3N4MA

E. coli rna polymerase alpha subunit c-terminal domain in complex with cap and dna
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
203
structure length
203
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Combined structural model for a transcription activation assembly
rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 63
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3n4mA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3n4mA01
4AQ6A 3RYKA 5ICGA 2FQ3A 2JZYA 3HIFA 5KHIA 3LA7A 3T8TA 2XAFA 1R00A 2P5VA 4QWQA 1BC8C 2CAUA 4S04A 2NAZA 3VEPA 2PI0A 3DF8A 4GYGA 2GIVA 2D40A 3FZVA 3TNQA 3TNPB 3M9AA 3SHFA 1U12A 4CXFA 5F64A 1F5TA 4RD7A 2STWA 1UIKA 2XKPA 2C0ZA 3I58A 1QXJA 4LG0B 2OA4A 1S7OA 3CJNA 2XHKA 4G7OF 3TKYA 5DCFA 2HDCA 5KHKA 3K0LA 4O5VA 1SAXA 4FAGA 5D4RA 2FSWA 1YFXA 4XETA 1QO0D 3HRTA 1I6XA 2A5YB 3K1PA 3CTAA 3MZHA 2ELHA 5D6FA 1J59A 4Q0UA 5FLXZ 3EHKA 2Y0OA 2Z99A 2FA5A 3CUQB 4GXOA 3TDUC 2RQPA 1RI7A 4Y17A 1MDMA 4A6EA 2EV0A 1O3TA 5CVVA 3Q5FA 4Q0SA 4AVPA 1BIAA 4KIGA 4LTAA 4YYOA 5J7MA 4ENNA 5DCMA 3FX3A 3E5UA 4Q48A 2ETEA 4DQ2A 1KQ9A 1ZZCA 2O03A 5D1IA 1TW3A 1FC3A 3WTXC 3RDIA 4H0EA 1ODDA 3IWFA 4LFUA 4CGZA 1TLHB 3IKTA 2YR2A 3S7EA 4YIFA 4PGHA 3PNAA 4QM8A 1XMKA 1LJ9A 2VOPA 1IN8A 3V8KA 2F5DA 1FZPB 4YFKF 1LEAA 3M3IA 4HBLA 4YFNF 2FNAA 1PDNC 2STTA 2X4HA 2QNKA 4KA4A 1FBUA 2BBYA 2MPFA 2KJBA 3T1BA 1NZCA 3KLNA 4M6XA 1CAXA 2EK5A 4HAMA 4HVQA 3H1MA 5E16A 3ZN0A 2V1XA 1F9NA 4M6YA 2P17A 5CLSA 2LNBA 4G6QA 1B6AA 1I27A 2H94A 3LQRA 2HGCA 4BHCA 4EV0A 4L18B 2F5FA 2H6CA 1YS6A 2DK5A 4L0ZB 1D8KA 4L0YB 3HQXA 3LWFA 3LWCA 1USTA 2MH2A 5FD5A 3PFIA 3HOSA 4EJVA 5JVTA 1CAWB 1ZVFA 4WCGA 1YG2A 2EWNA 2Z9OA 2PLYA 3BCWA 4A5NA 4AQ2A 1IW7F 2HEOA 2QQBA 1HKTA 1Q5OA 4AIKA 2UZKA 2DPDA 4HDVA 2OD5A 5BQTA 1O3QA 3QP5A 3HRMA 3KMHA 3SFZA 3GVAA 4YRDA 3I59B 4QLCU 1YIOA 4EM0B 4M9XA 4HF2A 4KN7X 3EO6A 3C7JA 2CWEA 1RL3A 2HTJA 5D8KB 2B0LA 2EFOA 3KCCA 3O3KA 1P4AA 2VE8A 4I02A 5FQ0A 4D7TA 3EQLF 3L7WA 1OD5A 3TO6A 2W57A 3JSOA 1RC6A 1K6OA 3BPXA 1UHMA 2HKXA 2IPQX 1X82A 3GYDA 2GAUA 5CVRA 2ZCWA 3I71A 1XDSA 2FBKA 4M71A 5LBQA 1JGSA 1DZRA 1SMYF 2ADUA 5D5VB 4XF9A 2D93A 2VE9A 1AOYA 1OYWA 4DNCA 4HSLA 4ENKA 2ZXJA 1U8RA 3UKTA 2V79A 1O5LA 1FLIA 1F1ZA 2EV5A 3KP5A 2CV6A 1PMIA 4XF3A 1RUNA 1UPIA 2ZMEA 4RGXA 1K78A 3E6DA 1TQMA 1O3SA 4UXAA 1Z1DA 2P6SA 3WW3A 4LULA 3R6SA 1LVAA 5JR7B 2VBYA 2ZFWA 4CO8A 5JCTA 3FHZA 1GQHA 3NL1A 1G3YA 3BB6A 3VB2A 3WODF 3HYIA 3MAJA 3EETA 1OYYA 3WTUC 4A12A 4MV2A 4KYWA 2P4WA 3JAMZ 3HRSA 5JR3A 2IVMA 2HJIA 1BM9A 2F2EA 4S05A 5FB2A 2L54A 4UNOA 1CF7B 4Z82A 5LEKA 1R23A 3H7JA 2CGPA 1EYBA 4Y15A 3WG9A 2QQAA 5JI6A 4HVOA 2QQ9A 3M7GA 5L3CA 1BJAA 2D1VA 2HS5A 4A0XA 3H9AA 3MEXA 3KSCA 2QVOA 4YNIA 1RNLA 4I0AA 2UY8A 4ZU4A 3NSTA 1BOAA 2VXZA 1L0OC 2IRFG 3U2RA 4JK1X 1SD4A 2XASA 3FMRA 3L9FA 1CAWA 4ON0A 1DZTA 4AXOA 3S0MA 2FMLA 5JHUA 1QBJA 4KUMA 1MJAA 2FF4A 3BJ6A 2PEXA 4LD5A 1G3TA 2UYAA 1DPUA 5I93A 2KXLA 3RJPA 3ECHA 3W6KB 1IF1A 2R7DA 4QGLA 1UB9A 4HLTA 2PAMA 1HW5A 2IA1A 3DKWA 3MQ0A 3FM5A 4MUVA 4YIIA 3HHHA 5JSRA 4WX9A 2PQQA 3HRUA 2EJRA 3M70A 4G7ZF 5JSOA 2F4PA 1KA8A 4IEVA 1ZRFA 4XLPF 2M45A 2EA7A 2PN6A 5DUKA 2IW5A 3F21A 1W7PD 2JTVA 3UKVA 4X6QB 3IRRA 5E1RA 3DPLC 1LDDA 2OU2A 4ORFA 3RTRA 1UCXA 2P5LC 2L4MA 2EA4A 4B29A 4IEPA 4RAYA 5JSPA 4Q0QA 3TGNA 3C3VA 1WQ2A 2PMHA 1FXZA 3CO7C 2ATFA 4XFGA 4IVNA 4HLXA 2M5WA 3GZ5A 2ZKZA 3GWZA 4KMUX 1YO5C 1TQPA 1E17A 3H8UA 1CGPA 3LQQA 3HT1A 4QM9A 4ETSA 4XFAA 3HTUA 4PIXA 5CADA 4AD9A 4OOIA 3ULQB 4NQWA 4RGUA 1JHFA 5I91A 3QP6A 4TV7A 5JFRA 3JZVA 4I09A 4IXAA 4LA2A 3IBMA 1GXQA 2LSOA 2IT0A 1R5HA 1HKSA 5LLQA 1LDKB 3WW4A 5BMZA 5I0SA 2WV0A 2DTRA 5F1RA 2ET1A 1IN7A 2O6GE 4HX7A 2QCSB 2I45A 3K9TA 1I5ZA 2QENA 2PHLA 1ZNPA 5D4SA 1QXRA 3I0TA 2M30A 2NNNA 3LA3A 3OV8A 4IF4A 2XAGA 2FOKA 1J3PA 3LOIA 3NJZA 1QPMA 1O57A 1O5UA 2IXKA 2B8MA 2OQGA 4WF2A 4HYEA 4GYIA 5HS8A 2PAKA 3F22A 3BPVA 3FF5A 2KIMA 1FX7A 4XF1A 1KYZA 4HZFA 3EYYA 1RUOA 5ILVA 4HF1A 3M8FA 4KICA 2WWYA 2B9UA 3CO6C 4N9HA 4IEZA 4OMYA 3GZ6A 2HTSA 5I8SA 1ZYRF 4L5IA 1EY2A 2CSOA 4L2NA 2R7FA 2A3SA 2BV6A 4UVBA 3KP2A 4XLNF 1XGOA 4LJZF 4L9VA 1I1SA 4CYDA 2M87A 1YHFA 4AIHA 2OZ6A 2VBZA 3RYPA 4A2UA 3F72A 4BIFA 1IPJA 5HDNA 2B5HA 3TOBA 3ZMDA 3E3VA 1WWXA 5KVRA 4AVAA 1XDUA 2E1NA 3HSRA 2EFWA 2JSCA 5LGTA 2OA2A 5KBFA 1USSA 5LEJA 1V4RA 3TO7A 4KWKA 4RGSA 3FFQA 3LSTA 3V7RA 2YX4A 4E2GA 2Y0MA 1JHHA 3MWMA 2RVCA 5CU1A 5DUIA 1YLFA 3KEQA 1V3FA 3OGJA 3MZYA 2PTMA 3O2PE 1ZG3A 4WK8F 5IT9K 2DW4A 2O1QA 1UD1A 1NYWA 1KGSA 5K5RA 1FBQA 2ZBKA 1XGMA 4P9FA 1FOKA 4FHTA 1ON1A 1O3RA 4HX8A 2E7WA 5BY5A 3QPTA 2JPBA 1IUYA 4PIZA 2XAQA 3B73A 2GXGA 3WGHA 3FHIB 2DU9A 2WC2A 1BI3A 3F3XA 1ZZ9A 1LEBA 2H6BA 5KHGA 4IEOA 3HHGA 3SXYA 3SQNA 2DI3A 1D8JA 1HXDA 3ZMTA 4LMYA 3DN7A 3R60A 1DGWA 2GU9A 5HLHA 3BDDA 3DFGA 3E5QA 3J81K 3JW4A 1ONVA 3R0JA 2RV8A 3RI4A 3DEUA 4U0YA 1Y9QA 2IA0A 3IIAA 2IA2A 3QAHA 3F8BA 3E6CC 2MD5A 3D0SA 4FAHA 1R36A 4ZH4F 4JV4A 4A5MA 4JVAA 4MNUA 4N9IA 4MTDA 4HMZA 2Q30A 1TQIA 3QPHA 1G6NA 1UCRA 4M74A 4Q0VA 3COAC 1FBSA 4M72A 4BQAA 3FXRA 4EJWA 3HSEA 2IC1A 4ZYDA 2A6EF 4HV5A 3ES4A 2VC0A 3MPBA 5DYMA 2GQQA 3HT2A 3BROA 4N0BA 1OFNA 3WW1A 1TNSA 3IDCB 3FMSA 3KEOA 4JTNA 2EFNA 3J80K 4Q4ZF 4BYYA 1HW2A 4FT8A 5E8GA 1ZREA 1S3JA 5ED4A 4A6DA 4IESA 4HBNA 3V4GA 5C6CA 2KJCA 2ESHA 4ENMA 4LLGF 1A04A 4ZU7A 2QBYA 2XLAA 5EFUA 2VN2A 1D3YA 2RGVA 1Q3EA 2AS5F 3ZMZA 2E1CA 2HQRA 2MLGA 3ES1A 4M9SA 3QACA 2CW0F 4TLFA 4MQVA 4K8FA 3CEWA 5K5QA 2UXNA 4RS8A 3TO9A 1CAUA 1TW2A 3BOQA 1IN5A 1P2FA 3ZP5A 1YFYA 3GYHX 3GXOA 1ZH5A 1XSDA 1MZBA 2YX7A 4LLLA 2LKPA 3FWEA 5ICCA 2XIGA 5CVJA 4LK0F 1NHAA 3DP7A 3D0JA 2IJLA 2XL9A 1UW8A 4EWAA 3MCZA 2GH2A 1S6LA 2QVSB 1OR7A 5AONA 3T0YA 1DDNA 2ESNA 2FQPA 5HDGA 3DXJF 4M9ZA 2XLGA 3LFKA 3ERED 3OCPA 5BS6A 1JXSA 4YSFA 4HN0A 5BOXA 1G3SA 2D1HA 3ISPA 5K8SA 1DP7P 1W4MA 1B59A 5DD4A 5ERIA 1R22A 2FEZA 4WXDA 2DT5A 2R3SA 1QZYA 5D5XB 4KFCA 1IRFA 5EEHA 5FLJA 4FBFA 4JTOA 1IN6A 4XFCA 3IL2A 1E2XA 5BXXA 4IJAA 1GVJA 2X0LA 1MKMA 1Z05A 3C1DA 4O3MA 5L3FA 4LG0A 1I1GA 5H20A 3RPQA 3LAJA 2GC3A 2DQLA 3DL3A 3VOEA 3EJKA 3WTWC 1YWKA 1NXMA 1B9NA 3RZZA 3CUQA 3WGIA 2NRAC 5DD8A 1EPZA 3FXUA 2OYZA 3U0ZA 4UVAA 5BV6A 2MNGA 2PA7A 2HOEA 1FY7A 5LHIA 1ZG1A 2GWRA 5JAXA 4NHJA 3ELNA 1J5YA 5I8YA 5HDKA 4PGGA 1STZA 3CF6E 2XRNA 5E1XA 3WTTC 1IN4A 1KU2A 2Z2SB 3R4KA 1QQIA 3F8FA 1J58A 5D5WB 2W84A 4E2QA 3M8EA 4HF0A 2RKHA 5DV5A 4EJOA 4HVRA 1XSXA 4ZYGA 4WXHA 1H1IA 2C6YA 4UHTA 2PAEA 3FZ3A 1U5TB 1IXSB 2QUFA 5J48A 5FPXA 1CAVB 4ASNA 5ICEA 3R61A 3G73A 5FPZA 4D7SA 1EP0A 1RTVA 4OIPF 1TNTA 4MHGA 3F8MA 1WLTA 4P96A 5DDGA 2MA3A 3UKNA 5LHHA 1UFMA 4KT5C 4HV6A 3RKWA 1S8NA 4YFXF 5L3DA 2QJVA 1FT9A 3IKVA 5A2QK 1REPC 4ZU5A 5ILUA 2PYTA 4KDPA 2V1DA 3SZPA 2ZNZA 3KLOA 1EH6A 2VBXA 4LLOA 1W5TA 4HN1A 3MYXA 5ICFA 3TDZC 3O6BB 4D0PA 3CUQC 1BN5A 1FP1D 3MDPA 5D5UB 1WSUA 2GA2A 3D5LA 4OINF 3WU1B 2D2WA 2PFWA 5FCCA 3GEZA 2ZO4A 3OTFA 4Q29A 3CJXA 1R58A 4R1HA 4BAYA 4HSJA 3TOAA 1YW7A 1P4XA 3O14A 1SFXA 4G8XA 3HSFA 1R5GA 2HKOA 2L3DA 4AIJA 1H1MA 5E18F 2VODA 4F7ZA 1ZGAA 1UHWA 2DBBA 4RB0A 3I59A 1XCBA 4G6DA 1ZG5A 3OF1A 3D82A 3BJAA 4G9YA 4QGNA 2XL7A 5EEGA 1EH8A 3REOA 3WTYC 2CG4A 5DEQA 5CYVA 1U6GA 3FM3A 1TBXA 1GQGA 3KP4A 2OBPA 4OIOF 4EM1A 2KIFA 4NB5A 4PCQA 2VECA 5J3UA 1O7FA 1ON2A 3GO5A 3FE5A 1B1BA 3L00A 1ZRRA 2QDRA 4AVBA 3K69A 3VHRA 3ML6A 4EGZA 2VQAA 1SD7A 4LB5A 2IXCA 4R79A 2VOOA 2N7GA 2MBFA 2DAOA 4UV9A 1W7PB 5BPIA 4AWXB 4ZZLA 5HLIA 5H6QA 5BPXA 3P9KA 3ST7A 2FBIA 2WTEA 4L9TA 5LRRA 1JUHA 3VODA 2P8TA 1PM7A 3GW2A 1Y0UA 3ECOA 4ESBA 5K5OA 4HDUA 2FRHA 1ZZ8A 4WZCA 2A6HF 3TQNA 2M8EA 5E20A 4IEWA 2IP2A 1ZRCA 1SD6A 3HUGA 1NE4A 2EV6A 3QU6A 2QZ8A 4GCVA 2G9WA 3DV8A 3HTSB 3KGLA 2GZWA 5KK1A 4A0YA 1YFWA 4IETA 4MGRA 2EB7A 1FWZA 4HX4A 1MJBA 1XMAA 4EQQA 4UXNA 1CF7A 1ZGJA 2AXLA 2Z33A 1XGNA 1V70A 1YQAA 3BJOA 1H9TA 4LUKA 1MDMB 4EWEA 4K2EA 5I8TA 4LGWA 1FP2A 2K4BA 1FSEA 1MGTA 4LB6B 2QLZA 4CHUA 4I98B 1AWCA 2P7CB 3NVCA 1Z7UA 4L5JA 3I53A 1MJ9A 1T38A 2DK8A 1PP8F 1KQ8A 3JTHA 5L3BA 6PAXA 2QM3A 2QYOA 1LRHA 5DCMB 2Q1ZB 2ZKLA 2A61A 1GHCA 1FSHA 5HOOA 1IPKA 2L4AA 3KE2A 5F6FA 1R1TA 2M1BA 1XGSA 1OI6A 4KU7A 2Q8KA 2ACJA 2FU4A 5I0TA 3USSA 1QGPA 5FGMA 2FBHA 3KP6A 4IPAA 3BP8A 4LK1F 2H27A 3FXQA 1QWRA 2A07F 3J80Z 4MH0E 3DPTA 1J3QA 2GC2A 4ONUA 2XAHA 4P9UA 1J2XA 4OIRF 2Q4SA 2UY9A 2EFQA 2GC1A 3GFIA 1J3RA 3KP7A 1VP6A 3CDHA 4HW0A 2JRTA 3BWGA 3PQKA 2TDXA 3H50A 1CAXB 4IEYA 2O8QA 1SQ4A 1LB2A 3ETQA 3K1NA 1DPRA 3G3ZA 1U5TC 2NYXA 4CZZA 1U3EM 5EZWA 1XB4A 4EM2A 3H92A 2VBWA 1J75A 3H3UA 3JTGA 3G7DA 5T3NA 3SHRA 1YTYA 1K7AA 1J0RA 5TRDA 4MX3A 2XKOA 1Q1HA 2YPRA 4XFFA 1X8MA 4PZJA 1XD7A 2D5HA 1BIBA 1FNNA 3T5XA 4P9GA 2FNPA 4OMZA 4UBHA 1QNTA 5FLIA 1WGPA 1NE6A 3BY6A 3NKTA 3SCGA 1W7PA 4MZUA 3F8NA 3Q9SA 4MEXF 1XN7A 1SFEA 2FE3A 2ISZA 3W6JB 4WVZA 2Q0OA 1RZ4A 1KYWA 3CLPA 2HFHA 5K1YA 3LZZA 3KZZA 1XE8A 1Z91A 4FX0A 4RB2C 3V7CA 3CUOA 2D5FA 2RNJA 3E6MA 3OD0A 2CFXA 4XRFA 2L01A 3AAFA 1P6RA 5BPDA 2G7HA 2XV4S 4Z2YA 5FQ0B 1IZ1A 3EYIA 3GFJA 2DQRA 2GC0A 5I0RA 4XFIA 2W85A 5CVIA 1X3UA 3E5XA 1P4WA 4R52A 2GXBA 4O6JA 3IHUA 4HOBA 3MFKA 3F6VA 3E97A 1W5SA 4FX4A 3U9GA 3H1WA 3CL1A 1HQCA 2BGCA 1YW9A 1YUDA 1B9MA 1XSVA 3F23A 1T2KA 1BI1A 4MGYE 2H0VA 5CJ9A 4Q47A 1EH7A 3ROUA 4U0WA 5I0UA 2FMYA 3CLOA 4PIYA 3J7AO 4NVPA 2ZMEB 4ZYHA 4KU8A 3L2CA 4G7HF 1K78B 4IEUA 3N4MA 3QOPA 3CO2A 1LR5A 4HQEA 4Y13A 4MQ9F 4L9JA 3GX4X 2Z69A 2HZTA 2Y48A 3LAPA 1X7NA 5HLGA 1L3LA 3L09A 4XSZF 1R1UA 2IXIA 2WFPA 2IXHA 3H3ZA 2ET7A 1FYLA 3EQEA 4XSXF 1LNWA 5LGNA 5L3EA 2KIUA 3PLQA 4O9GA 2ZNYA 4QXKA 1BI0A 1ZZBA 3FJSA 4QX5A 4IHTA 1OYIA 4QMAA 3ABTA 2VPVA 4IEXA 4MGKE 5D6EA 4CDGA 3K1MA 4R8HA 4L11A 1ZARA 1WKMA 5AIPA 4O9EA 2PQ8A 5CVUA 2K86A 5A2QZ 1ZLKA 4OU0A 3NEUA 2IXJA 1LDJA 2NS0A 3SXWA 4G94A 1P92A 4OFGA 4I01A 1IXCA 3HOTA 2O0YA 3I54A 5E1ZB 1HSJA 3RKXA 3IDBB 1U78A 1BC7C 1BI2A 1O7LA 4ENJA 3I7DA 4U88A 2OPKA 5TJJA 1RIOH 1FPQA 2K02A 1QY4A 3WE2A 1RGSA 4U0VA 5FD6A 3M1EA 1SEFA 3DQVC 3ABUA 2D45A 2NNYA 1WI9A 1R7JA 1Y3TA 1IXRC 1YFHA 3U1DA 2K0GA 5HVQC 4IRGA 5H6RA 2HR3A 2OZUA 1DGRA 4LUMA 4WXCA 4JQFA 4XF0A 2ZJ2A 2DPUA 2Z5UA 1GXPA 3KETA 4Q0PA 5ILSA 5E8IA 1VJ2A 4EGYA 1Z6TA 4Q5SF 3WW2A 4KN4X 2ETHA 2VC1A 4GGGA 3PQJA 2P6TA 4A0ZA 4OLLA 2L02A 1TTYA 2HYFA 1R1VA 4KMFA 4KL1A 1T6SA 5FLXK 4H7LA 3IWZA 3BALA 1SFNA 1IAWA 2H09A 3WGGA 3GUDA 3NRVA 2XGXA 3BZ6A 1T39A 4CICA 1YW8A 2CQKA 4I7HA 1J7KA 3V8LA 2F5EA 1D5VA 1UIJA 2J5OA 5C8WA 2OAZA 5L3GA 3S7IA 1VR3A 5E17F 3WTSC 4IRIA 5LRSA 3E6BA 4LLNA 3KGZA 4J1WA 2V6CA 4RAZA 1T98A 3RYRA 3ELKA 2O61A 1Z9CA 2HQNA 4U7DA 3I64A 3JSPA 2EA2A 1ZZ6A 2K27A 4KNYA 4IHSA 3LAGA 2V9VA 4BH9A 2Z3YA 4EMSA 2E7XA 5FDBA 4QGMA 1T0FA 4META 2V1UA 4XF4A 4ESFA 2BYVE 4XFBA 2K7LA 2LF8A 2PMUA 1FYKA 4EVIA 3T8RA 4HQMA 3P9IA 4P55A 2COMA 4KIBA 2XROA 3KP3A 3ZMVA 2IXLA 3RIRA 4I3PA 4JBAA 3S2WA 2BEOA 4WWCA 1YFUA 1OKRA 3EUHA 3SZTA 1B4AA 4EJUA 4IRHA 1XRUA 3FMQA 3QU3A 4MEYF 4BHBA 1DUXC 2PJPA 4ZZDA 1XE7A 2K9ZA 2MLKA 5AVPA 4KWJA 3SCFA 4MGZE 1CX4A 3VFZA 4J1XA 3LA2A 2XVCA 2VONA 4UUVA 4U7BA 3I5UA 3SCHA 2G7UA 4YG2F 4IEQA 2A68F 1BBYA 3WTZA 1HBXG 2O8XA 3GFMA 1K79A 4BNCA 1HSTA 3KFWX 1SD5A 4EWDA 1ZRDA 1C0WA 2CO5A 3H7YA 3IRQA 4X6RB 4XFHA 2XAJA 3WTVC 1QZZA 1PUEE 4YARA 4WBBA 2PBIA 4AVCA 4MTEA 3ZN1A 2DFIA 1J1LA 1KU9A 2W25A 3NQOA 3ZDSA 5FFZA 1G4DA 2OZJA 5FO5A 1IRGA 2EFPA 4P5OA 3N97A 3RNSA 5IT3A 5J8CA 4GULA 4MGIE 5BUVA 1OMIA 5HS9A 1FYMA 4UV8A 2MH9A 3C3WA 1ZLJA 1Q43A 4OIQF 3F6OA 2F5CA 5IT9Z 1FI2A 1S7AA 5J8FA 2YSRA 2K4JA 2YU3A 1WA4A 2LDUA 4I0BA 2BNNA 2QWWA 3SMHA 5KHJA 3RKYA 1XCVA 5KHHA 4EROA 3ZMSA 1HW1A 2JT1A 3GF2A 4UVCA 1JE8A 2XUBA 3Q9VA 3ZPLA 3EBRA 2KKOA 1HKQA 1O4TA 2LF7A 1ZAOA 1KU3A 1SFUA 3ZQ7A 2XLFA 3B02A 5AIQA 5HI0A 3EDPA 4KIFA 1SMTA 2CAVA 4RB1A 3H1YA 2PG4A 1S29A 4XEZA 2DLLA 1ZN2A 4XBFA 3J81Z 1PP7U 1U5TA 3JAMK 3P7NA 4LEJA 1CAVA 1U2WA 1H0MA 3GFLA 3PVBB 3L2HA 3C18A 4I2OA 1X8EA 1LQ1A 2Q2EA 5HS7A 2FXAA 2HWVA 1OPCA 3BPZA 1YYVA 3U10A 3K2ZA 4IERA 4PJYA 4HA8A 4RB3C 5E1WA 1WRJA 3WE3A 1YS7A 2RDPA 1YLLA 3I4PA 2OQRA 3U11A 2PFBA 2J5PA 2UYBA 2DO7A 1MD0A 3F8CA 5J6XA 3V8JA 4PDKA 1VTNC 4F8AA 1ZX5A 3ZMUA 5D8LB 3R0AA 2VT2A 4GO1A 2GA1A 4L9NA 1TQ5A 4UBGA 4EJTA 3GBFA 2UWMA 1ULYA 3P9CA 1F4KA 3QRFF 2EAAA 2PHDA 5FFXA 3ACLA 3V7SA 4BHPA 3OOPA 1LKNA 2Y75A 3WU0A 1G3WA 3GLXA 2MC3A 4ZYEA 2V09A 1KU7A 4KWLA 1Z6RA 4HLYA 4E2SA 2CYYA 4RGRA 2DCTA 2EVXA 3RPUA 2QBYB 2UXXA 5LGUA 3BU7A 4DINB 5LHGA 4BXUA 2ISYA 3IC7A 2BNOA 3KZYA 2HYGD 2P5KA 1CAUB 1H9GA 2BE5F 1KQ0A 2VT3A 2MHFA 4ESJA 2A69F 1ZHFA 1ZZ7A 2RC4A 4LA3A 4M73A 2E9QA 2JPCA 1EV7A 2RN7A 4E70A 1L3JA 2BNMA 2P7VB 5FLHA 4B09A 3NW4A 4B8XA 2O3FA 4Z07A 2KRFA 2W24A 2Q0AA 1J9IA
chains in the Genus database with same CATH superfamily
3ZYRA 3B93A 1MVEA 4XUPA 2LM3A 1BBT3 4M3CB 3BIEA 5ICGA 1GNYA 1DQ4A 3BG5A 1MS4A 3LPFA 2FQ3A 3DKXA 3HIFA 3TEXA 3LA7A 3T8TA 4UFHA 3O1SA 5C44J 5L9BA 3ZR8X 1BC8C 2CAUA 1Z7S3 3WCSA 1VMFA 4UYBA 4DYCA 4CDQA 2BY1A 1O4XA 5H9SA 1TL8A 1FAYA 3HPHA 4GYGA 2ERFA 2VZQA 3EXUA 2X8KA 3FZVA 3TNQA 1RUJ1 1W90A 2WNVB 2C0ZA 4A69C 3MV01 3IUOA 4V2GA 4ZTJA 4LG0B 3CJNA 4G7OF 5DCFA 3CU7A 4O5VA 4CU9A 1YFXA 4FTSA 1V6MA 1QO0D 3HRTA 5DAPA 1VAVA 1CVNA 4UOJA 2H1LA 2ELHA 4GJZA 4HFSA 3TDUC 1RI7A 3GCMA 5GTIC 3HR9A 2XBO2 2M0CA 4NHYA 3W58A 5F27A 3TBDA 3PU8A 4Q0SA 5F7UA 3FLTA 2JB8A 4BL0B 3C2HA 4YYOA 5C3PA 1I9RA 1OHFA 1V54H 3FX3A 1A31A 4RL7A 2O03A 4Q8LA 1M06G 1FC3A 3WTXC 1YO8A 5CFCA 1NOVA 4MYEA 2IGOA 2YR2A 2RJLA 4AFMA 4HG2A 3PNAA 1IN8A 3V8KA 1FZPB 2Y31A 4BEHB 4YFKF 2UWBA 1ETVA 4HBLA 2JE7A 1Y1VJ 1UJ8A 2L7MP 3AK0A 4UAPA 2X4HA 3GHMA 4V2VA 4PF1A 3LSHA 3TN91 5FLVA 4XZUG 3VBSA 4YM1A 3O5SA 3ZFEB 1NZCA 4CDUB 1CAXA 4HAMA 2ZOEB 1K83J 1UO9A 3ZN0A 2V1XA 2P17A 2VMHA 3LQRA 1XE0A 4BHCA 1VMJA 2F5FA 4C30A 4MOAA 4NWVA 4DPNA 1BCXA 3WP6A 2Y26A 2MH2A 1ACIA 4PF5A 3S57A 2VL4A 2DDBA 1HV1A 4BQ5A 1CAWB 3LFMA 2A5WA 2ZGKA 3WDWA 2RDNA 4BQ1A 2Z9OA 3I3DA 4NIHA 3ZXSA 4A5NA 1U5IA 3ZMNA 2D6NA 4AIKA 4QPGB 4HDVA 4CRQA 5BQTA 4XAAA 1O3QA 4Q4V1 3SFZA 1YIOA 2X6XA 4M9XA 3VBOA 3VBHC 3C7JA 3W9AA 1M4WA 3OMYA 5LZ6A 2HTJA 3AMQA 2B0LA 2JDAA 3O3KA 4I02A 4JDNA 2W57A 2XDVA 2W3JA 4UI9L 1RC6A 1VE0A 1K4TA 1K6OA 4RR3C 2HKXA 4XKCA 2XGEA 1BVP1 4DO0A 1XDSA 4M71A 3I2OA 1DZRA 5A33A 4XUNA 3FFZA 1WW4A 1YIJI 4XF9A 1WJ5A 2ZGLA 3NV4A 1U8RA 4FFFA 5JPMB 5DG2A 1JODA 1O5LA 1POV1 4GJYA 1FLIA 3ASNH 1MBHA 2M9HA 3ZN6A 5KWRA 5LY2A 4D5FA 2RDSA 5HLTA 1BR2A 2XPWA 3L2YA 3R6SA 3HUGB 4YW1A 2E32A 5IVCA 1GQHA 1XYOA 4ASMB 3NL1A 1G3YA 4QX3A 3VB2A 2B9SA 3WODF 3IMNA 1DQ2A 3IIIA 1MQTC 3EETA 4LHKA 4F55A 1DU0A 2WSUA 4CEWC 1BM9A 1ENRA 4LBQB 1LESA 1R1ZA 3NV3A 2VQUA 4Z82A 4E7HA 2RS13 1DGRN 1EYBA 3IAM2 4Y15A 2KL4A 2QQAA 5JI6A 1S0DA 1H4GA 3M7GA 5L3CA 4CDUA 1X3ZB 2HS5A 3KQRA 2Y0SN 3MEXA 1UAIA 3KSCA 3WP5A 2QVOA 3SDBA 1RNLA 3RQ4A 3WV6A 2NN8A 3NSTA 5EG0B 1T33A 3ESWB 1R081 4IOAF 3OUHA 1EJ9A 4JAAA 2JWTA 3O0WA 4KBZA 1S2EA 1CAWA 3A0BC 3AP6A 2JICA 2FMLA 2W00A 5JHUA 5K0UB 3LFUA 4LD5A 1TME1 1G3TA 2KD7A 3P5BA 4RHV3 1SFPA 1DPUA 3PVEA 2KXLA 4UF0B 3ECHA 3W6KB 4E7ZA 4GXLA 3U78A 4QGLA 1UB9A 1JYTA 4NHLA 4HL0A 3VYRB 1PJRA 5IVBA 4MUVA 4YIIA 1HRI3 3WP4A 2YC4A 5JSRA 4BMEA 2PQQA 2DFBA 2M7BA 1WLCA 4LK7A 5JSOA 4IEVA 4XLPF 3FBMA 2M45A 5DUKA 2IW5A 2G9ZA 4QPIC 2JTVA 3LSRA 1RETA 2I8DA 3CCJI 1CN1A 3DPLC 2RR13 2EA4A 2BHZA 1D5YA 4B29A 4IEPA 1FXZA 3CO7C 5FY5A 2EXHA 1BL0A 4Z6YA 4BUPA 2M5WA 1V6OA 4KISA 4K7JA 4NROA 3G6EI 4KMUX 3K51A 5TISC 1YO5C 5FAXA 4OZXA 3LQQA 3AZWA 4QM9A 2F4MB 3HTUA 1IRXA 4PIXA 4C2MJ 1NQDA 3BPSA 4M00A 4AD9A 2WAQN 4OOIA 1O8SA 2BFUL 1JHFA 2D6KA 5I91A 5JFRA 1AUYA 3RKQA 5SV5A 1YQ6A 1OPMA 2D43A 4LA2A 1ENSA 1LEMA 2LSOA 3KYDB 1R5HA 2HEYF 5GAGJ 3DTIA 5F1RA 3NAPB 2O6GE 3ZIWA 1PK6B 4HX7A 1K6YA 4XRSA 2WO7A 3GZAA 4RMNA 3JRDA 1A35A 3LOIA 2QSHX 1O57A 1O5UA 2B8MA 4YGEA 4LBQA 4WF2A 4HYEA 2PAKA 4LBKA 1D4M3 5GZFA 2HPMA 1FX7A 3MKZA 4XJUA 1KYZA 4CVUA 1W0NA 3BG3A 2B9UA 3T30A 4OMYA 3GZ6A 1ZYRF 2KDZA 2DOEA 5C4XJ 2NVTJ 2R7FA 1AU7A 3WF4A 5IWFA 3KP2A 1U9NA 4XLNF 4LJZF 1TNRA 1I1SA 4CYDA 3BTAA 2Z16A 1Q8QA 3MPPG 4JGYC 2QQPA 1KEXA 4BQQA 4HPKB 5LBCA 3TOBA 5M5XJ 3ZMDA 3ZFGC 1VQ6I 5KVRA 4AVAA 3PO3J 4G6TB 1XDUA 2Y9YA 2E1NA 3BG9A 2JSCA 4A6OA 5KBFA 2IS2A 1P9QC 1USSA 1ND3C 4XHBA 5JXIA 3TO7A 4RGSA 5FZEA 3LOCA 3LSTA 4DW6A 3MICA 1JHHA 1UY1A 1W05A 1SLLA 4JKKA 4URAA 3F2ZA 3IH2A 1JKPC 5CB7A 4OCTA 2ZX3A 4FPFA 3O2PE 3HD8B 1AR91 1UQXA 1GZCA 2DCKA 2DW4A 5F6KA 4JOMA 1UU5A 1UD1A 2JA2A 3TEDA 2ZBKA 1XGMA 1FOKA 1NA1C 4FHTA 5CKMA 2E34A 2E51A 1K42A 2E7WA 2QKMB 4K9SA 4YEJA 2W4SA 2WR9A 2GXGA 4A3IJ 3WGHA 2DA1A 2DU9A 2VCBA 3F3XA 3AKRA 1XPXA 1ZZ9A 2FMDA 1LEBA 2ZGRA 5KHGA 4IEOA 3HHGA 1D8JA 4QXBA 2J1RA 2FZ2A 2ZMKA 2IWGB 2HDDA 4A3KJ 1JJ8C 2V6EA 1DGWA 5HLHA 4XUQA 2X29A 4N8MA 3H3LA 4Y1XA 4A3JJ 3J81K 3H5AA 4W1UA 5C9AC 1ONVA 1DQ5A 2I2SA 1TZOA 1PX4A 4W97A 3DEUA 4D6QA 1LENA 1RUD3 1HRV2 1PK6A 3VHOA 3F8BA 2ILMA 3E6CC 1JTYA 2E1OA 2Z4FA 4JQTA 3D0SA 1BEV1 1SACA 3B6CA 4AI8A 1AL22 1R36A 3UYJA 2M4KA 2RJ2A 1PUFB 2ZJCA 3EMRA 4JVAA 1RUH1 4D6RA 1JXNA 1JOPA 2RM22 5LBFA 1GANA 3DBHB 1G6NA 1UYPA 4M74A 3COAC 2IC1A 2HWE1 3EUAA 3OYLA 1C8M1 5G04L 2E31A 1SMVA 5HXMA 1UOGA 3ILNA 2X1CA 2YU9J 3VBHA 2GQQA 3HT2A 5A1FA 2QQJA 1NUKA 4YPJA 4Q4ZF 3USUA 5B1AH 1GYKA 1ZREA 3VPRA 1S3JA 4A6DA 4IESA 3V4GA 3IN9A 1SFYA 1WJFA 4HEA2 1AF9A 2ZEXA 3N9NA 4RR3A 4ZU7A 4HKOA 1JZ3A 3M4FA 2HBTA 3U14A 2VC9A 3THCA 2HQRA 3KT1A 2DV9A 3ZX7A 3TO9A 4D5CA 1TW2A 1GNZA 1ZBA3 1HJGA 3UGGA 1YFYA 1BMV2 2BOJA 2R7SA 2AZ5A 2HWB2 2YX7A 3G2BA 1OA2A 2LKPA 3GTMJ 2IVJA 2XIGA 4LK6A 4LK0F 1W6MA 3OYFA 2D3SA 4E7KA 4EWAA 3C7HA 2P3JA 2QVSB 2X53S 5AONA 4LPLA 3BUCA 3BT9A 1W0OA 3RSJA 4W6YA 1DCSA 2FQPA 5HDGA 3DXJF 4XJWA 5IATA 3O1PA 3ERED 3OCPA 5BS6A 1ENQA 4II3A 4BQOA 1JXSA 4HN0A 3M07A 1MH4A 4AHZA 1MQTA 4ATFA 2D1HA 4P02B 5K8SA 1DP7P 2OQ7A 3OEBA 4S0HB 5ERIA 2FEZA 5FP3A 2DT5A 2XB0X 4YZ1A 5EEHA 2X05A 5HCHA 3DEMA 1S0EA 4FBFA 1LCLA 4IJAA 2DUOA 4RA0A 2QUOA 3OOXA 1GVJA 1ITYA 1Z05A 3C1DA 3O7OA 3TBIA 2HDWA 1ASJ3 5F39A 5H20A 1JZ5A 4CU7A 3EJKA 2MW8A 3ERMA 4WVVA 4CCCA 2ARXA 3OSGA 3CUQA 3EYPA 4FISA 5JMOA 3WGIA 5DD8A 1FOWA 5EPAA 5FY7A 1ODNA 4CP0A 1ZRIA 3WNPA 2X6YA 1PUFA 1W9YA 2MNGA 1JJ6C 1V6JA 2YBSA 3MF6A 5I8YA 4W8JA 2DU0A 1NCRB 4COWA 2WA4A 5FMCA 3S2HJ 5H9PA 3R4KA 2ZJRF 3LGRA 4EATA 2VULA 2A6VA 5J47A 2ME6A 2RJKA 1VFCA 3V0AA 1H1IA 2C6YA 2PAEA 3CKHA 1BZWA 4BE2A 1CAVB 1IRZA 3R61A 4QPIA 4CZSA 5FPZA 4D7SA 1RTVA 3H8XA 5FYCA 4MHGA 1WMDA 3GLLA 1WLDA 3W2VA 5JUVA 4P96A 4XIOA 4EN6B 3UKNA 1BR4A 5ACA2 1W2AX 2VJ4A 1FV3A 2L9RA 4H7MA 1JZ2A 1VBC2 1VBB1 2V1NA 1S8NA 2ZGPA 1ULCA 2FDHA 2HVRA 4KDPA 3J9SA 5DUXA 2IS6A 1EH6A 2JDNA 3R0RA 5FMDA 4D0PA 1W28A 1BN5A 5D5UB 1WSUA 4GB31 2GA2A 3D5LA 1X1BA 1WFXA 1H0BA 3WU1B 2D2WA 1JYCA 3OTFA 4Q29A 4DXRA 1GV5A 4XMIA 1AR61 4G8XA 4J01A 3HSFA 2L3DA 4Y5Z0 4IHXA 2VODA 3QOEA 2DBBA 3WHBA 1RHI2 3HXLA 2WRAA 2R5YA 4FOYA 4G6DA 3MLJA 3D82A 3HEFA 4QB2A 2EPFA 5CYVA 2LROA 5T5PA 3WNXA 3AMHA 3KP4A 3OBRA 4LG3A 1ULOA 2PMZA 4KNCA 3VB9A 4XYXA 3OYEA 3KT4A 1RXGA 1ZRRA 5DTDA 2QDRA 2E5ZA 2CQQA 4WM8C 3VHRA 2O14A 3ML6A 4XJAA 1SD7A 3TW7A 4LB5A 2JXAA 1RUI1 2W68A 2VOOA 2MBFA 5CAZA 1WJBA 3HB9A 5DDJ2 2WT1A 1JOJA 3A0NA 1JU4A 2O5RA 5HLIA 3AKTA 5BPXA 2A6ZA 4O61A 3I3LA 2FBIA 4Y5TA 5A6QA 4JGYA 3VODA 2P8TA 2JE9A 3GW2A 2PHUA 2WZR1 1LFPA 1C4RA 1V6KA 1QJEA 2OTJI 4J25A 4BQ4A 3ZFGA 1UYZA 3VDAA 5CKNA 3EUHC 1R6RA 3FISA 2KQRA 1XQNA 2PELA 3IMMA 1RITA 5IK5A 4DZJA 2UWCA 2RVAA 5IYDJ 4GIQA 2FCUA 4PJNA 3MW3A 3T0BA 1ND3A 2VQ0A 3N3HA 1NE4A 4YVWB 2QZ8A 3AP7A 2G9WA 1WW6A 1MBFA 3HTSB 4DY3A 1S0CA 1FMD1 4F3QA 1H1AA 2W1QA 5BNPB 3MKWB 1L7LA 5IYCJ 1YFWA 4IETA 1RUJ3 1POGA 2BGOA 2EB7A 1FWZA 4HX4A 4BM8A 1XMAA 1MZEA 4EQQA 3POEA 1CF7A 1IUFA 1XGNA 1H9TA 3GJAA 4EWEA 4K2EA 3UR3C 1LE8B 4QX1A 3KF5A 4X6AJ 2QLZA 4CHUA 3VBRC 1NA1A 3IAPA 4LLFA 4X8NA 3I53A 2JDZA 3BU0A 1T38A 2DYCA 2PQSA 2JDMA 3OYCA 3DTKA 3JTHA 3PSFA 5L3BA 1N1YA 3DGTA 4ZPIA 2MD0A 1OVSA 4M3GA 3NRUA 2KDOA 5DCMB 1YJKA 2VAUA 2Q1ZB 5FIXA 3VGIA 1GZ9A 5HOOA 4BBSJ 1SCSA 1XGSA 3ABZA 3USSA 2VUJA 5A7SA 5FGMA 2FBHA 4IPAA 2B4KA 2H27A 4IDZA 4OQ9A 5EYYA 5C9AA 2CH0A 2CYFA 2Q4SA 5FV3A 3J7HA 2EFQA 1O91A 4L8QA 3ZYJB 1VP6A 2ZEZA 1QH6A 3CHXA 3PQKA 3P5JA 4AGRA 5C3SA 4QKBA 3OSFA 3CZUA 4Q4X1 2O8QA 2L7KA 4HKLA 1A5JA 5CG8A 2FHRA 3TN93 3POSA 5EZWA 1XB4A 4EM2A 2VBWA 2VH9A 3SHRA 1J0RA 1W3XA 2WA0A 3QWLA 2LKXA 5F2SA 3FIWA 2DCEA 3AYCA 4P9GA 4IE6A 1QDOA 4OMZA 4Q4Y2 4FTBA 3ZXDA 4AYBA 1NE6A 2IVIB 5IVVA 3F8NA 4JRLA 2ZX0A 2ISZA 4D6SA 4MGTA 1TWGJ 1W8FA 4BLJA 1KYWA 2X1EA 5C8CC 3LZZA 1XE8A 2ZGSA 3ITQA 3V7CA 4D7YA 2K9QA 2VXJA 2RNJA 2ZTNA 2F5VA 3J26N 3E6MA 1SDDB 4NBQA 4XN3A 4XRFA 2W9XA 2L01A 3AAFA 1ZYBA 1SCRA 5FQ0B 5ABJC 3OS2A 1YQ8A 4UUSB 1CIYA 3IB3A 1NQJA 3OS1A 3QQAA 5L7OC 4R52A 3OBTA 5C4WC 2CV2A 2RM21 1QQP1 3K4AA 3F23A 4IV3C 1BI1A 1IZ3A 1K4SA 4RQPC 2H0VA 4TXWA 2WDBA 4C0BA 5JHFA 4XXPA 2BZDA 4Q47A 1EH7A 1LPQA 2JA8J 1Y9MA 5A6YA 1ULPA 3ACGA 3CLOA 5FYSA 3M3EA 2R7WA 5C5UA 5LA1A 1POV3 1OA4A 4CXYA 4RM3A 3CMGA 1E0EA 2HZTA 4DB5A 5GPCA 5GAHJ 2IXIA 1WD3A 4MLOA 2NOGA 2OKXA 3J8F2 3KVBA 1RPWA 3K7AJ 5DXDA 2HYKA 2NP0A 3HOBA 3Q9OA 5SV8A 1ZZBA 4QX5A 2BY3A 4AZZA 5CA6A 3NJVA 2VPVA 5E3NA 5FUIA 1MNEA 2VOWA 1VB4A 1G9CA 4MGKE 4LKFA 2X6OA 2ZAAA 4IE5A 4QPYA 4R8HA 1ZLKA 5FJKA 5IOZA 2MSYA 2AXTC 4G94A 2CU7A 3S3OA 1GU3A 3VD4A 3HOTA 2O0YA 3I54A 4CH7A 5LA0A 1U78A 4R9CA 1BC7C 1O7LA 3I49A 1IO2A 4AC0A 3GHNA 3H8RA 1AR82 3B00A 2OTLI 1RIOH 3VV1A 2UV1A 1R083 2K02A 5A3OA 1BBT2 4CPBA 1RGSA 2OXBA 1QKQA 1VALA 3RS6A 4DXTA 1Q1VA 2F48A 4U0VA 5FD6A 4BGDA 1SEFA 3AKZA 2V5DA 3ABUA 1Y3TA 3DPRC 3H36A 4KMQA 5FRMA 4JKLA 1Z7S2 2HR3A 2OZUA 5AFBA 1D2QA 2VMCA 3FC0A 2QKLB 4JQFA 4XF0A 1H6XA 1H8AC 4Q0PA 5E8IA 1VJ2A 5A3PA 2P6TA 3CC7I 2BY0A 1TTYA 4UUSA 1R1VA 4KMFA 1I6HJ 1T6SA 3FL7A 4FPHA 4H7LA 3IWZA 1SBDA 3HPNA 5F08A 1HX6A 2JSPA 3WGGA 5IHRA 3JRIA 3GUDA 3NRVA 2RE9A 2ID6A 2ZHNA 3BZ6A 5JMCA 2DVFA 4CICA 1IG3A 5LBBA 5FMBA 2XJVA 2F5EA 3TAYA 3GGLA 4TWTA 1OSGA 2KZVA 4DY5A 5F3GA 1RIRA 4AFCA 1GZWB 5KR7A 4GH4C 2V4VA 5C5TA 3WQ1A 4TLGA 3BZCA 3CDLA 1OCPA 1RUC1 2DUQA 3CCYA 4BQ3A 3ZGKA 4XNFA 1SZBA 3KGZA 4RAZA 3FHNA 5GJ6A 5ANQA 1YOVB 3JSPA 3B94A 2WB1N 1XYNA 3NKGA 1B72B 2HZDA 1JYNA 5FKMA 4NHXA 5ACA1 4BH9A 2Z3YA 4WM8A 4EMSA 2VZSA 3NNFA 2E7XA 2A73B 1VBC1 4NHKA 2ZPXA 1VIWB 5FDBA 3U4SA 2K9LA 4PUSA 2GM4A 4AW7A 2K7LA 3AB0A 4GMP3 2W95A 3HOUJ 5L73A 4P55A 1A6QA 3ZQFA 3ATGA 1SLAA 5E8AA 3F9KA 3AVSA 2PJRB 4I3PA 4JBAA 1XJAA 3VSLA 2CDPA 5FLMJ 2GMMA 2X9DA 1ENXA 4QX7A 1OKRA 3EUHA 4XACA 4RYDA 4AI3A 4C1WA 3IT8A 1WMFA 3FMQA 4YZ3A 2WYFA 3QU3A 4MEYF 4ZHNA 2ELJA 4XRMA 3K4NA 2LS6A 5AVPA 1APLC 1JYVA 1QJFA 2NS7A 3SCFA 4MGZE 2BTVC 3VFZA 1B09A 4J1XA 4C3HJ 1PMJX 5FZ7A 4U7BA 2V26A 1ULGA 4CDXB 4FOQA 1BBYA 5A3NA 3HJEA 2ZMEC 2NVYJ 1ZRDA 2BHYA 1TVGA 4XQFA 3MD2A 3FXJA 3IRQA 4X6RB 5LA9A 3H9QA 1QZZA 2DJNA 4ZDPA 2E1MB 3LQCA 1PUEE 4A3ZA 3VBRA 2VD7A 2DFIA 1J1LA 3NQOA 2D6PA 4U36A 2OZJA 4MGIE 2YB7A 5BUVA 2ORZA 5HS9A 4UV8A 1W06A 3K2OA 2K85A 5T52A 3TRSB 2O0OA 3VKFC 2F5CA 5IT9Z 3D6EA 2YSRA 4H14A 4LE4A 1B8IB 5F37A 5ERLA 1LHNA 3AG3H 1WI3A 4I0BA 2EINH 3KYLA 2JG9B 1G86A 4ZZ5A 3RKYA 1XCVA 5KHHA 4EROA 3GZTB 1AR93 4MXWA 3BTIA 3J7NA 2JT1A 1JE8A 2EQRA 3ZPLA 1HKQA 1O4TA 5D21A 1SFUA 3MIBA 1WZXA 4AFDA 3AMNA 3MVPA 1LODA 4F91B 3B02A 2Q8DA 5HI0A 1NH3A 3ZSMA 4CP1A 1QHDA 4WVWA 1JZ4A 4PJJA 1WWYA 3H1YA 3NV2A 2WO2A 4XBFA 1KS5A 3JAMK 3ZN4A 3P7NA 5BNNC 1FEXA 4LEJA 3G1OA 3A21A 4QT6A 2R16A 1LQ1A 1B72A 4FE7A 4ZXEA 5HS7A 5FY4A 3SC7X 1G9FA 1YYVA 5FZGA 4FE4A 4AFAA 3LSMA 5J4VA 2JA6J 2QCOA 1CQTA 1YLLA 4AVVA 2RS12 3U11A 2JG8B 3GTJJ 2V73A 1BEV3 1K5MC 1XNTA 2PMZN 5C3OA 4BK4A 3TP0A 3F8CA 5J6XA 3V8JA 4MVTA 1VTNC 4F8AA 4F52A 2HEWF 2ZHLA 3M1HA 2VT2A 4UBGA 5C8CA 5FZOB 1E5HA 1RUH3 4EJTA 4LMFA 2NM1A 3GBFA 5ISLA 3JXSA 1F4KA 2VJXA 2CUEA 3O1TA 3VZJA 2PHDA 2HWE3 5F2WA 1C8M3 4AYUA 3OOPA 1LKNA 3LDBA 1GVDA 3OYDA 3W6VA 3WSOA 4ZYEA 2IBDA 4Y3OA 1KU7A 3POFA 2GN3A 1Z6RA 4HLYA 5DMYA 2Z42A 3TB0A 2DCTA 3RZKA 3LKJA 5L7OA 1NG0A 1JT6A 4NRMA 3OYBA 4MHRA 4RHV2 4AVTA 3BR0A 5C4WA 2I10A 2ISYA 4LITA 3IC7A 1YI2I 3LPGA 3WT3A 2XUEA 3A01B 5JZGC 5C3EJ 1CAUB 1KDKA 2V9PA 2VT3A 3HN1A 3C2BA 2MHFA 4IV3A 3X2QH 2YGLA 4RQPA 1ZZ7A 1T6GC 4CYCA 3S1RJ 5EWSA 1HRI2 2GMPA 1I39A 4Y1VA 4OI1A 4ZY9A 2BNMA 4A3DJ 2YG0A 4A7KA 2P7VB 5FYMA 1F15A 1LGBA 2J22A 1TWHJ 4WZFA 3HQUA 2RR12 2JEMA 3IAQA 3DXUA 3VYTB 3WVJA 2EIMH 2JG9A 1UG2A 5FWJA 2XAFA 1K5JA 1R00A 4QWQA 1QHHD 4AGVA 3I55I 4ISRA 4RAFA 2WS91 3KHBA 1B35C 3VEPA 3RFRA 3TYJA 4KH9A 3DF8A 3LIGA 4M4PA 3AJZA 2A75A 4AUXA 3TNPB 3JRBA 3PUQA 4CXFA 5F64A 1ZR4A 4RD7A 2STWA 3LCPA 3I58A 3CDZB 5AVAA 5GKAC 3G1LA 2XHKA 2JIGA 2HDCA 5KHKA 2DTZA 2EXIA 3NJYA 3CTAA 4YGCA 1JW6A 1J59A 1PO11 4WVMB 3FKIJ 2P6CA 2RQPA 1GWKA 4Y17A 3DKQA 2FOWA 5HV0A 2XJTA 3KEYA 1IS5A 3ZFFC 1D4M2 2VNOA 5K7ZA 1JBCA 5T5LA 1QRYA 4AVPA 3VDDB 1NK2P 5FYZA 1SHWB 4Y52J 5J7MA 3ZIXA 3ZOBA 1WBFA 4XIDA 3DPRA 5M0TA 4XJ8A 1BJQA 4DQ2A 1KQ9A 1ZZCA 2JENA 5FZOA 5HPOA 3T1MA 1DQ0A 2BP6A 2LC2A 1OFSA 1ODDA 3N7JA 4H2AA 4LFUA 4C2TA 1TLHB 4AYBN 4UW5A 2DN0A 4CXWA 3CESA 5JLWA 2YGMA 4HNUA 1WVRA 1LJ9A 3HM5A 3OSDA 1BKZA 1OBNA 4M4RA 2QDNA 3SQOA 1AR73 1X1DA 1UX7A 3KLNA 4HANA 2EK5A 1W9WA 3A01A 5E16A 1P7JA 5FYUA 4M6YA 5JOZA 3PJQA 2RG4A 1TG7A 4KQ7A 1SBFA 1MMGA 4LOSA 1OCCH 1I27A 2H94A 4BE0A 4N43C 4EV0A 3BOWA 3WDYA 4CCNA 1YS6A 2DK5A 4GH4A 2GNTA 3HQXA 4LNVA 1VBB3 3LWFA 2W82A 4FPYA 2WAFA 3CJIC 4EJVA 1NCQC 2D44A 4C0HA 1ZVFA 2DJIA 1QOTA 1HLVA 3GTPJ 3W2AA 1YG2A 2BBAA 1VBA1 2PLYA 4N7UA 4GB33 1Z7S1 3ZQLA 5JOWA 3ZXEA 1IW7F 4OHZA 1HKTA 2LOOA 2DPDA 4SLIA 2JJ7A 2WV1A 2RMU1 4EM0B 1AR63 3EO6A 5D8KB 2ZSHB 3C7GA 4E7LA 2R061 5EJ1B 1P4AA 1NY72 5LB6A 2CWMA 1OD5A 2VOXA 3FDYA 4LKSA 3DYPA 1DIWA 1RUF1 3ECQA 4CDWC 1QF3A 1UHMA 2IPQX 3GYDA 2GAUA 5CVRA 2W52A 1XYPA 3LNQA 1RMU1 2CHHA 4PI0A 1SMYF 5KAFC 1RUD2 4JHZA 2ADUA 2GNBA 2D93A 1HCRA 3WY6A 4DNCA 3H3VK 2X5IC 1RUI3 2V79A 2COBA 2VZUA 2ADEA 2WZ8A 2EV5A 5C4JJ 4RS5C 3KP5A 5DUUA 3OGSA 1Y1WJ 4XF3A 4YVSB 4IGQA 3VDDA 2B63J 2ZMEA 2XSDC 1K78A 1OA3A 2VGDA 2VMFA 2WZR3 2GIZA 4UXAA 2P6SA 4LULA 2VU9A 1LVAA 1HOMA 3FHZA 1YRZA 1ETWA 2VVEA 3BB6A 3HYIA 1R9TJ 2DWRA 3VBFC 4UY8I 3WTUC 1OYYA 4A12A 4BZ4A 4KYWA 2P4WA 3JAMZ 1UY2A 5JR3A 4X1EA 1DYKA 2WLQA 3LEIA 3WDTA 4S05A 2WINB 5FB2A 4UNOA 2DA6A 3SKJE 4ARYA 3KZIC 1FMD3 2TUNA 3SEQA 3O0XA 1DF0A 3WG9A 3ZXGA 1LOEA 2QQ9A 4UFMA 3V0BB 1ZBA2 3MIFA 4OHYA 3VZKA 3H9AA 3O1MA 1CIWA 2HPIA 2NVQJ 3S1QJ 3W20A 2UY8A 5FWEA 4CCLA 3LFIA 4FOVA 4ZU4A 1BOAA 2ELKA 1APNA 2OX0A 1L0OC 2VTXA 1UOBA 5C7GA 3OPTA 2IS1A 3FMRA 2LY9A 2WY8Q 4ON0A 3S0MA 2W48A 3UESA 3VBUC 2VJJA 4KUMA 4HG6B 5BNNA 3HC7A 4IL6C 3CMYA 4ET7A 3RJPA 4D9JA 2R7DA 2C4XA 2KPMA 2PAMA 1HW5A 2HVSA 2IA1A 1Z0XA 1VRBA 4WX9A 3IH4A 3HRUA 4XVHA 5FMOS 1UYXA 2W94A 3M70A 4G7ZF 2F4PA 1KA8A 2MABA 4QHBA 3ZXJA 1K5MA 5K9YA 3LD8A 1ZRFA 2PN6A 1KONA 4IHYA 2GMEA 4Q4X3 4XOTA 1ASJ2 5E1RA 3IRRA 3BQZA 1LDDA 2OU2A 4ORFA 3RTRA 2P5LC 2L4MA 5E88A 2R7OA 2HLEA 1JTZX 4PT6A 4LOTA 1F4HA 4DBRA 4COZA 1QNWA 2DA4A 2WO3A 3GZ5A 3RZJA 2JDHA 3IDAA 1N1SA 3OY8A 4D94A 3H8UA 3ZKYA 1CGPA 3HT1A 1OLQA 4QWNA 2VXDA 2DUPA 1WPKA 1S0GA 1UKRA 1RVF1 5E6HA 4I09A 4IXAA 1UWWA 2GN7A 5JZGA 1GP4A 2VZPA 3PIGA 1TZLA 5B1BH 1GXQA 2KMUA 3H1CA 3PUBA 2LMDA 5BMZA 5I0SA 2WV0A 2D6OX 2ET1A 2NQYA 2QCSB 3K9TA 5D4SA 1DGWX 3LA3A 4IF4A 1J3PA 4XRSG 3KX2A 4AR2A 4JGZC 4DMIA 4P1WA 5IFTA 3URFA 3WR0A 3FF5A 2FBEA 4XF1A 1DU6A 3KLSA 4QQ2A 3EYYA 3WNMA 1QQP3 3GXUA 4JX5A 3S3NA 3M8FA 3SYTA 2QQKA 3PTRB 5KHDA 5IVFA 2ZX2A 4IEZA 5I8SA 1EY2A 4C1XA 2CSOA 1B35A 5BNOB 4AAPA 2KRCA 4A6SA 4JHTA 1CPMA 2ZGMA 2BV6A 2GOMA 4YG6A 4A3MJ 1FATA 1MS3A 1XGOA 4L9VA 1OJLA 1GOFA 2M87A 1A3KA 2WN2A 1BQPA 1LECA 3MEPA 5GLUA 4A2UA 4OHVA 5HDNA 2B5HA 2DA5A 1W6NB 4C3JJ 1LGNA 3E3VA 5FYYA 2PLV1 3VUOA 4XHXA 3OJBA 3JBG1 4MGQA 2VL8A 5CBLA 2OA2A 4FPJA 3ZYHA 2R071 4W6XA 2GBYA 2CU5A 1V4RA 4XK4A 3OYWB 3J7MA 4KWKA 4PHZA 3BTZA 5LY1A 4P9JA 2YX4A 1CJDA 4FTHA 4ZXKA 1XXNA 4DOUA 1POQA 3J4UH 3KV4A 1V3FA 4P14A 2NYYA 2WWSA 3KS7A 1JI8A 1C1LA 1NYWA 1KGSA 4XLEA 1FBQA 3M4OJ 3ZXAC 3WHCA 3VKLA 4IZZA 1CPNA 1O3RA 4HX8A 1NXD1 3QPTA 4PIZA 1QU0A 5HV4A 2SBAA 4NRQA 2WC2A 1BI3A 2W08A 4PK4A 5A7WA 4YW3A 3QLQA 1ULDA 2DI3A 4LMYA 5EGOA 4GFBA 2F6CA 3WNLA 4RBOA 3VN4A 3DFGA 4N53C 2F4IA 4EZ4A 1REDA 2PHRA 3R0JA 4YZ4A 1AYM1 2JK3A 4PLOA 4U0YA 4N43A 2KIQA 2E53A 3IIAA 1TNFA 2VO5A 3QAHA 3JQWA 4ASLA 1RUJ2 3I2GA 2PHTA 1D7PM 4FAHA 1NT0A 4ZH4F 1NCQA 4E7JA 3OGVA 3QODA 2QTWB 4JV4A 4PJLA 2ZXIA 3CCQI 2DTWA 4CP9A 3Q8EA 2DFCA 2Q30A 4IOCF 4AEDC 3WLUA 4YFWA 1UCRA 2JMWA 4YM2A 2XSJC 1U0JA 1FBSA 1NZIA 3MLLA 3FXRA 4EJWA 3ZPOA 4LJHA 3WF3A 1R5ID 2ZGUA 2A6EF 2VC0A 4CE8A 2AGSA 5BNOA 3BROA 1H6YA 4INDA 3I3QA 3FMSA 4B8EA 3KEOA 4BXFA 3AYDA 4BYYA 1HF0A 3FKJA 4FT8A 5ED4A 1RUC3 4HBNA 4BWOA 2KJCA 3A23A 4TTGA 3G6JB 4CDWA 2PHWA 5EFUA 4BJ6C 4F93B 3ZMZA 4YIRX 3U21A 2CGNA 4ES8A 1C5IA 3AL0C 1YIFA 3CEWA 5K5QA 4Y5SA 4RS8A 2CV0A 2C5DA 3BOQA 4QIWN 1OQYA 1IN5A 1P2FA 3ZP5A 2R6QA 5GZGA 1N75A 2F6BA 2X5IA 1OOPB 5GM0A 1XSDA 4RGKA 3FWEA 3V56A 2GNDA 2XQXA 2WN3A 1TT5B 4RS5A 3Q8FA 2CQXA 1QGLA 2M2EA 3Q3SA 3D0JA 3MIEA 4A3BJ 2XGCA 2VQHA 3MBWA 1ND2B 1S6LA 2EXJA 3HDDA 3T0YA 1MMNA 2GSYA 3RVHA 5J37A 3S1NJ 1JUSA 3WUDA 2P6HA 3UV9A 3MUY1 3A1YA 4P9WA 1IC8A 1G3SA 3ISPA 4UFJA 1R49A 4NC6A 1W4MA 2EIJH 5HXVA 1HJFA 1W3VA 2ORXA 3MV11 2J1VA 4KFCA 2AQFA 4G3YC 2LVSA 4CXXA 3DXTA 1RR8C 4XFCA 1S9HA 1HDDC 1PM4A 2RS51 3QH7A 3KM5A 4XICA 2V7FA 3OYMA 4GKYA 5LCWL 1W36C 2D98A 3LSIA 4ZJZA 4DGWB 3OWTA 3RPQA 4BY7J 2LR8A 2WY7Q 3AZVA 1MNDA 5HCBA 2QQWA 1NXMA 1B9NA 3RZZA 3B9IA 3BZKA 4CCJA 1XNDA 4YZ5A 4Z2AA 5A70A 3BG6A 3VBUA 5JWPA 4Q4W1 3JQXA 2G9FA 1AHSA 4Y22A 1KDMA 2X10A 1J5YA 3GMEA 2HOTA 1H8VA 3WNOA 5E1XA 1IN4A 3K70C 1KU2A 2LBFB 1WHUA 3DUIA 1J58A 4HF0A 2RKHA 4EJOA 4HVRA 1MBGA 1S0FA 4UHTA 3T3YA 4COUA 4LORA 1IXSB 2X6WA 2VQTA 1YJ9I 2DBIA 1LOFC 5TGTA 4IW3A 5L9VA 4LHNA 5ICEA 2VOKA 1TT0A 5LATA 1YJNI 3G73A 2OW4A 3I56I 2TBVA 4OIPF 3F8MA 4BS9A 3E7LA 5J1YA 2EIBA 3IDEA 2PHFA 1H2KA 4YFXF 5CPRB 2QJVA 4A7ZA 3IKVA 3SKVA 4BB3A 3PTYA 1V9U1 1OOPA 1MSFC 3KLOA 4LLOA 2ZSIB 2R0QC 4HN1A 4IV1B 4I99C 4WV8A 2NPIA 3MDPA 2B7EA 4XJ9A 1MR5A 1LEDA 5FXZA 2VKVA 4BQNA 2PFWA 1RJ8A 3GEZA 2ZO4A 1ND2A 3OYAA 1DG6A 4BAYA 2L9LA 3TOAA 5M5YJ 3HGYA 1D1BA 2VIXA 1SDWA 3GCXA 1SFXA 3CCUI 1R5GA 2QSGX 4LBJA 1R082 4AHWA 4D69A 1H1MA 3VL9A 1UHWA 1BHGA 3I59A 2HYXA 2QZ2A 1ZG5A 2NOJB 1MS8A 3BJAA 1LOAA 4QGNA 3ABLH 1EH8A 1FNZA 3REOA 3WTYC 4JGZA 2CG4A 3SEEA 3JRFA 4NUBA 1U6GA 3LEKA 3FM3A 1TBXA 2KIFA 4NB5A 2VECA 1W9SA 1O7FA 3ZQHA 1O8PA 1ON2A 3GO5A 2YHJA 3FE5A 3S1MJ 1GV9A 2DCJA 1B1BA 1JI6A 5FRAA 3OS0A 5FK7A 1F2NA 3BIWE 3HOWJ 1HN1A 1SBEA 2IXCA 1I1EA 2BVMA 2N7GA 4ES9A 5DABA 4ITVA 5BPIA 2VQCA 1Q8VA 1SAUA 3HKZA 3A0KA 3I97A 1ULFA 1MMSA 2WTEA 4L9TA 3VD7A 1QJY1 1PM7A 5GALA 3ECOA 4I6ZA 2A6WA 1LU1A 2CW8A 4NIIA 4HPQA 5LA2A 4CDQB 1GMMA 4FXGB 3JRCA 5A1AA 1ZZ8A 5DZGA 3VZLA 3I2HA 2IP2A 4XOGA 4YLZA 4NJ4A 3WCRA 2WS93 2WT0A 4EN9B 4GCVA 3POWA 1OLRA 1E5IA 1PGSA 2LW8A 4B3NA 4MGRA 3AP4A 2EH3A 1ZTRA 2M3AA 2Y8KA 2W1UA 2KM2A 4ZZ8A 1V70A 4LUKA 5FYHA 5I8TA 1FP2A 2K4BA 4PBOA 1YX3A 3AL6A 4UB6C 3CQZJ 5DUWA 4M0NA 1PO13 5J1RA 3I3BA 1MJ9A 2DK8A 4GWJA 3DYOA 1I3QJ 6PAXA 4QQLA 2ME0A 4FASD 1YNAA 4IV1A 5FRNA 3H9GA 3KE2A 3R05A 2M1BA 1OI6A 1WMEA 2ZGQA 4KU7A 2Q8KA 2GP3A 2HXIA 3JR9A 3C7FA 2FU4A 4CUCA 3K75B 4LK1F 2W39A 5D8AC 1AXKA 1WCMJ 5HCAA 4P9UA 3OUIA 4DUXA 1US3A 4PSWA 1D0XA 2GC1A 3GFIA 3FUQA 1K12A 3MN2A 3GCWA 2JB4A 3HAGA 3VBSB 1CZVA 4D7NA 3BWGA 2JKXA 5B4XA 5F0CA 5CIRA 1CAXB 4IEYA 3SITA 3ETQA 3K1NA 2ZX1A 2MEV1 3G3ZA 1QJX1 4AEDA 1U5TC 2NYXA 4CZZA 2HQAA 2BDRA 3H3UA 3JTGA 3G7DA 5T3NA 5LW9A 1K7AA 1W9FA 2JE8A 2VZVA 5TRDA 5FZ1A 2IGKA 2FDIA 2XQRA 1XD7A 1DBNA 2E7QA 3T5XA 4XOPA 2YZ4A 3LE0A 2AYHA 4YW5A 5A7PA 1S55A 2VBBA 1GUIA 3NKTA 2ZXHA 4XKWA 3ZSEA 3FHQA 1SFEA 2FE3A 4AWDA 4WVZA 2Q0OA 1AR92 4XBNA 5K1YA 1X2NA 3L9JT 3KZZA 1VBA3 4FX0A 1U5ZA 3VBOB 1R71A 3OD0A 5JIAA 2W92A 2CFXA 4Y26A 1PVC3 1P6RA 2B7YA 5DM7F 2G7HA 2XV4S 4Z2YA 4NWWA 2RMU3 1R1A3 4GWMA 3BR3A 5H2FC 3AP5A 4FFHA 4XFIA 3PIOF 2W85A 1YIPA 2R063 3S3MA 4LIUA 4AHXA 3F6VA 2JA7J 1W5SA 1G8XA 4FX4A 2VMGA 4V2FA 5A33B 2BRTA 4Z1VA 4LBOA 3U9GA 5IK7A 4JRAA 1HQCA 2WBKA 1RUF3 1XSVA 2AEZA 3N9OA 1RMU3 4ZC3A 4CSWA 4A93J 2DT7B 2I74A 5HODA 1H9PA 2FD8A 5GZCA 1BEV2 3T4HB 5F3CA 4GKXA 1A6IA 3ZN6B 5FZBA 4MIMA 5C70A 3N4MA 3QOPA 1RUH2 1LR5A 4W50A 3CF2A 4BJ5C 3OBAA 1MW7A 2AHQA 2HWE2 1J1TA 1C8M2 5JLXA 2B9VA 3AX4A 1SVOA 5T55A 3T2OA 3H3ZA 2ET7A 1FYLA 4G4FA 1LNWA 3TW6A 5L3EA 4QB6A 3AKSA 3PLQA 4O9GA 4WM7C 2ZNYA 2EAKA 5FP9A 2B46X 4IHTA 1OYIA 1JZ8A 3ABTA 5DAXA 2OCEA 4OYUA 4LE3A 1UZCA 4K1ZA 3WZ1A 2WQZC 4FP2A 1WGXA 4FFIA 2DMTA 3K1MA 1X36A 5JI9A 2QQIA 3PMEA 1OLMA 1EAH1 3WXPA 1ZARA 1UMZA 1WKMA 3NEUA 1LDJA 4I30A 3TEYA 4YG0A 3SXWA 4D8MA 1OQDA 4XQDA 2WADA 3RKXA 2K2SA 2CFOA 1AX1A 3RZGA 3BR1A 1COV3 2OPKA 1L7QA 1JHNA 3RZDJ 3ZQQA 3CDIA 3WE2A 2VCAA 1JHJA 3R4UA 1LOFA 4C91A 3DQVC 2RAEA 2D45A 2NNYA 1R7JA 4MGSA 2K0GA 3K48A 1VQMI 4LUMA 5EF6A 5F5AA 4AL9A 1GXPA 4Z8BA 1EV13 2NLRA 4IE0A 2A05A 2BY2A 1Z6TA 4Q5SF 3PHMA 4KN4X 5TSWA 3PQJA 2XF7A 4XAEA 3PIPF 1NLSA 2OUJA 4QU2A 2XH6A 3BALA 1ETKA 3HWJA 2H09A 3GNEA 4BQYA 1UMIA 2CQ7A 3LSEA 1MMDA 3OYJA 1YW8A 2CQKA 1TMF1 1D5VA 3RZHA 2M4GA 5C8WA 2OAZA 4NHMA 3S7IA 4AEKA 1A8MA 1VR3A 2R5ZA 5F04A 4PDWB 5E17F 2A70A 3WTSC 4AU7A 2FCTA 4LHSA 1W04A 2AC1A 4LO4B 1N1TA 5FPBA 5DUVA 4FCYA 4E4SA 1KS4A 3GDBA 4Q5OA 3BI3A 3RYRA 4JDMA 1IQAA 2HQNA 3I64A 2WA3A 1RVF3 1IS6A 1MS9A 1W8NA 4XW3A 4CA9A 2VASA 2Y0IA 4TN7A 4B4RA 3HBZA 3DLAA 3SEZA 1NG7A 4CEYC 4META 2V1UA 1BW6A 4XF4A 2JQ7A 4XFBA 2E33A 2B42B 2Q1FA 3T8RA 3AG1H 1WJAA 4HQMA 1H2MA 1VBE3 1AR72 3DYMA 3P9IA 1G9DA 3BR6A 2COMA 4KIBA 2TCTA 4DIQA 3RIRA 4X0GA 2P81A 2FJ1A 5JOXA 1MPXA 3S2WA 2BEOA 1PZ8A 2WNUC 4PLNA 1G2HA 4DEQA 4M3CE 2QQ8A 3ABKH 2JJ6A 4IE7A 4BDYA 4LKEA 1DUXC 3WDXA 1VBB2 2PJPA 4FSJA 2K9ZA 2MLKA 2WWUA 1WZ2A 1XNCA 4A3XA 3K3NA 1CX4A 4N4NB 2K9MA 3RZLA 2VONA 4UUVA 5KXEA 2VMIA 2DBNA 3I5UA 3V42A 4GB32 1IKPA 2A3WA 2A68F 4BJ0A 5M3MJ 2O8XA 1PZ9A 3GFMA 3KFWX 1W1WE 4EWDA 1FV2A 2Z1DA 4B1RA 2HI3A 5FZIA 2XAJA 3WTVC 1AR62 4RLFA 1VRH1 2VUAA 2MFZA 1DYOA 3WF2A 2BWAA 4WBBA 4B44A 2PLV3 4AVCA 4HK9A 5IVYA 2CRGA 4XTPA 1KU9A 2H8WA 3A7QA 5A3LA 3JBG3 3ZDSA 1G4DA 1H8TC 2ZHKA 1IRGA 4DRVA 4P5OA 3HNMA 2R073 4GULA 2A3XA 1T0FC 1Y0NA 4E27A 1OD3A 3OOUA 3ZRGA 1ZLJA 5A6XA 2L0KA 4UW3A 1JYXA 3VKNA 1UG0A 2BNNA 2QWWA 3R4SA 3ZMSA 3KPHA 5EHDA 5D8AA 4YRVA 1GR3A 5FJHA 3NNGA 1RUI2 2YPJA 4CCDA 3Q9VA 3NWKA 1Q8SA 2EICA 4ZONA 3ACIA 3M3YJ 1ZAOA 2VCCA 2Q8CA 4PDWA 4KGGA 5FKLA 4TYSA 4KIFA 1SMTA 3HN3A 5IVJA 3J7AY 4XEZA 3K4BA 2WZR2 2JD4A 4QPOA 3G1MA 2CQNA 1U5TA 1SC7A 3JUUA 3OYGA 3GFLA 2X1DA 2XJRA 3C18A 1FOD1 2Q2EA 3WD5A 3BC8A 3AKQA 1JN2P 1OPCA 3BPZA 4GMP1 4IERA 2Q1MA 4MG2A 1AYM3 1QJZA 4IO9F 4HA8A 4RB3C 1WRJA 2ZEYA 3AG2H 1YS7A 2RDPA 1FMD2 4GZ9A 2PFBA 3GTLJ 2UYBA 4XUTA 1MD0A 5JXHA 4PDKA 3ZMUA 5FMOL 2D7FA 3R0AA 1I5PA 2P3YA 4RA2A 2CS3A 3RQ0A 1ULYA 3P9CA 3ZPYA 3VBHB 2L9VA 2EAAA 5LWBA 1ST8A 3RZOJ 4BHPA 3USUB 1AXZA 4NO4A 3WU0A 1G3WA 3GLXA 5D2AA 3H0DA 1E3HA 2O8OA 1SEUA 1JKOC 4LO6B 2CYYA 4RGRA 2EVXA 4RR3B 4NIDA 3ZYPA 3BU7A 5T54A 3GZEA 2ZGOA 3U75A 2BNOA 4XKBA 5FZFA 3KZYA 3WEZA 2HYGD 1HV0A 2XHNA 4LBNA 2DFEA 1OCZH 4RSUA 2JVHA 1PZ7A 3IPVA 2OVUA 2P37A 4YM3A 4ESJA 1ZHFA 2RC4A 4M73A 4R4ZA 4Z2WA 1EV7A 1OUXA 1W6MB 1LOBA 4C8DA 2O3FA 3JD71 1K45A 1Q8PA 4JQRA 2KRFA 2R7EB 1OQEA 1H88C 1Z0HA 4Q4X2 2Q0AA 4CPBD 2XB6C 3PDQA 3ZSKA 1NTCA 1UZWA 3PUSA 2RS32 2CUZA 3C8XA 4HNTA 3MO4A 5A32A 2CMPA 3VYSB 5KHIA 1MQTB 1VMHA 4EE2A 1W8TA 1MS1A 2YFZA 2NAZA 1UF2C 2DFHA 3H9JA 4CEWB 4ATEA 2PI0A 5CFDC 1Z21A 4QTRA 4WM7A 2D40A 3AZYA 3M9AA 3KCXA 1CZTA 3SHFA 1U12A 1F5TA 4IKFA 2XKPA 2DOAA 2P34A 1NKGA 5F6LB 1QXJA 1S7OA 3I2FA 3TKYA 4LIVA 1DGLA 3OR2C 3K0LA 1SAXA 4FAGA 4UB8C 2ENRA 1F43A 2A5YB 2GDFA 2RS53 4Q0UA 2A5ZA 1STMA 3EHKA 2Y0OA 2Z99A 3CUQB 4GXOA 2VKEA 1MDMA 2R1BA 4A6EA 3DLLF 5LFAA 2WFF1 3LB9A 3PL8A 5CVVA 2GNMA 1QZEA 1FPN1 4LR4A 2Y6JA 3Q5FA 5KC5A 4AM3A 2WO1A 4ZS2A 3PM1A 2ECBA 2WQ8A 1QQP2 3SEPA 4NIGA 3K4KA 2Y6HA 3THPA 5L9RA 1W6QA 3BTXA 3OGRA 2IAIA 3ZKUA 2ETEA 4Q4W3 1YE9A 4M3DA 5D1IA 4H0EA 3RDIA 2HWD1 2GH8A 2JIJA 3V0AB 1N47A 3IKTA 4YG3A 1K3IA 4YIFA 4QAWA 1ETQA 3ILRA 4QM8A 5FUNA 1GNHA 5FREA 4QPIB 3M3IA 4YFNF 2STTA 1QU3A 3BLYA 2BBYA 2MPFA 1IDYA 4NE9A 2KJBA 4OMDA 1XG1A 1UMHA 5GAEJ 4M6XA 4HVQA 2P1BA 1FIPA 4AVSA 1FOYA 1F9NA 4QDSA 5H9RA 5CLSA 1MACA 4G6QA 4XBLA 1LOCA 1Z3YA 2HGCA 4GAZA 1S5LC 1IHMA 3WU2C 2WYSA 2H6CA 2FQ4A 2P5BA 1D8KA 4L0YB 2LYCA 4LKDA 5FD5A 1E3OC 4XQ4A 2N8GA 2R92J 3HOSA 5JVTA 1IGOA 2WQ4A 1V9U3 1F35A 3KV6A 1ETYA 3PNTA 3UKGA 1VQ4I 4L0PA 3BCWA 1T8IA 1IV8A 2ZS6B 5FYBA 3B5LB 2DVAA 5IUQA 2IXSA 3VHNA 4AQ2A 3LDRA 2HEOA 2QQBA 1Q5OA 2UZKA 3VWBA 4JKMA 3HGGA 2OD5A 4AK3A 4ZDOA 4XN0A 4BJTA 4Q8KA 3HRMA 3KMHA 3RGBA 1S0BA 4DUVA 4QLCU 4CEYA 2R5YB 1OPOA 2VW2A 3OIOA 1XSQA 2WZPP 5CFCC 2DT6A 5HNHA 4CEWA 1EUUA 3O0VA 2Y0SA 2VE8A 2QEXI 4D7TA 3X29B 2E6VA 3UNGC 3CD6I 3UGFA 2O9LA 3JSOA 3I8TA 2ICWG 2WNOA 1G59A 4QX2A 3JU9A 4XM3A 3I71A 1OH3A 1JGSA 2BVBA 4QXCA 3W59A 5DG1A 3JREA 2ZJQF 2YROA 1AOYA 1N3OA 3PMSA 4ISQA 5ANNA 4HSLA 2ZXJA 2OPTA 1KITA 3UKTA 1XTAA 1DFQA 3SH4A 4JGYB 1QJU3 2FX0A 2HVQA 5IP6A 4H55A 2VQLA 4NQWB 3CQOA 3ZFGB 2CV6A 2BW3A 1RUNA 1RB8G 1YEWA 1QJY3 3E6DA 1O3SA 3ONQA 1BA5A 4AF9A 3WW3A 3KWVA 1ND3B 4BMBA 1SPPB 2VBYA 2ZFWA 4CO8A 3ZXKA 3NNLA 3N7LA 2V4JC 5IVEA 1XNBA 3D1NI 1RUC2 2LALA 2YU2A 4NN0A 3HRSA 1IV6A 1AR71 1N1VA 2F2EA 1VZ0A 1N3PA 1GLHA 1CF7B 5F0FA 4M3BA 4C90A 5LEKA 2YUSA 3D3AA 4XMYA 3CCEI 4HVOA 2JA5J 3DU6A 5FY0A 1NA1B 2WNVC 4OZOA 3VSKA 1SFKA 3AFGA 3PVNA 2ZB9A 3AMPA 2WAQA 1YJWI 4GWIA 4JZRA 3F95A 2IRFG 3MUZ1 3U2RA 1MSEC 1DLLA 3ACFA 1SD4A 4BY1J 2XASA 1AYN1 4AXOA 3HOZJ 4AGGA 1QBJA 1MJAA 2FF4A 3BJ6A 2PEXA 5C9AB 1ACCA 2UYAA 4A42A 1W6PB 5I93A 1IF1A 1I50J 4BDZA 4XLCA 2MG4A 1HXS1 1HB2A 2H1KA 5FP8A 3L2VA 5C3RA 2R32A 3I2KA 2EJRA 2C24A 1AA7A 3BTLA 2KLOA 1W7PD 3UKVA 1GSLA 3Q0UA 4X6QB 3VD5A 1UCXA 2MEV3 1QJX3 2BVVA 3QBQA 4QDQA 4RAYA 4Q0QA 3TGNA 2PMHA 2ATFA 3CC2I 3ZFEC 4CDUC 4XFGA 3RRDA 4IVNA 4HLXA 2CNAA 2DOFA 4GA9A 1LVKA 4OI2A 3GBGA 2KR2A 1QMJA 2P2KA 4PJ0C 2TNFA 3ZQCA 2ZKZA 3Q8BA 1TQPA 4DNYA 1ZKGA 1UKGA 1WKYA 4C3IJ 1RINA 2Y69H 2YY1A 5DQ0A 3ULQB 4NQWA 5FR3A 2RHPA 3Q8CA 1CQ9A 3JZVA 2XWJB 5KCMA 5LLQA 1CR7A 3WW4A 2DTRA 1SPPA 4QPGC 2KT0A 2QENA 4CCOA 2PHLA 1PIV1 2E60A 1ZNPA 1QXRA 3I0TA 2OS2A 3OV8A 2XAGA 2FOKA 3NJZA 1QPMA 5DPNA 2OQGA 4GYIA 3DEEA 4HSRA 1AKHA 1DYPA 2Y9ZA 4BLIA 1WJCA 2VJIA 4HZFA 4BIOA 4N4OB 2XWBB 3LSGA 4O65A 5ILVA 4UW6A 4HF1A 1JKRC 2D3RA 3U37A 2WWYA 3CO6C 3DBRB 2HTSA 3CCVI 2BXZA 4BCUA 4L5IA 3D5RC 5CFDA 3HOVJ 4UVBA 4DRRA 1OISA 2K3FA 3O1UA 3U1KA 4OMCA 5FZLA 4FETA 2VBZA 3A0HC 5IYYA 3SZGA 1IPJA 3BGAA 2YU1A 4BIFA 1UHSA 2Q8EA 5EV7A 1WWXA 2XVKA 2VTFA 1W6PA 4JX6A 2EFWA 2KISA 1ZQ3P 4UT5A 3AJYA 1KXGA 3GTGJ 3HJRA 1XNKA 2FD5A 3FFQA 3V7RA 2LLKA 3MHZA 2Y0MA 2LREA 3MWMA 1I3HA 1VBD1 5FZHA 4OAZA 2RS31 2FDJA 5L36A 1H89C 3OGJA 3MZYA 4YWAA 2UURA 3GTQJ 3VZNA 5EIYB 5IT9K 2C1FA 3RCOA 1C8NA 1X1CA 2O1QA 1EAH3 3HMYA 5K5RA 1IGNA 1KFUL 4P9FA 1PGL2 4XJZA 2KP6A 2W46A 2XAQA 3FHIB 3HNYM 3SXYA 1ETXA 3SQNA 4BXSV 1GQPA 3DN7A 2EIEA 5FUPA 3L2RA 2OPWA 3MMYB 3POBA 4M01A 3E5QA 3FBIB 5K0UC 1P8JA 5G05L 2WS92 1MNMC 4FPEA 3RI4A 1FTZA 1Y9QA 3H5NA 5EQUA 2IA2A 3TEWA 2MD5A 1YCIA 3CP8A 4ZTFA 3E1F1 1C5HA 1ZA4A 2W7NA 4V2WA 4MNUA 4A44A 4N9IA 4GQ7A 4BU2A 3QPHA 1LULA 5K7PA 1XU2A 3D5SC 4BQAA 1PVXA 2B45X 1PO12 2P0WA 1RESA 4ZYDA 1TMF3 2VY0A 4DOZA 1YI9A 1OFNA 4N0BA 1YRNA 3WW1A 3WQ7A 3IDCB 5HNFA 3N36A 3T4VA 1IG7A 2EFNA 1HW2A 5E8GA 1EF4A 3HG9A 1RUG1 3BN6A 1PGW1 4BE1A 4ENMA 1A04A 2QBYA 2XLAA 4WM8B 1AZDA 3N9LA 2RGVA 4ITCA 1Q3EA 4XPVA 2AS5F 3FHAA 1BLZA 2L7FP 4M9SA 1WD4A 2G9GA 3QACA 3ASOH 1AX0A 4MQVA 2A6YA 2UXNA 2NMNA 3NMBA 4RFT0 4DXSA 5F9TA 1WMXA 5GLVA 5AC91 3GXOA 2R30A 1ZH5A 1MZBA 5IK8A 4LLLA 1TC3C 3NAPC 2C9KA 2HWC1 1PK6C 1H2NA 3DP7A 3BTYA 1UY0A 3WINE 1RRJA 5GTHC 2IJLA 2G19A 2QQNA 1Z7LA 3MCZA 5IAXA 4ARXA 1F9KA 4K8RB 5IP9J 4DS0A 1XNAA 4B1LA 4LO8A 2DXIA 1DDNA 2YS9A 4M3CA 2GP5A 2EXKA 3ZR6A 1VB2A 4M9ZA 2XLGA 3LFKA 2HWF1 4MXVA 4YSFA 3RSNA 2V5YA 2YC0A 5BOXA 4MFDA 2FDKA 1FMWA 4ZDLA 5KXDA 4WXDA 3VLBB 2R3SA 1QZYA 1IRFA 3ILFA 1VBA2 5FKKA 1E2XA 1FIAA 4R9BA 5BXXA 2PMWB 4JCKA 4YFZA 5FTTC 3VBRB 2WNVA 1PVC2 5F0HA 4XE9A 5L19A 2RMU2 4LG0A 3ZO0B 1R1A2 1VRH3 2GC3A 3DCQA 3DL3A 4FPOB 2L7ZA 2R062 3FBNB 3WTWC 1MVQA 4K1YA 1YWKA 2JWPA 3ALQA 3LSJA 4JYKA 1RUF2 3AMMA 1UZ0A 2OYZA 4Y7NJ 4MXWB 1OCOH 3U0ZA 2YPDA 1PO21 4UVAA 1PMHX 5BV6A 5M5WJ 2HOEA 3OB8A 1RMU2 5LHIA 2L9NA 1ZG1A 2GWRA 4K20A 3PURA 5JAXA 4NHJA 4PGGA 1STZA 1JTXA 2XPJA 1FOXA 3FLPA 1F4AA 4P9XA 3F8FA 5EJCA 2UU8A 5D5WB 2W84A 5DV5A 1XPWA 1ERDA 1XSXA 3J7LA 2VKHA 3WQBA 2RDQA 5BYNA 1JU3A 2JKBA 2VW0A 1AL0G 3ZSJA 2HOAA 4ASNA 5E3OA 2E2HJ 3JB8A 1KZHA 4BEHA 1TNTA 1OC1A 1Z67A 1WLTA 1DLCA 3Q8AA 3UK9A 4AI9A 5DDGA 4Y1ZA 2QQOA 2WKKA 1YXWA 1UFMA 1DU3D 3VYUB 3ZFEA 1FOD3 3RKWA 1VPHA 2R7ZJ 1REPC 2IS4A 4ZU5A 5EEAA 5ILUA 2V1DA 3HOYJ 3SZPA 5FO7B 4IGOA 2VBXA 1W5TA 3AM2A 5ICFA 5LASA 2ZAHA 3G71I 2P3KA 5C8CB 3KV5A 1YQCA 3CUQC 4PLMA 1G8WA 1V6IA 2KRHA