3N4MA

E. coli rna polymerase alpha subunit c-terminal domain in complex with cap and dna
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
203
structure length
203
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combined structural model for a transcription activation assembly
rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords Catabolite gene activator
total genus 63
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3n4mA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3n4mA01
1FYMA 2H0VA 2WFPA 5ILSA 1Q43A 5JCTA 3K1NA 2H6BA 5CADA 5LRSA 5BPIA 5CU1A 5E18F 4AVAA 4OIPF 1R7JA 1WGPA 1D8JA 1LB2A 2IXLA 2CAVA 4KIGA 3W6KB 1GQHA 3KGLA 2OU2A 4OINF 5D4SA 2ZFWA 5HS9A 3LAPA 2V1XA 1EH7A 3J81Z 4Q29A 2UYAA 2MA3A 2Y75A 1W7PD 4I01A 2R7DA 5JSPA 3RTRA 3EYIA 2P5KA 1WWXA 3JTHA 2VE8A 2VXZA 1J3PA 4AIKA 2XAGA 2CV6A 4I98B 4CDGA 3NSTA 1XMKA 1OR7A 2GIVA 1QZYA 2QENA 4QM8A 2LF8A 2OQGA 5FD5A 3D82A 5ED4A 2VBYA 3FZ3A 2JTVA 2CAUA 1LDJA 2M1BA 5L3GA 1IN8A 1B1BA 5FFZA 4MH0E 4HN0A 2FRHA 1ZARA 4ZU4A 4HV5A 2EJRA 3MPBA 4KIFA 4KMFA 4G94A 1UHWA 1NE6A 1P92A 1CF7A 5JAXA 4LLOA 3RNSA 2Z3YA 3K9TA 3FMRA 3ZMTA 3WGIA 4A0XA 4M6YA 2OPKA 3U0ZA 4PIXA 4L9TA 3I59A 5FPZA 2FBHA 3N4MA 5FCCA 5CVVA 2HOEA 2ETEA 3RKWA 4Q0SA 4JV4A 1QGPA 5BXXA 2IJLA 2VT3A 5TJJA 1F9NA 2P4WA 5ILVA 3KLOA 1R1UA 4AIJA 4EJWA 4LA3A 2ZO4A 2C0ZA 4EJTA 1B6AA 5HDNA 3GZ6A 5D5WB 4PGHA 2E7WA 3LWCA 4U7DA 3RPUA 2PLYA 4Z82A 2PN6A 3WTTC 3I5UA 4U0YA 1XSDA 4Y13A 3C18A 1P4WA 3VB2A 2ESNA 1XSVA 4KL1A 2P8TA 1BIBA 2BV6A 4G6DA 2E7XA 1VR3A 4FBFA 5KBFA 4A5MA 4IEVA 1TQPA 1T38A 1YQAA 1FBQA 4N9IA 4EV0A 4IEXA 4EGYA 3T1BA 1G6NA 4M6XA 5EEHA 2KJBA 3TDUC 1W7PA 4CXFA 4JBAA 4FT8A 5H6RA 1DPRA 3K1MA 1O3TA 3H92A 2QVOA 3FM5A 4HVQA 2EA7A 1F5TA 3HIFA 1XMAA 1TLHB 2KIUA 4GYIA 1IPKA 3BOQA 5LBQA 1R5GA 4AVPA 1FNNA 2W57A 1DZRA 2Q1ZB 4LMYA 1TTYA 3W6JB 3GLXA 2PBIA 3REOA 1EV7A 3ROUA 1ZNPA 4YFXF 3TO9A 2P7VB 3JAMZ 3H1MA 1O3RA 1QXRA 1IN5A 4NB5A 1S7OA 1H1MA 3M3IA 2Z33A 3QAHA 3FXUA 1V3FA 4MTEA 3BY6A 2ELHA 2F5FA 1YW7A 3K0LA 4IEUA 4KICA 1J75A 2E1NA 3WGHA 2GA2A 1WLTA 1KYZA 1U5TA 2P6SA 1BI1A 3ULQB 3MZYA 5HLIA 5HOOA 5A2QK 3FMSA 1ODDA 4XF1A 4XSXF 2UZKA 4FAGA 2OZUA 4GO1A 1R1TA 1XSXA 3GXOA 3SCFA 2B8MA 3SXYA 4EM2A 4A5NA 4M74A 1P4XA 1V4RA 2CSOA 3FXRA 2MBFA 4DQ2A 1X8EA 2L01A 3FHIB 2NNNA 2PAEA 2QYOA 1FPQA 3WTUC 2FSWA 4MTDA 3SHRA 1IN6A 2VQAA 2K9ZA 5FLHA 3ZP5A 4WXCA 4MGIE 4GYGA 3RKYA 4KYWA 2GA1A 3IKVA 4L0YB 2QBYA 2O61A 1CX4A 2QQ9A 4E2QA 1ZG3A 4L9JA 5CVRA 2ZMEA 3AAFA 4R52A 3OCPA 2X4HA 2Q0OA 5K8SA 1ULYA 5ICEA 4WX9A 1DGRA 2D5HA 1IXRC 2A3SA 2OBPA 5A2QZ 1PMIA 2RC4A 4UV8A 2L3DA 2P17A 4A0YA 1Y0UA 4ESBA 3KETA 4ZYGA 3F72A 4LB5A 1EY2A 2WTEA 3FX3A 4XFCA 3G73A 2L02A 3BB6A 3ECHA 4BHBA 3ST7A 4P5OA 3T5XA 5ICFA 4MHGA 4M9XA 1KYWA 1NXMA 2NRAC 5BMZA 4RGUA 2OZJA 5K5QA 2QNKA 3UKTA 2FOKA 2XLGA 3HSFA 3LSTA 1ZN2A 4AQ6A 2H94A 3OGJA 1ZZ7A 3E5QA 1QXJA 5DCFA 2D93A 2VT2A 3GYDA 4LLNA 5IT3A 4O3MA 3I54A 1G3SA 1Z7UA 3DQVC 4LG0A 3S2WA 1X82A 2WC2A 5JFRA 1MDMA 2NYXA 3E6BA 1R36A 3LA7A 3J80Z 2AS5F 3WW4A 2GU9A 2QUFA 3U1DA 3VEPA 1RL3A 1FZPB 3T8RA 1IN4A 3IHUA 2ET7A 1HQCA 2F5DA 4LLGF 2VC0A 2DBBA 2HFHA 3IWZA 1BC7C 3S0MA 1YUDA 3CLPA 2PMUA 3LQRA 1BOAA 1DPUA 3L00A 2A69F 5FDBA 3H3ZA 3PLQA 2Y0MA 5HS8A 4MV2A 5I8TA 5HLGA 1P2FA 2D2WA 3E5UA 2Z5UA 4OOIA 1QNTA 3KP7A 5HI0A 4HDVA 5H20A 4P9GA 2MLKA 3MWMA 1CAVB 1H0MA 1ZLKA 5FLXK 3HOSA 2RGVA 2EFNA 4BAYA 1QQIA 2OAZA 1FOKA 5D4RA 1ZAOA 2QVSB 3LA2A 1BI2A 4WF2A 4HDUA 3U11A 3I64A 4RS8A 1FBUA 2G9WA 2IW5A 4UXNA 2Q8KA 3UKNA 3DV8A 2YX4A 3QU6A 3F8CA 4LK1F 2BEOA 3GFMA 3L9FA 1YLFA 3DKWA 1CAWA 5CVIA 2UXNA 1EPZA 3CO6C 3L7WA 3M8FA 2HYGD 4P96A 1SFUA 2QZ8A 3IBMA 3QPTA 4LULA 1CAVA 4Q0UA 4XBFA 3LZZA 2GQQA 2G7HA 5CJ9A 5CYVA 1UFMA 2Q30A 4Y15A 3CF6E 2VOPA 5I0RA 2O0YA 2ZBKA 1EH6A 1J59A 2PG4A 2BYVE 2I45A 1SFEA 4PJYA 4M72A 3OF1A 3SFZA 4LTAA 5J3UA 2DI3A 4HLXA 3EYYA 4CYDA 2PAMA 4QWQA 2CYYA 1R00A 2QBYB 3E6DA 3MDPA 5DD8A 1XDSA 1K7AA 5E8GA 4JTNA 2Z2SB 3C3WA 3F8NA 4IEPA 1GXQA 5JI6A 3GO5A 3FF5A 1JXSA 4E2GA 4OIQF 4HQMA 2K27A 3FHZA 2E1CA 4ORFA 3HHHA 3P9IA 3MCZA 2XROA 2DFIA 1MJAA 1WA4A 2VBZA 3F6VA 4GULA 1TNSA 1WQ2A 2HZTA 4MQVA 4CZZA 2HTJA 2J5OA 4A0ZA 4E2SA 2D45A 2QLZA 3IRRA 1O3QA 3CO2A 1Z6RA 4Z2YA 1DP7P 4I3PA 2IVMA 1O3SA 1YTYA 2K0GA 1Q1HA 5TRDA 2KKOA 1U6GA 1TBXA 3DF8A 2VECA 1Y3TA 4WXHA 4LUMA 4AXOA 1ZLJA 1FSHA 2RQPA 2O1QA 2GH2A 2EVXA 2OYZA 2EK5A 3I58A 2BE5F 1BI0A 4MGKE 4G7ZF 3MYXA 3WW2A 4WBBA 2O03A 1X3UA 1Z91A 3TNPB 5C6CA 1YLLA 2W85A 3KZYA 1Z9CA 1RIOH 1TW3A 3P9KA 2ET1A 3ETQA 1BJAA 2DT5A 1Q5OA 4HX7A 3TOAA 1SD6A 3PFIA 3ZDSA 1USSA 4XFAA 3R6SA 2VOOA 3K2ZA 4P9UA 1KU3A 1T39A 2BBYA 1U3EM 4RGXA 3VFZA 1FY7A 4EWAA 3ZQ7A 4XRFA 3CJNA 4IETA 4RB2C 5F1RA 1U5TB 2QJVA 4CICA 4IF4A 4ESFA 1K78B 3PNAA 3H8UA 2XL9A 3ZMDA 4O9GA 3RJPA 3QACA 3CTAA 3IIAA 2L4MA 5LGUA 4HVOA 3LAGA 5E16A 3TNQA 4KMUX 5L3EA 1J9IA 4HYEA 4UVBA 4A6DA 4X6QB 2OQRA 3HRTA 3ZPLA 3HHGA 2RDPA 2PI0A 3BWGA 4GCVA 2VPVA 4WVZA 4PZJA 5HDKA 2ZNYA 2Q2EA 3D5LA 3V8JA 4YRDA 2EA4A 3H3UA 5J6XA 2PQ8A 1IZ1A 3HRUA 1ZGAA 3MAJA 3O14A 5T3NA 3EO6A 1XGOA 4ENKA 3L2HA 2XLFA 1W7PB 3RPQA 4D7TA 2XKOA 1U78A 4N0BA 2FBIA 3N97A 1FWZA 3WE2A 1Q3EA 3EHKA 2XAQA 3KEOA 2OA2A 3IDBB 5E1XA 3H1WA 1MD0A 2JPBA 4WK8F 1MGTA 4HVRA 2XHKA 3HRSA 5ICGA 1ZRDA 3SCGA 2PQQA 4HA8A 1HW1A 2ZCWA 5FPXA 1YW9A 1LRHA 5LLQA 2EFQA 1B59A 2GXGA 5EEGA 1IPJA 1P4AA 2YU3A 1ON1A 4QX5A 3EETA 1OYYA 2MPFA 4IEYA 2PFBA 4BHCA 4IXAA 4OFGA 3CDHA 2FMLA 3I71A 3ISPA 4U7BA 4H0EA 4CHUA 4EROA 4IRHA 3ES4A 1IXSB 3KP3A 2F4PA 1D3YA 2A68F 3LWFA 4Y17A 3TDZC 4A2UA 4IRIA 1RUNA 4RGSA 1J7KA 3SHFA 2BGCA 3EBRA 4O5VA 5D6FA 2O8QA 1XRUA 2FQ3A 3IC7A 2PJPA 3HQXA 2HQRA 3SZTA 4HBLA 1K79A 3IRQA 1XD7A 3TKYA 3BJOA 4HX4A 4BH9A 4QXKA 2KXLA 3NJZA 2D1VA 1W5SA 5I0TA 4ETSA 4MEXF 2TDXA 2QQBA 1IRGA 1OYWA 1YFUA 1B4AA 2IXIA 3UKVA 2LSOA 2CQKA 3F3XA 3H1YA 4RD7A 4HSJA 5AIPA 5C8WA 3B73A 4QGNA 2EV0A 1J58A 2IP2A 3GWZA 3OOPA 3R4KA 3JTGA 1E2XA 5D8KB 2ZMEB 4IVNA 3E5XA 5CVUA 3F8BA 3HTSB 5BY5A 1KU2A 1F4KA 1SFNA 1S6LA 1G3YA 4XSZF 4XFFA 3PQKA 1Z6TA 2ESHA 4EVIA 1CAUA 4KN4X 5L3DA 5K1YA 3ACLA 5JHUA 4ON0A 1T98A 4OIOF 3NRVA 2FE3A 1AOYA 4J1WA 3BPXA 4H7LA 3WGGA 3NW4A 1BM9A 3IWFA 5EFUA 5I93A 2V1UA 1L3JA 2EAAA 4AIHA 3IKTA 5D5UB 2EV6A 2EWNA 2NS0A 2XIGA 1TNTA 5KHIA 3WTVC 1S8NA 1L3LA 2PEXA 1DDNA 4WZCA 4LGWA 1K6OA 4Q0PA 3V4GA 3WG9A 2KIMA 4HF1A 4HF0A 2IRFG 1O7FA 5D8LB 3BZ6A 4J1XA 3F8MA 3ABTA 2K4BA 2JT1A 4HF2A 3RI4A 3R0AA 1GVJA 2DAOA 2FBKA 2K02A 5F64A 1ZVFA 5D5VB 1TQ5A 3U10A 2XVCA 4L2NA 5FLXZ 4OLLA 4HAMA 4L9VA 4AD9A 1I6XA 1YW8A 3KP4A 2ADUA 5JVTA 2BNMA 5I0UA 4Q48A 1U5TC 3ML6A 3CUQC 4HMZA 2Y48A 1TQMA 3TOBA 4K8FA 3HOTA 4N9HA 2Z69A 4XFGA 2VBXA 1JGSA 4ZH4F 1K78A 4U88A 2XRNA 1JE8A 1J0RA 4O6JA 3U2RA 3SXWA 2VN2A 5KHKA 2NAZA 4EMSA 2L4AA 2M30A 2CFXA 4G8XA 2OA4A 4BQAA 3QU3A 2GC1A 2BNNA 4QM9A 5DCMA 4HLYA 5BPXA 1ZX5A 5HLHA 3MFKA 1UD1A 3JSPA 1B9MA 4Q4ZF 3R61A 3DP7A 1X8MA 3J81K 3F22A 2HYFA 2FMYA 4LG0B 4UUVA 4XF4A 1XGSA 3H50A 1ZZBA 1YFYA 3K1PA 4L5IA 1ZYRF 3E6MA 1H9GA 4KWLA 4XF0A 2W24A 3LAJA 3ELNA 4M9ZA 4P55A 5L3FA 3SQNA 4HX8A 5J48A 1ZGJA 2A61A 4KA4A 1OYIA 5DUIA 3HRMA 3WTWC 2KIFA 3LOIA 1YS6A 2K86A 2P5LC 2FF4A 4IHSA 3SZPA 3M8EA 2M5WA 5E8IA 2QDRA 3BROA 1HKTA 4DINB 4AVCA 1J5YA 2HS5A 4KWKA 1R23A 3R60A 3NEUA 2NNYA 4D0PA 3HTUA 4S04A 2P6TA 1YFXA 3D0SA 3RIRA 3DN7A 4QMAA 3TGNA 3V8KA 2XLAA 1EP0A 2HKXA 2BNOA 1XCVA 1HW5A 2M45A 3CO7C 1JHHA 4JK1X 1HXDA 2MH9A 2ZJ2A 2IC1A 1JUHA 4ZU5A 4I09A 5D5XB 1BC8C 1LEBA 3I7DA 3Q5FA 3R0JA 2JSCA 1V70A 2PHLA 3V7CA 5LEJA 1L0OC 1WI9A 2LNBA 1OMIA 3CLOA 2WWYA 2MH2A 4XFBA 3WW1A 1Z05A 1LVAA 1ZH5A 1XN7A 2E9QA 3T0YA 2EFOA 4RAYA 4RB0A 4GGGA 4YIIA 1T0FA 2CO5A 3BCWA 3T8TA 2ISYA 5EZWA 5ILUA 3GBFA 1DZTA 1QY4A 2QQAA 2FXAA 2RKHA 1FXZA 2B9UA 2HEOA 4XFHA 1XGMA 1SMTA 4CGZA 5AIQA 4KUMA 2AXLA 3JAMK 4A12A 2F2EA 5J8FA 3BJAA 2F5CA 4I0AA 5FGMA 5LHHA 1CAXA 1LNWA 4LFUA 1R22A 1KGSA 3COAC 2JRTA 4HLTA 1RI7A 1EYBA 4EWEA 1QZZA 2MD5A 4HZFA 5FO5A 1D8KA 3QP6A 3FXQA 1HBXG 4YSFA 3M7GA 3FE5A 3RKXA 2EB7A 1ZRFA 2QCSB 4I2OA 3WU1B 4S05A 3MEXA 3WODF 3CJXA 4YNIA 4IHTA 2GAUA 1TW2A 3P7NA 3GW2A 2YX7A 3FZVA 2FU4A 3S7EA 4M73A 1A04A 2DQRA 2B5HA 1HSTA 4YIFA 2KRFA 4PCQA 2CWEA 1QPMA 2UWMA 3VODA 4KN7X 1YHFA 3OV8A 4CO8A 1NE4A 1MKMA 1STZA 3E6CC 3MZHA 4XEZA 3KP5A 1LKNA 4MGZE 1YYVA 2VE9A 1ZZCA 4IERA 1I1GA 3KZZA 5LGTA 1Z1DA 2W84A 5L3BA 4Z07A 1DUXC 3USSA 3F21A 4MNUA 5KHGA 2PHDA 3K69A 1O7LA 5BPDA 3KP6A 5D6EA 1NZCA 3HUGA 3I4PA 1JHFA 1G3TA 3JZVA 1OKRA 1OPCA 4HSLA 3ZMSA 2ZKZA 3M9AA 2H09A 5DD4A 5JSRA 1ZRCA 3EUHA 1BIAA 3LFKA 4XFIA 1H1IA 1ZHFA 3V8LA 5FQ0A 1UCRA 1YFHA 3BDDA 1ZRRA 4E70A 2M8EA 4EM0B 2DO7A 4IEZA 2STWA 1O5UA 2IXJA 3SMHA 1MZBA 2DK5A 5DCMB 2A6EF 1IAWA 4KDPA 1IRFA 5FLIA 4LJZF 4G7OF 2RV8A 1YS7A 5FB2A 2UY8A 3E3VA 4FAHA 5KK1A 3H7JA 1NYWA 2RN7A 3GX4X 4IEQA 2XUBA 5CVJA 1J3RA 1RTVA 1XGNA 5ERIA 4O9EA 1GQGA 4F8AA 3V7SA 3BJ6A 2IA2A 3FJSA 4WWCA 2LDUA 4HV6A 4I0BA 4EM1A 1OFNA 1SD7A 2W25A 5AONA 5F6FA 2UY9A 4EJUA 3HT1A 3J7AO 5J7MA 1UIKA 3SCHA 1R1VA 4EJOA 4ENJA 2IXKA 2JZYA 1VTNC 4IPAA 3PVBB 1GXPA 1J2XA 5DV5A 4LEJA 3E97A 2CW0F 1ZZ9A 3F6OA 4PIYA 4ZZLA 1REPC 2YPRA 1RZ4A 3DEUA 4M71A 2YSRA 4RB3C 2XASA 4PDKA 4ZYHA 2OZ6A 4BHPA 3HYIA 2ZNZA 3OD0A 4HQEA 3JSOA 2COMA 1J3QA 2G7UA 4UHTA 3I0TA 1O4TA 4JTOA 4RB1A 1IW7F 2VODA 2ETHA 4RGRA 2B0LA 3M1EA 3HSEA 2XV4S 3H9AA 4LA2A 3WW3A 1SD5A 1R58A 5I8YA 2D5FA 4Q0QA 2EFWA 3WTXC 4IEWA 5LRRA 1IUYA 3QRFF 2J5PA 1PDNC 2P5VA 3QPHA 2OD5A 4XLPF 4LK0F 2N7GA 1G3WA 2DU9A 3GFJA 2IA0A 5IT9Z 2VBWA 3C1DA 2EA2A 4MGYE 4QGLA 2XAFA 1O57A 2GC3A 2XKPA 4TV7A 1UIJA 1UPIA 5I0SA 1IXCA 1YIOA 1ONVA 3KCCA 3KLNA 4KT5C 1MJ9A 4QLCU 2Z99A 4L5JA 2KJCA 3NVCA 5BS6A 2A07F 1RC6A 3PQJA 3ES1A 6PAXA 2GC0A 3BPVA 3TQNA 5JR3A 4WXDA 2MC3A 2HWVA 2D1HA 3OTFA 1FP1D 3ZN1A 1VP6A 4EWDA 1HSJA 3ECOA 4OIRF 2DK8A 3MQ0A 4U0VA 1KU7A 3DPTA 4YYOA 1SMYF 2RNJA 2XGXA 2QWWA 2FEZA 4OMYA 3LQQA 4KWJA 4XF9A 4LD5A 1ZZ8A 3NQOA 4PIZA 4DNCA 2CGPA 1FYKA 4B8XA 2GXBA 1I1SA 1KQ8A 1D5VA 4JVAA 3WTZA 2HDCA 1I5ZA 2GZWA 3JW4A 1FC3A 5FQ0B 3HSRA 1MJBA 2XAJA 3TO7A 3ZMUA 5J8CA 2MLGA 5E1ZB 1Y9QA 5ICCA 2MHFA 4A6EA 2LF7A 1RNLA 3BU7A 3DXJF 4YFNF 2V79A 1FP2A 4LB6B 5HDGA 1NHAA 5HS7A 1ZG5A 4MGRA 1QWRA 1T6SA 4G9YA 3O6BB 2D40A 2DW4A 2FNAA 3LA3A 1C0WA 4K2EA 3WTSC 1KA8A 4Q0VA 1TQIA 2FQPA 4EQQA 3ZN0A 2R3SA 2HJIA 2ATFA 4AVBA 2M87A 4GXOA 3NL1A 1X7NA 3WTYC 2A6HF 4HN1A 1ZZ6A 3RYPA 2K4JA 2ACJA 1SQ4A 4NHJA 3NKTA 3RDIA 4QGMA 1O5LA 3L2CA 1XDUA 1T2KA 3CUQB 4D7SA 3DFGA 2DCTA 4ASNA 3DPLC 4R8HA 5E1WA 5E1RA 1U2WA 4LLLA 1KQ0A 1USTA 3DL3A 4AWXB 4UVCA 4WCGA 4UV9A 4UBGA 1BN5A 2YR2A 3CEWA 1QO0D 5BQTA 3BP8A 3VOEA 5IT9K 1WRJA 4UNOA 2VC1A 1S3JA 5HVQC 2MNGA 3S7IA 2L54A 3RYRA 4P9FA 4NVPA 3KSCA 2ZKLA 3M70A 1GHCA 4HOBA 1AWCA 2Q0AA 1PUEE 4R79A 1PP7U 5I91A 4G7HF 1ZG1A 4TLFA 1LJ9A 1B9NA 3I59B 1LDKB 1XCBA 5KHJA 1E17A 2DQLA 1UHMA 4I7HA 2HQNA 4U0WA 3G7DA 1UW8A 1SD4A 2XL7A 5FD6A 4YG2F 2V6CA 1CF7B 4BIFA 1LEAA 4KNYA 3B02A 1HKQA 3O2PE 3EJKA 5L3CA 3GUDA 1BBYA 3C7JA 4OMZA 4MQ9F 5BUVA 1BI3A 4RAZA 1UCXA 2FA5A 3FM3A 1SEFA 3GEZA 4ZZDA 5BOXA 1CAXB 4ZYEA 3HT2A 2IA1A 4NQWA 4EGZA 4R1HA 1LDDA 3EQEA 2Q4SA 5KHHA 1OI6A 2PA7A 4B09A 3BPZA 2UXXA 3KGZA 2QM3A 4ZU7A 1SFXA 4JQFA 4UXAA 1LQ1A 2WV0A 4ZYDA 3Q9SA 1G4DA 4XLNF 5H6QA 4IEOA 3GFIA 2CG4A 2Y0OA 4YARA 3V7RA 3P9CA 1HKSA 3F23A 4BXUA 1IF1A 4ENNA 1IN7A 2STTA 1YFWA 1XB4A 1CGPA 2EFPA 1R5HA 3I53A 4MUVA 4L9NA 2DTRA 3QOPA 3FWEA 1U12A 2H27A 5DEQA 3CUOA 1FX7A 1PM7A 5DUKA 3QP5A 2LKPA 4KU7A 2O6GE 3CUQA 2JPCA 1FBSA 1WSUA 1LR5A 1YG2A 3ABUA 3O3KA 3FMQA 3EDPA 1H9TA 2HGCA 4AQ2A 3GYHX 5LHGA 2XAHA 5FFXA 1P6RA 3KP2A 2IXCA 1FYLA 1ZREA 2O3FA 4ESJA 4L0ZB 3Q9VA 1VJ2A 5DYMA 1YWKA 1FLIA 4PGGA 3J80K 2X0LA 5BV6A 4MX3A 1UB9A 2FNPA 4FX4A 4M9SA 4KU8A 3GFLA 2A5YB 1F1ZA 2PAKA 2PMHA 1KQ9A 4FHTA 2UYBA 2K7LA 5E20A 1ON2A 4ENMA 3C3VA 2DPUA 4KFCA 1FT9A 4B29A 4IRGA 3IDCB 1EH8A 4G6QA 5JSOA 4L11A 1U8RA 3WE3A 3RZZA 2PTMA 3L09A 1I27A 1KU9A 4OU0A 5I8SA 3VHRA 3ELKA 3GF2A 4BYYA 1QBJA 3KMHA 3U9GA 2IXHA 2ISZA 4UBHA 2Z9OA 3IL2A 1CAWB 2F5EA 1SAXA 4X6RB 4EJVA 1J1LA 5AVPA 2H6CA 4LUKA 5DDGA 4ONUA 2VONA 3WU0A 5LEKA 3GVAA 2EV5A 3EQLF 1XE7A 1OD5A 2GC2A 2P7CB 1W4MA 2V9VA 4HBNA 4XF3A 2V1DA 5JR7B 4Q47A 4L18B 5D1IA 2HKOA 3RYKA 3TO6A 5K5RA 2PFWA 1W5TA 2HR3A 3FFQA 5K5OA 3KE2A 3D0JA 5LHIA 1XE8A 1PP8F 3G3ZA 3CL1A 1HW2A 3KEQA 2O8XA 2V09A 4HW0A 4KIBA 2IPQX 3BALA 1YO5C 3ZMVA 2HTSA 3ZMZA 1CAUB 3F8FA 4MZUA 4UVAA 4BNCA 1S29A 5LGNA 5KVRA 3GZ5A 4IESA 4XETA 1FSEA 1RGSA 3H7YA 2IT0A 2RVCA 2ZXJA 1FI2A 4FX0A 2C6YA 4I02A 1WKMA 1RUOA 4IJAA 4Q5SF 3ERED 4MEYF 1DGWA 5CLSA 5E17F 5FLJA 1MDMB 2R7FA 4META 4F7ZA 1S7AA 2GWRA 2DPDA 4YFKF 2PYTA 3KFWX 2DLLA
chains in the Genus database with same CATH superfamily
4Y5Z0 5ILSA 3K1NA 5M5WJ 2AC1A 5BPIA 5LASA 3BCAA 1EV12 2RG4A 2A6YA 1R7JA 1LKXA 1D8JA 3FC0A 2CAVA 3W6KB 3KGLA 2OU2A 5D4SA 2V1XA 1EH7A 3V0AA 2MA3A 5FYHA 1PO11 1NQDA 4I01A 2WDBA 3VZJA 1GOGA 3EYIA 2P5KA 2TNFA 3JTHA 3K6GA 1NAEA 3KZIC 2VXZA 3H5RA 4AIKA 1MBJA 1L7QA 2CV6A 4CDGA 3U75A 4FE4A 1HX6A 1GWMA 1Y9MA 4QM8A 4QSHA 2NS7A 4QPIA 2ZSIB 2JDZA 1Z7S1 3VD5A 5CNAA 2W95A 1VBC3 2HPMA 3OYBA 4BXFA 4KMFA 3BTXA 4PDWA 1P92A 1CF7A 4NWVA 2XBO1 3AYDA 3MI8A 4LLOA 4YG0A 3RNSA 3K9TA 5GTHC 4I30A 4CEYA 3WGIA 1UF2C 1N1SA 4M6YA 1QF3A 1YIPA 2YXSA 4L9TA 1XYPA 5L36A 4RGKA 1LUJB 2D6NA 2BPA2 4RYDA 1V54H 2HOEA 2XB0X 4Q0SA 3WHCA 3H8XA 2IFWA 2VUAA 2V7FA 5FZCA 3C2HA 1F9NA 2P4WA 3AB0A 4AIJA 4YGBA 4GWJA 2XVGA 3GDBA 1QQP3 2XGDA 4P14A 3LWCA 2B39A 2D5VA 4LO7A 3GTKJ 1XSDA 4LHNA 2I07B 5C3SA 4XMYA 2ESNA 3BI3A 1KZHA 1GZCA 1BIBA 1MR5A 3OBTA 4FBFA 2VKVA 1R1A1 2IBDA 4A5MA 2JEMA 2PJRA 4UF0A 1W0NA 4IEXA 3T1BA 1JHNA 4M6XA 1H9PA 1Q1VA 2MSYA 4K1YA 4CXFA 1KFXL 4CDQB 4JBAA 3QLQA 4QWNA 2VNVA 3K1MA 2R1DA 1Y39A 4YW6A 2UU8A 2RV9A 2K9QA 4KQ7A 2DA7A 1TMF3 1VAVA 2DBNA 2KIUA 2GIZA 5IP7J 3EPZA 1ZR4A 4NPMA 1TMF2 5EG0B 1PUFA 1FNNA 2Q1ZB 4OQ8A 1SFYA 5FP9A 4LK7A 4BUPA 5JPNB 2RMU2 1EV7A 3PIOF 5FUIA 3S8PA 1ZNPA 4KMQA 2EQRA 3DU6A 3JAMZ 2W7NA 3H1MA 3MF9A 3TRSB 3UYJA 1QXRA 4NB5A 1S7OA 3F2ZA 3M3IA 3G1OA 2R062 3WG2A 3S1QJ 4AVSA 3FXUA 1V3FA 1FOXA 5JI9A 2ZXHA 5A32A 3K0LA 4KICA 1BBT3 3IH2A 2GA2A 2I74A 1WLTA 4BOWA 2P6SA 1TME1 3A0HC 4BQXA 2CWSA 4LIVA 4XF1A 3SXYA 3LF7A 2A3YA 1MZEA 1X1AA 5HXMA 1P4XA 2MBFA 4DQ2A 2RS31 4GIQA 2VJ4A 3PSFA 5CQEA 4DYRA 3WTUC 2VQAA 2K9ZA 2F48A 3ZP5A 1QXPA 4XXPA 3UJQA 4RL7A 3IKVA 1BZWA 3A23A 1ND2B 3WHTA 2W1UA 4L9JA 5CVRA 4XLAA 3AAFA 1JXNA 5ICEA 3S5QA 2FCTA 4WZFA 4AUXA 1VBD2 2VQUA 1DGRA 1JUPA 2XQRA 2W91A 2A3SA 3FXKA 5A2QZ 4UV8A 5LY2A 3U37A 4ASLA 3O0VA 4CZCA 2NYYA 4W6XA 1O59A 4LB5A 3HNBM 3JQWA 4XFCA 5EJ1B 1TWHJ 4B44A 2L02A 1UYYA 1GU3A 4MHGA 3OYGA 2DTWA 3CJIC 2QNKA 4AM3A 1PNGA 3VN4A 5JMCA 3H3LA 3HSFA 3POFA 5FUNA 2XAUA 2H94A 4A3BJ 4RLQA 2ZX4A 3W9AA 3E5QA 1UN1A 3NNMA 4EYUA 2PN5A 2DVBA 4O3MA 3KCYA 2DOEA 3I54A 1YITI 4LG0A 1X82A 2WC2A 1WA6X 2DA3A 5JFRA 4AHWA 3G1LA 3WSOA 3Q9OA 5T55A 3TN93 4A6OA 3URFA 2GU9A 1JU4A 3ZFGC 1LFPA 3U1DA 1YQ6A 1BR1A 3OEAA 3QYEA 2A6XA 3T8RA 3CF5F 1IN4A 1XTAA 2QQWA 2ET7A 3TB0A 4PLNA 2J1SA 3IWZA 1P9QC 3S0MA 1MBEA 1JS9A 3KVBA 5EJZB 2VD7A 2KD7A 2E31A 1Z67A 3LQRA 1E0EA 4KITB 4DY3A 1BK0A 3PURA 3ASOH 1V5EA 3RQ4A 4ZTFA 3GJAA 4MV2A 2D2WA 5IOYA 5FV3A 2DT6A 4M0HA 3NKGA 4ZPIA 1LEMA 5A3OA 3QBQA 1X1BA 2MLKA 2WAFA 5F5AA 2ES3A 1RHI1 4BAYA 3W5MA 1QQIA 2Y31A 2HEYF 1H1AA 1ZAOA 2EIGA 1BI2A 2VASA 2VOKA 4LO5B 3LFIA 1V6LA 2QZ3A 4RS8A 1FBUA 2IW5A 3LDBA 4TZDA 1R083 2Q8KA 2ZC2A 2YU9J 2YX4A 2BEOA 3OUHA 5M5XJ 3DKWA 1NT0A 4NHKA 1BVP1 2UXNA 1VRH3 3UETA 1WCQA 2WNUB 1SFUA 4HNVA 1ONAA 5ACA3 2LVSA 1V9U3 1CAVA 3P5BA 1VRH2 2HBTA 2E53A 4BQ4A 2KRHA 2VU9A 2JVHA 3TYJA 2G7HA 5CJ9A 5CYVA 2PMZN 4Y15A 2P6HA 1OT5A 3DKYA 4MLOA 2BYVE 3OBRA 4D6QA 3T2QA 5CAZA 2QCOA 3TEDA 1E5HA 3JRDA 4LO8A 1SFEA 5FZLA 4PJYA 5FJHA 4AEDB 4E4HA 2WBMA 4UFJA 5FZKA 2E6VA 4RLFA 1R4NB 5J3UA 3FBNB 3DECA 4HLXA 5CKNA 1LPQA 2XOMA 5DG2A 2VO5A 2QBYB 4Y1UA 5DD8A 1IG0A 1JOJA 3FLRA 4FTBA 4JTNA 1H8AC 4IV1B 3U4SA 2VULA 2HOSA 1AYM2 4F92B 1GXQA 5JI6A 3N9OA 1JXSA 4E2GA 4A7YA 2R7XA 1GUUA 2ZPXA 4OIQF 2JUCA 2CQQA 2E2IJ 1S0FA 3VBSA 2E34A 1W6QA 4WM7A 2XROA 2DFIA 3JXSA 2HWF1 2VBZA 1TNSA 1WQ2A 3K3NA 3MD2A 4A0ZA 1LEDA 3CMMA 2EIDA 3GTJJ 4RFRB 2QGUA 4ZDOA 5CFDA 2HWC2 3S16J 1H2LA 4WXHA 1QU3A 4M00A 2GMEA 2YS9A 4L5EA 4JGZA 3AMMA 4WM8B 3UNPA 1OLME 1VBB2 2OYZA 5JPMB 2EK5A 2BE5F 1BI0A 2JWPA 4B4CA 3WW2A 2WT0A 1X3UA 1Z91A 1YLLA 5BNNB 1LECA 2ET1A 2AUYA 4B4QA 1BJAA 1B8IB 2DT5A 2G9GA 4L9BA 4JRAA 5FY0A 2ZMEC 5JLWA 4YFZA 1SD6A 3PFIA 2WL1A 4XFAA 2BVLA 3R6SA 3DCQA 1JYNA 1OFCX 1QJX1 5FOJB 1KU3A 4XW3A 2BBYA 4N53C 1U3EM 3TP3A 1AJOA 4RB2C 4YG6A 1HLCA 2XBO2 5AC91 1RESA 2XB6C 3JRFA 2E19A 2QJVA 1OOPC 4ESFA 3PNAA 1GV2A 2EXKA 3ZMDA 2XPWA 4A3KJ 1RJ8A 5GZEA 4DMIA 1WH5A 3CTAA 4C2MJ 3LPFA 3LIGA 2OVUA 2VZQA 5JOWA 4IL6C 2KMUA 4KMUX 1DCSA 5C8CB 4M01A 1J9IA 2FHRA 5F9TA 4HYEA 3RSNA 4A6DA 1LGCA 2CQ7A 2W46A 2TBVA 3J26N 4II2A 3HHGA 1EUTA 2RDPA 5ACA1 2VW1A 5FKLA 2VTXJ 4CZSA 2LY1A 2BHZA 3V8JA 5T54A 3H3UA 4SLIA 1IZ1A 1ZGAA 3MAJA 3JRIA 3O14A 5T3NA 1Z3YA 1XGOA 2WIIB 2XLFA 1C5IA 4ZY9A 3G4SI 1O8PA 1DGWX 3KQRA 2FBIA 3BOWA 2WR9A 2DJNA 3IDBB 3LQCA 2XJQA 2JPBA 1S7EA 1DGLA 4P08A 3VDDA 4WK8F 4PSWA 4HVRA 1Q8PA 3HRSA 1ZRDA 5JR2A 2JDYA 5LY1A 2G9FA 1KONA 5FPXA 3BG9A 5LLQA 1B59A 3ZR5A 4HKOA 5EEGA 1IPJA 2LK2A 1P4AA 1LOGA 2WA3A 3NAUA 1S72I 3S15J 3KF5A 5FTTC 2RHPA 4UW4A 3J7YJ 2ZKNA 1BLZA 3ISPA 4CHUA 3LEGA 3KP3A 2F4PA 2BZTA 2WNOA 4NMIA 4Y7NJ 4Y17A 4CXXA 4BQ5A 4HANA 4A2UA 2W5FA 3EUKL 4IRIA 4RGSA 1J7KA 3I9V2 4PJJA 2F4IA 4JDMA 2O8QA 1XRUA 3IC7A 2HQRA 1LOCA 1TME2 4PUSA 1K79A 3N9NA 4FOWA 2VKEA 1CX1A 1UY4A 1XJAA 5JZGA 4B47A 3TKYA 1IV6A 3BJOA 1HRV1 4QXKA 2KXLA 1W5SA 4ETSA 2J1UA 5F0CA 2Y6FA 5JI7A 1QJY3 4P00B 2CQNA 1QJZA 4Y26A 3D6EA 2B4KA 2VPRA 1K6YA 2IXIA 3F3XA 1LOBA 4HFSA 3I2JA 5JXJA 1UZ0A 2R7UA 2GMMA 2A1XA 1DYOA 1U5YA 1POV0 2ZMEB 2MGQA 2DDBA 3E5XA 5CVUA 3PVOA 1S2KA 4K6BA 3HG9A 1KU2A 1OURA 1ERDA 5KCMA 4UW5A 4XSZF 5DDJ3 1UY2A 3KYDB 1FPN3 5LK7B 3NRVA 1AOYA 4J1WA 5IWFA 3BPXA 3JCIA 4XUOA 1BM9A 2DYSH 3KV5A 1L3JA 2EAAA 1D0YA 3HQRA 4W97A 5D5UB 1VE0A 1YEWA 4R9DA 5FZFA 2XIGA 1OF3A 5GTIC 5FWJA 3ERMA 1H2NA 1T6GC 1W8NA 5J36A 2PEXA 2RREA 1DDNA 3AP9A 4Q0PA 3V4GA 1E3PA 2KIMA 3T0DA 4D5CA 3VPRA 4E7HA 2C5DA 1RUI2 3TEXA 3HMYA 1NUKA 2WNUC 2K02A 1ZVFA 3U10A 4RR3C 2E7TA 2M0CA 1OA4A 5CG8A 4LOTA 1HXS3 1LOAA 1UAAA 1YW8A 2ADUA 5JVTA 2BNMA 2JWTA 3KIOA 4Q48A 1VRBA 4E7ZA 2D3PA 2VAUA 2BDRA 2P3YA 4HMZA 3TOBA 3T3YA 1ZTRA 4CUBA 2Z69A 4N9HA 5ABJB 4QPGB 5IYDJ 2B7EA 4ZH4F 4U88A 1W05A 1ZYBA 2XRNA 4XURA 1Z7S3 2RS12 3ZN6B 2GDFA 4G8XA 4IHYA 4BQAA 2JE8A 3R4UA 2CDOA 3ZYFA 4QM9A 5DCMA 5BPXA 5HLHA 3JRCA 1NG6A 1B09A 4LBLA 4DO0A 4PFPA 3T4VA 4RGAA 3JSPA 1VLNA 1XMXA 3K4AA 3HKZA 1B8IA 3H50A 1NCQA 3CCRI 2W3JA 3RZLA 1G8XA 4L5IA 4CPBA 4KWLA 4FOYA 5JUVA 4YW4A 4DEQA 5TSWA 4Q1RA 2KFDA 1OQ1A 1FIAA 4RHV3 1JT6A 2YROA 1LHNA 4HX8A 3GTQJ 2JDUA 5J1UA 4KA4A 3A4CA 5DUIA 1NCRC 1C57A 4GMP1 3EYPA 1YJWI 3WTWC 4YVWC 4XQDA 4H2AA 2GBYA 4EZ4A 4IHSA 4PLOA 3I4NJ 1ENHA 4J19A 1E3OC 4CDUA 3E0JB 2JA6J 4OAYA 5TISC 1J5YA 2HS5A 1VNDA 3I49A 3SNMA 1I3AA 1Z78A 2P6TA 4GDFA 3D0SA 1GP6A 3DN7A 1A6QA 3V8KA 2X05A 1FNYA 3VD9A 1I6HJ 2M45A 1YIFA 4CDWB 3CO7C 1JHHA 2R5YA 2COBA 4ZU5A 1BC8C 4GB32 4DEVA 2CHHA 3Q5FA 1I39A 3R0JA 2JSCA 3VBUB 3ZQIA 3L2WA 2ZJCA 4I0WB 4FPHA 1TNFA 4BE1A 2EXHA 2HWD2 4ES8A 2VBPA 1ZH5A 1TME3 1XN7A 3OMYA 2EFOA 3DXTA 4RAYA 1XNCA 4GGGA 3WNPA 4IDZA 2E33A 3BCWA 3T8TA 3PUBA 1SLBA 5F3EA 4LQRA 5IPAA 3MICA 2RDQA 1VI0A 2FXAA 3Q8BA 5M0TA 1M1EB 1CIYA 4G9SB 3VDDC 3ETPA 1DQ1A 5J8FA 1R082 3KCXA 2WBKA 3H3VK 1MQTB 5CG9A 1BCXA 5E3LA 2NMNA 1YO8A 3AKQA 1NK3P 1LGNA 2ADDA 2C24A 2WWSA 1QNWA 2ZX2A 2CS3A 2B9SA 3BG7A 4HPQA 3ECQA 4EN7B 1AR72 3QP6A 1FOYA 3FUOA 3ABLH 5FO7B 3BVCA 3PHMA 1W6MA 1YHQI 4M73A 2DQRA 2CUFA 5L9BA 4PCQA 1U8BA 3ZPOA 4V2FA 2UWMA 2Y6LA 5FPBA 4XUPA 2EF6A 3NAPB 1STZA 3KEYA 3SITA 3L2VA 1US3A 1FIPA 2VE9A 2J1EA 3IPVA 1ZZCA 3H0DA 2HWE3 2X53S 2I10A 1Z1DA 3CDZB 2W84A 4Z07A 1DUXC 3DKQA 2E5NA 1W3XA 1AYM1 2PHWA 4ES9A 1O7LA 2K5CA 2XJTA 5BPDA 2DT7B 1PGL1 1WZXA 3F9KA 3IMMA 1G3TA 1V5FA 3PU3A 3I2DA 4AI0A 5B3SH 3EUHA 1ASJ1 3EB7A 5IVCA 2R061 2X9DA 2R043 3NJVA 4XFIA 3V8LA 5CKMA 4ATEA 1DQ0A 3MIEA 4LIUA 1L7LA 4EM0B 2RM22 4GH4C 1MBKA 2DO7A 2DDUA 1O5UA 5JIUA 1JYXA 2L9RA 2A6EF 4XAEA 2ZX0A 3VDBA 1UMHA 4EE2A 4KDPA 4LJZF 3ORJA 3E3VA 4LJHA 1NYWA 2KL4A 4HSTA 4IEQA 4B3XA 1J3RA 1CZTA 2X1DA 3RZGA 4M3CB 4FCAA 2VZOA 1COV1 1GQGA 4F8AA 4WWCA 3S2HJ 1RUH1 2LDUA 1AZDA 4HV6A 1OFNA 2WY8Q 2EIBA 5J7MA 4D69A 1QJY2 1UIKA 4OHWA 1PMHX 4II3A 4EJOA 4ENJA 3MF6A 3VUOA 2IXKA 2GLOA 2JZYA 2OQ7A 3E97A 2Q5TA 1R092 4PIYA 2VQCA 4ZZLA 1REPC 3VYRB 4F91B 3HR9A 2JE7A 1HB2A 4AVVA 2HQ5A 3OD0A 3LL7A 1J3QA 3VZOA 3NWKA 4QB2A 1N78A 1J09A 3VDCA 3C7OA 2LS6A 4EN6B 4M3CF 4LA2A 4C90A 3PSIA 1R58A 5K0UA 2L7KA 3JREA 1B35A 2XDVA 5F2WA 4DUVA 2Y6JA 3WTXC 4QQOA 3RGBA 1VBE3 1W9SA 1PDNC 3GM8A 2P5VA 4YZ4A 4XLPF 4A42A 1G3WA 1T33A 3GFJA 2RDRA 2VNRA 2IA0A 5DABA 2VBWA 1MACA 1O57A 2VH9A 4QT6A 2YBKA 1K42A 1UIJA 2XJVA 3O0WA 1IXCA 4HKLA 3KLNA 3U07A 4QB1A 3WNMA 5K7HA 2KJCA 2JK3A 3NNJA 1RC6A 3ES1A 5LA1A 4GJZA 4CEWB 3BTJA 5C4WA 2JDPA 4WXDA 3RSJA 2D1HA 1VP6A 5AVAA 4OIRF 4U0VA 4P9YA 2ARXA 3DPTA 4J6GA 4IGOA 3QD6A 1D7PM 2RNJA 4IQJA 2ZEXA 1H6YA 4IE4A 1IDZA 5LD2C 2RJLA 4XF9A 2XPVA 5C5UA 2W48A 1PGW2 4YGDA 1MEC2 1LOFA 1Z0XA 4BQOA 3VL8A 4DNCA 2PJRB 4YZ2A 2DFHA 1FYKA 1LJ7A 1PJRA 1KQ8A 2QUOA 1JYWA 2DFBA 3WTZA 2WINB 4AI3A 1I5ZA 2GZWA 3JW4A 1IRZA 1MJBA 3TO7A 1GBGA 2QKDA 3MW3A 4Q4X2 4AHYA 2E7AA 5FZ3A 3CC7I 1Y9QA 4UAPA 2JQ7A 2ICWG 3BU7A 3BQZA 3NJYA 5HDGA 1NHAA 5HS7A 1QVUA 4FI9A 4G9YA 4Z2AA 4F93B 1OLQA 1G2HA 5JMOA 3IPVB 3ZXFA 4NC6A 3AG4H 2FZ2A 2NS8A 2B9VA 2JD9A 1PVC1 3HOZJ 2HJIA 2ZS6B 2ZA9A 2JUGA 2QKLB 4D7NA 4AVBA 1LVKA 1GZWA 2A6HF 3WDWA 4HN1A 4LR4A 4DRVA 3AL6A 4G6TB 1QKQA 2G1MA 3O1VA 4CEYB 5IP6A 3WDVA 1XSQA 3WDUA 3L2CA 1PGW1 1T2KA 2Q8CA 1UYZA 1AR93 5FMOS 3VZNA 4BMEA 2EXJA 2QSFX 1USTA 3DL3A 4AWXB 3K7AJ 2ZXQA 1ENXA 3HGYA 2RE9A 3Q8CA 1BN5A 1LULA 2YR2A 4QTRA 4FPYA 2HWD3 5IVEA 1U5IA 3VOEA 1WRJA 3AP7A 2EZKA 3I8TA 2VC1A 5K4LA 2L54A 3KSCA 2ZKLA 2P3IA 4HOBA 4L92A 2BY2A 1V9U2 2VZPA 1Y43B 2W1WA 5F5QA 1RKWA 2JN6A 5FZBA 4DPNA 5EF6A 2WO1A 3JD73 1B9NA 2XSDC 1XCBA 1ZRIA 5FZ6A 3BQYA 4UFLA 2HQNA 3G7DA 4U87A 2V6CA 1MEC3 4KNYA 1HKQA 3EJKA 1UJ8A 5L3CA 2NXNB 2ZGRA 4XIKA 5IFPA 2CU5A 5BUVA 1UCXA 2I5UA 2R5YB 2R7VA 3GEZA 5J1XA 3HT2A 1E3HA 4WVMB 2HXIA 1BA5A 1BW5A 1PGSA 2E36A 4KG0A 1RHI3 3H36A 2DFFA 2Q4SA 5KWRA 2CL2A 2DA1A 3KGZA 2FZ1A 3CNAA 4CCMA 4XQFA 2VJIA 2Y0SA 2LTNA 1SDDB 4UI9L 3ZYGA 2PX9A 3CMGA 3DU5A 1WLWA 2WO3A 3HBLA 4NIIA 2WV0A 2ZACA 4XLNF 5H6QA 1J84A 4YARA 3P9CA 1HKSA 4A7ZA 4PT6A 3ZOIA 4ENNA 1YNAA 1Y7BA 3CJIB 4QX1A 2HVQA 5FXXA 1ACCA 1XB4A 3PUQA 2WO2A 4NIGA 1KS5A 5E3OA 4E7KA 1X9PA 1QZEA 2FD5A 4B3AA 2H27A 5HCFA 3HWJA 1NCQB 5BNQA 3QP5A 1RUH2 2XR4A 5FP8A 2WZEA 1AUYA 2JPCA 4NO4A 4M3FA 2FDFA 1WSUA 4D3WA 3DTIA 1LR5A 2YY1A 2VQLA 3OOUA 2HGCA 4AQ2A 2EINH 3CESA 2XAHA 2D6OX 1U5ZA 2ZJPF 1MMSA 1ZREA 1GZWB 5DYMA 1A8MA 1FLIA 3AZWA 2X0LA 4YLZA 3S32A 4D0QA 4MX3A 1Q8QA 4RS5A 4XR6A 4KU8A 1F5JA 5E6HA 3GFLA 4MIMA 2PAKA 1HLVA 2W9XA 1W0TA 3IUOA 4QX3A 1DU3D 1J83A 1UU4A 2K7LA 1G9AA 1ON2A 2GSYA 2GXAA 3IKWA 4KFCA 2YC2A 1R093 5ISLA 3TW7A 1IS4A 2CFOA 1EH8A 5JSOA 2MEV2 3IAPA 3QYBA 1U8RA 4KGQA 2PTMA 1VBA2 5FFOC 2X1CA 5I8SA 2WYFA 3GF2A 4BYYA 1U9OA 1QBJA 1ND2C 5BNPC 1KITA 2IXHA 4UBHA 2V72A 2OC6A 1CAWB 1S0JA 1SEUA 1KXGA 5IYYA 5KXCA 4OMDA 1PO22 3I2IA 5DDGA 4ONUA 5LEKA 3L2YA 2TUNA 1JZ8A 3JBG2 2RS33 2GC2A 2P7CB 1W4MA 3CCMI 4XL9A 5GZDA 3Q8AA 4Z2WA 3JBG3 3GTLJ 4CPBD 5D1IA 3TO6A 2PFWA 3CMAI 3AKTA 3FFQA 2BBAA 4OI1A 3KE2A 1PVC3 1REEA 5H9QA 3PDQA 2ZGNA 5HODA 5C4WB 4HG2A 3AKSA 1AR62 4KIBA 5GZCA 4RS5C 3K4DA 4HONA 1S29A 3WUCA 5FZ4A 4IESA 1RUJ3 1EF4A 1E5SA 3JRHA 1ULGA 2ZXJA 3HC7A 5JLXA 3FXMA 4ZXEA 1WKMA 4BQNA 3CHXA 2KDOA 5LW9A 4LBMA 4B3NA 1ND2A 1FOD3 2GWRA 1H6XA 2EPFA 1RPWA 1GFF2 2IS6A 4N90A 2PYTA 2DLLA 4Q8LA 1FYMA 2WFPA 4ZYAA 3KV4A 4GALA 1ENQA 5JCTA 1GUIA 1KDMA 5FZGA 1SHWB 4CP0A 3TL4X 5SV8A 3CJIA 5LRSA 3GTGJ 4AVAA 5A7SA 1WGPA 1JZ3A 2IXLA 3ATGA 4KIGA 2JKBA 1RMU2 5EEAA 1D2SA 5L19A 1JODA 2AZ5A 5HS9A 1U0AA 4Q29A 1D4M2 3J7NA 3LFMA 3AYEA 2YC0A 1H8TA 2VE8A 1TL8A 3JD71 3OYLA 5ERLA 4I98B 4ZZ8A 1B72A 2ZHMA 2X85A 1U5XA 3K10A 2GIVA 2XRLA 1QOTA 2LF8A 5CA6A 4WVMA 4Y33A 3D82A 2BY0A 1LDJA 3D5OA 2J42A 5L3GA 3OY9A 3W21A 1Y8QB 4MH0E 4HN0A 3OYCA 1GOHA 2XHNA 4HV5A 3BU0A 3BR1A 2EJRA 4V1PA 3A7QA 3LKJA 4UB6C 1PUFB 2WV1A 2Z3YA 3FMRA 4XBNA 4HXCA 4JX6A 1FEXA 2OPKA 1VQMI 2HOTA 4YVSA 2FBHA 4EZHA 5DAWA 1QGPA 2VTFA 3BKZA 4AEDC 3RI9A 4GB33 1LCLA 5ILVA 3NNLA 3M1CA 4W8JA 2KRCA 2E7WA 2W68A 1X1CA 4U7DA 2L9LA 4A6SA 1XNKA 4K21A 2PN6A 3C18A 1H8TC 2JJ7A 3D1NI 1MS5A 4JX5A 5FZDA 4FP3A 4IHVA 4KGGA 2P8TA 2V6EA 2FCUA 4IXLA 1V55H 1Z0HA 4IEVA 3CJTB 4GQ7A 4J00A 1BMV2 1W6PA 1G6NA 1JU3A 4X8NA 4YM0A 4A3EJ 1WBFA 3TDUC 1V6IA 3ZMOA 2W47A 1WKYA 1W6PB 4CXYA 3OPTA 1MNMC 1O3TA 3H92A 3I3QA 2QVOA 1FJLA 2DUQA 4HVQA 4PI2A 1F5TA 1G9CA 3AL0B 3HIFA 1TLHB 1JYCA 2NVTJ 3BOQA 1VQ6I 1AXZA 4OHVA 4WV8A 4JKLA 1DZRA 2G9ZA 4GKXA 4ZHNA 1ETQA 1TTYA 3W6JB 4IL7A 4CU8A 2OJED 2RS13 2YV8A 3VBRB 4BQYA 4YFXF 1MQTA 2JDNA 3MV11 2P7VB 3GTMJ 1O3RA 4UW6A 4JGZB 1H1MA 2A70A 1RRJA 1AR83 1B35C 2F5FA 1YW7A 2CGNA 4B1RA 3OBZA 1IOAA 2BGPA 1U5TA 2CQXA 3V0AB 1AA7A 2D98A 3BTCA 5HOOA 5IK4A 1X4PA 1JYIA 3CZJA 2MG4A 5F7UA 3SKVA 3JUUA 1H2KA 2AR6A 5FZMA 4YVSB 2XGCA 4GXLA 4AGRA 1Y56A 3ZYBA 4C0HA 3WP6A 3ITQA 4M74A 1V4RA 2CSOA 3E1SA 2IGMA 3FXRA 3M4FA 5DTDA 2IGNA 3K48A 3I2FA 1TP4A 3U4XA 4MTDA 1RETA 1XNTA 2DCEA 1MW7A 1UPSA 2ZGSA 4BGDA 5K7FA 5FLHA 4JAAA 4KYWA 2LYCA 3EXUA 3MBWA 2RDSA 2DVDA 1E5IA 3WZ1A 1ZA7A 2CY6A 4L0YB 2QBYA 4CDWA 1NQJA 1ZG3A 2OKXA 1YQ2A 4QX7A 2ZMEA 4XICA 1RJ7A 1ZBA1 4R52A 2DYRH 1JKPC 2WT1A 4QQPA 1RHI2 3MIGA 3OR2C 5B5EC 5IATA 2ZXIA 1PMIA 1H8TB 1WVRA 4A0YA 3VD7A 3DWLE 1EY2A 2X29A 5FXZA 5HCAA 3H35A 4RBOA 1WGXA 1BBT2 3BB6A 4P5OA 2JG9A 3FXOA 5K0UB 1QJFA 5BMZA 2BW3B 3VZLA 4L99A 3ON7A 3UKTA 3OS0A 3J8F2 2GH8A 3LSTA 1D4M1 2R7OA 3OGJA 1QXJA 5DCFA 3GYDA 2PHUA 1VBE2 1G3SA 1Z7UA 1SDWA 1FNZA 3LA7A 1NLSA 1LESA 5D8AC 3H0GJ 1RL3A 1FZPB 2R7ZJ 3HPNA 1RUG1 3IHUA 4F3JA 1HQCA 2F5DA 3V64A 4LLGF 2VPLA 2DOAA 3L2UA 1BC7C 5DQ0A 1X3ZB 1IV8A 4GD4A 1YUDA 3CLPA 1AR71 3WNNA 2FQ4A 1ULEA 2A69F 1QJU3 1FMD3 3MKWB 3PLQA 3MIDA 5CB7A 3BN6A 4PBPA 1DFQA 4P9IA 3RCOA 1YI7A 2XWJB 5HLGA 3E5UA 2Z5UA 2W92A 2ZJRF 4OOIA 1QNTA 3KP7A 5J4YA 1YQ5A 2EIKH 2Y0SN 4HDVA 3BOPA 5E79C 5LATA 5A33A 3MWMA 4PFOA 4CTEA 1ZLKA 5FLXK 3HOSA 2Y0IA 3S5AA 2JG9C 1J1TA 3PVEA 2H0BA 3GALA 2P6CA 2QVSB 3LA2A 3VDXA 4B7EA 4BY1J 3U11A 4FPGA 2KR2A 2RS11 4UXNA 1XE0A 1UHSA 3UKNA 4NIDA 1TE1B 1JZ6A 1CAWA 4LBKA 1XXNA 5CVIA 1MH4A 1VIWB 3L7WA 2HYGD 3AMPA 4QHZA 2VQGA 5A33B 3AKRA 2GQQA 3MIBA 3BCBA 1GKBA 3CU7A 2WAEA 3H9JA 2R7WA 1VZ0A 3FHAA 4BBSJ 5KXEA 1WW7A 2ZBKA 5C44J 1WMEA 4YGEA 2VMIA 1OHFA 1SBDA 4BCUA 2PG4A 5FXVA 2CV2A 2JMWA 4RSUA 2GN3A 1EAH2 3HOVJ 4XUNA 2DOFA 1UOGA 5DZFA 2LW8A 2V9KA 1X1DA 3SLIA 3SFZA 4E7JA 4LTAA 4XAAA 4B1MA 1ZKGA 2DI3A 4CYDA 2W00A 3N9LA 2EIJH 3RI8A 4QWQA 2C9KA 1ULDA 3B6AA 4P9XA 1R00A 4I76A 1I9RA 1ETOA 3E6DA 2I2SA 2YUEA 3MW2A 3ZQGA 4AYUA 1NXD1 2Q1FA 1K7AA 4G3YC 1OCPA 3OS2A 1XNDA 4E7SA 3F8NA 3M3QA 3FF5A 2EILH 5JZGB 4HQMA 2K27A 3FHZA 3AP5A 4W50A 1FV3A 2BW3A 5FKOA 3DGTA 3KT7A 1MJAA 4HL0A 1NOVA 2WS93 4GULA 4MQVA 1TG7A 3FKJA 1KQRA 4DNYA 3IRRA 2HI3A 3CO2A 4YM3A 1DP7P 4C1XA 1IZ3A 1O3SA 1Q1HA 5TRDA 1G8WA 5A32B 5E88A 4WM7B 3DF8A 2QQLA 1VBB3 4AXOA 3RJRA 1FSHA 4DJAA 2FCVA 2O1QA 2GH2A 4K40A 3CDIA 2PXJA 3HZJA 3I58A 1QEXA 4IV1A 4MGKE 4G7ZF 3MYXA 4TYSA 2O03A 2BWCA 5C6CA 2W85A 3KZYA 3OYIA 2X5IC 2M4KA 4AZZA 1QGLA 1TW3A 3P9KA 3ETQA 1R081 4A69C 3JU9A 3F0CA 2J1AA 1LU2A 3ZDSA 1USSA 3PM1A 2NN8A 3LSDA 1T39A 2HZDA 1DIWA 2NMOA 4S0HB 5HNHA 2ZGPA 4COZA 4B48A 4IETA 3OWTA 4BQQA 1PVXA 3THDA 1U5TB 1XPXA 1JGGA 3GJBA 3N05A 4Y5TA 4IF4A 1NK2P 1VBD1 1K78B 2V5YA 5KAIC 2XL9A 1UY3A 4O9GA 3QACA 3IIAA 4NPRA 5LGUA 2LREA 4CVUA 4QX0A 4HVOA 3LAGA 5E16A 3TNQA 4A3GJ 1HV1A 5L3EA 4XMAA 3VBRA 3VHNA 3B93A 3LEMA 1UZVA 2OQRA 1GOFA 4XZPA 1UMQA 3QPLA 4H55A 2V4JC 2VE1A 3GTPJ 3PFYA 2VPVA 4WVZA 2QKMB 4CA0A 2Q2EA 1IQDC 1W2TA 1LHOA 4YRDA 1WJFA 4FQGA 5J6XA 2PQ8A 4N8MA 5C9AB 4HKWA 2XUEA 2L7FP 1UL9A 4ENKA 3M1HA 3OSDA 1BW6A 2JA8J 2HWD1 3S17J 4D7TA 3LEIA 2XKOA 2BP6A 3K70C 3WQ1A 1FWZA 3ZN6A 1MD0A 2CDPA 1JOPA 1MGTA 1WH7A 2XHKA 1UELB 3I56I 3ZQHA 4QX8A 2N8GA 2ZEZA 3BR0A 4F52A 1A78A 5IW0A 4M4RA 5BNNA 1OCCH 3MFCA 2YU3A 4AAPA 1ON1A 4JQRA 1OYYA 1UKRA 5DM6F 2BV4A 2JG8C 1BJQA 3F95A 4U7BA 1QJX2 3HJRA 4UT5A 3ES4A 2JENA 2P0WA 3LWFA 3DPUA 2WZR1 4AI2A 3SHFA 2BGCA 3EBRA 3A0BC 1BK1A 2WAOA 3CKHA 4URTA 4O5VA 4A3MJ 4QIWN 5CIRA 4BB3A 2R0HA 3SZTA 1W39A 4HBLA 2MC4A 1IS6A 3CZUA 2VMDA 1OLMA 1JUIA 2HWC1 2OV7A 3M07A 4MEXF 2TDXA 4RM3A 2KZGA 2QQBA 1GR3A 1IRGA 1YFUA 4M3GA 1B4AA 3BR5A 3P3NA 3MV01 1ZK8A 2LSOA 1QOSA 3H1YA 3Q3SA 3JB8A 5AIPA 4QGNA 4QKNA 2DCYA 2J22A 3S3NA 1B72B 4C3JJ 1E2XA 5D8KB 2KDZA 4AEDA 1OPMA 3HN3A 5BY5A 1F4KA 1SFNA 2X8KA 2LD5A 1MVEA 5EP9A 2WZ8A 3AZVA 3OEBA 1HA8A 1Z6TA 3T09A 2ESHA 4KN4X 4ATFA 1B35B 1WCSA 3PUSA 2VY0A 3GGLA 2E60A 5FLVA 2V9PA 4OIOF 2VMCA 3WGGA 2HYJA 4M3BA 1WJBA 2BOIA 4XDOA 1DQ4A 4FPJA 5FOBB 2ZMKA 4DRRA 3VZMA 1FYUA 2NS0A 1TNTA 2HWF2 2VL8A 9ANTA 5IY5H 2WNUA 3UGFA 1OQEA 3M4OJ 5IYCJ 1ZM1A 4LGWA 3K4CA 3CJRB 3WG9A 3WX5A 1ITYA 4QHOA 5IVJA 2K4BA 2JT1A 2FBKA 1VMJA 2LR8A 2IAIA 4A3ZA 3CCVI 2XVCA 4L2NA 4OLLA 4CYCA 4X6AJ 2WS92 2JG8B 5DZGA 5A7OA 4CRQA 2Y8KA 4L97A 2ID3A 1WD4A 3SFIA 3A4UA 1SLCA 4MHUA 3CUQC 2Y48A 1TQMA 4K8FA 4LBQD 4M3CA 2D97A 2VBXA 1DLLA 3VDDB 3G71I 3I2HA 1JE8A 4NOTA 3SXWA 1AL21 5KHKA 1T56A 3A03A 4CDQA 2OXBA 3OUIA 1COV2 1A34A 4E4ZA 3QU3A 3RZMA 2BNNA 2Y64A 1ZX5A 1XU1A 3ILNA 1P7IA 3MFKA 2C4XA 3ZSEA 2IEKA 4XOPA 3X29B 1B9MA 1CONA 5FIXA 2MABA 4LG0B 2QBXA 3U78A 1XGSA 2CYFA 1SFKA 1T08B 1Y1VJ 2JE9A 1YFYA 4YW5A 4NAMA 5J40A 1H9GA 2X09A 4ZONA 3ELNA 4JX4A 4M9ZA 4XRSG 1OUXA 5FY4A 4P55A 5L3FA 2GOXB 3CMYA 3WP4A 3BUCA 3HRMA 2FF4A 2FDJA 3SZPA 3AXDA 2QDRA 4IGPA 4DINB 1JI6A 3VDAA 4OQ9A 4AVCA 5EQUA 4KWKA 1W6MB 3ABZA 1PX4A 4D0PA 3HEIA 2KQRA 3CC4I 2VXRA 4QMAA 4ITCA 4WVWA 3SH4A 1EP0A 1UZZA 3O8HA 1QH7A 4PDWB 1HRI3 2WNVC 2VC9A 2DVFA 1F4AA 4NNJA 2IC1A 2CMPA 4P1WA 1UZWA 3FXJA 4I09A 4Y1ZA 3SH5A 1T2XA 1LEBA 1QU0A 1V70A 3CDLA 2K9SA 2LM3A 3PJRA 3GCMA 1C8M2 1WI9A 2LNBA 2AHQA 1OMIA 2MH2A 3SC7X 3K3OA 1GICA 1LVAA 2BQPA 4M6VA 2E9QA 3T0YA 4RB0A 5FLMJ 4YIIA 1T0FA 4A41A 1O4ZA 2ISYA 4AK3A 2ME0A 1ORKA 1IKQA 1DZTA 1QY4A 2QQAA 2ZB9A 3DEEA 2ZGQA 3J7HA 1FXZA 2LTPA 3DTKA 4XFHA 1ZA4A 5AIQA 4KUMA 4A12A 1DG6A 2ZJQF 1SFOJ 2HWE2 3ZQCA 3D5SC 2F5CA 4I0AA 5FGMA 1DGRN 1LNWA 2LRDA 4XQWA 3N7MA 4LFUA 1R22A 1QJU2 3VBUA 1KGSA 3COAC 2BVVA 4OHZA 4OVEA 3WCRA 5C3OA 2XWBB 1QZZA 2MD5A 4HZFA 1I3HA 4NHXA 1SLAA 2V73A 1ZRFA 4BXXJ 3MEXA 1X3WB 3GW2A 3FZVA 1W5CC 3LOCA 3QWLA 3ILRA 4AHXA 2LY9A 2KRFA 2CWEA 1SACA 4CDUB 4F3QA 3VODA 3OD4A 4FSJA 3OV8A 1BL0A 3E6CC 3OIQA 2ZMNA 1QOOA 1LKNA 2DMPA 4IERA 5LGTA 5DMYA 5FK8A 3USSA 1QPIA 2VZVA 5KHGA 1YQ8A 3MPPG 1UY1A 3AP6A 3KP6A 1VQ8I 5FMDA 4FQZA 3HUGA 4LKFA 1HB4A 5JXHA 1WMDA 2ID4A 4NIAA 3AZZA 1ZRCA 1AU7A 1M06G 5BNPB 1H1IA 5FQ0A 1UCRA 3ENRA 2RJKA 4R4XA 1BYHA 4IEZA 3WF1A 3SMHA 1MZBA 5DCMB 1IAWA 1YJLA 4DUWA 5FLIA 4OI4A 3DBLB 4G7OF 2RV8A 1POV1 1QMJA 5FZHA 1KJRA 4BJ5C 1W8ZA 5LBCA 4YZ3A 1RTVA 2YZ4A 1N1VA 4PF5A 3N9PA 4HEA2 5CKQA 2IA2A 4AI1A 5KAFC 5GAHJ 5AONA 3KM5A 5F6FA 2RR13 4EJUA 2YPJA 3J7AO 3WXPA 2V4AA 3SCHA 4NDLA 3ZXAC 4QPIB 3LSIA 4FE7A 4DOZA 3AMHA 4FFIA 3I3MA 3CCEI 2ENRA 1GLHA 4LEJA 2CW0F 5FYSA 1ZZ9A 3F6OA 3RZKA 1V6JA 2NOGA 1RZ4A 4FXGB 4M71A 4QPWA 2XASA 1HN1A 3OGRA 4ZYHA 3INAA 4BHPA 5LB6A 4XIOA 2RM21 5K0UC 2ZNZA 1XG1A 1HXS2 1Y4WA 4JOMA 4BQWA 4Y1YA 1QJU1 1RUC3 1Y8RB 2B0LA 3M1EA 3HSEA 4Y22B 5JWPA 3H9AA 4CEWA 1SD5A 5K7PA 1UU5A 5I8YA 2VB6A 3OYFA 5FYUA 3UGHA 1EJ9A 2LUWA 5IK7A 1NG7A 2EFWA 4IEWA 5LRRA 1IUYA 3AJZA 3WQBA 1S0EA 3ZCOA 3IZOA 2W4SA 2N7GA 4IW3A 2DU9A 3EMRA 1O91A 5FPVA 5JOYA 5L9VA 2ZAHA 3C1DA 2QE3A 1W9FA 2XAFA 3EUAA 5KXDA 2MW8A 4CUAA 1GSLA 4NQWB 4ZTJA 3HXLA 4K8RB 5I0SA 1WCDJ 5JOXA 1ONVA 3KCCA 4AR2A 4KT5C 3A2KA 1MJ9A 2W1OA 3QH6A 5BS6A 2A07F 3O1RA 1GV5A 5FMOL 4QPGC 5HV4A 2MC3A 2HWVA 4WM8C 4CCDA 4IGQA 4EWDA 5A7QA 3L2RA 2DMQA 3WNXA 3W3CA 2E7QA 4JDNA 2M8GX 3NRUA 3ZGKA 2BWAA 2VXJA 3ZYIB 5IOZA 4KWJA 4PIZA 3ZFFC 3NQOA 1W0PA 1G9FA 3HGGA 2XQXA 5C4XJ 3I55I 1JTZX 3MKYB 5DXDA 2A5ZA 3GCWA 4AU7A 2GXBA 1I1SA 1DQ5A 4JVAA 2V1NA 1W03A 1HN0A 3IAQA 1FC3A 5CISA 4U36A 2QSHX 2MLGA 4BDZA 4HRIA 1D4VB 3WV6A 1ETVA 5E1ZB 3W58A 3HNYM 1JW6A 4IX7A 1RNLA 4XJWA 1SVLA 4YFNF 4LB6B 1QWRA 2R063 4ZZ5A 1QVTA 1MPXA 2V5DA 1OPOA 3WDTA 1TZOA 2FNAA 2ZFUA 3TBIA 2M2EA 4X0GA 1KA8A 2P3JA 2FQPA 2R3SA 5C3QA 2DCJA 3PIPF 2TCTA 3CP2A 5A7WB 2JJ6A 4XLEA 4XXAA 1SQ4A 4ABZA 1REDA 2EZIA 4BLIA 2WJSA 2EZHA 3RDIA 4S2HA 4KNCA 1EPWA 4QGMA 1WFXA 1XDUA 2QQVA 5T5JA 2DCTA 3ZFEC 4NAOA 2ZX1A 3BR6A 4UYBA 4LLLA 1KQ0A 4GH4B 4CDXC 5JOZA 2VUJA 3EUHC 4AQSA 5GKAC 3THCA 3UKGA 4OULA 3N7KA 3M7AA 3VYTB 1V0AA 4F83A 1C4RA 1RIRA 2YBSA 4XDPA 3ZX7A 1QO0D 4J01A 4UNOA 5HVQC 2MNGA 2PHXA 3RYRA 4NVPA 3ZKUA 1PM4A 5J09A 4Q4Y2 3PIJA 3NAPA 1PUEE 2HXOA 1DQ6A 1ZG1A 1N77A 4TLFA 4LBJA 4IO9F 1LOEA 1LJ9A 2OT7A 1JKQC 1LDKB 5KHJA 1E17A 4I7HA 4QXHA 3AL5A 4BQ2A 4QQLA 1E5RA 5C4JJ 1CF7B 4BIFA 1LEAA 2VMGA 4BQ3A 1S0IA 3GNEA 1IGOA 5FKMA 1BBYA 3FBMA 1NLRA 1PVEA 4MQ9F 1T95A 3ASNH 2LBFB 4RAZA 5J4VA 4NIHA 2WA4A 5C7GA 4CA9A 2R7TA 4EGZA 4UFHA 4R1HA 1LDDA 3NV4A 5KHHA 2UXXA 1MS3A 2QM3A 2VI6A 3AVRA 5C71A 2G0EA 4K7JA 4ZU7A 3ZDVA 1MMNA 1MNEA 2BJSA 4IV1C 4JQFA 3VB9A 3O8GA 1LQ1A 4PJLA 5M3FJ 2J7MA 1G4DA 2R49A 1HRV2 1CQTA 2CG4A 2Y0OA 2K9MA 1UOJA 3VBSB 5L7OC 2WLQA 3F23A 5A6XA 3B94A 4BXUA 2STTA 3ZQLA 4GRIA 2O5RA 4K20A 2DVGA 3GHNA 1CGPA 1R5HA 2A3WA 2YFZA 4MUVA 3POYA 3PUHA 1DQUA 3QOPA 2BXYA 4B43A 3PTRB 3FWEA 2NVUB 4AE2A 4GAZA 1IS5A 1FX7A 1PM7A 2R0QC 2D44A 5DZEA 2J1VA 4KU7A 2O6GE 1F31A 3CUQA 3PUAA 4XN3A 1JZ2A 3B7MA 4BKXA 4JGYB 4LITA 3EDPA 2DVAA 5CFDC 3GYHX 5LHGA 1VQKI 4XKCA 2R7SA 5JVGF 3PNYA 4QKBA 1FYLA 3TEZA 2KISA 3AG1H 1X36A 1K5MB 2RVAA 3C2UA 5ABJC 3LD8A 2BHYA 4MXVA 3H9QA 1YWKA 3Q9VA 5B66C 1OA3A 1VJ2A 2BGOA 5J3LA 3CCYA 3ZXLA 2LY2A 1SAUA 5FJKA 1Y6IA 2FNPA 3DBHB 4M9SA 4FX4A 2WN2A 5GJ6A 4IZZA 2UYBA 4C1WA 3HBZA 1W2UA 5C5TA 3WLUA 1OD3A 1HQWA 2FDIA 1RVF2 3AZYA 2DPUA 1FT9A 1F15A 3GZUC 4IRGA 3IDCB 2VTXA 2E35A 5IVVA 3M3YJ 3RZZA 2VCMA 3L09A 1FMVA 4C2TA 2XJUA 1RUF3 2HWF3 4OU0A 3RG0A 3RWNA 3U9GA 2ISZA 3J7ZI 3ME2A 3DXUA 2F5EA 3RPUD 1SAXA 4JDOA 2XJPA 5FWEA 2ZBJA 3T30A 2H6CA 1UX7A 1VQOI 3DYPA 3FK7A 3MEPA 3WR0A 3QODA 2LKXA 3OPZA 2EV5A 2JDKA 5JDBA 5ACA2 1ULFA 3A0NA 1XE7A 4PCRA 5FYBA 5FY5A 1F9KA 4HBNA 4JC1A 2Y38A 1D1BA 2OPTA 2V1DA 4L18B 1IPSA 3RYKA 4YW2A 3NARA 4FISA 4QPGA 3BLYA 5FKKA 5ABJA 2DWRA 1HW2A 2RS51 2WFF2 4XACA 2ZMLA 2O8XA 4ISRA 1SCRA 3BALA 3ZMVA 4OUMA 2HTSA 1DGWY 3ZMZA 4QHBA 3ZSMA 1CAUB 3F8FA 3GZ5A 4QPIC 1H4GA 2KHMA 5BYNA 1S0GA 2RVCA 3CMEI 1FI2A 3VBUC 3ZFGA 4FX0A 4QXBA 1JBCA 1GWLA 2C6YA 4LBQA 4I02A 3OIPA 4JX0A 3DPRC 4IJAA 3K4LA 2X6YA 4Q5SF 3C7GA 3JD72 4K9SA 3R4SA 4XC9A 2W52A 2R7FA 4META 4F7ZA 2E32A 1IDYA 1AR81 1YJKA 3IIIA 3PNVA 4CE8A 3KFWX 1D0HA 2FJ1A 2Y6GA 1WPKA 2DU0A 1WLCA 5CU1A 5E18F 5C3PA 4IHWA 1QJX3 2X5IB 1GQHA 1TC3C 2VJXA 1N1TA 5CPRB 1CR7A 2ZFWA 3LAPA 4YELA 5JSPA 2R7DA 2AREA 2GP5A 1UAIA 3RTRA 3U21A 2QQNA 4ARXA 1MMDA 2KLOA 1J3PA 3JQXA 5KXBA 1H9WA 3GBWA 1VBA1 3NSTA 1OR7A 3RMXA 1R49A 1XOYA 1RUF1 4R9BA 3KLSA 5FD5A 1LGBA 2JTVA 3J9SA 4JHZA 2M1BA 4FTHA 5IYBJ 2HWB1 1B1BA 5FMBA 4A93J 1ZARA 4ZU4A 3LSPA 3MPBA 4KIFA 1XB9A 4Q5OA 4UWDA 2OUHA 4G94A 1UHWA 1VBD3 5B2GB 4Q4X1 4LMFA 5T52A 4UFKA 3I59A 5FPZA 1OLRA 3N4MA 5CVVA 3LSJA 5BXXA 4BACA 5J47A 2VT3A 5TJJA 4OCTA 1R1A3 2RS32 5FKNA 3KLOA 1R1UA 3CJQB 4EJWA 2E1OA 1XBFA 4LA3A 2C0ZA 4MO3M 2VZRA 5HDNA 3GZ6A 5D5WB 4PGHA 1ZGWA 5H9SA 3I3EA 1JOBA 1JUMA 3D3AA 3N35A 3WTTC 3OR1C 4Y13A 1P4WA 2JDMA 4XDQA 2SBAA 4QKDA 2LMDA 4CP9A 3VB2A 1JMUB 2R4GA 1R4MB 1AVBA 1LNSA 3KT4A 2AO9A 4KL1A 2OUJA 3ESWB 4ARYA 4XJAA 2XSJC 1H8VA 1O6UA 2LROA 4CU7A 1TQPA 1T38A 2WS91 4N9IA 4EGYA 5EEHA 3ZYHA 3TEYA 1YE9A 2Y34A 4GWMA 3S3MA 4FT8A 5H6RA 4YW1A 3UV9A 4MGQA 3B69A 3BYWA 1POV3 3VKLA 1OC1A 4CCEA 2AGSA 1XMAA 4GYIA 4I3GA 4AW7A 3VSKA 1R5GA 4AVPA 1SVOA 2W57A 5IT6A 1COV3 3UJOA 2YGMA 3GLXA 3REOA 2BU9A 4B7KA 1FOD2 1X50A 5C8CA 1NA1B 3A22A 1IN5A 5FO8B 5F5CA 2XUMA 3T0BA 2ELHA 3V0BA 1J75A 3WNKA 3OYWB 3WGHA 1OCTC 2L9NA 2WNVA 2C1FA 3ULQB 3MZYA 5HLIA 2GOMA 3RVHA 1ODNA 3FMSA 3NNFA 4BE0A 3CCQI 3LGRA 4Y5SA 1R1TA 3IMNA 3HDDA 2HPIA 2B8MA 4E7LA 1PZ8A 2VKHA 4A5NA 1GNHA 3E7LA 3NQHA 5CZKA 1X8EA 5KR7A 1PVC2 2JA7J 3FHIB 2JVGA 4NN0A 2QYOA 3PO2J 3ACIA 2L0KA 3SHRA 4MGIE 4GYGA 3RKYA 4AFCA 2GA1A 3VBFC 2O61A 2L7ZA 4NHYA 4XQ4A 2QQ9A 3POIA 4E2QA 4FCYA 4WM8A 3J8F3 3WF4A 4BE2A 3OCPA 5F6KA 4CCLA 5K8SA 2DMTA 3K4MA 1KDKA 1LENA 5CFDB 1OJLA 1C8M1 2X6OA 2P17A 4A44A 2L3DA 3PNTA 1W8UA 2VQTA 2R7RA 1Y0UA 4ESBA 1VAKA 1YC61 1OVPA 4ZYGA 2ZAAA 2WTEA 2X48A 3S93A 2CTVA 5FZIA 5GLZA 3G73A 3UNGC 5J37A 3ST7A 3AVSA 3T5XA 5ICFA 2NRAC 1W6QB 2HLEA 4RGUA 2OZJA 5K5QA 3JR9A 1UKGA 3MN2A 4OZOA 2FOKA 4CCNA 2XLGA 4A3FJ 5HPOA 5M5YJ 3LDRA 1ZN2A 4OI0A 4AQ6A 2VT2A 3SEPA 4Z92B 4LLNA 2DCKA 5IT3A 4R9AA 3S14J 1GANA 3J8F1 3DQVC 1UNBA 3M8JA 1JHJA 1MDMA 3AM2A 2OPWA 4DIQA 3E6BA 4NPLA 2AH2A 3WW4A 2QUFA 4YW3A 1KJLA 4NHLA 3LFUA 3DTEA 2J1RA 3I4MJ 2A7AA 1VQ7I 2XC7A 2HWC3 3FKIJ 2DBBA 4QDRA 3QQAA 4IQPA 1A31A 1FMD2 2PMUA 1BOAA 5IUQA 1DPUA 3SISA 3BTAA 5CKTA 3H3ZA 4FQ4A 2RNGA 1JJ8C 4AHZA 1YYNA 2Y60A 5I8TA 1GT0C 3W6VA 1P2FA 1DLCA 4XVHA 1URXA 2WZR3 5HV0A 2LRPA 1F8VA 4L0PA 4AQTA 1MBHA 5H20A 4P9GA 3PO3J 1VAMA 2DA4A 4BBRJ 1CAVB 4MXWB 3FXLA 1GZTA 2RGVA 2RAEA 4P02B 2EFNA 1AR61 1JT0A 2OAZA 1IKPA 5D4RA 3B5LB 1POQA 2R0FA 1GNZA 3G6EI 2D3SA 4HDUA 4U2AA 2P37A 3I64A 3AP4A 2G9WA 1AL22 2NVXJ 1Q8OA 3DV8A 3QU6A 1ENRA 3F8CA 1WW6A 2XMLA 4LK1F 3G1MA 1T8IA 1WJ5A 4D7YA 1MEC1 1W6OB 1NH3A 1AYM3 1LE8B 1EPZA 3CO6C 4IV3A 3M3OA 3RFRA 4P96A 1CZSA 2GMPA 3IBMA 1ENSA 4LULA 2QSGX 4Q0UA 1W0OA 5I0RA 2O0YA 4LE3A 5LFAA 1J59A 5L7OA 2O14A 2HVSA 5E3MA 1MSFC 3OPWA 1PNFA 3ZLIA 3P5JA 3KT1A 4M72A 4BJ6C 4ISQA 4V2VA 5HNFA 2W82A 1DP3A 4LHSA 2PAMA 3OGVA 5A3UA 1S2EA 5FREA 5IVBA 1HQNA 2CYYA 2GNBA 2ID6A 3VKFC 4PDWC 5EGOA 3MDPA 1Q8VA 1XDSA 4INDA 4P5YA 5LA0A 1RUI1 4K3UA 2Z2SB 3K2AA 1Z7S2 3DF0A 4IEPA 3VKNA 1V9U1 1MH3A 2E1CA 1OOPA 3WF3A 4COWA 3HHHA 4KWUA 3P9IA 1H4HA 5CFCB 1VQ4I 1WA4A 3F6VA 3KB5A 2HTJA 1UMIA 2J5OA 1AYN3 2QLZA 4BIOA 4I3PA 2IVMA 1YTYA 2NVQJ 1RMU1 2KKOA 1TBXA 4AFBA 1Y3TA 2WADA 1ZLJA 2D6MA 2RQPA 5LA2A 3K4JA 1DU0A 4XNFA 2EVXA 3MKLA 1W6NA 3ZR6A 4WBBA 3TNPB 2I8DA 1D0ZA 2ZABA 2FDGA 5F04A 1RIOH 3WG1A 3OY8B 2L9SA 2CJJA 3FISA 1Q5OA 3OYNA 2DYCA 5E8AA 1AX2A 1F5FA 3TOAA 3RZDJ 3H5NA 1AJKA 3K4NA 3H42B 2VOOA 3K2ZA 2XPUA 4LBOA 3VFZA 1FY7A 4XRFA 4QQ2A 5B4XA 5F1RA 1S1AA 2ORXA 1R71A 3LCPA 1U9NA 4CICA 1W04A 3H8UA 1BQPA 1ALYA 4FXKB 1FMD1 3W5NA 4AFAA 3RJPA 5A80A 2L4MA 3FIWA 2QQPA 4XJ9A 3SYTA 3C8XA 4OAZA 4UVBA 4C30A 1Y9GA 5FKCA 1NCRB 1EV11 2LOOA 4BM8A 4N7IA 1PGL2 2R1BA 1N25A 5HXVA 1W8TA 4N43A 4UB8C 2CH0A 1PK6B 2PI0A 5EG0A 1VBE1 3N36A 4UW3A 3OL4A 2RQQA 3DYMA 1CD3G 2QQKA 5HDKA 2L7MP 4JZRA 1VBC1 4V2WA 4XM3A 2VMHA 1S4CA 4ZJZA 3GHMA 5FZ7A 3WG4A 1D1CA 4DYCA 3ZFEA 1W8FA 3FLPA 1Q3EA 4RGGA 3EHKA 2OA2A 3KEOA 2VCBA 2WAAA 5BNNC 5E1XA 4UF0B 3H1WA 2UWAA 5KC6A 2RJ2A 5ICGA 3SCGA 5DS9A 2ZCWA 2E2HJ 1YXWA 4IEJA 1FOD1 5L9RA 1F4HA 3POGA 1LRHA 3ZXKA 4B1LA 1XYNA 1XX5A 2EFQA 2GXGA 5FP4A 2F6CA 1AKHA 3OB8A 4QX5A 3APBA 4IEYA 4UFIA 4IXAA 4OFGA 2FMLA 4QKFA 2LC2A 3GTOJ 4H0EA 2EALA 4EROA 4IRHA 2PHRA 1ODMA 1CWPA 5EYXA 5F0HA 2VOVA 1YX3A 2OTLI 4XIDA 1KD7A 1RUNA 2ZHNA 2YB7A 1OUSA 1Q56A 3WHBA 3HAGA 1HC8A 2DTZA 4XBQA 4LHKA 5D6FA 4LOCA 3SEZA 4CCOA 2E63A 3T2TA 2PJPA 1K12A 1HXS1 3S57A 1ZBE1 2DODA 2HEWF 4RFT0 2DUOA 3CC2I 4DUXA 1XD7A 3KWVA 1UXZA 3ZXGA 3WOGA 3AMQA 2MYSA 4HX4A 1X19A 3M8LA 5I0TA 3NJZA 5EIYB 4DB5A 1OYWA 2CV0A 4XPVA 3KV9A 3ILFA 2R30A 5G04L 2CQKA 4MGTA 2IS1A 2GNTA 4RD7A 2AXTC 5C8WA 3B73A 1RUD1 2EV0A 3WINE 4JRLA 1J58A 3MIFA 2XJRA 2IP2A 3CCSI 3GWZA 3OOPA 3R4KA 1HJGA 4HNTA 1DU6A 3F8BA 2BOLA 1IJWC 4N4OB 1S6LA 4XFFA 4Q26A 5FBZA 3V65A 1S55A 1W9WA 4NWWA 4EVIA 3U1KA 5L3DA 3ZPYA 4HPKA 4PQ9A 4JP0A 5DAVA 5K1YA 3ZOBA 3ACLA 5JHUA 4ON0A 2ZGMA 1T98A 4BQ1A 2FE3A 1SC7A 3AYAA 3K70D 4CP2A 1HDKA 2V1UA 1FV2A 5FXWA 3IKTA 2CV1A 3WTVC 1L3LA 2WO7A 3K77A 4YPJA 1VQNI 4C91A 2GP3A 3ZSKA 4FP2A 3B01A 4GA9A 3OL3A 4HF1A 4HF0A 2IRFG 4PJNA 5FPAA 1O7FA 5D8LB 2VR4A 3BZ6A 4GFBA 2FOWA 3F8MA 2NLRA 4XLHA 4KISA 4HF2A 4MFEA 3RI4A 1I5PA 1GVJA 2DAOA 5F64A 1RUE3 1PK6A 5D5VB 1TQ5A 4N43B 5DG1A 4DGWB 5FLXZ 1NCRA 4YVWA 4AAXA 4AD9A 3KP4A 3NV3A 1CIWA 4CDQC 5I0UA 4FFFA 3ML6A 3GF6A 3J7MA 3OYKA 4BLJA 2FDHA 5FR3A 1RC9A 2WNEA 3MHZA 3ZRGA 4FFHA 1US2A 3U2RA 3S3OA 2VN2A 3T2PA 5FZ1A 1WJEA 1K61A 1UO9A 2M30A 4M4PA 2OA4A 2GC1A 4XOGA 2A6ZA 4RM2A 1V6MA 1JZ7A 3BG5A 3B6CA 1RUC1 5GAGJ 1UD1A 4D7MA 3LSKA 3Q0WA 3BZKA 3K75B 3DEWA 4PI0A 4Z8BA 3VBFA 4Q4W1 5DDJ1 3S2DJ