3RG0A

Structural and functional relationships between the lectin and arm domains of calreticulin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
320
structure length
292
Chain Sequence
DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRSKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calreticulin
publication title Structural and Functional Relationships between the Lectin and Arm Domains of Calreticulin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 70
structure length 292
sequence length 320
ec nomenclature
pdb deposition date 2011-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.250.10 Mainly Beta Ribbon Calnexin lumenal domain, non-globular proline-rich hairpin domain Calreticulin/calnexin, P domain 3rg0A02
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rg0A01
4YM1A 4DRVA 1N3PA 2EXJA 2A7AA 3IM0A 2W08A 2P3KA 1G7YA 1GZWB 5GLWA 4LBQD 3I4IA 1U0AA 3R4SA 4YZ2A 4XJ9A 2XB6C 1H9PA 1IKQA 4FQ4A 4XBQA 3OGGA 2EIGA 2A6XA 3IMNA 2HYKA 2GNBA 2SBAA 2ZGSA 4XOGA 1SACA 1W0PA 2A75A 1MS5A 2W52A 4P9YA 3ZXKA 1WW6A 3B3QE 4XHBA 2D43A 3V0AB 1SBFA 4YG6A 1H30A 2D7FA 1LULA 2D44A 3NV3A 4FPJA 3AP4A 4TYSA 5JVVA 4YFWA 2KM2A 4DS0A 1SLLA 1WD4A 3WV6A 4HANA 1N1VA 2R1BA 3AYDA 2A6VA 4U36A 4XBNA 5DG1A 1JHNA 1SCSA 1PZ8A 1S0GA 2ES3A 2VUAA 4FPFA 3WG4A 4BQ1A 3AYAA 4HL0A 5JOXA 2DYCA 2NYYA 3FLRA 4BM8A 1APNA 1W6OA 2A5ZA 1UX6A 5LK5A 1HLCA 4PQ9A 3ASIA 1JYIA 4Y1XA 4FOQA 3ZSMA 1LEDA 5JLVA 3ZSJA 1N1TA 1W6QA 2DU0A 2D6NA 3FUOA 1O4ZA 3WDUA 3ZPYA 5JMCA 4Y1ZA 1MVEA 1W0OA 1LOEA 4Y20A 1G8WA 5JOYA 1DBNA 5T5PA 3WG1A 2A3YA 1W6MB 1KDMA 1O4YA 2OVUA 1W6NB 2GMPA 1FNYA 2ZGNA 4GA9A 3FFZA 2DVGA 4H55A 3NV4A 1V6IA 4UW5A 1SCRA 1V6MA 4ZXKA 2JE9A 4LBKA 3SH5A 3AZVA 2OUHA 1KJLA 1RINA 5HCBA 5DZFA 1G9CA 1Q8OA 1GNHA 4LBQA 5T5OA 1QDOA 3WUDA 1LCLA 2BQPA 1R1ZA 1ENSA 2ZACA 3AXEA 1N1SA 3D5OA 1ULEA 2D6LX 2VH9A 5EXOA 1C57A 1V6NA 3WCSA 1AXKA 2EXHA 3AXDA 4XJ8A 1V00A 3ZSKA 5FREA 1D0HA 1J1TA 2CY6A 1DQ1A 2JE7A 1DZQA 4SLIA 1AF9A 3SH3A 3V0BA 5KXEA 5JOZA 2GMEA 4Y1YA 4FOWA 1X50A 2ZGUA 1UPSA 2UURA 1DLLA 2EXIA 3ZYPA 1HQWA 3N35A 3HMYA 4Y22A 3D6EA 3AZWA 5DZEA 4I30A 4M3CE 2DVDA 2P37A 3AZZA 2ZGQA 1QNWA 2YY1A 2UWCA 5GZFA 3WG2A 3R05A 5KXCA 4K20A 1GV9A 1AXZA 1MVQA 4GKYA 4YM3A 3IPVB 4GWNA 3B69A 2ZGRA 1ZM1A 2I2SA 2XG3A 2WSUA 3AP5A 3SLIA 1Q56A 3ILRA 4BLJA 5H9SA 3INAA 2AENA 4TZDA 1SFYA 1QDCA 2ZHMA 3AP7A 1AX2A 3AJYA 3MW2A 1A8DA 2EAKA 2JECA 3M2MA 4PCRA 5CA6A 3GNEA 2ARXA 2AYHA 2EXKA 4RL7A 1FV2A 2WT2A 3C2UA 4YW5A 3OBTA 3VUOA 4M3CA 1DYPA 2OW4A 2PELA 4DQAA 1G9DA 4D69A 3N36A 3WHUA 5DZGA 5GLTA 1F9KA 1GSLA 1LU1A 3I8TA 3RQ0A 2WSVA 3B01A 3AK0A 4ISQA 1N1YA 2A6YA 4YW1A 1JXNA 2OUJA 3FUQA 2V73A 2ZGMA 3N3HA 4XMIA 1FYUA 1LGBA 2D3PA 1AXYA 2JDZA 4K1ZA 5IK4A 2PHFA 1JW6A 1CN1A 1ONAA 3SITA 2CWSA 1AX0A 1GBGA 1AX1A 2DTYA 1UKGA 4P14A 4WVVA 1H9WA 4BOWA 3NV2A 3W59A 3OJBA 3ZXJA 4AGGA 4YGEA 1MZ6A 2JKBA 2ZMKA 2VW2A 3VKNA 1F5FA 1JOJA 2VW1A 1AZDA 1HQLA 1IS3A 1Z78A 2YXSA 4FPLA 4ASMB 5IUQA 4XXPA 2PHUA 1BXHA 3GALA 1ULCA 1GICA 3PMEA 2ZKNA 5CAZA 4WV8A 4C1XA 1GZWA 2ZABA 1WCSA 2PHXA 2V5YA 1Q8QA 1MS3A 1WBFA 5T50A 1QF3A 2EALA 3A0KA 1WW7A 3O0WA 3V64A 5T5JA 1LOCA 4YZ1A 4AYUA 1QGLA 3RRDA 3WHTA 3FLPA 1MR5A 4FP3A 4YGCA 3V0AA 4OZXA 1VAVA 4Z8BA 1FAYA 3N7MA 4BLIA 2W68A 1UZYA 4DFSA 1W6PB 5F9TA 3PVNA 1S0CA 1HDKA 1CR7A 1BYHA 5T52A 2ZAAA 4K21A 2NMOA 4Q2FA 3USUB 3SISA 1B09A 2P3JA 1KRIA 3M3CA 1QMJA 4WZFA 1DIWA 3MPPG 4JC1A 1CONA 3AX4A 2WLQA 2FHRA 3MW4A 1CQ9A 5EYYA 1LODA 2E7QA 1N3QA 1OKQA 3KM5A 1WW5A 2WNEA 3AFKA 2ZZJA 4R9AA 1SLTA 1UL9A 4YM0A 4FPYA 5EWSA 2GN3A 2VU9A 4YW4A 4AGVA 5DUXA 2LALA 1GLHA 2B7YA 5GZGA 1ULFA 1WLDA 1DYKA 1QU0A 2WQZC 3D4KA 3O12A 1ULDA 2R1DA 1DQ0A 2E51A 4IQPA 1W6MA 2NMNA 2VXRA 1Q8VA 1LGNA 1SLCA 2D6KA 2DTWA 1W6NA 2R16A 2P2KA 4XHXA 4FOYA 1FNZA 4LBOA 1SBEA 1WBLA 5GJ6A 4YZ5A 1LGCA 1SLBA 5DUUA 3UL2A 4JCKA 2WKKA 3AJZA 1LHNA 5GZCA 2E6VA 4Q1RA 3ZVXA 3ZYRA 4GKXA 3MEPA 5E88A 3RSJA 1LOBA 2GNDA 1WD3A 3O0XA 4FPHA 3WDVA 2WT1A 4UW3A 2ZMNA 4BPZA 4Y24A 4AVVA 3AP9A 4FPKA 2ARBA 3M3EA 5GLVA 2ZHKA 1DQ6A 1JUIA 4UW4A 3WZ1A 3B00A 3WG3A 1S0BA 2AGSA 3BTAA 3FBYA 3R4UA 1AJOA 4M00A 3VKLA 4AWDA 3V65A 1DHKB 1PZ7A 1DFQA 2D3RA 3OY8B 2ENRA 2VW0A 3RMXA 3NWKA 1QOOA 1NXD1 3MW3A 1MS1A 3JU9A 5DUWA 1IKPA 2D6MA 1FX5A 3WDYA 1RITA 1KQRA 5JDBA 1F31A 1A3KA 2AREA 2ZGOA 3VKOA 4YZ4A 2ZGLA 3ZXLA 4DPNA 1AVBA 4WVWA 3AZXA 1Q8PA 4KBBA 2R49A 1A78A 2DURA 2SLIA 2AH2A 2ZHNA 5IK8A 2ERFA 3O0VA 4R9CA 1XQNA 4Q8KA 2NP0A 3VKFC 1I3HA 1LENA 2PHTA 1C1FA 4MYEA 3IPVA 4ATFA 4BMEA 3UJQA 1HKDA 5F5QA 4FQZA 4FVVA 1QNYA 3PVEA 1WUVA 1V6OA 4YW2A 1I1EA 2Q5TA 1FV3A 2DUOA 2UWAA 3OYWB 3SNMA 1C1LA 3POSA 1CPMA 3T1LA 2LTNA 1G9BA 5KXBA 1MS9A 5T54A 1V6KA 4LBJA 1WLWA 4NO4A 1OQ1A 3TAYA 1LOFC 4XE9A 4XJWA 1QKQA 2D6OX 5IK5A 4NOTA 2CL2A 3VKMA 1UN1A 3B9CA 5JOWA 1DQ4A 1VLNA 5DG2A 2YV8A 1YO8A 3OBRA 3IN9A 1WW4A 4P9WA 1OFSA 4YG3A 4YFZA 2A3WA 4AGRA 2A6WA 2DU1A 1MS0A 1Q8SA 4PBPA 5T5LA 4M3CF 3O5SA 1GKBA 4M01A 1GNZA 2A3XA 1JBCA 5DXDA 4CTEA 2PHWA 2YZ4A 5FRAA 2P34A 3M1HA 2DUPA 1JYCA 1LHUA 3BODA 1LJ7A 1S0EA 4YGBA 3RMYA 3WDXA 3ZXEA 1RIRA 4YG0A 1LHVA 2W39A 1Y7BA 5L73A 4LBNA 1MS8A 3WDWA 3JUUA 3DGTA 1BZWA 2ZMLA 3VV1A 1TEIA 1IS5A 3LSEA 3WDTA 2GNMA 1V6LA 2C9AA 2NZ9A 3QCWA 3RG0A 1LEMA 1LOFA 4ATEA 4XXAA 2GDFA 3ILNA 4XJZA 3W58A 1VIWB 1JN2P 1GZ9A 1S0JA 4LBLA 4K1YA 3AYEA 5GM0A 1BQPA 4ISRA 1DQ2A 1WLCA 2C5DA 4FPOB 1S1AA 3HN1A 3PJQA 1W6PA 4FP2A 4XYXA 3RS6A 4Q27A 3LSDA 4XMAA 1NLSA 2RHPA 1W6OB 3WLUA 2TEPA 2CYFA 3N7LA 4XTMA 2GMMA 1G86A 3M3QA 1S0IA 1MZ5A 1UZZA 3USUA 1KJRA 2ZHLA 5GLZA 4YGDA 1W6QB 4FOVA 1G9FA 4Y20B 1YXWA 2CWMA 3POYA 5IK7A 4XBLA 4Y1UA 2FMDA 1LTEA 3A0NA 2E7TA 2WJSA 1SBDA 1YIFA 4YZ3A 1D2SA 1ENRA 1IS4A 1QOTA 4GXLA 1LHOA 1CVNA 1YYNA 4UW6A 5AVAA 2D3SA 2JJ6A 3NV1A 4Q8LA 2ZGKA 3AYCA 5HCAA 2NN8A 3ILFA 4FPGA 3DUIA 5GZEA 1CJPA 3BOPA 5E8AA 3L2YA 2PHRA 2A71A 1FATA 3WVJA 1MS4A 4LBQB 3U4XA 4XIOA 3KQRA 1LOGA 4YW3A 4PF5A 4PBOA 3UJOA 3AP6A 3SH4A 1QOSA 5EYXA 1GYKA 1YI7A 1LU2A 1SLIA 1IS6A 1CESA 2CNAA 2DVAA 3M3OA 5H9RA 3WCRA 3N7JA 1IOAA 1LOAA 4ITCA 1KITA 1SLAA 5CNAA 5T55A 4F83A 4FPEA 3N7KA 1Z0HA 1LECA 1LHWA 1VAMA 1CIWA 3POWA 4YLZA 5H9QA 5H9PA 2R0FA 3V0BB 2A70A 4BMBA 4GWMA 3T1MA 3OPZA 2YROA 4U2AA 4Q26A 1DQ5A 1EPWA 5HCFA 1DGLA 3WOGA 1ZA4A 5E89A 4XJUA 2DV9A 4RA0A 1PZ9A 4CZSA 4Y22B 2EF6A 1BKZA 1AJKA 1C4RA 3OY8A 4JRAA 2UWBA 5GZDA 4AVTA 4C1WA 5IT6A 1CPNA 3WUCA 2A6ZA 1UAIA 3A4UA 3ENRA 2GNTA 5DUVA 2DUQA 2YMZA 1MACA 2UU8A 5SV8A 2GN7A 4P9XA 1LESA 4Y1VA 3WNXA 4XDQA 2H0BA 4XJAA 2ZGTA 4GALA 3HR9A 1BJQA 4XTPA 3BIWE 2ZA9A 1S0DA 2NM1A 3ZXFA 3H0OA 1V6JA 2DWRA 2AR6A 4M3CB 3T2TA 5CBLA 2AUYA 2Z42A 4XZPA 3Q9OA 5CB7A 4Q1PA 4XIKA 1G9AA 3OYWA 3LCPA 4FPCA 1UMZA 2R0HA 2E53A 3FLTA 2CTVA 3IKWA 2WT0A 3TB0A 3QLQA 3CNAA 2D6PA 4ZKTB 2DVFA 1ULGA 4R9BA 2ZBJA 4LBMA 3ZSLA 4W65A 1ENQA 1KDKA 2VY0A 3APBA 3PVOA 4AVSA 1YRZA 2JD4A 3UK9A 1N47A 3ATGA 4YM2A 4DRRA 2G4IA 4XILA 4CRQA 5KXDA 1VALA 1HHNA 1S0FA 1N3OA 5BYNA 3AZYA 2GALA 1GANA 2P3IA 1GZCA 1URXA 2DVBA 5GALA 5GLUA 1K9CA 4L8QA 2ZGPA 4R9DA 4Y26A
chains in the Genus database with same CATH superfamily
5A7NA 4CDQA 4DRVA 5ACA1 3HVDA 2P3KA 1GZWB 3LEKA 4LBQD 5GLWA 3ZYIB 1OA3A 4YZ2A 3RJ2X 1DU3D 3W20A 1H9PA 4RGKA 3ZFEB 4LITA 4XAEA 4YVWC 5FY9A 1W90A 1C8M3 2HYKA 2JIJA 4QHBA 4XOGA 4AXOA 5IHRA 2B42B 1SACA 4MUVA 2BVVA 1EPZA 1MS5A 2VQAA 4XFHA 1OF4A 4EQVA 2D43A 2OIIA 2WNVA 4CEWA 4JQRA 4Q4W1 5BNQA 3LZZA 4WM7A 1XSRA 1QH6A 4XUPA 4HSJA 5J48A 5E1RA 4AK3A 3ZR5A 1D2QA 2GC2A 3AYDA 3JBG1 5I0UA 4CCMA 4RSUA 4U36A 1NE4A 5DDJ1 1AR72 4DXTA 2VUAA 4FPFA 5A6QA 4QGLA 1RUH2 4HL0A 1UZWA 1BBT1 3N9LA 1WWYA 4IETA 1DP0A 4UYBA 1PO12 5FYBA 1EV13 4CDUC 1QJY2 3KT7A 3R4DB 4XF1A 1JYIA 2VMCA 1G6NA 4Y1XA 5HPOA 3GDBA 3POEA 4XF0A 4NJ4A 4PQQA 2DU0A 3ZPYA 1L7RA 1NG0A 2XQXA 3FUOA 3J9SA 3HD8B 4XACA 3USSA 4Y1ZA 1MVEA 1W0OA 2D5HA 4Y20A 1G8WA 4EN7B 3PHMA 1DBNA 5A3WA 3LB9A 2IZWA 2WWSA 2D97A 1AR61 3ZFFA 1ZVFA 4R4XA 3GCXA 4BU2A 5HBAA 1QJFA 4UW5A 3NV4A 1V6IA 2VUDA 2Q8OA 4LBKA 5CKMA 1NLRA 2JG8C 4WM8C 5L9VA 3AZVA 4V1PA 2ZKLA 1RINA 5HCBA 5DZFA 4NRMA 5BNPB 3LA7A 4D6RA 3HPNA 2QVSB 4L97A 4ZS3A 1QDOA 2WO7A 1R1ZA 1ENSA 2WR9A 2ZACA 1N1SA 2J1EA 3AXEA 4OI1A 2WO1A 2VH9A 4CCJA 4URTA 1W8WA 1HQNA 1C57A 1RUJ2 3WCSA 5FMDA 1AXKA 2EXHA 3AXDA 3N9QA 1RUI3 4W6XA 4XJ8A 3ZM8A 1X8EA 3A21A 4E2SA 2IUWA 1DZQA 1AF9A 4L99A 4LIUA 2X29A 5JOZA 2GMEA 1GP4A 4BCUA 4QM9A 4OHZA 1UPSA 2UURA 5A33A 5IJRA 1DLLA 1QHDA 1VRH2 4BK5A 1UQXA 4AL9A 4ZZ8A 2HWC1 2P6CA 5DZEA 3CZUA 3AZZA 3ZFGC 1QNWA 4N43A 1JYWA 2UWCA 5CFDA 3WY6A 3R05A 5FY4A 5C8CC 1GV9A 2KXLA 4O65A 1F8VA 1I5PA 4GKYA 4AAXA 2EVXA 1FXZA 1SPPB 1UX7A 4FFHA 5F5CA 2YC0A 1YQ8A 3VBFA 2IFWA 1COV3 4GWNA 4KWJA 1ZM1A 5DAVA 2VMIA 2WSUA 3AP5A 1R092 1GP6A 5FYVA 4BLJA 4KU8A 3CBNA 3RZZA 2C1FA 1AX2A 4MX3A 4NAMA 2WYFA 3AJYA 1A8DA 2JB8A 4JDOA 1DZTA 2QNKA 2JECA 2K0GA 3B5LB 3O1OA 2ARXA 1QH7A 5C3QA 1QXJA 4RL7A 2XR4A 3OBTA 2XHKA 3AM2A 4R8HA 3TEXA 4M3CA 3ZFEC 4DUWA 3VUOA 1J83A 4BZ4A 3WW4A 4D69A 2WUHA 3RVHA 5GLTA 1F9KA 4AVBA 1UIJA 1FPN2 1LU1A 2WIIB 1XYPA 3Q8EA 4X6RB 1QJEA 3ON7A 1LRHA 1OD3A 2IC1A 2XUMA 1UKRA 3AK0A 3UGFA 4ISQA 2A6YA 3I2KA 3F2ZA 2OUJA 1UZVA 3FUQA 1NX9A 4W50A 2CU5A 2WN2A 2PLV2 1W2UA 4MADA 3NKGA 4XMIA 2D3PA 4O9GA 3VD9A 4LT5A 2VM9A 2JDZA 4K1ZA 1STMA 1WKYA 4UOJA 4E4SA 2PTMA 1PX4A 3OPWA 1ONAA 3KCCA 4D3WA 4XW3A 2GC0A 2ZOEB 2DTYA 1AX1A 1HXS3 4P14A 5FZGA 4BOWA 1OH3A 3NV2A 2YPDA 3OJBA 4IV3B 3ZYBA 3ZXJA 2VNRA 4LQRA 5F3CA 3HQUA 4DO0A 4RR3C 3DYPA 1JOJA 3DECA 2EA7A 3RJRA 3S7IA 1Z78A 3MV11 4FPLA 2ZTNA 3U14A 1J3QA 1VBE1 4ASMB 3GALA 3ST7A 3UYJA 4BQ3A 2ZKNA 4N53B 3T3YA 3MV01 5A6ZA 4C1XA 1ND3A 1WCSA 1HW5A 2V5YA 4IV1A 1Q8QA 2B39A 4KG8A 1O3RA 1UMIA 1UOBA 3ZMOA 1NLQA 2MEV3 5FOJB 5J37A 4LHSA 4HVRA 1VBC3 5F32A 4JGZB 1F2NA 3GXUA 2QQMA 3LKJA 1L3JA 1OOPA 4LA2A 1VAKA 3AMQA 3ZYGA 4E27A 3O1PA 2VQUA 4YGCA 1O3TA 3HN3A 4NRPA 2QCSB 5IAVA 3E97A 5C71A 3PTYA 4MGIE 2W68A 4IE5A 2VOTA 4XZUG 1W6PB 3JD71 3DV8A 3U1XA 4QMAA 4AQ6A 2R043 4AFCA 4HSLA 4H7MA 2LM3A 2ZAAA 3LGRA 2NMOA 4QD2A 4H2AA 1XNDA 1QMJA 2KD7A 1ODMA 3IMMA 3MPPG 4A6OA 1QEXA 5KC5A 5FZCA 3MW4A 5EYYA 5A7WB 2FCTA 4C90A 1OKQA 1REEA 5C3SA 1GP5A 3TYJA 1TMF3 2C26A 2ZZJA 4YM0A 1UL9A 3MF9A 4FPYA 2MHFA 2UY8A 4RQPA 5EWSA 2RG4A 2OKXA 3RGBA 2LALA 1CX1A 1QJX2 1ULFA 3HNMA 3O12A 4AVAA 5DN2A 1CWPA 1DQ0A 4O9EA 1VBA2 1OH4A 2NMNA 5F3GA 1Q8VA 1OLQA 1SHWB 4UFMA 1GQHA 1QJU1 2DTWA 5DAWA 1LAJA 1Z7S1 3MGUA 2K2SA 4MHRA 3VD3A 2ET7A 4E8DA 4YZ5A 5DUUA 2FCVA 4W4ZA 1LHNA 3J8F2 2QQLA 1UWWA 5E88A 2HWB2 2RM21 2CDPA 3DPRB 2WT1A 1ZBE2 2ZEZA 3GJBA 1R081 4DXZA 5L7OA 3IAQA 5C7GA 2X53S 3AP9A 4FPKA 5A3TA 5F7UA 2ZHKA 3O7OA 1VB4A 4UW4A 2ARCA 5G05L 4EV0A 1F4AA 4Z1VA 5JAXA 3B00A 3VKLA 1AJOA 1R1A1 3D82A 3MFCA 4HZFA 4S2GA 1KD7A 2IFRA 1TNRA 3I3EA 1AR73 1DFQA 1J84A 3OY8B 3I59B 5FYTA 2WABA 4AQSA 1RUH3 2HEVF 1AYM2 1QOOA 4KWKA 2ETEA 3MW3A 3JU9A 2J22A 3U11A 1OUXA 1PO13 1Y9QA 4LUKA 1QJY3 2D6MA 4ORFA 4QB6A 4RHV1 1ZRDA 1RITA 5CU1A 2D5FA 5FPAA 3OTFA 3MIFA 1EY2A 2WC2A 1YNAA 4HBNA 5BNNB 1MZEA 1UPIA 4HN0A 5DMYA 4YVSA 1PGL1 2DURA 4F7ZA 5JXJA 2FQPA 4B3NA 2ZHNA 5EJ3A 5IK8A 1PMHX 3AB0A 3K4AA 1XQNA 4QU1A 4IE0A 3IPVA 4A44A 1BEV1 4HETA 5G04L 5FY7A 1H1MA 5F5QA 2WNOA 4ASLA 1BCXA 1QNYA 4QXHA 1V6OA 1MZFA 2FDKA 5FMBA 1CAXB 4OCTA 1O91A 5A32B 2Q5TA 1PK6B 1H8TA 4JGYC 3NNFA 4N53C 5I8SA 2WNUA 2XBO2 3LE0A 3VBUC 1F5JA 3C7EA 4YWAA 5T54A 3HWJA 4FFFA 4EZHA 1KS5A 4Q0QA 1E5HA 2ORXA 1RUJ3 4JGZC 4LO8A 5LK7B 1UU6A 2GH8A 4OFGA 2HBTA 2R061 3DKQA 4XJWA 1QQP2 2D98A 5FZMA 2OQ6A 5IK5A 1EAH1 4NOTA 4XF4A 4XUTA 3B9CA 3ZDVA 2W94A 4Q29A 2J1UA 3KGLA 1ASJ2 2HBUA 2WQ8A 1YO8A 2WDBA 4QQHA 1KS4A 3P5BA 4YG3A 4Y5Z0 4YFZA 5KWRA 2A3WA 3AKQA 4AGRA 4CU8A 5LA1A 1VRH3 3MPBA 5T5LA 3W5NA 2RR12 1HB4A 1GKBA 2FZ2A 2BUKA 3N9NA 1BMV2 5I0SA 4UAPA 5FRAA 2K9ZA 4GB32 5E16A 2DUPA 3BODA 3ECQA 5CG8A 3GJAA 1S0EA 3AMPA 1PO22 3KV4A 4PIZA 5JZGC 1RIRA 3B9IA 4Q4X2 2VZRA 4GMP0 4EN9B 4A7YA 4CCLA 3WDWA 4HN1A 3DGTA 1CAWB 1R093 3JQWA 5FZ0A 3U4SA 4DOUA 1D0GA 1WCDJ 5C6CA 3H8XA 3LSEA 2QQWA 3C7OA 2GNMA 2VMEA 4O7XA 4ATEA 1SMVA 4Y4RA 3A23A 1RB8G 3FC0A 4ZONA 3GBWA 2JDMA 2PMWB 1W3VA 1IG0A 1AR82 3BPZA 2W95A 2XHNA 1NCQB 1S1AA 3PJQA 4PDWC 5AC92 1FPN3 3H1YA 3VBOA 1YFXA 4Q27A 4XMAA 2KA3A 3DPRC 3K77A 3POJA 4P9IA 1US2A 2TEPA 4XTMA 1PVXA 1GOGA 1QWRA 3I3DA 1UZZA 1KJRA 2PLV3 4HONA 2AZ5A 4HPKB 1HRI2 2IVIB 5CADA 3POIA 4FOVA 1YIPA 3FHIB 2ZAHA 3KV5A 1GMMA 4QXKA 1AR91 4RYDA 5KHIA 2WA4A 1MEC1 3ZXAC 2WJSA 1W9FA 1YIFA 2WN3A 3NJVA 5LASA 1QOTA 1CAVB 3J4UH 4WVMA 3UT0A 1C8NA 1CVNA 3VKOA 5I93A 1JU4A 2JJ6A 3NV1A 3AYCA 2R071 5EFUA 4LO6B 5GZEA 2Y64A 4M0HA 3SMHA 5A1FA 2A71A 2Y6HA 5FXZA 4KWUA 5D1IA 3WVJA 5BNNC 2CGOA 2DFBA 3BPSA 4LOTA 4XIOA 2G19A 4Q0SA 4Z2AA 3KQRA 3UJOA 4PF5A 4PBOA 3D8CA 3OSDA 1QOSA 3LWCA 1B35A 3TN92 1JOPA 1POV0 1ZRCA 4BQXA 2XVGA 3OEAA 2DCKA 4F83A 1LOAA 3NL1A 4ITCA 4QX3A 4PI2A 3VD4A 5FJKA 3B93A 1LHWA 4YLZA 2VBDA 1VAMA 3SCGA 1D4M2 1RXGA 2HWD1 5H9PA 2R0FA 5H9QA 3SCHA 3VBSA 1WCKA 1ZNPA 4R52A 3WNOA 1NKGA 3QD6A 1S2BA 1RUF2 5D8AA 2F4LA 1EPWA 1VMHA 1DGLA 3POGA 3WOGA 2VL4A 5JR2A 2VPVA 4XJUA 1W2AX 3FFQA 4RA0A 1QY4A 4Y22B 1NAEA 1ZZ8A 4JRAA 2CGNA 5GZDA 4C91A 4B7EA 3A4UA 4GULA 5IYYA 4KU7A 4Y4YA 2B9UA 2GNTA 5DUVA 1NCRA 3VL8A 4CP9A 5J09A 2XLFA 3BIEA 3RZKA 5CG9A 2JE8A 4IW3A 4QPIB 5LY2A 2DUQA 3M4FA 5F1RA 1ODNA 1TVGA 4XFFA 1QJX3 3VZNA 1S2KA 2VOVA 4HMZA 3X29B 3O1TA 1MQTC 1VBA3 2H0BA 3KD4A 2ZGTA 5KHKA 1ZRFA 3LDKA 4IEXA 5D2AA 3BIWE 2ZA9A 3ALQA 5LBCA 3ZXFA 3J7NA 2PN5A 2AR6A 2R32A 1XE8A 2VQTA 3LEIA 4GIQA 5FZIA 4CDWC 4QKDA 5FBJA 2VECA 3J8F3 4OMCA 4XDOA 4XIKA 3LOBA 3OYWA 2HWB3 1JZ6A 1AYN1 4FPCA 1UCXA 1OD5A 2E53A 1ZBE3 1Q3EA 1XNAA 2XJQA 2YU1A 3LD8A 3ZX7A 2WZPP 3TB0A 3QLQA 4GD4A 1ZZBA 2DVFA 1D4VB 2Z5WA 1AL0G 4R9BA 4P5YA 4QX2A 4GMP1 1ENQA 4AVSA 2RS32 4NHMA 3UK9A 1AYM3 1M4WA 4YW6A 2G4IA 3AC0A 1W05A 3SQOA 3FE5A 1N3OA 5BYNA 3KB5A 4Q4V1 4UFKA 1GZCA 1URXA 4B29A 5GLUA 2E63A 3RI8A 4QT6A 3BGAA 4FFIA 4YM1A 2YC2A 1N3PA 3JCIA 1UY2A 5DABA 1X9PA 2JG9A 3IM0A 5C9AB 2W08A 3TRSB 1M06G 2HWE2 2ZS6B 3VHNA 5J96B 3R4SA 2YGMA 3N9OA 4XJ9A 3LFIA 2XB6C 3KZ4C 5F5AA 4FQ4A 4P9GA 4XBQA 4QPGB 2A6XA 5T3NA 2SBAA 3O1SA 3PDQA 5APAA 2RMU1 1W0PA 1TME1 2BEOA 2X5IC 5A1AA 3ZXKA 3B3QE 1K3IA 4ONUA 1QXPA 4OULA 2JXAA 1NYWA 4YG6A 5FY8A 5IVYA 1RMU2 4QKFA 2XGXA 3LF7A 3MUZ1 2VTXA 5KC6A 4UI9L 2EICA 3E6DA 2XLAA 3NAPC 4AEMA 5C4WB 1XE7A 4QQOA 3WP5A 2XBO3 1SLLA 1WD4A 1N1VA 3PUHA 2R1BA 1PIV2 2A6VA 4DNYA 1Y9MA 4AI3A 5HI0A 1RUC2 1SCSA 3H1MA 4Z2WA 2ES3A 4FAHA 5A6YA 4META 5K0UC 1H6XA 1E5SA 1QQP3 2DYCA 3E5UA 3VDDA 4AG4A 1XOYA 1UX6A 2XL9A 3C7HA 4PQ9A 3ASIA 1KXGA 3OOXA 4QB1A 1ENXA 2Y6LA 1ASJ3 2QDNA 4FOQA 5A7OA 3IIAA 3ZSMA 5CFCA 1ZBA1 2LW8A 5JLVA 3ZSJA 1IQDC 1YQ5A 2WZEA 1POV1 2IXKA 2Y34A 3NNLA 5FLIA 2F6BA 2RR13 5A70A 5JMCA 3HIFA 5JR7B 3ACLA 1WA4A 2VOWA 3K75B 2VXJA 4YVWA 3IDEA 2A3YA 4XF9A 1KDMA 1XU2A 2HH9A 2JDHA 2OA2A 4GB33 5FPBA 1W6NB 4GA9A 3TEWA 2DVGA 1V6MA 1PO23 1W8FA 5LB6A 3SH5A 4YPJA 4CYDA 4Q4X3 1KJLA 3VB9A 4LK7A 4DUVA 1UOGA 1G9CA 2W0XA 1ACCA 2G9GA 3A7QA 3N9PA 4IESA 3SEPA 5JI9A 3KSCA 2BZDA 5F2SA 1S55A 4LBQA 3WUDA 1LCLA 2BQPA 1C8M1 3D5OA 1ULEA 1CJDA 3I3MA 2E9QA 2V72A 4CP2A 1YWKA 2VOXA 3AKTA 1WZXA 5DAPA 5FZ1A 4CUGA 3BTZA 2VZOA 1UYPA 3EO6A 4RS5B 2VZSA 2XJUA 1V00A 5JCTA 4HT1T 2C0ZA 5FREA 1D0HA 1W3XA 2CY6A 1DQ1A 2D40A 4KNCA 5JSPA 1AR83 1WMFA 2YBPA 5KXEA 4Y1YA 5AC93 2B45X 4FOWA 5B2GB 1HJFA 3T2PA 3PUSA 4HK9A 5F8PA 2VCAA 1NA1A 1OSGA 4IL7A 1PM4A 3WR0A 3HMYA 4I0WB 1YQ6A 5LEKA 3JZVA 2JEMA 2XH6A 1HRI3 1UY3A 4KQ7A 2GC3A 2ZGQA 5ABJA 1O5UA 3VBRA 3WG2A 2Y6JA 1IHMA 4K20A 3H50A 1AXZA 1K5MA 2JG8A 4WM8A 5FIXA 1AR62 3WQ7A 2RDQA 1VPHA 3KHBA 3MYXA 4OI4A 2W9XA 3TBDA 5KHGA 4N9HA 2V4VA 2VZPA 3VL9A 5JXGA 4EN8B 3L9JT 1Q56A 3ILRA 5H9SA 3INAA 3KQ4B 2ZHMA 1GNYA 3PU3A 3AP7A 1NQJA 4MSVA 1OPMA 1MPXA 4BXFA 1V0AA 5HXMA 5CA6A 4S2DA 3VZLA 1XRUA 2ILMA 3WX5A 4FAGA 1FV2A 2WT2A 3VZJA 3FHQA 2OW4A 3T0BA 3TN93 4QPGC 4MO3M 4B4RA 3N36A 3LQCA 1KFXL 1XXNA 4OMDA 3ZFGB 4AVCA 1JZ3A 5C8CB 3MHZA 1GSLA 4K9SA 4XEZA 5FLJA 5FPLA 3OF1A 2CV6A 3K48A 1HX6A 1D4M3 3FHAA 3OD4A 4XPVA 1RUI1 4HK8A 2VE1A 4JV4A 2V73A 2ZGMA 1RUF3 3N3HA 5BY5A 4PLMA 1AXYA 3PU8A 2WRAA 1IGOA 2PHFA 1JW6A 2XUEA 3OUJA 3SITA 1AX0A 1GBGA 1ZA7A 3KLSA 4V2WA 3DF0A 5GKAC 2H6CA 4FTEA 4P9JA 4QGMA 3E6BA 5C8WA 5J1XA 4YGEA 2XDVA 2JKBA 1OURA 2ZMKA 4LKDA 3VKNA 1Y43B 3PUIA 1X7NA 1IS3A 2EIBA 2VNGA 1CIYA 4XXPA 3EMRA 4NPRA 4Y5SA 5IVCA 1ULCA 1GICA 3HJRA 4M4RA 1DYOA 3PMEA 2QQIA 2WZR2 4LPLA 1DGWX 4WV8A 1GZWA 4LA3A 1HB1A 1WBFA 4CCCA 1QF3A 3WNNA 2BVBA 4TSVA 1COV1 2OQ7A 3I54A 4P08A 1XB9A 4XQ4A 5FPZA 4BHPA 1HB3A 1CD3G 2BGCA 5K9YA 3BU0A 4CCNA 4AFMA 4K8RB 3CKHA 2AC1A 4SBVA 5FZ7A 4DINB 1HRV2 1VAVA 1FAYA 1NT0A 2WL1A 3AFGA 3GM8A 3S0MA 1UZYA 4DFSA 2QUOA 1CZSA 3U37A 3PVNA 2Q30A 4Y3OA 4B1MA 4RR3B 3BOWA 1HDKA 1DGRN 2IWGB 1OVPA 1HV0A 3VBHC 3AMMA 4K21A 5BNOC 2ZEWA 3SISA 4BIFA 4NPMA 3WXPA 4RS5C 5FZ3A 1CONA 3MBWA 2WLQA 2RS33 2E7QA 1N3QA 2W1SA 1QJZA 3KM5A 1RUE2 4D7TA 1RJ7A 1RVF2 1EUTA 2VOKA 4LLFA 2GN3A 1DLCA 4AGVA 2YU2A 5I8TA 1PM7A 2B7YA 1DYKA 1HXS1 1T6GC 2WQZC 1ULDA 3GBFA 3H3LA 3T2QA 5F37A 5BNPC 5FZBA 3ZFFB 2X05A 1RJ8A 2HWE3 2R16A 3T2OA 3MIBA 2VCCA 3NNGA 5A3UA 3ZLIA 4LBOA 4HVQA 1WBLA 3LA2A 1WMDA 3ZPOA 1LGCA 5BNPA 3ZYRA 3W5MA 4KWLA 3MEPA 4JDNA 5LEJA 2MEV1 2BBVA 2GNDA 1E5IA 2BGOA 2ZMNA 5JI7A 2WS92 1RMU3 1FOD2 3AL5A 1QXRA 5FQ0B 4Y24A 4CPBD 2W46A 5FZKA 5GLVA 1R64A 2YDEA 3OG2A 3ZDSA 1YFYA 2Y26A 1JUIA 3E6CC 3H8RA 2XJPA 4EROA 5CVRA 1S0BA 3FBYA 3BTAA 2HEYF 1UY1A 2ZX4A 4FBFA 4PIXA 1PZ7A 1RUC3 2D3RA 1HN1A 2ENRA 2VW0A 5JMOA 2R041 2HWF2 4IEPA 5FP4A 5CYYA 3OGRA 4QGNA 5DPNA 3WDYA 5JDBA 1F31A 1W39A 1A3KA 2AREA 2VCBA 1W9TA 3ZYHA 4YZ4A 4TN7A 4DPNA 2VNVA 3OGJA 4WVWA 4QWNA 2OS2A 1Q8PA 3ACFA 4IGQA 2LRPA 4LLOA 2R49A 1OVSA 1TMF1 2AH2A 4LIVA 2ERFA 2RS52 5JSRA 5FFOC 4EWDA 3GF6A 1SPPA 1LENA 3O1UA 4MYEA 2VZTA 4AEDC 4BMEA 5IFTA 2KR2A 3HQXA 2Y0OA 4B7KA 2XJSA 1VBB2 1PGW2 3PVEA 1ALYA 1ZZCA 1AL22 1I1EA 1GFF2 2ZX2A 2DUOA 4CDQC 3N4MA 4NHXA 2WO2A 1PHMA 3CHXA 1C1LA 3K3NA 3T1LA 1W06A 5K7PA 1G9BA 4COWA 1MS9A 1V6KA 5EV7A 2DDUA 4LBJA 2BRTA 2PQSA 4MGQA 4XQDA 3TAYA 3F95A 3AVSA 1QKQA 2D6OX 4PIYA 4C0HA 2CL2A 3VKMA 5FZAA 2BERA 1U5YA 2WNVC 4CEWC 1I9RA 1DQ4A 2C4XA 2CSGA 1XJAA 4WM7C 5DG2A 3GGLA 2YV8A 3OBRA 2QZ2A 4LNVA 1FMD2 4NMIA 1Q8SA 1AR71 2UYBA 4PBPA 2G1MA 1RTVA 4IXLA 1RUH1 4M3CF 4M01A 1GNZA 1H4HA 1JBCA 1W8OA 2B46X 4PT6A 2PHWA 3ZYJB 4E8CA 2YZ4A 5L9BA 1XC6A 2VVFA 5LA2A 1PO11 4JGYB 3TEZA 1QJY1 5FPXA 4IV3A 1JYCA 1LHUA 3VBUB 1AR63 1XNCA 1VBD2 4PLOA 4OHVA 3RMYA 3CL1A 4GWJA 1LHVA 2W39A 5L73A 4JHZA 1IPSA 2MNGA 2PHLA 1VRBA 2VZUA 4D8MA 5JXIA 4XCAA 3JUUA 4AAPA 4MGSA 5A3OA 2WBKA 1FI2A 2BOIA 1A8MA 4IEQA 3RG0A 4JGZA 5FZLA 3UKVA 3ZFFC 4MGZE 3ZMNA 4XJZA 4BIOA 4DXSA 1VIWB 3BCWA 2FDGA 1GZ9A 4NROA 1SDDB 1REFA 4K1YA 5LRSA 1PMIA 4ISRA 1DQ2A 2C5DA 1IPKA 2PAKA 3HN1A 3MLKA 4PLNA 1W6PA 4XYXA 5FUNA 4A45A 3RZLA 2Q1MA 2ZEYA 4CDXB 1ZZ7A 2QKDA 1W6OB 2RHPA 5DQ0A 1BK1A 2QJVA 1RUJ1 4AI8A 5JZGB 1G86A 4YNIA 2XJRA 3UGHA 2W2IA 4CE8A 1U5IA 4I09A 4JAAA 1OMIA 4YGDA 1W6QB 5LBBA 4OHWA 2RDRA 2BFUL 3FJSA 3MO4A 2YG0A 5A7WA 1YXWA 3POYA 5AVPA 3I3QA 2IVJA 2JDYA 4JTOA 3UETA 4AFDA 2E7TA 4XUOA 1VRH1 4BM8A 3P3PA 4UW6A 5C33A 4LO4B 3OBAA 4EJRA 4JKKA 4Z92B 3ILFA 3HNBM 4FPGA 3H1WA 1CJPA 2DCZA 5F5IA 4IEWA 3OD0A 4PDWB 1OBNA 2A73B 2WZR3 2WFF2 1FATA 4D94A 2HJIA 3WW1A 3THPA 3U4XA 4N43C 5CFDC 1J58A 2O8OA 4QXCA 3AP6A 4D6SA 1O7FA 3SH4A 5EYXA 2DFCA 3KVBA 1CESA 1R091 3KVAA 3LIGA 4CP1A 4DZGA 4G3YC 3NJYA 3PUQA 3RZJA 3N7JA 3VBFC 1KITA 3E5QA 4UT5A 2RE9A 3N7KA 3OBZA 5FMOS 1LECA 1HRV3 3CO2A 3WD5A 2JENA 2R6QA 3V0BB 2ZPXA 1OA2A 3RI9A 2A70A 2B8MA 2X10A 4LMFA 4F8AA 4NIDA 3IAPA 1HJGA 5A7SA 3OPZA 2YROA 3U78A 3NSTA 5HCFA 3BTXA 1JUHA 4GAZA 1UF2C 4K7JA 2J7MA 3B94A 1FPN1 1UYYA 4LK6A 5LBFA 1BKZA 3OY8A 3I59A 4AVTA 4CVUA 4DXRA 3I2IA 5IT6A 2VMDA 1CPNA 3WUCA 2PA7A 5FYHA 4UXAA 4A7ZA 3NKTA 2PLV1 1U5XA 3VZMA 1XE0A 4QPWA 1RUE3 2XMLA 1Y9GA 1RVF3 2DBNA 1MACA 3ES4A 1VR3A 4L9BA 5FZ4A 2NLRA 3CF6E 4Y1VA 3RZHA 3BB6A 4Q4Y2 3ME2A 4K6BA 4Q5OA 2B4KA 2WYSA 3ACHA 3I3BA 4KI5M 4AE2A 5LA9A 3O1MA 3MIHA 1BJQA 5LRRA 4NVPA 4AFAA 2BJSA 1W0NA 2EAAA 5J98B 1S0DA 2BWCA 2NM1A 2ZEXA 3QH6A 4Q0VA 4IEYA 1V6JA 2VZQA 5LBEA 4GJYA 2BU9A 5FR3A 2VUJA 2VVDA 4GH4B 4XZPA 1OT5A 1CAXA 2RJ2A 5CB7A 3HNYM 3MI8A 5A32A 4XABA 1PK6A 1H8TB 4XUQA 5BUVA 2CTVA 2HWD2 2Q1FA 2WS93 1FOD3 1ND3C 4IV1C 2L9LA 4W8JA 4D0QA 4D6QA 2J1SA 5FY0A 4ZKTB 4XF3A 1VB2A 2P6HA 3RFRA 3CQOA 3SHRA 2ZBJA 4LBMA 5A3MA 5L36A 1OOPC 3ZSLA 5L9RA 5FZ6A 2IXHA 3WQ0A 2VY0A 2ZX1A 1UY0A 1MQTB 3APBA 3PVOA 4XFBA 3BN6A 5FXWA 1YRZA 1RGSA 3NRUA 4DRRA 5BV6A 2HWF3 4NIIA 1VALA 1HHNA 4CDXC 1ZRIA 3AZYA 1CAUB 3S5QA 3WP6A 4CDWB 1K9CA 1RXFA 2Y38A 4L8QA 2RV9A 4Y26A 3ZXGA 5FJHA 4BXSV 1ULPA 1G7YA 3I4IA 1U0AA 3SKVA 2E7AA 3CU7A 4ZU7A 4CSWA 2VAUA 2O0OA 2RS53 1OXCA 4LEJA 3J7LA 4LR4A 5FK8A 1QJX1 5LWBA 3DYMA 1RUG2 5KHHA 4X8PA 1OPOA 1VBA1 4MXWB 1WW6A 3Q8FA 4P9YA 4UBHA 1CAWA 2ZJCA 3RPQA 3V0AB 1VBB3 1H30A 2D7FA 1XSQA 2XJTA 1AL23 1LULA 4AFBA 2D44A 4LULA 4W6YA 4FPJA 5FZDA 4L2NA 3THDA 2G9ZA 5D21A 5JVVA 5CISA 3OUHA 1UW8A 2KM2A 4DS0A 3WV6A 4WBBA 1YC61 1I5ZA 1E57A 3FX3A 3J8F1 1QIQA 1F35A 1BHGA 2HWB1 2JKXA 2LUWA 3D0SA 4XBNA 3DL3A 1JHNA 2YGLA 3CDZB 1S0GA 3M7AA 5A6XA 1NCQA 4BQ1A 5JOXA 2W91A 1OQDA 3AYAA 1YFWA 1APNA 3IDAA 1SG3A 3ZKYA 4AHXA 3Q8CA 5LK5A 1HLCA 1OF3A 1ZX5A 3AMHA 5L7OC 1KGYA 4XUNA 1LEDA 1FMD3 4HPKA 2X5IB 3EB7A 3I2HA 1N1TA 3U0ZA 1DCSA 2D6NA 3MIDA 4AHYA 1CZVA 1VJ2A 3DEMA 1AYM1 2GC1A 1LOEA 5T5PA 1W6MB 3NAPB 4Z82A 2BYVE 3RYRA 2HYXA 1CAVA 2GMPA 1FNYA 2VMGA 3FFZA 3WF1A 1T2XA 2YFUA 2E26A 1VBD3 1K42A 2QQUA 2OUHA 4ZHNA 2Y6FA 4WVZA 5K0UB 3HQRA 4G9SB 3OUIA 1Q8OA 4NHKA 3OEBA 5T5OA 4YVSC 3GZTB 3VHRA 4FFGA 2D6LX 3EJKA 5EXOA 1JZ7A 1LKNA 3HOBA 4INDA 1RHI1 1UXZA 1I6XA 2VGDA 4IE4A 1O4TA 5C5TA 1J1TA 3VGIA 2QE3A 3GYDA 3WT3A 1KEXA 4J25A 4GH4C 3RWNA 2P3YA 1RUD2 2VULA 4EWAA 3NNJA 5FO9B 1X50A 2ZGUA 3RNSA 5LZ6A 1H8TC 2LS6A 2EXIA 4QM8A 2JIGA 4PI0A 3ZYPA 2Y6KA 5IFPA 4F3JA 1QQP1 4Y22A 3D6EA 3AZWA 4CP0A 5EIYB 3BTYA 2BGPA 2VTFA 4I30A 5EZWA 2DVDA 2O1QA 1W9SA 5KXCA 1ASJ1 4L92A 4XQWA 4CCOA 3WINE 1V9U2 1NCRB 3FN9A 1MVQA 1W2OA 4CP9B 4QPIA 3TNPB 2RR11 1C5IA 4NPLA 1J3PA 3WF0A 1BMV1 2ZGRA 3AKRA 3SLIA 5L19A 3KHCA 4GB31 2QQKA 4N8MA 5DAQA 3ZN4A 3LOIA 2WFF3 1PO21 3THTA 4MGYE 5I91A 1WGPA 4PCRA 2VZ1A 3GNEA 1JHJA 4Q4X1 2EXKA 2Q8DA 4E4HA 4AEKA 2GP5A 4ARXA 4QDSA 1W8HA 5JSOA 4DQAA 1H2MA 3KWVA 2NQYA 4UBGA 1G9DA 1ND2B 4MHUA 2BNNA 3QACA 5DZGA 3WHUA 4ZS2A 1UU4A 3WNKA 5J7MA 3RQ0A 3B01A 3LFMA 1TE1B 4OHXA 1N1YA 4YW1A 5AFEA 4OQ8A 1JXNA 2RS12 3I2JA 1UD1A 2FBEA 4JQTA 1UO9A 1FYUA 3J7MA 1AR81 1NY72 4IGOA 1CGPA 3ACGA 5AC91 5IK4A 1X33A 4AHWA 1JYNA 4H3WA 1GQPA 4I0BA 4WVVA 2I07B 3BUCA 3VBOC 4AGGA 1MZ6A 1F5FA 4GQ7A 1GOHA 1AZDA 1HQLA 2AEYA 5FO7B 2YXSA 4I02A 4A2UA 1O3QA 2PHUA 1BXHA 2J1VA 5CAZA 5C9AA 1PVC2 2PHXA 1DGRA 1Q5OA 1MS3A 5T50A 3QOPA 4QAWA 2EALA 2QQVA 3A0KA 4Q4Y3 5T5JA 5F6KA 5I0RA 1YUDA 3S57A 4QPGA 3WW3A 2F4PA 2BOJA 3CJIB 4I3PA 4LE4A 4IGPA 3RRDA 1JU3A 1Y4WA 1JZ8A 1PNGA 1H2NA 5KBFA 4MGKE 2YPJA 1WMXA 2YBKA 4FP3A 4JKMA 4RFT0 2V5DA 4OZXA 5FYUA 5FAXA 1C28A 3QH7A 1LR5A 3N7MA 4BLIA 3ACIA 3EHKA 4E2GA 2XJVA 3IWZA 4LKEA 5C4WA 5ANQA 4YSFA 4AW7A 1C3HA 2HWD3 3TN91 1CR7A 1JMUB 3T09A 1BYHA 5T52A 4BQWA 4Q2FA 3USUB 1B35C 1W8UA 1D4M1 5J36A 5I0TA 5ACA2 2OPWA 1CQ9A 2FD8A 1LODA 2QQNA 4QX8A 2O8QA 1RUF1 1WW5A 3VBSC 5SV5A 2LROA 1SLTA 4YW4A 2VU9A 4COYA 1YJKA 5DUXA 1JI6A 2Q4SA 4LHKA 5D8AC 5GZGA 1WLDA 4PJYA 1QU0A 1UZ0A 4QQLA 3ZOIA 4FCAA 5FYZA 4IQPA 1NZIA 5JUVA 2IXIA 3M70A 1F15A 3KT1A 4Q4W2 1W6NA 2XOMA 3I97A 4PF1A 1FNZA 2B9VA 3VBHB 2MPFA 5GJ6A 5BNOB 1NCRC 1W03A 2WKKA 1RUG3 5GZCA 2E6VA 3O1RA 3MLLA 3JBG2 4GKXA 1SQ4A 2WZ8A 3RSJA 4FPHA 1WD3A 3O0XA 5DDJ2 2JDKA 3RDIA 3WDVA 4CDUA 2C9KA 4BPZA 2TUNA 2XQRA 1K5JA 1UU5A 1BBT2 2VVEA 5FZOB 2ARBA 2WLPA 3M3EA 5I8YA 1DQ6A 2Z4FA 3I7DA 3WP3A 1PX3A 4A3ZA 3WG3A 4L0PA 4M00A 4AWDA 4B8EA 1O59A 1YI9A 3GZUC 1DHKB 5F3EA 4A41A 3VD5A 1C5HA 1VMJA 1EV11 1ND2C 1XYOA 2VBPA 3P3NA 4DY3A 3K51A 1MS1A 4V2VA 3LDBA 3RYKA 5FYYA 4KMQA 4QPYA 1NOVA 1US3A 1D7PM 1YJLA 2ZGOA 3POFA 4LO5B 1S2EA 2J1TA 2F17A 2RS31 1J59A 4E4DX 3AZXA 4HKWA 4KBBA 3T30A 1A78A 4HKLA 4FO9A 2BPA2 3GZAA 4JKLA 5IVEA 3O0VA 4EN0A 4A7KA 5AFBA 4Q8KA 2NP0A 4CU6A 2PHTA 5K8SA 1XU1A 1OI6A 2RDNA 1WCQA 1HKDA 1TQ5A 2IXLA 2ADEA 3PMSA 1CX4A 5C3OA 3GHNA 5CEHA 4YW7A 4LKSA 5EP9A 1WUVA 2HWE1 3WQ1A 3ZN6B 3OGSA 4MGTA 4YW2A 5FZHA 4JHTA 1FV3A 2UWAA 3SNMA 2JG9C 3LDRA 2I74A 1CPMA 2XVKA 2WFPA 3TEYA 5KXBA 2VZ3A 2WAAA 1X8MA 1WLWA 1W99A 1OQ1A 2DCJA 3N9MA 3ZKUA 3CJIC 1LOFC 3ZFGA 1RMU1 3A22A 2VTXJ 1EUUA 4NAOA 5C8CA 3NMBA 5JIAA 2W3JA 2HWC2 2FDFA 1OLRA 3OB8A 4X6QB 4DMIA 5JOWA 4CEYB 1RUD3 1VLNA 4TXWA 2YFZA 4K40A 2ET1A 2C24A 4AEDB 4K8FA 1WW4A 2A6WA 1MS0A 5CKQA 3O5SA 2A3XA 4NR1A 1H4GA 4UF0B 3ZR6A 3JQXA 4CDQB 2YYOA 3C3VA 2P34A 3M1HA 3MZHA 3VDDC 5FWEA 1H1AA 1LJ7A 1BLZA 1SFPA 1V9U3 1W8NA 4NWVA 2X09A 4YGBA 3ZFEA 4AI2A 4AI9A 4EZ4A 4HFSA 3I2GA 3NVCA 3PLQA 4KH9A 4XDPA 5CFCC 2Q0AA 2JDAA 4LBNA 2VUCA 2QQPA 1GUIA 4QDRA 3ZIXA 2WNVB 4CEWB 5A3LA 1BZWA 3E5XA 3IDBB 3WDTA 4E2QA 4WM7B 4JRLA 5FBZA 1V6LA 1O8SA 3QCWA 5FOBB 1XPWA 4AI1A 3AKPA 3WNPA 5FXVA 4AR2A 2VG9A 3ILNA 2VBBA 1H2LA 3NJZA 1S0JA 4FI9A 1YHFA 3AYEA 3ORJA 5FYSA 3VDAA 2W87A 1WLCA 4FPOB 1X9TA 4CCKA 3O1VA 4QQ2A 2RDSA 3RS6A 1O5LA 3LSDA 1NLSA 2TBVA 3WW2A 4RR3A 3EXUA 1H8VA 3OPTA 1VE0A 2GMMA 4NWWA 1GQGA 1WA6X 3M3QA 4HVOA 4BYYA 2RS13 1S0IA 2P17A 3PUAA 4TLFA 4BISA 1XYNA 2VZVA 4I01A 4HXCA 2DCYA 3T4HB 1VBE2 1G9FA 4Y20B 4QKNA 1POQA 2FMDA 1JYVA 1LTEA 4LHLA 3EQEA 2W1WA 3URFA 1ENRA 1IS4A 3WDUA 1LHOA 1XNBA 1YYNA 3PNAA 3MLJA 4UFHA 4KBZA 4Q8LA 2ZGKA 1Q43A 1UNBA 1X36A 5B4NA 1NA1C 5HCAA 1Y3TA 2FCUA 2W1UA 3DUIA 3I2FA 4N9IA 1YQ2A 5IVFA 3KV6A 1PVC3 1U12A 1CZTA 2H0VA 5ABJC 1VBC1 2QDRA 4YYOA 2X8KA 1ZZ6A 3VBRC 4YW3A 4S2HA 1K5MC 3JD72 4EE2A 1GYKA 2P5BA 3CLPA 1LU2A 3M3OA 1SLIA 1IS6A 2CNAA 1ZYBA 2DVAA 3AMNA 3I2DA 5H9RA 3FBMA 1AUYA 3SXWA 5CNAA 5FY5A 5T55A 3GZEA 1PIV3 2RVAA 4BQ5A 5FQ0A 3VN4A 1CIWA 3POWA 1YCIA 4ARYA 4GWMA 4A3XA 3T1MA 5A3NA 4U2AA 4Q26A 5FP3A 1DQ5A 5A33B 1SEFA 4QQPA 3ELNA 4BQ2A 4EN6B 3M3IA 1JZ2A 5HCHA 2DV9A 3IIIA 1PZ9A 3WNLA 4CZSA 2V4AA 2Y33A 1AHSA 1H2KA 2EF6A 3RWKX 1AJKA 4C1WA 3KCYA 2UWBA 5HV0A 3IB3A 3OGVA 4N43B 5CFDB 3ENRA 5ACA3 1QJU2 2BDRA 2D93A 1Z7S2 4OZOA 4CEYC 2XXZA 2UU8A 3VBFB 3RZMA 3FZ3A 2GN7A 4P9XA 2EIEA 3WNXA 4XDQA 3VDBA 3EBRA 2RM22 1HV1A 3J7HA 5JXHA 3R6SA 2VC9A 4GALA 1R082 3ITQA 4Q4W3 4XTPA 4LO7A 3CJXA 2CDOA 5IATA 3UESA 3H0OA 4TLGA 4E4ZA 2WZR1 3E1F1 4M3CB 2Z42A 3DCQA 2WQ4A 1R1A2 2ZXQA 3S6PA 3JBG3 1G9AA 3LCPA 1UMZA 2R0HA 5DDJ3 3FLTA 3DKWA 3UKTA 3UV9A 3T0DA 2A1XA 1WMEA 3WF3A 4LKFA 1BBT3 2WT0A 3K2OA 4DB5A 3CNAA 2WWJA 1FT9A 3LPFA 4J1WA 4RHV2 2OXBA 1HRV1 1OLMA 4MXVA 4W65A 2ZX0A 2RJLA 4BB3A 4OHYA 2J1RA 4MLOA 4BDVB 3LA3A 3P1IA 5EJ1B 1PGL2 3ATGA 3K46A 4YM2A 4XILA 3ETQA 4CCDA 1K45A 3BVCA 1HN0A 2J1AA 5A3PA 4N7UA 2P3IA 2DVBA 5GALA 1BEV2 2IXCA 2ZGPA 3LIHA 4R9DA 3VHOA 4A42A 4JGYA 2EXJA 4N53A 2A7AA 1XNTA 2WO3A 3MUY1 2N7GA 2ATFA 1ND3B 1JOBA 5ERLA 3VBUA 1RUE1 4IV1B 4UWDA 1RVF1 2W1QA 1RUOA 1IKQA 2PYTA 3OGGA 2EIGA 3H8UA 3IMNA 2GNBA 2ZGSA 1OOPB 2A75A 4GWIA 2CAVA 2W52A 5FV3A 4NIGA 4XHBA 1SBFA 5IVBA 2R062 4ZU5A 1RL3A 1NZCA 3NV3A 1EAH2 2VQ0A 3KV9A 2E33A 4NHYA 5FP7A 3AP4A 1GU3A 4TYSA 3UKNA 4YFWA 5EJZB 4HANA 5EQUA 5FUIA 3GBGA 2JWPA 5DG1A 2ARAA 1VP6A 1W9WA 3NO8A 1PZ8A 2WS91 4GZ9A 1FOD1 5EHDA 5FTTC 4KGQA 3WG4A 3ZN5A 4AZZA 4Y5TA 3FLRA 2NYYA 2HWC3 4CDXA 3HBZA 1W6OA 3LAGA 2A5ZA 3DXUA 4BWOA 5JZGA 2W5FA 3U10A 2BTVC 3H3ZA 4NRQA 4RQPB 1PGSA 1W6QA 4ZY9A 3PJYA 1O4ZA 2DCTA 5C70A 2HWF1 5JOYA 4CU9A 3POBA 3KF3A 3WG1A 4ES8A 4JX0A 1O4YA 3MFAA 5FYMA 2OVUA 2XL7A 2ZGNA 4BK4A 2DBIA 4H55A 4ZZ5A 4MG2A 5FLHA 4ZXKA 1SCRA 2JE9A 4HKOA 2XWBB 1SZBA 4PDWA 5JIUA 5F3IA 5FZ9A 2CHHA 5FZFA 3DPRA 1GNHA 2Z79A 2RS51 5LATA 4YARA 1YEWA 5L7OB 3ABZA 4DEQA 1YQCA 1T6BX 1UYZA 1V6NA 4UFIA 3S7EA 1VBB1 1PGW1 1AL21 2XWJB 4CUAA 3SEEA 4OQ9A 3ZSKA 1O3SA 2JE7A 4URAA 4SLIA 3SH3A 3V0BA 3K4DA 1RUNA 3JB8A 3TOJA 5C3PA 3V56A 4IE6A 1L7LA 1AR92 3SCFA 1MEC2 1O6UA 5FKCA 1HQWA 1W28A 1OKOA 1TNFA 3N35A 4CXWA 4P5HA 4IEOA 4CXYA 4M3CE 5BNNA 2R072 4IERA 2P37A 1DZRA 4LHNA 4JVAA 2J42A 2YY1A 3KF5A 1VBE3 4YVSB 5GZFA 3VZOA 4COVA 1OLME 2PHDA 4HG6B 2ZZQA 4CA9A 1FMD1 3MIGA 2ZX3A 4CXXA 2GH2A 4YM3A 5FWJA 2XONA 2FDHA 3IPVB 4QU2A 3B69A 3M8LA 2I2SA 2XG3A 5FDBA 4TZDA 2AENA 3PIGA 1SFYA 1QDCA 3W9AA 3MW2A 1VBD1 2EAKA 3M2MA 4HOOA 4CUCA 2WNUB 3O14A 4IV3C 2AYHA 5M0TA 3G7DA 2Q8EA 1WLTA 3C2UA 4YW5A 3JD73 1RHI2 2OZ6A 2FZ1A 4GH4A 1DYPA 2PELA 4FXKB 5FCCA 4CUBA 3ROUA 5HV4A 4LXLA 4NUBA 1OQEA 2WINB 4QKBA 4AF9A 1LNSA 2VD7A 3I8TA 2WSVA 2BNOA 2Q1ZB 1ZRRA 3SC7X 3TNQA 3LEMA 3VD7A 1JZ5A 5KHJA 4NIHA 1ULOA 1LGBA 5EPAA 3WP4A 4QB2A 3H8OA 1PNFA 1OC1A 3BALA 3HEIA 1MQTA 1UOJA 4IUGA 2FDJA 5FXXA 3U07A 1CN1A 2CWSA 3CZJA 4Y33A 1UKGA 2IXJA 1H9WA 4R4ZA 3W59A 5C3RA 2JD9A 3ZXDA 1CAUA 1UOFA 1QJU3 2VW2A 4XFCA 2VW1A 4CDWA 2YB7A 1Z7S3 2Y6GA 5J3UA 5IUQA 4NE9A 4OUEA 4ES9A 4COUA 4RQPC 5FMCA 4XAAA 3HAGA 2ZABA 3K4ZA 2VMFA 1J3RA 4XC9A 1DDLA 2RM23 1WW7A 1AYN2 3O0WA 3V64A 1LOCA 1LB2A 4YZ1A 4AYUA 1K12A 1R083 1QGLA 1REDA 1BK0A 3WHTA 3FLPA 1MR5A 2W47A 4MXWA 2E31A 3V0AA 2WFF1 4E9KA 1EYBA 2AACA 4Z8BA 1R1A3 1ZBE1 5A7PA 4KL1A 1GOFA 1JTZX 5FYIA 5JPMB 2BWAA 5F9TA 3VBOB 1S0CA 3KMHA 4IEVA 3WEZA 2XLGA 4LOSA 1E5RA 4NHLA 2UY9A 3B7MA 3CMGA 2GSYA 4FTSA 1GZTA 2Y60A 2O14A 3OCPA 1NXMA 1B09A 2P3JA 1JH5A 3M3CA 4Q4V2 4RHV3 4WZFA 1KRIA 1DIWA 1DG6A 1IZ3A 4JC1A 2BV4A 4K3UA 4BA6A 1UXXX 4QX5A 3AX4A 4D7YA 4I0AA 2FHRA 3VLBB 2VJXA 3I2OA 4C0BA 5LCWL 4ZU4A 3PURA 2WNEA 3AKSA 3FMGA 3AFKA 4R9AA 3W21A 3P6BA 2UYAA 2X5IA 3DN7A 4N7IA 4WVMB 2VNOA 4GJZA 2OYZA 5TSWA 1GLHA 2JDPA 2RJKA 3D4KA 4FT8A 3FWEA 1BEV3 2RMU2 3WQBA 1O8PA 2DF7A 4EWEA 2R1DA 1A34A 1TME2 1OUSA 2E51A 5FYCA 1W6MA 2VXRA 3NAPA 1JODA 1LGNA 3NW4A 1SLCA 2D6KA 2BP6A 4OUMA 1W8ZA 2GP3A 2PAMA 2H6BA 2P2KA 4XHXA 5FP8A 3G6JB 3UGGA 4FOYA 2BW8A 4WZCA 1SBEA 1SLBA 5ISLA 1B35B 4JCKA 3UL2A 3AJZA 2EIDA 3H42B 1U5ZA 4G4FA 4Q1RA 5K0UA 3ZVXA 4Q4Y1 4UFLA 1LOBA 4B4PA 4UW3A 3BI3A 3BYWA 4MVTA 4P00B 2R063 5K4LA 4AVVA 3ETPA 3VBSB 1BVVA 2XBO1 4QDQA 1EAH3 3CIHA 1H6YA 3MF6A 2JB4A 4J1XA 4P02B 3WZ1A 5C5UA 5D8AB 3R4UA 2AGSA 2WNUC 2Z2SB 1PMJX 1S4CA 3V65A 1ZBA2 4IEUA 2QBXA 3IT8A 5FK7A 4KGGA 4H7LA 3NWKA 4Q0PA 3RMXA 4MH0E 4XCBA 1NXD1 3EYPA 3TWIA 1PK6C 3PL0A 4I3GA 4DIQA 5DUWA 1IKPA 1FX5A 4MOAA 1KQRA 1OFNA 1YFUA 3MDPA 3VHPA 4TTGA 1DF0A 4B4QA 2ZGLA 3ZXLA 3D0JA 1AVBA 5FY1A 1UIKA 4QXBA 3AVRA 3JB4C 2SLIA 3HBKA 3GCWA 4RFRB 5CZKA 4DY5A 1H1IA 5A7QA 2YC4A 1YLLA 1IQAA 4OYUA 3WSOA 4CU7A 4R9CA 4Q0UA 2I45A 3PIJA 3VKFC 1IPJA 1C8M2 1I3HA 1C1FA 4OLLA 4ATFA 3KGZA 3UJQA 5LW9A 1IG3A 4FQZA 1HIXA 4B1LA 2QTWB 2OPKA 4FVVA 4P9LA 5LY1A 1EP0A 4IDZA 4ET7A 5LA0A 1GWKA 2PXJA 3OYWB 3HT1A 3WNMA 3POSA 4D7SA 3NJXA 2LTNA 2B5HA 1RUG1 2BFUS 2BNMA 2QQOA 3DXTA 3RZGA 2Q8CA 4NO4A 1UMHA 1ND2A 4TWTA 4XVHA 4XE9A 3WF4A 1UN1A 1EV12 4BQYA 3T0AA 1DGWA 3ES1A 5FP9A 3I49A 5CBLA 3C7GA 1UYXA 4O61A 1XBFA 2VR4A 1ST8A 4P9WA 3IN9A 4AQTA 1OFSA 2CGPA 1AR93 2R30A 4N90A 2AEZA 4NIAA 2DU1A 1MEC3 3U75A 3NQHA 1HRI1 4CTEA 5DXDA 2GU9A 4MZUA 1W9YA 3T08A 1L7QA 2P1BA 4QX7A 4BQ4A 4FXGB 2JDNA 2R073 1SDWA 2JG9B 3KS7A 4NN0A 4FTBA 1NCQC 3ZO0B 3C7FA 3J26N 4M0NA 2ZCWA 4OUSA 3WF2A 2JX9A 5DAXA 4AQ2A 3WDXA 1F4HA 3ZXEA 2VO5A 4YG0A 5IW0A 1Y7BA 2YBSA 1ZZ9A 5I0DA 2FMYA 1MS8A 2TNFA 4IE7A 5HXVA 3ZSEA 1W8TA 2ZMLA 3VV1A 1TEIA 1IS5A 5A80A 3BU7A 2C9AA 2NZ9A 1LEMA 3CJIA 1LOFA 4UFJA 4EYUA 4XXAA 1WCUA 2GDFA 3KT4A 3W58A 1RUI2 1JN2P 2OX0A 2QQJA 3LEGA 4LBLA 4RN5A 1RHI3 2HEWF 3Q8AA 5GM0A 1BQPA 3GHMA 1J1LA 2E32A 4HLTA 2Y8KA 4S2FA 4YRDA 1W04A 4ZXEA 4FP2A 4Z07A 4A6SA 3VDDB 3WLUA 2XKOA 3S5AA 2XKPA 2CYFA 3N7LA 3VZKA 4A4AA 5FPUA 4I2OA 3IDCB 4AI0A 4AEJA 1MZ5A 1H0BA 2ORZA 3HT2A 3USUA 5CFCB 4J6GA 2ZHLA 3KCXA 4OI2A 5GLZA 2G9FA 4XURA 1HB2A 1RUD1 4JDMA 2YHJA 2CWMA 4YVWB 5IK7A 4XBLA 1A6CA 3S30A 4Y1UA 1P8JA 1NQDA 3A0NA 1XNKA 2K46A 5E6HA 1SBDA 5IAXA 4YZ3A 4QHOA 1D2SA 4COZA 4GXLA 5AVAA 1X82A 4BJ0A 1COV2 2D3SA 4XFAA 2NN8A 5FZ8A 2XVLA 3BOPA 5E8AA 4LJHA 3L2YA 2R7EB 1KFUL 2PHRA 3THCA 1OA4A 3LPGA 4LORA 4RGGA 1V9U1 3SKJE 3UNPA 1MS4A 2CAUA 2GAUA 4LBQB 1NE6A 1LOGA 4JZRA 1RYYA 1AYN3 3NNMA 3PTRB 3VBHA 5BNOA 5JPNB 2V09A 1YI7A 4QPIC 4XFIA 4BE3A 4RS5A 3WCRA 1IOAA 1ZREA 1SLAA 4JTNA 4RGAA 2PAEA 4FPEA 4CDUB 1Z0HA 2VCMA 3H3UA 5FZOA 3ZIWA 2XPJA 3IBMA 4GMP3 3D3AA 5ANNA 1SFNA 5B4XA 4BMBA 1GWMA 4DUXA 4LTAA 2HKXA 1JS9A 1ZA4A 1NA1B 3T4VA 2BBAA 5CIRA 1W2TA 5E89A 1V70A 4AOCA 3PVBB 1C4RA 3MIEA 2PFWA 4Q4V3 4QHZA 2WWUA 3R0RA 4ZPIA 5F39A 1HXS2 2QFEA 4OVEA 1JZ4A 5ABJB 2A6ZA 1UAIA 4KG0A 3VBRB 2RS11 2OT7A 2ADDA 4FSJA 1K5MB 2JG8B 4WM8B 3BKZA 4LUMA 1NUKA 4MV2A 1NY71 1OHFA 3B02A 4H14A 3AL6A 4BH9A 3IZOA 1RC6A 2JICA 2YMZA 3C8XA 1BVP1 3RYPA 5SV8A 5FZEA 4OI0A 1GWLA 4CCEA 1LESA 2RMU3 2FDIA 1W2NA 5FUPA 1TME3 5BPXA 2MEV2 2VMHA 4XJAA 5A1LA 3K3OA 1VBC2 4LE3A 4DEVA 2WAOA 4XETA 3HR9A 2C6SA 4RD7A 5F6LB 5F2WA 1JYXA 5FO8B 2W92A 5JWPA 1TG7A 2GZWA 2HLEA 4AHZA 5IWFA 3DYOA 2DWRA 4M4PA 2Z69A 2P4EA 1PVC1 2JDUA 3T2TA 2AUYA 1TZOA 1GR3A 3CEWA 3FL7A 3Q9OA 3ZN6A 4Q1PA 5KR7A 1VMFA 4X8NA 5FPVA 3H7JA 5C9AC 1UY4A 2PQQA 2QZ3A 4CPBA 5IVJA 2R042 4PHZA 3IKWA 2YUEA 3MICA 5FKBA 2D6PA 3QBQA 4QX1A 1PIV1 2Y0IA 1ULGA 1RUC1 3VDCA 3H7YA 3Q8BA 3ZYFA 5IVVA 1ZBA3 1KDKA 5BXXA 2OZJA 1POV3 2JD4A 4W6WA 5CKNA 4CEYA 4C8DA 1N47A 4QX0A 1TMF2 4AEDA 5KXDA 4CRQA 4XFGA 5C4WC 3H9AA 4ASKA 3JXSA 1S0FA 2NPIA 2GALA 5FMOL 1GANA 4IEZA 2ID4A 3L2HA 4UF0A 4L11A 2WA3A 1JYTA
chains in the Genus database with same CATH topology
4DRVA 4CDQA 5ACA1 2P3KA 1GZWB 5GLWA 4LBQD 3ZYIB 1OA3A 4YZ2A 3RJ2X 1DU3D 1H9PA 3ZFEB 4YVWC 1C8M3 2HYKA 4QHBA 4AXOA 4XOGA 2B42B 1SACA 4MUVA 2BVVA 1EPZA 1MS5A 2VQAA 4XFHA 2D43A 2OIIA 2WNVA 4CEWA 4JQRA 4Q4W1 5BNQA 3LZZA 4WM7A 1QH6A 4HSJA 5J48A 5E1RA 4AK3A 1D2QA 2GC2A 3AYDA 3JBG1 5I0UA 4RSUA 4U36A 1NE4A 5DDJ1 1AR72 2VUAA 4FPFA 4QGLA 1RUH2 4HL0A 1BBT1 4IETA 1PO12 1EV13 4CDUC 1QJY2 3KT7A 3R4DB 4XF1A 1JYIA 1G6NA 4Y1XA 4XF0A 2DU0A 3ZPYA 1NG0A 3FUOA 3J9SA 3HD8B 3USSA 4Y1ZA 1MVEA 1W0OA 2D5HA 4Y20A 1G8WA 4EN7B 3PHMA 1DBNA 3LB9A 2IZWA 2WWSA 2D97A 1AR61 3ZFFA 1ZVFA 4R4XA 5HBAA 4UW5A 3NV4A 1V6IA 2Q8OA 4LBKA 1NLRA 2JG8C 4WM8C 3AZVA 4V1PA 2ZKLA 1RINA 5HCBA 5DZFA 5BNPB 3LA7A 4L97A 2QVSB 1QDOA 1R1ZA 1ENSA 2ZACA 3AXEA 1N1SA 4OI1A 2VH9A 4URTA 1HQNA 1C57A 1RUJ2 3WCSA 1AXKA 2EXHA 3AXDA 4W6XA 1RUI3 4XJ8A 4E2SA 1X8EA 1DZQA 1AF9A 4L99A 2X29A 5JOZA 2GMEA 4BCUA 4QM9A 4OHZA 1UPSA 2UURA 5A33A 1DLLA 1QHDA 1VRH2 2HWC1 5DZEA 3AZZA 3ZFGC 1QNWA 4N43A 2UWCA 5CFDA 3WY6A 3R05A 5C8CC 1GV9A 2KXLA 1F8VA 4GKYA 2EVXA 1FXZA 2YC0A 3VBFA 2IFWA 1COV3 4GWNA 4KWJA 1ZM1A 2VMIA 2WSUA 3AP5A 1R092 4BLJA 4KU8A 3RZZA 2C1FA 1AX2A 4MX3A 3AJYA 1A8DA 4JDOA 1DZTA 2QNKA 2JECA 2K0GA 3B5LB 2ARXA 1QH7A 1QXJA 4RL7A 3OBTA 2XHKA 3AM2A 4R8HA 3ZFEC 4M3CA 3VUOA 4BZ4A 3WW4A 4D69A 5GLTA 1F9KA 4AVBA 1UIJA 1FPN2 1LU1A 2WIIB 1XYPA 4X6RB 1LRHA 2IC1A 2XUMA 1UKRA 3AK0A 4ISQA 2A6YA 2OUJA 3FUQA 2PLV2 1W2UA 4XMIA 3NKGA 4LT5A 2D3PA 4O9GA 2JDZA 4K1ZA 4E4SA 2PTMA 1ONAA 3KCCA 4D3WA 4XW3A 2GC0A 2ZOEB 2DTYA 1AX1A 1HXS3 4P14A 4BOWA 3NV2A 3OJBA 4IV3B 3ZXJA 2VNRA 4RR3C 1JOJA 2EA7A 3RJRA 3S7IA 1Z78A 4FPLA 4ASMB 2ZTNA 1J3QA 1VBE1 3GALA 3ST7A 2ZKNA 4N53B 4C1XA 1ND3A 1WCSA 1HW5A 2V5YA 4IV1A 1Q8QA 2B39A 4KG8A 1O3RA 3ZMOA 5FOJB 5J37A 2MEV3 4HVRA 1VBC3 4JGZB 1F2NA 3LKJA 1L3JA 1OOPA 4LA2A 1VAKA 3AMQA 3ZYGA 4E27A 4YGCA 1O3TA 2QCSB 3E97A 3PTYA 4MGIE 2W68A 1W6PB 3JD71 3DV8A 4QMAA 4AQ6A 2R043 4AFCA 4HSLA 4H7MA 2LM3A 2ZAAA 3LGRA 2NMOA 4QD2A 1XNDA 1QMJA 3MPPG 5KC5A 3MW4A 5EYYA 4C90A 1OKQA 1REEA 3TYJA 1TMF3 2ZZJA 4YM0A 3ZXLA 1UL9A 3MF9A 4FPYA 2MHFA 2UY8A 4RQPA 5EWSA 2LALA 1QJX2 1ULFA 3O12A 4AVAA 1DQ0A 4O9EA 1VBA2 2NMNA 1Q8VA 1OLQA 1GQHA 1QJU1 2DTWA 1Z7S1 3MGUA 2K2SA 4YZ5A 2ET7A 5DUUA 1LHNA 3J8F2 5E88A 2HWB2 2RM21 3DPRB 2WT1A 1ZBE2 1R081 4DXZA 5L7OA 2X53S 3AP9A 4FPKA 2ZHKA 3O7OA 1VB4A 4UW4A 4EV0A 4Z1VA 5JAXA 3B00A 3VKLA 1AJOA 1R1A1 3D82A 3MFCA 4HZFA 4S2GA 1KD7A 2IFRA 1TNRA 1AR73 1DFQA 3OY8B 3I59B 4AQSA 1RUH3 2HEVF 1AYM2 1QOOA 4KWKA 2ETEA 3MW3A 3JU9A 3U11A 1PO13 1Y9QA 4LUKA 1QJY3 2D6MA 4ORFA 4RHV1 1ZRDA 1RITA 5CU1A 2D5FA 3OTFA 3MIFA 1EY2A 2WC2A 1YNAA 4HBNA 5BNNB 1MZEA 1UPIA 4HN0A 4YVSA 1PGL1 2DURA 4F7ZA 2FQPA 4B3NA 2ZHNA 5EJ3A 5IK8A 3AB0A 1XQNA 3IPVA 1BEV1 4HETA 1H1MA 5F5QA 4ASLA 1BCXA 1QNYA 1V6OA 1MZFA 1CAXB 1O91A 5A32B 2Q5TA 1PK6B 1H8TA 4JGYC 4N53C 5I8SA 2WNUA 2XBO2 3VBUC 1F5JA 5T54A 3HWJA 1KS5A 4Q0QA 1RUJ3 4JGZC 4LO8A 5LK7B 1UU6A 2GH8A 4OFGA 2R061 4XJWA 1QQP2 2D98A 5IK5A 1EAH1 4NOTA 4XF4A 3B9CA 4Q29A 3KGLA 1ASJ2 1YO8A 4QQHA 1KS4A 4YG3A 5KWRA 4Y5Z0 4YFZA 2A3WA 3AKQA 4AGRA 1VRH3 3MPBA 5T5LA 2RR12 1GKBA 2FZ2A 2BUKA 1BMV2 5I0SA 5FRAA 2K9ZA 4GB32 5E16A 2DUPA 3BODA 3ECQA 5CG8A 1S0EA 3AMPA 1PO22 4PIZA 5JZGC 1RIRA 3B9IA 4Q4X2 4GMP0 4EN9B 4A7YA 3WDWA 4HN1A 3DGTA 1CAWB 1R093 3JQWA 4DOUA 5C6CA 1D0GA 1WCDJ 3LSEA 2GNMA 4ATEA 1SMVA 1RB8G 3FC0A 3GBWA 1AR82 3BPZA 4PDWC 1NCQB 1S1AA 3PJQA 5AC92 1FPN3 3H1YA 3VBOA 1YFXA 4Q27A 4XMAA 2KA3A 3DPRC 4P9IA 2TEPA 4XTMA 1PVXA 1QWRA 1UZZA 1KJRA 2PLV3 2AZ5A 4HPKB 1HRI2 5CADA 4FOVA 1YIPA 3FHIB 2ZAHA 4QXKA 1AR91 5KHIA 2WA4A 1MEC1 3ZXAC 2WJSA 1YIFA 1QOTA 1CAVB 3J4UH 4WVMA 3VKOA 1C8NA 1CVNA 5I93A 2JJ6A 3NV1A 3AYCA 2R071 5EFUA 4LO6B 5GZEA 4M0HA 3SMHA 2A71A 5D1IA 3WVJA 5BNNC 2CGOA 2DFBA 4XIOA 4Q0SA 3KQRA 3UJOA 4PF5A 4PBOA 3D8CA 1QOSA 3LWCA 1B35A 3TN92 1ZRCA 1POV0 2XVGA 2DCKA 4F83A 1LOAA 3NL1A 4ITCA 3B93A 1LHWA 4YLZA 1VAMA 3SCGA 1D4M2 5H9QA 2HWD1 5H9PA 2R0FA 3SCHA 3VBSA 4AI1A 1WCKA 1ZNPA 4R52A 3QD6A 1S2BA 1RUF2 5D8AA 1EPWA 1DGLA 3WOGA 2VPVA 4XJUA 4RA0A 3FFQA 1QY4A 4Y22B 1ZZ8A 4JRAA 2CGNA 5GZDA 4C91A 4B7EA 3A4UA 4GULA 4KU7A 4Y4YA 2B9UA 2GNTA 5DUVA 1NCRA 3VL8A 5J09A 5CG9A 2XLFA 4QPIB 2DUQA 3M4FA 5F1RA 4XFFA 1QJX3 3VZNA 1S2KA 2VOVA 4HMZA 3X29B 1MQTC 1VBA3 2H0BA 3KD4A 2ZGTA 5KHKA 1ZRFA 4IEXA 3BIWE 2ZA9A 3ALQA 3ZXFA 2PN5A 2AR6A 2R32A 1XE8A 4GIQA 4CDWC 2VECA 3J8F3 4XIKA 3LOBA 3OYWA 2HWB3 1AYN1 4FPCA 1UCXA 1OD5A 2E53A 1ZBE3 1Q3EA 2XJQA 3ZX7A 2WZPP 3TB0A 3QLQA 1ZZBA 2DVFA 1D4VB 2Z5WA 1AL0G 4R9BA 4GMP1 1ENQA 4AVSA 2RS32 4NHMA 3UK9A 1AYM3 1M4WA 2G4IA 3FE5A 1N3OA 5BYNA 3KB5A 4Q4V1 1GZCA 1URXA 4B29A 5GLUA 2E63A 3RI8A 4QT6A 4YM1A 1N3PA 3JCIA 2JG9A 3IM0A 5C9AB 1M06G 2W08A 3TRSB 2HWE2 2ZS6B 3VHNA 5J96B 3R4SA 2YGMA 4XJ9A 2XB6C 3KZ4C 4FQ4A 4P9GA 4XBQA 4QPGB 2A6XA 5T3NA 2SBAA 2RMU1 1W0PA 1TME1 2BEOA 2X5IC 3ZXKA 3B3QE 4ONUA 4OULA 1QXPA 2JXAA 1NYWA 4YG6A 1RMU2 2XGXA 5KC6A 3E6DA 3NAPC 2XLAA 4AEMA 5C4WB 1XE7A 4QQOA 3WP5A 2XBO3 1SLLA 1WD4A 1N1VA 2R1BA 1PIV2 2A6VA 4DNYA 4AI3A 5HI0A 1RUC2 1SCSA 3H1MA 4Z2WA 2ES3A 4FAHA 4META 5K0UC 4AG4A 1QQP3 2DYCA 3E5UA 3VDDA 1UX6A 2XL9A 4PQ9A 3ASIA 1KXGA 1ENXA 4FOQA 1ASJ3 2QDNA 3IIAA 3ZSMA 5CFCA 1ZBA1 5JLVA 3ZSJA 1POV1 2IXKA 5FLIA 2F6BA 2RR13 5JMCA 3HIFA 5JR7B 3ACLA 1WA4A 2VOWA 4YVWA 3IDEA 2A3YA 4XF9A 1KDMA 1XU2A 2OA2A 4GB33 1W6NB 4GA9A 2DVGA 1V6MA 1PO23 3SH5A 4CYDA 4Q4X3 1KJLA 1G9CA 2W0XA 2G9GA 4IESA 5JI9A 3KSCA 1S55A 4LBQA 3WUDA 1LCLA 2BQPA 1C8M1 3D5OA 1ULEA 1CJDA 2E9QA 4CP2A 1YWKA 2VOXA 3AKTA 3EO6A 4RS5B 2XJUA 1V00A 5JCTA 4HT1T 2C0ZA 5FREA 1D0HA 2CY6A 1DQ1A 2D40A 4KNCA 5JSPA 1AR83 1WMFA 5KXEA 4Y1YA 5AC93 2B45X 4FOWA 5B2GB 4HK9A 1NA1A 1OSGA 4IL7A 3WR0A 3HMYA 4I0WB 5LEKA 3JZVA 2JEMA 2XH6A 1HRI3 4KQ7A 5ABJA 2GC3A 2ZGQA 1O5UA 3VBRA 3WG2A 1IHMA 4K20A 3H50A 1AXZA 1K5MA 2JG8A 4WM8A 1AR62 3WQ7A 3MYXA 4OI4A 3TBDA 5KHGA 4N9HA 3VL9A 4EN8B 3L9JT 1Q56A 3ILRA 5H9SA 3INAA 2ZHMA 3AP7A 1NQJA 4MSVA 1OPMA 5CA6A 4S2DA 3VZLA 1XRUA 2ILMA 3WX5A 4FAGA 1FV2A 2WT2A 3VZJA 2OW4A 3TN93 4QPGC 4B4RA 3N36A 3ZFGB 1KFXL 1XXNA 4AVCA 5C8CB 4K9SA 1GSLA 4XEZA 5FLJA 3OF1A 2CV6A 3K48A 1HX6A 1D4M3 3OD4A 4XPVA 1RUI1 4HK8A 4JV4A 2V73A 2ZGMA 1RUF3 3N3HA 5BY5A 4PLMA 1AXYA 1IGOA 2PHFA 1JW6A 3SITA 1AX0A 1GBGA 3KLSA 3DF0A 5GKAC 2H6CA 4FTEA 4P9JA 4QGMA 3E6BA 5C8WA 4YGEA 2ZMKA 2JKBA 3VKNA 1Y43B 1X7NA 1IS3A 2VNGA 4XXPA 4NPRA 1ULCA 1GICA 3PMEA 2WZR2 1DGWX 4WV8A 1GZWA 4LA3A 1WBFA 1QF3A 2BVBA 4TSVA 1COV1 3I54A 4XQ4A 5FPZA 4BHPA 1CD3G 2BGCA 5K9YA 4AFMA 4SBVA 4DINB 1HRV2 1VAVA 1FAYA 2WL1A 3AFGA 3S0MA 1UZYA 4DFSA 2QUOA 3PVNA 2Q30A 4RR3B 3BOWA 1HDKA 1DGRN 2IWGB 1HV0A 3VBHC 3AMMA 4K21A 5BNOC 4BIFA 3SISA 3WXPA 4RS5C 1CONA 2WLQA 2RS33 2E7QA 1N3QA 1QJZA 3KM5A 1RUE2 4D7TA 1RJ7A 1RVF2 2VOKA 4LLFA 4AGVA 2GN3A 5I8TA 1PM7A 2B7YA 1DYKA 1HXS1 1T6GC 2WQZC 1ULDA 3GBFA 3ZFFB 1RJ8A 2HWE3 2R16A 3MIBA 4LBOA 4HVQA 1WBLA 3LA2A 1WMDA 1LGCA 5BNPA 3ZYRA 4KWLA 3MEPA 4JDNA 5LEJA 2MEV1 2BBVA 2GNDA 2ZMNA 5JI7A 2WS92 1RMU3 1FOD2 5FQ0B 1QXRA 4Y24A 5GLVA 2YDEA 3ZDSA 1YFYA 2Y26A 1JUIA 3E6CC 2XJPA 4EROA 5CVRA 1S0BA 3FBYA 3BTAA 2HEYF 2ZX4A 4FBFA 4PIXA 1PZ7A 1RUC3 2D3RA 2ENRA 2VW0A 2R041 2HWF2 4IEPA 4QGNA 3WDYA 5JDBA 1F31A 1W39A 1A3KA 2AREA 4YZ4A 4DPNA 3OGJA 4WVWA 1Q8PA 4LLOA 2R49A 2AH2A 1TMF1 2ERFA 2RS52 5JSRA 5FFOC 4EWDA 3GF6A 1LENA 4MYEA 4AEDC 4BMEA 3HQXA 2Y0OA 4B7KA 2XJSA 1VBB2 1PGW2 3PVEA 1ALYA 1ZZCA 1AL22 1I1EA 1GFF2 2ZX2A 2DUOA 4CDQC 3N4MA 1PHMA 1C1LA 3T1LA 5K7PA 1G9BA 4COWA 1MS9A 1V6KA 5EV7A 4LBJA 4XQDA 3TAYA 1QKQA 2D6OX 4PIYA 4C0HA 2CL2A 3VKMA 1U5YA 2WNVC 4CEWC 1I9RA 1DQ4A 4WM7C 5DG2A 2YV8A 3OBRA 2QZ2A 4LNVA 1FMD2 1Q8SA 1AR71 2UYBA 4PBPA 1RTVA 4IXLA 1RUH1 4M3CF 4M01A 1GNZA 1H4HA 1JBCA 2B46X 3ZYJB 4E4DX 2PHWA 2YZ4A 2VVFA <