3RG0A

Structural and functional relationships between the lectin and arm domains of calreticulin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
320
structure length
292
Chain Sequence
DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRSKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Relationships between the Lectin and Arm Domains of Calreticulin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
molecule keywords Calreticulin
total genus 70
structure length 292
sequence length 320
ec nomenclature
pdb deposition date 2011-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.250.10 Mainly Beta Ribbon Calnexin lumenal domain, non-globular proline-rich hairpin domain Calreticulin/calnexin, P domain 3rg0A02
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rg0A01
2ZMLA 4YZ4A 3IPVB 4FPJA 3AK0A 1MACA 1QOOA 1S0DA 3SITA 1S0IA 4YZ5A 1S0FA 3LCPA 3SH5A 1N1TA 3AP7A 5FRAA 5GLUA 2B7YA 4FPFA 1K9CA 3FUOA 2D6NA 5IK8A 3UJQA 3IM0A 1WUVA 2D44A 3INAA 1DYPA 1ENSA 4FPEA 4K20A 2WT0A 4DFSA 1DIWA 4M00A 2R0HA 2A6WA 3W59A 1LU1A 4AWDA 1S1AA 3ASIA 3ZXEA 4M01A 2ZGMA 3WDWA 1N47A 3AZWA 3IN9A 2DVGA 4XILA 3T1LA 1V6NA 2YV8A 2CY6A 3ZPYA 1N1SA 4R9BA 1VAMA 4CRQA 2ZHMA 3M2MA 1AXYA 1JOJA 1NLSA 3ZYRA 1C1FA 4FOYA 5T52A 1LCLA 1OKQA 1PZ9A 2PHUA 3WCRA 2ZACA 1MZ6A 2CTVA 5GZDA 1CESA 2JD4A 3ILNA 3V0BA 4M3CF 1LODA 4BMBA 4DRVA 2GNDA 1LOAA 4C1XA 4FOVA 4FPOB 4FPGA 4M3CE 4YW5A 3FUQA 1J1TA 3B9CA 4ATFA 1N3OA 3I8TA 2V5YA 1GNZA 5KXEA 2DV9A 4AVSA 2VW2A 1W6MB 4NOTA 2E6VA 5JMCA 1GYKA 3RS6A 2P3JA 3I4IA 3VV1A 4WZFA 3ZVXA 2ZA9A 1QNYA 3USUA 1MS3A 4YGDA 1Q8VA 1QU0A 2ZHKA 1Q56A 3AZVA 3AZYA 2E7TA 1WLCA 4XOGA 3SISA 4R9AA 3WNXA 2ERFA 3AFKA 2DWRA 2YROA 2A6XA 1VAVA 1U0AA 2A3WA 1QMJA 2AREA 2P3IA 4ITCA 1MS0A 4FQZA 4LBQD 5LK5A 3VUOA 1X50A 1SCSA 3AYAA 3POYA 3D6EA 1LHVA 2WSVA 2NMOA 4NO4A 2ZGTA 4U2AA 2BQPA 3WDYA 2ZBJA 1DZQA 1KRIA 1CVNA 5GZGA 2OUHA 1HHNA 3WZ1A 4FVVA 4FP3A 2JKBA 3A0KA 1H9PA 2AYHA 3IMNA 3V0AA 5GZEA 1KITA 5DUWA 1KDKA 1GSLA 2EAKA 1Y7BA 3GNEA 3OBRA 3AP5A 1CIWA 1WD4A 2A5ZA 5JOYA 1BYHA 4LBNA 2GALA 4PCRA 1DQ6A 2A6VA 4RL7A 2DYCA 1RINA 3WDUA 2NM1A 3AZXA 1AXKA 2WT2A 2PHXA 5T54A 1YXWA 4YG6A 4WVWA 3Q9OA 3WDVA 1GZWA 1CJPA 5GLWA 2ARXA 3JUUA 1UMZA 3HR9A 1UPSA 4UW6A 4XDQA 2A3YA 3O0XA 3CNAA 2A7AA 5GLTA 1CONA 2XB6C 1BQPA 3N7LA 2VW0A 2SBAA 1G9FA 1DQ4A 1WCSA 1S0JA 4YG0A 3WUCA 5GJ6A 3RMXA 1Z78A 1O4YA 3FFZA 1KJLA 4Q27A 1LHUA 4Y1VA 1WW4A 2OVUA 2A75A 2EXIA 2A6YA 3SH4A 2AGSA 1CR7A 3OBTA 3N7MA 4YW3A 1Z0HA 3T2TA 5T5LA 1S0CA 1W0PA 5H9SA 3PVOA 3WLUA 1VALA 4FOWA 4BPZA 1MS8A 3ILRA 3N3HA 3ZSLA 1V6JA 2C5DA 2DVDA 4DS0A 1N1YA 2ZGQA 4K1YA 4YGEA 3AXEA 4BM8A 1LTEA 1Q8SA 3WOGA 1LOGA 2AENA 4YM3A 1BZWA 5T5JA 1SLTA 1W6OA 2EXHA 1G7YA 2UU8A 1SLCA 2W68A 5GZFA 3UL2A 3B01A 4KBBA 1LU2A 2G4IA 1SLBA 2PHFA 4I30A 3AYCA 3ZYPA 3QCWA 1IS6A 4TZDA 2RHPA 1N3PA 1UL9A 1W6PB 2DU0A 2DUPA 3ZSKA 2UWCA 3AP6A 1R1ZA 4XMIA 3WG2A 1W6QB 2EIGA 5EYYA 5JLVA 4UW4A 2DU1A 2ENRA 3BTAA 2A3XA 1F5FA 1JYCA 2LALA 1V6IA 1DYKA 4BQ1A 4R9CA 5EYXA 2NP0A 3PJQA 1QDCA 2CNAA 3OY8B 4FPCA 3SH3A 3VKLA 3W58A 1GANA 3OYWA 5CB7A 4FOQA 1HDKA 5GZCA 4LBLA 3ILFA 4XBLA 2FMDA 4DPNA 3WDTA 1Q8OA 5CA6A 1GLHA 2D43A 2E51A 2CWSA 2GMEA 2CL2A 3ENRA 5HCBA 4BOWA 4XJAA 4YGCA 5T55A 4UW5A 5KXDA 4BMEA 4XJWA 5E89A 3AP4A 4AYUA 2DURA 1IKPA 4ATEA 3PVNA 5DUVA 5L73A 1F9KA 1LOBA 3AYEA 4FP2A 4YLZA 4MYEA 4P9YA 5DXDA 3KM5A 1ENQA 2GMPA 3UK9A 4CZSA 3O0WA 1QOTA 2YMZA 1W6NB 1WLWA 4PF5A 2ZGRA 1LULA 2R1BA 2V73A 3ZXLA 1WW7A 1YI7A 4Y20A 4XJ9A 4BLJA 2VU9A 2AR6A 3WCSA 3NV1A 2GNMA 1MS9A 1QOSA 3B00A 2CWMA 4YW2A 2GDFA 5BYNA 3RSJA 3LSEA 4YM1A 5DG1A 3ZSJA 1MS4A 2W08A 2OW4A 4PQ9A 1KDMA 1ULEA 4H55A 2DUQA 3GALA 3JU9A 2ES3A 1PZ7A 1JW6A 2P34A 4IQPA 4PBOA 2R1DA 4WVVA 1JN2P 1SACA 3AYDA 1IOAA 5GM0A 3M3CA 3ZSMA 1AVBA 4AGVA 4ZKTB 3RRDA 1HLCA 3ZXFA 1MZ5A 3PMEA 1G8WA 4GWNA 5DUXA 1ENRA 3N35A 4YG3A 4YZ1A 1YO8A 1UN1A 3O12A 4M3CB 2DTWA 5GLZA 2GN7A 3WDXA 4K1ZA 1W6PA 5HCFA 1LOFC 2NZ9A 3KQRA 1I1EA 1V6KA 1H30A 4Q8LA 4XTMA 4XBQA 2PHTA 2A70A 2PHRA 4LBMA 5CNAA 4XTPA 4U36A 4FPYA 4AVVA 4GKXA 2ZAAA 3B69A 1FX5A 2OUJA 2Q5TA 1SLAA 4Y22B 4ISQA 4Y1ZA 4YM2A 2PELA 1SBDA 3FLTA 5GALA 4YW4A 3IPVA 4FQ4A 4XJZA 2GNTA 1AXZA 2KM2A 4TYSA 1ULDA 1LENA 3APBA 1VLNA 1LEDA 3BOPA 4Q1RA 1G9BA 3V65A 2W39A 2ZABA 5T50A 1C57A 1F31A 3V0BB 2EF6A 1CPNA 2WJSA 1C4RA 3WHTA 1WBFA 4LBQB 2ZHNA 2ZZJA 3OPZA 3RQ0A 3WHUA 2SLIA 1OQ1A 1GV9A 2HYKA 2FHRA 1GBGA 5H9QA 3V0AB 2LTNA 1G86A 1H9WA 1LGCA 1QDOA 3VKNA 4F83A 1B09A 1N1VA 4PBPA 3O0VA 5DZEA 3AJZA 3BIWE 1S0BA 2XG3A 1LESA 3OGGA 4Y20B 1RITA 1IS3A 4SLIA 2VH9A 3TAYA 4ASMB 1JYIA 1YRZA 2YXSA 5T5OA 5DUUA 1NXD1 5IK5A 5JOXA 3M3QA 1VIWB 5H9RA 1FNZA 4Q2FA 1WW6A 1GNHA 1TEIA 3DUIA 3N36A 1O4ZA 2C9AA 4CTEA 2ZGOA 1QGLA 1ZM1A 2DVBA 1I3HA 1XQNA 1WW5A 2D3RA 5JVVA 3FLRA 4JRAA 4R9DA 1AX1A 3R05A 3B3QE 3IKWA 3M3OA 4HANA 4LBOA 1BXHA 4XZPA 1AX2A 1S0EA 1IS5A 1LECA 1APNA 3SNMA 3R4UA 2ZGLA 1DBNA 2E53A 4ISRA 4M3CA 1DLLA 3M3EA 1DFQA 5JOWA 1FATA 3L2YA 2P2KA 2R0FA 4FPLA 3HMYA 1AX0A 1WLDA 5HCAA 2WLQA 4Y26A 3POWA 1KQRA 2VUAA 3FLPA 2WT1A 2WSUA 1V6LA 2YY1A 4YW1A 3AP9A 4XXAA 1QF3A 2NN8A 1AJOA 4P14A 3T1MA 4K21A 4Y1YA 1UZZA 2H0BA 4JC1A 2DTYA 3MPPG 1MVEA 3O5SA 3OYWB 2VY0A 5JOZA 3HN1A 1DQ1A 3RMYA 1JXNA 2ZGKA 1QKQA 2UWBA 3NWKA 4XE9A 4Y24A 3VKOA 3AX4A 1GKBA 2VXRA 1LJ7A 1DQ0A 3N7KA 5IK7A 3M1HA 1YIFA 1SBFA 1W6MA 2ZGUA 4C1WA 1G9CA 4GKYA 4ZXKA 3A0NA 4XHXA 2D3PA 4LBJA 2D6MA 2NMNA 3POSA 4L8QA 3H0OA 1ULCA 1UZYA 1EPWA 3N7JA 1SLLA 3ZXKA 2P37A 2Z42A 4XIOA 4XYXA 5AVAA 1ONAA 1JBCA 1LOCA 3UJOA 2D7FA 1V6MA 1MS1A 4FPHA 1D0HA 1LGNA 4LBKA 1IKQA 1D2SA 2GMMA 1GICA 1OFSA 2D6KA 1LHOA 4FPKA 5DG2A 2D3SA 1S0GA 5F5QA 1Q8QA 2YZ4A 5KXBA 1FV3A 1SLIA 1JUIA 1SCRA 4Q26A 4BLIA 3NV3A 1RIRA 1PZ8A 3ATGA 2R16A 2ZGPA 2JDZA 2GN3A 1YYNA 5IT6A 1LOEA 5T5PA 5F9TA 2ARBA 4W65A 4Y22A 2ZGSA 3WG1A 3NV4A 1LHWA 1DQ2A 3U4XA 4UW3A 3QLQA 5CBLA 3WV6A 1W6OB 5DZGA 1N3QA 5H9PA 2WNEA 3A4UA 1DQ5A 3FBYA 2ZKNA 3USUB 3AXDA 1W6NA 3MW3A 2PHWA 3AJYA 1GZWB 4D69A 3WG3A 4YM0A 2DVAA 1UAIA 4Z8BA 3R4SA 2NYYA 2I2SA 5JDBA 4GALA 4XHBA 2D6LX 2DVFA 4OZXA 1G9DA 2R49A 2GNBA 4RA0A 1HQWA 2ZMNA 1URXA 1WBLA 3C2UA 3NV2A 1WD3A 1ULGA 1Q8PA 2DUOA 4GWMA 4WV8A 5IK4A 1V00A 1A78A 1HQLA 3PVEA 3RG0A 1DHKB 3TB0A 1QNWA 1LOFA 5IUQA 1AZDA 1LHNA 2JECA 2JE9A 4LBQA 3SLIA 4Y1XA 1UX6A 4HL0A 4AGRA 4Q1PA 1BJQA 2JJ6A 3DGTA 4XBNA 2A6ZA 5DZFA 2EXJA 1A8DA 3D4KA 2CYFA 2VW1A 4XXPA 3WVJA 1LGBA 1CQ9A 2D6OX 1LEMA 1A3KA 4XMAA 1ZA4A 4YFZA 2UURA 3LSDA 2AUYA 1SFYA 4Q8KA 2A71A 3D5OA 5E88A 3VKFC 1FV2A 2JE7A 3WG4A 4GA9A 1DGLA 4AGGA 5SV8A 1FNYA 5EXOA 3VKMA 1GZ9A 4YGBA 5EWSA 3MEPA 2E7QA 1UKGA 4P9XA 1SBEA 1GZCA 4XJUA 4YZ2A 1MS5A 2P3KA 1AJKA 4YZ3A 3WUDA 2TEPA 3MW4A 3ZXJA 4JCKA 1HKDA 1ULFA 5KXCA 3AZZA 2ZGNA 3V64A 3MW2A 5CAZA 4XJ8A 2D6PA 1FAYA 2WKKA 2W52A 3OJBA 2UWAA 4DRRA 1FYUA 2ZHLA 1W0OA 2EALA 3BODA 4DQAA 5E8AA 5FREA 3OY8A 1C1LA 1MVQA 1JHNA 4P9WA 1CPMA 1MR5A 2WQZC 1IS4A 1CN1A 4AVTA 4GXLA 1AF9A 1BKZA 1V6OA 4Y1UA 1G9AA 4XIKA 2AH2A 2EXKA 2ZMKA 5GLVA 1KJRA 1W6QA 4YFWA
chains in the Genus database with same CATH superfamily
1TME2 2JEMA 4YZ4A 3IPVB 3SH5A 5L19A 1IHMA 1S0IA 3OSDA 4MXWA 1MQTB 1PVXA 3VZJA 5IAXA 1N1TA 4HT1T 5FRAA 3VBRB 4N9IA 4LTAA 1YIPA 2HWE3 3FUOA 3EJKA 3FC0A 4QU1A 1CAXB 3FHAA 3UJQA 3BB6A 1B35A 5D8AB 5E1RA 1GMMA 4K20A 2G1MA 3ZX7A 3THCA 4JDNA 1PMJX 2R0HA 5FAXA 1GWKA 1S1AA 3U07A 1JZ2A 2RMU1 5C71A 3LFIA 1GOGA 2KD7A 3HOBA 4XILA 1V6NA 2JIJA 2CY6A 5K9YA 3RVHA 4BHPA 1AYN1 1JU4A 5LA1A 3ME2A 1NLSA 4KH9A 5F1RA 2E26A 1PZ9A 5KHJA 4AL9A 3JQWA 1Q43A 1VBA3 4QMAA 2CTVA 3WQ7A 5LA0A 1CESA 4RSUA 3IDCB 4AQ2A 5HXMA 1EUTA 2JENA 4DRVA 1LOAA 4C1XA 2ZAHA 4FPOB 5FZ4A 5HI0A 4RQPC 3TOJA 1J1TA 2XL7A 1N3OA 2XVGA 3QH6A 3HNBM 4YVSA 3UKVA 2V5YA 2B9VA 2QQJA 5KXEA 1JU3A 3WW4A 2XBO2 2FDHA 4BXSV 5IYYA 4Q0SA 2JIGA 2P3JA 5FYVA 1TQ5A 3RS6A 1X9TA 1F5JA 1PO23 3VV1A 3VBFA 5I8YA 4ZY9A 5DAQA 2GC1A 2YUEA 3FWEA 3WF1A 4NPLA 4N53C 1SPPB 2ZZQA 1Q8VA 4FBFA 1Q56A 4QGLA 1VBB1 5D1IA 1VMHA 1NA1A 1HW5A 1O91A 2ERFA 1QJY1 1RVF2 2Y6FA 4IERA 3DPRA 4GULA 4MGKE 5FQ0A 3AYAA 1S2BA 2J7MA 4GMP0 3VLBB 1LHVA 5A6QA 2NMOA 4U2AA 1W3XA 2BQPA 3J26N 2Q8EA 2YC2A 1DZQA 2DBNA 1QJU2 4IV1A 5DPNA 4Y4RA 4L9BA 1CWPA 5BV6A 1H9PA 2AYHA 2JDHA 4IDZA 4XDOA 1RUH1 1Z7S3 1KDKA 4E9KA 5D2AA 2EAKA 5CADA 4NIIA 2VQTA 4Q4Y1 3KSCA 2A5ZA 2V72A 3MI8A 4RR3C 1OA4A 4LBNA 1RHI3 1YFWA 4MADA 2XBO3 2A6VA 4RL7A 1AYN3 1RB8G 2QBXA 3H3LA 1XE0A 5IVVA 1W9FA 3N9PA 2QTWB 2TUNA 1ZBA2 4IW3A 2VM9A 4NHXA 1YXWA 2X29A 4WVWA 2VZ1A 4BWOA 2FZ1A 4FFHA 5GLWA 4K8RB 5A3OA 3WP4A 1UMZA 3RDIA 3HR9A 4E2GA 4NN0A 4RR3B 1C8M3 2VOWA 2CGNA 3E5XA 4XFCA 4BZ4A 3JBG2 3JQXA 3KVBA 4KWLA 4YWAA 3TEXA 4AHZA 4D6SA 1AUYA 2OYZA 2JG9A 3RMXA 4W6XA 2VOTA 1O4YA 4QPIA 1K5MA 1LHUA 3VZKA 1PIV1 2OVUA 4IEPA 4MGTA 4B4QA 4ASLA 2AGSA 4GH4C 4PIXA 1OUXA 2ET1A 2K2SA 4JQRA 3RI9A 1LRHA 3WLUA 1OLQA 5H9SA 5C8WA 3FX3A 4BPZA 1KGYA 1RUI1 3E5UA 1L7RA 1RUD1 4DS0A 1N1YA 1IPSA 5A3MA 4YGEA 3T2QA 1CIYA 5CZKA 3AXEA 3LEGA 3WW3A 3OD4A 4XQ4A 1LTEA 2GU9A 4BM8A 3WOGA 1RHI1 4IE0A 3VBFB 4BQYA 1FXZA 3FMGA 1XU2A 1NLRA 3LEKA 2EXHA 3NNLA 5T5JA 1G7YA 4LKDA 1SLCA 4GMP3 4F7ZA 1LU2A 2G4IA 2ZEZA 3NVCA 5IJRA 3K75B 3PTYA 2ORZA 4CDQC 1YQ8A 3ZYPA 3DXUA 3MFAA 5LASA 4AEDC 1J3QA 5LEKA 4NR1A 3P3PA 5C4WB 2D40A 1REFA 2VZTA 2WWJA 1VJ2A 3CL1A 1X82A 3ZSKA 5A3PA 2UWCA 4OLLA 4XMIA 1OXCA 1W3VA 5FZOB 3RZZA 1XRUA 2DU1A 5L9BA 3K4DA 4JGZB 5LK7B 1JYCA 1YJKA 2Y6JA 4Y4YA 1CZVA 2RVAA 3HJRA 4Q0QA 4I3GA 4UWDA 1UOGA 5FZ3A 3SH3A 4FPCA 3ORJA 1ZBE2 4H7LA 3OYWA 5L9VA 4KI5M 3C7FA 2W95A 4XUPA 1HDKA 5GZCA 4LBLA 2RDRA 3NJZA 4UFKA 2MEV1 3KV9A 5A80A 1EV12 5G05L 2D43A 2E51A 1OQEA 4F3JA 1DZRA 4V2VA 2O8OA 3RJ2X 2Z79A 1WCUA 4UW5A 2YC0A 5IW0A 4BMEA 4XJWA 2ZEWA 1D7PM 5E89A 2IVIB 3ACFA 3GF6A 4NHYA 5FUIA 2DURA 5ABJB 1FI2A 1RYYA 2HH9A 3POGA 2I07B 4MO3M 4S2GA 1RMU3 4QPGB 4Z2AA 2RM23 3GXUA 2VZUA 1F9KA 3AKQA 4D94A 1K42A 4FP2A 4CDUA 3NKGA 3UK9A 1PMIA 2OX0A 4AG4A 3G7DA 1W6NB 2VCMA 2QVSB 2R1BA 2V73A 4GQ7A 2FDIA 4Y20A 5C5UA 1NE6A 3ES4A 3I3MA 5A3TA 3Q8AA 4P5YA 1V9U3 2XQRA 2RJ2A 2BFUS 2BNOA 1YFYA 1ZBA3 1JOPA 4JDOA 2CWMA 4L92A 2W1QA 3LE0A 4LK7A 5FZGA 4COUA 3ZN6A 3TEYA 4QB6A 2OW4A 3RFRA 3BU7A 2WN3A 4LE3A 3GALA 2Y6LA 1PZ7A 2P34A 3WINE 4PBOA 3AVSA 4N8MA 2YDEA 5FY1A 1UY0A 4K3UA 4XFAA 2IFWA 1RMU1 2RV9A 3AYDA 3GDBA 4KWUA 5GM0A 5I0SA 4YVWA 5F3GA 4AGVA 4W6YA 3RRDA 2HBTA 3I2OA 3ZR5A 2X5IC 5HV0A 2Q1FA 1ZYBA 1W8WA 1ULPA 4IL7A 1ENRA 3N35A 5DUXA 1ZZ7A 4EROA 1YO8A 1UN1A 2QZ3A 3O12A 4LO8A 3K77A 1QWRA 4MOAA 1UX7A 4XACA 4CPBD 5HCFA 1ZBA1 2NZ9A 1ND2B 2G9ZA 2Y60A 3KQRA 3NAPA 4XTMA 5JSRA 5K7PA 5J37A 3VDDA 1PVC1 2PXJA 4OHZA 2PHRA 3UYJA 3OPWA 3NW4A 4GKXA 2CV6A 4GB32 2OUJA 4NRMA 4ISQA 1I6XA 4HXCA 2PELA 3MIEA 2VO5A 4YW4A 2WBKA 2PLV2 5JMOA 2HWF1 2HWC1 2GNTA 1OH4A 3N9NA 1XBFA 4RHV1 3GCWA 5IAVA 1L7LA 2VQAA 3SKVA 3ZXGA 1QH7A 3LZZA 3MO4A 4Q1RA 3MLKA 2Y0OA 4QQHA 1QHDA 4WM8B 4ZXEA 5T50A 1C57A 4OHVA 3WQ1A 2EF6A 2RR11 1GQHA 4MG2A 3WHUA 4AFBA 1GV9A 2FHRA 2BV4A 3CF6E 2XJTA 1WCQA 2Q4SA 1KEXA 4FTBA 5CFDC 2OS2A 4XW3A 1XSRA 4LA2A 2GP3A 1N1VA 3S6PA 3KV4A 3O0VA 3BIWE 3MF6A 1XYOA 4OUSA 4Y20B 5A70A 1IS3A 2N7GA 4LIUA 1EAH3 1JYIA 3ZFEB 3T0AA 5EPAA 4Q4W2 5DUUA 4CE8A 5BNOB 1L7QA 2QUOA 1TE1B 3POFA 1PK6C 1W8FA 4O65A 5H9RA 1PNGA 4P9IA 5FZBA 5CFCB 2HKXA 1GNHA 2WUHA 3DUIA 2OZ6A 2CGPA 4CTEA 3VL8A 2WZEA 5GKAC 1XQNA 1WW5A 2D3RA 5FMCA 3VBHA 2KR2A 4FCAA 3DV8A 4I02A 4JRAA 4AAXA 3BCWA 3M3OA 4HANA 1EPZA 4XZPA 4AVBA 3N9MA 1W9SA 2V4VA 4META 3VBUB 1UW8A 1CAVB 3R4UA 1HJFA 4CXYA 2ZX4A 4PDWB 3W20A 4OCTA 3KHCA 4YNIA 3WNMA 3KGZA 1ZBE1 4ZU5A 3SEEA 1DFQA 4P9JA 1UY1A 4FPLA 3A21A 3HMYA 1VRBA 3ST7A 4K40A 1OT5A 4XF0A 2GP5A 4GIQA 1H4GA 4RQPB 3ZIWA 4C8DA 2WT1A 2WSUA 2YY1A 4XXAA 4CA9A 1QJX1 3HN3A 4OHXA 4P14A 4K21A 5FYMA 5FPUA 4Y5TA 3MPPG 1MVEA 2RG4A 4E4ZA 1X9PA 5JOZA 1R082 1WMXA 4A3ZA 1US2A 5FYBA 4EN0A 1AR92 1ZA7A 3GHMA 2OQ7A 3RZGA 1JXNA 4NWVA 2B46X 1VBD1 3DYOA 4Y24A 2Z2SB 5FYCA 1WKYA 1GKBA 2Z4FA 1J59A 4KWKA 5BNPB 5IK7A 2YU1A 3I2HA 4C1WA 4CCOA 5FZMA 2AZ5A 1FMD3 4L8QA 4CVUA 5IVBA 2Y33A 1EPWA 3UKTA 4Q4X1 2RS33 2HEWF 4BCUA 1QJX3 2HWD3 2JDNA 3I49A 2ADEA 1LOCA 3UJOA 2WNVA 4COZA 1V6MA 5C9AA 1RMU2 4BXFA 1MS1A 2ATFA 4LEJA 3SCHA 4LBKA 5C8CA 1RUJ1 2GMMA 4AF9A 3W5NA 4DMIA 5FYTA 1LHOA 2WRAA 4FPKA 4CEWA 1PO11 4OHWA 3K51A 5F32A 5FIXA 2B39A 4CUCA 4XFGA 2CGOA 1NT0A 4ZS2A 4A7YA 5FOJB 5M0TA 4AHXA 2YZ4A 1FV3A 2XJSA 4RYDA 4ZPIA 1SLIA 5CG8A 2WFF1 1JUIA 1QXRA 1Y3TA 4YRDA 2BGPA 4BE3A 3ATGA 2R16A 1QJY2 1RVF1 3NNGA 3PUAA 1YYNA 1NXMA 1YWKA 1HXS3 4PDWA 2ARBA 4P08A 4ET7A 3MZHA 2RE9A 4LOTA 3EHKA 3BPSA 1W2AX 2HWC2 2ZGSA 2OPWA 3LOIA 3NV4A 1QQP3 3B7MA 1LHWA 1HRV2 4BQ2A 5FXZA 1W6OB 3CQOA 5DZGA 5H9PA 1GFF2 4E8CA 3MF9A 1W6NA 4MHUA 3MW3A 2PHWA 4B1MA 5FZKA 1I5PA 1RUH2 4QDSA 2DVAA 1UAIA 4MH0E 4YM0A 3USSA 5JDBA 4XHBA 2DVFA 4OZXA 2BWAA 4IV1B 5K0UC 1HQWA 1TNRA 4UAPA 2XKOA 3J9SA 3C2UA 4HPKA 1WD3A 2X53S 5IK4A 2YBSA 1QIQA 1HQLA 3RG0A 1DHKB 4QKDA 1QNWA 2X09A 1XSQA 1KXGA 4BQXA 3NAPC 1AZDA 2JECA 4LBQA 4MLOA 4BQ3A 4Y1XA 3RI8A 2JJ6A 1A8DA 4L99A 2VW1A 1HB4A 4XXPA 5BNNC 3VB9A 1UYZA 1LGBA 4UXAA 2D6OX 2XLAA 4CXXA 4YFZA 3ZFGC 2UURA 3I2JA 1X33A 3VBOA 4QX7A 5LBEA 1VE0A 4QQPA 2JE7A 1PIV2 4GA9A 3GZEA 1NY71 5EXOA 4YGBA 2VJXA 2AC1A 3MEPA 1JI6A 3HD8B 4JKMA 1GZCA 4XJUA 5FPLA 4YZ2A 2P3KA 4YZ3A 1DZTA 1RUC1 4XAAA 3LWCA 1W8HA 3VBSA 1WZXA 5AFBA 1HKDA 1AYM1 1D4M1 2VVEA 5J48A 1QXJA 2YU2A 2ZGNA 3OEBA 4IGPA 5FPBA 1AL0G 1FAYA 1UF2C 3VHPA 1AYN2 3ZO0B 2UWAA 3RWKX 4QXKA 1RHI2 2JB4A 3URFA 2IXIA 1C1LA 4P9WA 1JZ6A 2WQZC 2PHDA 1CN1A 5CKNA 3GBFA 2BTVC 4XBNA 2XHNA 2Y6GA 3GJBA 3DEMA 4GXLA 4JRLA 1W2OA 4XIKA 2VPVA 4WM8C 4CDXB 1KJRA 1UXXX 4WVZA 1PK6B 4YFWA 5FZOA 1DGRN 2GH8A 1GOHA 1HRV3 1R64A 2YG0A 5C8CC 1HX6A 2BOIA 1MACA 1QOOA 1Z7S1 4GH4B 5FZ1A 1OF3A 4S2HA 5FXXA 1S0FA 1TVGA 1VR3A 2RMU3 1HB2A 1DCSA 1NCRA 2V4AA 2AEYA 1BEV1 3AP7A 3N9OA 4MV2A 3ETPA 3VBHB 2W47A 5F39A 3PNAA 1H2KA 1VBE2 1ND2A 4S2FA 3LFMA 1QJZA 5FUNA 3VD7A 5I8TA 2D44A 2VVFA 3T0DA 5EP9A 3CLPA 3OTFA 1OBNA 4DFSA 1RUC3 1VBC2 4XCAA 3W59A 1LU1A 4AWDA 1JYTA 5FPVA 4EN6B 2YBPA 3WDWA 3ACGA 1EV11 4OI2A 2FQPA 5FP8A 1OD5A 3AZWA 2GZWA 2OXBA 3IN9A 2WZR1 1W99A 4AEDA 4R52A 2XONA 4CDQB 1IG3A 3NNJA 1N1SA 2ZKLA 5CVRA 1VAMA 4AE2A 1YQ2A 2ZHMA 1ZZBA 3M2MA 4CDXC 1JOJA 4IEOA 5J09A 3ZXAC 4CPBA 4Z07A 3FE5A 3FL7A 1RUG2 3HNMA 3WR0A 1RL3A 2ARCA 2JD4A 5FY5A 2Z5WA 1RJ7A 3ILNA 4M3CF 4BB3A 5C8CB 1E5RA 4BMBA 2GNDA 3HBKA 2R073 3U11A 3B9CA 3OCPA 3ON7A 5IWFA 3SEPA 4YARA 4XCBA 5JXJA 1RUD3 1COV2 2WNUC 4LHKA 4EQVA 5J3UA 2DV9A 4AVSA 2W2IA 1W6MB 4NRQA 4RD7A 3OPTA 4NOTA 2E6VA 3ACIA 4Y33A 1W2UA 5J36A 5ACA3 4S2DA 4WZFA 1H8TA 4OZOA 3TWIA 1QNYA 4MGSA 3USUA 5AC92 5IATA 5FP9A 2ZHKA 4CXWA 5FY7A 3WQ0A 4Q0PA 3SCFA 1UIKA 5D8AC 1WLCA 4XOGA 3WNXA 4PF1A 3FHQA 2DWRA 2A6XA 4KBZA 1C8M1 1QMJA 1PK6A 1GZTA 3JZVA 4ITCA 4PQQA 4WM7B 2JICA 1OLMA 2ZS6B 5CFCA 1PGSA 3BYWA 5FK7A 3H8UA 2VQUA 2VBPA 3T09A 3D6EA 4ZU4A 2WSVA 1IPJA 1JTZX 4CEYB 3EYPA 4N53B 2ZBJA 4X6QB 3WDYA 4X6RB 4E8DA 5FMOS 5A1LA 1U5IA 1KRIA 4AFAA 1CVNA 3CZUA 4FT8A 4MGQA 2OUHA 4AK3A 5GZGA 4FVVA 1YNAA 1RUI2 2JKBA 3H8RA 2XDVA 2PLV1 3KCXA 4JVAA 4LKEA 3W9AA 5GZEA 1KITA 1FPN2 4AAPA 4TXWA 4A6OA 2MHFA 2MEV3 2QQLA 3GNEA 2W0XA 4R4XA 3S30A 5BNQA 3M8LA 1NY72 3BPZA 3OGRA 1IG0A 2BW8A 4PCRA 4QDRA 1YC61 4NIHA 4NIDA 2X5IB 2DYCA 1RINA 2IXJA 3AZXA 5FKBA 1AXKA 2VMIA 4I2OA 1EAH2 3MV01 2PHXA 2IXHA 3WDVA 2YHJA 3FBMA 1ODMA 3NSTA 4GZ9A 2VUJA 3JUUA 3O7OA 4UW6A 1NCQB 1ULOA 1ZNPA 4XDQA 2A3YA 3O0XA 2A7AA 1UD1A 1OA3A 5GLTA 2XB6C 3N7LA 2VW0A 2SBAA 1G9FA 1DQ4A 1XJAA 3WUCA 4YG0A 1ZREA 5JZGC 1Z78A 4IV3C 4LA3A 3BTXA 1W04A 2WA3A 4QPIB 5FYYA 1GNYA 1WW4A 4C0HA 4QX0A 3O1PA 1RXGA 2A75A 2EXIA 1X8MA 4FI9A 1CR7A 3CMGA 3F2ZA 4YVWC 1DF0A 4YW3A 1HRI2 1Z0HA 1Z7S2 1XE8A 1NYWA 4P00B 4UT5A 5T5LA 3ZKYA 5FPXA 5E6HA 4FOWA 1WA6X 2VUDA 4XPVA 1MS8A 4XF1A 1GWMA 3LD8A 3THPA 5KR7A 4OMDA 4G9SB 1BK1A 1VBE1 4J1XA 2RS11 2WQ8A 4I0BA 3J7MA 2AENA 2RMU2 1BZWA 3DPRB 3H1WA 4QHZA 5DDJ3 5GZFA 1B35B 2IC1A 2RM21 2HBUA 5K4LA 2IXCA 4OYUA 1JZ7A 3KT1A 5F5AA 4Q4V2 2ZX1A 4C91A 1XNKA 3J7LA 4L97A 2DU0A 2P6CA 2VZQA 2WQ4A 3I3QA 5CYYA 2HWB2 4FXKB 2XVKA 3CBNA 5EYYA 1HN1A 5C33A 4IEVA 3J7HA 4UW4A 4CUBA 3RYKA 4QGMA 3HPNA 4E27A 3WF2A 4CU6A 1SFNA 2GC3A 1DYKA 4HG6B 4ARYA 2E7AA 1W8UA 3MV11 2BRTA 2LRPA 2PN5A 1PX4A 3H1YA 3OY8B 3VKLA 4OULA 4I01A 1HQNA 5CB7A 1OF4A 3M3IA 5CFCC 3CEWA 4M0HA 3ZDVA 2DBIA 1NQJA 2FMDA 2XJQA 3ZMNA 4DPNA 2JKXA 3KWVA 4Q4X2 3NMBA 3NL1A 2Q1ZB 2CWSA 3ENRA 2CL2A 4WM8A 2QQIA 5HCBA 3WF3A 4BOWA 3RNSA 5KHGA 5KXDA 4AR2A 3MFCA 3AP4A 3PUQA 5BY5A 1SMVA 1IKPA 3EO6A 1OH3A 5DMYA 3PVNA 4ZONA 3P6BA 5L73A 4GB31 1NUKA 1HV0A 2XJVA 4DZGA 4A7ZA 4MYEA 5LBBA 4QHOA 1EV13 1PGL2 4ZZ5A 1Y9QA 1DU3D 2YMZA 5F7UA 1YI7A 4RHV2 4XJ9A 1REEA 2NPIA 4C0BA 3WCSA 3NV1A 3NJXA 1LAJA 2GNMA 1VP6A 1DGRA 2VZOA 3B00A 4B1LA 5LBFA 3ZSJA 3BVCA 3U37A 1MS4A 2W08A 4PQ9A 1D4VB 1KDMA 1ULEA 2H6BA 4CYDA 4A4AA 2ES3A 2WC2A 4W8JA 4Q4Y2 4WVVA 3ZKUA 1SACA 2XHKA 2Q1MA 1FPN1 3PL0A 2C4XA 2GH2A 1IOAA 3ZSMA 5LRSA 4FFFA 4QT6A 3KT7A 1NOVA 5FK8A 1HLCA 1H2NA 3ZXFA 5FR3A 4IEQA 4IE4A 4PI2A 5LRRA 3UGHA 1G8WA 4QM8A 4E2SA 4YZ1A 1CAWB 3HVDA 4Z82A 4OVEA 3WDXA 2OPKA 3EXUA 5FYUA 3KCYA 1EAH1 1I1EA 3KMHA 3ZYBA 4Q8LA 1O3TA 4Q0UA 5C7GA 3D0SA 1SZBA 4DUWA 4HFSA 3RYPA 4LBMA 5CNAA 5FP4A 1RC6A 4U36A 4QQ2A 2VOXA 4OQ9A 2ZAAA 3B69A 4LT5A 2QE3A 4X8NA 4Q4W3 2WS92 5HCHA 4KG8A 5C70A 3DYPA 4P5HA 5GALA 4XJZA 2R072 1KD7A 3Q8EA 4KU8A 5KWRA 3MIDA 4BYYA 1LENA 4ES8A 2BDRA 4PLOA 2RDNA 2W1WA 4XQWA 2K46A 2Y6HA 1AL23 2BFUL 4A6SA 2R30A 2W39A 4P9GA 1XOYA 5DAWA 3V0BB 4RN5A 5J7MA 2Q8OA 1COV3 4IE5A 3WHTA 4DY5A 3NJYA 5JZGB 3UESA 4LBQB 2ZHNA 3RQ0A 5FJHA 3VL9A 4EV0A 2SLIA 1UZWA 3T3YA 1GBGA 1V0AA 5F6KA 3T30A 4NJ4A 3KV6A 1QJX2 1W39A 2RS12 3GGLA 3PIJA 2XUMA 3DECA 3VGIA 4OQ8A 1ZZ9A 2VZRA 2UY9A 4QWNA 5DZEA 1RUC2 1VBC3 5EZWA 3OGGA 1AYM2 1D4M2 1BVP1 2YXSA 1NXD1 2WAOA 3M3QA 4V2WA 2PAKA 4HONA 1PHMA 3RYRA 1T2XA 3CKHA 1FNZA 1AL21 4NIAA 1O4ZA 1AR93 5D8AA 3TYJA 1YQ6A 1ZZCA 1ZVFA 2ZGOA 1R083 5ANQA 3QH7A 3VBOC 2HWB1 1XNCA 3ZFGA 1F8VA 3HBZA 3MDPA 5L36A 1AX1A 4CP0A 1WCDJ 3B3QE 4ONUA 1YFUA 4LORA 4LNVA 2BWCA 1AX2A 4LIVA 1UKRA 5DABA 5FYZA 5BNNA 1IS5A 3IDAA 4XF3A 5F5IA 1QJU3 4LO4B 4BK5A 4IV3A 3IBMA 5JZGA 4CDUB 4M3CA 1DLLA 5FLJA 1SG3A 1FATA 4C90A 2I74A 4Y5SA 2P17A 1PO12 5J1XA 4B29A 5ABJA 3LQCA 1AX0A 4AVCA 5FMOL 3POWA 3E6CC 1KQRA 3KLSA 4INDA 2K0GA 2VUAA 4MX3A 5F3IA 3N9QA 2ZPXA 1AR62 3H1MA 1EUUA 3B9IA 2YGMA 3AP9A 5FY9A 1XC6A 1DP0A 5JAXA 3PUHA 1O3SA 1AJOA 3ZM8A 2XOMA 5FZIA 1VBC1 4Y1YA 3VD9A 2DTYA 3O5SA 3OYWB 3WX5A 2LROA 3EMRA 2WNOA 3CZJA 3LA7A 4DNYA 1ZRCA 3RMYA 1QKQA 2UY8A 2ZX0A 1Y43B 3NWKA 4XE9A 1UIJA 5E16A 3VKOA 3AX4A 1OURA 4A44A 4HVOA 1LJ7A 1AHSA 1UY4A 2B9UA 1OD3A 3GBWA 3N7KA 4LHLA 4JKLA 2ZGUA 5A7OA 1G9CA 2BERA 1H4HA 1QQP1 1UOFA 2PQSA 4LBJA 2VOKA 2NMNA 4GWJA 3NQHA 3WNNA 2BJSA 4YVSB 1DDLA 1GR3A 4XUQA 2P37A 1F4HA 3DF0A 1OSGA 2RDSA 3ETQA 1VBA2 3W21A 3BTZA 3ZYJB 1H2LA 1C5HA 2VTFA 2P6HA 4IUGA 4FPHA 3WD5A 3ZN5A 1F2NA 4DXTA 1Y9GA 3PHMA 1IKQA 1D2SA 1OFSA 3AFGA 4M0NA 4CEWC 3ELNA 5F2SA 2D3SA 2QKDA 3VDAA 3RZLA 4MGZE 5AC91 3AKTA 1GQPA 5C9AC 1H8TC 1UYPA 1VMJA 2ZTNA 3KF3A 4Q26A 4BLIA 4CP9B 4E4SA 1JZ3A 3NV3A 2VNVA 4GB33 4QU2A 2ZGPA 2GN3A 2HWF2 4QDQA 1CAVA 2WNUA 5T5PA 2CDOA 3OOXA 2BUKA 2RJKA 4B7EA 4QX3A 4AEKA 4Y22A 1JUHA 1W9WA 4EZ4A 1R091 4HETA 3WG1A 2JX9A 3VDDB 4CU9A 1LNSA 2J1RA 2QJVA 1W8NA 5F2WA 2D5HA 4UW3A 5A33A 3J7NA 3WV6A 1N3QA 2WYSA 2WO2A 2WNEA 3A4UA 1DQ5A 3USUB 3AXDA 2C6SA 4N43C 1VBD3 3AJYA 1TNFA 2DDUA 3RPQA 4HOOA 3HWJA 3R4SA 4HKOA 4Z8BA 2I2SA 5BPXA 3GJAA 4QQOA 3ZSEA 1UYXA 3U75A 3MLJA 5JWPA 2GNBA 3POIA 4IGQA 1JZ4A 3SC7X 3LPGA 3NV2A 3GM8A 5A7WA 1ULGA 4GWMA 2VNRA 2WO3A 4UOJA 1W8ZA 3PVEA 1RUE1 3GHNA 1IZ3A 4BJ0A 2YB7A 3SLIA 4ARXA 2RS52 4DO0A 1ND2C 1IQAA 5F37A 1FT9A 2CYFA 1NAEA 2JDMA 4J1WA 3B5LB 2AEZA 4QXHA 2K9ZA 2DCYA 1CQ9A 3DN7A 5K0UA 4PJYA 4XMAA 1A3KA 1ZRIA 1JZ8A 3LIGA 4UF0B 2OKXA 1XNBA 1H2MA 3AVRA 2JG8C 2XPJA 5LBCA 4AXOA 1W9TA 2LUWA 2QQWA 2WIIB 3VKFC 3WG4A 1DGLA 5CU1A 1GZ9A 2J1VA 2VXJA 4G4FA 4WVMA 1WMFA 4GAZA 1H6YA 1CAXA 1MS5A 1AJKA 3ABZA 3HQUA 2XH6A 3KS7A 3WUDA 3AKRA 1X7NA 3PUIA 1X36A 1ZBE3 4IGOA 5LA9A 5KXCA 2WZR2 3OUIA 2WS93 1UOBA 5CAZA 2D6PA 3D82A 3WNOA 1UWWA 2WKKA 2XJUA 4P9LA 3ROUA 3OJBA 3ZYFA 4DRRA 1FYUA 4QX5A 3BODA 5ACA1 4CDWA 2EICA 2VD7A 1SEFA 2VZPA 1MVQA 5KC5A 1U5YA 2W5FA 1CPMA 3VBSC 1RUE3 1IS4A 2B8MA 1YUDA 4AVTA 5LA2A 3MPBA 4MGIE 1VBD2 4NUBA 3VD3A 3MYXA 3R4DB 2TNFA 2ZMKA 1OLRA 4LULA 5B4NA 4Q4V1 4AQSA 1CGPA 1MZEA 3WXPA 4Z1VA 2ZMLA 3OF1A 5JR2A 2R041 1W28A 4XUNA 4AQ6A 2VAUA 3BGAA 3QBQA 2JDPA 1NKGA 4QX1A 3V56A 3A22A 5A3NA 4Q4Y3 5BNNB 5CG9A 4DEVA 5GLUA 2QQKA 3IIAA 4FPFA 1UPIA 4HSLA 2J1UA 2Y64A 5JR7B 5IK8A 3O14A 1W8OA 2VC9A 2TBVA 4JTOA 3PURA 4B3NA 3P5BA 1WUVA 2CU5A 1KFUL 1ENSA 1UYYA 3GZAA 4Y5Z0 1F4AA 2A6WA 4XAEA 4A7KA 1VPHA 4DINB 2W1UA 3AC0A 2LS6A 4RFRB 2ZGMA 5ACA2 5LCWL 4XZUG 3IT8A 3VBOB 2VBDA 3I2FA 5IVEA 5FZEA 2WFF2 2F6BA 2WL1A 2Y34A 2YV8A 3ZPYA 3J4UH 4XFIA 1C1FA 1MEC1 3ZMOA 4N90A 1LCLA 1OKQA 5KC6A 2Y0IA 3JBG3 2ZACA 1MZ6A 2EAAA 4NRPA 3ZOIA 5KHKA 1LODA 3F95A 3LDKA 2Y26A 4JHTA 1VRH2 2R043 3C3VA 3L2HA 1XNAA 2MPFA 2PLV3 3KHBA 4FPGA 4M3CE 4WVMB 3FUQA 3RWNA 2VZSA 4HPKB 5HV4A 4ATFA 4JV4A 3K46A 5I0UA 4Q29A 4IEZA 4LOSA 1MZFA 2VW2A 5A7QA 2VUCA 5FZCA 2ZJCA 5JMCA 1GYKA 5CIRA 2GSYA 4B8EA 2RS31 2RJLA 1NE4A 3LCPA 3ZVXA 4CUGA 2ZA9A 4IEWA 1CD3G 4LPLA 3IZOA 4NMIA 3VBHC 1M06G 2X8KA 1QU0A 1O8SA 3AZVA 2ILMA 3AZYA 3U14A 4AI3A 2OIIA 5IVJA 2E7TA 2OZJA 4XABA 1W0NA 3SISA 4R9AA 3AFKA 2YROA 4BISA 2FCTA 2NLRA 2A3WA 1U0AA 2P3IA 1VBE3 5LK5A 4LBQD 4B4PA 1MS0A 3IDBB 4FQZA 4D6QA 4EN8B 1RUE2 1PO21 1I5ZA 5CEHA 1XNDA 3PVBB 3POYA 5FTTC 3VD5A 2WNVC 1GOFA 4NO4A 2ZGTA 5C3RA 5A3UA 1RTVA 1HRI1 3CHXA 1H6XA 4V1PA 3S57A 1HHNA 1BK0A 2WZR3 2E31A 4FP3A 3HAGA 3A0KA 3WQBA 5A6ZA 4PI0A 3IMNA 5I93A 4DXSA 4XUOA 3OGJA 1YFXA 5DUWA 5EIYB 1GSLA 3ACHA 3N9LA 3OBRA 3AP5A 5KHIA 1WD4A 5JOYA 1A8MA 4I0AA 3KQ4B 2GALA 2WLPA 2VG9A 1DQ6A 1UXZA 2RM22 3BN6A 3WDUA 4AEJA 1GU3A 5C9AB 4AOCA 1LKNA 1E5SA 5T54A 1TG7A 4YG6A 2JXAA 2GC0A 2WYFA 4L11A 1GZWA 2WR9A 2ARXA 4AEMA 1OQDA 4QPWA 5LB6A 1UPSA 1ND3B 2ZCWA 3CJIB 3TRSB 1F15A 3CNAA 3VDDC 1CONA 1BQPA 2IVJA 2WZ8A 1WCSA 2BEOA 2R063 2C1FA 4LLOA 4URTA 5F6LB 4JX0A 3VBUC 5FDBA 3FFZA 4FSJA 1KJLA 3I59B 1AR83 4KG0A 2XLFA 3NO8A 4GJZA 4LO5B 4Q27A 1AL22 4Y1VA 2GC2A 1R1A3 4DUXA 3MICA 5F3CA 3SH4A 5DDJ1 3OBTA 5FZ7A 3W5MA 3T2TA 1FPN3 1DYOA 1KFXL 1O3QA 1W0PA 3PVOA 3M70A 1VALA 4QM9A 5FPZA 1ALYA 5FP3A 4RQPA 3ZSLA 5HXVA 2C5DA 2DVDA 1DLCA 1NQDA 3ZDSA 2W91A 3HEIA 4IE6A 1Q8SA 2HWE1 3LB9A 4NROA 1PGW2 3PU3A 1LOGA 4AI0A 3P3NA 1OA2A 4YM3A 5HPOA 1ZRRA 3B02A 4BDVB 2UU8A 2WA4A 3UL2A 3ZIXA 2FZ2A 4KBBA 2Q8DA 1PGL1 1RUH3 4I30A 1A34A 3AYCA 1QEXA 5CFDA 3QCWA 3SHRA 4TZDA 1S2EA 1AR61 1OHFA 1TME3 2RHPA 3K4ZA 4TSVA 3TN91 1BLZA 5JUVA 3NAPB 1RUG1 3JCIA 2DCJA 2JDAA 4JGYB 1LB2A 1H0BA 2HWC3 3AP6A 1R1ZA 1W03A 2JB8A 2V5DA 4HZFA 5EFUA 1B35C 1C8NA 3UGFA 2ENRA 4FXGB 5FZFA 2A3XA 5J98B 2LALA 4M4RA 1V6IA 5C3OA 2BYVE 1UNBA 1YLLA 3FHIB 4NHMA 4Q5OA 4ASKA 4BQ1A 1COV1 4EWEA 5EYXA 4EZHA 2NP0A 1WMEA 3PJQA 3SMHA 5FY8A 2BVBA 4FOQA 4XURA 4CCJA 4CEWB 3DPRC 5J96B 5LATA 2VZVA 3WDTA 4DEQA 1Q8OA 5CA6A 4Z92B 3CO2A 2GMEA 3ZYIB 1RXFA 3PLQA 3VBSB 4IE7A 1RUG3 4XFBA 5K8SA 3H3ZA 1NCQA 3Q8BA 4UFMA 4AYUA 4ATEA 1CJDA 3BALA 4LKSA 4RFT0 5T3NA 1LOBA 2O0OA 4W4ZA 5C3QA 3AYEA 4Q0VA 1O7FA 4YLZA 3KD4A 4D8MA 1ENQA 4LITA 3JD73 2OA2A 2OT7A 3O0WA 3N4MA 1WLWA 1W90A 2BNNA 4COYA 2BOJA 1DG6A 1QOSA 5LEJA 4ZHNA 1MEC3 5FMDA 2GDFA 2Q0AA 4XQDA 2QFEA 5BYNA 5DG1A 5BNPC 2ETEA 1XNTA 4F83A 2ADDA 4OUEA 2YFUA 5C4WC 4JQTA 2P5BA 2DUQA 2C24A 4QX2A 1GWLA 3JU9A 3Q8CA 1W2TA 1JW6A 5DQ0A 4IQPA 4CCDA 1O6UA 2IFRA 2QQNA 1JN2P 5KHHA 2VMHA 3OEAA 4QKNA 2HWB3 3RZJA 3O1VA 3M3CA 2AACA 2IZWA 4K8FA 3UNPA 2YYOA 3PMEA 2BBVA 3WNPA 4QXBA 3CIHA 4YG3A 3WNLA 4IV3B 2X10A 4N7IA 3WT3A 1SDDB 5GLZA 2GN7A 4EJRA 3I54A 1LOFC 3WP5A 1H30A 4B7KA 1JHJA 1ZRFA 3EB7A 4XBQA 2PHTA 3MHZA 2A70A 2DCTA 2WABA 5EHDA 1K5JA 4XTPA 5JXHA 4FPYA 3K48A 1ZRDA 1OUSA 3FN9A 4QX8A 2D97A 4FFGA 4O9GA 1FX5A 2FCVA 1QJEA 1SLAA 1CAUB 2Q5TA 4Y1ZA 3E6BA 1SBDA 3FLTA 5FY4A 4CCKA 3UKNA 1POV0 4BU2A 1POV1 3THDA 4FQ4A 3OBAA 4DUVA 3ZYGA 5JSPA 1AXZA 2BNMA 4TYSA 1ULDA 5FKCA 3C8XA 5DN2A 1JOBA 1VLNA 5FXVA 4LUMA 3UETA 2ZEXA 4UFJA 3T4HB 3V65A 3O1OA 2HYXA 3AB0A 2WZPP 3R6SA 4RGGA 3TBDA 2V09A 3BOWA 4L0PA 3OUHA 3I3BA 2WJSA 3CDZB 1CZTA 1C4RA 3WF4A 4QGNA 3OPZA 2HJIA 4ZU7A 3AKPA 4OHYA 3V0AB 4HK8A 3GZTB 1G86A 1OOPC 5C3SA 3U10A 3I2GA 2VE1A 4KNCA 3VKNA 1B09A 3U0ZA 1QXPA 3O1TA 4PBPA 2IWGB 3AJZA 5I8SA 1OKOA 4AZZA 1LESA 4ASMB 1E57A 4SLIA 4UFIA 2ET7A 5CKMA 2W3JA 3BUCA 1K45A 3HNYM 4NWWA 1O8PA 4EWDA 3LKJA 1WW6A 2VOVA 2PAEA 2C9AA 4EE2A 3H8OA 1TMF1 4Y3OA 1QGLA 2DVBA 3H42B 2CAVA 5JVVA 2R061 3R05A 3ZFGB 1WMDA 3IKWA 4BA6A 4LHNA 3FZ3A 3O1MA 3AM2A 1POQA 2YBKA 1LECA 1SQ4A 1APNA 4TLGA 1DGWA 3T2OA 2QQVA 2VTXJ 2VZ3A 1DBNA 2ZGLA 1KS4A 4QPIC 2E33A 3BTYA 4IEXA 2VMEA 4YVSC 1AR71 3GYDA 1GP6A 5JOWA 2P2KA 1XB9A 3SQOA 4XC9A 4QPYA 1NLQA 2YFZA 4YW1A 3VHNA 4W50A 1XXNA 3ZFFA 4QQLA 3E6DA 2WWUA 4CP2A 3PJYA 3T1MA 4R8HA 1UZZA 5SV5A 2BPA2 4AFDA 4LQRA 2OQ6A 1FMD1 2VY0A 1BBT2 3HN1A 3BKZA 1EY2A 1PVC3 3EBRA 3ITQA 5TSWA 3RGBA 1VB4A 3HT1A 2ZGKA 3E97A 2JDKA 3KF5A 2UWBA 1AR82 4HN0A 1CX4A 1R092 1UY2A 1RJ8A 1DQ0A 4OMCA 1H1IA 1O4TA 3MIBA 1YIFA 3S5AA 1MEC2 1W6MA 2H0VA 2VMGA 3THTA 2BGCA 2W94A 4PDWC 4ZXKA 1V9U2 2QNKA 3HIFA 2D3PA 2WAAA 2D6MA 3DYMA 2VMCA 3T2PA 1RUF1 4LMFA 3ZFEA 2Z42A 3M7AA 4IV1C 4XYXA 3ZXKA 5K0UB 1JYWA 1HJGA 3MIHA 4QXCA 3O1RA 4BQ5A 2RR13 4NE9A 5FLIA 3S7EA 2IXKA 1IGOA 3NKTA 3WW1A 4WM7C 4ZS3A 2D6KA 2DFCA 1WWYA 1S4CA 2XR4A 1S0GA 2RS51 4NHLA 3VZMA 2BBAA 4JGZC 4N53A 1Q8QA 1ST8A 1UZVA 4CEYA 1H1MA 5FO9B 2EIBA 5AVPA 2C26A 1VB2A 2WS91 4Q4V3 5FMBA 1RIRA 4PT6A 1PZ8A 1RUJ3 3HT2A 4URAA 1OOPA 4QPGA 2R071 3O1SA 1LOEA 5FYHA 4LO6B 3VDBA 4EWAA 1V70A 1AR73 3TEZA 1BVVA 1MQTC 4RS5A 5JSOA 5AFEA 2WO1A 4YPJA 5JXGA 2HWF3 5EJ1B 3U4XA 3QLQA 2BU9A 3G6JB 3DXTA 1GQGA 3FBYA 2ZKNA 3LF7A 4LJHA 3TNPB 2P1BA 3WG3A 4CDXA 1IPKA 3WNKA 3LAGA 4O9EA 2FDFA 2JE8A 4GALA 4D7SA 3DCQA 4OI1A 4KQ7A 5BNOA 3KZ4C 3VN4A 2R49A 3K4AA 2ZMNA 3PDQA 4OFGA 1URXA 1WBLA 4OI0A 3LGRA 3O1UA 2F4PA 3QD6A 5DDJ2 5DAXA 2JDYA 1O5UA 1A78A 4JKKA 5EJZB 3TB0A 1LOFA 3A7QA 5IUQA 1LHNA 2D5FA 2JE9A 2W1SA 1VRH3 1ODNA 1UX6A 2R042 4HL0A 4NPMA 5DZFA 2X05A 3H3UA 4XDPA 3OGVA 3WY6A 3IAQA 1R1A2 1NCRC 5I0TA 4ES9A 5I0RA 4RS5B 1LEMA 5I91A 1Y9MA 5B2GB 1ACCA 3ACLA 3LSDA 2G19A 5L9RA 4JZRA 1KS5A 2R062 1SFYA 4Q8KA 2A71A 3D5OA 2WFF3 3SCGA 3FJSA 5SV8A 2Z69A 4H14A 1EYBA 2A73B 3VKMA 4YYOA 3ZN4A 2P3YA 2QZ2A 1UKGA 2VR4A 5F5CA 4GWIA 1JODA 4XEZA 2TEPA 3ZXJA 3IMMA 4HN1A 4CCNA 1JYVA 3AZZA 1ENXA 3C7HA 4UFLA 4MXVA 1J3PA 4HK9A 2VMFA 1D0GA 2HWE2 3AMNA 5I0DA 2E32A 2VBBA 1W0OA 2CAUA 1OOPB 2EALA 1O3RA 4DQAA 1PO13 5FREA 3UGGA 5FYSA 2VL4A 4NAOA 1OMIA 1JHNA 3MLLA 3T08A 3MUY1 1W06A 4JGZA 1AF9A 1V6OA 2XLGA 1G9AA 2JWPA 1VRH1 4CCEA 2H0BA 3OB8A 3IWZA 5ANNA 3WF0A 4WM7A 3PTRB 3X29B 4AI9A 1BMV2 1QQP2 4LE4A 4FPJA 3AK0A 5FCCA 3L9JT 3LOBA 4HLTA 1S0DA 4FFIA 5C6CA 5L7OA 3SITA 4YZ5A 3I59A 4LO7A 1HXS2 2B7YA 1VBA1 1NZIA 1K9CA 4IETA 2D6NA 1QJY3 3ZFEC 4Z2WA 2YGLA 1RUD2 3QACA 3IM0A 1QY4A 3INAA 1DYPA 2HWD1 4FPEA 3KCCA 5FFOC 3S0MA 2WT0A 2XGXA 4I0WB 1FOD2 4NVPA 2Q30A 1DIWA 4M00A 1PM7A 4R4ZA 4CSWA 3ZXEA 3ASIA 4NIGA 4M01A 1N47A 1OVPA 1PO22 3JD72 2X5IA 2DVGA 2EIEA 4G3YC 4KGQA 2G9FA 4LK6A 3T1LA 4AI2A 2BP6A 2O1QA 4R9BA 4CRQA 4J25A 4BK4A 4E4HA 1AXYA 5FQ0B 3ZYRA 4FOYA 5FZ6A 3R0RA 5T52A 2CHHA 1AYM3 1D4M3 2PHUA 3E5QA 5B4XA 3WCRA 4UI9L 5GZDA 1NA1B 1VBB3 5FZ0A 5FZHA 1UO9A 3ZFFC 3V0BA 3S7IA 5FPAA 1RUOA 3B93A 5A3WA 1JMUB 4FOVA 2EA7A 1J84A 4YW5A 3BI3A 5IFPA 2XVLA 2VECA 3I8TA 3GBGA 1ND3A 4OI4A 1US3A 5FJKA 1GNZA 5CKQA 1R093 2B5HA 3ECQA 3IIIA 5FBZA 5A7NA 4K9SA 3NJVA 4CDUC 1CAUA 3I4IA 3JXSA 2CDPA 1CX1A 1STMA 1A6CA 2MEV2 2EVXA 4CUAA 3VBUA 4A41A 1MS3A 3LPFA 4YGDA 1HV1A 3VZNA 5IVFA 1WA4A 3H8XA 3VZOA 1C5IA 1OLME 1PX3A 1VAVA 5FLHA 2AREA 3VD4A 1RUNA 3VUOA 2W92A 1F35A 1X50A 1SCSA 1WCKA 3IDEA 5JXIA 1Q5OA 3AL5A 3VHRA 4XETA 4OUMA 3VDCA 4MGYE 1E5HA 2KXLA 4XFFA 3WZ1A 4HKLA 2QCSB 1JS9A 2JDUA 2UYAA 3GZUC 4BQ4A 3J8F2 4EN9B 3V0AA 2FDGA 1K5MB 1Y7BA 1PGW1 1CIWA 4AI8A 1G6NA 3C7GA 4PLMA 1BYHA 3H7JA 1PIV3 2BGOA 3LIHA 3LA3A 2G9GA 3WP6A 3BIEA 4AEDB 4CDQA 2XJPA 5KBFA 1CZSA 1NX9A 1ZZ8A 2NM1A 3AMPA 4PHZA 1UU5A 5FY0A 2FD8A 1U12A 4CCCA 2WT2A 1ZZ6A 1OPMA 3K3NA 1ASJ3 1LR5A 5C3PA 4GD4A 3Q9OA 3TN92 2PTMA 3OBZA 1CJPA 4TLFA 4XVHA 4AFMA 5A3LA 1VBB2 4NPRA 3MIGA 2I45A 1OC1A 2WDBA 2LW8A 5FOBB 1S0JA 2ZEYA 5GJ6A 3PUSA 4LR4A 5JI7A 1SHWB 3A23A 4N7UA 2QQOA 2J1EA 1BMV1 2A6YA 5FWEA 1K5MC 3PIGA 5FWJA 3N7MA 3E1F1 2JG9C 3PU8A 2J42A 1S0CA 2ARAA 2XUEA 4GJYA 4FAHA 1ASJ1 4M4PA 3N3HA 3ILRA 2ZXQA 4D0QA 4J6GA 5A7PA 1V6JA 2H6CA 4JDMA 4EYUA 3NNMA 2ZGQA 4K1YA 4COWA 1AR63 2JD9A 1HB1A 3MBWA 2FBEA 4L2NA 2ID4A 5BNPA 4AHWA 1SLTA 1W6OA 2IXLA 1AR72 2W68A 4KL1A 1W2NA 4UYBA 3ZXDA 3B01A 1REDA 3JB8A 1SLBA 1T6BX 2PHFA 2FMYA 3VBRA 2R6QA 3JD71 4AFCA 1IS6A 3ALQA 3AKSA 3PMSA 4RR3A 4Q4W1 5EV7A 1N3PA 5ISLA 3UT0A 4JTNA 1UL9A 1W6PB 2DUPA 3M4FA 3WG2A 4GMP1 1W6QB 2EIGA 5JLVA 2VCCA 3CJIC 2IUWA 2FDJA 2P4EA 3JBG1 3BTAA 5A7SA 1F5FA 2C9KA 4HKWA 2O14A 1XE7A 4R9CA 4CCLA 4DXRA 2GAUA 1RGSA 5JPNB 2VNOA 4AI1A 4XUTA 1E5IA 1QDCA 2CNAA 2W46A 3NRUA 5FBJA 3W58A 1GANA 1I9RA 1V9U1 5L7OC 1WGPA 3ZR6A 2RS32 3I2DA 3ILFA 4XBLA 5IVYA 4IEUA 5LW9A 2WO7A 1GLHA 3TN93 2VNGA 4XJAA 4YGCA 5T55A 1UMHA 1C3HA 1YEWA 3CJIA 3OGSA 1YCIA 2B45X 5DUVA 3T4VA 3VBFC 3RZMA 4EN7B 5A32B 4F8AA 4CDWC 4WBBA 4H2AA 4P9YA 5DXDA 3KM5A 2GMPA 5A32A 1IQDC 5JI9A 4CZSA 2LM3A 1QOTA 3MUZ1 5FP7A 1R081 4PF5A 2ZGRA 1LULA 3ZYHA 3ZXLA 1ND3C 1WW7A 2CSGA 4FO9A 4KU7A 4BLJA 1POV3 2BVVA 2VU9A 3ZLIA 2AR6A 4X8PA 3WP3A 3MGUA 5JIUA 4HBNA 5HBAA 3HQXA 1MS9A 2R7EB 4YW2A 1HB3A 4CCMA 5A6XA 3RSJA 3LSEA 2WN2A 4YM1A 1BHGA 4H55A 1GP4A 3S5QA 2HLEA 4A42A 3KB5A 3LDBA 4PIZA 2R1DA 5FO8B 5CISA 4KWJA 1WLTA 2XMLA 4MZUA 2D93A 4A2UA 4LXLA 1AVBA 4ZKTB 1SDWA 1RUI3 1UCXA 3EQEA 5IVCA 3CJXA 1MZ5A 3D0JA 4XF9A 3U1XA 4AHYA 4GWNA 4K7JA 4AW7A 5DAVA 1S2KA 4M3CB 2DTWA 3KT4A 5LY2A 4CP1A 2XQXA 5AC93 4K1ZA 1W6PA 1JYNA 2QQPA 2ORXA 1HIXA 1XYPA 1V6KA 2XL9A 5FO7B 5FUPA 5IFTA 1OFNA 1TZOA 2JG9B 1H8TB 5A33B 2KA3A 3MIFA 4BIOA 2YC4A 1J83A 1QJU1 1SPPA 2O8QA 4UBHA 4AVVA 3CU7A 2VTXA 3LA2A 5D21A 4HMZA 4B4RA 4Y22B 5BNOC 4YM2A 4DY3A 1GP5A 2PQQA 3I2IA 4PLNA 4HSJA 4YSFA 3IPVA 1VAKA 2KM2A 1RUF3 3APBA 4YVWB 2DF7A 1QJFA 3KGLA 4HVRA 5FV3A 4NAMA 5A1FA 2J1AA 1LEDA 3GCXA 3BOPA 1OI6A 4JAAA 4XFHA 1R1A1 1G9BA 2ZABA 3KVAA 1F31A 3LEMA 2HEVF 1CPNA 2Y38A 1WBFA 3I3EA 2ZZJA 4SBVA 1UQXA 1OQ1A 2HYKA 5FZ8A 5H9QA 4LUKA 2LTNA 5F3EA 1U5ZA 2J22A 1H9WA 2YPDA 1LGCA 1QDOA 1D2QA 5FXWA 1TMF3 4I3PA 2RS13 3VBRC 2RS53 4D6RA 4A45A 1FMD2 1ZX5A 3LEIA 1BBT1 4A3XA 4D7YA 1FOD3 4W6WA 4E4DX 4MVTA 1S0BA 5LY1A 2XG3A 2VGDA 1Y4WA 4KMQA 1RITA 1K12A 3TAYA 2VH9A 3Q8FA 1YRZA 2PHLA 5T5OA 3VHOA 5IK5A 5JOXA 1VIWB 4LLFA 2PYTA 3WSOA 2B42B 4Q2FA 1TEIA 2EIDA 2J1SA 3N36A 2QQMA 4UF0A 1PVC2 5FZLA 4ORFA 4QHBA 5JCTA 1ZM1A 4CU7A 1I3HA 1RUF2 1NCRB 1YI9A 3POBA 3FLRA 1JH5A 4IEYA 2Y8KA 2F4LA 4R9DA 4FTEA 3I7DA 2W9XA 4GH4A 4LBOA 1BXHA 3P1IA 2J1TA 1S0EA 3H9AA 4MXWB 4K6BA 1X8EA 3SNMA 4WZCA 1P8JA 1C28A 2NQYA 2E53A 4ISRA 2WWSA 3DKQA 1CAWA 1S55A 3M3EA 5BXXA 3L2YA 4AVAA 2R0FA 1U5XA 1NZCA 1XU1A 2DCKA 3UV9A 3VZLA 1WLDA 4HVQA 5HCAA 1HN0A 2WLQA 1PNFA 2BZDA 4Y26A 2PAMA 2ZX2A 4MSVA 1RVF3 3FLPA 3QOPA 4LKFA 1V6LA 4D7TA 1QF3A 4FAGA 2JG8B 2NN8A 2QDNA 3OD0A 3TNQA 3H7YA 2D98A 1FOD1 2PA7A 4JC1A 5IHRA 2DFBA 3DL3A 4QB1A 4FTSA 5FZ9A 5DAPA 3AMHA 1DQ1A 2F17A 4BH9A 1UU6A 3OUJA 4P02B 1L3JA 2Q8CA 1TME1 1UZ0A 2C0ZA 3TEWA 3I3DA 2VXRA 5EJ3A 5ABJC 2WNUB 3LDRA 3M1HA 1JYXA 1SBFA 4I09A 4GKYA 3ZPOA 2HEYF 2Y6KA 3A0NA 3C7OA 1BEV3 3DKWA 1J3RA 4XHXA 4JGYA 3POSA 3D8CA 3H0OA 1OVSA 1ULCA 1UZYA 3N7JA 1SLLA 4N9HA 4RHV3 4COVA 3I97A 3C7EA 4XIOA 5AVAA 4MUVA 4RGKA 4TN7A 1ONAA 2FDKA 1BEV2 1JBCA 4ZZ8A 3AMQA 1W9YA 2D7FA 2ZOEB 4DB5A 1T6GC 1D0HA 3RJRA 1LGNA 2VCAA 4BQWA 5JPMB 1SFPA 1GICA 4IXLA 4O7XA 2XWJB 1NA1C 5DG2A 5FZDA 3ZFFB 4Q4X3 1O5LA 1PMHX 5A7WB 2DCZA 3FFQA 5F5QA 3B94A 1J1LA 1YHFA 1GUIA 5KXBA 3J8F3 2ZX3A 3T0BA 1PM4A 1SCRA 3U4SA 1Q3EA 4O61A 2XKPA 3NNFA 1H1AA 2UYBA 4H3WA 3IB3A 5JIAA 1OPOA 1UMIA 3AL6A 4CDWB 3POEA 4DOUA 2JDZA 3KV5A 4QKBA 3JB4C 4JGYC 4YW6A 5IT6A 4H7MA 5F9TA 1J58A 1AR91 3AMMA 5CFDB 4W65A 4DIQA 3ZN6B 2WINB 2A1XA 2L9LA 4DXZA 2VCBA 1BCXA 1DQ2A 5CBLA 2XBO1 1O59A 3H50A 4AQTA 3OG2A 3U78A 5L7OB 3K2OA 3J8F1 1GZWB 4IESA 1W8TA 4D69A 2JG8A 3IAPA 1UOJA 4UFHA 2NYYA 4XF4A 5FZAA 1UU4A 4CP9A 3RZHA 2D6LX 1G9DA 2QQUA 4RA0A 1VMFA 4D3WA 2VQ0A 5ERLA 4WV8A 1Q8PA 1M4WA 2B4KA 1RUJ2 2DUOA 2WFPA 1V00A 2VULA 2PMWB 2R32A 4QKFA 4QD2A 1XYNA 4RGAA 1C8M2 4YW7A 1H8VA 4BIFA 2PFWA 4AGRA 5EQUA 4QAWA 1MPXA 1BJQA 1HRI3 1TMF2 2WNVB 2A6ZA 3DGTA 2EXJA 4Q1PA 3D4KA 2QDRA 3SKJE 2FCUA 4CU8A 5G04L 3D3AA 5BUVA 4KGGA 3WVJA 1NG0A 4E2QA 3K3OA 4TWTA 3WEZA 5APAA 1HXS1 1K3IA 1ZA4A 2W87A 3RZKA 2RR12 2AUYA 4UBGA 4N43B 3POJA 3BU0A 2XXZA 5E88A 4N43A 1FV2A 4JHZA 4AGGA 2HWD2 3SXWA 1XPWA 4MHRA 1FNYA 1UY3A 5EWSA 5C4WA 1YJLA 5FYIA 2E7QA 4P9XA 1SBEA 1HRV1 2VMDA 3ES1A 4QB2A 5LZ6A 5A1AA 4PIYA 3MW4A 1ASJ2 2YPJA 4JCKA 5C5TA 1ULFA 1MQTA 4RS5C 1EP0A 5F8PA 2E9QA 1DGWX 3V64A 3MW2A 3WW2A 4LHSA 4XJ8A 3I2KA 4NHKA 2W52A 2E63A 4QPGC 1QH6A 2XWBB 1YQ5A 1YQCA 2ZHLA 4TTGA 2MNGA 5LWBA 5E8AA 2VVDA 3OY8A 1BBT3 1MR5A 1W05A 4CEYC 5A6YA 1JZ5A 1NCQC 1AR81 2XJRA 1BKZA 2RDQA 4Y1UA 3HQRA 2AH2A 2EXKA 5GLVA 1W6QA
chains in the Genus database with same CATH topology
1TME2 2JEMA 4YZ4A 3IPVB 5L19A 1IHMA 1S0IA 4MXWA 1MQTB 1PVXA 3VZJA 1N1TA 4HT1T 5FRAA 3VBRB 4N9IA 4LTAA 1YIPA 2HWE3 3FUOA 3EJKA 3FC0A 1CAXB 3UJQA 3BB6A 1B35A 5D8AB 5E1RA 4K20A 3ZX7A 4JDNA 5FAXA 2R0HA 1S1AA 3U07A 2RMU1 4XILA 1V6NA 2CY6A 5K9YA 4BHPA 1AYN1 3ME2A 1NLSA 4KH9A 5F1RA 1PZ9A 5KHJA 3JQWA 1Q43A 1VBA3 4QMAA 2CTVA 3WQ7A 1CESA 4RSUA 3IDCB 4AQ2A 2JENA 4DRVA 1LOAA 4C1XA 2ZAHA 4FPOB 5HI0A 4RQPC 3TOJA 1J1TA 2XL7A 1N3OA 2XVGA 3QH6A 4YVSA 3UKVA 2V5YA 5KXEA 3WW4A 2XBO2 4Q0SA 3RS6A 2P3JA 1TQ5A 1F5JA 1PO23 3VV1A 3VBFA 5I8YA 2GC1A 2YUEA 3FWEA 4N53C 2ZZQA 1Q8VA 1Q56A 4QGLA 1VBB1 5D1IA 1NA1A 1HW5A 1O91A 2ERFA 1QJY1 1RVF2 4IERA 3DPRA 4GULA 4MGKE 5FQ0A 3AYAA 1S2BA 4GMP0 3VLBB 1LHVA 2NMOA 4U2AA 2BQPA 3J26N 1DZQA 1QJU2 4IV1A 4L9BA 5BV6A 1H9PA 2AYHA 1RUH1 1Z7S3 1KDKA 4E9KA 2EAKA 5CADA 4Q4Y1 3KSCA 2A5ZA 3MI8A 4RR3C 1OA4A 4LBNA 1RHI3 1YFWA 2XBO3 2A6VA 4RL7A 1AYN3 1RB8G 2TUNA 1ZBA2 1YXWA 2X29A 4WVWA 4BWOA 2FZ1A 5GLWA 3WP4A 1UMZA 3RDIA 3HR9A 4E2GA 4NN0A 4RR3B 1C8M3 2VOWA 2CGNA 3E5XA 4XFCA 4BZ4A 3JBG2 3JQXA 4KWLA 4AHZA 1AUYA 2OYZA 2JG9A 3RMXA 4W6XA 1O4YA 4QPIA 1K5MA 1LHUA 3VZKA 1PIV1 2OVUA 4IEPA 4B4QA 4ASLA 2AGSA 4GH4C 4PIXA 2ET1A 2K2SA 4JQRA 3RI9A 1LRHA 3WLUA 1OLQA 5H9SA 5C8WA 3FX3A 4BPZA 1RUI1 3E5UA 1RUD1 4DS0A 1N1YA 5A3MA 4YGEA 3AXEA 4BM8A 3WW3A 3OD4A 4XQ4A 1LTEA 2GU9A 3WOGA 1RHI1 3VBFB 1FXZA 3FMGA 1XU2A 1NLRA 5T5JA 2EXHA 1G7YA 1SLCA 4GMP3 4F7ZA 1LU2A 2G4IA 3NVCA 3PTYA 4CDQC 3ZYPA 3MFAA 4AEDC 1J3QA 5LEKA 4NR1A 3P3PA 5C4WB 2D40A 1REFA 1VJ2A 3CL1A 1X82A 3ZSKA 2UWCA 4OLLA 4XMIA 3RZZA 1XRUA 2DU1A 4JGZB 5LK7B 1JYCA 1YJKA 4Y4YA 4Q0QA 4I3GA 3SH3A 4FPCA 1ZBE2 4H7LA 3OYWA 1HDKA 5GZCA 4LBLA 3NJZA 2MEV1 1EV12 2D43A 2E51A 1OQEA 4F3JA 1DZRA 2O8OA 3RJ2X 2Z79A 4UW5A 2YC0A 4BMEA 4XJWA 5E89A 3GF6A 2DURA 5ABJB 1FI2A 2I07B 4S2GA 1RMU3 4QPGB 2RM23 3AKQA 1F9KA 4D94A 4FP2A 4CDUA 3NKGA 3UK9A 1PMIA 4AG4A 3G7DA 1W6NB 2QVSB 2R1BA 2V73A 4GQ7A 4Y20A 1NE6A 3ES4A 1V9U3 2BFUS 2BNOA 1YFYA 1ZBA3 4JDOA 4L92A 2CWMA 4COUA 3ZN6A 2OW4A 3BU7A 4LE3A 3GALA 1PZ7A 2P34A 3WINE 4PBOA 2YDEA 4K3UA 4XFAA 2IFWA 1RMU1 3AYDA 5GM0A 5I0SA 4YVWA 4AGVA 4W6YA 3RRDA 2X5IC 1ZYBA 5DUXA 4IL7A 4FBFA 1ENRA 3N35A 4EROA 1ZZ7A 1YO8A 1UN1A 2QZ3A 3O12A 4LO8A 1QWRA 5HCFA 1ZBA1 2NZ9A 1ND2B 3KQRA 3NAPA 5JSRA 4XTMA 5K7PA 5J37A 3VDDA 1PVC1 4OHZA 2PHRA 3NW4A 4GKXA 2CV6A 4GB32 2OUJA 4ISQA 1I6XA 2PELA 3MIEA 4YW4A 2PLV2 2HWF1 2GNTA 2HWC1 4RHV1 2VQAA 3ZXGA 1QH7A 3LZZA 4Q1RA 3MLKA 2Y0OA 4QQHA 1QHDA 4WM8B 5T50A 1C57A 4OHVA 3WQ1A 2EF6A 2RR11 1GQHA 3WHUA 4AFBA 1GV9A 2FHRA 3CF6E 2XJTA 2Q4SA 4FTBA 5CFDC 4XW3A 4LA2A 3S6PA 1N1VA 3O0VA 3BIWE 3MF6A 1XYOA 4OUSA 4Y20B 1IS3A 2N7GA 1EAH3 1JYIA 3ZFEB 5BNOB 4Q4W2 5DUUA 2QUOA 1TE1B 1PK6C 5H9RA 1PNGA 4P9IA 5CFCB 2HKXA 1GNHA 3DUIA 2OZ6A 2CGPA 4CTEA 3VL8A 5GKAC 1XQNA 1WW5A 2D3RA 3VBHA 4FCAA 4I02A 3DV8A 4JRAA 3BCWA 3M3OA 4HANA 1EPZA 4XZPA 4AVBA 4META 3VBUB 1UW8A 1CAVB 3R4UA 2ZX4A 4PDWB 4YNIA 3KGZA 1ZBE1 4ZU5A 1DFQA 4P9JA 4FPLA 3HMYA 3ST7A 4K40A 4XF0A 4GIQA 1H4GA 4RQPB 3ZIWA 2WT1A 2WSUA 2YY1A 4XXAA 1QJX1 4OHXA 4P14A 4K21A 3MPPG 1MVEA 4E4ZA 5JOZA 1R082 4EN0A 1AR92 3GHMA 1JXNA 4NWVA 2B46X 1VBD1 1J59A 4Y24A 2Z2SB 1GKBA 4KWKA 5BNPB 5IK7A 4C1WA 2AZ5A 1FMD3 4L8QA 1EPWA 3UKTA 4Q4X1 2RS33 2HEWF 4BCUA 1QJX3 2HWD3 1LOCA 3UJOA 2WNVA 4COZA 1V6MA 5C9AA 1RMU2 1MS1A 2ATFA 4LEJA 3SCHA 4LBKA 5C8CA 1RUJ1 2GMMA 4AF9A 4DMIA 1LHOA 4FPKA 4CEWA 1PO11 4OHWA 3K51A 2B39A 4XFGA 2CGOA 4A7YA 5FOJB 4AHXA 2YZ4A 1FV3A 2XJSA 5CG8A 1SLIA 2WFF1 1JUIA 1QXRA 1Y3TA 4YRDA 4BE3A 3ATGA 2R16A 1QJY2 1RVF1 1YYNA 1NXMA 1YWKA 1HXS3 4PDWA 2ARBA 2RE9A 3EHKA 3LOIA 2HWC2 2ZGSA 3NV4A 1QQP3 3B7MA 1LHWA 1HRV2 1W6OB 5DZGA 5H9PA 1GFF2 3MF9A 1W6NA 3MW3A 2PHWA 1RUH2 4YM0A 2DVAA 1UAIA 4MH0E 3USSA 5JDBA 4XHBA 2DVFA 4OZXA 2BWAA 4IV1B 5K0UC 1HQWA 1TNRA 2XKOA 3J9SA 3C2UA 4HPKA 1WD3A 2X53S 5IK4A 1HQLA 3RG0A 1DHKB 1QNWA 1KXGA 3NAPC 1AZDA 2JECA 4LBQA 4MLOA 4Y1XA 3RI8A 2JJ6A 1A8DA 4L99A 2VW1A 5BNNC 4XXPA 1LGBA 4UXAA 2D6OX 2XLAA 4YFZA 3ZFGC 2UURA 1X33A 3VBOA 4QQPA 2JE7A 1PIV2 4GA9A 1NY71 5EXOA 4YGBA 3MEPA 4YZ2A 3HD8B 1GZCA 4XJUA 2P3KA 4YZ3A 1DZTA 1RUC1 3LWCA 5AFBA 3VBSA 1HKDA 1AYM1 1D4M1 2VVEA 5J48A 1QXJA 2ZGNA 1AL0G 1FAYA 1UF2C 3VHPA 1AYN2 3ZO0B 2UWAA 4QXKA 1RHI2 3URFA 2IXIA 1C1LA 4P9WA 2WQZC 2PHDA 1CN1A 3GBFA 2BTVC 4GXLA 4JRLA 4XIKA 2VPVA 4WM8C 4CDXB 1KJRA 4WVZA 1PK6B 4YFWA 1DGRN 2GH8A 1HRV3 5C8CC 1HX6A 1MACA 1QOOA 1Z7S1 4GH4B 4S2HA 1S0FA 1VR3A 2RMU3 3LCPA 3AP7A 5DDJ2 1NCRA 3SH5A 1BEV1 4MV2A 3VBHB 3PNAA 1H2KA 1VBE2 1ND2A 4S2FA 1QJZA 5I8TA 2D44A 2VVFA 3CLPA 3OTFA 4DFSA 1RUC3 1VBC2 3W59A 1LU1A 4AWDA 4EN6B 3WDWA 4OI2A 1EV11 2FQPA 1OD5A 3AZWA 2GZWA 3IN9A 4AEDA 2WZR1 4CDQB 4R52A 1N1SA 2ZKLA 5CVRA 1VAMA 4AE2A 2ZHMA 1ZZBA 3M2MA 4CDXC 1JOJA 4IEOA 5J09A 3ZXAC 4Z07A 3FE5A 1RUG2 3WR0A 1RL3A 5C8CB 2JD4A 2Z5WA 1RJ7A 3ILNA 4M3CF 4BMBA 2GNDA 2R073 3U11A 3B9CA 3OCPA 4YARA 1RUD3 1COV2 2WNUC 4LHKA 5J3UA 2DV9A 4AVSA 1W6MB 4RD7A 4NOTA 2E6VA 1W2UA 5J36A 5ACA3 4S2DA 4WZFA 1H8TA 3TWIA 1QNYA 3USUA 5AC92 2ZHKA 3WQ0A 4Q0PA 3SCFA 1UIKA 5D8AC 1WLCA 4XOGA 3WNXA 2DWRA 2A6XA 1C8M1 1QMJA 1PK6A 4ITCA 3JZVA 4WM7B 5CFCA 2JICA 2ZS6B 1PGSA 3H8UA 3D6EA 4ZU4A 2WSVA 1IPJA 1JTZX 4CEYB 3WDYA 4N53B 2ZBJA 4X6QB 1KRIA 4X6RB 5FMOS 1U5IA 4AFAA 1CVNA 4FT8A 4AK3A 2OUHA 5GZGA 4FVVA 1YNAA 1RUI2 2JKBA 2PLV1 3KCXA 4JVAA 3W9AA 5GZEA 1KITA 1FPN2 2MHFA 2MEV3 3GNEA 2W0XA 4R4XA 3S30A 5BNQA 3M8LA 1NY72 3BPZA 4PCRA 2BW8A 2X5IB 2DYCA 1RINA 2IXJA 3AZXA 1AXKA 2VMIA 4I2OA 1EAH2 2PHXA 2IXHA 3WDVA 2YHJA 3FBMA 3NSTA 2VUJA 3JUUA 3O7OA 4UW6A 1NCQB 1ZNPA 4XDQA 2A3YA 3O0XA 2A7AA 1UD1A 1OA3A 5GLTA 2XB6C 3N7LA 2VW0A 2SBAA 1G9FA 1DQ4A 3WUCA 4YG0A 1ZREA 5JZGC 1Z78A 4IV3C 4LA3A 2WA3A 4QPIB 1WW4A 4C0HA 2A75A 2EXIA 1X8MA 1CR7A 4YVWC 1DF0A 4YW3A 1HRI2 1Z0HA 1Z7S2 1XE8A 1NYWA 5T5LA 5FPXA 4FOWA 4XPVA 1MS8A 4XF1A 3THPA 4G9SB 1BK1A 1VBE1 4J1XA 2RS11 4I0BA 2AENA 2RMU2 1BZWA 3DPRB 3H1WA 5DDJ3 5GZFA 1B35B 2IC1A 2RM21 2IXCA 3KT1A 4Q4V2 2ZX1A 4C91A 1XNKA 4L97A 2DU0A 2WQ4A 2HWB2 4FXKB 2XVKA 5EYYA 5C33A 4IEVA 4UW4A 3RYKA 4QGMA 4E27A 1SFNA 2GC3A 1DYKA 2E7AA 2PN5A 3H1YA 3OY8B 3VKLA 4OULA 4I01A 1HQNA 5CB7A 3M3IA 5CFCC 3CEWA 4M0HA 1NQJA 2FMDA 2XJQA 3ZMNA 4DPNA 4Q4X2 5HCBA 3NL1A 2Q1ZB 2CWSA 3ENRA 2CL2A 4WM8A 4BOWA 5KHGA 5KXDA 3RNSA 3MFCA 3AP4A 5BY5A 1SMVA 1IKPA 3EO6A 3PVNA 5L73A 4GB31 1HV0A 2XJVA 4DZGA 4A7ZA 4MYEA 1EV13 1PGL2 2YMZA 1Y9QA 1DU3D 1YI7A 4RHV2 4XJ9A 1REEA 2NPIA 4C0BA 3WCSA 3NV1A 2GNMA 1VP6A 3B00A 1DGRA 3ZSJA 1MS4A 2W08A 4PQ9A 1D4VB 1KDMA 1ULEA 2H6BA 4CYDA 2ES3A 2WC2A 4Q4Y2 4WVVA 1SACA 2XHKA 2Q1MA 1FPN1 2GH2A 1IOAA 3ZSMA 5LRSA 4QT6A 3KT7A 1NOVA 1HLCA 1H2NA 3ZXFA 4IEQA 5LRRA 1G8WA 4QM8A 4E2SA 4YZ1A 1CAWB 4Z82A 4OVEA 3WDXA 2OPKA 3EXUA 3KCYA 1EAH1 1I1EA 3KMHA 4Q8LA 1O3TA 4Q0UA 3D0SA 4HFSA 3RYPA 4LBMA 5CNAA 1RC6A 4U36A 4QQ2A 2VOXA 2ZAAA 3B69A 4LT5A 2QE3A 4X8NA 4Q4W3 2WS92 4KG8A 4P5HA 5GALA 4XJZA 2R072 1KD7A 4KU8A 5KWRA 3MIDA 4BYYA 1LENA 4ES8A 4PLOA 4XQWA 1AL23 2BFUL 2R30A 2W39A 4P9GA 3V0BB 5J7MA 2Q8OA 1COV3 3WHTA 4DY5A 5JZGB 4LBQB 2ZHNA 3RQ0A 3VL9A 4EV0A 2SLIA 1GBGA 5F6KA 1QJX2 1W39A 2RS12 2XUMA 3VGIA 1ZZ9A 2UY9A 5DZEA 1RUC2 1VBC3 5EZWA 3OGGA 1AYM2 1D4M2 1BVP1 2YXSA 1NXD1 3M3QA 2PAKA 3RYRA 1PHMA 1FNZA 1AL21 1O4ZA 1AR93 5D8AA 3TYJA 1ZZCA 2ZGOA 1ZVFA 1R083 3QH7A 3VBOC 2HWB1 1XNCA 3ZFGA 1F8VA 3HBZA 3MDPA 5L36A 1AX1A 4CP0A 1WCDJ 3B3QE 4ONUA 1YFUA 4LNVA 2BWCA 1AX2A 1UKRA 5BNNA 1IS5A 4XF3A 1QJU3 4LO4B 4IV3A 3IBMA 5JZGA 4CDUB 4M3CA 1DLLA 5FLJA 1FATA 4C90A 2I74A 2P17A 1PO12 4B29A 5ABJA 1AX0A 4AVCA 5FMOL 3POWA 3E6CC 1KQRA 3KLSA 4INDA 2K0GA 2VUAA 4MX3A 1AR62 2ZPXA 3H1MA 3B9IA 2YGMA 3AP9A 5JAXA 1O3SA 1AJOA 1VBC1 4Y1YA 2DTYA 3O5SA 3OYWB 3WX5A 3LA7A 4DNYA 1ZRCA 3RMYA 1QKQA 2UY8A 2ZX0A 1Y43B