3N4MA

E. coli rna polymerase alpha subunit c-terminal domain in complex with cap and dna
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
203
structure length
203
Chain Sequence
b'TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Combined structural model for a transcription activation assembly
rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 63
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3n4mA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3n4mA01
3GXOA 3IDCB 1B1BA 2XGXA 2FF4A 3P9IA 1MKMA 2HGCA 2Q4SA 1KQ8A 1DZTA 4LEJA 3RKWA 3BZ6A 4UVCA 1TQ5A 4UVAA 1BI2A 2STTA 1FYKA 4WXCA 1HXDA 3IRQA 2WFPA 3ES4A 1ODDA 1USTA 3E5UA 5CVUA 5KBFA 1LDKB 1SMTA 3TQNA 4MX3A 2EV6A 2QQ9A 2EV5A 1P4WA 4ENMA 3R0JA 3ROUA 5IT3A 2ZNZA 3OF1A 3J81K 4E2SA 3O14A 1I5ZA 2VBXA 2XAJA 1QBJA 1CF7A 2MNGA 4OINF 2XAFA 1ZZ6A 1IZ1A 4NVPA 4I0AA 4L9NA 3TOBA 1ON2A 3K2ZA 1JHHA 3M8FA 1NXMA 4JQFA 1U12A 3HTSB 2XLFA 4IVNA 1W5TA 2EB7A 3RNSA 3BP8A 1CAUA 3AAFA 3RKYA 1IRFA 4ZYHA 4KYWA 4L18B 1IPJA 3KGZA 3EO6A 2W85A 3LQRA 5EEHA 1RC6A 2QM3A 3E97A 2J5OA 3LA2A 5L3GA 2PAEA 3T8RA 3FHIB 3ETQA 4Q0QA 3PQJA 2JPBA 3HRSA 1ZLJA 3KP4A 2UZKA 2M30A 2HTSA 1QGPA 4IJAA 2XL7A 1CAWA 1ZARA 5D8KB 4L0ZB 3T5XA 2QNKA 4J1WA 3MAJA 3BOQA 4BHBA 3ISPA 4N9IA 2RVCA 5LRRA 3WTTC 1GHCA 4UBHA 1W7PD 3FXRA 1YUDA 3FWEA 4EMSA 2E7WA 3NL1A 4NB5A 2HS5A 4HF0A 5E1XA 1FPQA 5HDKA 3BCWA 3KZZA 5TJJA 1FP1D 2VOOA 1TQPA 2QCSB 4FAHA 3C7JA 5E1ZB 3CO2A 2NRAC 3KP3A 2QBYB 4WK8F 3CDHA 3RKXA 1FBSA 3V4GA 3IC7A 4JTOA 3N97A 2R7DA 1XDUA 1E2XA 4LLOA 1J3QA 2CQKA 2BGCA 1FI2A 1S8NA 4EWDA 3GX4X 3OV8A 3ZMSA 2CYYA 4Y17A 3I64A 2O3FA 5J8FA 3DPLC 4FT8A 3HYIA 2EWNA 4WF2A 2MC3A 5FFZA 3ERED 2D40A 5I0UA 4TV7A 5D5UB 4O9GA 1RL3A 2XIGA 2IXLA 4PIZA 5LHGA 1C0WA 3CUQC 1Q1HA 4M9ZA 1KU9A 3JW4A 5D5WB 2ESNA 3GZ5A 3SCFA 4KIBA 4XRFA 1IN5A 4P96A 1ZZ8A 1HKQA 3HQXA 1O5UA 2GC3A 4IEWA 2FMYA 1EPZA 3E6BA 4ZZDA 4PIXA 4UBGA 1SD6A 2JZYA 2Q2EA 3VEPA 4KIGA 5CJ9A 2XROA 4G7HF 3U2RA 3HSEA 3ZMUA 4YFNF 3QP5A 2E1CA 4MTDA 5DUKA 4HW0A 2ESHA 1XD7A 2GA2A 1R5GA 4MGYE 5KHHA 3ML6A 1CAWB 2DBBA 3WTUC 5BUVA 3SFZA 4HSLA 2MD5A 2XAQA 1S7AA 3HSRA 4RAYA 3RPQA 1LVAA 3ZP5A 4O9EA 4XF0A 3MZYA 5I0SA 3MEXA 3EHKA 1J75A 2UXXA 2WC2A 3RJPA 2ET1A 5L3CA 4GCVA 1W4MA 1PDNC 4QXKA 2CW0F 5KHGA 1QZZA 4A6DA 3I53A 4HVQA 2GC1A 1SD4A 1REPC 2B8MA 3MPBA 1O3RA 2D1HA 2FOKA 1EH6A 1JHFA 2A07F 3USSA 2UY9A 4CZZA 1V3FA 1X82A 3GBFA 5K5QA 2OAZA 2IA2A 1HBXG 5D4RA 4PDKA 4LA3A 1BC7C 2VBYA 5FB2A 4IRGA 1UFMA 4ESFA 4RB0A 4EJOA 4ZU7A 3TO7A 4EJWA 3HIFA 1W7PB 4ONUA 4X6QB 4KNYA 5I0RA 4PGHA 2IVMA 4OIQF 4UUVA 4UXAA 4KA4A 2IA0A 3NQOA 4U88A 5E20A 4HF2A 5FPXA 2EFWA 2VC1A 2F5FA 3O2PE 4MNUA 1BI1A 5HI0A 2DPDA 4U0YA 3I71A 5L3FA 1TNTA 4Q0PA 1S3JA 1FT9A 4HSJA 1BI0A 3JTGA 3LOIA 1KU7A 4A5MA 1U6GA 1FOKA 5A2QZ 2OZUA 4XFBA 3GFIA 5EFUA 4MHGA 1O3SA 4UVBA 3MDPA 4IERA 3KP5A 1KU3A 2BBYA 5JSRA 2P5VA 2ZMEB 3K1NA 3HOTA 1U3EM 4LD5A 3FX3A 4L5IA 1IXRC 2F5CA 5JR7B 3H92A 1ZZBA 3SCHA 2BE5F 4G8XA 1D8JA 5J6XA 4CXFA 1YW7A 2E7XA 1U2WA 1XSVA 2VT3A 4EROA 4LK0F 4AVCA 4IF4A 1RUOA 3WW4A 2F5DA 4LLGF 2P6SA 3Q5FA 1YW8A 3CL1A 2PAKA 4RGUA 3ZMTA 5C8WA 2DW4A 4IEQA 5HVQC 5HDGA 2Z99A 4HV6A 2C0ZA 1B6AA 4R52A 1L0OC 1TQMA 2NAZA 2QWWA 5I0TA 3H3UA 1J2XA 4KMUX 3TO9A 3VODA 2IJLA 5BPDA 4UV9A 3NRVA 1QNTA 4YFKF 1FP2A 1PM7A 3KZYA 2D1VA 3CUQA 3KCCA 1VTNC 5CYVA 4ENNA 4U0WA 2KXLA 1LKNA 1YG2A 1ZHFA 1T38A 4K2EA 5BOXA 2JT1A 1LR5A 4CDGA 5LGNA 4XFHA 1YLLA 1QPMA 2DFIA 3LAJA 1V70A 2QVOA 4XSXF 1BBYA 5LEJA 4HBNA 2K86A 4A0ZA 3L2CA 4KT5C 5FO5A 4QMAA 1I6XA 4G7ZF 4OIPF 3GWZA 5EEGA 3TNQA 3PFIA 4WVZA 3SHFA 1XCBA 4ZYGA 5BPXA 1SQ4A 5FFXA 2A68F 1ZYRF 2HTJA 1OD5A 5ICEA 3ABUA 2A5YB 3JSOA 1J3RA 2D45A 4EJUA 4M74A 2P7CB 4P55A 3KEOA 1LEAA 3TO6A 3KETA 2M45A 2WWYA 3M7GA 4FAGA 2OZJA 2HWVA 3CJNA 2QJVA 2VQAA 4CICA 4EWAA 2Z9OA 3QPHA 3S7EA 4Q48A 4EVIA 1DGRA 3EYIA 2HYGD 2M87A 2VOPA 1T2KA 2DAOA 3I54A 2VBZA 3I59B 4GYIA 2VE8A 2DK8A 2Y48A 3IKTA 3HT2A 4HX7A 1DP7P 4P9GA 3K0LA 3F72A 1XGOA 3E5XA 1NYWA 5LBQA 3O6BB 2GH2A 4RB1A 2Q8KA 3L2HA 2LSOA 1TTYA 1TNSA 3COAC 3I58A 3TNPB 2IXIA 1DGWA 1U8RA 4M6YA 2KIFA 2KJCA 3CUQB 3GLXA 4HQMA 3TOAA 4JVAA 1BIBA 1HSTA 3WTYC 5FLIA 4Z2YA 5F64A 4LA2A 1STZA 1P4XA 2EFQA 2BNNA 1CAVA 1XGNA 4XF3A 2FQ3A 5CVRA 1O4TA 5BV6A 2M5WA 1RTVA 1ZX5A 2QDRA 1G3WA 3B02A 3KLNA 2Z33A 3QU6A 3BJAA 3F8NA 4AVAA 2E1NA 3LFKA 5IT9K 2ELHA 3NVCA 4HV5A 3NSTA 2VE9A 2L54A 1XGMA 4KWJA 3IBMA 2GAUA 5E8GA 4HYEA 4KICA 3HT1A 4Z07A 5FD6A 1SAXA 1WSUA 5D1IA 2XHKA 2VC0A 4M9SA 3M9AA 3F23A 5JVTA 3LAGA 3JAMK 1FBUA 4U0VA 3OTFA 2DCTA 4YG2F 1PMIA 2GXGA 5HLGA 2XASA 3LSTA 3CF6E 3ZMZA 2L4MA 4GO1A 2P8TA 4QLCU 1KQ0A 1LB2A 1IN7A 5BY5A 2I45A 3F8MA 3JTHA 1IXSB 4HF1A 1X3UA 2DI3A 3L9FA 4ASNA 4CHUA 1ZG5A 2FA5A 2OA4A 5DCFA 1FY7A 5FCCA 2KKOA 4EGZA 1NE6A 1CGPA 4I09A 1U5TC 4I01A 1BIAA 1Y0UA 1YLFA 4D7SA 3GYHX 4HX8A 3FJSA 1ZGAA 5BXXA 2PTMA 3EQLF 4M9XA 4AWXB 4RD7A 1ZG3A 1Z6TA 1MJBA 1R00A 3C1DA 3E3VA 3RTRA 3J80K 1BOAA 5DDGA 4S05A 1CAVB 1RGSA 2ISYA 2OYZA 4U7DA 1QXJA 1T98A 4G7OF 3F8CA 5J3UA 2QYOA 4L5JA 2HYFA 2D5HA 3WW1A 2XV4S 3Q9VA 1LEBA 4AIKA 1HKTA 5JSOA 1IRGA 2PI0A 1RZ4A 3RYKA 3KEQA 4MEYF 2LKPA 1GQHA 2Q1ZB 1MDMA 1K78A 2KRFA 4BAYA 4NHJA 3BPXA 1YS6A 1YFYA 2IXKA 3E6DA 3V7CA 4Q0SA 2K0GA 1IPKA 1PP8F 3VFZA 4R1HA 3E6MA 4EJTA 3S7IA 5JCTA 4BNCA 2JPCA 4IEPA 6PAXA 1O57A 3KMHA 2DLLA 2DK5A 1LRHA 3GO5A 2BYVE 5ED4A 2MH9A 4OMZA 4EJVA 4XF9A 1ZGJA 3BJ6A 4IEVA 3TGNA 4HOBA 4I0BA 4LLNA 4KU8A 2FRHA 3GW2A 1G4DA 5K8SA 1ZRFA 2D93A 4EQQA 2IXCA 2ET7A 3D0SA 1KU2A 1QWRA 2Y0OA 1R1TA 2J5PA 4QGMA 3WW3A 1ONVA 4MGRA 1ZVFA 1XDSA 3HSFA 5BMZA 4AVBA 1CF7B 4FX4A 3PNAA 1FX7A 1WRJA 1XCVA 2JTVA 2N7GA 2FMLA 5L3DA 2IW5A 3R6SA 4XETA 5D8LB 2ZBKA 5JR3A 5A2QK 2OZ6A 1E17A 2FBIA 4BYYA 1EH8A 2ZXJA 4I2OA 4HLYA 1CAUB 1ZREA 4CGZA 5JAXA 4N9HA 3EUHA 3ELNA 5LRSA 5L3EA 1Q43A 2TDXA 3BROA 3QPTA 4LB6B 1YHFA 3TKYA 2PA7A 3IIAA 4D7TA 2V1UA 1R1VA 2CFXA 4G9YA 2OU2A 4RGRA 2ZJ2A 3SXYA 4TLFA 2DPUA 5DD4A 4E2GA 1MDMB 1K78B 1H1IA 4WWCA 2FEZA 3K69A 5HS9A 3RZZA 2GC0A 3GFLA 1ZH5A 5CVJA 4CYDA 3FM3A 1ZLKA 1XGSA 3W6KB 5BQTA 4PIYA 2GQQA 4BQAA 1ZZ7A 2DTRA 3MYXA 4HBLA 1FXZA 4XFAA 1EYBA 2HEOA 3H9AA 4HAMA 3H7YA 4HVRA 3UKVA 5HS8A 1YS7A 4QGNA 5ICCA 1U5TA 2KIMA 1BC8C 2XKPA 2Y0MA 3D82A 3VHRA 4RB2C 4A6EA 2EA2A 1G3SA 4QM9A 2YU3A 2YX7A 2UXNA 4ON0A 4Q5SF 1OYIA 1TQIA 3VB2A 4ESBA 3ECHA 3V7SA 1BM9A 4AXOA 4ZYDA 4J1XA 3BWGA 2P5KA 2QQBA 4CO8A 4YNIA 4YIFA 3U0ZA 2O61A 3TDUC 3F6VA 3FZVA 1YFHA 2VONA 2ZCWA 5ICFA 3LZZA 4KN4X 4XSZF 4EM0B 4R79A 3R60A 1WGPA 4QX5A 1F1ZA 2L01A 1ZRCA 4AIHA 2DQLA 2NYXA 4MGZE 4MGIE 1J0RA 4XFIA 1O7FA 2EV0A 3WODF 4H7LA 1HW5A 3OD0A 4Q4ZF 1Z6RA 2F2EA 2L02A 5E18F 4LG0A 4ESJA 2IXJA 5LGUA 4AD9A 3M8EA 2MA3A 4BHCA 2H09A 3GEZA 2EJRA 4KL1A 2Q0OA 5D4SA 4IEXA 4QGLA 2PAMA 4XF4A 4FBFA 5ILUA 3HHGA 2RV8A 1FNNA 5BS6A 2HQRA 3I0TA 2RKHA 2G7UA 2DU9A 4DINB 3DF8A 1GQGA 2L4AA 5LEKA 4IETA 3SQNA 2H6CA 2MLGA 3PQKA 2IRFG 3CUOA 2HDCA 3CTAA 1B9NA 2Z69A 3LA3A 3U10A 3QAHA 3KP6A 1NHAA 1QQIA 2LF8A 2KIUA 1YFXA 4ENJA 1YFUA 2QZ8A 1JXSA 1D3YA 5BPIA 1MD0A 2FE3A 1OR7A 1PP7U 3DN7A 3NEUA 5E1RA 2CAVA 3WW2A 1U5TB 4IHTA 4M6XA 1VP6A 4G6DA 2K02A 1QY4A 1R36A 3FHZA 2LDUA 3WG9A 2PHDA 2E9QA 5ICGA 1O7LA 1GXPA 2HOEA 5KHIA 1LDJA 3BY6A 1UW8A 1J58A 2P6TA 1J1LA 4JTNA 3QU3A 1OPCA 3RIRA 3MZHA 3DL3A 2FNPA 2XAHA 3O3KA 1ZRRA 4EWEA 3PLQA 4RS8A 4YIIA 5CADA 3J7AO 2V9VA 4ORFA 2FNAA 3C3VA 1X8MA 2EFPA 1SFUA 1WLTA 4L0YB 4H0EA 3H3ZA 4AIJA 1F9NA 1ZZCA 2A6HF 1BJAA 2XAGA 2DO7A 2MHFA 3T0YA 1P2FA 3IDBB 4S04A 1UHWA 4KMFA 5I93A 5J8CA 3G7DA 2A61A 3F8BA 2MPFA 3DEUA 3S0MA 4N0BA 1IN4A 3H50A 3BJOA 1G3YA 1XMKA 1DUXC 1LNWA 4JBAA 1BI3A 2PJPA 3HRUA 1LQ1A 1QXRA 2FBKA 1ON1A 1MJAA 2O6GE 3RI4A 2UWMA 3WTSC 1VJ2A 3H7JA 2OPKA 4M72A 4F7ZA 2ATFA 1XSDA 4MH0E 1U78A 3FFQA 2GZWA 2O0YA 1TBXA 1ZAOA 5I91A 4DNCA 3WU1B 2Q0AA 1UCRA 4IEOA 4RGXA 2XLAA 3KFWX 4AVPA 4MUVA 4OOIA 2W25A 1K6OA 2C6YA 5K5RA 3C18A 3EDPA 2F5EA 4B09A 2RDPA 4XBFA 3S2WA 4IEUA 1XRUA 1EH7A 1Z91A 4AQ6A 4EGYA 3ZMVA 1I1GA 2KJBA 4ZYEA 4L11A 4P9UA 4LB5A 2W84A 5HS7A 5JI6A 2W24A 1I1SA 3WTXC 2UYBA 3OOPA 4U7BA 2ZO4A 2K7LA 4LJZF 2ZKLA 4BH9A 2XLGA 2VODA 2EAAA 3F3XA 2EFOA 1J3PA 1J9IA 5KVRA 2STWA 1IW7F 5FLXZ 4JV4A 2NNNA 4MZUA 1P92A 2PLYA 2PMHA 1OYWA 1SEFA 3TDZC 1R7JA 1BN5A 4NQWA 2PMUA 2EFNA 3FF5A 4PCQA 1SD7A 1W5SA 4GGGA 3R4KA 2PQ8A 2UY8A 4KWKA 3P9CA 1KQ9A 4WX9A 2O03A 5E8IA 2BNMA 4LLLA 3F21A 4E2QA 3WE2A 1UD1A 5KHJA 1DPUA 4A5NA 2DQRA 1IN6A 1ZN2A 2VN2A 2ZNYA 4LMYA 3KLOA 1DPRA 2QLZA 2A69F 3EQEA 4MV2A 2QQAA 1IF1A 3K1MA 1RNLA 4OIRF 3I5UA 3F22A 4A12A 3ES1A 5E1WA 5L3BA 1WQ2A 3U9GA 4MQVA 5FGMA 2ZKZA 2EK5A 3V8LA 4A0YA 4HDUA 2XKOA 4IPAA 4IESA 3M70A 1EV7A 4WCGA 3K9TA 2K4BA 2QBYA 4BXUA 1T0FA 2JRTA 4LTAA 4L9VA 4YSFA 1P6RA 1Z1DA 5LGTA 1NZCA 4JK1X 2GC2A 4RAZA 2GU9A 4XFGA 4O3MA 3RYPA 1K79A 4HLTA 3L00A 3PVBB 3JSPA 4HMZA 1UCXA 3B73A 3L7WA 4ZH4F 3ZN0A 1HW1A 2OBPA 3BPVA 3DP7A 3G3ZA 1UIJA 5ILVA 5TRDA 4ETSA 5J48A 4FHTA 5DCMA 1H9TA 4EM2A 4IEZA 1X8EA 3ULQB 5FLJA 4QWQA 1EP0A 5JSPA 2Z2SB 1HKSA 2ISZA 2D2WA 5FPZA 4UV8A 2A6EF 3F8FA 3WTZA 2UYAA 3RYRA 5E17F 3DPTA 2OA2A 4P5OA 5AONA 4XLPF 5I8SA 5DD8A 3G73A 1Q3EA 3ACLA 5ERIA 2HKXA 1SD5A 4M71A 3SZTA 4I3PA 2DT5A 4YYOA 5AVPA 2LNBA 5JHUA 2O8XA 2HR3A 2R7FA 5F1RA 4YRDA 2YX4A 4Y13A 3GVAA 3WGGA 3L09A 3BDDA 3GF2A 4LULA 2GWRA 2EA4A 1MGTA 1XB4A 2B9UA 5IT9Z 2Q30A 4OLLA 3FE5A 2HKOA 2BNOA 2VPVA 4KIFA 1PUEE 2FQPA 3CJXA 2RNJA 1H0MA 4OU0A 5I8TA 4PJYA 4IHSA 5KK1A 4O5VA 3ELKA 1Y9QA 4D0PA 3JAMZ 4XEZA 5CU1A 4QM8A 4Y15A 1G6NA 4XFCA 5D6EA 3ZMDA 1B9MA 1QO0D 1FBQA 2XVCA 4XFFA 1LDDA 2V1DA 1FYMA 1AWCA 5H6RA 2IPQX 3EJKA 4HVOA 4KDPA 1MZBA 1OMIA 1F5TA 4HZFA 4G6QA 4XF1A 4YFXF 4HN0A 5EZWA 2PG4A 4HN1A 1Z05A 2P4WA 3DFGA 4GYGA 2VXZA 3MFKA 4HLXA 1UHMA 1DZRA 1W7PA 2FBHA 3SMHA 4HDVA 5DCMB 4KUMA 2EA7A 3C3WA 4I98B 3V8KA 3FZ3A 3ABTA 5CLSA 4PGGA 1CX4A 3K1PA 2HJIA 3J81Z 2P7VB 3SZPA 4OIOF 1XSXA 4BIFA 3BPZA 1EY2A 1YQAA 2K4JA 4Q47A 3E6CC 3J80Z 3H8UA 2R3SA 3WTVC 3IWZA 4WZCA 5JFRA 1FSHA 5ILSA 2OQGA 4B29A 2L3DA 4O6JA 3CLOA 1VR3A 4LUMA 1IXCA 5HLIA 3W6JB 2ZMEA 2IXHA 1ULYA 2COMA 2G7HA 3GUDA 1LJ9A 4HX4A 1UPIA 4OFGA 3VOEA 1S6LA 5LHIA 3ZDSA 1R1UA 2ADUA 4RGSA 1TW3A 3HUGA 3BALA 3OCPA 2X4HA 1JGSA 2HQNA 3FM5A 2GIVA 4X6RB 1R5HA 3REOA 2NNYA 3H1WA 3Q9SA 4LK1F 5CVIA 4B8XA 3IL2A 4RB3C 2D5FA 1G3TA 1XN7A 5E16A 1SFNA 3FMRA 5C6CA 1GVJA 1S29A 3EBRA 3SXWA 1Z9CA 3IWFA 2B5HA 1J7KA 1Z7UA 3T1BA 1T39A 3RDIA 5AIQA 4ZU4A 1R22A 1S7OA 4MTEA 3ZQ7A 2CO5A 1SMYF 1ZRDA 3IKVA 1WWXA 4LGWA 5DUIA 1O5LA 1H9GA 1FYLA 2RC4A 2MH2A 4HQEA 2IC1A 1KGSA 2V1XA 1JE8A 3R61A 2IP2A 2GA1A 4BHPA 1T6SA 2YR2A 2V79A 4MEXF 4IRHA 2YSRA 1OYYA 3WGIA 1K7AA 4PZJA 4UNOA 3DXJF 3EETA 2CAUA 3HTUA 2PN6A 4F8AA 1YIOA 4XLNF 4HA8A 3IRRA 2P17A 4P9FA 1B4AA 2QVSB 5LHHA 1MJ9A 1J59A 4KN7X 4KFCA 5FLHA 1R23A 3P9KA 4UHTA 2OD5A 3ZPLA 1WKMA 1IN8A 3I4PA 3M3IA 1KYZA 1D5VA 3WGHA 1O3QA 3LWCA 4META 2XRNA 2Z3YA 3HHHA 4G94A 3V8JA 3MQ0A 4IRIA 3M1EA 2G9WA 2CGPA 5FQ0A 4WXHA 2H0VA 1D8KA 3GFJA 3LWFA 1AOYA 2BV6A 1RI7A 2X0LA 5H6QA 5HDNA 4E70A 2PHLA 1XE8A 2XL9A 3I59A 3WU0A 2K27A 1UB9A 1ZNPA 3R0AA 2PFWA 3FMSA 3NJZA 2Z5UA 3LAPA 2PFBA 3HRMA 5D5VB 1YYVA 2HFHA 4LFUA 1CAXA 5D5XB 2HZTA 4IXAA 4Z82A 4AQ2A 3SCGA 4GXOA 3MWMA 5DEQA 1RIOH 2CSOA 1YO5C 3OGJA 3CO6C 3V7RA 3D0JA 3KP7A 5FLXK 4DQ2A 4EV0A 4Q0VA 3NW4A 2PEXA 2WV0A 2RGVA 1JUHA 1HSJA 3FXQA 3CLPA 2IA1A 1YW9A 2PQQA 4K8FA 1HQCA 3WE3A 1FC3A 2F4PA 3DV8A 5I8YA 2OQRA 1B59A 1SFXA 3HRTA 2V6CA 2Y75A 5D6FA 4ZZLA 4LG0B 1USSA 1L3JA 3ST7A 2P5LC 2K9ZA 1YTYA 1XE7A 2CG4A 3H1MA 1HW2A 4WXDA 3RPUA 1GXQA 2CWEA 2LF7A 4UXNA 3ZN1A 3GYDA 2VBWA 1SFEA 2FSWA 3JZVA 1YWKA 2MLKA 3H1YA 2H94A 3D5LA 2XUBA 2VT2A 1KYWA 5F6FA 4EM1A 5T3NA 5KHKA 2H27A 2ETHA 2ETEA 2H6BA 1X7NA 3QRFF 2ACJA 2W57A 2FU4A 2QUFA 5K1YA 4M73A 3U1DA 3GZ6A 3QP6A 3UKNA 4L9JA 2NS0A 3F6OA 4ZU5A 3MCZA 5FQ0B 2O1QA 1TLHB 2RQPA 4KU7A 2V09A 3IHUA 5FD5A 1FZPB 1QZYA 5K5OA 3I7DA 3HOSA 2RN7A 3EYYA 4MQ9F 4KWLA 3SHRA 3NKTA 5FDBA 3T8TA 2EVXA 1WI9A 3E5QA 3KP2A 3CEWA 1Q5OA 4Q0UA 3GFMA 2M1BA 1CAXB 4I7HA 4R8HA 2B0LA 5CVVA 1OI6A 1L3LA 5LLQA 1I27A 1FLIA 1P4AA 4IEYA 1ZG1A 4L9TA 2PBIA 5H20A 5HOOA 2YPRA 2QENA 3LA7A 2BEOA 5DYMA 3WTWC 1R58A 1XMAA 3QOPA 1ZZ9A 1J5YA 1FSEA 2A3SA 3DQVC 4Q29A 2GXBA 5DV5A 2PYTA 1H1MA 3ECOA 4L2NA 3DKWA 4GULA 1KA8A 1YFWA 1A04A 2WTEA 3N4MA 3KGLA 2O8QA 3BB6A 2AXLA 2AS5F 1FWZA 1F4KA 3FXUA 3FMQA 1Y3TA 3QACA 3P7NA 4YARA 1RUNA 4ENKA 4LUKA 2JSCA 2MBFA 3BU7A 1IUYA 2ZFWA 2M8EA 4A2UA 1OKRA 3KSCA 5HLHA 2VECA 4MGKE 1O3TA 5J7MA 1OFNA 2CV6A 2FXAA 1V4RA 4A0XA 3U11A 5AIPA 3CO7C 1UIKA 4FX0A 4OMYA 3LQQA 1TW2A 3KE2A 1NE4A 4I02A 3UKTA 1IAWA 4WBBA 1WA4A 2IT0A 1DDNA
chains in the Genus database with same CATH superfamily
5HNFA 4AHWA 1B1BA 1MKMA 2HGCA 3JRBA 2PHUA 3WQ1A 2LFBA 3NMBA 4CPBA 5C3PA 1JGGA 3ZR8X 1AL23 1LHWA 4WXCA 1FMD1 3IMNA 5C4WA 3E5UA 1LDKB 2A6ZA 1WZXA 3FHAA 4NOTA 3BTLA 2YXSA 1PNGA 4KT6A 2ZNZA 4P9IA 5IVYA 4A6OA 4E2SA 3EMRA 3VD4A 1I5ZA 3KQ4B 2VBXA 4HANA 3WP4A 3A02A 2XAFA 4CEYB 4I0AA 4L9NA 3TOBA 2BRTA 3M8FA 3WNOA 1BL0A 1M4WA 3U1XA 1WW5A 4E7JA 2ADEA 3M4FA 3AAFA 1KS4A 4RQPA 4R9CA 4ZYHA 5GPAA 4KYWA 4L18B 1IPJA 5D2AA 5E88A 5ABJB 3I3QA 1F4AA 1RC6A 3E97A 4MSVA 3VBFB 2LVSA 2XRLA 3FHIB 3ETQA 4Q0QA 3PQJA 3HNYM 1ZLJA 1IJWC 1O4XA 3KP4A 1NG0A 1LHVA 3I3MA 3AP7A 3CHXA 1GLHA 4L0ZB 4DW6A 2QNKA 3J4UH 4F92B 4FPLA 4HPKA 3ISPA 5LRRA 2R0QC 5A3OA 1GHCA 4UBHA 4NIDA 4CDWA 1LODA 4NJ4A 1W7PD 2F48A 3FXRA 1DQ0A 3PL0A 2LALA 4NB5A 2HS5A 2E26A 4HF0A 1JUPA 4EJRA 2A6WA 5TJJA 5JUVA 5CG8A 1S0IA 2JUCA 3ZIXA 5BNNB 1TQPA 4FISA 4ATFA 2E2IJ 5IVBA 2BTVC 5IATA 2WL1A 2WABA 3EYPA 1HXS3 2HWB1 3LIGA 2DJIA 5GZEA 3IC7A 4GH4A 4JTOA 3OSFA 1J3QA 2DA4A 4ZDOA 2JIGA 1S8NA 4A3EJ 4O61A 3POEA 4ATEA 1NY72 4Y17A 3LEMA 4E7IA 1RUF2 1WCSA 2W7NA 3FUOA 1B8IA 3QBQA 2MC3A 3I56I 2LG4A 4XABA 4Q4Y3 3B7MA 2XIGA 3AG2H 2IXLA 3NNMA 4M9ZA 3RZMA 2QQKA 4XE9A 5FOJB 3D6EA 4ZXKA 3ZXGA 1WCKA 4A44A 2ESNA 1IV6A 4MGSA 4XRFA 3AJYA 1HKQA 2R062 3HKZA 3HQXA 4UYBA 1EPZA 4UBGA 2JVGA 4QX3A 1IKQA 1COV2 5HCAA 3N3HA 5CNAA 4G7HF 4AVZA 4YGDA 4YFNF 1H8AC 2JVHA 3VBRA 4E4HA 5SV8A 2GA2A 1RUG2 3ML6A 2Y6FA 3NARA 3T3YA 3ZFFB 1UPSA 3WTUC 4Y5SA 1RUH3 3CKHA 3DECA 4XACA 4IUGA 3RFRA 2ZHLA 2R041 3T08A 3VDBA 3JBG3 2LKXA 3QYBA 5I0SA 3MEXA 5F6LB 3NNGA 3RJPA 1TG7A 4E4DX 4ABZA 3LD8A 2EIMH 2R7VA 3I2FA 5TGTA 3ZYGA 3WLUA 3CCEI 5F8PA 3JXSA 2B39A 1O3RA 1AR91 2XSDC 3EXUA 3A0BC 2CS3A 2A07F 1QJFA 2LRPA 5ANNA 1ASJ2 1CQ9A 9ANTA 5D4RA 1W9SA 4PDKA 1BC7C 4LIVA 5FB2A 2ZJRF 4EJOA 1SBEA 5JZGC 3JUUA 1UY1A 1W7PB 4UXAA 4UUVA 1AYN1 4KA4A 1PX3A 3ERMA 5E20A 3FLTA 4NO4A 1Y43B 1X9PA 2R16A 2PHWA 4HKWA 1HB1A 4V19K 2LY9A 4LBQA 3FLRA 4MNUA 3I71A 4XKWA 4GMP3 3QLQA 3SDGA 2RJKA 1S3JA 5LK5A 4XMIA 4C2MJ 1FT9A 1BI0A 2VCAA 3JTGA 4XUPA 4Q4W2 1V9U1 4Y33A 3TP0A 2L7MP 4RN5A 4LBMA 4LK6A 4NAMA 3T0BA 2Z16A 4Y24A 4QKBA 3A0NA 3KP5A 1KU3A 4A3KJ 2DMNA 5E3NA 5A1LA 1U3EM 5A6YA 1IXRC 5JR7B 3H92A 1QOOA 5FXWA 3SCHA 3CCUI 3WF0A 4ZYAA 4IDZA 2TUNA 2BGPA 3APBA 1YW7A 5ACA3 4QHBA 4WM8C 2VULA 2QA4I 1T33A 1W0PA 1MSFC 4UW4A 3Q5FA 3DU6A 3BTYA 1WPKA 1RPWA 3OYHA 2C0ZA 5I0TA 1TQMA 1J2XA 3TO9A 3VODA 4QB6A 1QJZA 2TNFA 4QX7A 2XR4A 3ECQA 4ZDLA 1FP2A 5DM6F 5FPUA 3CUQA 1VTNC 4A6SA 5CYVA 1JJ8C 3WG3A 1W5CC 3OS1A 3VSKA 3AXEA 2AZ5A 2R7QA 3GZTB 2DBIA 5LGNA 2LH9A 3CZ6A 1VNDA 2GNMA 5EXOA 2P3IA 4OMCA 4IZZA 1UHSA 4I76A 3UJOA 1ZM1A 4IV1C 2QUOA 3UESA 1APNA 1JU3A 2JDHA 3LOCA 4OIPF 3GWZA 5EEGA 1DQ5A 2CQ7A 4WVZA 2KISA 1UXZA 2BY1A 1XCBA 4C3JJ 1SQ4A 5FFXA 3HR9A 4FTBA 2A5YB 1NT0A 3FUQA 4HSTA 2NLRA 3AMPA 4P55A 3BR3A 1U9NA 1LEAA 4NC8A 4D5FA 4NC7A 2OZJA 4S2FA 2QJVA 2L7KA 4CICA 1VQ9I 1KXGA 3QPHA 3S7EA 4Q48A 2OIIA 1I3HA 1MZFA 2G9FA 2HYGD 2GN7A 4GD4A 4F3JA 2IXSA 2VOPA 4BB3A 3OSDA 2ARXA 2JRMA 5J96B 2NPIA 4CUAA 2DK8A 3KZ4C 4QHOA 2RDSA 3HT2A 4PBOA 3K0LA 2FD5A 3JCIA 1NYWA 5LBQA 3PIOF 2WUHA 3O6BB 5J98B 3LDBA 4CEWA 3CJTB 4CCDA 2UV1A 5IYDJ 4GA9A 2P2KA 1T56A 2VUDA 3I58A 1DGWA 1WMDA 1U8RA 2KJCA 2JB4A 4U87A 2NOJB 4NR1A 1POV3 3WTYC 3NRUA 2ZAHA 5FLIA 2IWGB 3GTLJ 1QHHD 4RDUA 5HV4A 1P4XA 1OCRH 4GB31 4RA0A 3ZVXA 3OOXA 3BTJA 1XGNA 3RZJA 4RAGA 4CPBD 4O7XA 1XNAA 5LZ6A 5CVRA 4AI8A 2M5WA 1RTVA 1ZX5A 3PU8A 4HK8A 4YGCA 5A1FA 3B02A 3F8NA 2WQ8A 4DUVA 3LFKA 1OLTA 2QSFX 5IT9K 4WZFA 5FLVA 5AFEA 2DFEA 1UNBA 3NSTA 4NN0A 4HYEA 4ISQA 4PJJA 2ID4A 4Z07A 4CCMA 1WSUA 3SISA 1MS5A 3VD7A 5DM7F 2XHKA 1JKQC 2H0BA 4DZPA 4M9SA 1SG3A 3RMYA 1VF9A 3CZUA 1JI6A 5EV7A 3VBRC 3BODA 4YG2F 1PMIA 2OC6A 4CXYA 4D69A 2XASA 4P5HA 2RHPA 3BTXA 4AIDA 2KT0A 4XC9A 1KQ0A 3ZFEB 5E89A 1IN7A 5A32A 3AP9A 2E35A 3F8MA 2I45A 4HF1A 1W6PA 2I5UA 2JE8A 2Z79A 3KD4A 3J8F1 1RUE1 5FUPA 2W46A 5FCCA 2KKOA 5A7WB 5JZGB 1IG0A 4D7SA 2V5YA 3GYHX 4HX8A 4BACA 1ZGAA 5BXXA 5IAXA 2QQMA 1PGL2 2XVLA 4AWXB 2WA0A 5FZ3A 3WY6A 4YFZA 2WO1A 5L36A 2BGOA 3J80K 1A36A 5CEHA 4DMIA 1ETQA 5DDGA 2RE9A 3U14A 5JHFA 1CAVB 2DMTA 4U7DA 2DWRA 3THTA 1VBD1 3F8CA 2KFDA 4KG8A 2HYFA 2FUG2 3VDCA 3WF2A 5DN2A 2OVUA 1ORKA 1NLSA 3NWSA 4MXWB 1AXYA 1LHNA 4A7ZA 2Q1ZB 1MDMA 3CDLA 1I9RA 1X19A 3BPXA 1YS6A 3IH4A 2PMZA 1NA1A 3E6DA 2ZACA 3R0RA 4R1HA 3M3CA 4WM8B 4TZDA 4XZPA 2FZ2A 1FMD3 4A93J 1QIQA 1G9FA 4BNCA 3BIEA 4IEPA 6PAXA 5KWRA 5JOWA 3RSJA 4FPJA 2BYVE 1LVKA 5FJ8J 2MH9A 4EJVA 2LM3A 3FDYA 4I0BA 5FKBA 4M3FA 2PELA 3ACHA 5L19A 3P1IA 2YPDA 3K77A 1QMJA 2B63J 3I3DA 5B5EC 3RGBA 2QQJA 1KU2A 4YPJA 3KF3A 1AKHB 2L0KA 1W0TA 3MW2A 1ZVFA 3CMMA 3DBRB 3C7HA 2CU7A 3DEMA 1PUFA 4IV1B 4Y7NJ 4XORA 2JTVA 1XCVA 1VQLI 2FMLA 3H5AA 1O4ZA 2BQPA 3R6SA 3OBTA 4RSUA 2YZ4A 2ZBKA 4HPQA 4JRAA 5JR3A 5FYYA 3H9QA 5A2QK 1H30A 2OZ6A 1PGW2 4BYYA 5EJ1B 1Y4WA 4FPHA 3WCRA 3EUHA 5E79C 5DAPA 5LRSA 3TAYA 4N53C 4LB6B 1LTEA 4D7TA 2V1UA 1R1VA 2OU2A 2ZJ2A 5FYVA 1BBT2 2ID6A 1K78B 1WJCA 2FEZA 1HA8A 3HN1A 1DYOA 4NIHA 2WAAA 5CVJA 4HPKB 3U07A 4CYDA 1W6MA 3FMGA 1YI7A 2HWB3 4D0QA 1RB8G 3W6KB 3BOWA 5BQTA 3ASNH 3KEYA 2VQLA 3W5NA 3S5AA 4PIYA 1WFXA 4OMDA 4BQAA 1HX6A 1OJLA 4BQ4A 4HBLA 1GZWA 1X1PA 1FNZA 1ULDA 3UKVA 1T6GC 4QGNA 2Y0MA 1RYYA 3VHRA 2EA2A 1HC8A 1G3SA 4JDMA 4Q5SF 3VBUC 2G9ZA 1TQIA 4V2FA 1EV12 1HN1A 3W6VA 4AXOA 2W1UA 3U0ZA 4YIFA 4GFBA 1X36A 1B72B 5EJ3A 3TDUC 4FFIA 5HV0A 2VZUA 1Z0HA 1W0OA 4KH9A 1R49A 3DBHB 3QD6A 3LZZA 4XQDA 4KN4X 3R60A 3J8F2 1ZRCA 2NYXA 5HCFA 2GIZA 4AG4A 3OD0A 3AP5A 2F2EA 1XNBA 3FK6A 5E18F 5LGUA 4AD9A 2MA3A 3RCOA 4FPEA 5FROA 3GEZA 4KNCA 2EJRA 3ZR5A 4AGVA 2VTXA 3L2YA 2PAMA 3DWLE 1VMJA 5M3MJ 3CC7I 4XF4A 1CX1A 2R043 2DOAA 2DU0A 1FNNA 2HQRA 3AX4A 5EIYB 2G7UA 2DU9A 1HF0A 3VBRB 1J09A 4UF0A 5LEKA 3MICA 2H1LA 2MLGA 2KHMA 4XDQA 3OYLA 3S16J 2ZGPA 2IRFG 5A3PA 3K4JA 3CUOA 3HMYA 1RR7A 1NQDA 3DUIA 3U10A 3QAHA 1U5ZA 1AR93 1YFXA 5GZFA 1JXSA 3K46A 2GP5A 5A33A 1OR7A 2BXYA 1NCRA 1PP7U 3WXPA 4EN9B 5J3LA 3R05A 1WHUA 2HLEA 4Y1VA 5E1RA 3WW2A 4YW4A 1NX9A 2WR9A 3IPVB 2E19A 4G6DA 3B9IA 1K12A 4X8PA 5ICGA 5IYCJ 2HOEA 2ZEYA 3CCYA 2E6VA 1AYM1 1AYN3 1WCUA 3Q8BA 3BY6A 1UW8A 2P6TA 1J1LA 4BEHA 4ASMB 2FNPA 3J7HA 3LNQA 2JWPA 3PLQA 4GWJA 3I4NJ 1BZWA 4YIIA 4Q4V1 1QU0A 4Q27A 2ZXQA 3GLLA 2Z5WA 1RJ7A 2LS6A 3ZSLA 1IQDC 4O65A 2EFPA 1V9U3 4L0YB 4PLMA 4H0EA 4AIJA 3WG4A 1YC61 1ZZCA 3POYA 2A6HF 5GTIC 4PF5A 3A01A 1H89C 1A5JA 2ZX1A 2JKBA 2YGMA 4LBQB 1UHWA 4KMFA 3B69A 5I93A 5J8CA 2BVLA 5E3MA 3TL4X 4E7LA 2H8RA 2XQRA 2CU5A 5GTHC 2A61A 3F8BA 4NAOA 1IN4A 4BISA 3H50A 2GDFA 2YU2A 2XJRA 3O1UA 4ZDPA 3IDAA 4UW6A 4ZXEA 1LNWA 4MXVA 1BI3A 5BNPC 1NLRA 4OI4A 4G6TB 1HDPA 3HRUA 3ZRGA 1LQ1A 1QXRA 3ZR6A 5C4XJ 2IGKA 2OPKA 1CESA 1CWPA 4BMBA 4LHKA 3I97A 1JYWA 4F7ZA 1UKGA 5LD2C 4AI3A 1U0AA 1XPWA 2AO9A 2R30A 5DG2A 4NMIA 2F6BA 3AK0A 1ENSA 3TEYA 1K5JA 2JJ7A 3RZLA 4IEOA 4RGXA 2XLAA 3KV6A 5M5WJ 4V2GA 2CJJA 1O4YA 4OOIA 2W25A 1K6OA 1O6UA 2LTPA 1RUD2 2HYKA 2ORXA 3OY8B 3C18A 2O7OA 2RDPA 1R5ID 2DVDA 3VV1A 3PFYA 1Z91A 1LGBA 3ZMVA 5J1RA 4TLGA 3BCBA 5L9BA 1BW5A 4NPRA 5DMYA 2QQOA 2UYBA 2SBAA 4XHXA 2VBBA 2VUJA 3O5SA 3P3NA 4FPGA 4N53B 1EPWA 4PQ9A 4KITB 2STWA 1GWLA 2VI6A 2LTNA 2KDOA 5GALA 4AR2A 1X3WB 3HWJA 3RZOJ 5A6ZA 4XIKA 1U8BA 3P5JA 1P92A 2CUJA 1PZ9A 4K6BA 1DZQA 1R7JA 1BN5A 1XG1A 2W2IA 3ASOH 2EFNA 3FF5A 1SD7A 1UZCA 1IDZA 1Q8VA 2UY8A 1MW7A 1XYNA 3P9CA 1TWCJ 1Y39A 3F21A 2X1CA 2Z4FA 5KHJA 4A5NA 5HLTA 2ZNYA 4LMYA 2Y2ZA 4D1QA 2A69F 2HI3A 4MV2A 1UAIA 2D6LX 4Y5Z0 2L7ZA 2W9XA 2DODA 4LORA 3OYCA 3QYEA 1O8PA 1FJLA 2WNEA 4CEWB 2EK5A 1MBHA 1T2XA 4RS5A 2XKOA 1PO11 3POWA 3VUOA 2DTWA 3GMEA 3M70A 3G2BA 2GMMA 4GB33 1QOTA 3K9TA 2K4BA 2QBYA 3L2WA 5CA6A 1HV1A 2ZS6B 2R0FA 3VKMA 4JK1X 3A4UA 4O3MA 2QKDA 3VHPA 3K4LA 1QKQA 5M5XJ 2I2SA 4BWOA 2VOKA 3W58A 4HMZA 4P9WA 2HWC2 4ZH4F 4BBSJ 2RS31 1YXWA 2WZ8A 3WV6A 4LE4A 1WVRA 1X3ZB 1W6QA 2P1BA 3G3ZA 1UIJA 3ILRA 4ETSA 1QJY2 4A69C 2KMUA 1I5PA 4HONA 2WFF1 4IEZA 4IHWA 4M3DA 4P00B 3TWIA 1VQKI 2Z2SB 5FZGA 3EPZA 1OURA 4UV8A 2DDAA 2W1SA 1WLCA 4JCKA 4XLPF 3GM8A 3IMMA 3RZKA 5DD8A 4NQWB 2JG9A 1Q3EA 3ACLA 3OL4A 4NWVA 4M71A 1ZK8A 3SZTA 2K40A 4AYUA 1OSGA 1MPXA 4I3PA 2DT5A 4YYOA 1LU2A 3DKXA 5AVPA 3OWTA 2HR3A 1PO21 2ZX4A 3ZXEA 3J8F3 1RUE3 3MKLA 3GVAA 2ZXWH 3BDDA 5JMOA 1Q56A 2J42A 2GWRA 1MGTA 4AHXA 3WNPA 3ZIWA 2Y69H 2A05A 4AC0A 3CDZB 1W6PB 3JD71 2FHRA 3WDWA 5HXMA 4P5YA 1HJGA 3CJXA 4BDVB 4ZZ5A 4CDXC 2JDUA 5I8TA 4AK3A 5KK1A 3N7MA 4O5VA 3EUKL 4AUXA 3VZLA 4D0PA 1VBD3 4FP2A 4XEZA 4MYEA 4Y15A 1G6NA 4E7HA 5D6EA 1I50J 3G6JB 5LY1A 4Y4YA 1LDDA 5H6RA 4ZONA 4JKMA 3V65A 3MIDA 4NHMA 1YQ6A 4G6QA 4XF1A 1BMV1 3BPSA 2Y6KA 2PG4A 5FZKA 2YPJA 2XB5A 5FOBB 3W2WA 1YQ2A 1CIYA 4FQZA 3ZXLA 3ZXAC 1Z3XA 5DCMB 1FX5A 1QF3A 4I98B 1CQTA 1N78A 3V8KA 1Y1WJ 5CLSA 2VOTA 3O7OA 5BNPB 2VUCA 1W8OA 1CX4A 2HJIA 5FY9A 4LITA 3SZPA 1WJFA 3BPZA 2K4JA 1YJ9I 4Q47A 3E6CC 3ZYFA 3H8UA 3WTVC 4XW3A 5JFRA 4CCCA 2XVGA 5ILSA 1PMHX 2BDRA 5A3NA 2QF7A 3LIHA 1VR3A 4YELA 2W1WA 4DY3A 5EHDA 4FPKA 3O0VA 4NIIA 5LCWL 1VFCA 3GUDA 3OR1C 1UPIA 2X9DA 5FZDA 4IE6A 4Z2WA 3ZDSA 2Y60A 3BALA 2DVAA 1HKDA 3OCPA 5LY2A 3HQRA 1JGSA 3CJRB 2JQ7A 3KQRA 2BZTA 3H1WA 5DUUA 4AI2A 4MOAA 2E2JJ 1FMVA 5FPBA 2OJED 4ZY9A 1S29A 4YGEA 5IAVA 3AZYA 4OUEA 1J7KA 5FKCA 1Z7UA 3T1BA 3WG2A 4HKLA 4XLFA 2XJQA 3WSOA 1MNMC 4ZU4A 1R22A 1S7OA 4IV3C 2JA2A 2J1AA 1RUC1 1PUFB 3IKVA 1WWXA 1PO12 1H9GA 4OHYA 1FYLA 4BGDA 2MH2A 4HQEA 4EZ4A 4HNUA 2AGSA 1V6OA 5M0TA 2DUOA 3BR5A 1MNDA 5FZ1A 1HCRA 1XS9A 3NJYA 4MEXF 2NQYA 4A3MJ 1V0AA 3HVDA 4CXWA 4IRHA 1GV2A 1JYTA 3WGIA 1EKEA 2DJNA 1DDLA 3EETA 1A6CA 2WNUC 1FPN2 1O59A 1D0ZA 4LIUA 1OA2A 4PLNA 3POGA 1OCCH 3JRGA 1MJ9A 1J59A 3HPHA 1NXD1 4R9AA 1AHSA 4KMQA 1R23A 4UHTA 4JX5A 5H9QA 1WKMA 4V2VA 5FZLA 3B9CA 5CFDA 1O3QA 1XNTA 4G94A 3V8JA 3OBRA 4CU9A 1EAH1 3M1EA 3Q0UA 2D3SA 1SDDB 3OUJA 1LAJA 2JDZA 3MVPA 2H0VA 3BR1A 1D8KA 4XHBA 5H6QA 4MG2A 4COUA 3LSRA 4AGRA 1W06A 5EGOA 2FD8A 3HUGB 5GADJ 1OUSA 5EDNA 2Y33A 2WO7A 5LA1A 2R0HA 3E1SA 2A3YA 2X09A 2UWAA 5C3QA 3FMSA 5L7OC 1WMEA 2PFBA 2HOTA 2FBEA 2HFHA 4LFUA 1CAXA 1HRI1 5D5XB 1Y7BA 4Z82A 4AQ2A 3SCGA 4GXOA 1NG6A 4BK5A 3PMEA 3OUHA 2CSOA 3OGJA 4RS5C 4Q4X2 3NAPC 2D98A 5FZ0A 4QPIC 3B01A 4EV0A 2WV0A 1JUHA 1VAKA 1YW9A 4OZXA 2PQQA 1R091 3QOEA 4MGQA 3WE3A 1XYPA 3IAS2 4NUBA 4BIOA 2CQXA 2Y75A 3HG9A 3VD3A 2DMUA 5K7PA 3ST7A 2HZDA 1JZ8A 3RG0A 3CCQI 1XE7A 3H1MA 2JA7J 1UZ0A 1N3PA 3CCRI 3RPUA 1GXQA 2LF7A 1YIJI 4NBQA 1RINA 3PUQA 4D7NA 2D6PA 4CP9A 3LF7A 3X29B 1SBDA 3GYDA 4QX0A 2VBWA 3K4KA 4UF0B 2WINB 3E0JB 2NMNA 2HYJA 3J7YJ 1LHOA 1OF3A 1YWKA 2VY0A 1JOJA 2HYXA 4I30A 3PTYA 4XLAA 4QQ2A 2VT2A 2WO3A 5FZIA 1YEWA 1UY2A 5T54A 2ETEA 4L5EA 2H6BA 1RHI1 3QRFF 5CG9A 2XG3A 4H14A 3DEWA 3U1DA 1XBFA 3AP4A 4BQ2A 4L9JA 2E2HJ 1AYM3 1WCQA 4DBRA 3F6OA 1SCSA 3ZN6B 2E5ZA 3FXOA 4B43A 2CW8A 3VBHA 4CDXB 1LOBA 4XR6A 3I7DA 3HOSA 4YFWA 4D3WA 3T8TA 2YU1A 4Q4V3 1ND3C 1W2OA 5A3UA 2HWE1 1WI9A 2P3YA 3KP2A 1XNCA 1BVP1 4HL0A 5HCHA 4DYRA 1MMDA 3ZO0B 3BUCA 4Y26A 4BEHB 5FKMA 3FKJA 4FE4A 1OI6A 5LLQA 3ZXDA 4OYUA 1P4AA 4CYCB 3LEIA 1GMMA 2DOFA 2YPRA 2QENA 3LA7A 2BEOA 1R58A 2OTJI 1XMAA 1ZZ9A 1J5YA 2EXIA 1FSEA 1V6KA 2WS92 4IX7A 2WAQN 4B1LA 4JHTA 2PYTA 1H1MA 2E32A 4GULA 4PSWA 2HWF1 2W48A 1RUC2 4ISRA 4RA2A 1LULA 2AXLA 2AS5F 1FWZA 3FMQA 2ZSIB 3JREA 2HOAA 1FNYA 3QACA 2BW3B 4YARA 4ENKA 3SEEA 3OG2A 3GZAA 3BU7A 2ECCA 2ZFWA 2EILH 2JMWA 3M3EA 2CV6A 3M1HA 1AX1A 1JU4A 4LBKA 3U11A 1U5IA 1FAYA 5AIPA 3ZQFA 4RBOA 1R4MB 3G4SI 4GDFA 2RR12 1H8TA 5FZ8A 1NG7A 4OMYA 1D0XA 1NE4A 1VBE2 1X33A 3UKTA 4WBBA 1WA4A 2Y6LA 2R5YA 2XGXA 3JB8A 2R5ZA 1WBFA 4LEJA 5LBFA 3BZ6A 4UVCA 2SLIA 1MS3A 4IV3B 4UVAA 3JRAA 1BI2A 1FYKA 1OKOA 1HXDA 2QGUA 3MLKA 2VZQA 4BJ6C 5KBFA 3HJEA 1N75A 1ZA4A 1GP5A 1V6IA 4RM2A 4ENMA 2J22A 4XKCA 5JPMB 4P02B 1Y8QB 1W0UA 4KGGA 3H8XA 3J81K 2RJ2A 1HRI2 1HRV2 2CGNA 2XAJA 1QBJA 4JOMA 3U37A 3BTIA 2UWBA 4E27A 4XNFA 4NVPA 1W8WA 2WNUB 1ON2A 1AUYA 5F37A 4JQFA 3HTSB 2XLFA 2EB7A 3RNSA 2IFWA 3DEEA 1M1EB 3MKWB 2VBPA 4JGZA 3QYFA 2W85A 3LQRA 3OJBA 4FETA 1HIXA 4RHV2 4L97A 1QDOA 3AG3H 3HRSA 1POQA 1PJRA 3GHMA 3RI9A 1VRH1 1N1SA 2HTSA 4C30A 1PO13 1YI2I 4A7YA 2XL7A 1GDTA 3GXUA 4BHBA 4ZJZA 2RVCA 5IK8A 4N4NB 3WTTC 5JOYA 4EYUA 1QPIA 5L7OB 5IUQA 1IUFA 3FWEA 1PYVA 3OEBA 5EF6A 4MO7A 4DZJA 2WNOA 3PL8A 5E1XA 4BJTA 1FPQA 2YY1A 3KZZA 1Z7S2 1RVF2 5JMCA 3SYTA 1SLCA 4RS5B 2E71A 2VOOA 2WY7Q 2LREA 3NAPB 2QCSB 4PDWA 4H7MA 4XRSA 2RS33 3LDKA 2JA5J 4C0HA 3C7JA 5E1ZB 3CO2A 3KP3A 2QBYB 4AHYA 3RKXA 1MZ5A 1FBSA 1UG2A 3V4GA 3N97A 1XDUA 2G1MA 2CQKA 3LSMA 2BGCA 2WFF3 1CN1A 5FFOC 3M3QA 2K46A 5LK7B 1GT0C 2OV7A 4XAAA 3IP4B 3WR0A 2ZOEB 2ZBJA 5J8FA 3WDXA 2XJPA 2RDNA 1F5FA 4FT8A 2D40A 5I0UA 4TV7A 4O9GA 2P4EA 5LHGA 1SFKA 1Y0NA 4YVSC 3V42A 4G4FA 1POV0 3H8RA 1DGRN 2FX0A 1KU9A 3G1MA 5F3IA 4GJZA 3GZ5A 4LO7A 3SCFA 1G9AA 2VG9A 3PJRA 3G1LA 1PO23 4LHNA 1GLNA 4Y22A 2FCUA 1WH5A 2Y8KA 3KB5A 2AEYA 2LY1A 1GBGA 2EXHA 4XQ4A 2NP0A 1D1BA 4KIGA 3M2MA 3OYKA 2XROA 2HWF2 2UU8A 1YOVB 5FBJA 3HSEA 4FTEA 3QP5A 1ACCA 5DUKA 4BQ3A 3JD73 1EF4A 4MGYE 4R4XA 3V0AA 2EXJA 5KXBA 1CAWB 2DBBA 4XN0A 1HDDC 2RDQA 5A3TA 1ND3B 4UT5A 4HSLA 2MD5A 2O0OA 2DT7B 3AC0A 3HSRA 4LBLA 3RPQA 1JI8A 4ZC3A 3ZP5A 2QQLA 3KCYA 3I49A 5FP7A 1UMHA 2ZFUA 1CPNA 2WRAA 2A71A 2UXXA 2WC2A 5L3CA 4GCVA 1PDNC 3CMYA 4QXKA 3OEAA 5KHGA 1QZZA 5CFCA 3FC0A 3I53A 4HVQA 1GICA 3TN92 2GC1A 3PNYA 1SD4A 4WVWA 1WCMJ 4AVSA 1REPC 2B8MA 1WJDA 2E63A 1D2SA 2ECBA 1GV9A 1V3FA 2HQ5A 1X82A 4B7KA 4P1WA 2BUKA 3NQHA 2OAZA 1HBXG 2OW4A 3MKYB 1UWWA 2WZEA 4I6ZA 3J7ZI 4LA3A 3WG1A 2XONA 2XBO2 4ESFA 3ZQLA 2X6XA 2ZSHB 1C28A 3TO7A 2LLKA 4OHZA 4ZPIA 5IYBJ 2W5FA 5GLTA 3HIFA 4HETA 4ONUA 2VNVA 4PGHA 4OIQF 2IA0A 3NQOA 3BKZA 4U88A 1GNHA 2MW8A 1W9WA 3MLLA 5FPXA 2EFWA 2VC1A 2YBPA 3CU7A 4RLFA 1YIFA 4Z1VA 1RUJ2 2Q1FA 1TNTA 4Q0PA 2MG4A 4JKKA 4QDQA 1SMVA 2JXAA 2IS1A 2ZHMA 4TXWA 3HC7A 2Q2EB 3WDTA 1KU7A 4L9BA 1FOKA 4BS9A 1E5HA 3CCLI 5A2QZ 5J1UA 4XOPA 3FLPA 4UVBA 3UNPA 1OFCX 2XUEA 4CDUC 1UAAA 3AG4H 1JH5A 2OPWA 2VC9A 2FDKA 3FX3A 4L5IA 5EZGA 3GZEA 2F5CA 5IP7J 1YO8A 1SAUA 4G8XA 4IQPA 5J6XA 1VRH2 1RUC3 4C3IJ 3BVCA 1XSVA 3LPFA 4AVCA 1RUOA 3WW4A 5C3SA 2P6SA 3OIPA 3CL1A 4AAPA 4RGUA 4CH7A 5C8WA 4IEQA 1US2A 3AMNA 5C9AA 4UW5A 1B6AA 4R52A 1L0OC 3H3UA 3POSA 1RUI2 4KMUX 2IJLA 1CZVA 1QNTA 4YFKF 4LLFA 2XF6A 1S0DA 3ENRA 4KQ7A 4ENNA 1LKNA 1CONA 1YG2A 1T38A 4IQ4A 2XJVA 4K2EA 2A3XA 5IVEA 3TW6A 3TYJA 3SKVA 4L8QA 1NCQC 3OGSA 2MFZA 3KHCA 1QQP1 2VTXJ 1QPMA 3IAQA 2F17A 3WU2C 3SLIA 3PJYA 1XU2A 1QJX2 2DCKA 3WNNA 4A3JJ 2ORZA 3ZKUA 5IOYA 3L2CA 5JVGF 1TZOA 1EAH3 2JN6A 2C26A 3PFIA 3HOYJ 1VMFA 1ETVA 4UB8C 3G1OA 3S14J 3URFA 5EWSA 2HTJA 1OD5A 3GCMA 5ICEA 2M4KA 3R4SA 2MABA 1BOBA 3JSOA 2ARCA 1AR62 3DF0A 4M74A 4Q8LA 3KETA 3QCWA 2M45A 3M7GA 2XAUA 4BE0A 4EWAA 1HRI3 3B6CA 1LGNA 2PHFA 2YBKA 5EG0A 4LK7A 3I54A 2VBZA 4GYIA 3T2QA 2WNVC 1DP7P 3F72A 2R071 1V6JA 2GH2A 4RB1A 1R093 3OUIA 3L2HA 1Z0XA 1TTYA 2Y0SA 4A3XA 3LEGA 4PDWC 2IXIA 2P5BA 3HL2A 2LRDA 4C2TA 4YVSB 3M3YJ 3H3LA 3A0HC 4HQMA 3WHBA 4BBRJ 3TOAA 4II3A 1HSTA 1X4OA 2ZABA 2IVJA 4IHXA 4LA2A 3SEQA 3S3OA 2EFQA 2BNNA 4M3CA 3K51A 3MW3A 3JU9A 1DGWY 2DFBA 3ZKYA 1SEUA 1VLNA 3ZMOA 1RHI3 2R93J 1HLCA 5BV6A 2EAKA 4BQWA 1Q8QA 4FQ4A 3E1F1 3J7NA 1MBJA 1BKZA 5J36A 3BJAA 1LESA 2XJUA 3NVCA 2PN5A 1DYKA 5APAA 4MVTA 1XGMA 3IBMA 4M3BA 1J1TA 1SAXA 2C24A 1UG0A 4FP3A 2YC4A 2HWE3 5D1IA 4FCYA 4FXGB 3TRSB 3U4SA 2VC0A 3M9AA 2CV0A 3LAGA 2ZGSA 4XOTA 1FBUA 4CU8A 3OTFA 4BE2A 1XOYA 2QQWA 2GXGA 3V56A 2VIXA 3OYIA 3LSTA 3OPWA 2P8TA 2EBIA 4IXLA 1LB2A 4CA0A 4X0GA 2QQUA 3JTHA 1IXSB 1UELB 3L9FA 4ASNA 5JR2A 3N9MA 3T1LA 5C3RA 5DCFA 1FY7A 4EGZA 1NE6A 2HWF3 1AX2A 4FOYA 3EQLF 2QZ2A 4RD7A 1UYXA 3WUDA 2DCEA 2FZ1A 1VBA1 1VBC1 1JZ6A 5KXCA 3RTRA 3PVOA 1BVVA 1XXNA 1TMF1 3OMYA 5JPNB 3N9OA 1XJAA 1UYPA 3E7LA 5GLUA 3LCPA 1WJ5A 2V7FA 2VQTA 1SFYA 1VQ4I 3WW1A 4E8DA 4RR3A 4JDOA 3Q9VA 4AIKA 1HKTA 1US3A 3WF3A 1QQP2 5JSOA 1AR82 4XPVA 1IRGA 1ZBA2 2KR2A 2PI0A 3RYKA 4IE5A 2MC4A 3KEQA 4Y1XA 2LKPA 1JZ2A 3O1SA 4CDUB 3MIBA 3SKJE 1DCSA 2KRFA 4KWUA 2WWSA 3PNVA 3V7CA 2W1QA 3HZJA 1FIPA 2GN3A 1LE8A 1IPKA 1OKQA 2F4MB 3VFZA 3N7KA 3E6MA 4EJTA 1FTZA 1AXZA 5IVFA 3C7GA 2IEKA 3HQUA 1D1AA 1T95A 3IKWA 1O57A 5ED4A 4OMZA 3T1MA 2AC1A 2R5ZB 4IEVA 3PMSA 3A23A 3DCQA 1SACA 2O8OA 3W2AA 4F93B 3GW2A 2CRGA 4NC6A 5GZCA 3KS7A 3AVSA 3CNAA 2J5PA 3WW3A 1X58A 1NCQB 4MGRA 5F1JA 2XPUA 2IFRA 3FXKA 3I3LA 1ITYA 2F4LA 1DQ4A 4XQFA 1SFPA 5H9SA 3AFGA 5F39A 1FX7A 4M4PA 1UMZA 3LFIA 2E33A 1E17A 4EEFG 3NNFA 4IGQA 2ZXJA 2AXTC 4I2OA 1VRH3 1LEDA 4HLYA 1FV3A 5JAXA 5E3OA 2VQHA 2X6WA 3ELNA 5L3EA 1Q43A 2EH3A 2ZEZA 1W6NA 3QPTA 3H1CA 2E60A 1YHFA 4XIDA 3IIAA 3IN9A 1UX7A 1AL22 2BXZA 2CFXA 1B35C 4QKDA 4PJLA 4RGRA 3F0CA 4Q2FA 4TLFA 4E2GA 4JZRA 1LFUP 3KVAA 5HS9A 1NK3P 4XYXA 4YVWC 1MNEA 1ZH5A 2VZTA 1IOAA 5CQEA 3J7AY 2BP6A 3S5QA 1ZLKA 1XGSA 3MFAA 5DABA 2WNVB 1QH6A 5A3LA 1UOFA 4GALA 2CGOA 4OQ9A 4CRQA 3MYXA 1TWHJ 4XFAA 3MEPA 4HAMA 4YM2A 4HVRA 2RM21 1YS7A 3KT7A 2VOWA 1U5TA 1A8MA 4PDWB 1NKGA 2XKPA 3D82A 4OVEA 4Q5OA 4RB2C 3AL5A 4NIAA 4JX4A 5GZDA 4ON0A 1OYIA 1FYUA 4WM7A 4XJAA 4ESBA 3G71I 4OHXA 2P5KA 2QQBA 4YNIA 1TVGA 3LSGA 3F6VA 1YFHA 2M7BA 1R1ZA 2GNBA 4XSZF 2WQZC 4FPOB 2R6QA 4R79A 4PFPA 2DT6A 4QX5A 1F1ZA 1X1CA 5FZMA 2ZPXA 3VD5A 4AIHA 3SC7X 4MGZE 4MGIE 1J83A 2P81A 4XFIA 1JYVA 3BZKA 4RGGA 2C1FA 3CP8A 5B1AH 4H7LA 2PHRA 3GTQJ 4A42A 4Q4ZF 1MEC1 2L02A 2E36A 3NWKA 4XMAA 4ESJA 2IXJA 3DGTA 3WF4A 1VBC2 4BHCA 1H2LA 4G3YC 4Y1YA 1ENHA 4DXSA 2GOMA 2F6CA 2DA2A 5IHRA 2Q0OA 5D4SA 2NN8A 3KLSA 1CZTA 2D43A 2YGLA 5BS6A 1HXS2 4X1EA 2VB6A 4JQRA 1DIWA 4DGWB 1GQGA 3SQNA 4FOQA 1H9PA 4YWAA 3PQKA 1RC9A 2NOGA 4Q1PA 4LJHA 3GALA 4XJUA 1AL0G 3UR3C 3V0BB 1QQIA 2LF8A 3PVNA 2KDZA 4ENJA 2K9MA 4Q4Y2 1S2KA 4HK9A 4LMFA 4XURA 3NEUA 1R9TJ 2CAVA 4BQYA 3FHQA 4XAEA 4CP2A 2ZX2A 4HOOA 3WVJA 3S30A 2ZGUA 4YM1A 4BQXA 4BJ0A 4XJ9A 1KS5A 4YG0A 1S72I 1YE9A 2Y26A 1LUJB 4I0WB 1KRIA 3DLLF 4Y5TA 3QQAA 5KHIA 4KJZA 5CZKA 1LDJA 4YRVA 3LSJA 4JTNA 3CCJI 3O3KA 4RS8A 2ZGTA 1DGWX 2FNAA 2W4SA 1CIWA 4M3CE 1SFUA 2RNGA 1F9NA 2DO7A 4FASD 3WNMA 3N7JA 1QJU1 3JBG2 1UL9A 1UU6A 3GZNB 3H5RA 5KXEA 4N0BA 1OOPC 5F2WA 3WEZA 3BJOA 2G4IA 4NRPA 3UK9A 3BIWE 4UAPA 5FZ9A 5FYIA 5FZAA 1W6OB 2CH0A 4L99A 2YYOA 3KV4A 2R7ZJ 2R1DA 1ON1A 5FREA 2O6GE 2UWMA 3S57A 2RMU1 4M72A 3DPRA 1RXGA 2BVVA 4B4CA 2OS2A 3KCXA 1UZYA 3G6EI 5HCBA 1TNRA 4AQTA 3N9QA 3FFQA 4BDZA 3IIIA 2O0YA 2J1TA 3D8CA 3T2PA 4DNCA 1X1DA 3SNMA 1JMUB 1PX4A 2Q0AA 3S1NJ 3W3CA 4PJNA 2BY3A 3KFWX 3K10A 1QQP3 4MUVA 3K3NA 1IO2A 4LPLA 1QOSA 1RR8C 1GP6A 4B09A 4OHVA 5GJ6A 2RM22 4XBFA 3LB9A 4W65A 3SITA 3O1MA 4ZS3A 2LYCA 2VOVA 1XRUA 4IEUA 4INDA 2YROA 4AQ6A 2KJBA 3VHOA 4ZYEA 2DVGA 4P9UA 3GDBA 3BYWA 3GBGA 1W8NA 4WVMB 5HS7A 1KD7A 2W24A 1I1SA 2BY2A 3WTXC 5FP8A 2V4JC 2VBDA 4U7BA 2ZO4A 4AWDA 2K7LA 1FOD1 1XNKA 2RAEA 4XBLA 3F3XA 1J3PA 1N77A 5DPNA 2UURA 5KVRA 2ZTNA 3FBIB 2NNNA 5ACA2 5JXJA 1ENXA 2EQRA 4MZUA 4YVWB 3ZXKA 3GNEA 4GXLA 4LBNA 1SEFA 5CKMA 3LSKA 3TDZC 1C1FA 4HNTA 3BTAA 5E8IA 2BNMA 3JRDA 1XC6A 3WE2A 2R073 5FZBA 3NAUA 2VZVA 3I2KA 2XF7A 3VDXA 1FTTA 1ZN2A 2VN2A 5FY4A 1UYZA 1DPRA 5EG0B 3EQEA 2PHTA 2X53S 3S17J 1A3KA 2R92J 1RNLA 1RESA 3PUBA 3EUAA 5L3BA 3U9GA 2X1EA 1Q8OA 2MEV1 1QZEA 2WA3A 4XLEA 5C44J 3O1PA 3KIOA 5CQGA 5C3EJ 5IOZA 4BXUA 2Q8EA 1T0FA 1YRNB 4L9VA 4CCNA 3ONQA 4WM7C 2GC2A 2GU9A 1S4CA 4QPGC 3POIA 2OCEA 1K79A 1W9TA 5F5AA 3UNGC 3PVBB 3JSPA 4FFGA 3HJRA 1UCXA 2MGQA 5H9PA 3BPVA 5KNLA 2Q1MA 4BQQA 5FZ7A 1VBB1 4K21A 3OYWA 4DRVA 4CVUA 5DUXA 5J48A 1SPPB 3PJQA 4EM2A 5FLJA 4QWQA 2RS51 1EP0A 3BQYA 4B47A 3ABMH 1LJ7A 2P34A 3WG7H 2A6EF 3F8FA 4LBJA 3WTZA 1WW7A 5E17F 5KAIC 1G2HA 2B45X 1D4VB 3Q8FA 2JK3A 2VJ5A 4FXKB 3LE0A 5GLVA 3K70C 2M8GX 1V54H 3C7FA 1RITA 5C8CA 1MBGA 2O8XA 2G9GA 2YC2A 5FP4A 5F1RA 1ZRIA 3WGGA 3L09A 1D4M1 2EA4A 3C2HA 4EE2A 2PLV1 2KRHA 3KHBA 2JG8C 1P8JA 2Q30A 3DKYA 1ZBE1 1DLLA 3VBOC 1VBA3 1DP0A 1VBC3 2Y64A 3FE5A 2BNOA 5FPVA 1R1A1 1TMF3 3THDA 2FQPA 2W39A 4IEJA 3AG1H 2PHXA 1F35A 2LMDA 1AHDP 4PJYA 3VZKA 3HPNA 3ZOIA 4IHSA 1GNZA 3JAMZ 5CU1A 4QM8A 2Q5TA 4XFCA 3ZMDA 1B9MA 4DB5A 4AU7A 2XVCA 2IUWA 1ZELA 3PM1A 5F3EA 4BPZA 3VN4A 4PQQA 4B7EA 2VKVA 1MZBA 4F91B 1YJWI 5GLWA 3PHMA 4IO9F 3WHTA 4YFXF 3W59A 3I2IA 3DFGA 4GYGA 1MQTA 2VXZA 3MFKA 3KX2A 2O5RA 4HLXA 1OOPB 4MFDA 1UHMA 1JODA 2FBHA 5FMBA 4KUMA 5FPAA 4PI2A 3ILFA 3ABTA 3ZQHA 5C3OA 3K1PA 1BJZA 4LKFA 3J81Z 1OA4A 1ULFA 2CQQA 3MIEA 1PIV1 3OYDA 1FOD2 4S2DA 3MPPG 4BIFA 4CXXA 5CISA 1MH4A 3AXDA 2KLOA 3TP3A 4WZCA 4CUGA 3BR6A 4J01A 4B29A 4EN7B 3HPGA 2L3DA 4O6JA 1OXCA 1ND2C 2Y0SN 5HLIA 3O1VA 5F5QA 5FUNA 1ULYA 2G7HA 2V72A 2ADUA 4RGSA 4D6QA 1L7LA 1HQWA 4QB2A 1OCTC 1R5HA 1NOVA 5CYYA 2COBA 5CVIA 4B8XA 3IL2A 5H9RA 4X6AJ 3K70D 1XN7A 1SVLA 1SFNA 1GVJA 3EBRA 3SXWA 1Y1VJ 4AE2A 5FKKA 1JKRC 3H0OA 1Y8RB 3RDIA 5FRNA 5K0UA 1CPMA 3ZFEC 2WIIB 5JI9A 4XVHA 1K4TA 2Y31A 4D7MA 1LENA 2RC4A 4QWNA 4XUTA 4IL6C 3MN2A 2V1XA 1JE8A 1PZ7A 2IP2A 2L7FP 1FMD2 1ULGA 1T6SA 1GKBA 3BTZA 1W9FA 4W8JA 3J7MA 1A78A 4P14A 2VM9A 5FZCA 2YSRA 4FPCA 4UNOA 4LT5A 3DXJF 4NIGA 4IOCF 1VBB2 2CAUA 2BHZA 1F31A 2JIJA 4F8AA 3USUB 1YIOA 4HA8A 3MZ8A 4P9FA 2RM23 2R4GA 2QVSB 3VDDA 4LQRA 4AEDC 2CNAA 5FLHA 3P9KA 2OD5A 4H2AA 1IN8A 3I4PA 1KYZA 1IKPA 3LWCA 3OGVA 1TME1 2XRNA 4XJWA 4B1RA 5AC91 2AR6A 4ZTJA 4IRIA 2K9QA 4E4ZA 4IE7A 2QQ8A 2CGPA 1UX6A 4YW2A 3LWFA 2VMCA 2X0LA 5T55A 1SBFA 4E70A 1XE8A 4GWMA 3K7AJ 2XL9A 5BNOC 3RWNA 3I59A 3WU0A 3OYNA 4OAYA 1UB9A 2KM2A 4WM7B 2PFWA 3O0XA 4QPGB 4G9SB 2Z5UA 2VJIA 1W8FA 2DFHA 2PLV2 3MWMA 1RIOH 3I2DA 2M2EA 1MEC3 4C1WA 3V7RA 2IBDA 2YB7A 1W8ZA 4AEKA 4G12A 4LE3A 3T2OA 1RMU1 2RGVA 3ZSKA 5IK7A 2QFEA 3D5SC 3S32A 1JZ7A 4XN3A 5C4WC 2MSYA 2VXRA 1S0BA 1ZR2A 2F4PA 2OUMA 3DV8A 2HWB2 2V6CA 1USSA 1TL8A 4ARXA 1YITI 2K9ZA 2XGCA 4WXDA 5IW0A 3UJQA 4IKFA 3ZN1A 1W8TA 1V5FA 4I99C 3HNMA 4OWRB 2LD5A 4MIMA 1QH7A 1SVMA 1KYWA 5F6FA 4EM1A 4RQPC 5T3NA 1JZ3A 5KHKA 2H27A 2ETHA 4UFJA 4JYKA 2W57A 2Q8OA 2JG8B 4JX6A 3GZ6A 3I2HA 3VBOB 3HOZJ 1XB9A 3I2GA 2V1NA 3NWTA 3MCZA 4ZU5A 5FQ0B 5IWFA 3S93A 5K7ZA 3KT4A 2V09A 5FD5A 3W21A 2WV1A 5K5OA 1GZ9A 5J09A 3LEKA 4KWLA 2FMDA 1QHDA 3AVRA 1WCDJ 3ASIA 4CDWC 3ZXJA 3GJBA 4QKFA 1YQ5A 3VBSA 3CEWA 2IGOA 2ZEXA 1JBCA 1LFPA 3GFMA 4I7HA 3QWLA 4GZ9A 4B4PA 2R042 1L3LA 2VNGA 4NHLA 5A3MA 2IGNA 1I27A 1QJU3 5F27A 2GBYA 4PCRA 4IEYA 5HOOA 4FO9A 4OAZA 1KFXL 3VKLA 2KRCA 5DYMA 3WTWC 4GH4C 4CEYA 1OH3A 1ETYA 4DBQA 2Y38A 1R64A 4QX2A 1AR92 4MLOA 4L2NA 1YFWA 1A04A 2VZOA 4F83A 1FMWA 2WTEA 3KGLA 4COVA 4DXTA 2GXAA 2X1DA 4CCLA 3FHNA 2RMU3 1EUUA 3VKOA 5DS9A 4DEVA 1LOFA 3AL0C 2WT1A 3N9NA 1S0FA 1MZ6A 1GZCA 5C4JJ 2A7AA 3VBFA 1ND2B 2MBFA 5B2GB 1W36C 3CZJA 4LOCA 1AYN2 2WYFA 1OFNA 1H8VA 3RQ0A 4AFDA 4EQVA 5FKNA 2IS2A 5FK7A 3CO7C 4XXPA 4COWA 4FX0A 1XX5A 3KE2A 3HN3A 3IDCB 2G19A 3ZQIA 1V9U2 1Z67A 2Q4SA 1B09A 1KQ8A 5BNNA 3PIGA 1DZTA 2V4VA 5FP9A 1PVC1 2JA8J 2STTA 3I55I 2WBMA 1FOD3 2YC0A 3ES4A 2XWJB 2BWCA 2BWAA 2GMPA 5CVUA 1MBEA 3TQNA 1IHMA 1N47A 1OH4A 2QQ9A 4CSWA 3M1CA 1BK0A 2EV5A 3OS2A 2XVKA 5JVVA 1K42A 3VPRA 2OUHA 4N8MA 3OYJA 1SZBA 4LG3A 1JJ6C 2X5IA 4SBVA 1WJEA 3WINE 4RMNA 5IT3A 1MVQA 3S15J 3OF1A 5D8AA 1UOGA 4XKVA 1IS5A 5K0UC 1TWAJ 1MS1A 1BK1A 3NO8A 1T8IA 1JXNA 5IK5A 3A22A 1RRJA 4LO6B 5GAHJ 1NXMA 3DXUA 3K48A 1W5TA 4FE7A 3BP8A 1CAUA 1S5LC 1OLMA 4AEDB 3RKYA 1IRFA 5FWJA 4AQSA 4X8NA 3LSDA 2QM3A 3ZYIB 4EN8B 3JRIA 4BCUA 2XQXA 1RIRA 2K3FA 2FJ1A 2HWD1 2MEV3 4JX0A 3ZFFA 1QGPA 4ES8A 5EJZB 5D8KB 2CUEA 5BNOB 3T5XA 3MAJA 4AFCA 5LA9A 3BOQA 3PUSA 4QX8A 3AKSA 4XUQA 3QH7A 4H4KC 2Y6GA 4BQ1A 2ME6A 3IT8A 3Q8AA 1YUDA 4EMSA 2E7WA 2M4GA 1YRZA 1V00A 3HOXJ 4DOUA 1W36D 5FYBA 2CFOA 3PNTA 3SH5A 4FAHA 4XXAA 2NMOA 2V4AA 2NRAC 1VBB3 1AR71 1MSEC 4WK8F 3CDHA 2RS11 2R7TA 2R7DA 1UOJA 5C4WB 3I3BA 3INAA 1E2XA 4LLOA 1JYXA 3HOBA 1W03A 1FI2A 3W2VA 2W68A 1DQ6A 2RS53 1MMNA 3IAM2 3I64A 1OCPA 3DPLC 3AZWA 1OQDA 4B3AA 1BW6A 4S2GA 3OS0A 1H9WA 2VPLA 5D5UB 1RL3A 3CCMI 1GFF2 4PIZA 1C0WA 4D9JA 3CUQC 1APLC 4NRQA 1WWYA 4AFBA 2EF6A 1E5RA 5D5WB 3ZYBA 2TBVA 1W2AX 4JDNA 1OLQA 4A3ZA 2K9SA 4QQLA 1JOPA 1IN5A 4P96A 1ZZ8A 3HGYA 2JDKA 5E6HA 4RQPB 2GC3A 4IEWA 5FZEA 3E6BA 4K8RB 4PIXA 1D4M3 3N05A 2F5VA 1SD6A 2PLV3 2JZYA 5LBBA 2ENRA 3VEPA 3CBNA 4NWWA 3CP2A 4ASLA 4GB32 5EYYA 1IDYA 1YX3A 3U2RA 1IG7A 1E5SA 1ODNA 1ZBE3 4AI1A 3MI8A 3ORJA 2ESHA 1XD7A 4XDPA 3O1TA 2EIKH 1R1A3 1UQXA 2WAQA 5FMOS 5K9YA 1UY4A 2HDWA 2OQ7A 5BUVA 4DXRA 3SFZA 2XAQA 4CDWB 2Y6HA 3ACFA 4O9EA 4XF0A 3OBAA 1OVSA 3MZYA 1UMIA 1EA3A 3EHKA 4S2HA 2JICA 1J75A 4CDQA 2ZA9A 2ET1A 4LBQD 1W4MA 1U5XA 4OHWA 2CW0F 1JKOC 1C4RA 4UOJA 3A7QA 1GOGA 2X8KA 3MPBA 2FOKA 4GH4B 1GANA 5FV3A 3USSA 4Y52J 1NK2P 2E34A 5LBCA 4CZZA 3VBSC 3GBFA 2JDYA 5KAFC 1K4SA 4CEWC 3O12A 5EP9A 1PIV3 4D6RA 3IB3A 4YM0A 5TSWA 1B8IB 4ZU7A 5HBAA 4Y1UA 5F3GA 4YZ5A 4EJWA 2QBXA 1D5YA 2RV9A 1RUE2 3AL0B 4X6QB 4KNYA 2HOSA 5I0RA 2LY2A 3KPHA 1VZ0A 4HF2A 1C8M1 3FXLA 2F5FA 3O2PE 1BI1A 3LKJA 3OYFA 1JZ5A 2DPDA 4U0YA 3IAPA 4GJYA 3K4NA 3VGIA 1GNYA 1XU1A 4HSJA 1IS4A 3I9V2 3LOIA 1UF2C 2LKSA 1U6GA 4XFBA 3GFIA 3F95A 1KGYA 5EFUA 1NTCA 3I2JA 1VBD2 3MDPA 2VZSA 4YW1A 1PZ8A 4AGGA 1VB2A 2BBYA 2CYFA 3NKGA 5JSRA 2P5VA 4MHUA 3K1NA 4LD5A 2HH9A 4MADA 5ERLA 2NZ9A 5FLMJ 2WDBA 2BE5F 2VKHA 1D8JA 1MIJA 4FSJA 4CXFA 5IPAA 2R1BA 2E7XA 1U2WA 4EROA 4LK0F 1UZZA 2EZHA 4IF4A 3DPUA 2PAKA 2AENA 4MGTA 2DW4A 3AZVA 1BJQA 4BY1J 3ZSEA 3DYPA 1I1EA 3RI8A 1WGXA 5K0UB 4UV9A 3MF9A 4RGAA 3NRVA 1AA7A 3OPZA 1E5IA 1PM7A 3KZYA 2XSJC 4K7JA 4U2AA 3KCCA 2KXLA 4U0WA 3TBDA 5C71A 3Q0VA 2VZ3A 1H4HA 1WUVA 4AEMA 1TZLA 1OPMA 1LR5A 1MS8A 4XZUG 4CDGA 5M3FJ 5LA0A 2X5IC 1H6XA 4QIWN 2CSGA 1SANA 4XSXF 4QPWA 3QPSA 1BBYA 3KWVA 5LEJA 4HBNA 2K86A 4XRMA 2M0MA 1TME3 5FO5A 4BQ5A 5AC93 4AW7A 3HB9A 3UT0A 1WMXA 3B94A 2VXDA 4C9YA 3EB7A 1IZ3A 5BPXA 3HGGA 2A68F 1ZYRF 3C7OA 4M3GA 2A5ZA 3ABUA 2DYSH 2D44A 2D7FA 2ZJCA 2XB6C 3VYTB 1S0GA 2YUSA 4EJUA 3KEOA 2GP3A 2W94A 5F0CA 4MHRA 2WWYA 4Z8BA 4KBBA 4FAGA 2HWVA 2WLQA 3CJNA 1MZEA 2VQAA 3GTMJ 1G8XA 3OIOA 1MS9A 2J1UA 4GRIA 5DAWA 3K4AA 4RFRB 4EVIA 1DGRA 3EYIA 1WI3A 4TN7A 1W0NA 2VOXA 1T2KA 2DAOA 2BERA 2VUMJ 3B6AA 4DNYA 1NA1C 3I59B 3AL6A 2VE8A 3BTCA 3IKTA 1DYPA 1NY71 1RMU3 3DTEA 1RUF1 4UY8I 4GAZA 3AZZA 2LR8A 5KR7A 3P3PA 1FATA 3WD5A 2LSOA 2CWSA 3ZYPA 5JZGA 3COAC 1MH3A 1YYNA 3TNPB 3O0WA 2JUGA 4M6YA 2KIFA 4XUOA 2VMDA 3CUQB 1SHWB 3GLXA 4NHYA 2Q8CA 2R061 1BIBA 2VD7A 1Y9GA 2JX9A 4LOTA 3MGUA 2L9NA 4FQGA 3HBZA 1COV1 1STZA 4JHZA 1CAVA 4A3GJ 1STMA 4XF3A 1O4TA 1RUG1 1OLME 2WLPA 1G3WA 1REFA 1LOCA 1DHKB 2B7YA 2E1NA 3M7AA 4C91A 2WBKA 1H0BA 5IP9J 4Y3OA 4MXWA 2ELHA 4HV5A 1NH3A 1PM4A 4RL7A 1WJAA 1Q8SA 3HM5A 2L54A 2E7TA 3HT1A 3EUHC 1DQ1A 5FD6A 2A1XA 2ZHNA 1C8M2 3ZPOA 1SLLA 4QXCA 4WM8A 2WWJA 3CQZJ 3PUHA 2DCTA 1K83J 2I8DA 2HDDA 1VQ6I 4CE8A 4MFEA 3JRFA 3ZMZA 1ASJ1 4XCAA 4IGOA 2ZXIA 4QLCU 3S3NA 2O9LA 4QPYA 1TP4A 3P5BA 3VBSB 2A3WA 3T0DA 3QH6A 1NAEA 2DI3A 4PSXA 2FA5A 1U9OA 4C2UA 1L7QA 3O1RA 2Z42A 4CDQC 1AKHA 4Z6YA 1CGPA 3RWKX 4I01A 1Y0UA 2K5CA 3CC4I 2DVFA 2FDJA 1WMFA 2HQAA 2PTMA 1ZG3A 1TEIA 4IV1A 1VQPI 1R00A 1JOBA 1GYKA 2BFUS 1BOAA 4Q4W1 4GQ7A 1AYM2 4S05A 2OYZA 2ISYA 2CV2A 2ERFA 5LW9A 1W2NA 5J3UA 2QYOA 3BR2A 4CZCA 2D5HA 1AXKA 1H1AA 2XV4S 3GJAA 1LEBA 3CMAI 1DFQA 2HPIA 3CCVI 3HXLA 1Z77A 4Q4V2 4PBPA 2DCYA 2KZGA 1RZ4A 3D1NI 1C57A 4AFMA 1K78A 2R7OA 4BAYA 4YW5A 5FYHA 1YQCA 2IXKA 4BUPA 4Q0SA 3T2TA 1PVC3 1PP8F 4M3EA 2VCCA 4NHKA 2D3RA 3S7IA 1QA6A 1VQOI 5JCTA 2WA4A 2VGDA 2DK5A 4XLCA 1JW6A 3GO5A 1G9CA 4PF1A 2HVSA 5LATA 4QQHA 4W6WA 5EQUA 3BJ6A 5JXIA 4B48A 2KPMA 1E3OC 3TGNA 2DDBA 3BZCA 4N7IA 3A1YA 3MUY1 4LLNA 5A32B 4EN6B 2JEMA 1FOYA 1YCIA 3FXJA 1OR7C 1G4DA 5K8SA 2HVQA 1ZRFA 2D93A 1NCRC 2ET7A 2QQPA 3CLQA 1MS4A 3D0SA 3BLYA 4QT6A 1R1TA 1B72A 1ONVA 2X5IB 3OR2C 4K3UA 1XDSA 5DUWA 3M07A 4QPOA 3TEZA 5D8AB 1I39A 2JENA 2QKLB 4QXBA 2VR4A 4FX4A 1OLRA 5HPOA 3GZUC 2IW5A 1W99A 5GPCA 4TTGA 1PK6A 1NQJA 4DYQA 2HWD3 2R7SA 1EH8A 2DCZA 4P9YA 5FZOA 1CAUB 1ULCA 1ZREA 2NVYJ 4N9HA 3AYAA 1Z78A 1QVUA 3KV5A 2E1OA 3ZQQA 1W8UA 2TDXA 3BROA 2HEYF 1HB3A 4QDSA 2DA1A 3FKIJ 4CCKA 4HFSA 4G9YA 5L73A 1HOMA 3POBA 3U75A 3ZCOA 2DPUA 1OFSA 1MDMB 1H1IA 4Y20A 2YDEA 1GSLA 1BEV1 3WQ0A 2GC0A 3PUAA 3GFLA 4AYBN 2G0EA 1NA1B 3FM3A 3OYGA 1AR73 2RS13 1GUUA 3NV2A 1NLQA 2GQQA 4P08A 2DN0A 1ZZ7A 2ZX3A 5FY7A 2BOIA 1EYBA 2HEOA 2CHHA 3TBIA 5HS8A 3JB4C 3A4CA 4LR4A 3IPVA 1BC8C 2RJLA 3LPGA 4QM9A 2YU3A 2YX7A 4FFHA 3VDAA 3VB2A 1F43A