3RG0A

Structural and functional relationships between the lectin and arm domains of calreticulin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
320
structure length
292
Chain Sequence
DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRSKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Calreticulin
publication title Structural and Functional Relationships between the Lectin and Arm Domains of Calreticulin.
pubmed doi rcsb
source organism Mus musculus
total genus 70
structure length 292
sequence length 320
ec nomenclature
pdb deposition date 2011-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.250.10 Mainly Beta Ribbon Calnexin lumenal domain, non-globular proline-rich hairpin domain Calreticulin/calnexin, P domain 3rg0A02
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rg0A01
4TYSA 2A6WA 4I30A 3APBA 2DV9A 5DZEA 1RINA 3N7LA 1CR7A 1BXHA 5JOWA 3MW4A 5LK5A 5JLVA 1AJOA 4FPGA 3WV6A 1G86A 4YG3A 1ZM1A 3V65A 2VUAA 4BLIA 1LOCA 1F31A 2GN3A 1IOAA 1JBCA 2W08A 3ZSMA 3R4SA 3O12A 4P14A 3M3OA 5CA6A 5KXEA 2WT0A 5GZGA 2CWMA 2C5DA 4FVVA 1G7YA 1ULCA 1Z78A 2CTVA 2GNDA 2ZGNA 1YI7A 1MZ5A 2YY1A 3ASIA 1W6MA 1NLSA 1GYKA 5EYXA 3OYWA 3NV1A 2YROA 3M3EA 4W65A 3WHUA 1ZA4A 1AX2A 3QCWA 3A4UA 4BLJA 2ZGKA 1G9AA 1BKZA 4LBKA 1QOOA 3CNAA 1WD4A 1N1TA 1UN1A 4FOQA 1APNA 1MZ6A 3WVJA 3FLTA 2NMNA 2H0BA 2P2KA 2PHFA 3B01A 4U36A 1WLDA 4UW5A 1Q8PA 5JOYA 1J1TA 4ISRA 1GSLA 1K9CA 1DIWA 1BJQA 5H9QA 3INAA 2D6OX 1RIRA 1JHNA 1MS5A 1UZZA 1UX6A 1MR5A 4NO4A 4XDQA 4YM1A 3RMXA 4DPNA 2VW1A 3IPVA 4LBJA 3WCSA 2WKKA 2A3XA 1A3KA 4FQZA 1XQNA 4ITCA 2E6VA 1GLHA 2W52A 3AYDA 4Y20B 1TEIA 2CL2A 2R1BA 2JECA 4FPKA 4JCKA 1CPNA 1PZ8A 2W68A 3D5OA 3VKLA 1CONA 2DUOA 1MS8A 4YZ1A 4M3CF 3I4IA 1D2SA 1SFYA 4Z8BA 2A71A 3AP6A 1W6PB 4FPHA 3V0BA 4XXAA 2AENA 4DS0A 1N3PA 1W6NA 1IS5A 1YXWA 2WSUA 1SLBA 5CB7A 5SV8A 2E7TA 1DQ5A 4UW3A 5KXCA 3ZXKA 3T1MA 4YZ3A 1FNZA 1C57A 1O4YA 1W6QB 4XJ9A 3R4UA 1LOGA 4Q2FA 2I2SA 4Q8LA 3USUA 2P3JA 1LHVA 2Q5TA 2UWAA 4P9WA 5JMCA 4YZ2A 1UKGA 4HANA 4R9AA 1Z0HA 1LJ7A 3PVOA 3WCRA 3O0XA 4BQ1A 1H9PA 1KJRA 2DVFA 4XBLA 3ILFA 2HYKA 1WLCA 1C4RA 1JUIA 2ES3A 3AZWA 1HDKA 3IMNA 3WDWA 3ZXFA 4FOYA 2ZACA 5T50A 4K20A 3BODA 3M3QA 2VW2A 3HR9A 5JOZA 1ENRA 1ULFA 1S0BA 4R9DA 4AVSA 5HCAA 3O0VA 1N1VA 2DVDA 1AJKA 1Q8QA 2ZGMA 4UW6A 1ENSA 3WHTA 4AYUA 2CWSA 2D6PA 2UU8A 3AJZA 3POSA 4XILA 4XBNA 1DQ1A 3UK9A 4GWMA 1G9BA 3N35A 5EXOA 3TB0A 2D6NA 2P34A 3FBYA 5GZDA 2G4IA 2E7QA 2NMOA 2JDZA 1W6OB 3M1HA 4AVVA 3OJBA 1LODA 3B69A 1FATA 3ZSKA 3IN9A 4MYEA 1DQ2A 5GLVA 3WZ1A 4Y1XA 2A6YA 4WVVA 4XTMA 2ZGQA 2BQPA 3JUUA 4Y20A 3WNXA 2ZAAA 2CY6A 2DU0A 2ZMKA 2DUQA 1UPSA 1QNWA 1LULA 3N7KA 4IQPA 4H55A 1QGLA 3B00A 3VV1A 4YW2A 4XIOA 3O0WA 4WZFA 1KRIA 1W6PA 4M3CB 5DZGA 1BZWA 3WDTA 4ZXKA 2PHWA 1CPMA 2ZHLA 1YO8A 4UW4A 1D0HA 4LBLA 4ASMB 2SLIA 3FFZA 4L8QA 5GM0A 3HMYA 3FUOA 1DHKB 1W6QA 1S0EA 5T54A 5GZCA 3WG3A 1G9FA 1SLIA 5BYNA 4Q8KA 2A75A 1V6KA 2NP0A 4AGVA 3VKMA 1W0PA 5E8AA 3POYA 5AVAA 1MS1A 2YMZA 3RRDA 2A5ZA 2PHRA 3AXDA 1KDMA 4XIKA 4Q1RA 1MVEA 2PHTA 2PELA 4U2AA 1SLCA 1LGCA 1WW7A 1CIWA 2EXJA 1UAIA 4Y1UA 4ATFA 2ZHNA 2A3WA 1GKBA 4Q27A 1S0IA 5GJ6A 2R49A 2WSVA 4YW1A 1AX0A 2ZGUA 2D6LX 2CYFA 3PVNA 4Y1ZA 5DUWA 1LHNA 4BOWA 3SLIA 2NZ9A 1S0DA 4Y1VA 1HQWA 3POWA 2DTWA 3WUDA 1G9CA 1UZYA 3ZXEA 2D6MA 1QF3A 5EYYA 4XYXA 1MS3A 4XHBA 2ERFA 4C1WA 1C1LA 1FYUA 1MVQA 3AK0A 2EALA 1CN1A 5DXDA 5F9TA 4Y1YA 4XMIA 2UURA 3M2MA 1GZ9A 4RA0A 3RQ0A 3UL2A 4BPZA 2D3PA 2WT1A 3MEPA 5JVVA 4AGRA 3AP7A 1N1SA 4P9YA 4Y22B 1DZQA 2P3KA 3MW2A 2DWRA 1JYCA 2GN7A 3AYCA 5GLTA 4LBQB 1SBFA 1ENQA 4PBPA 5T5JA 3WOGA 2ZGRA 4BM8A 4F83A 2WNEA 1KDKA 2DUPA 3BIWE 2GMEA 2JKBA 4FP2A 4PF5A 1G8WA 2TEPA 3O5SA 4YGDA 3ZVXA 1AXYA 1X50A 2VU9A 4YW5A 2V73A 4M00A 2Z42A 3KM5A 2ZGTA 1GZCA 1JW6A 1AF9A 1RITA 2ARXA 1CJPA 2ZGOA 2NM1A 3PMEA 2A70A 2JE9A 2P3IA 1JXNA 3HN1A 2DTYA 1S0CA 1YRZA 2WLQA 2JE7A 2ZKNA 1IS4A 1IS3A 3IKWA 3LSDA 5T5PA 3WG1A 4FPFA 3WG2A 4AGGA 1V6MA 4GKXA 3LSEA 2FMDA 2ZHMA 1ONAA 1C1FA 3AZVA 1KJLA 2EIGA 4YW4A 3D6EA 4Y24A 1LEDA 4Q26A 4GKYA 4XJAA 2GNTA 3L2YA 5JDBA 4CRQA 3ZXJA 2A6VA 2A6ZA 4FP3A 1V6OA 2XB6C 2WJSA 2ZMLA 3PVEA 2ZHKA 1CESA 4YZ5A 2WQZC 1HQLA 5E89A 5CNAA 5EWSA 2SBAA 1V00A 3AJYA 1AZDA 1V6NA 4NOTA 3B3QE 3TAYA 1OKQA 2V5YA 1FX5A 3NWKA 4HL0A 5CAZA 3WDYA 1WBFA 4YFZA 1B09A 5IUQA 4DRVA 2PHXA 3AZXA 3OY8B 1QMJA 4OZXA 4BMEA 1GV9A 3ATGA 1SLTA 4Q1PA 1V6IA 4FPJA 4YFWA 3OBRA 2ENRA 1MACA 1LECA 3OYWB 2AREA 3H0OA 2ZA9A 4BMBA 1FV2A 4Y22A 1UL9A 2EXKA 3SH3A 4CTEA 1U0AA 1LHWA 3ILRA 5KXDA 1VAMA 4LBQA 4YM2A 2P37A 2A3YA 4WVWA 3N7JA 2AGSA 1HHNA 3FUQA 5DG2A 3AP5A 4JRAA 3UJQA 3JU9A 1LGNA 4SLIA 2R0FA 3A0NA 4XJUA 1DLLA 1N47A 1SBEA 3IPVB 3WDVA 4R9BA 4RL7A 1ULDA 1I3HA 2AR6A 3Q9OA 1SACA 5GLZA 3RSJA 2R0HA 5HCBA 2VXRA 2EXIA 4R9CA 5GALA 3ZYRA 2E51A 2LTNA 1A78A 4FQ4A 1AVBA 3GNEA 3N7MA 2EXHA 2WT2A 3R05A 1JOJA 4XJZA 5DUVA 1AXZA 2PHUA 1OFSA 2AUYA 1MS4A 1Q8SA 4K1ZA 3LCPA 1QDOA 4GWNA 1WCSA 2C9AA 4FPEA 1NXD1 2GDFA 4XBQA 3WUCA 1QKQA 4FPCA 3UJOA 3OBTA 5H9PA 5DZFA 3SITA 3MW3A 4YM3A 1MS9A 1W6NB 4YG0A 2AYHA 1LENA 2DVAA 3OGGA 5T5LA 1S0FA 1I1EA 5F5QA 3VUOA 3AFKA 1VAVA 1AXKA 3RMYA 3U4XA 2VY0A 1LCLA 2R1DA 3VKFC 1O4ZA 2GMMA 3AXEA 1LGBA 2OUHA 4PCRA 3USUB 5FRAA 3ZSLA 5IK7A 2D44A 3T1LA 1DYPA 4C1XA 3SH4A 2DURA 5IT6A 1W0OA 3I8TA 3BTAA 1DQ6A 2VW0A 1WW6A 1YYNA 4XZPA 3NV4A 3D4KA 3W59A 1WUVA 1W6OA 2GMPA 2DVBA 5T5OA 5IK4A 3OY8A 1Q56A 3B9CA 1V6JA 4DRRA 2JJ6A 2GNMA 5GLWA 1GNHA 5H9RA 2ZABA 2NYYA 3ZXLA 2GALA 3AX4A 2B7YA 3IM0A 1LOFA 1GNZA 3V0AB 2DVGA 3OPZA 4YG6A 1VLNA 1SLLA 4YM0A 2ZZJA 1CVNA 2UWCA 4JC1A 1UMZA 4XJ8A 4Y26A 2GNBA 3DGTA 5DUUA 1LHUA 4FOVA 2E53A 3C2UA 1MS0A 2ZBJA 3FLPA 3QLQA 1JN2P 3ILNA 1DYKA 1S1AA 4M3CA 4XE9A 1DBNA 1QOTA 1PZ9A 4GALA 1GZWB 1WBLA 1Y7BA 2XG3A 4XMAA 1DGLA 1KQRA 3WDXA 1DFQA 4CZSA 1HLCA 1SCRA 1G9DA 4XHXA 5E88A 1WLWA 2EAKA 5GZFA 2RHPA 3WDUA 1GBGA 5FREA 2W39A 4PQ9A 1F5FA 2YV8A 3ZYPA 1KITA 1VIWB 1F9KA 1S0GA 2ZGSA 3FLRA 3MPPG 1DQ4A 1FAYA 4GXLA 1LTEA 2JD4A 1QDCA 2OVUA 2UWBA 1OQ1A 1SLAA 1IKPA 2A6XA 3ZSJA 1URXA 1SBDA 2AH2A 4WV8A 5DG1A 4YLZA 1JYIA 1PZ7A 3RS6A 5L73A 2KM2A 3ZPYA 2CNAA 4GA9A 1LU2A 4YGBA 2YZ4A 1QNYA 5JOXA 2D3SA 1R1ZA 3VKNA 3NV3A 1LOFC 1CQ9A 1FNYA 4AVTA 1VALA 3SISA 1HKDA 1H9WA 3AYEA 3A0KA 1WD3A 4XOGA 3PJQA 1BQPA 4YZ4A 5GZEA 3N36A 1AX1A 1QOSA 3ENRA 2LALA 4YGCA 4XTPA 3SH5A 2A7AA 4M3CE 4M01A 2NN8A 1A8DA 4ISQA 5GLUA 3WLUA 1QU0A 2D6KA 1W6MB 4FPOB 2DU1A 1ULGA 5IK8A 4YW3A 5KXBA 4PBOA 3V0AA 1N1YA 1LESA 1IKQA 4KBBA 1LEMA 3AP4A 4XXPA 1Q8VA 4K21A 4AWDA 2DYCA 3RG0A 4ZKTB 1S0JA 2VH9A 4LBOA 3NV2A 1N3QA 4FPLA 1GICA 1Q8OA 4TZDA 5T55A 1LOAA 2R16A 3VKOA 4ATEA 4DQAA 2ARBA 5HCFA 1LOEA 2D7FA 1GANA 1GZWA 1N3OA 3V64A 4D69A 5DUXA 3BOPA 2ZMNA 1DQ0A 3AZYA 1LOBA 4K1YA 3SNMA 2ZGLA 3W58A 5IK5A 3T2TA 2D3RA 2D43A 1EPWA 3GALA 4LBMA 1LHOA 2FHRA 4FPYA 5H9SA 4LBNA 1LU1A 3KQRA 2OW4A 2YXSA 1V6LA 4P9XA 1WW4A 4LBQD 1IS6A 2ZGPA 1YIFA 4YGEA 1FV3A 4FOWA 3M3CA 3N3HA 1WW5A 3AP9A 3V0BB 1BYHA 1ULEA 3AYAA 4XJWA 2EF6A 3AZZA 4DFSA 3WG4A 5CBLA 1SCSA 2OUJA 5T52A 3DUIA 1H30A
chains in the Genus database with same CATH superfamily
1DGWX 4I30A 2DV9A 2WO2A 3AMQA 4GMP1 1OUXA 3N7LA 1CR7A 2B45X 3CIHA 2Y0IA 3MF6A 4NJ4A 1PMIA 4L99A 1GWMA 4PLNA 3UGHA 4N9IA 3MW4A 1HX6A 5GKAC 1JYWA 2J1TA 1AJOA 1BCXA 1PM7A 3J7HA 2VQUA 4XPVA 4CCEA 1JU3A 1GQHA 2Y0OA 1ZM1A 2XLGA 1ASJ1 4BLIA 5EHDA 2GN3A 4JZRA 3LEKA 3O1MA 5L7OC 1W99A 2JDPA 5FJKA 2RS32 4QB6A 4E4DX 5ACA3 5LY2A 2WT0A 5KXEA 1QWRA 5L9RA 2ILMA 4FVVA 3E5XA 1G7YA 5GZDA 2ZGNA 2CTVA 2GAUA 4EZHA 4URAA 5HXVA 4CP0A 2Y34A 1VMJA 4AI3A 1NY72 3UKVA 3ZFGB 4PIZA 4AEKA 5A32A 1E5IA 1UMHA 3H50A 3I49A 4PJYA 5LW9A 1XNDA 2VMDA 2WZ8A 4BLJA 1G9AA 5FZBA 3WVJA 4K3UA 4FOQA 5FZMA 4MHUA 4RN5A 4EE2A 3B01A 2P2KA 2R7EB 5LASA 2WFPA 2Y38A 4W6WA 4O9GA 3TN93 3KF5A 4ES9A 5JOYA 4HVQA 1J1TA 1MZEA 3QBQA 4I02A 4JDMA 4CU9A 3INAA 2D6OX 5FP8A 3G7DA 1JHNA 1MS5A 1UZZA 1UX6A 4N53C 4GH4B 3THTA 2Y6GA 1NQDA 3TNQA 3VDAA 4DPNA 2WKKA 1I6XA 3JBG2 4QXBA 2JDNA 1ASJ2 4AHWA 2CL2A 1L3JA 3NNMA 1PZ8A 2W68A 3VKLA 2QCSB 4J1XA 1H1AA 2HWD1 3CO2A 3J4UH 2DUOA 4XURA 2FD8A 4M3CF 2A71A 1W6PB 2JG9A 4G4FA 3V0BA 4H14A 4AI8A 4IL7A 3SQOA 4IGQA 3TRSB 1E5RA 1XBFA 1IS5A 5SV8A 1H2NA 4UW3A 2X5IA 3ZN6A 5LCWL 2B9UA 3B9IA 4XFFA 4CA9A 3FHQA 2BRTA 5C71A 2FDGA 3R4UA 4YW6A 4Q2FA 4DB5A 4DMIA 4MADA 2P3JA 2ZPXA 4YARA 1VMHA 2UWAA 5A6QA 3PUSA 3WCRA 1Z0HA 2VGDA 4LOTA 4BQ1A 2DVFA 1XPWA 4XBLA 3ILFA 1HRV1 3AZWA 5I8SA 1PVC3 5T50A 4LUMA 1VBC1 2JDUA 1K5MB 1V9U3 1FOD1 1S0BA 1QXJA 1N1VA 4QHBA 4UW6A 3WHTA 1HV1A 3J8F3 1H8TB 3A7QA 4AQ2A 2O1QA 3LAGA 5DAPA 5F8PA 4XILA 1AYN3 4XAAA 1DGRA 3ZFEB 4CCCA 4NHKA 5EXOA 2JDAA 4HLTA 4Q0SA 4WM7A 5ANQA 2ADEA 4P5YA 5BNPC 1O91A 1W8FA 3PNAA 4IEWA 5I0UA 2D6NA 2P34A 2E7AA 4MGIE 1OLME 3LA2A 3M1HA 2E7QA 2G1MA 2JDZA 3EXUA 2XMLA 3QH6A 3HBZA 3KT1A 1ZNPA 4E9KA 3B69A 2WWJA 5KBFA 5FV3A 4OHYA 3IN9A 3WZ1A 4CDQA 1G6NA 1VRH2 4UFKA 3OEBA 4IV3C 4XTMA 3JQWA 3VBHC 4V2WA 2BQPA 3JUUA 3WNXA 5FY5A 1HRV2 3AVRA 1DLCA 3MI8A 4LQRA 2WC2A 2MEV3 2Z5WA 3HD8B 4M4RA 3I97A 3GJAA 1PO12 1PVXA 1W6PA 4M3CB 5DZGA 5J3UA 4AK3A 5T3NA 5FK8A 1W3XA 1KGYA 4HETA 1ZZ7A 2C24A 2P5BA 2EIDA 4IEOA 4JX0A 3WDTA 4A3ZA 3VZMA 5D2AA 1XNAA 1MQTC 1D0HA 2BP6A 3BYWA 3N9OA 4LOSA 5F3IA 2VUCA 4ASMB 4QX3A 1Y4WA 2WNUB 1DHKB 1S0EA 3N9PA 1RC6A 2ET7A 2RM23 2RS33 1W8HA 1R081 5FPLA 3WG3A 1SLIA 2Y64A 4Q8KA 2A75A 5C8CA 2RG4A 3ZMOA 3POYA 1EUUA 3AVSA 1MPXA 2WUHA 3GCWA 5DDJ1 2A5ZA 5LEJA 2JG8C 3AXDA 4XIKA 4ORFA 4Q1RA 1Z7S3 1D7PM 1U5IA 3KCYA 4QXKA 4U2AA 3RNSA 1SLCA 1VJ2A 4AI0A 4KU8A 3JQXA 1UAIA 4Y1UA 4CEWC 2A3WA 1H4HA 1K5MA 4Z2AA 4CYDA 4JHZA 5A3PA 2F6BA 2WSVA 3H1MA 2WA3A 4GMP3 5LA0A 1NUKA 4YVWB 4UBHA 1R1A3 1S2EA 1HXS2 3E97A 3ZFEA 2IXCA 4D6SA 3K75B 1XRUA 4LKFA 2J1VA 2VOVA 4M0NA 4LEJA 3SEEA 2Y6FA 1ASJ3 2D5FA 5JUVA 4CU6A 1MS3A 4XHBA 3TNPB 1C1LA 1MVQA 3CDZB 3GXUA 1R082 3VDDA 1S4CA 5LWBA 1GZ9A 4HN0A 4LIUA 2D3PA 4B7EA 4CCLA 3OSDA 1RVF1 5JVVA 1ND3A 2E9QA 1TG7A 4NAOA 4Y22B 1DZQA 4F7ZA 1UY3A 2DWRA 5FZKA 5HBAA 2GN7A 5L19A 1XNCA 1RHI1 3ACFA 4NHXA 4S2FA 4S2DA 3ZFFC 1ZBE3 3PURA 5JWPA 5T5JA 5FXXA 1OA2A 4QM9A 3VZNA 4F83A 4NVPA 3L9JT 2VZVA 3ZKYA 1OD3A 1YQ8A 4HMZA 2TEPA 5L7OB 4UF0B 4XDPA 4FI9A 4YGDA 4IGPA 2OYZA 3U78A 1X50A 4OUEA 4C91A 4KBZA 4YW5A 4Y4RA 3VD4A 5C5UA 3KM5A 1WCKA 2DBIA 5FZEA 5FP7A 2IFRA 4BE3A 2ZGOA 5DABA 1VR3A 2HWC3 4LTAA 5C3SA 1ND2A 3VHPA 2WNUA 2ZS6B 4QPYA 2DTYA 3AFGA 1YRZA 3PLQA 3LSDA 1IS4A 1IS3A 3VBRC 2HWD3 5JPNB 3WINE 1PMHX 4QB2A 3SCHA 4AGGA 1XNKA 4R8HA 2FMDA 2ZEWA 3F95A 4E4SA 1O8SA 4GQ7A 1ONAA 4DXSA 2O14A 4KU7A 2VCAA 3UV9A 1EYBA 4CP2A 1LEDA 3K4ZA 4N53B 4QT6A 1RHI2 4KWLA 5FPXA 4CU7A 1WLTA 3N4MA 1RMU3 3IIAA 4CRQA 2A6VA 4FP3A 2XB6C 2BERA 2WJSA 5J48A 3PMSA 1TNFA 4L9BA 4JQTA 4YVWA 3O1UA 3AJYA 1UX7A 1ZBA2 1AZDA 4NOTA 2BYVE 1QY4A 3BALA 2V5YA 2DCZA 2XVKA 1J3QA 1HRV3 3WQBA 3OY8B 1VB4A 3DCQA 3E6BA 4BMEA 1SLTA 3PIJA 1V6IA 1VBC3 4FPJA 1NCRC 1FOD3 2XUMA 1UOBA 4ZS2A 1MACA 3OYWB 2W94A 4R4XA 2PHLA 1US2A 1UNBA 4QGNA 1UQXA 4Y22A 4AL9A 1XNTA 4HSLA 3ILRA 5LRRA 4KG8A 2Z4FA 5KXDA 1VAMA 5D1IA 5FMCA 3VD7A 4Z2WA 3ZLIA 1WA6X 3CEWA 3AP5A 3H1YA 3CBNA 4A41A 3JU9A 1LGNA 5FZ7A 5L7OA 5AFBA 4Q4X1 4UF0A 5C3PA 3A0NA 1JYNA 4HG6B 2OPKA 1N47A 4R9BA 4RL7A 2OPWA 2ZZQA 3B94A 4A4AA 3H8XA 3LPGA 1SHWB 3UNPA 2E51A 1NAEA 4NIHA 4BDVB 4TLFA 3GNEA 2VZPA 2WT2A 3N7MA 1AXZA 1OFSA 1P8JA 2AUYA 4QDRA 2FDHA 4LULA 5FBZA 5A1AA 1QDOA 1WCSA 2C9AA 3MLLA 5BNPB 5C3RA 5BNOC 5JZGC 5A3TA 3AB0A 4MXWB 3UJOA 5FY1A 1W9SA 3D82A 5JPMB 5IAXA 5CG9A 3ZYIB 3HPNA 3MW3A 1O3TA 4YG0A 4P02B 1HRI1 2VZUA 3JXSA 3GYDA 5JAXA 2WZR1 3NKGA 3AFKA 3MIHA 4CCNA 5A3WA 1VAVA 3ACHA 3JD71 3RMYA 3U4XA 1LCLA 4IV3B 4V2VA 4IESA 3VBHB 5A3LA 3USUB 5F6KA 3PDQA 1DYPA 2VE1A 4Q4X2 1LB2A 3SH4A 1TVGA 2JDMA 2DURA 1IZ3A 1WW6A 3O1RA 5JR7B 1SFPA 3I59A 3NV4A 4MZUA 5DDJ3 5ERLA 2VQTA 4QX8A 1W6OA 1AL23 5IWFA 1XSQA 3OY8A 4HVRA 2Z79A 1W2NA 5FKCA 1MQTB 1O3SA 3T0BA 1GNHA 2NYYA 4RD7A 4CPBD 2VOKA 4YNIA 4YVSB 3POGA 1VLNA 2RVAA 4D94A 3AMMA 4XJ8A 1HRI2 3DGTA 4XUOA 2XPJA 2GSYA 2WZR2 2YBSA 4PF1A 1ULPA 1JN2P 3BPZA 3JD72 1DYKA 2JWPA 2BFUS 2O8QA 5I0SA 3Q8AA 2JG8B 2W91A 3CZJA 3WDXA 3RYKA 3DYOA 4BQ3A 5AC91 4CEWB 1HLCA 2FCUA 3KV5A 2O0OA 2QQUA 1WLWA 2EAKA 3KT7A 2RHPA 4E2QA 3BPSA 4OHVA 4PQ9A 1AR61 5A6XA 3RDIA 1SMVA 4EQVA 1RVF3 1F9KA 2VQ0A 3O14A 2ZGSA 1XSRA 3GHMA 3PUIA 3SKVA 1DQ4A 4GXLA 1CAXA 1CZTA 1LTEA 3FX3A 2JD4A 1QDCA 2OVUA 3LDRA 4LJHA 5FZHA 1SDWA 5F3CA 3EHKA 1F8VA 1URXA 2GP3A 1PIV3 3ABZA 5FJHA 5DMYA 1UPIA 5DG1A 1JYIA 1R64A 4XC9A 5L73A 2HWF3 5FKBA 1KFXL 1W9FA 2CDPA 2UYBA 1OT5A 5K0UC 1QNYA 5JOXA 2D3SA 4Q4Y1 4URTA 3NV3A 1GNYA 2QQWA 3BTZA 2YUEA 2J1EA 5I0TA 1LOFC 1FNYA 3UGFA 3MGUA 3SISA 4ASLA 1HKDA 2E63A 1OOPC 5FXZA 1J58A 1IHMA 1XYNA 1DDLA 4XOGA 4D6RA 3PJQA 1GOHA 3CJIA 5L9BA 5AC92 2ZEZA 3N36A 1UOGA 3KB5A 3ZFFB 2HJIA 4GB32 1AR62 4UBGA 2A7AA 4EJRA 4M3CE 3HNMA 2D97A 3JB8A 3FWEA 3DEMA 1OURA 2NN8A 1DZRA 4ISQA 5A33B 2BV4A 3LOBA 3MF9A 2KA3A 3LFIA 4FPOB 1YHFA 1HJGA 4Q5OA 4WM8C 4YW3A 3WP6A 4PBOA 2ARAA 1REFA 4YVSA 3K4AA 4KBBA 2ETEA 4PT6A 3VBRB 2R061 3EYPA 1S0JA 1VRBA 4LBOA 3E1F1 1N3QA 5A1FA 2VAUA 3RZLA 2C0ZA 4LHKA 4COWA 4TZDA 2W2IA 1W2TA 1EAH1 2WYFA 4ATEA 2C9KA 1W8OA 3IAPA 2D5HA 2JG8A 3V64A 3KWVA 4W50A 4I01A 3UGGA 2ZMNA 4NE9A 4CEWA 2ZGLA 5FPVA 1O5LA 3GALA 2OQ6A 3WSOA 2YPJA 5C3QA 4FPYA 4LBNA 2GC3A 2OW4A 2XXZA 2YXSA 2B39A 4P9XA 3ZM8A 3RZKA 1KS4A 3VGIA 1PGW1 3KVAA 4N7UA 5LA9A 1UYXA 2XKOA 4XF3A 3N9MA 4I2OA 1W05A 1ULEA 1YI9A 3BIEA 4H7LA 2VR4A 4HK8A 3WG4A 5CBLA 2B9VA 4PI0A 3WF2A 1JZ2A 2JKXA 3APBA 1NCRB 3K48A 2W9XA 1W8NA 4OHXA 2FCTA 4CDUC 1BXHA 4LHSA 4ZU7A 1CAVA 2Y6LA 3E5QA 4Y4YA 5LK5A 5KHGA 2IWGB 3DPRA 1G86A 1T6GC 4LO4B 4OUSA 2BVVA 1RUE3 2VUAA 3TN91 3ZFFA 1LOCA 2XJRA 5FYSA 5KHKA 1S55A 4J6GA 1IOAA 2HKXA 2P1BA 3MFCA 1H2KA 2W87A 4AI2A 2QE3A 1WGPA 4NROA 5IW0A 4PDWA 2DCJA 4BQ5A 2E31A 4YW4A 4YSFA 5A33A 1Z78A 5FYZA 5F9TA 4CXWA 1YI7A 2R073 3ELNA 1PGW2 1GYKA 4QMAA 3T0DA 1HN1A 4HXCA 4XF9A 4Z1VA 5FYHA 3ES1A 2XBO1 4W65A 3WHUA 2RV9A 1AX2A 5ACA2 3QCWA 3A4UA 2XDVA 4Q4V1 1QOOA 5FFOC 3SHRA 4RS5C 3MIEA 3FLTA 2H0BA 5FQ0A 5JZGB 1WLDA 5BNOB 1Q8PA 4I0WB 4ISRA 1LRHA 4YPJA 3WR0A 2VBDA 2QZ2A 1DIWA 5HCHA 4UI9L 4SBVA 4TLGA 1XE7A 4OI1A 4LK6A 4LE4A 3NKTA 2VW1A 4LBJA 3NJZA 4GZ9A 3WCSA 5C3OA 4ITCA 1JZ7A 1VBA3 1J84A 1XQNA 2E6VA 3TN92 1TEIA 2R1BA 4JCKA 3U11A 4UFJA 1TME1 3D5OA 1ODNA 5FLIA 5CYYA 3O1VA 4YZ1A 3DXUA 3U1XA 3P1IA 4Z8BA 2RS51 1OLMA 4DZGA 2ZX2A 1PVC1 5JXGA 3TEZA 4XXAA 2X8KA 1W6NA 4ARYA 1YXWA 3I2GA 4NUBA 5FO7B 1ZRDA 3HVDA 1J83A 2E7TA 2XJPA 2IXLA 4AVBA 3ZXKA 3GZTB 1YJLA 4YZ3A 4CCKA 2YPDA 3GBGA 5JSRA 4XJ9A 4Q8LA 1LOGA 4KGQA 2XVLA 1AYN1 4RR3C 4F8AA 3RWNA 4BCUA 1LHVA 2WDBA 2QBXA 3A21A 3K4DA 4HANA 3LA3A 3PVOA 3TBDA 3O0XA 1KJRA 2YC4A 5FCCA 4H2AA 3WDWA 1WLCA 1JUIA 4PIYA 2GZWA 4FOYA 3P6BA 3RWKX 1Y9GA 1DZTA 1Q3EA 2W1QA 3KZ4C 3ZDVA 5LRSA 2VZ3A 5C70A 2VW2A 1RUC3 2C1FA 2CAUA 4L0PA 4Q4Y3 4XCBA 4QX5A 5JOZA 1FMD3 2DVDA 2FDJA 1Q8QA 4AG4A 1ENSA 1EY2A 3OPWA 5A3NA 2XJUA 1GUIA 1PVC2 2AEZA 2D6PA 2UU8A 3AJZA 3POSA 1DQ1A 4GWMA 2P6CA 2WFF3 3RZHA 1E5SA 3DXTA 4EZ4A 2EVXA 1V9U2 5E1RA 5BNOA 1ZRRA 3FBYA 3J8F2 3ZYHA 2NMOA 1RXFA 3CJXA 4L97A 4OI2A 3KCCA 4XFCA 1U12A 2VTXA 5FZGA 1AYN2 1NT0A 3FJSA 3AMHA 3UKNA 1W9WA 1NE6A 2W95A 3S6PA 1DQ2A 1SEFA 4MUVA 5IVFA 5K0UB 1W28A 4Y1XA 4WVVA 2ZGQA 2RM21 1OBNA 4EN9B 2RDSA 4FSJA 1OOPB 2ZMKA 2DUQA 1UPSA 1QNWA 2GC1A 4N9HA 5D21A 5FYVA 2XQRA 3HQUA 3VV1A 2ZAHA 1MZFA 1REDA 2I07B 1IG3A 4XIOA 1RB8G 3CF6E 2R063 4WZFA 2J1UA 1KRIA 1C28A 4JGZC 3URFA 1NQJA 5BXXA 1EAH3 1BZWA 5A7NA 3BU0A 1AR93 5IJRA 4IGOA 2BOJA 5FUPA 3UKTA 4BXSV 4QPIC 4UW4A 4D8MA 4LKSA 3H7JA 4LKDA 2RDRA 2A1XA 3FFZA 1WMFA 3HMYA 3T09A 1R1A1 4WM8B 4A3XA 4LNVA 5BYNA 3LPFA 1CAUA 4BH9A 2NP0A 5A7WA 3VKMA 5AVAA 2EICA 2IXIA 4XW3A 3RRDA 2ZEYA 2PHRA 4H3WA 1KDMA 1H1MA 2P4EA 2RM22 4WVZA 3NNFA 1MVEA 4KH9A 2PHTA 1WW7A 1LGCA 2PAEA 4DUVA 4QM8A 3KGLA 3ETQA 1SFNA 2LRPA 3AM2A 3GZEA 3ZYJB 3Q8FA 2JEMA 1OMIA 2ZGUA 4YW1A 1UY2A 1E57A 2VMFA 2RJ2A 2WABA 1TMF1 5A1LA 4LK7A 1RUI3 3MUY1 3RJRA 1HJFA 4OI4A 4OUMA 1Z7S2 1W8WA 4LO6B 1LHNA 3AL5A 2BGCA 1ZBE1 2BVBA 4NN0A 4Y1VA 5FYYA 2PQSA 3OBAA 3SCFA 3OUHA 2WO3A 2D6MA 1QF3A 3VBFC 4XYXA 2BBAA 1OFNA 4B8EA 4C1WA 1FYUA 4PIXA 1R1A2 3C7HA 5DXDA 1W0NA 2QQVA 3WQ1A 4DNYA 1DCSA 3HWJA 3RQ0A 1QJU1 5K0UA 5FY9A 3UL2A 3BB6A 5FZ3A 2HWC1 4B29A 2Q8OA 3AP7A 1N1SA 1OLRA 4CDUB 4DO0A 1QJFA 2P3KA 3MW2A 4GJYA 5FZ6A 2IUWA 2XBO3 3ZYBA 4AEDC 1SBFA 4Q4V3 4BZ4A 4PBPA 1OA4A 3BGAA 3THDA 2Y33A 3D8CA 4BM8A 2FZ1A 5DN2A 3U0ZA 4DIQA 2JKBA 2VTFA 4RFT0 3AL6A 1IQAA 1JOBA 5EV7A 1TMF2 3O5SA 1YQ2A 3AKTA 1RUH3 3MIFA 2BBVA 1KFUL 4E27A 3BI3A 4AW7A 4M00A 4QD2A 2Z42A 4XF1A 3ZN5A 1ZBE2 3MLJA 1RMU1 2VNRA 4X8PA 2ZXQA 1VBB1 1CJPA 2ARXA 4QGLA 4HFSA 1S2KA 3K3OA 2J7MA 2A70A 1O59A 3WW1A 4CP1A 4WM8A 2IXHA 1W2AX 2P3IA 2LW8A 2MEV2 2QZ3A 2HBTA 3HN1A 2ZX1A 1TME3 3I2HA 3IKWA 3VL8A 5JXHA 2Y8KA 4ZONA 3WG1A 4MGQA 4FPFA 1CX1A 3W9AA 3Q8BA 1OPOA 2VCBA 2RS53 3TOJA 3AKSA 3LSEA 2HWC2 2ZHMA 4GKXA 4JDOA 1UOJA 4S2GA 5JI9A 5EFUA 2XLAA 4GJZA 4R4ZA 1C1FA 3MPBA 2XKPA 3MV01 2EIGA 1NE4A 2XVGA 3NAPC 4XCAA 3VBSC 2GNTA 2HWD2 1KS5A 3B5LB 4MSVA 3WY6A 5JDBA 3VLBB 3KV9A 3ZXJA 2OIIA 2WO1A 2G9FA 3ZFGA 5C9AC 3W21A 3HNYM 4RQPC 4Y5SA 4IW3A 5E89A 5EWSA 1YFUA 3FC0A 3RVHA 1CD3G 1OD5A 1V6NA 1OQEA 2QQJA 4YWAA 3B3QE 1NOVA 4Q4W1 4JKKA 1ZZ9A 4E4ZA 3TEYA 3H8UA 1FPN3 1RMU2 2QUOA 1FX5A 3WDYA 2XWBB 3ZN4A 3FN9A 5IUQA 2VZRA 4DRVA 2PHXA 3VZKA 4YFZA 4OZXA 2FMYA 3GBWA 1GV9A 2YFUA 4GH4A 4Q1PA 5FUIA 5EJ1B 5LEKA 1OA3A 3OBRA 2VMGA 4OULA 1LECA 4Y5Z0 4YFWA 5ANNA 2J42A 4X6QB 2VMHA 4P9JA 1UL9A 4RR3B 4Y33A 2Z69A 5CFCC 1LHWA 4MXVA 2DCKA 1KXGA 4QPWA 1HV0A 1US3A 1VBC2 4MVTA 1OVSA 2P37A 4IDZA 3CZUA 4W8JA 4WVWA 1FOD2 1NG0A 3N7JA 4LA3A 5CIRA 4B1MA 1PK6C 3VDBA 1GQGA 3B7MA 3WNLA 2WO7A 4SLIA 5EJZB 3OF1A 3I7DA 2R0FA 3NJVA 4XJUA 3VL9A 3VB9A 1DLLA 3FFQA 3IPVB 5IFTA 1STMA 3OBZA 3Q9OA 4QU2A 1B35C 3KF3A 2NPIA 2R0HA 3J7NA 4A45A 4JGYB 5GALA 1JYVA 2BEOA 1UZWA 2LTNA 1A78A 3I3EA 3NNJA 3RFRA 4OHZA 1VMFA 1CGPA 1JOJA 4QDSA 2FZ2A 5DAXA 1GOGA 3WF3A 1NXD1 2GDFA 2R041 1QKQA 1YUDA 4FBFA 4FPCA 1JZ8A 4P9GA 3S30A 5H9PA 4XUQA 1AL21 3PUHA 4XVHA 2AC1A 2FQPA 5G04L 4IXLA 1BEV1 1EP0A 2AYHA 2DVAA 1GZTA 3KCXA 2HEWF 3ACGA 4MGYE 4PI2A 5A7PA 3LWCA 1I1EA 5K9YA 1REEA 1D4M1 2VXJA 1QEXA 5F39A 5FP3A 1H8TA 3AXEA 2OUHA 2RE9A 4PCRA 4JV4A 2Q30A 2X53S 4FFHA 4QQ2A 5FRAA 3ZSLA 5CKNA 3T1LA 5KWRA 4OCTA 1W0OA 1DQ6A 1ALYA 3DECA 3ZXGA 4CXXA 4GD4A 1W9TA 5ISLA 1XE0A 2JIJA 3D4KA 4JGZB 3BU7A 1WUVA 3W59A 5T5OA 4EYUA 1WWYA 5D8AC 1XOYA 2OX0A 3B9CA 1CIYA 4O7XA 4QPIB 3K77A 4CDWC 5ABJC 2JJ6A 2GNMA 4AFCA 4D3WA 4LHLA 4UFHA 1AHSA 3OUIA 4EWEA 3BTYA 3UT0A 1J3RA 2XGXA 1GNZA 5DDJ2 5KR7A 3V0AB 2DVGA 1TMF3 3OPZA 4YG6A 4CCDA 1HQNA 2W1SA 1AL22 1ZVFA 2HEVF 5FWJA 4RR3A 2UWCA 1UMZA 2YDEA 2GNBA 2VD7A 4FOVA 2XJQA 1UY0A 5A7SA 1PIV1 3C2UA 1LAJA 2Y60A 1RUNA 2NQYA 3ILNA 1RXGA 1C3HA 2V09A 1S1AA 4M3CA 3S0MA 3LF7A 2HWF1 1QOTA 1PZ9A 4ZPIA 5IATA 1GZWB 4XMAA 4HZFA 1DGLA 3HIFA 4LO5B 3I3QA 1SCRA 3U37A 1G9DA 4XHXA 2ADDA 1PM4A 5F3GA 1QJU3 1GBGA 4LA2A 3AKRA 2EIBA 1F5FA 2QJVA 3GM8A 2PAKA 1W90A 1AYM1 3GF6A 4N7IA 4JGYA 2V4AA 2H0VA 2QVSB 1FAYA 5EIYB 3VDCA 5J96B 2VOTA 3H8OA 4IEYA 1J3PA 3WW4A 2A6XA 3ZSJA 3T2OA 3I2OA 4WV8A 4YLZA 3RI9A 1RVF2 3VBFB 3RS6A 1R091 2CNAA 1UU6A 4KI5M 3AMPA 4A7YA 2RR13 4MHRA 4QB1A 1I9RA 1VBD1 2OZ6A 3ACLA 1X82A 5LY1A 1PIV2 1ULOA 1VBB3 3JCIA 4FTBA 1RUG3 5IVYA 2HWF2 3A0KA 3ZR6A 4RHV3 1GMMA 1IGOA 4XUPA 2KD7A 4R52A 3KHCA 1AX1A 3ENRA 4YGCA 1C5IA 2IVIB 4XTPA 1JZ6A 1X33A 1UCXA 1BVP1 4JGZA 4PLMA 4GMP0 1UYYA 4M01A 2Q8CA 3RI8A 2V4VA 2JB8A 1CWPA 4FFGA 4QPIA 2VC9A 1UW8A 1W6MB 4UFIA 5LK7B 1UIJA 2JDYA 2VOXA 5HXMA 1ULGA 4META 1XE8A 4V1PA 3OD0A 1YIPA 3V0AA 1IG0A 1LEMA 2W46A 4DXRA 1RJ7A 3ETPA 2Q4SA 3C7GA 4XXPA 3WXPA 3GZAA 2X05A 4FPLA 5LB6A 4A6OA 1VBD2 4Q4W3 3MIBA 2WA4A 4QWNA 2HBUA 1LOAA 1IPKA 3PL0A 2OZJA 4WBBA 5T55A 2ARBA 4DQAA 4EN8B 4CEYC 1LOEA 4K6BA 3J26N 2D7FA 2YU1A 1GZWA 3CQOA 2VVEA 3E5UA 4D69A 4RSUA 5FLHA 2AACA 3WP4A 4A2UA 1K42A 3NAPB 4K1YA 4QPGC 3VBOC 3W58A 3LDBA 4XF4A 3VBSB 4PQQA 2D43A 4N8MA 1LHOA 4YW7A 4E2SA 5C9AB 5F5IA 3LZZA 3P5BA 1V6LA 2Q1MA 4RQPB 1IS6A 4O61A 1RUE1 1YIFA 3KHBA 1L7RA 4AQSA 1FV3A 2IZWA 2Q1FA 3KMHA 3ZYFA 1WW5A 3VD5A 4B3NA 1ACCA 1PHMA 2PMWB 1W04A 2VZSA 1SZBA 2RS13 3AYAA 4QQLA 2P17A 3VBFA 5IVJA 4P9IA 2EF6A 4XETA 2R071 5CU1A 3DUIA 4N53A 1PNFA 4KG0A 5DZEA 5I8YA 5JSOA 1RINA 5JOWA 1TNRA 5JLVA 2VMEA 4FPGA 3WV6A 3S7IA 2WWUA 3OGSA 5FZIA 5CFCB 3IDBB 4D7SA 3V65A 5FZ4A 5FYUA 4E4HA 1F31A 4XDOA 3ZSMA 2R043 3LA7A 1PK6B 3R4SA 2JENA 3W5NA 2WL1A 3O12A 4P14A 3M3OA 4A42A 1HB3A 2E26A 2UY9A 2XHKA 5GZGA 2CWMA 2YHJA 4C90A 1BEV3 4IEPA 1ULCA 2GNDA 1VBA1 4UXAA 4K40A 1W6MA 1RUE2 2PN5A 5EYXA 1GP5A 1JZ4A 1CZSA 1ZZ6A 1D4M3 1B35B 2RJLA 3NV1A 3OYWA 2YROA 4A6SA 5B4XA 2VUDA 3M3EA 2HEYF 2WWSA 1ZA4A 4JQRA 2Y6JA 1NZIA 2ZGKA 1F4HA 3OTFA 3J7LA 4LBKA 5EZWA 3CNAA 1WD4A 1N1TA 5FPAA 1AR71 1APNA 2R072 4L92A 3USSA 4AVCA 5A3MA 4LORA 3P3PA 1BK0A 4MV2A 2GP5A 2DF7A 1GSLA 4IEUA 1K9CA 3WP5A 1BJQA 1H0BA 4M0HA 5H9QA 5A80A 3EO6A 2VG9A 4NO4A 4YM1A 3WT3A 3OD4A 4AHZA 3SXWA 2TNFA 3NAPA 4LT5A 1YFWA 4RGGA 2A3XA 5DQ0A 3VBSA 4AZZA 3MDPA 1RL3A 1GLHA 1VBE1 4LO8A 4Y20B 5F6LB 5CFDC 3M8LA 1CPNA 5F32A 1CONA 3P3NA 5IVEA 2B46X 3ZDSA 3ROUA 5FY8A 1MS8A 1OKOA 4HBNA 2WQ4A 3U75A 1D2SA 1VBA2 3ZXAC 5BNPA 1M4WA 3AP6A 3UETA 4KMQA 1POQA 4FPHA 1JI6A 2CV6A 4MXWA 5C33A 2WN2A 3NJXA 3NNLA 4G3YC 1N3PA 3TWIA 1XXNA 3K51A 5D8AB 4ARXA 3ZOIA 2WSUA 1RUC1 1SLBA 2QDRA 4CDWB 1FMD1 1W3VA 5ABJB 5KXCA 2P3YA 3T1MA 1RUF3 4BU2A 4W6YA 1FNZA 4IV3A 4NRPA 1W6QB 2E33A 3VBHA 3ZPOA 1AYM3 2WS93 2I2SA 4IETA 4LLOA 3USUA 2WFF1 2YC2A 1O3RA 2ORXA 4P9WA 5A3OA 4YZ2A 1UKGA 4R9AA 4QKBA 1LJ7A 1H9PA 3TEWA 1RUOA 4NRMA 3RPQA 4DY5A 5F7UA 2HYKA 2JDKA 1C4RA 2TBVA 1PK6A 1Y43B 1VBE2 2WYSA 3T30A 4I3PA 2EIEA 2ZACA 3D0SA 2VL4A 1R093 3IMMA 4J25A 1QQP1 3EJKA 2Y6KA 3M3QA 4NPLA 1ENRA 1ULFA 1MQTA 4AVSA 1VBD3 2L9LA 3O0VA 2ZGMA 2DFBA 1UMIA 5FMOS 3CKHA 1OVPA 2ZOEB 2Q0AA 3GHNA 2WAOA 4QQHA 1BLZA 3A22A 3SMHA 4CVUA 2NLRA 4A7KA 4UFMA 2ATFA 3V56A 1XB9A 1RUC2 4FCAA 4P00B 1GOFA 2JG9C 4Q4Y2 3M3IA 3WF1A 1FMD2 2JXAA 2RMU3 1AR91 4W6XA 3WQ7A 3F2ZA 1V70A 4AVVA 3MICA 4ZU4A 3OJBA 1LODA 4X8NA 2ZX4A 3ZSKA 3ZX7A 2WFF2 2X5IC 5GLVA 2VULA 2A6YA 5F2SA 2F4LA 4Y20A 2BWCA 2ZAAA 4KWJA 2CY6A 3CL1A 2DU0A 1F2NA 3VHRA 3N7KA 4UOJA 4H55A 1QGLA 2QNKA 1QQP2 4FAHA 1U5ZA 1YWKA 3M70A 3O0WA 1L7QA 4PHZA 2XUEA 4AOCA 1ZZ8A 3OGJA 5FXVA 1C8M1 1UZVA 3HQXA 4JKMA 1NCQC 5JSPA 2PHWA 2PAMA 3GCXA 3I2IA 2ZHLA 1BMV1 4LBLA 4OVEA 3ZSEA 5ABJA 2R062 1JZ3A 1JHJA 2EA7A 4AVAA 4L8QA 5GM0A 1RUI1 1BK1A 3FUOA 3ZR5A 1W6QA 1WCUA 4NHLA 4C8DA 1EAH2 1G9FA 1AR92 2DCTA 4WM7C 2Q1ZB 3T4HB 2CGOA 1V6KA 1WMDA 4AGVA 3H8RA 3X29B 1AR81 1UY1A 1W0PA 4KQ7A 4CE8A 4HKLA 5FP9A 5C4WC 4ZS3A 5FZAA 3LEIA 4LUKA 4ZXEA 5FZ9A 5FY4A 5FLJA 5A6ZA 3MBWA 2PELA 2WIIB 4ATFA 4CDQC 4MOAA 5CEHA 1W06A 3POEA 4Q27A 1GKBA 3VBOB 5FO9B 4QPGB 2R49A 2A73B 4Q29A 1JTZX 1AX0A 1OF3A 4NIGA 1PX4A 2DFCA 3MIGA 1YLLA 1C8M2 4WZCA 1YQ6A 4CUGA 2GU9A 4BOWA 1RUJ3 4UAPA 3ORJA 1TE1B 3VBRA 3NJYA 2DTWA 3POWA 4AQ6A 5J09A 1BMV2 1UZYA 4P9LA 3ZXEA 4WVMB 3OB8A 1RUI2 1RUH1 1JUHA 2WNOA 3AK0A 2EALA 2PXJA 4Y1YA 2K0GA 1I5PA 3C7FA 2C6SA 2UURA 3DV8A 1YQCA 1LNSA 5FUNA 2FCVA 4HONA 1DP0A 5DPNA 2WT1A 1AR82 3WW3A 5M0TA 1GP4A 4AGRA 5I93A 3E6CC 4ET7A 3OEAA 3IDAA 4MX3A 4P9YA 5FPUA 3I2JA 2R6QA 1HN0A 1O4TA 1OSGA 2B8MA 3J9SA 4BA6A 4XFHA 1OLQA 3AYCA 5C8CC 1J1LA 1ENQA 4IE4A 2K46A 3WOGA 1PGL1 1AR73 5FY7A 3BIWE 2GMEA 4PF5A 2WQ8A 1G8WA 3B93A 4CDXC 3ZVXA 1AXYA 2XBO2 2OKXA 5FPBA 1K5MC 2V73A 1ZYBA 1NLQA 5LA1A 1EV13 1GZCA 4Q4V2 1JW6A 1RITA 2DCYA 4JKLA 1NCRA 1XYPA 1RUD1 5CKMA 4BXFA 4IE0A 1Y9QA 4EN7B 2JE9A 1VBE3 5B4NA 1YNAA 1JXNA 2VMIA 3I3BA 1WMEA 1S0CA 1RUH2 4EWDA 2ZKNA 3BUCA 5T5PA 4XACA 1EUTA 3WG2A 1FPN1 2VBBA 1QXPA 4QKDA 4IEVA 4COZA 1V6MA 4FFFA 1GFF2 2XL9A 3AZVA 3VDDC 1KJLA 4P5HA 1TME2 3D6EA 4Q26A 4GKYA 1E5HA 3VBUC 2VZOA 4GWIA 3WNOA 1QJX3 2C4XA 2PLV1 3L2YA 1ND3C 3KVBA 3CHXA 4OHWA 3MFAA 5G05L 2RS52 2OS2A 1BBT1 1Y3TA 2BNMA 1PGL2 2ZMLA 4L11A 5CFDB 4AHXA 4YZ5A 1HQLA 4N90A 1H2LA 3S5AA 4I3GA 4LITA 3IB3A 4KWKA 1ZX5A 1XNBA 5FR3A 2Z2SB 1D2QA 3N9NA 3PTYA 5B2GB 2ORZA 5JZGA 4HT1T 3TAYA 3NWKA 4HL0A 1RUD2 5CAZA 1B09A 2YC0A 5CG8A 1QMJA 5F2WA 1JYTA 5JXIA 1QQP3 1VB2A 1NA1C 5FAXA 3LDKA 3SC7X 1ND2C 1W8TA 2ENRA 3K2OA 1FPN2 2AREA 3ZO0B 4NIAA 1DYOA 3JZVA 2IFWA 2WZEA 3VN4A 3RZJA 2ZEXA 3ZXDA 5JIUA 3K3NA 2PYTA 4ASKA 2FBEA 1D4VB 5CADA 4YM2A 1IQDC 4FTSA 2WNVC 2F17A 3ST7A 1HHNA 4JTNA 3FUQA 5DG2A 3UJQA 5IVBA 4DY3A 3PTRB 5I0RA 1QXRA 1O6UA 3LOIA 5LZ6A 3DYMA 2CHHA 3WDVA 4Y3OA 5F1RA 3I3MA 2N7GA 3CU7A 2UY8A 3MZHA 1I3HA 2AR6A 3WF4A 4BK4A 5HCBA 1POV0 2BU9A 2VXRA 2EXIA 4Q0UA 2ET1A 4R9CA 1Q5OA 4KGGA 4FQ4A 2QFEA 3NRUA 2QKDA 4XJZA 4K1ZA 1MS4A 1Q8SA 3IT8A 1SDDB 3MUZ1 4NHYA 1VPHA 3LCPA 2VECA 4JDNA 3BVCA 3LIHA 4XBQA 2JG9B 3CMGA 3WUCA 4HKOA 4W4ZA 3OBTA 3KSCA 4INDA 1C8M3 4DXZA 3LEMA 3H3ZA 1YJKA 5T5LA 3NQHA 1S0FA 4X6RB 2X5IB 3AC0A 5LBCA 4LPLA 3ZN6B 1X36A 5FYMA 4LHNA 3BOWA 5FYCA 1VAKA 3VKFC 4XF0A 4AAXA 2GMMA 1LGBA 3GDBA 5CFDA 4CPBA 4UWDA 5IK7A 3JB4C 4OFGA 2I74A 2MPFA 3KV4A 3PU8A 4NPRA 3JBG1 4B7KA 4C1XA 5IT6A 2LM3A 5FZ0A 4BK5A 4DOUA 3BTAA 5BPXA 3DYPA 1AR83 1K3IA 4LO7A 1YYNA 4QAWA 3RJ2X 2FDIA 1W2UA 5IHRA 2YFZA 3ZIWA 3SEPA 1JS9A 2DVBA 2Y26A 1NCQB 3ZMNA 4NR1A 3R6SA 2QQPA 4OMDA 4XZUG 1GU3A 1V6JA 4DRRA 3FMGA 1XJAA 3KGZA 1W8UA 2ZCWA 2HWE3 3EBRA 5GLWA 2BFUL 5H9RA 1F5JA 2PHDA 3NL1A 3IM0A 3AX4A 4Q0PA 1LOFA 3FBMA 3THPA 1OOPA 2C26A 1T2XA 2R32A 4Y26A 4WM7B 2W5FA 3POFA 1LHUA 5IVVA 2E53A 2ZBJA 5C4WB 3QLQA 1WMXA 3Q8EA 4EN6B 4QKNA 2RDNA 1KEXA 3B02A 2ZX0A 1Y7BA 2RR11 2XG3A 4CZSA 2VTXJ 1KQRA 4IEZA 3HN3A 4CDQB 5E88A 3WDUA 2YV8A 4TWTA 2BGPA 1VIWB 1RUG1 1UU4A 3RZMA 3FLRA 3DN7A 4RHV1 4QU1A 2W47A 4FO9A 3QACA 3VD9A 1ST8A 4OI0A 2Q8DA 4Z82A 4K7JA 1QJZA 2UWBA 3NW4A 1D0GA 4TXWA 1QJU2 4RS5B 4ONUA 2B4KA 1SBDA 1UD1A 3I2DA 4XFAA 1COV1 1NLRA 4DXTA 1PZ7A 2VZ1A 2KM2A 3A23A 3ZPYA 5JR2A 5KHJA 4GA9A 1LU2A 4YGBA 3WNKA 2Q8EA 2LS6A 3H42B 1H6YA 3LE0A 3VKNA 2YBPA 1CQ9A 1RUD3 3RZZA 5HV4A 5BY5A 2WRAA 1H9WA 5L9VA 1WA4A 3HBKA 2ARCA 1BQPA 1VRH1 2RR12 5C7GA 4XQWA 2JIGA 5C8CB 1QOSA 5FMOL 5FK7A 4D6QA 5A3UA 2OQ7A 4MG2A 2XR4A 3C7OA 4C0BA 5KHIA 1VBB2 2CSGA 4N43C 1RUG2 1V0AA 2H6CA 4CDXB 1NCQA 3ON7A 1A8DA 3MHZA 4RHV2 4MO3M 5GLUA 2XWJB 4E8DA 1PO11 1QU0A 1UY4A 5HI0A 2QQMA 3PUAA 2O8OA 3NSTA 2IVJA 4AEMA 2PLV3 4ZU5A 5IK8A 3IAQA 5KXBA 4UFLA 2F4PA 1BBT3 4CDUA 1COV2 1OH3A 1QJY3 2D40A 4NWVA 2CDOA 2ZTNA 4I0BA 4H7MA 1Q8VA 4K21A 1C8NA 4ZKTB 2BPA2 2VNOA 2VH9A 1M06G 2FDKA 1Q8OA 3C8XA 5FMDA 3QOPA 1ZZBA 5C4WA 4OYUA 1PMJX 4XQDA 1OI6A 2RS11 2PFWA 1IPSA 1X7NA 4MGSA 2VCCA 5JI7A 3WD5A 1GANA 3MV11 5DUXA 3VDDB 3BOPA 3O1OA 2WN3A 2BWAA 3SNMA 5IK5A 3LKJA 3T2TA 3VBUB 2D3RA 4RFRB 1EPWA 2QTWB 4Q4W2 2FHRA 2UYAA 2YGLA 1ND3B 3VZLA 4CU8A 4HOOA 5H9SA 1KD7A 4QHZA 1MEC1 3CJIC 2RDQA 1WW4A 3WP3A 4LBQD 4UT5A 5FZDA 4YGEA 4FOWA 3M3CA 3N3HA 4RS5A 1W9YA 2XH6A 1BYHA 3N9LA 1HXS1 2MHFA 3AZZA 4DFSA 1Q43A 2OUJA 5T52A 4DUWA 3U10A 2W3JA 3DKQA 2A6WA 4LE3A 4TYSA 2BNNA 2VJXA 1NA1B 3PIGA 1ND2B 1UXXX 4OMCA 4YVSC 2W1WA 2RS12 2BGOA 2AEYA 2VQAA 2JDHA 3HNBM 2BZDA 4YRDA 4YG3A 2WR9A 3RGBA 2WNVB 2HH9A 4Z92B 1JBCA 1ZZCA 2W08A 4IV1C 4AFDA 4NWWA 4ZY9A 3PUQA 5CA6A 3ACIA 1LR5A 1QIQA 1ZA7A 5F3EA 1MEC2 4CDXA 4QXHA 2C5DA 3BCWA 3U07A 4DEVA 3ASIA 1MZ5A 2YY1A 1NLSA 1JMUB 1K5JA 4IUGA 2R042 2YYOA 3ZIXA 4Q0VA 3ALQA 1BKZA 1BEV2 1NYWA 4AFAA 1UN1A 3JBG3 1MZ6A 4BJ0A 1ZREA 4U36A 2NMNA 2PHFA 2VNGA 4EN0A 1DGWA 4UW5A 1D4M2 3W20A 1YEWA 4ES8A 4BQ4A 2XOMA 4FTEA 5BNNC 1RIRA 4XDQA 3T08A 1MR5A 3WQ0A 3RMXA 4BQYA 3IPVA 3O1PA 2GC0A 1RUF1 1A3KA 4FQZA 4IE6A 4K8RB 3VBUA 1SG3A 1DGRN 4CXYA 2W52A 2X29A 3AYDA 2H6BA 2WS91 1QJEA 1XU2A 2JECA 2CAVA 4FPKA 4JAAA 3DPRC 1H6XA 1CX4A 4FXGB 4NMIA 5JIAA 3WNNA 1NX9A 4E2GA 5I8TA 2V72A 3T2PA 5C6CA 1O8PA 3I4IA 3MO4A 1SFYA 1X9PA 3M4FA 5FYBA 2GC2A 3L2HA 4BIFA 4EROA 1DU3D 5FIXA 4XQ4A 4DS0A 2AENA 3GGLA 4PDWC 2G9ZA 5FWEA 1ZBA1 2XQXA 5A7QA 3GJBA 2OT7A 5TSWA 5CB7A 4AHYA 3PHMA 3WEZA 1DQ5A 4G9SB 2X09A 1NA1A 1C57A 1O4YA 4NRQA 4F3JA 2BDRA 3FL7A 1XC6A 2Q5TA 4BWOA 5JMCA 2XLFA 5IAVA 2QQKA 4AEDB 2PQQA 1UU5A 1AUYA 2HWB1 3IIIA 2KR2A 5FYTA 1OH4A 1YQ5A 2MNGA 1RUF2 4IE5A 2WNVA 4Z07A 5LBBA 2RMU1 3DF0A 3ZXFA 1F35A 1ZRIA 2ES3A 1COV3 1HDKA 1AYM2 2WS92 3FZ3A 3IMNA 4IERA 4NIDA 5EPAA 1DG6A 4M4PA 4K20A 4KL1A 3BODA 3O7OA 3QH7A 3THCA 3HR9A 5HCAA 4R9DA 5J98B 5IFPA 4EWAA 4BIOA 1AJKA 2VCMA 4KNCA 4KWUA 4AYUA 2CWSA 1SQ4A 3H7YA 4QKFA 2J1RA 4XBNA 3UK9A 1R092 4NAMA 1G9BA 3WX5A 1VRH3 3N35A 3TB0A 2CU5A 2IXKA 3I59B 2EAAA 5C5TA 3J7MA 1UWWA 2G4IA 1W6OB 1UYPA 5CKQA 3KS7A 1FATA 1QH6A 5HV0A 3NMBA 2G19A 4MYEA 1JZ5A 1PO13 4IEQA 2HWB2 2XJSA 2GH2A 3NNGA 2RMU2 4C0HA 3BKZA 3UYJA 1JODA 1LULA 1Y9MA 4IQPA 2VZTA 1ODMA 2YBKA 1LKNA 3B00A 2B5HA 2OA2A 2BOIA 4YW2A 2QQLA 1VE0A 2OXBA 4CUCA 2K9ZA 5FOJB 4XUNA 1RJ8A 3OG2A 1IPJA 4N43B 4ZXKA 5HPOA 1CPMA 4K9SA 1YO8A 3OGVA 3SKJE 4COVA 3OCPA 2SLIA 5BUVA 4QHOA 3FHAA 5DAWA 3KT4A 1YFXA 5AFEA 5T54A 3RYRA 5GZCA 3T0AA 3OOXA 1RUJ1 1CAXB 3VD3A 1MEC3 3TEXA 4COYA 1QH7A 4AE2A 2QDNA 4XFIA 1S2BA 5FTTC 4AEDA 5E8AA 3HT2A 5KHHA 1MS1A 2R30A 2YMZA 1PGSA 1JH5A 4BQ2A 1U5YA 1HXS3 2RJKA 2EXJA 4LMFA 1CIWA 4TTGA 1AL0G 2ZHNA 5GJ6A 1GP6A 1S0IA 2LUWA 3ES4A 4QDQA 4LLFA 2D6LX 2CYFA 4Y5TA 3OUJA 2J22A 4A7ZA 3EB7A 3PVNA 4Y1ZA 5DUWA 2W1UA 1R083 3CJIB 3UESA 3SLIA 2NZ9A 4MGTA 2VMCA 1S0DA 4IEXA 1HQWA 1H4GA 3ZKUA 3AKQA 3WUDA 3H9AA 3LQCA 3HAGA 1G9CA 3MIDA 4J1WA 5A70A 5EYYA 4OQ8A 5FZ1A 1OQDA 2ERFA 1ENXA 1CN1A 3LGRA 4GWJA 1HW5A 1RGSA 4XMIA 4D0QA 5J1XA 4HVOA 3M2MA 1RUJ2 2IXJA 4MH0E 1EV11 1GQPA 1W2OA 4RA0A 4BPZA 5K7PA 1XU1A 1XYOA 4QQOA 5CVRA 3MEPA 4MLOA 1WKYA 4MGKE 5C9AA 5I91A 4CCOA 3RZGA 3K46A 1JYCA 4RQPA 2VVFA 2WZPP 1POV1 4LBQB 5GLTA 4AF9A 2JD9A 2PA7A 2ID4A 5FZFA 2ZGRA 3T2QA 5JMOA 2WNEA 1H2MA 1KDKA 2DUPA 4FP2A 4RGKA 4IV1B 3R0RA 4N43A 4QXCA 2VU9A 1EPZA 2JE8A 4FFIA 1UZ0A 4PLOA 1QJX1 3W5MA 2DBNA 1BHGA 2ZGTA 3PU3A 4GB31 3WNMA 1AF9A 4CCMA 1AR72 4QGMA 4GAZA 2NM1A 4FAGA 2ZKLA 3ZYGA 1NXMA 3PMEA 3H3LA 2BNOA 1YFYA 1RTVA 2WLQA 3NVCA 2VUJA 2XJVA 3EMRA 1YC61 2JE7A 4ZHNA 4CUAA 1TZOA 5CFCA 1RHI3 1EV12 2QQIA 3EQEA 3KV6A 3H1WA 4BQXA 1K12A 1OF4A 1H1IA 2XHNA 4HK9A 5BNNB 4AQTA 1ZBA3 4Y24A 5K4LA 2D98A 4XJAA 4CSWA 5IYYA 1ZRFA 1C5HA 4HPKB 5FBJA 3AMNA 4AXOA 2A6ZA 4FXKB 1V6OA 1B35A 1UOFA 1CAVB 3PVEA 2ZHKA 2GH8A 1CESA 5IVCA 2WQZC 3S57A 5CNAA 2SBAA 1V00A 3DPRB 3HJRA 4LXLA 2B42B 1QJX2 4LIVA 2HWB3 4BHPA 5FZOB 1OC1A 2YGMA 3CLPA 2VNVA 4S2HA 1OKQA 4L2NA 2X10A 1WBFA 4QX7A 5L36A 2FDFA 4DINB 3AZXA 4PDWB 5DAQA 1X9TA 3H3UA 1OHFA 3ATGA 4AAPA 1CJDA 5FY0A 3DL3A 4AI9A 5FP4A 3KLSA 1UF2C 2QQOA 4FT8A 4AEJA 3H0OA 3ECQA 2ZA9A 4BMBA 5FOBB 4MGZE 1FV2A 1ZRCA 3I2KA 2EXKA 3SH3A 2JX9A 5F37A 4CTEA 1U0AA 4JTOA 3LIGA 4CP9B 3C3VA 4LBQA 5FPZA 4E8CA 1W39A 4ZZ8A 2A3YA 5FQ0B 1CAWB 1F15A 1UO9A 2AGSA 3G6JB 4JRAA 3HT1A 5JXJA 5LATA 4IE7A 4HKWA 4RYDA 4IV1A 5E16A 4O9EA 1PO21 3FHIB 3GZUC 3U14A 5D8AA 1SBEA 4RGAA 4CDWA 2YB7A 1ULDA 2HLEA 1F4AA 1CZVA 2TUNA 1SACA 5GLZA 3RSJA 3ZFGC 4COUA 1OPMA 1L7LA 4I0AA 5EQUA 1UKRA 5FZ8A 3ZYRA 1AVBA 4P08A 3R05A 2EXHA 5DUVA 3BTXA 4CUBA 1WZXA 1FXZA 2PHUA 5K8SA 1NZCA 4CCJA 1FT9A 2YU2A 4GWNA 4FPEA 2IC1A 3POBA 2Y6HA 5A7OA 3U4SA 3VZOA 3WF0A 5KC6A 4BB3A 1GWLA 5ACA1 5DZFA 4OQ9A 3SITA 3IZOA 5I0DA 4CEYB 4YM3A 1MS9A 1W6NB 3M7AA 4B4PA 1LENA 3OGGA 4GH4C 4Q4X3 5BNNA 1UIKA 2HWE1 5F5QA 2ZJCA 3VUOA 4D7YA 4XUTA 1AXKA 5A6YA 3I2FA 2XL7A 1JOPA 2VY0A 3D3AA 4HPKA 2R1DA 2XONA 1O4ZA 4B4QA 4BYYA 1YCIA 3OGRA 3TYJA 5E6HA 2D44A 2VOWA 3IWZA 5EJ3A 1PO22 5BV6A 3SCGA 3I8TA 5J7MA 2DDUA 2VW0A 4TSVA 1O3QA 4XZPA 5FZOA 3T4VA 1X8MA 2GMPA 5IK4A 1Q56A 4NPMA 1A8MA 1HRI3 3I3DA 4XFBA 5FDBA 3C7EA 4AR2A 3ITQA 2WZR3 4JVAA 2JICA 4NHMA 1A34A 3OPTA 1T6BX 3VHOA 1TQ5A 3JD73 1U5XA 2ZABA 3E6DA 5SV5A 2GALA 2VPVA 2B7YA 3ZXLA 2QQNA 3QD6A 4HN1A 2P6HA 4GULA 2CGPA 4YM0A 1SLLA 2ZZJA 1W03A 5F5AA 1CVNA 4JC1A 2WLPA 1UXZA 4CP9A 5DUUA 4JHTA 3T3YA 2HWE2 1MS0A 3FLPA 3VZJA 1CAWA 2BTVC 4XE9A 1DBNA 3HQRA 5AVPA 4LKEA 4GALA 4ZZ5A 5C8WA 1WBLA 4QQPA 1A6CA 1DFQA 1PNGA 3LB9A 4QX1A 5LBEA 1VP6A 5GZFA 5BNQA 1DF0A 5FREA 2W39A 4LR4A 1H8TC 3ZYPA 1KITA 5F5CA 5J36A 2LROA 1S0GA 3POIA 3MYXA 1GR3A 3MPPG 3BN6A 3WW2A 3PJYA 3ZFEC 2ZX3A 4A44A 1SPPB 2VZQA 4B4RA 1POV3 1OQ1A 1SLAA 1IKPA 4GIQA 1HB2A 2AH2A 2J1AA 4BISA 4AFMA 1JYXA 5FZCA 2BJSA 4XEZA 4CEYA 3POJA 1FI2A 2YZ4A 1V9U1 2W0XA 4YYOA 4QX0A 5AC93 1H8VA 1R1ZA 4EV0A 3VBOA 4QPGA 3J8F1 3KQ4B 4GB33 5J37A 4AVTA 1AR63 1VALA 1QJY1 4DUXA 2V5DA 4Q0QA 1GWKA 4XAEA 1HB1A 3AYEA 3IDCB 3R4DB 1WD3A 5JCTA 1CAUB 3MLKA 1O7FA 4DEQA 4UYBA 2BUKA 4YZ4A 2J1SA 5GZEA 5A7WB 2D93A 5FO8B 1O5UA 2I45A 2LALA 3S7EA 5FMBA 3LEGA 2VM9A 3SH5A 1K45A 3GBFA 4WVMA 2W92A 5FYIA 1J59A 1I5ZA 5APAA 3WLUA 3IBMA 2D6KA 3WNPA 4OLLA 2PTMA 2DU1A 1W8ZA 4JGYC 2WNUC 4HSJA 5A32B 2JB4A 3PVBB 4I09A 4B1LA 3O1TA 2VVDA 1N1YA 1BVVA 5CZKA 2KXLA 1LESA 1IKQA 1HIXA 1OUSA 2WINB 2MEV1 3AP4A 3ME2A 3O1SA 4AWDA 2DYCA 3RG0A 4BQWA 3FE5A 4TN7A 3NV2A 1GICA 4O65A 2YG0A 1QHDA 2PLV2 3D0JA 3HOBA 2R16A 3VKOA 5FXWA 4XABA 5KC5A 2VO5A 2WAAA 3I54A 4QX2A 5DAVA 5HCFA 1BBT2 1OXCA 3LFMA 1QJY2 3LD8A 1N3OA 3Q8CA 2CGNA 3DKWA 3AZYA 1DQ0A 1LOBA 5CISA 5LA2A 4JRLA 4LBMA 4YVWC 2RS31 3KD4A 1JU4A 2HYXA 3N9QA 1PX3A 3HEIA 1LU1A 2BW8A 1HB4A 3KQRA 4OZOA 3IDEA 1NKGA 4D7TA 1WCQA 2AZ5A 2ZGPA 1SPPA 3AKPA 3NO8A 1NY71 4XFGA 3AP9A 4K8FA 3V0BB 5EP9A 5FZLA 2E32A 1WCDJ 1UYZA 1Z7S1 4XJWA 5LBFA 2K2SA 1X8EA 3RYPA 2G9GA 2VBPA 2XJTA 1SCSA 1PO23 3VHNA 1RYYA 2WBKA 1H30A 4AI1A 4AFBA 4NIIA 3S5QA
chains in the Genus database with same CATH topology
1DGWX 4I30A 2DV9A 3AMQA 4GMP1 3N7LA 1CR7A 2B45X 2Y0IA 3MF6A 1PMIA 4L99A 4PLNA 4N9IA 3MW4A 1HX6A 5GKAC 1AJOA 1BCXA 1PM7A 4XPVA 1GQHA 2Y0OA 1ZM1A 2XLGA 1ASJ1 4BLIA 2GN3A 5L7OC 2RS32 4E4DX 5ACA3 5KXEA 2WT0A 1QWRA 2ILMA 4FVVA 3E5XA 1G7YA 5GZDA 2ZGNA 2CTVA 2GAUA 5HXVA 4CP0A 4AI3A 1NY72 3UKVA 3ZFGB 4PIZA 4AEKA 5A32A 3H50A 4PJYA 1XNDA 4BLJA 1G9AA 3WVJA 4K3UA 4FOQA 3B01A 2P2KA 2WFPA 2Y38A 4W6WA 4O9GA 3TN93 5JOYA 4ES9A 4HVQA 1J1TA 1MZEA 3QBQA 4I02A 4JDMA 3INAA 2D6OX 3G7DA 1JHNA 1MS5A 1UZZA 1UX6A 4N53C 4GH4B 3THTA 4DPNA 1NQDA 3TNQA 2WKKA 1I6XA 3JBG2 1ASJ2 4AHWA 2CL2A 1L3JA 1PZ8A 2W68A 3VKLA 2QCSB 4J1XA 1H1AA 2HWD1 3CO2A 3J4UH 2DUOA 4M3CF 2A71A 1W6PB 2JG9A 4G4FA 3V0BA 4H14A 4AI8A 4IL7A 3TRSB 1IS5A 5SV8A 1H2NA 4UW3A 2X5IA 3ZN6A 2B9UA 3B9IA 4XFFA 3R4UA 4DMIA 4Q2FA 4DB5A 2P3JA 2ZPXA 4YARA 2UWAA 3WCRA 1Z0HA 2VGDA 4BQ1A 2DVFA 4XBLA 3ILFA 1HRV1 3AZWA 5I8SA 1PVC3 5T50A 4LUMA 1VBC1 1K5MB 1V9U3 1FOD1 1S0BA 1QXJA 1N1VA 4QHBA 4UW6A 3WHTA 1HV1A 3J8F3 1H8TB 4AQ2A 2O1QA 3LAGA 4XILA 1AYN3 1DGRA 3ZFEB 4NHKA 5EXOA 4Q0SA 4HLTA 4WM7A 5BNPC 1O91A 3PNAA 4IEWA 5I0UA 2D6NA 2P34A 2E7AA 4MGIE 3LA2A 3M1HA 2E7QA 3EXUA 2JDZA 3QH6A 3HBZA 3KT1A 1ZNPA 4E9KA 3B69A 5KBFA 4OHYA 3IN9A 3WZ1A 4CDQA 1G6NA 1VRH2 4IV3C 4XTMA 3JQWA 3VBHC 2BQPA 3JUUA 3WNXA 1HRV2 3MI8A 2WC2A 2MEV3 2Z5WA 3HD8B 1PO12 1PVXA 1W6PA 4M3CB 5DZGA 5J3UA 4AK3A 5T3NA 4HETA 3WDTA 1ZZ7A 4IEOA 3VZMA 1MQTC 1D0HA 4ASMB 2WNUB 1DHKB 1S0EA 1RC6A 2ET7A 2RM23 2RS33 1R081 3WG3A 1SLIA 4Q8KA 2A75A 5C8CA 3ZMOA 3POYA 5DDJ1 2A5ZA 5LEJA 2JG8C 3AXDA 4XIKA 4ORFA 4Q1RA 1Z7S3 3RNSA 1U5IA 3KCYA 4QXKA 4U2AA 4CEWC 1SLCA 1VJ2A 4AI0A 4KU8A 3JQXA 1UAIA 4Y1UA 2A3WA 1H4HA 1K5MA 4CYDA 2F6BA 2WSVA 3H1MA 2WA3A 4GMP3 4YVWB 4UBHA 1R1A3 1HXS2 3E97A 3ZFEA 2IXCA 1XRUA 2VOVA 4M0NA 4LEJA 1ASJ3 2D5FA 1MS3A 4XHBA 3TNPB 1C1LA 1MVQA 1R082 3VDDA 1GZ9A 4HN0A 2D3PA 4B7EA 1RVF1 5JVVA 1ND3A 2E9QA 4Y22B 1DZQA 4F7ZA 2DWRA 5HBAA 2GN7A 5L19A 1XNCA 1RHI1 4S2FA 4S2DA 5JWPA 3ZFFC 1ZBE3 5T5JA 1OA2A 4QM9A 3VZNA 4F83A 4NVPA 3L9JT 5L7OB 4HMZA 2TEPA 4YGDA 2OYZA 4C91A 1X50A 4YW5A 3KM5A 1WCKA 2IFRA 4BE3A 2ZGOA 1VR3A 2HWC3 4LTAA 1ND2A 3VHPA 2WNUA 2ZS6B 4QPYA 2DTYA 3AFGA 1YRZA 3PLQA 3LSDA 1IS4A 1IS3A 3VBRC 2HWD3 5JPNB 3WINE 3SCHA 4AGGA 1XNKA 4R8HA 2FMDA 4E4SA 4GQ7A 1ONAA 4KU7A 3UV9A 1EYBA 4CP2A 1LEDA 4N53B 4QT6A 1RHI2 4KWLA 5FPXA 1WLTA 3N4MA 1RMU3 3IIAA 4CRQA 2A6VA 4FP3A 2XB6C 5J48A 2WJSA 3PMSA 1TNFA 4L9BA 4YVWA 3AJYA 1ZBA2 1AZDA 4NOTA 2BYVE 1QY4A 3BALA 2V5YA 2DCZA 2XVKA 1J3QA 1HRV3 3OY8B 1VB4A 3E6BA 4BMEA 1SLTA 1V6IA 1VBC3 4FPJA 1NCRC 1FOD3 2XUMA 1MACA 3OYWB 4R4XA 2PHLA 4QGNA 4Y22A 4HSLA 3ILRA 5LRRA 4KG8A 5KXDA 1VAMA 5D1IA 4Z2WA 3CEWA 3AP5A 3H1YA 3JU9A 1LGNA 5L7OA 5AFBA 4Q4X1 3A0NA 2OPKA 1N47A 4R9BA 4RL7A 2ZZQA 3B94A 2E51A 4TLFA 3GNEA 3N7MA 2WT2A 1AXZA 1OFSA 2AUYA 4LULA 5FBZA 1QDOA 1WCSA 2C9AA 3MLLA 5BNPB 5JZGC 5BNOC 3AB0A 4MXWB 3UJOA 3D82A 5JPMB 5CG9A 3ZYIB 3MW3A 1O3TA 4YG0A 1HRI1 3GYDA 5JAXA 2WZR1 3NKGA 3AFKA 3MIHA 1VAVA 3JD71 3RMYA 3U4XA 1LCLA 4IV3B 3VBHB 4IESA 5A3LA 3USUB 5F6KA 1DYPA 4Q4X2 1LB2A 3SH4A 2DURA 1IZ3A 1WW6A 5JR7B 3I59A 3NV4A 4MZUA 5DDJ3 1W6OA 1AL23 3OY8A 4HVRA 2Z79A 1MQTB 1O3SA 1GNHA 2NYYA 4RD7A 2VOKA 4YNIA 4YVSB 1VLNA 4D94A 3AMMA 4XJ8A 1HRI2 3DGTA 2XPJA 2GSYA 2WZR2 5I0SA 1JN2P 3BPZA 3JD72 1DYKA 2O8QA 2BFUS 2JG8B 3WDXA 3RYKA 5AC91 4CEWB 1HLCA 2O0OA 1WLWA 2EAKA 3KT7A 2RHPA 4E2QA 4OHVA 4PQ9A 1AR61 3RDIA 1SMVA 1RVF3 1F9KA 2VQ0A 3O14A 2ZGSA 3GHMA 1DQ4A 4GXLA 1CAXA 1LTEA 3FX3A 2JD4A 1QDCA 2OVUA 1SDWA 3EHKA 1F8VA 1URXA 1PIV3 1UPIA 5DG1A 1JYIA 5L73A 2HWF3 1KFXL 2UYBA 5K0UC 1QNYA 5JOXA 2D3SA 4Q4Y1 4URTA 3NV3A 2YUEA 5I0TA 1LOFC 1FNYA 3MGUA 3SISA 4ASLA 1HKDA 2E63A 1OOPC 1J58A 1IHMA 1XYNA 1DDLA 4XOGA 3PJQA 3CJIA 5AC92 3N36A 3KB5A 3ZFFB 2HJIA 4GB32 1AR62 4UBGA 2A7AA 4EJRA 4M3CE 2D97A 3JB8A 3FWEA 2NN8A 1DZRA 4ISQA 5A33B 3LOBA 3MF9A 2KA3A 4FPOB 1YHFA 4YW3A 4WM8C 3WP6A 4PBOA 1REFA 4YVSA 4KBBA 2ETEA 3VBRB 2R061 1S0JA 4LBOA 1N3QA 2C0ZA 4LHKA 4COWA 4TZDA 4ATEA 1EAH1 2D5HA 2JG8A 3V64A 4I01A 2ZMNA 4CEWA 2ZGLA 1O5LA 3GALA 2YPJA 4FPYA 4LBNA 2GC3A 2OW4A 2YXSA 2B39A 4P9XA 1KS4A 3VGIA 1PGW1 4N7UA 2XKOA 4XF3A 4I2OA 1ULEA 1YI9A 4H7LA 4HK8A 3WG4A 5CBLA 3APBA 1NCRB 3K48A 4CDUC 4OHXA 1BXHA 4ZU7A 1CAVA 3E5QA 4Y4YA 5LK5A 5KHGA 2IWGB 3DPRA 1G86A 1T6GC 4LO4B 4OUSA 2BVVA 1RUE3 2VUAA 3TN91 3ZFFA 1LOCA 2XJRA 5KHKA 1S55A 4J6GA 1IOAA 2HKXA 3MFCA 1H2KA 4AI2A 2QE3A 1WGPA 4PDWA 2DCJA 4YSFA 4YW4A 5A33A 1Z78A 5F9TA 1YI7A 2R073 3ELNA 1PGW2 1GYKA 4QMAA 4Z1VA 4XF9A 3ES1A 2XBO1 4W65A 3WHUA 1AX2A 5ACA2 3QCWA 3A4UA 4Q4V1 1QOOA 5FFOC 3SHRA 4RS5C 3MIEA 3FLTA 2H0BA 5FQ0A 5JZGB 1WLDA 5BNOB 1Q8PA 4I0WB 4ISRA 1LRHA 3WR0A 2QZ2A 1DIWA 4SBVA 1XE7A 4OI1A 4LE4A 3NKTA 2VW1A 4LBJA 3NJZA 3WCSA 4ITCA 1VBA3 1XQNA 2E6VA 3TN92 1TEIA 2R1BA 4JCKA 3U11A 1TME1 3D5OA 5FLIA 4YZ1A 4Z8BA 2RS51 4DZGA 2ZX2A 1PVC1 4XXAA 2X8KA 1W6NA 1YXWA 5FO7B 1ZRDA 4AVBA 2E7TA 2XJPA 2IXLA 3ZXKA 3GZTB 1YJLA 4YZ3A 3GBGA 5JSRA 4XJ9A 4Q8LA 1LOGA 4KGQA 2XVLA 1AYN1 4RR3C 4F8AA 3RWNA 4BCUA 1LHVA 4HANA 3TBDA 3LA3A 3PVOA 3O0XA 1KJRA 5FCCA 3WDWA 1WLCA 1JUIA 4PIYA 2GZWA 4FOYA 1DZTA 1Q3EA 3KZ4C 5LRSA 2VW2A 1RUC3 2C1FA 2CAUA 4Q4Y3 5JOZA 4QX5A 1FMD3 2DVDA 1Q8QA 4AG4A 1ENSA 1EY2A 2XJUA 1PVC2 2D6PA 2UU8A 3AJZA 3POSA 1DQ1A 4GWMA 2WFF3 2EVXA 1V9U2 5E1RA 5BNOA 1ZRRA 3FBYA 3J8F2 2NMOA 4L97A 3CJXA 4OI2A 3KCCA 4XFCA 1U12A 1AYN2 3FJSA 3AMHA 3UKNA 1NE6A 5K0UB 3S6PA 1DQ2A 1SEFA 4MUVA 4Y1XA 4WVVA 2ZGQA 2RM21 4EN9B 4FSJA 1OOPB 2ZMKA 2DUQA 1UPSA 1QNWA 2GC1A 4N9HA 3VV1A 2ZAHA 1MZFA 1REDA 2I07B 4XIOA 1RB8G 3CF6E 2R063 4WZFA 1KRIA 1C28A 4JGZC 3URFA 1NQJA 5BXXA 1EAH3 1BZWA 1AR93 3UKTA 4QPIC 4UW4A 3H7JA 3FFZA 1WMFA 3HMYA 1R1A1 4WM8B 4A3XA 4LNVA 5BYNA 1CAUA 4BH9A 2NP0A 3VKMA 5AVAA 2IXIA 4XW3A 3RRDA 2PHRA 4H3WA 1KDMA 1H1MA 2RM22 4WVZA 1MVEA 4KH9A 2PHTA 1WW7A 1LGCA 2PAEA 4QM8A 3KGLA 3ETQA 1SFNA 3AM2A 3ZYJB 2JEMA 1OMIA 2ZGUA 4YW1A 1E57A 1TMF1 3RJRA 1RUI3 4OI4A 4OUMA 1Z7S2 4LO6B 1LHNA 2BGCA 1ZBE1 2BVBA 4NN0A 4Y1VA 3SCFA 2D6MA 1QF3A 3VBFC 4XYXA 1OFNA 4B8EA 4C1WA 1FYUA 4PIXA 1R1A2 5DXDA 3WQ1A 4DNYA 3HWJA 3RQ0A 1QJU1 5K0UA 3UL2A 3BB6A 2HWC1 4B29A 2Q8OA 3AP7A 1N1SA 1OLRA 4CDUB 2P3KA 3MW2A 2XBO3 4AEDC 1SBFA 4Q4V3 4BZ4A 4PBPA 1OA4A 3D8CA 4BM8A 2FZ1A 3U0ZA 2JKBA 4RFT0 1IQAA 5EV7A 1TMF2 3O5SA 3AKTA 1RUH3 3MIFA 2BBVA 1KFUL 4E27A 4AW7A 4M00A 4QD2A 2Z42A 4XF1A 3ZN5A 1ZBE2 3MLJA 1RMU1 2VNRA 4X8PA 1VBB1 1CJPA 2ARXA 4QGLA 4HFSA 1S2KA 2A70A 3WW1A 4CP1A 4WM8A 2P3IA 2IXHA 2QZ3A 3HN1A 2ZX1A 1TME3 3IKWA 3VL8A 3WG1A 4FPFA 3W9AA 1OPOA 3TOJA 2RS53 3AKSA 3LSEA 2HWC2 2ZHMA 4GKXA 4JDOA 4S2GA 5JI9A 5EFUA 2XLAA 4R4ZA 1C1FA 3MPBA 2XKPA 2EIGA 1NE4A 2XVGA 3NAPC 3VBSC 2GNTA 2HWD2 1KS5A 3B5LB 4MSVA 3WY6A 5JDBA 3VLBB 3ZXJA 2OIIA 5C9AC 2G9FA 3ZFGA 4RQPC 5E89A 5EWSA 1YFUA 3FC0A 1CD3G 1OD5A 1V6NA 1OQEA 3B3QE 1NOVA 4Q4W1 1ZZ9A 4E4ZA 3H8UA 1FPN3 1RMU2 2QUOA 1FX5A 3WDYA 2XWBB 3ZN4A 5IUQA 4YFZA 4DRVA 2PHXA 3VZKA 4OZXA 2FMYA 3GBWA 1GV9A 4GH4A 4Q1PA 5LEKA 1OA3A 3OBRA 2VMGA 4OULA 1LECA 4Y5Z0 4YFWA 4X6QB 2VMHA 4P9JA 1UL9A 4RR3B 2Z69A 5CFCC 1LHWA 4MXVA 2DCKA 1KXGA 1HV0A 1VBC2 4MVTA 2P37A 4WVWA 1FOD2 1NG0A 3N7JA 4LA3A 5CIRA 1PK6C 1GQGA 3B7MA 4SLIA 3OF1A 3I7DA 2R0FA 4XJUA 3VL9A 1DLLA 3FFQA 3IPVB 3Q9OA 4QU2A 1B35C 2NPIA 2R0HA 4JGYB 5GALA 2BEOA 1CGPA 2LTNA 1A78A 4OHZA 1JOJA 2FZ2A 1NXD1 2GDFA 2R041 1QKQA 1YUDA 4FBFA 4FPCA 4P9GA 3S30A 5H9PA 1AL21 2FQPA 4IXLA 1BEV1 1EP0A 2AYHA 2DVAA 4MGYE 3KCXA 2HEWF 3LWCA 1I1EA 5K9YA 1REEA 1D4M1 1H8TA 3AXEA 2OUHA 2RE9A 4PCRA 4JV4A 2Q30A 2X53S 5FRAA 4QQ2A 3ZSLA 3T1LA 5KWRA 1W0OA 1DQ6A 1ALYA 3ZXGA 3D4KA 4JGZB 3BU7A 1WUVA 3W59A 5T5OA 5D8AC 3B9CA 4QPIB 4CDWC 5ABJC 2JJ6A 2GNMA 4AFCA 4D3WA 4LHLA 1AHSA 4EWEA 1J3RA 2XGXA 1GNZA 5DDJ2 3V0AB 2DVGA