1OA4A

Comparison of family 12 glycoside hydrolases and recruited substitutions important for thermal stability
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
222
structure length
222
Chain Sequence
NQQICDRYGTTTIQDRYVVQNNRWGTSATQCINVTGNGFEITQADGSVPTNGAPKSYPSVYDGCHYGNCAPRTTLPMRISSIGSAPSSVSYRYTGNGVYNAAYDIWLDPTPRTNGVNRTEIMIWFNRVGPVQPIGSPVGTAHVGGRSWEVWTGSNGSNDVISFLAPSAISSWSFDVKDFVDQAVSHGLATPDWYLTSIQAGFEPWEGGTGLAVNSFSSAVNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO-BETA-1,4-GLUCANASE
publication title Comparison of Family 12 Glycoside Hydrolases and Recruited Substitutions Important for Thermal Stability
pubmed doi rcsb
source organism Streptomyces sp. 11ag8
total genus 59
structure length 222
sequence length 222
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1oa4A00
3WQ1A 1UU5A 2B42B 2DCJA 3WY6A 2C1FA 3VZLA 1QH6A 2BW8A 1AXKA 3B7MA 1KS4A 2NLRA 2F6BA 1H0BA 1XYPA 3RI8A 4S2FA 1C5IA 1HV1A 1OLQA 3WP3A 2JENA 4S2DA 1PVXA 3VZNA 1BVVA 3WP4A 2Z79A 3AKQA 1F5JA 1M4WA 1W2UA 2VULA 3WP6A 2JICA 2NQYA 3WP5A 3WT3A 2DFCA 4XQDA 3VZOA 3AMMA 2BVVA 3VHPA 1XNBA 2BWCA 3VL8A 1ENXA 3RI9A 3MFAA 2DFBA 3MF6A 3MFCA 2QZ3A 3AMNA 1UKRA 3AMHA 3LGRA 1H1AA 5K9YA 1OA4A 1OLRA 4S2GA 1REFA 1OA3A 2VGDA 1C5HA 1H4GA 3WX5A 3WXPA 1XYNA 1REDA 3AKSA 4HK8A 3VHNA 3WQ0A 1IGOA 3AMPA 1BCXA 1XYOA 3VHOA 3VGIA 2BWAA 5K7PA 1YNAA 1HIXA 1UU6A 4IXLA 1XXNA 4XPVA 3VZKA 4HK9A 1QH7A 3M4FA 2D97A 2B45X 3B5LB 2B46X 3VZJA 2DCZA 5HXVA 3AKTA 1TE1B 1UU4A 3VLBB 1REEA 2VG9A 4HKWA 2DCKA 3WQ7A 3EXUA 1HV0A 1T6GC 2D98A 3ZSEA 3AKRA 3WR0A 2VUJA 4NPRA 4H7MA 1XNCA 3VL9A 1OA2A 4HKOA 3LB9A 5EJ3A 2QZ2A 2DCYA 1KS5A 3O7OA 1H8VA 1XNKA 2JEMA 4HKLA 4XQWA 3VZMA 1NLRA 1H4HA 3HD8B 1BK1A 4XQ4A 4S2HA 3AKPA 3MF9A 3AMQA 1XNDA
chains in the Genus database with same CATH superfamily
3W59A 2JECA 1YLLA 5FYHA 5JIAA 4JQRA 2PN5A 2WAOA 3KVAA 4AVBA 1LEMA 2BPA2 2XVLA 2FCUA 4OHYA 1JHJA 2YFUA 3AP5A 1JU4A 5GLVA 2HWB1 3SEPA 4BOWA 1CX1A 4IV3A 1QIQA 1H1IA 1NQJA 5A3MA 1H6YA 2PHXA 1GNZA 3VDAA 3ZXFA 1O7FA 1GYKA 3JQWA 4BWOA 2Y0OA 1BVVA 2DVBA 2X5IB 4QXBA 1F4HA 3WP4A 2WRAA 1QXPA 5A33A 4BQ2A 5C4WB 1IS3A 2RS33 4XVHA 1WLWA 3C8XA 1FMD3 5IWFA 3WP5A 1NT0A 4R9AA 1VBC1 2J1AA 1BHGA 2EAKA 1V9U3 4AFBA 3KHBA 1KD7A 2C0ZA 1GZ9A 3B9CA 5A3WA 2JXAA 4Z2AA 2DFBA 2XJUA 2H6BA 4LIVA 4CCJA 4EWAA 4KU7A 3WW2A 1O3SA 4QPGB 1NAEA 2ZX0A 3PTRB 1S2BA 2HWB3 3U07A 1LOCA 4XUNA 4A7ZA 4S2GA 3PTYA 3V64A 4LHLA 4E9KA 4Y3OA 1RVF3 4K6BA 1JI6A 4YGDA 4ITCA 1GV9A 1P8JA 5D8AA 5FYVA 3VV1A 1A34A 2YDEA 1SPPA 3I3QA 3LDBA 2WSVA 1W8OA 3VHNA 2VVEA 3MUZ1 1S1AA 2XBO1 4KWKA 5FFOC 2Q4SA 4AEMA 1G9AA 5FOBB 5J37A 2ZPXA 2XONA 4OUMA 4ES9A 3HT2A 5IUQA 5HCAA 1DQ2A 1COV1 1A3KA 4QD2A 4DXZA 2WSUA 5FZ7A 4YVSA 1YI9A 2UWBA 4QXHA 4NHKA 1PVC1 3AZWA 5FYMA 3VN4A 4C0HA 3VBFA 1LENA 5HBAA 3N9LA 1US3A 4JHZA 2BNMA 5HXVA 1ST8A 4TWTA 3NJVA 1OKOA 3HNYM 5JMOA 4F3JA 3GF6A 4XMAA 4NPLA 2Y6KA 2YXSA 1A6CA 2W92A 2XBO3 4OI2A 2PHLA 3MPBA 4C91A 1S0BA 3ZXLA 3INAA 1FXZA 3D5OA 1SMVA 1XNAA 2ZKNA 2VUJA 4NPRA 4Q8KA 4XURA 4IV3B 1O3QA 1COV3 2QUOA 5A6YA 4D6QA 1GWKA 3M7AA 5EYYA 4XILA 4XF1A 3I2JA 1ZZ9A 2MEV2 5EIYB 5J36A 1LOBA 2IXJA 4CUBA 1ODMA 1WW6A 2WO7A 3ZN5A 3TEYA 5FQ0B 2KA3A 5BNOB 1JS9A 1MS5A 3WCRA 1J3PA 4MGYE 4CYDA 4NAOA 4Q4V1 1Z78A 3TOJA 4S2HA 1ALYA 1C1FA 3NW4A 4LO8A 1K5JA 3FHAA 2R041 2LM3A 2XB6C 2G9GA 4CUAA 2PMWB 4JGZC 2QKDA 2OZ6A 3MV11 3VBRC 2DURA 2FDGA 3NV2A 3FFQA 4JV4A 4MHRA 2QQJA 4MV2A 5T3NA 5EHDA 3OBZA 1SBDA 4MH0E 3MIEA 3MW2A 4UOJA 3WDYA 2F6BA 4XYXA 4ZZ5A 2ES3A 4CDQB 4O61A 4YSFA 5D8AB 5LWBA 1UY0A 2ARXA 3LAGA 4GJZA 2VW0A 4GALA 4Q4Y1 4B1LA 4EZ4A 3ZN6B 1X7NA 1RUF2 3O12A 3T0BA 3AKQA 1VALA 1LJ7A 5CYYA 2ZGMA 1LGBA 1ZZCA 2ZGPA 3AYCA 5LASA 4Q4V3 5ERLA 4LE3A 5ABJA 4LBMA 5SV8A 4IERA 1AL0G 2KM2A 1PGW1 1VLNA 4AE2A 5LA0A 2R043 5LBEA 1PNFA 3HOBA 5G04L 5K0UB 4OI0A 5F5QA 2C26A 3LQCA 1W8ZA 1J1LA 4AGRA 1QU0A 1W99A 2YBSA 4HN0A 3BN6A 1DYKA 1RJ7A 2GC3A 3R4SA 2D6OX 3IMNA 3THDA 4Q2FA 2VCCA 3GBWA 4AOCA 1REDA 3AKSA 2RV9A 2ZAHA 3H7JA 4PBOA 3H8UA 4YWAA 4B4QA 5CFCA 3JD71 3ILNA 1IHMA 4ASMB 5I8SA 2L9LA 1VBD1 1OSGA 4FOWA 5FY8A 4X6RB 4A42A 4BIOA 3GHMA 4D94A 5JWPA 2IFWA 1KRIA 1NZCA 1HB4A 3J4UH 2VTXA 3M1HA 4J25A 3SISA 4CCOA 1HQWA 2PAMA 1S0JA 1R092 1JYVA 1JYXA 4KL1A 5FZBA 1DFQA 2HBUA 4R4XA 3RJ2X 2DV9A 1CZSA 2IXLA 2QQNA 3I3MA 3WOGA 1CAVA 2ZX4A 5GZEA 1VJ2A 4DOUA 3R0RA 4LXLA 3KCYA 3SH4A 2W46A 2D6LX 4Q0QA 1MEC2 3NV1A 4B7KA 2UU8A 3N9OA 1PO21 2QQVA 4QAWA 1MZ5A 1CJPA 4QPIA 3WDTA 3AYDA 2CGNA 4Q5OA 2WS91 3HPNA 4QQPA 4DFSA 5A6XA 5J09A 5C3SA 2PLV1 5T52A 5FPBA 2VG9A 3VDDC 5I93A 1AYM2 4X6QB 1LOAA 1YWKA 2ILMA 2BFUL 4MYEA 4QKNA 2XLFA 4XJ9A 3IAPA 4XUQA 4WZFA 5FDBA 4LMFA 3VBOA 3WR0A 1AR62 1DBNA 2GN7A 2UURA 1Y9GA 2HH9A 5EV7A 5A1AA 4E4DX 1W0OA 2G9ZA 3LSEA 3VB9A 4K20A 1GZTA 2TUNA 3WF4A 2RDNA 1LHNA 1QGLA 3LD8A 1JYIA 1CWPA 3ES4A 4INDA 3VBHC 2WABA 1PO23 1NCQC 4Q4X3 4BHPA 3HWJA 1UPIA 3FE5A 2R32A 1CIWA 1DHKB 1NLRA 3IIAA 1EV11 5CAZA 2BQPA 5IVFA 2WS93 2BUKA 5FZ1A 3I2HA 3G7DA 2PLV3 1HJFA 5F3GA 3ZFEC 4MGTA 3JUUA 4HOOA 2ET7A 4QX7A 2VZRA 5C70A 1Q43A 4XDQA 4CP0A 1UZWA 3NJYA 2ZJCA 5A7WB 3NKTA 4MX3A 4N43A 2VL4A 3ASIA 4Y1ZA 3MI8A 4JX0A 1UIKA 4BQ4A 5FZHA 4LKEA 2ADEA 4WZCA 1VBA3 4ES8A 4BB3A 4IEPA 4KBZA 4S2FA 3PUAA 2HEYF 2JDHA 2Y6LA 4AFDA 2FDHA 2J1EA 4AVVA 1ULDA 1ULPA 2WLQA 2W5FA 4DXTA 2XUMA 1EV13 1OPOA 1ULGA 1VAKA 2DF7A 4JGYB 3LF7A 3ZYFA 4N9IA 3BPSA 5JCTA 4CEYA 5CFDA 4WBBA 4NIIA 1U5IA 2BWCA 1N1YA 2VXRA 3AP7A 3TEZA 1ENXA 1DLLA 1J83A 1PZ9A 4AVTA 4BMBA 5L19A 1PZ8A 3ZIWA 4IEXA 4OLLA 3WDVA 3POJA 4LNVA 2QQIA 2P3IA 4V2VA 4WM8C 3AMNA 4BZ4A 4NWVA 3LFMA 1HRV3 2JD4A 2P2KA 4QPIB 3O0VA 1UO9A 3BCWA 4HLTA 1REFA 2WQ8A 1SDWA 4G9SB 3J7NA 5GALA 1W9TA 3WX5A 1BQPA 3WXPA 5AFEA 3M70A 1POV1 4GULA 1QOTA 5JSPA 4HK8A 5A6ZA 2CDOA 5KXBA 2RS32 3C7HA 1RMU1 1FMD2 2VW2A 5GLTA 3N9PA 4FPJA 3T0AA 4YM3A 3DL3A 4IE0A 4MHUA 4Q0UA 3LOIA 3AMPA 5DZEA 4FI9A 5FKBA 1DYOA 4ZHNA 5FMBA 5I0SA 1C57A 1QJU3 3F2ZA 1HKDA 2QE3A 1LOEA 1VBB3 2H0BA 3I97A 3QLQA 5FZ6A 5IFTA 4IV1C 5HCBA 2XL7A 3JQXA 2VZVA 5ANNA 1W6QA 5JPNB 1OPMA 1XXNA 3MW4A 2XJQA 4RA0A 3TYJA 1RHI1 2W3JA 3CDZB 5AC92 4NJ4A 4QB2A 3OD0A 4OMDA 5LA2A 2V09A 2WUHA 4GH4A 3BOPA 2B45X 3WF3A 1RVF2 1V6LA 4PDWC 3WINE 3DCQA 2VUDA 3FMGA 3J7LA 4GMP3 3H3ZA 2OS2A 1POV3 1IS6A 1RMU3 2JDKA 4AFMA 1WMDA 2WNEA 3HNBM 2D98A 2XHKA 4ZXKA 3AKRA 1YQCA 1YRZA 2FDJA 2VMGA 2Y34A 3A4UA 3J8F3 3MO4A 3N35A 1UOFA 2PHRA 3D0SA 4P5HA 1H9WA 5GLWA 5BNNA 5JOWA 4JTNA 5FO7B 4TZDA 1LU2A 1UOJA 2DVDA 2E31A 4AVAA 1K5MA 3UGFA 1GQPA 1TVGA 1RHI3 4KG8A 5LY2A 3ZFFC 4A3ZA 2XGXA 4LHSA 3QH6A 1HB2A 4AI8A 4XQWA 1AX0A 1MS9A 1GBGA 2YGMA 3MLLA 3ZYHA 1CZVA 4I0BA 4UI9L 3E5QA 3WNLA 4M3CA 1NA1A 4CDWC 4AEKA 2VMIA 3PMEA 5E1RA 1OF3A 1OMIA 4LQRA 2VBPA 3PUIA 4K7JA 4YGBA 3AMQA 3M3CA 4L8QA 3UT0A 4EE2A 3ZXDA 2YZ4A 5J48A 3KS7A 3CF6E 2ZMLA 1DGWX 3O1MA 4ZU7A 3HIFA 1W3VA 3M8LA 1WCSA 2Q8CA 1Y7BA 1BJQA 1AF9A 3HVDA 4CDUB 1QHDA 3VDCA 2IVJA 3HBZA 5A7OA 1YI7A 2ZGSA 1VB4A 3EMRA 3V0BA 4Q8LA 1JMUB 5KXDA 3ACHA 2WJSA 3JXSA 3VKLA 5C3OA 4QGMA 3S5QA 3ZR5A 2OPKA 2JICA 2WNVB 5GZCA 2GNMA 1IPJA 1FT9A 3BPZA 3CJXA 2WO1A 1GQGA 2GH2A 3JBG2 3WW4A 5FP3A 1F31A 2WQ4A 4B4RA 5CNAA 1LEDA 4A41A 2RS12 4YVWB 4MO3M 4AXOA 5IVVA 2GNTA 3MFAA 1BMV2 1JH5A 4XMIA 5E16A 1J3QA 4FPKA 4LO6B 5FPLA 1UKRA 4BU2A 4CP1A 4RR3C 1OLRA 5FLHA 1FAYA 2J1RA 1OA3A 5FY5A 1H4GA 3KQRA 2FBEA 4OYUA 1M06G 4NIGA 1ODNA 5FPXA 2YMZA 3ETQA 4BIFA 4LITA 4EROA 4LEJA 5JZGC 4FPEA 1Y4WA 1OHFA 1GP5A 5LRRA 3ZSLA 4RS5A 2FMYA 3AXEA 2ERFA 3RMYA 3GXUA 5LBCA 1WD3A 3R4DB 1CJDA 1QWRA 1DF0A 1FATA 3K3NA 4L0PA 4QM8A 2D6MA 5H9PA 3RNSA 3RZKA 1Q56A 1O5UA 3RPQA 2W1WA 4CCDA 4XACA 3LPGA 1DU3D 1W6PA 3UK9A 1R1A2 1AJOA 2DTWA 1AXYA 3N9MA 4HANA 1JZ2A 1ZREA 3O0XA 1CPMA 3HQUA 2MEV1 4ASLA 4EZHA 4YARA 1J1TA 3FX3A 2WT1A 2G9FA 3POGA 4OZOA 5IVJA 2QQPA 4QXKA 1SZBA 4FXGB 3I2GA 2DCKA 3RWNA 1LHOA 2IFRA 1S0CA 5DAXA 5D2AA 2G19A 1AYN3 3AZZA 5L9BA 3PUSA 3ZSEA 1AXZA 1WBLA 5CKMA 1D2QA 3G6JB 2E7QA 2QDNA 1N3QA 5B4XA 3I3DA 2O0OA 3N9QA 1JUHA 4H7MA 1V6KA 4KGGA 5FOJB 1IZ3A 1SLIA 1XNCA 2AEZA 3OPWA 5IW0A 3PURA 3NQHA 4P9WA 3TBDA 2UY8A 1XQNA 3KV5A 4HKOA 1O4ZA 2E33A 3O1PA 2W1UA 4Z92B 2A3YA 3EHKA 5JI9A 3NJXA 4LBQD 3LCPA 2MEV3 1Y43B 4UFHA 2LS6A 2WNOA 3VBUA 1WW5A 3POYA 2WNUA 4AQ6A 1LCLA 3T2TA 1RUF1 4R9DA 1YFUA 4HPKA 3K48A 2ZHNA 3PHMA 4XQ4A 3ZMOA 1K42A 1IQAA 2IXHA 5CKNA 3MF9A 2MHFA 3HQRA 2GC0A 3MHZA 2YFZA 4JHTA 2C1FA 4BLIA 5DDJ2 1ZVFA 3VBRA 2JDAA 2A6XA 4LBNA 4EN0A 1YFXA 3GHNA 4HVRA 1GNYA 1LODA 5FP9A 2CYFA 2NLRA 4D6RA 2OUHA 1JOPA 3POSA 1ZRCA 1OOPC 2IXCA 4K1YA 4Q4X2 5E8AA 3WP3A 4WVMA 2JDNA 4FQZA 4P9LA 4Q1PA 1YJLA 3E5XA 2ZACA 4KWJA 1ZM1A 4Z1VA 2HWD2 4Y20A 1LHWA 2VZSA 3ON7A 1F2NA 1RUF3 4UT5A 1FNYA 1X8MA 4MGZE 1CX4A 4WVVA 3U1XA 5F1RA 3VZOA 1A8MA 3ZLIA 4BK4A 3ZKYA 4BLJA 5FMCA 1C1LA 2QDRA 1UWWA 1ZZ7A 1W6PB 3GJBA 5FUNA 3RI9A 1R091 1MQTC 1JZ6A 2ZMNA 1F4AA 2AGSA 2CV6A 3PU8A 4UAPA 3MFCA 3AYEA 5BNPC 1PNGA 1VBA2 1X9TA 3OUHA 4NAMA 3OPZA 3O1RA 1MEC1 2BRTA 2JJ6A 2XJTA 4XJUA 1H8TC 3K4ZA 3OB8A 2UYBA 1DP0A 1QXJA 2ADDA 1RITA 1LULA 3ZXJA 3H1YA 1TMF2 2E7TA 1SG3A 2K46A 3Q8EA 1X9PA 5GJ6A 2ZGLA 4AYUA 3FBMA 3ZPOA 5FMDA 1JZ5A 3FWEA 4CUCA 5AFBA 4XDPA 3AYAA 5FV3A 1AYM1 3GCXA 4PQQA 3WQ0A 4CCMA 2PAEA 2R6QA 2HEWF 4SBVA 1AR61 2R0FA 4XF9A 1ZZBA 4QX1A 4IETA 3VKNA 2VZ3A 4FP3A 3WG3A 4JRLA 5FWJA 3BUCA 3ZO0B 1HRV2 4KMQA 3VBSA 1NKGA 4EWDA 1C8NA 4JRAA 1OQDA 3ZFGC 3UJQA 3K2OA 2IWGB 2JE9A 4UFIA 4YG6A 3VZJA 4HPKB 2JG8C 4NN0A 2GU9A 2VMEA 2GZWA 4M0HA 1QJFA 2P34A 3CO2A 1UZ0A 4AEJA 1HN0A 3NNGA 1EPWA 2D44A 2VQ0A 3M3IA 1VE0A 2HWF2 5C4WA 2K0GA 4XFFA 1QJU2 1AYM3 4JGZB 3VBRB 4CU8A 1VBB2 1YCIA 4COZA 1XSQA 4QX0A 4FAGA 1QQP3 1NXD1 2VECA 4GZ9A 5F6KA 4COYA 2CU5A 1XU2A 2J1UA 4DZGA 4Y24A 2ZZQA 5IHRA 4YZ2A 2EIEA 4WVMB 3AJZA 2RJKA 3WNNA 5CG8A 1L7LA 3R05A 3UGHA 4E4ZA 4Q29A 5IVBA 4LO5B 1MR5A 4RN5A 4QPGA 3I3BA 1NCQA 1WW7A 3NMBA 3VD3A 3UYJA 5I0DA 4O9EA 3T1MA 2VE1A 4XHXA 3EBRA 3UKNA 2FDKA 2A1XA 2Y60A 2ET1A 5B4NA 4FAHA 1ONAA 4PHZA 1W6OB 5GZFA 3J8F2 3ZFEA 3BU0A 1WA4A 1YQ2A 3NKGA 4LLFA 3WDXA 3N7JA 1O91A 1ZZ6A 1QNYA 1AXKA 2GMEA 2P37A 2VOXA 2NM1A 2BBAA 5FYCA 1HLCA 1S0IA 1AJKA 1C28A 5FO9B 2JDYA 1DCSA 4HN1A 5HPOA 3OD4A 4RHV2 5IK7A 1Q8QA 1WLCA 4AHYA 1H6XA 5FZCA 4DY5A 3IB3A 1ZA4A 3NV3A 3VZNA 1PO12 3U14A 2CTVA 3ZXKA 4H3WA 5A7NA 5A32B 4ATFA 1F5JA 2YU1A 2Z42A 3AJYA 2RS31 4N7UA 4QX2A 1HRI2 2WLPA 1FMD1 1QF3A 2P6CA 2KXLA 2ZTNA 5KHHA 2OA2A 4JZRA 3RYPA 1V0AA 4P02B 1XNBA 3ZPYA 4LLOA 3VBSB 2XOMA 1KEXA 2EXJA 2D3SA 1NY72 2YB7A 3B00A 1K3IA 2V4AA 4LO4B 2XWJB 1EAH3 4I02A 4P00B 4C8DA 4IEWA 1DYPA 3NJZA 1GP4A 3KQ4B 1LTEA 4QKBA 4DRVA 4ZZ8A 1UXXX 2VGDA 4EV0A 1PK6C 4GXLA 4H55A 3E6CC 1QJEA 1RVF1 1S0DA 1SDDB 1YQ8A 1AR82 3M3EA 2A6VA 3HMYA 3VDDB 1G9BA 1ZBA3 2D6KA 1WLDA 4Y5Z0 2ZHLA 5BNOA 5FQ0A 5IK4A 1H2NA 4AHZA 1C3HA 3SHRA 1BEV3 5IVCA 1BCXA 1N1VA 1T2XA 2AR6A 1CESA 5DQ0A 1I9RA 3IPVB 5F3CA 1SLAA 2ZGQA 2QJVA 2DWRA 4IV1A 4A7YA 2YC2A 3THCA 3Q8AA 4B1MA 3VBHB 1GZCA 1XB9A 1NCQB 5FZ9A 4P5YA 1UF2C 3I2FA 4PF1A 3URFA 1AUYA 1WMEA 3KT4A 3APBA 4O7XA 4WM7C 2BEOA 1U5YA 1TE1B 1JBCA 4P08A 4CDQA 1UYPA 3ZFEB 3K3OA 4LUMA 3CZUA 5JOXA 1QKQA 4B3NA 2GC2A 3H1MA 1PMJX 3ZN6A 2D43A 5FY4A 5G05L 1I5ZA 1AHSA 3GZAA 3IDCB 4MGSA 3H7YA 2WZR3 4M4RA 3PUHA 3FUOA 3JB8A 2XQXA 1AL23 1JU3A 4Y5TA 4AEDA 3EO6A 2ZABA 2VQAA 1D0HA 5K0UA 1F15A 4MADA 5FKCA 4GMP0 3O7OA 4FPOB 1POV0 2ZS6B 3SH5A 4HFSA 3RS6A 1UY3A 4QHBA 5HV4A 1NX9A 3ACGA 4QMAA 4ZY9A 3MBWA 3H3LA 3RDIA 1CPNA 3ZYRA 1LKNA 5A1LA 3IDEA 5KHKA 5F32A 1STMA 3LE0A 1CIYA 3B94A 4EYUA 1AYN2 1VAVA 2XDVA 2PHFA 3J7MA 5FY1A 5H9SA 2VNGA 3JBG1 4OMCA 5FYYA 2BZDA 4AR2A 4BISA 4M01A 5CADA 1EP0A 2C9KA 2RS11 3OBRA 5IATA 3VZLA 4WM8B 1NCRC 4R52A 1BMV1 4D0QA 1KS4A 1DQ1A 2C4XA 3MICA 3K51A 4K21A 4D6SA 1VMJA 3N9NA 4NOTA 1H0BA 1OLMA 1W2NA 4CCKA 3D3AA 2HKXA 3UJOA 4CCEA 1TZOA 4XJWA 4XIKA 5DMYA 5EYXA 3PVOA 1K45A 2RMU2 3AM2A 3WG2A 5HCFA 1V70A 1WCKA 2Z79A 5FMOS 3ZDVA 2ARBA 3NWKA 3SCHA 3D6EA 2BNOA 2GMMA 2FDFA 5JOYA 1CN1A 2FQPA 2DUQA 1O8PA 3DGTA 5DUWA 3HN3A 4IV1B 1CGPA 3JBG3 1TME3 1C4RA 5LA9A 4CDXC 4FSJA 1CAUA 3NNJA 2OQ6A 2OXBA 2RS13 4K9SA 4C90A 1JHNA 3WHUA 1E5HA 1NYWA 5A3OA 1R1A1 4Z82A 4N53A 4YM0A 1ENQA 4YZ3A 4PDWB 1S0FA 2AZ5A 1O4YA 4RR3A 2W9XA 3KM5A 3RWKX 2H6CA 4D3WA 3PJYA 2D5HA 2ZCWA 2YC4A 2Q8EA 4NIDA 1XYNA 2C6SA 3IN9A 2ZGNA 1W9YA 4Y26A 3JZVA 1QOSA 3DEMA 2P5BA 1IKQA 1JZ8A 2CGPA 3DN7A 4ATEA 4XHBA 4YLZA 4AVCA 5C5UA 3VGIA 3PVNA 1GLHA 4AEDB 2GN3A 3ILRA 4PIZA 3WW3A 3LA3A 2HWE3 1WCQA 3BKZA 1E5SA 3KVBA 1GOFA 3L2YA 4O65A 5CVRA 1S2KA 2VVDA 4MLOA 5FYZA 4COWA 3ZFFB 3E1F1 5EFUA 3ABZA 4XEZA 2EAAA 1WZXA 2D93A 3KD4A 5FLJA 1GOGA 3ENRA 1R1A3 5A7WA 3PNAA 4PIXA 1ULCA 4JKKA 4CDWB 3OJBA 1IKPA 2B46X 1Q3EA 1QJX3 1PX3A 2I45A 3QH7A 2VCMA 2PYTA 1OFNA 3SQOA 4E8CA 3KT7A 2D6PA 3ITQA 2CNAA 2TBVA 1LOFA 2RDRA 4META 2O8QA 3DPRC 3HQXA 4GWNA 4M3CF 5FCCA 3WW1A 4XZUG 4JGYA 4MGKE 3OCPA 5BYNA 3RZMA 2VZPA 5ANQA 2FHRA 5F39A 5FY9A 4LOTA 5DDJ1 4V2WA 3DKWA 3RQ0A 1IG3A 4EN9B 3POEA 4TLGA 1L3JA 4OI1A 2XUEA 1YHFA 1MZ6A 1AX1A 1O6UA 2PFWA 4Q4X1 4NRQA 4ZS2A 1SEFA 4UYBA 3IDBB 1FV3A 5AC93 3B93A 4DS0A 3NRUA 2HWD1 4YW2A 3MV01 3ZXAC 2O14A 1POQA 2DVAA 3AKPA 3U75A 4DB5A 5CA6A 1CAUB 2WA4A 3AP6A 4DEQA 5C6CA 3DYOA 1X82A 1WD4A 1QQP2 4IE7A 2D3RA 2RS53 4I01A 1I5PA 2BOJA 4N53B 4MZUA 2GDFA 1LAJA 1CZTA 4XOGA 5EQUA 2AH2A 1VB2A 3B7MA 3HJRA 4RR3B 1OKQA 5DDJ3 1SLLA 4KWLA 4NRPA 2VTXJ 1SCSA 1W05A 3MW3A 5FZ0A 4JTOA 1VBA1 3P3PA 1OOPA 1C5IA 1NLSA 4A4AA 5C8CC 2R0HA 1QXRA 1I6XA 5JZGB 4HG6B 1XSRA 4LK6A 1TMF1 3LEGA 1ND2C 1TEIA 2F4LA 4CVUA 1JZ7A 1HB1A 4GWMA 2HWD3 4HSJA 1W28A 3LOBA 4IEUA 1JOBA 1WCDJ 3KV6A 4KGQA 1PGSA 3V56A 3FHIB 4IL7A 2GH8A 3W5NA 1S55A 3NO8A 2V5DA 4QQHA 1CD3G 4CCNA 4QB1A 1H30A 1RB8G 2A73B 1W0NA 3NNLA 3SEEA 4KWUA 4Q4W3 2JG9C 4CEWC 4LBJA 1HRV1 4MG2A 5BUVA 3UL2A 3T4VA 2Z4FA 4FFIA 3POBA 3FBYA 2VD7A 3UKTA 5JSRA 1H8TA 3GM8A 5C33A 5F37A 2WO2A 1CAXB 1SBEA 2CY6A 3QOPA 4A2UA 2B9VA 2ZGUA 3B9IA 1VMFA 2EXIA 2TNFA 2ZGRA 1H2KA 2LTNA 2WN3A 3OBTA 1TMF3 1DQ6A 1YYNA 2DVGA 4D8MA 2ATFA 2HWF1 3NNFA 1QJU1 4EN7B 1JYNA 5LBBA 4L2NA 1VBB1 1W8UA 1YFYA 2Q8DA 3ZR6A 3PIGA 2ZAAA 1EAH2 4ZS3A 1VIWB 3BI3A 1S2EA 5A80A 1JYCA 3RFRA 4W6WA 4MGQA 4BXSV 1OF4A 3T2QA 5EXOA 4NWWA 1W04A 2YGLA 1G8WA 3ATGA 4FFGA 2D97A 4IEOA 3WNPA 5FZFA 4AZZA 4CDUA 1YQ6A 2DCZA 1G7YA 4BCUA 4GMP1 2R072 1ZBA2 4WVWA 3BOWA 1W03A 4NMIA 4I3GA 5JI7A 2OKXA 5J3UA 4QX3A 1PZ7A 5FZKA 1JODA 1BEV2 1J58A 5FP8A 2WZEA 5GM0A 5IAXA 3AVSA 2YROA 3J8F1 3PLQA 5FRAA 2HWF3 1RXFA 1G9FA 2WNVA 4MUVA 3BTXA 2XVKA 2J1SA 3MYXA 3VL9A 1OA2A 3WLUA 1OOPB 1Z7S3 4FOYA 2A3XA 4YVWA 5EJ3A 5IAVA 1D4M2 4BH9A 1BYHA 1F5FA 2VPVA 4HVQA 2WO3A 2EXHA 3SKVA 5KBFA 4RHV1 1G86A 3B02A 3ALQA 3B3QE 1JN2P 4B4PA 5FJKA 5M0TA 2A75A 4I0WB 3VZMA 4DEVA 1OI6A 1PO11 1UN1A 2ZX2A 2NP0A 4ISRA 3I2KA 1UOGA 3C3VA 1KJLA 2DBIA 1OC1A 1HJGA 2EIDA 1TNFA 1HRI1 1FOD2 3ECQA 4NE9A 1OH4A 2WZR2 2ZEYA 1QJY2 4QB6A 2B42B 4K40A 5JR7B 2DCJA 4WVZA 2HLEA 2R1DA 5F5CA 5I0TA 1AL22 5I8YA 1NY71 1WKYA 2BP6A 1H8TB 4HSLA 1XE7A 4LKSA 1EUTA 4QGNA 3MIGA 3RSJA 1WCUA 4KH9A 4OFGA 5ACA2 2J22A 5GZDA 1KDMA 1H9PA 4P9XA 1W06A 4RHV3 3JCIA 3O1TA 1UXZA 2R7EB 5D8AC 1Q8VA 1F8VA 3F95A 2ZHMA 1AR81 4ZU5A 4GWJA 1OURA 1PO13 5FO8B 5F7UA 4FPYA 1U0AA 1W8HA 4M0NA 5GZGA 2OX0A 3LKJA 5IYYA 3ZYJB 4EWEA 1HRI3 1WUVA 2EIGA 4LTAA 3VD9A 3DXUA 5J7MA 3U4XA 2B8MA 2OZJA 1NLQA 5GKAC 4E2GA 3I2IA 2X09A 2PAKA 4GKYA 3EQEA 3MGUA 4YVSC 2OVUA 5A3PA 5FXZA 3VBFC 3DXTA 4BQYA 2CSGA 2RVAA 2QZ3A 1AR92 3GYDA 4I30A 2GP3A 3WF1A 4F7ZA 5LZ6A 1KXGA 1PGL2 2JG8B 2JD9A 4XBLA 4OQ8A 2WL1A 1V00A 2E32A 2W68A 5DZGA 4G4FA 5JPMB 2RDSA 2P3YA 3DV8A 3K4DA 3FC0A 3OBAA 1DGLA 3AVRA 3CHXA 3Q8BA 4DQAA 4LBQA 3IBMA 1AR83 4XTPA 1FV2A 4L9BA 4LBKA 3TWIA 1DDLA 4PLOA 5FREA 1IGOA 4IESA 1TME2 4IE6A 3TEXA 1DQ4A 4TTGA 2EA7A 3BIEA 4YZ1A 2W2IA 3BTYA 5H9QA 2JB4A 1SFNA 2VCAA 1PMHX 4P9JA 4A6OA 2QQKA 2CAVA 1YFWA 3MIBA 2CL2A 3IWZA 3T1LA 1AR72 1AZDA 3KCCA 4FPLA 4JAAA 5I8TA 1QH7A 2AYHA 1DGWA 3K75B 2WYFA 4LK7A 4HXCA 4WM7A 5IJRA 3AKTA 5FZOB 1D0GA 1K12A 1RUG2 4XFBA 4JDMA 2WR9A 4OUSA 1DZQA 4XUOA 2ZHKA 4XAEA 1HV0A 3BB6A 5BV6A 1AYN1 1PIV2 2R16A 4RFT0 4FPFA 5A3TA 1RUH3 1NG0A 2XL9A 3H9AA 3I3EA 4AQTA 5C8WA 3IDAA 1U12A 2HWE2 1W8FA 2PXJA 1APNA 1WMXA 4ZU4A 3U4SA 1W8WA 2VCBA 1LHVA 1OD3A 2PHWA 3C7EA 2ZBJA 2QQOA 1QDCA 3LB9A 1FPN3 3VHRA 1SLTA 2EF6A 2DCYA 3DECA 4QDSA 2ZGTA 1HDKA 3O0WA 1QJX2 4TN7A 3SH3A 2RMU1 3ZM8A 5KXCA 1ZZ8A 2VNOA 1BVP1 1XU1A 3N7KA 2A6ZA 5JR2A 5ABJC 4E4SA 1DIWA 3I59B 2FD8A 3WHTA 4UW4A 5C3PA 3IAQA 3T3YA 1ASJ3 1W0PA 4XJZA 3WCSA 2WWJA 2YG0A 2ZEZA 1XE8A 1BK0A 2VO5A 3S0MA 2IC1A 1SLCA 4PLMA 2ZX1A 5C3QA 1BLZA 3PJQA 3UV9A 4BE3A 2PELA 1PK6B 3ZSJA 2DDUA 3H8RA 4GA9A 1HV1A 4LBQB 4GJYA 2ARAA 5FYSA 1O3TA 3P6BA 2HWC3 1PVXA 1EPZA 1ULEA 3POWA 4LE4A 4MXWB 2A5ZA 1FNZA 2RMU3 4YW3A 1RUE3 3RZZA 3VKMA 5CFCC 1CAWB 3ZSMA 5C5TA 5LY1A 1HXS2 3OYWB 3B69A 3WG4A 4OUEA 2JX9A 2NQYA 3O1OA 3TN93 3W20A 4HETA 3AMMA 3THTA 2VOTA 3VHPA 1GUIA 1IS5A 1Y9MA 2RS52 3HR9A 4U36A 3ZYIB 1JUIA 1B35C 3VKOA 4HT1T 5FMOL 1EY2A 1XC6A 4LO7A 4QX5A 5K8SA 2BDRA 4JGZA 2YHJA 2VMDA 3ACIA 2EALA 2R49A 4WM7B 5K9YA 4BMEA 4CU9A 3IIIA 1C5HA 3NVCA 1KFUL 1G9CA 4AI3A 2VZUA 4NIHA 3KHCA 3RYRA 3RG0A 4AWDA 4YG3A 5DZFA 2Q0AA 3ME2A 1RUD2 1RC6A 1HX6A 2BJSA 3VBOC 3NL1A 1GANA 4AFAA 2VH9A 1XYOA 3BTAA 1UCXA 4BK5A 3NSTA 4R9CA 4UFJA 3P5BA 1W6OA 3VD4A 4IEQA 5EJ1B 3S7IA 1YNAA 3T09A 4Q4W2 5LA1A 4LBLA 5HXMA 1MACA 3ES1A 2VTFA 3GDBA 2FZ1A 5BXXA 2YBPA 2P4EA 5FIXA 5HI0A 4QHZA 4MGIE 4NVPA 2XKPA 3UKVA 3QCWA 2ZXQA 3P3NA 2K9ZA 4LA3A 3O5SA 1UU4A 3WUDA 1CVNA 3N3HA 5EZWA 4Q26A 1YEWA 2QQMA 3EXUA 2K2SA 5FUIA 2YU2A 2I07B 3WNMA 5TSWA 3DUIA 5A32A 1KGYA 1NCRB 2X29A 3WDWA 3DPRA 4TLFA 4XCAA 4XZPA 5FXVA 3ZXEA 1OQ1A 3AP4A 1X8EA 4W4ZA 1QQP1 2RDQA 1Q8OA 4N43C 4W65A 5JAXA 4HZFA 4N9HA 4DY3A 5CEHA 2QQUA 5EP9A 1IS4A 5C71A 3OGRA 4RD7A 3U10A 4JC1A 5F2SA 1L7QA 4OHVA 4Q27A 5DABA 5FYBA 5A3UA 4QHOA 1XNKA 3LSDA 3Q8CA 2V5YA 4UF0B 4QXCA 1Y9QA 3A23A 4NUBA 1ND3C 1VBE2 1UW8A 2Z5WA 3MEPA 4CEYC 5CFDC 1G6NA 3OY8A 3VDDA 4CDXB 5DAWA 3UGGA 2ARCA 1VRBA 1VP6A 1XBFA 3WY6A 5T5JA 1S0GA 2H0VA 1UX7A 2WZPP 4UXAA 1Z7S2 3HNMA 1WWYA 3O1UA 4XXAA 4XETA 1MZEA 3IPVA 2R063 4GQ7A 3L2HA 4C1XA 5JLVA 3WSOA 2RR12 5C9AC 2W0XA 4YPJA 1KJRA 4QKFA 3VBHA 1J59A 4AGVA 4L92A 1WBFA 1OT5A 2YYOA 3H42B 3KF3A 1YQ5A 3MPPG 4Y33A 2OIIA 2EXKA 5EJZB 4XF4A 1DQ5A 4HVOA 5F5IA 4IE4A 3M2MA 1JXNA 4FPCA 4RL7A 3TNQA 5L7OC 2J7MA 1KDKA 3MLKA 4LUKA 1W6MB 4QQOA 5FYIA 1U5XA 3HT1A 3DF0A 2JKXA 4IUGA 4AI0A 2JKBA 5DXDA 5EPAA 1WA6X 2SLIA 1CR7A 2VVFA 4YM1A 4OULA 3EB7A 1X50A 5L9RA 3MF6A 4FFFA 1EAH1 1I3HA 4A44A 5FWEA 4NROA 2W91A 3ZXGA 3ZKUA 3GZUC 4GH4C 2Y33A 3BYWA 1LRHA 3OTFA 3A22A 1SQ4A 2WAAA 2B5HA 1N1TA 3W5MA 2R071 1ZBA1 3N4MA 4F8AA 5J96B 3J7HA 3KSCA 3DPRB 2Y38A 3OPTA 1IG0A 3N36A 5T50A 1D7PM 2Q1ZB 2XWBB 1BEV1 1F35A 2ZMKA 4ARYA 5C3RA 1GICA 5FZ3A 3WD5A 2X8KA 2Y8KA 2XJPA 5BNNC 1D2SA 1T6BX 1WGPA 3UNPA 2BWAA 2Q1MA 4BQ1A 1ZBE2 3KGLA 3WG1A 4KG0A 1FI2A 2I74A 1K5MC 4IXLA 2D40A 2XH6A 4I3PA 3P1IA 2QVSB 4DO0A 1A78A 4HMZA 2WZ8A 4I2OA 1D4M1 1R083 2WFF2 4WM8A 2UY9A 2PTMA 2DVFA 1LNSA 3CJIC 4J1WA 3WF0A 3E6DA 2RG4A 1NA1C 4IGOA 3OY8B 4B8EA 2R073 1GZWA 1JYWA 4QDRA 1MZFA 2BVBA 4ZXEA 1T6GC 3LPFA 1V6JA 4LHNA 4C1WA 1FOD1 4PJYA 5H9RA 4N8MA 4CRQA 3VKFC 2WZR1 5L36A 1QJY1 1UAIA 4URTA 3TB0A 2F4PA 3FZ3A 4GB33 1RUJ3 1W2TA 2HYKA 4RFRB 4W8JA 1EUUA 5APAA 2EIBA 1AL21 4LJHA 2A6YA 5FZLA 4E4HA 1MS4A 4YGEA 2RJ2A 3FN9A 3MZHA 2E63A 5KR7A 2WFPA 4CXXA 5C8CB 1C8M2 1GOHA 4CUGA 3TRSB 2WQZC 1D4M3 1H8VA 2E6VA 3MIDA 3A7QA 4XUPA 5ACA1 2JEMA 1RYYA 4CSWA 1ND2B 5A3LA 2HBTA 5CZKA 2VU9A 2WWUA 1ZRFA 4KNCA 4PDWA 1SFYA 2XJSA 3BU7A 2X10A 4QPWA 3MDPA 4XFCA 1RXGA 2R1BA 2Z2SB 1RUI3 4XIOA 3LIHA 5L73A 1RUH2 1UPSA 2XJVA 2BERA 1FOD3 3SKJE 4UFMA 2LW8A 3WQ1A 2J1TA 3OUIA 1QJY3 4CTEA 1YXWA 2JG9B 4NRMA 4NIAA 4CEWB 1TQ5A 1UMIA 4CCLA 2Q30A 4L97A 1FPN2 3CNAA 5FY7A 3POIA 2TEPA 1OBNA 3GZTB 4GAZA 3USUA 4ASKA 1AR91 1RUNA 2VNRA 3S7EA 1UQXA 3RZLA 5CB7A 1LGNA 3U11A 4DPNA 2WC2A 1URXA 4XABA 3ZFFA 1PGL1 4QX8A 2Z69A 4S2DA 2JE7A 5ACA3 2VXJA 1H2MA 3H0OA 4NHMA 3WVJA 4QU2A 3TNPB 4X8PA 4AI9A 4Y1XA 2Y6HA 1XPWA 2VZ1A 3ZYBA 3H50A 4CDWA 5KHJA 4RS5C 1ZA7A 1ASJ2 4CP9B 4RSUA 1VBC3 2CWMA 3J26N 4LPLA 1ZRRA 4BM8A 3EYPA 1TME1 3A0NA 3SITA 1G9DA 4XBQA 2D5FA 4K8RB 4M3CE 1YUDA 1N47A 3ZN4A 5FYTA 3RJRA 4MXVA 3D8CA 3FLPA 4CPBD 2D7FA 2UWAA 1Q8SA 1AR71 1AR93 1WW4A 2J42A 2HWC2 1OXCA 2DUOA 3LZZA 2Q5TA 1GFF2 1GZWB 2E9QA 4ORFA 2YC0A 4PI2A 1RUE2 2P3JA 4FOVA 4LR4A 2OT7A 3USSA 3X29B 1OQEA 2AC1A 2VQTA 4YFZA 4UWDA 4DUXA 2W87A 2XKOA 4OVEA 1RUG1 2W52A 1ZRIA 1HB3A 2WYSA 4YYOA 2FCTA 3TN92 4W6YA 2JIJA 2RHPA 2VC9A 3WF2A 2FMDA 4AVSA 1RUC2 3U78A 4OHZA 1PIV1 2F17A 4NR1A 4COVA 2BBVA 4BXFA 3PU3A 2ZA9A 2XPJA 1JTZX 3S6PA 2HJIA 3BGAA 4DXRA 2HWE1 4PF5A 5K7PA 2ORXA 2XG3A 4P14A 3HAGA 4Q1RA 3GGLA 1PVC3 3I4IA 4KBBA 3ROUA 4KI5M 3D82A 2W94A 2XR4A 3AL6A 2D6NA 2XLAA 5FZIA 5A33B 4XFAA 1BBT2 3AXDA 2B9UA 3MUY1 1AR73 4OQ9A 1IPKA 5FTTC 1GMMA 3JB4C 4P9YA 2WNUC 4ZPIA 5FP7A 3VBUC 1NE4A 1QJX1 5F9TA 4GIQA 4P9IA 4DMIA 2VM9A 3I2DA 3AC0A 5CG9A 4XW3A 4A3XA 5JXIA 1W39A 3ZOIA 3V0AA 1RUG3 3S57A 2FZ2A 5CKQA 5JZGA 3I49A 1ZYBA 1GKBA 3GALA 1UZZA 5T5OA 3WEZA 4XFGA 1PIV3 1S4CA 1ULFA 4ZONA 4I0AA 1A8DA 3USUB 3PVBB 4MSVA 4YRDA 3FLRA 3M3QA 2XMLA 2ZOEB 5FPAA 4FTSA 1HW5A 1BZWA 3AZYA 2FCVA 5FZ8A 1DLCA 1MS8A 4CCCA 3RVHA 4O9GA 2BGPA 4QQLA 4AK3A 5T54A 5AVPA 1SPPB 2RE9A 4FPGA 4A45A 3OGSA 3LFIA 2CGOA 2UYAA 4YM2A 1W90A 4CP2A 3NAPC 4AHXA 4CXYA 1YO8A 5AC91 2JWPA 1V6MA 1UD1A 5J98B 2CDPA 2EICA 1HXS1 4MVTA 1CAXA 2HEVF 2VW1A 4U2AA 3VD7A 3H1WA 4QGLA 5FYUA 2B4KA 1XNDA 5A1FA 3TAYA 4YVSB 2GALA 3OSDA 3AZXA 5LB6A 2Y0IA 4DUWA 5CU1A 3VBFB 1W8NA 2RS51 1OH3A 1UYXA 2XHNA 3WNKA 3T0DA 2R30A 4FTEA 2VMFA 2PA7A 4TXWA 3ZX7A 2E53A 2CHHA 1RTVA 1GU3A 2JIGA 3RYKA 3POFA 4XDOA 1OLQA 2O8OA 4Q4Y3 1UNBA 5FR3A 3ELNA 4NHXA 4Y5SA 1IPSA 3D0JA 5FBZA 2BV4A 2DYCA 3T4HB 2VR4A 3C7GA 1GWMA 1OUXA 4Y4RA 5I0UA 2KR2A 4HBNA 4XC9A 3RRDA 1VR3A 2JE8A 2VUCA 3GNEA 1RUD1 3IZOA 5FPUA 1HXS3 3WT3A 5K4LA 5KWRA 2VOKA 3KT1A 5FZ4A 4EN8B 1B35A 2WINB 3KB5A 3KV4A 2RM22 4YG0A 4H14A 5T55A 2VOVA 3VBSC 4A7KA 2R062 3JU9A 1MPXA 4PIYA 4Q4W1 3MIFA 5FUPA 1VRH2 1H1AA 3PDQA 1RJ8A 1Z0HA 2WKKA 5DAQA 1LESA 1J84A 2ORZA 2AUYA 3V0AB 3FJSA 4DUVA 5LEJA 3JD73 3LIGA 5FK8A 1RUOA 2X5IC 5C4WC 1HQLA 3HEIA 5BNQA 1VBD3 5HCHA 4AI2A 3OGGA 1RUD3 2Y64A 1XNTA 3FLTA 4YNIA 2IXKA 1IQDC 1W2AX 3E5UA 4D7SA 1WLTA 2JDUA 2W08A 1OVSA 3ILFA 3IKWA 4UW3A 4BQ3A 5A6QA 4ZKTB 1US2A 4K3UA 1ACCA 3AB0A 2BOIA 1JW6A 4YW7A 1MQTA 5LBFA 1W3XA 5KC6A 2LUWA 4JDOA 1AVBA 5BNPA 4QDQA 3T30A 2W1SA 1L7RA 2DU1A 2BU9A 4QPGC 1FYUA 3FHQA 2P3KA 3B5LB 3GBFA 5KXEA 5ABJB 4YW5A 1UYYA 1YIFA 2I2SA 4PLNA 1VBE1 4IEYA 5IFPA 1ENRA 1REEA 3ORJA 5DAPA 4KQ7A 4A6SA 4V1PA 4HKWA 2AACA 3WQ7A 4CA9A 4DINB 3ST7A 4QM9A 3LEIA 5GLUA 1QJZA 3CMGA 1VAMA 5A7SA 2MNGA 2UWCA 1NZIA 4AI1A 5JUVA 5KHGA 2ZZJA 2WT2A 1OUSA 2VZQA 3LEKA 4CU7A 5IVYA 4FPHA 1Z7S1 5FZMA 5JIUA 5FLIA 2AEYA 1R082 2A7AA 4I09A 3CEWA 4F83A 5CISA 2RJLA 4BQWA 3TEWA 5CFCB 1O5LA 4DIQA 3LDKA 2JB8A 1ZX5A 3CQOA 1O59A 1CONA 2RR11 3AX4A 3SLIA 4FT8A 1VPHA 2AREA 3ZFGA 4L99A 5FJHA 2WN2A 2Y6GA 1ND3A 1MS1A 4XUTA 1AX2A 2JG8A 1NOVA 3KZ4C 1VBE3 2LRPA 5AVAA 3DYMA 1OD5A 5T5PA 1BK1A 1GR3A 1LHUA 2B39A 3N7MA 4DXSA 1W2OA 1V6OA 2VQUA 1B35B 3AFGA 3BALA 3CU7A 1V6NA 3KCXA 4OHXA 3KLSA 1CAVB 5FAXA 5JSOA 3ZIXA 1GSLA 4GB32 1RUJ2 3SMHA 4LBOA 3PIJA 5DG2A 3AK0A 5F6LB 2WWSA 3O1VA 2BW8A 3LDRA 1MVQA 2PHUA 3H8XA 5B2GB 3C7FA 5DUUA 2VZOA 2IUWA 4IV3C 5L9VA 4IW3A 4D7TA 3GCWA 2C5DA 4AQSA 2VY0A 3RI8A 4LOSA 1PX4A 4HL0A 5C9AA 2PHDA 2VNVA 3KF5A 2JENA 4XJ8A 2RR13 4FBFA 3ZDSA 4IGPA 4JQTA 1D4VB 4D69A 4AG4A 5BNOC 4RGKA 3VBOB 2P1BA 1UY1A 1M4WA 1RUI2 3A0KA 1KQRA 2QCSB 1DGRA 2VULA 3D4KA 4UBHA 3LA7A 5FZEA 1V9U2 2V4VA 5L7OA 4CZSA 4EN6B 3RGBA 5FZOA 2ZX3A 4KU8A 1JOJA 1VMHA 1MQTB 5E88A 3KV9A 4B29A 1BXHA 3VL8A 1NXMA 2A70A 1PM4A 5BNPB 2NZ9A 1ZBE1 4TSVA 2XXZA 4Q0VA 2HWB2 2VOWA 3J9SA 4NHYA 3BIWE 2X53S 5DPNA 2E7AA 5IK8A 1NE6A 3E6BA 4JKLA 1UYZA 2A71A 2ENRA 2YPJA 5JVVA 2WFF1 4IQPA 1RL3A 1ZRDA 3CIHA 4UFLA 2GMPA 1E5IA 1UY2A 4CDQC 3KGZA 4NO4A 4K1ZA 1QNWA 1JZ3A 3SXWA 3T2PA 3I2OA 2YBKA 5SV5A 4JKMA 4AF9A 4RQPA 1VBC2 2GNBA 4N43B 5GLZA 3VHOA 3H8OA 1TG7A 4YFWA 5LK7B 3I59A 2WA3A 4LIUA 4PCRA 5IK5A 1Q5OA 4AEDC 4TYSA 5FZAA 5K0UC 4H2AA 1UU6A 1ZBE3 3A21A 3FL7A 3QACA 4RGGA 3T2OA 4NHLA 3Q8FA 1JZ4A 2VBBA 4MOAA 3VZKA 2PQQA 3ZFGB 4HONA 4SLIA 5F3EA 1ND3B 1C8M1 1NUKA 3AZVA 2BNNA 3CJIA 2WFF3 3M4FA 4W50A 4Y1VA 3V65A 2IZWA 4G3YC 4YW4A 3WNXA 4Z2WA 4CEYB 1PK6A 2YY1A 4N7IA 2GC1A 5CFDB 3WV6A 1V6IA 1I1EA 3DYPA 2XBO2 3N7LA 2Y26A 4FO9A 4MXWA 2QQLA 4XTMA 5FXXA 1OFSA 1CAWA 1KFXL 1N3PA 1RUH1 4M4PA 1LOGA 1COV2 3OYWA 4J6GA 3CLPA 1W9SA 2G1MA 3HBKA 4E8DA 3OG2A 3CKHA 3OOXA 4B7EA 1PVC2 3LEMA 1F9KA 2WBKA 4JDNA 1KITA 1OVPA 5C9AB 1UY4A 2XVGA 1FPN1 2QZ2A 1KS5A 2ZEXA 4LA2A 5FBJA 2O1QA 2VUAA 3I8TA 4ARXA 5CIRA 4YZ4A 1C8M3 4DNYA 2A3WA 1O4TA 3OEAA 4FFHA 4AAXA 5L7OB 4OZXA 5I91A 1MS0A 2DCTA 5KHIA 2Q1FA 1H4HA 4FVVA 4EJRA 3FFZA 5LRSA 4Q0PA 4XE9A 2IVIB 3M3OA 5CBLA 4QPYA 1ASJ1 5JMCA 3ACFA 1W6QB 2BGOA 4BA6A 1UZYA 1RINA 1XOYA 1QH6A 2XLGA 3OGJA 4YGCA 1GP6A 3U0ZA 4FQ4A 3IT8A 4GH4B 4N53C 2DUPA 3GZEA 2NPIA 2W39A 3PUQA 1UKGA 4OCTA 5KC5A 1U5ZA 5JOZA 1TNRA 2AENA 4BYYA 2HWC1 5FY0A 2X05A 2W95A 1QDOA 1RUE1 4RQPB 5E89A 5F5AA 1XRUA 4H7LA 4LULA 4GWIA 3KMHA 4Q4V2 3MIHA 3S30A 1LECA 4Y22A 4RQPC 1W2UA 4XBNA 3WP6A 4E2QA 1O3RA 5BNNB 3TN91 3LWCA 4IE5A 2R042 5HV0A 1RUC1 2XJRA 1E5RA 1SACA 2JDMA 3LA2A 4XFIA 3THPA 5JXJA 1K5MB 3UESA 3W9AA 4AW7A 2ZKLA 2WT0A 3CL1A 4XF0A 1NCRA 3R6SA 3E97A 4WV8A 2HYXA 3CJIB 3ETPA 2PHTA 4L11A 5IT6A 1LR5A 3AMHA 1DZRA 1O8SA 3SCFA 4AQ2A 4R4ZA 5F3IA 1OA4A 1NA1B 4M3CB 4AGGA 1BBT1 2GSYA 4Q4Y2 2CAUA 4BQ5A 1UL9A 1QY4A 3QBQA 4IEZA 1W9FA 3SCGA 1XJAA 3T08A 3I7DA 1YJKA 3BTZA 4UF0A 4Q0SA 1LOFC 4YZ5A 1OLME 4XCBA 2QNKA 2MPFA 1SFPA 2OUJA 1GQHA 4AAPA 1PGW2 3OF1A 4JGYC 1RUC3 3C7OA 5DN2A 2ID4A 4AFCA 3PMSA 1R64A 4CDXA 2ETEA 4XF3A 2J1VA 5A7PA 2XQRA 3FUQA 3V0BB 4BDVB 2OPWA 4Y4YA 5ISLA 2ZGKA 5E6HA 4EQVA 3VUOA 2BFUS 4XAAA 2JDPA 4HK9A 1QMJA 4N90A 5LCWL 4PT6A 1BBT3 4BJ0A 4QPIC 2DU0A 2GNDA 1SHWB 2OW4A 3JD72 3IM0A 4FTBA 2YPDA 2WDBA 1SLBA 4ISQA 3ZSKA 4D7YA 1VBD2 3PVEA 1DGRN 2LROA 4UW5A 1HN1A 4LKFA 5DAVA 2VZTA 1N1SA 1WMFA 5FXWA 1H1MA 4GKXA 1ZNPA 4FXKB 1W6MA 4E2SA 3UETA 3WZ1A 4AHWA 2V72A 2P6HA 4QT6A 3C2UA 1UMHA 1W6NA 1SBFA 3SNMA 2GP5A 1PO22 1N3OA 2VAUA 3KWVA 2E51A 4C0BA 3WDUA 3NV4A 4HKLA 4Y22B 5C7GA 1YIPA 1UX6A 2QBXA 2WS92 5FPZA 4RS5B 3NAPA 1NQDA 2NMOA 2PLV2 5BY5A 1IOAA 1Q8PA 2ZGOA 3GBGA 3BODA 3HN1A 5JDBA 4BQXA 1JYTA 3RZHA 3GJAA 3ZMNA 5FPVA 5IVEA 1UU5A 2SBAA 3IMMA 1HQNA 2W1QA 2FDIA 3K77A 1CQ9A 3ZYPA 3DKQA 3AFKA 4NPMA 4LKDA 1GWLA 1PM7A 2EVXA 2RM21 3R4UA 4IEVA 4R9BA 2P17A 1GNHA 2IXIA 2R061 5D21A 5FZGA 5DUVA 3WNOA 1UOBA 1VRH1 4QQ2A 1XYPA 3ACLA 3PL0A 5A3NA 1DG6A 3Q9OA 1EV12 4JCKA 3I54A 4QU1A 3W21A 1RIRA 4URAA 2JDZA 4LT5A 1UMZA 4Z8BA 2DTYA 4PI0A 2BYVE 4K8FA 2QFEA 2DFCA 4XQDA 5DUXA 2BVVA 4CXWA 4QWNA 2Q8OA 5FZDA 2ZEWA 1LGCA 1X36A 4CU6A 1EYBA 4FOQA 4PBPA 1R093 3U37A 5LATA 4ET7A 4LHKA 3MLJA 2QQWA 4XJAA 3VDBA 3L9JT 4X8NA 2RM23 2OYZA 2YV8A 5I0RA 2D3PA 2VBDA 3LGRA 3VBUB 5BPXA 2WNUB 4CE8A 2B7YA 1MEC3 3S5AA 1DQ0A 1SCRA 1VRH3 1YC61 2G4IA 2VJXA 2NMNA 3O14A 4CDUC 1ENSA 5J1XA 1MVEA 4UFKA 3RMXA 2NN8A 4BPZA 2VMHA 3W58A 2DBNA 4R8HA 1H2LA 1ND2A 2X5IA 2BGCA 2YUEA 1ULOA 3CBNA 3CZJA 3VD5A 5EWSA 4PQ9A 2C24A 2WNVC 1QEXA 1AR63 2PQSA 1MS3A 2Y6FA 3K46A 5LEKA 1W6NB 1PHMA 4RYDA 4FP2A 4Y1YA 1J3RA 1XE0A 3O1SA 1HIXA 1S0EA 4OHWA 4YVWC 4Y1UA 3BVCA 1LB2A 4XPVA 1FX5A 2C9AA 5LW9A 4OI4A 1R081 1PMIA 2JG9A 5F2WA 4Y20B 3AL5A 3NAPB 4CEWA 3H3UA 5C8CA 5T5LA 4E27A 1BKZA 4W6XA 4P9GA 5A70A 2NYYA 5FP4A 1UIJA 2QTWB 4RGAA 3RZJA 4IDZA 1R1ZA 1RMU2 2KD7A 3NNMA 2VMCA 2V73A 4IGQA 2Y6JA 4QKDA 3VLBB 4DRRA 1B09A 2CWSA 4COUA 5A7QA 2OQ7A 2E26A 3OUJA 2GAUA 3SC7X 2W47A 1Y3TA 4UW6A 1UZVA 4GD4A 5JXHA 1LU1A 3AP9A 1RUJ1 4GB31 4AL9A 5D1IA 4CP9A 5JXGA 4Z07A 2BTVC 5LK5A 3QD6A 1RGSA 4J1XA 3ZVXA 3EJKA 3K4AA 3OGVA 2N7GA 1RHI2 4XXPA 5DG1A 5FK7A 4FCAA 1QOOA 4ONUA 3WUCA 4LORA 4CPBA 3RZGA 1W8TA 2A6WA 4UBGA 4XFHA 5F8PA 4YW1A 1DZTA 3ZYGA 3B01A 3HD8B 4JVAA 1W9WA 2WIIB 1E57A 4M00A 1RUI1 4YW6A 2LALA 3OEBA 3WQBA 1X33A 1V9U1
chains in the Genus database with same CATH topology
3W59A 2JECA 1YLLA 5JIAA 4JQRA 2PN5A 4AVBA 1LEMA 2BPA2 2XVLA 4OHYA 3AP5A 5GLVA 2HWB1 4BOWA 4IV3A 1H1IA 1NQJA 5A3MA 2PHXA 1GNZA 3ZXFA 1O7FA 1GYKA 3JQWA 4BWOA 2Y0OA 1BVVA 2DVBA 2X5IB 3WP4A 5C4WB 5A33A 1QXPA 1IS3A 2RS33 1WLWA 3WP5A 1FMD3 4R9AA 1VBC1 2EAKA 1V9U3 4AFBA 1KD7A 2C0ZA 1GZ9A 3B9CA 2JXAA 2DFBA 2XJUA 2H6BA 4EWAA 4KU7A 3WW2A 1O3SA 4QPGB 2ZX0A 1S2BA 2HWB3 1LOCA 4A7ZA 4S2GA 3PTYA 3V64A 4LHLA 4E9KA 1RVF3 4K6BA 4YGDA 4ITCA 1GV9A 5D8AA 3VV1A 2YDEA 2WSVA 3VHNA 2VVEA 1S1AA 2XBO1 4KWKA 5FFOC 2Q4SA 4AEMA 1G9AA 5FOBB 5J37A 2ZPXA 4OUMA 4ES9A 3HT2A 5IUQA 5HCAA 1DQ2A 1COV1 1A3KA 4QD2A 4DXZA 2WSUA 4YVSA 1YI9A 2UWBA 3VN4A 4NHKA 1PVC1 3AZWA 4C0HA 3VBFA 1LENA 5HBAA 2BNMA 5HXVA 4TWTA 4F3JA 3GF6A 4XMAA 2YXSA 1A6CA 2XBO3 4OI2A 2PHLA 3MPBA 4C91A 1S0BA 3ZXLA 3INAA 1FXZA 3D5OA 1SMVA 2ZKNA 2VUJA 4NPRA 4Q8KA 4IV3B 1O3QA 1COV3 2QUOA 3M7AA 5EYYA 4XILA 4XF1A 1ZZ9A 2MEV2 5J36A 1LOBA 2IXJA 1WW6A 3ZN5A 5FQ0B 2KA3A 5BNOB 1MS5A 3WCRA 1J3PA 4MGYE 4CYDA 4Q4V1 1Z78A 3TOJA 4S2HA 1ALYA 1C1FA 3NW4A 4LO8A 2R041 2LM3A 2XB6C 2G9GA 4JGZC 2QKDA 2OZ6A 3VBRC 2DURA 3NV2A 3FFQA 4JV4A 4MV2A 5T3NA 4MH0E 1SBDA 3MIEA 3MW2A 3WDYA 2F6BA 4XYXA 2ES3A 4CDQB 4YSFA 5D8AB 2ARXA 3LAGA 4Q4Y1 2VW0A 4GALA 3ZN6B 1X7NA 1RUF2 3O12A 3AKQA 1VALA 1LJ7A 2ZGMA 1LGBA 1ZZCA 2ZGPA 3AYCA 4Q4V3 4LE3A 5ABJA 4LBMA 5SV8A 4IERA 1AL0G 2KM2A 1PGW1 1VLNA 4AE2A 2R043 5K0UB 1PNFA 4OI0A 5F5QA 1J1LA 4AGRA 1QU0A 4HN0A 1DYKA 1RJ7A 2GC3A 3R4SA 2D6OX 3IMNA 4Q2FA 3GBWA 1REDA 3AKSA 2ZAHA 3H7JA 4PBOA 3H8UA 4B4QA 5CFCA 3JD71 3ILNA 1IHMA 4ASMB 5I8SA 1VBD1 1OSGA 4FOWA 4BIOA 4X6RB 4D94A 3GHMA 5JWPA 2IFWA 1KRIA 1NZCA 3J4UH 3M1HA 3SISA 1HQWA 2PAMA 1S0JA 1R092 4KL1A 1DFQA 4R4XA 3RJ2X 2DV9A 2IXLA 3WOGA 1CAVA 2ZX4A 5GZEA 1VJ2A 4DOUA 3R0RA 3KCYA 3SH4A 2D6LX 4Q0QA 1MEC2 3NV1A 4B7KA 2UU8A 1PO21 1MZ5A 1CJPA 4QPIA 3WDTA 3AYDA 2CGNA 4QQPA 2WS91 4DFSA 5J09A 5I93A 2PLV1 5T52A 2VG9A 3VDDC 1AYM2 4X6QB 1LOAA 1YWKA 2ILMA 2BFUL 4MYEA 4XJ9A 2XLFA 4WZFA 5FDBA 3VBOA 3WR0A 1AR62 1DBNA 2GN7A 2UURA 5EV7A 4E4DX 1W0OA 3LSEA 4K20A 2TUNA 1JYIA 1LHNA 1QGLA 3ES4A 4INDA 3VBHC 1PO23 1NCQC 4Q4X3 4BHPA 3HWJA 1UPIA 3FE5A 2R32A 1CIWA 1DHKB 1NLRA 3IIAA 1EV11 5CAZA 2BQPA 2WS93 2BUKA 3G7DA 2PLV3 3ZFEC 3JUUA 2ET7A 1Q43A 4XDQA 4CP0A 2ZJCA 3NKTA 4MX3A 4N43A 3ASIA 4Y1ZA 3MI8A 1UIKA 4WZCA 1VBA3 4ES8A 4IEPA 4S2FA 2HEYF 4AFDA 4AVVA 1ULDA 2WLQA 2XUMA 1EV13 1OPOA 1ULGA 1VAKA 2DF7A 4JGYB 4N9IA 5JCTA 4CEYA 5CFDA 4WBBA 1U5IA 2BWCA 1N1YA 2VXRA 3AP7A 1ENXA 1DLLA 1PZ9A 4AVTA 4BMBA 5L19A 1PZ8A 3ZIWA 4IEXA 4OLLA 3WDVA 4LNVA 2P3IA 4WM8C 3AMNA 4BZ4A 4NWVA 1HRV3 2JD4A 2P2KA 4QPIB 3O0VA 3BCWA 4HLTA 1REFA 1SDWA 4G9SB 5GALA 3WX5A 1BQPA 5AFEA 3M70A 1POV1 4GULA 1QOTA 5JSPA 4HK8A 5KXBA 2RS32 1RMU1 1FMD2 2VW2A 5GLTA 4FPJA 4YM3A 3DL3A 4Q0UA 3LOIA 3AMPA 5DZEA 5I0SA 1C57A 1QJU3 1HKDA 2QE3A 1LOEA 1VBB3 2H0BA 3QLQA 4IV1C 5HCBA 2XL7A 3JQXA 1W6QA 5JPNB 1OPMA 1XXNA 3MW4A 2XJQA 4RA0A 3TYJA 1RHI1 5AC92 3OD0A 2V09A 4GH4A 3BOPA 2B45X 1RVF2 1V6LA 4PDWC 3WINE 3FMGA 4GMP3 3H3ZA 1POV3 1IS6A 1RMU3 4AFMA 1WMDA 2WNEA 2D98A 2XHKA 4ZXKA 3AKRA 1YRZA 3A4UA 2VMGA 3J8F3 3N35A 2PHRA 3D0SA 4P5HA 1H9WA 5GLWA 5BNNA 5JOWA 4JTNA 5FO7B 4TZDA 1LU2A 2DVDA 4AVAA 1K5MA 4KG8A 1RHI3 3ZFFC 2XGXA 3QH6A 4AI8A 4XQWA 1AX0A 1MS9A 1GBGA 2YGMA 3MLLA 4I0BA 3E5QA 4M3CA 1NA1A 4CDWC 4AEKA 2VMIA 3PMEA 5E1RA 1OMIA 4K7JA 4YGBA 3AMQA 3M3CA 4L8QA 3ZXDA 2YZ4A 5J48A 3KS7A 3CF6E 2ZMLA 1DGWX 4ZU7A 3HIFA 3M8LA 1WCSA 1Y7BA 1BJQA 1AF9A 4CDUB 1QHDA 3HBZA 1YI7A 2ZGSA 1VB4A 3V0BA 4Q8LA 5KXDA 2WJSA 3VKLA 4QGMA 2OPKA 2JICA 2WNVB 5GZCA 1IPJA 1FT9A 2GNMA 3BPZA 3CJXA 1GQGA 2GH2A 3JBG2 3WW4A 1F31A 2WQ4A 4B4RA 5CNAA 1LEDA 4AXOA 2RS12 4YVWB 2GNTA 3MFAA 1BMV2 1JH5A 4XMIA 5E16A 1J3QA 4FPKA 4LO6B 1UKRA 4CP1A 4RR3C 1OLRA 5FLHA 1FAYA 1OA3A 1H4GA 3KQRA 2FBEA 1M06G 5FPXA 2YMZA 3ETQA 4BIFA 4EROA 4LEJA 5JZGC 4FPEA 1OHFA 5LRRA 3ZSLA 4RS5A 2FMYA 3AXEA 2ERFA 3RMYA 1WD3A 3R4DB 1CJDA 1QWRA 1DF0A 1FATA 4QM8A 2D6MA 5H9PA 3RNSA 1Q56A 1O5UA 3RPQA 1DU3D 1W6PA 3UK9A 1R1A2 1AJOA 2DTWA 1AXYA 4HANA 1ZREA 3O0XA 1CPMA 2MEV1 4ASLA 4YARA 1J1TA 3FX3A 2WT1A 2G9FA 2QQPA 4QXKA 4FXGB 2DCKA 3RWNA 1LHOA 2IFRA 1S0CA 1AYN3 3AZZA 3ZSEA 1AXZA 1WBLA 1D2QA 3G6JB 2E7QA 2QDNA 1N3QA 2O0OA 1JUHA 4H7MA 1V6KA 4KGGA 5FOJB 1IZ3A 1SLIA 1XNCA 4P9WA 3TBDA 2UY8A 1XQNA 4HKOA 1O4ZA 4Z92B 2A3YA 3EHKA 5JI9A 4LBQD 3LCPA 2MEV3 1Y43B 3VBUA 1WW5A 3POYA 2WNUA 4AQ6A 1LCLA 3T2TA 1RUF1 4R9DA 1YFUA 4HPKA 3K48A 2ZHNA 3PHMA 4XQ4A 3ZMOA 1IQAA 2IXHA 3MF9A 2MHFA 2GC0A 4BLIA 2C1FA 5DDJ2 1ZVFA 3VBRA 2A6XA 4LBNA 4EN0A 1YFXA 3GHNA 4HVRA 1LODA 2CYFA 2NLRA 2OUHA 3POSA 1ZRCA 1OOPC 2IXCA 4K1YA 4Q4X2 5E8AA 3WP3A 4WVMA 4FQZA 4P9LA 4Q1PA 1YJLA 3E5XA 2ZACA 4KWJA 1ZM1A 4Z1VA 2HWD2 4Y20A 1LHWA 1F2NA 1RUF3 1FNYA 1X8MA 4MGZE 1CX4A 4WVVA 5F1RA 3VZOA 1A8MA 4BLJA 1C1LA 2QDRA 1ZZ7A 1W6PB 3RI9A 1R091 1MQTC 2ZMNA 2AGSA 2CV6A 3MFCA 3AYEA 5BNPC 1PNGA 1VBA2 3OPZA 1MEC1 2JJ6A 2XJTA 4XJUA 1H8TC 2UYBA 1QXJA 3ZXJA 1RITA 1LULA 3H1YA 1TMF2 2E7TA 5GJ6A 2ZGLA 4AYUA 3FBMA 3FWEA 5AFBA 3AYAA 1AYM1 3WQ0A 2PAEA 2R6QA 2HEWF 4SBVA 1AR61 2R0FA 4XF9A 1ZZBA 4IETA 3VKNA 4FP3A 3WG3A 4JRLA 3ZO0B 1HRV2 3VBSA 4EWDA 1C8NA 4JRAA 1OQDA 3ZFGC 3UJQA 4YG6A 2IWGB 2JE9A 3VZJA 4HPKB 2JG8C 4NN0A 2GU9A 2GZWA 4M0HA 2P34A 3CO2A 4AEJA 1EPWA 2D44A 2VQ0A 3M3IA 2HWF2 5C4WA 2K0GA 4XFFA 1QJU2 1AYM3 4JGZB 3VBRB 1VBB2 1YCIA 4COZA 4FAGA 1QQP3 1NXD1 2VECA 5F6KA 4COYA 1XU2A 4DZGA 4Y24A 2ZZQA 4YZ2A 4WVMB 3AJZA 2RJKA 5CG8A 3R05A 4E4ZA 4Q29A 4LO5B 1MR5A 4QPGA 1NCQA 1WW7A 4O9EA 3T1MA 4XHXA 3EBRA 3UKNA 2ET1A 4FAHA 1ONAA 1W6OB 5GZFA 3J8F2 3ZFEA 1WA4A 3NKGA 4LLFA 3WDXA 3N7JA 1O91A 1ZZ6A 1QNYA 1AXKA 2GMEA 2P37A 2VOXA 2NM1A 1HLCA 1S0IA 1AJKA 1C28A 5FO9B 4HN1A 5IK7A 3OD4A 4RHV2 1Q8QA 1WLCA 4AHYA 4DY5A 1ZA4A 3NV3A 3VZNA 1PO12 2CTVA 3ZXKA 4H3WA 5A32B 4ATFA 1F5JA 3AJYA 2Z42A 4N7UA 2RS31 4RQPC 5KHHA 1HRI2 2WLPA 1FMD1 1QF3A 2KXLA 2ZTNA 2OA2A 3RYPA 1XNBA 3ZPYA 4LLOA 3VBSB 2EXJA 2D3SA 1NY72 3B00A 4LO4B 2XWJB 1EAH3 4I02A 4IEWA 1DYPA 3NJZA 1LTEA 4DRVA 2VGDA 4EV0A 1PK6C 4GXLA 4H55A 3E6CC 1RVF1 1S0DA 3M3EA 3VDDB 1AR82 2A6VA 3HMYA 1G9BA 1ZBA3 2D6KA 1WLDA 4Y5Z0 2ZHLA 5BNOA 5FQ0A 5IK4A 1H2NA 4AHZA 1C3HA 3SHRA 1BEV3 1BCXA 1N1VA 2AR6A 1CESA 1I9RA 3IPVB 1SLAA 2ZGQA 2QJVA 2DWRA 4IV1A 4A7YA 3VBHB 1GZCA 1NCQB 1UF2C 3URFA 1AUYA 1WMEA 3KT4A 3APBA 4WM7C 2BEOA 1U5YA 1TE1B 1JBCA 4CDQA 3ZFEB 4LUMA 5JOXA 1QKQA 4B3NA 2GC2A 3H1MA 3ZN6A 2D43A 1I5ZA 1AHSA 3GZAA 3IDCB 3H7YA 2WZR3 3FUOA 3JB8A 1AL23 4AEDA 3EO6A 2ZABA 2VQAA 1D0HA 5K0UA 4GMP0 3O7OA 4FPOB 1POV0 2ZS6B 3SH5A 4HFSA 3RS6A 4QHBA 4QMAA 3RDIA 3ZYRA 1CPNA 1LKNA 3IDEA 5KHKA 3B94A 1AYN2 1VAVA 5H9SA 2PHFA 2VNGA 3JBG1 5CADA 4M01A 1EP0A 2RS11 3OBRA 3VZLA 4WM8B 1NCRC 4R52A 1BMV1 1KS4A 1DQ1A 3MICA 3K51A 4K21A 4NOTA 1H0BA 2HKXA 3UJOA 4XJWA 4XIKA 5EYXA 3PVOA 2RMU2 3AM2A 3WG2A 5HCFA 1V70A 1WCKA 2Z79A 5FMOS 2ARBA 3NWKA 3SCHA 3D6EA 2BNOA 2GMMA 5JOYA 1CN1A 2FQPA 2DUQA 3DGTA 5DUWA 4IV1B 1CGPA 3JBG3 1TME3 1C4RA 4CDXC 4FSJA 1CAUA 2RS13 4K9SA 4C90A 1JHNA 3WHUA 1NYWA 1R1A1 4Z82A 4N53A 4YM0A 1ENQA 4YZ3A 4PDWB 1S0FA 2AZ5A 1O4YA 4RR3A 3KM5A 2H6CA 4D3WA 3PJYA 2D5HA 2ZCWA 1XYNA 3IN9A 2ZGNA 4Y26A 3JZVA 1QOSA 1IKQA 2CGPA 3DN7A 4ATEA 4XHBA 4YLZA 4AVCA 3VGIA 3PVNA 1GLHA 4AEDB 2GN3A 3ILRA 4PIZA 3WW3A 3LA3A 2HWE3 3L2YA 5CVRA 1S2KA 2VVDA 4MLOA 4COWA 3ZFFB 5EFUA 4XEZA 2EAAA 5FLJA 2D93A 3KD4A 3ENRA 1R1A3 3PNAA 4PIXA 1ULCA 4CDWB 3OJBA 1IKPA 2B46X 1Q3EA 1QJX3 3QH7A 2I45A 2PYTA 1OFNA 3KT7A 2D6PA 2CNAA 2TBVA 1LOFA 4META 2O8QA 3DPRC 3HQXA 4GWNA 4M3CF 5FCCA 3WW1A 5BYNA 4JGYA 4MGKE 3OCPA 2FHRA 5DDJ1 3DKWA 3RQ0A 4EN9B 1L3JA 4OI1A 1YHFA 1MZ6A 1AX1A 2PFWA 4Q4X1 1SEFA 3IDBB 1FV3A 5AC93 3B93A 2HWD1 4YW2A 3ZXAC 3AKPA 2DVAA 4DB5A 5CA6A 1CAUB 2WA4A 3AP6A 5C6CA 1X82A 1WD4A 1QQP2 2D3RA 2RS53 4I01A 4N53B 4MZUA 2GDFA 4XOGA 2AH2A 1VB2A 3B7MA 4RR3B 5DDJ3 1OKQA 1SLLA 4KWLA 3MW3A 1SCSA 4JTOA 1VBA1 3P3PA 1OOPA 1C5IA 1NLSA 5C8CC 2R0HA 1QXRA 1I6XA 5JZGB 1TMF1 1ND2C 1TEIA 4GWMA 2HWD3 4HSJA 3LOBA 4IEUA 1WCDJ 4KGQA 3V56A 1PGSA 3FHIB 4IL7A 2GH8A 1S55A 3NO8A 4QQHA 1CD3G 1RB8G 1H30A 2A73B 4Q4W3 2JG9C 4CEWC 4LBJA 1HRV1 5BUVA 3UL2A 3FBYA 3UKTA 5JSRA 1H8TA 5C33A 1CAXB 1SBEA 2CY6A 3QOPA 4A2UA 2ZGUA 3B9IA 2EXIA 2TNFA 2ZGRA 3OBTA 1H2KA 2LTNA 1TMF3 1DQ6A 1YYNA 2DVGA 2ATFA 2HWF1 1QJU1 4EN7B 4L2NA 1VBB1 1YFYA 2ZAAA 1EAH2 1VIWB 1JYCA 4W6WA 5EXOA 4NWWA 2YGLA 1G8WA 3ATGA 4IEOA 2D97A 4CDUA 2DCZA 1G7YA 4BCUA 4GMP1 2R072 1ZBA2 4WVWA 3BOWA 5JI7A 4I3GA 5J3UA 1PZ7A 1BEV2 1J58A 5GM0A 3PLQA 2YROA 3J8F1 5FRAA 2HWF3 1G9FA 2WNVA 4MUVA 2XVKA 3MYXA 3VL9A 1OA2A 3WLUA 1OOPB 1Z7S3 4FOYA 2A3XA 4YVWA 5EJ3A 4BH9A 1D4M2 1BYHA 1F5FA 2VPVA 4HVQA 2EXHA 5KBFA 4RHV1 1G86A 3B02A 3ALQA 3B3QE 1JN2P 4B4PA 2A75A 4I0WB 3VZMA 1OI6A 1PO11 1UN1A 2ZX2A 2NP0A 4ISRA 3C3VA 1KJLA 1TNFA 1HRI1 1FOD2 3ECQA 2WZR2 1QJY2 2B42B 4K40A 5JR7B 2DCJA 4WVZA 2R1DA 5I0TA 1AL22 5I8YA 1NY71 1H8TB 4HSLA 1XE7A 4QGNA 3MIGA 3RSJA 4KH9A 4OFGA 5ACA2 5GZDA 1KDMA 1H9PA 4P9XA 4RHV3 3JCIA 5D8AC 1Q8VA 1F8VA 4ZU5A 2ZHMA 1AR81 1PO13 5FO8B 4FPYA 1U0AA 4M0NA 5GZGA 3LKJA 3ZYJB 4EWEA 1HRI3 1WUVA 2EIGA 4LTAA 5J7MA 3U4XA 2B8MA 2OZJA 5GKAC 4E2GA 2PAKA 4GKYA 3EQEA 3MGUA 4YVSC 2OVUA 3VBFC 2QZ3A 1AR92 3GYDA 4I30A 4F7ZA 1KXGA 1PGL2 2JG8B 4XBLA 2WL1A 1V00A 2W68A 5DZGA 4G4FA 5JPMB 3DV8A 3FC0A 1DGLA 4DQAA 4LBQA 3IBMA 1AR83 4XTPA 1FV2A 4L9BA 4LBKA 3TWIA 1DDLA 4PLOA 5FREA 1IGOA 4IESA 1TME2 1DQ4A 2EA7A 4YZ1A 5H9QA 1SFNA 4P9JA 2CAVA 1YFWA 3MIBA 2CL2A 3IWZA 3T1LA 1AR72 1AZDA 3KCCA 4FPLA 4JAAA 5I8TA 1QH7A 2AYHA 1DGWA 4WM7A 3AKTA 1D0GA 1RUG2 4XFBA 4JDMA 4OUSA 1DZQA 2ZHKA 1HV0A 3BB6A 5BV6A 1AYN1 1PIV2 2R16A 4RFT0 4FPFA 1RUH3 1NG0A 2XL9A 3H9AA 4AQTA 5C8WA 1U12A 2HWE2 1APNA 4ZU4A 1LHVA 2PHWA 2ZBJA 1QDCA 3LB9A 1FPN3 3VHRA 1SLTA 2EF6A 2DCYA 2ZGTA 1HDKA 3O0WA 1QJX2 3SH3A 2RMU1 5KXCA 1ZZ8A 2VNOA 1BVP1 1XU1A 3N7KA 2A6ZA 5ABJC 4E4SA 1DIWA 3I59B 3WHTA 4UW4A 1ASJ3 1W0PA 4XJZA 3WCSA 1XE8A 3S0MA 2IC1A 1SLCA 4PLMA 2ZX1A 3PJQA 3UV9A 4BE3A 2PELA 1PK6B 3ZSJA 4GA9A 1HV1A 4LBQB 1O3TA 2HWC3 1PVXA 1EPZA 1ULEA 3POWA 4LE4A 4MXWB 2A5ZA 1FNZA 2RMU3 4YW3A 1RUE3 3RZZA 3VKMA 5CFCC 1CAWB 3ZSMA 1HXS2 3OYWB 3B69A 3WG4A 2JX9A 2NQYA 3TN93 4HETA 3AMMA 3THTA 3VHPA 4U36A 1IS5A 2RS52 3HR9A 3ZYIB 1JUIA 1B35C 3VKOA 4HT1T 5FMOL 1EY2A 4LO7A 5K8SA 4QX5A 4JGZA 2YHJA 2EALA 2R49A 4WM7B 5K9YA 4BMEA 1C5HA 3NVCA 1KFUL 1G9CA 4AI3A 3RYRA 3RG0A 4AWDA 4YG3A 5DZFA 2Q0AA 3ME2A 1RUD2 1RC6A 1HX6A 3VBOC 3NL1A 1GANA 4AFAA 2VH9A 1XYOA 3BTAA 1UCXA 3NSTA 4R9CA 1W6OA 4IEQA 3S7IA 1YNAA 4Q4W2 4LBLA 1MACA 3ES1A 2FZ1A 5BXXA 5HI0A 4MGIE 4NVPA 2XKPA 3UKVA 3QCWA 3P3NA 2K9ZA 4LA3A 3O5SA 1UU4A 3WUDA 1CVNA 3N3HA 5EZWA 4Q26A 3EXUA 2K2SA 2I07B 5TSWA 3DUIA 5A32A 3WDWA 1NCRB 2X29A 3DPRA 4TLFA 4XZPA 3ZXEA 1OQ1A 3AP4A 1X8EA 1QQP1 1Q8OA 4N43C 4W65A 5JAXA 4HZFA 4N9HA 4DY3A 1IS4A 4RD7A 3U10A 4JC1A 4OHVA 4Q27A 1XNKA 3LSDA 2V5YA 1Y9QA 1ND3C 1VBE2 1UW8A 2Z5WA 3MEPA 4CEYC 5CFDC 1G6NA 3OY8A 3VDDA 4CDXB 1VP6A 3WY6A 5T5JA 1S0GA 2H0VA 2WZPP 4UXAA 1Z7S2 4XXAA 4XETA 1MZEA 3IPVA 2R063 4GQ7A 3L2HA 4C1XA 5JLVA 2RR12 5C9AC 2W0XA 1KJRA 1J59A 3VBHA 4AGVA 4L92A 1WBFA 2YYOA 5C8CA 3MPPG 2OIIA 2EXKA 4XF4A 1DQ5A 4HVOA 3M2MA 1JXNA 4FPCA 4RL7A 3TNQA 5L7OC 1KDKA 3MLKA 4LUKA 1W6MB 4QQOA 1U5XA 3HT1A 3DF0A 4AI0A 2JKBA 5DXDA 2VVFA 2SLIA 1CR7A 4YM1A 4OULA 1X50A 3MF6A 1EAH1 1I3HA 3ZXGA 3GZUC 4GH4C 1LRHA 3OTFA 1SQ4A 2B5HA 1N1TA 2R071 1ZBA1 3N4MA 5J96B 3KSCA 3DPRB 2Y38A 3N36A 5T50A 2Q1ZB 2XWBB 1BEV1 2ZMKA 1GICA 3WD5A 5BNNC 2X8KA 2XJPA 1D2SA 1WGPA 2BWAA 2Q1MA 4BQ1A 1ZBE2 3KGLA 3WG1A 4KG0A 1FI2A 2I74A 1K5MC 4IXLA 2D40A 2XH6A 4I3PA 2QVSB 1A78A 4HMZA 4I2OA 1D4M1 1R083 2WFF2 4WM8A 2UY9A 2PTMA 2DVFA 3CJIC 4J1WA 3E6DA 1NA1C 3OY8B 4B8EA 2R073 1GZWA 1MZFA 2BVBA 1T6GC 1V6JA 4LHNA 4C1WA 1FOD1 4PJYA 5H9RA 4CRQA 3VKFC 2WZR1 5L36A 1QJY1 1UAIA 4URTA 3TB0A 2F4PA 3FZ3A 4GB33 1RUJ3 2HYKA 1AL21 2A6YA 1MS4A 4YGEA 3MZHA 2E63A 2WFPA 5C8CB 1C8M2 3TRSB 2WQZC 1D4M3 1H8VA 2E6VA 3MIDA 5ACA1 2JEMA 5A3LA 1ND2B 1ZRFA 2VU9A 4KNCA 4PDWA 1SFYA 2XJSA 3BU7A 3MDPA 4XFCA 2R1BA 2Z2SB 1RUI3 4XIOA 5L73A 1RUH2 1UPSA 2XJVA 1FOD3 3WQ1A 1QJY3 4CTEA 1YXWA 2JG9B 4CEWB 1TQ5A 2Q30A 4L97A 1FPN2 3CNAA 2TEPA 3GZTB 3USUA 1AR91 1RUNA 2VNRA 3S7EA 5CB7A 1LGNA 3U11A 4DPNA 2WC2A 1URXA 1PGL1 3ZFFA 2Z69A 4S2DA 2JE7A 5ACA3 1H2MA 3H0OA 4NHMA 3WVJA 4QU2A 3TNPB 4X8PA 4Y1XA 5KHJA 3H50A 4CDWA 4RS5C 1ASJ2 4RSUA 1VBC3 2CWMA 3J26N 4BM8A 1ZRRA 1TME1 3A0NA 3SITA 1G9DA 4XBQA 2D5FA 4M3CE 1YUDA 1N47A 3ZN4A 3RJRA 4MXVA 3D8CA 3FLPA 2D7FA 2UWAA 1Q8SA 1AR71 1AR93 1WW4A 2DUOA 2HWC2 3LZZA 2Q5TA 1GFF2 1GZWB 2E9QA 4ORFA 2YC0A 3USSA 1RUE2 2P3JA 4FOVA 4LR4A 3WXPA 3X29B 4DS0A 1OQEA 4YFZA 2XKOA 4OVEA 1RUG1 2W52A 3TN92 4YYOA 4W6YA 2RHPA 2FMDA 4AVSA 1RUC2 4OHZA 1PIV1 4NR1A 4COVA 2BBVA 2XPJA 2ZA9A 1JTZX 3S6PA 2HJIA 2HWE1 4PF5A 5K7PA 2XG3A 4Q1RA 4P14A 3HAGA 1PVC3 3I4IA 4KBBA 3ROUA 3D82A 2D6NA 2XLAA 5A33B 4XFAA 1BBT2 3AXDA 2B9UA 1AR73 1IPKA 5FTTC 3VBUC 3JB4C 4P9YA 2WNUC 1NE4A 1QJX1 5F9TA 4GIQA 4P9IA 4DMIA 3I2DA 5CG9A 4XW3A 4A3XA 1W39