3PMSA

Recombinant peptide: n-glycanase f (pngase f)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
312
structure length
312
Chain Sequence
DNTVNIKTFDKVKNAFGDGLSQSAEGTFTFPADVTAVKTIKMFIKNECPNKTCDEWDRYANVYVKNKTTGEWYEIGRFITPYWVGTEKLPRGLEIDVTDFKSLLSGNTELKIYTETWLAKGREYSVDFDIVYGTPDYKYSAVVPVVQYNKSSIDGVPYGKAHTLALKKNIQLPTNTEKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINNSNTFQHQLGALGCSANPINNQSPGNWTPDRAGWCPGMAVPTRIDVLNNSLIGSTFSYEYKFQNWTNNGTNGDAFYAISSFVIAKSNTPISAPVVTNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptide:N-glycosidase F
publication title Recombinant peptide:N-glycanase F (PNGase F)
rcsb
source organism Elizabethkingia meningoseptica
molecule tags Hydrolase
total genus 86
structure length 312
sequence length 312
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2010-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09112 N-glycanase_N Peptide-N-glycosidase F, N terminal
A PF09113 N-glycanase_C Peptide-N-glycosidase F, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3pmsA02
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3pmsA01
3MIEA 1YIPA 3MIFA 1PNGA 1YI9A 4QHBA 1SDWA 3MLKA 3KS7A 3MIGA 4E4ZA 1PNFA 1YJLA 3PHMA 3PMSA 3MLLA 3MIHA 1OPMA 3MLJA 1YJKA 3MICA 1PGSA 3MIBA 4R4XA 1PHMA 3MIDA 4R4ZA
chains in the Genus database with same CATH superfamily
4N43C 5HI0A 1CR7A 1UZ0A 2BOIA 3R4SA 1IOAA 5ACA3 1RXFA 2XONA 1HXS3 1UXXX 4ZPIA 3LDKA 1UY2A 2VJXA 3J9SA 2JG8B 3E5XA 1CIWA 3ECQA 4QPGB 4XF1A 3VBSB 3VV1A 2PELA 4XTPA 4DZGA 1WMEA 4JDOA 4QDQA 3MYXA 4M3CE 5LK5A 2WZR1 2XLFA 3W20A 3PHMA 5KC5A 5FRAA 2YROA 4SBVA 2LW8A 3KD4A 4KNCA 1NE6A 2PQSA 3L2HA 1QJY1 2A6XA 2ZGPA 3K2OA 2HYXA 2X09A 3B02A 1NZCA 1DGWA 4IE4A 1AF9A 4LTAA 4M00A 4XFHA 5FYHA 4Y1UA 5FZCA 2XJSA 1YRZA 2UWCA 2XWBB 3VD7A 4TN7A 4COYA 3SHRA 3LDBA 4CE8A 1YI9A 3O1RA 5FJKA 1W6MA 3I59A 3Q8CA 3FWEA 5CFCC 2YMZA 3KHBA 1T2XA 3LEKA 3WDXA 2L9LA 4EZHA 5FZIA 4BQ3A 5BNOA 1QJX1 4O65A 2VUAA 2JDNA 3WNMA 2HWD1 4XUTA 3NL1A 4UBGA 2RJLA 3VD9A 1YFXA 3RMXA 1IS4A 3ZYPA 4A42A 5LA0A 4BXFA 3C7GA 1VIWB 4DRVA 2XBO1 1PZ7A 4ORFA 1TNFA 4Y4YA 4JGYB 1HRI3 4JGZB 2YPJA 3NKGA 3R0RA 4ZU5A 5I8SA 2ZGTA 3NJVA 4A3XA 2VMDA 5K8SA 2D6NA 4FPYA 2QJVA 2WLPA 2GMMA 1OLMA 1JZ5A 2H0VA 2ZTNA 3PVOA 1OQEA 2QDRA 4MGKE 3ZXAC 2BQPA 2ZHKA 5CU1A 1GICA 1XYNA 5HCAA 1R1A3 4KI5M 1PK6B 2ES3A 4L2NA 2Q8EA 5FZ0A 2D6OX 2CY6A 4RQPB 3P5BA 2AR6A 3I3DA 4NIGA 2OPWA 1W8UA 1PVC1 3WEZA 4BE3A 4NWWA 3MV11 1PGSA 1UX7A 4P5YA 3ZSJA 4DO0A 4R4XA 1K5JA 5BNNB 2C6SA 3PUSA 1ZRCA 3C7HA 1JTZX 1FOD1 3LCPA 2E26A 1RITA 4N8MA 5G05L 4NRPA 4OVEA 4AVBA 4XJUA 1MACA 4FOWA 4LULA 2R041 2WIIB 2D6PA 2HEWF 3DEMA 4GH4B 1SMVA 1J3PA 1UOFA 2JKBA 2RS53 1V6MA 3ZYFA 4FI9A 1UZZA 1F5FA 1PVXA 2J1AA 1Z7S1 1LOAA 4OMCA 3RFRA 2DDUA 3MUY1 4E4DX 4MSVA 2JDHA 3U75A 2IXHA 1BKZA 1WD3A 4KQ7A 1H9WA 3ZKUA 2P3KA 2QQIA 5GLTA 3POIA 4FTSA 1TEIA 2MNGA 1YQ6A 1ZBA2 4UFJA 1A8MA 1GZ9A 4QQLA 4GKXA 2ZEWA 3A21A 4N53C 4CRQA 2ZHMA 1E5IA 3O1VA 1TMF3 5DDJ3 3N9PA 5A33A 3OYWA 4C1XA 1A3KA 1W6QA 3AYEA 4HPKB 4UBHA 5DPNA 3WD5A 3WX5A 4ET7A 5C8CA 1JYNA 1O3QA 3WNOA 5G04L 2ZA9A 4NPLA 3BIEA 1S0IA 2H6BA 4OQ9A 1NOVA 2QE3A 2F4PA 2XHKA 1KFXL 2WO7A 4XACA 4CCLA 2YC4A 3ZYBA 1GZTA 3WQ0A 2PLV2 4YW1A 4AGGA 3KLSA 4QDRA 4LOTA 5CIRA 2C9KA 1SLAA 3GCWA 1US3A 3U4XA 4IV3B 5C3SA 4D7SA 4Q0SA 3E5UA 4Y20B 1NYWA 3TN93 4YVWA 4M4RA 1POV0 3RZMA 3ZX7A 4AGRA 1PGL2 1UOJA 4L9BA 5LA1A 2JIJA 1F9KA 1XXNA 3CKHA 1ULCA 4QKFA 5FOJB 1CAVB 5IHRA 4MXVA 1VMJA 3M3QA 2DF7A 5DG1A 4R4ZA 1W9FA 2EIDA 5FZHA 1CZSA 5FO8B 4DUVA 4Q4X1 5JXHA 2VO5A 3WZ1A 2J1RA 5C5TA 1ENSA 1OF3A 5IT6A 3EQEA 4XC9A 1AYM1 4MXWA 3ZYJB 3E1F1 4B4QA 2YHJA 1ASJ1 3HNYM 4G4FA 4XAAA 3FFZA 1AR92 4XBQA 5FPAA 4AEMA 3ZXGA 2HWB1 4M3CF 5A1FA 5A3MA 2Y0OA 3I97A 5JSRA 3ABZA 2Q1MA 2R30A 1VAKA 1ZX5A 3I54A 4MGZE 4AVCA 1YFWA 1UOGA 1X8MA 2W52A 1VAVA 4IDZA 2BYVE 3POFA 5FPZA 4ZZ8A 3DV8A 2WKKA 1O59A 3NNLA 4NN0A 4R9DA 1A8DA 1Q8VA 2RS11 5L7OC 3H8RA 2MHFA 1ULGA 4RFRB 3MUZ1 2RS31 1WLWA 5FXZA 4DXTA 1OXCA 2IVJA 3N7LA 4CXXA 3H3ZA 1SBFA 1XOYA 3M2MA 2D6MA 4UF0B 3UESA 2QQKA 2JKXA 1H6XA 4LITA 2RMU1 1ONAA 1IZ3A 3B69A 2A6WA 2D5FA 4BHPA 2FD8A 2FBEA 3S5AA 5GZFA 1HB3A 4KGQA 5SV5A 1H4GA 4W65A 3K3OA 1ZNPA 1RVF3 2CWMA 5ACA2 2BNNA 3DKWA 2JG9B 1SBEA 3NV3A 4HLTA 4GJYA 4F8AA 4XUOA 4OFGA 2R073 3W5NA 3BUCA 2YY1A 3ITQA 3KF3A 1MQTC 3PNAA 4NOTA 5DUWA 1Y9GA 5A7OA 3WHUA 4AL9A 1JYXA 2DBNA 2ARBA 4WZCA 2FDGA 1ZVFA 4KWLA 5M0TA 3ZVXA 1WW6A 4MYEA 3ME2A 4F83A 2ZGNA 1YIPA 3HQRA 5LBEA 2PHWA 4ZZ5A 3OGVA 1OFNA 2JB8A 3FLTA 4P5HA 4AZZA 1ND2A 1QMJA 4AEKA 4I30A 1SLLA 5A3NA 2BGCA 5BNPA 4CP1A 4NE9A 2Q30A 2VZOA 2R32A 2ZX0A 3CJIA 1OLME 3B94A 3JB8A 4TZDA 1R093 2PFWA 3TNQA 1Z0HA 1MZ6A 4F7ZA 3I2HA 5DN2A 2UWAA 2EAKA 2VMEA 4Y5TA 1ODNA 4H7MA 4CA9A 1ULOA 4FQ4A 1V6NA 4RHV3 2VZVA 2G1MA 1ND3C 2GMPA 3WNKA 1RUF1 1J1TA 4L8QA 4EZ4A 4UFHA 1BVVA 2VU9A 1FPN3 2Y60A 5FUPA 1QHDA 1VPHA 4AAXA 4CUGA 2Q1ZB 5C4WC 1AR83 1JYCA 2XVKA 2VUDA 1C4RA 3FLPA 3IT8A 1RUC1 3TNPB 2WZPP 3RZZA 5ISLA 1IS3A 2BTVC 1X82A 4Q0QA 4CCDA 4CXWA 2YXSA 3F2ZA 4QU1A 5DZFA 4CUCA 3GCXA 1YLLA 4BK4A 1NLRA 1HRI2 1RGSA 2D6LX 2W0XA 3PTRB 3QBQA 4KBBA 5FK8A 1UO9A 3AKPA 3D5OA 4PDWB 4U2AA 1WUVA 1VE0A 2ARAA 1QNYA 1SQ4A 3OGJA 5FY7A 3X29B 2BVBA 1SPPA 2E33A 2QQLA 2CYFA 2Y34A 3M3CA 2JG8C 3D4KA 1C8M2 4QPGC 3VBSC 5LRSA 4Q5OA 5IYYA 5K0UB 1DCSA 1HQWA 4NHKA 1R1A2 1OMIA 2DVAA 4X8PA 4AI1A 3I2OA 1AXZA 4K21A 3BU0A 1VB2A 4AQTA 5LW9A 3MPBA 3UNPA 1W8HA 1JYVA 4B8EA 1QJEA 2VZSA 4NAOA 5T50A 4FTEA 1W3VA 4BPZA 1OLQA 2RM23 4YM2A 3SLIA 1VRH2 4EE2A 1YI7A 4YZ2A 5T5PA 3AP9A 3OY8A 1XU1A 2W87A 4QX3A 3AJYA 4UW6A 5CB7A 5CFCA 4XAEA 2VOTA 4IE7A 3W9AA 4URAA 2Y8KA 2UYBA 2RS52 3R6SA 1PMJX 3T2TA 3MFCA 3KCYA 4YLZA 3H42B 4QKBA 3LZZA 4COVA 2R1DA 1NUKA 5D2AA 1FNYA 5FUIA 4IEYA 3H1YA 1REDA 5BNOC 3OG2A 3J7NA 5FTTC 4IESA 4Y26A 3VD4A 4Q26A 1JUIA 3BU7A 1QQP3 2BGOA 1GWKA 1DQ6A 3QH7A 2ID4A 4D6RA 1CIYA 2GNBA 3M70A 4QHBA 1IKQA 3BTAA 3IIIA 2WDBA 2Q1FA 2VOWA 1TMF2 4WVWA 5FO7B 1Q56A 3K4DA 4JGYC 1VP6A 1ZBE3 2O8QA 4Q4W1 1UXZA 4XBNA 1JW6A 3I3MA 4YW6A 2P3JA 5BNQA 3C3VA 4I0WB 4ZS2A 1L7RA 2DURA 2EIGA 1FMD2 1CJDA 1V9U1 1RUOA 1BEV3 3KV9A 4YW4A 4YG6A 1N3OA 5FUNA 1PK6C 5EP9A 4W6XA 1MS0A 5DG2A 4CDWC 1VALA 4PIYA 4RQPC 3HT2A 4CP0A 1SLBA 2OX0A 1WBFA 4LBMA 4ZONA 4LO5B 5A7PA 1VBC2 2V5YA 2JECA 4K1YA 3QOPA 5FKBA 5JXJA 5A70A 2W95A 5DZEA 5BNNC 3BOPA 3OBTA 5FPLA 2B4KA 3FE5A 3MLKA 3AZZA 1ZZ6A 4YSFA 1IPJA 1CWPA 4XDPA 1W8WA 4GWNA 3AYDA 4H7LA 3DCQA 4QM9A 4YFZA 2YBKA 1YUDA 2WNEA 5A3PA 2Z5WA 3WG3A 1FXZA 3ILRA 3PIGA 2A5ZA 4GH4C 4LKDA 4B7EA 4BMBA 1TG7A 1QDOA 1EPZA 1GP5A 3UGHA 1K45A 2ZACA 1NY71 3S7EA 2OUHA 4NROA 1WMFA 5FZ6A 3ZYGA 2VZ1A 2W1WA 2WS92 3J7HA 2HWF3 2VQUA 1EV11 4N53A 4XFGA 2X10A 5I0TA 2QQVA 5ANQA 4I09A 5I0UA 3ZDVA 2HEVF 4Y1VA 3BVCA 1S1AA 2A73B 2YC2A 5AVPA 5KR7A 2ZPXA 4S2HA 2BP6A 1I9RA 4UFIA 4FPFA 5H9PA 2QQJA 4FCAA 3VDDB 2W94A 2XQRA 5FYIA 5A3UA 3RWKX 1LB2A 1R083 5L9BA 1GV9A 2Y6LA 1DGRA 3AZVA 4DY3A 4BISA 1W8FA 1XE7A 3T2PA 1M06G 3U4SA 2ORZA 4AEDC 3ALQA 1S55A 4LLOA 2WFF2 4LE3A 5FAXA 3NNFA 2RR13 4RFT0 1ENXA 3SKJE 1WW7A 3HVDA 1CAXA 4IV3C 4JRLA 1SFPA 1GQHA 3ZXKA 2JJ6A 2A3XA 1S2EA 1PZ8A 2OKXA 1E5RA 4IXLA 3I3EA 2W91A 1SDWA 2DCYA 2EICA 2JDMA 1N1VA 3EYPA 5IFPA 3K46A 4NPRA 1DF0A 5IK5A 4CEYA 1ALYA 2DCJA 1LHWA 2DU1A 3W5MA 2WFPA 1K12A 3GNEA 2I2SA 3V65A 1Y9MA 1LENA 1PIV1 2Q8DA 2B46X 5A3OA 3WP5A 4AFBA 4BZ4A 1JZ7A 3FMGA 3HNBM 5FYMA 3SEEA 5JUVA 2B5HA 4GQ7A 3AP6A 2W1SA 4CCJA 3JCIA 1R092 3N35A 4LKSA 2CU5A 4JKMA 1F4HA 3VHRA 2Z69A 5L7OA 4RHV2 4FTBA 4Z07A 5A7WB 2C1FA 3J26N 2BNOA 4UFLA 4B7KA 1UMHA 2HLEA 2X8KA 4RR3B 5T5JA 4ARXA 5AFBA 2EVXA 3A7QA 5FY8A 4FPJA 3ETQA 5FBZA 1DFQA 2XMLA 3URFA 4XW3A 5KC6A 5HV0A 2BEOA 3GBFA 1OPMA 2OXBA 5FY4A 2OS2A 2UYAA 4LIVA 1VBA1 4HANA 4IEXA 1D4M3 1DQ4A 1GZWA 4OLLA 1H1IA 3APBA 3RMYA 4EWDA 2BERA 1POV1 1ZREA 4XHXA 2Y6GA 2XBO3 4AVTA 2QQPA 2MEV2 2VY0A 3NJXA 4MHRA 5I0DA 2JG9C 3B01A 1RJ8A 2FDFA 4CP2A 4Y22A 4ZKTB 4O61A 5HV4A 3ST7A 5KXBA 3BTZA 1CAWA 2WC2A 5J7MA 1NCQB 1WKYA 3V0BB 1G86A 1RUNA 4FFGA 4JTOA 3VLBB 1YC61 3ZO0B 3U78A 1DYPA 1YJLA 3PLQA 3GZTB 1WA6X 2VZUA 3AZXA 3ZOIA 1HX6A 1GBGA 5LBBA 1PMHX 1PVC3 1N1SA 3AKQA 4FFIA 3B5LB 3V56A 4K8FA 2D44A 3H8XA 1EUTA 3ETPA 1ND3A 4CUAA 1COV1 1LGCA 2LTNA 4NJ4A 3FUQA 1FOD3 3MGUA 1GWLA 4BQXA 2C5DA 3ZFGA 5LY1A 4OHVA 2GN3A 1LAJA 4FP2A 4XVHA 2BUKA 3WUDA 1JZ3A 5C4WA 1TME2 1FYUA 2ZZJA 4MZUA 3MDPA 2GNTA 2XJRA 3VBRB 1DQ5A 3BCWA 3M3EA 1UY3A 5FO9B 4QGMA 4UWDA 1J3QA 1OH3A 2WYSA 3FHAA 2VULA 2DTWA 3FUOA 3FHQA 3KQRA 3NW4A 3BTXA 4Q4Y1 4YVSB 4EN9B 5E1RA 4ES9A 1QQP2 1GKBA 1UAIA 3ZXFA 1XJAA 3V0AB 1QGLA 2XVGA 2E32A 1FV2A 1RHI1 1ZBE2 2E7QA 3IDEA 2JG8A 4MLOA 4PDWC 4QPGA 3VBSA 1XNBA 1A34A 1AR62 1CX4A 2VR4A 3NJZA 4XQWA 3RNSA 1NXD1 1JOBA 5F2SA 4ZXKA 2R062 5FZOB 3M1HA 5K0UC 1BEV2 2XG3A 2OQ6A 2FZ2A 4AI2A 2GNMA 4PJYA 5T55A 1IQDC 4HK9A 5FYBA 3RI9A 1RUH1 3ZYIB 5FMOS 3OD4A 3L2YA 5JR7B 2JD4A 4FPKA 1HQLA 4BXSV 1BMV2 1RUD1 2CTVA 2WR9A 3M3IA 1KJLA 1HRV1 1BK1A 2C9AA 5AVAA 5J98B 3MO4A 5APAA 3IIAA 4Z8BA 4D8MA 5GLUA 2A75A 4IE0A 3KGZA 4UW5A 2VXRA 3K51A 1AYN2 3H1WA 1AYM3 4E2GA 4K20A 3POJA 3R4DB 1KS4A 3F95A 4GMP1 1W2NA 2HWF2 3ENRA 5IK8A 2P1BA 1M4WA 1IG3A 1RMU1 4META 5FXWA 2BU9A 3N9QA 4YFWA 3VBFB 1F4AA 4XOGA 4JGZA 4DFSA 2ZGSA 3T30A 2B39A 1S0FA 4DUWA 1S0EA 2VMFA 2P3YA 3E6DA 1DG6A 1MZ5A 2VBDA 4SLIA 2K9ZA 3BGAA 3N36A 2RS13 4CP9A 1VRBA 3PURA 5T5OA 2PAKA 4E8CA 5LRRA 4X6RB 1CVNA 3LKJA 1PGW2 1PK6A 3OEBA 4O7XA 1H1AA 3JB4C 4OZOA 2PAEA 4RQPA 4OHZA 1K5MA 3OB8A 2RR12 4AAPA 2PQQA 3ZN6B 1LODA 1SHWB 2Y6JA 3IMMA 2PYTA 4JQRA 4QPWA 2F6BA 2QQOA 4I3GA 5BYNA 5BNNA 3JD71 2W1UA 4OUEA 5JAXA 4AQSA 3ZSKA 3I49A 1UN1A 4AWDA 1UYZA 2QUOA 4YYOA 4X6QB 3WF4A 3LSDA 2XQXA 2HWE1 5FY9A 3ATGA 4XHBA 1AJKA 4BU2A 4N90A 3JBG1 1RUJ3 3CZUA 1HB2A 1HLCA 3LA7A 2UU8A 1DLCA 3HBKA 3S5QA 4E2QA 2DBIA 5AC93 5T52A 1O5UA 1GU3A 3ON7A 3LF7A 4LO7A 5F6KA 3ACIA 1G9CA 2WNVB 1U5XA 2P6CA 1HJGA 4XFFA 2WWSA 1AXYA 2Y33A 4CPBA 2R0FA 3UGFA 1N3PA 3KT4A 1EPWA 1CN1A 1PNFA 5F6LB 4QKDA 1H9PA 3S7IA 3THPA 4HPKA 2VCAA 2YC0A 1DP0A 3JUUA 1S2BA 4HT1T 1OBNA 5B4NA 3RSJA 5CAZA 3H0OA 3VDDC 2AUYA 4GWMA 1Y43B 3KV5A 1QJX2 3MW2A 4K40A 3RWNA 1W28A 4AF9A 5IFTA 4D0QA 2GP5A 5CEHA 1YHFA 2HWD2 2E9QA 2JX9A 3HJRA 3UKTA 4O9EA 4CDXB 1NT0A 2YU2A 1PX4A 2WQZC 1ZA4A 1D4M2 4DEVA 5IVEA 1C57A 4CCNA 2XBO2 4XCAA 2TEPA 3WG1A 4HOOA 1CAVA 3VL8A 3WVJA 3C2UA 3K4ZA 5A1LA 3O1MA 5JWPA 1CZVA 4XF0A 4LHKA 3OPWA 1SLCA 2FZ1A 1QDCA 1AR71 1ZZ8A 2FCUA 4M3CB 4LT5A 2P34A 4C91A 3VDAA 5JI7A 5A6YA 4ZU7A 2VQTA 2WJSA 3RYKA 2B9UA 5LK7B 4AHWA 4NRMA 1W9TA 1ULFA 1NKGA 1W39A 3GBWA 4AEJA 2P17A 1R64A 2BFUS 1PVC2 1IGOA 1ENRA 2HJIA 5HCFA 1KJRA 4YPJA 4XJAA 2YDEA 1QOSA 4OZXA 4S2GA 1J83A 1OOPC 1Q43A 4LBQD 5L73A 1FOD2 1WD4A 3ZYRA 3AL6A 4QGLA 3WHTA 1S2KA 3CEWA 4GJZA 4P14A 4W6YA 4LXLA 1OD5A 4CDQB 5C3QA 1ZZBA 1H4HA 2ILMA 2R042 2VNVA 3LA3A 4PT6A 4QMAA 3TEWA 4RR3C 1N1YA 3SC7X 3VHNA 4AHZA 1Z7S2 4BCUA 1UD1A 2JD9A 3LSEA 1VBE1 4S2FA 3PU8A 1RUI1 3NV4A 3DGTA 4QDSA 1NLSA 1QXJA 3I2IA 3NJYA 3LIHA 4GWIA 2VC9A 5F5AA 4RS5B 5B2GB 2WN3A 2ZX3A 4F3JA 1U5YA 2JG9A 4PQ9A 5CKQA 4KG8A 5CG8A 1V6KA 1QH7A 5FFOC 5I8YA 3PUHA 1HIXA 4RD7A 2JIGA 1VBB1 1NCRB 1UYPA 2J1SA 1XQNA 1C8M3 2Z42A 3J8F1 1DYOA 1UZYA 5KHHA 4A7KA 2XLAA 4BMEA 2JB4A 3KCXA 3WW2A 5GLVA 4CDWB 5ABJB 4FOYA 5EFUA 1NCQC 1W6PA 5FBJA 5A7SA 1WZXA 2PHRA 1E5HA 4XMIA 1DGLA 1V9U3 4JQTA 5LZ6A 1QF3A 3VBOB 3POEA 1VRH3 3KZ4C 1JU3A 3AFGA 4WBBA 5IW0A 3BODA 1IKPA 4D7YA 4GKYA 4XFCA 5J1XA 1LGNA 1W3XA 4ZU4A 4WM8B 5FWEA 1SZBA 2E53A 4M4PA 4XIOA 3NWKA 1VBD1 5E6HA 3MIGA 5SV8A 3SCFA 4ISQA 1S0JA 4JRAA 4AE2A 4I02A 5F8PA 2ZEYA 4H55A 1OUXA 3GJBA 5EV7A 1W6NA 1AYM2 1DGRN 3R4UA 3S30A 1ZYBA 2Y26A 1UCXA 3VBRC 3DKQA 2J1TA 2KR2A 5KBFA 1ASJ2 1JN2P 3IPVA 2HWB2 4P9YA 2DU0A 4YVSC 1DU3D 2A6ZA 2IXLA 1RXGA 4C0BA 2WNUA 2A6YA 3IDCB 4RYDA 3ILFA 1UNBA 2BNMA 2Z79A 4GB31 3WSOA 1EAH1 3O0WA 5KXDA 4YG0A 4Q0PA 2RS12 5FZAA 3CU7A 2GN7A 4KWUA 1WCKA 4I3PA 4H14A 4MADA 4BH9A 5K0UA 2RS32 4AEDB 3O1PA 1FMD3 4JHTA 3LWCA 4EN0A 1QKQA 2YZ4A 1W9SA 3VUOA 2RMU2 4QM8A 2E7AA 1RJ7A 1JOPA 3MIHA 3JQXA 2WZEA 1OVSA 4QU2A 5JVVA 1RUG1 3H7JA 1VBC3 3SXWA 2ZOEB 5LWBA 1JHNA 2W3JA 1LEDA 1QJU1 2O14A 3C7FA 5EIYB 4PI2A 2KXLA 5E16A 3I2GA 3O12A 1PZ9A 2XLGA 4OQ8A 2D43A 4AVSA 2VL4A 4RA0A 4QGNA 2V73A 2YFZA 4QQOA 5EYYA 1UY1A 1Y7BA 4IQPA 5FMDA 5FMBA 1I1EA 2CGNA 1RUJ2 3VHPA 4MGTA 4LORA 1G7YA 5CYYA 3WT3A 4ES8A 3TAYA 3USUB 4OHYA 2VECA 5FYZA 4XUQA 3AYAA 1Y9QA 1XC6A 1U0AA 2VE1A 3PUQA 2JE7A 1MR5A 2CDOA 2WS93 4Y3OA 5A7QA 2NM1A 5FZBA 1GSLA 3RZLA 1WMDA 1VB4A 5HCBA 1OA2A 4I2OA 1NE4A 1PO23 3C7OA 1YQ8A 5FK7A 1QOTA 3CIHA 4RGGA 3RYPA 3VBFC 1W6OB 1S0DA 4QXHA 5F1RA 3OGRA 2NZ9A 3FX3A 3IKWA 3MFAA 2HWC1 1QJZA 5I8TA 1B35C 1UU6A 4D3WA 3ZN4A 3KGLA 1RUF2 4V1PA 1ZBA1 4GALA 1VMHA 3AMPA 3RI8A 2N7GA 4Y1XA 2AH2A 3MEPA 1STMA 2O1QA 3QD6A 5JIUA 2AEZA 5C3RA 2WFF3 1RUC2 5JPNB 3THDA 3ZMOA 4AQ2A 4HFSA 3H50A 1TE1B 3CZJA 4QD2A 5GLZA 1BBT1 1W6MB 3IDBB 5FP3A 2ADEA 1A78A 2YGLA 3HT1A 5DUVA 2NQYA 2X5IB 1GNHA 1ULEA 4KU8A 4A45A 3T0DA 1G6NA 2D5HA 4XIKA 1F2NA 2A71A 2JE8A 4XMAA 3DYMA 3CF6E 5D21A 4AYUA 2X29A 1BZWA 3P1IA 3T09A 1D0GA 1WBLA 3E6CC 2K2SA 3TB0A 1LHOA 3N9OA 4W8JA 5EXOA 1HDKA 4E9KA 1BYHA 3WQBA 4LK7A 1PGL1 4P02B 1JU4A 3J4UH 3PU3A 5KHKA 3GDBA 1FV3A 5A6QA 4QPIB 5LBCA 1UY0A 1ULPA 3AJZA 4N9HA 4HK8A 5LASA 5CKNA 4YGCA 2BV4A 3OUHA 2WNVC 2Q5TA 4S2DA 4WM7B 1FI2A 3VDBA 4B1MA 4YW5A 1WCUA 1XSRA 2GU9A 5F5IA 1EYBA 3O1UA 3RZJA 1VR3A 2QQMA 2XGXA 1GWMA 1H8VA 3AYCA 4AFAA 1RINA 4RGAA 1LCLA 5GM0A 3RVHA 1AR91 5C5UA 4ZHNA 4RGKA 3MIEA 4JAAA 3WINE 2RVAA 3RJRA 3NAPC 3RS6A 3O5SA 2I07B 5DMYA 2KD7A 4QKNA 4N43A 2R0HA 4XF3A 1PO11 2XJTA 1HKDA 4B3NA 4Q0UA 2ATFA 1AHSA 2GH8A 4V2WA 3AFKA 4HG6B 1OI6A 4CDXC 4Q4Y3 3KHCA 2E63A 1LHNA 4H2AA 1AX1A 3WNLA 2G4IA 2MEV3 4FPHA 4LBNA 5FXVA 3FC0A 3ZR6A 2I45A 4D6SA 3EO6A 4YZ1A 5FR3A 1Q8PA 2XUEA 4PLNA 2LM3A 4A44A 4LO6B 4DY5A 2RDRA 4Q4W2 3B93A 2UWBA 4D7TA 5L9RA 3VL9A 5J09A 4Z2WA 4A6SA 2CDPA 1DDLA 3KM5A 4IEQA 4Q0VA 3BYWA 1XSQA 1HXS1 3RRDA 4M01A 3WDTA 4MG2A 1V9U2 2G9FA 4PIZA 5FJHA 3N4MA 4WVZA 2YBPA 4JX0A 2W5FA 2VCCA 1LOFC 1VAMA 2ORXA 1RUH3 1CAUA 2RV9A 1QXPA 2BDRA 2ZBJA 2FDKA 1VJ2A 2HBUA 1Q8OA 1RUD3 5CZKA 5A1AA 1FNZA 3U14A 1ODMA 4PIXA 5JDBA 1PM7A 5EJ3A 5A32B 1TME3 1EY2A 2ZEZA 2XH6A 4NO4A 1HRV3 4CDQC 2QZ3A 1KGYA 4MO3M 3ZFEB 2VZ3A 5BXXA 1GOFA 1H1MA 2ZMLA 3UGGA 3KT7A 4UFKA 3T08A 5JPMB 1NY72 1SCSA 1WGPA 4LOSA 4XQ4A 4C1WA 2PHFA 1T6BX 3D6EA 2VUCA 3KS7A 3L9JT 4NHXA 1EV12 2CWSA 2P6HA 2VD7A 4ASMB 4RS5C 2IXKA 1RMU3 3VKFC 1HV1A 1AX2A 1AR63 4FT8A 1TVGA 3EBRA 4HMZA 5J37A 1TNRA 5D1IA 1NCRC 1NCQA 2R063 3V0BA 5IWFA 1O7FA 2ZGRA 3J7MA 1HRI1 2XKPA 1W99A 2PHDA 3LEIA 4LHLA 5ABJC 2VVDA 2QQNA 4WZFA 3FBYA 1WW5A 3GGLA 4MOAA 1U5ZA 1OHFA 1QXRA 4XXAA 1HJFA 1O5LA 1YWKA 4K9SA 4PLOA 5CKMA 3VBOC 3OUJA 4Z92B 1QU0A 2J42A 2YGMA 3VBUB 5DZGA 1R1A1 5T3NA 2QCSB 2UY8A 3AVSA 2FCTA 2GALA 4WM8C 2PXJA 2OZJA 2LALA 1CJPA 3UV9A 1Q8SA 4FFHA 1H0BA 2DUPA 2SBAA 3OD0A 4IL7A 3WP3A 1E5SA 1RTVA 1UMZA 1OSGA 1LRHA 2JDAA 3K77A 3NRUA 3PUAA 4J1WA 4MX3A 2QVSB 1Y4WA 2CSGA 3VBRA 1AYN3 4BLIA 1UQXA 4Y1YA 2EA7A 2Y38A 4QWNA 5FY0A 1RUE3 5A6XA 4ONUA 4YVSA 1G9BA 2IFWA 3AMQA 3MIFA 4ISRA 1PO22 4P00B 4C90A 4B1LA 3ILNA 5F7UA 2RS51 3V0AA 3ZYHA 4CU8A 3A4UA 3NSTA 1C8NA 2VZQA 3B3QE 1DIWA 4XZUG 5D8AB 5BPXA 3N9LA 1H6YA 4NPMA 4NMIA 1MS1A 3PMSA 3S6PA 4QB6A 3I2KA 1UPIA 4XURA 5T5LA 4DEQA 2GZWA 5BV6A 2EXJA 2WT1A 1UPSA 1REEA 3UK9A 4K8RB 3WG2A 2WL1A 3E97A 1UMIA 1W0OA 1XNCA 2IC1A 2ARXA 3ZSEA 2XPJA 2WAAA 5DDJ1 4CEWB 1WLDA 2RDQA 1QIQA 3OBAA 4GULA 4XJZA 4YW3A 5C6CA 3VBHB 1G9AA 3ZPYA 1VBA2 2WO1A 4Q4V1 3WXPA 3T4HB 4EN8B 3OUIA 4R52A 3AKSA 4NR1A 3GXUA 4A2UA 2WQ4A 2IWGB 4A4AA 1UKRA 5JOXA 3NNMA 5FPUA 3SITA 1UOBA 1S4CA 3TN91 1O3TA 1W9WA 3AB0A 3U11A 1YFUA 2WZR3 3D82A 1X33A 3H3UA 2KM2A 2WSVA 1MVEA 5FPBA 2WZ8A 3B9CA 3IAQA 1Z78A 4FO9A 1QJY3 1YEWA 3FZ3A 4AI8A 1AJOA 4NIDA 1OOPB 1KXGA 4J6GA 2FQPA 1DZQA 1HQNA 5AC92 1MS9A 2ZGQA 2E51A 3VBFA 2YG0A 1H2LA 3LOIA 2D98A 3POBA 4OCTA 5GLWA 5FIXA 1COV2 2WN2A 4KH9A 4PBPA 3OBRA 4KGGA 3INAA 3NVCA 4LUKA 1QJX3 2XR4A 4E4HA 3KQ4B 1LOGA 4FPOB 3KVBA 3CDZB 2AYHA 2HWD3 3QACA 4ARYA 4EJRA 4BQ5A 1NQJA 2R6QA 1RB8G 1TQ5A 3AC0A 3ZN6A 4FQZA 3D0JA 2B9VA 4Q4Y2 1SFNA 5DAQA 3ZN5A 5LATA 2TUNA 3IZOA 5JXIA 1MQTA 1W2TA 4PBOA 4CU7A 3ZPOA 1IPSA 2JDKA 1KD7A 1GLHA 1YIFA 3Q9OA 1YYNA 2X5IC 3ZSMA 1KEXA 5JLVA 1RHI2 5FY5A 1RVF1 3GZAA 4M0NA 4XYXA 2FHRA 4OMDA 1S0BA 1KFUL 3PDQA 1N47A 3NNGA 2R071 1DBNA 4NIHA 2BOJA 3CNAA 4QPIC 1RUH2 2WNVA 4A7ZA 2JDYA 3HD8B 3T0AA 1O4YA 2OZ6A 2D6KA 3LIGA 4BQWA 2W47A 2BJSA 2QQUA 1RUD2 2RHPA 1MEC1 2R16A 5L36A 2VCBA 3NKTA 4KG0A 4WM7C 4AR2A 1Y3TA 2VMHA 4YM3A 3ASIA 3DL3A 3GZEA 3JQWA 4A7YA 2R043 1U12A 3NV1A 4P9LA 1VBD3 4Q8KA 5LEJA 3PL0A 1HRV2 1QOOA 2ADDA 4MV2A 4FPGA 3CBNA 2FCVA 4Z82A 2WQ8A 1Z7S3 4KL1A 4N9IA 1F15A 3ZDSA 5LCWL 5H9RA 5FZKA 2WT2A 2QDNA 2QTWB 4YWAA 5EQUA 5EJ1B 3WP4A 2GAUA 1ST8A 2W46A 3WF2A 3HIFA 4W50A 1LGBA 3GYDA 2ERFA 2Y0IA 1FPN1 1RMU2 2JEMA 4DUXA 1Q5OA 1AR81 2ZS6B 3HAGA 3MPPG 4UOJA 5A80A 5FQ0B 4AVVA 1QJFA 1P8JA 3SNMA 3DPRB 3O0XA 2DVGA 1OT5A 4YGBA 1EAH3 4M3CA 4J25A 1ENQA 3VHOA 1DYKA 4AOCA 1IG0A 3UL2A 1UYXA 3N9NA 2V4AA 3ZLIA 1OURA 5C9AB 2XDVA 4CUBA 5KHIA 1O3RA 1LOFA 3I8TA 1S0CA 5IVYA 4LJHA 3VKNA 5L19A 2B8MA 4IEVA 5IJRA 5FYUA 2AGSA 5BUVA 3MW4A 3GF6A 1GR3A 3N7JA 1LU1A 1RUG3 1J84A 4HKOA 5FP7A 1Q3EA 4IV1B 1KDKA 3I3BA 4BWOA 2J22A 4AI3A 2YUEA 3WY6A 4ZXEA 5KHGA 2Y64A 1V0AA 2P2KA 3LQCA 4CDQA 2DUOA 2YYOA 1GQPA 2VMGA 3OTFA 4Q4X3 4JDMA 4FFFA 2RM21 2WSUA 1HN1A 4ATEA 4AVAA 2HWE2 4LMFA 4YNIA 3KSCA 2JICA 3RZGA 4IEOA 4TWTA 3FLRA 4DXRA 1CAXB 1OQDA 4QXCA 3JBG2 2YU1A 1RUE2 4HKLA 4MHUA 2SLIA 3ZFEC 1ASJ3 2HWB3 3ELNA 1AZDA 1O8SA 3THTA 4JGYA 4R9CA 4RS5A 5EPAA 3MICA 1SLTA 2YB7A 1B35B 4CEYB 3S57A 5H9QA 3VZOA 1H30A 4K3UA 2CNAA 2K0GA 3N3HA 1NCRA 1XNAA 4LHSA 2D97A 4NHLA 4BQ4A 4XETA 2W39A 5L9VA 2VVFA 2RS33 4DRRA 2CAVA 4OYUA 5FZ4A 4AW7A 1MZFA 3A23A 4NVPA 2JENA 4CDWA 4YZ4A 1XNKA 2RMU3 3QH6A 4NWVA 5IATA 4Y33A 4IETA 4A6OA 4IERA 3LFIA 1ZBE1 5KHJA 3VBOA 1BVP1 3UT0A 2DCKA 1ZZCA 3SKVA 3JXSA 3C7EA 3HEIA 4U36A 2XB6C 4E27A 1DZRA 2W92A 1MS3A 1F31A 3KB5A 3NO8A 4IE6A 4XFBA 3WW1A 3D8CA 3MBWA 4K6BA 4QAWA 4WM8A 3DECA 1X9TA 5GALA 2EIBA 4MGQA 4XDQA 3VBUC 4GH4A 5FV3A 1JUHA 2DTYA 5FYYA 2WZR2 1UZWA 1NA1B 5IAVA 2AC1A 2BZDA 2G9GA 2VG9A 1JH5A 1S0GA 4AFCA 3TEZA 1GP6A 1QJY2 5F2WA 3HOBA 5HBAA 5E8AA 5EJZB 4RL7A 5JZGB 2JDZA 4WV8A 1XE0A 1UWWA 5E89A 3WDYA 4DNYA 1KDMA 3N9MA 4H3WA 4PF1A 4QHOA 4Y22B 5CADA 5FZEA 2ZGUA 1GYKA 4BM8A 3ZXEA 2HEYF 2ZX2A 4OUMA 4CCKA 4PCRA 4PI0A 1AL21 1LOEA 2BGPA 3A0NA 3NAPB 4P9WA 3B7MA 3BALA 5J3UA 1GZCA 5D8AC 3VZNA 4KWJA 4LO8A 4DIQA 3G6JB 1RUF3 4XILA 5T54A 1UU5A 2HWF1 2PHUA 3NNJA 4AEDA 4OI2A 5BNPC 3DYOA 1U5IA 1HW5A 2PN5A 1RUC3 5B4XA 4IV3A 5TSWA 2A70A 1VBE2 2EALA 3AZYA 3HBZA 4HVRA 5DUUA 2ZKNA 4UXAA 3SH5A 4BYYA 4INDA 4CEWC 4QHZA 1R081 3ZFGB 4URTA 2K46A 3FN9A 4XUPA 4OI1A 3VBHC 5IAXA 1SDDB 3I2FA 2VXJA 2AENA 4Y1ZA 4AGVA 1OD3A 4GD4A 4L11A 2IXIA 4QB1A 4UI9L 4WVMB 5IVBA 5JSOA 3GALA 1XNTA 1CGPA 3UETA 4FSJA 1VBB2 2VH9A 3VZLA 4FAGA 3SH4A 3ZFFB 4JKLA 3J8F2 1ZA7A 2ZX4A 4BIOA 3FHIB 3HQXA 4BLJA 3JZVA 4LNVA 4XFAA 1JZ4A 3M8LA 3OGGA 3USUA 3WDUA 5FZLA 4LR4A 4HONA 3ZKYA 2FDHA 1LOBA 5I93A 4BQYA 1O91A 3PJYA 3AXEA 5FMCA 3I7DA 4DQAA 2GSYA 2WA3A 1V70A 4MGSA 2KA3A 2ZXQA 5FLHA 3IM0A 3IAPA 4K1ZA 1W6OA 4I01A 3SCGA 4OI0A 2ZKLA 2EXKA 2BVVA 1VBD2 2PMWB 1W04A 1WCQA 4UF0A 4IEPA 2OA2A 2VNGA 4EQVA 3MIBA 3WG4A 5CFDB 1PHMA 2ZX1A 1NZIA 5FP4A 4CCOA 2VW1A 3KV6A 5FP9A 1US2A 4MVTA 2DV9A 4COZA 1DGWX 2OVUA 3SMHA 4AHYA 4E4SA 1W2OA 1PNGA 1I3HA 2BWAA 4GZ9A 4GAZA 3ZXJA 2B7YA 4YW7A 1GMMA 3IMNA 1SCRA 2OPKA 5FY1A 4DMIA 4FAHA 2VZTA 1BQPA 2X5IA 1WCSA 4LBKA 3CL1A 1JYWA 3SEPA 1VLNA 1H8TB 4CPBD 1H2NA 4LKFA 4LUMA 3BI3A 4O9GA 4Q4W3 1ZRDA 4GB32 1EAH2 1LHUA 2P4EA 3BN6A 1JYTA 2FMDA 3I2DA 4W6WA 5JIAA 2VTFA 3O1TA 2WYFA 1CONA 1D4M1 2ZGLA 4L97A 1PX3A 4KU7A 5C70A 2QQWA 4IE5A 3VD5A 4BK5A 1T6GC 3NQHA 3WNXA 4QPIA 4E2SA 4TYSA 1CPNA 5LA2A 1NAEA 1RUG2 3UKNA 1APNA 3AVRA 4CP9B 3ES4A 4WM7A 1QJU2 3AMHA 4ZY9A 3WF0A 2E31A 2BBVA 1OFSA 1X50A 4Q4X2 2AACA 3GHNA 3TYJA 5KXEA 5JSPA 1K5MB 2V72A 4LBQB 3WNNA 2TBVA 5LB6A 3PMEA 3VD3A 3VKOA 3K4AA 4YM1A 2XJUA 3C8XA 4BJ0A 1XYPA 3WCSA 1OLRA 2A6VA 1X7NA 4IEWA 5ANNA 2RDNA 3KVAA 5IUQA 4BQ2A 4QX8A 1EV13 2AZ5A 1N3QA 4PDWA 2XHNA 2Z4FA 1KRIA 3AMNA 5FYCA 3OSDA 4YGDA 1W8OA 4IEZA 3SH3A 3UJOA 2IXCA 2WABA 3VZJA 4DXZA 4IUGA 3WUCA 5C33A 1RIRA 1GANA 2Q8CA 3D0SA 3DPRC 1NQDA 2HWC2 3BOWA 3ORJA 4IGPA 1MPXA 2NMNA 3DXUA 5FPXA 3O1SA 2WLQA 5DAVA 4BIFA 5E88A 1LHVA 2VNOA 5FKCA 1YJKA 3ZXDA 1YFYA 4LKEA 5C9AC 4OHWA 5F9TA 3LAGA 3LDRA 2WO2A 1LJ7A 2Q0AA 3HR9A 5F3IA 4FVVA 1W9YA 1YO8A 4AK3A 1GP4A 3PJQA 1OUSA 1BBT2 2R1BA 2VOKA 3GHMA 4UYBA 5FZ3A 1WA4A 3KV4A 4BQ1A 4EN7B 2VNRA 4LK6A 1KITA 1YQCA 2CHHA 4Q4V3 4UW4A 1LEMA 2WUHA 4K7JA 1JZ6A 3K48A 2D7FA 1L7QA 4IV1C 3VDCA 2DCZA 4CDUB 5FPVA 5A32A 3QLQA 3M4FA 1W8NA 3LEMA 3MF6A 1O4ZA 4YG3A 2VQ0A 1TZOA 4XDOA 3W59A 1GNZA 3ZFEA 3M3OA 1GQGA 1UYYA 1O3SA 2OW4A 1PIV3 2VTXA 5HCHA 2PA7A 2R49A 1XNDA 4HKWA 1LU2A 1FT9A 2GDFA 3AM2A 2E6VA 4TLGA 3THCA 4D94A 3S0MA 2G9ZA 4UFMA 4C0HA 2F4LA 3GBGA 2QZ2A 2HH9A 3DN7A 4DINB 1AL0G 3MZHA 4HETA 3WQ7A 4CEYC 1JBCA 1LKNA 3PIJA 3RDIA 4CU9A 1W0NA 4AFDA 1LR5A 1JODA 4L99A 1XBFA 3SISA 3ZXLA 5FWJA 1NXMA 2PAMA 1J59A 1F5JA 5I0SA 4LO4B 3I59B 5HXMA 5FOBB 4XCBA 1PO12 4EV0A 1WWYA 3U37A 1K3IA 5K9YA 1UKGA 4AXOA 1VBA3 2HKXA 5BNOB 5JMOA 5FZDA 5GZEA 1POV3 2CV6A 1ULDA 2PLV1 1RC6A 3VBUA 1IQAA 5CBLA 3VZMA 2YPDA 5AFEA 1EUUA 2W1QA 5FLIA 2VM9A 4GWJA 5JMCA 2HYKA 5C7GA 2YFUA 3SQOA 3T1LA 3WV6A 5IK7A 3TEYA 1MVQA 5CVRA 4UW3A 4EWAA 1NA1C 1ZZ7A 4Z1VA 1UZVA 1OC1A 2E7TA 2H6CA 3H8UA 4R9BA 2PHLA 2WO3A 4Q1PA 3U10A 3UKVA 2C24A 1HXS2 5FZ9A 1PM4A 4I0AA 3MLLA 1OA4A 3MW3A 4JVAA 2ZJCA 5JZGC 4NHMA 3EB7A 2VCMA 4FXKB 3AP7A 4BB3A 5JR2A 1QNWA 5CA6A 1RUJ1 3RGBA 1D4VB 4COUA 5D8AA 1COV3 3RYRA 3VDDA 1W6PB 4CZSA 1DQ2A 2ZGOA 5AC91 2B45X 3MF9A 1MEC3 4FPCA 2JDPA 3O14A 4TSVA 2XXZA 4JKKA 5CG9A 2OT7A 3D3AA 4QQ2A 1G9DA 3OEAA 2WT0A 3Q8EA 3AZWA 4BOWA 3NV2A 4JV4A 4CEWA 3GZUC 4DOUA 1XE8A 4NIAA 2FMYA 2O0OA 2EXHA 4YARA 4HZFA 3K75B 3BPSA 3G7DA 2VUJA 3VBHA 4CCMA 3ZIXA 4PQQA 3ZFGC 2MPFA 1JXNA 2DUQA 3ACFA 3VKMA 1AUYA 5C71A 2VOVA 2P3IA 1RHI3 3WR0A 1W6NB 5DQ0A 4DB5A 4IGQA 4GMP0 3T3YA 3POWA 5JCTA 2QNKA 1DQ1A 5ACA1 2YV8A 3HMYA 3IPVB 3ZFFC 4LLFA 1G9FA 5BY5A 2XJPA 2VVEA 3CHXA 3BTYA 4A41A 2WNUB 1OQ1A 2GP3A 3OYWB 5A33B 4EYUA 2LUWA 1W6QB 3U1XA 1SFYA 5C8CB 3LGRA 4LBJA 3O7OA 1OOPA 2BW8A 1C5IA 1UIJA 4DXSA 5I0RA 1YNAA 4R9AA 1V6LA 1W0PA 2DWRA 5A7WA 3FJSA 3H1MA 1WCDJ 2OIIA 2WRAA 3J7LA 4XEZA 1W90A 2WNOA 5JXGA 3EJKA 4CCEA 2YBSA 2XJQA 4RR3A 4AFMA 1GFF2 1H2KA 4P9XA 2DFCA 5J36A 4LHNA 4YVWB 3BPZA 4YZ3A 4QT6A 3WQ1A 5IVVA 1NX9A 4QX0A 3WNPA 1EP0A 5CFDC 1XRUA 1X9PA 2ZABA 4PLMA 1SG3A 4XPVA 5F3EA 5JOYA 4YM0A 4MUVA 4GMP3 1LULA 1WLTA 2IXJA 2EF6A 4OI4A 2DFBA 1O4TA 3DUIA 3HN3A 4UAPA 4LIUA 4MXWB 2VPVA 1GOHA 2IZWA 3VGIA 1UX6A 4KBZA 1UY4A 4EROA 1H8TC 1OPOA 2D3SA 2ZMKA 5F32A 1B09A 1W06A 2VGDA 1IS5A 2ET1A 2VMIA 3HNMA 3OCPA 4G9SB 3CMGA 4BA6A 4CVUA 5A6ZA 1IHMA 2HBTA 3CJXA 3OF1A 4HN0A 2FDIA 5KWRA 4YZ5A 1QY4A 4TLFA 2VW2A 2Q4SA 5DDJ2 2XVLA 4JGZC 1C8M1 3AKRA 4NHYA 2DVBA 3HWJA 2Q8OA 1L7LA 3AX4A 4FPEA 3AP5A 5CNAA 5FZ7A 3JD73 1JS9A 1POQA 2IFRA 5FZ1A 2CAUA 2W68A 3O0VA 1V6IA 3Q8AA 4Q4V2 4V2VA 2V4VA 1YQ2A 5FYVA 4DS0A 4MGIE 5H9SA 2TNFA 3LD8A 5FCCA 4QX1A 1CX1A 1W05A 1VRH1 2HWE3 2IUWA 2W9XA 3AK0A 3K3NA 3TN92 2XJVA 4AI0A 5IVCA 4RSUA 1K5MC 4JDNA 3JBG3 3UJQA 1PIV2 1W8TA 5F39A 1V00A 5DAPA 3LFMA 1F35A 2D3PA 3LPFA 3WP6A 5FREA 3B9IA 2NYYA 1C5HA 2OYZA 5C8WA 1E57A 5C3PA 1ZRRA 4YW2A 4XF9A 2V5DA 4LBLA 1DLLA 5J96B 2QFEA 2GC2A 1FATA 5FMOL 4GA9A 5FQ0A 1ND2B 1DHKB 2V09A 4QX2A 1X36A 5FP8A 4NIIA 2J1VA 1KS5A 3DPRA 5DAXA 1GUIA 5BNPB 5FDBA 3AL5A 4LA2A 5HXVA 1AL23 4Y24A 3RG0A 1K42A 5FZOA 3IWZA 2JXAA 3CJIB 2C4XA 4Q27A 5C9AA 1LECA 3UYJA 5CISA 2WWUA 1TMF1 1HV0A 3HPNA 2G19A 4XJWA 2A1XA 3BB6A 2D93A 1OF4A 4A3ZA 1W8ZA 2VZPA 2D40A 4XABA 1FMD1 2C0ZA 1C1FA 5C3OA 4XF4A 5DUXA 2B42B 1LESA 1J3RA 4AHXA 4E4ZA 2JDUA 1UL9A 3TWIA 4IV1A 4COWA 4CU6A 3M7AA 2RDSA 4RN5A 3R05A 1AR73 4N43B 2BWCA 4ITCA 1I5PA 4E8DA 4HL0A 4Y20A 5A3LA 5EWSA 2WBKA 1AVBA 4CDUC 3KCCA 1VBC1 2NLRA 4W4ZA 1RVF2 4ZS3A 2C26A 1GNYA 2J1UA 3SCHA 4FPLA 4YGEA 1MS4A 3VN4A 3WF1A 1UIKA 1D0HA 2VW0A 4YRDA 3OBZA 3EMRA 3AMMA 5HPOA 4HSJA 1SPPB 2R072 2NN8A 3V64A 1YQ5A 5FLJA 4JTNA 4XZPA 4CTEA 1XPWA 3WW3A 4FOVA 4J1XA 3OJBA 5EYXA 2F17A 5F5QA 3ES1A 1B35A 4I0BA 1MEC2 3T1MA 1FAYA 1HB4A 2LRPA 2QBXA 3B00A 4XJ9A 3CQOA 1RL3A 2RJKA 2WS91 3T0BA 2ZHNA 2PHXA 1PO21 3PVBB 2CGOA 1NLQA 3OY8B 5A7NA 2BBAA 3VKLA 1CAUB 5CFCB 3T4VA 5F3CA 1VBE3 3LPGA 2OQ7A 2ZMNA 1HB1A 1RUI3 2X53S 5EZWA 3MI8A 2D3RA 4FXGB 3RQ0A 1MS8A 2QKDA 3Q8FA 5IVJA 1A6CA 2VAUA 5I91A 1PMIA 1AX0A 1FPN2 2VQAA 3ZIWA 4GXLA 3RPQA 2Z2SB 2A7AA 2OUJA 4FP3A 1AR82 5IK4A 2WFF1 1D7PM 1Q8QA 3DXTA 1VBB3 2VTXJ 2RJ2A 4EN6B 1NA1A 1CESA 1SLIA 2GC1A 3J8F3 4LEJA 3TBDA 5F37A 1ZRIA 5F3GA 1JOJA 1OH4A 2XKOA 1NG0A 3WF3A 4KWKA 5IVFA 2EIEA 4FBFA 1JHJA 4QXBA 3RZKA 1LTEA 3PTYA 5JZGA 1BK0A 1OVPA 2NMOA 3Q8BA 5GZCA 2VZRA 4P9GA 3RZHA 1QEXA 5EHDA 2LS6A 5DAWA 2NP0A 4GIQA 4CYDA 1OKQA 4QXKA 2DVDA 4XQDA 1YXWA 2PHTA 2WINB 3KT1A 3W58A 2XL9A 2ZZQA 3NAPA 1W2AX 2DYCA 4XJ8A 2GMEA 3RJ2X 1O8PA 1R091 4CSWA 1ACCA 4ATFA 1ZZ9A 3FBMA 1D2QA 2RM22 5FYTA 2GNDA 1XB9A 4N7UA 2GC3A 3AP4A 4RHV1 4CDXA 3W21A 4P9JA 2DCTA 2UURA 1MZEA 4TTGA 5JOWA 3KWVA 1LNSA 4JCKA 1LOCA 4B29A 1UF2C 1OKOA 1X8EA 3OOXA 4QB2A 2XWJB 4JHZA 4XE9A 5K4LA 3WLUA 4B4RA 5A3TA 2J1EA 3ACGA 2XUMA 3E6BA 3IN9A 3LA2A 1WLCA 5GJ6A 3POSA 4P08A 2BFUL 5FZMA 4WVMA 5LY2A 4GB33 3ZMNA 3IBMA 2BPA2 1V6OA 4M0HA 4WVVA 5JI9A 4LA3A 2CGPA 3DYPA 2GH2A 5LEKA 3MHZA 1D2SA 1JI6A 3HN1A 1YCIA 3POYA 4QQPA 3ZFFA 3WW4A 3U0ZA 4N53B 3OPZA 3USSA 1BHGA 2MEV1 3IDAA 4MH0E 1XYOA 5ERLA 3VB9A 1VMFA 3CLPA 4HN1A 2WAOA 4MGYE 3TRSB 3IB3A 2VOXA 3I2JA 3NMBA 2ZHLA 3PVEA 4LPLA 1JZ8A 1J1LA 1UW8A 1IPKA 2WNUC 1MS5A 2A3WA 3JD72 4Z2AA 5C8CC 3LOBA 2WA4A 3EXUA 1J58A 1QJU3 5DABA 3T2QA 1CZTA 1WW4A 3FFQA 3EHKA 1QWRA 4XFIA 4XUNA 1SEFA 4C8DA 3ROUA 5K7PA 4QPYA 3TOJA 2R7EB 5FZGA 1QH6A 2ZAHA 1IS6A 2LROA 4OUSA 3OPTA 4IW3A 1DZTA 5CFDA 4YVWC 4BDVB 3OGSA 2ZGKA 4PHZA 1CD3G 4L0PA 3CO2A 1SBDA 5GZDA 1L3JA 2VBPA 3ACHA 3WCRA 1RYYA 4Q1RA 1TME1 4HBNA 1G8WA 3I3QA 1SACA 4JZRA 4LE4A 4Y5Z0 4HXCA 1F8VA 4NAMA 3ZM8A 1R1ZA 3MIDA 4XXPA 1DQ0A 2A3YA 4CXYA 4UT5A 4HVOA 1H8TA 1I5ZA 4CCCA 3KMHA 3T2OA 3AXDA 5JOZA 2J7MA 1AL22 1QQP1 4R8HA 3U07A 1H2MA 1W2UA 2HWC3 3ZSLA 4X8NA 4ASLA 5ABJA 2NPIA 3A22A 4L92A 2P37A 1ZBA3 2EAAA 2UY9A 3H3LA 4JC1A 4LQRA 2CL2A 2I74A 4AI9A 4Q29A 2VBBA 1BJQA 3I4IA 5L7OB 4QX7A 2PTMA 3A0KA 1JYIA 5J48A 5FZFA 5FZ8A 3H7YA 1WMXA 1KQRA 2ZAAA 1AR61 1AXKA 3AKTA 1C28A 3P3NA 1BBT3 2ZEXA 1OA3A 5DXDA 3MLJA 4D6QA 3E5QA 4Y4RA 2Y6FA 1R082 2R061 2XOMA 4OHXA 1BEV1 3H8OA 1GOGA 2JE9A 1W03A 3ACLA 3MV01 3DF0A 1BXHA 1BCXA 4QX5A 2VMCA 3GM8A 3P6BA 2PLV3 3P3PA 1AR72 4Q8LA 2BRTA 2DVFA 2W08A 4N7IA 4B4PA 5KXCA 2RG4A 1FX5A 2XL7A 1BLZA 2AREA 4DPNA 3QCWA 4Q2FA 2JWPA 1BMV1 3N7MA 1GZWB 4LBQA 4PF5A 1CQ9A 4HSLA 3TEXA 4FOQA 4G3YC 4XTMA 4D69A 1ZM1A 4ASKA 1MQTB 1ZRFA 3VZKA 1O6UA 4IEUA 5GKAC 3LE0A 1CAWB 2ZCWA 1JZ2A 1HN0A 2ET7A 2ZGMA 2Y6HA 3HQUA 5FXXA 3PUIA 1AYN1 2Y6KA 3JU9A 1C1LA 3KF5A 2O8OA 2ETEA 2EXIA 1RUE1 1XU2A 1ND2C 2ENRA 3N7KA 4LBOA 4TXWA 1AR93 2AEYA 3WDWA 2W2IA 3ZR5A 4QQHA 2H0BA 1UU4A 1JMUB 2P5BA 3GJAA 3CJIC 4IGOA 4AG4A 3BKZA 1I6XA 1ND3B 5F5CA 1RUI2 1PO13 4XBLA 5LA9A 5LBFA 2X05A 3WOGA 4HVQA 3O1OA 1REFA 1C3HA 3WDVA 3FL7A 3POGA 4EWEA 4NUBA 5C4WB 4OULA 5A3WA 4NRQA 4AQ6A 1CPMA 5FYSA 5GZGA 1PGW1 1N1TA 1V6JA 3LEGA 3H9AA 2IVIB 2FDJA 4P9IA 3LB9A 2RR11 2RE9A 3BIWE 4Y5SA 3PVNA 4CDUA 4KMQA 2WWJA 2ARCA 1URXA 2GC0A
chains in the Genus database with same CATH topology
4N43C 5HI0A 1CR7A 3R4SA 1IOAA 5ACA3 1HXS3 3J9SA 2JG8B 3E5XA 1CIWA 3ECQA 4QPGB 4XF1A 3VBSB 3VV1A 2PELA 4XTPA 4DZGA 1WMEA 4JDOA 5LK5A 3MYXA 4M3CE 2WZR1 2XLFA 3PHMA 5KC5A 5FRAA 2YROA 4SBVA 3KD4A 4KNCA 1NE6A 3L2HA 1QJY1 2A6XA 2ZGPA 3B02A 1NZCA 1DGWA 1AF9A 4LTAA 4M00A 4XFHA 4Y1UA 4COYA 2XJSA 1YRZA 2UWCA 2XWBB 3SHRA 1YI9A 1W6MA 3I59A 3FWEA 5CFCC 2YMZA 3WDXA 5BNOA 1QJX1 2VUAA 2HWD1 3NL1A 4UBGA 2RJLA 1YFXA 3RMXA 1IS4A 3ZYPA 1VIWB 4DRVA 2XBO1 1PZ7A 4ORFA 1TNFA 4Y4YA 4JGYB 1HRI3 4JGZB 2YPJA 3NKGA 3R0RA 4ZU5A 5I8SA 2ZGTA 4A3XA 5K8SA 2D6NA 4FPYA 2QJVA 2WLPA 2GMMA 2H0VA 2ZTNA 3PVOA 1OQEA 2QDRA 4MGKE 3ZXAC 2BQPA 2ZHKA 5CU1A 1GICA 1XYNA 5HCAA 1R1A3 1PK6B 2ES3A 4L2NA 2D6OX 2CY6A 4RQPB 2AR6A 1PVC1 4BE3A 4NWWA 1PGSA 5BNNB 3ZSJA 4R4XA 1ZRCA 1JTZX 1FOD1 3LCPA 1RITA 4AVBA 4OVEA 4XJUA 1MACA 4FOWA 4LULA 2R041 2WIIB 2D6PA 2HEWF 4GH4B 1SMVA 1J3PA 2JKBA 2RS53 1V6MA 1UZZA 1F5FA 1PVXA 1Z7S1 1LOAA 4E4DX 4MSVA 2IXHA 1BKZA 1WD3A 4KQ7A 1H9WA 2P3KA 5GLTA 4FTSA 1TEIA 2MNGA 1ZBA2 1A8MA 1GZ9A 4QQLA 4GKXA 4CRQA 4N53C 2ZHMA 1TMF3 5DDJ3 5A33A 3OYWA 4C1XA 1A3KA 1W6QA 3AYEA 4HPKB 4UBHA 3WD5A 3WX5A 5C8CA 1O3QA 2ZA9A 1S0IA 2H6BA 1NOVA 2QE3A 2F4PA 2XHKA 1KFXL 3WQ0A 2PLV2 4YW1A 4AGGA 3KLSA 5CIRA 1SLAA 3U4XA 4IV3B 4D7SA 4Q0SA 3E5UA 3TN93 1NYWA 4YVWA 1POV0 3ZX7A 4AGRA 1PGL2 4L9BA 1F9KA 1XXNA 1ULCA 5FOJB 1CAVB 4MXVA 3M3QA 2DF7A 5DG1A 4R4ZA 5FO8B 4Q4X1 3WZ1A 1ENSA 5IT6A 3EQEA 1AYM1 4MXWA 3ZYJB 4B4QA 2YHJA 1ASJ1 4G4FA 4AEMA 5AC92 3FFZA 1AR92 4XBQA 5JSRA 3ZXGA 2HWB1 4M3CF 5A3MA 2Y0OA 2Q1MA 2R30A 1VAKA 1ZX5A 3I54A 4MGZE 4AVCA 1YFWA 1X8MA 2W52A 1VAVA 5FPZA 2BYVE 3DV8A 2WKKA 4NN0A 4R9DA 1A8DA 1Q8VA 2RS11 5L7OC 2MHFA 1ULGA 2RS31 1WLWA 3N7LA 3H3ZA 1SBFA 3M2MA 2D6MA 2RMU1 1ONAA 1IZ3A 3B69A 2A6WA 2D5FA 4BHPA 2FBEA 5GZFA 4KGQA 5SV5A 1H4GA 4W65A 1ZNPA 1RVF3 2CWMA 5ACA2 2BNNA 3DKWA 2JG9B 1SBEA 3NV3A 4HLTA 4F8AA 4OFGA 2R073 2YY1A 3PNAA 5DUWA 1MQTC 4NOTA 3WHUA 2ARBA 4WZCA 1ZVFA 4KWLA 3ZVXA 1WW6A 4MYEA 3ME2A 4F83A 2ZGNA 1YIPA 2PHWA 1OFNA 3FLTA 4P5HA 1ND2A 1QMJA 4AEKA 4I30A 1SLLA 2BGCA 5BNPA 4CP1A 2Q30A 2R32A 2ZX0A 3CJIA 3B94A 3JB8A 4TZDA 1R093 2PFWA 3TNQA 1Z0HA 1MZ6A 4F7ZA 2UWAA 2EAKA 4H7MA 4FQ4A 4RHV3 1V6NA 1ND3C 2GMPA 1RUF1 1J1TA 4L8QA 1BVVA 2VU9A 1FPN3 1QHDA 5C4WC 2Q1ZB 1AR83 1JYCA 2XVKA 3FLPA 1C4RA 3IT8A 1RUC1 3TNPB 2WZPP 3RZZA 1IS3A 2BTVC 1X82A 4Q0QA 2YXSA 5DZFA 1YLLA 1NLRA 1HRI2 1RGSA 2D6LX 2W0XA 3QBQA 4KBBA 3AKPA 3D5OA 4PDWB 4U2AA 1WUVA 1QNYA 1SQ4A 3OGJA 3X29B 2BVBA 2CYFA 3M3CA 2JG8C 3D4KA 1C8M2 4QPGC 3VBSC 5LRSA 5K0UB 1HQWA 4NHKA 1R1A2 1OMIA 2DVAA 4X8PA 4AI1A 1AXZA 4K21A 1VB2A 4AQTA 3MPBA 4B8EA 5T50A 4FTEA 4BPZA 1OLQA 2RM23 4YM2A 3SLIA 1VRH2 1YI7A 4YZ2A 5T5PA 3AP9A 3OY8A 1XU1A 5CB7A 3AJYA 4UW6A 5CFCA 3W9AA 2UYBA 2RS52 3R6SA 3T2TA 3MFCA 3KCYA 4YLZA 3LZZA 4COVA 2R1DA 1FNYA 4IEYA 3H1YA 1REDA 5BNOC 5FTTC 4IESA 4Y26A 4Q26A 1JUIA 3BU7A 1QQP3 1DQ6A 3QH7A 2GNBA 3M70A 4QHBA 1IKQA 3BTAA 4WVWA 2VOWA 1TMF2 5FO7B 1Q56A 4JGYC 1VP6A 1ZBE3 2O8QA 4Q4W1 4XBNA 1JW6A 2P3JA 5BNQA 3C3VA 4I0WB 2EIGA 2DURA 1FMD2 1CJDA 1V9U1 1RUOA 1BEV3 4YW4A 4YG6A 1N3OA 1PK6C 4W6XA 1MS0A 5DG2A 4CDWC 1VALA 4PIYA 4RQPC 3HT2A 4CP0A 1SLBA 4LBMA 1WBFA 4LO5B 1VBC2 2V5YA 2JECA 4K1YA 3QOPA 5DZEA 5BNNC 3BOPA 3OBTA 3FE5A 3MLKA 3AZZA 1ZZ6A 4YSFA 1IPJA 4GWNA 4H7LA 3AYDA 4QM9A 4YFZA 1YUDA 2WNEA 2Z5WA 3WG3A 1FXZA 3ILRA 4GH4C 2A5ZA 4B7EA 4BMBA 1QDOA 1EPZA 2ZACA 1NY71 3S7EA 2OUHA 1WMFA 3ZYGA 2WS92 2HWF3 1EV11 4N53A 4XFGA 5I0TA 4I09A 5I0UA 2HEVF 4Y1VA 1S1AA 2A73B 5AVPA 2ZPXA 4S2HA 1I9RA 4FPFA 5H9PA 4FCAA 3VDDB 1LB2A 1R083 1GV9A 1DGRA 3AZVA 4DY3A 1XE7A 1M06G 4AEDC 3ALQA 1S55A 4LLOA 2WFF2 4LE3A 5FAXA 2RR13 4RFT0 1ENXA 1WW7A 1CAXA 4IV3C 4JRLA 1GQHA 3ZXKA 2JJ6A 2A3XA 1PZ8A 4IXLA 1SDWA 2DCYA 1N1VA 4NPRA 1DF0A 5IK5A 4CEYA 1ALYA 2DCJA 1LHWA 2DU1A 2WFPA 3GNEA 2I2SA 3V65A 1LENA 1PIV1 3WP5A 2B46X 4BZ4A 4AFBA 3FMGA 2B5HA 4GQ7A 3AP6A 3JCIA 1R092 3N35A 3VHRA 2Z69A 5L7OA 4RHV2 4FTBA 4Z07A 2C1FA 3J26N 2BNOA 4B7KA 2X8KA 4RR3B 5T5JA 5AFBA 2EVXA 4FPJA 3ETQA 5FBZA 1DFQA 3URFA 4XW3A 5KC6A 2BEOA 3GBFA 1OPMA 2UYAA 1VBA1 4HANA 4IEXA 1D4M3 1DQ4A 1GZWA 4OLLA 1H1IA 3APBA 3RMYA 4EWDA 1POV1 1ZREA 4XHXA 2XBO3 4AVTA 2QQPA 2MEV2 2VY0A 2JG9C 3B01A 1RJ8A 4CP2A 4Y22A 4ZKTB 5KXBA 3ST7A 1CAWA 2WC2A 5J7MA 1NCQB 3V0BB 1G86A 1RUNA 4JTOA 3VLBB 3ZO0B 1DYPA 1YJLA 3PLQA 3GZTB 3AZXA 1HX6A 1GBGA 1PVC3 1N1SA 3AKQA 3B5LB 3V56A 4K8FA 2D44A 1ND3A 1COV1 1LGCA 2LTNA 3FUQA 1FOD3 3MGUA 2C5DA 3ZFGA 4OHVA 2GN3A 4FP2A 2BUKA 3WUDA 5C4WA 1TME2 1FYUA 2ZZJA 4MZUA 3MDPA 2GNTA 2XJRA 3VBRB 1DQ5A 3BCWA 3M3EA 5FO9B 4QGMA 1J3QA 3NW4A 2VULA 2DTWA 3FUOA 3KQRA 4Q4Y1 4YVSB 4EN9B 5E1RA 4ES9A 1QQP2 1GKBA 1UAIA 3ZXFA 3V0AB 1QGLA 2XVGA 1FV2A 1RHI1 1ZBE2 2E7QA 3IDEA 2JG8A 4MLOA 4PDWC 4QPGA 3VBSA 1XNBA 1AR62 1CX4A 3NJZA 4XQWA 3RNSA 1NXD1 4ZXKA 2R062 3M1HA 5K0UC 1BEV2 2XG3A 2FZ2A 4AI2A 2GNMA 4PJYA 5T55A 4HK9A 3RI9A 3ZYIB 1RUH1 5FMOS 3OD4A 3L2YA 5JR7B 2JD4A 4FPKA 1HQLA 1BMV2 1RUD1 2CTVA 3M3IA 1KJLA 1HRV1 1BK1A 2C9AA 5AVAA 5J98B 3IIAA 4Z8BA 5GLUA 2A75A 3KGZA 4UW5A 2VXRA 3K51A 1AYN2 3H1WA 1AYM3 4E2GA 4K20A 3R4DB 1KS4A 4GMP1 2HWF2 3ENRA 5IK8A 1M4WA 1RMU1 4META 4YFWA 3VBFB 4XOGA 4JGZA 4DFSA 2ZGSA 2B39A 1S0FA 1S0EA 3E6DA 1DG6A 1MZ5A 4SLIA 2K9ZA 3N36A 2RS13 5T5OA 2PAKA 5LRRA 4X6RB 1CVNA 3LKJA 1PGW2 1PK6A 1H1AA 3JB4C 4RQPA 2PAEA 4OHZA 1K5MA 2RR12 2PQQA 3ZN6B 1LODA 2PYTA 4JQRA 2F6BA 4I3GA 5BYNA 5BNNA 3JD71 5JAXA 4AQSA 3ZSKA 1UN1A 4AWDA 2QUOA 4YYOA 4X6QB 3LSDA 2HWE1 3ATGA 4XHBA 1AJKA 4N90A 3JBG1 1RUJ3 1HLCA 3LA7A 2UU8A 5AC93 4E2QA 5T52A 1O5UA 1G9CA 4LO7A 5F6KA 2WNVB 1U5XA 4XFFA 2WWSA 1AXYA 2R0FA 1N3PA 3KT4A 1EPWA 1CN1A 1PNFA 5F6LB 3S7IA 1H9PA 3THPA 4HPKA 2YC0A 3JUUA 1S2BA 4HT1T 3RSJA 5CAZA 3H0OA 3VDDC 2AUYA 4GWMA 1Y43B 4K40A 1QJX2 3MW2A 3RWNA 4AF9A 1YHFA 2HWD2 2E9QA 2JX9A 3UKTA 4O9EA 4CDXB 2WQZC 1ZA4A 1D4M2 1C57A 2XBO2 2TEPA 3WG1A 1CAVA 3VL8A 3WVJA 3C2UA 5JWPA 4XF0A 4LHKA 1SLCA 2FZ1A 1QDCA 1AR71 1ZZ8A 4M3CB 4LT5A 2P34A 4C91A 5JI7A 4ZU7A 2WJSA 3RYKA 2B9UA 5LK7B 4AHWA 1ULFA 1W39A 3GBWA 4AEJA 2P17A 2BFUS 1PVC2 1IGOA 1ENRA 2HJIA 5HCFA 1KJRA 4XJAA 2YDEA 1QOSA 4OZXA 4S2GA 1OOPC 1Q43A 4LBQD 5L73A 1FOD2 1WD4A 3ZYRA 4QGLA 3WHTA 1S2KA 3CEWA 4P14A 4W6YA 1OD5A 4CDQB 1ZZBA 1H4HA 2ILMA 2R042 3LA3A 4QMAA 4RR3C 1N1YA 3VHNA 4AHZA 1Z7S2 4BCUA 1UD1A 3LSEA 1VBE1 4S2FA 1RUI1 3NV4A 3DGTA 1NLSA 1QXJA 4RS5B 5B2GB 2ZX3A 4F3JA 1U5YA 2JG9A 4PQ9A 4KG8A 5CG8A 1V6KA 1QH7A 5FFOC 5I8YA 1HIXA 4RD7A 1VBB1 1NCRB 1XQNA 1C8M3 2Z42A 3J8F1 1UZYA 5KHHA 4A7KA 2XLAA 4BMEA 3WW2A 3KCXA 5ABJB 5GLVA 4CDWB 4FOYA 5EFUA 1NCQC 1W6PA 2PHRA 4XMIA 1DGLA 1V9U3 1QF3A 3VBOB 1VRH3 3KZ4C 3AFGA 4WBBA 4D7YA 3BODA 1IKPA 4GKYA 4XFCA 1LGNA 4ZU4A 4WM8B 2E53A 4XIOA 3NWKA 1VBD1 3MIGA 5SV8A 3SCFA 4ISQA 1S0JA 4JRAA 4AE2A 4I02A 4H55A 5EV7A 1W6NA 1AYM2 1DGRN 3R4UA 3S30A 1ZYBA 2Y26A 1UCXA 3VBRC 5KBFA 1ASJ2 1JN2P 3IPVA 2HWB2 4P9YA 2DU0A 4YVSC 1DU3D 2A6ZA 2IXLA 4C0BA 2WNUA 2A6YA 3IDCB 3ILFA 2BNMA 2Z79A 4GB31 1EAH1 3O0WA 5KXDA 4YG0A 4Q0PA 2RS12 3CU7A 2GN7A 1WCKA 4I3PA 4H14A 4BH9A 5K0UA 2RS32 4AEDB 1FMD3 3LWCA 4EN0A 1QKQA 2YZ4A 3VUOA 2RMU2 4QM8A 2E7AA 1RJ7A 3MIHA 3JQXA 4QU2A 5JVVA 1RUG1 3H7JA 1VBC3 3SXWA 2ZOEB 1JHNA 1LEDA 1QJU1 2KXLA 5E16A 3O12A 1PZ9A 2XLGA 2D43A 4AVSA 4RA0A 5EYYA 4QGNA 2V73A 4QQOA 1Y7BA 4IQPA 1I1EA 2CGNA 1RUJ2 3VHPA 1G7YA 3WT3A 4ES8A 3TAYA 3USUB 4OHYA 2VECA 3AYAA 1Y9QA 1U0AA 2JE7A 1MR5A 2WS93 2NM1A 1GSLA 1WMDA 1VB4A 5HCBA 1OA2A 4I2OA 1NE4A 1PO23 1QOTA 4RGGA 3RYPA 3VBFC 1W6OB 1S0DA 5F1RA 2NZ9A 3FX3A 3IKWA 3MFAA 2HWC1 1QJZA 5I8TA 1B35C 1UU6A 4D3WA 3ZN4A 3KGLA 1RUF2 4V1PA 1ZBA1 4GALA 3AMPA 3RI8A 2N7GA 4Y1XA 2AH2A 3MEPA 3QD6A 2O1QA 5JIUA 5JPNB 2WFF3 1RUC2 3ZMOA 4AQ2A 4HFSA 3H50A 1TE1B 4QD2A 5GLZA 1BBT1 1W6MB 3IDBB 1A78A 2YGLA 3HT1A 5DUVA 2NQYA 2X5IB 1GNHA 1ULEA 4KU8A 1G6NA 2D5HA 4XIKA 1F2NA 2A71A 4XMAA 4AYUA 3CF6E 3E6CC 2X29A 1BZWA 1D0GA 1WBLA 2K2SA 3TB0A 1LHOA 5EXOA 1HDKA 4E9KA 1BYHA 1PGL1 3J4UH 5KHKA 1FV3A 4QPIB 3AJZA 4N9HA 4HK8A 4YGCA 2WNVC 2Q5TA 4S2DA 4WM7B 1FI2A 4YW5A 2GU9A 4FSJA 1EYBA 1VR3A 2XGXA 3AYCA 1H8VA 4AFAA 1RINA 4RGAA 1LCLA 5GM0A 1AR91 3MIEA 4JAAA 3WINE 3RJRA 3NAPC 3RS6A 3O5SA 2I07B 4N43A 2R0HA 4XF3A 1PO11 2XJTA 1HKDA 4B3NA 4Q0UA 2ATFA 1AHSA 2GH8A 4CDXC 3AFKA 1OI6A 4Q4Y3 2E63A 1LHNA 1AX1A 2G4IA 2MEV3 4FPHA 4LBNA 3FC0A 2I45A 3EO6A 4YZ1A 1Q8PA 4PLNA 2LM3A 4LO6B 4DY5A 4Q4W2 3B93A 2UWBA 4D7TA 3VL9A 5J09A 4Z2WA 1DDLA 3KM5A 4IEQA 4Q0VA 1HXS1 3RRDA 4M01A 3WDTA 1V9U2 2G9FA 4PIZA 3N4MA 4WVZA 1LOFC 1VAMA 1RUH3 1CAUA 1QXPA 2ZBJA 1VJ2A 1Q8OA 1RUD3 1FNZA 5JDBA 4PIXA 1PM7A 5EJ3A 5A32B 1TME3 1EY2A 2XH6A 4NO4A 1HRV3 4CDQC 2QZ3A 3ZFEB 5BXXA 1H1MA 2ZMLA 3KT7A 5JPMB 1NY72 1SCSA 1WGPA 4XQ4A 4C1WA 2PHFA 3D6EA 3L9JT 3KS7A 1EV12 2CWSA 4ASMB 4RS5C 2IXKA 1RMU3 3VKFC 1HV1A 1AX2A 1AR63 4FT8A 4HMZA 3EBRA 5J37A 1TNRA 5D1IA 1NCRC 1NCQA 2R063 3V0BA 1O7FA 2ZGRA 1HRI1 2XKPA 2PHDA 4LHLA 5ABJC 2VVDA 4WZFA 3FBYA 1WW5A 1U5ZA 1OHFA 1QXRA 4XXAA 1YWKA 1O5LA 4K9SA 4PLOA 3VBOC 4Z92B 1QU0A 2YGMA 3VBUB 5DZGA 1R1A1 5T3NA 2QCSB 2UY8A 2GALA 4WM8C 2OZJA 2LALA 1CJPA 3UV9A 1Q8SA 1H0BA 2DUPA 2SBAA 3OD0A 4IL7A 3WP3A 1RTVA 1UMZA 1OSGA 1LRHA 4J1WA 3VBRA 4MX3A 2QVSB 4BLIA 1AYN3 4Y1YA 2EA7A 2Y38A 1RUE3 4ONUA 4YVSA 1G9BA 2IFWA 3AMQA 3MIFA 4ISRA 1PO22 4C90A 3ILNA 2RS51 3V0AA 3A4UA 3NSTA 1C8NA 3B3QE 1DIWA 5D8AB 5BPXA 1MS1A 3PMSA 3S6PA 1UPIA 5T5LA 5BV6A 2GZWA 2EXJA 2WT1A 1UPSA 1REEA 3UK9A 3WG2A 2WL1A 3E97A 1W0OA 1XNCA 2IC1A 2ARXA 3ZSEA 2XPJA 5DDJ1 4CEWB 1WLDA 4GULA 4YW3A 4XJZA 5C6CA 3VBHB 1G9AA 3ZPYA 1VBA2 4Q4V1 3WXPA 4EN8B 4R52A 3AKSA 4NR1A 4A2UA 2WQ4A 2IWGB 1UKRA 5JOXA 3SITA 3TN91 1O3TA 3AB0A 3U11A 1YFUA 2WZR3 3D82A 1X33A 3H3UA 2KM2A 2WSVA 1MVEA 3B9CA 1Z78A 4FO9A 1QJY3 3FZ3A 4AI8A 1AJOA 1OOPB 1KXGA 4J6GA 2FQPA 1DZQA 1HQNA 1MS9A 2ZGQA 2E51A 3VBFA 1H2LA 3LOIA 2D98A 5GLWA 1COV2 4KH9A 4PBPA 3OBRA 4KGGA 3INAA 3NVCA 4LUKA 1QJX3 4FPOB 1LOGA 2AYHA 2HWD3 3QACA 4EJRA 1NQJA 2R6QA 1RB8G 1TQ5A 3ZN6A 4FQZA 3D0JA 4Q4Y2 1SFNA 3ZN5A 2TUNA 1MQTA 4PBOA 1KD7A 1GLHA 1YIFA 3Q9OA 1YYNA 2X5IC 3ZSMA 5JLVA 1RHI2 1RVF1 3GZAA 4M0NA 4XYXA 2FHRA 1S0BA 1KFUL 1N47A 2R071 1DBNA 3CNAA 4QPIC 1RUH2 2WNVA 4A7ZA 3HD8B 1O4YA 2OZ6A 2D6KA 2RHPA 1RUD2 1MEC1 2R16A 5L36A 3NKTA 4KG0A 4WM7C 1Y3TA 2VMHA 4YM3A 3ASIA 3DL3A 3JQWA 4A7YA 2R043 1U12A 3NV1A 4P9LA 1VBD3 4Q8KA 5LEJA 1HRV2 1QOOA 4MV2A 4FPGA 4Z82A 1Z7S3 4KL1A 4N9IA 3ZDSA 5H9RA 2WT2A 2QDNA 3WP4A 2GAUA 3HIFA 1LGBA 3GYDA 2ERFA 2Y0IA 1FPN1 1RMU2 2JEMA 1Q5OA 1AR81 2ZS6B 3HAGA 3MPPG 5FQ0B 4AVVA 3SNMA 3DPRB 3O0XA 2DVGA 4YGBA 1EAH3 4M3CA 1ENQA 3VHOA 1DYKA 3UL2A 5C9AB 5KHIA 1LOFA 3I8TA 1S0CA 3VKNA 5L19A 2B8MA 4IEVA 2AGSA 5BUVA 3MW4A 3GF6A 1GR3A 3N7JA 1LU1A 1RUG3 4HKOA 1Q3EA 4IV1B 1KDKA 4BWOA 4AI3A 2YUEA 3WY6A 5KHGA 2P2KA 4CDQA 2DUOA 2YYOA 3OTFA 2VMGA 4Q4X3 4Y20B 4JDMA 4ATEA 2RM21 2WSUA 4AVAA 2HWE2 4YNIA 3KSCA 2JICA 4IEOA 4TWTA 3FLRA 1CAXB 1OQDA 3JBG2 1RUE2 4HKLA 3ZFEC 2SLIA 1ASJ3 2HWB3 3ELNA 1AZDA 3THTA 4JGYA 4R9CA 4RS5A 3MICA 1SLTA 4CEYB 1B35B 5H9QA 3VZOA 1H30A 4K3UA 2CNAA 2K0GA 3N3HA 1NCRA 4NHLA 2D97A 4XETA 2W39A 2VVFA 2RS33 4DRRA 2CAVA 4AW7A 1MZFA 4NVPA 2JENA 4CDWA 4YZ4A 1XNKA 2RMU3 3QH6A 4NWVA 4IETA 4IERA 1ZBE1 5KHJA 3VBOA 1BVP1 2DCKA 1ZZCA 4U36A 2XB6C 1DZRA 1MS3A 1F31A 3KB5A 3NO8A 4XFBA 3WW1A 3D8CA 4K6BA 4WM8A 5GALA 4XDQA 3VBUC 4GH4A 1JUHA 2DTYA 2WZR2 1NA1B 2G9GA 2VG9A 1JH5A 1S0GA 4AFCA 1QJY2 5HBAA 5E8AA 4RL7A 5JZGB 2JDZA 4WV8A 5E89A 3WDYA 4DNYA 1KDMA 4H3WA 5CADA 4Y22B 2ZGUA 1GYKA 4BM8A 3ZXEA 2HEYF 2ZX2A 4OUMA 4PCRA 1AL21 1LOEA 3A0NA 3NAPB 4P9WA 3B7MA 3BALA 5J3UA 1GZCA 5D8AC 3VZNA 4KWJA 4LO8A 3G6JB 1RUF3 4XILA 5T54A 1UU5A 2HWF1 2PHUA 4AEDA 4OI2A 5BNPC 1U5IA 1HW5A 2PN5A 1RUC3 5TSWA 4IV3A 2A70A 1VBE2 2EALA 3AZYA 3HBZA 4HVRA 5DUUA 2ZKNA 4UXAA 3SH5A 4BYYA 4INDA 4CEWC 1R081 3ZFGB 4URTA 4OI1A 3VBHC 2AENA 4Y1ZA 4AGVA 4L11A 2IXIA 5JSOA 4WVMB 3GALA 1CGPA 1VBB2 2VH9A 3VZLA 4FAGA 3SH4A 3ZFFB 3J8F2 2ZX4A 4BIOA 3FHIB 3HQXA 4BLJA 3JZVA 4LNVA 4XFAA 3M8LA 3OGGA 3USUA 3WDUA 4LR4A 1LOBA 5I93A 1O91A 3PJYA 3AXEA 3I7DA 4DQAA 2GSYA 2WA3A 1V70A 2KA3A 5FLHA 3IM0A 4K1ZA 1W6OA 4I01A 3SCGA 4OI0A 2ZKLA 2BVVA 2EXKA 1VBD2 4IEPA 2OA2A 2VNGA 3MIBA 3WG4A 5CFDB 1PHMA 2ZX1A 2VW1A 4COZA 4MVTA 2DV9A 1DGWX 2OVUA 3SMHA 4AHYA 4E4SA 1PNGA 1I3HA 2BWAA 3ZXJA 2B7YA 4FAHA 3IMNA 1SCRA 2OPKA 4DMIA 1BQPA 2X5IA 1WCSA 4LBKA 3CL1A 1VLNA 1H8TB 1H2NA 4LUMA 4O9GA 4Q4W3 1ZRDA 4GB32 1EAH2 1LHUA 2FMDA 3I2DA 4W6WA 5JIAA 1CONA 1D4M1 2ZGLA 4L97A 4KU7A 1T6GC 3WNXA 4QPIA 4E2SA 4TYSA 1CPNA 1RUG2 3UKNA 1APNA 3ES4A 4WM7A 1QJU2 3AMHA 2BBVA 1OFSA 1X50A 4Q4X2 3GHNA 3TYJA 5KXEA 5JSPA 1K5MB 4LBQB 2TBVA 3PMEA 3VKOA 4YM1A 2XJUA 1XYPA 3WCSA 1OLRA 2A6VA 1X7NA 4IEWA 5IUQA 1EV13 2AZ5A 1N3QA 4PDWA 1KRIA 3AMNA 4YGDA 4IEZA 3SH3A 3UJOA 3VZJA 2IXCA 4DXZA 3WUCA 5C33A 1RIRA 1GANA 3D0SA 3DPRC 1NQDA 2HWC2 3BOWA 2NMNA 5FPXA 2WLQA 4BIFA 5E88A 1LHVA 2VNOA 3ZXDA 1YJKA 1YFYA 5C9AC 4OHWA 5F9TA 3LAGA 1LJ7A 2Q0AA 3HR9A 4FVVA 1YO8A 4AK3A 3PJQA 1BBT2 2R1BA 2VOKA 3GHMA 4BQ1A 1WA4A 4EN7B 2VNRA 1KITA 4Q4V3 4UW4A 1LEMA 4K7JA 3K48A 2D7FA 4IV1C 4CDUB 2DCZA 5A32A 3QLQA 3M4FA 3MF6A 4YG3A 1O4ZA 2VQ0A 3W59A 1GNZA 3ZFEA 3M3OA 1GQGA 1O3SA 2OW4A 1PIV3 2PA7A 2R49A 1XNDA 4HKWA 1LU2A 1FT9A 2GDFA 3AM2A 2E6VA 4D94A 3S0MA 4C0HA 3GBGA 2QZ2A 3DN7A 4DINB 1AL0G 3MZHA 4HETA 3WQ7A 4CEYC 1JBCA 1LKNA 3RDIA 4AFDA 1LR5A 4L99A 3SISA 3ZXLA 1J59A 1NXMA 2PAMA 1F5JA 5I0SA 4LO4B 3I59B 5FOBB 1PO12 4EV0A 5K9YA 1UKGA 4AXOA 1VBA3 2HKXA 5BNOB 5GZEA 1POV3 2CV6A 1ULDA 2PLV1 1RC6A 3VBUA 1IQAA 5CBLA 3VZMA 5AFEA 5FLIA 5JMCA 2HYKA 3T1LA 3WV6A 5IK7A 1MVQA 5CVRA 4UW3A 4EWAA 1NA1C 1ZZ7A 4Z1VA 4R9BA 2E7TA 2H6CA 3H8UA 2PHLA 3U10A 4Q1PA 3UKVA 1HXS2 4I0AA 3MLLA 1OA4A 3MW3A 4JVAA 2ZJCA 5JZGC 4NHMA 4FXKB 3AP7A 1QNWA 5CA6A 1RUJ1 4COUA 1D4VB