3IDBB

Crystal structure of (108-268)riib:c holoenzyme of camp-dependent protein kinase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
157
structure length
149
Chain Sequence
TRRASVCAEAYNPDEIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Novel isoform-specific interfaces revealed by PKA RIIbeta holoenzyme structures.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 37
structure length 149
sequence length 157
ec nomenclature
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3idbB01
1NZCA 2FQPA 4JTNA 4LTAA 2XL9A 1PMIA 3RYPA 1G6NA 4D7SA 2P17A 3I7DA 3LAGA 3H50A 4BH9A 2EAAA 3KGLA 3EBRA 4MGIE 4WBBA 4IESA 3N4MA 5I8SA 2CAUA 1QWRA 3SHRA 2H6CA 3TNQA 4XFFA 2WC2A 5JSOA 1ZZCA 2Z69A 1NE4A 3FFQA 3I59A 1J3RA 5BY5A 4XETA 4XF1A 4QGNA 3SXWA 3H8UA 3OCPA 4QM9A 5J3UA 4KWLA 1VP6A 2VECA 4HLTA 1DZTA 3D0JA 4KL1A 3SCGA 3FX3A 4HVOA 3E5QA 1YWKA 2ETEA 1X7NA 3DKWA 3ACLA 3H1WA 4PIXA 5FPZA 5EZWA 2I45A 3NSTA 5FQ0B 3PVBB 4PJYA 2OPKA 4K8FA 1JUHA 3SCHA 1YFXA 4EROA 5KHKA 2DCTA 1YFWA 3KSCA 3CJXA 4E2GA 1IPKA 3E6DA 4XF3A 3LOIA 2Y0OA 3C3VA 2UYBA 5KBFA 2O8QA 3M70A 3IIAA 1PM7A 4META 3TNPB 1O3QA 3QOPA 3ES1A 3ETQA 3MYXA 2OA2A 1UIJA 5I91A 1WA4A 2PFWA 3SCFA 5J48A 3S0MA 3WW1A 3H1YA 1NE6A 4XFHA 4XF4A 2FMYA 1YFUA 4LA3A 1J3QA 2PAEA 5AVPA 4DINB 1CAVB 5C6CA 2V09A 3FWEA 2CAVA 4AQ2A 3NVCA 4HN1A 5JSPA 5LEKA 3RYRA 5JCTA 5JR7B 3IDCB 2B5HA 3KCCA 3KGZA 4Z07A 4KWJA 2VQAA 3FZ3A 1WGPA 3L2HA 3O14A 4QM8A 1EYBA 4XF9A 3GBFA 4IEWA 5FLHA 1OFNA 2B9UA 1LRHA 3FJSA 5J7MA 3USSA 1CAXB 2K9ZA 3MDPA 2Q1ZB 4HN0A 2XL7A 1CAWB 1O5LA 4BYYA 5FPXA 2GH2A 4FAHA 5BPXA 4EWAA 1RUOA 1YHFA 3BB6A 4Z82A 4UBGA 2XLGA 1OD5A 4QMAA 1I6XA 2BGCA 3E6CC 1DGWA 2WFPA 3LA2A 5LRSA 2BNNA 2IXCA 2GC1A 1J59A 1O5UA 3PNAA 3ROUA 2C0ZA 4QXKA 4QX5A 5KHIA 1H1IA 1ZZ7A 2D5HA 4XEZA 1CAVA 4IEVA 3MZHA 3H7YA 4B29A 3OGJA 5D1IA 4I0AA 3CL1A 1CGPA 4IEPA 2OZ6A 1CX4A 4YARA 4WZCA 1ZREA 2ZKLA 1YLLA 3HT1A 4O9EA 4XFIA 4IEZA 3H3UA 4EWDA 1UCXA 2IXJA 2O1QA 1CAXA 4F8AA 4MX3A 4I01A 3EJKA 1XE7A 1UIKA 2OZJA 2H6BA 4ORFA 1LKNA 5I8TA 2IXHA 4D7TA 1ZRDA 4P9GA 4UXAA 4MZUA 1X82A 4L11A 4HVQA 4KU7A 2ZCWA 2GU9A 4EV0A 3S7EA 1XE8A 3OTFA 3H3ZA 3HQXA 4YRDA 5JSRA 1L3JA 4XFAA 5BXXA 3KMHA 1DZRA 4IEXA 1X8EA 1DGRA 3E6BA 5BUVA 4HZFA 3DL3A 5HI0A 3EHKA 3BPZA 1SEFA 4E2QA 2GC0A 4MV2A 5CU1A 2EVXA 4ZU7A 1ZNPA 3RYKA 4O9GA 2QDRA 4OLLA 4PIZA 4KU8A 1RTVA 1YFYA 2PAMA 3IWZA 4Q29A 4Q0UA 5E1RA 2PHLA 2ET7A 4IEQA 2PHDA 4JTOA 1FXZA 5C8WA 2QNKA 3UKVA 1EP0A 3WW3A 5CADA 1U12A 1EY2A 1O3RA 3LA7A 4J1WA 5KHGA 2MPFA 4R8HA 1IPJA 4Q0SA 2GC3A 4XFCA 3ELNA 1LB2A 4LA2A 2OYZA 1FI2A 2B8MA 3H9AA 4HBNA 4KWKA 4IEUA 5FDBA 5I0TA 4MGKE 4AVCA 5I8YA 2N7GA 2QCSB 4JVAA 5FQ0A 2VPVA 2CGPA 4GULA 4I02A 2IXLA 3CLPA 3LZZA 3E97A 3SMHA 2Q4SA 3BU7A 3LA3A 2XKPA 3CEWA 2PAKA 5KHHA 3MPBA 4LUMA 4MH0E 2XLAA 4IEOA 3UKTA 3NKTA 1CAUB 1GQGA 5BV6A 4YNIA 2QJVA 1Q3EA 2XKOA 4UBHA 3E5UA 4N9IA 4J1XA 3RPQA 3CO2A 4WVZA 4X6QB 1SFNA 3RNSA 4R52A 4AXOA 4HSLA 2CV6A 5I0RA 4LUKA 5FLIA 3ZDSA 5T3NA 4CYDA 3H7JA 1J3PA 1VR3A 4LULA 1QXRA 2HKXA 5FCCA 3RDIA 3WW4A 4PIYA 3D0SA 2PYTA 2XHKA 2MHFA 3CF6E 3NJZA 4FAGA 4JV4A 2PTMA 2XGXA 1ZRRA 2PA7A 2BYVE 3U10A 3VHRA 3OD0A 3EQEA 4MGZE 5CVRA 2EA7A 4ONUA 4NVPA 1CAUA 3UKNA 1CAWA 1LR5A 1VJ2A 2GZWA 4XFBA 1NXMA 3M3IA 3B02A 5I93A 3G7DA 4I0BA 4AVAA 4RD7A 2IC1A 1RC6A 3S7IA 4YSFA 1SQ4A 3U0ZA 4HMZA 4MUVA 1UD1A 1Q43A 1XRUA 1ZZ8A 2MNGA 1QY4A 1O3TA 1X8MA 1QXJA 3JZVA 4I09A 5E16A 5EFUA 1OI6A 5K8SA 2UY9A 3PLQA 4OFGA 3BALA 4FBFA 4IEYA 5JAXA 4N9HA 1O3SA 1I5ZA 5F1RA 1ZRFA 1ZZ6A 3HIFA 3I54A 1ZVFA 3QACA 1H1MA 1UW8A 1Y9QA 3IDBB 2BEOA 3FHIB 1J58A 3DV8A 4H7LA 2ET1A 2HJIA 3ST7A 3BCWA 3E5XA 3D82A 1ZX5A 2KXLA 4L2NA 2BNOA 3GYDA 4I3PA 3H1MA 4FT8A 2IXKA 2H0VA 1ZZBA 1NYWA 3U11A 1O4TA 1O7FA 4A2UA 5I0UA 4Q0QA 1RL3A 2UYAA 5LRRA 1OMIA 1J1LA 2UY8A 2D93A 3HT2A 2F4PA 1ZZ9A 3LWCA 4Q0VA 4TLFA 4YYOA 3DN7A 1WLTA 3ES4A 4XFGA 5LEJA 4EWEA 3R6SA 2ATFA 3NL1A 4E2SA 5I0SA 1YUDA 2K0GA 2PQQA 4X6RB 1Q5OA 2IXIA 2XLFA 4LLOA 4I2OA 1HW5A 1EPZA 2Z2SB 2Q0AA 3IBMA 4BHPA 2GC2A 5KHJA 1Y3TA 2BNMA 4IERA 4HSJA 1UPIA 4LEJA 4F7ZA 1FT9A 5FLJA 1GQHA 3EO6A 3RZZA 1RUNA 4XF0A 2D40A 4BIFA 2GAUA 4MGYE 2Q30A 4IETA 1V70A 4Q0PA 4ZU5A 3WW2A 3I59B 4HVRA 3NW4A 1RGSA 2D5FA 1ZRCA 4AVBA 2QVSB 2E9QA 4QGMA 4AQ6A 3FE5A 4QGLA 3OF1A 1TQ5A 4ZU4A
chains in the Genus database with same CATH superfamily
2MEV1 3T1MA 2BU9A 3MBWA 4GWJA 3FHQA 4JTNA 3I3MA 2HWE2 1BMV1 3WY6A 1C5IA 2XL9A 3MICA 4IE0A 2VNGA 5HCHA 1MR5A 2A6YA 3AMMA 5FV3A 3WQBA 3FLTA 3ZXJA 4D7SA 1YQ5A 5F6LB 3I7DA 4WM7C 5L73A 1SDDB 1VAVA 5H9SA 4LBQA 4AEDA 4BMEA 1AYN2 1NY72 1CZTA 1ULCA 2DURA 3U4XA 3AB0A 5GALA 1QQP1 5LZ6A 1CPMA 2DCJA 1H8VA 2ZAHA 3ABZA 4WBBA 5FZIA 1LOCA 3F2ZA 4RHV3 3HNBM 3J7HA 2ZXQA 3N9MA 3N4MA 3AKRA 2CAUA 1QWRA 4NPLA 3AYDA 4OCTA 4TYSA 3LD8A 3ZN4A 2EICA 2F4LA 5A80A 3O0XA 1RUJ3 2CTVA 2HEWF 5C8CC 4GWNA 2YV8A 1XE0A 1BKZA 4XETA 3SXWA 5EIYB 3H8UA 2IUWA 3K4DA 4ATEA 1F8VA 3NAPC 2WWSA 4QM9A 4L9BA 3WG4A 1MQTB 3THPA 3ZXFA 5JMOA 4Y33A 5SV5A 3VBRA 4KL1A 5J98B 2VMCA 2GMPA 3N36A 4HVOA 3E5QA 3D3AA 4LO4B 4CCKA 1ZBA2 1ULOA 3QCWA 3DKWA 2RR13 1RMU3 4PIXA 1OXCA 1UU4A 1SBFA 2BWCA 4FP3A 5EJ1B 5FPZA 2ZMKA 3NSTA 4LHNA 3JQXA 3VBSB 1JUHA 4C0HA 2YUEA 2ZMLA 2XDVA 5T5PA 3VHPA 2AR6A 3AZVA 5FPLA 3VLBB 1RUC1 3N9QA 5CFCA 5FMCA 5DAWA 3VZOA 2ZX3A 1TVGA 1RJ7A 1IS5A 4XJWA 5A7NA 3ZSLA 2JD4A 2X53S 2W2IA 3L2YA 1JZ3A 5EPAA 4XF3A 4G4FA 2TEPA 1QJY2 1VBA2 1PO22 2Y0OA 3PURA 4LBJA 3JU9A 4BIOA 1C8M2 2HWD1 4CCOA 3MV11 3P3NA 3A21A 1G9CA 4Y26A 1PM7A 1AR61 1O3QA 5CB7A 3MYXA 3I3QA 4RQPC 4XCBA 4CP0A 3WOGA 5I91A 4QKNA 1E57A 1FMD2 1CWPA 2HWC2 1GU3A 3ZSMA 3SCFA 1W39A 3MW2A 4XYXA 3WW1A 5L9BA 1O6UA 1KDKA 2D44A 1UKGA 3ALQA 1UMZA 4AFCA 2WS93 4XHBA 4A7KA 3UV9A 5IJRA 3TOJA 1BK0A 1GQPA 5DUXA 1RB8G 2D6LX 1GUIA 1ND3B 1SLTA 1QKQA 1B09A 4UFHA 4MOAA 2VUJA 3POGA 3DYMA 2GH8A 4OHXA 3NVCA 4HN1A 5FYIA 3ZXKA 5FXXA 4C0BA 2QTWB 3AMNA 2LROA 4JQRA 4BOWA 3KCCA 5CG9A 1F9KA 1ZM1A 1XU2A 2A6WA 3FZ3A 4CDWA 3L2HA 5FZ6A 3LCPA 1EYBA 3MPPG 5FLHA 3TRSB 1UQXA 1VBC1 4IV3A 2VULA 4FOYA 4E27A 3VKLA 1K12A 3NNMA 1ZBE3 3AZYA 4AG4A 5FZHA 3HEIA 3MUY1 4L8QA 1OF3A 3VL8A 3MW3A 5C3QA 3IB3A 4IGQA 1S0FA 4P9XA 4HN0A 5CKMA 4YW3A 4QQPA 4LK6A 2BOJA 1UU5A 2XONA 1HN1A 4EWAA 4PBPA 3POSA 2BBAA 2A1XA 1MVQA 3U78A 1PK6C 3B7MA 1A8DA 3JCIA 2VBDA 4UBGA 2TNFA 4COWA 4QMAA 3CMGA 5FZ9A 3AKTA 3E6CC 1UZWA 1C1LA 2JDZA 4FTEA 2IXCA 1AL21 2AEZA 2NM1A 5IUQA 1QJX3 3PNAA 4GKYA 4QXKA 1VBE3 1HDKA 4FFGA 4QQLA 1YQ2A 4N53B 5CAZA 3WXPA 3PIGA 3EB7A 5ACA1 1RHI1 2VQTA 2FDGA 3H7YA 1W8WA 3OGJA 1U5ZA 1T2XA 1WW4A 2AENA 3MF9A 2EXJA 1RUH2 2W0XA 4HK8A 3U07A 1WCQA 3DYPA 1WW7A 4QPWA 5FZKA 1YLLA 3IDEA 1OOPB 1NAEA 1R083 3FUOA 3H3UA 4NMIA 5FXWA 2Q8DA 2RE9A 2Q1FA 4C91A 2JG8B 1NCRA 1UCXA 4AQTA 3AL6A 4JDNA 4BK5A 2Y0IA 4JC1A 4F8AA 2JEMA 4I01A 3EJKA 1ZYBA 4Z92B 1POV3 4CZSA 1UIKA 4CRQA 1UNBA 5DABA 2ZGKA 1AYM2 1D4M2 2IXHA 3C7GA 4R9DA 3RWNA 1MQTC 3W5NA 3J8F2 4JGZB 5JLVA 4L11A 1R092 3TEXA 3T08A 1QJU2 4EQVA 2ARCA 3GHMA 3KWVA 1E5HA 4B1LA 3GBWA 4FXGB 1FOD1 1XE8A 3AVSA 5JSRA 5FZLA 1L3JA 1R1A1 4XFAA 2Y6KA 4GKXA 4EN6B 1W0PA 2E7TA 1W2AX 1CZSA 4YZ5A 2WT1A 3KMHA 2VNRA 5FYZA 4NWVA 4IE6A 3A4UA 3U4SA 5HXVA 3W21A 3W5MA 1MS3A 5CNAA 2E6VA 3POIA 2RHPA 1X8EA 3WDWA 2RS53 1ULPA 4LIVA 2WNEA 4MGTA 3GZUC 4JKLA 1JU3A 1VBB1 4YM0A 2EF6A 2Z79A 2HWF1 2ZZQA 4M0HA 1R64A 1N1VA 1XB9A 2FCVA 4FVVA 3WX5A 2VOVA 1GZWA 3PUHA 4HZFA 3DL3A 4IGPA 5HI0A 5FIXA 1HX6A 4GMP1 1SEFA 1G9DA 4MV2A 4JKMA 5FY4A 2HBUA 2ZACA 3RYKA 4I30A 3B69A 4AOCA 2C5DA 5D8AB 4CDWB 4CXYA 4PIZA 4AFAA 2BTVC 4R4XA 3GF6A 5C4WC 3CIHA 1ASJ1 2D43A 3NO8A 1S4CA 5E1RA 4D8MA 2ET7A 2P3IA 5TSWA 2HEVF 3M3OA 3ZXGA 1W8TA 4JGZA 2R042 1FPN2 3NJXA 2QQOA 5F32A 3UKVA 1LTEA 2E32A 3KS7A 1KEXA 4CCJA 2RS31 1UY4A 1GMMA 1H2MA 2JENA 2MPFA 1PZ8A 2HWB1 3TEWA 5DDJ2 3P6BA 1TMF1 1RJ8A 2X8KA 1HV0A 5A7WB 1LB2A 4LA2A 2OYZA 2BVVA 2B8MA 5FJKA 3H9AA 5IHRA 2R0FA 2WJSA 3HMYA 2VG9A 3PUQA 1UOJA 5B2GB 4CP2A 1QGLA 5FZ0A 1S0DA 5A3NA 4Q8LA 1REEA 1RUG1 3LGRA 1K5MA 4AVCA 1Q8QA 2QCSB 3M1HA 4JVAA 2VPVA 2CGPA 4QX7A 2FDIA 4Q4Y1 2WKKA 5E88A 4XCAA 4A41A 4CSWA 3CLPA 1GOFA 5A1AA 2TBVA 4HK9A 1RUOA 2CDOA 5ABJB 4A6SA 2D3RA 1UY1A 3DCQA 2V73A 3BU7A 2XKPA 3CEWA 3SEPA 4YG0A 1UMIA 1C1FA 2DCZA 2LS6A 3TN91 2WUHA 4FTSA 5BV6A 1XOYA 4P9WA 4LT5A 5CIRA 3HOBA 1Q3EA 2NZ9A 4N43C 2XKOA 4UBHA 4R9BA 1W8HA 1IQDC 3V56A 3ZDVA 4K21A 1HLCA 2DTYA 3H42B 1S0IA 3BTAA 3V0BB 1PIV1 2RS11 2J1TA 1SFNA 2X05A 2BERA 2HYXA 2JD9A 4CCDA 4DRVA 5IVFA 1NOVA 1K42A 5DUUA 4LBLA 4QB1A 1YC61 4RSUA 5FLIA 5A7WA 1W9YA 2PQSA 4LITA 5I0RA 5IFPA 4Q27A 1LGCA 4K1ZA 4CYDA 5L7OB 1LCLA 4E8CA 4C1WA 5FWJA 1J3PA 4DPNA 1SG3A 1XNBA 1QXRA 3ZVXA 5F3GA 1W03A 1FNYA 2NLRA 1OQDA 4PIYA 3LPFA 4MXWB 5GLTA 3KV5A 1YQCA 2ZS6B 3AK0A 1WW5A 1DBNA 3MEPA 1YI7A 2PA7A 2W87A 5LBEA 1I3HA 5FMBA 3THDA 2XVGA 4Q8KA 1BJQA 4KH9A 2XVKA 3U10A 3VHRA 3WG3A 1XSQA 4CUCA 5ABJA 3EQEA 4RS5B 1F35A 4RHV1 1WWYA 1EPWA 2Y6JA 3A23A 1RUC2 2WLQA 4NVPA 3UKNA 2R043 4AI9A 1CONA 3HQRA 4Q4V2 4YW7A 3T0BA 2ZABA 1Z78A 4RGAA 3VD7A 2BBVA 3BPSA 2ZEYA 5FREA 3ZFFB 2VY0A 5IVYA 2DU0A 3MV01 3HAGA 4FPOB 1T6GC 3G7DA 5I93A 4AVAA 2HWD2 4BB3A 5H9PA 3J4UH 1WMDA 1G7YA 4JDMA 2ZBJA 4BQXA 5CFDC 1RC6A 3S7IA 2QKDA 1W6PA 3TB0A 1S0GA 1QDOA 2VNOA 4CP9B 2I07B 4GA9A 3VBUC 1W8FA 2QUOA 1UYXA 2RR11 3ACGA 2JIGA 5L7OA 1RMU1 1TG7A 2MNGA 2W94A 3Q8EA 1O3TA 2RDRA 1YQ6A 3ZYIB 4AZZA 1QXJA 4P9LA 3HN1A 4KBBA 4SLIA 5D8AC 5E16A 1W6NB 2XMLA 4CDWC 4MXWA 2W1SA 5FR3A 2QQVA 3U75A 3PLQA 4OFGA 3GZTB 2GN3A 2RVAA 4QQOA 5L19A 4AEJA 4CDUA 1WZXA 5DAXA 3VBHB 3WUCA 2R30A 1Q8SA 3VKFC 4RS5A 5ANQA 1KXGA 3G6JB 3I2JA 4MG2A 2EXIA 3IIIA 4HG6B 1JZ7A 1OLME 1ND2C 2Y8KA 4ZONA 1V9U3 1BLZA 2XBO2 4CCNA 3LPGA 3WNOA 1OVPA 1PM4A 2WN3A 3WG2A 1U0AA 3QACA 1WBFA 2VZQA 2VMIA 5KC6A 4XPVA 1W8UA 3S5AA 3A22A 4FSJA 2WSUA 1SLLA 1A78A 1UW8A 2DTWA 2WAAA 1JYVA 4I3GA 2C9KA 4LBQD 1RYYA 4FOWA 3TYJA 2VQ0A 3I3EA 1NCQB 1DQ0A 2HJIA 1YCIA 3BCWA 3D82A 4L2NA 1W9TA 5D2AA 1NZIA 3I3BA 2VAUA 2RDSA 2WS91 1A8MA 3O7OA 3C8XA 4I3PA 4CP9A 5LK7B 3HBZA 4QDRA 1I1EA 1VRH3 4XABA 3PVNA 1ZZBA 1UY3A 3VZNA 5AC91 1F15A 4Q4X3 2JECA 4AGRA 4O65A 1GWKA 1Q8PA 2BFUL 3NNJA 4GB33 1O4TA 5IT6A 4CPBA 2V72A 3VBFB 4UFKA 1NQJA 1W6NA 2WQ8A 5I0UA 5ACA2 1SCSA 3A7QA 5IVEA 2UYAA 3BTZA 4LORA 1STMA 4CEWB 5JI9A 2BUKA 3UETA 1JYNA 1NX9A 3VBOC 4UFMA 1MPXA 2D93A 1ZBE1 3IMMA 4DO0A 5LBBA 2GP5A 4D6QA 1UPSA 2F4PA 1G9FA 1NKGA 4Q4V3 5FZ1A 3ACHA 1EAH3 3ES4A 2NN8A 5DZGA 3AL5A 4E2SA 3MLJA 4W4ZA 5I0SA 4MSVA 4TZDA 2HH9A 3FL7A 2R063 3OUIA 1OHFA 4NHKA 4Z1VA 5FKCA 2Q5TA 1JZ8A 1MS8A 3IPVB 1SZBA 3VV1A 1IZ3A 3ZN5A 2JJ6A 4YM2A 2EAKA 3PIJA 5FJHA 1PVC1 5JOZA 1OSGA 1QJX1 3IMNA 5KHJA 2JG9B 1RIRA 1VBE1 4IERA 1QJZA 1IOAA 1ODNA 3FBMA 1UPIA 4M3CE 4V2VA 1N3PA 2W47A 4WM8B 4BQ3A 1FT9A 5LY1A 1LHOA 3BKZA 5JPMB 5FLJA 1FOD2 4QHOA 4PLMA 2A3YA 5JIUA 2ZGLA 3FC0A 2P2KA 1K5JA 5FKBA 1W05A 4XF0A 2P34A 1GFF2 5GZEA 4BQ5A 4CP1A 4NHMA 5HV0A 1I9RA 1LEMA 2Q30A 4OULA 3B5LB 1PNGA 3OBZA 4IETA 4Q0PA 3WW2A 3X29B 1MACA 3SNMA 1RVF3 2WSVA 2RV9A 3NW4A 4CEWA 3KT4A 2DVGA 2V4AA 1QHDA 2D6MA 1OH4A 2DYCA 2KM2A 3OYWB 4QQHA 3WUDA 4AFBA 1ST8A 2W3JA 2VMFA 3BYWA 4HFSA 3ZFFC 4E8DA 3ZN6B 1POV1 2ARBA 1TQ5A 1UWWA 4L99A 3ZSJA 2RJ2A 1IG0A 3CNAA 2FQPA 5BYNA 2WNVB 4UFJA 2EALA 5JWPA 1BQPA 1MZ5A 4XMAA 1V6KA 1QMJA 5CKNA 2GNBA 1G6NA 4V2WA 1HIXA 3SEEA 2P17A 3IPVA 4QPGA 4HPKB 3LAGA 2EAAA 5LW9A 3J9SA 2R073 3WDXA 1MS9A 5BNPC 3VD9A 4WM8A 4K9SA 5FAXA 2WNOA 1H1AA 2OQ7A 2JB8A 4PDWA 1OD3A 2FDJA 4IESA 4Y5TA 5LA9A 2WZPP 2RS51 5I8SA 4ISRA 1PMJX 1TMF2 4QWNA 2H6CA 1EUUA 3MIGA 2WC2A 4XFFA 5DZEA 3TNQA 3VBHC 2WABA 1CQ9A 5FY0A 5JSOA 3WSOA 3HD8B 1JU4A 4ES8A 2ZPXA 5JOWA 3M4FA 2UU8A 2WYSA 1Q8VA 2Y6GA 1J3RA 4NHLA 3OYWA 4BLIA 1OURA 3D8CA 2VBPA 3SKJE 3ZIXA 4IV1C 1UXZA 4H55A 1EV12 1W8OA 4KWLA 4Q4Y2 1YJKA 2WNUC 3ZN6A 4FFHA 2HYKA 1OC1A 1YWKA 2R16A 4BQWA 4JRLA 1NCQC 3ACLA 1MVEA 3R4SA 1W2UA 1OLMA 1V0AA 4W65A 5AFEA 1W6OA 4UT5A 5JMCA 2PHXA 3KV4A 3NV3A 4M0NA 5FZFA 2X09A 3O1VA 5DAQA 2CY6A 5FQ0B 5FZMA 3PVBB 1YNAA 4ATFA 3CHXA 4HPKA 1TNRA 1F5FA 4FPCA 4UI9L 4Y20B 5KXBA 2VBBA 1REDA 1WLDA 2WR9A 1WLCA 4P5HA 1YFWA 2A70A 4DZGA 1PIV2 4YW1A 4J6GA 4OYUA 5IW0A 2SBAA 1IPKA 4E2GA 5C3SA 2A71A 3MI8A 4WM7A 5JOXA 2ORZA 2ZTNA 4W50A 3WF1A 1O8SA 2W68A 2UYBA 3LKJA 3ITQA 4N90A 3TNPB 4META 4M00A 2CHHA 5LB6A 4AFDA 4QPIA 1UIJA 3BOWA 3I97A 1BEV3 3PJQA 4QPYA 4CE8A 2XHNA 3MFAA 2ZGNA 1F4AA 1NE6A 2R49A 3GXUA 4FPJA 2FMYA 4H3WA 5C8CA 4FPLA 5J96B 4ZPIA 3VZKA 1J3QA 1AR92 4HANA 5AVPA 3ZMOA 3RZGA 1CAVB 1H2KA 4UFIA 1RUF1 1IKPA 4B4QA 1SHWB 2E33A 3NAPA 2YU1A 4KGGA 3LEIA 4AQ2A 3WZ1A 1DFQA 1MEC2 3VZJA 3WHTA 2PHRA 5FPUA 5FBJA 3AZZA 4Z07A 4YVWB 1ULEA 3FBYA 4Q4W3 4Y4RA 2VQAA 3LFIA 5A3PA 1GWMA 2ENRA 3O14A 4UF0A 1JXNA 1H0BA 2WRAA 4XF9A 4IEWA 3HWJA 2FD8A 2B9UA 1LRHA 4LBOA 3FJSA 3ILNA 2ZHMA 5K0UC 1NXD1 1IQAA 2GP3A 2J1SA 2YBPA 3ZSKA 3USSA 2K9ZA 4OUSA 4XQ4A 1JYIA 4M3CA 1AJOA 3WDVA 4NOTA 5FPXA 1CAWB 1O5LA 3BODA 3NKGA 5A3LA 3FFZA 4XUNA 5BPXA 4AW7A 3IKWA 3MGUA 4Z82A 1DLCA 2Y34A 1LAJA 2O0OA 4FXKB 2F6BA 1OD5A 5FY1A 4AWDA 1LOBA 2XB6C 4HKLA 1I6XA 2BVBA 2RJLA 2BGCA 2VZTA 2ZHKA 2WFPA 1BBT2 5JXHA 2PHTA 3C7EA 3LEMA 2C0ZA 2E7QA 4QX5A 1PK6B 2WZR3 4RQPA 5A7PA 3SISA 1HQLA 1ZZ7A 3VB9A 4FTBA 1H8TB 1WW6A 3WP6A 2YC4A 1CAVA 5F39A 2JDNA 4IEVA 4I0AA 2ZEZA 5IATA 3AKQA 3M7AA 2ZZJA 4LIUA 5FMOL 4YARA 3M3EA 2BP6A 1AR83 2ZEXA 2ZKLA 4JZRA 1S0BA 4QX3A 4V1PA 4C1XA 1Z7S2 4O9EA 4IL7A 4XACA 4XFIA 3IZOA 5ERLA 3VDDC 2OXBA 3AXDA 2O1QA 3FN9A 1H9PA 1Y9GA 4MXVA 4MX3A 3MFCA 4IE4A 1CPNA 4CUBA 1XE7A 2H6BA 4UW5A 4GXLA 3N7MA 4D7TA 1ZRDA 1X9PA 2JE7A 4UXAA 4MZUA 4AK3A 5AC92 3H3LA 2OUJA 4KU7A 4D69A 1REFA 2QQMA 4HXCA 4OUMA 4PI2A 5CKQA 1HXS2 1TEIA 3JBG3 1CJPA 2ZCWA 1H4HA 1QDCA 3TEYA 2BGOA 2BPA2 2G9FA 1MZFA 4O61A 4XDQA 4QXBA 2B46X 4NR1A 4Z2AA 2PLV2 3RG0A 2Q8CA 4H2AA 1PK6A 4OZOA 1ULGA 3USUB 1GZTA 3BU0A 5BNQA 1RUD1 1UAIA 3KB5A 3O0WA 4YGBA 4DXTA 2OT7A 4BM8A 3WF2A 3GHNA 3WHUA 5HCAA 2RM23 2QZ2A 3AJYA 3CBNA 5F5CA 4P9YA 1HQWA 3OGGA 1JW6A 3EMRA 2YHJA 2VO5A 2WWUA 1VAMA 2CU5A 2YYOA 4PHZA 4DIQA 3K48A 1RUI3 3RMYA 4MGSA 1LHVA 2AUYA 1ZNPA 4ZY9A 3RRDA 5FZAA 4ZU7A 3KLSA 1VRH1 3GBGA 4O9GA 2XWJB 3W20A 1PVC2 2D7FA 5DAVA 4Q4X1 5F2SA 1YFYA 2JDUA 3PMSA 5DG1A 4BPZA 1IKQA 4GB31 3PTYA 4A4AA 4S2HA 2PHLA 1UY0A 2VZ3A 1CR7A 2PHDA 4LHLA 1F2NA 4QB2A 4XILA 1FXZA 1JYXA 2W91A 5F7UA 4GZ9A 1KS5A 2E53A 4EN8B 3AFGA 3W58A 2D6KA 4ZXEA 1EP0A 2O8OA 3WW3A 2H0BA 5JI7A 4N8MA 5CADA 1OBNA 1AX2A 1O3RA 5C4WB 3LA7A 4J1WA 5T54A 3ZYPA 1ENSA 4CU8A 3VHNA 1NA1B 3M3QA 4XFCA 3SITA 1MQTA 2FBEA 5IK4A 1E5SA 1EAH1 4YVWC 2QBXA 3ZX7A 2HWE3 4KWKA 2W39A 1K3IA 4IEUA 4LE4A 4CXWA 3WP3A 2R061 4JCKA 1OKQA 3O1UA 1GOGA 3ZM8A 4NHYA 1W99A 4GH4C 4MGKE 4RR3C 1VE0A 1VALA 2N7GA 4ES9A 1AYN3 4QKFA 3N9NA 4GULA 2ZGOA 4I02A 3VBSA 1GP4A 2IXLA 3LZZA 2GSYA 1Y9MA 2LALA 2OVUA 3E97A 3OPWA 2Q4SA 2ID4A 1O4YA 2R6QA 4HT1T 1XYPA 1DGRN 1UZZA 5LASA 2PAKA 5FP3A 5GLVA 4IEOA 3NKTA 5J37A 4AEDC 2R0HA 2QJVA 3I2KA 2J1EA 1TME2 3AX4A 2J1AA 3WDTA 3QLQA 4J1XA 2ARAA 5DN2A 1XJAA 2PELA 1H8TC 4GJYA 5T52A 5C4WA 5F2WA 4D0QA 1E5RA 4IUGA 4LNVA 4JX0A 3THCA 5FZ8A 4NRPA 3T3YA 1HRV1 4XC9A 4N43B 4HSLA 4AXOA 4EZ4A 2DVFA 5LATA 5J1XA 1ZBA3 2DUPA 3HBKA 3IN9A 4LUKA 5T3NA 5IVBA 2GMEA 3LEKA 4IW3A 4C90A 4CPBD 1WCSA 3GJBA 2BDRA 3HVDA 1US2A 1ND3A 4LULA 1OQ1A 1QJEA 4LKFA 5FCCA 4XBLA 4G9SB 2I74A 4QKDA 3AMPA 5C33A 3D0SA 2PYTA 1JH5A 5FYHA 3I4IA 3CF6E 2WT0A 2FZ1A 1V6IA 3NJZA 5LY2A 4A45A 4ZZ5A 2JE9A 2WT2A 4UOJA 5A7SA 2BYVE 1COV2 2DVBA 2R071 1OA4A 2E7AA 1VBD1 2BFUS 3OGRA 4NPRA 3OD0A 4Z2WA 5CVRA 2QQJA 1QJY3 1VBA3 1PO23 1HRI1 1C8M3 1LOEA 2Q8EA 4ONUA 4MYEA 4FO9A 4NIAA 5K9YA 2GZWA 5CFCC 5GLZA 1FMD3 2HWC3 5T5OA 5IAXA 1W6MB 2C24A 1OVSA 2ZGQA 4L92A 2IC1A 4MADA 4DXZA 3APBA 4DXRA 3WLUA 3LDRA 4N43A 4AI8A 4D3WA 1W3VA 3B9CA 3N35A 4CEYC 1UD1A 4YVSB 3O1OA 1Q43A 4N53A 4PF1A 1NLSA 2WFF1 1FX5A 4JAAA 5F37A 1GOHA 1CVNA 1H4GA 1RXGA 1UY2A 5CFDB 3WQ0A 2G1MA 1RUE2 2WYFA 4KWUA 2VOKA 3H0OA 1X8MA 4KGQA 5EFUA 1IS3A 1GR3A 2R7EB 3VKNA 1AR72 3VBUB 3VDAA 1AX0A 1RUF2 3NV1A 3BALA 3ZYBA 5FXVA 3DPRC 4YM1A 4DOUA 1OOPA 2B4KA 3POWA 1X50A 3HR9A 3BUCA 1WCDJ 3VD5A 3OUJA 5JAXA 4CDQB 1O3SA 4Y1ZA 1I5ZA 1POV0 2JG8A 4X8PA 3OJBA 4PBOA 2P4EA 1XXNA 1ZRFA 3LEGA 1OT5A 2PHFA 2VXJA 1Q8OA 3HIFA 5F8PA 5GM0A 1LOFC 4JDOA 2JIJA 4PI0A 1NA1C 4H7MA 3I2GA 1NUKA 4IV3C 2VW0A 5JOYA 3UT0A 1BEV1 2J1RA 1S1AA 3ZXAC 1ND2B 3THTA 2RMU2 3CZJA 1UU6A 3OY8B 3V65A 3WDUA 3WV6A 3UNPA 4UW3A 1ZX5A 4P00B 1D2QA 3GYDA 3SKVA 3BIEA 4D94A 1J84A 1UYZA 5KR7A 4FT8A 1AJKA 2IXKA 3P1IA 4URAA 2FDKA 5FK8A 3LE0A 5CFDA 3JD72 5FUPA 4A7YA 1RUH3 4BE3A 4PCRA 1PO11 1B35B 1ALYA 2WINB 4A2UA 4XIKA 3WF4A 2MEV2 1F31A 1RL3A 3WP5A 2WWJA 3VBUA 5LRRA 3WNMA 2A5ZA 1BMV2 1JYWA 4EYUA 5GZDA 1LGBA 4FCAA 3IAPA 1RINA 5D8AA 3OGVA 4XE9A 2G9GA 5FPVA 4QDSA 1TE1B 4Q0VA 3LIGA 1E5IA 1KFUL 3URFA 1C4RA 1AYM3 1D4M3 1D0HA 2Y26A 3LSEA 4XFGA 3J8F3 1PGW1 4D7YA 2ATFA 1UOFA 3VBOB 3NL1A 1V6OA 1QQP2 1R093 1UYPA 1QJU3 2YY1A 3KF5A 4G3YC 4LO7A 4BCUA 1NCRC 1N1SA 1YIFA 4X6RB 4BWOA 4EE2A 2BWAA 4LLOA 1YEWA 2YBSA 3AFKA 2Z2SB 3OY8A 2Q0AA 3IBMA 4MGQA 2GC2A 5FZ7A 1Y3TA 3OUHA 2WZR1 3ME2A 3WF3A 4AGVA 5DQ0A 2NPIA 2Z42A 4AHZA 3NNFA 2A3XA 1C5HA 1QOOA 1C28A 1MZ6A 2D40A 3T4VA 1VIWB 5C3RA 4MGYE 1UYYA 3RZLA 5KWRA 3KVBA 1RUD2 3O1RA 3I3DA 2VZOA 5F5AA 1JN2P 4YGEA 1YI9A 4K1YA 2XJUA 5FZDA 4ARXA 4FI9A 1XU1A 2E9QA 4QGMA 5JPNB 1W28A 5A3TA 2EIDA 3BVCA 3NRUA 4EN9B 4ZU4A 1WA6X 5F6KA 4BQYA 5APAA 1FPN3 3VBOA 2YPJA 3M3CA 5EQUA 4M01A 1HB1A 4E4SA 1RUJ1 1CESA 3R0RA 4LHKA 1PMIA 1JYTA 2WL1A 4YVSC 2DUQA 2X5IC 3V0BA 3JBG1 2P1BA 4E4HA 5EWSA 1N1YA 5DDJ3 4GQ7A 3H50A 2W95A 3HPNA 3PDQA 5FYYA 3T0AA 1KJLA 2VCMA 3J26N 2BRTA 4CDXB 5FZOB 3KGLA 4WVMB 1AR62 3ZFGC 1L7QA 2W52A 1JZ5A 3EBRA 2JKBA 3ZO0B 4KNCA 2IZWA 3AKPA 2Q8OA 5A32B 3T1LA 1IHMA 1XYNA 2AREA 5C3PA 2ZOEB 3SHRA 2RM21 4DFSA 3ZMNA 1RXFA 3K4AA 2PMWB 4GIQA 4CDQC 4WZFA 5BNPB 1ZZCA 3IDAA 2DDUA 2VZVA 4A44A 1LEDA 2XVLA 1LENA 4LBNA 1RUI1 3GCXA 5E89A 2VTXJ 1ENQA 3AVRA 2TUNA 5J3UA 2DVDA 3PMEA 4HLTA 4UWDA 1DZTA 1S2BA 3AP7A 1GZCA 2I2SA 2P3KA 3FX3A 1QOSA 2XUMA 3BIWE 4KG0A 2ETEA 5FMDA 2VZRA 4Y5SA 1VBC2 3OPZA 3ZOIA 3H1WA 1BZWA 2VMGA 4IV1B 3KM5A 2VC9A 1LHWA 1PZ7A 1XSRA 2FMDA 4KQ7A 3UJQA 2ZGUA 1OUSA 1W0NA 2I45A 5EZWA 3UGHA 3ZFFA 4W6WA 2WNUB 4PJYA 3PL0A 2OPKA 4XXPA 1SACA 4K8FA 4B3NA 5DUWA 5JIAA 1CIYA 3SCHA 4AAXA 4EROA 5L9VA 5FP4A 4WVMA 2DCTA 3M2MA 1B35C 4K7JA 2OKXA 1NT0A 3VDBA 2JDKA 5FMOS 3AP9A 1AXKA 4BMBA 2K46A 3E6DA 2Q1MA 4Q1PA 4XDPA 1HRV2 3OG2A 3WNPA 1AL22 4NJ4A 4BJ0A 3C3VA 2ZGTA 5KBFA 2O8QA 3M70A 3IIAA 5F5QA 5A33B 1AYN1 5C3OA 5HCBA 5BNPA 1SPPB 3ES1A 3C7OA 3ETQA 3FHAA 1RHI2 3QOPA 4COZA 1S0JA 3NWKA 3VKMA 5C9AB 1MS4A 1WA4A 2PFWA 4NIDA 4HONA 3T4HB 2A75A 5A3MA 3B94A 5J48A 3S0MA 1SLAA 3H1YA 3B9IA 3ENRA 2P3JA 4XFHA 2DUOA 3VBHA 1RUC3 2VVDA 4XF4A 4AYUA 1HJGA 1YFUA 4BZ4A 4ET7A 4E4DX 4DINB 5IK7A 1VBD2 5FO7B 4XZUG 5C6CA 2V09A 3FWEA 2YGLA 4NIIA 4CUGA 2HWD3 3T30A 4YG3A 5JR7B 3IDCB 2ERFA 1PVXA 4KWJA 4JHZA 4W8JA 3SLIA 1WGPA 4Q2FA 1NCQA 1D2SA 2JX9A 1ZBA1 1OFNA 4YGDA 2BGPA 2CSGA 1AF9A 1P8JA 2VU9A 2X29A 4NAOA 3CQOA 1CAXB 3RZMA 3MDPA 2Q1ZB 1HN0A 3GCWA 1UZVA 4JRAA 1JZ2A 1DYPA 4BYYA 3ZYFA 4LO6B 1PGSA 3O1SA 1R1A2 2C4XA 3AZWA 3OPTA 1GBGA 1VMJA 2GH2A 2V5YA 4QT6A 3WEZA 1YHFA 3BB6A 2EIBA 3VBFA 5K0UB 4CVUA 4NAMA 1HB3A 2WFF2 1S0CA 4QX1A 4YFWA 4LLFA 1KDMA 3KF3A 1R081 4OI2A 2XLGA 3ZKYA 5JZGC 3OBTA 3PJYA 3QH6A 2ADEA 3QH7A 1DGWA 1VBB2 5F5IA 1QJY1 1VBA1 2HWF2 1C8M1 3ROUA 2XBO3 2BZDA 3CJIB 3GNEA 5IFTA 2VTFA 3FMGA 4CU6A 1H1IA 4XEZA 5FZ4A 4KG8A 1M4WA 1LECA 4CDUC 4CDXC 1FMD1 2HWC1 1GNZA 2WIIB 1A34A 4D6SA 5A70A 1VMFA 4CU7A 3LDKA 5D21A 1IS4A 4IEPA 1CGPA 2OZ6A 1CX4A 4WZCA 1ASJ2 4YZ4A 3OSDA 1ZREA 5EXOA 5FZCA 2G19A 1PNFA 3HT1A 1W9WA 2XJQA 2EIGA 2FHRA 2JG9A 4MHUA 4AGGA 1WD3A 4JKKA 2JDYA 1ZRIA 2RS32 2VW2A 4JGYC 5CEHA 1G86A 1CAXA 3POEA 3WCSA 2HWB2 5FO9B 4Y22B 4XHXA 4AHXA 4Y4YA 2EXKA 2OZJA 4ORFA 5FPBA 4QX2A 1LKNA 3HJRA 2DF7A 4PF5A 5ACA3 3B00A 4NRMA 3SH3A 5I8TA 3MIEA 1W6QB 2W1WA 3VDDB 3PU3A 5K0UA 3VGIA 3GM8A 1X82A 2DU1A 4AEKA 4HVQA 1SLCA 4NN0A 1O59A 2Y6HA 3ILFA 2GU9A 4FPGA 1RUG2 3VUOA 3ZXDA 2E51A 1SLBA 4BXFA 3H3ZA 5FYSA 4FOVA 2DV9A 4YW5A 4YW4A 4LXLA 1ENXA 2Y6LA 1ODMA 5H9RA 4IEXA 5A6ZA 2ZKNA 4R9CA 3S6PA 1FV3A 2QDNA 1DGRA 2WNVA 1LGNA 5FRAA 4XDOA 5EP9A 3TN92 1H2LA 1GNHA 3K2OA 3NJYA 3T2PA 3IAQA 2B39A 3EHKA 1PGL1 4XXAA 3NNGA 4E2QA 3T09A 2WQ4A 4K40A 2EVXA 5CU1A 3T2QA 5EJ3A 1N47A 1JS9A 1FOD3 3K51A 1JOJA 4IXLA 2HLEA 2RS12 1N3OA 1N3QA 3GALA 1RTVA 2ZGPA 5FWEA 2PAMA 3IWZA 4OHWA 4Q29A 5C9AC 5HPOA 5KXEA 4Y22A 3GGLA 4OZXA 2WA3A 4IEQA 1UXXX 4QXHA 3ZFEB 1JOBA 1S2KA 1MZEA 5GZCA 3WNLA 1GZ9A 3ILRA 2VW1A 5F9TA 3RFRA 3AP4A 4MHRA 1EY2A 2HWF3 4XTMA 3AYCA 2WAOA 4R8HA 1IPJA 2JDAA 3JUUA 4XJUA 4DQAA 2AACA 1AVBA 1X36A 1JHNA 1PHMA 1AYM1 1D4M1 1V6LA 4QHZA 1JTZX 2E31A 3AJZA 4RN5A 4UFLA 5FY9A 1SFYA 2BQPA 3SQOA 3BTXA 1R091 2KR2A 3RZHA 4QDQA 2P37A 2XXZA 3D6EA 1GNYA 2CNAA 1ASJ3 1WUVA 4RHV2 2VVEA 5I0DA 3ETPA 3GZAA 3CDZB 5FQ0A 3JB8A 1JI6A 1HKDA 3JQWA 1JYCA 2XQXA 3ECQA 3JB4C 4NRQA 1G8WA 1RUJ2 2W92A 4Y20A 3MLKA 2AZ5A 5G05L 3WQ1A 5KXCA 2HWB3 3RI8A 3LA3A 1Y43B 2RDNA 4GH4B 2QQUA 4RR3B 5LWBA 1TMF3 3AM2A 3AXEA 3NJVA 3OEAA 3MPBA 2P3YA 4LUMA 1C8NA 4FOQA 4OI4A 1CAUB 1W0OA 2A6XA 1XNDA 2Y64A 1OQEA 1BCXA 5FP8A 4Y1UA 1KQRA 4PQ9A 3CJIC 4PQQA 2RR12 1SBEA 2FCUA 3I2IA 1RMU2 4URTA 4PDWC 2VGDA 1APNA 3RPQA 3CO2A 2B9VA 4WVZA 4LBQB 2ZEWA 1EV13 3RNSA 4Q4Y3 3MIDA 4QHBA 4AEDB 4R52A 3K46A 4UW4A 3D5OA 4U2AA 3NV2A 2HEYF 5A1LA 4ASKA 2VM9A 2XQRA 4XUOA 3OBRA 2R041 1FPN1 2VZ1A 2L9LA 1CZVA 1GP5A 1VR3A 2JDPA 4LOSA 3ZXEA 3RDIA 3KD4A 3OEBA 5L9RA 3RS6A 4AI3A 2UWAA 2JWPA 3DUIA 4PT6A 4RL7A 1WMXA 2OUHA 4D6RA 4LK7A 2MHFA 5SV8A 4YVWA 5C5TA 4GWIA 2XGXA 4JV4A 3T2TA 2QQKA 4M4PA 4RGKA 2VZSA 1PIV3 1CIWA 3ACIA 3KQRA 4DNYA 4AI2A 1OF4A 5FPAA 3N9LA 2CL2A 3A0NA 3EYPA 4MGZE 3KHCA 4GH4A 3VBRB 4WV8A 3K4ZA 4FPEA 5JUVA 1D0GA 5GKAC 3KVAA 1CAUA 3KQ4B 1CAWA 4ZXKA 2WS92 1LR5A 1VJ2A 4LO8A 2Z4FA 4XFBA 3VHOA 5CYYA 1H9WA 1AHSA 2A3WA 4UYBA 1NXMA 2JXAA 4FFFA 4OMCA 3M3IA 4OHVA 5A7QA 4P5YA 1EUTA 1O91A 4I0BA 4ZKTB 4COUA 3BTYA 1WMEA 3Q8BA 2YU2A 1DP0A 5F3CA 1A6CA 4IGOA 5CFCB 3BI3A 4YSFA 3WR0A 1AR93 1SQ4A 2XJVA 5DZFA 3U0ZA 3AKSA 3E1F1 2W5FA 1UO9A 1V9U1 4HMZA 2V4VA 4QPIC 5IWFA 1GLHA 1H8TA 4YWAA 3AYEA 4XTPA 2IFRA 1ZBE2 1MEC3 1ZZ8A 5FUIA 1QY4A 3LF7A 3RSJA 1LU1A 2CWSA 5AVAA 3ZYRA 3JZVA 4I09A 4BLJA 2DBIA 5ANNA 5KC5A 1OI6A 4CEYB 1NG0A 3HNYM 1ZA7A 3KV9A 5K8SA 5JVVA 4OHZA 2VZPA 1W9SA 1H6YA 1WD4A 2PHWA 5BNNC 4DXSA 3T0DA 2WO3A 1W2TA 3EXUA 2LTNA 3ZFEC 2F17A 2WBKA 2JDMA 4N9HA 3GDBA 2VR4A 4W6YA 4Y1XA 3ZIWA 1I5PA 3MIHA 1LJ7A 4XQDA 5FY7A 2BW8A 4B4RA 4XQWA 1QJX2 2OPWA 2XJTA 2DFCA 4JQTA 1YRZA 1CX1A 3DPRB 5T5LA 1VBE2 4E4ZA 2GNDA 3ATGA 3I54A 4KBZA 5DMYA 2ADDA 3CZUA 3LIHA 4H14A 5A6QA 5B4XA 1XBFA 1WBLA 1H1MA 5HV4A 3PTRB 1ACCA 4FP2A 2Y60A 3FHIB 4WVVA 5FBZA 1J58A 4LE3A 1BBT3 1V6MA 2A73B 4S2DA 3DV8A 4DUXA 2VUCA 2ET1A 2CDPA 3QD6A 4AHWA 2KXLA 3VZLA 4IV3B 1DYKA 1Z0HA 3C7FA 4Q4V1 1TZOA 1R082 1KS4A 1BK1A 3N9PA 2ZJCA 2G4IA 2H0VA 3DF0A 4QXCA 4Q5OA 2JB4A 3USUA 3O1PA 2OX0A 2RJKA 3U11A 4S2FA 1D7PM 5FYCA 2VCAA 3KHBA 1KRIA 1O7FA 1W90A 3H8OA 1LULA 1Z7S3 4DS0A 1JHJA 4Q0QA 4XBNA 2WN2A 4CEYA 2BJSA 1MS5A 2YDEA 1KJRA 1OH3A 2ILMA 2YZ4A 4PLNA 2UY8A 5KXDA 1VPHA 4AVSA 2D6PA 4AVTA 5M0TA 5HBAA 4TLFA 1DU3D 4YYOA 4JHTA 1IS6A 4RYDA 3DN7A 1WLTA 2IVJA 4Y3OA 3FLPA 3RJ2X 2VUAA 4EWEA 1LU2A 3DPRA 5C71A 5LEJA 1F4HA 5AC93 3VD4A 1OFSA 4SBVA 4YZ3A 2DFBA 3ZR5A 1RVF1 1DYOA 1HXS3 3J7MA 4U36A 5C5UA 4AI0A 2RS52 2OQ6A 2XLFA 4XAAA 4I2OA 4ZS3A 1L7RA 1HW5A 1EPZA 2QQLA 3K75B 5DUVA 3I8TA 1ENRA 3WG1A 5IYYA 5K7PA 2PLV3 1LOFA 4NIGA 2A6VA 2WO2A 2BNMA 1DQ6A 2XBO1 1NA1A 5IVCA 2FZ2A 4GD4A 1JBCA 4W6XA 2XPJA 1NCRB 3AP6A 1W06A 2DVAA 5LBCA 2VCBA 3VL9A 4LKSA 3K77A 3WDYA 4L0PA 4F7ZA 5JXGA 1AXYA 1GQHA 2LW8A 5FYUA 1RUNA 2Z5WA 4HKWA 1T6BX 2NQYA 4LQRA 1URXA 2IFWA 3RJRA 1MS0A 1FYUA 3MF6A 1PZ9A 2K2SA 1DGLA 1LOAA 3VBRC 1H6XA 4DY5A 3O1TA 1AX1A 1V70A 3ZXLA 4ZHNA 1UX7A 1W8ZA 1UF2C 3GZEA 3I59B 4HVRA 5IK5A 1GV9A 3RVHA 1DLLA 1PVC3 2UWCA 2QVSB 1UOGA 4AQ6A 3OF1A 1YIPA 4XUPA 1PGL2 3HQUA 4OI0A 4QU1A 2P6HA 3RWKX 5FOBB 3AMQA 1WLWA 3K3OA 4S2GA 3O0VA 5L36A 1NZCA 2EXHA 2JICA 4TXWA 1KD7A 4FPHA 4LTAA 4P08A 4YW6A 2B7YA 3OGSA 1NLQA 3RYPA 2CWMA 5CG8A 2CGOA 1V00A 4TSVA 1S55A 1GZWB 1VAKA 3LSDA 4A42A 3NQHA 2JKXA 1QIQA 4NROA 4BH9A 4CU9A 4BXSV 5FP9A 2C26A 1YYNA 2QQIA 5FK7A 1CD3G 1DIWA 4MGIE 5J09A 2R1BA 3MW4A 2X5IB 1M06G 5A6YA 4BQ1A 4P14A 3MLLA 5JR2A 1VB2A 2YC2A 1XNTA 5IK8A 4BQ2A 2YBKA 3ZFGB 1RITA 2VE1A 1ULDA 4DB5A 1J1TA 2Z69A 3NV4A 4MLOA 3L9JT 1NE4A 2VNVA 3FFQA 3VZMA 1XNCA 3I59A 4UAPA 5LA1A 2AH2A 3HNMA 4B1MA 5BY5A 4XF1A 4QGNA 1O4ZA 3OCPA 1Y4WA 3Q9OA 4DEQA 2VL4A 1VP6A 2VECA 3D0JA 4OQ8A 4LO5B 3SCGA 2G9ZA 4IE7A 4K20A 1XPWA 4FQZA 5B4NA 3BOPA 1V6NA 3VBSC 3SC7X 3RI9A 1TME3 4DMIA 4YZ2A 1DCSA 1JZ6A 1X7NA 2D97A 4R9AA 1ONAA 2D3SA 3KV6A 4XW3A 3OB8A 3FLRA 4A3XA 2NP0A 3ZYHA 1K5MB 1JMUB 4FPFA 4INDA 4OMDA 4YM3A 1W6MA 3KT7A 1Y7BA 1J83A 1YFXA 1UZYA 5KHKA 4Q26A 1UZ0A 2GN7A 2WDBA 3KSCA 1SCRA 3CJXA 3ZSEA 1PMHX 3WD5A 3U14A 4YVSA 4AAPA 2X5IA 5FYVA 4OVEA 1W3XA 2ZX1A 4K8RB 5CISA 1OPMA 3LOIA 2E26A 1U5YA 3P3PA 1HB2A 3ZFGA 1LHNA 1OKOA 2VOTA 4Q4W1 2DCYA 5T55A 1COV3 4AR2A 4EZHA 2OA2A 4NUBA 2W9XA 5AFBA 4AL9A 2NMNA 1YO8A 1ND3C 2QZ3A 4DUVA 1N1TA 2Y33A 4E9KA 4EN7B 4RFT0 2VXRA 3ZPOA 4CDQA 1QJFA 1WCUA 2AYHA 4XBQA 4LA3A 1CN1A 4B7EA 2PAEA 4YW2A 2VD7A 2W1QA 2CAVA 4TTGA 2GMMA 3LB9A 5BNOA 2ZGMA 2ZHLA 3RYRA 5JSPA 5LEKA 3DGTA 5JCTA 3VKOA 4OHYA 1K45A 2B5HA 3KGZA 1EV11 2WO7A 2YFUA 1ND2A 3KZ4C 1H30A 4QKBA 4QM8A 1QH6A 3U37A 4MVTA 4A3ZA 2D6OX 1OLQA 2J22A 3GBFA 5BNOB 2YXSA 4X8NA 1V6JA 3SH5A 5J7MA 1BVVA 1WCKA 2VCCA 4YFZA 2RG4A 3Q8AA 4BU2A 4B4PA 2W1UA 2AEYA 1RUE3 2YGMA 1DZQA 2XL7A 2LM3A 4FAHA 1AR73 1KITA 1V9U2 3B01A 1RUF3 4FQ4A 1B35A 1AR81 4AFMA 5FOJB 3POJA 4XJ8A 4N53C 5FZBA 1DGWX 1SBDA 1W6PB 3LA2A 3WNXA 5LRSA 2BNNA 1J59A 2GC1A 5E8AA 1O5UA 1IPSA 5GLWA 1C57A 1QEXA 2LUWA 4A7ZA 1ZA4A 3DEMA 5KHIA 2XJPA 1GICA 2D5HA 1QXPA 2ZGRA 3DECA 4XMIA 5JZGB 1OOPC 2JDHA 3MZHA 4B29A 1AL0G 1VRH2 2HBTA 5D1IA 4TLGA 2UURA 3CL1A 4Q4X2 2YB7A 2JG8C 2C9AA 2RMU3 4GB32 3WNNA 1QNYA 2Y38A 1DHKB 5A1FA 1KGYA 2GDFA 5EHDA 5JXIA 1LHUA 4IEZA 4CDUB 1AR91 4ZZ8A 3RGBA 5CA6A 3TEZA 1G9BA 4EWDA 1FV2A 4AE2A 4NO4A 4JGZC 3N9OA 2IXJA 1KFXL 2J1UA 4IE5A 5HXMA 3JD73 1MEC1 4ARYA 4K6BA 4ASMB 2OS2A 4RGGA 2J42A 5FY8A 3BGAA 2VUDA 5G04L 4OQ9A 3UYJA 4OUEA 2VVFA 2MEV3 1EAH2 4P9JA 4P9GA 3V64A 3R4UA 1YJLA 3KCXA 4IDZA 4JGYB 3PVOA 3O5SA 2ZX2A 3PHMA 2YC0A 4NHXA 2R062 4XJAA 4LR4A 3J7LA 3KT1A 2P6CA 2VTXA 4FPYA 4EV0A 3S7EA 2VJXA 2VQUA 5T5JA 1HJFA 3HQXA 3OTFA 4LHSA 4YRDA 4QB6A 2C6SA 1HQNA 1K5MC 3N7KA 5FZ3A 5BXXA 3ZR6A 1DDLA 5FZGA 3ASIA 4M3CF 5FYMA 5A3WA 1QQP3 5JDBA 5GZGA 4BDVB 4P9IA 2FDFA 1DZRA 3C7HA 3KCYA 3DKQA 4QD2A 2ES3A 5JZGA 1DF0A 2WZEA 3TBDA 1GKBA 4M4RA 4GALA 2KA3A 4N7UA 3ZYJB 3E6BA 2D98A 2YMZA 2NYYA 1BBT1 4AF9A 4TN7A 5BUVA 5DPNA 3UJOA 2XH6A 3AP5A 4N7IA 1X9TA 3BPZA 1OA3A 4UW6A 5C70A 2GC0A 3QBQA 1H2NA 4CDXA 4NIHA 1RVF2 2ZHNA 5FZOA 4A6OA 3ON7A 3C2UA 2BV4A 4XZPA 1OPOA 4DY3A 2HWE1 2PHUA 2QDRA 3IM0A 4OLLA 3B93A 4KU8A 3WT3A 3S5QA 1XNKA 3VD3A 2V5DA 3MUZ1 5A32A 1YXWA 2YROA 3MO4A 3LDBA 4Q0UA 4IQPA 5E6HA 3DYOA 2ZMNA 4JTOA 5FXZA 1UKRA 4BISA 4Z8BA 1Z7S1 1RUD3 5C8WA 1W9FA 2QNKA 1NLRA 1NY71 3UGFA 4JGYA 4ZS2A 3I2OA 5F3IA 3U1XA 3SH4A 1U12A 5FY5A 5C7GA 5KHGA 4BA6A 2VMDA 4Q0SA 2GC3A 4OI1A 4XJZA 1X33A 3ZKUA 3J7NA 1BYHA 2XG3A 3ELNA 5LBFA 4ASLA 1FI2A 1QU0A 4HBNA 1PX3A 2R072 1U5IA 1DQ4A 1F5JA 2A7AA 5FDBA 4XVHA 5BNOC 3I49A 2XOMA 4CTEA 5ABJC 1HXS1 4IV1A 5EYYA 2XJSA 4COVA 1HRI2 4QX8A 5I0TA 4Q1RA 2WO1A 1OUXA 3NNLA 5I8YA 2KD7A 2WNUA 1AR63 2PLV1 1L7LA 5ISLA 3Q8FA 1AUYA 2IWGB 3OD4A 5J36A 1CJDA 4PLOA 3SMHA 4EJRA 2GALA 5EV7A 2AGSA 4GJZA 2VH9A 4YZ1A 2W46A 3PUSA 1BXHA 4LJHA 5KHHA 1DQ1A 1LESA 2W08A 5K4LA 1VLNA 4MH0E 4B7KA 1AZDA 2XLAA 3AYAA 3UKTA 1GQGA 2UWBA 3DXUA 4YNIA 4F83A 5DAPA 3W59A 5IVVA 5A3OA 2ZX0A 1DQ5A 3I2DA 5A33A 3E5UA 2YPDA 3I2FA 3POYA 4N9IA 1SPPA 4AEMA 1UN1A 4QPGB 1FNZA 5CZKA 5C9AA 5L7OC 4QU2A 3T2OA 4X6QB 1GP6A 4J25A 3V0AB 5JXJA 1GWLA 2QE3A 1PO21 3WINE 2D3PA 4CCCA 2XUEA 2CV6A 1SLIA 1LOGA 2AC1A 3ZDSA 5LA0A 5DG2A 1VBC3 1UMHA 4PDWB 1AXZA 3H7JA 3MHZA 3RZKA 3PUAA 5EYXA 5HCFA 2HKXA 2SLIA 3A0KA 2FDHA 5FP7A 1HB4A 4LOTA 1HV1A 3CU7A 3WW4A 3HN3A 3OBAA 4XJ9A 4B8EA 4RS5C 4CCLA 2XHKA 2OIIA 2Y6FA 4AQSA 2B45X 1D4VB 3UESA 4FAGA 4DRRA 1GYKA 2PTMA 4NPMA 4YG6A 5LCWL 1ZRRA 1FATA 4ITCA 3Q8CA 3WVJA 1VRBA 3AZXA 1W2OA 1BEV2 1DQ2A 4LPLA 4P02B 4DUWA 2WA4A 1HRV3 4MO3M 1AL23 2E63A 1POQA 3POBA 3LOBA 3N7LA 2EA7A 2DWRA 3RMXA 3O1MA 3DXTA 4GWMA 5IVJA 3H8XA 2P5BA 4AI1A 2ZGSA 1QH7A 1RHI3 1W6OB 4NWWA 4CUAA 2B42B 2FCTA 4XOGA 1S2EA 3N7JA 4ISQA 1O8PA 2ARXA 5F3EA 1OA2A 1Q56A 3B02A 3AMHA 3WCRA 1SMVA 1IGOA 4RD7A 1PO12 5FYBA 3V0AA 4YLZA 4Q4W2 2RDQA 5A7OA 3ZPYA 2XWBB 1VBD3 1TME1 3CJIA 4MUVA 4BK4A 2YFZA 4NE9A 4WM7B 1LNSA 2ZX4A 3JXSA 1HRI3 4XUQA 1XRUA 3ORJA 5FZEA 3AC0A 1UL9A 2QQWA 4YGCA 2QFEA 3P5BA 3NMBA 1UX6A 1QNWA 2A6ZA 4QPIB 1PGW2 3S57A 1QOTA 2UY9A 2WLPA 3D4KA 3S30A 2EIEA 2O14A 4HKOA 4FBFA 2VMHA 4IEYA 4F3JA 2XR4A 5FO8B 1FAYA 2C1FA 3F95A 4L97A 5F1RA 2OW4A 5C8CB 1R1ZA 1R1A3 5DXDA 3WQ7A 3TAYA 4HL0A 1RUH1 3GJAA 1ZZ6A 3VN4A 5BNNB 1WMFA 1JOPA 2R32A 2NMOA 2WZR2 2WFF3 4QAWA 1ZVFA 4XIOA 3RQ0A 1G9AA 1DG6A 2VMEA 3NAPB 1COV1 1W6QA 2DBNA 1OLRA 5EJZB 3VDDA 1Y9QA 4LMFA 2DCKA 3MIBA 1BHGA 2VOWA 2BEOA 2VOXA 3IDBB 5FTTC 1VBB3 4C8DA 3N3HA 1TNFA 3LFMA 1JODA 4UF0B 3WF0A 1S0EA 4H7LA 3H8RA 4COYA 1UOBA 3ACFA 3OOXA 3E5XA 3ST7A 1AR82 2BNOA 4QX0A 3VBFC 4GMP3 1GANA 5H9QA 4K3UA 3H1MA 2ORXA 2GNMA 3J8F1 1SFPA 4M3CB 1GSLA 2QQNA 4CEWC 4LBKA 4LBMA 1NYWA 3LQCA 1QJU1 1W8NA 2PN5A 1SDWA 1JUIA 3PUIA 3R4DB 4XAEA 1IG3A 4Y1YA 2YG0A 2WZ8A 3UK9A 4RFRB 4CA9A 3K3NA 1C3HA 1U5XA 2CGNA 5GLUA 2GNTA 2ZAAA 2J1VA 2PXJA 3WP4A 2RS33 1J1LA 1OMIA 4WVWA 4Y24A 1BVP1 3MIFA 4LKDA 3RZJA 3JBG2 3HT2A 1RUE1 5T50A 1VB4A 4RQPB 4HETA 1ZZ9A 3LWCA 4QPGC 1W04A 2R1DA 4CCEA 4GAZA 3POFA 4LKEA 2D6NA 5LK5A 5A6XA 1AR71 3R6SA 5BNNA 5LA2A 4AHYA 2JG9C 3ZFEA 1YUDA 4KI5M 4I0WB 1LODA 2K0GA 4WM8C 2LRPA 2PQQA 5IAVA 4TWTA 4O7XA 5FFOC 4DEVA 5FUNA 1PO13 1WKYA 3R05A 1RUG3 3UL2A 4RA0A 1Q5OA 1US3A 1XQNA 2IXIA 4GMP0 2RM22 2WQZC 3UGGA 4CCMA 1VMHA 4Y1VA 3PU8A 5CBLA 1NQDA 3IT8A 5GJ6A 4AVVA 3TWIA 4BHPA 4YPJA 4EN0A 4HSJA 1A3KA 4LEJA 2J7MA 1RUI2 4XUTA 1XYOA 2X10A 3FUQA 1MS1A 5A3UA 4FFIA 3M8LA 3EO6A 4QQ2A 3RZZA 2QQPA 3TN93 2IVIB 1YQ8A 4BIFA 5GZFA 2JE8A 2RMU1 2ZA9A 3I2HA 2GAUA 4HOOA 1PX4A 1W2NA 2XJRA 5DDJ1 4ZU5A 3CKHA 1ULFA 1XC6A 4R4ZA 1RGSA 2D5FA 1QF3A 2BOIA 3INAA 3VDCA 4BQ4A 1ZRCA 4AVBA 2RS13 2WNVC 4FPKA 4XURA 1XNAA 3B3QE 4Y5Z0 3W9AA 3ZLIA 3JD71 4CXXA 3FE5A 3BN6A 4KMQA 2CYFA 4QGLA 4RR3A 3WNKA 3O12A 5FYTA 2VZUA 1JZ4A 3ZYGA 3PVEA
chains in the Genus database with same CATH topology
2MEV1 3T1MA 4JTNA 2HWE2 1BMV1 3WY6A 1C5IA 2XL9A 3MICA 2VNGA 1MR5A 2A6YA 3AMMA 4D7SA 3FLTA 3ZXJA 5F6LB 3I7DA 4WM7C 5L73A 1VAVA 5H9SA 4LBQA 4AEDA 4BMEA 1AYN2 1NY72 1ULCA 3U4XA 2DURA 3AB0A 5GALA 1QQP1 1CPMA 2DCJA 1H8VA 2ZAHA 4WBBA 1LOCA 4RHV3 3N4MA 3AKRA 2CAUA 1QWRA 3AYDA 4TYSA 3ZN4A 3O0XA 1RUJ3 2CTVA 2HEWF 5C8CC 4GWNA 2YV8A 1BKZA 4XETA 3SXWA 3H8UA 1F8VA 4ATEA 3NAPC 2WWSA 4QM9A 4L9BA 3WG4A 1MQTB 3THPA 3ZXFA 5SV5A 3VBRA 4KL1A 5J98B 2GMPA 3N36A 4HVOA 3E5QA 4LO4B 1ZBA2 3QCWA 3DKWA 2RR13 1RMU3 4PIXA 1UU4A 1SBFA 2BWCA 4FP3A 5FPZA 2ZMKA 3NSTA 4LHNA 3JQXA 3VBSB 1JUHA 4C0HA 2YUEA 2ZMLA 3VHPA 5T5PA 2AR6A 3AZVA 3VLBB 1RUC1 5CFCA 3VZOA 2ZX3A 1RJ7A 1IS5A 4XJWA 3ZSLA 2JD4A 2X53S 3L2YA 4XF3A 4G4FA 2TEPA 1QJY2 1VBA2 1PO22 2Y0OA 4LBJA 3JU9A 4BIOA 1C8M2 2HWD1 3P3NA 1G9CA 4Y26A 1PM7A 1AR61 1O3QA 5CB7A 3MYXA 4RQPC 4CP0A 3WOGA 5I91A 1E57A 1FMD2 2HWC2 3ZSMA 3SCFA 1W39A 3MW2A 4XYXA 3WW1A 1KDKA 2D44A 1UKGA 3ALQA 1UMZA 4AFCA 2WS93 4XHBA 4A7KA 3UV9A 3TOJA 1RB8G 5DUXA 2D6LX 1ND3B 1SLTA 1QKQA 1B09A 2VUJA 2GH8A 4OHXA 3NVCA 4HN1A 3ZXKA 4C0BA 3AMNA 4BOWA 4JQRA 5CG9A 3KCCA 1F9KA 1ZM1A 1XU2A 2A6WA 3FZ3A 3L2HA 3LCPA 1EYBA 3MPPG 5FLHA 3TRSB 1VBC1 4IV3A 2VULA 4FOYA 4E27A 3VKLA 1ZBE3 3AZYA 4AG4A 4L8QA 3VL8A 3MW3A 1S0FA 4P9XA 4HN0A 4YW3A 4QQPA 1UU5A 4EWAA 4PBPA 3POSA 1MVQA 1PK6C 3B7MA 1A8DA 3JCIA 4UBGA 2TNFA 4COWA 4QMAA 3AKTA 3E6CC 1C1LA 2JDZA 4FTEA 2IXCA 1AL21 2NM1A 5IUQA 1QJX3 3PNAA 4GKYA 4QXKA 1VBE3 1HDKA 4QQLA 4N53B 5CAZA 3WXPA 5ACA1 1RHI1 3H7YA 3OGJA 1U5ZA 1WW4A 2AENA 3MF9A 2EXJA 1RUH2 2W0XA 4HK8A 3U07A 1WW7A 1YLLA 3IDEA 1OOPB 1R083 3FUOA 3H3UA 2RE9A 4C91A 2JG8B 1NCRA 1UCXA 4AQTA 4JDNA 2Y0IA 4JC1A 4F8AA 2JEMA 4I01A 3EJKA 1ZYBA 4Z92B 1POV3 4CZSA 1UIKA 4CRQA 2ZGKA 1AYM2 1D4M2 2IXHA 4R9DA 3RWNA 1MQTC 3J8F2 4JGZB 5JLVA 4L11A 1R092 1QJU2 3GHMA 3GBWA 4FXGB 1FOD1 1XE8A 5JSRA 1L3JA 1R1A1 4XFAA 4GKXA 4EN6B 1W0PA 2E7TA 4YZ5A 2WT1A 3KMHA 2VNRA 4NWVA 3A4UA 5HXVA 1MS3A 5CNAA 2E6VA 2RHPA 1X8EA 3WDWA 2RS53 2WNEA 3GZUC 1VBB1 4YM0A 2EF6A 2Z79A 2HWF1 2ZZQA 4M0HA 3WX5A 1N1VA 4FVVA 2VOVA 1GZWA 4HZFA 3DL3A 5HI0A 1HX6A 4GMP1 1SEFA 1G9DA 4MV2A 2ZACA 3RYKA 4I30A 3B69A 2C5DA 5D8AB 4CDWB 4PIZA 4AFAA 2BTVC 4R4XA 3GF6A 5C4WC 1ASJ1 2D43A 3NO8A 5E1RA 2ET7A 2P3IA 5TSWA 2HEVF 3M3OA 3ZXGA 4JGZA 2R042 1FPN2 3UKVA 1LTEA 3KS7A 2RS31 1H2MA 2JENA 2MPFA 1PZ8A 2HWB1 5DDJ2 1TMF1 1RJ8A 2X8KA 1HV0A 1LB2A 4LA2A 2OYZA 2BVVA 2B8MA 3H9AA 2R0FA 2WJSA 3HMYA 2VG9A 5B2GB 4CP2A 1QGLA 1S0DA 4Q8LA 1REEA 1RUG1 3LGRA 1K5MA 4AVCA 1Q8QA 2QCSB 3M1HA 4JVAA 2VPVA 2CGPA 4Q4Y1 2WKKA 5E88A 3CLPA 2TBVA 4HK9A 5ABJB 2D3RA 2V73A 3BU7A 2XKPA 3CEWA 4YG0A 3TN91 1C1FA 2DCZA 4FTSA 5BV6A 4P9WA 4LT5A 5CIRA 1Q3EA 2NZ9A 4N43C 2XKOA 4UBHA 4R9BA 3V56A 4K21A 1HLCA 2DTYA 1S0IA 3BTAA 3V0BB 1PIV1 2RS11 1SFNA 4DRVA 1NOVA 5DUUA 4LBLA 4RSUA 5FLIA 5I0RA 4Q27A 1LGCA 4K1ZA 4CYDA 5L7OB 1LCLA 4C1WA 1J3PA 4DPNA 1XNBA 1QXRA 3ZVXA 1FNYA 2NLRA 1OQDA 4PIYA 4MXWB 5GLTA 2ZS6B 3AK0A 1WW5A 1DBNA 3MEPA 1YI7A 2PA7A 1I3HA 2XVGA 4Q8KA 1BJQA 4KH9A 2XVKA 3U10A 3VHRA 3WG3A 5ABJA 5BNOA 3EQEA 4RS5B 4RHV1 1EPWA 1RUC2 2WLQA 4NVPA 3UKNA 2R043 1CONA 4Q4V2 2ZABA 1Z78A 4RGAA 2BBVA 5FREA 3ZFFB 2VY0A 2DU0A 3HAGA 4FPOB 1T6GC 3G7DA 5I93A 4AVAA 2HWD2 5H9PA 3J4UH 1WMDA 1G7YA 4JDMA 2ZBJA 5CFDC 1RC6A 3S7IA 2QKDA 1W6PA 3TB0A 1S0GA 1QDOA 2VNOA 2I07B 4GA9A 3VBUC 2QUOA 2RR11 5L7OA 1RMU1 2MNGA 1O3TA 3ZYIB 1QXJA 4P9LA 3HN1A 4KBBA 4SLIA 5D8AC 5E16A 1W6NB 4CDWC 4MXWA 3PLQA 4OFGA 3GZTB 2GN3A 4QQOA 5L19A 4AEJA 4CDUA 3VBHB 3WUCA 2R30A 1Q8SA 3VKFC 4RS5A 1KXGA 3G6JB 2EXIA 1ND2C 1V9U3 2XBO2 3WG2A 1U0AA 3QACA 1WBFA 2VMIA 5KC6A 4XPVA 4FSJA 2WSUA 1SLLA 1A78A 1UW8A 2DTWA 4I3GA 4LBQD 4FOWA 3TYJA 2VQ0A 1NCQB 1DQ0A 2HJIA 1YCIA 3BCWA 3D82A 4L2NA 3O7OA 2WS91 5LK7B 1A8MA 4I3PA 1I1EA 3HBZA 1VRH3 3PVNA 1ZZBA 3VZNA 5AC91 4Q4X3 2JECA 4AGRA 1Q8PA 2BFUL 4GB33 5IT6A 1O4TA 3VBFB 1NQJA 1W6NA 5ACA2 5I0UA 1SCSA 2UYAA 4CEWB 5JI9A 2BUKA 3VBOC 2D93A 1ZBE1 1UPSA 2F4PA 1G9FA 4Q4V3 1EAH3 3ES4A 2NN8A 5DZGA 4E2SA 3MLJA 5I0SA 4TZDA 4MSVA 2R063 4NHKA 1OHFA 4Z1VA 2Q5TA 1MS8A 3IPVB 3VV1A 1IZ3A 3ZN5A 2JJ6A 4YM2A 2EAKA 1PVC1 5JOZA 1OSGA 1QJX1 3IMNA 5KHJA 2JG9B 1RIRA 1VBE1 4IERA 1QJZA 1IOAA 3FBMA 4M3CE 1UPIA 4WM8B 1N3PA 1FT9A 1LHOA 5JPMB 5FLJA 1FOD2 4PLMA 2A3YA 5JIUA 2ZGLA 3FC0A 2P2KA 4XF0A 2P34A 1GFF2 5GZEA 4CP1A 4NHMA 1I9RA 1LEMA 2Q30A 4OULA 3B5LB 1PNGA 4IETA 4Q0PA 3WW2A 3X29B 1MACA 3SNMA 1RVF3 2WSVA 3NW4A 4CEWA 3KT4A 2DVGA 3OYWB 1QHDA 2D6MA 2DYCA 2KM2A 4QQHA 3WUDA 4AFBA 4HFSA 3ZFFC 3ZN6B 1POV1 2ARBA 1TQ5A 4L99A 3ZSJA 3CNAA 2FQPA 5BYNA 2WNVB 2EALA 5JWPA 1BQPA 1MZ5A 4XMAA 1V6KA 1QMJA 2GNBA 1G6NA 1HIXA 2P17A 3IPVA 4QPGA 4HPKB 3LAGA 2EAAA 3J9SA 2R073 3WDXA 1MS9A 5BNPC 4WM8A 4K9SA 5FAXA 1H1AA 4PDWA 2WZPP 4IESA 2RS51 5I8SA 4ISRA 1TMF2 2H6CA 3MIGA 4XFFA 2WC2A 5DZEA 3TNQA 3VBHC 5JSOA 1CQ9A 3HD8B 4ES8A 2ZPXA 5JOWA 3M4FA 2UU8A 1Q8VA 4NHLA 1J3RA 4BLIA 3OYWA 3D8CA 3ZIXA 4IV1C 4H55A 1EV12 4KWLA 4Q4Y2 1YJKA 2WNUC 3ZN6A 2HYKA 1YWKA 2R16A 4JRLA 1NCQC 3ACLA 1MVEA 3R4SA 1W2UA 4W65A 5JMCA 5AFEA 1W6OA 2PHXA 3NV3A 4M0NA 2CY6A 5FQ0B 3PVBB 1YNAA 4ATFA 4HPKA 1TNRA 1F5FA 4FPCA 4Y20B 5KXBA 1REDA 1WLDA 1WLCA 4P5HA 1YFWA 2A70A 4DZGA 1PIV2 4YW1A 4J6GA 4E2GA 2SBAA 1IPKA 2A71A 3MI8A 4WM7A 5JOXA 2ZTNA 3LKJA 2W68A 2UYBA 4N90A 3TNPB 4META 4M00A 4AFDA 4QPIA 1UIJA 3BOWA 1BEV3 3PJQA 4QPYA 3MFAA 2ZGNA 1NE6A 2R49A 4FPJA 2FMYA 4H3WA 5C8CA 4FPLA 5J96B 3VZKA 1J3QA 1AR92 4HANA 5AVPA 3ZMOA 1CAVB 1H2KA 1RUF1 1IKPA 4B4QA 3NAPA 4KGGA 4AQ2A 3WZ1A 1DFQA 1MEC2 3VZJA 3WHTA 2PHRA 3AZZA 4Z07A 4YVWB 1ULEA 3FBYA 4Q4W3 2VQAA 2ENRA 3O14A 1JXNA 1H0BA 4XF9A 4IEWA 3HWJA 2B9UA 1LRHA 4LBOA 3FJSA 3ILNA 2ZHMA 5K0UC 1NXD1 1IQAA 3ZSKA 3USSA 2K9ZA 4OUSA 4XQ4A 1JYIA 4M3CA 1AJOA 3WDVA 4NOTA 5FPXA 1CAWB 1O5LA 3BODA 3NKGA 5A3LA 3FFZA 5BPXA 4AW7A 3IKWA 3MGUA 4Z82A 2O0OA 4FXKB 2F6BA 1OD5A 4AWDA 1LOBA 2XB6C 4HKLA 1I6XA 2BVBA 2RJLA 2BGCA 2ZHKA 2WFPA 1BBT2 2PHTA 2C0ZA 2E7QA 4QX5A 1PK6B 2WZR3 4RQPA 3SISA 4FTBA 1HQLA 1ZZ7A 1H8TB 1WW6A 3WP6A 1CAVA 4IEVA 4I0AA 3AKQA 3M7AA 2ZZJA 5FMOL 4YARA 3M3EA 1AR83 2ZKLA 4V1PA 1S0BA 4C1XA 1Z7S2 4O9EA 4IL7A 4XFIA 3VDDC 3AXDA 2O1QA 1H9PA 4MXVA 4MX3A 3MFCA 1CPNA 1XE7A 2H6BA 4UW5A 4GXLA 3N7MA 4D7TA 1ZRDA 2JE7A 4UXAA 4MZUA 4AK3A 5AC92 4KU7A 2OUJA 4D69A 1REFA 4OUMA 1HXS2 1TEIA 3JBG3 1CJPA 2ZCWA 1H4HA 1QDCA 2BPA2 2G9FA 1MZFA 4XDQA 2B46X 4NR1A 2PLV2 3RG0A 1PK6A 1ULGA 3USUB 5BNQA 1RUD1 1UAIA 3KB5A 3O0WA 4YGBA 4BM8A 3GHNA 3WHUA 5HCAA 2RM23 2QZ2A 3AJYA 4P9YA 1HQWA 3OGGA 1JW6A 2YHJA 1VAMA 2YYOA 3K48A 1RUI3 3RMYA 1LHVA 2AUYA 1ZNPA 4ZU7A 3RRDA 3KLSA 1VRH1 3GBGA 4O9GA 2XWJB 1PVC2 2D7FA 4Q4X1 1YFYA 3PMSA 5DG1A 4BPZA 1IKQA 4GB31 3PTYA 4S2HA 2PHLA 1CR7A 2PHDA 4LHLA 1F2NA 4XILA 1FXZA 1KS5A 2E53A 4EN8B 3AFGA 3W58A 2D6KA 1EP0A 2O8OA 3WW3A 2H0BA 5JI7A 5CADA 1AX2A 1O3RA 5C4WB 3LA7A 4J1WA 5T54A 3ZYPA 1ENSA 3VHNA 1NA1B 3M3QA 4XFCA 3SITA 1MQTA 2FBEA 5IK4A 1EAH1 4YVWC 3ZX7A 2HWE3 4KWKA 2W39A 4IEUA 4LE4A 3WP3A 2R061 4JCKA 1OKQA 4GH4C 4MGKE 4RR3C 1VALA 2N7GA 4ES9A 1AYN3 4GULA 2ZGOA 4I02A 3VBSA 2IXLA 3LZZA 2GSYA 2LALA 2OVUA 3E97A 2Q4SA 1O4YA 2R6QA 4HT1T 1XYPA 1DGRN 1UZZA 2PAKA 5GLVA 4IEOA 3NKTA 5J37A 4AEDC 2R0HA 2QJVA 1TME2 3AX4A 3WDTA 3QLQA 4J1XA 2PELA 1H8TC 5T52A 5C4WA 4LNVA 1HRV1 4AXOA 4N43B 4HSLA 2DVFA 1ZBA3 2DUPA 3IN9A 4LUKA 5T3NA 2GMEA 4C90A 1WCSA 1ND3A 4LULA 1OQ1A 5FCCA 4XBLA 4G9SB 2I74A 3AMPA 5C33A 3D0SA 2PYTA 1JH5A 3I4IA 3CF6E 2WT0A 2FZ1A 1V6IA 3NJZA 2JE9A 2WT2A 2BYVE 1COV2 2DVBA 2R071 1OA4A 2E7AA 1VBD1 2BFUS 4NPRA 3OD0A 4Z2WA 5CVRA 1QJY3 1VBA3 1PO23 1HRI1 1C8M3 1LOEA 4ONUA 4MYEA 4FO9A 5K9YA 2GZWA 5CFCC 5GLZA 1FMD3 2HWC3 5T5OA 1W6MB 2ZGQA 4L92A 2IC1A 4DXZA 3APBA 3WLUA 4N43A 4AI8A 4D3WA 3N35A 3B9CA 4CEYC 1UD1A 4YVSB 1Q43A 4N53A 1NLSA 2WFF1 1FX5A 4JAAA 5CFDB 1CVNA 1H4GA 3WQ0A 1RUE2 2VOKA 3H0OA 1X8MA 4KGQA 5EFUA 1IS3A 1GR3A 3VKNA 1AR72 3VBUB 1AX0A 1RUF2 3NV1A 3BALA 4DOUA 3DPRC 4YM1A 1OOPA 3POWA 1X50A 3HR9A 1WCDJ 5JAXA 4CDQB 1O3SA 4Y1ZA 1I5ZA 1POV0 2JG8A 4X8PA 3OJBA 4PBOA 1XXNA 1ZRFA 2PHFA 1Q8OA 3HIFA 5GM0A 1LOFC 4JDOA 1NA1C 4H7MA 4IV3C 2VW0A 5JOYA 1BEV1 1S1AA 3ZXAC 1ND2B 3THTA 2RMU2 3V65A 1UU6A 3OY8B 3WDUA 3WV6A 4UW3A 1ZX5A 1D2QA 3GYDA 4D94A 4FT8A 1AJKA 2IXKA 5CFDA 3JD72 4A7YA 1RUH3 4BE3A 4PCRA 1PO11 1B35B 1ALYA 2WINB 4A2UA 4XIKA 2MEV2 1F31A 1RL3A 3WP5A 3VBUA 5LRRA 2A5ZA 1BMV2 5GZDA 1LGBA 4FCAA 1RINA 5D8AA 4CDWA 4XE9A 2G9GA 1TE1B 4Q0VA 1KFUL 3URFA 1C4RA 1AYM3 1D4M3 1D0HA 2Y26A 3LSEA 4XFGA 3J8F3 1PGW1 4D7YA 2ATFA 3VBOB 3NL1A 1V6OA 1QQP2 1R093 2YY1A 1QJU3 4G3YC 4BCUA 4LO7A 1NCRC 1N1SA 1YIFA 4X6RB 4BWOA 2BWAA 4LLOA 3AFKA 2Z2SB 3OY8A 2Q0AA 3IBMA 2GC2A 1Y3TA 2WZR1 3ME2A 4AGVA 2NPIA 2Z42A 4AHZA 2A3XA 1C5HA 1QOOA 1C28A 1MZ6A 2D40A 1VIWB 4MGYE 5KWRA 1RUD2 1JN2P 4YGEA 1YI9A 4K1YA 2XJUA 1XU1A 2E9QA 4QGMA 5JPNB 4EN9B 4ZU4A 5F6KA 1FPN3 3VBOA 2YPJA 3M3CA 4M01A 4E4SA 1RUJ1 1CESA 3R0RA 4LHKA 1PMIA 2WL1A 4YVSC 2DUQA 2X5IC 3V0BA 3JBG1 5EWSA 1N1YA 5DDJ3 4GQ7A 3H50A 1KJLA 3J26N 4CDXB 3KGLA 4WVMB 1AR62 3ZFGC 2W52A 3EBRA 2JKBA 3ZO0B 4KNCA 2IZWA 3AKPA 2Q8OA 5A32B 3T1LA 1IHMA 1XYNA 2AREA 2ZOEB 3SHRA 2RM21 4DFSA 3ZMNA 4GIQA 4CDQC 5BNPB 4WZFA 1ZZCA 1LEDA 2XVLA 1LENA 4LBNA 1RUI1 5E89A 1ENQA 2TUNA 5J3UA 2DVDA 3PMEA 4HLTA 1DZTA 1S2BA 3AP7A 1GZCA 2I2SA 2P3KA 3FX3A 1QOSA 2XUMA 3BIWE 4KG0A 2ETEA 1VBC2 3OPZA 3H1WA 1BZWA 2VMGA 4IV1B 3KM5A 1LHWA 1PZ7A 2FMDA 4KQ7A 3UJQA 2ZGUA 5EZWA 2I45A 3ZFFA 4W6WA 2WNUB 4PJYA 2OPKA 4XXPA 1SACA 4K8FA 4B3NA 5DUWA 5JIAA 3SCHA 4EROA 4WVMA 2DCTA 3M2MA 1B35C 4K7JA 5FMOS 3AP9A 1AXKA 4BMBA 3E6DA 2Q1MA 4Q1PA 1HRV2 1AL22 3C3VA 2ZGTA 5KBFA 2O8QA 3M70A 3IIAA 5F5QA 5A33B 1AYN1 5HCBA 5BNPA 3QOPA 3ES1A 3ETQA 1RHI2 4COZA 1S0JA 3NWKA 3VKMA 5C9AB 1MS4A 1WA4A 2PFWA 2A75A 5A3MA 3B94A 5J48A 3S0MA 1SLAA 3H1YA 3B9IA 3ENRA 2P3JA 4XFHA 2DUOA 3VBHA 1RUC3 2VVDA 4XF4A 4AYUA 1YFUA 4BZ4A 4E4DX 4DINB 5IK7A 1VBD2 5FO7B 5C6CA 2V09A 3FWEA 2YGLA 2HWD3 4YG3A 5JR7B 3IDCB 2ERFA 1PVXA 4KWJA 3SLIA 1WGPA 4Q2FA 1NCQA 1D2SA 2JX9A 1ZBA1 1OFNA 4YGDA 1AF9A 2VU9A 2X29A 1CAXB 3MDPA 2Q1ZB 4JRAA 1DYPA 4BYYA 4LO6B 1PGSA 1R1A2 3AZWA 4QT6A 1GBGA 2GH2A 2V5YA 1RUOA 1YHFA 3BB6A 3VBFA 5K0UB 2WFF2 1S0CA 4YFWA 4LLFA 1KDMA 1R081 4OI2A 2XLGA