3PMSA

Recombinant peptide: n-glycanase f (pngase f)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
312
structure length
312
Chain Sequence
DNTVNIKTFDKVKNAFGDGLSQSAEGTFTFPADVTAVKTIKMFIKNECPNKTCDEWDRYANVYVKNKTTGEWYEIGRFITPYWVGTEKLPRGLEIDVTDFKSLLSGNTELKIYTETWLAKGREYSVDFDIVYGTPDYKYSAVVPVVQYNKSSIDGVPYGKAHTLALKKNIQLPTNTEKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINNSNTFQHQLGALGCSANPINNQSPGNWTPDRAGWCPGMAVPTRIDVLNNSLIGSTFSYEYKFQNWTNNGTNGDAFYAISSFVIAKSNTPISAPVVTNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptide:N-glycosidase F
publication title Recombinant peptide:N-glycanase F (PNGase F)
rcsb
source organism Elizabethkingia meningoseptica
total genus 86
structure length 312
sequence length 312
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2010-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09112 N-glycanase_N Peptide-N-glycosidase F, N terminal
A PF09113 N-glycanase_C Peptide-N-glycosidase F, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3pmsA02
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3pmsA01
1SDWA 3MLKA 1PNFA 1PHMA 1YJLA 3MIBA 3PHMA 3MIHA 3MIEA 1YIPA 3MICA 3MIFA 3PMSA 1PNGA 1YJKA 4E4ZA 3MLJA 3KS7A 3MIDA 1YI9A 1PGSA 3MIGA 1OPMA 4R4XA 4QHBA 4R4ZA 3MLLA
chains in the Genus database with same CATH superfamily
1BJQA 1BBT3 4OHXA 1XOYA 1FXZA 3GBWA 5BY5A 3GDBA 3VGIA 5EYYA 1O4TA 5FMBA 3SQOA 3NAPC 4BXFA 5HCHA 2XMLA 4GMP1 5IAXA 4L0PA 5FYZA 2YGLA 1UKRA 2WNVC 5BNNB 2OX0A 2UURA 2PA7A 2GN3A 3K4ZA 1F4AA 1LOGA 2VCCA 1QJU1 2QTWB 2VR4A 4Z07A 1W8TA 3IMNA 3EHKA 2E33A 2RS13 4IDZA 4E8CA 3IAQA 4XDQA 3SCGA 3FL7A 4LBJA 2AC1A 1HN0A 1T6GC 1A34A 2WNEA 4XILA 5IK8A 4MGZE 2A70A 2BGOA 2JDAA 3GZUC 1DHKB 4Y20B 1AR83 3NJVA 3WP4A 2VXRA 1JYVA 1H8TB 4DY3A 2N7GA 1UZVA 4DEVA 3JZVA 3RZLA 1CJPA 1QDOA 3ILFA 4AG4A 5AC91 2ZKNA 3FWEA 3WDTA 2Z79A 1SMVA 1JZ3A 4LT5A 3AK0A 5FZHA 5JSOA 2P37A 1UY4A 3POFA 5HXMA 4AW7A 2D5FA 2JXAA 2JDKA 4YGEA 3NV2A 2K0GA 1HRI1 2CWMA 3OBRA 4Q0QA 4QXCA 5L7OC 4IE4A 5JXGA 2VMEA 2HWD3 4RHV3 5C4WB 3O1MA 1RMU3 4GH4C 1VALA 3B94A 4XJ9A 2X5IB 1NA1C 1QQP2 1UY3A 3TRSB 4C91A 4BQXA 2ZXQA 2W2IA 4BWOA 1V0AA 1YIFA 4LQRA 3EJKA 1WMEA 2JDNA 3A7QA 5K7PA 2CGPA 1GBGA 1XNBA 4ISQA 4TLFA 2EIBA 2BYVE 4P14A 1UMIA 2HWB2 5E88A 3ZXLA 5EHDA 3JBG1 5FPLA 2XPJA 1GNYA 1UX7A 1CAXB 3E1F1 4IGPA 4IV3A 1MS4A 1X50A 2YC4A 5A3TA 5FXVA 1J3QA 1MPXA 1OQ1A 4Q4V1 4CDUC 1ZRDA 4XDOA 4CEYA 1RUI2 1CZTA 3GJAA 4HKOA 3R6SA 2RS53 3KS7A 5A7NA 1YFXA 1W8UA 1CJDA 1SEFA 1H1MA 1W03A 4I0AA 4KNCA 3POWA 5FZIA 1UY1A 4MXWA 5C3OA 1YNAA 3UL2A 2W46A 3LEIA 2CY6A 2FZ1A 2V4AA 1RUD1 3ZOIA 4I0WB 1JTZX 1S4CA 1ASJ2 4K1ZA 3DUIA 1UOJA 4HLTA 1UMZA 4OHWA 4NE9A 3ZR5A 3T0AA 4M0HA 4PDWA 4XQWA 1JYTA 5IVYA 4HT1T 5KHJA 1PVC1 5F6KA 4O65A 3WHUA 4EQVA 1JOPA 1L7LA 1YQ8A 2P6CA 2XL9A 5JUVA 1K12A 2EIGA 3MF9A 3S0MA 1W3VA 2LM3A 3ITQA 1AHSA 3OPZA 4NHYA 3NKGA 4CUCA 1ENQA 4LITA 4RGGA 5A32A 1FMD1 2Q4SA 3H0OA 3VHNA 4QPWA 1BQPA 3NNMA 2QBXA 4LO4B 2ZGUA 5FY5A 5CISA 1VAVA 1AR71 1GICA 3OF1A 4FPLA 3WW3A 2C5DA 3D0JA 4BQ2A 3NJXA 1VBB1 2WT0A 4XUTA 1R081 3B93A 4LBQB 5LBEA 5C8CB 3ASIA 2C24A 1HRV2 1AX0A 1NT0A 5EJ1B 5FZ1A 1W9SA 1PM7A 5A7SA 2E63A 1QIQA 3PTYA 2VMGA 4AK3A 4RS5A 1W6QB 2ARBA 2XVGA 3USUB 2C0ZA 1Z7S2 3PJYA 1XNKA 5CB7A 2JE7A 4YVWC 4MGTA 3AMPA 3FN9A 5DMYA 1LJ7A 3PU8A 1W2NA 1SPPA 2IXKA 5JZGB 4A6SA 1Z0HA 1RUF3 2RR13 1CPNA 1DGWX 2R1BA 2W9XA 2VL4A 4QPIA 2VGDA 4WVWA 3IM0A 5CU1A 2D43A 3ZYFA 4EE2A 1LU1A 1QU0A 1UO9A 4H55A 4OFGA 2C4XA 2OW4A 4FFFA 4BK4A 2YDEA 3WD5A 1OPOA 3WQ1A 1ACCA 3TBDA 4YZ1A 1QEXA 1SCRA 3UESA 1S2KA 3WX5A 2QCSB 2ORXA 2ZMLA 2VM9A 3AKRA 3H9AA 1EY2A 1ZRIA 5EXOA 2YGMA 3RPQA 4CCMA 4KMQA 1AR61 1N47A 1BK0A 1VBD3 2AREA 2WL1A 4META 3N35A 1GZCA 4W4ZA 4QXHA 5DAQA 3ZYBA 3GNEA 3E97A 5C8WA 3IB3A 1J83A 1OA2A 3ZFFA 2WFF1 3VBOC 4Q0UA 3W59A 4MSVA 5I0TA 1JU3A 2CDOA 4RL7A 2VVDA 1NE4A 2ZGQA 3FBYA 3H3LA 1D0HA 3SHRA 1ZM1A 3ME2A 3K4DA 3T2PA 2XGXA 5GLTA 1JZ7A 1S0BA 2VVEA 3R4DB 3SEEA 1K3IA 1PX3A 3GHNA 2WKKA 1W9WA 2A73B 3TN91 5FZ3A 1WD4A 1Y9MA 3GYDA 2LRPA 2W94A 1LCLA 2YYOA 5F37A 3BPSA 3D3AA 2VTXJ 2R062 1RUE1 4NRQA 5D1IA 3J26N 1CQ9A 2X29A 1VP6A 2GNTA 2VBBA 2ZX0A 3GHMA 3N9PA 2NZ9A 3Q8CA 5HXVA 2WBKA 4JHZA 4RQPA 1QJU2 1DQ0A 3RZZA 4HVOA 2XJTA 4EWDA 4XFFA 1US3A 2WDBA 4YW7A 1LHWA 2BRTA 5IK5A 5FP9A 2ZCWA 4CDXB 4AI2A 5FYIA 1ULGA 4CE8A 3JCIA 4XHBA 5LASA 4U2AA 1MS1A 1W06A 1RUG1 4QB2A 4AF9A 1UZWA 4WZFA 1IQDC 5FZ7A 2DUPA 5FZLA 4QAWA 2Y6KA 4URTA 4AI9A 4EZHA 3V56A 4P9IA 3Q8FA 5AC92 4GALA 4OI1A 1O91A 4BQ4A 1SLAA 4YRDA 1NLQA 2J22A 4R4XA 4C90A 1SLTA 2PFWA 4CEWB 1A8MA 1PO12 1YXWA 4FPGA 4C0HA 1W39A 1X8MA 4Q1PA 3CLPA 1R093 1B35A 1HRI2 4MGYE 5HV0A 4D6RA 1AL22 2ERFA 2BVVA 4AGGA 3D8CA 3W20A 5BUVA 1BYHA 1YEWA 2Y26A 1ZZCA 4LMFA 2Q8CA 4CDQB 2BNOA 4Q0VA 3VLBB 3ZFGA 5FY9A 3AKTA 1L3JA 2R073 3T2QA 4AEDB 1PIV1 1XE0A 1OC1A 1CAVB 3J4UH 4ZZ5A 3WQ0A 3KWVA 4EZ4A 3ZLIA 1WLDA 1N1VA 1LHOA 3NNLA 3PNAA 1VBA1 3JBG2 3QBQA 2WZR3 1W05A 2XLGA 2RM21 5FP4A 1K5MC 4XDPA 5K0UA 3VD7A 1ST8A 4CDWC 4DPNA 5HV4A 3ETPA 1MS9A 1NX9A 4MGKE 5JCTA 5A70A 1MQTA 2XBO3 4AHXA 1ND3C 4K7JA 2I2SA 3LSDA 3DECA 3ZXGA 1TME3 5IFPA 5F3CA 3OBTA 3ABZA 5SV5A 4CCNA 4XHXA 1QNYA 4JDOA 4XETA 4ZXEA 3T09A 4JGYB 3A0NA 4IQPA 1GZTA 4N53B 3AC0A 2VJXA 5B2GB 1TMF1 2LUWA 3HPNA 4Y22A 5IVEA 2FDFA 2HWF1 1RUD2 4Z2WA 4Z2AA 2DBIA 1GLHA 2WQ8A 1V9U1 4L8QA 3FZ3A 1Y7BA 3LB9A 1U0AA 5CKMA 5FBJA 4K9SA 1W99A 2EA7A 5H9SA 2R32A 2JB8A 1KXGA 3VDDC 1PVC2 3IMMA 3OBAA 4WM8C 1RUOA 4FTSA 4Q4W3 1ODMA 1UYPA 4B7EA 5FZBA 5BNPA 2XB6C 3J9SA 2XWBB 4QWNA 3MIFA 5T55A 4V2WA 1RUJ1 4PLMA 3ZSLA 5DQ0A 3R05A 4MHRA 5C3RA 4OHYA 4XC9A 3SITA 4YZ4A 2ZGNA 4IEOA 4IEPA 1OD5A 2ZHLA 3RDIA 1FMD2 2XXZA 3T2OA 4BQWA 1M06G 3VBSB 4JHTA 1MZ5A 1S0EA 1ZA7A 1O3RA 5L19A 3ROUA 4YWAA 2CWSA 4WM7A 4BLJA 2VW0A 1JZ6A 3UGGA 1WCUA 4Y24A 1NLRA 1HQLA 3VD4A 3BTZA 4GULA 2Y38A 3J8F1 4OHZA 3NJYA 4CCJA 1LU2A 2GC3A 4IESA 5FYUA 5KHGA 4Q4X3 4XAAA 5ACA1 2A3WA 2Z42A 4MGIE 4IGOA 2WNVB 4I01A 3N4MA 3ES1A 1MS8A 4AVTA 5B4NA 2QUOA 2XHKA 1XPWA 2KR2A 5I0UA 4NRMA 4YARA 3S7IA 3FLRA 4G3YC 2R16A 4XMAA 5HPOA 2HBUA 1DCSA 2ZGRA 4NIIA 1W2AX 3EB7A 3WNNA 1RJ8A 1SQ4A 2OUHA 2PLV3 2Y33A 4IUGA 3HWJA 4LXLA 3CZUA 4QXKA 2DDUA 2A3XA 5BNOA 1EAH1 3HIFA 1ZBE2 2OVUA 5LA0A 4IE6A 1WWYA 2J1EA 3RYKA 1W2OA 3WDYA 1JZ2A 2RS11 4C1XA 2NN8A 4CP1A 2YU2A 4NO4A 3T1LA 3AJZA 3HT2A 1LNSA 1SFYA 4JQTA 2UWBA 3UYJA 3U78A 2VZ3A 3PMSA 1SLIA 4IL7A 2OS2A 3PDQA 5FYVA 2H0BA 5D2AA 3ZN5A 1AR62 1B35B 1ULOA 1WBLA 2J1AA 1ENRA 1R1A1 4BJ0A 4OUSA 3I2IA 3FE5A 3Q8BA 1DLLA 5L9VA 4MO3M 1D4M3 2QQOA 2RDQA 2WWSA 5L7OB 1LRHA 5FYYA 4BA6A 1TEIA 2WFF2 3AP4A 4A4AA 5F2SA 4YLZA 1HN1A 1GSLA 2QDNA 4GH4B 1Z78A 1IS4A 4CRQA 5C5UA 1VMJA 2JG9A 1BZWA 1NA1B 2GC2A 5FIXA 1F9KA 4P08A 3OOXA 4LBKA 4RR3A 1C5IA 1V6LA 5FOBB 1JYWA 3V0AA 5EZWA 4CCEA 2VZVA 4JRLA 4AAPA 1RUC2 1CONA 3ENRA 3WDVA 2QQUA 5DAWA 5CFCB 1JBCA 3TN92 1UZ0A 1PGL1 1RXGA 1X33A 2W08A 3POYA 1MQTB 5F3IA 2R041 3RZJA 2VZRA 1UF2C 3GZTB 4O7XA 5A6XA 2QFEA 5GZEA 3EO6A 1PK6A 4QPGA 4IGQA 3MBWA 1LR5A 4A42A 1QOSA 5FZ8A 1RIRA 3RSJA 5BV6A 5JPNB 4XTMA 4XFBA 5CBLA 5KHHA 1LGNA 4LLOA 4UW4A 3KHBA 3O1SA 2Y64A 1RUH1 2LW8A 3H3UA 3KVBA 2OZ6A 1RUG2 2RS51 3ZPOA 2Z69A 1YIPA 1PO23 1URXA 4NOTA 2BNMA 4IXLA 3VDCA 4CPBD 5JPMB 3EMRA 2ZZQA 3OPTA 4FXGB 1SDDB 3SCHA 3EBRA 1GOGA 2W1SA 5JIAA 2DVDA 4COVA 1ZNPA 1AZDA 1UKGA 3U1XA 4EN0A 1A8DA 1O3QA 3I2DA 1RHI3 3O0XA 2WN3A 2OPKA 4OMCA 1JUHA 4JC1A 1HQWA 1VB4A 4LO7A 2JG8C 3WNOA 1JZ8A 4AGRA 1VIWB 3WDUA 4RGAA 1KEXA 3CJIA 3HR9A 4DUXA 2MEV2 3LF7A 3VBUB 2JDZA 1NY71 4Y4RA 3TB0A 4ATEA 2XH6A 4FPEA 3TYJA 2ZKLA 1PIV2 1PX4A 5T3NA 2R49A 3FMGA 5BYNA 2W5FA 3BALA 4PLOA 1U5ZA 1U5IA 5F3EA 2VMCA 3JXSA 1BHGA 1V6MA 4BIOA 1LESA 3J7LA 1QY4A 3AKPA 2PHXA 4HN0A 2FCVA 2RM22 3INAA 3VBRA 4IEZA 1XYPA 4ZZ8A 4YG3A 3KCCA 4BIFA 3NVCA 4DMIA 4N7IA 3JUUA 5FPXA 1OOPA 1DYOA 1FNYA 3H1YA 4XCBA 2Q8DA 5FQ0A 4B8EA 5FP7A 3TAYA 3BUCA 3C8XA 1W6NA 2PELA 2RV9A 2UWAA 1VE0A 2DTWA 2PHRA 4QU1A 1K5JA 1QQP1 1FPN3 2P3JA 3DEMA 3MDPA 3PLQA 5LY1A 4KG0A 3LKJA 1QMJA 4FSJA 5F9TA 4Q4Y3 1V6KA 3WG1A 5FP3A 4M00A 4F7ZA 2Q5TA 4ES8A 2XL7A 4EN7B 5E16A 5I8SA 1N1TA 3N9LA 2R7EB 1NXD1 1OQDA 5A7OA 3CZJA 4YW3A 1OKQA 4UI9L 4EN8B 4QDSA 4JX0A 3TWIA 3N3HA 1F35A 4LKEA 2IXHA 5FZ6A 4ARYA 4TN7A 4LE4A 1N3PA 4OZXA 1AR92 4K1YA 2AGSA 4K8FA 4XOGA 5DDJ3 5BNNA 4JTNA 4KBZA 2JB4A 3LA7A 3N7MA 1OF3A 2ZAHA 1WCSA 2A6XA 2A6VA 2QQVA 4IV3C 2Y6HA 2Z4FA 2EXIA 1T6BX 3OGVA 4DY5A 1HV1A 4M3CB 4CEYC 2VOKA 3TOJA 3M1HA 4Y20A 4FXKB 2WR9A 1H8TA 3FJSA 1XE8A 2D3SA 5GLVA 3G6JB 4CU9A 3J8F2 3F95A 1JI6A 1RGSA 2FDIA 1U5YA 4BQ5A 3VKOA 5ACA2 5FUPA 3ZFEC 4XF4A 1C3HA 1DQ5A 1H6YA 2D6PA 2VZQA 1TE1B 1JYCA 5FXXA 2OQ7A 3I2HA 2NM1A 5ANNA 3I2JA 2VOVA 2GSYA 2B5HA 2DVFA 3JU9A 2GU9A 5KC5A 4PDWC 5LB6A 1KJLA 1UOFA 4XXPA 4BHPA 3NRUA 5A3MA 5C4WA 1EAH2 1BEV3 4NWVA 5A80A 2D6MA 4EWAA 5LRRA 2X5IA 3AJYA 4D0QA 2P1BA 1SACA 3L9JT 4BMEA 4HVQA 4Z92B 2WS93 2RS12 1HRV1 2JEMA 4CP9B 5DUWA 4FOYA 1ENXA 2ZX3A 3VBFB 4AXOA 1EPWA 2A75A 2VULA 3AXDA 3BODA 5GZFA 1CAXA 3WG3A 2IXJA 2Y0IA 3GM8A 1UOGA 2LROA 2ID4A 3OTFA 4H2AA 3VZNA 4BU2A 3IKWA 3ACGA 2E9QA 3WW1A 3ZDVA 3FUOA 1JZ4A 4OUEA 2XG3A 1JYIA 3PMEA 2I07B 2Q0AA 1LOCA 3RFRA 1JHJA 2XONA 1HQNA 3WF3A 3BTXA 4Y5Z0 2O14A 2PHWA 5D8AC 1Q5OA 3D5OA 3T0BA 2Y6LA 1C4RA 1QNWA 3LPGA 1HB1A 4XUQA 4KBBA 5FZCA 4AVVA 4MX3A 3UK9A 5SV8A 4JTOA 2MHFA 1GFF2 2HWD2 3A0KA 1W8OA 2G4IA 4CYDA 3O1RA 2GMPA 3NMBA 1PGL2 2R1DA 4Z82A 1W2TA 5H9PA 5A3WA 4QPIC 2WAAA 5DG2A 1GWKA 1UOBA 1C1LA 2W92A 1ND3B 1SFPA 4JGZB 3QD6A 1YJKA 4HZFA 4QDQA 4RN5A 4E4DX 5HBAA 3NSTA 2ZZJA 2BZDA 3DGTA 2WN2A 5JSRA 1NAEA 4NROA 4XF9A 2BBAA 2G9GA 5E6HA 2E32A 3RRDA 5IATA 4AQ2A 2RG4A 5LCWL 2RS52 5LBBA 2ADEA 3O5SA 3JQWA 2VQAA 1UU5A 1OH4A 3ZFFC 4NMIA 1VRH3 1ULEA 1F5FA 1ZBA3 4LBQA 4QB1A 5C8CA 2E7QA 3VDDB 1WCQA 3N9QA 2G1MA 2QVSB 3PIJA 2R061 1KDMA 2VD7A 3I54A 1VB2A 3HVDA 2IXCA 3IPVB 4FOVA 4WM8B 4XMIA 5FPVA 4AVCA 4DRVA 1W6QA 3VHRA 1Q56A 2B45X 2PHDA 3KGZA 3USUA 2BQPA 4DQAA 4E4SA 3UKVA 4UFHA 1VBE3 2LALA 5C9AB 4GZ9A 3I3BA 3AMMA 3ATGA 4KI5M 5GKAC 3MYXA 5C33A 5JZGA 4MG2A 1NY72 4Q4W1 4XUNA 5FZOB 4UT5A 3NNGA 4GXLA 1COV1 5GLUA 4GKXA 1SCSA 3NNFA 4RQPC 4LHSA 3LE0A 1NYWA 1QJX3 5JXIA 3MICA 4GD4A 1OFSA 1J1LA 1PO11 4D8MA 1IKPA 2YHJA 3N9NA 3NL1A 3PVNA 5FBZA 4QD2A 4QHOA 4BOWA 2HWE3 3MIDA 2WZ8A 2E26A 2WABA 1C1FA 1IG0A 2PAKA 1AL21 3POJA 1H0BA 2L9LA 4MGQA 4HBNA 4XURA 4YVSC 3ORJA 1G8WA 2W1WA 2WC2A 3WF2A 4YG0A 4B3NA 5FZ0A 1NUKA 2DVBA 2ZGTA 4YG6A 2IFWA 2ZMNA 3AYDA 1T2XA 3POSA 4Y26A 5FP8A 3SCFA 5EQUA 3VKMA 2HLEA 1HXS1 2DCKA 3ACIA 3I3DA 4GAZA 4NHKA 3R0RA 4W50A 5A33B 3BVCA 2XWJB 1AX1A 1KD7A 2VECA 4LE3A 1GMMA 5FLJA 1QXJA 2CYFA 2ZACA 1HB3A 1RUF2 1GP4A 1ULCA 1VBC3 3KZ4C 2KD7A 4X6QB 4B7KA 1W0OA 3AVRA 4J1WA 5GZDA 4I3PA 3M3CA 5IUQA 2WLQA 4YFWA 3S30A 3KF5A 1IGOA 3U4SA 5KC6A 4AI3A 3AP5A 1LOAA 1NXMA 2VQUA 4Q2FA 4FPJA 5CKNA 1H9PA 2RS31 4CUBA 4CDXA 4KWKA 2K9ZA 3LA3A 2W1QA 2B7YA 3AFGA 2O8OA 2YPDA 2W91A 4TWTA 1CAUB 1YQ6A 4A41A 2WSUA 4ZU7A 2QE3A 2YXSA 2IZWA 4DOUA 3AKSA 4C8DA 5ISLA 3B01A 3UETA 2YG0A 3V64A 3HQXA 1LOFA 2CNAA 5B4XA 5J98B 2ZHKA 5APAA 3BIWE 3OCPA 1XYOA 1K42A 2C9AA 4CEWA 2ZEXA 3LDKA 4BPZA 4P9YA 2ADDA 4M0NA 2XUMA 4LBLA 4IEWA 3VZJA 1YLLA 4NPRA 1EUUA 2OQ6A 2PMWB 5L9RA 1ND2C 4S2FA 4MH0E 4XBNA 3WOGA 5IVFA 2D40A 3UNPA 1OA3A 2CHHA 2HEWF 4PBOA 1ZZ8A 1UPIA 4CDQA 5ABJB 2R30A 4AHYA 2WQ4A 5BNPC 1IKQA 4AEDA 2HEYF 3AM2A 5F6LB 1CAVA 2YMZA 1WKYA 5EJ3A 5EJZB 4E27A 5JWPA 2QQPA 3DXUA 3HBKA 2NLRA 3WXPA 5FO8B 4I2OA 2OA2A 2A5ZA 2WT2A 3E6DA 2OYZA 4COZA 3Q8EA 2ARAA 1QKQA 4YYOA 4X8NA 1PM4A 2YU1A 1HW5A 5L36A 2DFBA 4BK5A 3JD71 1W8FA 4D6SA 4Q5OA 4WM7C 1PO21 3DXTA 3OB8A 5DAPA 2EAKA 4YW5A 1Q8PA 3ETQA 3LPFA 1HX6A 4MV2A 2FCUA 3U4XA 3LQCA 3I2OA 2JDHA 3MFAA 3MW4A 1ZBE1 3DPRB 1MACA 4LKFA 5FZEA 1XB9A 1NCRC 2VZTA 4Q1RA 2ZMKA 4A7ZA 3QH7A 4AHZA 4JGYA 1SHWB 1JHNA 4N53A 3AMNA 3T2TA 3USSA 3D0SA 2YPJA 1PNGA 1DGRA 1O8PA 1XNDA 2XUEA 4XFHA 5HCFA 4ARXA 4COYA 1DP0A 4UW5A 3C7EA 3MIGA 3PIGA 3U14A 4CU6A 4IETA 2HWB3 2R072 4QKNA 3RI8A 4BYYA 2AENA 5BNOC 3ZYRA 1LOBA 2B9UA 5C6CA 2ETEA 1JYNA 1AXYA 4YW1A 5KXCA 4D3WA 3DL3A 3MUZ1 3G7DA 3O7OA 2WZR2 1NCQB 4LKDA 4U36A 2ZHNA 3VDBA 1ZZ6A 3ZSKA 4EYUA 4YM3A 4H7LA 2P3IA 5FZKA 5J37A 2XVLA 1SBFA 4ZY9A 2ET7A 3VBSA 4N7UA 1QF3A 2AR6A 3WVJA 4B29A 1JODA 5C71A 4A7YA 1RUC1 5JAXA 3E5XA 4Q0SA 1KGYA 3AB0A 2W52A 1DIWA 1QXRA 1SLBA 1TME2 3K48A 3AMHA 4QGMA 3SKJE 3WP3A 2MPFA 1W2UA 2ZEYA 1XJAA 3DKQA 3I97A 5FLHA 4M3CE 3VZMA 4DUVA 1GANA 2ZAAA 3FLPA 1GP5A 5BNQA 3MEPA 5IVBA 3J7MA 1RL3A 2JG9C 4GIQA 4AGVA 1DQ1A 3LOBA 3BTYA 5JXHA 3RYRA 1POQA 2WNVA 4DXSA 2D5HA 3RJ2X 5BPXA 4X8PA 3DKWA 2BBVA 2R0HA 4LO5B 1I3HA 4MZUA 3ACHA 4XABA 3VUOA 5FZMA 4HONA 5T5OA 3PL0A 5KR7A 4H3WA 3ZDSA 5T5JA 5F5QA 2LS6A 4IE7A 4Q4W2 1W6MB 5FY0A 2TNFA 1YWKA 3POBA 3SC7X 5F1RA 5EV7A 3I2GA 3ZO0B 1COV2 4C1WA 1LB2A 3CU7A 3HMYA 1AYN1 2C26A 2VG9A 4KG8A 1HB4A 3AP9A 4MLOA 4XFAA 2A6WA 1PK6C 3Q9OA 4QPGC 4CCOA 5JDBA 4CCLA 1ALYA 4P9LA 2HWC1 5C3SA 2V5YA 3I2FA 2XDVA 5A1LA 3ZFEB 2FDHA 2HEVF 2WNUC 5AVPA 3OG2A 2JWPA 2C6SA 3WP5A 5LW9A 3VZKA 3N7LA 5FPAA 2GNDA 1HJGA 4XJZA 1AL0G 4CXWA 2BUKA 3NWKA 1YHFA 3CF6E 1UL9A 2FDJA 2KA3A 1EV13 1Z7S3 3WNXA 1O4YA 4EV0A 2NP0A 4Q4X2 2MEV1 4QXBA 3UJOA 5L7OA 5T5LA 5A3LA 2VOTA 3NQHA 3O14A 1BK1A 1UYYA 1Q8QA 1S0FA 2P3KA 2Q30A 4GH4A 1NKGA 2P5BA 2FZ2A 1NA1A 2QNKA 5H9RA 1UCXA 3AYAA 5IVVA 2JDPA 2DVGA 2VMDA 5JOXA 3QH6A 1HXS2 5IAVA 3KV9A 4I3GA 2QQKA 5JIUA 3THTA 3VV1A 5HI0A 1OLQA 2WO1A 4D7YA 1MEC3 5CFCA 2DF7A 3CJIC 3ZKYA 4UAPA 3HD8B 4AI0A 5IVCA 2E51A 3CBNA 1EP0A 1XSRA 1NQDA 3JB4C 3P5BA 4HL0A 4HN1A 3VHPA 1D0GA 3AZWA 5CYYA 4ASLA 3FX3A 2JD4A 5G05L 2CL2A 2O0OA 4PF5A 5CG9A 2VXJA 3FBMA 2UWCA 2YBPA 2O8QA 1KITA 3AZZA 1F5JA 2ZPXA 3RJRA 4DS0A 2JD9A 3KT7A 3MV11 5D8AB 1DQ2A 2RS32 5JLVA 2K46A 3VBRC 3W21A 1UIKA 3FFZA 5FYTA 3RZGA 2R6QA 2IVIB 3HJRA 4QT6A 1JN2P 5FK7A 1QJY3 4TZDA 4NJ4A 1D4M2 1OOPC 4DIQA 4UWDA 1SBDA 3K4AA 4FVVA 4V1PA 1OI6A 2EICA 5JMCA 4QKFA 1OFNA 3KV6A 4W65A 1F4HA 1VPHA 2D6OX 1AR91 2J1VA 2KXLA 5EWSA 3WZ1A 4DEQA 1JU4A 5L9BA 1GZWB 3WDWA 1S2BA 3T4VA 4XYXA 2PYTA 4GMP3 5A6YA 5FXWA 1XQNA 1KFUL 2QQNA 4Y1VA 4FPOB 5AFBA 3RZHA 5IK4A 4OZOA 1OVSA 3OJBA 1WA6X 2UYAA 3LWCA 3VBHB 3OY8B 2XJSA 2QQMA 5A3NA 1WLTA 1GR3A 3WEZA 3VBUA 2E53A 3H50A 4NHMA 5FJHA 1LGBA 2VBPA 4LBNA 4BE3A 1VMHA 2RHPA 1LHNA 3AVSA 3WINE 3POEA 4RFRB 4W8JA 1LODA 3NAPB 4TXWA 1QH6A 5JI7A 4QQ2A 2VC9A 1HDKA 2QJVA 4BZ4A 4QX7A 4F83A 1H2LA 5GLZA 1G9FA 4CCKA 1RVF1 1UXXX 3M3OA 5DABA 4AHWA 4NIHA 2VE1A 3JD72 4PLNA 2GNBA 2BFUS 4S2DA 4FTBA 4MHUA 1PO22 1BBT1 1S0CA 4LHNA 3C7GA 1HKDA 2DBNA 4XF0A 1ZBA1 1H8TC 2PN5A 4YVWA 1W6PB 3RG0A 3WG4A 1HRI3 3O0WA 1QJEA 1S0DA 3KQRA 4N43C 3LZZA 1F8VA 3HNYM 1L7QA 2E6VA 1Q43A 2GC1A 3B3QE 4PCRA 3VD5A 3HNBM 2OZJA 4HOOA 3NV4A 4LHKA 3A23A 5KWRA 3ZPYA 2XVKA 1PGW1 3I2KA 1PMJX 2VW1A 3OGSA 4IERA 3UKNA 3BI3A 4XFIA 3N9OA 4LR4A 2BERA 5F39A 2VMIA 4CU8A 2K2SA 4IV1C 4NIAA 1N3QA 4NAMA 3NV1A 1AR81 2VU9A 3JBG3 4KWUA 1G9CA 3AZYA 5LATA 5F5CA 3THPA 4F3JA 2FHRA 4IE0A 3TEZA 5F2WA 1GQPA 3WHTA 4EROA 4Q4V3 1EYBA 3LD8A 2PHUA 1OPMA 3QOPA 4LIVA 2X05A 3WCSA 4EN9B 3MW2A 5KHKA 5CFDC 5DZEA 1FV2A 2VZPA 3DV8A 1VMFA 3S5QA 3U75A 1MS0A 1W0NA 3ZXKA 2B9VA 3Q8AA 4FO9A 2BWCA 1MS5A 1UY0A 2GMEA 1GQGA 3MW3A 4FP3A 5FFOC 1W04A 4M3CA 3CQOA 2HWD1 2ES3A 4IW3A 1RUD3 4RHV1 5CIRA 5DXDA 1RMU1 4Z1VA 1AXZA 3M3QA 2ZX4A 1TNFA 1U5XA 2DWRA 4LKSA 1FPN2 3NO8A 4ATFA 4CDUB 3N7JA 3WNLA 4XIKA 1CGPA 1WMXA 2YB7A 3CO2A 2VCAA 5JXJA 4HG6B 1H1AA 4Q8KA 4JQRA 4Q8LA 5I93A 1PVC3 2NPIA 4DXTA 4Q4Y2 3ST7A 2PAMA 5GZCA 1FOD3 4P9XA 3CIHA 4KGQA 1UIJA 2ZA9A 1H2KA 4CP2A 4F8AA 3BB6A 4COWA 2YUEA 4MUVA 1JOJA 1US2A 2DUQA 3K46A 2WYFA 4G4FA 1AYN2 5G04L 2WO2A 1AR73 4KWJA 4P5HA 4XTPA 5FPUA 3POGA 1HB2A 2PQQA 4OYUA 4Q29A 1ZRFA 4CP9A 1LHVA 1VBB3 1FT9A 3KD4A 2E7TA 1R083 2HWC2 3PVOA 3VBFA 2ZJCA 3B00A 3M2MA 2CU5A 4XW3A 1NOVA 4LPLA 5FY8A 3WF1A 1NE6A 3H1WA 1BVP1 1ZREA 4O9EA 2CDPA 1I9RA 1E5HA 3U11A 1BLZA 5FWJA 3H7JA 3VL9A 4ZS2A 1XNTA 5FY4A 4BLIA 4DZGA 4FAGA 3HBZA 1PHMA 1ND2B 1RXFA 1XSQA 5C8CC 3WF4A 1VLNA 3VB9A 2ARXA 4B4QA 5CEHA 3E6CC 1LEDA 2BEOA 2FCTA 3GXUA 3WF0A 3J7HA 4QB6A 2VZOA 3B9CA 5JR2A 3GGLA 4LA3A 5DUXA 3UV9A 4D6QA 4A2UA 4ITCA 3I8TA 5E8AA 5L73A 3O1OA 1HLCA 1X82A 3T30A 1PZ8A 4Q0PA 4FOQA 4QQOA 5FZFA 5FY1A 3IDCB 5A6ZA 3RGBA 3S57A 2FD8A 1PMHX 3RVHA 3VN4A 5K8SA 1BEV2 4QMAA 3HQUA 5JZGC 4KQ7A 4E4HA 1UU6A 1X7NA 3I59B 4TTGA 1UQXA 2WS92 2XJRA 2ZTNA 4YVWB 1PNFA 1H2NA 1CX4A 1CIWA 1XYNA 2WWUA 4OULA 1ND3A 1XU2A 2HKXA 2ZGLA 1CIYA 2QZ3A 4XFCA 4JGZA 4BCUA 2VQ0A 2VZ1A 3OSDA 1RC6A 2GN7A 2DYCA 5FYHA 3VKLA 4AFAA 1NCRB 5J7MA 2ZS6B 4M01A 5LK5A 2Y6GA 1W9YA 4JVAA 4RA0A 3P6BA 4LOSA 4BQ1A 3KSCA 3FHAA 1JMUB 2WNOA 3C7FA 1OUSA 4NWWA 3NW4A 1RUF1 2RR11 4I0BA 3KGLA 3ZYIB 3KT4A 3POIA 5FKBA 3SLIA 2VTFA 4I02A 5FUIA 1J1TA 4PF1A 4AEKA 3VDDA 2RDNA 2DCZA 3KF3A 4WM8A 5CG8A 2I74A 3IPVA 1B09A 3LEKA 4WVMB 4QKDA 1RUE3 3VBOB 1DYKA 5LK7B 3CDZB 4LNVA 1X9TA 1G9BA 4OQ8A 2IUWA 3KM5A 5C9AA 2JDUA 2BOJA 5IVJA 1DGRN 1DLCA 1VBD1 2VY0A 4I30A 4RYDA 5FWEA 3MLJA 3PUQA 4KH9A 4LHLA 4GB33 4HMZA 4UF0B 3T0DA 1BKZA 2SLIA 4NUBA 5FOJB 3ELNA 5A3OA 3WW4A 4Z8BA 5JOZA 1GOFA 1REFA 5FZOA 3FHIB 4ASMB 1H8VA 1H9WA 4P9JA 4RSUA 1RUG3 2GZWA 4N9HA 2F4LA 2VVFA 4HVRA 3P1IA 1Y9QA 1O5LA 1S2EA 2XR4A 4AVAA 1RVF2 1XU1A 1WLCA 2BP6A 1DF0A 2Q1FA 4NAOA 4E2GA 3ACLA 2AUYA 2BWAA 1RINA 1BMV2 4J6GA 1BBT2 4A7KA 5FCCA 5KXEA 2A6ZA 1XRUA 4XCAA 1ZBA2 3J7NA 3M7AA 3T3YA 4OVEA 3C2UA 1TQ5A 4E9KA 1KDKA 2NMNA 3WQBA 3ILRA 2CGOA 2WZPP 3KCYA 4B1LA 1UW8A 2OPWA 1POV0 3OD4A 1W8WA 2JICA 5BXXA 1W9FA 4CEWC 4QX8A 4YW4A 5KXDA 1F31A 4LIUA 1OLRA 1VBE2 1PIV3 1PGW2 2ILMA 3LDBA 3LIHA 1AF9A 4YM1A 1GP6A 1UYZA 3PJQA 3GJBA 4GWJA 3KQ4B 4HSJA 4XACA 3H1MA 5A33A 3MLKA 2QQIA 3OYWA 3V0BB 2PHLA 5T54A 4INDA 5GM0A 1AR82 1VBA3 4FQZA 2W39A 1GU3A 4HPKB 4CDQC 2JE9A 3MGUA 1UZZA 1G7YA 5HCAA 3RMXA 3VD9A 1TVGA 3GCWA 4MXVA 4JCKA 1QJX2 1WBFA 4ZONA 2D3RA 2WAOA 2F17A 3AYCA 3KMHA 2JE8A 2QDRA 4RS5C 4Y3OA 1AYM3 4GJYA 4YGBA 2YFZA 5EPAA 4PIXA 1R091 4UFMA 3RWKX 4BH9A 5LWBA 1E57A 3OUHA 1TMF3 2RJKA 2Y34A 1EV11 3MPBA 2OKXA 3WSOA 2HWF3 4RHV2 5AVAA 4JKKA 1RMU2 1C8M3 1CAUA 1LGCA 1V9U3 1K5MB 2P6HA 1IS3A 3RQ0A 4CDWB 2R071 2UYBA 1C28A 2DU0A 4FBFA 4ISRA 3AL5A 2HYXA 4O9GA 3FFQA 5ANQA 1OHFA 1GWLA 4JGYC 2DURA 1J58A 4N53C 4ZHNA 2F6BA 1DZTA 2WYSA 3GCXA 1LHUA 1WMFA 2WZR1 4GQ7A 4QGNA 5EFUA 5GALA 1GKBA 5IYYA 5KXBA 3HNMA 3WG2A 1YI9A 4W6XA 2VNRA 5DZFA 1RUJ3 1VBC2 3I7DA 2ORZA 3H42B 1C5HA 4FFHA 1W28A 4Y1YA 1V6IA 2XBO1 2XJVA 1SG3A 3HQRA 4L97A 3WCRA 2W87A 1IS6A 1H6XA 2D93A 1MZ6A 5FZAA 3EYPA 5ABJA 1TME1 4QM9A 1F15A 2Y0OA 3ZYGA 2HJIA 2WUHA 5D21A 4R9CA 5DG1A 3E6BA 5FREA 5CAZA 3WQ7A 3PVBB 4URAA 2ENRA 4R9AA 4DO0A 4UFIA 1XE7A 3URFA 1OUXA 1XNCA 4K21A 3ZSJA 1UYXA 3VBSC 2YROA 4HETA 5ACA3 1ZZBA 3BCWA 4P9WA 3UKTA 1D7PM 2W95A 5DN2A 1ZZ7A 4D69A 1ULFA 1RYYA 2BTVC 2AACA 4LUMA 3K77A 5LA1A 4LK6A 3OPWA 4YGDA 1V00A 4WV8A 4WVZA 2Y6JA 5F3GA 4YFZA 1W6OB 2FQPA 3WR0A 2VUCA 4AZZA 3DPRA 3TEYA 1SLLA 1KQRA 1X36A 2ZGMA 3M4FA 4K3UA 4QX3A 2I45A 4XFGA 4NHLA 4Y4YA 5CA6A 5A7WB 5E1RA 1W8NA 1EAH3 2TBVA 3H7YA 2UY8A 4LK7A 5DAVA 2BJSA 2B46X 4E2SA 2VUJA 3WT3A 1LEMA 2AYHA 4CZSA 1DDLA 5IFTA 1DU3D 2PTMA 2RMU3 5FO7B 2ZABA 2NQYA 4OHVA 1POV3 3KV5A 4XF1A 5FYBA 4JDMA 3LFMA 1E5SA 1Q3EA 2PHTA 1W90A 2YY1A 4OMDA 1BVVA 2WT1A 3N36A 2FMDA 3SH3A 3ILNA 4X6RB 5FYMA 1CX1A 2A1XA 4PQQA 4Q4X1 1R1A3 1QGLA 1AJOA 2AZ5A 1DZRA 4FPYA 5H9QA 3RYPA 1DGWA 1YUDA 1NCQA 1OH3A 1YFUA 1REEA 3HAGA 5FPBA 4DUWA 4N43B 4ZKTB 1CAWB 3ZN6B 3GALA 3WNMA 2X53S 1ZX5A 3IN9A 3KV4A 4NIGA 3GZEA 4CCCA 3OYWB 1B35C 3IWZA 4TLGA 2PLV1 2RR12 1OBNA 4AL9A 2JIGA 2TUNA 2J1RA 3A21A 5TSWA 2MNGA 1E5RA 3APBA 4IV1B 3LA2A 2W3JA 3AX4A 3ZFGC 4AQ6A 4D7TA 3DF0A 2IC1A 1QWRA 1ONAA 1WMDA 2BGPA 2VMHA 3LDRA 1SBEA 3R4UA 4KGGA 3ALQA 1CESA 4QU2A 1NG0A 2R043 3CL1A 4PQ9A 5J09A 3MV01 1N1SA 2WIIB 2WQZC 1OD3A 5CFDB 4WZCA 4JKLA 1DYPA 4QX0A 4KL1A 5DUVA 1UX6A 5CNAA 4EJRA 3SH5A 4WBBA 4AEJA 5CFCC 5K0UC 4DXRA 1VBD2 4L11A 5AFEA 1JH5A 4RGKA 5JVVA 4GWMA 5GLWA 5A1FA 3S5AA 3OGJA 1TG7A 1W6MA 1D4M1 1JS9A 1KJRA 1MQTC 4UW3A 3VKFC 5EIYB 2P34A 2Y60A 2BOIA 2RVAA 1RUH3 4AAXA 2X10A 3VHOA 3KT1A 4HANA 1J84A 5LZ6A 4XUOA 1GZ9A 2C9KA 1LENA 3AL6A 3D82A 5FZ4A 4A6OA 1PZ9A 2DFCA 1IG3A 2QZ2A 4CPBA 1FYUA 4IEUA 2RJ2A 3KLSA 1V6OA 5CKQA 3MFCA 3ZFEA 1QJFA 3DN7A 1O59A 4K20A 1N1YA 1I6XA 4JRAA 4DB5A 3DCQA 5JSPA 2Q8OA 3CMGA 3HEIA 4C0BA 2IWGB 4KWLA 2GH8A 5C70A 4YM0A 1O3TA 3I3EA 3K2OA 4BQ3A 1C57A 3HOBA 4GJZA 4M4RA 4UOJA 1H4HA 5IJRA 3WP6A 1GNZA 2JDYA 1CVNA 2O1QA 3RZMA 2YC2A 5I91A 1M4WA 4XJ8A 3AXEA 1X9PA 3VKNA 3RZKA 1FOD1 1C8NA 1JW6A 2VH9A 4RFT0 4DNYA 3P3PA 1PGSA 1R1ZA 2JDMA 3V65A 2E7AA 1FAYA 2X09A 4GKYA 3VZOA 3SEPA 1UZYA 2V72A 1IPJA 2QQWA 3A22A 3EQEA 3GZAA 3LIGA 2Q8EA 4P02B 3VBUC 1I5ZA 4A44A 2JG8B 1FV3A 4XJAA 3OGRA 2H0VA 3MUY1 1H30A 1UU4A 1AX2A 4IEQA 3IAPA 5T50A 1YO8A 4J25A 1RHI1 1DFQA 2A3YA 5D8AA 2P4EA 5EYXA 5HCBA 2PAEA 1R092 4QX2A 2BNNA 1QQP3 2C1FA 3ZX7A 1SLCA 1W3XA 3UGFA 5JI9A 4NHXA 2BFUL 5FMOS 1YYNA 1EV12 1REDA 2WJSA 2YBSA 2YBKA 1U12A 1Q8OA 1W8HA 2WA3A 1OMIA 1WW6A 1HJFA 4QDRA 4R4ZA 3BOWA 1Q8SA 1VAKA 1PMIA 3NKTA 2EF6A 3FUQA 3PUIA 5DZGA 1ZVFA 5A3PA 3DYOA 2VOXA 1W0PA 3WUCA 2A7AA 1L7RA 1GZWA 1RUI3 3IDBB 5E89A 3ZMNA 4AEMA 4ASKA 5K4LA 4HFSA 1O4ZA 1MEC2 4OI2A 1I1EA 2VNOA 3WLUA 1EPZA 1OKOA 4UFLA 3T1MA 2EALA 1O3SA 2XJUA 4CUGA 4S2GA 3T08A 2WO7A 2VBDA 1ZA4A 3VD3A 2XBO2 4CXYA 3VBHA 3OY8A 4AVSA 4LBOA 2AEZA 2BDRA 5M0TA 3AZXA 1DGLA 1JUIA 4P00B 3FLTA 4GMP0 3W58A 1ASJ3 4HSLA 4P5YA 4LEJA 1V6NA 1FPN1 4OCTA 2EXKA 2QQJA 2OXBA 4FPFA 4PI2A 2EIEA 3NAPA 5DUUA 5IK7A 3PHMA 1AJKA 2J1SA 2W1UA 4OUMA 4RR3C 1FX5A 4Q4Y1 1QJY2 2IXIA 4AE2A 3QCWA 4QGLA 2WLPA 1BCXA 3UT0A 2VAUA 3C3VA 4OQ9A 2DV9A 4FT8A 5GZGA 4BISA 4IV3B 3OEAA 3B5LB 2ARCA 2AEYA 1W6PA 5LEKA 5DDJ1 3WNPA 1WCDJ 4CEYB 1V6JA 3OUIA 3GF6A 1OXCA 1UPSA 5KBFA 1OQEA 5JOYA 2W68A 1X8EA 2DTYA 4HK8A 5CADA 3RNSA 2XOMA 4CP0A 4MXWB 1WA4A 2E31A 2GDFA 2PXJA 5J1XA 1HRV3 3LEMA 1OA4A 2GP3A 3AZVA 4GB31 2EAAA 5F8PA 1G9DA 3U07A 1OF4A 1V70A 4OI0A 1FI2A 3VDAA 2YFUA 4PDWB 1EUTA 5F7UA 3LCPA 4R8HA 4MYEA 4NVPA 1IZ3A 1NZIA 4YVSA 3BOPA 5FY7A 2J1TA 3E5UA 3H8UA 4L2NA 3VBFC 4B4RA 3MPPG 4P9GA 2Z2SB 4PT6A 1CPMA 3O1VA 4YPJA 1DBNA 4BM8A 3UGHA 5FZ9A 5A32B 2HBTA 2PLV2 3L2HA 1A3KA 4H7MA 4XE9A 3WW2A 1MS3A 1O8SA 2EVXA 1Y43B 1UNBA 2NMOA 4ZU5A 3ZVXA 1BEV1 2X8KA 2DVAA 1ZRCA 2YC0A 4CDUA 2IXLA 2CAUA 1CZVA 3H3ZA 2WS91 3DYPA 3CNAA 3HN1A 2J1UA 1LECA 3PUHA 1QOTA 1Y3TA 3M70A 3ZIWA 3EXUA 4XQDA 5FO9B 5F5AA 5J36A 2UU8A 4RS5B 2R0FA 1JZ5A 5EP9A 3OBZA 2D44A 2DU1A 3ZXAC 4TYSA 1VR3A 1YFYA 3MF6A 4Q4V2 2VZSA 4QQPA 5FTTC 3WUDA 4A3ZA 1QOOA 2J7MA 4Q26A 1KS4A 4BB3A 2YZ4A 1SPPB 3BU7A 1P8JA 4AFCA 5J96B 1FNZA 2FBEA 3B02A 4AYUA 4JGZC 4Y1XA 1AYM1 2BPA2 4QPIB 4PJYA 1JYXA 2FDKA 4NR1A 1SFNA 2R063 2ZEWA 5GJ6A 1H2MA 2A71A 2D7FA 1YQ5A 2CV6A 1C8M1 4FP2A 1IQAA 1NQJA 1QJU3 4HKWA 3M8LA 1IHMA 1DQ4A 4NPLA 1D2QA 1G9AA 5A1AA 4CTEA 2ZX1A 4QQHA 5DAXA 4ES9A 1ND2A 4XZPA 2BU9A 2ZOEB 3AP7A 3IBMA 5LEJA 2XHNA 4NN0A 1GQHA 2QKDA 4BMBA 4XIOA 3FHQA 4OLLA 3ZN4A 3LFIA 3ZXFA 3TNPB 5BNNC 4XXAA 4GA9A 5FZDA 1XXNA 3ZFFB 1FOD2 1OLME 1CD3G 4JZRA 2DCYA 3KCXA 1S0JA 3MI8A 1COV3 2XLFA 3QACA 4SBVA 3WV6A 4IEXA 4LA2A 4BQYA 1O7FA 4XPVA 5C3PA 5AC93 5I8YA 2BV4A 3ON7A 5C9AC 1CN1A 1TZOA 4AR2A 3TEWA 4R52A 3SNMA 1BMV1 4XUPA 1BXHA 1PO13 2XLAA 4N9IA 3I59A 5A6QA 1AR72 2CAVA 1VRH1 4FPHA 4LBQD 4FQ4A 4XBQA 4AFBA 1VBB2 4HK9A 4E4ZA 1R082 1SDWA 2DUOA 2B4KA 1R64A 2GP5A 2GNMA 2XJPA 4LLFA 1AL23 4QHZA 3RWNA 5LRSA 3SH4A 4UBGA 1RHI2 1UAIA 5FDBA 1WD3A 1MZFA 3CEWA 1NCRA 1Q8VA 3IIAA 4LJHA 5FZGA 5J48A 3MIHA 4RQPB 4CXXA 1VBE1 4G9SB 2LTNA 3OGGA 4KU8A 2ZEZA 2VO5A 1H4GA 3AFKA 5FAXA 1UXZA 1WCKA 4JAAA 2FDGA 2P17A 2XQRA 4CA9A 1HXS3 4E2QA 1YCIA 3N7KA 4AOCA 5C4WC 3ACFA 1DZQA 1IPSA 3E5QA 5C3QA 3N9MA 3T4HB 4YZ3A 2ZGSA 2X5IC 2G9FA 1OVPA 4W6WA 5A3UA 5K9YA 4YVSB 3QLQA 2G9ZA 3KHCA 4JV4A 2F4PA 2XKOA 1QJX1 1NZCA 4WVMA 1YQCA 4YM2A 1G86A 4CVUA 2RMU1 3VBOA 4COUA 3AYEA 4MOAA 1POV1 2GAUA 2RDSA 2P2KA 1ODNA 3U10A 2VNGA 3U37A 3ZSMA 1XC6A 3ECQA 4LO8A 1OT5A 2HWE1 3D6EA 3I4IA 3TEXA 3RMYA 3AKQA 2W47A 2GC0A 2RS33 1AXKA 4UF0A 4LBMA 3WY6A 3OD0A 3SXWA 5FR3A 3RI9A 3CKHA 1UD1A 3ZSEA 2OUJA 1S0IA 4AQTA 2VUAA 1OURA 4SLIA 4NIDA 3O1UA 3ZFGB 3O1TA 4TSVA 3C7HA 4NRPA 2VZUA 2J42A 5FV3A 4AFDA 1WW7A 2VUDA 3MHZA 4AQSA 4BXSV 3ZXJA 2Q1MA 4QKBA 4NPMA 4XEZA 1D2SA 3JB8A 4FFGA 1JOBA 3W5MA 1AUYA 2OT7A 3C7OA 1VBC1 3IT8A 4PIYA 3O12A 5A7QA 5F32A 4R9BA 3ZR6A 5K0UB 1PVXA 4CUAA 5JOWA 3R4SA 5CZKA 1FMD3 5DDJ2 1CR7A 4XQ4A 1GOHA 3O0VA 1S1AA 4DFSA 3KB5A 3WNKA 2D3PA 1RUE2 4FPCA 3IZOA 1O5UA 1PZ7A 3S7EA 3TNQA 5DPNA 4FAHA 3B9IA 4UBHA 3M3IA 2ZGKA 4Y5SA 3ZMOA 3BYWA 1RB8G 1QDCA 4K6BA 5IW0A 4I09A 1GNHA 2DCJA 3MZHA 1IOAA 2EIDA 4GWNA 1XNAA 4AVBA 3UJQA 4CCDA 4Y22B 4GB32 3V0BA 4L9BA 5CVRA 4Y1UA 2KM2A 4IE5A 2WNUA 3S6PA 5I8TA 4HPKA 3LAGA 2Q1ZB 1A6CA 4PBPA 4EWEA 5ABJC 3JD73 2TEPA 4KU7A 1QXPA 2XQXA 2NYYA 5FXZA 3CHXA 2PHFA 1AVBA 3LOIA 5LBFA 3F2ZA 2D97A 4UFJA 2JECA 3ZKUA 4LORA 5BNPB 1WW5A 3ZM8A 1RJ7A 1RITA 1ZBE3 4Q27A 2EXJA 1QJZA 3OUJA 1MR5A 1YFWA 3NNJA 5A7PA 1OSGA 4LULA 5JR7B 3W5NA 3WDXA 3D4KA 4XBLA 2HH9A 1SZBA 1K5MA 4V2VA 4CDWA 3X29B 2JKBA 4WM7B 4A45A 4JKMA 1ULPA 4DRRA 3DPRC 2H6BA 2HYKA 2XKPA 3A4UA 3VZLA 3H8RA 4D7SA 1AR63 1RTVA 4LOTA 1QHDA 2B42B 2DCTA 2ET1A 2IFRA 4MVTA 4XJUA 1GUIA 3IDEA 2B8MA 4YZ2A 2ZX2A 1APNA 1TNRA 1UMHA 2V09A 4RD7A 1FATA 1K45A 4B1MA 4HXCA 2WFF3 3ZXDA 5FUNA 2VCBA 1VBA2 4MGSA 1DG6A 1WLWA 2UY9A 4N8MA 1J3PA 4FCAA 5LA2A 1CZSA 3BKZA 1F2NA 4YW6A 1YRZA 2WZEA 3U0ZA 2V5DA 4R9DA 4ONUA 1VJ2A 4L99A 4S2HA 2ATFA 2WA4A 1HV0A 2WWJA 4PHZA 3MLLA 1RUC3 1DQ6A 1LULA 5BNOB 1AYM2 1NCQC 4XJWA 3TN93 4YZ5A 1D4VB 2P3YA 2AH2A 2QQLA 4LO6B 1LKNA 3LEGA 1TMF2 3HN3A 5T5PA 2HWF2 1WGPA 4XAEA 2YV8A 1A78A 1C8M2 3SKVA 4B4PA 1V9U2 2EXHA 2HWB1 1W9TA 2BGCA 4QM8A 2D6NA 5ERLA 2VOWA 4J1XA 3L2YA 1ULDA 3THDA 1JXNA 1MZEA 1XBFA 1OLMA 1ZZ9A 3ES4A 3GBFA 5IWFA 2D98A 1W6OA 1S55A 1RUI1 2ZBJA 3IIIA 2H6CA 4GWIA 3O1PA 4Y5TA 1I5PA 2RJLA 5A7WA 4EN6B 5LBCA 1RUJ2 1GWMA 2D6LX 2ZGOA 4HKLA 1MVEA 3LGRA 4AI1A 1AYN3 1RUNA 2JG9B 5FK8A 4CDXC 1YC61 4PIZA 2VMFA 2D6KA 4RR3B 5F5IA 4QX5A 5C7GA 2HWC3 4UW6A 3V0AB 1IS5A 3NJZA 1ASJ1 5JMOA 1VRH2 5FJKA 5J3UA 2WSVA 4PI0A 2B39A 1UY2A 5FLIA 2BVBA 1LOFC 3IDAA 3K3NA 3ZYHA 1HIXA 2OIIA 1O6UA 2MEV3 2GALA 4N43A 2Y8KA 3RS6A 2SBAA 1CAWA 3BGAA 4FFIA 1ZRRA 3ZN6A 4AI8A 1PK6B 4QPGB 4XF3A 5FPZA 4E8DA 4M4PA 3LSEA 4UYBA 5IT6A 5C5TA 2VPVA 3GBGA 4JDNA 1YJLA 3B7MA 3MIBA 4Y33A 4DXZA 1LAJA 3PU3A 3PURA 1J3RA 1NLSA 3BPZA 3FC0A 4H14A 2WNUB 3MIEA 3ZYPA 4AWDA 4W6YA 3I3MA 4IEVA 1J59A 4CU7A 2CGNA 3K51A 1GYKA 2RM23 3NV3A 4IV1A 4K8RB 4A3XA 2RDRA 3BU0A 4ORFA 3DYMA 4QPYA 4YGCA 1VAMA 4AEDC 2VCMA 4LTAA 4ET7A 2GMMA 3B69A 3M3EA 4YNIA 1WZXA 4UXAA 2JX9A 5IHRA 4M3CF 4ZS3A 2CSGA 3P3NA 2RMU2 1KRIA 1YI7A 1KS5A 4QX1A 4CSWA 4IEYA 5CFDA 2ZHMA 2Z5WA 3K3OA 5I0RA 4FTEA 2RE9A 2HWE2 1CWPA 5I0SA 3PUSA 2WO3A 3BTAA 2BW8A 4ZPIA 3H8XA 3AP6A 1Z7S1 3ZIXA 4BDVB 1R1A2 3SMHA 1ZYBA 3CJXA 3KVAA 3I49A 3CJIB 5FKCA 3VL8A 5FMCA 1WUVA 2Y6FA 2V4VA 1STMA 4N90A 4OI4A 1YQ2A 4XVHA 2VW2A 1S0GA 4WVVA 5FYCA 1MVQA 1UN1A 1AR93 1H1IA 3BN6A 2G19A 1QH7A 3THCA 2CTVA 4AFMA 3BIEA 1MEC1 4D94A 2WINB 5FMOL 4ZXKA 3MO4A 4FPKA 3ZXEA 1ENSA 2ZGPA 4K40A 1LOEA 4FI9A 2GH2A 2WRAA 3SISA 3VBRB 5KHIA 5LA9A 3OEBA 4O61A 5T52A 3JQXA 4YW2A 2WFPA 1LTEA 1Y4WA 3H8OA 1OOPB 2XJQA 3PUAA 4L92A 5I0DA 1IPKA 2R042 5FQ0B 4UFKA 3I3QA 1W6NB 3AMQA 1GV9A 1WW4A 1N3OA 1KFXL 3W9AA 2A6YA 2JJ6A 2JKXA 3K75B 2IVJA 4LUKA 3PVEA 4YSFA 2VQTA 2W0XA 3J8F3 1G6NA 2VNVA 3ZYJB 3PTRB 1QJY1 4FOWA 5FRAA 5FYSA 1E5IA 1UWWA 2VTXA 3VBHC 4DINB 2JENA 2PQSA 2V73A 1VRBA 4MADA 1RUH2 1RVF3 2FMYA 3HT1A 4QQLA 4XZUG 1W8ZA 4Y1ZA 4ZU4A 4QHBA 2JIJA 5FMDA 2JG8A 1Y9GA 5LY2A
chains in the Genus database with same CATH topology
1BJQA 1BBT3 4OHXA 3GBWA 1FXZA 5BY5A 3VGIA 5EYYA 1O4TA 3NAPC 4GMP1 2YGLA 1UKRA 2WNVC 5BNNB 2UURA 2PA7A 2GN3A 1LOGA 1QJU1 4Z07A 3IMNA 3EHKA 2RS13 4XDQA 3SCGA 4LBJA 1T6GC 2WNEA 4XILA 5IK8A 4MGZE 2A70A 3WP4A 3GZUC 1DHKB 4Y20B 1AR83 2VXRA 1H8TB 4DY3A 2N7GA 3JZVA 1CJPA 1QDOA 3ILFA 4AG4A 5AC91 2ZKNA 3FWEA 3WDTA 2Z79A 1SMVA 4LT5A 3AK0A 5JSOA 2P37A 4AW7A 2D5FA 2JXAA 4YGEA 3NV2A 2K0GA 1HRI1 2CWMA 3OBRA 4Q0QA 5L7OC 2HWD3 4RHV3 5C4WB 1RMU3 4GH4C 1VALA 3B94A 4XJ9A 2X5IB 1NA1C 1QQP2 3TRSB 4C91A 4BWOA 1YIFA 3EJKA 1WMEA 2CGPA 5K7PA 1GBGA 1XNBA 4ISQA 4TLFA 2BYVE 4P14A 2HWB2 5E88A 3ZXLA 3JBG1 2XPJA 1CAXB 4IV3A 1MS4A 1X50A 1J3QA 1OQ1A 4Q4V1 4CDUC 1ZRDA 4CEYA 1RUI2 4HKOA 3R6SA 2RS53 3KS7A 1YFXA 1CJDA 1SEFA 1H1MA 4I0AA 4KNCA 3POWA 4MXWA 1YNAA 3UL2A 2CY6A 2FZ1A 1RUD1 4I0WB 1JTZX 1ASJ2 4K1ZA 3DUIA 4HLTA 1UMZA 4OHWA 4M0HA 4PDWA 4XQWA 4HT1T 5KHJA 1PVC1 5F6KA 3WHUA 2XL9A 2EIGA 3MF9A 3S0MA 2LM3A 1AHSA 3OPZA 3NKGA 1ENQA 4RGGA 5A32A 1FMD1 2Q4SA 3H0OA 3VHNA 1BQPA 4LO4B 2ZGUA 1VAVA 1AR71 1GICA 3OF1A 4FPLA 3WW3A 2C5DA 3D0JA 1VBB1 2WT0A 5C8CB 1R081 3B93A 4LBQB 3ASIA 1HRV2 1AX0A 1PM7A 2E63A 3PTYA 2VMGA 4AK3A 4RS5A 1W6QB 2ARBA 2XVGA 3USUB 2C0ZA 1Z7S2 3PJYA 1XNKA 5CB7A 2JE7A 4YVWC 3AMPA 1LJ7A 5JZGB 2IXKA 1Z0HA 1RUF3 2RR13 1CPNA 1DGWX 2R1BA 4QPIA 4WVWA 2VGDA 5CU1A 3IM0A 2D43A 1LU1A 1QU0A 4H55A 4OFGA 2OW4A 2YDEA 3WD5A 1OPOA 3WQ1A 3TBDA 4YZ1A 1SCRA 1S2KA 3WX5A 2QCSB 2ZMLA 3AKRA 3H9AA 5EXOA 1EY2A 2YGMA 3RPQA 1AR61 1N47A 1VBD3 2AREA 2WL1A 4META 3N35A 1GZCA 3GNEA 3E97A 5C8WA 3ZFFA 1OA2A 2WFF1 3VBOC 4Q0UA 3W59A 4MSVA 5I0TA 4RL7A 2VVDA 1NE4A 2ZGQA 3FBYA 1D0HA 3SHRA 1ZM1A 3ME2A 2XGXA 5GLTA 1S0BA 2VVEA 3R4DB 3GHNA 2WKKA 2A73B 3TN91 1WD4A 3GYDA 1LCLA 2YYOA 5D1IA 2R062 1RUE1 4BH9A 3J26N 1CQ9A 2X29A 1VP6A 2GNTA 3GHMA 2ZX0A 5HXVA 2NZ9A 4RQPA 1QJU2 1DQ0A 3RZZA 4HVOA 2XJTA 4EWDA 4XFFA 1LHWA 5IK5A 2ZCWA 4CDXB 4AI2A 1ULGA 3JCIA 4XHBA 4U2AA 1MS1A 1RUG1 4AF9A 4WZFA 1RUOA 2DUPA 4URTA 3V56A 4P9IA 5AC92 4GALA 4OI1A 1O91A 1SLAA 4YRDA 4R4XA 4C90A 1SLTA 2PFWA 4CEWB 1A8MA 1PO12 1YXWA 4FPGA 4C0HA 1W39A 1X8MA 4Q1PA 3CLPA 1R093 1B35A 1HRI2 4MGYE 1AL22 2ERFA 2BVVA 4AGGA 3D8CA 5BUVA 1BYHA 2Y26A 1ZZCA 4CDQB 2BNOA 4Q0VA 3VLBB 3ZFGA 3AKTA 1L3JA 2R073 4AEDB 1PIV1 1CAVB 3J4UH 3WQ0A 1WLDA 1N1VA 1LHOA 3PNAA 1VBA1 3JBG2 3QBQA 2WZR3 2XLGA 2RM21 1K5MC 5K0UA 4CDWC 4DPNA 1MS9A 5JCTA 1MQTA 2XBO3 4AHXA 1ND3C 4K7JA 2I2SA 3LSDA 3ZXGA 1TME3 3OBTA 5SV5A 4XHXA 1QNYA 4JDOA 4XETA 4JGYB 3A0NA 4IQPA 4N53B 5B2GB 1TMF1 2LUWA 4Y22A 2HWF1 1RUD2 4Z2WA 1GLHA 1V9U1 4L8QA 3FZ3A 1Y7BA 3LB9A 1U0AA 4K9SA 2EA7A 5H9SA 2R32A 1KXGA 3VDDC 1PVC2 4WM8C 4FTSA 4Q4W3 4B7EA 5BNPA 2XB6C 3J9SA 2XWBB 3MIFA 5T55A 1RUJ1 4PLMA 3ZSLA 3R05A 4OHYA 3SITA 4YZ4A 2ZGNA 4IEOA 4IEPA 1OD5A 2ZHLA 3RDIA 1FMD2 1M06G 3VBSB 1MZ5A 1S0EA 1O3RA 5L19A 3ROUA 2CWSA 4WM7A 4BLJA 2VW0A 4Y24A 1NLRA 1HQLA 4GULA 2Y38A 3J8F1 4OHZA 1LU2A 2GC3A 4IESA 5KHGA 4Q4X3 5ACA1 2A3WA 2Z42A 4MGIE 2WNVB 4I01A 3N4MA 3ES1A 1MS8A 4AVTA 2QUOA 2XHKA 5I0UA 4YARA 3S7IA 3FLRA 4G3YC 2R16A 4XMAA 2ZGRA 1RJ8A 1SQ4A 2PLV3 2OUHA 3HWJA 4QXKA 2A3XA 5BNOA 1EAH1 3HIFA 1ZBE2 2OVUA 3RYKA 3WDYA 2RS11 4C1XA 2NN8A 4CP1A 4NO4A 3T1LA 3AJZA 3HT2A 1SFYA 2UWBA 3PMSA 1SLIA 4IL7A 2H0BA 3ZN5A 1AR62 1B35B 1WBLA 1ENRA 1R1A1 4OUSA 3FE5A 1DLLA 1D4M3 2WWSA 5L7OB 1LRHA 4BA6A 1TEIA 2WFF2 3AP4A 4YLZA 1GSLA 2QDNA 4GH4B 1Z78A 1IS4A 4CRQA 2JG9A 1BZWA 1NA1B 2GC2A 1F9KA 4LBKA 4RR3A 1C5IA 1V6LA 5FOBB 3V0AA 5EZWA 4JRLA 1RUC2 1CONA 3ENRA 3WDVA 5CFCB 1JBCA 3TN92 1PGL1 1X33A 2W08A 3POYA 1MQTB 2R041 1UF2C 3GZTB 2QFEA 5GZEA 3EO6A 1PK6A 4QPGA 1LR5A 1QOSA 3RSJA 1RIRA 5BV6A 5JPNB 4XTMA 4XFBA 5CBLA 5KHHA 1LGNA 4LLOA 4UW4A 1RUH1 3H3UA 2OZ6A 1RUG2 2RS51 2Z69A 1YIPA 1PO23 1URXA 4NOTA 2BNMA 4IXLA 5JPMB 2ZZQA 4FXGB 3SCHA 3EBRA 5JIAA 2DVDA 4COVA 1ZNPA 1AZDA 1UKGA 4EN0A 1A8DA 1O3QA 3I2DA 1RHI3 3O0XA 2OPKA 1JUHA 4JC1A 1HQWA 1VB4A 4LO7A 2JG8C 4AGRA 1VIWB 3WDUA 4RGAA 3HR9A 3CJIA 2MEV2 3VBUB 2JDZA 1NY71 3TB0A 4ATEA 2XH6A 4FPEA 3TYJA 2ZKLA 1PIV2 5T3NA 2R49A 3FMGA 5BYNA 3BALA 4PLOA 1U5ZA 1U5IA 4BIOA 1V6MA 1LESA 1QY4A 3AKPA 2PHXA 4HN0A 2RM22 3INAA 3VBRA 4IEZA 1XYPA 4YG3A 3KCCA 4BIFA 3NVCA 4DMIA 4N7IA 3JUUA 5FPXA 1OOPA 1FNYA 3H1YA 5FQ0A 4B8EA 3TAYA 1W6NA 2PELA 2UWAA 2DTWA 2PHRA 1QQP1 1FPN3 2P3JA 3PLQA 3MDPA 4KG0A 3LKJA 1QMJA 4FSJA 5F9TA 4Q4Y3 1V6KA 3WG1A 4M00A 4F7ZA 2Q5TA 4ES8A 2XL7A 4EN7B 5E16A 5I8SA 1N1TA 1NXD1 1OQDA 2BPA2 4YW3A 1OKQA 4EN8B 3TWIA 3N3HA 2IXHA 4LE4A 1N3PA 4OZXA 1AR92 4K1YA 2AGSA 4K8FA 4XOGA 5DDJ3 5BNNA 4JTNA 3LA7A 3N7MA 2ZAHA 1WCSA 2A6XA 2A6VA 4IV3C 2EXIA 4DY5A 1HV1A 4M3CB 4CEYC 2VOKA 3TOJA 3M1HA 4Y20A 4FXKB 1H8TA 3FJSA 1XE8A 2D3SA 5GLVA 3G6JB 3J8F2 1RGSA 1U5YA 3VKOA 5ACA2 3ZFEC 4XF4A 1C3HA 1DQ5A 2D6PA 1TE1B 1JYCA 2NM1A 2VOVA 2GSYA 2B5HA 2DVFA 3JU9A 2GU9A 5KC5A 4PDWC 1KJLA 4XXPA 4BHPA 5A3MA 5C4WA 1EAH2 1BEV3 4NWVA 2D6MA 4EWAA 5LRRA 2X5IA 3AJYA 1SACA 3L9JT 4BMEA 4HVQA 4Z92B 2WS93 2RS12 1HRV1 2JEMA 5DUWA 4FOYA 1ENXA 2ZX3A 3VBFB 4AXOA 1EPWA 2A75A 2VULA 3AXDA 3BODA 5GZFA 1CAXA 3WG3A 2IXJA 2Y0IA 3VZNA 3OTFA 3IKWA 2E9QA 3WW1A 3FUOA 2XG3A 1JYIA 3PMEA 2I07B 2Q0AA 1LOCA 1HQNA 4Y5Z0 5D8AC 2PHWA 1Q5OA 3D5OA 1C4RA 1QNWA 4KBBA 4AVVA 4MX3A 3UK9A 5SV8A 4JTOA 2MHFA 1GFF2 2HWD2 3A0KA 2G4IA 4CYDA 2GMPA 1PGL2 2R1DA 4Z82A 5H9PA 4QPIC 5DG2A 1C1LA 1ND3B 4JGZB 3QD6A 1YJKA 4HZFA 4E4DX 5HBAA 3NSTA 2ZZJA 3DGTA 5JSRA 4XF9A 2G9GA 3RRDA 4AQ2A 2RS52 3O5SA 3JQWA 2VQAA 1UU5A 3ZFFC 1VRH3 1ULEA 1F5FA 1ZBA3 4LBQA 5C8CA 2E7QA 3VDDB 2QVSB 4MGKE 2R061 1KDMA 4WM8B 3I54A 1VB2A 4XMIA 2IXCA 3IPVB 4FOVA 4AVCA 4DRVA 1W6QA 3VHRA 1Q56A 2B45X 2PHDA 3KGZA 3USUA 2BQPA 4DQAA 4E4SA 3UKVA 1VBE3 2LALA 5C9AB 3AMMA 3ATGA 5GKAC 3MYXA 5C33A 5JZGA 1NY72 4Q4W1 4GXLA 1COV1 5GLUA 4GKXA 1SCSA 4RQPC 1NYWA 1QJX3 3MICA 1OFSA 1J1LA 1PO11 1IKPA 2YHJA 3NL1A 3PVNA 5FBZA 4QD2A 4BOWA 2HWE3 3MIDA 1C1FA 2PAKA 1AL21 1H0BA 4HBNA 4YVSC 1G8WA 2WC2A 4YG0A 4B3NA 2DVBA 2ZGTA 4YG6A 2IFWA 2ZMNA 3AYDA 3POSA 4Y26A 3SCFA 3VKMA 4NHKA 1HXS1 2DCKA 3R0RA 5A33B 2XWJB 1AX1A 1KD7A 2VECA 4LE3A 5FLJA 1QXJA 2CYFA 2ZACA 1RUF2 1ULCA 1VBC3 3KZ4C 4X6QB 4B7KA 1W0OA 4J1WA 5GZDA 4I3PA 3M3CA 5IUQA 2WLQA 4YFWA 3S30A 1IGOA 5KC6A 4AI3A 3AP5A 1LOAA 1NXMA 4Q2FA 4FPJA 1H9PA 2RS31 4CDXA 4KWKA 2K9ZA 3LA3A 2B7YA 3AFGA 2O8OA 4TWTA 1CAUB 4ZU7A 2WSUA 2QE3A 2YXSA 2IZWA 4DOUA 3AKSA 3B01A 3V64A 3HQXA 1LOFA 2CNAA 5J98B 2ZHKA 3BIWE 3OCPA 1XYOA 2C9AA 4CEWA 4BPZA 4P9YA 4M0NA 2XUMA 4LBLA 4IEWA 3VZJA 1YLLA 4NPRA 1ND2C 4S2FA 4MH0E 4XBNA 3WOGA 2D40A 1OA3A 2HEWF 4PBOA 1ZZ8A 1UPIA 4CDQA 5ABJB 2R30A 4AHYA 2WQ4A 5BNPC 1IKQA 4AEDA 2HEYF 3AM2A 5F6LB 1CAVA 2YMZA 5EJ3A 5JWPA 2QQPA 4E27A 2NLRA 3WXPA 5FO8B 4I2OA 2OA2A 2A5ZA 2WT2A 3E6DA 2OYZA 4COZA 4YYOA 5L36A 1QKQA 4X8NA 1HW5A 2DFBA 3JD71 4WM7C 1PO21 2EAKA 4YW5A 1Q8PA 3ETQA 1HX6A 4MV2A 3U4XA 3MFAA 3MW4A 1ZBE1 3DPRB 1MACA 4Q1RA 1NCRC 4A7ZA 2ZMKA 3QH7A 4AHZA 4JGYA 1JHNA 4N53A 3AMNA 3T2TA 3USSA 3D0SA 2YPJA 1PNGA 1DGRA 4XFHA 1XNDA 4COYA 5HCFA 4UW5A 3MIGA 4IETA 2HWB3 2R072 3RI8A 4BYYA 2AENA 5BNOC 3ZYRA 1LOBA 2B9UA 5C6CA 2ETEA 1AXYA 4YW1A 5KXCA 4D3WA 3DL3A 3G7DA 3O7OA 2WZR2 1NCQB 4U36A 2ZHNA 1ZZ6A 3ZSKA 4YM3A 4H7LA 2P3IA 5J37A 2XVLA 1SBFA 2ET7A 3VBSA 4N7UA 1QF3A 2AR6A 3WVJA 4B29A 4A7YA 1RUC1 5JAXA 3E5XA 4Q0SA 4QGMA 3AB0A 2W52A 1DIWA 1QXRA 1SLBA 1TME2 3K48A 3AMHA 3WP3A 2MPFA 1W2UA 2BBVA 3VZMA 5FLHA 4M3CE 1GANA 2ZAAA 3FLPA 5BNQA 3MEPA 4GIQA 1RL3A 2JG9C 4AGVA 1DQ1A 3LOBA 3RYRA 2WNVA 2D5HA 3RJ2X 5BPXA 4X8PA 3DKWA 2R0HA 4LO5B 1I3HA 4MZUA 3VUOA 5T5OA 4H3WA 3ZDSA 5T5JA 5F5QA 4Q4W2 1W6MB 2TNFA 1YWKA 5F1RA 5EV7A 3ZO0B 4C1WA 1COV2 1LB2A 3CU7A 3HMYA 1AYN1 4KG8A 2VG9A 3AP9A 4MLOA 4XFAA 2A6WA 1PK6C 3Q9OA 4QPGC 5JDBA 1ALYA 4P9LA 2HWC1 2V5YA 3ZFEB 2HEVF 2WNUC 5AVPA 3WP5A 3VZKA 3N7LA 2GNDA 4XJZA 1AL0G 2BUKA 3NWKA 1YHFA 3CF6E 1UL9A 2KA3A 1EV13 1Z7S3 3WNXA 1O4YA 4EV0A 2NP0A 4Q4X2 2MEV1 5L7OA 3UJOA 5T5LA 5A3LA 3O14A 1BK1A 1S0FA 1Q8QA 2P3KA 2Q30A 4GH4A 2FZ2A 1NA1A 2QNKA 5H9RA 1UCXA 3AYAA 2DVGA 5JOXA 3QH6A 1HXS2 4I3GA 5JIUA 3THTA 3VV1A 5HI0A 1OLQA 4D7YA 1MEC3 5CFCA 2DF7A 3CJIC 3HD8B 4AI0A 2E51A 1EP0A 1NQDA 3JB4C 4HL0A 4HN1A 3VHPA 1D0GA 3AZWA 4ASLA 3FX3A 2JD4A 2CL2A 2O0OA 4PF5A 5CG9A 3FBMA 2UWCA 2O8QA 1KITA 3AZZA 1F5JA 2ZPXA 3RJRA 4DS0A 3KT7A 5D8AB 1DQ2A 2RS32 5JLVA 3VBRC 1UIKA 3FFZA 2R6QA 4QT6A 1JN2P 1QJY3 4TZDA 1D4M2 1OOPC 1SBDA 4FVVA 4V1PA 1OI6A 5JMCA 1OFNA 4W65A 2D6OX 3WZ1A 1AR91 2KXLA 5EWSA 1GZWB 3WDWA 1S2BA 4XYXA 2PYTA 4GMP3 1XQNA 1KFUL 4Y1VA 4FPOB 5AFBA 5IK4A 3OJBA 2UYAA 3LWCA 3VBHB 3OY8B 2XJSA 1WLTA 1GR3A 3VBUA 2E53A 3H50A 4NHMA 1LGBA 4BE3A 4LBNA 2RHPA 1LHNA 3WINE 1LODA 3NAPB 5JI7A 1QH6A 4QQ2A 1HDKA 2QJVA 4BZ4A 4F83A 1H2LA 5GLZA 1G9FA 1RVF1 3M3OA 4AHWA 3JD72 4PLNA 2GNBA 2BFUS 4S2DA 4FTBA 1PO22 1BBT1 1S0CA 4LHNA 1HKDA 4XF0A 1ZBA1 1H8TC 2PN5A 4YVWA 1W6PB 3RG0A 3WG4A 1HRI3 3O0WA 1S0DA 3KQRA 4N43C 3LZZA 1F8VA 2E6VA 1Q43A 2GC1A 3B3QE 4PCRA 2OZJA 4LHKA 3NV4A 5KWRA 3ZPYA 2XVKA 1PGW1 4IERA 2VW1A 3UKNA 4XFIA 4LR4A 2VMIA 2K2SA 4IV1C 1N3QA 3NV1A 1AR81 2VU9A 3JBG3 1G9CA 3AZYA 3THPA 4F3JA 2FHRA 4EROA 3WHTA 4Q4V3 1EYBA 2PHUA 1OPMA 3QOPA 3WCSA 4EN9B 3MW2A 5KHKA 5CFDC 5DZEA 1FV2A 3DV8A 1MS0A 3ZXKA 4FO9A 2BWCA 1MS5A 2GMEA 1GQGA 3MW3A 4FP3A 5FFOC 4M3CA 2HWD1 2ES3A 4RHV1 1RUD3 5CIRA 5DXDA 1RMU1 4Z1VA 1AXZA 3M3QA 2ZX4A 1TNFA 1U5XA 2DWRA 1FPN2 3NO8A 4ATFA 4CDUB 3N7JA 4XIKA 1CGPA 3CO2A 4Q8KA 1H1AA 4JQRA 4Q8LA 5I93A 1PVC3 2NPIA 4Q4Y2 3ST7A 2PAMA 5GZCA 1FOD3 4P9XA 4KGQA 1UIJA 2ZA9A 1H2KA 4CP2A 4F8AA 3BB6A 4COWA 2YUEA 4MUVA 1JOJA 2DUQA 4G4FA 1AYN2 4KWJA 1AR73 4P5HA 4XTPA 2PQQA 1ZRFA 4Q29A 1LHVA 1VBB3 1FT9A 3KD4A 2E7TA 1R083 2HWC2 3PVOA 3VBFA 2ZJCA 3B00A 3M2MA 4XW3A 1NOVA 1NE6A 3H1WA 1BVP1 1ZREA 4O9EA 1I9RA 3U11A 3H7JA 3VL9A 4BLIA 4DZGA 4FAGA 3HBZA 1PHMA 1ND2B 5C8CC 1VLNA 2ARXA 4B4QA 3E6CC 1LEDA 2BEOA 3B9CA 4LA3A 5DUXA 3UV9A 4A2UA 4ITCA 3I8TA 5E8AA 5L73A 1HLCA 1X82A 1PZ8A 4Q0PA 4FOQA 4QQOA 3IDCB 3VN4A 5K8SA 1BEV2 4QMAA 5JZGC 4KQ7A 1UU6A 1X7NA 3I59B 2WS92 2XJRA 2ZTNA 4YVWB 1PNFA 1H2NA 1CX4A 1CIWA 1XYNA 4OULA 1ND3A 1XU2A 2HKXA 2ZGLA 2QZ3A 4XFCA 4JGZA 4BCUA 2VQ0A 3VKLA 1RC6A 2GN7A 2DYCA 4AFAA 5J7MA 1NCRB 2ZS6B 4M01A 5LK5A 4JVAA 4RA0A 4BQ1A 3KSCA 4NWWA 3NW4A 1RUF1 2RR11 4I0BA 3KGLA 3ZYIB 3KT4A 3SLIA 4I02A 1J1TA 4AEKA 3VDDA 2DCZA 4WM8A 2I74A 3IPVA 1B09A 4WVMB 1RUE3 3VBOB 1DYKA 5LK7B 4LNVA 1G9BA 3KM5A 5C9AA 1DGRN 1VBD1 4I30A 2VY0A 3MLJA 4KH9A 4LHLA 4GB33 4HMZA 1BKZA 2SLIA 5FOJB 3ELNA 3WW4A 4Z8BA 5JOZA 1REFA 3FHIB 4ASMB 1H8VA 1H9WA 4P9JA 4RSUA 1RUG3 2GZWA 4N9HA 2VVFA 4HVRA 1Y9QA 1O5LA 4AVAA 1RVF2 1XU1A 1WLCA 4E2GA 1DF0A 3ACLA 2AUYA 2BWAA 1RINA 1BMV2 4J6GA 1BBT2 4A7KA 5FCCA 5KXEA 2A6ZA 1XRUA 1ZBA2 3M7AA 4OVEA 3C2UA 1TQ5A 4E9KA 1KDKA 2NMNA 3ILRA 2CGOA 2WZPP 3KCYA 1UW8A 1POV0 3OD4A 2JICA 5BXXA 4CEWC 4YW4A 5KXDA 1F31A 1OLRA 1VBE2 1PIV3 1PGW2 2ILMA 4YM1A 1AF9A 3PJQA 4HSJA 3H1MA 5A33A 3MLKA 3OYWA 3V0BB 2PHLA 5T54A 4INDA 5GM0A 1AR82 1VBA3 4FQZA 2W39A 4HPKB 4CDQC 2JE9A 3MGUA 1UZZA 1G7YA 5HCAA 3RMXA 4MXVA 4JCKA 1QJX2 1WBFA 2D3RA 3AYCA 3KMHA 2QDRA 4RS5C 1AYM3 4YGBA 4PIXA 1R091 1E57A 1TMF3 2RJKA 1EV11 3MPBA 2HWF3 4RHV2 5AVAA 1RMU2 1C8M3 1CAUA 1LGCA 1V9U3 1K5MB 4CDWB 1IS3A 3RQ0A 2R071 2UYBA 1C28A 2DU0A 4FBFA 4ISRA 4O9GA 3FFQA 1OHFA 4JGYC 2DURA 1J58A 4N53C 2F6BA 1DZTA 4QGNA 1LHUA 1WMFA 2WZR1 4GQ7A 5EFUA 5GALA 5KXBA 1GKBA 3WG2A 1YI9A 4W6XA 2VNRA 5DZFA 1RUJ3 1VBC2 3I7DA 1C5HA 4Y1YA 1V6IA 2XBO1 2XJVA 3WCRA 4L97A 1IS6A 2D93A 1MZ6A 5ABJA 1TME1 4QM9A 2Y0OA 3ZYGA 2HJIA 4R9CA 5DG1A 3E6BA 5FREA 5CAZA 3WQ7A 3PVBB 2ENRA 4R9AA 3URFA 1XE7A 4K21A 1XNCA 3ZSJA 3VBSC 2YROA 4HETA 5ACA3 1ZZBA 3BCWA 4P9WA 3UKTA 1ZZ7A 4D69A 1ULFA 2BTVC 4LUMA 4YGDA 1V00A 4WV8A 4WVZA 4YFZA 1W6OB 2FQPA 3WR0A 3DPRA 1SLLA 1KQRA 1X36A 2ZGMA 3M4FA 4K3UA 3VZOA 2I45A 4XFGA 4NHLA 4Y4YA 5CA6A 5E1RA 1EAH3 2TBVA 3H7YA 2UY8A 2B46X 4E2SA 2VUJA 3WT3A 1LEMA 2AYHA 4CZSA 1DDLA 1DU3D 2PTMA 2RMU3 5FO7B 2ZABA 2NQYA 4OHVA 1POV3 4XF1A 4JDMA 1Q3EA 2PHTA 2YY1A 1BVVA 2WT1A 3N36A 2FMDA 3SH3A 3ILNA 4X6RB 4Q4X1 1R1A3 1QGLA 1AJOA 2AZ5A 1DZRA 4FPYA 5H9QA 3RYPA 1DGWA 1NCQA 1YUDA 1YFUA 3HAGA 1REEA 4N43B 4ZKTB 1CAWB 3ZN6B 3GALA 2X53S 1ZX5A 3IN9A 3OYWB 1B35C 3IWZA 2PLV1 2RR12 2TUNA 5TSWA 2MNGA 3APBA 4IV1B 4D7TA 3LA2A 3AX4A 3ZFGC 4AQ6A 3DF0A 2IC1A 1QWRA 1ONAA 1WMDA 2VMHA 3R4UA 1SBEA 4KGGA 3ALQA 1CESA 4QU2A 1NG0A 2R043 3CL1A 4PQ9A 5J09A 2WIIB 1N1SA 2WQZC 5CFDB 4WZCA 1DYPA 4KL1A 5DUVA 1UX6A 5CNAA 4EJRA 3SH5A 4WBBA 4AEJA 5CFCC 5K0UC 1VBD2 4L11A 5AFEA 1JH5A 5JVVA 4GWMA 5GLWA 3OGJA 1W6MA 1D4M1 1KJRA 1MQTC 4UW3A 3VKFC 2P34A 1RUH3 3VHOA 3KT1A 4HANA 1GZ9A 1LENA 3D82A 1PZ9A 2DFCA 2QZ2A 1FYUA 4IEUA 3KLSA 1V6OA 3ZFEA 3MFCA 3DN7A 4K20A 1N1YA 1I6XA 4JRAA 4DB5A 5JSPA 2Q8OA 4C0BA 2IWGB 4KWLA 2GH8A 4YM0A 1O3TA 1C57A 1H4HA 3WP6A 1GNZA 1CVNA 2O1QA 5I91A 1M4WA 4XJ8A 3AXEA 3VKNA 1FOD1 1C8NA 1JW6A 2VH9A 4RFT0 4DNYA 3P3PA 1PGSA 1R1ZA 3V65A 2E7AA 1FAYA 4GKYA 1UZYA 1IPJA 3EQEA 3VBUC 3GZAA 1I5ZA 2JG8B 1FV3A 4XJAA 2H0VA 1H30A 1UU4A 1AX2A 4IEQA 5T50A 1YO8A 1RHI1 1DFQA 2A3YA 5D8AA 5EYXA 5HCBA 2PAEA 1R092 2BNNA 1QQP3 2C1FA 3ZX7A 1SLCA 5JI9A 5FMOS 2BFUL 1YYNA 1EV12 1REDA 2WJSA 1U12A 1Q8OA 2WA3A 1OMIA 1WW6A 4R4ZA 3BOWA 1Q8SA 1VAKA 1PMIA 3NKTA 2EF6A 3FUQA 5DZGA 1ZVFA 2VOXA 1W0PA 3WUCA 2A7AA 3IDBB 1GZWA 1RUI3 5E89A 3ZMNA 4AEMA 4HFSA 1O4ZA 1MEC2 4OI2A 1I1EA 2VNOA 3WLUA 1EPZA 3T1MA 2EALA 1O3SA 2XJUA 4S2GA 1ZA4A 2XBO2 3VBHA 3OY8A 4AVSA 4LBOA 3AZXA 1DGLA 1JUIA 3FLTA 4GMP0 3W58A 1ASJ3 4HSLA 4LEJA 1V6NA 1FPN1 2EXKA 4FPFA 3NAPA 5DUUA 5IK7A 3PHMA 1AJKA 4RR3C 4OUMA 1FX5A 4Q4Y1 1QJY2 2IXIA 4AE2A 3QCWA 4QGLA 2WLPA 1BCXA 3C3VA 2DV9A 4FT8A 5GZGA 4IV3B 3B5LB 1W6PA 5LEKA 5DDJ1 1WCDJ 4CEYB 1V6JA 3GF6A 1UPSA 5KBFA 1OQEA 5JOYA 2W68A 1X8EA 2DTYA 4HK8A 5CADA 3RNSA 4CP0A 4MXWB 1WA4A