3RG0A

Structural and functional relationships between the lectin and arm domains of calreticulin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
320
structure length
292
Chain Sequence
DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRSKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Relationships between the Lectin and Arm Domains of Calreticulin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
molecule keywords Calreticulin
total genus 70
structure length 292
sequence length 320
ec nomenclature
pdb deposition date 2011-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.250.10 Mainly Beta Ribbon Calnexin lumenal domain, non-globular proline-rich hairpin domain Calreticulin/calnexin, P domain 3rg0A02
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rg0A01
1V6KA 1WLWA 4YFWA 4Z8BA 3MW2A 1JXNA 1AJOA 1HQLA 4UW4A 1SCRA 1C1FA 1DQ0A 1SBEA 3T2TA 4BMEA 2YZ4A 3O0VA 3R4SA 2VU9A 4K21A 4AGVA 2D6OX 1ENRA 1UAIA 4LBQB 3IMNA 2GALA 3OY8B 4R9BA 3ZSKA 3ZXJA 1C4RA 1VAMA 2SLIA 1URXA 2CWSA 1FV3A 1MS9A 2AUYA 1APNA 2GNDA 4FOQA 1W6QB 3O0WA 5IUQA 3LSEA 1F9KA 2AYHA 3HMYA 1SLBA 5IK5A 1S0BA 4XYXA 2YV8A 3A4UA 1JOJA 1RINA 2GMMA 3SITA 3ZSJA 3SLIA 4XHBA 2JD4A 1U0AA 1G9BA 2ES3A 2VUAA 1GZWB 2A6VA 4PF5A 3NV4A 2UWBA 1LESA 4CTEA 1DGLA 1W6NA 1ONAA 5JOXA 5DUXA 1LEDA 4M3CE 4YZ1A 3AP6A 4XTMA 1ZM1A 1ULCA 5EWSA 2PHWA 1GBGA 4MYEA 4LBMA 3W58A 3T1LA 5F9TA 5CA6A 1OKQA 3ZSLA 4TYSA 2HYKA 3T1MA 3U4XA 2GNBA 4XHXA 1LOGA 4YZ2A 4Y26A 1V6JA 1CVNA 3AZXA 1A8DA 4XIKA 4I30A 1GNHA 3WDXA 3SH4A 1S0DA 2EF6A 3BODA 2R49A 2ZA9A 3AXEA 4OZXA 3N7JA 3NV1A 1W6QA 1Y7BA 1B09A 3D5OA 1KQRA 2ZGQA 3Q9OA 2G4IA 2A71A 2XG3A 5DXDA 1FAYA 1HQWA 1QGLA 1YIFA 2D6MA 3BIWE 4LBNA 4XBLA 1UL9A 1WBFA 2VH9A 4AGRA 4HANA 4M00A 1UN1A 2A6WA 2PHFA 2NZ9A 3B9CA 3N7KA 4M3CB 4AGGA 3LCPA 2DVAA 4JCKA 3M1HA 1IS3A 2DUPA 4WV8A 5SV8A 1GYKA 4ATEA 3OBTA 1LHUA 3AJZA 4XXAA 5H9QA 4HL0A 3PVOA 1N47A 5KXEA 4AYUA 1IS4A 4FPEA 4Q1PA 3IPVA 2E51A 2E6VA 2DVDA 4BM8A 3POSA 2VW0A 3USUA 4FP3A 1S0IA 1O4YA 1V6MA 2D43A 2UWCA 1LTEA 5L73A 2EXHA 5T5PA 3TB0A 1Q8OA 4NO4A 1C57A 2DUQA 2E7QA 3POYA 1LULA 1ULGA 3ENRA 2EXJA 1SLIA 1CONA 4PCRA 1LU1A 1WW4A 1FNYA 2JKBA 3SISA 4DS0A 5IT6A 1ULDA 3N3HA 3RMXA 1PZ7A 1G9FA 1JHNA 3R05A 4FPJA 4WVVA 4FOVA 4YG6A 2CYFA 3A0NA 5E88A 5GLWA 1UMZA 1RITA 1CESA 3AXDA 1N1VA 3AK0A 1DQ2A 1QKQA 1Z0HA 2D44A 2WQZC 2ZGNA 2ZMNA 3BTAA 3V0AA 2EALA 5H9PA 3V64A 3ASIA 4U36A 1SBDA 4FPLA 1YI7A 2WT0A 3ATGA 1N1SA 1WUVA 4M01A 3AJYA 2H0BA 1G8WA 1VALA 4Q1RA 5EYYA 4BPZA 1SLAA 1N3OA 1DHKB 2DVBA 2W39A 3INAA 1C1LA 4U2AA 3RMYA 4SLIA 3VKLA 4YM3A 2GDFA 1MR5A 1WW6A 2P3IA 4R9AA 1LOCA 5GZCA 3OYWA 2DV9A 5T55A 5DG1A 5H9SA 3KQRA 4P9XA 3UK9A 1DFQA 2A5ZA 2NM1A 1W0OA 4Y1XA 1PZ9A 2EIGA 3FLPA 1LHOA 3RRDA 1SACA 2AH2A 4YG0A 2AGSA 2KM2A 1S0CA 4R9DA 2ENRA 3KM5A 1PZ8A 5GJ6A 1UZZA 4YGEA 3MW3A 4PQ9A 1S0JA 1F31A 5E8AA 3ZXFA 2ERFA 4UW5A 1AJKA 4M3CA 1MVQA 4K1YA 1UZYA 4Q8LA 2ZGRA 3N35A 1MS3A 3I4IA 1Q8QA 1GNZA 3VUOA 3POWA 4FOWA 4KBBA 4TZDA 4JRAA 5GALA 5CNAA 1WD4A 2P2KA 3IKWA 3M3QA 4P9WA 4DRVA 4YFZA 1LOAA 3RQ0A 1BJQA 1ENSA 3ZYRA 1HKDA 2R1BA 3WUCA 2A6YA 4D69A 5JLVA 1MS0A 1N3PA 3JU9A 2ARBA 5CAZA 2E53A 3PJQA 3C2UA 3IN9A 4FPGA 4ZKTB 2D6NA 4YZ5A 4R9CA 1LOFC 3V0BA 3RS6A 2ZGSA 2NMOA 2UU8A 5FREA 3ZSMA 3FLRA 1BQPA 5JMCA 1W6OB 2W68A 3AYDA 4YGBA 2EXIA 2WNEA 2GMPA 1QOSA 4FQ4A 1LENA 1SBFA 3NV2A 1BYHA 4XBQA 3SH5A 1V6OA 2D6LX 5DUVA 5BYNA 4FPKA 1QDCA 4ISQA 4YW1A 4FVVA 5JOWA 1IS5A 4PBPA 4XJZA 5HCAA 1CN1A 4Q8KA 4Q2FA 1D0HA 3WCSA 1YRZA 1FATA 1H9PA 5GZGA 2WKKA 3FUOA 1OFSA 1WD3A 2YROA 2ZGPA 3ZPYA 1AX1A 3WHTA 3N7MA 2D6KA 2ZBJA 4CZSA 2CY6A 1LGNA 1QU0A 3B69A 1G9DA 3SNMA 1BXHA 2A3WA 5KXDA 1UKGA 1QNYA 2CTVA 4BLJA 2GN3A 1I1EA 2ZGTA 2LTNA 3O5SA 1BKZA 2SBAA 5GLUA 1HDKA 1SFYA 2A70A 2GMEA 3ILNA 1SLLA 1WW7A 4XDQA 4Y1UA 1AX0A 1SCSA 3PVNA 2ZACA 3MEPA 4AVSA 1LODA 1QDOA 2DYCA 2Z42A 2VY0A 4YW5A 5GLVA 2ZGMA 3AX4A 1JN2P 3OJBA 4FPYA 4LBQD 4PBOA 4YM2A 1G9CA 1LJ7A 1TEIA 1MACA 2YXSA 5LK5A 2AR6A 3NV3A 1DLLA 5HCFA 1MS8A 4GXLA 1CQ9A 3WDUA 5CB7A 3ILRA 3AP9A 5DUWA 3JUUA 4LBKA 5GZDA 2ZGKA 1WLDA 3FBYA 5JVVA 3WZ1A 3AYCA 1LOBA 3V0AB 1Q8VA 4UW6A 2A6ZA 3APBA 4RA0A 1ZA4A 2PELA 4Q26A 2GN7A 2AREA 1DYKA 1H30A 3GNEA 5IK7A 1GANA 2D3RA 3BOPA 2C9AA 2V5YA 5AVAA 3FUQA 4UW3A 3PVEA 3WG2A 4LBLA 2ARXA 4BLIA 2R0HA 2A7AA 3VV1A 1K9CA 1JUIA 3OY8A 1V00A 4LBJA 1DZQA 2DURA 3OGGA 3OYWB 1LECA 2DVGA 1ENQA 1JYCA 3USUB 1VAVA 1X50A 3AZWA 2WJSA 4Y1YA 4Y22B 4Y22A 5KXBA 2JDZA 1DBNA 4Y1VA 2DU1A 3QCWA 1LOFA 5T5OA 2R1DA 4FPOB 1AXKA 3M3CA 2B7YA 3AZVA 4RL7A 3WDYA 1GZWA 2TEPA 4AWDA 1Q8PA 1NLSA 2XB6C 3RG0A 5GZEA 1XQNA 2D7FA 2UWAA 1GSLA 3OBRA 4YG3A 1GZ9A 4DPNA 3WG1A 3RSJA 3GALA 3I8TA 1LEMA 1FYUA 3ILFA 1WW5A 3WDWA 3WOGA 2OUJA 2DU0A 1HLCA 5EYXA 1V6IA 1A3KA 3DUIA 3WG3A 5T52A 1J1TA 2ZHLA 4XILA 3WHUA 4LBOA 4YGDA 1QF3A 1UPSA 3AP7A 3AP5A 2P3JA 2WT1A 1CPNA 2ZGUA 3L2YA 2LALA 4XJWA 3V65A 4C1WA 1WCSA 1V6LA 5KXCA 2FHRA 1S0FA 2DWRA 2R16A 3WVJA 3R4UA 4AVVA 1V6NA 3LSDA 5JDBA 2JJ6A 4XXPA 2CL2A 1GKBA 2NP0A 2ZMLA 3NWKA 4FPFA 4K20A 5GLTA 4FPHA 1QNWA 3AFKA 1AX2A 1LGCA 1ULEA 2NN8A 4DFSA 2NMNA 5DUUA 1Q8SA 2UURA 5DZGA 4ASMB 1QMJA 1DQ4A 1VLNA 1W6NB 3N36A 1LCLA 2WLQA 2Q5TA 4Y20B 3WV6A 2I2SA 1YYNA 1LGBA 3DGTA 5GZFA 2A3YA 2WSVA 3CNAA 3IPVB 4L8QA 1SLCA 4FOYA 2GNMA 3QLQA 3VKMA 2CNAA 4XOGA 3TAYA 1LHNA 3VKNA 1KRIA 4YW2A 4FP2A 3M3EA 3D4KA 4AVTA 1DYPA 4GKXA 4C1XA 1I3HA 5GM0A 4DQAA 2D3PA 2EXKA 3ZYPA 3FFZA 3HN1A 5HCBA 2FMDA 1KITA 2OUHA 1KJRA 2NYYA 2C5DA 5JOYA 3WNXA 4Q27A 5T54A 1KDKA 1W6PA 4YM0A 1MS1A 2ZABA 4XJ9A 3B3QE 1O4ZA 1QOTA 4F83A 2V73A 4YW3A 1QOOA 1OQ1A 1Z78A 2JE7A 2ZAAA 3AP4A 1A78A 4GWMA 4JC1A 4YM1A 3WDVA 5H9RA 4M3CF 5EXOA 2ZHNA 2AENA 1DQ1A 5T50A 4ZXKA 4LBQA 1CR7A 3ZVXA 4DRRA 1EPWA 1MZ5A 2P3KA 4Y1ZA 3ZXEA 1VIWB 3FLTA 2VXRA 2PHTA 3WUDA 3M2MA 1W6MA 2PHUA 5E89A 2OW4A 2CWMA 1H9WA 1R1ZA 1GICA 5T5LA 1N1TA 2R0FA 2WT2A 2ZHMA 1G9AA 1GLHA 2DUOA 2W52A 2ZGOA 1FNZA 1LHVA 3AYAA 3MPPG 2D6PA 5IK8A 1CPMA 1AF9A 3ZXKA 2ZZJA 4FQZA 3O0XA 3WG4A 4W65A 5FRAA 4NOTA 2GNTA 1SLTA 4YGCA 4WVWA 2P37A 1JW6A 3AZYA 1GZCA 5JOZA 4YZ4A 1CJPA 4GWNA 2ZKNA 4ISRA 4XIOA 2WSUA 3WLUA 2ZGLA 1IS6A 1G86A 4K1ZA 1Q56A 1G7YA 1S0EA 1NXD1 3OPZA 4YW4A 4XTPA 4GKYA 1W0PA 3W59A 1DQ5A 4BOWA 3N7LA 4ITCA 3WDTA 1AXYA 4GA9A 1W6OA 2A3XA 3PMEA 5GLZA 2A75A 1IKPA 1KJLA 1FX5A 3HR9A 4FPCA 1GV9A 4BQ1A 3B01A 3H0OA 2A6XA 1W6PB 3UL2A 4GALA 4XMIA 4YLZA 3VKOA 3WCRA 2PHRA 1ULFA 4XZPA 2JECA 1S0GA 3M3OA 4P14A 2PHXA 4WZFA 3D6EA 5CBLA 2JE9A 1WLCA 2RHPA 4CRQA 1UX6A 1LU2A 4IQPA 2YMZA 1RIRA 1MVEA 1MS5A 4XMAA 3MW4A 4Y24A 1DQ6A 1IKQA 3IM0A 4XBNA 4ATFA 1N3QA 4Y20A 3B00A 2DVFA 2W08A 2BQPA 3A0KA 2D3SA 2DTYA 2OVUA 1JBCA 3AZZA 3O12A 4YZ3A 1CIWA 1MS4A 1AXZA 3VKFC 3UJQA 1F5FA 4BMBA 1YO8A 3SH3A 1W6MB 2P34A 3UJOA 3ZXLA 5T5JA 1IOAA 2VW2A 4H55A 5F5QA 3V0BB 5DZFA 1N1YA 1WBLA 1LHWA 2YY1A 2ZMKA 5DG2A 1DIWA 5IK4A 4XJUA 4P9YA 1D2SA 2DTWA 1MZ6A 1KDMA 1AZDA 3AYEA 1YXWA 4XJ8A 1FV2A 2VW1A 2ZHKA 1S1AA 1LOEA 2E7TA 1HHNA 2EAKA 4XJAA 5DZEA 1JYIA 1BZWA 1AVBA 4XE9A
chains in the Genus database with same CATH superfamily
4MXWA 1U5XA 2VZOA 4YFWA 5LEJA 1BEV2 4L11A 2FDHA 4MGIE 4BK5A 2X09A 2Z5WA 3CDZB 4UW4A 1DCSA 4KWLA 1OXCA 3EYPA 5E6HA 1XNAA 1J59A 1HRV1 1W8WA 3R4SA 4W8JA 1RHI2 4K21A 4RS5A 4LPLA 3WR0A 1ENRA 2D6OX 3ABZA 2YPDA 1IG0A 4LBQB 4XDPA 4MG2A 2GALA 3AMPA 2XL7A 1NOVA 1AR82 3H3UA 4R9BA 4AAXA 1FV3A 2AUYA 4FOQA 1OA2A 3O0WA 3NO8A 1OURA 3JB4C 2YBSA 4NRQA 1RVF1 5FTTC 3DF0A 2UY8A 3ACHA 3LB9A 1IPJA 1UYYA 4JQTA 3PMSA 4FBFA 4D0QA 1RUD1 1U0AA 4NMIA 1G9BA 1GZWB 4PF5A 4JRLA 1JHJA 2YC2A 1LESA 1QQP2 3I54A 3THCA 2DF7A 4QX1A 3ES4A 1ONAA 5C8WA 3ACIA 1W9FA 4DOUA 2W92A 3BGAA 2KXLA 4MGSA 1DGRA 3AP6A 5FWJA 1CAWA 4XTMA 3TN91 1XNKA 3PL0A 1PGL1 1JYVA 1HV0A 1GBGA 2BUKA 4MYEA 5C8CC 4DY5A 1AR93 2R041 4LBMA 3WP5A 5IATA 5JI7A 3ZSLA 4P08A 2HYKA 4LO7A 1JH5A 1EAH1 1V6JA 4E4ZA 3KS7A 4YVWA 1YQ8A 1EAH2 3TYJA 1GNHA 4LA3A 3UKTA 1TVGA 2VUJA 5SV5A 1VBB3 2EF6A 3BODA 4OFGA 5EIYB 3UKVA 2ZA9A 1H4HA 3AXEA 2JWPA 4R4ZA 4SBVA 4QX2A 3LFMA 4RD7A 5LA2A 5L36A 3TEYA 1KQRA 4BXFA 4YRDA 2ZGQA 3HBZA 3CHXA 2DFBA 1HQWA 1YIFA 2Q1ZB 1J83A 2D6MA 4LBNA 3N4MA 4XBLA 5AFEA 3ETQA 3W21A 4M00A 4AGRA 3HQUA 2PHFA 2C0ZA 4ARXA 3B9CA 5AC92 1D7PM 5J09A 4B29A 1QY4A 4MHRA 2D40A 4JCKA 2WNOA 2ZX0A 4KBZA 4ONUA 5IVYA 4WV8A 1LNSA 1HRV3 2VECA 2VMDA 3OBTA 4ATEA 4LOSA 1PK6B 1UY3A 1YJKA 3AJZA 5EFUA 4AI9A 4LEJA 3ZYFA 3BCWA 4Q1PA 2RS31 4N53C 4EROA 4QKDA 5C33A 1ND3C 3TOJA 2DVDA 3POSA 2BOIA 3I2JA 4Q4X2 2R042 1S0IA 2XGXA 1UQXA 2D43A 2VUDA 4NO4A 1J1LA 2DUQA 2E7QA 2Y6JA 1ULGA 2ARAA 5A3UA 1ZVFA 1CONA 4PCRA 1UPIA 4UFJA 3VL9A 5IT6A 1ULDA 3N9QA 1PZ7A 1VBC2 4JHTA 2AEZA 4BYYA 4XFFA 5F6LB 4OHVA 3C7OA 2VZTA 4JTOA 1FXZA 2PQSA 3VBOC 3AXDA 4HKWA 4Z2WA 4O61A 4AFCA 1WLTA 2C4XA 2XBO2 2WQZC 3OBZA 3BTAA 1AR73 2XMLA 2NQYA 4HPKB 1W8TA 1PMJX 3ASIA 1AR91 2R043 3WNOA 5A70A 5FO9B 1TME3 3KQ4B 4AVAA 2WQ8A 2VNGA 5FZIA 2H0BA 1G8WA 4Q1RA 4UYBA 1OA3A 5FO7B 4PLMA 1DHKB 2DCJA 2DVBA 2W39A 3E5UA 3SCFA 1RUE1 2GDFA 4P9LA 5A3WA 1X8MA 1VBB1 2YFUA 2CSGA 3IB3A 1DYOA 4A7YA 5JXIA 4BXSV 1UOJA 4Q4W1 5ERLA 4EV0A 2Y6FA 3KQRA 4P9XA 2VVDA 4QPIC 3ELNA 3MYXA 5G05L 3OGJA 4Y1XA 2EIGA 3RDIA 4DB5A 5A1LA 4HKOA 1R082 1H1MA 4RN5A 4NIIA 1S0CA 4R9DA 4XPVA 4CCOA 1PZ8A 5GJ6A 1UZZA 4H3WA 4YGEA 3MW3A 3K4AA 1JZ3A 5E8AA 3ROUA 2FDKA 4K1YA 2WO3A 1AYN1 3I4IA 1EV11 1UMHA 3MIEA 4UBGA 4JRAA 2BW8A 1ZREA 2P2KA 3IKWA 3M3QA 4HMZA 3H8RA 3RQ0A 1BJQA 5B4NA 3MI8A 3VHRA 4D69A 4XFAA 3SKJE 2VVEA 2WNUC 1O5LA 2PN5A 3BYWA 3K3OA 1OQEA 3GGLA 5LK7B 2CAVA 1KEXA 3IN9A 3U78A 4B7EA 4ZKTB 1G6NA 2D6NA 4YZ5A 4R9CA 4CU7A 1D2QA 2RJ2A 2NMOA 1W06A 5I8SA 2WZR1 1WCUA 1IZ3A 4Y4YA 2AZ5A 2W68A 1PHMA 1UZ0A 3FWEA 4YGBA 4AQ2A 3NNLA 3POBA 4UFIA 1SBFA 2B45X 3M4FA 3W20A 1BYHA 2RE9A 4MZUA 1JZ6A 4QAWA 1QH6A 5I8TA 4CE8A 5JOWA 5E1RA 2BFUL 5J98B 5HCAA 3LPFA 4Y3OA 3H3ZA 1PVC1 1WKYA 1NXMA 2GZWA 2TNFA 5FMDA 1RUNA 4AEKA 3CU7A 2YROA 1AX1A 3DPRA 2BEOA 2BTVC 2D6KA 2CY6A 3B69A 2HBTA 3OUIA 4TTGA 4KL1A 3SNMA 2QQWA 2CTVA 4XQWA 1I1EA 2VMHA 4NIAA 2Y34A 2LTNA 5CIRA 3ZFEC 1C8M2 3HNMA 1BKZA 4NVPA 4K8FA 3ILNA 1W03A 3BOWA 1V70A 2WFF2 4H2AA 2JB4A 2V72A 2XWBB 5A6YA 3CQOA 5KHHA 4Q0QA 2QBXA 4WM7B 5GLVA 2ZGMA 2BVVA 1RUH1 4FPYA 3ZMOA 3L2HA 1OD5A 3AKTA 1LB2A 4PDWA 3THTA 3NV3A 4BE3A 1WCKA 1AL0G 1DLLA 3MIGA 1EPZA 1OFNA 4L92A 4XURA 5F3GA 3C7GA 2WNVB 2DDUA 3CF6E 3BTXA 3RFRA 3QH6A 2JDUA 3VZJA 1C3HA 5IWFA 2W87A 4IE6A 2I74A 4H7LA 4BK4A 3AYCA 5FUPA 2LRPA 2A6ZA 2RS32 1JYXA 4QHZA 3O1VA 5DAVA 1RMU2 1H30A 3VBOB 4YVWC 2OXBA 2D3RA 3BOPA 3M7AA 2OZJA 3I2KA 3PVEA 4OHWA 4XF4A 3VDDC 1SG3A 2A7AA 4OI2A 4Q29A 4AEMA 3H1WA 1QJX1 2XPJA 3O1TA 4LBJA 1E57A 1V00A 3GJAA 2XBO3 4LHLA 4XW3A 4NHLA 4UI9L 1WMDA 4MH0E 2FQPA 4GB31 1QXJA 5FYZA 1ENQA 5B2GB 3USUB 3EHKA 1X50A 4Y22A 1PIV1 4OMDA 2G9GA 1VBD3 4DXTA 4EJRA 2FCTA 5A1AA 4BQ2A 1YC61 1UYXA 4RL7A 4YWAA 1S55A 3ZFFC 1GSLA 3OBRA 4LIUA 1PK6A 3WG1A 1O3QA 3GALA 4IV3A 3AMNA 1LEMA 1WW5A 3WOGA 5C9AC 1VBD2 2QTWB 2DU0A 1HLCA 1O3TA 1V6IA 1A3KA 1PX3A 1YLLA 1ZBE2 3OD0A 3O1SA 5TSWA 1OKOA 5T52A 4Q4X3 4YVSB 5T3NA 3WHUA 1NCRC 1OSGA 3AP5A 3IIAA 5C3QA 4LORA 3ZN6A 1CWPA 3KMHA 3I3MA 5FZHA 3V65A 1WCSA 3L9JT 3IZOA 3K3NA 1ZBE1 4MADA 1V6NA 2Y33A 4XXPA 4AVBA 1GKBA 5FYCA 2ZMLA 2WWUA 1XSRA 5GLTA 2PMWB 3AFGA 1QNWA 3AFKA 3BU0A 4CUBA 3D0SA 4CDQA 2NN8A 4DXRA 2R7EB 1HQNA 5A6XA 5DZGA 4ASMB 2W2IA 4Y5Z0 4ZU4A 3NJXA 2WFF3 4FO9A 5A6QA 1PM4A 3H42B 4V1PA 3VBUA 2PTMA 1SDDB 2ZXQA 3P1IA 1DP0A 1BVVA 3N36A 4HN0A 2GC0A 1LCLA 4FTSA 2Q5TA 3UGFA 1GFF2 4F8AA 2ZX3A 1JU3A 3WQ1A 5GZFA 4P9JA 2WSVA 4I3GA 2JKXA 2EAAA 3TEZA 4KMQA 3CMGA 4FOYA 3TNPB 2GNMA 4UF0B 2WO7A 3VKMA 1FOD2 5FPVA 4GB32 4JGZA 4XFCA 3VBFC 2VQUA 2ZKLA 4YW2A 1KRIA 2VMIA 3D4KA 4UBHA 1XJAA 3MV11 3RPQA 1I3HA 2EVXA 5GM0A 3ZYPA 2XVKA 5ANQA 5K7PA 2BOJA 3HN1A 5HCBA 3FE5A 1NCQC 2O14A 1W0NA 2HJIA 2KD7A 4LOTA 4MGYE 4LTAA 5A7NA 5JOYA 2UYAA 3SQOA 3KCXA 4YM0A 2RDNA 2ZAHA 4B3NA 4D6SA 4OUMA 3H8XA 4FAGA 1VMFA 2UYBA 2JIGA 4XJ9A 3GCXA 1NUKA 2PAMA 4CCKA 4NJ4A 4ORFA 4YW3A 1GUIA 3PURA 1Z78A 3AP4A 4GWMA 4I3PA 2R30A 4JC1A 2BWCA 5A3OA 2XQXA 5EXOA 1OI6A 2AENA 2Q4SA 2ZEWA 5T50A 2QQKA 1V9U3 4AFBA 3ZVXA 3J7MA 5LY1A 1QJX2 1EPWA 2RV9A 2P3KA 3I59A 3OUHA 4JGZC 4Y1ZA 3ZXEA 3JBG2 4B8EA 3ZYHA 3CJIA 1ZBE3 1RMU1 2FZ1A 4RQPC 1W6MA 3VDDB 2OW4A 4Y5TA 3VBUC 2HWF3 2CWMA 3JB8A 1CAUA 1H9WA 5FK7A 4CDXC 4AI2A 5JIUA 4FFHA 2R0FA 2H6BA 1VRH3 4QM8A 4OI1A 2WT2A 1G9AA 3HVDA 2DUOA 2PA7A 2F4PA 4LMFA 2VUCA 1FMD2 2W52A 2G9ZA 5LA0A 2D6PA 4ZZ8A 2D98A 4NRMA 3ZXKA 2JEMA 1JI6A 1K5MA 1BHGA 4EN0A 3B94A 3LOBA 2Z79A 3WG4A 1RHI3 4N9HA 4IEZA 1IPKA 2GNTA 2Y6GA 4YGCA 3X29B 2VVFA 1JW6A 2D5HA 1GZCA 2HYXA 4CEYC 2LM3A 4GWNA 4W6XA 4RGKA 3IAQA 4PT6A 2GSYA 5FP4A 5AC91 5JUVA 3G6JB 3POFA 1R1A3 2ZOEB 2VXJA 2GU9A 1XXNA 4GKYA 1UYPA 1VB2A 3WD5A 4CEWA 1RUI3 1FPN3 4CP2A 1XC6A 3T4VA 5DN2A 1DQ5A 2XR4A 1H2MA 3ZFGC 3WDTA 4HSJA 3IAPA 3RI9A 3I2OA 1W6OA 2A3XA 4CDWB 1MQTA 1UWWA 5C7GA 4QPYA 4GIQA 3O1MA 1IKPA 1KJLA 3H1MA 4BZ4A 1R093 1UY2A 1YI9A 3QD6A 1TG7A 1ZBA2 3KT7A 2VTXA 2ZX2A 4HSLA 1W6PB 4RQPB 4XMIA 3U0ZA 4LT5A 2QNKA 3SEPA 3T0BA 3WNKA 2OIIA 2JECA 1US3A 5A7QA 2P17A 5DAPA 5A7WB 4E2SA 3RZKA 4EZ4A 2JE9A 3B7MA 2BZDA 1POQA 3M8LA 4JAAA 2MHFA 2YMZA 1RIRA 1RJ7A 1OQDA 1QEXA 2J1AA 3MW4A 3HIFA 3OTFA 3PU3A 1IKQA 2GC2A 4BA6A 1F4AA 3C3VA 4QXBA 2I45A 2BQPA 2D3SA 3C7EA 3KVBA 3TN93 2OVUA 3RI8A 1JBCA 3SCHA 5J37A 4A3ZA 3KCYA 2WZEA 1AXZA 1O91A 2BU9A 1F5FA 3FL7A 4QGLA 1QJFA 3POEA 4IGPA 3WNNA 1SFPA 1IOAA 1TNRA 2VW2A 2R062 3LEGA 1CAUB 2B39A 5F5QA 3V0BB 1I5PA 3GZTB 3VDAA 2Y6KA 1H0BA 2XHKA 3VZLA 1QJU2 4P9YA 1A8MA 4XVHA 5JXGA 4FI9A 4RFT0 4DUVA 3AYEA 5D8AB 2FBEA 4XJ8A 2IXJA 1NA1C 2HEYF 1S1AA 2E7TA 4J1WA 2WZPP 3ACLA 5B4XA 4DIQA 1BZWA 1HB1A 4CEWC 2RM23 2V5DA 2FD8A 1V6KA 3DKWA 2CGPA 2X5IA 1WLWA 3WW1A 2CAUA 5HV0A 1PGW2 1PX4A 1JXNA 2YU1A 3BUCA 1KFXL 1D0GA 2K0GA 1C28A 4LIVA 1C1FA 3FX3A 4LULA 3VBRC 3ZFGB 2J22A 1VBE3 1SBEA 3O1UA 3T2TA 1K5MC 1HRI2 1RUI1 2YZ4A 4AGVA 2IFWA 4IXLA 2JDYA 3NNJA 1UAIA 3IDAA 4BH9A 5F1RA 1H6YA 1DF0A 4Q0PA 4EWDA 3VBSA 4BQ3A 4X6RB 1B35A 2VAUA 3PTRB 4CCMA 2SLIA 2YC0A 3GBFA 2CWSA 1XU1A 1MS9A 2XXZA 4QQ2A 4QQPA 1K3IA 5FY8A 1W6QB 5IUQA 5KHKA 1V0AA 2F4LA 1AR92 1CAXB 1F9KA 5IK5A 1R64A 5JR7B 5J96B 5ISLA 1CZVA 1S0BA 4OI0A 3K48A 2VBDA 1A6CA 1GR3A 3SITA 1RINA 2JD4A 3I3DA 2ES3A 2VUAA 3CIHA 3F2ZA 2WNVC 5F3EA 1UNBA 5FCCA 5JOXA 5DUXA 4M4RA 5FP8A 4YW7A 1UY0A 4L9BA 4M3CE 4TSVA 1IPSA 1LRHA 1AR71 2RS52 1HN0A 1OT5A 2B42B 3T1LA 2BGPA 4WBBA 1OKQA 5CA6A 3U4XA 1YHFA 1ULPA 4XHXA 1UD1A 3MICA 5APAA 1JUHA 1RUG3 3AZXA 1A8DA 4I30A 1VB4A 3JQXA 5IVCA 2YUEA 2WZ8A 4LK7A 4XF0A 5FKCA 3SH4A 4LUKA 4DEVA 2R49A 4JKKA 4OZXA 2YPJA 3NV1A 1FT9A 1NLRA 1Y7BA 1B09A 2MEV1 2G4IA 4XDOA 4DXSA 3A21A 1ULOA 3WNMA 1UL9A 5F32A 2VH9A 2OKXA 1VAKA 1RUH2 2W3JA 4HANA 2Y38A 3N7KA 5LCWL 4AGGA 4NROA 1AYN3 5KHGA 4O65A 1NA1A 2WS92 4WM8B 3ZLIA 3GZEA 5KXEA 1N47A 2XJPA 4AYUA 1IS4A 4V2WA 1POV0 3IPVA 1H8TC 3GJBA 3BTYA 2E6VA 3OSDA 1U5IA 1VBC3 4OZOA 5C3SA 2W1UA 1SEFA 4ES8A 3MO4A 4FP3A 3OGVA 3ZXGA 2UWCA 2W1QA 1JYTA 1Q8OA 4Q4V2 2VMGA 4OCTA 2GH2A 1UOFA 1LULA 3VHPA 2JKBA 3MF6A 3SISA 3ZDSA 4DS0A 2VBPA 5EJ3A 3RMXA 4BQ4A 1VPHA 4LLFA 4QGNA 5IFPA 1KXGA 2WDBA 3AKSA 2GAUA 1XBFA 2XONA 3C7HA 3E1F1 3A0NA 3R05A 2HWF2 4IGOA 4JKLA 4IV1B 5FZ3A 3ZN4A 3RZJA 1RITA 1N1VA 1W05A 3AC0A 3LDBA 3M70A 4L0PA 4EN7B 4MXVA 5IAVA 4EN9B 3VBRB 1QKQA 1PVC3 1W8HA 2ZMNA 4G3YC 1T6GC 1L3JA 4W50A 5LA1A 2EALA 5L7OC 1YI7A 3DN7A 4CDXB 4Q4X1 1N1SA 5IHRA 1A34A 4CEWB 4M01A 2BBAA 4G4FA 4QDSA 4COWA 5EYYA 3KVAA 4U2AA 1DZTA 4IEUA 1C1LA 2OPKA 3DEMA 3ZKYA 5FOBB 5HV4A 1WWYA 2P3IA 1WW6A 2FMYA 4NUBA 4QB1A 3VGIA 3WXPA 5IVFA 4R9AA 5GZCA 3OYWA 1CAVA 2DV9A 4XUNA 5FJKA 5T55A 3MFAA 3UK9A 3ON7A 3U14A 3UGHA 4UWDA 3H7YA 1OF3A 4RGGA 1BCXA 3T08A 1SACA 1PIV2 1JYWA 4FT8A 4FSJA 4OHYA 4W6WA 1POV1 3KM5A 2QE3A 4DINB 1UZWA 1S0JA 1F31A 2ERFA 4UW5A 2HWD3 4KQ7A 3WQBA 3NAPB 1UZYA 4Q8LA 2C26A 1MS3A 2QQMA 4ZU5A 1XE0A 4FOWA 4TZDA 4NRPA 2H6CA 1P8JA 5CNAA 3H3LA 5GALA 4B7KA 4P9WA 1JODA 4DRVA 4YFZA 1WCDJ 1NY71 1VBB2 2J1RA 2FDJA 5JR2A 1MS0A 1N3PA 3JXSA 4D8MA 3K4DA 1OC1A 4JHZA 4HPKA 4XABA 3PJQA 4A6OA 5BNOB 3AMMA 3LGRA 4FPGA 4CDXA 5FXXA 1LOFC 2XQRA 1W8FA 3NQHA 4P00B 4D6QA 1AYM3 1WGPA 4YVWB 2X10A 3FLRA 5JMCA 3PNAA 1W6OB 2Q1MA 4CDWA 1AUYA 1W3XA 4LK6A 4LKEA 2EXIA 3RYPA 1QJU3 4EE2A 5LRSA 1QOSA 5CISA 2QFEA 3WF3A 2BNNA 3QBQA 2BNOA 2E31A 1DGWX 5BNQA 5FYVA 4YW1A 1SPPB 4IE4A 1E5HA 3ZKUA 1IS5A 4PBPA 1RUJ2 4CCJA 4Q8KA 1H8VA 4A45A 1FATA 1H9PA 3H1YA 3FUOA 1OFSA 1WD3A 1RUF2 4LITA 3N9PA 2ZBJA 2RR12 5ABJB 1QU0A 1OD3A 1WMEA 1K5MB 2W95A 2A3WA 5FFOC 2XLGA 2E7AA 1UKGA 3N9NA 5LA9A 5KC6A 4A44A 3NRUA 2CHHA 2XHNA 2OT7A 4RS5C 1SFYA 5FZBA 4AFMA 3KGZA 2VOKA 3UYJA 4XDQA 2RMU1 1ACCA 5FV3A 3PVNA 1RXFA 5LEKA 2WS91 3MEPA 4AVSA 4WM8C 1LODA 1PO12 1YFUA 4LE4A 2W47A 3SXWA 2WWJA 3GZAA 2VY0A 3E5XA 4CU9A 5JI9A 1HXS2 3AX4A 5FY5A 3AM2A 2XLFA 1BK1A 4QT6A 2RVAA 3GHNA 2YFZA 1LJ7A 1NAEA 4HN1A 4WM7C 4YM2A 3MV01 5FZAA 1X36A 1QJZA 3POJA 4TXWA 2ETEA 1UOGA 4BIOA 1UU5A 1Y43B 2EIBA 4MO3M 2W5FA 1W9TA 2YYOA 3JZVA 5CB7A 2K9ZA 4OI4A 2WNUA 3AP9A 3T30A 3Q8FA 5FLIA 5IFTA 2XDVA 5FZOA 1O8SA 1PNFA 1RYYA 2WINB 5FUIA 3WZ1A 3FBYA 4X6QB 3T0AA 2ZJCA 5JVVA 4KGGA 1LOBA 2VNOA 4YNIA 4AHZA 4RA0A 5FP7A 4AK3A 5FY7A 2VZ1A 5A33B 1GANA 1NA1B 2LW8A 5AVAA 3FUQA 1XOYA 4A7ZA 1UXXX 4AG4A 5C8CA 2HWE2 1AYM1 1Y3TA 3C7FA 5ACA1 5FBJA 1JUIA 3OY8A 1XPWA 2DCZA 2J1UA 4E9KA 4COYA 4D7YA 3B93A 3KD4A 4WZCA 3LZZA 3T09A 3BI3A 1VAVA 4Y1YA 4TN7A 3VLBB 1YUDA 3KHBA 1SFNA 2MEV2 3P6BA 1SPPA 4Y1VA 5FPBA 2IFRA 3QCWA 1LOFA 4B1MA 2HWE1 4N8MA 1PVXA 3VN4A 5BY5A 1RUD2 2HWC2 1YFYA 1JZ8A 3M3CA 2B7YA 3NJYA 4CDWC 3HWJA 3AZVA 3IMMA 1GZWA 2TEPA 3JBG3 3EXUA 4JV4A 4E4HA 1XQNA 3ZFEA 1GZ9A 3RSJA 2FCUA 3T0DA 1H8TA 3VZNA 5K9YA 1FYUA 1GOFA 3ILFA 3WDWA 3U10A 2R073 4DMIA 4CCEA 1J84A 5FY9A 3Q8EA 2RS53 3HN3A 1REEA 4CPBA 1S2EA 5CKMA 4B4PA 4HT1T 4R52A 1UIJA 1NKGA 4HBNA 1J1TA 4XILA 3WX5A 4RS5B 4ZHNA 5DDJ3 2RS12 1COV3 4AEDA 4CCLA 2E63A 4MGTA 2ZGUA 4QKFA 3L2YA 4TWTA 4C1WA 2G19A 3FHIB 1V6LA 2BGOA 2ZEYA 1ZZ6A 2ZPXA 1S0FA 5DMYA 1PM7A 1RL3A 3R4UA 1D4VB 3LSDA 3ORJA 3OG2A 3TRSB 5JDBA 2CL2A 1KS4A 3HT1A 3R6SA 4NHYA 2YG0A 4QB2A 3WP3A 3UKNA 5CFCB 5FPAA 2WWSA 1RGSA 3LPGA 4OVEA 5A7WA 3VD9A 1Q8SA 1QMJA 1WMXA 4QD2A 3VZKA 3J8F1 5A33A 4F7ZA 1JZ5A 4NPRA 1VLNA 3LEIA 1D4M3 4YYOA 4HVRA 4AHWA 1VBE2 2ET1A 2VNVA 3ACGA 1MZFA 3WV6A 2I2SA 2Y8KA 5BNPA 2VZQA 4J6GA 3WNLA 1EUUA 1CZTA 3NAPC 5CKNA 1SLCA 4AQSA 3QLQA 4AZZA 5A3LA 3TAYA 4E4DX 4FP2A 1UU4A 4AVTA 1R081 3JD73 1GWMA 3BU7A 4LO8A 2HWE3 1VBD1 4C1XA 4QPIA 5C9AB 5J48A 4FFFA 3KHCA 3DYMA 4S2GA 4E2QA 1ENXA 1WZXA 4GH4A 3NMBA 1QJU1 4Q4W2 5LB6A 5LBEA 2EIEA 2FMDA 2O0OA 3DL3A 3KWVA 1XRUA 4IUGA 2FZ2A 5FYHA 2W0XA 2XJSA 4IEWA 4Q27A 3VBHA 2R063 5A3PA 5JCTA 1KDKA 1EYBA 4GZ9A 5KHJA 2ZABA 3DKQA 3ZN5A 2X5IB 3CZUA 3B3QE 1Y9MA 5F3CA 1QOTA 1Y9GA 4F83A 4NHKA 2DCKA 2V73A 2VZSA 1QOOA 1NCRA 3WDVA 4D7TA 4ES9A 1A78A 4N43A 3I3EA 1R1A2 2IC1A 4KU7A 2DCYA 4M3CF 4CP1A 4GJYA 2VOTA 1ZA7A 2VCBA 3OBAA 4IV1C 4HK9A 2QQNA 3KSCA 4Y5SA 1MZ5A 3FC0A 1QJY2 4AI0A 1LKNA 2WO2A 1KS5A 1REFA 2PHTA 1CAXA 4NAMA 1E5IA 1X9PA 1GWLA 4CXWA 1W3VA 2PHUA 4NIHA 3ZPOA 1ZBA1 1R1ZA 2IVIB 1FPN2 4XC9A 1VRBA 5J36A 3MZHA 5FZ8A 5IW0A 4K40A 1EUTA 1OOPC 4UOJA 3CZJA 1ND3A 4QX8A 2VCAA 3T2QA 1RUF1 2VQ0A 1AF9A 3BVCA 3P3NA 3J8F3 2JG8B 2BYVE 1D4M1 1RUI2 1VBA2 3O0XA 1HRV2 5FRAA 3UGGA 4RYDA 5FZOB 4B1LA 4WVWA 2P37A 3AZYA 2RS33 3VBRA 2XKPA 2ZKNA 4I09A 4ISRA 4XAAA 2EA7A 2ZGLA 1JZ4A 4K1ZA 3KT4A 2RMU2 3HNBM 3MLKA 3VBOA 1NXD1 4YW4A 1TNFA 4XTPA 1US2A 5F2WA 1YQCA 2IXLA 2WZR2 4QDQA 2VZVA 4ITCA 4BOWA 1QJX3 5JAXA 2FCVA 3H8OA 1AXYA 1FMD1 4GA9A 5L9RA 1W8ZA 4C90A 3THPA 5A80A 3TEWA 3W5NA 2DBNA 3J7HA 3T4HB 5BV6A 1JZ7A 4FPCA 5FMOL 3ZYIB 2C24A 2JDPA 3FBMA 1V9U2 3HEIA 5BNOC 1DZRA 1RVF3 2A6XA 5J1XA 3AKPA 4HZFA 3VKOA 2PHRA 4QXHA 4XZPA 4A3XA 1S0GA 2HLEA 1B35C 3WF2A 5JXHA 3D6EA 2VNRA 4GH4C 3RNSA 3MIFA 4D6RA 1F8VA 3FHAA 3RZGA 1MVEA 5F7UA 1DGRN 1NQDA 4CDUC 1W2AX 3ALQA 1DDLA 4XBNA 3RJ2X 4Y20A 1PO21 2DVFA 3K2OA 1YQ5A 1Z7S3 2PHDA 4KU8A 3AZZA 3LA3A 4P9GA 1U12A 1MS4A 2QQJA 5LBBA 5HCHA 2PLV3 3VKFC 1XYNA 3RYKA 5FZ7A 3LOIA 3SH3A 1W6MB 2P34A 4RHV1 2HEVF 4P02B 4H55A 2WA3A 2W9XA 5DZFA 2CDOA 1Y4WA 4HLTA 1COV2 3VD7A 3O14A 1QHDA 5DDJ2 5F39A 4MGKE 2ID4A 5GKAC 4QPIB 1BMV1 2BRTA 5IK4A 4HK8A 4XJUA 4PIYA 1D2SA 4CXXA 5F37A 1MZ6A 3I2FA 2ZTNA 1KDMA 5L19A 2PLV2 5L9VA 4E27A 1AR62 5IVBA 3OD4A 2ZHKA 1LOEA 4B4RA 1IG3A 2PYTA 5FXVA 4XJAA 1W9YA 4NHMA 1M4WA 4M0HA 2YHJA 2C1FA 4XE9A 5LATA 2ZX1A 4LO4B 4XQDA 5CKQA 1O59A 4Z8BA 5IAXA 3FHQA 5FZGA 3B02A 2WUHA 3S7IA 1AJOA 5A3TA 1TE1B 2WIIB 2VR4A 1ND2C 3NW4A 2DFCA 3KLSA 4PF1A 3DV8A 1CZSA 2JIJA 1RVF2 3IMNA 4QXCA 3OY8B 3ZSKA 1C8M1 3ZXJA 1C4RA 1VAMA 2WLPA 1URXA 3I2HA 4QQLA 1UW8A 2GNDA 1APNA 3KCCA 4ET7A 2MNGA 2MPFA 3HMYA 2AYHA 2RR11 1SLBA 3RGBA 1ZRRA 3Q8CA 2B9UA 4EWAA 4D3WA 3I2DA 4GWJA 3QH7A 2YV8A 3A4UA 1JOJA 3JQWA 5LW9A 3SLIA 4XHBA 3GBWA 4OYUA 4V2VA 5BNNB 3PUSA 3NV4A 2ZZQA 3B5LB 1PGW1 2UWBA 1R092 2XJVA 4Z1VA 3VBUB 2VJXA 4CTEA 2ILMA 2OX0A 2PFWA 2QQLA 1OPMA 3VBHB 5CEHA 3IDCB 1RUC2 4YZ1A 3D3AA 2AEYA 1NCQB 4OHXA 3ZIXA 4BCUA 3BKZA 1ULCA 2PLV1 5FP9A 3LIHA 3HPNA 5F9TA 4W6YA 4HVQA 4TYSA 4NIDA 3BALA 1LOGA 1BMV2 1HJGA 4YZ2A 2O8OA 4Y4RA 1V9U1 1CVNA 3WQ7A 5FO8B 1SQ4A 1HXS3 2WYSA 3E6CC 1NZCA 1RUH3 5C70A 3NJZA 4CUGA 4N53A 4ZPIA 1OA4A 3T2PA 5FZDA 3WF1A 2GP5A 4MLOA 1SDWA 3WP6A 1W8NA 2A71A 2XG3A 2WA4A 1QGLA 3BIWE 4GD4A 4NHXA 1WBFA 4LKSA 1VRH2 2HWB2 5C5TA 4EZHA 5AFBA 1W8OA 3FMGA 2A6WA 3W9AA 3AL6A 2DCTA 3LCPA 4QX7A 4PIXA 5FZ0A 3LQCA 1IS3A 3S30A 1W2UA 2DUPA 2LS6A 4KH9A 4XCBA 5SV8A 3HJRA 3QACA 4NIGA 1CGPA 2YBPA 1OH3A 3K4ZA 3VBSB 3TNQA 3LFIA 4AXOA 1C8M3 3NKGA 3HBKA 5DAWA 3RJRA 4P5HA 5AC93 3POIA 1GQPA 4DZGA 2D93A 3I3QA 3USUA 1V6MA 2QZ3A 1LTEA 4Q0UA 3HOBA 4XCAA 1C57A 2OQ7A 3CJIC 4KI5M 3POYA 4PI0A 4QHBA 1RB8G 4CEYB 3JD72 3ENRA 2EXJA 3Q8AA 3ZN6B 1SLIA 1GP6A 3BTZA 1HV1A 2XKOA 1LU1A 3T2OA 4GH4B 4AQ6A 5BNNA 3LIGA 1OLME 3JBG1 1JHNA 1QQP1 2QKDA 4FPJA 3SEEA 1W2OA 1M06G 1YJLA 2CYFA 2O8QA 1GQGA 5E88A 1UKRA 2Z2SB 1H8TB 2N7GA 4C91A 4XETA 5FYSA 4NAOA 5BNPC 3S0MA 4AW7A 5FZLA 1DQ2A 1HN1A 2ZGNA 3V0AA 3H50A 5H9PA 3V64A 2UY9A 2XJRA 1AR61 4U36A 1SBDA 1W39A 2RJLA 1FOD3 4EWEA 2WT0A 1WUVA 4FCAA 3J7LA 3H8UA 2OPWA 5HXVA 4BPZA 1SLAA 3E6DA 3RMYA 4K3UA 1COV1 4JGYC 3VKLA 1Z7S1 1YIPA 3CL1A 3F95A 3HQXA 1LOCA 2EIDA 2Y0OA 1DFQA 2NM1A 1W0OA 5E16A 4NE9A 3FLPA 2BGCA 3VD5A 1LHOA 3ZFFB 4RR3C 2RJKA 3D0JA 3J26N 1BBT3 2AGSA 3MF9A 5BNNC 1VMJA 3PTYA 2RDQA 2HWB1 5FYYA 1AJKA 3A23A 1I9RA 3MIDA 4CDUA 1S4CA 2ZGRA 3N35A 2P4EA 3GBGA 1Q8QA 5D8AA 5IYYA 2XJTA 1YFXA 3VUOA 1XB9A 3PU8A 4L2NA 4K6BA 2Q1FA 5CG9A 4ZXEA 2JX9A 4YSFA 3K75B 1UZVA 3LAGA 3OGSA 2WNUB 2RM21 3ZYRA 3WUCA 1RUE2 1NCQA 2Q0AA 2VD7A 4PI2A 5F3IA 1ZRFA 4BQXA 4R4XA 1MZEA 5FZ9A 5FZ4A 1OMIA 2XVLA 2GH8A 1R083 3RS6A 3RWNA 2ZGSA 3WW2A 1O3RA 1H4GA 1CX4A 2UU8A 5FREA 3H9AA 1BQPA 2OYZA 4GJZA 3AYDA 4AHYA 5FLJA 3KV9A 2WNEA 2GMPA 4AOCA 1O8PA 3EMRA 4OUSA 4X8NA 4FQ4A 1LENA 1TME2 2WNVA 3NV2A 2J42A 4ZS3A 4XBQA 3SH5A 1V6OA 2D6LX 3EQEA 4JVAA 2OQ6A 5BYNA 1QDCA 1PO11 1J3QA 3MGUA 1JZ2A 4IEVA 4ZONA 4ASKA 3UETA 1CN1A 4Q2FA 3OEBA 5CFCA 4CDQB 1YRZA 4QM9A 5A7OA 5GZGA 2WKKA 2C6SA 2ZGPA 3NVCA 4FAHA 5G04L 3CLPA 1JTZX 1GZTA 1G9DA 3WT3A 1BXHA 3ZO0B 4CP9A 4QPGA 5CFDC 5A7SA 5LRRA 2ZGTA 2IUWA 1AR81 1MEC3 3O5SA 2ADDA 2SBAA 1RUE3 1ODMA 3ECQA 1HDKA 2A70A 3RWKX 1U5YA 4E2GA 3OOXA 1SLLA 2BV4A 1WW7A 1RUOA 4NPLA 1AX0A 1SCSA 3CJXA 1UX7A 2PQQA 2ZACA 4LJHA 1S2KA 1NT0A 4O7XA 2YGMA 4YVSA 5HPOA 1QDOA 2DYCA 3LEKA 2YGLA 1RUG1 4CU6A 5FUNA 1JN2P 4CEYA 2RDRA 3ZR5A 1TEIA 2YXSA 1MACA 2VC9A 2CV6A 1PGSA 4XF3A 2BP6A 1UYZA 3WINE 5HCFA 2VCCA 3OPWA 4GXLA 1KGYA 2GP3A 2I07B 1CQ9A 3PIGA 2P1BA 2X8KA 3MIBA 5ANNA 3ILRA 4OMCA 3WDUA 5I0TA 4HOOA 5DUWA 5FMCA 1OBNA 5A32B 4IE0A 4LBKA 5FKBA 2XUEA 1Q8VA 2G9FA 4UW6A 3APBA 1YEWA 1ZA4A 2PELA 4Q26A 3RYRA 2GN7A 2LROA 4H7MA 3RZHA 2AREA 2JD9A 3MLLA 3GNEA 5JXJA 4OULA 4RHV2 3WNPA 5IK7A 1L7LA 2V5YA 3JCIA 4DO0A 1RUJ3 1KFUL 3OCPA 1X9TA 2R0HA 3MUZ1 5HI0A 3VV1A 5JMOA 1K9CA 4QPWA 2H0VA 1DZQA 5CZKA 4AEJA 5L9BA 5CFCC 1W2NA 1U5ZA 3OYWB 1PNGA 4BQ5A 1LECA 3SHRA 3CJIB 4DY3A 2W91A 1OVSA 2DVGA 4DNYA 1JYCA 3LF7A 4ASLA 3AZWA 4Y22B 3O1RA 5KXBA 2LUWA 1BBT2 1DBNA 4XUTA 5T5OA 4DEQA 5FOJB 1XE7A 2R1DA 1UO9A 4FPOB 4FXGB 3BN6A 4PIZA 2ARCA 2WN2A 2ZCWA 2VULA 5C4WC 5KHIA 3WDYA 1Q8PA 2YC4A 1NLSA 2XB6C 2VOWA 5LY2A 2JDMA 3ZYJB 4DPNA 3MPBA 1HB2A 3AVRA 4B4QA 5C3PA 2XVGA 3AL5A 3PUHA 1VE0A 3WY6A 2OUJA 1MEC1 5FK8A 5FZ6A 5EHDA 4CVUA 1CAWB 4XEZA 2BBVA 2FDIA 4JGZB 3DUIA 4AFDA 1X82A 1FOD1 4RHV3 1F15A 3WG3A 2ZHLA 3USSA 1TMF3 1GNYA 1QF3A 4S2HA 2VMEA 3RZLA 1UPSA 2P3JA 1I5ZA 4Z2AA 2JG9A 4JDOA 4Z82A 1BEV1 3P3PA 2X5IC 3PJYA 4RFRB 1E5SA 4N53B 3U07A 2KR2A 2D97A 1ZX5A 2BWAA 5KXCA 2DWRA 1L7QA 2R16A 4IDZA 4D94A 2AACA 1PK6C 4AVVA 3VDBA 2YBKA 2VE1A 1OOPA 2J1SA 3NWKA 4FPFA 2A1XA 5A32A 5I0RA 1OLRA 4FPHA 1AX2A 1J58A 2HWB3 1ULEA 3K51A 2HWD1 2AC1A 2Z4FA 2NMNA 4DFSA 4Z07A 3SC7X 4BQWA 4TLGA 5BPXA 1DQ4A 1HRI1 3U75A 1W6NB 4WVZA 1RUJ1 2BNMA 2VTXJ 2WLQA 1GU3A 1ALYA 3GF6A 1ND2A 5L7OA 4FTEA 3TEXA 1QJY1 2JG8C 1UCXA 4CCCA 4IEOA 1XYOA 1H1AA 3DGTA 4OUEA 5EZWA 4L8QA 1GQHA 5JSOA 5FYIA 2CNAA 4L97A 1VBA3 2XJQA 1DYPA 4OHZA 3S6PA 4GKXA 2OZ6A 4DQAA 3D82A 2D5FA 4CDQC 1CD3G 1ZZ8A 1CIYA 1NX9A 1H6XA 5F5CA 1KITA 3G7DA 3WQ0A 1KJRA 2QVSB 1C5IA 1VR3A 4AAPA 2WQ4A 5BXXA 2C5DA 5JSRA 2W1SA 3URFA 5T54A 1PO13 3WNXA 4CCNA 4LKFA 2FDGA 1ZRCA 3FJSA 1MS1A 2OA2A 3W5MA 2VG9A 2R071 2J7MA 3AKQA 3S7EA 2RS51 5FBZA 3S5QA 4O9EA 1ZZ9A 3RVHA 2JE7A 2VTFA 4BB3A 3EO6A 5JWPA 1HB4A 2ZHNA 3DECA 4ZXKA 1UMIA 5JIAA 5C8CB 1CR7A 4D7SA 4DRRA 1HXS1 1RUG2 3SMHA 4P5YA 3I59B 4IW3A 1FI2A 1J3PA 4XUQA 3NNMA 4WVMB 4QGMA 4KNCA 2C9KA 2QJVA 3O1OA 5DAXA 3NJVA 4OQ9A 3WUDA 4KGQA 4R8HA 4XZUG 2JE8A 1UY1A 5E89A 2ATFA 1W99A 2E33A 4EN8B 4Q4V1 3ZXLA 4AI3A 2ZHMA 1GLHA 4META 3MDPA 2EICA 2QCSB 1FNZA 3HQRA 5IJRA 1LHVA 5CG8A 1ND3B 3KZ4C 3MFCA 4QPGC 4BJ0A 1CPMA 2J1VA 4Q4Y3 4CDUB 3S57A 3DXUA 1AL21 5F5AA 3WW4A 4FQZA 3U11A 4UFMA 4CP9B 2R6QA 4K7JA 1ZRDA 5HXMA 3LKJA 4N7IA 4OLLA 3ZSEA 4PLNA 2QQVA 1SLTA 1OLMA 2IWGB 2ZEZA 5F8PA 5FLHA 4A6SA 2O1QA 5CADA 4YZ4A 2X29A 3LA2A 3WLUA 1F35A 1VBC1 3FN9A 1IS6A 1G86A 1WA6X 2HH9A 1G7YA 1W04A 2ZS6B 4AL9A 1TMF2 3OPZA 1D4M2 4RR3A 2BVBA 3K46A 3K77A 2QDNA 4LUMA 2IXIA 2JG9B 2J1EA 1S2BA 4DUXA 1JU4A 3PMEA 2XWJB 1GP4A 5D2AA 5GLZA 4QWNA 2Y26A 4KWUA 5LWBA 1HIXA 1CAVB 3HR9A 3CKHA 1FX5A 1QQP3 3DYPA 5LASA 5JZGB 1ZZBA 2VZ3A 4XUOA 5LBCA 5CFDB 1PIV3 3H0OA 1HJFA 3I2GA 4GALA 4YLZA 4RQPA 2HWC3 3I7DA 2RM22 1JMUB 4NWWA 5J3UA 3ZMNA 3ZYBA 3M3OA 1DGWA 4P14A 3VD3A 3VHNA 4WZFA 1W8UA 1PGL2 3VHOA 3DPRB 3KV4A 4CRQA 1UX6A 4IQPA 1TME1 1MS5A 5FQ0B 2Y6HA 4Y24A 3WF4A 1YQ6A 1ND2B 2V4AA 4ATFA 1N3QA 4AEDC 5C71A 5L7OB 4XF1A 2W08A 3N9OA 3ZYGA 2DTYA 2WO1A 3O12A 4XACA 5F5IA 4KG0A 3UJQA 4BMBA 1REDA 5T5JA 3ZFFA 3J8F2 4IV3C 5ABJC 1N1YA 1WBLA 1LHWA 4Q4V3 1W9SA 5C9AA 4OQ8A 3MUY1 1POV3 3KF5A 1BEV3 3NKTA 4JDMA 3ES1A 4RSUA 5D1IA 2XOMA 4ZY9A 2QDRA 4Q4Y1 1YXWA 2VW1A 1XU2A 4AFAA 2MEV3 2EAKA 3BB6A 4UFLA 1JYIA 1RHI1 1OOPB 2HBUA 4XOGA 3IDBB 3THDA 5C5UA 5IK8A 4E8DA 4NN0A 3MW2A 1XNCA 2XUMA 1STMA 4EN6B 1O3SA 1HQLA 4BIFA 1SCRA 2WFF1 4A41A 4YVSC 1DQ0A 4BMEA 3O0VA 2VU9A 2W1WA 3GXUA 4JQRA 1QJY3 1K12A 3GHMA 5FY0A 1FMD3 4QQHA 4XFHA 1B35B 3I97A 3BPSA 4LXLA 1SMVA 4A2UA 3ZDVA 3BPZA 5A6ZA 5IVVA 3CBNA 3LSEA 1LR5A 3Q8BA 1VJ2A 1VP6A 4K9SA 5EJ1B 2QZ2A 4I2OA 1CX1A 4S2DA 3CO2A 4XYXA 2GMMA 5C6CA 3KV5A 2JICA 3NSTA 2Q8OA 5JSPA 2VZPA 2A6VA 3ITQA 4N43C 1O4TA 1UU6A 2NPIA 3J4UH 4ZS2A 2FDFA 5I0UA 2JG8A 1BVP1 4HKLA 3RZMA 1DGLA 1W6NA 4IV1A 5FDBA 4WM8A 5FMOS 1LEDA 4J1XA 4E8CA 3I49A 4I0WB 4L99A 2WC2A 3ZX7A 5FPXA 4COVA 3VBHC 1Q5OA 2ADEA 4O9GA 4LQRA 1ZM1A 4TLFA 3LDRA 3AB0A 1Q43A 2PHWA 4UF0A 3J9SA 3W58A 1C8NA 4M4PA 3B9IA 4JGYA 4QX0A 4N9IA 1XSQA 4QDRA 3T1MA 2GNBA 5KC5A 4UFKA 4HETA 2W94A 4Q0SA 4Y26A 4XIKA 5FYUA 5K8SA 3GCWA 3WDXA 5BUVA 4KG8A 5C4WB 1NG0A 5C4WA 1S0DA 2Q8EA 3ZXAC 1PMHX 3OUJA 3N7JA 4Q4W3 1W6QA 3VBSC 5I0DA 5EQUA 1YFWA 1UXZA 3D5OA 1EV12 1WCQA 2P3YA 3A22A 1OLQA 3Q9OA 3RZZA 1O5UA 1MPXA 1OUXA 1X7NA 4Q5OA 1FAYA 2L9LA 5DXDA 1RUC1 4LHSA 5EWSA 1OHFA 1VRH1 4QX5A 2WL1A 4Q0VA 5D8AC 1GMMA 1UN1A 2NZ9A 3IBMA 4YW6A 4M3CB 4PDWC 2QUOA 3H7JA 4UXAA 1TQ5A 2DVAA 1SHWB 1H2NA 3M1HA 1JS9A 1F2NA 2B5HA 4H14A 1GYKA 1OPOA 1VBE1 4IEYA 1LHUA 4NR1A 1GP5A 3N9MA 1F4HA 4XXAA 5H9QA 4EQVA 4HL0A 1YWKA 1Z7S2 3DXTA 3PVOA 1I6XA 4FPEA 2HWD2 2E51A 1QJEA 3O7OA 3SKVA 5FPLA 1QXRA 4GB33 3VB9A 4BM8A 1W2TA 2VW0A 5FMBA 5F2SA 5L73A 1O4YA 1YNAA 5BNOA 1DU3D 5T5PA 3TB0A 2EXHA 2WR9A 3U4SA 5IVJA 1FPN1 1H2LA 3J7NA 5DABA 1T2XA 1RUD3 1FNYA 1WW4A 4A7KA 3N3HA 4CA9A 2E26A 1G9FA 3LEMA 1R091 4WVVA 1ASJ2 3HT2A 4FOVA 4YG6A 2Y6LA 4UT5A 5A3MA 3DCQA 5GLWA 1UMZA 1CESA 3ZOIA 4MXWB 4FTBA 1PMIA 4E4SA 5JPNB 3AK0A 5LZ6A 2GC1A 3U1XA 1Z0HA 2D44A 1K5JA 3TBDA 1BLZA 4JZRA 4Q4Y2 4FPLA 3ATGA 2B4KA 5M0TA 1C5HA 1JOPA 3AJYA 2VMCA 1VALA 5F6KA 1N3OA 5DDJ1 2ORXA 1AR83 3INAA 3M3IA 4FFGA 4YM3A 4SLIA 1MR5A 5FPZA 4ZU7A 1XYPA 1Q3EA 1PVC2 4Z92B 4HG6B 1AHSA 5FXZA 1NYWA 2RMU3 5DG1A 5H9SA 3C8XA 3NNGA 3UESA 3ZR6A 2A5ZA 5FZFA 4CP0A 5FZEA 3VBFB 1PZ9A 2WAAA 3V56A 4X8PA 1GWKA 4DXZA 3RRDA 2VZUA 4BHPA 2VPVA 1DLCA 2AH2A 1RUC3 4YG0A 2V09A 4CU8A 2KM2A 2ENRA 2OS2A 3WW3A 3D8CA 4A42A 4Y33A 2K46A 2WN3A 4PQ9A 5D21A 4BU2A 4JX0A 4M3CA 2IVJA 4AHXA 3NAPA 1MVQA 1QXPA 1GNZA 4MVTA 3POWA 4KBBA 3KB5A 4QKBA 1O7FA 3BIEA 3ZFEB 4ARYA 1WD4A 2K2SA 2JB8A 2Y60A 1LOAA 3UT0A 5EP9A 4KWKA 1ENSA 4LHKA 1HKDA 2R1BA 5DPNA 2A6YA 5JLVA 2WAOA 3JU9A 2ARBA 5CAZA 1XNBA 2E53A 3ETPA 2V4VA 3C2UA 2E9QA 4PLOA 3IT8A 2BDRA 3V0BA 4XFIA 1RC6A 4WM7A 4IEQA 5JPMB 3ZSMA 4QU2A 4AEDB 4URAA 2XBO1 1XNDA 5CVRA 3TWIA 1LAJA 4NWVA 3LE0A 2B9VA 5FZKA 3ST7A 4XFGA 5DUVA 4IEPA 1VMHA 3PDQA 4I01A 1ODNA 1ASJ1 2ET7A 4FPKA 4ISQA 2VGDA 5FYMA 4FVVA 3VBFA 5EJZB 4INDA 4RGAA 5I8YA 1HX6A 4XJZA 1OUSA 3VZOA 1QH7A 1W90A 3MIHA 1D0HA 3WCSA 3AMQA 3MBWA 4COZA 3LA7A 3ZPYA 1AR63 1YCIA 3WHTA 3N7MA 4MOAA 4CZSA 4CPBD 1LGNA 2Q8DA 5KXDA 1QNYA 4BLJA 2GN3A 5FYTA 3E5QA 3ZM8A 3OB8A 3KGLA 5FXWA 4N7UA 5GLUA 4WVMA 2GMEA 2ORZA 2CU5A 2P6HA 5FP3A 4C8DA 4Y1UA 4J25A 4LE3A 1UF2C 3N9LA 5FZ1A 2HWF1 2F6BA 3HAGA 2WBKA 2VQTA 2Z42A 4MHUA 1EAH3 1BBT1 4QQOA 4YW5A 1NE6A 3KF3A 3OJBA 4LBQD 3NNFA 4PBOA 1G9CA 5LK5A 1H2KA 2AR6A 2PAKA 4I0BA 2VMFA 4PDWB 3VZMA 4FXKB 1K42A 3NL1A 1MS8A 2PXJA 4MGQA 1EV13 5JZGA 2P5BA 2IZWA 1AYM2 1BK0A 3OEAA 4C0BA 3EJKA 3JUUA 4AQTA 2JDAA 5GZDA 2ZGKA 1WLDA 5FJHA 1OH4A 4MUVA 2F17A 5FPUA 3V0AB 3S5AA 1ZYBA 4AE2A 3AMHA 1UOBA 2QQUA 4IE5A 4IETA 5DQ0A 1DYKA 5ABJA 4S2FA 1HRI3 3ZFGA 4CSWA 2C9AA 3WG2A 4UW3A 4LBLA 2ARXA 1MQTC 4BLIA 2JDKA 4URTA 5LBFA 2WZR3 2RS13 2HEWF 2X53S 5HBAA 1PO22 2DURA 1MQTB 3OGGA 3PHMA 2HKXA 1EP0A 3PVBB 4GWIA 3QOPA 3T3YA 2WJSA 2GC3A 1WA4A 2JDZA 3KV6A 2DU1A 3IWZA 5ACA2 4DUWA 2R072 2VO5A 1AXKA 4N90A 5EPAA 4CYDA 2CGOA 2B46X 4UAPA 1ZZCA 4QU1A 4ZZ5A 1RTVA 4AWDA 2WABA 2QQIA 4XUPA 4IL7A 3RG0A 5GZEA 1QWRA 1GOGA 2D7FA 2W46A 4F3JA 2UWAA 2WYFA 4YG3A 5I91A 3PUAA 4GMP1 3CEWA 2QQPA 3DPRC 3I8TA 2Y0IA 5J7MA 1XE8A 4EYUA 4IE7A 2VBBA 3TN92 1IQDC 5EYXA 2VOXA 4LO6B 4MSVA 4NPMA 5FZMA 3FFQA 1ZRIA 2YB7A 4JGYB 2WS93 4N43B 4FFIA 4LBOA 4YGDA 5JZGC 4C0HA 2CDPA 3AP7A 5I93A 2VOVA 2WT1A 3ZIWA 4CCDA 1F5JA 3A7QA 1CPNA 2ZX4A 4BDVB 2LALA 3OPTA 4XJWA 2G1MA 3AKRA 4P9IA 1NE4A 1Y9QA 2FHRA 3I3BA 4JKMA 1AL22 1J3RA 5C3RA 3WVJA 3VDDA 2WRAA 4LO5B 1ST8A 2JDNA 2JJ6A 1ZBA3 4UFHA 2XLAA 2NP0A 1MEC2 4IESA 4K20A 1IHMA 3EBRA 3HD8B 4AI8A 1GOHA 1LGCA 3WEZA 3R4DB 4QMAA 4XFBA 2JXAA 5DUUA 2UURA 3OF1A 5CU1A 3E97A 3VL8A 4GAZA 1AL23 4XQ4A 1W9WA 1W28A 4AF9A 5FQ0A 3E6BA 4QPGB 4Y20B 4IV3B 4BQYA 5ACA3 1YYNA 1LGBA 2IXHA 1NLQA 2RS11 3AVSA 3DYOA 4HXCA 4YPJA 4BISA 5A3NA 2A3YA 3ZXDA 5BNPB 5I0SA 3CNAA 3IPVB 5KR7A 1K45A 4GULA 1JYNA 1L7RA 3KT1A 1LHNA 1R1A1 3VKNA 2RR13 2P6CA 3M3EA 5K4LA 4I02A 4PHZA 4JTNA 2VCMA 4IERA 2Q8CA 2D3PA 2EXKA 4HONA 4CUAA 3FFZA 4AI1A 5K0UC 3MLJA 2OUHA 2YU2A 4QB6A 2VQAA 3MHZA 2NYYA 5CFDA 1ASJ3 5A1FA 5C3OA 1JOBA 2VZRA 1W6PA 2HWC1 4MGZE 5IVEA 3HNYM 5AVPA 1O4ZA 3EB7A 4COUA 1HW5A 2ZEXA 3IDEA 1NCRB 3ZSJA 1OQ1A 2ZAAA 4YM1A 2B8MA 5A7PA 3ZXFA 4LA2A 3PUIA 2JDHA 2JG9C 4QXKA 4RR3B 5FIXA 1TMF1 5H9RA 4BWOA 4MX3A 1DQ1A 4LBQA 1PO23 2XH6A 1IQAA 2A73B 4LR4A 1TZOA 2VL4A 2Y64A 1VIWB 4XAEA 4QHOA 5DAQA 2NLRA 3FLTA 2VXRA 3LWCA 3M2MA 4JDNA 2PHLA 3ACFA 3GDBA 1SZBA 4XF9A 2VM9A 1GICA 4IGQA 4MV2A 4W4ZA 5K0UA 5T5LA 1N1TA 2QQOA 2WFPA 2J1TA 3ME2A 3PUQA 4QKNA 3IIIA 2ZGOA 5FR3A 2YDEA 3AYAA 2IXKA 3MPPG 3SCGA 4A4AA 4LKDA 2ZZJA 5CYYA 1WMFA 2RDSA 2IXCA 4W65A 4AR2A 2BPA2 4NOTA 2JENA 3VDCA 1E5RA 1XNTA 2XL9A 5FAXA 1ZNPA 1HB3A 4G9SB 5JOZA 1CJPA 3GM8A 3UV9A 1NZIA 1OF4A 2WSUA 4XIOA 2R32A 2DBIA 3LD8A 1OVPA 1YQ2A 4GMP0 4LHNA 3WF0A 1Q56A 1ZZ7A 1S0EA 4QX3A 3WSOA 2TBVA 1UIKA 1VBA1 3POGA 5EV7A 1W0PA 3JD71 3W59A 4HFSA 5FYBA 3N7LA 4GQ7A 3GYDA 3P5BA 1T6BX 2PAEA 3I2IA 3R0RA 4PQQA 2Z69A 3OGRA 5FWEA 2A75A 4AVCA 1GV9A 4BQ1A 3B01A 4IEXA 2R061 3UL2A 1NY72 2TUNA 3WCRA 5K0UB 1DG6A 2E32A 1ULFA 1X33A 4LLOA 2PHXA 3PIJA 1QIQA 5CBLA 1AR72 1WLCA 2RHPA 1O6UA 1LU2A 1RXGA 2BERA 4HVOA 4XMAA 4GMP3 2X05A 1DQ6A 4M0NA 3FZ3A 1NQJA 3IM0A 5FZCA 4CUCA 3B00A 3A0KA 5FY4A 4YZ3A 1CIWA 4KWJA 1RMU3 1YO8A 2RG4A 3UJOA 2Q30A 5FY1A 1KD7A 3UNPA 2YY1A 2ZMKA 1EY2A 1H1IA 5DG2A 1RJ8A 2BFUS 4CXYA 1DIWA 1CJDA 4PJYA 5KBFA 4LNVA 3LDKA 4K8RB 5KWRA 3O1PA 2DTWA 4YARA 3U37A 4I0AA 1AZDA 3PLQA 2KA3A 1RUF3 1IGOA 1AYN2 1FV2A 2CGNA 1X8EA 3WP4A 2BJSA 1HHNA 3GZUC 5DZEA 3VD4A 2XJUA 1AVBA 1UY4A
chains in the Genus database with same CATH topology
4MXWA 1U5XA 4YFWA 5LEJA 1BEV2 4L11A 4MGIE 2Z5WA 4UW4A 4KWLA 1J59A 1HRV1 3R4SA 1RHI2 4K21A 4RS5A 3WR0A 1ENRA 2D6OX 4LBQB 2GALA 3AMPA 2XL7A 1NOVA 1AR82 3H3UA 4R9BA 1FV3A 2AUYA 4FOQA 1OA2A 3O0WA 3NO8A 3JB4C 1RVF1 5FTTC 3DF0A 2UY8A 3LB9A 1IPJA 3PMSA 4FBFA 1RUD1 1U0AA 1G9BA 1GZWB 4PF5A 4JRLA 1LESA 1QQP2 3I54A 2DF7A 3ES4A 1ONAA 5C8WA 4DOUA 2KXLA 1DGRA 3AP6A 1CAWA 4XTMA 3TN91 1XNKA 1PGL1 1HV0A 1GBGA 2BUKA 4MYEA 5C8CC 4DY5A 1AR93 2R041 4LBMA 3WP5A 5JI7A 3ZSLA 2HYKA 4LO7A 1JH5A 1EAH1 1V6JA 4E4ZA 3KS7A 4YVWA 1EAH2 3TYJA 1GNHA 4LA3A 3UKTA 2VUJA 5SV5A 1VBB3 2EF6A 3BODA 4OFGA 3UKVA 2ZA9A 1H4HA 3AXEA 4SBVA 4R4ZA 4RD7A 5L36A 1KQRA 4YRDA 2ZGQA 3HBZA 2DFBA 1HQWA 1YIFA 2Q1ZB 4LBNA 2D6MA 3N4MA 4XBLA 5AFEA 3ETQA 4AGRA 4M00A 5AC92 2PHFA 2C0ZA 5J09A 3B9CA 4B29A 1QY4A 2D40A 4JCKA 2ZX0A 4ONUA 4WV8A 1HRV3 2VECA 4ATEA 3OBTA 1PK6B 1YJKA 3AJZA 5EFUA 4LEJA 3BCWA 4Q1PA 2RS31 4N53C 4EROA 5C33A 1ND3C 3TOJA 2DVDA 3POSA 4Q4X2 2R042 1S0IA 2XGXA 2D43A 4NO4A 1J1LA 2DUQA 2E7QA 1ULGA 1ZVFA 1CONA 4PCRA 1UPIA 3VL9A 5IT6A 1ULDA 4BYYA 1PZ7A 1VBC2 4XFFA 5F6LB 4OHVA 4JTOA 1FXZA 3VBOC 3AXDA 4HKWA 4Z2WA 4AFCA 1WLTA 2XBO2 2WQZC 3BTAA 1AR73 2NQYA 4HPKB 3ASIA 1AR91 2R043 5FO9B 1TME3 4AVAA 2VNGA 2H0BA 1G8WA 4Q1RA 1OA3A 5FO7B 4PLMA 1DHKB 2DCJA 2DVBA 2W39A 3E5UA 3SCFA 1RUE1 2GDFA 4P9LA 1X8MA 1VBB1 4A7YA 4Q4W1 4EV0A 3KQRA 4P9XA 3RDIA 2VVDA 4QPIC 3ELNA 3MYXA 4DB5A 3OGJA 4Y1XA 2EIGA 4HKOA 1R082 1H1MA 1S0CA 4R9DA 4XPVA 1PZ8A 5GJ6A 1UZZA 4H3WA 4YGEA 3MW3A 5E8AA 3ROUA 4K1YA 1AYN1 3I4IA 1EV11 3MIEA 4UBGA 4JRAA 2BW8A 1ZREA 2P2KA 3IKWA 3M3QA 4HMZA 3RQ0A 1BJQA 3MI8A 3VHRA 4D69A 4XFAA 2VVEA 2WNUC 1O5LA 2PN5A 1OQEA 5LK7B 2CAVA 3IN9A 4B7EA 4ZKTB 1G6NA 2D6NA 4YZ5A 4R9CA 1D2QA 2NMOA 5I8SA 2WZR1 4Y4YA 1IZ3A 2AZ5A 2W68A 1PHMA 3FWEA 4YGBA 4AQ2A 1SBFA 2B45X 3M4FA 1BYHA 2RE9A 4MZUA 1QH6A 5I8TA 5JOWA 5E1RA 2BFUL 5J98B 5HCAA 3H3ZA 1PVC1 2GZWA 1NXMA 2TNFA 1RUNA 4AEKA 3CU7A 2YROA 1AX1A 3DPRA 2BEOA 2BTVC 2D6KA 2CY6A 3B69A 4KL1A 3SNMA 2CTVA 4XQWA 1I1EA 2VMHA 5CIRA 2LTNA 3ZFEC 1C8M2 1BKZA 4NVPA 4K8FA 3ILNA 3BOWA 1V70A 2WFF2 2XWBB 5KHHA 4Q0QA 4WM7B 5GLVA 2ZGMA 2BVVA 1RUH1 4FPYA 3ZMOA 3L2HA 3AKTA 1OD5A 1LB2A 4PDWA 3THTA 3NV3A 4BE3A 1WCKA 1AL0G 1DLLA 3MIGA 1EPZA 1OFNA 4L92A 2WNVB 3CF6E 3QH6A 3VZJA 1C3HA 2I74A 4H7LA 3AYCA 2A6ZA 2RS32 1RMU2 1H30A 3VBOB 4YVWC 2D3RA 3BOPA 3M7AA 2OZJA 3PVEA 3VDDC 4OHWA 4XF4A 2A7AA 4OI2A 4Q29A 4AEMA 3H1WA 1QJX1 2XPJA 4LBJA 1E57A 1V00A 2XBO3 4LHLA 4XW3A 4NHLA 1WMDA 4MH0E 2FQPA 4GB31 1QXJA 1ENQA 5B2GB 3USUB 3EHKA 1X50A 4Y22A 1PIV1 2G9GA 1VBD3 4EJRA 4RL7A 1S55A 3ZFFC 1GSLA 3OBRA 1PK6A 3WG1A 1O3QA 3GALA 4IV3A 3AMNA 1LEMA 1WW5A 3WOGA 5C9AC 1VBD2 2DU0A 1HLCA 1O3TA 1V6IA 1A3KA 1ZBE2 1YLLA 3OD0A 5TSWA 5T52A 4Q4X3 4YVSB 5T3NA 3WHUA 1NCRC 1OSGA 3AP5A 3IIAA 3ZN6A 3KMHA 3V65A 1WCSA 3L9JT 1ZBE1 1V6NA 4XXPA 4AVBA 1GKBA 2ZMLA 5GLTA 3AFGA 1QNWA 3AFKA 3D0SA 4CDQA 2NN8A 1HQNA 5DZGA 4ASMB 4Y5Z0 4ZU4A 2WFF3 4FO9A 3VBUA 4V1PA 2PTMA 1BVVA 3N36A 4HN0A 2GC0A 1LCLA 4FTSA 2Q5TA 1GFF2 4F8AA 2ZX3A 3WQ1A 5GZFA 4P9JA 2WSVA 4I3GA 2EAAA 4FOYA 3TNPB 2GNMA 3VKMA 1FOD2 4GB32 4JGZA 4XFCA 3VBFC 1KRIA 2ZKLA 4YW2A 2VMIA 3D4KA 4UBHA 3RPQA 1I3HA 2EVXA 5GM0A 3ZYPA 2XVKA 3HN1A 5HCBA 3FE5A 1NCQC 2HJIA 4MGYE 4LTAA 5JOYA 2UYAA 3KCXA 4YM0A 2ZAHA 4B3NA 4OUMA 4FAGA 2UYBA 4XJ9A 2PAMA 4ORFA 4YW3A 1Z78A 3AP4A 4GWMA 4I3PA 2R30A 4JC1A 2BWCA 5EXOA 1OI6A 2AENA 2Q4SA 5T50A 1V9U3 4AFBA 3ZVXA 1QJX2 1EPWA 2P3KA 3I59A 4JGZC 4Y1ZA 3ZXEA 3JBG2 4B8EA 3CJIA 1ZBE3 1RMU1 2FZ1A 4RQPC 1W6MA 3VDDB 2OW4A 3VBUC 2HWF3 2CWMA 3JB8A 1CAUA 1H9WA 4CDXC 4AI2A 5JIUA 2R0FA 2H6BA 1VRH3 4QM8A 4OI1A 2WT2A 1G9AA 2DUOA 2PA7A 2F4PA 2W52A 1FMD2 2D6PA 2D98A 3ZXKA 2JEMA 1K5MA 4EN0A 3B94A 3LOBA 2Z79A 3WG4A 1RHI3 4N9HA 4IEZA 1IPKA 2GNTA 4YGCA 3X29B 2VVFA 1JW6A 2D5HA 1GZCA 4CEYC 2LM3A 4GWNA 4W6XA 2GSYA 5AC91 3G6JB 1R1A3 2ZOEB 2GU9A 1XXNA 4GKYA 1VB2A 3WD5A 4CEWA 1RUI3 1FPN3 4CP2A 1DQ5A 1H2MA 3ZFGC 3WDTA 4HSJA 3RI9A 1W6OA 2A3XA 4CDWB 1MQTA 4QPYA 4GIQA 1IKPA 1KJLA 3H1MA 4BZ4A 1R093 1YI9A 3QD6A 1ZBA2 3KT7A 2ZX2A 4HSLA 1W6PB 4RQPB 4XMIA 3U0ZA 4LT5A 2QNKA 2OIIA 2JECA 2P17A 4E2SA 2JE9A 3B7MA 3M8LA 4JAAA 2MHFA 2YMZA 1RIRA 1RJ7A 1OQDA 3MW4A 3HIFA 3OTFA 1IKQA 2GC2A 4BA6A 3C3VA 2I45A 2BQPA 2D3SA 3TN93 2OVUA 3RI8A 1JBCA 3SCHA 5J37A 3KCYA 1AXZA 1O91A 4QGLA 1F5FA 3ZXLA 1IOAA 1TNRA 2VW2A 2R062 1CAUB 2B39A 5F5QA 3V0BB 3GZTB 1H0BA 2XHKA 3VZLA 1QJU2 4P9YA 1A8MA 4RFT0 3AYEA 5D8AB 2FBEA 4XJ8A 2IXJA 1NA1C 2HEYF 1S1AA 2E7TA 4J1WA 2WZPP 3ACLA 1BZWA 4CEWC 2RM23 1V6KA 3DKWA 2CGPA 2X5IA 1WLWA 3WW1A 2CAUA 1PGW2 1JXNA 1KFXL 1D0GA 2K0GA 1C28A 3VBRC 1C1FA 3FX3A 4LULA 3ZFGB 1VBE3 1SBEA 3T2TA 1K5MC 1HRI2 1RUI1 2YZ4A 4AGVA 2IFWA 4IXLA 4BH9A 1UAIA 5F1RA 1DF0A 4Q0PA 4EWDA 3VBSA 4X6RB 1B35A 2SLIA 2YC0A 3GBFA 2CWSA 1XU1A 1MS9A 4QQ2A 4QQPA 5KHKA 1W6QB 5IUQA 1AR92 1CAXB 1F9KA 5IK5A 5JR7B 5J96B 1S0BA 4OI0A 3K48A 1A6CA 1GR3A 3SITA 1RINA 2JD4A 2ES3A 2VUAA 2WNVC 5FCCA 5JOXA 5DUXA 4L9BA 4M3CE 4TSVA 1LRHA 1AR71 2RS52 2B42B 3T1LA 4WBBA 1OKQA 5CA6A 3U4XA 1YHFA 4XHXA 1UD1A 3MICA 1JUHA 1RUG3 3AZXA 1A8DA 4I30A 1VB4A 3JQXA 2YUEA 4XF0A 3SH4A 4LUKA 2R49A 4OZXA 2YPJA 3NV1A 1FT9A 1NLRA 1Y7BA 1B09A 2MEV1 2G4IA 1UL9A 2VH9A 1VAKA 1RUH2 4HANA 2Y38A 3N7KA 4AGGA 1AYN3 5KHGA 1NA1A 2WS92 4WM8B 5KXEA 1N47A 2XJPA 4AYUA 1IS4A 1POV0 3IPVA 1H8TC 2E6VA 1U5IA 1VBC3 1SEFA 4ES8A 4FP3A 3ZXGA 2UWCA 1Q8OA 4Q4V2 2VMGA 2GH2A 1LULA 3VHPA 2JKBA 3MF6A 3SISA 3ZDSA 4DS0A 5EJ3A 3RMXA 4LLFA 4QGNA 1KXGA 3R05A 3AKSA 2GAUA 3A0NA 2HWF2 4IV1B 3ZN4A 1RITA 1N1VA 4EN7B 3M70A 4MXVA 4EN9B 3VBRB 1QKQA 1PVC3 2ZMNA 4G3YC 1T6GC 1L3JA 2EALA 5L7OC 1YI7A 3DN7A 4CDXB 4Q4X1 1N1SA 4CEWB 4M01A 4G4FA 4COWA 5EYYA 4U2AA 1DZTA 4IEUA 1C1LA 2OPKA 5FOBB 3VGIA 2P3IA 1WW6A 2FMYA 3WXPA 4R9AA 5GZCA 3OYWA 1CAVA 2DV9A 5T55A 3MFAA 3UK9A 3H7YA 4RGGA 1BCXA 1SACA 1PIV2 4FT8A 4FSJA 4OHYA 4W6WA 1POV1 3KM5A 2QE3A 4DINB 1S0JA 1F31A 2ERFA 4UW5A 2HWD3 4KQ7A 3NAPB 1UZYA 4Q8LA 1MS3A 4ZU5A 4TZDA 4FOWA 2H6CA 5GALA 5CNAA 4B7KA 4P9WA 4DRVA 4YFZA 1WCDJ 1NY71 1VBB2 1MS0A 1N3PA 4HPKA 3PJQA 5BNOB 3AMMA 3LGRA 4FPGA 4CDXA 1LOFC 1AYM3 1WGPA 4YVWB 3FLRA 5JMCA 3PNAA 1W6OB 2Q1MA 4CDWA 1AUYA 3RYPA 2EXIA 1QJU3 5LRSA 1QOSA 2QFEA 2BNNA 3QBQA 2BNOA 1DGWX 5BNQA 4YW1A 1IS5A 4PBPA 1RUJ2 4Q8KA 1H8VA 1FATA 1H9PA 3H1YA 3FUOA 1OFSA 1WD3A 1RUF2 2ZBJA 2RR12 5ABJB 1QU0A 1WMEA 1K5MB 2A3WA 5FFOC 2XLGA 2E7AA 1UKGA 5KC6A 4RS5C 1SFYA 4AFMA 3KGZA 2VOKA 4XDQA 2RMU1 3PVNA 5LEKA 2WS91 3MEPA 4AVSA 4WM8C 1LODA 1PO12 1YFUA 4LE4A 3SXWA 5JI9A 3GZAA 2VY0A 3E5XA 1HXS2 3AX4A 3AM2A 2XLFA 1BK1A 4QT6A 3GHNA 4HN1A 4YM2A 1LJ7A 4WM7C 1X36A 1QJZA 2ETEA 4BIOA 1UU5A 1Y43B 5CB7A 2YYOA 3JZVA 2K9ZA 4OI4A 2WNUA 3AP9A 5FLIA 1PNFA 2WINB 3WZ1A 3FBYA 4X6QB 2ZJCA 5JVVA 4KGGA 1LOBA 2VNOA 4YNIA 4AHZA 4RA0A 4AK3A 5A33B 1GANA 1NA1B 5AVAA 3FUQA 5C8CA 4A7ZA 4AG4A 2HWE2 1AYM1 1Y3TA 5ACA1 1JUIA 3OY8A 2DCZA 4E9KA 4COYA 4D7YA 3B93A 3KD4A 4WZCA 3LZZA 1VAVA 4Y1YA 3VLBB 1YUDA 1SFNA 2MEV2 4Y1VA 2IFRA 3QCWA 1LOFA 2HWE1 1PVXA 3VN4A 5BY5A 1RUD2 2HWC2 1YFYA 3M3CA 2B7YA 4CDWC 3HWJA 3AZVA 1GZWA 2TEPA 3JBG3 3EXUA 4JV4A 1XQNA 3ZFEA 1GZ9A 3RSJA 1H8TA 3VZNA 5K9YA 1FYUA 3ILFA 3WDWA 3U10A 2R073 4DMIA 2RS53 1REEA 4B4PA 4HT1T 4R52A 1UIJA 4HBNA 1J1TA 4XILA 3WX5A 4RS5B 5DDJ3 2RS12 1COV3 4AEDA 2E63A 2ZGUA 4TWTA 3L2YA 4C1WA 3FHIB 1V6LA 2ZPXA 1ZZ6A 1S0FA 1PM7A 1RL3A 3R4UA 1D4VB 3LSDA 3TRSB 5JDBA 2CL2A 1KS4A 3HT1A 3R6SA 3WP3A 3UKNA 5CFCB 2WWSA 1RGSA 4OVEA 1Q8SA 1QMJA 3VZKA 4QD2A 4F7ZA 3J8F1 5A33A 4NPRA 1VLNA 1D4M3 4YYOA 4HVRA 4AHWA 1VBE2 2ET1A 3WV6A 1MZFA 2I2SA 5BNPA 4J6GA 3NAPC 1SLCA 4AQSA 3QLQA 5A3LA 3TAYA 4E4DX 4FP2A 1UU4A 4AVTA 1R081 3JD73 4LO8A 3BU7A 2HWE3 1VBD1 4C1XA 4QPIA 5C9AB 5J48A 4S2GA 4E2QA 1ENXA 4GH4A 4Q4W2 1QJU1 2FMDA