3RG0A

Structural and functional relationships between the lectin and arm domains of calreticulin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
320
structure length
292
Chain Sequence
b'DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRSKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calreticulin
publication title Structural and Functional Relationships between the Lectin and Arm Domains of Calreticulin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 70
structure length 292
sequence length 320
ec nomenclature
pdb deposition date 2011-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.250.10 Mainly Beta Ribbon Calnexin lumenal domain, non-globular proline-rich hairpin domain Calreticulin/calnexin, P domain 3rg0A02
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rg0A01
1UZYA 4YZ1A 4Y22A 4I30A 1LU1A 2ZKNA 4XBQA 2DVAA 1V6MA 2V73A 2VUAA 4Q27A 2VW0A 5JDBA 5E89A 4LBLA 1W6MB 2AENA 2ZABA 3HMYA 4AGGA 4YW5A 1WW6A 2B7YA 2JD4A 1CONA 3ZXJA 2P34A 2DU1A 4P9YA 1LESA 4CZSA 2FMDA 1GZWB 1LECA 1LOFC 3BTAA 3NV3A 1W6QB 1D0HA 2GNTA 1AZDA 5FREA 5JLVA 3HR9A 1JUIA 1DZQA 2NMNA 2PHRA 3FLRA 1GICA 5GZDA 3V0BB 1BKZA 2YROA 1ULGA 2DYCA 1Q56A 4NOTA 1YIFA 2DTWA 4M01A 1F31A 3LSEA 4GKXA 2GN7A 3WCSA 3KQRA 4L8QA 1MS0A 1W0OA 2DV9A 4R9BA 3BIWE 2PHTA 5CA6A 3OYWA 3NV1A 5EXOA 2D6LX 4D69A 1HKDA 2AYHA 1DQ4A 2ZGPA 2D43A 3SH5A 4Z8BA 2UWBA 1LOGA 3M3EA 1PZ7A 1LULA 4FPJA 1LODA 5CBLA 4ITCA 2NYYA 1ULCA 3ASIA 2R16A 1QKQA 2C9AA 2AGSA 4YZ5A 3ZXEA 1Q8PA 2WLQA 1KQRA 1GZ9A 1OKQA 4ASMB 1SLLA 4K1ZA 2XG3A 1S0BA 2LALA 4XJ8A 3ZYRA 1HQLA 1W6PB 4FPLA 4U2AA 2ZGSA 4XMAA 4YW4A 1RINA 5KXDA 2ZMNA 1O4ZA 3N35A 2EXJA 4Y20B 1HHNA 5JOWA 1O4YA 3WCRA 2HYKA 3I8TA 3N7MA 1W6OB 2BQPA 3AZWA 3M2MA 1UN1A 5DZGA 3R4SA 4BM8A 1N1VA 1LOFA 1JN2P 4BQ1A 3M3OA 1W0PA 1S0CA 3ZXFA 3WHUA 1V00A 2SBAA 1LOAA 3FFZA 5DUXA 3SISA 4DS0A 2A5ZA 2P3KA 4P9WA 4PBPA 4WZFA 1XQNA 1FX5A 4YGCA 1MZ6A 1ULFA 4XILA 4HL0A 4YZ3A 1QDCA 4UW3A 4XJAA 3KM5A 4FOQA 4OZXA 1WLWA 3VKNA 3UK9A 4AVSA 2JJ6A 1JHNA 3W58A 1FV3A 4NO4A 2DUPA 1W6OA 3WG4A 1SLAA 4FPOB 1IS4A 3ZSLA 2OUJA 2JKBA 1F9KA 3BOPA 2ZMKA 5GALA 3WZ1A 1WW7A 5GZCA 4PQ9A 1SACA 4BMEA 4DRVA 4Q2FA 1LCLA 1FV2A 1WBFA 2EXIA 3WUDA 2V5YA 2YMZA 1FNYA 4IQPA 1C4RA 1CIWA 3R4UA 4BMBA 3PVOA 5EWSA 2TEPA 3IN9A 2E53A 4HANA 2R0HA 1KDKA 1LOEA 4XBLA 2GMPA 1VAMA 4UW5A 5F5QA 1UL9A 3AX4A 3O0XA 5T5LA 3DGTA 1DLLA 5IT6A 1LGNA 4AVVA 2A75A 1H30A 3AYCA 4Y22B 1C1FA 4YGBA 2CWMA 5H9RA 3TAYA 3ZSMA 3D5OA 1MVEA 2D6KA 4U36A 3INAA 3APBA 4GA9A 5GLUA 5T52A 5JOXA 3ZSKA 1G9BA 1C57A 4FPHA 1GLHA 2P3IA 3AYAA 3M3QA 1IS5A 5JOZA 5IUQA 1GYKA 5E8AA 2WJSA 3OJBA 4XTMA 2D7FA 1I3HA 2ZGTA 3RSJA 2GMMA 2VH9A 1SFYA 2E6VA 2ARBA 2ZACA 5EYXA 5HCFA 3N3HA 3RRDA 2DVDA 1IS6A 1DFQA 1GNZA 4GKYA 4M00A 5DUVA 4H55A 3WDVA 1CPNA 1G7YA 1AXKA 5DUUA 1AVBA 3DUIA 1WD3A 3B9CA 3O0VA 1AXYA 4YW2A 3WG3A 5JOYA 3IM0A 5DUWA 2CTVA 3AP6A 1ULEA 5IK8A 5GZFA 1QOTA 4PBOA 1URXA 3OYWB 3ATGA 4ISRA 5IK7A 4XHXA 4YFZA 1AJKA 2EIGA 2DWRA 2WT2A 5DZFA 1LOCA 5H9PA 3NV2A 1N3QA 1SLBA 2PHFA 3O12A 2EALA 4XXPA 3RMYA 4K20A 1QGLA 3POYA 1LEMA 2GALA 2UURA 3MW4A 1GV9A 1LGBA 3WV6A 2ZGLA 1AJOA 1S0JA 4WVWA 1CVNA 1V6OA 2D3SA 2ES3A 2PHXA 2R1BA 3O5SA 3U4XA 2EAKA 1HQWA 4Q1PA 1UX6A 2ZHMA 3WOGA 4AGVA 2AREA 2JDZA 1VLNA 1Z0HA 3JU9A 4Q1RA 1F5FA 1DGLA 3ZXKA 1ENQA 1DQ2A 1UKGA 2A71A 2D6MA 3AZVA 3PMEA 1U0AA 1KJRA 3M3CA 4XTPA 4W65A 3OBRA 2PHWA 4FPEA 4XHBA 4BLJA 5BYNA 2H0BA 1NLSA 3HN1A 3GNEA 4XBNA 1I1EA 2CYFA 5KXEA 3AP7A 1W6NB 2OVUA 4FPYA 3WG2A 4YGEA 4Y26A 4XYXA 1CN1A 1FAYA 3IPVA 2NN8A 4XMIA 4ATEA 2A6YA 4XXAA 2ENRA 4YG6A 1RITA 1GNHA 2YV8A 2YY1A 2EXHA 1A3KA 5F9TA 1LHOA 1LHWA 1SCSA 4KBBA 2VW1A 5CNAA 4C1XA 3AYDA 3ILRA 1QU0A 4FOVA 2GNBA 2ZGUA 3AZZA 3V64A 3AXDA 4Y1UA 1J1TA 4R9AA 3I4IA 1YRZA 1SBDA 1S0IA 4K21A 2A6XA 2CY6A 1V6IA 1WD4A 1DIWA 1SCRA 3JUUA 4LBQA 1G9CA 2ERFA 4XE9A 3VV1A 1X50A 1LU2A 1YYNA 1W6NA 2AH2A 3AJYA 1OQ1A 1ULDA 1WCSA 3NWKA 5DG2A 1PZ8A 1V6KA 3B00A 4TYSA 3WUCA 1IKQA 1BJQA 1G8WA 3OY8A 2W52A 4FPGA 4LBMA 4XIKA 2R0FA 4PCRA 1MS5A 2YZ4A 4RA0A 3FLTA 1DQ1A 1DYKA 1R1ZA 1HDKA 3BODA 2W39A 1A8DA 2NM1A 3CNAA 4M3CB 2CL2A 1UPSA 1SBEA 4Y1XA 3OGGA 5T54A 3VKOA 4YG3A 1V6NA 1A78A 1GBGA 3H0OA 3RQ0A 4BOWA 1GSLA 4RL7A 5E88A 2PHUA 4YG0A 2A7AA 4JC1A 4XJ9A 1S1AA 4UW4A 2NP0A 1JYIA 2A6VA 3WDXA 1RIRA 3AYEA 1QOOA 5T5JA 5DG1A 2WSUA 5L73A 1IOAA 4XJZA 2GN3A 1MS3A 1AXZA 2I2SA 2A70A 3UJOA 3AP9A 1GANA 3AP4A 3ILNA 5DXDA 2DVBA 3MEPA 3V65A 1DQ6A 1AF9A 4YM0A 4DPNA 4M3CA 1BZWA 3GALA 3B3QE 2CWSA 1N47A 1JBCA 1JW6A 2PELA 2VXRA 4R9DA 5H9SA 5CB7A 1Z78A 2KM2A 3AZXA 3M1HA 5JVVA 2JECA 1WBLA 5KXBA 1BXHA 1CR7A 3T2TA 4M3CF 1JYCA 4LBNA 2DUQA 5JMCA 1KRIA 1LHUA 1QDOA 5GLWA 3A0KA 4FPKA 1LENA 1Q8OA 2OUHA 2UWAA 1C1LA 2R1DA 1LHVA 3FLPA 2LTNA 2ZHKA 4AVTA 2VY0A 1NXD1 4LBQD 4FP2A 4XJWA 1QMJA 3FUQA 4FPCA 2GNMA 4LBKA 1YO8A 5FRAA 1UMZA 1IKPA 1AX0A 3FBYA 5HCBA 3SITA 3AP5A 3LSDA 4XZPA 2DVFA 2DUOA 2Z42A 3FUOA 1CQ9A 3AXEA 2G4IA 3W59A 2A3XA 3O0WA 1H9PA 1GKBA 3VKMA 1MVQA 3RS6A 3AFKA 2JE9A 2D3PA 4Q26A 3USUA 2C5DA 4WVVA 4FP3A 2NMOA 2DTYA 3B69A 5LK5A 5T50A 4PF5A 3IPVB 2EF6A 1G9AA 2WKKA 1KDMA 3N7KA 3WVJA 2SLIA 1BYHA 4JRAA 1ONAA 5GM0A 1MS1A 3WG1A 4FQ4A 5KXCA 4GWMA 2WQZC 3WDUA 2XB6C 4FQZA 4XOGA 3LCPA 1DQ0A 4BPZA 5EYYA 4K1YA 1FYUA 5HCAA 1AX1A 1WLCA 3OPZA 1N3PA 4YM3A 4FOWA 3WDWA 1LTEA 1APNA 3R05A 4FOYA 4LBQB 4F83A 2ZBJA 1Y7BA 1G9FA 3PJQA 3PVNA 4YFWA 1H9WA 4LBJA 2DVGA 3UJQA 4ATFA 1CESA 4YLZA 2ZGRA 5IK4A 3OY8B 1AX2A 4M3CE 2GMEA 1OFSA 1YXWA 4ZXKA 4CTEA 4XJUA 2ZGMA 4TZDA 3ENRA 3SH3A 4CRQA 1MACA 5T5PA 1MS9A 2UU8A 1W6MA 1V6LA 1ZM1A 4YGDA 2AUYA 5T55A 1JXNA 2E7TA 3WDTA 1LGCA 3WDYA 4BLIA 3VKFC 4GALA 4WV8A 3QLQA 3AZYA 1LHNA 2A6ZA 4Y1VA 2W08A 3T1LA 4P14A 4YW3A 2W68A 1KITA 2ARXA 1FATA 1GZWA 1Q8SA 4AGRA 2Q5TA 1QNYA 1W6QA 5GJ6A 2P3JA 3T1MA 2ZMLA 3V0BA 2VW2A 1WW5A 2GNDA 1HLCA 1ENSA 1N3OA 2WNEA 3OBTA 5CAZA 1IS3A 4MYEA 1SLCA 1S0GA 2NZ9A 1S0EA 3SLIA 1G86A 1G9DA 2D6NA 2EXKA 2GDFA 1LJ7A 5SV8A 4XIOA 1UAIA 1Q8VA 3VUOA 1N1YA 3A4UA 3N7JA 3ZPYA 1LOBA 3L2YA 4XDQA 1MS8A 4DFSA 2ZGOA 4ISQA 4P9XA 2UWCA 4Y1YA 4Q8KA 1YI7A 3Q9OA 1CPMA 1D2SA 2A3WA 4YM1A 5DZEA 2ZHLA 1QNWA 3C2UA 4Y1ZA 2D3RA 4YZ2A 1CJPA 2WT1A 3RG0A 2D6PA 4AYUA 1BQPA 1LEDA 4Q8LA 5AVAA 1EPWA 4DQAA 4R9CA 2E7QA 2RHPA 5GZGA 2ZGQA 2AR6A 2D6OX 4GWNA 3V0AB 1W6PA 1N1SA 5GLVA 2ZHNA 2WT0A 3SNMA 3ZYPA 5H9QA 4Y20A 3D6EA 3IKWA 1ENRA 1JOJA 3MW3A 2P37A 1TEIA 1SLIA 4YM2A 3B01A 1S0DA 4C1WA 3IMNA 3VKLA 4DRRA 3QCWA 2P2KA 1MR5A 3POWA 2ZZJA 2ZGKA 3ZVXA 2DU0A 1K9CA 3ILFA 4JCKA 3AK0A 3USUB 1ZA4A 1S0FA 3N7LA 4SLIA 3D4KA 4FVVA 3SH4A 3WNXA 4LBOA 4AWDA 1KJLA 2JE7A 2ZA9A 3V0AA 3AJZA 1WUVA 3MPPG 3A0NA 3ZXLA 1Q8QA 4FPFA 3NV4A 5GLZA 2A3YA 2D44A 3POSA 1DHKB 2OW4A 3WHTA 2FHRA 1DYPA 2WSVA 3RMXA 3TB0A 1GZCA 4YZ4A 1WW4A 4Y24A 1VALA 2YXSA 1VAVA 1DBNA 1B09A 1SBFA 2R49A 5GLTA 3UL2A 3MW2A 1WLDA 4ZKTB 4UW6A 4GXLA 5T5OA 1QF3A 3N36A 2ZAAA 5IK5A 1FNZA 2E51A 1UZZA 4YW1A 2CNAA 1MS4A 2DURA 1DQ5A 3ZSJA 5GZEA 2ZGNA 2A6WA 3WLUA 1QOSA 2VU9A 3PVEA 1N1TA 1MZ5A 1V6JA 1SLTA 1PZ9A 1VIWB
chains in the Genus database with same CATH superfamily
4YZ1A 3K3NA 1A6CA 4QDQA 4BJ0A 4XBQA 2VUAA 1KEXA 2CSGA 2VW0A 2Y33A 4MGKE 1W6MB 2ZABA 3ZXDA 4RFT0 2CAVA 3HNMA 4PT6A 1XNCA 3RYRA 2MEV2 3ZR5A 4AGGA 1WW6A 4GWJA 2OS2A 2RDQA 3KSCA 3ALQA 2P34A 1BK1A 2WN2A 3E5XA 2JD9A 2Q1FA 1UX7A 2FMDA 2PXJA 2W92A 4Q0QA 1LOFC 4AG4A 2B39A 2GNTA 4RS5A 1YIPA 2NMNA 4TWTA 2JWPA 3FLRA 3V0BB 2ZX4A 1QJY3 3LIGA 3GHMA 5FZ9A 5FLHA 2VCAA 3KV4A 1CAVB 5C9AB 4M01A 4IGPA 1F31A 1BCXA 1PHMA 1UNBA 3LSEA 2QQNA 4UAPA 2J1UA 1W0OA 4R9BA 4CCOA 1EAH3 3MFCA 4FI9A 2WFF1 5CA6A 4BCUA 2D6LX 5IJRA 3D3AA 1Y9MA 2UWBA 4GJZA 2EIBA 1RUC2 4GH4B 3I49A 1VAKA 4XUTA 3NJZA 1LODA 4ITCA 4HSJA 5F32A 2E31A 2NYYA 2R16A 3T0BA 1VB4A 3P3NA 4BHPA 2C9AA 4I0BA 4ZZ5A 4FXGB 4N43A 4YZ5A 1PO13 2ZXQA 4FBFA 4PLNA 1MEC1 2WLQA 3BALA 4QXKA 3EYPA 4ASMB 5L9VA 2W94A 4FCAA 4K1ZA 4DO0A 1A8MA 3AFGA 3POFA 1W6PB 4FPLA 3PHMA 5KXDA 2XJPA 3ZMNA 5G05L 3WCRA 2HYKA 2ZAHA 2HEWF 4LA2A 5D2AA 2VZUA 2GC3A 4EN7B 2BNNA 1BBT1 4LO4B 5DZGA 3R4SA 4AL9A 1O5LA 1VMFA 1N1VA 2QZ2A 1JN2P 4BQ1A 3RZHA 4L97A 4B1MA 1S0CA 4DUWA 1Y4WA 4XFHA 3W9AA 1V00A 2SBAA 1WWYA 1LOAA 3FFZA 3ETQA 3R4DB 5LY2A 2P3KA 3CQOA 2OT7A 4H7MA 4YYOA 3RVHA 4WZFA 4LJHA 4YGCA 3UETA 3E6DA 3PL0A 4BXSV 2PHLA 3Q8AA 4XILA 2JDKA 3MV11 2MEV1 4ZU5A 1OPMA 4WM8A 3LKJA 3IIIA 2BUKA 4FOQA 1WLWA 4OZXA 4P02B 5D21A 3UK9A 1RUOA 4JGYB 2CAUA 1JHNA 4NO4A 1HXS2 3VDDC 1SLAA 3CJIC 4JV4A 2JKBA 4EE2A 1LAJA 1VBA1 3ELNA 1AL0G 2GAUA 4AFAA 4Y4YA 3C7EA 4CEWA 5L19A 2XJQA 1LCLA 2EXIA 2J42A 2JE8A 1QJU3 4CXXA 3MV01 2IXLA 4QM8A 3C7FA 1C4RA 2JB4A 2RS13 4BMBA 3ON7A 1JYXA 3PUQA 2TEPA 3HEIA 4LT5A 1KDKA 3AX4A 1RUC1 1DLLA 3F2ZA 1DF0A 2MHFA 2DBNA 2WS92 3BU0A 1LGNA 4HVRA 1H30A 3CMGA 4Y22B 1C5IA 1W03A 3T0AA 2EIEA 4U36A 3APBA 5T52A 3PJYA 3DXUA 5FZDA 3FL7A 1RUI2 2XL7A 3P5BA 1H8TB 2WJSA 2KXLA 1I3HA 4IXLA 5EQUA 2HWE2 3PLQA 5K0UB 1YWKA 3ZDSA 1SFYA 2XXZA 3O14A 5EYXA 5CFCB 3VBUC 1RTVA 2VVEA 2P4EA 2WQ4A 4XDPA 2XBO1 1DFQA 1GNZA 4GKYA 1KGYA 4N8MA 4CDXA 5BNOC 3CBNA 1G7YA 3ME2A 5DUUA 2X05A 3MUZ1 5IVVA 1ST8A 3B9CA 5FYIA 5FOBB 5EJZB 5LW9A 5DUWA 2CTVA 4AEDA 5C8CC 4AI8A 4F8AA 5GZFA 3UYJA 4PBOA 5BNPC 4H3WA 2OPKA 3ZFFA 1AYM3 2XL9A 1TG7A 4QDSA 1RUE2 4XF0A 1W3XA 1ULPA 2DWRA 2EIGA 4XF1A 2WWSA 5DZFA 1LRHA 2PYTA 2FZ2A 3O12A 1UZ0A 1W0NA 4K20A 1VBC2 3VBOB 5FAXA 1ND3A 3RI8A 3CF6E 1GV9A 1LGBA 1WGPA 2ZGLA 4QKNA 2UY8A 1AR62 1V6OA 2RE9A 4W50A 5IW0A 2Y26A 5BXXA 2R1BA 3DCQA 3TNQA 2F4PA 2QQOA 3RZMA 2AREA 2JDZA 1VLNA 4E8DA 4JVAA 2HWB2 4D0QA 4IEXA 3D0SA 4IEUA 4K7JA 5C4WB 2YBKA 4QPGC 5D1IA 4LULA 1UKGA 4CCCA 3AZVA 5FMBA 4CP9A 4GAZA 2R041 4S2HA 4W65A 5EP9A 2PHWA 2YYOA 4FPEA 4BLJA 5BYNA 4AVAA 1VR3A 4H14A 3HN1A 3GNEA 1I1EA 1W6NB 2OVUA 1K5JA 4LO6B 2Y38A 4XYXA 1DGWX 4NE9A 3S57A 4ATEA 3JD72 2Q8EA 3I54A 4QQHA 4YG6A 1RITA 5A6XA 2VW1A 1XE8A 4HOOA 4EROA 4RHV2 3H3ZA 5A3OA 1QU0A 2D93A 4HN0A 1RUI1 2GNBA 4G4FA 1NCQC 5T3NA 5AC92 1ZZ9A 2W9XA 1PMJX 4CDQB 4MXVA 2HWE1 2PLV2 2Y6FA 3UKVA 1JYVA 2ET1A 4K21A 2RJLA 2JG8C 3JUUA 2BFUL 4JTNA 1VBD3 4XE9A 3Q8EA 3T4HB 2F17A 1PGSA 1X50A 1VPHA 2XJSA 1LU2A 1UYZA 2CGNA 3AKPA 2UYBA 2VZPA 2JDYA 4QGLA 4COYA 2PHDA 1V6KA 1IZ3A 2Z4FA 3VL8A 1MZFA 1G8WA 1VJ2A 3K4DA 3GF6A 1CAUA 2QNKA 1MS5A 2YZ4A 2X5IB 5I8SA 1W9WA 3FLTA 1DYKA 1E5SA 1R1ZA 1RUE1 4K3UA 3ZYGA 4O9GA 4K40A 4OHVA 4KH9A 1UPSA 3ZFEC 4JDMA 5D8AA 2YPDA 4YG3A 1XSQA 1S4CA 4RL7A 1K42A 2JDHA 5FY9A 1EV12 1QH7A 2WABA 3NKTA 4YG0A 2ORZA 1Y3TA 1S1AA 1AR61 4KU8A 5J96B 5IFPA 1XBFA 1OA2A 1Q43A 2VZSA 1REFA 2NLRA 5ERLA 3AYEA 1QOOA 4RQPC 3TN91 4AI0A 1CZVA 2WSUA 4PJYA 4E4DX 1IOAA 1EY2A 1PK6C 2WUHA 3NO8A 3WINE 2HWF2 4LO7A 3LA7A 3M3IA 2A70A 1W8UA 1GANA 1YFUA 3I2JA 3MEPA 1RUF1 2F4LA 5JXJA 4NN0A 4LLFA 1AF9A 5LATA 4QQPA 4DPNA 3MBWA 3LDRA 4M3CA 5K7PA 4NWWA 5I8TA 1RYYA 2CWSA 4IL7A 4P5HA 3VHPA 3FJSA 4BQXA 1OSGA 1YLLA 3WP5A 4XABA 3EO6A 4TXWA 4D7SA 3AZXA 3O1MA 4HZFA 5JVVA 4MGZE 2OQ7A 1DDLA 4AEKA 2BP6A 2JICA 3J26N 4DUVA 2ZEZA 1PM7A 3A0KA 1Q8OA 2UWAA 4QHZA 2PLV1 1PX4A 2R1DA 3E6BA 3FLPA 1AR91 1FOD2 2ZHKA 3TOJA 1NXD1 4L99A 5CFDA 2YGMA 3O1OA 4XJWA 1QMJA 3EQEA 3JB8A 2Y34A 4LBKA 2GNMA 4Q4X1 1YO8A 3ETPA 1IKPA 3ZO0B 4E4SA 4A45A 2BU9A 3OBZA 4QT6A 3FWEA 3LSDA 3RZLA 1QJEA 2DUOA 1F8VA 3I2KA 3WX5A 3OOXA 2HKXA 3I7DA 2WZR2 2WBKA 3LA3A 5TSWA 3W59A 1M4WA 3NSTA 1NY72 1GKBA 4KNCA 3TRSB 1OF4A 1H6YA 5FZ4A 1POV1 2P17A 3VKMA 3QD6A 4A7KA 2FZ1A 4V2VA 3AFKA 3VBUB 2OA2A 1RUJ1 4Q26A 2C5DA 4WVVA 2D40A 2WFF3 3ZYJB 5KC6A 4OQ9A 1NXMA 4FP3A 3DL3A 5LK5A 3W21A 3HNYM 3T4VA 2KR2A 4HBNA 2VZQA 2WKKA 1KDMA 4IE0A 1L7RA 5DAWA 1EV11 4EN8B 4KWLA 4JRAA 5GM0A 5C8CB 2E7AA 2I07B 4N43C 4GWMA 5BNPB 2WIIB 3B93A 5A32A 3WDUA 2JG9C 1J84A 2XB6C 3KS7A 4IEPA 4GB32 2JDPA 1DQ0A 1GNYA 4NJ4A 3WF3A 5FZOB 4BPZA 1MEC3 1AL22 1FYUA 1OLRA 4WZCA 5EIYB 5HCAA 4OVEA 3OBAA 4DUXA 3LA2A 4NPMA 3ZN5A 4DNYA 1LTEA 1OD3A 1G9FA 4Y4RA 2VUDA 1H1AA 1TVGA 2YDEA 1H9WA 1SHWB 4LBJA 4MGSA 1BBT3 2XLFA 3BTXA 3A21A 1RL3A 2XGXA 1CESA 2LUWA 2XQXA 4S2GA 4YLZA 2ZGRA 5FPXA 4ARXA 4M3CE 3VN4A 2GMEA 1RUH2 3I2FA 5J48A 3WQ1A 2ZX2A 2ZGMA 4QPGB 4C91A 4PHZA 1MS9A 3RZZA 2R30A 5LBBA 3THPA 4QPYA 4OI4A 1V6LA 5T55A 4AFBA 2AUYA 5EZWA 1OC1A 1POQA 2ILMA 2B46X 1FOD1 4FFGA 2MEV3 4JKLA 4Q4W1 2J22A 1LGCA 5K8SA 4L2NA 4WV8A 1NOVA 2F6BA 4IEZA 2WNUA 2W08A 3R6SA 1QJY1 4YW3A 1KITA 4EV0A 2Q5TA 3MYXA 3U10A 2ZMLA 4AOCA 1VBA3 3WT3A 2VW2A 2WZR1 4OMCA 1NCQB 4CEWC 1PVXA 1N3OA 1NY71 2WNEA 5CAZA 3K4AA 1MQTC 4P9JA 5DMYA 1S0GA 1UMIA 2WINB 1GU3A 1PGW2 3HNBM 3OUJA 4ARYA 5AFEA 3SLIA 2EXKA 2GDFA 1GQHA 1LJ7A 2OPWA 5FP9A 1OUSA 4V2WA 4XIOA 1UAIA 1Q8VA 4LA3A 1N1YA 1O8PA 3A4UA 2JX9A 1HB1A 3N7JA 4WM7A 3ZPYA 2Y6LA 3S0MA 3N9QA 5JI7A 1OFNA 1JUHA 3RNSA 1RUC3 3BKZA 1JYTA 5FZBA 4XZUG 4BIOA 2BDRA 2YBPA 1YI7A 3Q9OA 2ZTNA 4I0AA 1CPMA 4PIZA 4Y1ZA 3UV9A 2XHKA 1CJPA 1VMHA 4GB31 2H0VA 3DYOA 2P6HA 4QKBA 4BQWA 1AL21 1MPXA 4DQAA 2QTWB 4YSFA 5GZGA 2RHPA 2VBDA 2D6OX 5CYYA 5C5TA 2BGCA 5GLVA 1JS9A 4NIHA 4YNIA 2ZHNA 3D6EA 3K2OA 2Q8CA 1JOJA 3A22A 2XONA 4CDXC 5A7WB 2A73B 1RUG2 1SLIA 2XBO3 3PNAA 4FO9A 1I5ZA 1ZBE2 3IDAA 3KT7A 4M0HA 1S0DA 3NNJA 4C1WA 4DRRA 4AEDC 1PK6B 2P2KA 4Q4Y2 1MR5A 1RUH1 4XFIA 5A1LA 5FDBA 3ZFFC 3VB9A 2G1MA 4JCKA 3LB9A 1MZEA 2VUJA 3KF3A 3RYKA 3USUB 1X7NA 2JDUA 2XVGA 3ZYIB 1S0FA 3AKQA 3N7LA 4S2DA 1CGPA 3K46A 3D4KA 2GP5A 4FVVA 1QXRA 1BEV2 3VDAA 1ZRFA 1LNSA 5C33A 3V0AA 1ND3C 2RM22 1HB4A 3NV4A 4FPFA 2QCSB 1HXS3 1SZBA 3POSA 3CO2A 5FK7A 2C0ZA 1NZCA 3DYPA 2C4XA 3VD7A 4QX0A 2W1QA 4J1XA 5JIAA 4YZ4A 2V09A 1WW4A 3O7OA 1VALA 3E97A 1PMIA 3S7EA 1B09A 3ZMOA 4NIIA 3MW2A 1WLDA 3T2PA 5JXIA 1PGW1 4FTSA 4A6SA 5T5OA 2XUMA 3N36A 3NVCA 2W1SA 5FPBA 4ZXEA 2IXHA 2FBEA 1W2AX 2R043 3OCPA 5GZEA 5F3GA 4CDWC 1ALYA 2VTXA 3KD4A 1QOSA 3ZIWA 2VMIA 1ZRDA 3K4ZA 3B7MA 1PIV2 5FY1A 5FY8A 3T2OA 2NP0A 4URTA 1YFWA 4SBVA 5EJ1B 3G7DA 1H8VA 3PU3A 2ZKNA 1YQ8A 2ZX0A 4I30A 2V73A 3LPGA 4IGOA 4YWAA 5JZGA 3RZGA 4QKFA 3RPQA 5JDBA 1UY3A 3DF0A 4COWA 4FTEA 5LBFA 2VOTA 1RUI3 2QDNA 1DGRA 1CONA 5BPXA 2HWE3 3GBGA 4LMFA 5E6HA 4P9YA 1LESA 1L7QA 3ZM8A 2G19A 4R52A 3A7QA 1GZWB 3NV3A 1W6QB 3OGJA 1AZDA 3GDBA 4M0NA 1DG6A 3EHKA 2R32A 3HR9A 2HEVF 4N43B 1GICA 5JSPA 1BKZA 5JSRA 1DGRN 2JG9B 4NOTA 4Q4Y1 1HRV1 2DTWA 2E9QA 4BWOA 1UOBA 1XU2A 2XQRA 3WCSA 4GULA 2GN7A 3TEZA 3NJYA 3VBFA 2DFBA 2DV9A 4P9LA 3BIWE 3FX3A 2WO7A 2P5BA 3OYWA 5ACA2 5J98B 5EXOA 3URFA 2K9ZA 2XWBB 1HKDA 4CP0A 2Q30A 4XF4A 4OCTA 5F37A 5IAVA 1RUE3 1SFPA 1YC61 3NJXA 3M3EA 5D8AC 3USSA 4AI2A 1WMFA 2YGLA 2VM9A 2WLPA 2BNMA 4FPJA 3OEBA 2RM21 3ACFA 1NQJA 4XCAA 3WF4A 1OQDA 1VBC3 3GGLA 3ACHA 3VBSA 2RS32 2G9GA 4NRMA 3N4MA 3MIGA 3GZTB 3AMNA 3I59A 4LEJA 3ZXEA 4KBZA 1AR63 1OQEA 1KQRA 1GZ9A 1OKQA 2IWGB 4JQRA 4Q0UA 2Y60A 4QQ2A 4CCLA 1W2TA 3U78A 1S0BA 5KHJA 4XJ8A 3ZYRA 1C3HA 3TN93 1HQLA 4XMAA 4B3NA 1OPOA 4LE3A 1NAEA 4X6RB 1O4ZA 2HWB3 5IFTA 5ABJA 1T6BX 5JMOA 1Z7S1 3FE5A 1F5JA 3PIGA 4DXTA 5BNNC 5JOWA 4CDUA 2WZ8A 2BQPA 4ZY9A 1W8WA 1RUF3 4KGQA 4OHXA 1C8M1 5FY7A 2J7MA 2OXBA 1W0PA 1UY1A 3ZXGA 3O1UA 2Y8KA 1UY4A 5LB6A 5LRSA 1PIV1 2VMEA 3E6CC 4MUVA 1NX9A 4N53A 2A5ZA 1MQTB 1QQP2 4ET7A 3JD73 3AMMA 1OXCA 1XQNA 1POV0 2ET7A 1UF2C 4RHV3 2VCBA 1QDCA 2FCTA 1JH5A 5AC93 4AF9A 1L3JA 3DN7A 3WQBA 3I3MA 4JGZA 2PLV3 3W58A 1FV3A 4A3ZA 4Q0SA 1W6OA 1GP5A 4P08A 1O3SA 3ZSLA 4C90A 2ZMKA 4LR4A 3HIFA 4XUQA 3SEPA 4AHZA 4BMEA 3MIHA 5JSOA 5EJ3A 1ACCA 3B9IA 5F3CA 1TME2 5KBFA 2V5YA 1QJFA 1QJZA 4JHTA 4HVQA 1NA1A 5J37A 4KWUA 4IQPA 1CIWA 1POV3 3PVOA 1ZZ7A 5IAXA 3IN9A 2H6BA 2R0HA 4XBLA 4CDXB 4CEYA 2GMPA 1JZ8A 1RUJ3 3CLPA 3O0XA 1J83A 2D98A 3DGTA 4MADA 2Q1ZB 4RFRB 2V4AA 4XF9A 5DAPA 2BEOA 2QBXA 3OD4A 3BN6A 2QUOA 4AEDB 4YGBA 1EV13 1MVEA 1XOYA 2E26A 1OKOA 3INAA 2ZJCA 4QB6A 5C3OA 1Y43B 4HPKA 1G9BA 4COVA 4FPHA 4HT1T 3HOBA 3M3QA 1HQNA 5IUQA 5E8AA 2EVXA 2DBIA 3OJBA 4TLFA 2J1RA 4OUEA 3SCFA 3RSJA 2GMMA 2VH9A 2HWF3 2E6VA 2ZACA 2ARBA 4AFDA 4MXWB 5FK8A 5C71A 1DCSA 4A7YA 3AL6A 3H9AA 4I2OA 1WZXA 4JHZA 3RRDA 1IS6A 3ZXJA 2I74A 3MIBA 5DUVA 1ZZBA 5FZCA 3ZX7A 4TTGA 2ADDA 1UMHA 4P9GA 3RJRA 3C7GA 3QH7A 5JOYA 3HJRA 3AP6A 5IK8A 1WMXA 4LIVA 5FPLA 1URXA 1W8HA 2X8KA 3BVCA 3J7MA 1PO22 1RMU2 1AJKA 3EMRA 3ZFGA 2PAEA 3NV2A 4ZHNA 4N9HA 5ISLA 5A1FA 1H2MA 1R081 1SLBA 4CDWB 3POYA 1LEMA 3MW4A 1FOD3 4Q4W3 4COUA 4B4QA 2PQQA 2WNUC 3WV6A 1RB8G 1W8NA 1AJOA 2WNVA 4WVWA 2XUEA 2PFWA 4YARA 5CVRA 3O5SA 3IDCB 1W04A 2QDRA 3WD5A 3WOGA 5FYYA 3VBRC 3J8F2 2WZR3 4AI1A 3THCA 1RXGA 1XU1A 2D6MA 4QPIA 5I0DA 3RWNA 3KGLA 3VD5A 4UXAA 2IC1A 1QXJA 1KJRA 1LR5A 1EPZA 2VTFA 3M3CA 4XHBA 4ASLA 4Q0VA 4YVSB 5J7MA 4UBHA 1NLSA 2IXJA 1GMMA 2CYFA 5KXEA 4FPYA 5CG8A 3IZOA 3OGVA 3WG2A 1XNAA 1YEWA 3JCIA 3ZXAC 2ENRA 3UNPA 5F3EA 5FZ6A 1KS4A 1SCSA 2WFPA 3AYDA 3OSDA 5FP4A 1VB2A 4FOVA 1CX4A 1J59A 4Y1UA 4R9AA 4Z82A 1YRZA 4GB33 5I0TA 3OUIA 1ND2A 4XF3A 1AL23 2ADEA 1WD4A 1DIWA 2QQLA 3KB5A 1H0BA 3O1TA 3KCCA 4IEVA 2ERFA 2VOXA 4KG0A 1FI2A 3VV1A 3K77A 5C5UA 4D94A 4E4HA 1YYNA 2AH2A 4MOAA 5FPVA 3LDKA 1RUNA 3WUCA 4NWVA 2YBSA 1BJQA 5JWPA 3FFQA 2W52A 4XIKA 3U75A 3TBDA 4C8DA 4IW3A 3UGHA 5LZ6A 2IZWA 5HV0A 1RUH3 1PO21 1YQ2A 4PDWB 4MGTA 3H8UA 3NQHA 4P5YA 4NAMA 5BNNB 1O3RA 5A7SA 5FZGA 2UYAA 4QHOA 3HT2A 1OHFA 1XNTA 2VECA 2W39A 3BODA 3CNAA 4M3CB 2GC0A 4Y3OA 4IGQA 4AAXA 1UD1A 1K5MA 3OGGA 5T54A 1V6NA 1A78A 3T2QA 3VKOA 5BNQA 4BOWA 2FD8A 1ZNPA 2OZ6A 1OD5A 3EJKA 4AEJA 2IXCA 2AZ5A 2A7AA 2TNFA 1RHI2 3OTFA 4JC1A 4XJ9A 4UF0A 4BZ4A 2RR12 2DDUA 2A6VA 2ZOEB 1RIRA 3HQUA 2OKXA 4NHLA 1REDA 5FMOL 4Z92B 4LOTA 2G9ZA 4XJZA 3WEZA 2BNOA 4Y5Z0 4EN9B 4LUMA 4AQTA 3UJOA 1GWMA 1RVF2 1OF3A 4HKWA 2BZDA 1DQ6A 5F5AA 4CU6A 3GJBA 3NAPA 3CIHA 2VBBA 2JXAA 3RGBA 4A4AA 3GALA 3VL9A 5CISA 2PELA 1H4HA 1BHGA 1JW6A 2VXRA 4CPBD 4Q4V2 3FC0A 2ARAA 1UU4A 3HVDA 1W2UA 2B8MA 2O8OA 2ORXA 4ZS3A 1BXHA 1CD3G 1IPSA 1NZIA 1JYCA 4LBNA 2DUQA 3T2TA 3ZYBA 3BGAA 3H1YA 4QX3A 2OUHA 3J9SA 4CUCA 2LTNA 4AVTA 3TYJA 4FP2A 2K2SA 1KS5A 1UKRA 3ES4A 3I3DA 1UMZA 2BYVE 2QQJA 4FSJA 5HCBA 4QX2A 1XB9A 4XW3A 2IVJA 2PTMA 3IAPA 3AVRA 3UT0A 5A32B 5F2WA 3AB0A 3ZN6B 1ZBE3 3I2IA 2A3XA 1OA4A 2C1FA 1DLCA 4XQWA 5FXZA 4Y5TA 3VBFC 2B5HA 4IV3B 4MGQA 1HRV3 2HEYF 3MICA 4INDA 2ZX1A 4Q4Y3 3KGZA 1IQAA 4E2GA 4P9IA 2GZWA 5L36A 3ZDVA 4LTAA 1UOJA 3NMBA 4XDOA 4L9BA 1G6NA 2DTYA 1X36A 4BISA 4PF5A 2BBVA 1HXS1 3IPVB 1BEV3 3KVAA 3ZR6A 1O4TA 3IT8A 2Z2SB 2PA7A 3GYDA 3WVJA 3N9NA 4LKFA 5DAQA 2RM23 4N7UA 2VPVA 3DEMA 4CU7A 5C7GA 1MS1A 1AR72 2RR11 2Q1MA 1S2BA 1VRH2 3LEKA 1WCDJ 1CIYA 3OPWA 5A33A 4YPJA 3ORJA 2YPJA 3NNMA 5A3TA 4L0PA 1WLCA 4NHKA 3IMMA 3FMGA 4FOWA 5ABJC 3WDWA 1U5XA 1FMD2 1EP0A 1RVF1 1F2NA 4FOYA 4LBQB 4CDUC 5A80A 4XFGA 1F15A 2WNUB 3PJQA 1Z7S3 5LASA 3GXUA 3K48A 5C6CA 1HV0A 4YFWA 4N90A 5A3NA 2WS91 2X29A 2ZPXA 3RWKX 1W2OA 1D7PM 1C8M3 3PTYA 3UJQA 5A7QA 3POIA 2VGDA 2VNVA 1D2QA 3OY8B 4ZZ8A 1W8OA 4W6YA 3VBRB 1OFSA 2ZKLA 4N53C 5HXMA 5FQ0A 5L7OA 2B45X 4D7TA 2VO5A 1CAXB 4QDRA 1PIV3 3UGFA 5IVJA 1J3QA 3LWCA 5B4XA 5JCTA 4BB3A 3SH3A 4BK5A 4CRQA 5FZKA 1CZSA 3LF7A 4LKSA 2WWJA 3SCGA 1JU4A 1SDWA 1AHSA 1W6MA 1YQ6A 2VJXA 4YGDA 4Q29A 3UKNA 2E7TA 3OEAA 3WDTA 4MGYE 3PUAA 3I97A 4BLIA 4XFAA 3VKFC 4A3XA 1LHNA 4MLOA 2WYFA 4HFSA 1CX1A 1R092 1WMEA 5LRRA 4P14A 3THTA 2W68A 3DKQA 2ARXA 4M4PA 2HLEA 5FY0A 4AEMA 3T1MA 2P3JA 3MLKA 1T6GC 3V0BA 4R8HA 4LKEA 2VUCA 3E1F1 4BA6A 1C5HA 2HH9A 3OBTA 5FYVA 1IS3A 2QE3A 2VOKA 4ZS2A 5FJHA 1HRI2 2BGPA 1CAVA 5C9AA 1NA1C 2MNGA 1TQ5A 3LFIA 1S0EA 3VD3A 1W9YA 2HJIA 3MF9A 1G86A 4J25A 3VZOA 3ES1A 5ANQA 5SV8A 4CEYC 5ACA3 2VMDA 4HSLA 4MGIE 1VBC1 2J1EA 3X29B 3K51A 1ZZ6A 1MS8A 2ZGOA 4GH4A 2VBPA 3ZPOA 1VBB2 5FZFA 2UWCA 4Y1YA 4BQ4A 1UW8A 1FPN2 4Q8KA 1AR71 3ACIA 5DZEA 1VRH1 5CKNA 2GC2A 3RJ2X 5FZ8A 1QNWA 3ZIXA 2RS33 2D3RA 3VZNA 2FCUA 4YZ2A 5LA1A 4UI9L 2HWB1 5FZ0A 3WNPA 2D6PA 2BJSA 4MHUA 5FUNA 3VHNA 2QQWA 4Q8LA 5AVAA 4BE3A 4R9CA 2ZX3A 5FJKA 3V0AB 1W6PA 4W8JA 1FMD1 1COV2 3VDDB 2WT0A 3SNMA 2KD7A 3CJIB 1JU3A 2C9KA 1HV1A 2GP3A 4COZA 3CJXA 4UFMA 2JENA 5CKQA 3KZ4C 4OULA 4HVOA 2OIIA 2TUNA 5FO8B 1ENXA 1I9RA 1X8MA 1XE7A 3JD71 5DN2A 5GKAC 3POWA 3SCHA 2Q4SA 2ZZJA 4OMDA 5A3MA 2V4VA 3OF1A 1TZOA 4RHV1 1K9CA 1ZA7A 4HETA 1QQP3 1OURA 5AC91 4FFHA 5FYBA 1P8JA 2IUWA 4NIAA 3ZFGC 4AZZA 2WWUA 1QWRA 4JKMA 3E5QA 3WNXA 4LLOA 1KJLA 1DGWA 1R1A2 2ZA9A 4UFLA 1C28A 4LUKA 2CV6A 2RJKA 1R083 5FY5A 1PGL2 4JGYA 3BCWA 1Q8QA 1R091 2WNVC 4RS5C 5LWBA 5LK7B 1DHKB 5AVPA 2YHJA 3WHTA 1EUTA 3KT4A 3RMXA 1UIJA 3WNLA 3TB0A 3LOIA 5FYSA 4EWDA 4JAAA 4A44A 4AQ2A 3T3YA 3H1MA 3ZN4A 1W28A 4CCMA 4RYDA 4OFGA 4DOUA 2FDIA 4UW6A 1GR3A 4QPIC 4EWEA 4GWIA 1XNDA 1H1MA 2B9UA 2IFWA 4IEWA 1ZVFA 4R4XA 3P6BA 1XRUA 4WVMB 4O9EA 3WP3A 3ZKUA 5BNOB 2YU2A 2YUEA 5EPAA 2CNAA 2DURA 1OVSA 1DQ5A 3ZSJA 4OHWA 3WLUA 1F4HA 3MUY1 3PVEA 3V56A 4DMIA 1UU6A 1JHJA 3JQWA 1SDDB 4RGAA 5FBZA 1PZ9A 1VIWB 3AKTA 3K3OA 3KV5A 4Y22A 4K8RB 3VBFB 1Y9QA 2Y64A 4DY3A 2AENA 3HMYA 1M06G 2HWF1 3EBRA 4L11A 2B7YA 1CAWB 1H4GA 1XPWA 4CXWA 3OG2A 4NPLA 5CFCA 4F3JA 1LECA 3BTAA 5FREA 2NQYA 1D0HA 4QD2A 1DZQA 2PHRA 4XQ4A 5GZDA 1V9U2 1ULGA 1XXNA 1GP6A 2DYCA 4AFMA 1Q56A 2UY9A 1YIFA 2Y6JA 3KF5A 4Y5SA 4QGNA 2ZZQA 1QY4A 3CZUA 4GKXA 5LY1A 3KQRA 4JQTA 1PMHX 1MS0A 1XJAA 2O0OA 1OH3A 3HT1A 2BGOA 3J7LA 4JRLA 3QBQA 1PO23 2AYHA 4WM8C 4D69A 1DQ4A 1RMU3 4H7LA 3SH5A 3GZAA 4Z8BA 1JZ3A 4DZGA 1K5MC 1R1A1 2BBAA 3LEMA 4C0HA 4CYDA 3POJA 4B4RA 3VBOA 2B9VA 2WC2A 4BQ5A 1IHMA 1VP6A 1ULCA 3W20A 3ASIA 5JAXA 3AKRA 1IG3A 1QKQA 1X82A 3ACLA 3M8LA 4YW6A 4DINB 1Q8PA 1XC6A 4BQ2A 1O3QA 1UWWA 3L2HA 2WR9A 1SLLA 4E2SA 2XG3A 4E2QA 4PIYA 4CSWA 3BYWA 4D6SA 1L7LA 4U2AA 2ZGSA 3ST7A 4AFCA 1RINA 1UXZA 2ZMNA 1SG3A 1WCUA 3N35A 4MVTA 2EXJA 2JG8B 4QU1A 1HHNA 4HLTA 2VQ0A 4Y20B 2EICA 5HXVA 5C4WA 3I8TA 3U4SA 1W6OB 1HB3A 3ZKYA 4URAA 3AZWA 4LKDA 3AL5A 5FMOS 3MLJA 1C8NA 5G04L 4AAPA 1LOFA 3NNFA 3KQ4B 1U12A 2VZRA 1FT9A 2XLAA 3ZXFA 1EYBA 3ZYHA 1UOGA 3Q8FA 4IE5A 4AQ6A 3Q8CA 3WXPA 1REEA 4XURA 5DUXA 4IV1A 1BVVA 1IG0A 1QJU2 5J09A 1H1IA 3GHNA 2G9FA 2HWC2 3BOWA 2QQPA 3TEXA 3KV6A 1ULFA 4PLOA 4EJRA 1SPPB 4NVPA 4UW3A 4XJAA 3ZFEB 4CDQA 4AVSA 2P6CA 2JJ6A 4PIXA 3WNNA 3WG4A 1RUD2 1NLQA 2XJUA 4QQOA 1TMF2 2VVDA 1YNAA 5KC5A 3KHCA 3WZ1A 3BOPA 3IBMA 4RQPB 1WW7A 5GZCA 1V9U1 2WZEA 2XMLA 4QPWA 4PQ9A 1SACA 4IETA 4DRVA 4Q2FA 3S5QA 2HYXA 1FV2A 5A7OA 3WUDA 2RV9A 3O1RA 1JOPA 2YMZA 5IVBA 2X5IA 5EWSA 4HANA 4XAAA 2J1AA 4YVWA 1XYPA 1VAMA 2K46A 3NNLA 3BUCA 3PTRB 1UCXA 4QXCA 4RR3A 4MHRA 2A75A 3AYCA 5A6YA 1GQPA 1JZ4A 1C1FA 3SHRA 3ZYFA 4FTBA 2VCCA 2CWMA 5H9RA 3C3VA 3TAYA 3RI9A 3ZSMA 3P1IA 1JZ7A 1WMDA 1LKNA 5GLUA 5JOXA 3ZSKA 4H2AA 5F39A 1I6XA 1C57A 5J36A 1GLHA 2P3IA 2RR13 3AYAA 4QAWA 4CCJA 1IS5A 5JOZA 4MV2A 2RVAA 4XTMA 2A1XA 2D7FA 4XFCA 3FN9A 1U5IA 4PI2A 4FAHA 4LITA 5HCFA 5DDJ2 5HCHA 1ZBA2 5FCCA 2XJTA 4HKOA 4XUPA 1O59A 1RVF3 3OPTA 4RS5B 1U5YA 4M00A 3WDVA 1CPNA 4OUMA 1AXKA 2XVLA 1AVBA 1ZREA 2O1QA 4D6RA 1AXYA 2WS93 4YW2A 3H3LA 5FZAA 3WG3A 3U0ZA 5L7OC 1ULEA 1UYXA 2E63A 1PVC2 4DB5A 1QOTA 2W47A 3TEWA 3ATGA 4ISRA 2HWC1 5FWEA 3WQ7A 5IK7A 2EAAA 4XHXA 3MF6A 2WT2A 3OUHA 1N3QA 1NE6A 2PHFA 1ZYBA 1OI6A 5I8YA 2EALA 4DXZA 4XXPA 3RMYA 1OLQA 2WDBA 2QQMA 4UFKA 2GALA 3J4UH 5DAXA 3WW2A 4CCDA 1GQGA 1PNGA 2W95A 3W5NA 1RUD1 1RUG1 1S0JA 1ZRIA 4ONUA 1CVNA 1TMF1 4C0BA 4JDNA 5IVEA 1ZBE1 2D97A 4UYBA 4OUSA 5F5CA 2W1WA 4HN1A 3U4XA 2EAKA 3HQXA 1UX6A 2ZHMA 5CZKA 1STMA 4AGVA 2VMFA 5C3PA 3GBWA 1Z0HA 3JU9A 5FUIA 1F5FA 2R072 1DGLA 4FFIA 4LOSA 3ZXKA 3RFRA 2QVSB 1DQ2A 1J1LA 1OLMA 2BV4A 1U0AA 2XJVA 3PMEA 3H8XA 3CDZB 4B1LA 1S2KA 4XTPA 1BEV1 3VBUA 4A6OA 4HMZA 1O8SA 3KHBA 3AP7A 5BUVA 1ULOA 4GH4C 3OD0A 4AR2A 5KHIA 1CN1A 2NN8A 5FYUA 5FXXA 4NMIA 3CHXA 4HG6B 4CPBA 3I3BA 1GNHA 5C8CA 4C1XA 1W3VA 4QX1A 5F9TA 1SFNA 1AR73 5C3SA 4KGGA 3JBG2 1VRH3 2ZGUA 3AZZA 3V64A 1J3PA 3AXDA 4WM8B 4CU9A 5JR7B 4QB1A 2FDKA 1IPJA 3CEWA 3I4IA 3ZSEA 1SBDA 5FZOA 4XETA 1K5MB 2CY6A 1V6IA 5DDJ1 2VC9A 4B7EA 1SCRA 1ZBA1 2W0XA 5EHDA 4CUBA 1FMD3 3IDBB 1G9CA 2XJRA 2QQVA 2C6SA 3I2GA 3OGRA 4CEWB 1OQ1A 1ULDA 5DG2A 5FYTA 3MZHA 3EXUA 4TYSA 4I01A 5BY5A 1IKQA 2WAOA 4NR1A 2VNGA 1PVC1 3JB4C 4LBMA 4FPGA 4AHXA 4BK4A 3HAGA 4PCRA 4CU8A 4UOJA 4CVUA 5FR3A 3D0JA 4OI1A 4RA0A 3E5UA 3S6PA 3UGGA 4QPGA 1DQ1A 2WA3A 3KCXA 3SKJE 2VQAA 4EWAA 5IATA 3S30A 4MG2A 2IXKA 1IPKA 2NM1A 1YI9A 2CL2A 4W4ZA 5CFDC 1SBEA 4Y1XA 1O91A 2GH8A 3BU7A 3H0OA 3RQ0A 1GSLA 3CKHA 2O14A 4JGYC 5E88A 1JZ6A 4D7YA 1OOPA 4KL1A 2XVKA 5A7NA 4UW4A 4ES9A 1JYIA 1R093 1V0AA 1GP4A 3WDXA 4RN5A 1K3IA 3VBHA 3MO4A 5L73A 4OQ8A 5BV6A 1TE1B 2GN3A 2I2SA 4XFBA 2YFUA 2YC2A 3AP9A 3ILNA 5ACA1 3O1SA 2DVBA 3I3QA 4BXFA 2VQUA 2BWCA 4NIDA 4YM0A 5LA0A 4N9IA 4NRPA 5A70A 2YC4A 4CP1A 1N47A 1JBCA 3FHAA 3DXTA 3W5MA 4ZPIA 2KM2A 3KLSA 1DZRA 1ZZ8A 1W9FA 2RS31 3MGUA 2WRAA 4LK7A 4QB2A 1VBB3 4J1WA 3ZFFB 1FPN3 1CJDA 2NPIA 2Y0OA 4M3CF 4META 3JBG1 1KRIA 5JMCA 1LHUA 5F6KA 5GLWA 4IESA 4G9SB 4QM9A 4FPKA 4CP2A 3GM8A 4QXHA 5FLJA 1GZTA 1LHVA 5FKCA 3H8OA 1ND3B 2VY0A 4LBQD 4LIUA 4DY5A 2QJVA 1CWPA 5FRAA 3T09A 1BMV2 3CZJA 5FUPA 3FBYA 3H3UA 3O1VA 3KV9A 1K12A 3HQRA 5L9RA 1V70A 3SQOA 5A7WA 4EN0A 1J58A 2FMYA 3H42B 3SXWA 4RGKA 4DXRA 1QQP1 3O0WA 3OB8A 5FZ3A 3WNOA 2VMGA 3L9JT 1PK6A 3WP6A 4A41A 3ABZA 1MVQA 3RS6A 4CP9B 2VULA 3VZKA 3U14A 2AC1A 3USUA 2LRPA 3BI3A 4AK3A 1GOFA 2V72A 1BBT2 2NMOA 3B69A 2BWAA 3NRUA 5JXGA 1QJX2 4ORFA 3PUSA 1G9AA 4HK8A 1R1A3 3VBOC 4RGGA 3N7KA 2XOMA 2SLIA 1H2NA 1O7FA 1NLRA 2ZCWA 3LEIA 4FQ4A 4B7KA 1NCRA 2JKXA 2WAAA 2BRTA 5FWJA 1HW5A 1YJLA 5APAA 4YW7A 2XKPA 3CL1A 5A7PA 3LCPA 1UZVA 1TME1 2OYZA 5EYYA 4K1YA 3UKTA 5SV5A 3BTYA 1AX1A 1N3PA 3QACA 3VGIA 5CKMA 1APNA 1O6UA 5C4WC 1NG0A 2ZBJA 2BW8A 2CDOA 5LCWL 5LEKA 1HIXA 1W8TA 1YFYA 3PVNA 4WM7C 5FPZA 1XSRA 2WO3A 4LPLA 4X8NA 5FLIA 1VBA2 2DFCA 4ATFA 4Y33A 3GJAA 4QHBA 3SEEA 1AX2A 1CAUB 4I02A 5JPMB 3KCYA 2FQPA 3WW3A 4IV1C 2QQUA 2FDFA 4HKLA 4ZXKA 4XJUA 4TZDA 1WKYA 1XE0A 2HBUA 1MACA 5T5PA 4CCEA 5I91A 4K6BA 1FXZA 4FFFA 3Q8BA 1WCKA 2Y0IA 4KI5M 5D8AB 2MPFA 4AXOA 4GQ7A 4CDQC 1GWKA 4LQRA 3WDYA 3WP4A 3D8CA 3KT1A 3QLQA 3AZYA 3C7OA 3N9OA 3WSOA 1GFF2 1BMV1 3CU7A 3T1LA 2ID4A 4IDZA 4L92A 4UBGA 1GZWA 5FY4A 1T2XA 3PUHA 1W6QA 1AYN2 4GIQA 5GJ6A 1KXGA 2QQKA 4IUGA 3HPNA 4CXYA 1A34A 2Q8OA 1V9U3 1ENSA 3ROUA 2JG9A 3U1XA 1HJGA 2KA3A 3THDA 3M4FA 4MYEA 1RXFA 1JZ5A 1Q3EA 1RMU1 2NZ9A 3LQCA 4WVZA 4X6QB 1LB2A 2X5IC 1DZTA 4YVWC 3SMHA 4DEVA 5F6LB 3VUOA 2E32A 5DABA 1QH6A 2XBO2 1QJX1 3K75B 3L2YA 3POBA 4XDQA 4DFSA 2ARCA 4RR3C 4P9XA 4BQYA 1R64A 1OBNA 4A42A 4GZ9A 1NQDA 5A3UA 1ZZCA 5FP7A 1D2SA 4AQSA 1O3TA 5FZMA 2JIGA 3J8F1 1LEDA 2E7QA 5CFDB 2ZGQA 4NHMA 2XLGA 5KWRA 4QU2A 1TNFA 4JTOA 4TSVA 2C26A 3ZYPA 1F4AA 1ENRA 2WA4A 3MW3A 2P37A 3TWIA 1E57A 1X33A 3AMHA 1QEXA 1WCQA 4LHKA 3IMNA 4OI0A 3VKLA 2ZEXA 3QCWA 4IEQA 3HD8B 5JZGC 4O7XA 1B35A 4ZU4A 4JDOA 1JOBA 2ZGKA 3NJVA 4LXLA 1YCIA 5FFOC 1UOFA 3PURA 3ZVXA 5IWFA 2DU0A 3ILFA 1MQTA 3WQ0A 1UQXA 4FXKB 1ZRRA 1GWLA 1W8FA 2B42B 2X10A 4LO5B 1AR82 2HWC3 4SLIA 2ATFA 2R042 3SH4A 3LDBA 1UIKA 3JZVA 2V5DA 3U07A 2RS52 2JE7A 5F7UA 1WUVA 4QXBA 3A0NA 2JIJA 4XUOA 5KHHA 3H8RA 2WL1A 1E5RA 5FZ1A 2D44A 2OW4A 3LAGA 1RUD3 1RUG3 1AYN1 3WY6A 2WSVA 5M0TA 1TMF3 4GJYA 2PMWB 2Z79A 1GZCA 1DU3D 5FXWA 1J3RA 2YXSA 4TN7A 3UL2A 2D5HA 2VZ1A 5GLTA 2RJ2A 4BU2A 4EZHA 5I0SA 2H6CA 2ZAAA 4NHXA 1FNZA 1UZZA 4YW1A 3HN3A 2K0GA 2XR4A 1JYWA 2QFEA 1WA4A 2PQSA 2ZGNA 4NAOA 4WBBA 2RDRA 3DPRA 1OA3A 2VU9A 3H50A 1V6JA 5JXHA 1ODNA 1RHI1 3VBSC 4IEYA 2R49A 4ES8A 5FMDA 2D5FA 2XKOA 1UZYA 1LU1A 4RD7A 2DVAA 1V6MA 2ZEWA 4Q27A 2HWD2 1XYOA 5E89A 4LBLA 5IVFA 2R7EB 4LHNA 4YW5A 2JDAA 2JD4A 2PN5A 5FYMA 5FV3A 2W2IA 5C3QA 3I3EA 2DU1A 1PX3A 4CZSA 3M70A 4MXWA 5DDJ3 1K45A 1UY2A 1ZBA3 4I09A 1E5HA 5E1RA 5JLVA 4IEOA 1JUIA 3U11A 4Q4V1 3PVBB 2YROA 3C8XA 5DPNA 3TN92 3ZLIA 1UXXX 5B4NA 2LM3A 2DCJA 4L8QA 4J6GA 1TNRA 1PVC3 2PHTA 3TNPB 3MLLA 3NV1A 1AR81 1RUF2 3IAQA 2ZGPA 1DYOA 3U37A 2D43A 4JGZC 1HJFA 2TBVA 4WM7B 1D4M2 1LOGA 2RS51 1PZ7A 2J1TA 1RJ7A 2P1BA 4GMP1 1LULA 4NRQA 2WN3A 3FHIB 4UFIA 4ASKA 4CDWA 2VOVA 5EFUA 5CBLA 1OOPC 2IVIB 4LNVA 2VD7A 4IV1B 3BTZA 1Y9GA 2VMCA 4OYUA 2RMU2 4PI0A 2R062 3VLBB 5I0UA 3VDCA 2AGSA 3WW4A 4IE7A 3VBHC 3MIEA 2FDJA 2LALA 3DECA 5IYYA 4IE4A 4YW4A 4UWDA 3RZKA 5A3PA 3ZOIA 2R073 3DKWA 1AR92 1WLTA 1O4YA 4AW7A 3EB7A 2VG9A 3N7MA 4CCNA 5A3WA 3M2MA 4UT5A 4Q4X2 1UN1A 4DEQA 4QX7A 5CU1A 4BM8A 4YVSA 5FZ7A 2WQ8A 5LA9A 2RDNA 3M3OA 3NNGA 1KFXL 3WHUA 4DS0A 3SISA 1AUYA 2I45A 4P9WA 2AACA 1SEFA 4PBPA 1FX5A 2HWD1 2RG4A 1OH4A 1MZ6A 5FPUA 4YVWB 4HL0A 1RUJ2 4YZ3A 3JBG3 3BPZA 5FMCA 3KM5A 3PUIA 2QKDA 5FZEA 3VKNA 4CA9A 1QHDA 5FXVA 1ASJ2 4RR3B 4QX5A 2DUPA 5CEHA 1GOGA 5IVCA 4FPOB 1IS4A 3J7HA 2LS6A 1SQ4A 2DCTA 2JEMA 2OUJA 3DV8A 3POGA 2VQTA 4DXSA 1F9KA 5GALA 3QOPA 1H2LA 1VBE2 3JQXA 4KU7A 2N7GA 1UU5A 2PAKA 2Y6HA 2B4KA 1WBFA 2ZEYA 4BQ3A 1VMJA 1FNYA 2RDSA 3DYMA 4AE2A 3R4UA 1CZTA 4PDWA 3WR0A 2E53A 5BNNA 1LOEA 4UW5A 5F5QA 2FCVA 1UL9A 4AHYA 1I5PA 1D4M1 5T5LA 3WF1A 3AM2A 5IT6A 1GUIA 3GCWA 3LEGA 4QMAA 4QWNA 4AVVA 4NPRA 4AVCA 4FT8A 2CDPA 5JZGB 2RMU1 3BB6A 2R061 3D5OA 3P3PA 2D6KA 1NCRC 3OGSA 4GA9A 5DAVA 4E9KA 1ZX5A 1UYPA 2YG0A 4N7IA 5FZIA 2DCKA 4Z1VA 1GYKA 1HRI1 1HX6A 2ZGTA 3KWVA 1TME3 1W99A 2JB8A 1US2A 3NW4A 4Q4W2 3I2OA 3GZUC 1VE0A 3N3HA 2DVDA 1YQCA 2VAUA 1BVP1 4H55A 2O8QA 3PMSA 5CG9A 2VNRA 1QJY2 1VBB1 3DUIA 1WD3A 3O0VA 1BLZA 1FPN1 2VOWA 2AEYA 5C3RA 3IM0A 2LROA 1EAH2 4PLMA 3OYWB 4YFZA 3MIDA 2XDVA 2VMHA 1ND2C 1LOCA 5H9PA 5FTTC 1H8TA 5FOJB 4MO3M 1COV1 5CADA 2IFRA 5K0UA 4XFFA 3GCXA 1ASJ1 1QGLA 2UURA 3HBKA 1PNFA 1DP0A 5JPNB 3VBSB 4FAGA 2W91A 1PO12 3I59B 5F3IA 4RSUA 3WF2A 2D3SA 2ES3A 2PHXA 2X09A 3GBFA 1VBE1 4BYYA 1W9SA 1HQWA 4Q1PA 3ZN6A 4Q1RA 1HN1A 1D4VB 5ABJB 4XEZA 1ENQA 4G3YC 2W87A 2A71A 4CDUB 1PM4A 2Z5WA 4IV3A 1E5IA 4LHSA 5I0RA 3OBRA 2WO2A 1UYYA 2H0BA 4XBNA 4ZU7A 1XNBA 1IGOA 1PGL1 2W5FA 4I0WB 4O65A 4YGEA 4Y26A 4MH0E 5FP3A 1FAYA 1QJX3 3IPVA 4N53B 5E16A 4XMIA 4LE4A 2BOIA 2A6YA 4XXAA 2YV8A 2YY1A 2EXHA 1A3KA 1LHOA 1LHWA 2VE1A 1KD7A 4KBBA 5CNAA 1UY0A 3ILRA 4K8FA 2WZPP 4M4RA 2W46A 4XC9A 1OT5A 4EN6B 1ZRCA 4I3GA 5KHKA 1J1TA 5FYHA 4EYUA 1NT0A 3AMPA 4JGZB 1EUUA 3S7IA 1JYNA 1S0IA 3J8F3 3A23A 2GSYA 3KMHA 2A6XA 2C24A 3VZLA 2J1VA 1HN0A 3HWJA 1YFXA 3NAPC 4LBQA 1OOPB 3B94A 5F8PA 2EA7A 2VL4A 5F2SA 5JR2A 3FZ3A 3BIEA 1HB2A 1XNKA 1W6NA 3AJYA 5FYCA 2JDMA 3VBHB 1WCSA 3NWKA 1PZ8A 3B00A 4XCBA 1KFUL 1B35C 2YC0A 3OY8A 1EAH1 3C7HA 3LGRA 1NA1B 2R0FA 3VBRA 2BVVA 2RS12 4QKDA 1UPIA 4Z2WA 5FO7B 1CAXA 3VD4A 4CEYB 4AI9A 1RGSA 1HDKA 1A8DA 4Q5OA 3NKGA 5A3LA 4P00B 2HBTA 1QXPA 3LPFA 1GBGA 4XUNA 2PHUA 2L9LA 2X53S 3AC0A 4LK6A 4QQLA 3MFAA 1PO11 5AFBA 1JODA 3LFMA 1YJKA 4HPKB 4CUGA 5J3UA 2XWJB 5T5JA 5LBCA 1YUDA 5DG1A 4CUAA 1AYN3 3MHZA 1NKGA 3MPBA 2WO1A 2GH2A 1MS3A 1AXZA 3LD8A 4D3WA 3AP4A 5DXDA 4OZOA 3D82A 3V65A 4KQ7A 3MI8A 3POEA 5HI0A 2Y6GA 3O1PA 2VNOA 4B29A 4PF1A 1NE4A 3WNMA 1US3A 1BK0A 1BZWA 3B3QE 1RJ8A 3DPRC 2CGPA 4R9DA 5H9SA 1W8ZA 5CB7A 1Z78A 3B02A 3PU8A 1AYM2 3WNKA 4OHYA 1HRV2 3M1HA 1RHI3 2JECA 1WBLA 4DIQA 2OQ6A 1JI6A 5KXBA 3RDIA 1CR7A 3ZFGB 3IB3A 1QDOA 3BPSA 4F7ZA 1LENA 2CU5A 1C1LA 4QGMA 5JUVA 1YHFA 2AEZA 3FHQA 1W90A 3FUQA 2WNVB 4GMP0 4XPVA 3VDDA 1AX0A 3VDBA 1WA6X 4R4ZA 3AP5A 3CJIA 3I2DA 3M7AA 3SITA 5HPOA 2W1UA 1NCRB 4XZPA 2DVFA 2Z42A 3NL1A 3FUOA 3LZZA 2W3JA 3N9PA 1CQ9A 5LA2A 1W2NA 2G4IA 3AXEA 2GU9A 4CCKA 1OVPA 2VZTA 3H1WA 4Q4V3 4NIGA 2YU1A 1QJU1 3J7NA 1H9PA 3LE0A 4QPIB 2RS11 4AHWA 4TLGA 5JI9A 5JIUA 4XQDA 2JE9A 4OLLA 2D3PA 4Q0PA 1Z7S2 4NROA 3WW1A 2BTVC 3S5AA 1AR83 3PIJA 5T50A 1C8M2 1SMVA 2Q0AA 2EF6A 2J1SA 5A1AA 2RS53 4KG8A 2VCMA 4V1PA 5FO9B 2XHNA 4GMP3 2P3YA 4NUBA 5F5IA 1BYHA 4BIFA 1ONAA 5DQ0A 3WG1A 5KXCA 4CE8A 2WQZC 4QX8A 5K4LA 5KR7A 2DCZA 1S55A 4FQZA 4XOGA 4BDVB 4LO8A 4KMQA 1ND2B 5C9AC 3HBZA 3G6JB 3OPZA 3VZJA 4YM3A 1VBD2 1F35A 3R05A 4F83A 3SKVA 2FDHA 1Y7BA 4A2UA 3H7JA 4WVMA 3VZMA 4YVSC 5BNOA 2DVGA 3N9LA 1RC6A 3UESA 2CGOA 3R0RA 2LW8A 5F1RA 3GZEA 5J1XA 1YQ5A 5IK4A 2QZ3A 2VTXJ 1W9TA 1AYM1 2JDNA 1YXWA 2BFUS 2EIDA 4O61A 3MIFA 4CTEA 4OHZA 2DCYA 3VHRA 5BNPA 3ENRA 2GC1A 2UU8A 2BOJA 2HWD3 2BVBA 1ZM1A 4X8PA 1JXNA 3PDQA 2E33A 1H2KA 3RZJA 1JMUB 1CAWA 1OUXA 4GALA 1W05A 2A6ZA 4Y1VA 4UF0B 5FZLA 3I2HA 3VD9A 2Q8DA 2QQIA 1FATA 1Q8SA 2OX0A 2VXJA 4AGRA 1QNYA 2PAMA 4JZRA 3AKSA 2VVFA 5LBEA 5C70A 2FDGA 1Q5OA 1WW5A 2GNDA 1HLCA 4W6WA 4Z07A 2XPJA 4AI3A 1D0GA 1UZWA 1SLCA 2YFZA 3F95A 4IERA 5A6QA 1G9DA 4PDWC 4B4PA 3NAPB 2D6NA 4UFHA 3MDPA 3TEYA 3T0DA 4XVHA 4HONA 3RYPA 3T30A 4BH9A 1W39A 5FKBA 5FP8A 1LOBA 3AVSA 4E8CA 1O5UA 1D4M3 4ISQA 1B35B 4Z2AA 4OI2A 1GOHA 2A3WA 4YM1A 2ZHLA 2RMU3 3C2UA 2R063 4XACA 5I93A 4HXCA 1XYNA 4LORA 2R071 4EZ4A 2WT1A 3RG0A 1NCQA 4AYUA 1BQPA 5LEJA 1EPWA 1S2EA 4D6QA 4D8MA 2ETEA 4E27A 2AR6A 4NHYA 5FYZA 1HRI3 2YB7A 4GWNA 1N1SA 1VBD1 4MSVA 5HV4A 1R082 2ZS6B 2CHHA 4ZONA 3AMQA 1NYWA 1OMIA 1X9PA 2JG8A 2VZOA 4Y20A 5H9QA 3VHOA 3IKWA 2BPA2 1AR93 2VR4A 3LIHA 1OLME 3IIAA 5IVYA 1TEIA 2BERA 4AVBA 4Q4X3 4YM2A 5FZHA 3B01A 1IQDC 4KWKA 2R6QA 2VZVA 5B2GB 2XH6A 4HK9A 4K9SA 4MX3A 2Z69A 3N9MA 5C8WA 3AK0A 3ITQA 2WFF2 3ECQA 1ZA4A 4JX0A 5EV7A 4E4ZA 1JTZX 5A6ZA 1H8TC 4MZUA 3B5LB 4AWDA 4LBOA 1SPPA 4I3PA 5K0UC 3FBMA 3QH6A 1X9TA 3DPRB 3AJZA 4LHLA 3MPPG 4YRDA 3ZFEA 1QIQA 5CFCC 1COV3 3ZXLA 1ASJ3 3H7YA 5GLZA 2A3YA 5L9BA 3ACGA 2FHRA 2WNOA 5HBAA 2Y6KA 5A33B 1DYPA 1NUKA 1MEC2 2OZJA 1VRBA 4JKKA 1U5ZA 4RQPA 4Y24A 3T08A 3LOBA 1VBE3 1W06A 1VAVA 1DBNA 1SBFA 3WF0A 3IWZA 3JXSA 5FIXA 4UFJA 1ODMA 5FPAA 4A7ZA 4ZKTB 4GXLA 4IE6A 4IV3C 1JZ2A 1QF3A 3SC7X 5IK5A 2E51A 3KVBA 4B8EA 3IDEA 1UO9A 1MS4A 2WYSA 4S2FA 4EQVA 5KHGA 2VZ3A 2A6WA 1H6XA 4W6XA 4KWJA 5K9YA 5ANNA 1N1TA 1MZ5A 1X8EA 5CIRA 1SLTA 2DF7A 4GD4A 5FQ0B 2IXIA 5FBJA 4PQQA 5IHRA 5L7OB 4FPCA 4XAEA
chains in the Genus database with same CATH topology
4YZ1A 1A6CA 4XBQA 2VUAA 2VW0A 4MGKE 1W6MB 2ZABA 3ZXDA 4RFT0 2CAVA 4AGGA 1XNCA 3RYRA 2MEV2 1WW6A 3KSCA 3ALQA 2P34A 1BK1A 3E5XA 4Q0QA 2FMDA 1LOFC 4AG4A 2B39A 2GNTA 4RS5A 1YIPA 2NMNA 4TWTA 3V0BB 3FLRA 2ZX4A 1QJY3 3GHMA 5FLHA 1CAVB 5C9AB 4M01A 1F31A 1BCXA 1PHMA 3LSEA 1W0OA 4R9BA 1EAH3 3MFCA 2WFF1 5CA6A 4BCUA 2D6LX 2UWBA 1RUC2 4GH4B 1VAKA 3NJZA 1LODA 4ITCA 4HSJA 2NYYA 2R16A 4BHPA 1VB4A 3P3NA 2C9AA 4I0BA 4FXGB 4N43A 4YZ5A 1PO13 4FBFA 4PLNA 1MEC1 2WLQA 3BALA 4QXKA 4ASMB 4K1ZA 4FCAA 1A8MA 3AFGA 1W6PB 4FPLA 3PHMA 5KXDA 2XJPA 3ZMNA 3WCRA 2HYKA 2ZAHA 2HEWF 4LA2A 4EN7B 2GC3A 2BNNA 1BBT1 4LO4B 5DZGA 3R4SA 1O5LA 2QZ2A 1N1VA 1JN2P 4BQ1A 4L97A 1S0CA 4XFHA 3W9AA 1V00A 2SBAA 1LOAA 3FFZA 3ETQA 3R4DB 2P3KA 4H7MA 4YYOA 4WZFA 4YGCA 3E6DA 2PHLA 4XILA 2MEV1 4ZU5A 1OPMA 4WM8A 3LKJA 4FOQA 2BUKA 4OZXA 1WLWA 1RUOA 3UK9A 4JGYB 2CAUA 1JHNA 4NO4A 1HXS2 3VDDC 1SLAA 3CJIC 4JV4A 2JKBA 1VBA1 3ELNA 1AL0G 2GAUA 4AFAA 4Y4YA 4CEWA 5L19A 2XJQA 1LCLA 2EXIA 1QJU3 2IXLA 4QM8A 1C4RA 2RS13 4BMBA 2TEPA 4LT5A 1KDKA 3AX4A 1RUC1 1DLLA 1DF0A 2MHFA 2WS92 1LGNA 4HVRA 1H30A 4Y22B 1C5IA 4U36A 3APBA 5T52A 3PJYA 1RUI2 2XL7A 1H8TB 2WJSA 2KXLA 1I3HA 4IXLA 2HWE2 3PLQA 5K0UB 1YWKA 3ZDSA 1SFYA 5CFCB 3O14A 5EYXA 3VBUC 1RTVA 2VVEA 2WQ4A 2XBO1 1DFQA 1GNZA 4GKYA 4CDXA 5BNOC 3ME2A 1G7YA 5DUUA 3B9CA 5FOBB 5DUWA 2CTVA 4AEDA 5C8CC 4AI8A 4F8AA 5GZFA 4PBOA 5BNPC 4H3WA 2OPKA 3ZFFA 1AYM3 2XL9A 1RUE2 4XF0A 2EIGA 2DWRA 4XF1A 5DZFA 2WWSA 1LRHA 2PYTA 2FZ2A 3O12A 4K20A 1VBC2 3VBOB 5FAXA 1ND3A 3RI8A 3CF6E 1GV9A 1LGBA 1WGPA 2ZGLA 2UY8A 1AR62 1V6OA 2RE9A 2Y26A 5BXXA 2R1BA 3TNQA 2F4PA 2AREA 2JDZA 1VLNA 4JVAA 2HWB2 4IEXA 3D0SA 4IEUA 4K7JA 5C4WB 4QPGC 5D1IA 4LULA 1UKGA 3AZVA 4S2HA 2R041 4W65A 4BLJA 2PHWA 2YYOA 4FPEA 5BYNA 4AVAA 1VR3A 4H14A 3HN1A 3GNEA 1I1EA 1W6NB 2OVUA 4LO6B 2Y38A 4XYXA 1DGWX 4ATEA 3JD72 3I54A 4QQHA 4YG6A 1RITA 2VW1A 1XE8A 4EROA 4RHV2 3H3ZA 1QU0A 2D93A 4HN0A 1RUI1 2GNBA 4G4FA 1NCQC 5T3NA 5AC92 1ZZ9A 4CDQB 4MXVA 2HWE1 2PLV2 3UKVA 2ET1A 4K21A 2RJLA 2JG8C 3JUUA 2BFUL 4JTNA 1VBD3 4XE9A 1PGSA 1X50A 2XJSA 1LU2A 2CGNA 3AKPA 2UYBA 4QGLA 4COYA 2PHDA 1V6KA 1IZ3A 3VL8A 1MZFA 1G8WA 1VJ2A 3GF6A 1CAUA 2QNKA 1MS5A 2YZ4A 2X5IB 5I8SA 3FLTA 1DYKA 1R1ZA 3ZYGA 1RUE1 4K3UA 4O9GA 4K40A 4OHVA 4KH9A 1UPSA 3ZFEC 4JDMA 5D8AA 4YG3A 4RL7A 1EV12 1QH7A 3NKTA 4YG0A 1Y3TA 1S1AA 1AR61 4KU8A 5J96B 1OA2A 1Q43A 1REFA 2NLRA 3AYEA 1QOOA 4RQPC 3TN91 4AI0A 2WSUA 4PJYA 4E4DX 1IOAA 1EY2A 1PK6C 3NO8A 3WINE 2HWF2 4LO7A 3LA7A 3M3IA 2A70A 1GANA 1YFUA 3MEPA 1RUF1 4NN0A 4LLFA 1AF9A 4QQPA 4DPNA 4M3CA 5K7PA 4NWWA 5I8TA 2CWSA 3VHPA 4IL7A 4P5HA 3FJSA 1OSGA 1YLLA 3WP5A 3EO6A 4D7SA 3AZXA 4HZFA 5JVVA 4MGZE 1DDLA 4AEKA 2JICA 3J26N 1PM7A 3A0KA 1Q8OA 2UWAA 2PLV1 2R1DA 3E6BA 3FLPA 1AR91 1FOD2 2ZHKA 3TOJA 1NXD1 4L99A 5CFDA 2YGMA 4XJWA 1QMJA 3EQEA 3JB8A 4LBKA 4Q4X1 2GNMA 1YO8A 1IKPA 3ZO0B 4E4SA 4QT6A 3FWEA 3LSDA 2DUOA 1F8VA 3WX5A 2HKXA 3I7DA 2WZR2 5TSWA 3LA3A 3W59A 1M4WA 3NSTA 1NY72 1GKBA 4KNCA 3TRSB 1POV1 2P17A 3VKMA 3QD6A 4A7KA 2FZ1A 3AFKA 3VBUB 2OA2A 1RUJ1 4Q26A 2C5DA 4WVVA 2D40A 2WFF3 3ZYJB 5KC6A 1NXMA 4FP3A 3DL3A 5LK5A 4HBNA 2WKKA 1KDMA 1EV11 4EN8B 4KWLA 4JRAA 5GM0A 5C8CB 2E7AA 2I07B 4N43C 4GWMA 5BNPB 2WIIB 3B93A 5A32A 3WDUA 2JG9C 2XB6C 3KS7A 4IEPA 4GB32 1DQ0A 4BPZA 1MEC3 1AL22 1FYUA 1OLRA 4WZCA 5HCAA 4OVEA 3LA2A 3ZN5A 4DNYA 1LTEA 1G9FA 1H1AA 2YDEA 1H9WA 4LBJA 1BBT3 2XLFA 1RL3A 2XGXA 1CESA 2LUWA 4S2GA 4YLZA 2ZGRA 5FPXA 4M3CE 3VN4A 2GMEA 1RUH2 3WQ1A 2ZX2A 2ZGMA 4QPGB 4C91A 1MS9A 3RZZA 2R30A 3THPA 4QPYA 4OI4A 1V6LA 5T55A 4AFBA 2AUYA 5EZWA 2ILMA 2B46X 1FOD1 4Q4W1 2MEV3 1LGCA 5K8SA 4L2NA 4WV8A 1NOVA 2F6BA 4IEZA 2WNUA 2W08A 3R6SA 1QJY1 4YW3A 1KITA 4EV0A 2Q5TA 3MYXA 3U10A 2ZMLA 1VBA3 3WT3A 2VW2A 2WZR1 4CEWC 1NCQB 1PVXA 1N3OA 1NY71 2WNEA 5CAZA 1MQTC 4P9JA 1S0GA 2WINB 1PGW2 5AFEA 3SLIA 2EXKA 2GDFA 1GQHA 1LJ7A 4XIOA 1UAIA 1Q8VA 4LA3A 1N1YA 3A4UA 2JX9A 3N7JA 3S0MA 4WM7A 3ZPYA 5JI7A 1OFNA 1JUHA 3RNSA 1RUC3 4BIOA 1YI7A 3Q9OA 2ZTNA 4I0AA 1CPMA 4PIZA 4Y1ZA 3UV9A 2XHKA 1CJPA 4GB31 2H0VA 1AL21 4DQAA 4YSFA 5GZGA 2RHPA 2D6OX 2BGCA 5GLVA 4YNIA 2ZHNA 3D6EA 1JOJA 4CDXC 2A73B 1RUG2 1SLIA 2XBO3 3PNAA 4FO9A 1I5ZA 1ZBE2 3KT7A 4M0HA 1S0DA 4C1WA 4DRRA 4AEDC 1PK6B 2P2KA 4Q4Y2 1MR5A 1RUH1 4XFIA 5FDBA 3ZFFC 4JCKA 3LB9A 1MZEA 2VUJA 3RYKA 3USUB 1X7NA 2XVGA 3ZYIB 1S0FA 3AKQA 3N7LA 4S2DA 1CGPA 3D4KA 4FVVA 1QXRA 1BEV2 1ZRFA 5C33A 3V0AA 1ND3C 2RM22 4FPFA 3NV4A 2QCSB 1HXS3 3POSA 3CO2A 2C0ZA 1NZCA 4J1XA 5JIAA 4YZ4A 2V09A 1WW4A 3O7OA 1VALA 3E97A 1PMIA 3S7EA 1B09A 3ZMOA 3MW2A 1WLDA 1PGW1 4FTSA 5T5OA 2XUMA 3N36A 3NVCA 2IXHA 2FBEA 3OCPA 2R043 5GZEA 4CDWC 1ALYA 3KD4A 1QOSA 3ZIWA 2VMIA 1ZRDA 3B7MA 1PIV2 2NP0A 4URTA 1YFWA 4SBVA 4FAHA 3G7DA 1H8VA 4I30A 2ZKNA 5JZGA 2ZX0A 2V73A 3RPQA 5JDBA 4COWA 3DF0A 4FTEA 1RUI3 2QDNA 1DGRA 1CONA 5BPXA 2HWE3 3GBGA 4P9YA 1LESA 4R52A 1GZWB 3NV3A 1W6QB 3OGJA 1AZDA 4M0NA 1DG6A 3EHKA 2R32A 3HR9A 2HEVF 4N43B 1GICA 5JSPA 1BKZA 5JSRA 1DGRN 2JG9B 4NOTA 4Q4Y1 1HRV1 2DTWA 2E9QA 4BWOA 1XU2A 3WCSA 4GULA 2GN7A 3VBFA 2DFBA 2DV9A 4P9LA 3BIWE 3FX3A 5ACA2 3OYWA 5J98B 5EXOA 3URFA 2K9ZA 2XWBB 1HKDA 4CP0A 2Q30A 4XF4A 1RUE3 3M3EA 5D8AC 3USSA 4AI2A 1WMFA 2YGLA 2WLPA 2BNMA 4FPJA 2RM21 1NQJA 1OQDA 1VBC3 3VBSA 2RS32 2G9GA 3N4MA 3MIGA 3GZTB 3AMNA 3I59A 4LEJA 3ZXEA 1AR63 1OQEA 1KQRA 1GZ9A 1OKQA 2IWGB 4JQRA 4Q0UA 4QQ2A 5KHJA 1S0BA 4XJ8A 3ZYRA 1C3HA 3TN93 1HQLA 4XMAA 4B3NA 1OPOA 4LE3A 4X6RB 1O4ZA 2HWB3 5ABJA 1Z7S1 3FE5A 1F5JA 5BNNC 5JOWA 4CDUA 2BQPA 4OHXA 1RUF3 4KGQA 1C8M1 1W0PA 3ZXGA 5LRSA 1PIV1 3E6CC 4MUVA 4N53A 2A5ZA 1MQTB 1QQP2 3JD73 3AMMA 1XQNA 1POV0 2ET7A 1UF2C 4RHV3 1QDCA 1JH5A 5AC93 4AF9A 1L3JA 3DN7A 4JGZA 2PLV3 3W58A 1FV3A 4Q0SA 1W6OA 1O3SA 3ZSLA 4C90A 2ZMKA 4LR4A 3HIFA 4AHZA 4BMEA 3MIHA 5JSOA 5EJ3A 3B9IA 1TME2 5KBFA 2V5YA 1QJZA 4HVQA 1NA1A 5J37A 4IQPA 1CIWA 1POV3 3PVOA 1ZZ7A 3IN9A 2H6BA 2R0HA 4XBLA 4CDXB 4CEYA 2GMPA 1RUJ3 3CLPA 3O0XA 2D98A 3DGTA 2Q1ZB 4XF9A 2BEOA 3OD4A 4AEDB 2QUOA 4YGBA 1EV13 1MVEA 3INAA 2ZJCA 1Y43B 4HPKA 1G9BA 4COVA 4FPHA 4HT1T 3M3QA 1HQNA 5IUQA 5E8AA 2EVXA 3OJBA 4TLFA 3SCFA 3RSJA 2GMMA 2VH9A 2HWF3 2E6VA 2ZACA 2ARBA 4AFDA 4MXWB 4A7YA 3H9AA 4I2OA 3RRDA 3ZXJA 1IS6A 2I74A 3MIBA 5DUVA 1ZZBA 3ZX7A 4P9GA 3RJRA 3QH7A 5JOYA 3AP6A 5IK8A 1URXA 2X8KA 1PO22 1RMU2 1AJKA 3ZFGA 2PAEA 3NV2A 4N9HA 1H2MA 1R081 1SLBA 4CDWB 3POYA 1LEMA 3MW4A 1FOD3 4Q4W3 4COUA 4B4QA 2PQQA 2WNUC 3WV6A 1RB8G 1AJOA 2WNVA 4WVWA 2PFWA 4YARA 5CVRA 3O5SA 3IDCB 2QDRA 3WD5A 3WOGA 3VBRC 3J8F2 2WZR3 4AI1A 1XU1A 2D6MA 4QPIA 3RWNA 3KGLA 4UXAA 2IC1A 1QXJA 1KJRA 1LR5A 1EPZA 3M3CA 4XHBA 4ASLA 4Q0VA 4YVSB 5J7MA 4UBHA 1NLSA 2IXJA 2CYFA 5KXEA 4FPYA 5CG8A 3WG2A 3JCIA 3ZXAC 2ENRA 1KS4A 1SCSA 2WFPA 3AYDA 1VB2A 4FOVA 1CX4A 1J59A 4Y1UA 4R9AA 4Z82A 1YRZA 4GB33 5I0TA 1ND2A 4XF3A 1AL23 1WD4A 1DIWA 3KB5A 1H0BA 3KCCA 4IEVA 2ERFA 2VOXA 4KG0A 1FI2A 3VV1A 4D94A 1YYNA 2AH2A 1RUNA 3WUCA 4NWVA 5JWPA 1BJQA 3FFQA 2W52A 4XIKA 3TBDA 2IZWA 1RUH3 1PO21 4PDWB 3H8UA 5BNNB 1O3RA 2UYAA 3HT2A 1OHFA 3BODA 2VECA 2W39A 3CNAA 4M3CB 2GC0A 1UD1A 1K5MA 3OGGA 5T54A 1V6NA 1A78A 3VKOA 5BNQA 4BOWA 1ZNPA 2OZ6A 1OD5A 3EJKA 4AEJA 2IXCA 2AZ5A 2A7AA 2TNFA 1RHI2 3OTFA 4JC1A 4XJ9A 4BZ4A 2RR12 2A6VA 2ZOEB 1RIRA 4NHLA 1REDA 5FMOL 4Z92B 4XJZA 2BNOA 4Y5Z0 4EN9B 4LUMA 4AQTA 3UJOA 1RVF2 4HKWA 1DQ6A 3NAPA 2JXAA 3GALA 3VL9A 2PELA 1H4HA 1JW6A 2VXRA 4Q4V2 3FC0A 1UU4A 1W2UA 2B8MA 2O8OA 1BXHA 1CD3G 3T2TA 1JYCA 4LBNA 2DUQA 3H1YA 2OUHA 3J9SA 2LTNA 4AVTA 3TYJA 4FP2A 2K2SA 1KS5A 1UKRA 3ES4A 1UMZA 2BYVE 4FSJA 5HCBA 4XW3A 2PTMA 5A32B 3AB0A 3ZN6B 1ZBE3 2A3XA 1OA4A 2C1FA 4XQWA 3VBFC 2B5HA 4IV3B 4Q4Y3 1HRV3 2HEYF 3MICA 4INDA 2ZX1A 3KGZA 1IQAA 4E2GA 4P9IA 2GZWA 5L36A 4LTAA 4L9BA 1G6NA 2DTYA 1X36A 4PF5A 2BBVA 1HXS1 3IPVB</