3N4MA

E. coli rna polymerase alpha subunit c-terminal domain in complex with cap and dna
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
203
structure length
203
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combined structural model for a transcription activation assembly
rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords Catabolite gene activator
total genus 63
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3n4mA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3n4mA01
1WGPA 2I45A 4M73A 5H20A 2XUBA 4MH0E 1KU2A 2O03A 1ULYA 4WK8F 5FD5A 3LSTA 1G3YA 1OYIA 4A12A 3E5QA 5L3BA 1FSEA 4LEJA 5DEQA 1ZZ7A 1ON1A 3ECOA 2RDPA 5HDKA 2EB7A 2JTVA 5BXXA 1H1MA 3I7DA 5C8WA 2ZCWA 1BIBA 1Z6TA 4FHTA 3TNPB 3B73A 3COAC 2HR3A 1YS7A 4FAGA 4IERA 1W4MA 3V8KA 3PFIA 5DCFA 3WE3A 1Q3EA 3FFQA 5E8GA 4MUVA 3DP7A 3BPVA 4I7HA 3ML6A 2GZWA 2OD5A 1W5SA 3NVCA 2EFNA 1PM7A 2VOOA 2J5PA 4KT5C 4QGLA 4M9SA 4L5IA 2HTSA 2JPBA 3ETQA 2PAEA 4G7ZF 4Q0QA 1JUHA 4HF0A 1ZLJA 1F4KA 5I8YA 5JR7B 3J81K 2C0ZA 4GCVA 1K6OA 2L4MA 4RB1A 1BM9A 3M7GA 3TKYA 1J3PA 1Y9QA 2PMHA 4HV6A 2CAVA 1BIAA 4Q29A 2O3FA 3C18A 1ZRRA 4H0EA 2MBFA 1FBSA 5KK1A 1JHHA 5HDGA 2QQ9A 1FPQA 1YW8A 3UKNA 1U12A 4HN1A 2WTEA 1TBXA 1J2XA 4GGGA 4LG0B 2UYBA 3GWZA 1UW8A 3CO7C 4META 1LDKB 3CL1A 4L11A 1HSTA 3JZVA 1JHFA 1QPMA 1CAUB 4KU7A 4A5MA 1B1BA 3GXOA 1FP2A 5CVVA 1FBQA 2ESNA 3FXQA 5H6QA 4MEYF 2GQQA 1DGRA 3ABTA 4PJYA 4CYDA 3O2PE 5D5WB 1X7NA 2OA2A 2WFPA 3CJNA 2O61A 1OYYA 3CUOA 1A04A 1HXDA 2EA4A 4MHGA 1KA8A 1X8EA 2PN6A 1MD0A 4GULA 4X6RB 1ZHFA 2LKPA 4KUMA 4ESJA 2X0LA 2CO5A 4Q0PA 1I1SA 1J59A 5FO5A 2FNAA 4KYWA 4L0ZB 4MGRA 2IA2A 3WTZA 1XN7A 2ETEA 1FXZA 1BJAA 2M30A 2G9WA 2ZKZA 4GYGA 5LLQA 2XAGA 3HIFA 4JBAA 3OD0A 2XHKA 4ONUA 4E2QA 3ULQB 1BI0A 4IESA 2COMA 4B09A 4IEUA 2EAAA 3DL3A 4IEOA 2PYTA 5E16A 4P55A 1AOYA 4KIGA 3KE2A 3FM5A 5L3EA 4ZU4A 2L02A 4OIPF 2PBIA 3LAGA 2FMYA 2KXLA 3OCPA 1XE7A 1JE8A 4XBFA 3FF5A 4EQQA 5HLGA 4BH9A 3H3ZA 1V3FA 2JT1A 4I01A 5ILUA 1O3SA 2PQ8A 1CF7B 1LNWA 3H8UA 1HKSA 3M8FA 5J6XA 1CAWA 1DGWA 2Z2SB 2CWEA 3DPTA 2STTA 2LNBA 2VQAA 1ZZBA 3TOAA 5I91A 4DINB 3RKXA 2IA0A 2XGXA 1QXJA 4AIHA 4NQWA 4ETSA 3M8EA 4FT8A 4EROA 3BOQA 1XSDA 2RC4A 1PUEE 4UV9A 2D40A 3WU0A 2DK5A 1NXMA 2E1CA 1O3RA 1R36A 3GW2A 4UBHA 3ES4A 1FLIA 2VC1A 4BHBA 4OMZA 4EGYA 1Z91A 4ENKA 3E5XA 1VTNC 2RN7A 2E9QA 3HT1A 4YSFA 4MTEA 5IT3A 1MDMB 1OPCA 4M71A 3ES1A 4KNYA 4LK1F 4AIKA 2VBXA 2D2WA 3LQQA 2FF4A 5LEJA 1CX4A 3E6CC 2ELHA 3ZP5A 5DCMB 2BEOA 2XVCA 3BP8A 5DYMA 3FJSA 5FPZA 3IKVA 4EJWA 1SMTA 4L9NA 3TO9A 1X3UA 1FC3A 4A0ZA 2FXAA 4CHUA 4MQVA 3J7AO 5C6CA 5TJJA 3MCZA 1R5HA 4IEXA 3F72A 2D45A 3H1MA 2Y0OA 4A0YA 5I0TA 2EJRA 3C7JA 4EVIA 2CG4A 3DKWA 2M8EA 2V1UA 1Z7UA 4HBNA 1O7LA 2G7UA 4YYOA 1H1IA 1E17A 2WC2A 1RUOA 3D0SA 1MKMA 2HFHA 1ZAOA 1YFUA 2ZBKA 5FD6A 4G7HF 4IRIA 1P4AA 2KIFA 2MC3A 4WBBA 4BNCA 1KQ8A 5F1RA 3FZ3A 2V79A 4LA2A 1T0FA 5KBFA 4NHJA 1XMAA 1U5TA 2OBPA 2BYVE 4NB5A 3BB6A 4NVPA 2ZJ2A 2PFWA 2RKHA 1ZVFA 4XFGA 5JAXA 2Q0AA 3OF1A 3NJZA 4TLFA 2PHDA 1EV7A 1ZX5A 1Z6RA 2NNYA 1X82A 1QZZA 4U0YA 3VODA 4KMFA 4YG2F 4Q4ZF 5BY5A 3ZQ7A 2H09A 1XGNA 1ZGJA 4N9IA 3TDZC 1OMIA 3NL1A 1YG2A 3ZMZA 5JFRA 1EH8A 1UCRA 3KP3A 5HS7A 3H1WA 4RB3C 4XFCA 2HTJA 2BNMA 3Q9VA 1MZBA 4BIFA 1FYKA 4QMAA 2O8XA 2YPRA 2GC1A 2EV6A 1EP0A 5D5VB 3P7NA 2V6CA 3HHHA 1ON2A 5A2QK 1XDSA 5TRDA 2J5OA 2Q1ZB 4M9ZA 3KGLA 1SFNA 2GH2A 3CLPA 2NS0A 1QXRA 1RGSA 3DPLC 4HX4A 5DUIA 4Q0VA 2BBYA 1O5UA 3V7RA 3FHZA 1HQCA 5J7MA 4QXKA 3K1MA 1I1GA 2D1HA 3BWGA 5DDGA 3I53A 2MD5A 1YWKA 3SCFA 3H1YA 3EYYA 1D8JA 3WG9A 5CYVA 2AS5F 4MX3A 1K78B 2DLLA 5LGTA 2W84A 1KYZA 3S7EA 1UPIA 3ZDSA 2B9UA 4G7OF 3I5UA 3VFZA 4KWLA 4I0AA 3FZVA 1VR3A 3GX4X 2OQGA 4Q0UA 3IRQA 4PGGA 4P9GA 4WVZA 1BBYA 2IXJA 1ZARA 4QGNA 3F3XA 1FYLA 3S0MA 3K1PA 5FDBA 1ZRDA 4QLCU 3RZZA 3MZYA 1WQ2A 4QX5A 3ELKA 3DQVC 1BI2A 1P4WA 3P9KA 2KIMA 2QBYA 4XFIA 4Y17A 3ROUA 2DCTA 1YIOA 1YHFA 1WI9A 5I93A 1IW7F 1IXSB 4EV0A 4J1XA 2P8TA 1FYMA 4HSJA 4LUMA 2M5WA 4S05A 2W85A 3WGHA 1ZLKA 1T6SA 2D1VA 3TNQA 3MPBA 1SAXA 2DFIA 2HQRA 3I59A 3TO6A 5DD8A 4XRFA 4LB6B 4ORFA 3IC7A 4HX8A 4XSXF 5D8LB 3QPHA 1IN4A 4J1WA 4LG0A 4EJTA 2IRFG 2QCSB 3F8BA 1IN7A 5AVPA 4A5NA 1FOKA 3J81Z 4O3MA 2OPKA 3U2RA 1HSJA 3M3IA 3RI4A 1W7PA 5FFZA 3R6SA 4JVAA 5D8KB 1OYWA 3QU3A 3FMSA 2Y48A 3H7YA 2DPUA 3ISPA 5E18F 3Q9SA 1SD4A 3SXYA 4CGZA 2DQRA 5HVQC 3SHRA 2O0YA 1IPKA 1GQGA 2L54A 4EWEA 5CADA 1YO5C 1QO0D 4BYYA 2F5FA 4AVPA 3FXRA 4XF4A 4L9VA 3DV8A 2VE8A 2HKOA 2PG4A 2NAZA 1J3RA 4KMUX 5AIPA 2GXBA 3GYHX 2DBBA 4H7LA 4UNOA 1XGSA 1XD7A 3WTWC 4MGYE 1ZNPA 5L3CA 3SHFA 4K8FA 3SZPA 1S7AA 1MJ9A 3K0LA 3GFJA 5BPDA 4QWQA 4FAHA 2DT5A 3V7CA 3JTGA 3E6BA 2MH9A 2IVMA 3BU7A 1TQMA 5FCCA 3CEWA 3WW4A 5EFUA 3LA2A 4AQ6A 3VB2A 4WXDA 4OFGA 1V4RA 1R1TA 2MLGA 4LJZF 1OFNA 5D6EA 2YX4A 1DPRA 3EYIA 4PIXA 3SXWA 4HVRA 3GLXA 3WTVC 4L9TA 1IUYA 3KP5A 4IEWA 2JPCA 2GU9A 4RB0A 5LRRA 2KIUA 2TDXA 2K02A 2QQBA 2ESHA 4KFCA 1QNTA 4WXHA 5FQ0B 5DUKA 2A5YB 2PLYA 5E1WA 4HN0A 3TDUC 5JSPA 2CFXA 1EYBA 2M87A 2VECA 2K4JA 4AWXB 1Z05A 5L3GA 1CAXA 2IXIA 3WTSC 1QBJA 3D82A 4IF4A 1G4DA 1IXRC 2HQNA 4PCQA 3DN7A 4Q5SF 1J7KA 3EDPA 3U11A 3WE2A 3EO6A 3HQXA 3HUGA 2OZUA 1TQ5A 3M1EA 4EM2A 5LGNA 3LQRA 2A3SA 4ZYHA 1UB9A 3ECHA 4WX9A 3IKTA 4MNUA 1F1ZA 1IRFA 1T39A 4OU0A 3BPZA 1OKRA 4EGZA 1HW1A 1YS6A 1NE6A 4JQFA 3WTXC 1USTA 3EQEA 4HF2A 5DV5A 1UHMA 4YIFA 2VBYA 4O9GA 5KVRA 2W57A 3MFKA 4YIIA 3G3ZA 1BN5A 2FRHA 4Z82A 2VT2A 1QWRA 4MGIE 4ZU7A 4E70A 2P7CB 2ZKLA 3KEOA 5H6RA 5HS9A 3MYXA 3C1DA 3L7WA 2FQPA 5DCMA 3RKWA 1Q1HA 3SCGA 1YFYA 4ZYDA 5KHKA 3CF6E 2K9ZA 4Y15A 5D5UB 3HTUA 3L2HA 1H0MA 4RGXA 2DPDA 2M1BA 5EZWA 1IN8A 1S6LA 1U2WA 2W24A 4CZZA 3LWCA 1Z9CA 4RGSA 3JTHA 1ZRFA 4HF1A 3E6MA 4HBLA 5DD4A 3PLQA 3CUQC 1XRUA 2A69F 1XMKA 5L3FA 4LUKA 4HDUA 5IT9Z 4LTAA 3K2ZA 3KCCA 4YARA 3BPXA 3I58A 1ZGAA 1STZA 1RNLA 1MJAA 1YW9A 2D93A 3IHUA 3FE5A 4L2NA 3ZMVA 3R0JA 2MNGA 1J1LA 1YFWA 2IC1A 3HSFA 4LA3A 4IHSA 1QQIA 5I8TA 3R0AA 1FZPB 3KGZA 4AXOA 4XF9A 1U5TB 1Q5OA 2KJCA 5ILSA 5FB2A 3F8CA 2LDUA 2R3SA 2VODA 3E3VA 3HYIA 2UY9A 3ELNA 3ZPLA 5LHHA 1BC8C 1SMYF 1LJ9A 2D5HA 4OMYA 2HS5A 4GYIA 3IIAA 2QYOA 4ZYEA 4I2OA 4N0BA 4O5VA 4CDGA 2N7GA 1SFEA 4WZCA 4R52A 2XLAA 4IRGA 4M72A 5J8FA 3F22A 1DZTA 3KETA 5T3NA 1SD5A 1BI3A 4ENJA 4YFKF 5LHGA 4E2GA 3MWMA 4XF3A 4MTDA 2ETHA 2NNNA 2B8MA 4BQAA 3F8NA 3O6BB 4ENNA 4D7TA 5AIQA 2QBYB 5JSRA 1XGOA 3CO6C 4I02A 4JTNA 4RAZA 4XFFA 3UKVA 2LSOA 1R58A 1FT9A 5K8SA 2EA7A 5ICEA 2CSOA 2XRNA 4UVAA 2Q8KA 1EH7A 1ZN2A 5D1IA 1IZ1A 3REOA 3QU6A 2A6EF 1O57A 2XASA 2A61A 3JAMZ 1F5TA 3L9FA 1HW2A 4M6YA 2K0GA 4MZUA 5BS6A 3KP6A 2ATFA 2ADUA 5L3DA 3FWEA 2F2EA 3WU1B 1JXSA 2Z69A 4ASNA 2Z99A 2CGPA 2B0LA 3I59B 4Z2YA 1FSHA 1IRGA 4DNCA 5BUVA 2RV8A 3DFGA 4LLLA 1LDJA 2XAFA 5D6FA 1H9TA 3E6DA 1HKTA 1P2FA 1W7PB 4P96A 4P9UA 3WGIA 4HW0A 1GQHA 2P6TA 6PAXA 3U1DA 4Z07A 1ZZ8A 2YX7A 3RKYA 1CF7A 2QQAA 4U0VA 3NRVA 3KMHA 5BOXA 4YNIA 2PFBA 4ZZDA 4D0PA 1J75A 3OV8A 2K27A 4L18B 2IP2A 2R7DA 1B9MA 4AVBA 1ZG3A 5CVIA 5CU1A 5CVJA 5EEGA 3H7JA 4KIFA 3B02A 2QLZA 4PIYA 1Q43A 3LFKA 1HBXG 1D3YA 4B8XA 2CV6A 5LRSA 2QVOA 2X4HA 4D7SA 4GXOA 3T5XA 2E7XA 4AQ2A 2HZTA 3F8FA 1ZZ6A 2O1QA 3ERED 2W25A 4R1HA 4WF2A 4QM8A 4B29A 3NEUA 4G9YA 2VONA 4UBGA 1MDMA 4WXCA 4S04A 5ERIA 1J3QA 4IEZA 3PQJA 2ET1A 3I0TA 1DPUA 3M9AA 2ZNZA 2OZJA 3R61A 2VE9A 5J3UA 4PGHA 4BHCA 4WWCA 3SCHA 3PNAA 4Y13A 2FMLA 4EM1A 2UWMA 1SFXA 2L4AA 2RNJA 4JV4A 3T0YA 3ZN1A 1TLHB 1K78A 2O6GE 1ZG5A 3KLNA 4GO1A 3OGJA 2IPQX 1KU3A 1HW5A 2KRFA 3BJOA 1Z1DA 5E17F 4EM0B 1LVAA 2IA1A 1UD1A 3VEPA 2F5CA 3CLOA 2YR2A 3ACLA 3I71A 2UY8A 1Y0UA 3HRUA 4LFUA 3MDPA 2XAQA 5ICGA 4OIQF 3S7IA 3GF2A 2P17A 5A2QZ 1XB4A 3QACA 2ZXJA 3HRTA 1T98A 2HYFA 2Z9OA 1LKNA 3BZ6A 1FX7A 3LZZA 1NHAA 3QRFF 2GC0A 1L0OC 3NW4A 3QAHA 2VBWA 1WKMA 2Y75A 2PAMA 2BV6A 4HAMA 2M45A 4WCGA 1S3JA 3T8TA 4RB2C 4XETA 3RPQA 2XV4S 3H9AA 2BE5F 3WODF 3DXJF 2PA7A 3TOBA 5FPXA 1R1VA 3GFLA 1S29A 2NRAC 2VXZA 2JSCA 4PIZA 2XIGA 2B5HA 1IN5A 1ZG1A 2GC3A 4CICA 2ZFWA 1IF1A 3HOTA 1KYWA 3V8JA 3H92A 2DTRA 2EV0A 3ZMDA 2QM3A 3L09A 3U0ZA 1RI7A 4K2EA 2O8QA 4XLPF 3H50A 2GAUA 3SFZA 3AAFA 2R7FA 4LMYA 3SQNA 3IWZA 2Z33A 2QVSB 4YRDA 1ZRCA 1QY4A 3JAMK 3WW2A 4Q47A 2XL9A 5HS8A 1GXQA 4IPAA 3F8MA 1VP6A 5JSOA 4IJAA 1EH6A 2UXXA 4BXUA 3I4PA 2LF8A 3T1BA 4EWAA 5FLIA 3S2WA 4UUVA 4AVAA 3WTYC 3GZ6A 3IDBB 5E1XA 3U10A 1YTYA 3JSOA 3EHKA 3ABUA 4O9EA 1LEBA 2CAUA 2HWVA 1TW3A 5JI6A 1K7AA 3D0JA 3UKTA 1WRJA 2BGCA 1J9IA 1DDNA 1NZCA 1FP1D 1KU9A 3EJKA 4HDVA 2DK8A 3RTRA 3CUQB 1LB2A 1HKQA 2XLGA 1YLLA 3V4GA 1SD6A 4IHTA 1CAVB 4QGMA 3GFMA 1W5TA 2OA4A 2AXLA 3TGNA 4KDPA 3QP6A 3U9GA 2MH2A 2IW5A 4OLLA 3K9TA 1RL3A 2PQQA 4HA8A 3LWFA 2XROA 2CYYA 5K5OA 3GBFA 3WGGA 1MJBA 3BDDA 5BPXA 2EFWA 1J5YA 2FE3A 4LK0F 4XEZA 4CO8A 2H0VA 2PMUA 1FNNA 3ZMTA 3F6VA 4EJOA 3IL2A 4MEXF 1S7OA 2DW4A 5J48A 1RC6A 4IEYA 3I64A 5I8SA 2OAZA 4RAYA 2P4WA 4EMSA 1DP7P 1G3WA 4XF0A 3VHRA 3HHGA 3CTAA 2IXCA 1B9NA 4ZZLA 2BNOA 1G6NA 4ZH4F 2H94A 4L9JA 5KHIA 1KQ9A 3GZ5A 4OIRF 1U8RA 2K86A 3BROA 1YLFA 3Q5FA 3CDHA 4HQMA 2A68F 1F9NA 3QOPA 3TQNA 4HMZA 4U7BA 1U5TC 3LAJA 1IPJA 4IEVA 3V7SA 2XKPA 4IEPA 1YFHA 2EA2A 4A6EA 5E8IA 4RGUA 3WW3A 5J8CA 1B4AA 2GXGA 1RZ4A 2H27A 3W6KB 2RQPA 3F21A 1SFUA 3FHIB 2EFQA 3MAJA 5LBQA 5K1YA 2Q30A 2D5FA 1MGTA 4X6QB 4QM9A 4Q0SA 3ZMUA 1P4XA 2VOPA 3WTTC 5HLIA 1J0RA 3MQ0A 4RD7A 1U3EM 4XSZF 1I5ZA 4LLGF 2MLKA 5EEHA 4XF1A 3SMHA 2HOEA 2ZNYA 4LLOA 1FY7A 1ZH5A 5I0SA 4G8XA 3E5UA 1YW7A 4BAYA 3I54A 3EUHA 1JGSA 2FBKA 2KKOA 3LA3A 2P5VA 4KU8A 4KL1A 3PQKA 4A0XA 1PMIA 2HJIA 1U78A 2OU2A 1ONVA 4OINF 1REPC 4HSLA 1NYWA 3OTFA 2QENA 2FOKA 1XGMA 3FXUA 3GEZA 1GHCA 2F5EA 1WLTA 3HT2A 3RNSA 4AVCA 4HX7A 1TQIA 2IT0A 1TNTA 2UXNA 5KHJA 4JK1X 5D4RA 2BNNA 3IWFA 1S8NA 2MHFA 3L00A 4KWJA 4ESBA 1O4TA 2HKXA 4OOIA 2IXHA 2JZYA 3GYDA 3RJPA 5E20A 1B59A 3SZTA 2VBZA 1FWZA 1ZZ9A 2E7WA 5K5RA 3USSA 1I27A 4LLNA 1CAWB 3LA7A 5CLSA 3IBMA 5D4SA 2XL7A 5BQTA 2K7LA 3FMRA 1YYVA 4KICA 3WW1A 2GIVA 5FGMA 1SD7A 3KP4A 1UHWA 4KN4X 2DQLA 2V1DA 4A2UA 4P5OA 4M74A 1LDDA 3LAPA 3FM3A 1PP7U 1L3LA 5HDNA 5JHUA 2Q4SA 2DU9A 2F5DA 1R00A 2STWA 2DAOA 4F7ZA 1OI6A 4I98B 3KEQA 1PP8F 4HV5A 4N9HA 3RDIA 2RVCA 4IEQA 3V8LA 2Q2EA 4R79A 3RIRA 4HVOA 4I3PA 3F6OA 5CVRA 1R7JA 5JR3A 2XAHA 3QP5A 3GO5A 1WA4A 4U88A 4IVNA 3EBRA 1P92A 1SEFA 1V70A 5K5QA 2ISYA 2F4PA 2PI0A 1UCXA 3K69A 4EJVA 1WSUA 2ZMEB 5ILVA 4MGKE 4I09A 4HZFA 2XKOA 5CVUA 4DQ2A 3R4KA 3D5LA 2YU3A 1DUXC 3J80K 4I0BA 5FFXA 1QZYA 1Y3TA 3M70A 4BHPA 3NKTA 2EFPA 4IRHA 3JW4A 5BMZA 2GA1A 3NSTA 2FSWA 1IAWA 5LEKA 3IRRA 4LULA 2PTMA 1EPZA 2H6BA 1B6AA 1RTVA 1XSXA 2Z5UA 1O5LA 3ZN0A 2QJVA 1D8KA 2A07F 1J58A 2FA5A 1NE4A 4UV8A 1KQ0A 2DI3A 3H3UA 3WTUC 3K1NA 1K79A 1X8MA 2P7VB 1TTYA 5D5XB 1CAXB 4EJUA 3HSRA 2Z3YA 5AONA 4ON0A 5LGUA 5HOOA 4F8AA 1DZRA 3KSCA 2EFOA 2YSRA 1IXCA 4FX4A 4XFAA 4UHTA 2QNKA 2FNPA 1BOAA 2VN2A 1ZYRF 2PHLA 1TW2A 5FQ0A 4YFNF 3G7DA 5IT9K 4Q48A 5FLXZ 2P5KA 2H6CA 2QWWA 4G6QA 1AWCA 4E2SA 2A6HF 2WV0A 1R1UA 1QGPA 2FU4A 3RPUA 4R8HA 3FX3A 4KWKA 1G3SA 3DF8A 3E97A 4HLXA 4PDKA 2ZMEA 5CJ9A 5ED4A 3OOPA 3C3VA 4JTOA 3GFIA 1T2KA 4IXAA 2L3DA 1G3TA 4LD5A 3R60A 1WWXA 1ODDA 3TO7A 3IDCB 1XDUA 5BV6A 1U6GA 3RYPA 1VJ2A 3BJ6A 1OD5A 3LOIA 3KP2A 2G7HA 4UXNA 4HYEA 1UIJA 1TQPA 2V1XA 2IXLA 5FLXK 2CW0F 2FQ3A 2GWRA 1ZZCA 2P5LC 4MV2A 3VOEA 4RGRA 4XLNF 2DO7A 2RGVA 1R22A 4TV7A 4XFBA 1BI1A 3W6JB 4FBFA 4ENMA 2GA2A 3RYKA 4U7DA 4U0WA 5FLJA 2E1NA 1C0WA 3GVAA 1YUDA 3P9IA 1USSA 1CAUA 2IJLA 2VC0A 2L01A 1W7PD 2ACJA 1OR7A 1R5GA 2FBHA 4OIOF 1BC7C 4M6XA 3CJXA 1RUNA 1EY2A 2MPFA 1LEAA 3F23A 4FX0A 4AIJA 2HEOA 1UFMA 4O6JA 2FEZA 5HI0A 3RYRA 1FI2A 1RIOH 2UYAA 4L5JA 2K4BA 4HVQA 3J80Z 2XLFA 1E2XA 3KZYA 4M9XA 4HLTA 2QUFA 3NQOA 2NYXA 2QZ8A 4AD9A 5HLHA 1H9GA 1I6XA 2ZO4A 2CQKA 4RS8A 2MA3A 2HDCA 2EVXA 2PJPA 1R23A 4ZYGA 1YQAA 4HQEA 3HOSA 2EK5A 4ESFA 5JVTA 3BCWA 5JCTA 4MQ9F 1GVJA 5ICCA 1KU7A 1SQ4A 2WWYA 2IXKA 3P9CA 4ZU5A 2FBIA 2OYZA 2HGCA 3HSEA 5BPIA 3EETA 3ZMSA 3EQLF 1LQ1A 4PZJA 4UVBA 4LB5A 1CGPA 5F6FA 1UIKA 1O3QA 2JRTA 1XSVA 3HTSB 2VPVA 2OZ6A 3JSPA 5FLHA 1LR5A 1PDNC 5ICFA 4KA4A 4UVCA 1IN6A 3DEUA 3C3WA 3O14A 2PEXA 4MGZE 1KGSA 2EV5A 2UZKA 2HYGD 4KN7X 5I0UA 1FBUA 3ST7A 2PAKA 3PVBB 4IETA 3MEXA 5E1RA 4HOBA 1LRHA 2LF7A 5I0RA 2Y0MA 1XCBA 3KZZA 3BJAA 3GUDA 1O3TA 1ZREA 4LGWA 2C6YA 2P6SA 3BALA 2GC2A 1GXPA 2EWNA 4UXAA 3N4MA 2QDRA 3HRMA 2XAJA 3T8RA 3L2CA 4XFHA 4G6DA 4A6DA 4P9FA 1O7FA 3BY6A 3G73A 1TNSA 3KFWX 3CO2A 2VT3A 1L3JA 2ISZA 2V09A 1YFXA 4CXFA 1P6RA 5F64A 4YFXF 2V9VA 1XE8A 3MZHA 3O3KA 1T38A 4HLYA 3FMQA 5LHIA 3HRSA 2KJBA 3QPTA 4EWDA 5KHGA 3KP7A 3N97A 2ET7A 3CUQA 5E1ZB 1CAVA 4G94A 3KLOA 5KHHA 1XCVA 2OQRA 4L0YB 1D5VA 2Q0OA 4KIBA
chains in the Genus database with same CATH superfamily
5IVJA 2I45A 2DUOA 3FLRA 1VNDA 1YRNB 1UXXX 1YJNI 1LAJA 2O03A 4WK8F 1JKRC 1LKXA 1A31A 3E5QA 4QQHA 3ZKYA 1FSEA 1GWKA 5G04L 2C24A 5HDKA 2EB7A 3U75A 2WZEA 2FD5A 2P3YA 2CV1A 4N53A 4QQ2A 3ECQA 3WG1A 1YS7A 4FAGA 1Y43B 4QPWA 4EZ4A 4C1WA 5IT6A 1W4MA 1AR83 1MVQA 4CYCB 4YW1A 3FFQA 3OBZA 4AQTA 1V5FA 3OYLA 3WDVA 1DQ2A 3HWJA 1XPWA 1L7RA 3KYDB 4QGLA 2P1BA 2JPBA 3ETQA 5CNAA 4JGZC 4FTHA 1F4KA 2ZMEC 5F5IA 3VDXA 2RNGA 1PX3A 4PQ9A 2M34A 2L4MA 1CN1A 5F1JA 2ME6A 5LBBA 3TKYA 2CAVA 2IVIB 1GZWA 1WI3A 1NCQB 2MBFA 5A80A 3SH5A 4QSHA 1HCRA 1ULOA 3PSIA 3KCYA 3V0BB 2WTEA 1TBXA 3PVEA 1WCQA 4E6KG 4LG0B 3GWZA 3RJRA 4EJRA 1O6UA 1SCSA 4XZPA 1TWCJ 3JZVA 2R073 1AKHB 1DQ0A 3CJRB 2WAOA 2LOOA 1OA3A 5ACA2 1FP2A 2VOXA 3ABTA 4GB32 4CYDA 1ETVA 2XAUA 2VZSA 1FV2A 2R5ZB 4D7NA 4PCRA 3CJNA 2VOTA 2R062 3AZWA 3W6VA 3AFHA 5K7FA 1HA8A 3LE0A 2WNUB 5CBLA 4YRVA 1X8EA 1MD0A 4GULA 3BTXA 2G19A 2LKPA 3K77A 1X1PA 2CO5A 3CC2I 1WMDA 4PHZA 5H9PA 1PO23 4KYWA 2QSFX 3IMMA 4E4ZA 2Y6FA 3IPVA 4M4PA 2LBFB 2ETEA 1FXZA 3DYMA 3I2HA 1BJAA 5FIXA 1W8OA 3VD7A 2ZKZA 1YXWA 3CESA 4JBAA 3OD0A 2XHKA 1EAH1 4GH4A 1GV9A 4YLZA 4E2QA 4IESA 2RAEA 4K40A 2Y6KA 3DL3A 4C2MJ 1P8JA 2PYTA 2Q8CA 4P55A 1AOYA 4ZU4A 1L7QA 4OHYA 4IZZA 4JHZA 3H3ZA 1V3FA 3LSEA 1OC1A 4XBLA 2PQ8A 2GBYA 2JK3A 1ZM1A 4FPEA 1CAWA 3EYPA 4YVWA 3ATGA 2LNBA 3N9MA 4XC9A 3KYCB 3ZVXA 1IGOA 1ZZBA 4D7YA 4OCTA 4DINB 3RKXA 4BJ0A 4I3GA 2XPUA 1QXJA 4E7SA 1DQ6A 2VL4A 3HD8B 1B35C 2X5IB 2LTPA 2OW4A 1X9TA 3WU0A 1PX4A 4IOCF 3LEGA 2WWSA 5DG1A 4D1QA 4Q4X3 3MMYB 3LFUA 3OS0A 4DIQA 3E5XA 1VTNC 2RN7A 3PUAA 1T8IA 1HLVA 3C7GA 3FUQA 3HT1A 1SLCA 3HL2A 3OIOA 3OYBA 4IHYA 3RFRA 5LY2A 2BUKA 4ET7A 4NO4A 2ELHA 3ZP5A 5DCMB 5C3EJ 3H8OA 2BEOA 5FWEA 5DYMA 2VMHA 2NVYJ 4CDQB 2J1SA 2X09A 4BK5A 3JCIA 3ZQLA 1FC3A 4A0ZA 4CHUA 2HVQA 4DZJA 1SBFA 4YW4A 2MG4A 1R5HA 1VFCA 2KRHA 2D45A 5LA0A 3WU2C 2JX9A 3C7JA 4EVIA 1UY4A 4LK7A 2M8EA 2OIIA 1O7LA 3CCJI 1SLBA 4YYOA 2CQNA 4QPQA 1E17A 3L1PA 3ERMA 2ADEA 3N35A 2V1NA 4CYCA 1WJAA 5A7NA 1AR81 1RUC2 5FD6A 3OSFA 1OHFA 1NY71 4H55A 1AL0G 1T0FA 5KBFA 1ULEA 1AVBA 4NHJA 2VLAA 4DZPA 2R49A 3AMHA 3GDBA 2BGPA 2G9GA 5J1XA 9ANTA 2DDAA 1MBKA 1KGYA 1GZ9A 2PFWA 1XNDA 2CWSA 4EATA 4G4FA 3DLLF 1H6XA 2Q0AA 4KNCA 2RS53 4DUXA 1TMF1 2PMZA 2BBAA 2NNYA 1VMFA 2ZB9A 3OGVA 3FXKA 1ST8A 3X2QH 1W3XA 4ZTJA 3VKFC 2V73A 2CQXA 1ZGJA 1W9FA 2CJJA 1I9RA 1RVF3 2VQCA 4I0WB 3AKZA 1EH8A 1AXZA 2DCEA 3NMBA 4BIFA 1W0UA 1FYKA 3OR1C 1WD4A 3C7FA 2NXNB 1W9TA 2GC1A 1EP0A 2K9LA 2EALA 3GBGA 3VL9A 1T0FC 2P3JA 3B94A 2DV9A 4OHVA 3VHOA 3AL0C 3HHHA 3P6BA 4LKFA 4NMIA 1RUH1 3WG2A 4CUGA 3S6PA 2QQVA 4LPLA 1XB9A 3KGLA 1POGA 5DAXA 1TNRA 2VASA 4HX4A 1AA7A 2JENA 1VBC3 1BYHA 1D1CA 5DUIA 4XRSA 2BBYA 2XOMA 3V7RA 1HQCA 1H1AA 2PELA 1I1GA 5DDGA 1HIXA 2OC6A 5FP8A 1U5ZA 2LS6A 2D7FA 2AS5F 2BJSA 5DZGA 1IV8A 4MLOA 4XOPA 2VUMJ 2D6MA 1K78B 2DLLA 1BK0A 1UL9A 4IGQA 3V0AA 2M8GX 4FQZA 1KRIA 3ZXSA 5K0UC 1LFPA 2B9UA 5ISLA 4G7OF 3I5UA 2FDJA 4AM3A 4I0AA 2D43A 4Q0UA 3IRQA 4P9GA 2QQMA 1UU5A 4XRMA 1GZCA 2IXJA 3DXUA 4NROA 4IX7A 3UGHA 3K10A 4E7IA 1FYLA 1QJU2 4JRAA 3S0MA 3ZQFA 2GXAA 3K1PA 1ZRDA 4QLCU 2OX0A 1ETWA 4BE0A 1A5JA 4N7IA 2KIMA 2NQYA 5FP4A 3Q0WA 4B4CA 2IBDA 3MEPA 2EAKA 5FY7A 1W39A 2M5WA 3WGHA 3BODA 4J19A 2QQUA 3QH7A 2HWD3 3MPBA 4PFOA 2HWC1 2BGOA 2VOKA 4ORFA 1R1A2 3MUZ1 4A3EJ 4LG0A 5AVPA 3MIEA 4O3MA 1N78A 2ES3A 1HSJA 4NN0A 2DCZA 5FFZA 3R6SA 1LESA 4HRIA 1OYWA 2Y48A 1F36A 1V00A 4ARYA 5LD2C 5E18F 2PLV3 3VWBA 3M8LA 3PUQA 5HVQC 3SHRA 2VAUA 2O0YA 1IPKA 1YO5C 4ZTFA 3H5RA 2BY3A 4OYUA 1DCSA 3AK0A 1VB2A 1MQTA 2VZVA 2BY0A 2DBBA 1GV2A 2RS51 2BVVA 1XGSA 1AJOA 4K8FA 3SZPA 1JU4A 3K4KA 1MJ9A 1W28A 3K0LA 2E2IJ 3ON7A 3GFJA 1RUI3 5BPDA 3JB8A 1FIPA 3G6JB 4DNYA 3OIPA 3E6BA 3BU7A 4XBQA 3ZXAC 5FCCA 3W2VA 2IFWA 1RUF2 2K9QA 2M4GA 1R1TA 3VBOA 2UUZA 4S2FA 5F3EA 4XABA 1PZ9A 2CWMA 3KVAA 4PI2A 4IO9F 2JPCA 1IG3A 2GU9A 2I10A 3ZQIA 2KIUA 2W9XA 5FUPA 1DGRM 2QQBA 2ESHA 4BJ6C 1QNTA 2AYHA 1RUH2 4JX6A 3TDUC 5JSPA 2X8KA 4ZXKA 2K4JA 3UETA 2XC7A 2LREA 1Z05A 5L3GA 5FMDA 1CAXA 1GP5A 1V9U2 4YIRX 3D82A 2DCKA 4IF4A 1WW4A 2JDNA 3NAPA 4CPBA 1IXRC 4Z6YA 4Q5SF 3EDPA 3U11A 4CCOA 1QOTA 3PL8A 3LQRA 2A3SA 4WX9A 3FK7A 2WAFA 2JDAA 4COUA 1P7JA 3PUIA 5LBEA 3GZTB 3IKTA 1JUMA 1F1ZA 1IRFA 4OU0A 1ENXA 3C2GA 4Q5OA 2BDRA 3WF2A 3WTXC 1USTA 5DV5A 4AZZA 3SKVA 3OYJA 2FRHA 5B1BH 1TT5B 1R082 5JZGA 4E70A 1VRH3 4FISA 5T54A 1U8BA 3DEEA 2KMUA 2DURA 4QQOA 3C1DA 4WVMA 2LR8A 5DCMA 1Q1HA 2EPFA 2ZGTA 1SACA 1AYN1 4Y15A 1RUF3 4RGAA 1RUG2 5JI9A 4RGXA 2DPDA 2NMNA 3D8CA 1SVOA 3VGIA 1TC3C 2ZBJA 1W6OB 3PUHA 1Z9CA 5FXWA 2IS2A 4RGSA 4F93B 4HBLA 3GJBA 1OA4A 1XRUA 2I74A 1SDWA 1QJX1 2CW8A 3GNEA 1OQDA 2WO7A 4YFZA 4YARA 5B5EC 1SCRA 3I58A 1ZGAA 4J6GA 1U5YA 1V6JA 2D93A 3FE5A 4IL7A 1GDTA 4LBKA 4NIAA 3ZMVA 4XTPA 4PFPA 2Y31A 1X9PA 4FSJA 1QJX2 4PSXA 5I8TA 1FZPB 3WG3A 3KGZA 4A3JJ 3AP6A 2ZHNA 3GGLA 1U5TB 2ZGOA 2CU5A 3MBWA 1ZA7A 4IXLA 2TUNA 3OGRA 2NS7A 1BC8C 5J4VA 1LJ9A 2R7UA 2DFBA 4YZ3A 5D2AA 4OMYA 3L9JT 5KWRA 2W95A 1T2XA 3NV2A 4CDGA 1YJWI 4R9BA 3OYIA 3HOUJ 4WZCA 1E3OC 4M72A 5J8FA 3I56I 1DZTA 1MVEA 3IPVB 4JP0A 3MWMA 3JREA 1LHOA 2B8MA 3POYA 4A42A 5AIQA 3VBFC 1XJAA 2VGDA 4RAZA 3UKVA 4DW6A 3CF5F 3OBAA 5A7WB 3MD2A 4UVAA 3S8PA 1SZBA 5FROA 1ZN2A 4RLQA 3S14J 4AQSA 1GQPA 3SQOA 3L2YA 1US2A 3IZOA 1B72A 2WDBA 3JAMZ 2D44A 1JKQC 1F5TA 3AZVA 2A6YA 4UAPA 2D6NA 5AFBA 2ATFA 2ADUA 2F2EA 3NWSA 3LKJA 4JGYA 4AC0A 4QU1A 1BLZA 1H2KA 1UZZA 4UOJA 4GMP1 3H42B 5A3NA 1W2AX 4DNCA 5BUVA 4DY5A 4LLLA 5JLWA 2J7MA 2YU1A 1V9U1 2BWAA 3MV01 4IV1B 2RV9A 1P2FA 1JTYA 1W7PB 2J22A 1ZR4A 4RM2A 4HW0A 1GQHA 3DGTA 1FOD1 4LMFA 3U1DA 3ZFFC 3PO3J 4LT5A 2W1SA 3V56A 1LGNA 1AXYA 1I3HA 3NRVA 5ACA1 1R49A 1Z7S1 5FJKA 5KCMA 3O0VA 4LBLA 1IKQA 4ZZDA 2M7BA 2R7SA 1D4M3 4HNUA 1Q8PA 4DYRA 3UJOA 3OYNA 3P1IA 5CVIA 2KHMA 5CU1A 1JYCA 2EQRA 4KIFA 1AYN3 1GU3A 1RUF1 1PNFA 2OS2A 2E51A 1Q43A 4AEDA 5FREA 1AKHA 2JWTA 2VO5A 4FPOB 5FRNA 1S2BA 3ZSMA 1WWYA 1WUVA 3ASIA 1D2SA 3NEUA 1W8TA 4G9YA 4DGWB 2VONA 4UBGA 1W8FA 5ERIA 2VUJA 4MGTA 1IG0A 2VJ4A 2F4OB 1K6YA 1DPUA 3M9AA 5F0FA 1LEDA 3LF7A 1IS3A 1GT0C 3DBHB 3VBUC 3VDBA 2DFCA 2VE9A 4KMQA 3SCHA 2FMLA 1NAEA 2IZWA 3T0YA 4BQYA 5H2FC 3ZN1A 3M3QA 3KLNA 3VDDA 4TSVA 1NG7A 3ZIXA 2IPQX 1KU3A 2KRFA 5E17F 2J1RA 2X51A 3UGGA 2F5CA 4FXKB 2Q8OA 2D6LX 2C26A 3F95A 3I71A 4DOUA 4LFUA 1WZXA 2XBO2 5FMOL 5A2QZ 2R1DA 3HRTA 2HWF1 4O7XA 3MKLA 3WV6A 2Z9OA 1D5YA 2KD7A 1LKNA 4QKDA 3BZ6A 2HQAA 4FO9A 3KD4A 3RZOJ 2NLRA 2AREA 5LCWL 2VBWA 3T0AA 3JD72 2PAMA 5K0UB 1S3JA 3T8TA 1PK6C 2VCCA 2VJJA 2W91A 4KWUA 2YUSA 5IHRA 3DXJF 1N1SA 1JKOC 2AEZA 1UQXA 1R1VA 2PHUA 3GFLA 1OKQA 4AI8A 5FO8B 2CUEA 2JSCA 1RKWA 2PHRA 1S5LC 1IN5A 4N43C 4C0HA 1R5ID 1NA1B 2DYRH 3SEEA 1UWWA 2DTRA 3NAPC 3M4OJ 5FAXA 5A33B 3BR0A 3L09A 4A3KJ 4E8DA 4P9XA 2HQ5A 3LSJA 1RI7A 2DA2A 4XLFA 3UNPA 2O8QA 2FJ1A 3T2OA 2ZX0A 5E3OA 2JUCA 5H9RA 2R7FA 4LMYA 3TOJA 4GMP3 3IWZA 3DCQA 2QVSB 1LOCA 1QY4A 1RHI1 3KVBA 1GXQA 4IPAA 2WWJA 5FKMA 3I4PA 5BNNB 1BJQA 2LF8A 2D6KA 5FLIA 1RUE2 3G1OA 4CEWC 4E4HA 2BOIA 2ZOEB 1F4AA 2WO1A 4MYEA 1HXS1 3U10A 2RREA 1YTYA 3EHKA 4LBMA 3ABUA 1KQRA 3OYHA 5ACA3 2AH2A 3LDBA 2VPRA 4IV3A 1YX3A 1N47A 4FE7A 1H8TA 5B4XA 1J9IA 1NZCA 2GN3A 5J1RA 1V55H 4IHVA 4M00A 3NV3A 2LKSA 2LBFA 1ASJ3 4QTRA 2E2HJ 2N8GA 2YFUA 1W5TA 2AXLA 4KDPA 3U9GA 4OLLA 5A3MA 1RL3A 1Q1VA 5DM7F 3LWFA 3L2QA 2XROA 3AJYA 3GBFA 3S3OA 5DTDA 2C1FA 3SISA 2ZJPF 4YZ1A 2EFWA 3C7OA 2B42B 2FE3A 3ITQA 2JE9A 1QGLA 3EUHC 1FNNA 3F6VA 4EJOA 3T4HB 4CEWA 5CFDA 4MXWA 2EF6A 5DDJ3 1RC6A 4GFBA 5I8SA 3S93A 1PO21 5DQ0A 1S0JA 2ZEXA 4EMSA 1Y39A 1NCRB 3UK9A 5JLXA 1NT0A 2IXCA 3K4JA 4ZZ8A 2B45X 4FPJA 2ZSIB 2AENA 3S1RJ 2VIXA 1AR82 3BZCA 1ODMA 1POV1 3PNVA 4PSWA 3KT4A 4Y1XA 2A68F 4NE9A 3QOPA 3TQNA 4IEVA 3V7SA 3K70C 1MZFA 3BTAA 2ZJQF 2X6OA 4C30A 2H27A 2RQPA 3QPLA 3FLPA 1WH7A 3PTRB 4R9CA 3F21A 4MXWB 3QODA 2WB1A 2W52A 3FHIB 2VQUA 5K1YA 1PZ7A 1MGTA 3N7KA 3AFKA 5GM0A 3WTTC 3MQ0A 3OL3A 2X5IA 4RD7A 5FYMA 1TWGJ 1OD3A 1PO12 2V5DA 4BOWA 4XJ8A 4LLOA 3BZKA 5I0SA 3ZFEA 1G59A 1W0NA 2YY1A 1YW7A 2DVFA 1GYKA 5FOJB 3EUHA 3LMMA 4IEJA 2FBKA 4C2UA 2E1OA 2P5VA 4KU8A 3QPSA 4NUBA 4PJ0C 1H4GA 1V5GA 1WPKA 4OINF 1Y4WA 5DAPA 4HSLA 5GZEA 3OY9A 4HNVA 2A5ZA 3ZQQA 2M0CA 3L2UA 3GEZA 5LZ6A 3I3DA 3HT2A 2P37A 1AU7A 4AVCA 4HX7A 3H0GJ 2HWF3 2IT0A 1TNTA 2UXNA 5HCHA 3W58A 1RUD2 2E60A 1H8TC 2NOGA 5JPNB 4ESBA 2HKXA 4LO6B 3SITA 2JZYA 2DDUA 3OYFA 2LM3A 5K7HA 1ZZ9A 2E7WA 5K5RA 3ZIWA 1CAWB 1VF9A 1JXNA 4YG0A 5EYYA 1LGBA 3O0XA 3VZOA 4HFSA 5IFPA 3LA7A 1MZ5A 2J1AA 4U87A 4NOTA 2XGEA 4EN8B 3AZYA 1SANA 2YHJA 4Y5Z0 1YYVA 1GWLA 5FGMA 4A2UA 1UHWA 1YIFA 2DQLA 5KAIC 4Q8LA 3RSJA 4KGGA 3LAPA 5FY4A 1FAYA 4RN5A 1FPN2 3ZR6A 4ZC3A 5FZBA 4N53B 4JDNA 1J83A 4GQ7A 2Q4SA 2DU9A 2F5DA 3RI9A 2DAOA 4F7ZA 2QCOA 1OI6A 1MBJA 4RMNA 2WO3A 3F9KA 4HV5A 2W08A 4IEQA 3GZAA 3RIRA 1O4XA 4I3PA 4LO7A 5CVRA 1R7JA 1OF4A 5EEAA 2XAHA 3GO5A 2PMZN 3BN6A 1TZOA 4AI0A 2WSUA 5IVYA 4B1LA 2ISYA 1C28A 3I4IA 1ND2C 4W6XA 2WQ4A 3K69A 4EJVA 5ILVA 2DT7B 1GFF2 2JG8B 3I9V2 4I09A 3PJRA 4MGKE 4DQ2A 2YU3A 5A7OA 4I0BA 5FOBB 1QZYA 3M70A 3NKTA 2EFPA 2GMMA 5BMZA 4QB2A 1ETOA 4JGYC 5KAFC 4RYDA 1EPZA 2A6VA 1B6AA 3OYMA 1WD3A 3P3NA 4UFJA 1ODNA 4XACA 2QJVA 1D8KA 3B00A 1DQ1A 1JYWA 2FA5A 3N9OA 3I3BA 1FJLA 4B4QA 3SC7X 3CCYA 4QWNA 4K3UA 3K2AA 4GB33 1X8MA 2PLV2 2XWJB 2DMQA 3RG0A 1YITI 3ZN6A 2H8WA 4G12A 2Z3YA 4CU6A 5AONA 5FP7A 2EFOA 4PDWB 3VDDC 1HN0A 2VN2A 4JGZB 1WMXA 1TW2A 5A7SA 2ID3A 4HETA 2M7AA 4YFNF 2CNAA 2XBO3 2P5KA 2KIQA 2H6CA 2X05A 3ZGKA 2LW8A 4D8MA 1OFCX 2WV0A 3OR2C 2XVGA 3RPUA 1F31A 3ACFA 4FFGA 1ZBE2 1IRXA 1C8M2 4PDKA 4RFT0 5CJ9A 2EIBA 4QX7A 3TL4X 3GFIA 1FNZA 4IXAA 1BVVA 1OQ1A 5IFTA 3TN92 1FEXA 4YVWC 1XDUA 1JBCA 1VJ2A 3BJ6A 4Y5SA 4F83A 2ARBA 2DCJA 3KP2A 4HYEA 1UIJA 3TRSB 1QJY2 2GWRA 3IV5A 3WSOA 4GKXA 3IP4B 3VOEA 4XLNF 3QD6A 1Z3XA 2DO7A 4TV7A 2R0HA 5JVVA 1YIPA 2Y34A 4FBFA 2R043 2EIJH 4AFCA 4XQFA 4U7DA 4AI1A 2JD9A 1G2HA 4NHLA 3P9IA 4DMIA 4GD4A 2VC0A 2JJ7A 4XN3A 5GTHC 1LU1A 3BTZA 5JI7A 3TWIA 1W0OA 4COWA 3G1MA 4KJZA 3C2UA 3WOGA 4CXXA 2HZDA 4GRIA 5GJ6A 1SPPA 2E34A 4FX0A 3H5AA 3ABKH 3BQYA 3NNGA 4BL0B 3BYWA 2ZEYA 2GMPA 2JG9A 4IE0A 1TT0A 1NTCA 4YEJA 3NQOA 2QZ8A 4AD9A 3BG6A 4A3ZA 5HLHA 4IE7A 1I6XA 2CQKA 3A1YA 3G1LA 1SVMA 1R23A 1LOFC 4PJMA 1K12A 2LY9A 5CPRB 3HOSA 3CC7I 2EK5A 1RJ8A 4OI2A 2E36A 1E0EA 4BDYA 2VZ1A 1SQ4A 3I2DA 2WQZC 2BWCA 2FBIA 3AKPA 4XKVA 5BPIA 1VBE3 2WZR3 4PZJA 4LB5A 3NKGA 4DOZA 2JRTA 2Z1DA 1Z7S3 4UVCA 1IN6A 4DUWA 3O14A 3I3MA 1OCZH 1KGSA 1CPMA 3AX4A 4Y52J 2HYGD 2PAKA 4Q2FA 4A7ZA 3PVBB 2DA7A 4IETA 3WNMA 1RETA 4MGQA 4XW3A 3DPUA 4HOBA 3W9AA 4RQPC 2LF7A 1BEV1 2ID4A 2Y0MA 2RQQA 3KZZA 3BJAA 1QJEA 2ZZJA 2KP6A 4FASD 2C6YA 2P6SA 3BALA 5DPNA 3ZXGA 1R093 2GC2A 1GXPA 1DBNA 2QDRA 2QQ8A 4XXAA 4A6DA 3A7QA 5FR3A 2JMWA 4BXFA 5FZOA 3G73A 5CYYA 2VT3A 1SHWB 5KXCA 5KNLA 1UU4A 5A6XA 2QF7A 2V09A 3DTIA 1US3A 5F64A 1W0PA 1XE8A 3VBOC 2PHTA 5FYBA 1T38A 2B39A 2Y6LA 4NAMA 1GUIA 4BQOA 4AG4A 3QPTA 1Z0XA 5LFAA 1ETQA 2JSPA 2HWE3 1CAVA 1GICA 1X58A 2BTVC 3SH3A 3U4SA 5A6QA 2R042 1MS1A 4J00A 4NJ4A 1JT6A 2HBTA 2MC4A 4Q4Y2 5C71A 4FE4A 5H20A 5F5AA 4YW3A 1W2UA 4MH0E 2LD5A 3FK6A 1OYIA 4A12A 2VXDA 3NJXA 3T2TA 3CMAI 1TME1 3H8XA 3ECOA 1LTEA 3RI8A 1N1VA 3TN93 5C8CC 5BXXA 4OAYA 3DEMA 3I7DA 3BQZA 1N75A 1IZ3A 5C8WA 1BIBA 3TNPB 4ATFA 3B73A 4LQRA 2HR3A 4NDLA 5JIAA 3ABZA 3KT1A 4OHWA 4D94A 1KFUL 1RUJ2 2VTFA 3WE3A 4CXWA 5T5JA 3DP7A 4ZY9A 4I7HA 5BNGA 1J09A 2OD5A 1BJZA 1W5SA 3A21A 4CU8A 4FPYA 2EFNA 2HWB2 3AKRA 1G9DA 2P5BA 1HDKA 4KT5C 1D4VB 2HTSA 1APNA 4UUTA 3K4CA 4G7ZF 1JUHA 3V64A 3RZJA 4C90A 4V2FA 3ORJA 4HEA2 5I8YA 5JR7B 3O8GA 2ME0A 2C0ZA 3EMRA 4RQPA 4NBQA 4XKWA 4GCVA 3FHQA 2RR13 1H6YA 2VJXA 3C18A 3IAQA 1EF4A 3GCMA 3BVCA 5FZ7A 4ZJZA 1YW8A 4RAGA 2WINB 3ZXEA 4L5EA 3D6EA 2JA6J 3N9NA 4ZDLA 5EF6A 4IOAF 1AR73 2K9MA 1UW8A 4META 1KS4A 2ZEWA 3VHPA 4E4DX 1MNMC 5GPAA 1JHFA 5GZFA 1B1BA 4OHXA 1DGWX 1MEC2 1HKDA 3PIOF 3U4XA 1TNFA 2WQ8A 4URTA 3FXQA 5H6QA 1DGRA 3O2PE 4PI0A 2VJIA 2XF6A 4L99A 1PMHX 3ACGA 2CW7A 3DU6A 1AHDP 4D5CA 3KZIC 3BI3A 1JHJA 5CFDB 1A04A 1ZKGA 3W21A 3OIQA 1LFUP 2ZGNA 2EXJA 4JZRA 4MHGA 3I3EA 3ZSKA 4WZFA 5GP9A 1YI2I 2PN6A 1XYPA 5A1FA 1ZA4A 5IATA 2NP0A 2CUFA 1MS8A 1J59A 5FO5A 5F0CA 4QKBA 3WLUA 1RXFA 2XG3A 3CCRI 4MGRA 3VYUB 2A5WA 2IA2A 2OCEA 3POJA 4BQQA 5F7UA 3W20A 3S1MJ 4GYGA 1LEMA 4AUXA 1AZDA 1VMHA 5A7PA 2R92J 1VQMI 4ONUA 4CP9B 3HOXJ 1S2KA 5EPAA 2CDOA 3LEIA 4IEOA 1Y7BA 2W2IA 1RXGA 3H0OA 4C1XA 4CCEA 3FM5A 5L3EA 3A4CA 1ZYBA 1XE7A 5HCAA 4XBFA 1JE8A 4I01A 5ILUA 1O3SA 2XB0X 3HKZN 1CF7B 1BVP1 3M8FA 2OF7A 2R7QA 2CWEA 1QNWA 2VQAA 1VBB1 3BCBA 4FCYA 4FFFA 4NQWA 2FD8A 4ETSA 1WBFA 2JRMA 4R4XA 1PUEE 1ZBA1 3AB0A 4UV9A 2D40A 2HXIA 2CTVA 1R36A 3GW2A 1W8NA 2DDBA 4YW7A 4OMZA 4EGYA 5EG0A 1M4WA 4ENKA 5KHDA 3PJYA 1K3IA 4GIQA 1PO13 2ZGSA 3I3LA 4DXZA 5IYYA 1RUI1 1MS5A 1NK2P 3PFYA 1T95A 1F43A 1MDMB 4JQRA 2WRAA 4M71A 4CCMA 2C9AA 3BG5A 5DS9A 1SMVA 3CJTB 4LK1F 5F2WA 2DVGA 2FF4A 3O0WA 4Q4V3 5LEJA 2P34A 1CX4A 4BLJA 3WHBA 5K0UA 2XVCA 2QQPA 3OPWA 2GLOA 1QVTA 3IKVA 4COYA 5CKTA 1C8NA 2D98A 4MQVA 3J7AO 5C6CA 2IWGB 4AOCA 4HSRA 2WIIB 1B72B 4IEXA 2Q1MA 5BNOB 3C2BA 2ZGLA 1QNYA 4M3DA 3S17J 3H1MA 1HDPA 3WXPA 2EJRA 3H3VK 5EIYB 4XMIA 3O1RA 1H1IA 5IP7J 1W6MB 1RUOA 1C1LA 1MKMA 4FPLA 1ZAOA 1YFUA 3VDDB 4G7HF 1B35A 2MC3A 3SKJE 2RM23 4BNCA 1KQ8A 2V79A 1EV13 1SC7A 4XKCA 2BQPA 2B46X 3ZRGA 2BYVE 5FMOS 4NVPA 1WZ2A 5J09A 5DAVA 5IPAA 2ECBA 1D0YA 3OF1A 1Y6IA 1UELB 1NXD1 5D21A 1EV7A 3U07A 3ASOH 1ZX5A 1X82A 4RGGA 4U0YA 2W3JA 4IE4A 5EXOA 4YG2F 1UMQA 4Q4ZF 5BY5A 2H09A 1WMFA 4N9IA 1TL8A 4FI9A 4BQ2A 5JPMB 4C3IJ 1UCRA 5HS7A 2O0OA 3T4VA 2NVTJ 4RB3C 4XFCA 2HTJA 3CZUA 2YU9J 4QMAA 1UY3A 2YPRA 1JZ3A 2EV6A 1M1EB 2DCYA 3RCOA 3THCA 5D5VB 3HAGA 1D1BA 3I3QA 1AX1A 2V6CA 4XUTA 2BHZA 5FZLA 1XDSA 3TP3A 3SDGA 5HCBA 4L0PA 3AMQA 2GH2A 1QXRA 1HXS3 1SFYA 5GLVA 3PTYA 2NZ9A 3DPLC 4RR3A 1O5UA 1XU2A 3SLIA 1CPNA 1NK3P 5IYCJ 2D1HA 3BWGA 2MD5A 4DZGA 1YWKA 1SFOJ 3EYYA 1W6PB 3WG9A 1UOFA 4NR1A 5LK7B 1PVC2 3D5OA 3WHTA 5IK5A 2W1QA 3UYJA 3S7EA 4QX0A 5TISC 3ZDSA 1MBEA 2VZRA 2KFDA 5FZCA 2XJQA 4Z92B 5DDJ2 5A3UA 3LEMA 4UW4A 3W2AA 2DYSH 2RS31 1VR3A 4WVVA 2A70A 3GX4X 2OQGA 4D6QA 2BV4A 2BOLA 5FMCA 4XLAA 1BBYA 2MD0A 4HKWA 4QGNA 1YE9A 4XOGA 3S57A 4FETA 2WA4A 3MZYA 3ELKA 2A71A 2ERFA 2X85A 4Y1VA 1BI2A 4H14A 1VQ5I 4A7KA 4KT6A 4XFIA 4DBRA 1YIOA 5IOZA 4N43A 1XNCA 1IXSB 2VBDA 3AP7A 4J1XA 2P8TA 4A93J 1QEXA 4HSJA 2DXIA 4LUMA 3T0BA 5DZEA 2MEV3 2DMUA 1OURA 3GHNA 1T6SA 1REFA 3JU9A 3I59A 1V5EA 3IC7A 2YBKA 4XSXF 4X8PA 4X8NA 2HI3A 4J1WA 2VU9A 4XUOA 1N25A 2FX0A 4CUAA 4XJUA 3VD5A 5IYBJ 1FOKA 2OPKA 3U2RA 3M3IA 4XK4A 3IH3A 1YQ6A 4JVAA 5KXEA 3FXMA 3QU3A 3FMSA 3H7YA 4AAXA 4GXLA 2DPUA 3ISPA 3Q9SA 5CFDC 5C8CA 2A05A 1BR4A 4LE4A 1GQGA 2MYSA 5CADA 1RJ7A 4BYYA 2J42A 4AVPA 3FXRA 2P6CA 4G9SB 4L9VA 3DV8A 2VE8A 2PG4A 1DIWA 2NAZA 2QKDA 4KMUX 1MMSA 3OB8A 5AIPA 3PDQA 4MGYE 5L3CA 1LUJB 2RM22 5APAA 4WM7B 1AL22 5EZGA 1KD7A 1MACA 4QWQA 1VIWB 4FAHA 5I0DA 2DT5A 3V7CA 2VZTA 1BR1A 3JTGA 3VBUA 3WP5A 4Y4RA 3CEWA 4QX2A 4UYBA 4WXDA 4C8DA 1AHSA 3Q9OA 3AXDA 1JZ8A 4LJZF 5D6EA 4YGCA 2E6VA 2YX4A 5TGTA 5JHFA 4PIXA 5FPLA 4CP0A 4BKXA 3WTVC 4L9TA 2C4XA 1ZR2A 3F2ZA 3MF9A 3KP5A 1QZEA 3LL7A 4B47A 3ENRA 3D5RC 4A3XA 2DUQA 5BYNA 4YWAA 2D3PA 1UMZA 2A6XA 5IVVA 3LSGA 4WXHA 3ZSLA 1UHSA 2A5YB 3LSMA 4EN6B 5C9AA 1SFKA 2CFXA 1EYBA 3LNQA 3M2MA 1AUYA 2M87A 5A32B 2VECA 4PF5A 4LO5B 1OXCA 1OCPA 2CUZA 5GAGJ 2XVLA 4LHSA 5CZKA 3T1LA 1LNSA 1OVPA 3WCSA 2O7OA 1DGWY 1W6OA 3M1EA 4Q4X2 5JXGA 2DVBA 1CJPA 3U21A 2DMPA 3ZYBA 3ECHA 3I49A 1SEUA 4LOSA 1IS5A 1BMV1 3BPZA 4RDUA 1OKRA 3CCMI 1W36C 2IGOA 3AKSA 5JWPA 3NQHA 2Q8DA 3EQEA 2VTXA 4HF2A 4O9GA 2WS91 4BJTA 4YIIA 2R1BA 3G3ZA 1BN5A 5FYSA 4CEYC 1QWRA 1BOBA 1POQA 4IV1A 5FYUA 2ZKLA 2X48A 3KEOA 4LKSA 5IK8A 1UZYA 2DT6A 5HS9A 2VULA 1MS0A 4M3CF 3BR5A 1Q56A 2ZFUA 2XF7A 1KDKA 1IC8A 1YC61 2JG9C 1A3KA 1X19A 3L2HA 3VBFA 3LPFA 1GR3A 1IUFA 2Z16A 1R9TJ 2M1BA 1AJKA 5EZWA 4L8QA 3USUB 3NRUA 4B4PA 1WBLA 5C7GA 2W24A 2L7ZA 4QT6A 3LWCA 4RAFA 2X53S 4KQ7A 3CUQC 1GOHA 5L3FA 4LUKA 4FOWA 1WCKA 1JKPC 1Y1WJ 1I1EA 2FQ4A 5C4WA 1WLDA 3KCCA 1YQ2A 1QQP3 4HNTA 2IUWA 2WFF2 1W6QA 2WADA 1RNLA 4ANJA 1W04A 4QPGB 2E26A 2HNHA 1J1LA 1HRI1 2XH6A 5FZKA 4EYUA 4B4RA 4XONA 4LA3A 2VG9A 3WQ0A 4CTEA 2M4KA 4NPMA 3G4SI 3R0AA 5FYIA 2QQWA 2MEV1 3POFA 3C7EA 1Q5OA 3DLAA 3OYDA 1H9PA 2LDUA 3V0BA 2VB6A 3ZPLA 4INDA 5JOZA 1PGL1 4RBOA 2QYOA 4ZYEA 4I2OA 4O5VA 2CYFA 2N7GA 2LYCA 3ZLIA 2XLAA 2X1DA 3ZFEB 1QA6A 3KETA 4QPGA 2HYJA 4B7KA 4ENJA 4E4SA 2VKHA 5LHGA 4E2GA 2YUEA 5J47A 2NNNA 3MLLA 3BTLA 1BEV2 4XZUG 3MUY1 5F3IA 4I02A 5FPUA 1WCUA 1JZ2A 2XONA 2A7AA 2HEVF 1K42A 3HOZJ 2DBNA 2FDIA 3WP6A 2CSOA 5C3OA 2JDMA 4MOAA 1GP6A 1EH7A 5DZFA 1IZ1A 4XILA 3GXUA 1VAMA 1O57A 3HM5A 2XASA 3IH4A 4M0HA 1IQDC 3L9FA 5BS6A 3DBLB 2KA3A 3B5LB 3WU1B 1E3HA 1MBHA 4ASNA 2VBBA 2Z99A 1HJFA 2LK2A 3WZ1A 3I59B 4Z2YA 3CDLA 1IRGA 2XPVA 1G9CA 3G71I 5LB6A 2RV8A 1LDJA 5EV7A 2XAFA 2ZPXA 3P5BA 2CUJA 4P96A 1AR93 3VSLA 4HSTA 3RZLA 3GTLJ 4B1RA 3WNXA 1RESA 4Z07A 4RA2A 2Y2ZA 3SEZA 2D6PA 1RUG3 3DYOA 1AR63 3VBSA 3O1PA 4HG2A 2ZGMA 4BU2A 1H0BA 3KQRA 4YNIA 5C70A 1UZWA 1A35A 5FY0A 3SNMA 1T08B 3I2FA 4YZ5A 4NQWB 2HWE2 4QAWA 2IP2A 2DYCA 2R7DA 4X6AJ 5C9AC 5FTTC 4CCJA 1Y9MA 2KR2A 3B02A 1P7IA 2RS11 4KITB 1NA1C 1JTXA 3LFKA 2XJPA 4B8XA 3HPHA 1Q8OA 2LVSA 5LRSA 3O5SA 5FYHA 4AHWA 4D7SA 1P9QC 3D1NI 3K4BA 4ZDPA 4AQ2A 4E7HA 1N3OA 2Q5TA 4CDQC 2GMEA 4QM8A 4B29A 1FYUA 4IV3B 1MDMA 1UOJA 4WXCA 3K51A 2L9SA 4RM3A 1J3QA 3KT7A 3KYLA 2ZAHA 4IEZA 4ZYAA 2ZNZA 2W48A 1XNKA 1PYVA 2NYYA 2KDOA 3R61A 4B3AA 5IK7A 2M9HA 4BHCA 3VZNA 3PNAA 4Y13A 4NIDA 4EM1A 1FATA 1SFXA 2MGQA 2L4AA 4FTEA 4P1WA 5B2GB 4HK9A 4MO3M 1RUI2 2GNBA 3MLKA 2O6GE 1ZG5A 5J96B 4E7JA 3OG2A 1TVGA 2B7YA 3HPGA 1XTAA 1YEWA 3CMEI 3VN4A 1COV3 3CCUI 4EM0B 3S5QA 1WJDA 4HANA 1QDOA 1KZHA 3CLOA 1PGW1 3RPUD 2YR2A 3BR6A 2BRTA 2D5VA 1Y0UA 3HRUA 3MDPA 2XAQA 5ERLA 5A32A 4WV8A 2OUMA 4OIQF 1UY1A 3S7IA 3GF2A 1OF3A 3CBNA 1XB4A 4V2WA 5JZGC 2DA6A 1T98A 2HYFA 3ZOBA 4M0NA 4OI0A 2VMFA 2WT1A 5K7PA 1FX7A 5EJ3A 3LZZA 1NHAA 3THPA 3QRFF 1UF2C 3NW4A 1WW5A 1ITYA 3CC4I 1JTZX 1WKMA 2X5IC 3RS6A 2BV6A 2R7OA 3IM0A 2XF5A 5E88A 4ARXA 3OYEA 2XV4S 3H9AA 4M4RA 3CKHA 1RINA 2BE5F 1VQKI 3WODF 4JX0A 3AKQA 1RUC3 2K2SA 5FPXA 1S29A 3PVNA 2VXZA 4P5HA 3GM8A 4PIZA 1ND2B 4NC6A 1ZG1A 1N77A 1WMEA 2Q1FA 3VUOA 1XNBA 1OISA 5DUWA 1KYWA 3ME2A 1CZVA 5KC5A 4CDWA 5FXVA 3FIWA 2QM3A 2ZKNA 3R05A 2W1WA 1KJRA 3H50A 4QIWN 3SFZA 3AAFA 1OKOA 3SQNA 4JQTA 2Z33A 4E9KA 4YRDA 1H8VA 5HXVA 5HS8A 2XXZA 3UT0A 3I55I 1WJEA 4IJAA 3PIPF 1OSGA 4BXUA 1XC5A 3ZXDA 1AR91 4EWAA 4ES8A 4NNJA 2CQ7A 3S2WA 4UUVA 1F15A 3IDBB 3WTYC 3GZ6A 3GCXA 4EQVA 2R6QA 3LEKA 4HOOA 3S3MA 1UAAA 3HBKA 3M07A 2R93J 4DY3A 2ZJRF 2E7QA 3T09A 2B7EA 1DGRN 1X1AA 4D9JA 1LOBA 4MADA 2ZHLA 1LEBA 2D3SA 2WS92 2CAUA 3EUAA 3D0JA 3UKTA 2DU1A 2L2OA 1DDNA 1KU9A 1EJ9A 3M4FA 3SDBA 3EJKA 2W4SA 2WL1A 4HONA 1BMV2 3APBA 2SBAA 2I07B 3A01B 2L9RA 3CUQB 2XLGA 2PHWA 1SD6A 2OA4A 3TGNA 3LPGA 2JUGA 1HDDC 1QQP2 2UWBA 2MH2A 4BMEA 2WN3A 5F32A 3PNYA 3K9TA 4Y5TA 2PHXA 4RHV2 5T52A 1SDDB 4WM8B 3QH6A 3WGGA 3SEQA 4A6SA 3O1MA 1RUD1 5LATA 5C4WB 2XJRA 4BGDA 4LK0F 2H0VA 2PMUA 3JQXA 4XUQA 2A3YA 4MEXF 1XNTA 1X50A 2DW4A 1RMU2 2FZ2A 1O4YA 4Q4V1 1BBT1 2P4WA 2C9KA 4QDSA 3VHRA 3P3PA 1B9NA 3VBFB 4ZH4F 2H94A 4L9JA 2R5YB 3URFA 5KHIA 1KQ9A 4MXVA 4OIRF 1FX5A 4XIOA 1QMJA 2LY2A 3CDHA 3K6GA 4HQMA 4H2AA 4YGDA 2W47A 1WJCA 4XPVA 1PMJX 5SV5A 3LAJA 1SLTA 3GBWA 2KT0A 1BL0A 4JKKA 5DUXA 5E8IA 2EIEA 4RGUA 3WW3A 4V1PA 1WJBA 1WVRA 2V6EA 3W6KB 4RR3B 2WZ8A 1A6IA 3POGA 2NM1A 1VBB3 1GOFA 2TEPA 2EFQA 4X6QB 4QM9A 3E1SA 5F27A 5HLIA 1NCQC 3JRDA 3J26N 2ZGRA 2JDPA 2VR4A 1I5ZA 1G9FA 4WVWA 3PMSA 4Q4W1 1NZIA 2WNVB 3E5UA 2ADDA 1HQLA 1ENQA 2AQEA 3I54A 3POBA 3CMMA 1HX6A 1NH3A 2KKOA 3LA3A 2R7ZJ 2K40A 1OCRH 4XRSG 2CDPA 1FMD2 4LKEA 4KL1A 4D7MA 3RZDJ 4CPBD 4A0XA 4A3LJ 2HJIA 4Y33A 1NLQA 3TEXA 1DU3D 1HRI3 3QYEA 5AVAA 5E79C 2BY1A 1MS4A 3BLYA 1NYWA 4CXYA 2QENA 4H3WA 5IYDJ 1GHCA 2ZABA 2F4MB 4AIDA 4BDZA 3LOCA 5GZCA 5JOWA 1TQIA 2E63A 3JRBA 5KHJA 5D4RA 2BNNA 1MSFC 4C3JJ 3IWFA 1QJY3 1W9WA 4KWJA 1XX5A 1O4TA 4V2GA 5F8PA 1W6QB 1MMAA 4PJNA 3RJPA 5E20A 3HDDA 5G05L 4QU2A 2HDWA 2ARAA 1I27A 1J1TA 1Q8VA 4HXCA 3VBUB 2Y6JA 1CONA 2OVUA 3A22A 1HRV3 1TG7A 4Y22A 1EV11 4M01A 3OBRA 3CCEI 4QHOA 3ESWB 4AEDC 5CAZA 2GIVA 4M74A 3KIOA 1LENA 2M0MA 3WDUA 5DDJ1 2PJRB 1VB4A 2RDSA 3LSDA 3CNAA 3WHUA 3N3HA 4IGOA 1OVSA 4A44A 2EXHA 3K75B 4XLEA 1WW7A 4N9HA 3HBZA 1VQ6I 1YNAA 4NWWA 5LA9A 1RHI2 1QRYA 5JR3A 2HWE1 3GLLA 3ZFFA 1V70A 4UI9L 3GMEA 1WSUA 3JBG2 1HV0A 1W2OA 4FQGA 3D5LA 2ZA9A 4Y1ZA 3J80K 4Z1VA 1LFBA 1Y3TA 2OQ7A 4IRHA 1KJLA 1B8IA 2FSWA 5LEKA 4F3QA 3IDEA 2PTMA 2OJED 2NMOA 2H6BA 1RTVA 4QKNA 1XSXA 2Z5UA 1DYKA 3BIEA 1OPMA 1ASJ1 1NE4A 2K46A 2RG4A 4UV8A 4XQDA 2EZIA 2DI3A 1E5SA 3H3UA 2XSJC 3WTUC 2OUJA 4QPYA 2FBEA 5H9QA 4CDWB 2P7VB 1ENRA 5D5XB 1D0ZA 4BEHB 4EJUA 5FJHA 1ZBA3 2BW8A 1R1A3 4ON0A 4F8AA 4EEFG 1DZRA 2ZHKA 3NJYA 1IXCA 4XFAA 4UHTA 2FZ1A 3J8F2 2GOXB 2FNPA 4E8CA 2PHLA 5FQ0A 1DU0A 2QKMB 3WUCA 1SLLA 5FZEA 1RUE3 3MW3A 3Q8AA 3VL8A 5IT9K 4Q48A 5FLXZ 2XVKA 5A3WA 2YS9A 1GWMA 4FP2A 4C91A 2QTWB 3WY6A 1JN2P 1O59A 1R1UA 1QGPA 1GNHA 3T2PA 4R8HA 1DP3A 3E97A 4BQ3A 2FCTA 2RR11 2ZMEA 2CMPA 4JTOA 3OOPA 1C8M1 2VD7A 3GZUC 2CGOA 5FBJA 4LD5A 3R60A 3TO7A 2X29A 1U6GA 3TBDA 4YW2A 4PT6A 5K7ZA 3AKTA 3OSDA 3TP0A 1QHDA 4TWTA 3K46A 2IXLA 1VQ8I 4AYUA 4RQPB 2H1KA 4IKFA 4N4NB 2PJRA 2P5LC 4OULA 4MV2A 1V6KA 5FPBA 4XFBA 5EJZB 4D5FA 3KWVA 4N53C 2HYKA 3DXTA 2CFOA 3ZXFA 4U0WA 1WCSA 4CSWA 3HB9A 1G86A 3GVAA 1HRI2 1YUDA 1X3ZB 2A3WA 2RJ2A 2VJ5A 2IJLA 1VBD3 2AGSA 4AFAA 1GKBA 1XS9A 1R5GA 4ZS2A 4FTSA 4OIOF 1BC7C 3THTA 1RUNA 2MPFA 1LEAA 4ISQA 3F23A 3ZFFB 1NQJA 4ZKTB 4HKLA 4DXTA 4IL6C 4AIJA 1UFMA 4O6JA 4HPKB 3RYRA 3PO2J 1FI2A 4F91B 1RIOH 1ZBA2 3VLBB 3G2BA 4SBVA 2K4BA 2XLFA 1E2XA 1OJLA 4XHBA 3NAUA 4JGYB 2QUFA 1W99A 1S7EA 3V65A 2VZPA 2DA5A 2ZO4A 1D4M2 4CEYB 1G9AA 2HDCA 2QE3A 5C3PA 2R072 2PJPA 2HVSA 1PNGA 3O1TA 1CR7A 2PHFA 3S1QJ 4ESFA 4AHZA 5JVTA 1GVJA 1K5JA 4PUSA 2IXKA 1VRH1 3HJRA 1I5PA 1BK1A 2HGCA 5DM6F 4XQWA 1LQ1A 5FV3A 3KHCA 1CGPA 1UIKA 1XSVA 3HTSB 3JSPA 3QWLA 1PDNC 5FP3A 4AHXA 3K3OA 4N4OB 5HV0A 1B09A 2EV5A 5FZ4A 2UZKA 4KN7X 3A01A 1X4PA 1PVEA 3AM2A 4HPQA 4EZHA 3MEXA 1LE8A 4BA6A 1LRHA 4ASMB 1XCBA 4F3JA 4JGZA 2DTZA 2F17A 1UOBA 4Q4X1 1YQ8A 1U9OA 2VVDA 2EWNA 3N4MA 3I97A 1OCOH 4FCAA 4XFHA 4BE2A 4G6DA 2YG0A 3GJAA 4FVVA 1F35A 3KFWX 1QOSA 3LSPA 3CHXA 5TSWA 3H35A 2F6CA 5GKAC 4XL9A 4J25A 3ACIA 3ILRA 2VVFA 1MEC1 2KJBA 1FOXA 1FTZA 5E1ZB 2J1VA 2LP0A 4LO8A 4C9YA 4Q27A 5KHHA 1XCVA 4RSUA 3HGYA 4L0YB 1WGPA 5FP9A 3H0DA 5IK4A 5FZMA 1GANA 1JZ6A 1PJRA 2XUBA 2VCBA 1KU2A 1ULYA 5FD5A 1W8ZA 4QB6A 2Y6HA 3MKYB 1G3YA 1GLHA 2JE7A 4DPNA 2RM21 4A3FJ 3LDRA 3PVOA 4K8RB 2Y33A 1R1ZA 4BM8A 5FRAA 3IB3A 2JTVA 5A1AA 4MVTA 2ZCWA 1UY0A 5F0HA 4FHTA 1BHGA 3VDAA 1VBD1 1IG7A 2EZKA 3FUOA 1AYN2 2HWB1 4IERA 1GV5A 2QQLA 5DCFA 4QDQA 4MUVA 5E8GA 1A78A 4Z2AA 3ML6A 4W6WA 2JWPA 2GZWA 1DG6A 1RIRA 2VY0A 5F39A 1GBGA 2BVLA 5B3SH 4IQ4A 4P9YA 5A3LA 2QQJA 3D3AA 2H0BA 4M9SA 4ZDOA 1AYM2 2SLIA 1UMHA 4OUSA 2XDVA 4JDMA 5KC6A 2QQNA 4CCDA 4Y4YA 1IS4A 1ZLJA 3C8XA 2I8DA 1V9U3 1XU1A 1VQOI 1PZ8A 1WJ5A 1K6OA 3WF0A 4LOCA 1BIAA 4B3XA 3VZJA 2Y0SN 4Q29A 1ZRRA 3QYBA 1XSRA 5FK8A 5KK1A 5HDGA 2QQ9A 1FPQA 5H9SA 2YB7A 3UKNA 2X6YA 2BERA 5IVFA 2JB4A 4GGGA 2UYBA 2CHHA 4LBQD 1D4M1 3MIGA 3CO7C 3NNLA 3K4MA 3CL1A 4L11A 1HSTA 1QPMA 2VL8A 4KU7A 2LROA 4QKFA 3WG4A 4QPIC 2DVDA 2VQGA 5CVVA 1MZ6A 2QQIA 2ESNA 3PNTA 3VBOB 2R30A 4MEYF 2DF7A 4NRMA 2AEYA 5D5WB 2A73B 1X7NA 3CCVI 3DKXA 2OA2A 1DHKB 4K6BA 2VQTA 1OYYA 2K9SA 3CUOA 1A34A 2EA4A 2NVXJ 5JLVA 3POIA 2VNVA 2KLOA 3CMYA 1KA8A 5JXJA 4V19K 3ZQCA 4X6RB 2UV1A 2NN8A 5FKBA 4C2TA 4KUMA 2QUOA 4ESJA 1ND2A 2X0LA 3MICA 4GAZA 4Q0PA 1I1SA 4XIDA 4CP9A 1OR7C 5BNOC 2FOWA 1X3WB 2QGUA 3P5JA 4XR6A 3WTZA 1XN7A 1PK6B 2WKKA 1UO9A 1ACCA 2M30A 2G9WA 1GNYA 2DFEA 5BNNA 4Q4Y3 3BR1A 1APLC 1BI0A 4IEUA 4CRQA 1KONA 2VNOA 1D0HA 2OPTA 3RRDA 3KE2A 2L02A 2PBIA 3RQIA 2KXLA 1I39A 3OCPA 3K2OA 4EQQA 3FF5A 5HLGA 3WDTA 3POEA 2JT1A 2DBIA 4WM7A 4XURA 1UN1A 4R4ZA 1LNWA 3JD71 3H8UA 2UWCA 5J6XA 1DGWA 1OT5A 4M3CE 2Z2SB 1OOPC 5L9RA 3QOEA 3DPTA 5C5TA 2WNUC 3WCRA 1U0AA 3CP8A 3TOAA 2VPLA 3HNMA 5I91A 3UJQA 4D0QA 1EKEA 2XGXA 1GLNA 2VW1A 1ERDA 4AIHA 1X33A 3M8EA 1XSDA 1V6MA 3J8F1 2DK5A 2E1CA 2HWB3 4AVSA 2VQLA 1Q8QA 2VC1A 3CZJA 4Y24A 2A75A 3J7NA 3T1MA 4EN0A 2E9QA 2P81A 4O61A 2J1EA 2WN2A 2V9KA 3GTKJ 1NLSA 4MTEA 1BXHA 2IS4A 2V4JC 5HNFA 3THDA 4KNYA 4AIKA 2VBXA 4AF9A 3GTJJ 4GH4B 2NVUB 2Q2EB 5AC92 4N8MA 4EJWA 1SMTA 5JIUA 4IUGA 1UZCA 1E57A 5BNPA 3FISA 5FFOC 2XB6C 5M5XJ 2Y0OA 1JT0A 3BC8A 5CEHA 3DKWA 1Z7UA 2V1UA 4K21A 3J7MA 3KF3A 2IGMA 4A3BJ 3NNFA 3VZLA 3IAM2 3B3QE 5GLUA 2WC2A 2XJVA 4BXSV 3PU8A 3MW4A 2DFFA 4ZHNA 2ZBKA 3FFZA 4BQ1A 3PUSA 2L7MP 4IRIA 4WBBA 3ILNA 1DGLA 5F37A 3K3NA 4LA2A 2VVEA 5J1YA 5EGOA 2JE8A 4P14A 3IKWA 2WJSA 1JZ5A 2EZHA 1ZVFA 3S1NJ 1QU0A 3MLJA 3N9PA 5F6LB 3NJZA 4TLFA 2PHDA 1FV3A 4ZONA 5GZGA 1QZZA 3VODA 5IAXA 2RMU1 3ZQ7A 4JC1A 3NL1A 1YG2A 2EH3A 5JFRA 3KP3A 2JDZA 4GH4C 1JOJA 3H1WA 4PBOA 4P9IA 1MZBA 2WR9A 1STMA 1W8WA 1HOMA 1S0BA 4G3YC 1JYNA 4X0GA 3KZ4C 3M3EA 2VKEA 1ON2A 1BA5A 2Q8EA 1TMF2 2YZ4A 5TRDA 5D8AA 4M9ZA 1VQ7I 1SFNA 4QD2A 1LPQA 3K4DA 1RGSA 5IW0A 4B1MA 4Q0VA 4XJAA 3DCFA 4QXKA 3I53A 4LKDA 2Z42A 2L9VA 3WQ7A 2B9VA 5CYVA 3FHNA 2LMDA 3SJMA 2ZMLA 2L5QA 1LJ7A 2LTNA 3ZO0B 4OZXA 1MBGA 4Q4W2 2W84A 3UL2A 1DQUA 1VBC2 2VNGA 4PLOA 1JI6A 1VBD2 1UPIA 3VFZA 4P5YA 4LHNA 4KWLA 2O9LA 5FYVA 2XJUA 1IO2A 2TCTA 4FQ4A 1YQ5A 2XHNA 4WVZA 2BZTA 4TXWA 2JVHA 1ZARA 1FTTA 5E8AA 4ABZA 2L9NA 4FPKA 2OUHA 3F3XA 1W6MA 5L9VA 4GWIA 5FDBA 4FOQA 4FP3A 2COBA 4QX5A 4QX1A 4DRVA 1I3AA 1P4WA 3P9KA 1UKGA 2EILH 2YGLA 4Y17A 2DCTA 4WM8A 1YHFA 2V4AA 1WI9A 1IW7F 5CKQA 5LBFA 4EV0A 2HOAA 4PBPA 4S05A 4ES9A 1K5MA 2W85A 2DN0A 4M3CA 2D1VA 3TNQA 4D6SA 2DFIA 3DEWA 3TO6A 3A23A 3GHMA 4XRFA 1BBT2 4Q4V2 2CL2A 5A3PA 3O1VA 4HX8A 5D8LB 2Z5WA 4R9AA 4QPIB 4EJTA 2IRFG 1EA3A 3F8BA 1IN7A 3PL0A 4A5NA 3T30A 4I76A 2YPJA 3AP5A 1CD3G 3RI4A 3MIHA 2VZUA 4NRQA 4D3WA 4IDZA 3PSFA 1MS9A 3WG7H 5D8KB 3KS7A 3ZYIB 4CU9A 5C3RA 1S55A 1RUJ1 1SD4A 3NARA 1QQP1 4LHKA 3SXYA 4CGZA 2DOAA 2L54A 5T5OA 3NWKA 3WX5A 4BK4A 1H30A 1QO0D 2UWAA 5IWFA 1O8SA 1QOOA 3RZHA 2F5FA 5FZ8A 5BNOA 1VQ4I 5FO7B 1J3RA 4QPOA 3QBQA 4LORA 2GXBA 3GYHX 4H7LA 4UNOA 1ULCA 1WLWA 1XD7A 2ZXIA 3HC7A 4CCLA 1ZNPA 4FFIA 1S7AA 2W7NA 3S16J 2F4LA 2FUG2 1XE0A 4MHRA 5FY8A 2MH9A 4P02B 4BXXJ 3HOBA 2E19A 1S9HA 2VW0A 1DDLA 2GNTA 3R4DB 4KBZA 4AQ6A 3VB2A 1VBC1 1Y1VJ 1LCLA 3M1HA 3I2GA 1V4RA 1C1FA 4NIHA 1DZQA 1BEV3 4RL7A 3HNBM 1DPRA 3FMGA 3EYIA 2CRGA 3LSHA 4GZ9A 3GLXA 3RQ0A 5A6YA 2KDZA 1IUYA 4IEWA 2BPA2 4RB0A 2V5YA 5C5UA 2TDXA 1ND3A 2K02A 5FZ9A 5FBZA 3BUCA 3GTOJ 3Q8FA 4KG8A 1OCTC 5FQ0B 5DUKA 3D4KA 2PLYA 4HG6B 5E1WA 4HN0A 1ZTRA 2DJNA 4XJ9A 1UJ8A 2WAAA 1YO8A 2AQFA 3J7YJ 1TEIA 2ZX4A 4AWXB 4LNVA 5HLTA 2IXIA 3WTSC 1RUD3 3B6AA 1G4DA 2HQNA 1NG6A 5EYRA 4DFSA 4PCQA 3BG7A 5M5YJ 4UFLA 1TQ5A 3RMXA 5FUIA 2WV1A 2WNVA 1GZTA 4B3NA 1UB9A 1T56A 3E0JB 4JOMA 2ICWG 1OQEA 4QQLA 4W50A 5L19A 2D6OX 2QDNA 2RMU2 4YELA 1X1BA 4MNUA 3LGRA 1T39A 4II3A 2DA3A 2Y9YA 1F5JA 1OH4A 3AP9A 4S2HA 4QX3A 1AX2A 1JW6A 1NE6A 4MHUA 5FLMJ 3TAYA 2R7VA 2ELJA 4LXLA 2VBYA 1CESA 2W57A 1TME3 4LITA 3QCWA 2VT2A 1HXS2 1I50J 1HV1A 4AE2A 2P7CB 4AVTA 5H6RA 4OUMA 2KL4A 2RR12 3NJVA 3L7WA 3RKWA 2QSGX 1OBNA 3SCGA 3O1SA 1YFYA 4ZYDA 3Q0VA 3BOWA 3CF6E 1QHGA 1OLRA 1HN1A 2WYFA 4ASLA 1H0MA 2QBXA 3U1XA 1W6PA 5L73A 1X1DA 3J7ZI 3CCSI 4B48A 3AL6A 3JD73 2LALA 1LHWA 3POWA 3HUGB 1R1A1 1Z3YA 2RS33 3JTHA 2D3RA 3PU3A 3E6MA 2ZS6B 3PLQA 1WA6X 4LBQB 4O65A 1XMKA 2EZLA 5IT9Z 3Q8EA 3ZYJB 2VUDA 3AZZA 1MH4A 3BPXA 3JRIA 1STZA 3FKJA 3DTEA 2R063 1YW9A 4CCCA 1S0GA 2KQRA 4NWVA 4P00B 4L2NA 3ZSEA 2X6XA 4HK8A 2MNGA 2IFRA 2IC1A 3GZNB 2LUWA 1L7LA 1VQLI 1OLTA 4MG2A 2VQHA 5GPCA 2JICA 4DYCA 4H7MA 2IS6A 3CJQB 2WB1N 4AXOA 2HWF2 2V7FA 3AP4A 1FOWA 3MF6A 5FB2A 3LB9A 2R3SA 2VODA 3E3VA 4YM0A 2UY9A 3KM5A 1QJY1 2W1OA 2E2JJ 3KCXA 2R16A 2HS5A 4GYIA 2W00A 1SG3A 1Q8SA 2GN7A 2F5VA 4XUPA 4R52A 3OS1A 1CVNA 3F22A 2QZ3A 1QJU3 3FXJA 4XF3A 1DYOA 4BQ4A 4CDUB 4YVSC 4BQAA 3F8NA 3O6BB 4ENNA 3ZPOA 4BB3A 1Y8RB 1UYYA 5L7OC 4BQ5A 2QBYB 2X1CA 3OPZA 4Y7NJ 3TEDA 3CO6C 4XFFA 3DKYA 1FT9A