3N4MA

E. coli rna polymerase alpha subunit c-terminal domain in complex with cap and dna
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
203
structure length
203
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combined structural model for a transcription activation assembly
rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords Catabolite gene activator
total genus 63
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3n4mA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3n4mA01
1R1TA 3HSFA 2FBHA 4E70A 2K4BA 2GH2A 1XDSA 2XRNA 5BXXA 3VB2A 1P2FA 2B0LA 3DPTA 4EJUA 4UVAA 4MZUA 2DAOA 4Y17A 4KWLA 4MV2A 4XSXF 5FPXA 1L0OC 3K9TA 2QNKA 2P7VB 2BGCA 1B9NA 4QXKA 4RB3C 2D5HA 2BEOA 4G94A 1FXZA 5FB2A 2EV6A 2G7HA 3GVAA 1WWXA 2XHKA 1XMAA 3E6CC 4HZFA 3MQ0A 2IC1A 3I58A 2YPRA 1R58A 1ONVA 4QM9A 3F6VA 4QWQA 3CUQA 5L3CA 3P9CA 2E7XA 2HZTA 3U0ZA 1YWKA 2IT0A 1IUYA 4HQMA 5ED4A 2RN7A 1UW8A 1TQIA 1YIOA 3ERED 4XF1A 3ISPA 4KMFA 3HHHA 5CVRA 1RTVA 5J8CA 2Z5UA 2DBBA 4BYYA 1EV7A 2B8MA 2VECA 4EGYA 2CG4A 1CAWA 2KJBA 2UWMA 5TJJA 2HFHA 3KLNA 5HDKA 4WXCA 3SQNA 5LGNA 4FHTA 1BBYA 3F8BA 5DCFA 3B73A 2O1QA 1OPCA 1QPMA 2HEOA 2ZKLA 3GFLA 4HLYA 2NRAC 1YQAA 4GCVA 3IWZA 2P5VA 3WE2A 3HIFA 1RIOH 1FX7A 3BOQA 4Q29A 3U10A 2XAQA 2Y0OA 3SCHA 4G6DA 2ZKZA 2H27A 4MEYF 1OR7A 4M6YA 5A2QZ 4D7TA 5CJ9A 3FXQA 3WTSC 5I8SA 2ZCWA 4OMYA 1ZG3A 2QQBA 2VONA 2Q0AA 3QU6A 1QWRA 2FSWA 1ZG1A 2CW0F 5ILUA 1QXRA 2PAEA 4N9IA 2IP2A 2Z2SB 3CF6E 3H7YA 1LDJA 3NW4A 4AVBA 1P4WA 1J3PA 4R52A 4HLXA 2H0VA 4CXFA 1O7LA 2MLGA 2R7FA 4UBHA 1W7PA 2D45A 1FBQA 4HW0A 1F9NA 3OV8A 2NYXA 1KGSA 4HVOA 3U1DA 2EFWA 1L3JA 1IRFA 1E2XA 2JPCA 5BOXA 2GC1A 2QJVA 5E17F 4KN7X 1MJ9A 3KP7A 4FX4A 2RDPA 1OYWA 1ZRCA 3IL2A 2C0ZA 4EJTA 3PLQA 5LBQA 3GX4X 3FFQA 3DN7A 3ZMTA 2Q8KA 1OD5A 2L4MA 3KP3A 2WFPA 4WBBA 5K5OA 2ISYA 3SCGA 5I91A 5J8FA 4XETA 3V7SA 3WE3A 1DGRA 1ZREA 2VBYA 3GWZA 5FLIA 2K7LA 5E16A 2PYTA 4BHBA 3GZ6A 5KHJA 3BZ6A 1PP7U 1YLLA 4J1WA 1IN6A 2JZYA 2CO5A 3BJ6A 1CAXB 2WV0A 3MZYA 1FSHA 3RJPA 4UXNA 5J7MA 4MNUA 2EB7A 1LRHA 3K69A 3C7JA 3L09A 5D5UB 3NEUA 1ZN2A 2ESHA 1L3LA 1S29A 2W25A 4MQVA 1S7AA 5HOOA 1FOKA 2D1VA 3HOTA 4O5VA 2Z33A 4PIZA 4EWDA 4LJZF 4YFKF 4IPAA 1OKRA 3K2ZA 1LR5A 5D6EA 2DO7A 1J3RA 4WXDA 2K0GA 2ADUA 1HSJA 3J80Z 4Q0PA 4JTOA 4XF3A 3J80K 4U0YA 1ZZ7A 1S8NA 4R79A 1Z6RA 1BIAA 2VOPA 1J9IA 3MFKA 2V1XA 2FEZA 2QBYA 4IEVA 4U7BA 2FQPA 3ABTA 4MTEA 1SEFA 2CAVA 5DV5A 2Q2EA 1FP1D 2GU9A 3ULQB 5JSPA 3I71A 4LG0B 1IN8A 4NQWA 3UKNA 4KWJA 3ELKA 1WA4A 3J81Z 4HVRA 4ZYGA 2EV5A 4KYWA 1LB2A 2J5OA 5JI6A 1ZVFA 4ENKA 1ON1A 3OCPA 1EH8A 5CYVA 4WZCA 1DGWA 3FX3A 5FLHA 2BV6A 5DCMB 2VBXA 3GBFA 1IXRC 3H7JA 1MJAA 1U78A 4LMYA 4LB5A 1EYBA 3DQVC 4KA4A 4RGSA 3F3XA 4XF4A 2RVCA 3D82A 3DL3A 1LKNA 1XDUA 5E20A 5KHHA 3OTFA 3DV8A 1MGTA 2MC3A 2ZO4A 4EM0B 3HRUA 2O8XA 2L3DA 3ZMUA 1QNTA 3CJNA 4ZZLA 1I5ZA 2W85A 1SD4A 1WLTA 1X8EA 2O61A 3WTYC 2JSCA 3ZMVA 2ET1A 3BCWA 4A5NA 3I5UA 3DFGA 2L4AA 2QCSB 2EA7A 2CAUA 5C6CA 3CO6C 5KK1A 4N0BA 1AOYA 3CLOA 4QMAA 2LF8A 1TNTA 3KEQA 1GXPA 3M8FA 2H09A 1LJ9A 1I27A 3I59B 4EMSA 1I6XA 2UXNA 1PUEE 4MEXF 5ICGA 4CYDA 2PMHA 4UHTA 4P96A 1QZYA 4ZYDA 1FYMA 2EWNA 5HI0A 4GXOA 5FPZA 1W5TA 2RNJA 1XMKA 1NE6A 2IXLA 3GYHX 4Q5SF 3G7DA 2LSOA 4ORFA 1HW2A 3RTRA 5EFUA 4P9UA 4E2SA 3RKXA 4PGGA 3CLPA 3IBMA 1XCVA 3FE5A 3IC7A 3BP8A 2FXAA 4RGUA 3WG9A 3JSPA 5FQ0A 1IW7F 3VFZA 4WX9A 3TO6A 3M3IA 1XN7A 1BI1A 2X4HA 1NZCA 5FFZA 5IT9Z 3P9IA 2PFBA 3IIAA 4EV0A 1Q3EA 1TTYA 4MGZE 1YS7A 3I59A 2ZBKA 2P6SA 4LLLA 1ZRDA 3RYRA 4P9GA 3HYIA 3IDBB 5LHGA 4LEJA 4I02A 2XUBA 1I1SA 3RNSA 2JTVA 2VN2A 4HN0A 1SMYF 3C3WA 4KN4X 3NVCA 1HKQA 1T0FA 4CICA 1F1ZA 3B02A 3GYDA 4ZZDA 1Q43A 4KT5C 1R5GA 2QENA 4XFBA 3F8MA 4AVAA 1RUOA 1G6NA 3R4KA 4G6QA 1NE4A 3E3VA 4QGNA 4HN1A 2FMYA 3W6JB 2EFOA 2HS5A 2IA2A 2PJPA 2QLZA 5L3BA 3Q9SA 4X6RB 1RGSA 2C6YA 1TNSA 4ENMA 4AQ6A 1VTNC 4DNCA 2L54A 3LAPA 4UBGA 4RB2C 1HQCA 4O9EA 4I98B 2DQLA 5K5RA 3H1YA 4L0YB 1R00A 2CFXA 3NRVA 3FHZA 5AVPA 2UZKA 3CTAA 4OIOF 1S3JA 1CGPA 4NB5A 5E1XA 2JPBA 4ENNA 1YW9A 4A2UA 2DTRA 5JAXA 2UY9A 4Z82A 3ZP5A 4AIKA 4Q48A 4P5OA 2O03A 1JXSA 3RYPA 1UIKA 2BNMA 3WTTC 2FNAA 2HKOA 3P9KA 5K8SA 3GXOA 4I0BA 3K1PA 1SAXA 2GIVA 4R1HA 2XAJA 1LDKB 2BNOA 1Z9CA 1X3UA 3HQXA 1R36A 5DYMA 3EYYA 5I8TA 4CDGA 3MYXA 2CSOA 3QACA 4LULA 3D0JA 5K1YA 3RPUA 4EVIA 2FQ3A 1GHCA 3WW4A 2A69F 1BC7C 2E1NA 2KRFA 2QBYB 3NKTA 1BJAA 5D4SA 1Q5OA 6PAXA 1B6AA 1ZRFA 3GUDA 3NJZA 4HDVA 4HSJA 4BHPA 1BN5A 1FBUA 1SMTA 2XROA 4WF2A 3KP5A 4X6QB 3HSEA 4M73A 1ZX5A 2A61A 2KJCA 2KIUA 1T38A 3O3KA 1WRJA 3LWFA 2IA1A 1YUDA 5FO5A 1ZZ8A 1UIJA 1R22A 1KU3A 2J5PA 1KQ8A 3BB6A 4EGZA 5HVQC 4IXAA 4YRDA 4LTAA 3HHGA 2NAZA 1O57A 4G7OF 1CF7B 5L3GA 4KIBA 4O9GA 3CUQC 1G4DA 2FA5A 1J0RA 2MHFA 1O3QA 1IZ1A 2V1UA 3BALA 3E6DA 3WU0A 3V7CA 4JVAA 5JR7B 3WW2A 4XSZF 4KL1A 3BY6A 3WTZA 1OFNA 4L9NA 1K78A 3BPZA 4XF0A 1UHMA 1O4TA 3ZPLA 2F4PA 4G9YA 2Y75A 3HTSB 4Q0VA 2OZJA 2N7GA 3KZYA 1QQIA 1P6RA 2PMUA 2A3SA 4I01A 3IRQA 1U5TB 5BV6A 1TBXA 1KQ0A 3UKVA 2GZWA 5D4RA 1ZZ9A 1UHWA 3I64A 3E97A 5HLIA 3KETA 3H8UA 2O8QA 2HWVA 3IKTA 4I09A 3FXRA 1ZHFA 3IHUA 2KKOA 1Z6TA 1PDNC 2PN6A 4L18B 4HF2A 1J2XA 4HA8A 1IRGA 2P5KA 4WVZA 3EQEA 1HW1A 1RUNA 4ESJA 3KLOA 2ETEA 3F72A 4L2NA 4HBLA 2ET7A 2HQRA 2GC0A 2STTA 1TW2A 1X7NA 2UY8A 5H6QA 3U11A 2OZ6A 3IKVA 1MJBA 2Q30A 1BI2A 3KP2A 1NXMA 1J7KA 4GGGA 4WWCA 3KEOA 5AIPA 4I3PA 5I8YA 1BM9A 2XAFA 3KP6A 3WTWC 5KBFA 1YFWA 4Z07A 3H50A 2HYFA 1CX4A 5J6XA 2IRFG 2D93A 1R5HA 1YS6A 4OU0A 4BXUA 2Z69A 3DPLC 2HQNA 2R3SA 3LA3A 2D1HA 1XSXA 3HOSA 2HTSA 4Q4ZF 3RKWA 5J3UA 1RZ4A 1UCXA 4ENJA 4F8AA 4O3MA 3RPQA 4PIXA 4I0AA 2F5DA 2RGVA 3GEZA 1CAXA 3MPBA 4IJAA 1V3FA 3DXJF 3HRTA 5C8WA 2LF7A 4I2OA 5BPDA 3DKWA 4OLLA 5AONA 4Z2YA 3M1EA 4L9VA 4L0ZB 4QX5A 3FM5A 3FZ3A 2WC2A 3I0TA 1PM7A 2KIMA 3R0JA 1OYYA 4JTNA 2WWYA 2OU2A 1O5LA 4U88A 3TDZC 2XAHA 1QXJA 2GA2A 5D1IA 3ST7A 3LWCA 1RC6A 3DP7A 2M45A 2Q1ZB 2M30A 4A0ZA 5HLGA 5FCCA 2FRHA 3F6OA 3EUHA 5D5XB 2YX4A 1IPJA 4E2QA 2VT2A 2GAUA 4GO1A 1G3YA 1UCRA 1U12A 4KFCA 2Q4SA 2XAGA 3TO9A 2IXJA 3V8LA 2YX7A 3T5XA 1H9TA 3PNAA 3JZVA 1YFUA 3H3ZA 4MGRA 1GXQA 1F4KA 3V8JA 4IEUA 2CV6A 1A04A 1SFXA 3JTHA 1JE8A 1GVJA 4KIGA 3F8FA 1HW5A 3EJKA 2B5HA 2ATFA 2V79A 2IXIA 3LQRA 1Y9QA 4BNCA 4H0EA 1T98A 1IAWA 1IXSB 1XSDA 4MGIE 5ICFA 5JCTA 3C3VA 4Q0QA 4Q47A 2UXXA 2CWEA 3QRFF 3SXWA 3W6KB 2BYVE 1BIBA 4O6JA 1FWZA 1FT9A 4GYIA 4B09A 1LVAA 1Z05A 5H20A 3DF8A 2H6CA 4M6XA 1R1UA 3GZ5A 1STZA 1ZGJA 4A6DA 5CU1A 1CF7A 3K0LA 4S04A 2RQPA 5F6FA 2TDXA 5E1RA 5CADA 3F21A 2FNPA 4D0PA 1QZZA 2EV0A 3S2WA 3IRRA 3C1DA 4EJWA 1B4AA 1SQ4A 3USSA 1ZARA 3HT2A 1LEBA 3WU1B 2MBFA 2IJLA 5CLSA 2XIGA 3CUOA 1XE7A 3FZVA 4KIFA 3IDCB 4OIRF 4OIPF 3KE2A 2D2WA 2LKPA 1W7PB 2RC4A 2DCTA 2PI0A 4XFHA 3WTXC 3J7AO 5LRSA 1O7FA 4LD5A 2MH2A 1ON2A 3OF1A 2BBYA 4HV5A 4RGRA 1U2WA 4XRFA 4MGYE 3OGJA 4LB6B 2GXGA 3CDHA 1U5TA 2Q0OA 4U0WA 3REOA 4HLTA 5FD5A 4IRIA 5D8LB 2GXBA 1XCBA 2V09A 2D40A 1O3RA 5BPXA 4Y13A 1H9GA 1KQ9A 3FMSA 3ZMSA 4QM8A 1WQ2A 1X82A 1HSTA 4LFUA 4LK1F 4CGZA 2HYGD 2L02A 4LLGF 1XE8A 5I0SA 1IF1A 4Q0SA 2EFNA 2GC2A 2XL9A 3E5XA 5FQ0B 3CO2A 1TQ5A 3TQNA 4IEQA 5HS7A 2OZUA 4WXHA 3JTGA 2XKOA 1PP8F 4IEPA 2ZXJA 3G3ZA 3TDUC 2KXLA 3O2PE 3T8TA 2PQQA 2XVCA 4ASNA 3ML6A 1REPC 5LLQA 4KICA 3E5QA 4RAZA 4DINB 5ILVA 5H6RA 1JUHA 1J75A 4GYGA 4U7DA 1FI2A 2VOOA 1CAWB 3F23A 1ZZ6A 3R61A 2V9VA 4FX0A 4A6EA 4AXOA 2IXCA 3WGGA 1SD5A 1ZGAA 2HOEA 3BPXA 4JBAA 2ESNA 2A6HF 2V1DA 2O6GE 2FU4A 5FFXA 2STWA 3SHFA 3LAGA 4CHUA 3ES1A 1XSVA 1HKSA 2OPKA 3ZDSA 1BOAA 1FNNA 2OA4A 1SD6A 1FC3A 5JHUA 2JRTA 2OQGA 1X8MA 4WK8F 4TV7A 3VHRA 1EY2A 5BPIA 2K9ZA 5DD4A 4XEZA 5HS9A 2ELHA 2VBWA 1R1VA 2MPFA 4DQ2A 1U3EM 1YW7A 2HJIA 3SMHA 1FZPB 2FOKA 5I0UA 4ZYHA 1J58A 4BQAA 2F5FA 2G7UA 3QP5A 1FPQA 3J81K 1CAVB 3LA2A 3KP4A 2Z99A 3FHIB 2PG4A 2GQQA 4IRHA 1Z91A 1YTYA 1RL3A 2P17A 3T1BA 3EHKA 3PFIA 1YFXA 4M72A 5CVIA 3ES4A 3NSTA 1JGSA 1W7PD 1QO0D 4L5JA 5EEGA 2HTJA 1U8RA 3BDDA 1DZTA 1OYIA 4YIIA 4ZU7A 1K78B 4ZYEA 2F5CA 3K1NA 3F22A 4HYEA 4WCGA 1H1IA 4JV4A 2W57A 2PEXA 1XGSA 3QU3A 3I4PA 1FSEA 4AQ2A 3KCCA 5J48A 4CZZA 3ZMZA 2Y0MA 5FLJA 2A07F 4EROA 2XLGA 5D5WB 3L2CA 3RKYA 4HOBA 1CAVA 3FXUA 5F1RA 5ILSA 1LDDA 1WI9A 3M70A 2EAAA 2X0LA 4ZU4A 4IVNA 1R7JA 4UXAA 1JHFA 4PGHA 3TOBA 1EP0A 2MH9A 3GFIA 3VODA 2OBPA 4EM2A 2QVOA 3KGZA 1T2KA 3PQKA 3BU7A 1O3SA 3WGHA 4JQFA 4QGLA 1SD7A 4KU7A 4IEXA 3E6BA 1D8KA 2QZ8A 3SZPA 2K27A 2CGPA 3COAC 2QM3A 4MTDA 2MA3A 5LGTA 5E8GA 4HX7A 1WGPA 1IN5A 2VBZA 2EK5A 2G9WA 1USSA 4IF4A 5DUKA 1NYWA 1EH6A 1Y3TA 4HBNA 5LEJA 3IWFA 4JK1X 4MQ9F 1XGOA 3SHRA 1ZG5A 2PBIA 2OA2A 2H94A 2VPVA 1YFYA 4IHSA 1R23A 3AAFA 5CVJA 1KYZA 1CAUB 4N9HA 4IEYA 3N4MA 1D3YA 5LHIA 1S6LA 3M8EA 1ZRRA 2FF4A 1LNWA 4IEOA 2AXLA 2A5YB 4KWKA 2MLKA 2XLAA 3RI4A 1IPKA 4AVPA 3ZN1A 5JVTA 1ODDA 1IN4A 2HKXA 4ON0A 4YNIA 2K02A 4UVBA 4I7HA 5CVUA 1ZAOA 1D8JA 2AS5F 2PTMA 2PHDA 3L2HA 2XKPA 3MAJA 4CO8A 1TQPA 1J59A 2M87A 3ACLA 4XLPF 1BI3A 4P55A 4OOIA 2XASA 1XGMA 3M7GA 2EFPA 1FBSA 2PHLA 4EM1A 5HS8A 4AVCA 3TKYA 5KHGA 3LQQA 1S7OA 1I1GA 3R6SA 2QDRA 4FT8A 1ZYRF 1DDNA 2P4WA 2Z9OA 2QUFA 4PIYA 4M71A 4IETA 1BI0A 4J1XA 2A68F 3MCZA 4BH9A 3PQJA 3QOPA 4LUKA 2ZFWA 1BC8C 4OIQF 5HLHA 4LK0F 3TGNA 3GLXA 3BWGA 4RB0A 2XV4S 2LDUA 4MUVA 3WGIA 4MGKE 2L01A 3KGLA 3OD0A 1TLHB 4XLNF 3FM3A 4XFGA 4YYOA 3FMRA 4HAMA 3HRMA 4L5IA 2MNGA 2XL7A 1LEAA 2Y48A 4EJVA 5D5VB 4HX8A 4YG2F 3TO7A 4XF9A 3NL1A 5CVVA 3H92A 3HTUA 4LLNA 4Y15A 3TNQA 3ELNA 4R8HA 4KDPA 1USTA 2W24A 5BQTA 3S0MA 3EO6A 4K8FA 4G8XA 2BNNA 4EQQA 3TNPB 1NHAA 4KUMA 2VQAA 2COMA 1MKMA 3F8CA 2NS0A 1V70A 4PCQA 5T3NA 1YFHA 1FY7A 2YU3A 1FP2A 1GQHA 2OQRA 1U6GA 4P9FA 1Z1DA 3EDPA 5I93A 4IEWA 5LGUA 2F2EA 5FLXZ 3JSOA 2M5WA 4ZH4F 3TOAA 1SFUA 1E17A 4LLOA 3CL1A 3L9FA 2DPDA 3KFWX 3GW2A 3HT1A 1Q1HA 2FBKA 2YR2A 1F5TA 2ZMEA 3SZTA 2ISZA 2QWWA 1VP6A 3ETQA 4E2GA 3DEUA 3UKTA 4ONUA 2EJRA 3V7RA 4ETSA 3VOEA 3GFJA 5KHKA 5E1WA 2I45A 3ZMDA 4L9JA 3EETA 1KU2A 4A5MA 4YFNF 3I54A 5HDGA 4BHCA 2E1CA 3MDPA 2W84A 3H3UA 1D5VA 2IVMA 5TRDA 3O6BB 4HDUA 4MH0E 2XGXA 1K79A 1G3TA 4G7ZF 1FYKA 2CQKA 5FD6A 4KU8A 1ZNPA 4LG0A 1MDMA 4PDKA 3FJSA 5L3FA 2VC0A 4AIHA 4BIFA 5ICEA 5E8IA 4UV8A 1YHFA 4HMZA 3KMHA 4RAYA 2LNBA 1G3SA 4TLFA 4UNOA 2F5EA 1V4RA 3FWEA 4XFAA 3BPVA 2P6TA 5BUVA 1O5UA 2VE8A 5BY5A 2B9UA 2XLFA 2PAMA 2RV8A 1XGNA 3EYIA 2JT1A 2R7DA 4Q0UA 5K5QA 3LOIA 2DU9A 2GWRA 1ZZBA 5JR3A 1EH7A 4RB1A 4FAHA 5D6FA 3KSCA 2QYOA 3H9AA 3JW4A 1VJ2A 4M9ZA 3M9AA 1JHHA 3KZZA 2IPQX 3ECOA 4B8XA 1DPUA 2M8EA 3N97A 1SFEA 2K4JA 3PVBB 1K7AA 4AIJA 2P7CB 2M1BA 3L7WA 2HGCA 4EWEA 4ZU5A 3LAJA 2GC3A 3EBRA 3RZZA 3GF2A 3BJAA 1DUXC 5LEKA 4YSFA 1RNLA 4OINF 1Z7UA 2QQAA 1KU9A 1Y0UA 2O3FA 2ZNZA 3EQLF 1P92A 2IW5A 4IESA 2UYBA 1ZH5A 1IN7A 3D0SA 4YFXF 2HDCA 1FYLA 3WTVC 3E6MA 3T0YA 1XB4A 2FBIA 3T8RA 4ESBA 5IT9K 1PMIA 1UD1A 2DW4A 4MX3A 2CYYA 1DP7P 5A2QK 3BJOA 2PAKA 4OFGA 1OMIA 1YYVA 1KYWA 5IT3A 2DQRA 5KVRA 3CJXA 4L9TA 1AWCA 2EA4A 1T6SA 1YO5C 3SXYA 1UB9A 4M9XA 3HRSA 3F8NA 1J5YA 1DZRA 3CUQB 3ZN0A 2P5LC 1OI6A 4S05A 4ESFA 2KIFA 4HSLA 1QBJA 5F64A 2NNNA 2IXKA 3I7DA 4LA3A 4META 2IA0A 3SCFA 1XRUA 4A12A 3V4GA 5LRRA 4D7SA 5DUIA 5KHIA 2P8TA 4UUVA 4LA2A 2DI3A 1HXDA 3LZZA 5LHHA 4M74A 4F7ZA 3VEPA 2VC1A 4MHGA 4EJOA 1U5TC 4UVCA 1H0MA 1FLIA 4HX4A 4KMUX 4NVPA 2QQ9A 4A0YA 2OYZA 5L3DA 1B59A 4L11A 1ZLJA 3WODF 4NHJA 3WTUC 4UV9A 1YG2A 2ACJA 2OAZA 2E7WA 3S7EA 4FAGA 2E9QA 4IERA 3MEXA 3QP6A 1C0WA 2QVSB 5EEHA 1XD7A 1GQGA 1DPRA 2PQ8A 2BE5F 5HDNA 1ULYA 5E18F 3Q9VA 2NNYA 1KA8A 1G3WA 2FMLA 5JFRA 4QLCU 2FE3A 4M9SA 2UYAA 2H6BA 5FGMA 2EFQA 1QY4A 3ECHA 1T39A 5AIQA 3WW1A 1K6OA 3QPHA 2YSRA 3ROUA 1SFNA 3R60A 3BROA 1YW8A 1LQ1A 5EZWA 5I0RA 3G73A 2RKHA 3U2RA 3LSTA 4XFIA 3D5LA 4KNYA 4GULA 1WKMA 1KU7A 2A6EF 3S7IA 3SFZA 1P4AA 2K86A 3RIRA 2HR3A 5FLXK 4HQEA 1MZBA 1W4MA 3QPTA 1RI7A 2VXZA 4G7HF 5ICCA 2DLLA 1MDMB 4OMZA 2Z3YA 3R0AA 1TW3A 5E1ZB 2ZMEB 4PJYA 2PFWA 2ETHA 1B1BA 2PA7A 5JSRA 1CAUA 3V8KA 5D8KB 4QGMA 5DEQA 2IXHA 1W5SA 1MD0A 3O14A 3P7NA 2VODA 4LGWA 4FBFA 4RS8A 4IHTA 5DD8A 4HF1A 4YARA 2D5FA 1WSUA 3LA7A 3C18A 5ERIA 2WTEA 4LUMA 1P4XA 3ABUA 4K2EA 1ZLKA 3ZQ7A 2DK5A 2ZNYA 1EPZA 4HF0A 4B29A 1J3QA 3WW3A 2PLYA 5BS6A 3FF5A 4AWXB 2GA1A 4PZJA 4HVQA 2EA2A 2V6CA 2DT5A 3Q5FA 2MD5A 3E5UA 3H1WA 4RD7A 1HBXG 3H1MA 3NQOA 5I0TA 3CO7C 1VR3A 4RGXA 2OD5A 4A0XA 1B9MA 1UPIA 3GFMA 3CEWA 3L00A 3LFKA 3K1MA 4BAYA 1H1MA 2ZJ2A 4XFFA 4EWAA 2DK8A 2VE9A 1TQMA 4U0VA 3U9GA 3GO5A 4IEZA 1UFMA 4XBFA 2EVXA 3MZHA 3MWMA 3RYKA 1YLFA 3OOPA 2DFIA 5JSOA 3I53A 2O0YA 3FMQA 3HSRA 5DCMA 5L3EA 1ZZCA 4H7LA 5FDBA 1HKTA 1O3TA 1QGPA 4AD9A 4XFCA 3RDIA 4YIFA 2DPUA 4HV6A 3JAMK 3HUGA 3JAMZ 5BMZA 3QAHA 1IXCA 4IRGA 1J1LA 2VT3A 5DDGA
chains in the Genus database with same CATH superfamily
2GN3A 4UFJA 4CDUA 2VR4A 4CZSA 3B69A 2K4BA 2RM23 5BXXA 4FQ4A 1FTTA 3VB2A 1P2FA 2NYYA 4R9AA 4EJUA 1ETOA 3WG3A 4IL6C 3NARA 5F3EA 4KWLA 5FZFA 1XSQA 1TVGA 2C26A 4XSXF 2YU1A 1DYOA 4XJAA 4P9YA 3WCSA 3LDKA 5JI7A 4QXKA 1G9DA 3ZN6A 5FZ0A 2EV6A 1XNTA 1B8IB 3GVAA 2ZAAA 2L9LA 3S16J 2WB1A 3IM0A 1GZWB 1IV6A 4QIWN 2R7XA 3T2OA 4XACA 3P9CA 1X4PA 2JG8C 2YFUA 4AL9A 1IUYA 4HQMA 5ED4A 2RN7A 3H0GJ 1YIOA 2PLV1 4W65A 5FP8A 4XMIA 1NG7A 4KMFA 1TL8A 1ULCA 5CVRA 4QT6A 1EV7A 2NN8A 2G4IA 1OLTA 5LA9A 3MICA 4GALA 1FMD1 3VYTB 5EP9A 3B73A 1QPMA 5BNQA 5G05L 3AXEA 1TMF1 1VAKA 2HI3A 3IWZA 3ACFA 3HIFA 1RIOH 3ZIXA 1P7JA 1DP0A 3U10A 4A3GJ 2AHQA 2ZKZA 4OHYA 2R5YB 4AYBN 5CJ9A 3FXQA 3WTSC 4XOGA 4FPYA 2ZCWA 4UF0A 3I2OA 2V6EA 1RJ8A 2VONA 3QU6A 1QWRA 4UFHA 2D43A 2CW0F 2R30A 2PAEA 3KF3A 1UY0A 3I2IA 4DQAA 4ZY9A 1BCXA 1WBLA 3NW4A 5A7WB 1P4WA 2AACA 1J3PA 2AXTC 4Q4W2 1KDKA 1GP5A 1W2OA 4YW3A 1O7LA 4UT5A 1VQ5I 2R7FA 4E9KA 4RQPC 3JCUC 3BN6A 3CCJI 2E19A 4HW0A 1FOYA 3OV8A 2NYXA 1RUF3 2ZZJA 1KGSA 3U1DA 2F4OB 1E2XA 1LEMA 2JPCA 2PJRA 5EGOA 4H55A 2BW3B 4KN7X 1MJ9A 3KP7A 4FX4A 1Z3XA 4ZS3A 4EJTA 2DOEA 5IATA 3B6CA 5EIYB 3FFQA 1NA1A 1F5JA 3DN7A 3PVEA 3ZMTA 5DTDA 1SDWA 2L4MA 2GP5A 4IQJA 1D2SA 2BBVA 2XBO3 1VIWB 3V7SA 2VBYA 5FLIA 2HVRA 3MV11 1X4OA 5FZBA 1XYOA 2PLV2 2AQFA 1ND2C 4BHBA 2XH6A 5KHJA 2VTXJ 1JMUB 5FZKA 3JXSA 3AMQA 2CO5A 3R4SA 1VBA3 2WV0A 3NAUA 2ZGOA 3LE0A 4B7EA 3P3PA 1S29A 1QJFA 1AZDA 4YGDA 4UW4A 1LPQA 3PVOA 2R043 2C24A 2DO7A 3K4NA 2ADUA 3IP4B 4Q0PA 1PGW1 5GADJ 4PT6A 3TOJA 4EQVA 1BIAA 4L99A 3HPNA 1APLC 2FEZA 4IEVA 1X3WB 2FQPA 1OC1A 4MTEA 1V9U2 3MUZ1 2RS32 2GU9A 4YW6A 4QTRA 1Z77A 2DMTA 1IN8A 4KWJA 2DTWA 1YEWA 2J5OA 1ZVFA 3ZXJA 4CYCB 1EH8A 4WM8B 3A0HC 1A8DA 5CYVA 3AL5A 2ZXQA 5FWEA 1DGWA 3C2GA 3Q8BA 3GBFA 4DBQA 1IXRC 2BY0A 3FXLA 4XLAA 4LMYA 1PM4A 3VBHA 1YNAA 2ZPXA 3VDBA 5HODA 2W1OA 3OEBA 3WDWA 2X6WA 4JZRA 4LIVA 3CBNA 3OTFA 1VBE3 3TMOA 2AZ5A 2MC3A 4QPGB 4JYKA 5F0CA 4BB3A 1MH4A 1N3QA 3ZMUA 3T1LA 3CJNA 4ZZLA 4BQWA 4PUSA 1WKYA 3N9MA 3AG2H 1NOVA 2RM21 1W2UA 2V9PA 3ZO0B 4BM8A 4QX0A 5T52A 3ZMVA 1DQ4A 3I5UA 4Y5Z0 1BR4A 4HSTA 1LULA 2WN3A 3DFGA 5FKLA 1AXYA 2QCSB 2EA7A 2CAUA 3WNXA 1HDPA 3CO6C 2WWUA 4XN0A 1LOFC 1C8M1 1KJLA 3KEQA 4RS5B 3X29B 4IW3A 1I27A 4EMSA 1ND3A 2FHRA 3M3EA 5IP9J 1JUPA 1OCRH 5TSWA 1U5YA 2Q8EA 1VAVA 1X1CA 5DAXA 3KZ4C 5K0UB 3D5SC 4CYDA 2PMHA 4XK4A 4JGYB 5C7GA 1Z78A 3WNMA 4ZYDA 2XRLA 5FPZA 5CYYA 2QQIA 3CDZB 2IXLA 2GOMA 4PBOA 4E2SA 3ME2A 1XCVA 2B63J 2WB1N 2D6OX 3JSPA 1GICA 1MZ5A 1XN7A 5J1XA 5K7HA 3IIAA 3OB8A 2LLKA 1Q3EA 2VTFA 1TTYA 3T0DA 2OC6A 1AXKA 1W2TA 2DFCA 2ZBKA 4SLIA 4LLLA 4JX4A 1ZRDA 1VQPI 5IP6A 2OPTA 3IDBB 1HB4A 2WZR3 3RNSA 2JTVA 5EQUA 5D8AC 3NVCA 4BY7J 5C44J 1I3QJ 3GYDA 3I2DA 4UWDA 2DUPA 1SMVA 2QENA 1RUOA 4NHLA 1G6NA 5FPLA 2DCZA 2FMYA 5HBAA 3HG9A 3VBOC 1K5MB 2HS5A 1X3ZB 4M0HA 2IA2A 2PJPA 2FDGA 5L3BA 2OTLI 3Q9SA 2I07B 2C6YA 4W50A 1GSLA 4AQ6A 4DNCA 2VKEA 1RUI2 1GANA 1R00A 2CV2A 2DN0A 4CXXA 2UZKA 5C9AB 2NMNA 1X2NA 1WJDA 1S1AA 2UY9A 3ACIA 4Z82A 5DS9A 2OW4A 1UG0A 1UIKA 3N7KA 5IFTA 1SAXA 4R1HA 2BFUL 4W6WA 4CDGA 5CBLA 4LULA 3RPUA 1W9WA 1RUG2 1UOBA 3WW4A 1QH6A 4DOZA 4P9IA 4LKDA 4KGGA 2ME0A 1GUIA 4EN0A 2KRFA 1DLCA 3UESA 5D4SA 5JLVA 4XOPA 4AU7A 2X9DA 3NJZA 3UV9A 3ZRGA 2R0FA 9ANTA 3KP5A 4X6QB 4DXRA 2M34A 4M73A 1DQ0A 2W68A 1I50J 1W8FA 2KIUA 2XF6A 5L9RA 3O3KA 1WRJA 3LWFA 4DYRA 1YUDA 1ZZ8A 1R22A 1KU3A 4PK4A 2WNEA 5HVQC 2RS52 1Y39A 1GUUA 2W0XA 1ZYBA 3O1OA 1CF7B 5SV5A 2TUNA 3N9PA 5DPNA 1HB2A 1O3QA 2A6ZA 4Z6YA 3CCMI 3I4NJ 3AC0A 5IOYA 4KL1A 3KYLA 1DYKA 2WAFA 2V7FA 3VBUB 4XF0A 3F9KA 1UHMA 1YXWA 3KHBA 3GZTB 2LY1A 2LC2A 2KP6A 1DQ2A 3DPRC 2Y75A 1R49A 3JRHA 4Q0VA 2GLOA 2FCTA 1JGGA 2CQQA 1N75A 1EAH2 4S0HB 3PO3J 5D8AB 2VQUA 1U5TB 5EDNA 1F43A 1KQ0A 3ZMOA 3UETA 3VN4A 3OJBA 3E97A 5CKTA 1HV1A 3H8UA 1BBT3 3IKTA 2K9SA 1RB8G 2XG3A 1ZHFA 1ZGWA 4UOJA 1PDNC 5F04A 2R071 3H9JA 1J2XA 1PHMA 1IRGA 3C8XA 1HW1A 3C7HA 4GWJA 5FP9A 3F72A 4L2NA 4HBLA 2ET7A 3BVCA 2GC0A 2STTA 3VBSA 5FY9A 4Z8BA 1YO8A 3ASNH 1IDYA 4RGGA 1MBGA 3U11A 2OZ6A 2LMDA 1AR82 1XU1A 1NXMA 1IOAA 1W9YA 2VW2A 1I9RA 2DVFA 5AIPA 1T2XA 4MG2A 3KP6A 2ZZQA 1YFWA 4XCAA 2YPDA 2HYFA 3VHPA 2D93A 5J6XA 2IRFG 2WS91 3CCQI 1UU4A 2Z69A 5KXCA 3DPLC 1AYN1 2HTSA 1UY1A 5J3UA 5FRNA 2Y6HA 4LHNA 4F8AA 3RPQA 5KNLA 1UAIA 4PIXA 4EE2A 1NY72 3MD2A 4NAMA 4HG2A 2XF5A 3LPFA 2WNUC 2RS31 5M3FJ 3NJYA 1CQ9A 2LF7A 5JIUA 4GXLA 2XOMA 4QX5A 1GP4A 4C8DA 3I0TA 2RJKA 1BBT1 2E6VA 1CR7A 1YQCA 1NCQC 1OYYA 3BR1A 1A34A 2VMFA 4U88A 3TDZC 2XAHA 1W8TA 3CMGA 4FISA 4ZONA 2EIGA 2WYFA 4C91A 3MW3A 4IHWA 3HKZN 3EUAA 5F1JA 2I5UA 2D7FA 1GNZA 2A5ZA 4CEYB 2WUHA 2FRHA 3F6OA 3EUHA 2SLIA 4AC0A 2YX4A 2DVBA 4JHTA 1RITA 2Y6KA 5FPBA 3VBUC 4B1RA 2GAUA 3SNMA 4QKBA 4AHZA 4FTHA 3BTJA 4K20A 2BXZA 2XR4A 2L7FP 2XAGA 3O7OA 1D4M1 2O5RA 5KC6A 3GTMJ 1I6HJ 3V8JA 1JBCA 1A04A 1SFXA 1PZ7A 4IV1B 1JE8A 1IRZA 2ATFA 2LM3A 2IXIA 2F5VA 1Q8OA 3LQRA 5IVJA 1T98A 4QKFA 1IAWA 3O1VA 2JRMA 5FZ3A 5ICFA 1Q1VA 1W6NB 1JZ5A 4IO9F 2VNGA 3ABLH 2CWEA 3QODA 3KQ4B 1O4YA 3PSIA 3O0WA 5B2GB 4FO9A 4O6JA 1H6XA 2G9FA 1FT9A 4C1XA 1A31A 1Y43B 3AYEA 2ZEZA 3HJEA 4AYBA 5B1BH 2HVSA 2QSHX 1MMGA 4M6XA 2K9LA 1ALYA 1R1UA 3GZ5A 2FZ1A 1XG1A 1MS4A 3AYAA 4OWRB 3K0LA 4S04A 5E1RA 5F6FA 2TDXA 5LY1A 5CADA 3F21A 1HDDC 1QZZA 3ZXFA 3JR9A 2RE9A 2EINH 1ZARA 2P2KA 3HT2A 5CLSA 1UHSA 2XIGA 4KIFA 3IDCB 3HXLA 4OIRF 3AZYA 1W7PB 3A22A 2W94A 2PI0A 1K61A 1C8M2 4XFHA 3WDXA 4Y3OA 5LRSA 4LD5A 3O1UA 5L7OB 3OF1A 2OF7A 4HV5A 4RGRA 4XRFA 4LB6B 3B3QE 3POBA 5F37A 4DPNA 4XUNA 2RS13 2ZABA 4LPLA 4XUQA 3OIPA 3OR2C 4HLTA 1XCBA 4DZJA 1SLIA 1O3RA 1UOGA 5BPXA 3H8RA 4Y13A 1YX3A 3HL2A 3NRUA 4TZDA 2CJJA 4RLFA 1X82A 2RDRA 2Q1FA 2L02A 4LLGF 2DTZA 4Q0SA 1BMV1 4RFRB 3LEGA 2GC2A 3CMMA 5E3OA 5IVEA 1TQ5A 1V9U3 4Y26A 3ZFFB 4ES9A 3UYJA 4DXTA 1FOD3 5J47A 3DBHB 3G3ZA 3SDGA 3OYJA 5E8AA 1REPC 4BJ0A 2HYJA 1JUHA 5CFDA 1UKRA 1POV3 1P7IA 5J96B 1CAWB 3W5MA 1ZZ6A 2CW8A 3T1MA 1WMFA 2CUJA 1WCKA 1J09A 1SLTA 2HOEA 2JDKA 4Y52J 1URXA 2WV1A 2ESNA 1WA6X 3HJRA 1BYHA 3OD4A 2STWA 2FDHA 4CHUA 1XSVA 2OPKA 2X1CA 1XNKA 4IV1C 4DB5A 1X8MA 1OR7C 2XVGA 3AP9A 4K6BA 3BG7A 1ETVA 2CUFA 4QDRA 4XEZA 1BEV3 2BRTA 4IHYA 1R1VA 2LKXA 5JMCA 5JUVA 4DQ2A 1YW7A 5L73A 2F5FA 4GMP1 3QP5A 4CCNA 1XPXA 1CAVB 2VQTA 4AFBA 1RL3A 4Q5OA 4Y5TA 3B94A 4XUPA 2D44A 3S6PA 1LECA 2DCYA 4L5JA 2H1KA 4FVVA 2Z5WA 1DZTA 4BEHA 4IKFA 4YVSB 2V4VA 4ZU7A 3CCEI 4YFWA 3MF9A 3A2KA 3K1NA 1PK6C 1ZR2A 1KGYA 1XMXA 3OGRA 5L7OC 4JRLA 2AC1A 1XGSA 1FSEA 4QDSA 5J48A 2QTWB 3OYCA 4ES8A 2Y9ZA 4RGAA 5FLJA 1PIV1 2XLGA 5D5WB 2RMU2 3L2CA 1YI7A 1Z7S1 2WA3A 5F1RA 5ILSA 4KQ7A 2UV1A 3VD5A 4F52A 2C5DA 4BQ3A 4XR6A 1JHFA 4YG6A 2DA7A 3N36A 5DDJ2 3ZXAC 3NJXA 3X2QH 5T54A 5FK8A 1SVLA 3WHBA 1SD7A 1F2NA 4KU7A 4I99C 4IEXA 1RXFA 5IJRA 2L7MP 2QZ8A 2K27A 2GXAA 2MA3A 4HX7A 1WGPA 1IN5A 3SITA 4AR2A 3RZKA 2G9WA 1USSA 1NYWA 4PFOA 1YJWI 2YC2A 3OSDA 3SHRA 2EF6A 3ACGA 4P9XA 2WWJA 1K83J 3JRIA 1W36C 2OA2A 2VPVA 4XMAA 4NIIA 5CVJA 1ZR4A 4FOYA 4ZTFA 4YVWC 1MS0A 1QDCA 2HWB3 2NQYA 4XRSG 1Q8PA 3APBA 5T5PA 3WQ1A 1U9OA 3JD72 1CESA 3ZSJA 1ZRRA 2FF4A 1LNWA 3M8JA 1RUE3 1QJU3 2A6VA 4IGPA 2WJSA 2XLAA 1D1AA 3ZMNA 4YW5A 5C70A 3GTJJ 4BA6A 1JODA 3CQOA 4YNIA 4I7HA 5CVUA 1ZAOA 1MZFA 2PTMA 1W8OA 1PGL1 4KGQA 3MAJA 1AJKA 4P55A 2R7RA 4RHV1 4OOIA 2XASA 4X8NA 3M7GA 5DM7F 4CUGA 4EM1A 2WO1A 4ZJZA 2C4XA 4AVCA 1DP3A 4AVVA 5KHGA 2FQ4A 4GZ9A 1Y8RB 3LQQA 3BOWA 5A3TA 3FN9A 3DEWA 1NQJA 2QDRA 1OHFA 4PQ9A 2O14A 2QUFA 2JSPA 3ILNA 1NKGA 2EICA 1UXZA 1BI0A 4M3CF 4XIDA 1K6YA 4J1XA 1LODA 1X19A 3PQJA 5LA0A 3QOPA 2R6QA 2CWMA 4YW1A 4YVSC 4LK0F 1YIFA 4E7LA 1VMHA 4RB0A 4PLOA 1ERDA 3KGLA 1PK6B 5A6ZA 3VD4A 4XLNF 2WQZC 3FM3A 4YYOA 3HBLA 4IOCF 4HAMA 2V5DA 1H6YA 3PMEA 1UY2A 2XL7A 1NZIA 3I97A 3BODA 1LEAA 3WNPA 2W5FA 5FYYA 4BWOA 2W46A 1X50A 4W4ZA 3LQCA 2HOAA 1USTA 5BQTA 1SC7A 2VVEA 4WVVA 2XB6C 1HIXA 1NHAA 4N90A 4KUMA 2NXNB 2ZJCA 4COVA 2VQAA 2COMA 3TAYA 2NS0A 1V70A 3TW6A 2KMUA 5T3NA 2XJSA 3AKSA 1ZK8A 2YU3A 2VNRA 1GQHA 1ACCA 1U6GA 3TWIA 4B48A 3EDPA 2WL1A 4BXXJ 3VKFC 2HEWF 1K5MC 5FLXZ 3JSOA 3VSLA 3TOAA 4LLOA 3GHMA 4A4AA 2DPDA 3GW2A 4FPFA 3WQBA 2YR2A 3ILFA 2YBKA 1B35A 3ETQA 3WF2A 4ONUA 3VDDA 2EJRA 3V7RA 2E33A 2OQ6A 3TEYA 2R061 1EUUA 2ZHNA 4ETSA 3AP4A 1R1A2 5EZHA 3ZMDA 3CMYA 3RPUD 5H9RA 4A5MA 1MMSA 1GNYA 2B42B 2E1CA 1R4MB 1HB1A 3VZLA 2IVMA 2GP3A 3O6BB 1G3TA 2RDSA 1FYKA 2M8GX 2CQKA 3ZQQA 2WBMA 1XS9A 1ZNPA 1MDMA 2TBVA 3FJSA 1H2LA 4BIFA 5E8IA 1QXPA 5FYUA 3KMHA 4YELA 4BBSJ 2VOVA 1B35B 4G12A 4QDQA 1HDKA 4UNOA 1V4RA 5EF6A 3WF3A 2DU1A 2NZ9A 3CC2I 1Y7BA 3ZQGA 2P6TA 2JECA 1O5UA 1LCLA 2ADDA 5DAVA 5GLUA 3PU3A 3OG2A 2B9UA 2RV8A 3EYIA 1S4CA 5CEHA 5JHFA 3H0OA 2OVUA 1KDMA 1XQNA 4NAOA 4CEWA 3KSCA 3S32A 4B7KA 2HWC1 5IK7A 3JW4A 2EIDA 4P00B 2Y26A 1GOFA 1JHHA 2G19A 3Q9OA 1JOPA 2XJPA 1G9CA 5DAPA 4C3JJ 4C2MJ 3HNBM 2M8EA 1US2A 5IYBJ 4HANA 3FK7A 3WEZA 4LQRA 4NN0A 4RLQA 2E1OA 4BE2A 2OQ7A 5J4YA 4AIJA 2P7CB 2WO7A 4EWEA 1YJNI 1VE0A 4YRVA 5EHDA 4FFIA 4KWUA 3EBRA 3DPRB 2L5QA 3GF2A 3PUIA 3MIBA 2ZNZA 3EQLF 2GN7A 1P92A 3V0AA 1AR83 1WD4A 4CCDA 3CESA 4RGKA 1R1A3 1GV5A 1MMNA 4JAAA 4NHYA 3E6MA 3JRAA 5GZCA 3RJRA 5IT9K 3RZGA 3D5OA 2VVFA 4WM8C 5A2QK 4EN7B 2PAKA 2O8OA 3IMMA 1R082 1Q8QA 3FBIB 2DQRA 2W52A 3LF7A 4NRPA 4CP9B 3CJXA 1T6SA 5JWPA 1UB9A 3W20A 1ZM1A 3J9SA 3B00A 3H36A 3JRBA 1J5YA 4A41A 4F55A 5A3UA 1DZRA 3CUQB 3ZN0A 1AF9A 2QF7A 2W4SA 4ESFA 2KIFA 1QBJA 5HNFA 1LOEA 1WCUA 5F64A 1NLSA 2B9VA 3N7LA 1DHKB 4EZHA 2X85A 2IXKA 3O1SA 3C2HA 4LA3A 2IA0A 5D2AA 2DOAA 5DUIA 1KS4A 2KQRA 1RUF1 1S2EA 5FO8B 4LA2A 4LBQA 3ZQHA 5IYCJ 5LZ6A 4CEYA 1POV0 1F8VA 1IG0A 2ZSIB 5A7NA 4KMUX 1SVMA 2OYZA 4BDVB 3DXTA 3VYRB 1B59A 2AYHA 1ZLJA 3G1OA 3WODF 3WTUC 1IG7A 3PNTA 3BTLA 4NHJA 1SLCA 2OAZA 4SBVA 4IERA 4KNCA 2LOOA 1C0WA 3KT4A 1XD7A 1GQGA 1SAUA 2PQ8A 3JRDA 2PMWB 5HDNA 1E5HA 2WZ8A 1QRYA 5F6KA 2NNYA 1KA8A 2FMLA 4WVWA 4R4XA 4DYCA 3MIGA 5IFPA 4A93J 1JTYA 3UGGA 3GDBA 3CJIA 3ZKYA 1LOCA 1POGA 2ZXHA 1K6OA 4FTEA 5FZDA 2VTXA 2PQSA 2IEKA 4E4HA 5I0RA 3G73A 4NHXA 5JPMB 4XFIA 4KNYA 4ITVA 4AZZA 2EZHA 2KR2A 2DA3A 3FLPA 5JOXA 1QOSA 3RIRA 1W28A 4NR1A 1W4MA 2OX0A 2DLLA 1MDMB 2YG0A 2O9LA 2CYFA 5F8PA 4QD2A 2PJRB 1TW3A 2WFF1 2LG4A 3Q8FA 1BR1A 3V8KA 1N1TA 2HWB2 2YZ4A 5C71A 5F39A 4N43C 1MD0A 3O14A 1HLVA 2VODA 2D6KA 4FBFA 2BWCA 2JX9A 5DD8A 4HF1A 4HONA 5FZAA 3UKGA 3LA7A 5ERIA 1SHWB 4OHZA 4FTSA 3NKGA 5EJZB 2X5IC 1P4XA 1ZLKA 4A3FJ 4ATFA 3LFUA 4A7KA 4LBOA 2ZNYA 4RN5A 2W3JA 3AJYA 3WW3A 1N1VA 2PLYA 2D3RA 3FF5A 1W90A 2EA2A 2V6CA 2DT5A 5FZGA 4HKOA 4XIKA 3H1WA 1LOGA 1XNAA 2LUWA 2DJNA 4LOCA 1UZZA 4XQ4A 2K2SA 1G9AA 3CJRB 1OLME 2JB8A 3OGVA 4LJHA 2ERFA 2ZHKA 2VL8A 1QJZA 3N9OA 2LBFA 3RQ0A 4QPIA 1UPIA 3GFMA 1W99A 5JXJA 2GH8A 3VBFC 3L00A 2ZGUA 5IVYA 4A3LJ 4K7JA 2ZX4A 2HWB1 5A70A 2CW7A 4JHZA 1DQ5A 5J40A 4ISRA 1UFMA 3HNYM 2EVXA 3RYKA 4QPIB 3OOPA 4ANJA 5JSOA 1X1AA 5HCHA 3LL7A 3MEPA 1ZZCA 5CFCC 1HKTA 4CU8A 1QGPA 2YS9A 2YDEA 2DODA 3NNGA 1F5FA 3HUGA 5BMZA 1KXGA 2ZHLA 1XE0A 3WF1A 2OV7A 1XNBA 4AHWA 1QIQA 5FMOL 4GH4A 2E32A 4BISA 2FBHA 3J7MA 1Y0NA 2XRNA 3JRGA 4FTBA 1GWMA 3MUY1 4MZUA 2DAOA 2NOGA 3DEMA 3QWLA 4MV2A 1MNMC 5GLTA 1L0OC 4Y24A 4RA0A 1ZA7A 1ULDA 1DYPA 3Q0VA 2D5HA 1NCRA 3AM2A 3VKLA 2V4AA 2K9MA 1PIV3 5T55A 4NO4A 4MOAA 1IKQA 1ODNA 2G9ZA 4S2FA 3U1KA 1UQXA 3N9NA 4DGWB 1ONVA 3F6VA 2ZEWA 3GCWA 4QWQA 2Z4FA 3CUQA 2MC4A 2QQNA 4L0PA 4I3GA 2HZTA 3U0ZA 1UXXX 2GMMA 1QMJA 3HGYA 3HPGA 1MBHA 1TQIA 3ISPA 3RJ2X 3HHHA 2JDAA 2QE3A 3ZYBA 3RSNA 2Z5UA 2ZX0A 2DBBA 2X53S 5M5YJ 4EGYA 1CAWA 2KJBA 2ZEXA 3ESWB 2LTPA 5LGNA 3DPUA 1HQWA 3T2TA 1AA7A 2DFHA 4P5YA 3F8BA 2DCJA 3BQZA 2HEOA 3USUA 4ZDLA 2ZKLA 4FFGA 5FYHA 4HLYA 5FYMA 2NRAC 2XSDC 1RUC2 2VZPA 4B3XA 1V55H 3WE2A 3FK6A 1FX7A 1WJ5A 2DMNA 3BOQA 2XWBB 5FLMJ 3SCHA 2D98A 2XUEA 1OR7A 5A2QZ 4OMYA 1GDTA 4MO3M 2Q2EB 2A5WA 1W2NA 5AFEA 2DUQA 3KM5A 1RUD1 2LY9A 2FSWA 4YZ2A 3AZVA 1ZG1A 5ILUA 1QXRA 4N9IA 2PMZA 5A3MA 3H7YA 5B4XA 1RVF2 1PZ8A 4UW3A 2I2SA 4C1WA 4M00A 1KFUL 2WNUB 4LO8A 5A7PA 2JG8B 3WY6A 4XHBA 1FMVA 2D45A 5GAGJ 2BGOA 2PHXA 1F9NA 4BL0B 5C4WA 1O59A 2OPWA 1D0ZA 3VZJA 1IRFA 3S2DJ 4NIDA 4XBQA 2GC1A 2EZKA 1SPPB 4HNVA 2R0HA 5FTTC 3AFHA 1OYWA 1ZRCA 2NVYJ 2C0ZA 2VZRA 1LESA 3U14A 3HOZJ 1OD5A 1XOYA 2R7ZJ 4XW3A 4HKLA 1MEC2 5J8FA 3GTPJ 1JYCA 3GTLJ 2R7TA 3AVRA 2WSVA 2AQEA 1RUF2 1SLLA 3F0CA 5FOJB 2XWJB 3BZ6A 3W2AA 2VZ3A 1YLLA 4COWA 4JGZA 1IN6A 1X58A 1CAXB 4Y7NJ 3MZYA 3RJPA 5GZFA 5J7MA 3K69A 3C7JA 1OXCA 3PJQA 2IZWA 4LK7A 4QPYA 5D5UB 4RR3C 3ZQCA 2R5YA 1L3LA 1FNYA 3FXJA 5HOOA 4LBMA 1FOKA 2D1VA 3HOTA 4K3UA 2DOFA 2Z33A 3HOYJ 4JP0A 1C8NA 1OF4A 5GPAA 3K2ZA 2VJJA 4WM8A 4WXDA 3PTYA 3J80Z 4XF3A 1S8NA 4BDYA 4XHXA 2CGOA 4Z92B 4FFFA 1VALA 3JB4C 5AC92 1N1SA 2IXSA 3ULQB 3I71A 1XC6A 3I3LA 3ELKA 4HVRA 2EV5A 4KYWA 1LB2A 3ZXEA 3BG9A 4ENKA 1ON1A 2HWE1 1D7PM 1LFBA 2GDFA 2YYOA 4WZCA 4Q4X2 3JCIA 3A02A 2R041 5K9YA 5DCMB 4XICA 2W08A 1XB9A 3NNJA 1MJAA 1FOXA 4MYEA 3N05A 1U0AA 3DQVC 2HDWA 4KA4A 4XQWA 4EN9B 4ZZ5A 2RDNA 2CQ7A 1HXS1 3D82A 4NE9A 3ZYFA 1QOTA 1LKNA 5E20A 5KHHA 4Z1VA 1DGWX 3HEFA 3ZOIA 3HRUA 3AJZA 2O8XA 4LK6A 4BKXA 1GBGA 1I5ZA 5KAIC 4EATA 3VYSB 2K3PA 1VAMA 1WLTA 1MEC3 2O61A 2JSCA 5B1AH 2VMGA 2ET1A 1DGRN 2VM9A 1A8MA 4FP3A 3K48A 3OL4A 1MNDA 5KHDA 5KK1A 1AOYA 2X6YA 2DURA 3PDQA 4DUXA 1A6IA 1UOFA 4JDNA 1WMDA 2DXIA 1W6MB 3WCRA 1PK6A 3AKZA 1GXPA 1P8JA 1YI9A 4Z2WA 3VL8A 4BU2A 3I59B 2XXZA 1VRH2 2UXNA 4MEXF 4DW6A 2VPLA 1D4VB 1LOAA 3WV6A 2F4LA 2JDNA 2ZGQA 2ME6A 1UF2C 1COV3 1GR3A 1MS5A 1FYMA 3AMHA 2R7OA 1W5TA 2Y0IA 2RNJA 1NE6A 3GYHX 2WINB 3G7DA 2LSOA 1XC5A 1U8BA 4NRQA 4PJNA 1AR72 3N9LA 5A80A 3FE5A 1YX5A 2Y64A 2FXAA 4RGUA 1DDLA 5FQ0A 4ISQA 1QQP2 2BBAA 5JVVA 3TO6A 1BI1A 5FFZA 4ASLA 3P9IA 3WSOA 2FDKA 4EV0A 1IV8A 3SEZA 4MGZE 3N3HA 2P6SA 4X1EA 5FMCA 4CVUA 2OCEA 1M4WA 3S1RJ 5LHGA 3LGRA 4LEJA 1FMD2 1POQA 4YEJA 3M4OJ 2XUBA 1I1SA 1AL23 2VN2A 4HN0A 3O1PA 1V5GA 1W2AX 1SMYF 1VQ9I 1HN0A 4M4RA 1VBC2 4ZZDA 1Q43A 1TWFJ 4KT5C 1B35C 1C4RA 2ICWG 3VDDC 3R4KA 4G6QA 2VD7A 5A3OA 1NE4A 4QGNA 4HN1A 2EFOA 1Y1VJ 1Y4WA 4MHRA 3RZOJ 1W0PA 2ZEYA 4YW2A 3KV9A 1TNSA 2UUZA 5EGOB 2QQKA 4D69A 1AYM1 5K0UC 2YU9J 4XUOA 3HGGA 1HQCA 4O9EA 3OS2A 3H1YA 3SFIA 2BY2A 3NRVA 3FHZA 1F4AA 3Q8EA 4OIOF 2JDHA 4BJ6C 1CGPA 2JIGA 1Q8VA 2JPBA 2RREA 4ENNA 4A2UA 4YZ5A 3OWTA 4Q4W1 4AIKA 1DF0A 4Q48A 1TME3 2W48A 3GLLA 3K2OA 1LVKA 3WTTC 4PF5A 2FNAA 3P9KA 3GXOA 2GIVA 2XAJA 4BACA 1X3UA 1R36A 5DYMA 4CCLA 3QACA 3D0JA 5A3WA 2Y6GA 2BWAA 1W3VA 4ZC3A 1GV2A 1HQNA 3OYLA 1UZCA 1WW4A 1BW6A 2QBYB 3NKTA 5DZGA 1MS8A 1B6AA 1ZRFA 1UJ8A 3K4KA 3CF5F 4HSJA 5KXEA 4BHPA 1Y56A 1BN5A 1SMTA 2JIJA 5F9TA 3VBOB 2A61A 1SLAA 3EB7A 3CF2A 1W9TA 3JRFA 3DCFA 3M3CA 2J5PA 4YM2A 3I4IA 1UMZA 3G71I 2JK3A 4DEQA 5E3NA 3PUAA 1PVC1 5HCFA 3C7FA 3A21A 3LIGA 3FUOA 4NPLA 1BR2A 1X1BA 5BYNA 1MBFA 1ENQA 5FR3A 2CDOA 4KIBA 3CUQC 2E2JJ 1G4DA 1IZ1A 1VQ4I 2WT1A 3E6DA 3WU0A 4XYXA 3O0VA 3BY6A 3WTZA 1HKDA 4H2AA 2Y69H 1O4TA 4AFMA 3ILRA 1UYPA 4O7XA 3PNVA 2F4PA 4G9YA 2R072 5FYIA 2BOIA 1JYVA 3POFA 2OZJA 2N7GA 1MBEA 2XJRA 1YJ9I 1XX5A 4HEA2 2CGNA 2CQXA 1YQ2A 3HM5A 2A3SA 3THCA 1HB3A 3RZLA 3IRQA 1UY3A 5H9SA 1TBXA 1MVEA 3UKVA 5EJ1B 2I10A 1UHWA 1YI2I 3I64A 4M4PA 1LU2A 1WI3A 1LJ7A 2HWVA 2FDIA 5C3PA 3FXRA 1YQ8A 1D4M3 5A33A 4WM7B 1STMA 2W82A 3H8OA 4HK9A 1L7RA 4L18B 3FXKA 5DAQA 1RUNA 4ESJA 3KLOA 4M6VA 1GV9A 5JPNB 3ZFEA 3LDBA 1XNCA 4Y4RA 3VWBA 5T50A 3BR2A 1TW2A 1AX0A 1QJY3 2JVGA 2VOKA 1JZ2A 3P5BA 4XILA 4BK5A 1A6CA 4CCCA 1MJBA 1VBC3 2BVBA 1L7LA 3MIEA 1ULFA 2XAFA 1AL22 5KBFA 1MR5A 1E0EA 4Y1VA 4D0QA 1ENRA 4Z07A 4Y33A 4RDUA 3LFIA 1V54H 2R7EB 1R5HA 4OU0A 4BXUA 4MADA 3LA3A 1R081 4X0GA 4Q4ZF 5DUUA 1UCXA 4ENJA 1YIPA 5ERLA 2W91A 2YY1A 3KF5A 3WG2A 1QQP3 4BCUA 2F5DA 3GEZA 1CAXA 3VD3A 1VQKI 2TNFA 4NIAA 3VGIA 2XVKA 3SH3A 3HRTA 4Q1RA 3SDBA 5BPDA 4I2OA 4OLLA 5CQGA 2CY6A 3J8F3 4Z2YA 3M1EA 4Q4Y3 2EXJA 2RR12 3WG7H 5GKAC 3LNQA 5AVAA 2WC2A 4AHYA 2J1TA 2AO9A 3T09A 4HPQA 1LEDA 3B01A 1ONAA 5FROA 5FYTA 4QU2A 3IMNA 1N25A 2X5IB 1H8TA 3W6VA 1LOFA 4K1YA 2WNOA 4X6AJ 1V0AA 2R7SA 5IT6A 1HOMA 1LFUP 1QNYA 1RC6A 2M30A 4D5CA 5HLGA 5FCCA 3ZSLA 1IPJA 2VT2A 4Q4Y1 4LT5A 1FOWA 1YIJI 3K70D 4B3AA 1A35A 1IDZA 2XUMA 2R042 1UCRA 4DXZA 1EUTA 1JOJA 2Q4SA 2XMLA 3TO9A 3V8LA 2WA4A 3OIQA 3C2UA 2IS2A 3PNAA 1YFUA 1HCRA 4Q4X1 3LDRA 2CV6A 5C33A 5JOWA 1SLBA 4OYUA 1GVJA 2M0CA 4U87A 3EJKA 2B5HA 2BDRA 2DFFA 2V79A 1Y9QA 3VBFA 5CFCB 3OYWA 4MGIE 4YVWA 1ULOA 5JCTA 2WKKA 1FV3A 3QRFF 2PLV3 2KPMA 1BIBA 5FIXA 1T95A 4CDWA 3URFA 1GVDA 1QJY1 4GYIA 3OSGA 3W59A 1LVAA 2E60A 5H20A 3RQ4A 3WDVA 1W0UA 2V9KA 1NA1C 1VBD2 3VDCA 1KZHA 4GDFA 4P9LA 4ET7A 2P3IA 1OH4A 1GOHA 4GRIA 3OY9A 2FNPA 4XKBA 1F15A 3LKJA 4D0PA 5K7ZA 3H9GA 1B4AA 4IHXA 3O12A 2A6XA 3USSA 1RXGA 5BNOA 4A6OA 4BZ4A 3A4CA 5EZGA 3KE2A 3OYWB 3MFAA 3W5NA 3WTXC 1O7FA 1DGWY 2BBYA 1U2WA 3W3CA 3IAQA 4QQ2A 4MGYE 5A1LA 3ACHA 1JZ7A 2FUG2 3REOA 5FD5A 3L9JT 1GLNA 2W1WA 2GXBA 2V09A 4YIRX 5HCAA 1VBE1 5JXHA 2P34A 1KQ9A 1WQ2A 4Q4X3 1JZ3A 1HSTA 3CDIA 3R4DB 1CWPA 2QQOA 3KYCB 4AQTA 4RHV3 1XE8A 4FOQA 3AYCA 2W47A 2XL9A 3E5XA 3RZHA 3CO2A 1OOPA 2JD4A 1ZTRA 3AFGA 5F3GA 4XJUA 5GLVA 1F36A 2ZACA 2ZXJA 4UB6C 2KXLA 1QJX3 2RS51 5FZLA 1LGCA 3O2PE 1WWYA 4ASNA 5LLQA 3E5QA 2JKBA 2IS4A 4DINB 5ILVA 5H6RA 1J75A 2ZS6B 4GYGA 2QKMB 3K10A 2VOOA 4ZTJA 2VO5A 2OKXA 4WM7A 3BLYA 4A6EA 4JDOA 4XRMA 1BHGA 2QSFX 1AR61 5J4VA 3WGGA 3PIJA 1VBE2 2FZ2A 2A6HF 1RMU2 3K3OA 2O6GE 1WJCA 5FFXA 3SHFA 1OUSA 4R9CA 1FJLA 2W87A 3H1CA 5FZ1A 2IAIA 2IVJA 1BOAA 5FY4A 3WHTA 1FC3A 4W6XA 2VI6A 3RZDJ 1REEA 1EAH1 3Q8CA 2Q8DA 4WK8F 1XXNA 1RC9A 3VHRA 3I3QA 1EY2A 1T6BX 4H14A 3DYOA 5HS9A 1JUIA 4BQQA 1Z3YA 4P02B 2J7MA 2VMIA 4NC6A 3SMHA 1SFPA 5K0UA 5CKNA 2FOKA 1J84A 1J58A 4PFPA 4BQAA 1YE9A 2VCCA 2R062 1FPQA 3ZFFC 5J98B 3FHIB 2JA8J 2GQQA 1UMIA 2LYCA 1WCSA 1Z91A 1H89C 4GAZA 3OBZA 3T1BA 2BU9A 2A6TA 4A45A 1YFXA 2VXRA 2HTJA 4QPWA 1U8RA 2HYXA 3TBDA 1EV12 3BDDA 3H0DA 1OYIA 2OCCH 1UOJA 5IAXA 4E7ZA 1REDA 1RUH2 3ABMH 3F22A 1JKPC 2PMZN 3J8F2 2PEXA 1ND3C 1OUXA 3QU3A 4AQ2A 1H0BA 1UMQA 4D3WA 4CZZA 3T4VA 4HNTA 2A07F 2M9HA 1C8M3 4MXVA 3BZCA 4HOBA 3NV4A 2XPUA 3K4CA 5T5OA 3RGBA 1H1AA 1LDDA 3OY8A 3IN9A 1ND2A 2NVXJ 2VJIA 4XN3A 1PVXA 5FKNA 2VULA 4PSXA 1IQAA 3ZQIA 3TOBA 2P3YA 1QF3A 3GFIA 3VODA 1WVRA 3IH3A 1UL9A 1ZA4A 4EM2A 1T2KA 3U07A 5HV4A 4H3WA 4JQFA 2GNBA 4AG4A 1UY4A 5C8CA 3E6BA 3IAM2 3SZPA 2CGPA 4AEKA 4MTDA 1PO13 1V6LA 2VBZA 2NMOA 5DUKA 4HBNA 1QQP1 3IWFA 4JK1X 1XGOA 4URTA 3OBRA 3QYFA 1ZG5A 4D8MA 4XTMA 3J7YJ 4E8CA 3GTKJ 3MGUA 2WIIB 4IHSA 1R23A 3AAFA 4N9HA 4PI2A 1MW7A 1HQLA 2P3KA 1JYTA 4NOTA 4L9BA 1S6LA 3E7LA 1OKQA 1VBC1 1CZVA 2A5YB 3BTCA 3JD71 3ZN1A 5JVTA 1XNDA 4EEFG 1IN4A 5FP4A 3M2MA 4HKWA 2VXJA 3L2HA 3MKYB 2ID4A 2XKPA 1VQLI 3AXDA 3MKWB 2M87A 2J42A 1XGMA 2EFPA 5J1UA 1WH5A 5FPVA 3TKYA 1S0FA 5IP7J 1I1GA 2D97A 1YC61 2GBYA 4HPKB 5BNNA 2Z9OA 2HWE3 4PIYA 3DXUA 4FPJA 2VU9A 4OHWA 4IETA 1QHDA 2MW8A 1UZ0A 3MCZA 1QJU1 1C5IA 4LUKA 4OIQF 3BR5A 3TGNA 2EZLA 2WAQA 3BWGA 4LNVA 2XV4S 4MUVA 2V26A 1RUJ3 4BBRJ 4XIOA 1TLHB 4XFGA 3FMRA 2BQPA 1VQ8I 3GGLA 1QGLA 1XU2A 4URAA 4HX8A 1JH5A 1ZBA3 1RRJA 3I2GA 3V0AB 1UU5A 3Q8AA 3DUIA 3JREA 2B45X 3H92A 5FZIA 4AAXA 3CNAA 4R8HA 4XQDA 2W39A 1PMHX 3EO6A 2GSYA 4G8XA 1PX4A 4BPZA 2BNNA 3PUHA 3TNPB 2W1QA 4EYUA 5F0FA 3PO2J 3ZQFA 1MKMA 3F8CA 4Q4V2 2RV9A 2DCKA 1VNDA 4UFIA 1FP2A 3WU2C 2YFZA 4P9FA 4AOCA 1YJKA 1X36A 1DZQA 4IEWA 2F2EA 2M5WA 2VUJA 4LO6B 1E17A 4QQLA 4YWAA 3KFWX 1BBT2 3O1MA 4FSJA 1Q1HA 2TRTA 2PXJA 5FJHA 2ZMEA 1OA3A 4E2GA 3OBAA 4WZFA 2WZEA 1LUJB 3VBRA 3VOEA 1UO9A 5KHKA 2VAUA 5KWRA 2M4KA 2CSGA 4XZUG 3EXUA 3PJYA 1W9FA 5HDGA 3JBG2 5JR2A 4PJ0C 4JX6A 5E3MA 4HDUA 3JUUA 2XGXA 3TL4X 1ZBE3 4AIDA 1C1FA 1QH7A 1RUH1 2F6CA 1HRV2 2D5VA 4ZPIA 4PDKA 3HN3A 5FJ8J 3QPLA 5L3FA 2VC0A 2E35A 4OUSA 2W2IA 1NLRA 4DO0A 1RR8C 3EPZA 4RAYA 4PQQA 1QU3A 2LNBA 3ZIWA 1FMWA 3GBGA 3VD7A 2F5EA 1BEV1 1SANA 4DXSA 3SC7X 4XM3A 3JBG1 3BPVA 2JENA 3POYA 3ZR6A 5BUVA 2O0OA 1W05A 2XLFA 4G3YC 1TNRA 1XGNA 1RUC1 1ZQ3P 2JN6A 4OI2A 1HX6A 5KCMA 2XQXA 5K5QA 2HQ5A 4LO4B 1JU3A 1S72I 2RR13 1ZZBA 4PLMA 5JR3A 4FAHA 5D6FA 1W06A 4JKKA 2AH2A 2QYOA 1WLWA 3H9AA 2Q8OA 5CKQA 4FPOB 3M9AA 4OI1A 4G9SB 1HRI2 4Y22A 3BG6A 4B8XA 4QPOA 3N97A 2P1BA 2KA3A 3ZXGA 5FUNA 1NCRC 5LBBA 1JYNA 2AR6A 3N7JA 2OIIA 2M1BA 3L7WA 4QKNA 2HGCA 2ORZA 4MXWA 4P9JA 3FC0A 1OSGA 5A33B 3RZZA 4YSFA 1VZ0A 2QQAA 4UFMA 2CH0A 1G8XA 5B3SH 5DMYA 1IN7A 2DA6A 4E7JA 2HDCA 3B9IA 1FYLA 4AYUA 1XB4A 3GALA 2ZGNA 3T8RA 4ESBA 5GAHJ 4GWMA 1PMIA 4OMDA 3PIPF 1JU4A 3DF0A 5FP3A 1JYIA 1YYVA 1I39A 5F0HA 4IE5A 2ARBA 4AEJA 1S0BA 1D4M2 1T33A 2D6PA 4OULA 4KBBA 1BKZA 3IKWA 1KONA 2HNHA 2GOXB 3SJMA 2DMPA 3T0BA 4UUSA 3ZR5A 2ILMA 3WNLA 1IJWC 2HWF3 1LHVA 5DUXA 2NNNA 1B72B 3GJAA 4HG6B 1OD3A 2B4KA 3KZIC 3ZQLA 3FLRA 4V2WA 4D7SA 1REFA 5FZ7A 3VZMA 2P8TA 4OHXA 4UUVA 1E5RA 3GTOJ 1SBFA 3UK9A 3DTIA 5LHHA 4F7ZA 3VEPA 4MHGA 4EJOA 4AVZA 2C9KA 4HX4A 4NDLA 2QQ9A 3SKJE 4AI0A 3ZXLA 4OHVA 1UU6A 3NWSA 2E7WA 1S55A 3S7EA 2LTNA 2E9QA 1AJOA 1GLHA 1RUJ2 2QVSB 3J7LA 4BQNA 2XBO1 2XJUA 1DPRA 2XPJA 5BNPC 3SH5A 5E18F 2ZX3A 2BY1A 5BNOB 4MGTA 3MLJA 4ZDOA 2HVQA 2FE3A 5GTHC 5CKMA 4PDWA 2H6BA 2JEMA 2LRDA 5AIQA 3ZXDA 4CRQA 2JDZA 3QPHA 3I2FA 2YSRA 3ROUA 4CA9A 2KDOA 1F4HA 3MKLA 4D7NA 3DWLE 3Q0WA 4B4QA 5C3QA 4QX7A 4M3DA 1NY71 1OISA 3D5LA 5DAWA 5C3EJ 3OSFA 1N3PA 4CUBA 5I0DA 3BU0A 5FKOA 3S7IA 3E0JB 2X48A 3HOUJ 2LD5A 1P4AA 2WAOA 5FLXK 5CA6A 4YZ3A 3AFKA 3AMPA 3QPTA 4JKLA 5GM0A 2VXZA 2I74A 4GFBA 3O5SA 3R0AA 4XVHA 5E1ZB 3HWJA 4PJYA 2ZOEB 2PA7A 3VDDB 2VOXA 5L9VA 3OMYA 5IWFA 2F48A 2PHUA 3OYFA 5L36A 2VLAA 2MYSA 4HL0A 2JDYA 5DDJ1 4RS8A 2VBPA 4JGYA 2RS33 1WSUA 2A73B 3C18A 4BEHB 2WY7Q 2WTEA 3BC8A 1KQRA 3ZQ7A 5JDBA 3VHOA 4E6KG 1NA1B 4YLZA 3W9AA 5BS6A 2Y60A 2OUHA 4OAZA 2GA1A 1MQTC 3Q5FA 3GXUA 3E5UA 2RNGA 1BZWA 4RD7A 1HBXG 3CJTB 3H1MA 3NQOA 3HR9A 5I0TA 1WD3A 2WY8Q 5EWSA 1VR3A 3VKNA 3KT1A 4DS0A 2JQ7A 3LB9A 4O61A 2QKDA 3ZOBA 3CEWA 4BAYA 4PBPA 4HXCA 4G4FA 1JYWA 3BPSA 5ACA2 1TQMA 4Y1UA 1H9PA 3GO5A 1K4TA 2NVTJ 3WNKA 4CDWB 1ENSA 3FHAA 3FBYA 3SEPA 3RKQA 1YLFA 3U1XA 3G2BA 4XQFA 4V2VA 4MHUA 1NX9A 5GZEA 5L3EA 4H7LA 3H42B 3K4JA 5IK8A 3L2QA 2VW1A 3JAMK 3BGAA 4N43B 1J1LA 3DEEA 1FPN2 2WNVC 3LEKA 4H7MA 1COV2 4CCJA 1R1TA 4E70A 5BNOC 1H2KA 3LFMA 3HBZA 1R6RA 2GH2A 1XDSA 2A75A 1CVNA 4Q4V3 3DPTA 1JHNA 3NWKA 2VCAA 4LXLA 4Y17A 2W1SA 1F35A 3KS7A 3C7OA 3WUDA 4XLEA 3T0AA 1N78A 2VUDA 2L7KA 4CYCA 5FFOC 2BVLA 2BEOA 4G94A 1S0GA 2GMEA 3CKHA 3ZFEB 1LGNA 4QQPA 2G7HA 1QKQA 2VCMA 1TT5B 1QJU2 1XMAA 2CRGA 4HZFA 1HJGA 3MQ0A 1O4ZA 1AUYA 2IC1A 3I58A 1R58A 2WYSA 2RMU3 3GTQJ 2WZR1 4PHZA 1ULPA 1OOPC 5L3CA 5IK4A 1YWKA 3KX2A 3LPGA 1RUI3 2BW8A 4QPIC 2YPJA 3O8GA 3ERED 4XF1A 1W3XA 2MG4A 1DG6A 4Q8KA 1RKWA 2ZAHA 3UNGC 4AUXA 5J8CA 4BYYA 3PUBA 5A32B 1JKQC 2VECA 3WLUA 4AEDC 3J26N 4B1MA 4ZXKA 1VRBA 3HAGA 2HFHA 3CCSI 4WXCA 4MFDA 3OY8B 4DBRA 1BBYA 2XGDA 3HMYA 5DCFA 1OQ1A 1OPCA 2O1QA 4V2FA 3ZN5A 4XE9A 1SACA 3USUB 2ECCA 4IE6A 3K3NA 1YQAA 4GCVA 5FLVA 2Y6JA 1S9HA 4BDZA 2P5VA 2ZGTA 3FLTA 4XXAA 4BGDA 2XAQA 4G6DA 2H27A 1OBNA 4MEYF 4D7TA 1BEV2 2V73A 3FL7A 4DRRA 1NK3P 4M01A 5FWJA 2VXDA 3POWA 5DZEA 5CFDB 2JA7J 1ZG3A 2QQBA 2Q0AA 2EXHA 1ND3B 1V6JA 2IP2A 1SPPA 3CF6E 4U2AA 3D6EA 2CU7A 1LDJA 4AVBA 4XLCA 2DTYA 3ZFFA 2H0VA 4CXFA 1G59A 3B9CA 5A7OA 4UBHA 1W7PA 3TBIA 1ULGA 4AI2A 1FV2A 4HVOA 3CP2A 2EFWA 1L3JA 1IS6A 4M3GA 2DDUA 3RZJA 1YCIA 2QJVA 2Q1MA 1LHUA 1UNBA 1BJQA 2VQGA 4A6SA 1W6QA 5LBQA 2VASA 1ACIA 5A6QA 2ARAA 2HQAA 4S2DA 2CQNA 2Q8KA 2GM4A 3KP3A 1FPN3 1V00A 5K5OA 5FYCA 3UGHA 4XETA 5F2SA 3WE3A 1PGSA 1DGRA 1W6PA 1PJRA 3MIHA 1ZREA 2A05A 5IY5H 2PYTA 3DKYA 3E1SA 4S2GA 2AUYA 3WZ1A 3HOWJ 2ZHMA 3L2RA 2JZYA 1FIAA 3CJIC 4CP1A 1FIPA 2BY3A 5K4LA 5JI9A 4UXNA 2EB7A 2JDUA 3ABZA 2DF7A 4NPRA 2BJSA 2H1LA 3N35A 5A7SA 3NEUA 5T5JA 4DOUA 4MQVA 1S7AA 2HWD2 4L5EA 2JWTA 4I6ZA 2J1UA 4PIZA 4YGCA 3TRSB 4EWDA 4E7HA 1ZELA 4CDQB 4YFKF 4IPAA 1OKRA 1LR5A 5D6EA 1AYN3 3WDYA 4AEDB 1J3RA 2J1VA 2K0GA 1HSJA 4JTOA 1MZ6A 4U0YA 4XKCA 1NXD1 2JDMA 3PURA 2M7BA 2VOPA 1J9IA 4LKEA 1WLDA 3WQ0A 5LWBA 3ABTA 2FDFA 1SEFA 2CAVA 3VBRB 4II2A 3M7AA 1D1BA 1AR93 4LG0B 2A6YA 4NQWA 4FPCA 1WA4A 3J81Z 3TEZA 4YFZA 5JI6A 2JB4A 3ZKUA 2K9QA 2DA2A 1FPN1 1IC8A 1Q56A 2HWD3 4QAWA 4LMFA 3FX3A 5FLHA 3GZNB 3C7GA 3T30A 1J83A 2Y38A 1U78A 5DG2A 4LB5A 3B6AA 3OIOA 3F3XA 3K4LA 5A7QA 2RS12 3THPA 1VBA2 2RVCA 3QOEA 4AI9A 3FMGA 3UNPA 1RMU3 3DL3A 1XDUA 4CA0A 4YG3A 4D7MA 2D6LX 3DV8A 1SBEA 2ZO4A 1HXS2 2L3DA 4YM3A 5CISA 4RR3B 3M1CA 3S17J 1OVSA 4NMIA 1SD4A 1AR91 2UWCA 3WUCA 2P6CA 1X8EA 3OS0A 3ZVXA 2DT6A 3J7ZI 3BCWA 3OBTA 3HVDA 5IOZA 4WVMA 5HXVA 1QJX2 3UJQA 2OUMA 5C6CA 5IVVA 3CLOA 4QMAA 4QXCA 2M3AA 3O8HA 4ZKTB 4GIQA 1FTZA 5EJ3A 5H9QA 3HD8B 2BFUS 2E7TA 1LJ9A 3VDAA 1YHQI 1QJEA 4QSHA 3OYKA 1HRI1 1I6XA 1O6UA 4AI3A 4Q1PA 2R4GA 4BQ4A 1OPMA 4UHTA 1MS9A 4P96A 3NJVA 1IG3A 1QZYA 4TXWA 2EWNA 5HI0A 5JXIA 4GXOA 4Q4W3 4LIUA 4ORFA 3RTRA 5EFUA 4P9UA 3PL8A 1YYNA 2IFWA 1VQ7I 4R4ZA 3IC7A 2F4IA 2PHWA 3WG9A 1XYPA 1IW7F 1PVEA 2X51A 3VFZA 4WX9A 3RMXA 2X4HA 1ZBE1 3FUQA 4Y4YA 1LE8A 1KFXL 3W58A 4CXYA 2JE9A 4P9GA 3SQOA 4H4KC 2PN5A 3ZFGC 4I02A 4KN4X 1HKQA 5J09A 4CICA 1F1ZA 2VJ5A 1R5GA 4XFBA 4AVAA 3FHQA 4C9YA 3W6JB 3VBRC 1A36A 2ENRA 1TG7A 3DKXA 2MEV3 3TP0A 2PHFA 2KIQA 3HBKA 2QCOA 1XBFA 1VTNC 3K51A 1OLMA 3AL6A 4E4DX 1X2MA 4LHKA 5FMOS 2DQLA 2CHHA 4L0YB 3CIHA 3U78A 1CN1A 1PUFA 2E5NA 5AVPA 4XUTA 4NB5A 5JAXA 3ZP5A 3WR0A 4XLHA 1K45A 1PNFA 4P5OA 5JOZA 3RYPA 1ST8A 5FZHA 2ZJPF 3ZYGA 2BNMA 5K8SA 4HETA 4I0BA 3K1PA 3QD6A 1LENA 3HQXA 3EYYA 5I8TA 3DKQA 5K1YA 1WW7A 2FQ3A 1GHCA 4PI0A 3CC7I 5F6LB 1S7EA 4J19A 3TP3A 2YC0A 2A69F 1BC7C 1A5JA 2E1NA 1TME2 2O7OA 1JZ4A 1BJAA 4A3DJ 2VY0A 3VBHB 1LNSA 3GUDA 3MF6A 4HDVA 1S0DA 1D1CA 4I30A 3TEWA 4WF2A 4XKWA 3NMBA 1ZX5A 5A6XA 4A3BJ 1POV1 5DQ0A 2DFEA 1JKRC 2AEYA 4IUGA 1T38A 2XJVA 5FAXA 5LASA 4RR3A 5FO5A 4JKMA 2HWC3 3BB6A 2YC4A 4EGZA 4IXAA 3RS6A 2A3XA 2YV8A 4YRDA 4LTAA 2DVAA 3NNLA 4XJ8A 5LW9A 4I76A 4JGZC 1QU0A 1Y1WJ 3QBQA 2E2IJ 2FA5A 1H4GA 1GT0C 2V1UA 2BTVC 2YB7A 4A3KJ 4QX1A 1W6PB 4JVAA 3WW2A 3PHMA 1EKEA 4QHOA 1W0OA 3CU7A 4L9NA 5E89A 3BPZA 3DYMA 3M3QA 2JG9C 4PJLA 1F9KA 1FATA 5KC5A 3HTSB 1AX1A 2UU8A 2DYSH 2VJ4A 3KZYA 4Q4V1 3BI3A 2OT7A 1P6RA 1AU7A 2PMUA 5IHRA 1UX6A 2LR8A 5BV6A 3M1HA 1UKGA 1JI8A 2A6WA 2JWPA 5D4RA 1ZZ9A 5EXOA 1V6OA 3KETA 4QKDA 1MS3A 3RMYA 4I09A 2QZ3A 5FMBA 1Z6TA 1PVC3 2LVSA 2PN6A 2ZMNA 4HF2A 3BR3A 3EQEA 5BNPB 2ETEA 2EPFA 1R091 2CFOA 2HQRA 2A3WA 2OTJI 1UX7A 2UY8A 5H6QA 4D94A 3I3BA 4D9JA 4K9SA 4E7KA 2Q30A 1Z7S2 2VKHA 3KP2A 5IYYA 3KLSA 1J7KA 4E8DA 4XABA 3ASIA 4JC1A 4I3PA 1BM9A 3AP6A 5ACA1 3CCVI 3H50A 1CX4A 1SCSA 4EZ4A 2D1HA 1XSXA 4IV3A 3HOSA 1H2MA 2V4JC 3C2BA 2VQ0A 4D1QA 3RKWA 4ZS2A 3ZLIA 1ZBA2 3QCWA 4O3MA 3K4AA 5FY8A 5A7WA 4E4ZA 1WBFA 2R7WA 3OPWA 3K70C 3MPPG 4CP0A 3MPBA 5DXDA 2ID6A 1TC3C 1B8IA 4PDWB 5AONA 2KT0A 4L9VA 4L0ZB 3FM5A 3S1MJ 3MW2A 4WM7C 4NHMA 5APAA 5SV8A 1RJ7A 3VLBB 3I2JA 2WWYA 2Y30A 3FIWA 4NUBA 3BZKA 2GA2A 5CAZA 1WJEA 3FXMA 4RAGA 1RUD3 3BUCA 3LWCA 1R9TJ 2Y0SA 2KD7A 2YROA 3AX4A 3D1NI 2WZR2 3DP7A 1YRNB 1MQTB 2M45A 4A0ZA 2PELA 5D5XB 2BZDA 4LLFA 3M3YJ 1NH3A 4FPHA 3BR6A 4BK4A 2JG9B 1G3YA 5EEAA 1YRNA 1MQTA 1OQYA 2IXJA 5EYRA 2YX7A 4UI9L 5C5TA 1H9TA 1MMAA 1OJLA 3H3ZA 2IGNA 4Q27A 2VMHA 1F4KA 3RWNA 4IEUA 5JOYA 2L7ZA 4A42A 5A6YA 2BXYA 4XL9A 5B5EC 1N47A 1HW5A 4COZA 4FXGB 3KEYA 1MSEC 3J4UH 4AGVA 4HK8A 4DUVA 4FE7A 1CONA 1RUE1 3C3VA 4IE7A 4Q0QA 2UXXA 5M5XJ 2R0QC 4KISA 3SXWA 3V64A 3JRCA 3W6KB 3NAPC 1OURA 2YU2A 1HN1A 5E3LA 1TWHJ 4B09A 4ZXEA 2KFDA 2V1NA 2H6CA 3LEMA 2HDDA 2WLPA 2DYRH 1STZA 3A1YA 1H2NA 1CF7A 1KEXA 2RQPA 1FOD2 2IFRA 3V56A 3C1DA 3MN2A 1SQ4A 1NCRB 4P9WA 4AHXA 5DUVA 3WU1B 4B1LA 2IJLA 3ZFEC 1XE7A 3FZVA 3PSFA 4OIPF 3AG3H 2LKPA 2W00A 5C5UA 2ZB9A 4IQ4A 3G6EI 3L2WA 3AK0A 1PO22 4HPKA 2MH2A 1ON2A 5BNNB 3C7EA 2JE7A 2XPWA 1MIJA 3CDHA 1TNFA 1U5TA 5FO7B 4AFCA 2Q0OA 3F95A 2CMPA 5CNAA 3VB9A 5D8LB 1RUH3 2D40A 3GCMA 2AEZA 4GA9A 1W6QB 3FMSA 4QM8A 2QQPA 4LFUA 3LSIA 2DMUA 4CGZA 2HYGD 1JZ8A 2IBDA 1MBKA 1WCMJ 4J01A 2E1MB 3CDLA 2EFNA 5GPCA 5FQ0B 4F93B 3SEEA 1BW5A 4KI5M 5HS7A 3LSGA 3KT7A 3JTGA 4CE8A 5LK7B 4B44A 2BVMA 4XKVA 2YXSA 1W8NA 3TN92 5H9PA 1IS3A 4FPKA 2PQQA 4HT1T 3ML6A 3U4SA 2WSUA 3VUOA 3BIEA 3KQRA 2RS11 2XQRA 3HZJA 4U7DA 1FI2A 2VUMJ 3R61A 3CCUI 3B93A 4FX0A 1X33A 3A03A 2EAKA 3S1QJ 1WCDJ 2QUOA 2BUKA 4DMIA 1SD5A 1ZGAA 3DLLF 1AX2A 4RS5A 3FHNA 3IAPA 4V1PA