3N4MA

E. coli rna polymerase alpha subunit c-terminal domain in complex with cap and dna
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
203
structure length
203
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation/dna
molecule keywords Catabolite gene activator
publication title Combined structural model for a transcription activation assembly
rcsb
source organism Escherichia coli
total genus 63
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3n4mA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3n4mA01
4O5VA 4ONUA 3GLXA 4IRIA 3JAMZ 2V9VA 4IESA 4Q0UA 4GULA 3J81K 5FPXA 3RPUA 4EJOA 2BNOA 2P6SA 1LR5A 2MH2A 4G8XA 5DUIA 1YIOA 4TLFA 2Y0OA 1CAUB 4MZUA 5KHKA 2NS0A 1USTA 2HYGD 3FM5A 4WXHA 2EFWA 3MAJA 4LUMA 1H1IA 2HKXA 4EWAA 2Y75A 4A5MA 3EJKA 1ZLKA 3F6VA 1H9GA 2RKHA 3OV8A 3SCGA 1EH7A 2JTVA 4I7HA 3RTRA 1XE7A 4HDVA 2UY8A 1MDMA 1Q5OA 3VHRA 3L09A 2STWA 4HVQA 4Q29A 2H6CA 1D8KA 3GX4X 3L00A 2D93A 3GFLA 4M74A 1I5ZA 5KHJA 4OU0A 2ELHA 1CAXA 4G7ZF 5CU1A 3I64A 3O2PE 1S6LA 2NAZA 3HRMA 2MD5A 4R52A 4BAYA 1KQ9A 5FQ0A 2QENA 3AAFA 2EFOA 2ISZA 3HRTA 3ROUA 4A6DA 3RYKA 1KU9A 5ILSA 3WTWC 1R23A 3SQNA 4NVPA 1XSXA 3TO7A 4L9VA 5E1XA 4KNYA 3DL3A 2XROA 2IP2A 4WX9A 4IEWA 1OYWA 2B8MA 2XKPA 5E1WA 1QGPA 3BROA 1ZZ6A 2IXKA 2XVCA 3MEXA 1WGPA 2M5WA 3LQQA 3P9IA 1HW5A 1ZZ7A 2MA3A 3TKYA 3EBRA 3IKTA 1LNWA 5BY5A 4AVCA 2X0LA 2FNPA 4PZJA 1JE8A 4ENKA 4XSXF 4LB6B 3DQVC 1QWRA 4KDPA 1A04A 5DUKA 2R7DA 4KIGA 3RKYA 3RYRA 4MEXF 4ETSA 2IXIA 1UPIA 4A5NA 4L0ZB 2VOOA 4UVAA 1T98A 2ESHA 1UIKA 1BM9A 4N9HA 5I0UA 3PLQA 3CF6E 3BPZA 1YG2A 4HMZA 1FWZA 3QP5A 2NNYA 4HSLA 4QGNA 2Z9OA 5FCCA 1O7FA 3V8KA 5BS6A 4RAZA 4Q5SF 1MJ9A 3KZYA 4GCVA 1RGSA 3FZ3A 3F22A 4MQVA 3KMHA 1ON1A 2BE5F 4AXOA 3FF5A 3I4PA 2IXLA 2O61A 5HDKA 3MPBA 5HVQC 4KU8A 5C8WA 3ABUA 4MGZE 1FP2A 1W7PA 2F4PA 2XLGA 2ADUA 3IBMA 1HSTA 3KE2A 1OYYA 4JBAA 3MZYA 1ZZ8A 4I0BA 3H7YA 3SMHA 3L7WA 4I09A 3FWEA 3F23A 4FX0A 4A6EA 3OCPA 4MQ9F 4XF9A 1FNNA 5LGUA 2PMHA 3HT1A 1NE6A 2A6EF 2P5KA 4ESBA 1WKMA 5AVPA 4ZYGA 4LG0A 4U0VA 1DDNA 4BNCA 4NQWA 2ET7A 3VFZA 3K9TA 5TJJA 4ZZDA 2F5DA 2UXNA 3J80K 2Y0MA 4LMYA 1ZRDA 4XFHA 1BJAA 2VBZA 1YLLA 2IPQX 3OTFA 3HSRA 1FBQA 1J9IA 3WGGA 1U12A 2IXCA 3CO7C 5K5QA 4DQ2A 3DEUA 1D3YA 2HQNA 1QXJA 2UXXA 5ED4A 2VE9A 1O3TA 2W85A 2P6TA 4RS8A 2OA2A 2ZMEA 5FGMA 5I0RA 1CF7B 4XLNF 3HOSA 4P55A 3ML6A 1J59A 3KLOA 3RNSA 1SFEA 3LA2A 2QCSB 2ZNYA 1CAVB 4L5JA 2HZTA 2GC1A 3C3VA 4IF4A 1IN7A 5HI0A 3JTHA 3QPHA 3P9KA 3CLPA 3TQNA 4LLNA 2VBXA 1J3QA 2ZKLA 5D5VB 3IWZA 2RVCA 1VJ2A 1BIAA 3BPXA 3FXRA 5BV6A 1MJBA 1STZA 3QRFF 1XGNA 5BXXA 4UBGA 2FU4A 4L11A 4EJUA 4Q4ZF 3ULQB 3V4GA 1B1BA 2E7XA 1JHHA 5JR3A 3HTSB 1O4TA 1OD5A 1YQAA 1W4MA 5JAXA 4YRDA 3F3XA 2MPFA 4LFUA 2XKOA 4UNOA 2FMYA 3HT2A 3KCCA 1U5TB 2ZCWA 3MFKA 4K8FA 3K2ZA 1YW9A 1UCXA 4HN1A 3FMRA 3TNPB 2HWVA 3M8FA 3I0TA 3JSOA 2GH2A 3RYPA 5K5RA 2DO7A 2VECA 1LVAA 1R00A 1YS6A 4I02A 4GYIA 2KJCA 4M6XA 2Q8KA 4S04A 4I01A 4KN7X 1EV7A 4XFGA 2LSOA 2IW5A 1ZLJA 2GU9A 1ZZ9A 1V3FA 4ENMA 2IRFG 4XFBA 5H6RA 3BALA 3V7RA 2YSRA 2OU2A 2LDUA 1YFHA 1J1LA 2ZJ2A 1YUDA 3CO6C 4B29A 3J81Z 1OKRA 1QPMA 2IVMA 2PI0A 1EYBA 3WE3A 1XGMA 5FFZA 5J48A 4L9NA 5E1ZB 1OYIA 2AXLA 1GHCA 2QDRA 3G7DA 3VODA 3H3UA 4HF1A 1F5TA 1FC3A 1KU3A 2GIVA 1XCBA 2GAUA 3K1MA 4XEZA 3CUQA 2IC1A 1F1ZA 2XAQA 4CYDA 1TW3A 2IA0A 5L3GA 3HQXA 3TGNA 1SAXA 3SFZA 2ATFA 2O0YA 1UFMA 3DXJF 2B5HA 2LF8A 3K1NA 3Q9VA 4IEPA 4Q0PA 4OFGA 2V1DA 3LOIA 3EYYA 3DPTA 5JFRA 1UCRA 3LFKA 1MDMB 4L2NA 3CL1A 5DCMA 3ZMDA 4H7LA 3LZZA 2ZBKA 4MGIE 4Q0SA 1S7OA 4EGYA 5L3EA 2BNNA 3IDBB 1KYZA 2EV0A 2E1NA 3VEPA 1P4AA 2XHKA 1B9MA 3HOTA 2EB7A 3HRSA 1MJAA 1GXQA 2ACJA 5FB2A 4JQFA 2QBYA 5JSPA 2MHFA 4A0YA 3E5UA 1G3SA 1JHFA 2Q0AA 3PVBB 2P4WA 1KQ8A 1DZTA 3SXYA 4GXOA 2D1VA 3WTSC 1F9NA 2L4AA 2AS5F 3ELNA 2EA7A 2DT5A 1ZG1A 4LK0F 1H9TA 1MZBA 2EWNA 3WTVC 1K78B 1ON2A 4HAMA 4YYOA 2QWWA 4Z2YA 4YFXF 4HDUA 1QBJA 2DU9A 4HLXA 3E6DA 2VC0A 2HFHA 1PP8F 4ESFA 2QVOA 3IRRA 1XGOA 5EZWA 5LHIA 2DQLA 1HSJA 2H0VA 2FRHA 1X3UA 5E8IA 3NQOA 3C7JA 4GYGA 5HLIA 4HX7A 3LAGA 4A0XA 1ZRFA 5LLQA 1FYLA 1K7AA 5FDBA 2F5FA 3REOA 1D5VA 4UHTA 5L3FA 3WTXC 4FAGA 3F8BA 2GXGA 1U8RA 4GGGA 5BPIA 3H1WA 4KWJA 1LB2A 1XB4A 3IDCB 3I5UA 4JK1X 2QUFA 1TNTA 4EM0B 3TDUC 3HSEA 1FZPB 4O9GA 1NHAA 1SMYF 3N97A 1U6GA 3GO5A 5FO5A 1V70A 3KGLA 4KIBA 4J1WA 4KYWA 5DD4A 2YX7A 3BJ6A 5KHGA 3D5LA 1PMIA 3MCZA 4M72A 2QQ9A 2QQAA 2QM3A 1BI0A 3DV8A 5D8KB 3WTYC 4FT8A 4F8AA 1IRFA 1BIBA 2CFXA 2VPVA 1UB9A 5E1RA 2PAMA 2PMUA 2HS5A 5LEJA 3WTZA 3SCHA 1YFYA 3V8LA 1TTYA 3EYIA 4L9TA 5ILUA 2FOKA 3DP7A 5DEQA 5F1RA 1R1UA 3ES1A 2M30A 1BI3A 6PAXA 2NNNA 3GWZA 3KEOA 4I3PA 2W24A 3QU6A 2FQPA 1REPC 2B0LA 1J7KA 2K4JA 5EFUA 4UV9A 2ZKZA 3HHHA 3WG9A 1S8NA 4E2QA 3LAPA 4RB1A 1C0WA 2O6GE 3O3KA 2XASA 3ISPA 2DLLA 3RDIA 4OOIA 2NRAC 1DPUA 5CJ9A 3TOBA 5D5WB 2LF7A 4AIKA 1I1SA 2ZXJA 5E17F 3IWFA 3V7CA 1DUXC 4LTAA 4FHTA 4LB5A 1SFXA 5BUVA 1PUEE 4Y13A 1J2XA 2M1BA 3LA3A 5BOXA 4XBFA 3WU1B 4LA3A 3KP7A 1ONVA 4OINF 2P17A 4META 2VE8A 4KUMA 4HW0A 4P96A 1MKMA 1P6RA 4I2OA 3KSCA 4MGKE 1ZG5A 2O8QA 1QNTA 5E18F 2RGVA 2Z5UA 3I59A 2GXBA 2CW0F 3EQEA 1SD4A 2OPKA 4EWEA 3CUQC 2V79A 3N4MA 3C3WA 3MWMA 4HBLA 5I8YA 2FBIA 1NE4A 2QZ8A 4CZZA 3F8NA 1HKTA 3EHKA 2A61A 1O3RA 2V6CA 4ENJA 5D4SA 4IPAA 4AVAA 3D82A 4OLLA 2FF4A 1T6SA 4EV0A 4Z82A 4HA8A 3BOQA 1XN7A 3EUHA 1O7LA 4M73A 1LEBA 1BI2A 2A3SA 2PHDA 3SCFA 1IN4A 3VB2A 2D5HA 2E9QA 3E6BA 1IF1A 1ZRRA 4G7OF 3D0JA 3WGIA 2E7WA 2BNMA 4HLTA 2HDCA 1TQPA 3GW2A 4M9ZA 1DZRA 2D40A 1KA8A 1Y9QA 2PEXA 3E3VA 2KXLA 3KP2A 1BI1A 4WXDA 1DPRA 3K69A 1FI2A 3PNAA 5E20A 1I6XA 1NXMA 2IT0A 2QJVA 3U2RA 4XSZF 2KIFA 1LEAA 3SZTA 3HTUA 2D45A 1O3QA 2GC0A 2OD5A 3T0YA 1FLIA 4MGRA 1G3TA 5AIPA 3R61A 1L3LA 4HYEA 4CXFA 1WI9A 4MEYF 4IEZA 1IN8A 5A2QK 4U7BA 1RTVA 3UKVA 3M1EA 3S7IA 4L5IA 4HBNA 2Q30A 2A69F 1TW2A 3QOPA 4LJZF 1LJ9A 1G4DA 4BHPA 2A5YB 1IPJA 1YFWA 4DINB 2YU3A 3MZHA 4OMYA 2L02A 2N7GA 4D7SA 4YSFA 4JTNA 3ELKA 4DNCA 3FHIB 1O57A 3F8MA 4EWDA 3LA7A 1YHFA 1KU7A 1FOKA 1FBSA 2JPBA 3V8JA 2LNBA 5LBQA 4YG2F 2VN2A 3I54A 5HS8A 1ZVFA 4RGUA 3F6OA 1XD7A 1R1VA 4IJAA 5CVUA 1SFUA 2YPRA 4D0PA 1T39A 5I91A 5ICCA 1YFXA 4HX4A 3KZZA 4IVNA 1W5SA 4PGHA 2PG4A 1UIJA 2IXHA 2G7UA 1ZNPA 2PAEA 5FLXZ 1YW7A 5LRSA 1OPCA 1XSDA 3H1YA 4U88A 3JAMK 2C6YA 4QM8A 1J5YA 1FYMA 1SD7A 4O6JA 2I45A 5J8CA 3E6MA 3TO9A 4LLOA 3Q5FA 3O6BB 3ZP5A 1CAUA 4KWLA 3ZMVA 4ZU7A 2XAHA 1EH6A 4MUVA 3CTAA 4XFFA 5CVIA 5BPDA 3E97A 3GUDA 3KFWX 3M9AA 4LULA 2KIMA 4HX8A 4UBHA 3KEQA 4MV2A 5FFXA 5ICGA 1OI6A 2UYAA 1AOYA 4M9XA 1GVJA 3T1BA 5D5XB 2P8TA 5JR7B 4XF0A 3S7EA 4L9JA 1ODDA 4HLYA 5AIQA 3BP8A 1RZ4A 5DYMA 1Y3TA 3ABTA 2P7CB 3V7SA 1RUNA 2ETEA 3U0ZA 2EFNA 1X7NA 2VBYA 5EEHA 1H0MA 2PTMA 2XLAA 2PQ8A 3LWCA 5D1IA 2HYFA 4KFCA 1WRJA 2UZKA 5LRRA 3FX3A 3U1DA 1BN5A 2BBYA 5HDGA 4XFAA 1SEFA 2PFBA 3L2HA 1CAWB 5CVVA 1TLHB 4HVOA 1FYKA 1Z05A 2G7HA 2WWYA 1ZGJA 3R0AA 3MDPA 5CYVA 4PGGA 5E16A 2XAJA 4IEUA 2HGCA 2J5PA 2WTEA 2O8XA 1ZX5A 3H7JA 3E5QA 1J3PA 3FJSA 4IETA 4LLLA 1QY4A 3DFGA 4PCQA 1PM7A 2K27A 2G9WA 5JVTA 5TRDA 1E17A 4HN0A 3GVAA 2R3SA 5H6QA 5CVRA 3IKVA 4D7TA 4M6YA 1K6OA 1JXSA 4FBFA 3ZPLA 2QNKA 4QWQA 1IXRC 1FXZA 4EM2A 2CAVA 3FMQA 5DDGA 2CO5A 3NKTA 1Z91A 5CADA 2GC2A 4QXKA 1SD6A 3SHFA 4QGMA 5BMZA 2D2WA 3DF8A 4BIFA 2F5EA 2ZFWA 3ST7A 5BQTA 2QVSB 4F7ZA 4IEXA 1R7JA 2FBHA 4IRGA 2VOPA 2FEZA 3DPLC 3R4KA 4MTDA 5J3UA 3JSPA 5DD8A 3ZQ7A 1E2XA 4PIXA 4P9FA 4RGSA 1LQ1A 1YWKA 5JSOA 4HQEA 1CAXB 1RI7A 1EP0A 4QX5A 1XCVA 2PA7A 1S29A 1KQ0A 3K0LA 5ICFA 4PJYA 3TO6A 5FQ0B 1T2KA 4RB3C 3GYHX 2M87A 3CJXA 4I98B 4EJVA 1ZARA 3ZMUA 2CYYA 2V1XA 4YARA 2K0GA 1D8JA 2FNAA 1X82A 2EAAA 5JCTA 2L4MA 5FD5A 4LGWA 1Q3EA 2L54A 1O3SA 1S3JA 1R5HA 1GQHA 3BJOA 2MLKA 4ORFA 3DN7A 2DPDA 3IC7A 2EV6A 3S0MA 2FSWA 1K79A 1H1MA 4HF2A 1TQMA 1Y0UA 3U11A 3UKNA 1BC8C 2OYZA 4KICA 1W7PD 1FP1D 1MD0A 3HHGA 1T38A 3KP3A 4YFNF 2UY9A 4OIQF 2XV4S 2P5LC 1XMAA 4MHGA 1F4KA 3F72A 1CF7A 1XSVA 4BHCA 2Z2SB 5KVRA 4Z07A 2TDXA 2VBWA 2DK8A 5FLJA 4ASNA 2MNGA 1CAVA 5ICEA 1S7AA 4G6QA 1P4WA 4WVZA 3M8EA 4LLGF 3RKXA 1O5UA 4RD7A 4ZYEA 3OGJA 2HKOA 3ERED 3R6SA 2JZYA 3BB6A 2DBBA 4G9YA 4G6DA 5A2QZ 1J3RA 4MX3A 2K4BA 3TDZC 2CV6A 2Q1ZB 2PN6A 3KLNA 2OA4A 5I8SA 2QYOA 3KP6A 3HSFA 4HV6A 2Q4SA 3QACA 4UVCA 1UHMA 1XRUA 5C6CA 3H50A 1KGSA 1W7PB 1Q1HA 3S2WA 2EVXA 3GFMA 3JZVA 4IHSA 1ZAOA 2DPUA 4ON0A 2IJLA 3ECOA 4R1HA 2RNJA 1ZZBA 2XUBA 1YFUA 4EROA 2VT2A 2GQQA 2W57A 4B09A 1U5TA 3C1DA 4ZH4F 4A2UA 1IW7F 4E70A 3E6CC 4M9SA 1WSUA 1VR3A 2OZUA 4LG0B 2PYTA 3F8FA 3WW4A 2Q2EA 2ETHA 3GF2A 2O3FA 3FM3A 4BH9A 3IL2A 1LDJA 3K1PA 5FPZA 2L01A 3J80Z 2GZWA 2VODA 5L3DA 5L3CA 1HXDA 1WWXA 3BY6A 4ESJA 4M71A 1OFNA 2QLZA 2DK5A 5K5OA 3NSTA 4ZZLA 2V09A 1ZH5A 2H6BA 4PDKA 4EMSA 4QMAA 4E2GA 2ZMEB 3USSA 5DCFA 5EEGA 1IZ1A 3QP6A 4P5OA 3WTUC 1QZZA 2STTA 5F6FA 1TQIA 1B59A 2COMA 1KU2A 2XAGA 3CO2A 4HOBA 5H20A 4AIHA 3E5XA 2PHLA 4HV5A 4WWCA 4UV8A 5DV5A 2XLFA 4BHBA 3I53A 3ZMZA 2MH9A 3FZVA 3W6JB 3HYIA 2JSCA 3OF1A 3WE2A 3NJZA 4LA2A 4XFCA 4XLPF 2HR3A 2X4HA 2XIGA 2DTRA 3FXUA 4AWXB 1YW8A 3LWFA 4AQ2A 2VT3A 1Z9CA 3KGZA 2YR2A 3CUOA 2A68F 4EJWA 3WU0A 1G6NA 4CO8A 3P9CA 1HW1A 3Q9SA 3TOAA 2M45A 3NEUA 5CLSA 5HDNA 1USSA 1XMKA 2WV0A 4CHUA 5I93A 2P5VA 2WFPA 1B6AA 4P9UA 4X6QB 5FD6A 4MH0E 3FXQA 4XRFA 3H3ZA 4LUKA 5ILVA 5K8SA 4XF4A 1FX7A 3T5XA 3I58A 2EJRA 2P7VB 1X8MA 2OZ6A 3BZ6A 4CGZA 2J5OA 3DKWA 2OQRA 3J7AO 3ACLA 3BJAA 1J58A 3BCWA 4L0YB 1XE8A 1ZHFA 4KMFA 1FSHA 1CGPA 2UYBA 3D0SA 4JTOA 4WZCA 5HLGA 2IA2A 2JRTA 4EQQA 4QM9A 2M8EA 1ZGAA 3IIAA 1Z6TA 3MYXA 2K7LA 4HQMA 1K78A 3EO6A 2BEOA 4AIJA 1IN6A 5JI6A 1LDDA 1HW2A 1WA4A 3ZN1A 2MLGA 3R0JA 2Q0OA 1JUHA 3M3IA 4S05A 1G3YA 1AWCA 5KK1A 4HVRA 5I0TA 2HQRA 3CUQB 3JW4A 5LEKA 2O1QA 5KBFA 5D4RA 4CICA 3FE5A 5HOOA 3H1MA 1EH8A 4Q47A 3ZMTA 3GXOA 1HKSA 1LKNA 4YIFA 2OAZA 2Z3YA 4RGRA 4YNIA 3F8CA 2L3DA 2XRNA 4XETA 5I0SA 3NL1A 1MGTA 1DGWA 3HIFA 5AONA 4LEJA 1W5TA 4IEQA 2OBPA 3LQRA 2ET1A 4AQ6A 2FBKA 1FY7A 5JHUA 4IEOA 5DCMB 1Z1DA 4N0BA 1DGRA 2ZNZA 1GXPA 3U10A 3WW3A 4OIRF 3W6KB 3NW4A 5IT9K 3C18A 1Z7UA 2Z33A 2K9ZA 2DW4A 1J75A 3H8UA 1RIOH 4U0YA 1TQ5A 4HF0A 5D5UB 3VOEA 2QBYB 5L3BA 3HUGA 4JVAA 2ISYA 2FMLA 3OD0A 2XGXA 4UXNA 1J0RA 4WBBA 1RNLA 3CEWA 4BYYA 1QXRA 3L2CA 1SQ4A 1X8EA 1IAWA 1U5TC 3ZN0A 2VONA 5HLHA 4KWKA 4EM1A 1RC6A 3KP5A 5IT3A 1UHWA 4G7HF 4QLCU 2MBFA 2FA5A 3R60A 2H09A 3U9GA 2PQQA 2KRFA 3QU3A 2F5CA 3RI4A 4EGZA 5J8FA 3H9AA 3GZ6A 4BXUA 3EETA 1IXSB 5LGTA 2EFPA 1P92A 2ZO4A 3BWGA 3QAHA 1QO0D 4EJTA 3ES4A 4MNUA 1DP7P 2HTSA 3GZ5A 4RAYA 1O5LA 4YIIA 4WCGA 1TBXA 5K1YA 3F21A 2WC2A 2XL7A 4JV4A 4Q0QA 3I7DA 3PFIA 3ZMSA 1G3WA 1GQGA 3H92A 3LAJA 5D6FA 4ZYHA 2CAUA 1VP6A 3TNQA 4ZU5A 2C0ZA 3ZDSA 2HTJA 4R79A 2NYXA 4G94A 4UXAA 4FX4A 2CWEA 4WF2A 5FLIA 2Z69A 2RC4A 3WTTC 3G73A 4P9GA 2EA2A 1FPQA 4KU7A 5D6EA 1YLFA 1I27A 3BDDA 1R58A 4NB5A 2K02A 3GFIA 2D5FA 5J7MA 1QQIA 3JTGA 4FAHA 1WQ2A 1OR7A 4U7DA 3CLOA 4LD5A 4KA4A 2BGCA 3SHRA 2ESNA 4BQAA 3NVCA 2XL9A 1L0OC 4KN4X 4B8XA 3GYDA 2V1UA 1YO5C 4IEYA 3LSTA 5F64A 2CQKA 2H94A 3WW1A 2Y48A 4EVIA 2PFWA 1BOAA 1P4XA 3O14A 2EV5A 2JT1A 1B9NA 3IHUA 1ULYA 4OIPF 4TV7A 2VC1A 1IUYA 1ZZCA 2FE3A 5BPXA 3UKTA 3HRUA 4Q0VA 4UVBA 1SMTA 3MQ0A 2PAKA 1KYWA 2KKOA 3WGHA 4I0AA 4R8HA 1R22A 2DI3A 3RKWA 4J1XA 4QGLA 1BC7C 2OZJA 2GA2A 1UD1A 5FLHA 2BV6A 4KMUX 2CG4A 2KJBA 2Z99A 1IRGA 1L3JA 1HKQA 2K86A 2A6HF 3GBFA 2PJPA 1ZREA 4E2SA 1FSEA 2RDPA 5CVJA 4ZU4A 1U3EM 2IA1A 1Z6RA 5ERIA 3T8TA 1B4AA 2HJIA 3NRVA 1TNSA 1R1TA 4A12A 1YYVA 4KL1A 3IRQA 1PP7U 4N9IA 4ZYDA 1OMIA 4AVBA 3I59B 1LDKB 4XF1A 3EQLF 1YTYA 2PLYA 3PQJA 4KIFA 1ZYRF 1PDNC 1IXCA 2GA1A 2A07F 2DCTA 4NHJA 4A0ZA 3WW2A 1FT9A 4XFIA 5J6XA 3GEZA 5LHHA 1IN5A 2F2EA 4L18B 2LKPA 2GC3A 4ENNA 3KP4A 3RZZA 4PIZA 5LGNA 3ETQA 1VTNC 3BU7A 2EFQA 2HEOA 1ZN2A 1XDSA 1R5GA 1NZCA 4AVPA 2HOEA 3FMSA 2OQGA 3L9FA 4LK1F 3P7NA 4RB0A 4AD9A 3WODF 4IHTA 4H0EA 4MGYE 1ZRCA 2EA4A 2DFIA 5HS9A 1HBXG 1RL3A 1T0FA 4HZFA 4KT5C 3SZPA 5D8LB 5LHGA 3COAC 3CDHA 5FLXK 1QZYA 2DQRA 4IRHA 5I8TA 1UW8A 2CSOA 2YX4A 1WLTA 1EPZA 2DAOA 5JSRA 3EDPA 1SFNA 2O03A 2BYVE 1U78A 4WK8F 4HSJA 3M70A 4O3MA 1U2WA 2H27A 4CDGA 2IXJA 3SXWA 2PBIA 2W25A 2R7FA 1I1GA 1NYWA 3GFJA 3ECHA 4IXAA 1V4RA 3B73A 3QPTA 4GO1A 2UWMA 4OMZA 2RQPA 3RJPA 3BPVA 1XDUA 1FBUA 2FXAA 2QQBA 4OIOF 4PIYA 3OOPA 1Q43A 5KHIA 5KHHA 4UUVA 2RV8A 3RPQA 4Q48A 2EK5A 5E8GA 1LRHA 1IPKA 2B9UA 1P2FA 5T3NA 4YFKF 3T8RA 2RN7A 3I71A 4XF3A 4Y17A 3B02A 4X6RB 1SD5A 3G3ZA 4IERA 2VXZA 1CX4A 5HS7A 3FFQA 1XGSA 2KIUA 4K2EA 1YS7A 3PQKA 4IEVA 2CGPA 2W84A 3FHZA 3M7GA 1JGSA 4U0WA 4WXCA 2MC3A 5IT9Z 3RIRA 1BBYA 3KETA 2GWRA 1R36A 1RUOA 4RB2C 2VQAA 2JPCA 3CJNA 4MTEA 1CAWA 1HQCA 4O9EA 4Y15A 4RGXA 2XAFA 2FQ3A 2E1CA 1EY2A 2D1HA 1ZG3A
chains in the Genus database with same CATH superfamily
3CCYA 1HIXA 1Z67A 3GLXA 4XQ4A 4GULA 3RPUA 2BNOA 5FV3A 3POEA 1LR5A 1VAMA 4CEWB 1SAUA 4IV3A 1OLRA 1YIOA 1EKEA 4RA0A 1CAUB 4DBRA 5CISA 2NS0A 5FYSA 3K4BA 2HYGD 4OVEA 3TP3A 2EFWA 5HV4A 3THDA 2YYOA 5H9PA 4NHYA 3HXLA 2IVIB 1CD3G 4D0QA 2XQXA 2VIXA 3GZAA 3EJKA 3F6VA 3POSA 1H9GA 3SYTA 3FC0A 3SCGA 2PLV3 5J96B 1EH7A 1OURA 3RTRA 4HDVA 3Q9OA 3DEEA 3ZFGA 1RYYA 4EN7B 1PK6B 3VHRA 4Q26A 3AYEA 4HVQA 4Q29A 1PVC3 4YVWA 3OIQA 3DBRB 2D3RA 3GFLA 5KHJA 3WHCA 3DUIA 5CU1A 3I64A 2NAZA 2MGQA 3HMYA 3LNQA 5ISLA 4BAYA 2QSGX 3R0RA 3AAFA 2EFOA 3P5BA 3ROUA 4A6DA 2FQ4A 3OSGA 4AGRA 1KU9A 1UU5A 2KIQA 2EIMH 1AL0G 1ODMA 3EB7A 5FPUA 4V2GA 1VQLI 3PMEA 4QKDA 4DEVA 4IEWA 5K7HA 2VZRA 5AC91 3BROA 4I30A 5LK5A 5FZAA 3MEXA 1HW5A 1X33A 1RUH3 4HT1T 2MA3A 1LNWA 4AVCA 4J6GA 2HWF3 3A4CA 4PZJA 2DCEA 3KV4A 2XONA 1HLCA 2BVBA 2UU8A 4Q4W3 1QWRA 2FD8A 1T0FC 1A04A 1C8NA 2R7DA 4R9AA 1MR5A 3ZKYA 2DA7A 4KIGA 4BXSV 4MEXF 3OPTA 2NZ9A 3B9IA 5FRNA 4L0ZB 3PHMA 5IVYA 3M3CA 4C91A 4LQRA 4AGVA 5BNOC 3N9QA 4A3MJ 3WG2A 2ESHA 1BW5A 1BM9A 4N9HA 2QCOA 1AUYA 4QDSA 1XB9A 3BPZA 1OVPA 4CZSA 1R64A 2NNYA 3JRAA 4XBLA 3OUHA 1NLQA 5EWSA 5IW0A 4RAFA 4IZZA 3V8KA 4RAZA 3VBHB 5IOZA 4MQVA 3DECA 3ZXKA 4AXOA 3I4PA 1IG0A 1VQKI 4MGZE 1IJWC 5H2FC 3I49A 1A6IA 2FDHA 3I4MJ 4E8DA 3SMHA 3H7YA 2YBKA 3L7WA 3VD3A 3FWEA 4MQ9F 1FNNA 3S8PA 1NE6A 2B9VA 3KHBA 1RUC1 1GANA 4PQQA 2UV1A 3MIBA 4BNCA 4NQWA 2L7MP 1YYNA 2ET7A 2EIDA 4U2AA 4ZZDA 3MIEA 2UXNA 2KRHA 3P3PA 1ZRDA 2VBZA 3IN9A 1LHVA 2IPQX 4PBPA 3WCRA 1FBQA 1KGYA 4GWNA 3C8XA 5FZ9A 1U12A 2IZWA 3SLIA 5K5QA 3KF5A 1Z78A 1COV1 2LM3A 1YHQI 2HQNA 4II3A 5FGMA 3OGRA 3NAPC 3HOSA 5JUVA 3TW6A 2ZGMA 4P55A 4P02B 2HYKA 2QCSB 2ZNYA 1PO11 1KJLA 4IF4A 1N47A 4IV3C 2KM2A 2R7SA 3QPHA 3FXOA 5K4LA 3Q8AA 1J3QA 2KDOA 4CDUA 3PUQA 2HOTA 4JCKA 2RVCA 5FY4A 3BPXA 5B4NA 1XGNA 3BR3A 5C33A 2FU4A 3TP0A 4Y22A 4AC0A 2WN3A 4FE4A 1RVF3 2E7XA 5JR3A 3PUSA 4UW5A 1O4TA 1XMXA 1YQAA 2ZEYA 3LSKA 4RMNA 4UNOA 2ZAHA 4BCUA 4HEA2 4E4SA 4HANA 1UCXA 2Q5TA 3FMRA 2DFCA 3DCQA 3JSOA 4V2WA 3M1HA 2MEV3 3UK9A 3KQRA 4AFDA 2DO7A 2W46A 4AAPA 1E3PA 3RZMA 1UJ8A 1R00A 2JA2A 2J1UA 4I02A 4GYIA 4FASD 2KJCA 2X5IA 4I01A 2WY7Q 2VCBA 4K20A 1WVRA 2LSOA 1OH4A 2K3FA 2YBPA 4ENMA 2IRFG 5H6RA 1QKQA 5DUUA 4XTPA 3M2MA 3W58A 2ZJ2A 3FLTA 1YUDA 5FPAA 2JRMA 3J81Z 1GWKA 2Y33A 2PI0A 1X2MA 5E1ZB 2J22A 2ZHMA 3LF7A 2FDIA 4RBOA 3WG7H 2MFZA 4MVTA 2R073 1BMV2 1XCBA 1OFSA 4XEZA 3GXUA 2XAQA 4CYDA 3VBUA 1QDOA 3BG9A 1A31A 4Q4V2 3AZWA 2DU0A 1ZR4A 4ZY9A 2DURA 3KWVA 1QJY2 2JA6J 2KFDA 4IEPA 2YG0A 2X6YA 4OFGA 2ZJPF 3LOIA 3A03A 3DPTA 1NCQB 3LFKA 1MDMB 3AX4A 4L2NA 1AR72 1JXNA 1MNMC 2P4EA 5KAIC 4C0BA 1MBGA 2YY1A 4BY7J 1RUC2 1VQPI 1QJX2 2XUMA 4NWWA 5A7OA 1LODA 4YW2A 3VEPA 1P4AA 1UY2A 1B9MA 1W8TA 4EN8B 5FB2A 4JQFA 4TZDA 2IAIA 1DIWA 2DYCA 2YGLA 4INDA 1G3SA 1JHFA 3GJBA 4XCAA 2OF7A 1SDWA 4AI0A 4GXOA 2D1VA 3D4KA 2EZKA 4AVVA 2L4AA 1H8VA 2BWAA 3TEZA 4FFIA 4WM8A 4LK0F 1HRI2 4CPBA 1H9TA 1MZBA 1ON2A 3WT3A 4HAMA 4X1EA 4YYOA 2QWWA 4Z2YA 4YFXF 3MLJA 2WB1A 1VB4A 2DU9A 2YB7A 1PIV3 1JT6A 2QVOA 1HSJA 4PLMA 2H0VA 1X3UA 4FOVA 4AFBA 3AYCA 3LAGA 5LLQA 1FYLA 2YC4A 4UFMA 5LA0A 2VZPA 4UHTA 2WA3A 2NVQJ 3T0BA 2XRLA 1U8RA 1FOD1 4WV8A 4TSVA 1DQ1A 3MW2A 3I3MA 1TNTA 4A7ZA 1D1CA 1FZPB 3JCIA 1O6UA 1CJPA 4COUA 4A3DJ 2H1KA 2VQTA 1SMYF 3N97A 3IT8A 3GO5A 3H0OA 1FAYA 5DD4A 4P5HA 5DDJ1 1SLIA 4CDUC 3J9SA 2QQ9A 2QQAA 2NS8A 1MQTB 2WBKA 3Q8EA 2VZ1A 1BI0A 3KM5A 4EJRA 4C3IJ 3POJA 3S6PA 1BIBA 2CFXA 3AK0A 5E1RA 2PAMA 2D6PA 2HS5A 1R6RA 4PF1A 1YFYA 3E0JB 4WVMA 4DMIA 4GQ7A 1EV13 5DEQA 5F1RA 6PAXA 5IATA 5KC5A 4Q4Y1 2FQPA 2RS32 1J7KA 5EFUA 1XX5A 2OUHA 2E2IJ 4E2QA 5F3CA 2JENA 2O6GE 4B47A 5D5WB 4RA2A 2JKXA 4F83A 2ID6A 2X5IC 1PVXA 3SEZA 1UF2C 4ES9A 3V7CA 1DUXC 3AKPA 4BQOA 3T08A 1YQ2A 2P81A 2JD4A 2EF6A 3N7MA 2VKHA 2DYRH 5KXBA 4XBFA 3KP7A 1VMFA 3C7GA 1LE8B 3PUHA 4MG2A 1C8M2 1RUF1 4KUMA 4D1QA 4I2OA 1LNSA 1ZG5A 1NKGA 3I59A 2CW0F 2V79A 3ASNH 3MWMA 2WV1A 4HBLA 3THTA 2RREA 3VBUC 1XNCA 3CDLA 2QZ8A 5JI7A 4CZZA 2EXHA 1HKTA 4NJ4A 2JE9A 5ANNA 4ARXA 2V6CA 1Q8PA 4OHWA 2W1OA 1GOHA 3D82A 4MHUA 4EV0A 4BS9A 2VQHA 1O7LA 1LEBA 1VBE3 3POYA 2AACA 2K5CA 2E9QA 3UNGC 3PFYA 3WGIA 3WXPA 4PFOA 4HG2A 2X10A 2ZZJA 2HDCA 3AFGA 1LFUP 3UESA 5FZ4A 1ZBE3 4WXDA 5BNGA 1JW6A 2VH9A 3GZNB 3CC4I 3K4JA 2ZGQA 1HB1A 2A6VA 1YCIA 1P7JA 4XUNA 4QTRA 4GKYA 2OD5A 5GP9A 1KS5A 3S16J 4WM8C 4MGRA 1LHOA 4IEZA 1M4WA 3HNBM 1FOD2 3M1EA 3PUBA 5JVGF 3K2AA 2UWAA 3HD8B 4MO3M 2Q30A 4ANJA 1RINA 2K40A 2A69F 5J4VA 4DIQA 4LJZF 1LJ9A 1TVGA 1G4DA 2WNOA 5FMBA 2A5YB 4DINB 5JZGA 2ZSIB 3ZPOA 1Y0NA 4E7HA 2RS53 4JZRA 1W8UA 1O57A 3WNNA 3V65A 4NRPA 1KU7A 1W6QB 3AC0A 3LSGA 3HQUA 1ONAA 2WADA 2R063 5HS8A 4XUQA 4JX0A 4RGUA 3F6OA 3U14A 1D0GA 3MW3A 4IJAA 5CVUA 4GAZA 2EXIA 3ONQA 2NQYA 3CHXA 4F93B 5L36A 4D0PA 3O0XA 5HNHA 1A6CA 1TMF1 3QCWA 1RUJ2 4M4RA 5FPBA 5A7SA 3HC7A 5LFAA 1YW7A 2Y0SN 3H5RA 2C24A 1XSDA 4FPYA 4DYCA 4LJHA 4NC8A 2C6YA 3I3BA 4JKLA 4D5FA 3FK7A 1J5YA 2VG9A 1W8WA 2BWCA 1TT0A 3Q5FA 2VZ3A 4KWLA 3ZMVA 4ZU7A 1KD7A 5J47A 2GIZA 3HAGA 4MUVA 1ITYA 1Z21A 2V72A 5CVIA 3K4DA 3IH3A 1RUF2 2WAQN 3OYBA 3M9AA 5B3SH 2KIMA 5CKMA 2XJQA 1Z7S1 1OC1A 1FPN1 3D3AA 3O1RA 1UZYA 2VNOA 1HXS1 3UKGA 3A2KA 4MV2A 4FSJA 4MXWB 2UYAA 4HKWA 3T1BA 5B5EC 4CEYA 1AVBA 4XURA 3S7EA 1N75A 2J1TA 5IUQA 2QKDA 2AQFA 1RHI2 4CZCA 2SBAA 1RZ4A 1V6MA 3RPUD 3MUY1 3U1XA 5DYMA 2DT6A 3ABTA 3V7SA 1W8NA 3BTLA 1FYUA 5FLMJ 1LVKA 5EEHA 2DA2A 1H0MA 2XLAA 2VOTA 4MGTA 1WUVA 3VD7A 4CDXA 2UZKA 1UKGA 2WZR3 3Q3SA 1MZEA 1W2NA 3L2RA 3THCA 3LSDA 5DZGA 3VSLA 1ND2A 4XFAA 2P3JA 3L2HA 5CVVA 3VWBA 4HVOA 4ATFA 1ZR2A 2IUWA 4A3BJ 4PGGA 2X09A 2DDBA 2RV9A 2JSPA 1HJGA 3H7JA 3FJSA 1QY4A 4PCQA 1SCRA 4IV3B 1NA1C 5TRDA 3PUIA 5F8PA 2R7XA 4HN0A 5A1AA 1POV1 1C4RA 1FMD3 3RG0A 4A44A 5HCHA 1JXSA 4CCKA 4FBFA 3ZPLA 2QNKA 3H1CA 4QWQA 3K4NA 2CAVA 2VJ4A 2CO5A 3OJBA 1WW6A 2PXJA 4UW6A 4FETA 5C70A 3AG3H 4BIFA 4BACA 4S0HB 3BZKA 2P6HA 1PX3A 2QVSB 1OD3A 1P9QC 4F7ZA 2R7VA 4IEXA 4FQ4A 5GZFA 4M4PA 2RVAA 5ACA3 2QKMB 2WO2A 5GLTA 1C1LA 4MTDA 3TEYA 1DQ2A 1QJU2 3JSPA 2E53A 5DD8A 2X51A 3ZX7A 2DYSH 2XUEA 4YVWB 1ZKGA 1YWKA 3GF6A 4M6VA 1GNYA 4HQEA 2FBEA 4H55A 2VNRA 5FJHA 1S29A 1KQ0A 3ATGA 3JU9A 4M3EA 3OEAA 1JUPA 5JZGC 1UX7A 2M87A 4DY3A 4EJVA 2WT0A 1B8IA 2IGMA 2V1XA 2QQWA 1X82A 2FHRA 2HPMA 2L4MA 4FP2A 4LGWA 2DJNA 2L54A 5A7QA 2DDAA 1O3SA 4CA9A 1R5HA 1JH5A 3BJOA 1GQHA 3ZKUA 2NVXJ 4RLQA 4ORFA 1EAH1 4MYEA 4XN3A 1H1MA 1TQMA 5A7PA 3UKNA 4CU7A 1V6KA 3HHGA 2EAKA 2DVGA 4O61A 1U8BA 3KP3A 5D2AA 1RUI1 3FHQA 1WBLA 2XAUA 4K1ZA 1XSVA 2TDXA 5C3OA 1AR91 2MNGA 1GDTA 1CAVA 1S2EA 4G6QA 1Z7S2 4A3JJ 3T1MA 2ZX1A 3NNGA 1HXS2 4RD7A 4JDNA 3CCLI 4H14A 3OGJA 3ERED 3R6SA 1S0BA 1W3VA 3BB6A 3KX2A 3FHNA 1E0EA 4G9YA 2LTNA 2K4BA 2OJED 1YJLA 2A1XA 3KLNA 2QYOA 3C7FA 1VBA3 3CCRI 3KZIC 3QACA 5E6HA 2HVSA 2ZZQA 4V19K 3A02A 3NJYA 1GYKA 1V6LA 2DTWA 1VF9A 1RUE1 1BJZA 1XNTA 4NHXA 3S2WA 2ZMKA 2KZVA 1HOMA 1UZCA 3ZYRA 4JP0A 1AKHA 3G1MA 2DPUA 3F95A 1NQJA 4CEYC 2RNJA 4HKOA 1KITA 4IE0A 2IGNA 1GOGA 4B09A 2L7FP 3OIPA 1US3A 4A2UA 1S0IA 5AC93 4FPEA 2R1DA 2MW8A 2D6OX 3E6CC 5APAA 3FBMA 4DGWB 4M9SA 3F8FA 2ME0A 2NYYA 2ETHA 3GF2A 9ANTA 4NQWB 4UT5A 1HRV1 1D1BA 1C5HA 4PQ9A 2XBO1 3HNYM 5IYCJ 4P9XA 3NARA 5L3DA 4QQHA 1HXDA 3BR2A 4CDXC 3BG3A 2ZPXA 1TWAJ 3BY6A 4M71A 1OFNA 1UY3A 2I74A 4DOZA 5LB6A 1GLHA 5LWBA 2V09A 1GZTA 2Y6FA 1ZH5A 2H6BA 1TZLA 4PDKA 4QMAA 2DJIA 4FP3A 1EJ9A 4XICA 5DCFA 5EEGA 3QP6A 4P5OA 2QTWB 5KC6A 3OYNA 2QDNA 3ECQA 3PTYA 3EMRA 4JHTA 4KWUA 3IPVA 2W82A 1U5XA 5AFEA 4XW3A 1B59A 2XAGA 4HOBA 4AIHA 1SVLA 3S32A 1SDDB 3IAQA 2Y31A 1H2LA 4UV8A 3L9JT 2AH2A 5CG8A 4DY5A 2QQ8A 3MFAA 3I4IA 5FMCA 2MH9A 4CDUB 2EBIA 4ARYA 3HYIA 1JN2P 2JSCA 4R4XA 3WE2A 3NJZA 2ZGKA 4XFCA 1HX6A 3WNXA 3BG7A 2C4XA 1HJFA 2GMPA 2DVFA 4Y22B 4YGDA 1WZXA 3FXUA 2W47A 2VT3A 1Z9CA 1JHJA 4DOUA 5A3TA 1RUC3 1G6NA 4CO8A 3BQYA 1HW1A 1QNWA 1QVTA 3Q9SA 4YZ2A 1KFUL 2Y26A 3NEUA 3ZR8X 4XN0A 1V55H 1USSA 2WV0A 4M3CE 4JHZA 1VQNI 5I93A 2XG3A 4X6QB 4FCAA 1BCXA 2BGPA 3AVRA 4MH0E 3FXQA 1W36C 4XRFA 5KAFC 1R49A 1Y1WJ 2YUEA 4LUKA 4YFWA 4FQGA 2RM21 3CCUI 3GHMA 3BZ6A 4Z2AA 3S3MA 2X5IB 3DKWA 1COV3 4YFZA 3J7AO 3BJAA 4L0YB 4WVWA 1ZHFA 5DXDA 1JZ4A 1DGLA 5F5QA 1CGPA 4WZCA 3OYFA 1Z6TA 3FIWA 2ORZA 3J7ZI 1CVNA 4M3GA 1QJFA 2YGMA 1FOYA 1PO13 1KRIA 1TC3C 4C2UA 1WA4A 3AFKA 4UB8C 1JKQC 1DU6A 4P9YA 2C26A 4XUOA 1R081 1UX6A 1WLDA 2AEZA 4S05A 1AWCA 2RMU1 1I39A 1K83J 5KK1A 4HVRA 3ZSKA 4D9JA 3CMEI 2BVVA 4LXLA 4UFIA 2C9AA 3VBUB 4CICA 3HB9A 2FX0A 3JRIA 2JDYA 1LKNA 2ZTNA 2Z3YA 2JDUA 4N8MA 3AMHA 1DGWY 1FV2A 1Y43B 2L3DA 4RM3A 1RUE2 4LO5B 5IK5A 2VUJA 4QXCA 1DGWA 2JE7A 2R042 4CPBD 1W5TA 4ZXEA 2MG4A 4FPFA 1OOPA 1FY7A 1T6GC 1SACA 4N0BA 3VDAA 5FZ8A 3C18A 1ULFA 3SEEA 5IOYA 5FP3A 2R7EB 2IS4A 2K9ZA 3AMNA 3WDTA 5J36A 1TQ5A 3QOEA 3MO4A 2XBO2 4JVAA 2ISYA 4NIGA 3OD0A 5IFTA 2E35A 4AW7A 2VOXA 4EYUA 4QU2A 4YM1A 4DO0A 1QXRA 3L2CA 5C5UA 3J7NA 2NS7A 2WFF1 2ARXA 3DTKA 3T30A 3KP5A 3IM0A 3GBWA 4OCTA 3OPWA 1UHWA 5FXVA 4WM8B 2MBFA 4DS0A 2FA5A 1UZ0A 3U4SA 5EIYB 2PQQA 2KRFA 4P14A 3LSJA 3OMYA 3ABMH 1FMVA 2Y9ZA 1ORKA 3OOXA 1FOWA 5FRMA 3P3NA 1RMU2 3H9AA 3AP5A 3MW4A 1P92A 2YV8A 1QDCA 5A80A 1TME2 1CZSA 2EIKH 4LBNA 1BR1A 4RAYA 5EYRA 3IMNA 4CCJA 3AKZA 3BCBA 4JV4A 5EP9A 5E3MA 4AK3A 1WCDJ 1VBC1 3PFIA 1GQGA 3B3QE 2DOEA 1D4VB 4I0WB 2X6WA 2B4KA 2VXJA 2CAUA 2QEXI 3TNQA 1X36A 1AJKA 4ZU5A 1AHDP 1WW5A 2CJJA 2HTJA 1S55A 4R79A 2XJSA 3V0AA 4WF2A 3TL4X 2CDPA 2VZUA 4OUMA 2FOWA 3CNAA 1UO9A 5CFDA 1JT0A 1BYHA 1QQIA 5FO7B 3JTGA 1F31A 4FAHA 1WQ2A 1JTXA 5CIRA 2KDZA 4K9SA 4LD5A 2BGCA 4G6TB 4BQAA 2XL9A 1XNKA 5FOBB 2H94A 3WW1A 2Y48A 2XVLA 4WVMB 5LW9A 1BOAA 1P4XA 3O14A 4WM7A 4BXXJ 5FMDA 2JT1A 1B9NA 2B42B 2XJUA 3IHUA 3RSJA 4OIPF 2VC1A 1MMGA 4AFMA 2FE3A 5FRAA 3HRUA 1KYWA 3WGHA 4I0AA 4R8HA 2DI3A 4J1XA 2RS11 4QGLA 1XJAA 4CE8A 1R082 2OZJA 3APBA 3VZMA 2CG4A 2RMU2 1N3OA 4RHV1 2OTJI 1OPMA 2KD7A 3GBFA 4Y52J 4E2SA 2RDPA 2GMEA 4IHYA 4ZU4A 3T8TA 3MD2A 1GUUA 2ZX3A 3PJQA 4QHBA 3IRQA 1PP7U 3SITA 3S1QJ 4BA6A 3G4SI 2TCTA 3I59B 1WMEA 1VQ8I 1TZOA 5DDJ3 3EQLF 2BFUL 3ZXAC 1H0BA 1PDNC 1IXCA 2NM1A 4N4OB 2DCTA 4PSXA 4A0ZA 3MKWB 1FT9A 2XPWA 2LY9A 5KR7A 3B01A 2GC3A 1OJLA 3VZOA 1V6NA 2HEOA 4GWMA 1XDSA 1LUJB 5F5AA 2LFBA 4AHZA 1R5ID 3BR5A 3ME2A 2HOEA 1SFOJ 3FMSA 1BZWA 2OQGA 4LK1F 2JDHA 1G9AA 5GTIC 4MGYE 4Q4Y3 2WFF2 3URFA 3ZR6A 3DBLB 1NK2P 1S72I 1NA1B 5HS9A 1HBXG 2W39A 3V56A 1GLNA 3G71I 2COBA 4QX3A 4AFCA 1Z3XA 1QZYA 4FPOB 1QZEA 2V4JC 1QH6A 1RJ8A 4HONA 1UW8A 2ZSHB 2CW7A 2C1FA 2YX4A 2LRDA 3EDPA 2FDJA 4QAWA 1SFNA 4P5YA 1U78A 4E9KA 4HSJA 4BEHA 4B4CA 2H27A 2K9SA 4CDGA 4L99A 2VVEA 3SXWA 1FOXA 3J7LA 2W25A 4SLIA 3DWLE 1NYWA 1RUF3 2IEKA 2MC4A 2GOXB 4QB1A 2JDZA 2AEYA 2OUJA 4PJ0C 4NOTA 5L19A 3BPVA 5FZ0A 2FXAA 1JUIA 4ES8A 4OIOF 4XPVA 4DJAA 3T4HB 1IUFA 4Q48A 1S0GA 2W2IA 2WL1A 4LPLA 5JZGB 1CN1A 4J25A 3ZXLA 2XB6C 4XOTA 4CXXA 1N3QA 3FFZA 3I71A 5EJCA 1AR61 5FK7A 3VD4A 4Y17A 3G3ZA 1IHMA 1RXGA 1CX4A 1D0YA 3FKIJ 1QOSA 3FFQA 2KIUA 3PQKA 4IEVA 2UUZA 4QQ2A 1D4M2 2KZGA 3KCYA 4A69C 1ERDA 4U0WA 5A32A 2XSDC 1LESA 3ESWB 4JYKA 3QLQA 4PJMA 2VW2A 3KETA 3UGGA 4O9EA 4LBLA 2DMPA 5CFDC 2E1CA 1EY2A 1ZG3A 3S57A 4ONUA 2NPIA 3M4OJ 1G9BA 3AZVA 3JAMZ 3CMAI 4AVTA 1LOEA 2RS12 5FPXA 4JDOA 1BBT3 4BJTA 1W2OA 2P6SA 1OUSA 2R7RA 2L7ZA 4G8XA 4WM7C 4TLFA 3G2BA 2Y0OA 5L7OA 3JBG1 3WG3A 4N7UA 4MZUA 5KHKA 1T56A 2W91A 4WVVA 3B69A 2GP3A 4WXHA 2KRCA 4S2DA 2BP6A 1QOOA 2JK3A 1B09A 4RYDA 1NXD1 3MLKA 2BGOA 3BN6A 4CCNA 2G9FA 2Y75A 2A6TA 4A5MA 1W8FA 1ZLKA 4IE7A 3DYPA 1D0XA 3FL7A 4XLHA 1K42A 4OMCA 2RKHA 1WI3A 5HODA 1R091 4XC9A 5DUWA 4I7HA 1DYKA 3Q8CA 3U4XA 3T2PA 4CEYB 2C5DA 4FTSA 2PHXA 1F15A 1D0ZA 2STWA 3L00A 1JI6A 1VQOI 2D93A 4A6SA 3PNVA 4M74A 5IFPA 2R49A 1CAXA 4B8EA 3RZGA 4ZDOA 3O2PE 1S6LA 1Q8OA 1K5JA 3SISA 1TMF3 5FQ0A 1QJZA 2BY2A 2ZOEB 3HOZJ 2QSFX 2BBAA 5DABA 2LVSA 1JODA 3RYKA 1ZM1A 4CDXB 4X6AJ 5ILSA 2JEMA 3HOYJ 2C9KA 5FY5A 3SQNA 4IW3A 5FZ7A 4L9VA 4EN0A 5EEAA 3C7OA 2XROA 2RHPA 2A73B 1OYWA 1OA4A 2B8MA 3Q8FA 4CUGA 1LPQA 2XKPA 4FISA 2RDRA 5E1WA 2K9LA 3RMYA 1VQ7I 1ZZ6A 2XVCA 1WGPA 2M5WA 1FEXA 3BIWE 3IKTA 2ZEXA 2X0LA 1TWGJ 1W36D 4ENKA 2IFRA 4BY1J 1ULCA 4F91B 5HBAA 4LB6B 3DQVC 4CCLA 5C4JJ 2ID4A 3BTIA 4D6SA 1UPIA 1Z7S3 4E7IA 1DU0A 1FPN3 3OL3A 1HXS3 3QYEA 1XG1A 4DFSA 2XPVA 2CMPA 3O1TA 4HNUA 4S2HA 4QT6A 1YG2A 4HMZA 1APLC 1FWZA 4HSLA 4IL7A 1XC5A 4IE6A 2R7TA 2Z9OA 1GZWA 4YZ1A 5BS6A 3WCSA 4Q5SF 1MJ9A 3WU2C 3F22A 1ZYBA 2VI6A 3R4UA 5HDKA 1ASJ1 3MPBA 1K4SA 3KVBA 2XLGA 2IGOA 4JBAA 1QVUA 2FMDA 3F23A 4A6EA 1R1A2 5DAPA 4ZPIA 5LBCA 2C6SA 3MPPG 3HT1A 5KWRA 1CQTA 2A6EF 1B8IB 4ESBA 4LG0A 4FFGA 4QHOA 1ULEA 2E63A 2F5DA 4IL6C 1LOFA 4YZ3A 1BEV1 1N78A 1TWCJ 1WCSA 4XRMA 1YLLA 3OTFA 1J9IA 5FFOC 5CKNA 2R7WA 3WGGA 5GZEA 3CO7C 2JWPA 4AI8A 2B46X 1POV3 2W0XA 4DQ2A 3DEUA 2DBNA 5JXJA 1QXJA 3CJIA 5ED4A 2XMLA 3JBG2 4IQJA 2YU2A 4RS8A 3KHCA 2ZMEA 1VMJA 2AGSA 4KG8A 4LO8A 1CIYA 2PHTA 3KLOA 2NXNB 3TMOA 2WZPP 5A70A 1CAVB 1UAAA 2CUZA 3WOGA 2V6EA 2GC1A 4HOOA 4C90A 2FDKA 3B7MA 2VMCA 5HI0A 5FZLA 5L7OC 3P9KA 1VFCA 1H6XA 4QPGA 2JA8J 3NV3A 3K3OA 3ZQFA 4LLNA 4BUPA 2P3IA 2AC1A 2ERFA 1ZK8A 2ZKLA 2VCMA 2YS9A 3EPZA 3IUOA 5A3OA 2CW8A 3FXRA 3QRFF 4UBGA 2NP0A 4CYCA 2ARAA 2K9NA 1B1BA 3D8CA 1JHHA 1AKHB 3HTSB 3IMMA 5M5WJ 2RAEA 2GNBA 3ASIA 5JAXA 3N35A 3JRFA 2V9KA 3KCCA 3VYUB 1A78A 3MV01 3MFKA 4K8FA 2BY3A 4YWAA 3NNFA 3TNPB 4BQ5A 1P8JA 4Z2WA 1W0UA 4AQSA 3RYPA 1EAH3 4K6BA 1LVAA 2VTFA 1YS6A 4KISA 1Z0XA 4KN7X 1EV7A 3UV9A 2IW5A 2GU9A 1V3FA 4FOQA 1V9U1 2DFEA 1RUI3 4PSWA 3JD72 3RQ0A 1YFHA 2P2KA 1S1AA 2Y34A 4AYBA 1PMHX 4BL0B 3F9KA 4ZDLA 1AR93 1QPMA 4OI2A 1EYBA 1XGMA 5FFZA 4C3HJ 5J48A 2AXLA 3G7DA 2LS6A 3IPVB 4HF1A 5FPLA 1FC3A 1KU3A 3AYDA 2A71A 1OLMA 2ZEWA 1F1ZA 4AAXA 1OKQA 3ZIWA 4I99C 1TT5B 3UETA 1H9WA 2P3KA 1UFMA 1RUE3 2D3PA 5CKTA 1YQCA 2ZMNA 3WHUA 1Y8QB 2HXOA 4Q0PA 5EF6A 1W5CC 5FUPA 1XBFA 3H36A 2PLV2 5IYBJ 2A6WA 4LT5A 3CJQB 3ACGA 1VPHA 4ET7A 1WJAA 5FKMA 1JZ3A 3LZZA 1OPOA 4Q0SA 1S7OA 4COWA 1UKRA 2FZ2A 1LJ7A 4QKNA 1HRV3 2EV0A 4YW3A 2XBO3 4A42A 4ISRA 2XHKA 5IY5H 3S3NA 3M4FA 2EB7A 3HRSA 1YJ9I 2HEYF 2ACJA 1UAIA 5JSPA 2L9RA 3I2IA 3LEGA 4K21A 2RQQA 1Y8RB 2P4WA 3HPHA 3TBIA 1DZTA 4L92A 4DUWA 4HFSA 3WTSC 2JG9A 2R92J 2UURA 1UG0A 5FZEA 5CFCA 2EWNA 3WTVC 1O8PA 1RUH2 1LOFC 4Q8LA 4HLXA 5EHDA 3E6DA 3D1NI 2VC0A 3VSKA 4ESFA 4V2FA 1XGOA 3OBTA 1GU3A 5FP9A 4Q4W2 3HPNA 4Q8KA 2QQOA 4ZHNA 3NQOA 5HXVA 4BQQA 3CJIC 1VI0A 3BI3A 4A0XA 2CV0A 5FDBA 2DCKA 4YG0A 1QQP1 2ZMEC 1D5VA 4FXGB 1CZVA 5L3FA 3WTXC 3ZXJA 1LOGA 1UZZA 2YDEA 1OVSA 2GXGA 3OBZA 4KWJA 1F9KA 1LB2A 3IDCB 4QSHA 1XPWA 3TDUC 5KHDA 3RWKX 5F9TA 2X6OA 4E4ZA 1NHAA 3BVCA 1V70A 3KGLA 1G9CA 2CGNA 1OFCX 1OOPB 2YX7A 5AVAA 1H89C 3PJRA 5IJRA 3M3OA 2RM23 4M3BA 1C1FA 5JR2A 2J1AA 1L7RA 3WTYC 4FT8A 4F8AA 4OUSA 1IRFA 4W4ZA 4XLEA 2ARCA 4ZZ5A 5IVCA 5LCWL 2HWE1 5C3SA 3PM1A 5L73A 4XIDA 3WTZA 3V8LA 5FMOL 2HEWF 4PI2A 3PIJA 2FOKA 3OGGA 1R1UA 3ES1A 2M30A 1BI3A 4XL9A 2W24A 3K10A 3S2DJ 1MS3A 4RQPA 2ZKZA 4JRAA 3O3KA 1X19A 3RDIA 1R083 2NRAC 1J09A 2PHRA 2LF7A 2RMU3 1QHGA 5E17F 3GLLA 2JWTA 4Q1RA 1WCQA 2W9XA 1TL8A 1UOJA 3DPRA 1UWWA 3HKZN 2VVDA 4BDVB 3S5QA 4LA3A 1POGA 3O8HA 3CF2A 3SEQA 5JLXA 5BNQA 3JRHA 3PDQA 2VE8A 1HCRA 1N25A 4OHXA 1MKMA 1PMJX 1ZQ3P 2O8QA 2GXBA 1LULA 3EQEA 1SD4A 2OPKA 4CUAA 5FOJB 4OAZA 1W6MA 3GGLA 3V0AB 2WS91 1X3WB 3F8NA 2DMQA 1OKOA 2A61A 1MVQA 3MEPA 5D4SA 1OF3A 4AVAA 4AIDA 1GFF2 5KNLA 5CFDB 1JUMA 4OLLA 3ZSMA 2FF4A 1YEWA 1DLLA 2GN7A 3OR1C 2DF7A 4Z82A 4HA8A 3BOQA 4MO7A 3CZ6A 5DAVA 4M73A 2WFF3 2PHDA 4XVHA 3HBLA 2D5HA 2RR11 4DXTA 2BQPA 3GJAA 3B6AA 4XJWA 4BWOA 2Y60A 1ZRRA 3K4MA 5G04L 3IIIA 4WM7B 4HLTA 1TQPA 2MEV2 1DZRA 2XVKA 5JXIA 2HWB1 3FBNB 1Y9QA 2D6LX 3E3VA 5A3LA 5FYBA 1YOVB 4IUGA 1IPSA 2X8KA 2KIFA 1LEAA 3SZTA 3HTUA 5DN2A 3PIPF 3I3EA 1IRXA 2MSYA 4ABZA 3H9QA 3FN9A 5AIPA 4HYEA 1QQP2 1VBC3 4OZXA 1TP4A 3K7AJ 1UU4A 4CA0A 3OBRA 2YHJA 4U7BA 2HOAA 1RTVA 3UKVA 2AZ5A 3S7IA 3MBWA 2DCZA 4P1WA 2R072 4HBNA 2HVQA 5F2WA 2GLOA 4IE5A 2YMZA 2LALA 4AL9A 4XOGA 4XJUA 5FP8A 2YU3A 4ASLA 3MZHA 2A70A 2VKEA 3OUJA 1Y39A 2N7GA 4JTNA 4DNCA 4M3CA 4QQLA 4EWDA 3H9JA 2VQLA 1HV1A 1UG2A 4AI2A 3V8JA 2VNVA 2LNBA 5LBQA 3JQWA 3UR3C 1ND3A 5C8CA 4C2MJ 4A3CJ 1XD7A 1GUIA 2HWE2 3JB4C 5I91A 4FE7A 4I3GA 3AKQA 2L9SA 3KZZA 4HX4A 1W5SA 4PGHA 5JIAA 1F4AA 4YG6A 4B3AA 2GP5A 4NO4A 4QD2A 3KT1A 1ZNPA 2PAEA 4R4ZA 3ZRGA 2WO1A 1UMHA 4AGGA 1W04A 4LE4A 2RS13 5C5TA 3CZJA 4ZS3A 4U88A 3JAMK 3ACHA 3LE0A 5LY2A 3ZQIA 3WUDA 2Y30A 4YW7A 3I97A 4RHV3 2DT7B 5F0CA 4JX6A 3QYFA 1SD7A 3ZXFA 2X1DA 3HEIA 2I45A 4BEHB 3AXEA 5J8CA 1HLVA 3E6MA 2YUSA 3TO9A 4LLOA 2XAHA 1EH6A 3ZSEA 4RQPC 3TEXA 1X1AA 3CTAA 4XFFA 1AR81 4H3WA 3E97A 3KFWX 3DXUA 4CDWA 1WHUA 4LULA 1BQPA 2WDBA 1G9DA 3K2OA 3KEQA 2D43A 2RDNA 5ICGA 1OI6A 4W6XA 1DQ0A 2P8TA 2WLQA 3BTAA 2ZABA 4AHXA 5AIQA 4HNVA 4PK4A 5IVEA 4NIDA 2PMWB 2EFNA 2NVTJ 2HNHA 2PTMA 5ERLA 3ZOIA 2LUWA 1SG3A 2X48A 3ZQCA 4KFCA 2RR12 3M3QA 5A32B 5LRRA 2AHQA 3U1DA 3OYHA 2M7BA 2BBYA 2HYXA 3IP4B 5HDGA 1VRH1 1T08B 4EEFG 2PFBA 1W1WE 2R6QA 4GDFA 3AG4H 1ZGJA 1WJDA 5M3FJ 3T4VA 1IC8A 2R0QC 1S5LC 2XOMA 5T5OA 3K70C 1UMIA 4GXLA 5F3GA 4UI9L 4HK9A 2RJLA 2HGCA 2J5PA 2WTEA 2XF7A 1PGSA 1I9RA 1EV12 3PVEA 1ZX5A 3E5QA 1J3PA 5EJZB 4NN0A 1MZFA 2K27A 4QIWN 5JVTA 5A7WA 1E17A 3ALQA 1MMAA 2QQJA 5L7OB 4NIHA 3GVAA 2LRPA 4BJ6C 4D7TA 4BQWA 4CDQA 1FXZA 3FMQA 3NKTA 1Z91A 5CADA 2VMIA 2GC2A 5K7PA 3A21A 1SD6A 2D2WA 3QPLA 2ZFWA 4AHWA 4ITVA 1MSFC 3HQRA 3VYSB 1AR63 5C4XJ 2A75A 3C7EA 3ZSLA 4DRVA 1CAXB 1W0NA 1GP5A 4QX5A 3T2OA 4XNFA 4A93J 3U1KA 3O1UA 3FLRA 4JQTA 2PA7A 1BR4A 2QQLA 3K0LA 5ICFA 3FBIB 2LOOA 5FQ0B 4RB3C 4YLZA 3RZOJ 5CBLA 3CJXA 1ZARA 3ZMUA 2ZJQF 1JYVA 5A33A 2JG8A 3OB8A 1U5YA 1SBDA 5FD5A 1Q3EA 3MKYB 2HOSA 1NG0A 1U5ZA 1ND3C 4QWNA 3ZQGA 1VBE2 1N3PA 1RJ7A 2WINB 2YBSA 2DPDA 4BQ1A 3MICA 3S0MA 1MQTC 4AE2A 2FSWA 1K79A 1UYYA 1UXZA 2ZGPA 1Y0UA 3JBG3 3U11A 4XKCA 5TGTA 2WQ4A 1IS5A 1FP1D 3FXLA 5GLUA 1T38A 3CCQI 5A3UA 2UY9A 4OIQF 3VPRA 1Y9GA 2P5LC 1XMAA 3TBDA 1SHWB 3F72A 1CF7A 5KVRA 2VUMJ 1AR82 3RWNA 2DK8A 1KXGA 2VTXJ 4ASNA 4XABA 4WVZA 4LLGF 3BIEA 5HV0A 1R093 3RKXA 1O5UA 2CU7A 3DKXA 2LLKA 4AVSA 2L9LA 2OPWA 3VKOA 4JGZA 2DBBA 3PIOF 3LOCA 2VUCA 1GZWB 3HOVJ 3ZXGA 3GM8A 4HV6A 4LITA 2Q4SA 4UVCA 1ZGWA 1UHMA 5C3RA 4CDWC 5F08A 3H50A 1KGSA 5HNFA 3JQXA 4YW4A 3NO8A 1Q1HA 1PNFA 5FYVA 1W06A 3LSEA 2EVXA 3JZVA 2M34A 1GICA 2YC0A 3M3YJ 4R1HA 3A7QA 2W57A 1H9PA 1H8AC 1VRH2 3WNMA 3EYPA 2HYJA 5FO9B 2VL4A 3CMYA 2E71A 2CDOA 2R062 1WSUA 4LG0B 4LR4A 1Q56A 5FKCA 3WW4A 5JDBA 4ZTFA 3IL2A 1M06G 1LDJA 3IH4A 3K1PA 4ATEA 3OY8A 2L01A 5FPZA 1IGOA 1KEXA 1SLLA 5IAVA 1AYN1 3K48A 1YRZA 4ESJA 2CQNA 2K2SA 2OPTA 2QLZA 2DK5A 3GTGJ 3NSTA 3CJIB 1A6QA 4N7IA 2IS6A 1UMQA 1UY4A 4E2GA 2ZMEB 4R9BA 1IZ1A 3MHZA 3HN3A 3OYGA 4GH4A 2VUDA 2BERA 2STTA 1QZZA 5F6FA 3FDYA 2BZDA 2EIGA 2FCVA 3AP7A 1WMDA 1X1DA 4HV5A 1PNGA 1VALA 2P6CA 3H42B 3M8LA 3H3VK 4QPGB 1Y6IA 1IDYA 3OR2C 3I53A 1ASJ3 2GBYA 3ZMZA 3FZVA 4R9DA 4CDQC 3WF0A 3W6JB 1WWYA 1X1BA 1SC7A 1RUD1 5IP6A 2VOVA 3PU8A 2K85A 1C57A 4CYCB 2GM4A 2XIGA 1W8HA 1BR2A 1U9NA 2DTRA 4AWXB 1YW8A 2DA6A 1MW7A 3KGZA 3M07A 3CUOA 1JYIA 1VBA1 4IE4A 1ENQA 2VZTA 4CHUA 1B6AA 1D5YA 2HDWA 2GH8A 5EYYA 1BEV3 1WD4A 2KLOA 4P08A 1VBB1 4XF4A 5JOZA 1YE9A 2P7VB 2WZR2 4CGZA 2DN0A 3A0BC 3ACLA 4E4DX 1XE8A 2VD7A 1MH3A 4KMFA 1FSHA 5H9QA 2R7QA 3I8TA 2UYBA 4JTOA 2IA2A 2JG8C 4EQQA 5GLWA 5C4WA 2M8EA 1ZGAA 3IIAA 1SZBA 3A01A 4NROA 3MYXA 2K7LA 5FZ1A 4K3UA 2Y0SA 3EO6A 2BEOA 1IN6A 2TBVA 1LDDA 2Y6LA 3OYCA 3OPZA 3CF5F 5FTTC 4MFEA 1PHMA 3RZJA 3VBOA 1JTYA 3BTYA 5DUVA 3M3IA 1G3YA 2VJXA 5LK7B 2DWRA 3GCXA 4QQOA 1W6OA 5I0TA 2HQRA 2O1QA 5FKKA 1FMD2 5FAXA 3ZMTA 5E3OA 1GNZA 1ALYA 1ULPA 4Y1YA 4AI9A 1DU3D 1W05A 4IHWA 1BHGA 2WAQA 5JXGA 2HVRA 3HDDA 3VYRB 2XRNA 3VL8A 1ENSA 4XETA 2BJSA 4HPKA 3NL1A 1UXXX 5ACA2 2JA5J 1PZ9A 2E7QA 3QYBA 1BXHA 4JGZC 4BGDA 4Y1UA 1AXKA 1HF0A 5FYCA 3IKWA 1W9SA 4BQ2A 1DGRA 1GXPA 3W6KB 3B00A 2ZX4A 1XYPA 2E36A 3CCEI 2DW4A 3H8UA 1RIOH 1LHUA 4U0YA 5D5UB 4AHYA 2EIEA 2XGXA 4S2GA 1J0RA 3W5MA 1V9U3 1AYN2 1O4XA 4BYYA 4BU2A 5A1FA 2VBBA 1IAWA 3HBZA 2VXRA 5HLHA 2ZGUA 3VUOA 4LO7A 2Z5WA 3DCFA 3TEWA 5CFCB 1YI9A 4QLCU 4XDOA 2IBDA 4CEWA 3HM5A 1KONA 1Z7LA 2E6VA 3BTXA 3QU3A 2Y38A 1ENXA 1TG7A 3GDBA 1JKPC 5L9VA 2QQMA 2HQAA 2F5CA 4QHZA 2A5ZA 3DEWA 2W3JA 3RI4A 2XJTA 4EGZA 3PNYA 1A34A 5LGTA 2EFPA 4L5EA 2VJJA 2K9QA 3V64A 3DU6A 3R05A 3BWGA 1MMSA 1FTZA 1H4GA 3N9OA 4EJTA 3WF1A 4YIIA 4Z92B 4WCGA 1QPIA 5FIXA 1TBXA 3CDZB 1VAKA 5K1YA 3F21A 4AUXA 3SEPA 1RUD2 4GH4C 4D8MA 2XF5A 3H92A 1VP6A 1H8TA 1EF4A 5BNPA 2LY2A 4IGOA 2CS3A 1MH4A 4NIIA 3T0DA 2J42A 4NHMA 3D6EA 3U07A 4S2FA 4HSTA 1N1SA 1VBA2 1VBD1 2ECBA 5J98B 5C3PA 1U0JA 2VM9A 2ILMA 1NOVA 1NT0A 4KU7A 1E5RA 2W4SA 2O9LA 1I27A 3QWLA 2F17A 4XQDA 3BDDA 3W3CA 3GFIA 1VBB2 1IQDC 5J7MA 3VZNA 3SC7X 3Q0WA 1OR7A 2TUNA 3ZFGC 2BVLA 1OUXA 4XXAA 1D0HA 4YVWC 3RJ2X 4KN4X 3GYDA 3PNTA 2CL2A 4UY8I 4E7SA 3HOUJ 4XE9A 5AC92 1C5IA 5FY9A 2PN5A 4PHZA 3VD9A 1ULGA 3BG6A 4AG4A 1JYWA 4TV7A 4COVA 4RQPB 1IUYA 1ZZCA 2JUGA 3H8XA 2CWMA 1YI2I 1OT5A 4UVBA 3MQ0A 4DBQA 1W0PA 3DKQA 2PAKA 3JRDA 4BQ4A 2KKOA 2GA2A 1UD1A 4JDMA 3V0BA 2BY0A 1H2KA 2KJBA 5C3EJ 1QQP3 2DUOA 2K86A 1WMFA 5C4WC 3K70D 3Q0VA 2EALA 5CVJA 4E6KG 1DYPA 1QA6A 3N05A 5JOWA 3S5AA 2PMZN 1TNSA 2V4AA 1WMXA 3I2GA 4UFHA 4AEJA 1UYPA 5IK4A 1YYVA 2X05A 1MIJA 2BUKA 2BTVC 1F8VA 5I0DA 1X4PA 3KYDB 2PLYA 3L2UA 1RR8C 3AKRA 3VYTB 1DFQA 3PQJA 4KIFA 3OS2A 1W6MB 2GA1A 1GR3A 3WHBA 4NHJA 4XFIA 3GEZA 4L18B 2V5YA 1YO8A 4URAA 5FXXA 4ENNA 3LSHA 3AL6A 2R0HA 1I50J 2HWE3 2WYFA 5FR3A 2EFQA 2RJKA 1R5GA 1NZCA 4IOAF 5LA9A 5GZCA 5CA6A 2KPMA 4IHTA 3WODF 1VZ0A 1ZRCA 4LKEA 3USUA 2E5NA 5FP7A 4KT5C 3SZPA 5LHGA 3CDHA 3HBKA 5J1XA 4F3JA 2DQRA 4IRHA 5I8TA 1JBCA 1COV2 2Q1MA 3N9MA 1WLTA 1DYOA 2F4LA 2KP6A 2ADDA 4JAAA 1YQ5A 4AEDA 5JWPA 4XXPA 2LREA 5FXWA 4D69A 4M01A 3AZXA 4UFKA 4Y1VA 2M9HA 4OI4A 2E32A 3DGTA 2PBIA 1QH7A 1WJBA 1PO12 3ECHA 4YGEA 3FHAA 4ITCA 5LZ6A 4OMZA 3RJPA 5JPNB 1WA6X 1X1CA 1XDUA 1FBUA 3Q0UA 2QQBA 1ETWA 4XR6A 2WS93 4A6OA 4PIYA 3H5NA 5KHIA 1OISA 5GAEJ 1G7YA 1IOAA 5J3LA 3IZOA 4GMP1 1W28A 5FKNA 1VBD2 1D2QA 3GTKJ 1S0DA 2BW8A 4BZ4A 5E8GA 1CWPA 1IPKA 3O7OA 4M3CB 4YFKF 3ZSJA 1LEDA 3K77A 1S0EA 4BK4A 3AMQA 1SD5A 3VKFC 5BNNA 1XGSA 1H8TC 5E8AA 1YS7A 5BNPC 2W08A 2RR13 1ND3B 1AA7A 5C8CB 1QHDA 1JGSA 2EH3A 1MBEA 2OS2A 2MC3A 2NOGA 3VKMA 3ZYFA 3AZYA 3IDEA 5ABJA 3SZGA 3O1PA 5GAHJ 2HWB3 4RB2C 2BW3A 2JPCA 3LSIA 4MTEA 5LA1A 4D7MA 3I56I 2GN3A 3N9LA 1O8SA 4KNCA 2D1HA 4JQRA 3OL4A 1OR7C 4DZPA 2ZBJA 5M5YJ 4IRIA 4IESA 4A3FJ 1SBFA 2CNAA 4EJOA 1SANA 4MSVA 2DMNA 2MH2A 3MIGA 5IAXA 2BOLA 2QZ2A 5DUIA 3MV11 2GOMA 1MS4A 1XNBA 3MKLA 5DS9A 5J1UA 1WCKA 1USTA 3FM5A 3AKTA 3RS6A 2CQ7A 2WQZC 3GZEA 4BISA 3VDCA 3MAJA 1H1IA 4CDWB 4EWAA 4FXKB 2DFFA 1K3IA 2PJRA 3ZN6A 5FYMA 3DYMA 2LMDA 4GB31 3OV8A 2JTVA 3S1NJ 1XE7A 1WW4A 3I2KA 4W65A 1MDMA 1Q5OA 1MNEA 5HCAA 1I5ZA 1JZ6A 5LA2A 2R16A 1VQ4I 3J4UH 1EUUA 1KQ9A 4AVZA 2ISZA 1HDDC 1ZA4A 1R23A 2EIBA 1JMUB 4L8QA 4NVPA 3DYOA 4URTA 3HNMA 2D5VA 4FTHA 2WUHA 1XTAA 5E1XA 2VNGA 3SQOA 5A3MA 2JKBA 4XBQA 1Y56A 3OIOA 3VBFA 1PO21 3NV2A 3ZQQA 1SCSA 3LQQA 3AP6A 3BYWA 3TKYA 1DP3A 2JDMA 2LTPA 4KJZA 5BY5A 2XB0X 1NAEA 1YJNI 3FXKA 2FNPA 4LKDA 1DQ5A 1X50A 2JICA 2UWBA 5A7WB 4KDPA 2VPRA 5DUKA 3HGGA 2Y6JA 1AR83 1LAJA 2FDFA 2VPLA 3FMGA 4BBRJ 4LORA 4ETSA 3LFMA 3I9V2 4CDQB 4UVAA 4LOTA 1BBT1 1T98A 2LK2A 1UIKA 1URXA 4AEDC 5I0UA 3RVHA 2ZMLA 3PLQA 3AP9A 3OSFA 4AOCA 2ZJRF 2Y64A 2OX0A 2VZQA 4QKFA 1X4OA 2WAAA 3BUCA 5FCCA 1O7FA 3ZR5A 2AO9A 1GV9A 2B63J 4KQ7A 1MS8A 1RGSA 2DBIA 1MS5A 3DXTA 4B7KA 4KU8A 4E7JA 5C8WA 4BE2A 3ABUA 1FP2A 1W7PA 3IBMA 4NR1A 5DDJ2 5B66C 1E5HA 3MZYA 1ZZ8A 4I0BA 3TOJA 3WQBA 3DLLF 2GNMA 1VRH3 4HPQA 2JA7J 4XF9A 2IGKA 4KG0A 2WKKA 3THPA 1G8WA 2PMHA 1OBNA 4Y5TA 1IRZA 4HXCA 5K0UA 5A33B 1WKMA 2JG8B 2M0CA 4XMIA 4ZYGA 2J7MA 4U0VA 1BK1A 1AXYA 1DDNA 2WNEA 5BNNC 5TJJA 2WWJA 2J1EA 3BOPA 4FPLA 4LMYA 4NDLA 1BJAA 1LGNA 4XZUG 2ZHLA 4FPCA 4Q4Y2 1H1AA 3HSRA 1WW7A 3B94A 4Y4YA 5ABJC 1F2NA 2WYSA 4WZFA 5FZHA 3CLQA 2VE9A 1O3TA 2W85A 4W50A 5IK7A 1MNDA 3ORJA 3WSOA 1CF7B 2K3PA 1WZ2A 2QQNA 1J59A 1U0AA 1B35A 3RNSA 4IGPA 4E7ZA 4L5JA 1AX0A 1LOAA 2HZTA 5GZDA 5GM0A 1NY71 3ACIA 3C3VA 4FPGA 3ZQLA 4GB32 3JTHA 5E88A 4JGZB 1I3QJ 3RI9A 3CLPA 3TQNA 1RESA 1OCZH 5J40A 2VBXA 1IV6A 5F1JA 2ELKA 1QF3A 1R4MB 1HA8A 5CPRB 3IWZA 3KS7A 1TEIA 5BV6A 1MJBA 1STZA 1A3KA 3OSDA 4QB2A 5CKQA 1CX1A 4ISQA 3GTQJ 5FUIA 4EJUA 4Q4ZF 1YX3A 1DGRN 2JDKA 2IVJA 3RSNA 1OD5A 2F4MB 1W4MA 5F0HA 4YRDA 1KDMA 3F3XA 3IV5A 2QQVA 4LFUA 2XKOA 5J1YA 2ZC2A 2BXZA 4FFHA 5CZKA 3CBNA 1W2UA 2ZCWA 4NIAA 2O5RA 3K2ZA 1YW9A 1T2XA 1JKOC 4C8DA 2HWVA 3I0TA 1AX2A 2GH2A 1S7EA 3AJZA 2L2OA 5K5RA 1XS9A 1R4NB 2K46A 3W5NA 3E1SA 4Y5SA 2M4GA 3S3OA 3OY8B 4AFAA 4YW6A 4M6XA 2Q8KA 3INAA 4S04A 2OUMA 4PCRA 4XFGA 5EJ1B 1ZLJA 4KI5M 5FZOA 1JJ6C 3BALA 2YSRA 3CJTB 2VKVA 4IX7A 2OU2A 1GBGA 1KQRA 4OHZA 4CUCA 1WJ5A 4TN7A 1B72A 2BV4A 4BQNA 1OKRA 3J7MA 2JVHA 4XZPA 3QODA 1OYIA 1S9HA 3NKGA 3OYLA 1GHCA 2OC6A 1BBT2 4GH4B 2F5VA 3VODA 4LBKA 3H3UA 2VGDA 2G9ZA 4A3IJ 1LECA 2WT1A 4BJ0A 3VL9A 2GAUA 2IC1A 3PL0A 1L7LA 4I76A 1TW3A 2IA0A 4UWDA 1HB2A 1UQXA 3OUIA 4PFPA 3SFZA 2ATFA 3WDUA 1JZ5A 1Y7BA 2GDFA 3DXJF 1BLZA 1NK3P 3G1OA 2V5DA 2LF8A 1G9FA 3UNPA 5HPOA 2WAOA 2J1SA 1JOBA 3EYYA 5JFRA 3ZFGB 2H8WA 3CL1A 2Q8OA 5GPAA 2W52A 4H7LA 2ZBKA 1A8MA 2A3YA 2E7TA 3VDDA 2V26A 1TMF2 1ODNA 4C3JJ 2VOWA 2BY1A 5GZGA 2O8KA 1AYN3 3E5UA 2Q0AA 2Y8KA 3V42A 1LU1A 1KQ8A 1SLAA 4XKVA 1SLBA 4OUEA 2JIGA 3BC8A 3PMSA 1VQ9I 5BNOA 3NNLA 4LG3A 1ZG1A 1I3AA 1NQDA 3EUKL 5HXMA 2BFUS 4IHXA 4BE0A 5C4WB 3WDVA 4Y3OA 3A01B 4HSRA 1OCRH 3DTIA 4L9BA 5FYZA 4HDUA 1OSGA 2AUYA 1QBJA 1GWMA 4D5CA 3CZUA 5GKAC 3VBOB 3GMEA 1NY72 1LKXA 4EN6B 4UW3A 3PO2J 5EXOA 5E8IA 1RETA 3C7JA 1WBFA 5HLIA 1W6OB 4HX7A 3LDBA 5FKOA 3A1YA 1UOFA 3VBSA 3BLYA 2X85A 2F5FA 2M8GX 1FPN2 1RUD3 3REOA 1ETVA 2Z79A 4PLOA 4FAGA 5A3WA 4BK5A 4YEJA 2JB4A 3HL2A 4GGGA 5BPIA 1B35C 5GAGJ 3H1WA 4YW1A 5JOXA 1FNYA 2VB6A 3I5UA 4FO9A 5C3QA 2QUFA 4CUBA 4EM0B 3LSRA 4HPKB 1BVVA 3ZPYA 4O9GA 1SPPA 2K9MA 3ZYHA 1U6GA 5C71A 1DF0A 3UJQA 4KIBA 4J1WA 4ZJZA 4KYWA 1IQAA 3MCZA 1VBB3 5H9SA 2ZS6B 3DV8A 4FFFA 3N7LA 2VPVA 4M3DA 4RFT0 3SDGA 1UB9A 3AL0C 1OA2A 2EILH 2PMUA 4XK4A 1E3HA 4FTEA 5IPAA 5IT6A 3NAPA 3UJOA 5ILUA 5HCFA 3GTLJ 4GA9A 4XQWA 5FWEA 3FKJA 3OYMA 2ZXWH 1V6OA 1LFPA 2NNNA 2QKLB 5FZMA 1REPC 1N1VA 2K4JA 1XE0A 3IAS2 4UAPA 2ZX2A 2WABA 3NJVA 4ZYAA 1C0WA 3F0CA 2XASA 1ND2C 2CUFA 2ZHNA 3IB3A 2VZVA 1I1SA 3BODA 3J7HA 2B9SA 1IKPA 2R4GA 4LB5A 2NN8A 4B3XA 4N43A 1SFXA 5BUVA 4AYUA 1PUEE 1YC61 1BJQA 1J2XA 3LA3A 5BOXA 1D2SA 3JRCA 2ES3A 4DPNA 3K6GA 2EZIA 3WX5A 1W6PA 3HOBA 2VL8A 4META 4KITB 1V0AA 3CMMA 4HW0A 2WAEA 4MGKE 5FYUA 5E18F 5IYDJ 1H8TB 5FZ3A 5BNPB 2VZOA 4EWEA 3N4MA 2FBIA 3CU7A 1CQ9A 4E7LA 2WBMA 1WLCA 4UF0A 4ENJA 4YIRX 1VAVA 1RITA 4BE1A 2P37A 4IPAA 5J1RA 4LOCA 3K46A 2R7OA 2VW1A 5K7ZA 3ILNA 2WNVA 4QX0A 2W48A 1J1TA 5JOYA 4TLGA 5FZIA 3EUHA 1BI2A 2FCTA 1K12A 3E6BA 4G7OF 2E7WA 5FY0A 3VDDC 4Q5OA 1EAH2 1HV0A 1KA8A 1NTCA 2PEXA 2KXLA 2OTLI 1YJKA 4OI0A 1DPRA 3K69A 3PNAA 1I6XA 2IT0A 5JMOA 4M0NA 5IWFA 3D5RC 1RUI2 4OHYA 2D45A 1T8IA 1O3QA 4W6YA 2DUQA 3WP6A 1QEXA 2GC0A 3D5SC 3V0BB 4XQFA 1AR92 3T0YA 1FLIA 3FXMA 2LW8A 5CEHA 1RR7A 5KXCA 1G59A 3R61A 4CXFA 4RSUA 1BMV1 1WI9A 4MEYF 5DAQA 5LBFA 3BZCA 5A2QK 1K5MA 3CIHA 2JN6A 2LP0A 4Q4V1 1F43A 4I6ZA 4GWIA 3ZVXA 3QOPA 3OGSA 2AENA 3O1VA 4QPYA 4XOPA 2ZEZA 1QJY1 1VBD3 2ZGTA 3LDRA 2WR9A 4BHPA 2YZ4A 1IPJA 1DLCA 2Y6GA 3CCSI 2PHWA 3VBSC 3FK6A 3ACFA 4D7SA 2X9DA 1XPXA 2RE9A 1Q8SA 1ZTRA 1AR71 2E60A 4GFBA 4M0HA 1FOKA 5FZFA 1H88C 3WQ1A 5D8AA 4YG2F 2BXYA 2W68A 3I54A 1ZVFA 1PZ8A 1QJX1 3WD5A 3EUAA 2ELJA 1QGLA 1S0FA 1WJCA 1CONA 1T39A 3EXUA 4W8JA 5ICCA 1HRV2 2HWC1 3OEBA 3USUB 2ZGSA 2PG4A 1V54H 2PX9A 4A45A 1WCUA 2BHZA 2G7UA 2XGDA 3OS0A 1UN1A 5LRSA 1U5IA 3J26N 5K7FA 4KMQA 3E1F1 5FPVA 1OH3A 4QM8A 1UZVA 1HRI1 4AEDB 3ZDVA 2YPJA 2W5FA 2QFEA 2VE1A 3NNJA 2CH0A 1F4HA 1WGXA 5DM7F 1IS3A 1CPMA 2ZXHA 3IH2A 3HGYA 5BPDA 1VQMI 3GUDA 4B4QA 2XXZA 4ZZ8A 1AXZA 2JQ7A 3ZFFA 1UY1A 4HNTA 5IVVA 4UBHA 4JKKA 1FV3A 4N43C 4M9XA 1GVJA 1W3XA 1GOFA 5LBBA 5JR7B 4XF0A 1ODDA 1HB4A 4HLYA 4YW5A 4CCCA 1UYXA 2O7OA 3QPSA 1FX5A 2LBFA 1RUNA 3VHNA 2ETEA 3U0ZA 2AQEA 1SLCA 5BNNB 1X7NA 2VBYA 4ASMB 4E8CA 3NRUA 1PUFA 1XU2A 2HYFA 3U75A 1I5PA 5BYNA 4BOWA 2M4KA 3W20A