A 4M00A 5FXZA 4Y20A 3H8XA 1UO9A 4OFGA 3I59B 2BNNA 4BOWA 1OUXA 5FKCA 1R093 1VB2A 2CY6A 3LSEA 3V0AB 1G8WA 1ULGA 4WM7A 3DF0A 2VMIA 2P3YA 1J3QA 1C8M2 5DG1A 3WDWA 2JX9A 4DY3A 5J7MA 2HYXA 2ILMA 2O14A 2PAMA 1PVC2 1RHI1 1AX1A 1W2NA 3CJIA 3UL2A 3HQXA 1R1A2 1YI9A 2JDMA 2RV9A 4XXPA 3EMRA 1LODA 4EE2A 4J1XA 3AZYA 1D2QA 1AYM3 1FPN1 1QOOA 2BVVA 4AK3A 1UPSA 5ACA1 5I0RA 1NX9A 1H6YA 3WOGA 4AI0A 3GZTB 4X8PA 1OF3A 1HB1A 5CU1A 3NW4A 3VBRB 1QJX2 3WEZA 4IE4A 3OSDA 1JUIA 2WNEA 2WBKA 3URFA 1RUH3 2DFBA 1ZZ9A 4W6WA 2W5FA 3PUAA 4YW3A 3C7OA 1W9WA 2JE9A 5JOWA 5IK7A 4XCAA 4YGEA 4LE3A 3DXUA 4UXAA 4CEWC 1XNKA 1FXZA 3IMNA 1NZIA 2XL7A 1DQ1A 2YPJA 4Z1VA 5DMYA 1EP0A 2ZHNA 4LKDA 2HWB3 1SCRA 4CDQC 4IW3A 1BKZA 1VBD3 4RD7A 3KT4A 1ACCA 4OLLA 3CLPA 3N9NA 1GU3A 4BU2A 1JXNA 3ZKUA 1J84A 4EYUA 2Y60A 1NYWA 3CU7A 3HT1A 4OI2A 3TBDA 3ZFGC 1RUF3 2SLIA 1R64A 5CKQA 4GIQA 1LENA 1VBA1 1GQGA 1NUKA 1UU6A 3ZN6A 2HWD1 3I2HA 4IE7A 3TNPB 3RZHA 3AC0A 3X29B 1BCXA 1VAKA 4XJ9A 2WNUA 4W6XA 4MSVA 2Y8KA 2VMGA 5GLWA 1WD3A 2GN7A 5FMCA 2ZEYA 4COZA 5ISLA 4KWUA 3T1MA 5BNPA 1VB4A 3LDKA 2Q1MA 1ULOA 4D7TA 4FPKA 1H8TB 2PLV3 3DYOA 3VD9A 2PMWB 4LA3A 4R9BA 2VTXA 2VBPA 4IDZA 2CU5A 1F8VA 2N7GA 3V0BB 2D3RA 4RGKA 1LHVA 2JE7A 3UGGA 1HJFA 5F3CA 1SDDB 4YG6A 1J3PA 3ZDVA 1CZTA 4JGZB 2AR6A 3AKPA 3MICA 1V00A 2OUJA 4Y26A 1JZ5A 4XJWA 2XJTA 2AENA 3VDBA 1HKDA 4XFGA 3FLPA 1TEIA 1JZ8A 5FCCA 2RVAA 1UY3A 2E53A 4JKLA 1AR63 4IEXA 3POGA 4IV3A 2DBNA 1POV3 1E5IA 3MZHA 4YW2A 3O5SA 4P9WA 5L73A 3PNAA 2OZ6A 1AYN1 1KJLA 4Q27A 2ARBA 2Y0OA 4Q0PA 4LBNA 4YNIA 1YFUA 2D6MA 2Y6JA 3WDXA 2D43A 5KC5A 1OQ1A 2R073 3VBOC 3UJQA 1RUI3 1BK0A 3VD3A 3DPRB 5IVBA 3PVOA 1WMDA 4HETA 3I8TA 4FOQA 4ZU7A 1COV1 5A33A 4LT5A 1CIYA 4QX0A 2QZ2A 1GNHA 1AXKA 2BWCA 1LNSA 5FPVA 1H4HA 3S57A 3Q8BA 4JC1A 1OA2A 5EPAA 5JWPA 3GM8A 4LULA 3C8XA 3KSCA 4XW3A 4AQ6A 3ALQA 1YQ6A 3ZFEB 1W6OB 2VMFA 5A7NA 4XQDA 4MLOA 2W46A 2P34A 4KG8A 3TEYA 1JOJA 5A32A 1K5MA 2RR13 5F39A 1WW6A 3MIEA 4O61A 3IWZA 2WO1A 1QIQA 3H1YA 4RQPA 4S2HA 3S6PA 2J1SA 2UURA 4P08A 3KD4A 1MZFA 4LO4B 5LCWL 5JR7B 1E5RA 2D3PA 2QQWA 4PDWA 1LKNA 3H9AA 3NAPB 4GKXA 4QQOA 5LASA 2VCAA 3ZX7A 4BK5A 4XJUA 3HIFA 3ZFFB 4COVA 2XR4A 2D6PA 1D7PM 2W92A 1UYPA 2ZGMA 3UESA 3I59A 3V64A 4PF1A 5FP3A 4Y1XA 3MHZA 1QJX3 2ZACA 4B7KA 4COWA 4CDXC 2YGMA 4CCOA 1LULA 2VJXA 1AL0G 2GN3A 5IAXA 4GALA 4QQ2A 3NJVA 3HPNA 3O0VA 3AJYA 3PDQA 3QCWA 4CP0A 3H8RA 2VCCA 3ST7A 4J1WA 3J7NA 2ETEA 3AXEA 5JIAA 5LEJA 4JHTA 2RDSA 4A6SA 1IG0A 3J4UH 2AEZA 1OD5A 2J7MA 2EALA 3CKHA 3JBG2 4J25A 1PMHX 2R32A 2C6SA 4F83A 4N7IA 5C71A 4FTSA 3ZXEA 4KU8A 1ZZ6A 4PLOA 3C3VA 4K1ZA 1YFWA 5I93A 3IBMA 1XQNA 3O12A 2MPFA 1MR5A 4XACA 4QGLA 3VBRA 4LA2A 3SISA 2PAEA 3FMGA 2XL9A 4HVOA 3RVHA 3IIAA 2Y0IA 2JDZA 4CU8A 4MUVA 4CTEA 1HQLA 3O1UA 4RHV1 4YM3A 1PGL1 1PHMA 5FWJA 5E89A 1A3KA 2RHPA 1Q3EA 2DYCA 2W52A 3D3AA 4LO8A 5GZEA 4AGGA 3BKZA 1DYOA 3WNLA 5A6QA 2YHJA 1O3TA 1K45A 2CV6A 2ZAAA 4W6YA 3THTA 2WSUA 4AI2A 2XJSA 4I02A 2JDPA 1X9PA 3G7DA 3QD6A 2WS91 5JSPA 3LQCA 4L99A 4IV1A 1OQEA 2OVUA 4UT5A 4UFMA 5E88A 4EWEA 1F35A 1CPMA 2G9FA 3VL9A 5IFPA 1G9AA 4EZHA 3LA2A 3CNAA 3SC7X 3E5UA 1N3QA 2EIDA 3R4DB 1C57A 4I3GA 1ULPA 3OD4A 3SKJE 1QJY2 1VRH2 3OPZA 5FYSA 4ES9A 3VZLA 2ZKNA 4CDUC 5K9YA 4B4RA 5J48A 4ARXA 1NAEA 4AF9A 4AZZA 1LGCA 4G4FA 1HXS1 2R071 2VNOA 3B9CA 4N7UA 3ME2A 2JJ6A 5AVPA 4MHRA 1J83A 1HLCA 3A22A 1BLZA 2UYAA 2ZHKA 3ES4A 4DUWA 4JQRA 5JCTA 3O1MA 5IVCA 3P3NA 1C1FA 3V0BA 5KC6A 1F4AA 5FIXA 3T1LA 4MVTA 3MFCA 2EA7A 2VZOA 4JGZA 2W3JA 1AR91 2CGNA 4JVAA 4LUMA 4XF9A 3I3MA 3ZO0B 1HDKA 2DWRA 5A6XA 4R9CA 2QQNA 3ZXJA 1JZ3A 2YROA 4PIZA 1NE4A 1W03A 1W8NA 4DRRA 1VBB1 4FOVA 4X6RB 3D0JA 4GMP1 2ID4A 1GZWA 4JTNA 5F3IA 1IOAA 5HV0A 3VD4A 2C26A 2X5IB 2VQUA 2JDKA 4GH4B 4DY5A 5FYMA 3HT2A 2VMEA 4L92A 1CGPA 3B3QE 1HRV2 2JKBA 2RMU3 1QHDA 2EVXA 1VIWB 4CA9A 4Q4W1 4B4PA 2F4LA 3DPRA 3ENRA 2W94A 2VVDA 3GZAA 4UW5A 1GWLA 1ZZ8A 4Y3OA 3HN3A 4IE6A 4FXKB 3M1HA 2VMHA 2ZGNA 1BYHA 5ABJB 5FYHA 3D82A 2ZTNA 4DEVA 1MEC1 3AJZA 4UW4A 1N1TA 4FFGA 1LOFC 1CX4A 2VH9A 4I0AA 3ZFEA 3POWA 3LA3A 1F4HA 1W6OA 2BJSA 1QWRA 3AP5A 3B9IA 4MZUA 3SEEA 2ZX0A 4YW5A 2C5DA 1JHJA 1QY4A 2JENA 3TEZA 3JZVA 3N9PA 4DOUA 4XMIA 4W8JA 2BQPA 2Y6LA 3PJYA 3Q9OA 3R6SA 5I8TA 5C33A 5KHJA 1XNCA 2VZ1A 1C5HA 2A1XA 4B1LA 4ZXKA 4QX1A 2PTMA 1EV12 4Z82A 2DU0A 1VAVA 1SLBA 3HNMA 4MGIE 4Y5TA 2BP6A 2GC2A 3NAPA 3UK9A 4F3JA 1W9YA 4FI9A 3ZFFA 1G9DA 4P9LA 1NCQC 1URXA 2WZEA 3K3OA 2RS31 4YZ3A 3T2PA 5CADA 4CEWB 2A73B 3OPWA 1DQ4A 2O8OA 2QUOA 2BVBA 4XXAA 1RUD2 3HNBM 4UW3A 5ERLA 3TN93 4CDQB 3N9MA 4HFSA 1KGYA 1UCXA 1I6XA 1W2UA 2E26A 4XOGA 1YFYA 4LMFA 1W3VA 1X7NA 2D93A 1AJKA 3MIBA 2HWC2 4P9GA 1OKQA 5FZ3A 3VL8A 3ZFGB 2XLFA 2ARAA 2NQYA 4GB31 1RMU1 2WZR3 5IVEA 1RINA 5L7OC 3VBHC 3ZXFA 1AR83 3I7DA 5FZAA 2AH2A 4FQZA 3N3HA 4P5YA 1GR3A 2FZ2A 2OPWA 4D0QA 4URTA 3I3DA 3OTFA 4GJZA 5FY0A 4GWIA 1W3XA 4QX8A 1RGSA 1VBE1 2VUCA 2ZGQA 3OY8B 3WF4A 1NA1C 3I49A 4E4ZA 1IQDC 1QJY3 1ZVFA 5CFCA 1PO11 4LKFA 4FQ4A 3AP4A 3KGZA 1GSLA 3H3ZA 3SKVA 2P3KA 1YJLA 2XUEA 4FT8A 2X10A 4N43A 5L9BA 2WYSA 4Z92B 3T30A 3WHTA 1UF2C 2BEOA 3ZSKA 1U5IA 2LALA 4AHZA 4IEOA 3CDZB 1WBFA 4GXLA 4AI9A 3N35A 4IEZA 2UY8A 5FZMA 4AG4A 2VULA 3NV4A 1WCKA 2AGSA 2W95A 3AZWA 3WG3A 1ZREA 4LTAA 3DCQA 1MS1A 2CNAA 1WW5A 3I3QA 3WP5A 1RVF1 4M01A 2GH2A 2XVKA 4WVZA 3WNXA 4D7SA 3IMMA 3OUHA 1FPN2 3OGJA 2X8KA 1QJU3 1X8EA 5A7WB 1Y3TA 5ACA2 4YVSC 1O91A 1E5HA 1YQ8A 1IPSA 1FNZA 1F5FA 1G7YA 3H50A 3WP6A 3POIA 3N4MA 1JYXA 4XMAA 1C28A 2ZMLA 2YC4A 3VBOB 1HW5A 3RYPA 3VKLA 2XMLA 2QE3A 2R7EB 2XQXA 2ZGRA 4JDOA 3WF1A 4CP9A 1IS3A 2OUHA 4CXXA 2BV4A 5L36A 1OOPA 1LU1A 4M3CE 3A23A 3LPFA 4IE5A 1MVEA 3GALA 1BVP1 1WA4A 4OZXA 4YVWB 5GZDA 3JCIA 3ZXDA 1UYYA 1GFF2 1W9SA 2W87A 4ZONA 3NNMA 2IXIA 2LS6A 3RNSA 3RS6A 3MUY1 3L2YA 5FZHA 5FJKA 3TAYA 5C3OA 1UIJA 1Q8PA 1S2EA 1SBFA 4YM2A 1ND2B 2Q0AA 1POV0 4Q4V1 2ZZQA 2IXKA 1XC6A 3C2UA 2ORXA 2XH6A 4NRPA 1BMV1 5DAWA 4AQTA 1MQTB 2P1BA 2X5IA 4E4SA 3HVDA 3O1VA 3WQ1A 5F3GA 5LATA 3O7OA 4TSVA 3AM2A 4BPZA 3B7MA 1U5XA 3G6JB 3H7JA 4CP1A 3KLSA 4QKDA 4Y4RA 4BQ5A 4MGKE 4NAOA 3S30A 5KR7A 4QPIB 3QBQA 1PNFA 1WA6X 2QDRA 2WIIB 4W65A 4FFHA 1SEFA 5DN2A 4XAEA 1A8MA 2VQ0A 5FYCA 3ZSJA 1D4M2 4NRQA 1C1LA 2VUAA 1PMIA 3U37A 4YW7A 2E7QA 2R0FA 5ABJA 3WNNA 2G9ZA 4OUMA 1FT9A 1ENRA 5LRSA 2FDKA 3LEKA 1JYTA 5TSWA 1AZDA 1WCSA 5JAXA 4AFAA 5AC93 5FBJA 1DBNA 4IESA 3ZMOA 3HBZA 2HJIA 4LKSA 2Y26A 3T0BA 1PK6C 3MV01
chains in the Genus database with same CATH topology
4GMP0 3WW1A 1YIFA 1RUD3 1DGRA 4GKYA 4IEYA 4K7JA 1VP6A 4WM7B 3M4FA 4XF4A 1GANA 4R52A 2R041 4AHWA 2QCSB 1EAH2 3CJIB 5HCAA 4FAHA 3L9JT 2JG9C 3JQWA 2VGDA 2ZOEB 4L97A 4TWTA 1Q8SA 3U11A 4CDWC 3IDEA 2WQZC 1NXD1 1PZ7A 1AXYA 3WUDA 4CEWA 1COV2 1R092 5LRRA 1VBC1 4Y22B 2GMMA 1AR71 3I54A 1G9CA 1DF0A 4CDQA 1IS5A 2JEMA 4YYOA 5JI7A 4Y1UA 2F6BA 2RS51 3VHNA 3U4XA 2WWSA 3GBWA 4FPHA 3ZFGA 3ZXKA 1GKBA 2WA4A 4R4ZA 3WP4A 2RE9A 4LUKA 5IT6A 5DZEA 1QJU1 4NWVA 2BUKA 4X8NA 5BNOB 5T5LA 1RUG1 2A6VA 2JICA 1DYKA 4AFBA 1NE6A 1RHI3 3MIFA 2Q5TA 4RR3C 1Z7S1 3E5XA 4XFBA 1QXPA 4AHXA 1FPN3 5ACA3 3ZN6B 3M8LA 1H0BA 1W6QB 4GQ7A 1V9U1 1YFXA 4DNYA 3M3IA 4BMBA 3OD0A 2MHFA 4NWWA 5BNPB 3OGGA 3VHPA 1D2SA 3INAA 1LTEA 1IPKA 2A7AA 2Z69A 1VBD2 3AYEA 3H8UA 1JYIA 4Y5Z0 2VVFA 4AGRA 4FXGB 3ETQA 5KXCA 5FO9B 2K2SA 2BBVA 3WXPA 1LEMA 3FHIB 1D4VB 4P9IA 4HBNA 4RGAA 4AYUA 2WT0A 3W58A 3AP6A 1JTZX 1M4WA 5J37A 4Q1RA 4QGNA 5FO8B 3VBOA 4FPCA 3VBSC 4IV3B 1VBA3 3VKMA 4DZGA 2HWD3 1W0OA 2PHUA 2OIIA 4PCRA 2ZGSA 4LHNA 2VG9A 4RHV2 2D6OX 3PVBB 1E57A 4WM8C 1PGL2 2LTNA 2I2SA 5BV6A 5KHKA 4I01A 4N53C 3EHKA 1F5JA 5FPZA 5CA6A 4BCUA 1DQ5A 3HAGA 1MVQA 3O0XA 4EN7B 3IDCB 5A33B 3E5QA 5EXOA 4Y1ZA 2GC1A 1MZ6A 1JHNA 1ND2A 3B02A 2IFWA 1PNGA 2WS92 3M3QA 3QH7A 4MGYE 1MQTA 1XNDA 1V6LA 4AGVA 1XU1A 1CQ9A 2VU9A 1NLSA 3H0OA 3LOIA 1O3QA 2XLAA 3NSTA 1LGNA 1RUJ1 1K5MB 1ENSA 5T50A 1KS5A 1HXS2 2R072 4Q4X1 3S0MA 2WLPA 2IC1A 1AYN3 5GLUA 4CDXA 2ZZJA 3WY6A 4PDWB 5KHIA 3MFAA 4WVVA 3ZYPA 2B42B 1AR92 2XVLA 2V09A 5DZGA 4DRVA 4K9SA 1COV3 4FBFA 3PMEA 2Z2SB 4HVRA 4QHBA 5DDJ1 3JD71 2P37A 4D3WA 5BXXA 2RR12 3UKNA 1BXHA 1OLQA 3LA7A 5FTTC 3WDTA 4AVTA 1NQJA 2HKXA 4Y24A 3AYCA 3FLRA 2ZJCA 5I0TA 1VR3A 1MS0A 3WDVA 3FUOA 1VAMA 2VUJA 3AP7A 4FTBA 4HT1T 5FMOS 1AX2A 5T52A 4Q4W2 5H9RA 2A71A 1CJPA 2V5YA 1EYBA 4Y22A 5FQ0A 1W6MA 4MV2A 3WW4A 1MS5A 3SMHA 5FBZA 3HN1A 3NL1A 1MEC2 1S0CA 3AFKA 1SLIA 2QFEA 1MACA 4N9HA 1PO21 4ATEA 1O3SA 3NJZA 1LECA 3FJSA 1DQ0A 4XDQA 5BNOA 3BALA 4M3CA 4DPNA 2WT1A 3JU9A 3NWKA 4CDUA 3AKSA 5FAXA 3WUCA 5BNNC 2NMNA 3DUIA 2D5FA 4IV1B 1DLLA 3NO8A 2XBO1 4BZ4A 2R0HA 1W6QA 1GYKA 3LAGA 4AEMA 4R9DA 2RS32 4O9EA 5JDBA 3WLUA 1DU3D 3B5LB 3GBFA 2Q30A 4KGQA 2ES3A 2WFF1 4RHV3 2WSVA 1T6GC 4YW1A 5KXDA 4GB32 1RMU2 3ZXAC 3GYDA 3VZJA 3LOBA 1ASJ1 2D6LX 1CPNA 4OI0A 1HRI1 3GF6A 2WS93 5HCFA 4I2OA 3LZZA 1JW6A 2UY9A 2YC0A 1GZWB 5T54A 4AVCA 5KHGA 3FBMA 5CG8A 3VZKA 4EWAA 1VBE2 4RS5B 1SBDA 2O0OA 1IQAA 4ZU4A 1KFXL 4O9GA 2DVBA 1PO12 1G9BA 3LSDA 2A6ZA 2NPIA 2DFCA 2ZAHA 1HXS3 1Y43B 3SCHA 1DHKB 1LOFA 1HQWA 3PLQA 4QPGC 4FPOB 3VUOA 2ZMKA 3CEWA 5CVRA 2BTVC 1V6MA 2VOKA 2TNFA 4BM8A 3VZNA 1AR93 5AVAA 4F7ZA 1RVF2 3N7JA 1WMFA 3MW3A 4R9AA 3TNQA 4LBMA 3RMXA 5GLZA 4LBLA 1X33A 2DCKA 3WDUA 1VBB3 1FV3A 4GMP3 4D94A 1DQ2A 1F31A 2RMU2 2O1QA 4C90A 4PBOA 3FLTA 3SLIA 1FOD1 1BBT1 2PAKA 2UWAA 3TOJA 3VBFC 2XJQA 2B39A 3WCSA 4XFFA 3FBYA 1O7FA 1JN2P 5JIUA 1B35C 4Q4W3 4PLMA 1KITA 5EYXA 4N9IA 2DVAA 1QH7A 3W9AA 5CBLA 5A3MA 1REDA 5L7OA 1C8NA 3VBHA 5CIRA 1MS9A 4Q4V2 1MEC3 1S55A 1BMV2 2IZWA 3A0NA 1DGWX 3D8CA 3RQ0A 3J26N 1UKGA 5CFDC 1ULCA 1G86A 3FZ3A 2NN8A 3WHUA 4RFT0 1C3HA 1C5IA 1XNBA 3AB0A 4XETA 3ZPYA 1SLCA 2HWE1 1NA1A 4B8EA 2AYHA 1QNYA 2XUMA 1DZQA 2DCZA 3AZZA 3TRSB 4AQ2A 2GZWA 2PA7A 5I8SA 4DS0A 3E6BA 4S2FA 2QKDA 4XBQA 2NP0A 3WT3A 5IK5A 4G9SB 2GMPA 2TUNA 2RS11 1WBLA 3TN92 5C8CC 1OMIA 4R4XA 1R1ZA 5CFCB 2RS33 3KCYA 5DZFA 3GHNA 2DTWA 4HKWA 1CAUB 1OPMA 2R061 5BPXA 3RWNA 4N43B 3WR0A 2GNBA 2WZR2 5KHHA 1OI6A 2NYYA 1AR82 1ND3C 4ISRA 2AUYA 4YARA 2R042 2RJLA 3AX4A 4BIOA 1JYCA 2ZCWA 2DURA 4GB33 1RMU3 1IS4A 2VVEA 5J09A 3USUB 5KXBA 3HWJA 4HKOA 5C9AC 2GNDA 3PVNA 5SV5A 4E9KA 4ZU5A 4YGBA 2F4PA 2OZJA 5FFOC 4V1PA 4IEPA 1QF3A 2VW2A 2MEV1 4N53B 1VBC2 1AR72 4BHPA 2XG3A 1VBE3 2ZGTA 1OA4A 1TNFA 5C4WC 1PO13 4OHXA 2NLRA 2XHKA 3ZXLA 4A7KA 5F1RA 1OOPB 1WW4A 1AF9A 2RS52 4AEDC 4TYSA 3B01A 2E9QA 4JRLA 1RUE1 2Z79A 1QJU2 1G9FA 5EJ3A 2FZ1A 3APBA 3L2HA 2W0XA 5JSOA 5JZGC 1BK1A 2XJVA 2V73A 4ITCA 1QDCA 2H6BA 4BH9A 1RVF3 2QVSB 1H1MA 1Z7S2 4RS5A 3D6EA 1YI7A 1NY71 4COYA 2IWGB 4IERA 2CL2A 3WVJA 1FYUA 2WL1A 2JECA 2DCYA 2DV9A 4L11A 2B7YA 2XPJA 4IEQA 1C8M1 5JSRA 4OHZA 2JG8C 4H3WA 1PVC1 2WNVC 1Q8QA 3MLLA 4JDNA 2XKPA 1ZYBA 3PJQA 3MYXA 1M06G 4GA9A 1MS8A 3ZIWA 1QNWA 4E2SA 2JG9A 3M3OA 1LOGA 3AMQA 4Q4V3 2A5ZA 3R4UA 1PZ8A 3ZSMA 4I0WB 2G9GA 5DUXA 4CDWA 4FPEA 1RIRA 4YFWA 5E8AA 1YRZA 4SBVA 4QM9A 1PGW1 1DDLA 4AQSA 2ZHMA 5AC92 1SACA 1QOSA 2XWJB 2WINB 1ZZBA 3LB9A 1AXZA 2FMDA 1S0BA 4IEUA 1F2NA 1CR7A 1D0HA 3R4SA 2YZ4A 2PHRA 3RYRA 2HEVF 4WVWA 1DGWA 1V6KA 4AEJA 2ZGOA 1IGOA 4KNCA 1LOBA 1HV0A 1S0FA 2PHLA 1CAXB 5A3LA 5D1IA 1O5LA 1ZBA1 2P17A 1KDMA 2DCJA 4RQPC 3VDDC 5JMCA 1H2LA 2BGCA 2R043 1CIWA 4E4DX 2GH8A 2R1BA 1Y9QA 1LOAA 2D6NA 4YFZA 4HPKB 5I0UA 1HV1A 3N7MA 4ONUA 4J6GA 4LE4A 3PMSA 2JD4A 1BQPA 4AI1A 1CAUA 3KB5A 1QJZA 1VBC3 1AR73 1XRUA 2DUOA 1QQP1 4YZ5A 4YW4A 1WLTA 3ILFA 4PLNA 2GC0A 4KWJA 1OA3A 1FMD1 3AYAA 1H2MA 1RHI2 2RS53 4D7YA 4JGYC 3ZYGA 1FI2A 3USUA 1YHFA 3VKOA 1LESA 4EN6B 4LNVA 4TZDA 1RUG3 1TMF3 1WLDA 1WD4A 4WM8A 1DZTA 5CB7A 2AREA 1OHFA 4WV8A 1UX6A 4N53A 4META 5BY5A 1Z7S3 3KM5A 2DVGA 1ULEA 4XF0A 3AXDA 3M2MA 4XJZA 4C0HA 4EN8B 1V9U3 4K20A 1CJDA 2Q8OA 2OPKA 3JQXA 3U10A 1NQDA 1RUC1 5FOJB 4A3XA 5KWRA 3SNMA 2FHRA 2YUEA 1O4ZA 1SFYA 3VKNA 3ILNA 1KDKA 1VBA2 2XBO2 1NCRC 2HWD2 3RI9A 4HN1A 1DFQA 2Q4SA 3POYA 4INDA 3E97A 1H8TC 4I3PA 1TNRA 2GC3A 4OULA 4KU7A 2TEPA 1L3JA 4CDXB 3MW4A 1X36A 4FPGA 5FMOL 1ZA4A 5I0SA 3WW2A 4AI8A 3LCPA 1H2NA 2VNRA 4MYEA 4UW6A 4FTEA 5CFDB 3FFQA 3JBG1 1RJ7A 1TME1 2PQQA 4WVMA 2BYVE 1BEV1 4IEVA 2DUQA 4XBNA 3WDYA 2R16A 1UN1A 1H30A 1IZ3A 3EXUA 5DUUA 1KQRA 4BWOA 1XYOA 2XLGA 4WBBA 1AYN2 3BOPA 1I9RA 1ULDA 4N90A 1WLWA 1RUJ3 5C8CB 3OCPA 4XHBA 3ZVXA 4Q4X3 4XQWA 4Q29A 4PIYA 2KXLA 4K1YA 3IDBB 5JLVA 5FREA 1Z0HA 1NLRA 1CN1A 2WJSA 5FQ0B 1W6MB 3N36A 3RI8A 2ZPXA 4S2GA 4A2UA 4H7LA 2XJPA 2C0ZA 2XKOA 4AFDA 1SLTA 4KL1A 5BNNA 3LGRA 4K21A 1CAXA 4QQLA 5K0UC 1MZ5A 3JD73 1VRH1 4U36A 5DDJ3 3J9SA 2W68A 1RL3A 3AKQA 1S0DA 4M3CB 4BA6A 1TMF1 3MF6A 4CDUB 1FOD2 3A0KA 3ZMNA 1IKQA 5GZGA 4CZSA 4FP3A 4YG3A 4AVAA 2IXCA 3BODA 4K3UA 4HPKA 3KGLA 4Q0SA 2H0BA 3SCFA 3KS7A 1SFNA 1OQDA 4L9BA 2GALA 1UZYA 2WT2A 2Z42A 1H4GA 4I30A 2VNGA 4AEDB 1GV9A 4OHWA 3E6DA 5FLHA 3T2TA 1GICA 4Q2FA 2DU1A 4NVPA 1PO23 5E1RA 1X82A 3VZOA 4K6BA 2WFPA 3OYWB 2ZMNA 4Q1PA 1JUHA 1X8MA 1UW8A 4FOWA 3WQ7A 4FP2A 3FFZA 3OJBA 5BUVA 2DVDA 4OI1A 3UV9A 2XBO3 5DXDA 3AKRA 4QPGA 5D8AC 3P3PA 3V65A 4QM8A 3VBUC 3J8F1 4ASMB 1PM7A 5GZCA 3ECQA 1FNYA 2ZABA 3ZIXA 1J1LA 1DQ6A 2PHWA 1W6PB 1HX6A 3RPQA 3ZYJB 2WFF3 4LR4A 3FWEA 3RDIA 2HEYF 4PJYA 3NKTA 3K51A 1J3RA 1Q43A 3VHOA 4B29A 1SDWA 2CAVA 5HI0A 3R0RA 1MZEA 4FPFA 1CAVB 4JRAA 5JPNB 3THPA 1ASJ3 1RUOA 2XJRA 3LWCA 2B45X 3VBFA 1HRI3 1RITA 4Y4YA 3SITA 1QKQA 4NHMA 1N1VA 2D5HA 3UKVA 5CG9A 4EN9B 1B35A 3DV8A 3WCRA 2MEV2 1AJOA 3GHMA 3GZUC 1V6JA 3ZN4A 1NCQB 2ZBJA 4FVVA 2RJKA 3B69A 3ZDSA 3O14A 1UZZA 4Q8KA 1RUNA 5EWSA 3R05A 3V56A 2A6XA 2CYFA 1APNA 1ZBE3 2UU8A 3KZ4C 5CFDA 4XFIA 4AHYA 1S0GA 3CO2A 1RUE2 2DVFA 1SMVA 5I8YA 1GQHA 1VBB2 5L7OB 4ORFA 3VBHB 3POSA 4GH4C 3WP3A 1EPZA 4BYYA 3KCCA 2I45A 1NY72 3M3EA 3PHMA 4RGGA 4CRQA 4E2QA 4PF5A 2IXJA 1NA1B 5C8CA 2QNKA 3RSJA 5CAZA 2VXRA 4NHKA 3ES1A 1FOD3 1BBT3 2BFUS 2P3JA 4XIKA 5ABJC 1W6NB 3QLQA 2QJVA 5JI9A 4AVSA 4ES8A 2ZGLA 2YV8A 5T55A 2HYKA 1IHMA 2TBVA 1ND3A 4HSJA 4RA0A 2OA2A 2QZ3A 1DIWA 1GBGA 5K8SA 4Z2WA 1NXMA 2YGLA 1WUVA 2FQPA 4ISQA 4JGYB 1RB8G 4YM0A 1QH6A 4GULA 5FDBA 1I3HA 4LO6B 3JUUA 1FATA 1IPJA 5C9AA 5C8WA 4H14A 1REEA 4YVSB 1SQ4A 4JTOA 4MXWB 2PHDA 5JPMB 4LHKA 4FAGA 3BU7A 3HMYA 1NOVA 1YJKA 3HD8B 4LHLA 2ZA9A 3BPZA 2HWE3 2DUPA 4RSUA 4HK8A 3S7EA 5LEKA 1PGW2 3CJXA 5C4WA 2I07B 5T3NA 2CWSA 4AFMA 5J36A 1CESA 3WD5A 3RJRA 3ILRA 4AEDA 1R081 4H7MA 1ZRCA 4BMEA 2PN5A 3D5OA 1V6NA 2RS13 3ZYRA 3RRDA 1H9WA 3QACA 5JZGA 1QXJA 5K7PA 4IEWA 2IXLA 3AP9A 2R063 1XE8A 1ZZ7A 4H55A 3OYWA 2E7AA 4FO9A 5GKAC 3WW3A 1W39A 1ZBA2 1RTVA 4PIXA 1NCRB 3AK0A 1RC6A 1YCIA 3ELNA 3W59A 4Q0UA 4I0BA 3WQ0A 1D4M1 4JAAA 4KQ7A 1UL9A 3A4UA 2EF6A 1XU2A 4ASLA 2YY1A 2RM21 3EBRA 3I4IA 4QMAA 2P2KA 1NG0A 1RJ8A 1PIV1 2HWF1 1J58A 3AMPA 5H9QA 2JG8A 2GU9A 1ZBE1 2WNVA 5H9PA 2MEV3 4CEYC 4DXZA 4COUA 5FPXA 2NM1A 2BPA2 1W6PA 4NOTA 1QQP2 4XE9A 3KT1A 3QOPA 1PK6B 4XTPA 5FOBB 1FAYA 1H1AA 1LJ7A 3LKJA 4Q4Y1 3CL1A 2A3WA 1NZCA 1FMD2 1F9KA 1EAH1 1AL21 4XF3A 4XFCA 4EN0A 4HKLA 2EXKA 1CAVA 2CWMA 3CF6E 2CGPA 1RUE3 1S0IA 3N7LA 1LB2A 1YUDA 4NO4A 1CAWA 2JG9B 2D98A 2ATFA 2OYZA 5EZWA 1R091 1NCQA 3FUQA 3OBTA 2E6VA 4CDWB 3MLKA 4XTMA 3OBRA 3RJ2X 3MI8A 3TB0A 4YVWC 2EXIA 4YM1A 5C6CA 4YZ2A 3MW2A 5E16A 3MGUA 4BQ1A 1AX0A 5JOYA 2UYBA 3GNEA 1C8M3 2GDFA 4JDMA 3WG4A 4AHZA 4DINB 1AYM1 1ND2C 1RUC2 2VW1A 2EAKA 5K0UB 5F6LB 1MQTC 1BZWA 2D40A 1PVC3 2R6QA 4QPYA 1YYNA 4WZCA 4Y1YA 3VDDA 2ZX2A 5GJ6A 5GM0A 3AFGA 1R1A3 3B94A 3ZXGA 4KGGA 2NZ9A 1LHWA 1RUH1 4QPIC 1KD7A 2KM2A 4RR3B 2DTYA 3FC0A 4EJRA 1AHSA 5F9TA 2WC2A 1VJ2A 4AI3A 4CP2A 1MS4A 4B7EA 3H7YA 3V0AA 1W6NA 1LEDA 4XJAA 3RYKA 2HWB1 4PBPA 2HEWF 2YXSA 1VBD1 1GLHA 3QH6A 1OFNA 5F5QA 4QT6A 3M70A 2VOXA 1LHOA 3UJOA 1OFSA 2A6YA 5SV8A 3OF1A 1RUF1 4WM7C 5IUQA 2EXHA 2X53S 4JGYA 1TME2 1DYPA 2ENRA 1LOEA 2VOWA 1CD3G 5JOXA 2C9AA 1BEV2 3I2DA 1LCLA 2R1DA 1I5ZA 2ZX1A 4YVSA 5HCBA 1YO8A 3CJIC 4MXWA 3WG1A 2PLV1 5JVVA 1S2BA 2W08A 1A6CA 2UWBA 4HZFA 1QU0A 3VBSB 2IFRA 5T5PA 5HBAA 1ZBA3 1ULFA 2K0GA 5D8AB 1KFUL 3VBUB 4C91A 4WM8B 1WW7A 1PGSA 1LU2A 4C1XA 1LOCA 3BTAA 4P9XA 1PZ9A 4BLIA 3ATGA 4P5HA 1AR61 1HIXA 4M3CF 1DZRA 2Z5WA 1O4TA 1POV1 2BNOA 4M0NA 2ZKLA 4BIFA 2JXAA 1QQP3 4LBJA 3MIDA 4YG0A 5T5OA 5BNOC 1W0PA 3KCXA 1NCRA 2WA3A 1EPWA 4OUSA 1FMD3 1RUG2 1U0AA 1TMF2 4Q26A 2D44A 1RUI1 3NV2A 2IXHA 1Q5OA 1TQ5A 1UMZA 2E51A 4QD2A 1JH5A 1H8TA 3SCGA 1S0JA 2QDNA 3H1WA 4OI4A 2WNUC 1HQNA 1LHUA 4XF1A 4IETA 4XFHA 2W39A 3PVEA 5BNPC 1V9U2 1DG6A 3E6CC 1KXGA 1JBCA 4FSJA 1CONA 1PK6A 2RR11 4YRDA 4HSLA 3PTYA 3FE5A 5BNQA 1OSGA 3D0SA 1LGBA 3TWIA 1R1A1 4LO7A 4XIOA 2Q1ZB 4IL7A 4MGZE 1UU5A 1RUC3 3AMMA 2VECA 1S0EA 3AMNA 1OLRA 4WVMB 4OHYA 1QDOA 3DN7A 3VKFC 1N1SA 2VPVA 4IV3C 2QQPA 3SHRA 1DGLA 3U0ZA 2PHFA 3DGTA 1QJX1 1S1AA 3VLBB 3DL3A 4Q8LA 5LK7B 3HR9A 2H0VA 1H1IA 2GNMA 1J1TA