3PMSA

Recombinant peptide: n-glycanase f (pngase f)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
312
structure length
312
Chain Sequence
b'DNTVNIKTFDKVKNAFGDGLSQSAEGTFTFPADVTAVKTIKMFIKNECPNKTCDEWDRYANVYVKNKTTGEWYEIGRFITPYWVGTEKLPRGLEIDVTDFKSLLSGNTELKIYTETWLAKGREYSVDFDIVYGTPDYKYSAVVPVVQYNKSSIDGVPYGKAHTLALKKNIQLPTNTEKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINNSNTFQHQLGALGCSANPINNQSPGNWTPDRAGWCPGMAVPTRIDVLNNSLIGSTFSYEYKFQNWTNNGTNGDAFYAISSFVIAKSNTPISAPVVTNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptide:N-glycosidase F
publication title Recombinant peptide:N-glycanase F (PNGase F)
rcsb
source organism Elizabethkingia meningoseptica
molecule tags Hydrolase
total genus 86
structure length 312
sequence length 312
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2010-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09112 N-glycanase_N Peptide-N-glycosidase F, N terminal
A PF09113 N-glycanase_C Peptide-N-glycosidase F, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3pmsA02
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3pmsA01
3PHMA 1YJKA 1SDWA 4R4XA 4E4ZA 3MIBA 4QHBA 3MLKA 1PNGA 3KS7A 1YJLA 3MIHA 3MLJA 1YI9A 3MICA 3PMSA 1PNFA 4R4ZA 3MIFA 3MIDA 3MLLA 3MIEA 1PGSA 3MIGA 1PHMA 1OPMA 1YIPA
chains in the Genus database with same CATH superfamily
3ZMNA 2WAOA 1C1LA 1YQ8A 2A7AA 3FHQA 4MGZE 2RDNA 3D82A 4EV0A 4FSJA 1NZIA 4AI9A 4LBLA 3VUOA 1RVF2 2H0BA 3S7EA 1FV2A 3O1PA 2BV4A 2WO7A 1F9KA 2BRTA 2NM1A 1LGNA 3DL3A 3PMEA 4QWNA 1LJ7A 4WVMB 1W28A 4ZKTB 2GNMA 5J1XA 3U0ZA 1ZBA3 4CCDA 4WVVA 1UD1A 2D5HA 2DBNA 2GU9A 1GANA 2W08A 4I02A 4Q0SA 1S2KA 1WMFA 5FO7B 1W6NA 4QMAA 5FZOB 1ZRDA 4L11A 1JN2P 5JPMB 1CIWA 4WBBA 1WMEA 2WRAA 1JUIA 5I0RA 3NNGA 2BOJA 2DF7A 4EZHA 4ZHNA 3UKVA 4XC9A 2DTWA 1LULA 1EUTA 4B4PA 3ZDVA 1ODNA 4GMP0 1JYXA 1N3PA 2JJ6A 4I3GA 1AVBA 4JHZA 4PBOA 3MI8A 4QGNA 2EXIA 4D94A 2YY1A 5K0UC 4KG0A 5T5OA 1DYPA 5JI9A 3E97A 1KS5A 3HN1A 5JVVA 4XW3A 1CIYA 1PK6C 1OC1A 1BCXA 2EXHA 3IBMA 3IIIA 4YM0A 3FLRA 3BODA 4QU2A 2CAUA 5FZCA 2CU5A 2P3YA 4XXAA 3R6SA 1W2NA 2X5IB 3ZFGA 4LBQB 1DZRA 2VMFA 3WQBA 4LO5B 1NY72 1QQP2 3VBSC 4AVAA 3FBMA 4IE7A 1QJU2 3HR9A 1KFUL 3QLQA 2Q8DA 1HN0A 2EIGA 4Q4V2 4A6OA 5JZGC 5A3UA 1RUG1 1F4AA 3KF5A 2NMNA 1SLAA 3BKZA 1CAXB 3U10A 1ZX5A 4GJZA 4GWNA 5A32B 4YGDA 3LSDA 3UESA 5EJ1B 1UPIA 2VNGA 4AFBA 3GHMA 1VR3A 2X09A 1BK0A 4LHLA 4XUTA 3AYEA 3OY8B 2A6WA 1XQNA 4OMCA 3Q8BA 4Y5TA 2VMCA 2R49A 3R0RA 3DPRA 4NUBA 4R8HA 1MS3A 3LA2A 3RVHA 1RXFA 5DXDA 1HXS2 5FREA 1RB8G 2WFF1 5L9BA 1JZ4A 4HZFA 1JW6A 4WVZA 1CAUB 1JI6A 5CU1A 5FP3A 3ZKUA 1CX4A 3OSDA 2ET7A 2W52A 1PZ9A 2YU1A 3IB3A 5FYBA 1H0BA 3E5UA 5FMCA 1BKZA 1SCSA 2JENA 3VHOA 2CGNA 3SXWA 1RUD3 3V56A 1E5SA 2WS91 4RN5A 3VDCA 5HV4A 2JKXA 4XILA 5LATA 3PUAA 3KQRA 1NXD1 2Y6HA 3PUQA 1ONAA 3N7LA 1NCRA 1AXYA 4GZ9A 2VW1A 3VZOA 2WZR2 5L9RA 3KLSA 1WD3A 2PHTA 2ZBJA 5HXMA 2WWSA 4AFDA 3ILNA 1H6YA 4XCBA 2AR6A 2YG0A 5IK5A 2J1VA 2RS11 1CVNA 2PHDA 3ASIA 4AI0A 2KM2A 3ILRA 4XYXA 1ASJ2 4FPCA 1GZWA 5CAZA 3ZR5A 5F3GA 3I59A 4Q1RA 3WSOA 2UWAA 3TEWA 5GZCA 4IV3B 5FLIA 1TME1 1I3HA 2VUDA 1GLHA 3SITA 3VBFA 1UOJA 2ZHMA 4IXLA 4CP9A 2B8MA 1NX9A 2XHNA 2G1MA 4Q8KA 1CX1A 1LOBA 3ZYGA 3E6DA 1ZZ8A 1BZWA 3ACFA 4K40A 5DABA 4NIGA 3AJYA 4FPFA 1MS9A 2Y6JA 2VCMA 1QJY3 2XVLA 3ZXKA 1VJ2A 2JD9A 2VTXJ 4H55A 3L2HA 5CFDC 1OA3A 3AK0A 5K8SA 2CYFA 2WSVA 4P9JA 4CDWB 3J8F3 1ZBE1 3PTYA 2PHFA 2QZ2A 2ZGPA 1KS4A 3PUIA 5J3UA 5EJZB 3CO2A 2RG4A 4ZU5A 2FBEA 3PVNA 4O65A 3H1YA 1MZ6A 1BBT3 1VLNA 1KQRA 2VQTA 1LOCA 4LBNA 1SHWB 1LCLA 1B09A 1W9FA 3VBRB 4AOCA 2PHLA 5FYCA 4B1LA 1FNZA 4ORFA 3FC0A 4ZPIA 4CP2A 3LDRA 3ZYJB 4JGYA 2Y26A 2X10A 1W8NA 1R081 3A21A 2ZKLA 2ET1A 1XSRA 1TEIA 4Q4W3 2PHRA 5A7WA 3KT7A 1V6NA 1YXWA 1NLRA 3MW2A 4FO9A 1PX3A 4J6GA 1HB3A 1AR81 1QJEA 4RYDA 1VBD1 4CRQA 2WYSA 3H3UA 1Q8PA 4FAGA 1O4ZA 2VUJA 3KCCA 1E5HA 1CAVB 5FCCA 1GQGA 1S0IA 1PZ8A 1WBFA 4NHKA 1UY4A 3D5OA 2VGDA 4FCAA 2IVIB 1IPJA 1K5MB 4LBKA 5DAXA 3I2DA 4LJHA 4Q4Y1 2QBXA 3P5BA 2ZACA 1HRI1 5BUVA 4M0NA 2D6KA 3LDKA 5FV3A 4OI0A 3WG1A 1OOPC 5LA1A 5FPZA 1AR62 5IVFA 4QB2A 3SKJE 1PNGA 2JG9A 2XMLA 3ETPA 3CIHA 5IVVA 4QT6A 4NMIA 5A6YA 1RMU3 4AAXA 4KWUA 2ZCWA 1PMJX 4GIQA 2P4EA 5F8PA 3LA3A 4NIAA 5BPXA 1SACA 2KA3A 1RUH3 2I45A 5FZIA 3USSA 3RZKA 4LE4A 5C33A 4Y22A 4AQ6A 5JDBA 4PDWA 4OLLA 4LTAA 1OUSA 4DZGA 2Y6FA 1SEFA 3AMQA 3WDXA 2VXJA 3EO6A 4X6QB 1ZZ9A 3BYWA 1JUHA 2PXJA 3I2IA 5A7OA 4RR3A 1OQDA 1W9WA 3EHKA 3JBG1 4D3WA 4EZ4A 2B4KA 1G9DA 1LOEA 4Y20A 5A1AA 4YG0A 4XF4A 4AEJA 2ZPXA 3W21A 2H6BA 2KR2A 1QKQA 1WW6A 1YEWA 2W95A 4FOQA 3WEZA 4GB32 4Y1ZA 1NA1C 1VRH2 1LB2A 4K6BA 4O9EA 4V1PA 5FO8B 1AR91 3T1MA 4LPLA 3WP4A 4NIHA 4FQZA 4NHMA 1W6MA 1SPPB 2JE7A 2VM9A 3M1HA 4HSLA 4A3ZA 3ZKYA 1RVF3 5IHRA 3AVSA 4RHV1 3FFZA 2LM3A 4RGAA 5GLUA 1JOBA 2ETEA 1VMFA 5E6HA 4UF0B 3T4HB 5BV6A 4AGGA 2AACA 1GOGA 2E33A 1SLIA 4C8DA 4MSVA 5I8YA 4NR1A 5IK8A 3P3PA 2WFF2 4QHZA 4BQ3A 3TN92 1V00A 3CNAA 4JV4A 2GNDA 2WNUC 4NHXA 5DZFA 2K2SA 1TVGA 1GZ9A 1LOGA 2BGOA 4Q0PA 3LKJA 2PAEA 4DIQA 1FATA 4DY5A 5GZDA 5HCAA 4FVVA 1BVP1 4QXBA 4BQ4A 1ACCA 1GKBA 3BUCA 2WS92 4MO3M 1LHWA 3LEMA 4GKXA 5T5JA 3BTYA 5CZKA 2YBKA 1W8ZA 5BYNA 1XYNA 4DUXA 4YVSC 1WCUA 4UW5A 4CZSA 5C8WA 1DYOA 2XXZA 2DDUA 1CWPA 2PTMA 3H8XA 2WA3A 3ZXAC 3HIFA 3OJBA 1J3PA 1I1EA 1QHDA 4E8CA 1JODA 5ABJB 1F5FA 3R4DB 1UZYA 1QQP3 4XFCA 3Q8FA 1QJU3 2E7TA 4J1WA 3DGTA 4Q4V3 4TLGA 1TME2 1H30A 4TXWA 5EV7A 5FQ0B 2Y34A 1IS3A 4JC1A 3WHTA 2Y6GA 3B94A 1POV3 4FAHA 1DCSA 4HK8A 3VBSA 4QGLA 4UFHA 4Q29A 3WD5A 3GZAA 4IEWA 5L36A 3J7HA 3NRUA 3N7KA 3MGUA 1IPKA 3OBAA 3TWIA 4ZS2A 4JX0A 1W8UA 2ATFA 3ZPOA 1H8VA 4Y1UA 4XFHA 1SLBA 2JE8A 2VH9A 2XJRA 4GKYA 1HXS3 5SV5A 5IFTA 4IDZA 2A1XA 1HJGA 5FZFA 4RL7A 4ITCA 4CU7A 4NROA 1J1LA 1COV1 2PYTA 3MICA 4H14A 3LFIA 1NLQA 1PGW2 1R082 2WZEA 2YB7A 2PHXA 1SMVA 5AC92 4I2OA 1QY4A 4LKDA 4J25A 5C5UA 5FPXA 5F3CA 5FKCA 1VBD2 1KFXL 1DDLA 2ZMLA 1NT0A 4Y3OA 3FE5A 3OBTA 4CEYB 1R093 2WZR3 5FIXA 5LBCA 1Y43B 4LLOA 1XYPA 2NQYA 3VKLA 1WLCA 3BOWA 5DZGA 2NPIA 4BMBA 4AF9A 4EN8B 5F5QA 4P9WA 3ELNA 3GM8A 5I8TA 5JI7A 3P3NA 4AVSA 2BVBA 4COWA 1HIXA 1MS1A 3NNLA 3AZZA 3MUZ1 3ZVXA 1HRI2 3IMNA 4DXSA 3QH6A 2VCAA 3ETQA 4LBOA 4D6SA 4QPGA 1DGRN 4XE9A 1DQ0A 4UI9L 2WDBA 2B7YA 4H3WA 1ENSA 2HWD2 2R0HA 4ZU7A 2UURA 1WZXA 4ATFA 1ND3C 3FL7A 1H8TB 1OLRA 1PIV1 4XETA 5IVBA 1ULFA 2IXHA 3NAPB 4CA9A 2LUWA 5D21A 3K2OA 3WCSA 4ATEA 2DURA 4AVCA 3D0SA 2VNOA 4XXPA 1QXJA 4A44A 3WP3A 4E2SA 3ZFFB 4W50A 3ZPYA 3PIJA 1JZ6A 5CFDA 1W8OA 1GNYA 2G9GA 3J8F1 4N43B 4BLIA 2JXAA 2XB6C 2WNVB 5FMOS 1KRIA 3NNJA 2F4PA 3S7IA 1N3QA 5C4WA 3DCQA 3JBG2 3ZR6A 1DYKA 4HONA 5EFUA 1X36A 5FYZA 4BXSV 3MHZA 2VZUA 2EIBA 4FFIA 4MGKE 5K7PA 2OZ6A 4IEZA 4BH9A 5FZBA 5D8AB 3ENRA 1GU3A 1AJKA 3O7OA 2F6BA 3PVOA 1EYBA 5CYYA 3J7MA 1K3IA 3JUUA 4QXKA 3WQ7A 1OVPA 3AC0A 4B29A 1NLSA 5DUVA 4RHV2 3KHBA 5JXGA 2GH2A 4MHUA 2WLQA 2AH2A 2DUPA 1OLMA 1V9U2 2Y6LA 1QOSA 3BIWE 4FOVA 3OB8A 1I5PA 2VOKA 1QMJA 3FX3A 3KV4A 4SLIA 3VN4A 3E6BA 2ZMNA 1AXKA 5EHDA 1OT5A 2UYAA 1UKGA 3VBOB 3BGAA 4NO4A 2E31A 1CPMA 1T6GC 3AZVA 4FOWA 3LPGA 5D1IA 2X5IC 4IEPA 1FYUA 2W2IA 1RUNA 4Y26A 1OSGA 2KXLA 3GBFA 1S55A 5J37A 1O59A 5A33A 4AQSA 1AL21 1Z0HA 2W0XA 3NO8A 4K8FA 4P08A 2JDMA 4QPYA 3AMMA 5A3PA 3FLPA 1WA4A 3SEEA 3B9IA 3C7GA 1SBEA 3S0MA 4YGEA 5GLWA 1AUYA 3WW1A 4CEWB 2HLEA 4FP2A 1WW4A 4FPKA 3ZSMA 4UOJA 2ZKNA 2CV6A 2VCCA 1WCQA 5B4XA 5FP9A 4DFSA 4X8NA 4LR4A 3BTXA 2ZX3A 4DEVA 2QUOA 3KCYA 1Z7S2 2F17A 3E5QA 4B8EA 1NCQB 2RM21 4TLFA 1W6PA 1ZM1A 3AKRA 4GB33 3KGZA 3VBUA 4M3CF 2ARXA 1J58A 3IAPA 2BZDA 2QFEA 4Q8LA 4XVHA 1PX4A 4NRQA 5FYMA 1VAKA 1NA1A 4NVPA 3ACGA 3AKSA 1W0OA 4OUSA 3DYMA 4I3PA 5KHJA 2R32A 3CZUA 2WZ8A 1FV3A 2DFBA 5ERLA 4FPGA 4DNYA 3H1MA 2XBO1 1O8PA 3MIEA 3WF2A 1D4M2 1RHI1 3AP9A 2WFF3 3TN93 3MIGA 5KHHA 2WYFA 5FYVA 5J98B 4PI0A 3TEZA 1YCIA 4KBBA 4BE3A 4HK9A 5KXEA 1COV2 2LS6A 4CPBA 4BZ4A 2A3XA 2ZGQA 4JAAA 2JDKA 4KNCA 4MHRA 1WA6X 2WNUA 1G6NA 4IV3C 1XU2A 1VBA2 2WO1A 2WS93 4CDXB 4COYA 5FY4A 3WF1A 1OI6A 4DINB 3LIGA 2D98A 4GH4B 5FK7A 5JWPA 3WF3A 1O5LA 3USUB 2WO3A 1O91A 2Q0AA 3VKFC 3VZLA 1KDKA 4XF0A 2BU9A 2VZ3A 2R6QA 1BVVA 2IXLA 1EPZA 4MVTA 4MOAA 2NN8A 1QDOA 1PO22 2GZWA 2OXBA 4YVSA 4CDWC 1D4VB 3IAQA 1JZ3A 1YI7A 3F95A 3PUSA 2P17A 1TME3 2VBPA 1QQP1 3VBRC 4DXZA 4E27A 2AUYA 1QJU1 3O1SA 1OVSA 3HEIA 4EYUA 1WWYA 4AL9A 5KXDA 1JYWA 1RUF2 1VBE1 1PIV2 2RJKA 1YI9A 1F15A 2H6CA 3A0KA 3OGVA 4XFIA 1LKNA 2D6LX 4YGBA 1CPNA 5A7NA 3M7AA 1G9CA 4UXAA 4QAWA 3VGIA 4BQ1A 3LOIA 1EV12 1SFPA 2EICA 4XDQA 5FJKA 4E9KA 1WW5A 3I3EA 1ZBE3 2A6VA 5FJHA 4LBQD 1RUE1 2VD7A 3LZZA 1GV9A 2QCSB 4R4XA 2AC1A 2IXKA 1K5MC 1HXS1 1IKPA 3VZMA 1HLCA 4GWIA 3MO4A 1AX2A 1R083 2XKPA 4Q27A 1X8EA 1AX0A 2HYXA 1ULEA 1V0AA 1NQJA 3B69A 3I8TA 2C5DA 1DGRA 4S2DA 1VBD3 1UOGA 1ENQA 2DTYA 2XJVA 4JRAA 4MGTA 1NKGA 3B3QE 5FMDA 2YPJA 1LHNA 5CVRA 3VL9A 4D69A 4W65A 4CDQB 4F7ZA 1UZVA 1A78A 1W8TA 3I7DA 4S2FA 3RRDA 4A45A 2WZR1 1UN1A 3FBYA 1H1IA 1ZVFA 4EWEA 1QF3A 1QNYA 4Q4Y3 1ASJ1 1HRI3 2XJTA 5JSRA 4P5YA 1Y3TA 1IS6A 2JDHA 2HBTA 4JCKA 5F39A 3WDWA 5DN2A 1UW8A 3NJYA 4QD2A 3OYWB 3THDA 3T0BA 4LKEA 4A7KA 4PT6A 4KL1A 5IAXA 4V2WA 2HWD3 1OHFA 2VNVA 2X53S 5FXXA 2VR4A 5F37A 2XQXA 3A7QA 1ZZCA 1RC6A 3CMGA 5FZ3A 4ARXA 2JDAA 1L7QA 1S0EA 1VB4A 1AL22 4X6RB 1UF2C 1SZBA 3ES1A 1ND3A 1MEC2 1ZYBA 1C3HA 1HKDA 3NV4A 1AXZA 2FCVA 1B35A 3PUHA 1W6QA 2VPVA 1RUJ2 2D3PA 3IDCB 3B01A 3JBG3 1BJQA 4ET7A 4COUA 3K4ZA 2XVGA 1FX5A 3JZVA 2A6ZA 1VIWB 1XRUA 1H6XA 2JB4A 2RM22 3V0AA 4WVMA 3SCHA 2XL9A 1AF9A 2DVBA 3KD4A 5LEKA 3VHNA 3N9OA 4C90A 4EN6B 5LA9A 1AR93 2QJVA 1T6BX 5FZOA 3E1F1 3MDPA 3PTRB 2E32A 4N8MA 4LHKA 3N7JA 3OBRA 5BXXA 2VTXA 3BB6A 5EXOA 1Q43A 2K0GA 2IFRA 1OMIA 1IQDC 1GSLA 2EF6A 2EVXA 4RHV3 4XUNA 2Q8EA 2C9AA 1QOOA 3UKNA 1V9U3 3N9QA 3HBZA 4XF9A 2PA7A 3ZFEB 3VV1A 1V6LA 5FZEA 1GQPA 2K46A 3UK9A 2AYHA 1RJ8A 2XBO2 3O1TA 1RHI2 5F5AA 3CEWA 1ENRA 1POV0 1VALA 3K77A 1QWRA 2QKDA 2FHRA 5KC5A 4E4SA 5ABJC 1W39A 2D7FA 3KV9A 4WM7B 1DQ5A 1AR61 1ND2B 5FP8A 1RUC2 5A3TA 3J7LA 1F31A 4AYUA 3F2ZA 2WA4A 2X5IA 3W5NA 2I07B 3GGLA 4DPNA 2HEWF 3IKWA 1FNYA 3T30A 1CGPA 2GSYA 2XG3A 4MYEA 4AXOA 1LHOA 3I3DA 4Q0UA 3I4IA 4KWKA 2EALA 3O1VA 4XCAA 4RQPC 3S57A 3HOBA 1CAXA 4BPZA 5IUQA 1JZ8A 2D3RA 4Q0QA 1ULDA 2P37A 3G7DA 3H42B 4H7MA 4N7IA 2XUMA 2JDUA 3WT3A 4WM8B 1MPXA 4QKNA 4FXGB 4ZZ5A 5FKBA 2WWUA 3ZYIB 1CONA 1Z7S3 4RSUA 3WNPA 3ORJA 1HQWA 4A3XA 5JR2A 2WBKA 3T0DA 1SBFA 2Q30A 1S0FA 2ZABA 4Q0VA 5FXVA 1Q56A 2B46X 2TNFA 4PQ9A 2PELA 4N53A 4M01A 5IW0A 1LAJA 4ES8A 5LBBA 3VBHC 4GB31 4LE3A 4SBVA 5FBZA 1VRH1 5A3MA 3KMHA 1C57A 1VBE2 3FHAA 1P8JA 3NKGA 4CDUB 2ES3A 2IXIA 2TBVA 3HJRA 4CCJA 4AI2A 5JAXA 4LOSA 1E5RA 1I5ZA 4AFAA 1GP4A 3DV8A 2DCJA 1D4M3 4IE4A 4U2AA 5FOJB 5FAXA 4YYOA 1D0GA 1RUE2 1N3OA 2UYBA 3MLJA 4LBMA 2QZ3A 1GICA 2FMDA 4LT5A 3I2KA 1QIQA 3WNNA 2FDGA 1COV3 3D6EA 3OOXA 3TN91 4B4QA 2BDRA 5FPUA 2DV9A 5C6CA 3BI3A 3WX5A 3C8XA 1OPMA 1VBA3 1ZNPA 3OBZA 3TRSB 4QDQA 4XBLA 1OFNA 1JOPA 3S6PA 1W0NA 1G7YA 3EMRA 1X8MA 4E4ZA 1W2TA 2XLGA 2D6NA 4IV3A 4MGQA 4OI4A 5E8AA 2R041 4IEOA 3SQOA 1BEV1 1H8TC 3WHUA 4TN7A 2ZGUA 3ZFGB 4ASLA 4K1ZA 1AL0G 3KCXA 2DU0A 5B2GB 3NAPC 3UJOA 1XE0A 3VHRA 3EXUA 1PO23 5AVAA 2XL7A 5JXHA 5IK7A 4XURA 3ZXLA 1RXGA 3NWKA 2HJIA 3ZSJA 3U1XA 2XWJB 4AHZA 1OF3A 1W9SA 2GC0A 4ASKA 4N43C 3KT1A 4EN9B 4L2NA 1V6IA 2WNVC 4CDWA 1MVQA 3DXUA 4QPIB 2Z42A 1W2OA 4YZ2A 1ZZ7A 1W0PA 3PJQA 3W59A 4NPRA 2VZOA 1W3VA 1GP6A 3X29B 4LOTA 1N1VA 1RUF3 1PIV3 1AR72 1EAH2 1UX7A 2JX9A 2PAMA 3DPRB 3VBRA 2ID4A 5D8AC 3SNMA 3OTFA 1FMD2 1FI2A 4Z1VA 4AW7A 3CHXA 3U4SA 1X82A 2VTFA 5L7OC 2VVFA 4YZ1A 1OLQA 2R072 4IEYA 3HQUA 4C1WA 1IG3A 1REEA 4HANA 4MG2A 1CAWA 3LEIA 3NW4A 5FMBA 1JZ2A 3TYJA 4BOWA 3KHCA 1GOFA 1CAVA 1Q8SA 3BCWA 5LK7B 2CGPA 4DRRA 2A6XA 4O61A 4P00B 2D6PA 5HCHA 2GMPA 3HD8B 4NHYA 5KC6A 3VBOC 5FZ0A 2IWGB 3ZX7A 2QQLA 2W1WA 2Z79A 5F6LB 3UGGA 3KT4A 1RUOA 2FZ1A 1PGW1 3CJIB 3T09A 3RZHA 1UL9A 1V6JA 4OQ9A 5AC91 1AYM2 1H2KA 4K7JA 1M06G 1F2NA 4BMEA 2CNAA 4P14A 5BNPB 1QDCA 3I2FA 2CHHA 2HKXA 1AJOA 1LR5A 3DXTA 3RMYA 5JIAA 1KJRA 1PM4A 1G9FA 3H8RA 4XQDA 3I59B 4R9DA 3ST7A 2OUJA 5T3NA 3VKMA 4IE0A 3AZWA 4AWDA 1DFQA 4PBPA 4CP9B 5IVYA 1O4YA 4UAPA 1WCDJ 3T2PA 1F5JA 1QH7A 2GP5A 4YLZA 4CEWC 4Z2WA 2HWB2 4S2GA 3ZYRA 1LODA 5KBFA 5LRSA 4JQTA 2YC0A 2VZPA 1JOJA 3VHPA 2W94A 2J1SA 4P5HA 1MZ5A 1BMV2 1XPWA 2BWCA 3WOGA 1IS4A 3WY6A 4B1MA 3APBA 3MF9A 3IZOA 5ANQA 5LASA 3LGRA 1XSQA 1NCQC 1NUKA 2XH6A 4X8PA 1EPWA 5FZLA 3IDBB 2Q8OA 4D6RA 3AP6A 3O1RA 2ZAAA 2HWD1 3OGGA 5DG1A 4YSFA 2AZ5A 3GCXA 1AL23 4PI2A 1QOTA 1GNHA 1MEC3 1UYYA 1SDDB 5F5CA 5DAWA 5J96B 1LECA 4BDVB 2QQOA 4ARYA 5FY1A 3IT8A 3OD4A 1W8FA 2PLV2 3LCPA 2P3KA 5FK8A 1QJX1 1SPPA 1IQAA 4XHXA 1ST8A 1VE0A 4UFMA 1VBC2 3VD5A 2BNMA 1XNTA 2J7MA 3WDVA 2RM23 2WT0A 1QXRA 3AKTA 1DQ6A 4UF0A 1OA4A 2FDJA 4EN0A 4BQ2A 4QQLA 1KEXA 2PQSA 4JKKA 3SKVA 2BFUS 2WIIB 5L73A 1OLME 3CBNA 5FZ7A 5IWFA 1LHUA 2ZHLA 5K4LA 1UCXA 2FCTA 1U5YA 2W3JA 4JDNA 1BLZA 1DHKB 4CDXC 1VPHA 1PNFA 4IW3A 5C3PA 2RMU1 3ITQA 4FPYA 2OX0A 2MEV1 4MXWB 4XABA 4GH4C 3DN7A 5FPBA 1UMHA 2ADEA 5A1LA 5LBFA 2ENRA 4XZUG 1F4HA 2HEVF 2AEYA 4E2QA 2XBO3 1GWMA 1V9U1 1LTEA 1UU4A 1E57A 1RHI3 2JG9B 3CLPA 4IEVA 5FZHA 3C7FA 3VKOA 4XZPA 2ZGLA 2UY8A 4XHBA 3RZGA 3MLKA 2ADDA 3ABZA 3UT0A 3IPVA 1IGOA 3BVCA 4AEDC 2DVGA 4EE2A 4AQ2A 1S0BA 2AREA 2WL1A 5DG2A 5ABJA 3VD4A 4BHPA 3JCIA 1R1A1 5A6ZA 3NKTA 2IZWA 2W5FA 4YM1A 4G9SB 1DZQA 5L9VA 1UIKA 4JKLA 4AQTA 2R042 3WNKA 4Q26A 1BEV2 1QGLA 5FZAA 2IC1A 2C6SA 4LXLA 1C5HA 1D2QA 4Y4YA 1ULPA 4XUQA 3LDBA 4Y20B 2BP6A 4LORA 2QVSB 4E2GA 1AYN2 1E5IA 2EAKA 1H2MA 1YC61 4RQPA 4YVWB 5C5TA 5DUXA 4IGPA 1DGWX 2QDRA 4XTMA 3W20A 1VBB2 1WW7A 5K0UA 5A7SA 3MFCA 3RI9A 4IEXA 5EYXA 1PM7A 1RL3A 2Z69A 3KV6A 1Z7S1 1W6MB 3OD0A 4HKLA 1PK6A 4OCTA 4UFJA 4XJWA 2D44A 4OHVA 1JYIA 4PLMA 3KGLA 4CTEA 4QPWA 5CB7A 4Q2FA 1VBE3 2HWC1 4AG4A 4QX0A 3AB0A 1SLCA 5A6QA 4P9GA 1YO8A 3VBHA 2D93A 2XJPA 4LITA 5JZGA 3HN3A 1W9TA 2ARCA 2GMMA 2YV8A 2QQUA 1LNSA 2QQNA 3HQXA 3MW3A 3O0WA 1J3QA 2P5BA 3IDEA 1A3KA 1RUE3 1W6OA 1X7NA 3T2OA 4Y1XA 1D4M1 3POFA 4YW1A 5A7QA 2PHUA 5AFEA 3WDTA 2VOTA 2F4LA 2NMOA 3POWA 1NYWA 2RDQA 2C4XA 4RS5C 1SLTA 4MGIE 2YDEA 1HRV1 4XMAA 4AGVA 5L19A 5ISLA 4R9CA 3KWVA 2BQPA 3U4XA 2VOXA 1XOYA 3M8LA 4YFWA 4DO0A 1WGPA 4FI9A 4LIUA 4N9IA 2RS52 1PGSA 1VBA1 4NAOA 3E5XA 1FT9A 5DQ0A 3WNLA 4A2UA 4B4RA 5KXCA 1G9AA 5M0TA 2CDOA 4L92A 2VC9A 1REFA 1ALYA 2EXKA 3AFKA 3NV1A 1MQTB 2YROA 5IJRA 4CCEA 2VUAA 2BTVC 3WNMA 3DEMA 1J59A 1QNWA 1KJLA 2VVEA 2JICA 3EBRA 1H8TA 2CWSA 3BPSA 2QNKA 3K4DA 3Q8AA 5IVCA 1EY2A 4K8RB 1PO21 3NAPA 4PHZA 1YFUA 1ASJ3 3O12A 4CUCA 4XUPA 5F7UA 2VULA 2OT7A 2W87A 3MUY1 3OUIA 1XNAA 4LK7A 5CADA 2PN5A 4S2HA 1FPN2 5EZWA 3S30A 5FWJA 2I74A 2X8KA 4HSJA 2ARAA 2VZRA 3OGSA 1UY0A 4N43A 4PIZA 2WNVA 1N1TA 1AR73 3DKWA 4AHYA 4XIOA 1XB9A 4YW3A 3GZEA 4PF1A 2JDYA 2MNGA 1RUF1 1FMD3 2E53A 4I30A 4LHSA 4IERA 1S2EA 4LA2A 3GXUA 5G04L 4CVUA 4TYSA 2R073 3GJAA 3I2GA 4LQRA 4YZ4A 5D8AA 1EV11 1UIJA 4AR2A 2IXJA 1DP0A 4NRPA 4P9YA 3EYPA 4QKFA 3ZFEC 5I0UA 3EB7A 4QQPA 2JECA 5L7OA 5DAVA 3V0BA 3N36A 1ULCA 3Q9OA 1QJX2 4Z8BA 4FPHA 4URAA 2JG8B 3O0XA 3BOPA 4BLJA 2B42B 4COVA 2VU9A 3NJZA 4IE5A 2QQMA 5H9PA 4F83A 2XOMA 2EIEA 2ZEZA 3S5AA 1C4RA 1UOBA 1AZDA 1CZTA 1M4WA 3VZKA 2R0FA 3VBOA 1AYM3 1NZCA 2P6CA 3DKQA 4IQPA 3I97A 4WM7C 3AZYA 4A7YA 4LUKA 4AFMA 1A6CA 3MBWA 2WC2A 1GYKA 4LO4B 2CY6A 5IVEA 4NPMA 1DG6A 4YW7A 1K5JA 2RMU2 1SFNA 2MEV2 4QB6A 1ZRIA 1RJ7A 3T3YA 5LEJA 5CNAA 4CE8A 2YZ4A 1O5UA 4QPGB 4AVBA 2ZEYA 3QD6A 1YJLA 5DAQA 3ZSLA 2ZGRA 3LB9A 4D7YA 2HWB3 3NJVA 3OCPA 1L7LA 4UFKA 4NE9A 3H3ZA 1AX1A 3PL0A 1NOVA 3WR0A 2SBAA 2AENA 4I0WB 5FPLA 4WM8C 2FDHA 3R05A 5IAVA 4CEWA 2YMZA 4BK4A 3BN6A 2B5HA 2RR11 3ZDSA 1AR63 4A41A 5HPOA 4M3CE 5EIYB 4AHWA 3RZZA 1MR5A 1JYNA 5B4NA 1GQHA 5LCWL 4NIIA 2VMIA 4XBQA 4BK5A 4EJRA 3K4AA 5GKAC 3VB9A 2R7EB 5C7GA 1UAIA 1R1A2 1WUVA 1OOPA 2JKBA 2XQRA 1ENXA 1NCQA 2YUEA 3AL5A 2XJSA 3RWNA 3N9PA 4XUOA 3FJSA 4HT1T 4XQ4A 5C4WB 1OD5A 2H0VA 4CDUC 2BBVA 4PIYA 1MEC1 2PLV3 2GNBA 5FMOL 1J83A 1GR3A 3OF1A 3OPWA 4HFSA 1W06A 3L9JT 2ORXA 3HT1A 1RUJ1 2ARBA 3NMBA 4H2AA 4ZXEA 1G8WA 1O3SA 1HB1A 4QM8A 3ATGA 4YRDA 3WP5A 1V6MA 4I0BA 1Q8OA 4MX3A 1MS5A 4LNVA 4ZU4A 1TNFA 1UNBA 2ZX4A 1JZ7A 2RS32 4CCKA 4M4PA 3HWJA 1VRH3 4QHBA 4IL7A 2Y6KA 1CQ9A 2HWC2 5KHGA 2RJLA 2RV9A 3GNEA 3D3AA 1UQXA 4QX5A 5BNOB 3B02A 2ERFA 1YFWA 1JH5A 1D7PM 2ZEXA 3ACHA 4R52A 5FY9A 2W1SA 3ZN5A 3ZYPA 3UETA 2V73A 5LRRA 3M2MA 3A4UA 4CDXA 4DY3A 5E1RA 3BPZA 3U75A 4Y5Z0 4GH4A 5DDJ2 3O1OA 5T54A 1HV0A 2N7GA 3I49A 1ZREA 3USUA 2W46A 1W9YA 4MUVA 1U5ZA 2GC3A 4HG6B 2Q5TA 4IUGA 5FLJA 2IUWA 1SBDA 1H9PA 4PF5A 3O1UA 5DPNA 2GMEA 1PO12 3B00A 5JOYA 2VO5A 4K20A 1O6UA 1HRV2 2EA7A 2GN3A 3HPNA 2Z2SB 1DF0A 2OS2A 2WABA 4QPIC 3WNOA 2WZPP 4L9BA 3KV5A 1RUC1 3WZ1A 4AEDA 2WFPA 5E16A 5CISA 2OPKA 3RFRA 1LEMA 2L9LA 1SQ4A 2R043 1BEV3 3LA7A 3RWKX 1LEDA 4KWLA 5LWBA 5F5IA 1I9RA 3P1IA 3I2OA 3AL6A 3JQXA 3NVCA 1H1MA 3UL2A 4BB3A 1KGYA 1PVC2 3AFGA 3AMHA 1D2SA 5J7MA 1O3TA 1POQA 1AYN3 2ZZQA 1DQ1A 5C8CB 1UXZA 3LOBA 1JYCA 2DYCA 3VBUB 3SCGA 4MLOA 1GZTA 1VBB3 1X9PA 3WNXA 3VD9A 4OHYA 4QU1A 3KSCA 3CKHA 3SCFA 2VY0A 2VXRA 2VCBA 2Z5WA 4Q4X2 4JDMA 3M3OA 3POBA 4D6QA 2Y60A 3W9AA 1VMHA 4META 1QEXA 4CP0A 3CJIC 4KWJA 2WJSA 3K75B 4FOYA 3MIHA 4TTGA 2ZAHA 5FZ4A 3H1WA 3M70A 2DUQA 5BNPC 2V4AA 4MV2A 5JUVA 3FZ3A 4RA0A 3RZMA 2LRPA 2OZJA 4ASMB 2WR9A 2B9VA 3TOJA 3GZUC 1N1YA 3A23A 3ZSKA 3LAGA 1LOAA 2FCUA 1NAEA 1W05A 2WNUB 3CF6E 3K46A 3V65A 4C0BA 5DZEA 3U37A 3IDAA 1NG0A 4PQQA 1YIFA 2OQ7A 3GALA 4Z2AA 5FR3A 2ZZJA 2FQPA 3D4KA 3KVBA 3R4SA 4KGQA 3ZMOA 1HB4A 4CU6A 1TE1B 3PJYA 5C9AB 2BJSA 3ZO0B 1IS5A 1TG7A 1W8HA 2RS53 2HWE1 2W9XA 3P6BA 4RS5A 5AC93 4MXVA 4WVWA 2J22A 1Q5OA 1A8DA 5A80A 2WKKA 4QX1A 4LKSA 3OYWA 5EJ3A 3ZXJA 3LE0A 3UKTA 1PGL2 2QQIA 1S0DA 4OYUA 1CZSA 3ZN4A 5IT6A 1QH6A 4L0PA 3WW3A 5C3QA 1NE4A 3BTZA 1U0AA 3M3IA 4KMQA 5JSPA 4BQXA 5JLVA 4QX3A 5HCFA 2V72A 2A3WA 1MZEA 2YU2A 4IE6A 1K42A 2JDPA 1BBT2 4XIKA 4GMP1 2VW0A 1UPSA 3J9SA 3NNFA 1U5XA 2B39A 3OGRA 5FZ1A 1FPN3 4LMFA 3LD8A 2A75A 4OFGA 3FUQA 5KHIA 3L2YA 2RR12 3RQ0A 4CSWA 1N47A 2D6OX 1UXXX 5FDBA 1YQ2A 1W8WA 3VDDB 1YQ6A 1DIWA 2WQZC 2EXJA 3NQHA 5FY7A 1S0CA 2SLIA 2YC4A 1DZTA 4IEQA 4DRVA 4F3JA 5LW9A 2FDFA 1U12A 2G19A 3M3CA 3TNPB 4RFT0 1AR71 1EAH1 1OA2A 2JDZA 4AI1A 3C3VA 3KZ4C 4N9HA 4ONUA 2RDRA 2GC2A 2XVKA 1FMD1 1XE7A 1YIPA 4UYBA 4QXCA 1H1AA 2R1BA 1H9WA 2R062 1ZA4A 2BGCA 2R071 2OKXA 5CFCB 5LZ6A 4IV1B 5F32A 4Y24A 1QJX3 2G9FA 3SH3A 2QQPA 3WQ0A 3WF0A 2YC2A 3C7HA 4IEUA 2XJUA 2E63A 1OQEA 1UZZA 4HVRA 4URTA 3ZFEA 5ANNA 3THPA 1REDA 3HNMA 4EN7B 3IN9A 2P3IA 4RFRB 4LA3A 4NIDA 4UW6A 3ON7A 4EWDA 1LOFC 1ZRCA 1URXA 1GWKA 2X29A 1AYM1 2J1EA 3HBKA 4HKOA 3GJBA 2BUKA 4OZXA 4RGKA 4UW3A 1WBLA 4BQ5A 5C3SA 5JSOA 4WM7A 2RMU3 2ZA9A 4IESA 4BU2A 2MEV3 1GBGA 2DVAA 2P34A 4CP1A 3BU0A 4CCOA 1Q8QA 2A71A 3KM5A 5GZFA 5JR7B 2GALA 2WNEA 5CIRA 2JE9A 4A7ZA 3LF7A 1H4HA 1DQ4A 2PMWB 4P02B 3NJXA 5CKMA 1BXHA 1W03A 2J1RA 3FMGA 1K12A 2ZS6B 1TQ5A 3N35A 3N7MA 2HWB1 4YVWC 1ZZBA 1WCSA 3D8CA 1X50A 1OKOA 4NOTA 2BW8A 3MV11 4M3CB 3ZN6B 1BMV1 3C7EA 1YQCA 3WUCA 4WM8A 1V70A 1WCKA 2HEYF 4E8DA 1RINA 1R1A3 1HW5A 2JIJA 3NL1A 5EWSA 1GOHA 4XAEA 5IK4A 1B35B 2YBSA 3ACLA 4XF1A 2BGPA 2ZJCA 4LBQA 4YW5A 4HBNA 1OH3A 3VL8A 3AYDA 4YW2A 1LRHA 4A42A 5F2WA 4L99A 1EP0A 3M4FA 3V0AB 1J84A 4AE2A 5A32A 4NRMA 4CDUA 5I0SA 2E7AA 2PLV1 2HWF2 1X33A 2IVJA 5D2AA 4FFFA 1UY3A 5JXIA 1DGLA 4JGZB 4QB1A 3H7JA 2YXSA 2A6YA 4O9GA 3OY8A 4FPOB 1LESA 4HPKB 5BNNB 1VBC1 3WP6A 2UU8A 5FWEA 1VAMA 5JCTA 5EYYA 2PAKA 4WZCA 2RS33 2J1AA 3ZOIA 4B3NA 5DMYA 4FBFA 1TNRA 4NJ4A 2PHWA 2Y38A 5A3LA 5KXBA 1TMF1 3CZJA 2HWC3 2VMGA 3HNBM 2D3SA 3JD72 4K1YA 4YW4A 2NLRA 4XJZA 5FZKA 3WQ1A 5HCBA 5H9RA 2E9QA 4FFHA 1CAUA 4MZUA 1SLLA 3I54A 2LW8A 1JS9A 4UFIA 5FXWA 4GJYA 1DBNA 3PLQA 1Y9MA 1MQTC 5ACA2 1W90A 1W6NB 4HKWA 1F35A 5DDJ3 1L7RA 1XNCA 3B5LB 5I0TA 1YLLA 4CEYC 1JU4A 1CJDA 3G6JB 2WQ8A 4LHNA 4QM9A 3QBQA 2P3JA 5LA0A 1PO13 2MPFA 2VNRA 1HX6A 2CDPA 4TSVA 5EQUA 1HRV3 3I3MA 2BYVE 2UY9A 3VKNA 2W39A 3GF6A 1YFXA 1OURA 5LB6A 2HWE2 4K3UA 3N9MA 4KBZA 3GDBA 4WZFA 4QPIA 1IPSA 2EIDA 2OA2A 4YM3A 3PDQA 2KD7A 1IKQA 4I09A 3UYJA 3ZXGA 5SV8A 1PVC3 3TAYA 4M0HA 4U36A 3ZIXA 4YARA 1H2NA 1JYVA 1C8M1 4CXYA 5A1FA 2OW4A 3ILFA 1UY1A 1YRZA 3UJQA 2ZHKA 4AI8A 3W5MA 3SISA 1JXNA 1W04A 1AYN1 1LU2A 2WT1A 4N53B 2X05A 1ZRFA 5CKQA 4AEMA 4YGCA 3ZFFC 3WLUA 1PZ7A 4Q4X3 2G9ZA 1UY2A 1ZZ6A 1VBB1 1W2UA 4KQ7A 1F8VA 2VQUA 2JG8C 3C2UA 4FTEA 1V6KA 4UBHA 3CU7A 4Y33A 4ISRA 3ROUA 4AGRA 4YG6A 2DCYA 1S0GA 4MADA 4QXHA 4CUBA 1R092 3CJIA 3KS7A 4QX2A 5A7PA 1RUI1 4YZ3A 1EV13 3JU9A 3RGBA 5IYYA 2YPDA 5BNPA 2UWCA 2DWRA 5FLHA 3VDBA 1OQ1A 2DFCA 2GN7A 5KHKA 4HN0A 2TEPA 4QPGC 3N9LA 5A3OA 4QKBA 4BCUA 2Y33A 1OH4A 3U78A 1VP6A 3HAGA 3ZXFA 3RZJA 1VB2A 4BISA 4OQ8A 4QDRA 4W6XA 3KF3A 1STMA 5FY8A 5FTTC 2O1QA 3GBWA 5F9TA 3D0JA 4P9XA 4XMIA 2D43A 1NCRB 1K5MA 3N9NA 1RYYA 1UOFA 2WAAA 3JQWA 2IXCA 2RS51 3O14A 4H7LA 1RTVA 5GJ6A 2WINB 1CR7A 5FP4A 3WINE 1IG0A 3DUIA 5KWRA 2Y0IA 3GYDA 5T52A 1UYPA 1GZWB 3AP5A 3OPZA 3URFA 1PMHX 2LTNA 3BALA 4JHTA 5EPAA 4XQWA 3UGHA 4DB5A 5IATA 2A3YA 2QTWB 2VECA 2BNNA 3RI8A 3BTAA 5C4WC 2J1TA 1Q3EA 5J36A 3VBFB 2JEMA 1JBCA 4JTOA 1FOD2 3NV2A 1H2LA 1HV1A 5H9QA 3ES4A 1QJFA 5GLVA 1O7FA 2RR13 2VW2A 1WKYA 4PLOA 2V09A 4FPLA 1FPN1 4I0AA 5GZGA 4DUWA 4KU8A 5IVJA 1MVEA 1ZA7A 3LPFA 1UZ0A 4CXWA 1JMUB 1CAWB 5FY0A 5HV0A 5FYTA 4XEZA 2XONA 1TZOA 3M3EA 4KI5M 5AVPA 3UGFA 5I93A 4QX7A 3MF6A 4K9SA 3T08A 1DLCA 1CN1A 4D7SA 5FZ8A 4LULA 5BNOC 3POGA 2R063 2XWBB 3R4UA 5GM0A 4JGYB 1BQPA 4BQYA 4C1XA 1HB2A 1XNDA 3W58A 3ZSEA 1LENA 1RUJ3 4K21A 4MXWA 5A7WB 5TSWA 4FPJA 4JVAA 2WWJA 2C9KA 2J1UA 3AP7A 3H50A 2C26A 1UMZA 2BOIA 4AAPA 3AKQA 4RGGA 3MIBA 2BERA 4E4DX 2Q1MA 4YM2A 2DU1A 3K3OA 1TMF2 2YFUA 4HXCA 4ZS3A 2VAUA 2W47A 3O0VA 5HI0A 1XJAA 2K9ZA 4HL0A 5JOZA 3J4UH 3DECA 1LOFA 4XTPA 2VZQA 1H4GA 2MHFA 2E6VA 4Y4RA 3MLLA 1J3RA 2Y0OA 1R1ZA 2OYZA 3RYPA 1IHMA 3WW2A 3ZYFA 4AZZA 3OGJA 4TWTA 4F8AA 4ZY9A 5C8CC 5J48A 2OQ6A 4XDPA 2NP0A 1LU1A 1Y7BA 2LALA 4BIFA 2EAAA 3I3BA 3VBUC 3I2JA 5JPNB 2Q8CA 5FZGA 4GWMA 5C3RA 1WMXA 2C24A 1RUG2 4YVWA 5FUIA 3ZIWA 5A3NA 3MZHA 1RUC3 1MACA 4N90A 4J1XA 4Y22B 5FP7A 4PDWB 3WG4A 2W92A 3WF4A 1GUIA 2XR4A 2VG9A 4LBJA 3MIFA 3MIDA 2UWBA 5FYHA 3RNSA 4BA6A 4DUVA 1T2XA 1IZ3A 2W1QA 2XLFA 5FQ0A 3RSJA 3T4VA 1XNBA 3MEPA 4RR3B 2VZTA 1NE6A 4MH0E 1C8M2 5BNQA 4XFFA 3INAA 3I3QA 3Q8EA 2ZOEB 4AFCA 1A8MA 2D6MA 2HWF3 5JXJA 4BWOA 1N1SA 1C8NA 3DF0A 4JTNA 1ZBA1 5F3EA 4HOOA 3QACA 3ZM8A 3FUOA 2WUHA 2ILMA 2J42A 1OFSA 2BFUL 3JB8A 3PIGA 5FXZA 2Y8KA 1SCRA 2JD4A 4KG8A 4ZXKA 3JD73 5C9AC 2RS31 2WLPA 4DQAA 1UYZA 2IFWA 1C28A 3JB4C 5LY1A 3GHNA 2CSGA 4AVTA 1DU3D 1HDKA 5GLZA 2XPJA 4HVOA 2YHJA 1OBNA 2YGLA 3B7MA 3MYXA 4FP3A 4LEJA 2D5FA 4YFZA 5C71A 5I0DA 4FTBA 2JIGA 2V5DA 3ME2A 3NV3A 3QH7A 1RUI2 1FAYA 5ACA3 3IPVB 3RYKA 3THTA 1C1FA 2O14A 1SDWA 4XBNA 2RS12 4LIVA 4DMIA 4P9IA 3T2TA 4CDQC 2CL2A 5FUPA 5DDJ1 2AEZA 3QOPA 1MQTA 3OEAA 1WLTA 4R9AA 5G05L 3LEKA 3SLIA 3ZXEA 4CEYA 3AVRA 1XBFA 3O1MA 1LGCA 4LLFA 2C1FA 3AMNA 4XFGA 3ZXDA 1PO11 1QU0A 3U14A 4O7XA 4Y5SA 1JHNA 2W91A 2ZGTA 3VDAA 2HWE3 2WNOA 3PMSA 2A73B 4IGOA 4NN0A 5FUNA 5CG9A 1S4CA 2BWAA 5CBLA 4FFGA 4JDOA 3VDDC 2P2KA 4OI2A 4XFBA 4RQPB 5APAA 2GC1A 5JOWA 2A5ZA 4OUMA 3WVJA 1BYHA 3PHMA 3TEXA 1WD4A 3O5SA 4HN1A 3K51A 3N3HA 2VOVA 5K0UB 4CCMA 5JMOA 2HYKA 1ZBE2 1PVC1 5C70A 1PK6B 1US3A 1VAVA 2O8QA 5T5LA 1CD3G 4CYDA 1JHJA 4GMP3 2OIIA 4UWDA 3Q8CA 4V2VA 4OHXA 5CFCC 3VBSB 4IV1C 1MZFA 3GCWA 4OHWA 2ZX2A 2FDKA 2Q1FA 2YYOA 1EUUA 3VBHB 5JZGB 2V5YA 4Q4X1 1YYNA 3ZFFA 3FFQA 1SFYA 1V6OA 2NYYA 1DGWA 4YWAA 2D40A 3AJZA 1Y4WA 4BYYA 1KXGA 1ULOA 2BBAA 1AR82 2JG8A 4COZA 5A70A 1W6OB 5T50A 1EAH3 1RUD1 3IMMA 4FXKB 4CUGA 5FOBB 4OHZA 2QQJA 3HVDA 3WXPA 4TZDA 3K48A 4LO6B 4L8QA 1MS8A 2CAVA 2QE3A 3EQEA 4XJUA 2YBPA 5CEHA 3IIAA 2ZGSA 2E26A 3OUHA 3AXEA 1I6XA 3ZYBA 4MGSA 4RD7A 3BU7A 3RJ2X 1XNKA 4Q4Y2 1UMIA 4QKDA 1GMMA 1LHVA 1OKQA 4FQ4A 2VQAA 2QDNA 5FPAA 4AEKA 2R16A 3VLBB 3UV9A 1Y9GA 5F2SA 2XHKA 4ZZ8A 5LY2A 4PJYA 4I01A 2WN2A 4D8MA 5FZ6A 2O8OA 1BHGA 1GP5A 3AYAA 1ND2C 4CPBD 1G86A 4YW6A 4G3YC 1QJY1 2E51A 5E88A 3RDIA 1B35C 3SHRA 3AKPA 3M3QA 1PGL1 3WCRA 5F1RA 1VRBA 4WV8A 4Y1YA 1HN1A 2PFWA 5DUWA 5F3IA 4GULA 2V4VA 2VBBA 3OUJA 1D0HA 5F6KA 2XGXA 4NWWA 3VZNA 2FDIA 4CCCA 1FOD3 1LGBA 2D97A 2XJQA 4OMDA 5LBEA 4IETA 1RITA 3SH4A 3EJKA 1KD7A 1O8SA 1BBT1 4LUMA 1BK1A 3T0AA 2BPA2 3RS6A 4QQ2A 3SC7X 4LO8A 2GP3A 2JDNA 3V64A 3OPTA 4YZ5A 3VZJA 4JGZC 5I8SA 4YPJA 1XXNA 1W2AX 5BNNC 1JU3A 2ZTNA 2HBUA 1OD3A 3LWCA 4Q4W1 5BY5A 3WUDA 3OEBA 4OUEA 1AR92 4YNIA 2Q4SA 5L7OB 4D7TA 1Q8VA 5CFDB 3V0BB 2WSUA 2HH9A 2ZMKA 3THCA 2XUEA 2B9UA 1DQ2A 1OF4A 1OUXA 4EROA 5CKNA 1O3QA 1UYXA 2WT2A 4W8JA 2PQQA 4CCLA 2CWMA 2BEOA 4Z07A 1S2BA 5HXVA 4JRLA 3LIHA 4C0HA 2R061 4EQVA 5KR7A 3KVAA 3WG3A 4QHOA 4AI3A 4CU9A 5BNOA 3N4MA 2VOWA 2ZGNA 1UWWA 5FYYA 3AM2A 4L97A 4OZOA 2DCZA 5CG8A 5K9YA 3RPQA 5IFPA 4UW4A 1ZBA2 4BM8A 3MFAA 3POJA 2O0OA 4GA9A 5FBJA 1VBC3 3H8UA 1YWKA 2VMEA 3A0NA 3PU3A 1U5IA 3KB5A 1MS0A 4OULA 3T2QA 2YFZA 2VVDA 1YJKA 1XU1A 1TMF3 3AXDA 1S1AA 1MS4A 3TEYA 1RMU1 4CUAA 4XFAA 5FO9B 1S0JA 4E4HA 1GWLA 5A6XA 1YHFA 4A4AA 1ZRRA 1YUDA 1UO9A 3FWEA 1RUH1 5LA2A 2NZ9A 2A70A 4QX8A 2GDFA 1J1TA 3E6CC 1Y9QA 5J09A 2W1UA 4ES9A 4N7UA 3SMHA 4W4ZA 1RGSA 3ZFGC 4PLNA 2JWPA 4KGGA 4MGYE 1X9TA 5JOXA 4GD4A 1OOPB 2VBDA 2AGSA 3DYPA 4N53C 2DCTA 5C8CA 4HLTA 5A33B 1RUG3 3PU8A 5GZEA 3U11A 5EP9A 4NWVA 1APNA 3GZTB 3H9AA 4ISQA 3POIA 2RHPA 1GFF2 5GLTA 1NQDA 3WV6A 4LK6A 2WN3A 4Z92B 3B93A 4FT8A 2XKOA 3MPPG 3NSTA 2R30A 3CL1A 1CESA 1UKRA 1AHSA 2QQWA 4GWJA 1WMDA 1QXPA 1XE8A 2RE9A 3DPRC 1C8M3 1RVF1 5FYUA 2CGOA 4GAZA 2Y64A 2RDSA 1W6PB 3FN9A 5AFBA 3WDYA 3H0OA 1KDMA 3CJXA 1FXZA 4GXLA 3S5QA 1HJFA 2HWF1 2VL4A 1HQNA 2Z4FA 1CZVA 3AP4A 4OVEA 3FHIB 4BJ0A 5FFOC 2QQVA 2E7QA 5JMCA 2XDVA 1UU5A 2RJ2A 3H7YA 3ACIA 1NA1B 5FPVA 4CXXA 1O3RA 2DVFA 4A6SA 5A3WA 1PMIA 2ZGKA 2FMYA 4G4FA 4NPLA 1NCRC 1C5IA 4R9BA 4BQWA 3JD71 3NNMA 4DXRA 1RUD2 3IM0A 3WDUA 3KQ4B 5C9AA 4CU8A 3ECQA 3RJRA 1RUI3 3POEA 1JTZX 2VZVA 1UU6A 5T5PA 2RS13 4B7EA 4DXTA 2ZGOA 5ACA1 3HMYA 3U07A 2ZX0A 2ORZA 1XC6A 2WO2A 4FTSA 3JXSA 3B9CA 1US2A 4XOGA 4UT5A 4AEDB 4XAAA 3HQRA 4Y1VA 2G4IA 3GBGA 3VBFC 2DCKA 5FZDA 3H8OA 4INDA 4XDOA 4CDQA 4HVQA 1NY71 1OPOA 1A34A 5JIUA 3DYOA 3RYRA 4AVVA 4BXFA 1GNZA 3MW4A 3MV01 3LSEA 2P6HA 4LO7A 4Q4V1 1YFYA 5DUUA 2I2SA 1YQ5A 2DVDA 5T55A 1POV1 4UFLA 3RMXA 2VZSA 3IWZA 3ZLIA 4GQ7A 4JKMA 3BIEA 1W99A 4JZRA 4YVSB 4JQRA 1OXCA 1QJY2 2FZ2A 4XJ8A 3PVBB 3QCWA 3AYCA 4M4RA 4W6WA 3VDDA 1IOAA 1VMJA 2GNTA 2TUNA 2WQ4A 2ZXQA 2OUHA 3K3NA 2ZGMA 3CQOA 1RIRA 3TNQA 1JZ5A 3J8F2 5C3OA 4M00A 5DAPA 4OI1A 1YNAA 3LEGA 4JGYC 4NHLA 4NAMA 3RG0A 3J7NA 4HMZA 5FYIA 5E89A 4Z82A 3LQCA 2R1DA 4ZONA 3SH5A 2CTVA 4AK3A 2BVVA 3H3LA 2VMHA 3J26N 4GALA 5CFCA 2VMDA 4IV1A 3UNPA 3SEPA 1XYOA 1AR83 1QJZA 2ZX1A 4Q4W2 1CJPA 3FLTA 1UZWA 4KH9A 4LKFA 2DBIA 5FRAA 4R4ZA 4PCRA 1K45A 1L3JA 4XJAA 4XACA 1R091 4BIOA 2VZ1A 2GAUA 2GH8A 3CDZB 4HETA 3VD7A 3WW4A 2C0ZA 1O4TA 2VUCA 4Q1PA 5H9SA 3TBDA 1NXMA 4DOUA 4EWAA 5HBAA 2DUOA 2FD8A 4RS5B 1HQLA 5FY5A 4D0QA 3ZYHA 2JG9C 1PVXA 5FYSA 4YG3A 5CA6A 1JYTA 3MPBA 1GZCA 4QQOA 2ZEWA 3C7OA 1W3XA 3POYA 2ZHNA 4UBGA 1ULGA 2B45X 4B7KA 1SG3A 1RMU2 2LROA 3AZXA 4PDWC 2RVAA 4M3CA 5LK5A 1R64A 3ZN6A 1KITA 4IGQA 4QGMA 3LFMA 4QDSA 2P1BA 2QQKA 2W68A 3ALQA 1RUH2 4PIXA 3T1LA 1ND2A 3A22A 4XJ9A 3PURA 4FPEA 5I91A 3HNYM 3VD3A 4KU7A 4RR3C 1Z78A 1DLLA 1UX6A 3HT2A 2OPWA 1FOD1 3WG2A 2YGMA 4QQHA 5FZMA 2XLAA 3I2HA 3PNAA 3POSA 4XF3A 3AMPA 4C91A 4AHXA 3RZLA 5GALA 3TB0A 1ODMA 2VQ0A 1ND3B 2VJXA 4Q5OA 2JB8A 1WLDA 2BNOA 4JGZA 2Q1ZB 2VE1A 3OG2A 4HPKA 5FZ9A 4CCNA 3PVEA 1WLWA 4DEQA 3AX4A 1PHMA 4DS0A 5BNNA 4XPVA 1G9BA 4P9LA 1W6QB 2OVUA 4W6YA
chains in the Genus database with same CATH topology
3ZMNA 1C1LA 2A7AA 4MGZE 3D82A 4FSJA 4EV0A 4LBLA 3VUOA 1RVF2 2H0BA 3S7EA 1FV2A 1F9KA 2NM1A 3DL3A 1LGNA 3PMEA 1LJ7A 4WVMB 4ZKTB 2GNMA 3U0ZA 1ZBA3 4WVVA 1UD1A 2D5HA 2GU9A 1GANA 2W08A 4I02A 4Q0SA 1S2KA 1WMFA 5FO7B 1W6NA 4QMAA 1ZRDA 4L11A 1JN2P 5JPMB 1CIWA 4WBBA 1WMEA 1JUIA 5I0RA 2DF7A 3UKVA 2DTWA 1LULA 4B4PA 4GMP0 1N3PA 2JJ6A 4I3GA 1AVBA 4PBOA 3MI8A 4QGNA 2EXIA 4D94A 2YY1A 5K0UC 4KG0A 5T5OA 1DYPA 5JI9A 3E97A 1KS5A 3HN1A 5JVVA 4XW3A 1PK6C 1BCXA 2EXHA 3IBMA 4YM0A 3FLRA 3BODA 4QU2A 2CAUA 4XXAA 3R6SA 3ZFGA 2X5IB 4LBQB 1DZRA 4AVAA 4LO5B 1NY72 1QQP2 3VBSC 3FBMA 1QJU2 3HR9A 1KFUL 3QLQA 2EIGA 4Q4V2 5JZGC 1RUG1 2NMNA 1SLAA 1CAXB 3U10A 1ZX5A 4GWNA 5A32B 4YGDA 3LSDA 1UPIA 2VNGA 4AFBA 3GHMA 1VR3A 4LHLA 3AYEA 3OY8B 2A6WA 1XQNA 2R49A 3R0RA 3DPRA 4R8HA 1MS3A 3LA2A 5DXDA 1HXS2 5FREA 1RB8G 2WFF1 4HZFA 1JW6A 4WVZA 1CAUB 5CU1A 1CX4A 2ET7A 2W52A 1PZ9A 1H0BA 3E5UA 1BKZA 1SCSA 2JENA 3VHOA 2CGNA 3SXWA 1RUD3 3V56A 2WS91 4XILA 3KQRA 1NXD1 1ONAA 3N7LA 1NCRA 1AXYA 2VW1A 3VZOA 2WZR2 3KLSA 1WD3A 2PHTA 2ZBJA 2WWSA 4AFDA 3ILNA 2AR6A 5IK5A 2RS11 1CVNA 2PHDA 3ASIA 4AI0A 2KM2A 3ILRA 4XYXA 1ASJ2 4FPCA 1GZWA 5CAZA 3I59A 4Q1RA 2UWAA 5GZCA 4IV3B 5FLIA 1TME1 1I3HA 3VBFA 1GLHA 3SITA 2ZHMA 4IXLA 2B8MA 4Q8KA 1LOBA 3ZYGA 3E6DA 1ZZ8A 1BZWA 4K40A 3AJYA 4FPFA 1MS9A 1QJY3 2XVLA 3ZXKA 1VJ2A 4H55A 3L2HA 5CFDC 1OA3A 3AK0A 5K8SA 2CYFA 2WSVA 4P9JA 4CDWB 3J8F3 1ZBE1 3PTYA 2PHFA 2QZ2A 2ZGPA 1KS4A 5J3UA 3CO2A 4ZU5A 2FBEA 3PVNA 3H1YA 1MZ6A 1BBT3 1VLNA 1KQRA 1LOCA 4LBNA 1LCLA 1B09A 3VBRB 4CP2A 2PHLA 1FNZA 4ORFA 3FC0A 3ZYJB 4JGYA 2Y26A 1R081 2ZKLA 2ET1A 1TEIA 4Q4W3 2PHRA 3KT7A 1V6NA 1YXWA 1NLRA 3MW2A 4FO9A 4J6GA 1AR81 1VBD1 4CRQA 3H3UA 1Q8PA 4FAGA 1O4ZA 2VUJA 3KCCA 1CAVB 5FCCA 1GQGA 1S0IA 1PZ8A 1WBFA 4NHKA 3D5OA 2VGDA 4FCAA 4LBKA 1IPJA 1K5MB 3I2DA 4Q4Y1 2ZACA 1HRI1 5BUVA 4M0NA 2D6KA 4OI0A 3WG1A 1OOPC 5FPZA 1AR62 1PNGA 2JG9A 4QT6A 1RMU3 2ZCWA 4GIQA 3LA3A 5BPXA 1SACA 2KA3A 1RUH3 2I45A 3USSA 4LE4A 5C33A 4Y22A 4AQ6A 5JDBA 4PDWA 4OLLA 4LTAA 4DZGA 1SEFA 3AMQA 3WDXA 3EO6A 4X6QB 1ZZ9A 1JUHA 4RR3A 1OQDA 3EHKA 3JBG1 4D3WA 1G9DA 1LOEA 4Y20A 4YG0A 4XF4A 4AEJA 2ZPXA 2H6BA 1QKQA 1WW6A 4FOQA 4GB32 4Y1ZA 1NA1C 1VRH2 1LB2A 4K6BA 4O9EA 4V1PA 5FO8B 1AR91 3T1MA 3WP4A 4FQZA 4NHMA 1W6MA 2JE7A 3M1HA 4HSLA 1RVF3 4RHV1 3FFZA 2LM3A 5GLUA 2ETEA 5BV6A 4AGGA 1SLIA 4MSVA 5I8YA 4NR1A 5IK8A 3P3PA 2WFF2 3TN92 1V00A 3CNAA 4JV4A 2GNDA 2WNUC 5DZFA 2K2SA 1GZ9A 1LOGA 4Q0PA 3LKJA 2PAEA 1FATA 4DY5A 5GZDA 5HCAA 4FVVA 1BVP1 1GKBA 2WS92 1LHWA 4GKXA 5T5JA 5BYNA 1XYNA 4YVSC 4UW5A 4CZSA 5C8WA 2PTMA 2WA3A 3ZXAC 3HIFA 3OJBA 1J3PA 1I1EA 1QHDA 5ABJB 1F5FA 3R4DB 1UZYA 1QQP3 4XFCA 1QJU3 2E7TA 4J1WA 3DGTA 4Q4V3 1TME2 1H30A 5EV7A 5FQ0B 3WHTA 1IS3A 4JC1A 3B94A 1POV3 4FAHA 4HK8A 3VBSA 4QGLA 3WD5A 4Q29A 3GZAA 4IEWA 5L36A 3N7KA 3MGUA 1IPKA 3TWIA 2ATFA 1H8VA 4Y1UA 4XFHA 1SLBA 2VH9A 2XJRA 4GKYA 1HXS3 5SV5A 4RL7A 4ITCA 1J1LA 1COV1 2PYTA 3MICA 4H14A 1PGW2 1R082 2PHXA 1SMVA 5AC92 4I2OA 1QY4A 5FPXA 1VBD2 1KFXL 1DDLA 2ZMLA 3FE5A 3OBTA 4CEYB 1R093 2WZR3 1Y43B 4LLOA 1XYPA 2NQYA 3VKLA 1WLCA 3BOWA 5DZGA 2NPIA 4BMBA 4AF9A 4EN8B 5F5QA 4P9WA 3ELNA 5I8TA 5JI7A 3P3NA 4AVSA 2BVBA 4COWA 1HIXA 1MS1A 3AZZA 3ZVXA 1HRI2 3IMNA 3QH6A 3ETQA 4LBOA 4QPGA 1DGRN 4XE9A 1DQ0A 2B7YA 4H3WA 1ENSA 2HWD2 2R0HA 4ZU7A 2UURA 4ATFA 1ND3C 1H8TB 1OLRA 1PIV1 4XETA 1ULFA 2IXHA 3NAPB 2LUWA 3WCSA 4ATEA 2DURA 4AVCA 3D0SA 2VNOA 4XXPA 1QXJA 3WP3A 4E2SA 3ZFFB 3ZPYA 5CFDA 2G9GA 3J8F1 4N43B 4BLIA 2JXAA 2XB6C 2WNVB 5FMOS 1KRIA 2F4PA 3S7IA 1N3QA 5C4WA 3JBG2 1DYKA 5EFUA 1X36A 4MGKE 5K7PA 2OZ6A 4IEZA 4BH9A 5D8AB 3ENRA 1AJKA 3O7OA 2F6BA 3PVOA 1EYBA 3JUUA 4QXKA 3WQ7A 4B29A 1NLSA 5DUVA 4RHV2 2GH2A 2WLQA 2AH2A 1V9U2 2DUPA 4FOVA 4RGAA 1QOSA 3BIWE 3VN4A 2XPJA 2VOKA 1QMJA 3FX3A 4SLIA 3E6BA 2ZMNA 1AXKA 2UYAA 1UKGA 3VBOB 4NO4A 3AZVA 1CPMA 1T6GC 4FOWA 5D1IA 2X5IC 4IEPA 1FYUA 1RUNA 4Y26A 1OSGA 2KXLA 3GBFA 1S55A 5J37A 5A33A 4AQSA 1AL21 1Z0HA 2W0XA 3NO8A 4K8FA 4QPYA 3AMMA 3FLPA 1WA4A 3B9IA 3S0MA 1SBEA 4YGEA 5GLWA 1AUYA 3WW1A 4CEWB 4FP2A 1WW4A 4FPKA 3ZSMA 2ZKNA 2CV6A 4DFSA 4X8NA 4LR4A 2ZX3A 2QUOA 3KCYA 1Z7S2 3E5QA 4B8EA 1NCQB 2RM21 4TLFA 1W6PA 1ZM1A 3AKRA 4GB33 3KGZA 3VBUA 4M3CF 2ARXA 1J58A 4Q8LA 2QFEA 1VAKA 1NA1A 4NVPA 3AKSA 1W0OA 4OUSA 4I3PA 5KHJA 2R32A 1FV3A 2DFBA 4FPGA 4DNYA 3H1MA 2XBO1 3MIEA 1D4M2 1RHI1 3AP9A 2WFF3 3TN93 3MIGA 5KHHA 5J98B 1YCIA 4KBBA 4BE3A 4HK9A 5KXEA 1COV2 4BZ4A 2A3XA 2ZGQA 4JAAA 4KNCA 2WNUA 1G6NA 4IV3C 1XU2A 1VBA2 2WS93 4CDXB 4COYA 1OI6A 4DINB 2D98A 4GH4B 5JWPA 1O5LA 3USUB 1O91A 2Q0AA 3VKFC 3VZLA 1KDKA 4XF0A 2R6QA 1BVVA 2IXLA 1EPZA 4MVTA 2NN8A 1QDOA 1PO22 2GZWA 4YVSA 4CDWC 1D4VB 1YI7A 2P17A 1TME3 1QQP1 3VBRC 4DXZA 4E27A 2AUYA 1QJU1 5KXDA 1RUF2 1VBE1 1PIV2 2RJKA 1YI9A 2H6CA 3A0KA 4XFIA 1LKNA 2D6LX 4YGBA 1CPNA 3M7AA 1G9CA 4UXAA 3VGIA 4BQ1A 3LOIA 1EV12 4XDQA 4E9KA 1WW5A 1ZBE3 2A6VA 4LBQD 1RUE1 3LZZA 1GV9A 2QCSB 4R4XA 2IXKA 1K5MC 1HXS1 1IKPA 3VZMA 1HLCA 1AX2A 1R083 2XKPA 4Q27A 1X8EA 1AX0A 1ULEA 1NQJA 3B69A 3I8TA 2C5DA 1DGRA 4S2DA 1VBD3 1ENQA 2DTYA 2XJVA 4JRAA 3B3QE 2YPJA 1LHNA 5CVRA 3VL9A 4D69A 4W65A 4CDQB 4F7ZA 1A78A 3I7DA 4S2FA 3RRDA 2WZR1 1UN1A 3FBYA 1H1IA 1ZVFA 4EWEA 1QF3A 1QNYA 4Q4Y3 1ASJ1 1HRI3 2XJTA 5JSRA 1Y3TA 1IS6A 4JCKA 3WDWA 1UW8A 4QD2A 3OYWB 4A7KA 4KL1A 2HWD3 1OHFA 2X53S 1ZZCA 1RC6A 1S0EA 1VB4A 1AL22 4X6RB 1UF2C 3ES1A 1ND3A 1MEC2 1ZYBA 1C3HA 1HKDA 3NV4A 1AXZA 1B35A 1W6QA 2VPVA 1RUJ2 2D3PA 3IDCB 3B01A 3JBG3 1BJQA 4COUA 2XVGA 1FX5A 3JZVA 2A6ZA 1VIWB 1XRUA 2RM22 3V0AA 4WVMA 3SCHA 2XL9A 1AF9A 2DVBA 3KD4A 5LEKA 3VHNA 4C90A 4EN6B 1AR93 2QJVA 3MDPA 4LHKA 3N7JA 3OBRA 5BXXA 5EXOA 3BB6A 1Q43A 2K0GA 2IFRA 1OMIA 1GSLA 2EF6A 2EVXA 4RHV3 3UKNA 2C9AA 1QOOA 1V9U3 3HBZA 4XF9A 2PA7A 3ZFEB 3VV1A 1V6LA 3UK9A 2AYHA 1RJ8A 2XBO2 1RHI2 3CEWA 1ENRA 1POV0 1VALA 1QWRA 2QKDA 2FHRA 5KC5A 4E4SA 5ABJC 1W39A 2D7FA 4WM7B 1DQ5A 1AR61 1ND2B 1RUC2 1F31A 4AYUA 2WA4A 2X5IA 2I07B 4DPNA 2HEWF 3IKWA 1FNYA 1CGPA 2GSYA 2XG3A 4MYEA 4AXOA 1LHOA 4Q0UA 3I4IA 4KWKA 2EALA 4RQPC 1CAXA 4BPZA 5IUQA 2D3RA 4Q0QA 1ULDA 2P37A 3G7DA 4N7IA 4H7MA 2XUMA 3WT3A 4WM8B 4FXGB 3ZYIB 1CONA 1Z7S3 4RSUA 1HQWA 4A3XA 1SBFA 2Q30A 1S0FA 2ZABA 4Q0VA 1Q56A 2B46X 2TNFA 4PQ9A 2PELA 4N53A 4M01A 4ES8A 3VBHC 4GB31 4LE3A 4SBVA 5FBZA 1VRH1 5A3MA 3KMHA 1C57A 1VBE2 3NKGA 4CDUB 2ES3A 2IXIA 2TBVA 4AI2A 5JAXA 1I5ZA 4AFAA 3DV8A 2DCJA 1D4M3 5FOJB 4U2AA 5FAXA 4YYOA 1D0GA 1RUE2 1N3OA 2UYBA 3MLJA 4LBMA 2QZ3A 1GICA 2FMDA 4LT5A 1COV3 3D6EA 3TN91 4B4QA 2DV9A 5C6CA 3WX5A 1OPMA 1VBA3 1ZNPA 3TRSB 4XBLA 1OFNA 3S6PA 1G7YA 1X8MA 4E4ZA 2XLGA 2D6NA 4IV3A 4OI4A 5E8AA 2R041 4IEOA 1BEV1 1H8TC 3WHUA 2ZGUA 3ZFGB 4ASLA 4K1ZA 1AL0G 3KCXA 2DU0A 5B2GB 3NAPC 3UJOA 3VHRA 3EXUA 1PO23 5AVAA 2XL7A 5IK7A 3ZXLA 3NWKA 2HJIA 3ZSJA 2XWJB 4AHZA 2GC0A 4N43C 3KT1A 4EN9B 4L2NA 1V6IA 2WNVC 4CDWA 1MVQA 4QPIB 2Z42A 4YZ2A 1ZZ7A 1W0PA 3PJQA 3W59A 4NPRA 3X29B 1N1VA 1RUF3 1PIV3 1AR72 1EAH2 2JX9A 3DPRB 2PAMA 3VBRA 5D8AC 3SNMA 3OTFA 1FMD2 1FI2A 4Z1VA 4AW7A 1X82A 5L7OC 2VVFA 4YZ1A 1OLQA 2R072 4IEYA 4C1WA 1REEA 4HANA 1CAWA 3NW4A 3TYJA 4BOWA 1Q8SA 1CAVA 3BCWA 5LK7B 2CGPA 4DRRA 2A6XA 2D6PA 2GMPA 3HD8B 5KC6A 3VBOC 2IWGB 3ZX7A 2Z79A 5F6LB 3KT4A 1RUOA 2FZ1A 1PGW1 3CJIB 1UL9A 1V6JA 5AC91 1AYM2 1H2KA 4K7JA 1M06G 1F2NA 4BMEA 2CNAA 4P14A 5BNPB 1QDCA 2HKXA 1AJOA 1LR5A 3RMYA 5JIAA 1KJRA 1G9FA 4XQDA 3I59B 4R9DA 3ST7A 2OUJA 5T3NA 3VKMA 3AZWA 4AWDA 1DFQA 4PBPA 1O4YA 1WCDJ 1F5JA 1QH7A 4CEWC 4YLZA 4Z2WA 2HWB2 4S2GA 3ZYRA 1LODA 5KBFA 5LRSA 2YC0A 1JOJA 3VHPA 4P5HA 1MZ5A 1BMV2 2BWCA 3WOGA 1IS4A 3WY6A 3APBA 3MF9A 3LGRA 1NCQC 2XH6A 4X8PA 1EPWA 3IDBB 2Q8OA 3AP6A 2ZAAA 2HWD1 3OGGA 5DG1A 4YSFA 2AZ5A 1AL23 1QOTA 1GNHA 1MEC3 5J96B 1LECA 3IT8A 3OD4A 2PLV2 3LCPA 2P3KA 1QJX1 1IQAA 4XHXA 1VBC2 3WDVA 2BNMA 2RM23 2WT0A 1QXRA 3AKTA 1DQ6A 1OA4A 4EN0A 4QQLA 2BFUS 2WIIB 5L73A 1LHUA 2ZHLA 1UCXA 4JDNA 1U5YA 4CDXC 1DHKB 1PNFA 2RMU1 4FPYA 4MXWB 2MEV1 4GH4C 3DN7A 2ENRA 2HEVF 4E2QA 2XBO3 2JG9B 1V9U1 1LTEA 1UU4A 1E57A 1RHI3 3CLPA 4IEVA 3VKOA 4XZPA 2ZGLA 2UY8A 4XHBA 3MLKA 3IPVA 1IGOA 4AEDC 2DVGA 4AQ2A 1S0BA 2AREA 2WL1A 5DG2A 5ABJA 4BHPA 3JCIA 1R1A1 3NKTA 2IZWA 4YM1A 4G9SB 1DZQA 1UIKA 4AQTA 2R042 4Q26A 1BEV2 1QGLA 2IC1A 1C5HA 1D2QA 4Y4YA 4Y20B 2QVSB 4E2GA 1AYN2 2EAKA 1H2MA 4RQPA 4YVWB 5DUXA 1DGWX 2QDRA 4XTMA 1VBB2 1WW7A 5K0UA 3MFCA 3RI9A 4IEXA 5EYXA 1PM7A 1RL3A 2Z69A 3OD0A 1Z7S1 1W6MB 4HKLA 4XJWA 1PK6A 1JYIA 2D44A 4OHVA 4PLMA 3KGLA 4CTEA 5CB7A 4Q2FA 1VBE3 2HWC1 4AG4A 3AB0A 1SLCA 4P9GA 1YO8A 3VBHA 2D93A 2XJPA 5JZGA 2GMMA 2YV8A 3O0WA 3HQXA 3MW3A 1J3QA 3IDEA 1A3KA 1RUE3 1W6OA 1X7NA 4Y1XA 1D4M1 4YW1A 2PHUA 5AFEA 3WDTA 2NMOA 3POWA 1NYWA 4RS5C 1SLTA 4MGIE 2YDEA 1HRV1 4XMAA 4AGVA 5L19A 4R9CA 2BQPA 3U4XA 2VOXA 3M8LA 4YFWA 1WGPA 4N9IA 2RS52 1PGSA 1VBA1 3E5XA 1FT9A 4A2UA 1G9AA 4B4RA 5KXCA 4L92A 1REFA 1ALYA 2EXKA 3AFKA 3NV1A 1MQTB 2YROA 2VUAA 2BTVC 1J59A 1QNWA 1KJLA 2VVEA 2JICA 3EBRA 1H8TA 2CWSA 2QNKA 1EY2A 1PO21 3NAPA 1YFUA 1ASJ3 3O12A 2VULA 5CADA 2PN5A 4S2HA 1FPN2 5EZWA 3S30A 2I74A 2X8KA 4HSJA 4N43A 4PIZA 2WNVA 1N1TA 1AR73 3DKWA 4AHYA 4XIOA 4YW3A 2MNGA 1RUF1 1FMD3 2E53A 4I30A 4IERA 4LA2A 4TYSA 2R073 4YZ4A 5D8AA 1EV11 1UIJA 2IXJA 4P9YA 3ZFEC 5I0UA 4QQPA 2JECA 5L7OA 3V0BA 3N36A 1ULCA 3Q9OA 1QJX2 4Z8BA 4FPHA 2JG8B 3O0XA 3BOPA 4BLJA 2B42B 4COVA 2VU9A 3NJZA 5H9PA 4F83A 1C4RA 1AZDA 1M4WA 3VZKA 2R0FA 3VBOA 1AYM3 1NZCA 4IQPA 4WM7C 4A7YA 3AZYA 4LUKA 4AFMA 1A6CA 2WC2A 1GYKA 4LO4B 2CY6A 1DG6A 2RMU2 1SFNA 2MEV2 1RJ7A 5LEJA 5CNAA 2YZ4A 1O5UA 4QPGB 4AVBA 3QD6A 1YJLA 3ZSLA 2ZGRA 3LB9A 4D7YA 2HWB3 3OCPA 3H3ZA 1AX1A 1NOVA 3WR0A 2SBAA 2AENA 4I0WB 4WM8C 3R05A 4CEWA 2YMZA 2B5HA 2RR11 3ZDSA 1AR63 4M3CE 4AHWA 3RZZA 1MR5A 1GQHA 2VMIA 4XBQA 4EJRA 5GKAC 1UAIA 1R1A2 1WUVA 1OOPA 2JKBA 1ENXA 1NCQA 2YUEA 2XJSA 3RWNA 3FJSA 4HT1T 4XQ4A 5C4WB 1OD5A 2H0VA 4CDUC 2BBVA 4PIYA 1MEC1 2PLV3 2GNBA 5FMOL 3OF1A 1GR3A 4HFSA 3L9JT 3HT1A 1RUJ1 2ARBA 1G8WA 1O3SA 4QM8A 4YRDA 3ATGA 3WP5A 1V6MA 4I0BA 1Q8OA 4MX3A 1MS5A 4LNVA 4ZU4A 1TNFA 2ZX4A 2RS32 3HWJA 1VRH3 4QHBA 4IL7A 1CQ9A 2HWC2 5KHGA 2RJLA 3GNEA 5BNOB 4QX5A 3B02A 2ERFA 1YFWA 1JH5A 4R52A 4CDXA 3ZYPA 3ZN5A 2V73A 5LRRA 3M2MA 3A4UA 4DY3A 5E1RA 3BPZA 4Y5Z0 4GH4A 5DDJ2 5T54A 1HV0A 2N7GA 1ZREA 3USUA 4MUVA 1U5ZA 2GC3A 5FLJA 2Q5TA 1SBDA 1H9PA 4PF5A 2GMEA 1PO12 3B00A 5JOYA 4K20A 1HRV2 2EA7A 2GN3A 2Z2SB 1DF0A 4QPIC 2WZPP 4L9BA 1RUC1 3WZ1A 4AEDA 2WFPA 5E16A 2OPKA 1LEMA 2R043 1SQ4A 1BEV3 3LA7A 1LEDA 4KWLA 1I9RA 3JQXA 3NVCA 1H1MA 3UL2A 1PVC2 3AFGA 3AMHA 1D2SA 5J7MA 1O3TA 1AYN3 2ZZQA 1DQ1A 5C8CB 3LOBA 1JYCA 2DYCA 3VBUB 3SCGA 4MLOA 1VBB3 3WNXA 4OHYA 3KSCA 3SCFA 2VY0A 2VXRA 4Q4X2 2Z5WA 4JDMA 3M3OA 3W9AA 4META 4CP0A 3CJIC 4KWJA 2WJSA 4FOYA 3MIHA 2ZAHA 3H1WA 3M70A 2DUQA 5BNPC 4MV2A 3FZ3A 4RA0A 2OZJA 4ASMB 3TOJA 3GZUC 1N1YA 3ZSKA 3LAGA 1LOAA 3CF6E 2WNUB 4C0BA 3V65A 5DZEA 1NG0A 1YIFA 3GALA 2ZZJA 2FQPA 3D4KA 4KGQA 3R4SA 3ZMOA 1TE1B 3PJYA 5C9AB 3ZO0B 1IS5A 2RS53 2HWE1 4RS5A 5AC93 4MXVA 4WVWA 1Q5OA 1A8DA 2WKKA 3OYWA 5EJ3A 3ZXJA 1PGL2 3UKTA 1S0DA 3ZN4A 5IT6A 1QH6A 3WW3A 1NE4A 1U0AA 3M3IA 5JSPA 5JLVA 5HCFA 2A3WA 1MZEA 1BBT2 4XIKA 4GMP1 2VW0A 1UPSA 3J9SA 1U5XA 2B39A 1FPN3 4OFGA 2A75A 5KHIA 3FUQA 3L2YA 2RR12 3RQ0A 1N47A 2D6OX 5FDBA 3VDDB 2WQZC 1DIWA 2EXJA 4DRVA 1S0CA 2SLIA 1DZTA 4IEQA 4F3JA 1U12A 3M3CA 3TNPB 4RFT0 1AR71 1EAH1 1OA2A 2JDZA 4AI1A 3C3VA 3KZ4C 4N9HA 4ONUA 2GC2A 2XVKA 1FMD1 1XE7A 1YIPA 1H1AA 2R1BA 1H9WA 2R062 1ZA4A 2BGCA 2R071 5CFCB 4IV1B 4Y24A 1QJX3 2G9FA 3SH3A 2QQPA 3WQ0A 4IEUA 2XJUA 2E63A 1OQEA 1UZZA 4HVRA 4URTA 3ZFEA 3THPA 1REDA 4EN7B 3IN9A 2P3IA 4LA3A 4UW6A 4EWDA 1LOFC 1ZRCA 1URXA 2X29A 1AYM1 4OZXA 4HKOA 2BUKA 4UW3A 5JSOA 1WBLA 4WM7A 2RMU3 2ZA9A 4IESA 2MEV3 1GBGA 2DVAA 2P34A 4CP1A 1Q8QA 2A71A 3KM5A 5GZFA 5JR7B 2GALA 2WNEA 5CIRA 2JE9A 4A7ZA 1H4HA 1DQ4A 1BXHA 3FMGA 2ZS6B 1TQ5A 3N35A 3N7MA 2HWB1 4YVWC 1ZZBA 1WCSA 3D8CA 1X50A 4NOTA 2BW8A 4M3CB 3ZN6B 1BMV1 3WUCA 4WM8A 1V70A 1WCKA 2HEYF 1RINA 1R1A3 1HW5A 3NL1A 5EWSA 5IK4A 1B35B 3ACLA 4XF1A 4YW5A 2ZJCA 4LBQA 4HBNA 3VL8A 3AYDA 4YW2A 1LRHA 4L99A 1EP0A 3M4FA 3V0AB 4AE2A 5A32A 4CDUA 5I0SA 2E7AA 2PLV1 2HWF2 1X33A 1DGLA 4JGZB 3H7JA 2YXSA 2A6YA 4O9GA 3OY8A 4FPOB 1LESA 4HPKB 5BNNB 1VBC1 3WP6A 2UU8A 5JCTA 1VAMA 5EYYA 2PAKA 4WZCA 2RS33 4B3NA 4FBFA 1TNRA 5A3LA 2PHWA 2Y38A 5KXBA 1TMF1 2HWC3 2VMGA 3JD72 2D3SA 4K1YA 4YW4A 2NLRA 4XJZA 3WQ1A 5HCBA 5H9RA 2E9QA 1CAUA 4MZUA 1SLLA 3I54A 1DBNA 3PLQA 1MQTC 5ACA2 4HKWA 1W6NB 5DDJ3 1XNCA 3B5LB 5I0TA 1YLLA 4CEYC 1CJDA 3G6JB 4LHNA 4QM9A 3QBQA 2P3JA 1PO13 2MPFA 2VNRA 1HX6A 4TSVA 1HRV3 2BYVE 2UY9A 3VKNA 2W39A 3GF6A 1YFXA 2HWE2 4K3UA 4WZFA 4QPIA 2OA2A 4YM3A 1IKQA 4I09A 3ZXGA 5SV8A 1PVC3 3TAYA 4M0HA 4U36A 3ZIXA 4YARA 1H2NA 1C8M1 2OW4A 3ILFA 1YRZA 3UJQA 2ZHKA 4AI8A 3SISA 1JXNA 4N53B 1AYN1 1LU2A 2WT1A 1ZRFA 4AEMA 4YGCA 3ZFFC 3WLUA 1PZ7A 4Q4X3 4KQ7A 1ZZ6A 1VBB1 1W2UA 1F8VA 2JG8C 3C2UA 4FTEA 1V6KA 4UBHA 3CU7A 4ISRA 3ROUA 4AGRA 4YG6A 2DCYA 1S0GA 1R092 3CJIA 3KS7A 1RUI1 4YZ3A 1EV13 3JU9A 5BNPA 2UWCA 2DWRA 5FLHA 1OQ1A 2DFCA 2GN7A 5KHKA 4HN0A 2TEPA 4QPGC 4BCUA 1VP6A 3HAGA 3ZXFA 1VB2A 4W6XA 5FTTC 2O1QA 3GBWA 5F9TA 3D0JA 4P9XA 4XMIA 2D43A 1NCRB 1K5MA 3JQWA 2IXCA 2RS51 3O14A 4H7LA 1RTVA 5GJ6A 2WINB 1CR7A 3WINE 3DUIA 5KWRA 2Y0IA 3GYDA 5T52A 1GZWB 3AP5A 3OPZA 3URFA 3BALA 2LTNA 4DB5A 4XQWA 2A3YA 2VECA 2BNNA 3RI8A 3BTAA 5C4WC 5J36A 1Q3EA 3VBFB 2JEMA 1JBCA 4JTOA 1FOD2 3NV2A 1H2LA 1HV1A 5H9QA 3ES4A 5GLVA 1O7FA 2RR13 2VW2A 4PLOA 2V09A 4FPLA 1FPN1 4I0AA 5GZGA 4KU8A 1MVEA 1CAWB 4XEZA 3M3EA 5AVPA 5I93A 3MF6A 4K9SA 1CN1A 4D7SA 5BNOC 4LULA 2R063 2XWBB 3R4UA 5GM0A 4JGYB 1BQPA 4C1XA 3ZSEA 1XNDA 3W58A 1LENA 1RUJ3 4K21A 4MXWA 5TSWA 4FPJA 4JVAA 3AP7A 3H50A 1UMZA 3AKQA 4RGGA 3MIBA 4E4DX 2Q1MA 4YM2A 2DU1A 1TMF2