1OA4A

Comparison of family 12 glycoside hydrolases and recruited substitutions important for thermal stability
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
222
structure length
222
Chain Sequence
NQQICDRYGTTTIQDRYVVQNNRWGTSATQCINVTGNGFEITQADGSVPTNGAPKSYPSVYDGCHYGNCAPRTTLPMRISSIGSAPSSVSYRYTGNGVYNAAYDIWLDPTPRTNGVNRTEIMIWFNRVGPVQPIGSPVGTAHVGGRSWEVWTGSNGSNDVISFLAPSAISSWSFDVKDFVDQAVSHGLATPDWYLTSIQAGFEPWEGGTGLAVNSFSSAVNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-BETA-1,4-GLUCANASE
publication title Comparison of Family 12 Glycoside Hydrolases and Recruited Substitutions Important for Thermal Stability
pubmed doi rcsb
source organism Streptomyces sp. 11ag8
molecule tags Hydrolase
total genus 59
structure length 222
sequence length 222
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1oa4A00
1QH7A 1YNAA 1W2UA 3AMNA 3VGIA 1KS5A 1XNKA 3AKQA 3EXUA 4XQWA 1BK1A 1AXKA 2JENA 4HK8A 1H4GA 4IXLA 3VZNA 1OLRA 3M4FA 3WXPA 3AMPA 1UU6A 3WQ7A 1OLQA 2BVVA 2DFCA 3B5LB 3MF9A 5HXVA 5K9YA 1XXNA 2DCZA 1F5JA 3AKSA 1XNDA 3LGRA 3MF6A 4S2GA 4XPVA 1C5IA 1T6GC 2VG9A 1HIXA 3B7MA 3VZLA 1REEA 4HKWA 1BVVA 3ZSEA 2BWAA 1REDA 1QH6A 2JEMA 3O7OA 3VHNA 3VL9A 4XQDA 4HKOA 3WR0A 1XNCA 1ENXA 2Z79A 3AMMA 2JICA 3MFAA 4S2HA 1H4HA 2D97A 5EJ3A 3WT3A 1OA4A 3RI9A 3AKRA 3WX5A 3WQ0A 4S2FA 2BWCA 2DFBA 3WY6A 1KS4A 1H0BA 4XQ4A 1PVXA 3VZOA 3MFCA 1XNBA 2D98A 1XYOA 1HV0A 3VZJA 3WP6A 3HD8B 2QZ3A 4HK9A 2QZ2A 1OA3A 2F6BA 2VGDA 3LB9A 1REFA 3VZMA 1BCXA 5K7PA 2B45X 2C1FA 2B46X 3AKPA 4H7MA 3WP5A 1UKRA 1XYPA 1NLRA 1UU4A 3AMQA 2DCYA 3RI8A 1TE1B 3VZKA 1H1AA 3VL8A 1C5HA 3VHPA 1M4WA 1IGOA 3WQ1A 2DCJA 1OA2A 2B42B 2VULA 2NQYA 4NPRA 2NLRA 1HV1A 2VUJA 4HKLA 2DCKA 3AKTA 3AMHA 3VHOA 3WP4A 1XYNA 2BW8A 3VLBB 1UU5A 1H8VA 3WP3A 4S2DA
chains in the Genus database with same CATH superfamily
5IK8A 3CLPA 3MPBA 4ATFA 3NJZA 4CCLA 3DYOA 1X33A 1YNAA 3EBRA 2YYOA 2IUWA 1GYKA 5B4NA 5IAVA 1W8WA 4ZZ8A 4NMIA 5FKBA 5IW0A 4EN9B 5A1FA 1S1AA 3AP7A 2OW4A 4CA9A 1A34A 2DBNA 4J25A 2VXJA 2ZHKA 1HJGA 2VZTA 1LOAA 1IPKA 4FPCA 2AUYA 1BHGA 3PTRB 4DB5A 3PJYA 5JXGA 4XBLA 1U0AA 1W6OA 3ACGA 2Y6GA 2YPDA 5LBFA 1RITA 5LBBA 3POWA 2CHHA 4LORA 3IPVA 2D6OX 1LOCA 3JU9A 2XUEA 3RZLA 1GKBA 1NG0A 4FFFA 3CEWA 4EN0A 5C4WC 3PUSA 1XXNA 5A6YA 4QKBA 1F5JA 1ODNA 2JG8B 2JX9A 3LWCA 4DINB 1ZZ9A 2XUMA 3QD6A 3TEWA 2QQPA 1D0HA 1JBCA 1HRI1 4E8DA 5FMBA 1CAUA 1J3RA 2V4AA 2EA7A 4UFMA 1HIXA 2IC1A 1REEA 4J1WA 1SMVA 5FJHA 4BYYA 2BWAA 2W3JA 2HEVF 4IEZA 2X09A 1GOGA 1R1A1 4YFWA 5A80A 3KV6A 1FATA 3VBOB 4AGVA 5J36A 5A1LA 1GP5A 2WLQA 4AQSA 2DTWA 4MHUA 4YRDA 5E8AA 5JI9A 1PK6C 2PHWA 4EN6B 4CVUA 3TEZA 1N1VA 1F4AA 1QJU3 1Q8VA 2FCVA 2JIGA 4LBKA 4OMCA 2RDRA 4XF4A 2JICA 4FPGA 2DVAA 4XFHA 2ZGNA 3P6BA 4XXPA 2W47A 4B1MA 2JD4A 3B9CA 2R0FA 1US2A 2ZEZA 1C4RA 4XMIA 2GNDA 4W50A 2RG4A 4YVSA 1HQWA 5DQ0A 1OOPB 3P3PA 2ZEXA 2YV8A 3VD7A 4BIOA 4QPGC 4QM8A 2TUNA 5CAZA 3RZKA 1WCKA 3CU7A 1R082 1LEDA 3W59A 1YC61 5KC5A 1E5SA 3N3HA 3BKZA 2WWJA 2LS6A 1OHFA 1AYN1 1FMD3 3WNXA 3Q8EA 2E26A 1IG0A 1W6NB 2YFUA 4MZUA 3OPTA 1XNTA 4YWAA 4AEMA 5C4WB 2IFRA 1KXGA 1FPN3 4KWUA 1GOFA 1LULA 2DVFA 5K7PA 3MLJA 2VW1A 4HBNA 3KT4A 3NV2A 5J3UA 2E53A 2JG9A 2R072 4LA3A 1HB3A 3UKTA 1GZTA 1W8ZA 2XVGA 4I09A 1GP4A 4N9IA 3VZKA 3V0BA 4LULA 1Q43A 1VAMA 5KHKA 2LUWA 2VBPA 4BDVB 4D7SA 1W39A 3WQ1A 2QE3A 3POBA 1V9U3 3ZPOA 3H9AA 1XE0A 1W9SA 2VTFA 1AR93 3OPZA 2WO3A 1PK6B 2HWB2 3T2OA 4K7JA 4CPBA 1UPSA 1NLSA 1UMHA 3T0BA 5LA2A 5FZAA 5A3UA 3EJKA 4DZGA 2RMU1 4NPRA 1UY1A 1D0GA 1YYNA 4AVBA 3CZJA 4SLIA 4TZDA 4RGAA 1UXXX 1RUD3 1WKYA 4GA9A 4P9LA 3UETA 1KJLA 4D6SA 4OUMA 5F5IA 3AMNA 5DDJ1 1GZCA 3URFA 1HB4A 3AM2A 2ZXQA 4MLOA 4MYEA 1POQA 3E5QA 3USUA 4AQTA 5C33A 2GN7A 3ACLA 4ZS3A 3P3NA 1ASJ1 1TZOA 1VRBA 1YQ6A 2BGOA 4XMAA 4M0NA 1CAXA 4B4QA 1ALYA 4BA6A 1DYOA 1L7QA 3B69A 4DEQA 3VDDC 5K0UB 3HIFA 1AR61 4XBQA 3RWNA 2WDBA 2ORZA 5A7OA 3ECQA 4EN7B 4LO4B 5FO9B 4BQ4A 5K9YA 3ME2A 4BJ0A 1ZM1A 3KCCA 4CP1A 5JMCA 1RMU1 1E5IA 3T1MA 2DWRA 4UOJA 4DUVA 1LU2A 5LRRA 2AR6A 1F8VA 4AEJA 4X6RB 5EXOA 5AFEA 4A7ZA 1MS9A 2XH6A 5IHRA 1T6GC 3M3CA 3PMEA 4XUNA 1AL22 1EV12 5F1RA 2LRPA 5FMDA 2DURA 1WLDA 3AXEA 3ELNA 3VZLA 1LU1A 1BVVA 4XEZA 1DQ2A 1OUXA 2KM2A 4D7YA 1U12A 3IM0A 1OVSA 2ZGQA 2A70A 1WW6A 3BYWA 3RSJA 2XJSA 5JXIA 2Z79A 5DMYA 2WC2A 4IEUA 1G6NA 1UCXA 1UZZA 3S5AA 4NJ4A 4HOOA 1TMF2 4KWLA 4YFZA 4CDWA 4LE3A 5JZGA 3TB0A 4XFCA 2VY0A 2VZPA 1QJX1 4Z1VA 4IE7A 2ZHNA 5CZKA 1HQLA 3I3DA 2HWF2 5FZ9A 3OGRA 1UY0A 3U78A 1PVXA 3BGAA 4FXGB 5FBZA 3VZOA 1YQ8A 2Q0AA 4COZA 5EIYB 1T6BX 4CEWC 4GMP3 4TLFA 3VDDB 1G7YA 5T55A 4YGCA 2UY9A 2WAAA 3ES1A 5DZGA 3LAGA 4W6XA 5CB7A 2F17A 3M1HA 4Q4X2 2A6XA 2CGNA 3ZM8A 2PLV2 4GB33 1OT5A 5EYYA 4ITCA 3HNYM 3BU7A 3SLIA 4BISA 2A5ZA 4XJ9A 2JB4A 4Q4V3 5F5CA 3IMNA 5FMCA 2E31A 4DUWA 1GMMA 5FTTC 5IVYA 3BU0A 1NOVA 2ILMA 4UYBA 5F8PA 5KXBA 1FI2A 3ZYIB 1ZZBA 2CNAA 4AFAA 4JVAA 2G9FA 1QOOA 4B7KA 5CVRA 5C3SA 3EHKA 3ZIXA 2VU9A 3FC0A 5FXWA 3RYPA 2XJVA 4F8AA 3NVCA 4MV2A 2PAKA 1QIQA 1Y7BA 3D8CA 1CPMA 5L19A 5KWRA 5FLIA 4EE2A 1GR3A 1W3VA 2Q8DA 4YM2A 5BNNA 3PUQA 3VHOA 3I7DA 1XYNA 3ILNA 3RJ2X 2JDUA 4URTA 1GLHA 4WM7C 3TAYA 4D69A 4EN8B 4C1WA 2R062 4QPYA 3R4SA 5EZWA 1S0JA 3K3NA 2Q8OA 1KS5A 4YW5A 1Y9QA 1CQ9A 3E6DA 1SHWB 2R32A 4CEWB 3BUCA 3VD5A 3O5SA 1DIWA 1NKGA 3POGA 5AC91 5JOZA 3C7FA 1QJY2 4Y20B 1FYUA 4AOCA 4RR3C 2W2IA 2D93A 4CCCA 1AXKA 3VBSC 1NE4A 1OSGA 1COV2 1LHWA 2JENA 3R05A 4XAAA 5A3MA 3OY8B 3K77A 1VBE1 1CAVA 1PGL2 3N35A 2QJVA 4NIIA 4YM0A 4Y1XA 3A0NA 3TN93 2Y33A 2ZABA 2BDRA 1H1IA 4CDXB 3JB8A 3WQ7A 3B5LB 1W0OA 2DDUA 2Y0IA 1DGRN 3VBRB 2CU5A 1QOSA 1RVF3 4GJZA 2PN5A 2QNKA 4W4ZA 3MW4A 3VKLA 3MGUA 3ORJA 3RYRA 2HWC3 1NQJA 5FZKA 1O5LA 1HB1A 3I3EA 5T3NA 2Q8CA 2F4LA 4AYUA 5H9PA 3AZVA 4COVA 1I1EA 1X7NA 1A3KA 1AR73 1NXD1 4XFIA 5HV0A 4CRQA 4XF3A 3HQRA 1UNBA 3ZKYA 1H9PA 3MIFA 2E33A 1NCQC 2W9XA 4L0PA 5T52A 2VL4A 1FOD3 4IEQA 3PVOA 2D97A 3C7OA 2HKXA 2XJTA 3M7AA 4Q4Y3 4WM7B 4YW2A 3SC7X 1PX3A 1X8MA 4I2OA 4LBMA 1MEC3 2DUOA 4GH4C 3H1YA 3WQ0A 3RZZA 1OI6A 2JDHA 3NO8A 4S2FA 4AEDA 3KWVA 1LB2A 3GBWA 1HLCA 4N53C 1KGYA 4RR3B 3VBSB 1Q56A 5FDBA 3HVDA 4OYUA 5FK7A 3OOXA 4M0HA 1HRV3 2WZEA 2CWSA 1RUH3 2B9UA 3GZAA 5CIRA 2R042 3LA3A 1OA3A 2F6BA 5F6KA 1JMUB 5FY7A 2CL2A 4MADA 2BV4A 1WLCA 3EMRA 5FZCA 1GWKA 4LO8A 3WW2A 3ZFEC 1W9YA 3J7MA 4BLIA 5CFCA 2JJ6A 1S0EA 4FOVA 2BZDA 4FPLA 1CZVA 3WDWA 2HBTA 1E5RA 1ENQA 1K12A 1YO8A 5EQUA 4FFHA 1XYPA 3JD71 4Q2FA 1QXJA 1LR5A 3FN9A 4Y4YA 2GMMA 3LEKA 4LMFA 1DQ4A 1WD4A 1XRUA 1F9KA 1KEXA 1ULCA 2YY1A 3SISA 3V64A 3VDBA 4B4RA 3MICA 2EAKA 1BYHA 3MYXA 4NAOA 5LZ6A 1D2QA 4QWNA 5HV4A 4NE9A 3T0DA 1OD3A 2VJXA 4CU7A 4C90A 3HNMA 1GZWA 5KHHA 2VULA 1PIV3 4WVWA 2VUJA 3CQOA 4HKLA 1HW5A 5D8AA 3NMBA 2FQPA 4GH4B 1QF3A 2B9VA 4CUBA 5F6LB 4B7EA 1YWKA 5C9AC 5LY2A 5L9VA 2OT7A 4RS5A 1D4VB 3FJSA 1K42A 1EAH1 1NCRA 4AFBA 2FMYA 4GQ7A 4N53B 1ZREA 5GJ6A 1U5IA 1DU3D 4YVWC 4R9CA 2R061 2UURA 1A8MA 2PMWB 3MEPA 4Q4W2 3MDPA 4CP9B 4K6BA 1MS4A 2EXIA 1QNWA 1U5XA 1W2NA 2VMEA 2DYCA 3C3VA 3GZTB 3LPFA 3ZFEB 5LB6A 4DIQA 4V1PA 5FP8A 2CDPA 5FZEA 4V2VA 4QX7A 1FX5A 1COV1 3UGHA 4QPIA 3VBHC 1GBGA 1HKDA 5FBJA 3ZO0B 4FSJA 3LFIA 3UGFA 4Z8BA 3J7HA 4MGSA 5JCTA 2WBKA 1W99A 1SBEA 3UKNA 3OJBA 1EUUA 3WHTA 3MUY1 2XLGA 3M2MA 4LEJA 4F3JA 4HKWA 3MV01 3WNOA 2WQZC 2UYBA 1W3XA 4JKLA 4LKDA 3WNPA 3WNMA 5ABJC 5LCWL 4Y26A 3ZFFB 1K5MC 4DY3A 5C3RA 4A3XA 5KC6A 1H2NA 1SLBA 1XNCA 3ZVXA 3FX3A 4I0BA 1W2TA 1W0NA 5C9AB 3WT3A 4AXOA 1H4HA 4FP3A 5DXDA 5I91A 1OPMA 5GZGA 2VQ0A 5CFDA 3AKRA 3QH7A 4XIOA 2BUKA 4P5HA 5ANQA 1BEV2 4FAGA 2DV9A 3NJXA 1D4M3 4TWTA 3IDBB 4YNIA 1PGW2 1OXCA 2VNRA 1W28A 4YVWB 2WRAA 3VBUA 3SH5A 2RE9A 2W87A 4AFMA 1K45A 3H7YA 3ZN6B 5IUQA 4Z2WA 2XONA 5GM0A 5APAA 3ZX7A 4MGZE 1V00A 4LOSA 2HWD1 2BOIA 4RSUA 1RUC2 5IFPA 3JUUA 3VHRA 3AVSA 3HD8B 3WSOA 2QZ3A 2FCTA 1FAYA 3BODA 2D6LX 1RC6A 3BOPA 4LIVA 5FZOB 4E4HA 1QKQA 2Q1ZB 4AZZA 3VBHB 5IVVA 3NRUA 2RM23 3OGGA 3M3OA 5FY0A 1JOPA 1LHOA 5LEJA 4IEYA 2VE1A 1S4CA 1W06A 4Y4RA 2R041 1BK0A 5CBLA 1JHJA 3G7DA 4GZ9A 3W58A 4CUCA 4BK5A 4QXKA 3KV9A 3PU3A 3ZXEA 1JZ2A 2QKDA 5JOXA 5EJZB 4QU2A 1PMJX 1RUE1 4J6GA 1ULOA 1UO9A 1Z7S3 1BBT2 2TEPA 4QX2A 5ABJB 2EXJA 1LENA 1CIWA 4QU1A 3U4SA 1K5MB 2LW8A 3J8F3 3LZZA 3VHPA 4OI0A 3PVNA 1E57A 1W8TA 4CCNA 2ADEA 1RIRA 4B1LA 1GZ9A 2XR4A 3T4HB 3H7JA 4JRAA 1SZBA 1RL3A 5E16A 5SV8A 1D2SA 4NO4A 3HNBM 2IXHA 2MEV2 4Z2AA 1KITA 1POV3 4AI3A 3FHIB 5LY1A 4LK6A 1H6YA 3OD0A 2QQOA 2RS33 1B35C 2HWD3 1J3PA 4R4XA 3JBG2 1GWMA 3IZOA 1Q8PA 3K51A 4PBPA 4QDQA 3OGJA 2VD7A 5DUVA 3DPRB 5FP7A 3TWIA 4CCEA 1GNHA 5B4XA 2QQWA 1HXS3 2VZ3A 3HBKA 3WG4A 2CAVA 2PHFA 3I2DA 4E8CA 4IEXA 3RYKA 1TG7A 3IB3A 1V6IA 3KQ4B 3RMYA 3VBFA 2EAAA 1SCRA 3KCXA 4Y3OA 5GLUA 3VZNA 3RGBA 3RZHA 4C1XA 1UU6A 5LEKA 4GWJA 3OG2A 2EIBA 2BVVA 2DCTA 2OIIA 3IAQA 4YW6A 5CADA 1X8EA 3IKWA 1O4YA 3I8TA 5IYYA 1V6KA 1IQAA 2VMHA 2WNUA 4ARYA 2P1BA 3NJVA 1HN0A 1Q8QA 4K21A 2HYKA 5I0RA 3WNKA 4RHV3 4CTEA 2XJRA 1SDWA 4KQ7A 2AZ5A 1NY72 1RYYA 3DGTA 4P9JA 1TME3 4XFFA 1OQEA 4AQ2A 2VBDA 3AZYA 1CIYA 3S30A 2WFPA 2VUCA 1ONAA 3PNAA 1JOJA 1F4HA 1QJU2 4AK3A 3MPPG 5IK5A 1VBA2 1ND3A 1Q5OA 1AYM2 3PUAA 2VQUA 1DQ0A 1UF2C 2QQVA 5FYCA 1RUG3 5A7NA 2XOMA 3LPGA 4QHBA 4R9DA 4YW7A 1QY4A 3N9PA 5FWJA 5BUVA 1RUI3 1EP0A 5FUNA 4CPBD 3NKTA 3T09A 2VMIA 4XC9A 1QWRA 3WY6A 5FQ0A 3ZYBA 2WS91 5EJ1B 2ETEA 1W0PA 4AVTA 4NUBA 1PGW1 4COUA 4XVHA 4Q8LA 4ORFA 3UYJA 3A7QA 1FMD2 2PELA 4ZXKA 4WM8C 3Q9OA 5GLWA 4A2UA 3VZMA 1BCXA 3MHZA 2G9GA 1FPN2 4MXWB 1H2LA 3O1VA 1RUC1 3BCWA 1YCIA 4XCAA 4N43C 2J7MA 2R30A 2ZJCA 3HQUA 5BYNA 2WZR2 2W08A 2XWBB 3AFGA 4UXAA 5JPMB 1W8OA 4UBGA 2W1SA 3WVJA 4CDQB 2VXRA 5T54A 3TEXA 1CAWB 5JWPA 4QQHA 2P34A 3RI8A 3VKNA 4KI5M 2NP0A 1MZ6A 1WLTA 1RTVA 2VOWA 2JECA 1FXZA 1C5HA 5JPNB 2G4IA 1V9U2 3PURA 1VBC3 1JYWA 3AXDA 4RQPA 1EUTA 1AR92 1ZBA2 2PHUA 4OCTA 3A0KA 1UYYA 1PMHX 1WCDJ 1OA2A 4GALA 5J98B 2RDQA 4MGYE 4DNYA 4WV8A 2Y6FA 4C8DA 1PGSA 2W46A 1EPZA 1HQNA 3KCYA 4FOYA 4PLMA 2P3YA 1RUD2 4MH0E 4XF0A 5LBCA 4ASLA 2BW8A 4YGEA 3NQHA 1H8TC 3C8XA 4IV1A 1DGRA 1XOYA 5JXHA 1QMJA 4IUGA 2MEV1 2Q4SA 2X5IB 3VGIA 2FDGA 3JB4C 3ZYRA 2CGPA 5IVJA 3OYWA 1BZWA 1LCLA 3FWEA 4XHXA 2FZ1A 3GBGA 4ZONA 3WHUA 4IEPA 3JBG1 1SDDB 4WM8B 5GLTA 1ZRRA 2D7FA 2VECA 2NYYA 3A22A 3QLQA 3N9MA 2WO1A 1Z0HA 5M0TA 4JTOA 1DHKB 1MQTC 4UFLA 5BNPA 1YIFA 4JDNA 5D2AA 3T2TA 3AVRA 3KM5A 1P8JA 2W52A 2DFCA 2KR2A 4TLGA 2LM3A 3QH6A 1WCQA 2P37A 3SH3A 4QKNA 2DCZA 5BNQA 3ES4A 3ZOIA 3AKSA 4YZ2A 5C70A 5CEHA 1ZRCA 4HMZA 2J1UA 2OZ6A 1NE6A 3UL2A 4BXFA 5JOYA 3U75A 4PI0A 1NUKA 1RUF2 1PO21 2DVDA 4XPVA 5C8CA 1CD3G 4QX0A 1C57A 2V73A 4P00B 5IATA 5A32A 1OOPC 1UY2A 5H9RA 2E9QA 2JG8A 4DOUA 4QMAA 5FPBA 1W2OA 2SLIA 2KXLA 1MZFA 4K9SA 1ZX5A 1QH6A 4GMP0 4LOTA 3T0AA 4A7KA 3I59B 4QHZA 2DVGA 3E5XA 2IXJA 5FYYA 2QTWB 3ZMNA 1VBD2 1YQ5A 1G8WA 1RJ8A 2ZA9A 4LBQB 4QXCA 5DUUA 3OF1A 4MGIE 5FY4A 1GU3A 1H8TB 4S2HA 5IK4A 3POYA 3CJIB 2K2SA 3RI9A 1S2KA 4C0HA 4DRVA 1RHI3 2BGCA 5C3PA 1EYBA 2R1BA 1XQNA 2RR12 1VBA1 3PLQA 4EZHA 1JODA 4LO7A 4BQ1A 2OYZA 1Q8OA 5FZ0A 4FQ4A 5JIAA 1H0BA 2A75A 2E63A 3B3QE 4MGKE 5JUVA 3RVHA 4CU9A 2ET1A 1ZYBA 4AAXA 4YM3A 2WWUA 4JGYA 4XYXA 4BIFA 4E27A 3TNQA 4UWDA 4AI1A 2WO7A 5FKCA 2X05A 5J96B 1O4TA 1ZA7A 4NHYA 1MQTB 5JLVA 2J1VA 2RJLA 2XVLA 2ZAAA 2HLEA 4NIAA 3WUDA 4GB32 3CMGA 4N9HA 5BY5A 3NAPA 2GNBA 4JKKA 1GSLA 4OVEA 2VPVA 4LHSA 4Q4V2 3ZR5A 5F3EA 1ZBE1 4RGGA 3AKPA 3SKJE 3JQXA 2VCMA 4H7MA 5CU1A 2PHXA 1YXWA 3DECA 3MBWA 1LGBA 5FZ4A 2GNTA 4RYDA 3AMQA 1CVNA 1W6OB 3LDRA 2DCYA 2WYSA 3PU8A 3H3UA 3IPVB 2WZR1 4XBNA 3DCQA 3I2FA 1N3PA 3LDKA 3AZZA 4DPNA 2BNNA 3I54A 4ZPIA 1YRZA 2DCJA 4LBJA 1RUOA 4UFJA 3R4DB 2RS51 1QQP2 2P6CA 1UYZA 2JG9C 2WINB 3AZXA 3J26N 4AAPA 2PQQA 3ILFA 1ZBA1 1CAUB 5K0UC 1MZEA 4FT8A 3H1MA 1HRI3 2ZMKA 4UFHA 2HH9A 4B8EA 2W1QA 2YB7A 3VLBB 3WP3A 3O1UA 2BBAA 4DS0A 5LBEA 1CESA 1NQDA 1R1A3 1O5UA 1H9WA 2WFF2 1SLLA 1T2XA 1W90A 4K20A 4CEYC 4BM8A 2JIJA 2RS11 1BK1A 4ES8A 5JDBA 1JZ3A 5FPVA 4D94A 3WUCA 1G9DA 5J48A 4QPGA 1CX4A 1OH4A 1UMIA 1RUJ2 1W9FA 2GMPA 1ZBE3 2ZGPA 3A23A 3KB5A 4ZU5A 2VBBA 2X29A 3VD3A 4KU7A 3IT8A 1LOFA 1C8M2 2XKOA 3H3ZA 4INDA 3TN92 4X8PA 1WZXA 2ZX4A 3WXPA 1OLRA 4TTGA 1N3OA 3DUIA 3H1WA 4FPHA 4CCJA 5GZEA 1VMJA 3MF9A 3B94A 4LXLA 1J1LA 1ST8A 2XKPA 1I5ZA 4UI9L 5DZFA 5A6QA 1UD1A 3AJYA 5HPOA 4SBVA 1JYVA 2AACA 4LKSA 4S2GA 3RJRA 3UGGA 1US3A 1RUNA 1UIJA 1AYN3 4H55A 2KA3A 2OS2A 4Z82A 1U5ZA 1AR72 4HZFA 3K2OA 3WF4A 1RUF1 3L9JT 1IKPA 3SEPA 2JG9B 2HEWF 1O4ZA 1UXZA 1FOD2 1DF0A 2QQKA 1DBNA 4JQRA 3V0BB 4Q4Y2 1UZVA 3HT1A 1KDMA 3OTFA 1LHVA 1MEC2 1G9FA 3Q8AA 4FPFA 4QPWA 2HJIA 1OA4A 1JTZX 4CP0A 2WL1A 2RS13 4KG0A 2VOVA 4MHRA 5LWBA 2IZWA 4XUTA 5FV3A 1AUYA 3K3OA 1PX4A 4XAEA 1R092 5FRAA 2Q5TA 4L2NA 1LNSA 4CEYB 4PIXA 2VTXJ 3POSA 4L92A 3DF0A 2BERA 5LA1A 2P3IA 3Q8BA 1SEFA 1S0DA 1XNBA 1HRV2 2RMU3 2RR11 3LEIA 4IGPA 5FOJB 2XL9A 1RUH2 2ZGKA 5A33A 4HK9A 2YXSA 1OQ1A 4NHKA 3UJOA 1LECA 2VGDA 4AG4A 4CDWC 5JZGC 3MO4A 3W5NA 3ZXJA 5HCHA 1BXHA 1JUIA 1S55A 2RJKA 2GC2A 2NN8A 3J9SA 3USUB 2GH8A 2B45X 2W39A 5DDJ3 4N8MA 1IQDC 3VDDA 3S5QA 3OUJA 3UKVA 5ACA2 4AHYA 1LOBA 2JDYA 1CAXB 1JYXA 3S0MA 1JU3A 3MLLA 3K46A 1ASJ3 2YG0A 1LGNA 5D1IA 4EZ4A 2C24A 2BRTA 1UWWA 1XU1A 3O1RA 2QDRA 4Y24A 2OX0A 4JGZC 4ET7A 2EIGA 4GWIA 1AR63 2ZKLA 3RWKX 1O3QA 4LITA 2Y6HA 3W5MA 3GYDA 5I0UA 3RS6A 1GUIA 1AR82 3IBMA 5FZBA 1PIV2 1R081 2BPA2 1RMU3 2QDNA 3U11A 1ND2A 1OKQA 4UW5A 1JXNA 3AP6A 1NYWA 2O0OA 2WNVA 3BTYA 1S0BA 2D3RA 4XW3A 2P17A 1QQP1 3WV6A 4CDXC 1UU5A 1WMFA 2WIIB 4M00A 4I0WB 3VBRC 2QUOA 1LJ7A 1SLAA 3DEMA 1LESA 1G86A 4KGQA 2QFEA 3AP9A 4KBBA 4IETA 4YLZA 2YBKA 3V56A 4E4ZA 1V6NA 1PNFA 1Y9GA 2XXZA 3KF3A 1UZWA 3KT1A 4XQWA 4PLNA 2R071 1IKQA 5L7OA 3VDAA 3HWJA 1W8FA 1YLLA 5JZGB 4CDWB 2WFF1 2FD8A 1W6PA 4ZU7A 4GXLA 5A3LA 5D21A 4NROA 5A7WB 3RZGA 1J83A 2VMDA 2LTNA 2A1XA 3CJXA 4PI2A 4XJZA 3U1XA 1S2EA 1QJX3 4LLFA 3GJAA 1O91A 1RUJ1 3HN1A 4OI2A 4JZRA 4WVVA 3NKGA 2GP3A 2HWB1 4MXVA 4IV3C 5E1RA 3GM8A 1RGSA 1C8M1 1KD7A 2QVSB 3VD9A 2DVBA 3THPA 5FO7B 3H8UA 3U10A 1SFPA 1XB9A 4FFIA 4JGZB 4BQYA 2D6MA 4G4FA 1YQ2A 3KGLA 4LT5A 5EFUA 1IHMA 3ZSEA 5C8WA 2GH2A 1NZIA 4XJ8A 5EV7A 3M8LA 4PBOA 1QU0A 2IFWA 1HB2A 2RDSA 3K4DA 4LHKA 4F7ZA 5BNOA 4TYSA 2PA7A 4ZZ5A 2GZWA 4HONA 1CPNA 3HJRA 4GKXA 4WVMB 2WLPA 4XF9A 1XU2A 3AMMA 3QBQA 4Q5OA 1GNYA 4PQQA 2ZCWA 1QDCA 3D0JA 1X82A 3M3IA 2R073 4HXCA 1WBFA 4FOWA 4CSWA 2P4EA 1UL9A 2FDJA 2BWCA 4HN0A 1JYIA 4BK4A 4MOAA 3WDTA 1LRHA 3D4KA 4PJYA 3WG3A 2WNEA 3ILRA 1TQ5A 3K48A 2ES3A 5BNNB 1V0AA 3ZPYA 2Y6JA 3KSCA 3ZN5A 1R091 1DCSA 2EICA 1WCSA 1V6MA 1VBB2 4LKEA 5L9BA 4A6SA 1JUHA 1C3HA 2VCAA 2XJUA 4ZS2A 3KZ4C 3LF7A 1AL21 1EV11 2WWSA 4L11A 2RM22 5IAXA 3HEIA 4IV3B 2WN2A 5L36A 1YJLA 2B7YA 5L73A 3AB0A 3WINE 4EJRA 5FUIA 4MO3M 3ZXLA 2JDMA 3DXUA 5AC93 1UKGA 3O0VA 1O7FA 4JHTA 4NN0A 4HPKA 1SFYA 1Z7S2 3VKOA 3H8RA 5FY5A 3R4UA 1Y3TA 1TMF1 1N3QA 1VBE3 3J8F2 3WD5A 4XDOA 4R9BA 1FNZA 2Y6LA 4OI4A 3DL3A 1SPPB 5H9SA 4DXSA 5GLVA 2QQUA 4NRPA 4AFDA 5CFCC 2HWF1 4MGQA 2XBO2 4O61A 5CG8A 4LO6B 4HVRA 2J1RA 3LFMA 3HQXA 2YPJA 2ZGLA 4RD7A 3BIEA 4I02A 1G9BA 4OFGA 3ATGA 2B4KA 1PVC2 1AJKA 4NPMA 3AKTA 1N47A 3WQBA 1AR81 2P2KA 1NCQA 4JCKA 1TNRA 2B5HA 2Z4FA 4FQZA 4LUKA 4OHYA 5DG1A 4Q4X1 3N7JA 2NZ9A 2PLV1 3PIJA 4WVZA 5A3OA 3F95A 4ASMB 1F35A 2D5HA 4AI2A 1QJZA 1HXS2 3WF2A 1W6MA 4C91A 2BOJA 2IVJA 4NOTA 2ZPXA 2ENRA 2HWE2 5FUPA 3RPQA 3MIDA 1GNZA 1WUVA 4KGGA 5A3PA 5D8AC 1FNYA 2GC3A 4K1ZA 5F2WA 4D3WA 4Q8KA 4D0QA 2WA4A 2Q30A 4AEDB 3KF5A 3NL1A 5HCAA 2XJPA 3VKMA 3ZFFC 4AR2A 4RS5C 4YM1A 1NCRC 2WN3A 4LQRA 5F2SA 1YFWA 4HETA 1W6QA 3I2HA 5T5LA 4CP9A 5HXVA 1KDKA 3WF1A 3V0AA 1LAJA 2RV9A 4LHLA 1JHNA 3SCFA 3VB9A 4YZ1A 1O8PA 4IW3A 5A70A 4BQ5A 3QCWA 2QBXA 3LGRA 3N7KA 2WQ8A 4OMDA 5T50A 3OGSA 2A3XA 2D6KA 4ASKA 5DAQA 3UJQA 2YUEA 4KH9A 1BMV2 3GNEA 1Q3EA 3WEZA 5CFCB 1TME2 3ZYPA 1DLCA 1VRH2 1REDA 4JRLA 2YGMA 4QX8A 4QM9A 4EWAA 1J59A 1UX6A 2ARCA 2XDVA 3BN6A 4A41A 5DAXA 5JMOA 3JD73 1QJY1 2MNGA 4R52A 1RUG2 5A7SA 1X50A 1MR5A 1X9TA 2VNVA 3MIHA 1PGL1 3I3BA 3PDQA 4QKFA 2IXCA 4RFRB 1UYXA 5FK8A 2ARXA 1OD5A 2DU1A 4GWMA 4D6RA 2R7EB 2HBUA 2R1DA 3SHRA 3ZXKA 3R6SA 2ZX1A 2QCSB 3KVBA 4XFAA 5D8AB 3MFCA 5EWSA 3KMHA 4H3WA 4XF1A 2WQ4A 5F37A 4BXSV 4L99A 4UW3A 3VZJA 1SLCA 4RS5B 3ROUA 1NCRB 4XUOA 3SCGA 3NV3A 3WW1A 1REFA 3LSEA 4FTEA 2ATFA 4M3CA 1EAH3 1VBB1 2D44A 2NM1A 1OPOA 3ZYFA 1SFNA 3VBUC 1L3JA 4AGGA 1WMDA 2XMLA 5A7PA 2R063 4N7IA 1MACA 1N1YA 2OUJA 1WCUA 2ZTNA 3OB8A 4HFSA 1AX2A 2ZGRA 3NJYA 4EWEA 1VBC2 2VZQA 4PDWC 2VUDA 1BLZA 2IXLA 3DPRC 4QPIB 2C26A 2NMNA 2NMOA 1TNFA 3WF3A 2VCCA 1PHMA 1W8UA 1COV3 1N1TA 2ARAA 1A78A 1LTEA 2VTXA 4R8HA 4CCOA 2B42B 3WNNA 5KXCA 2D3PA 2YHJA 1BVP1 1HV1A 2NLRA 2YZ4A 5IK7A 2J1SA 2D3SA 5FPUA 4XJAA 1UW8A 2Z5WA 2XBO1 4GWNA 3MIBA 3LD8A 1D7PM 5FPLA 1PO12 1VMFA 4QB2A 2XVKA 5I8TA 4Y1YA 4COWA 1XC6A 1VB2A 4Q27A 1PVC1 2VVFA 5LA0A 4DQAA 3E97A 3GXUA 3LSDA 2EALA 1JN2P 5FFOC 2I45A 2D40A 5IJRA 3VKFC 3KGZA 4XTMA 2XL7A 4AI0A 3B01A 2R6QA 3ZMOA 4WZCA 2I74A 2JD9A 2C6SA 4IQPA 2O8QA 5SV5A 1RXFA 5CYYA 2HWE1 4HT1T 1L7LA 5C3QA 3VBUB 3LEMA 3LOIA 3ZXDA 4FPKA 4JDMA 4UF0A 4BQXA 2WUHA 2VAUA 4DFSA 3HMYA 3W21A 3EB7A 2ZX0A 4IEVA 2EVXA 3FFQA 4PDWB 3JCIA 1WMXA 3PUHA 3H8XA 1QNYA 1OURA 3VBFC 4AVCA 2JE7A 3B7MA 4MUVA 4XUQA 1QGLA 4GKYA 2XQRA 2PHDA 2ERFA 2ZEWA 3OBRA 5CNAA 3E5UA 3ZFGA 4UW6A 3FE5A 2R043 3WR0A 1ENXA 2QQJA 2WNUC 4A45A 1VRH1 4CCKA 4Q4W1 5FZ7A 4PF5A 3LA7A 1ODMA 5EJ3A 2ZEYA 2ZGOA 1RUE3 2JXAA 1NA1A 1RHI2 4LIUA 3WX5A 3CDZB 3WOGA 3AK0A 2Y0OA 4XACA 4F83A 1FT9A 5IWFA 2DFBA 4DY5A 2JDPA 3B93A 5K8SA 3H0OA 5FAXA 1KS4A 4XQ4A 4I3GA 4HLTA 4CDQC 3VUOA 2C9AA 3IDEA 4XZPA 1ENRA 2DU0A 1B35A 1YJKA 4LO5B 1DQ6A 3AL6A 3IIAA 2BNOA 3B02A 4PIYA 4QDRA 3EQEA 5FPAA 4AVVA 4Q1RA 4LK7A 1ND3C 5FZLA 3U4XA 3NNGA 4E4SA 3WLUA 3I2JA 4AHZA 1CR7A 3GHMA 5FY9A 1UY4A 1W03A 3WDYA 5FZHA 4JX0A 1C8NA 3ZSMA 5FP4A 1QXRA 3OBAA 4Y22A 5FYSA 4QGLA 4CXWA 1U5YA 1ZNPA 2BFUL 2GU9A 1OBNA 4RFT0 3T30A 2P3JA 3N9QA 2A7AA 4I0AA 2AEZA 4NAMA 1L7RA 3VBFB 2FDIA 5A7QA 1IS3A 1TE1B 5DN2A 3S7IA 1Q8SA 3R0RA 2BNMA 3GF6A 4EYUA 2VH9A 1MS5A 1Y4WA 4AF9A 2A73B 1ZZ7A 1IOAA 2WYFA 2X5IC 5FYVA 3RG0A 1BEV1 2VMCA 3LKJA 3T08A 1CAWA 2YFZA 3O1MA 4HG6B 5FMOS 2WNUB 3M70A 4QDSA 3WG1A 2WSUA 1UPIA 2GALA 4HVQA 3MW3A 4FPOB 1QEXA 4Q0UA 4UAPA 4OQ8A 1WWYA 1F15A 1OF4A 1RJ7A 1HRI2 4TSVA 1XE7A 5FJKA 3T2QA 2V09A 3PL0A 2WKKA 4IDZA 1RXGA 2VR4A 2YBPA 1ULDA 5JAXA 2FDKA 1R1A2 2I2SA 4GD4A 3WF0A 1R64A 4FAHA 4WBBA 2VOXA 4HL0A 4XILA 4META 4Q1PA 1IS4A 1UQXA 3F2ZA 4OZXA 2XB6C 1ND3B 4BLJA 3HBZA 3DYPA 4DEVA 4XDPA 1S0IA 2VNOA 3N7LA 4RGKA 1BQPA 1BBT1 1S0FA 1STMA 5K4LA 2L9LA 2UWAA 5JXJA 5FQ0B 3LIGA 3U14A 3BTAA 4CDUA 5HCFA 3J4UH 1F31A 4WM8A 3USSA 3SKVA 2DF7A 4GAZA 4AVSA 1I6XA 5JSRA 2GN3A 4QX3A 1BEV3 2WS93 1XNDA 1PM7A 3CJIC 3AC0A 3MF6A 4N43A 1WBLA 5GLZA 5E89A 2W5FA 4NWWA 1N1SA 3AYAA 5EPAA 2XPJA 2B8MA 2IXKA 1XPWA 2W1UA 3I3MA 3OEBA 5BNPC 1W04A 3KQRA 1RUC3 3ON7A 2C5DA 1SCSA 2XGXA 3OSDA 2Y34A 3ACFA 5DPNA 5FYHA 3A4UA 1QOTA 2GNMA 4P5YA 1PZ7A 1WW7A 2ZS6B 4FPEA 3S6PA 3I4IA 1ZRFA 2Q1FA 5C8CC 1PM4A 4A44A 4O65A 4DXRA 1DFQA 5AVAA 5CKNA 3O12A 1NAEA 4OI1A 4UBHA 4RQPB 4HN1A 3I59A 3CO2A 2Y60A 3NV4A 5FLJA 4MGTA 4FTBA 4BOWA 2ZGUA 3SNMA 5E6HA 4HVOA 4JV4A 3NV1A 1UMZA 5J37A 2ARBA 4NVPA 4A7YA 2GMEA 1XBFA 1BBT3 1YEWA 3N36A 3PVEA 3AL5A 4P9XA 3WCRA 3WDXA 3U0ZA 1IZ3A 2VUAA 1OVPA 4H14A 1VPHA 4H7LA 1NX9A 2CDOA 4U36A 4E2GA 2EIEA 3OBTA 4FO9A 3WW4A 4FXKB 4FCAA 5FY1A 2C4XA 1KFUL 2D43A 4XHBA 3ZSLA 4CZSA 1NY71 2W91A 4QHOA 3OYWB 5DDJ2 4CXXA 1JZ5A 1NZCA 2MEV3 4TN7A 2C1FA 2PXJA 2VMFA 5AFBA 3GBFA 1VJ2A 2J1AA 3MUZ1 4K8RB 1ASJ2 3VBOA 4Y1VA 1MQTA 1DQ5A 1OH3A 3ACHA 2ORXA 2AEYA 1QJU1 4JGYC 4QKDA 1UU4A 3JBG3 1AYM1 2DTYA 1QJEA 5A6XA 4KL1A 4YGDA 2BJSA 2R16A 4OHZA 4B4PA 5BNPB 1AR62 4LBOA 2VZUA 2YC4A 2OQ6A 2OUHA 2ZGTA 3L2YA 4CU8A 2VZOA 4YG0A 3NAPC 1V6OA 4U2AA 2A3YA 2ZACA 4AEKA 3AX4A 5FYMA 5T5OA 4I3PA 3AP5A 1RMU2 1OOPA 4Q29A 3SCHA 5C8CB 2Z42A 2NQYA 2H6BA 1DZQA 2E7QA 3P1IA 3O0XA 3THDA 2D6NA 5F3CA 2DCKA 1PO23 4YVSC 3RNSA 2QQLA 4YGBA 5A32B 1FMD1 3D6EA 4Y1UA 3O1PA 2ZMNA 3AJZA 4S2DA 2JE9A 5ISLA 3BTXA 3CNAA 4OHXA 1FPN1 1W6NA 1ZRIA 4P9YA 2FHRA 5EYXA 2ZMLA 5C4WA 5GZCA 1F5FA 3D5OA 3JZVA 3KD4A 1C28A 3ZIWA 4M3CE 3W9AA 1B09A 1WLWA 2LROA 1QHDA 5FYBA 3BALA 5FZGA 3K4AA 2R0HA 4TXWA 2A71A 4JHZA 2D6PA 1DZTA 4YW1A 3ZXFA 3EO6A 1QJX2 1V9U1 3G6JB 4AWDA 1VBA3 4Y33A 1MVQA 1AYM3 1GQHA 1AR91 1SQ4A 2J1TA 2JWPA 2YGLA 2Z2SB 1TEIA 3ACIA 4GIQA 4ONUA 4AHXA 4L9BA 4JGYB 1YHFA 1PK6A 1XE8A 4A6OA 1WW4A 2AYHA 5L9RA 3ZDVA 2CWMA 1H6XA 1RUD1 1C5IA 2O14A 2VG9A 3HAGA 1V6JA 3VDCA 5C6CA 2A6WA 3NAPB 1LOFC 1XJAA 4Y5SA 2FCUA 2H0BA 2K46A 5J7MA 2VQTA 3PMSA 1CN1A 3Q8CA 4ZHNA 1O3RA 1EY2A 5C3OA 5FZ3A 2Y64A 2YC0A 3MV11 3VL9A 3AZWA 3MI8A 3ASIA 5LK7B 4YVSB 5FZIA 3BTZA 4JTNA 2XWJB 1DG6A 3HN3A 5DAVA 4BPZA 3RZMA 3J7NA 4YSFA 2G1MA 3GZEA 1RVF2 3ZYHA 3BI3A 1CJPA 1DYKA 2WZR3 5K0UA 4XE9A 3RQ0A 1JZ6A 4DXZA 2CYFA 5GZFA 1CZSA 2HWC2 4OQ9A 3O1OA 3THCA 5LK5A 5FOBB 1PNGA 4NRQA 1MS1A 2RVAA 2BQPA 4LHNA 2RS53 4IGQA 1JZ7A 1AXYA 3AYDA 1E5HA 1VAVA 5C5UA 1ZBA3 2AENA 1XSRA 3LDBA 3GZUC 5FWEA 5JVVA 4CEYA 4X8NA 3AYCA 5KHIA 3EYPA 1X36A 4LPLA 4QB6A 2BTVC 2BVBA 4OZOA 2UWBA 4BQ3A 1JYNA 4DMIA 4BHPA 5FY8A 5IVBA 1AHSA 5FYZA 3W20A 4GULA 4AHWA 4W65A 2JB8A 4E9KA 2DUPA 2P6HA 2VQAA 5AC92 4QPGB 4FPJA 1VBD1 1XNAA 3GDBA 2G9ZA 1DP0A 4MX3A 4L8QA 5JOWA 4BCUA 2K9ZA 1VBE2 4CXYA 4AQ6A 1VAKA 3NNLA 5FIXA 2P3KA 3DN7A 4QAWA 3CBNA 4Y5Z0 3T2PA 2DBIA 4EV0A 3IDAA 3DKWA 1OMIA 3FFZA 3TEYA 4PLOA 4XFBA 1TVGA 5G05L 3N7MA 3WDVA 4OLLA 4JAAA 1KQRA 4GMP1 3GCWA 2ID4A 3N9OA 3SXWA 4BH9A 3AMHA 1FV2A 4YPJA 2R49A 4W6WA 5J09A 4E4DX 3WW3A 5I8YA 3GALA 1W8NA 4XJUA 4GB31 3ZXAC 2OPWA 1SG3A 3ETQA 4NHLA 1W2UA 1RUF3 4D7TA 1OLMA 2ZHMA 2ZAHA 1IPJA 3BIWE 1WD3A 3HOBA 5KHJA 4Q4V1 3POEA 2XLFA 2ZKNA 3BB6A 3KS7A 1WA6X 2X53S 5F3IA 4E2SA 2VM9A 1ND2C 5GZDA 3U07A 2YDEA 3LEGA 4HSJA 2I07B 2KD7A 2WZPP 1ZRDA 4P02B 2WNVC 3LCPA 3WG2A 4QGMA 2YMZA 4KWKA 4UT5A 1K5JA 1DZRA 5GKAC 3JQWA 4MVTA 1JW6A 5KR7A 1UIKA 1OC1A 3FMGA 1VBD3 4Q0PA 3UT0A 3FL7A 3MIEA 3I2GA 2ADDA 3BVCA 4LA2A 2FMDA 3BPSA 3TNPB 1IS5A 3C7EA 1BJQA 1YFXA 3C7HA 4PT6A 3FHQA 1VP6A 5A7WA 2A3WA 5CISA 4H2AA 2RR13 5FCCA 5A33B 5L7OC 4LTAA 4GJYA 3FZ3A 4JKMA 4C0BA 1YFUA 5H9QA 1UAIA 1V6LA 1GANA 5A3TA 2BFUS 4JGZA 3C7GA 3CHXA 2FDFA 3PTYA 5B2GB 4NRMA 5BNNC 1CGPA 3VHNA 5A3WA 1F2NA 4IERA 3JD72 1O3TA 2C9KA 4YYOA 1S0GA 2O1QA 3UK9A 4CEWA 4HSLA 5IVCA 1VALA 2XHKA 5FZMA 3LA2A 3MFAA 2XG3A 1NXMA 4Y20A 5FZDA 1W8HA 3IIIA 4EROA 5HBAA 4UFIA 1GICA 4NIGA 1C1LA 3CIHA 4YARA 3TN91 3OY8A 2WAOA 1LODA 5FMOL 4QXBA 2TNFA 4QXHA 4WVMA 5IVEA 1GFF2 4CDXA 1RVF1 1ND2B 2QQIA 1LEMA 4PF1A 4LKFA 5BNOC 4XETA 3KHCA 1R083 3VBRA 2AGSA 1GWLA 2WNVB 4ES9A 4M01A 1UX7A 2FZ2A 1HV0A 2HWC1 1W9TA 3I97A 2GP5A 1IS6A 3I2KA 1GP6A 2VNGA 1QQP3 5FZ6A 4AE2A 4JQTA 1EAH2 4Q0VA 3UNPA 2AC1A 1AR71 2VOKA 4K8FA 2JKXA 5A6ZA 1R1ZA 2YC2A 1Y43B 4R9AA 1RINA 3T3YA 1UOGA 5L7OB 1J3QA 1FOD1 4QT6A 5ERLA 1W6PB 1D4M2 4FTSA 5F7UA 4Q4Y1 2JDKA 4Q26A 2ZOEB 2WFF3 2HYXA 4IV3A 3CL1A 1MEC1 2PHTA 3ITQA 2WABA 4WM7A 4Y1ZA 5FLHA 2AREA 3ABZA 4XXAA 4LBNA 1Y9MA 4M3CF 2ET7A 4XFGA 4XIKA 3NW4A 1RUJ3 5F39A 2JDAA 2HWB3 3I2IA 1H2MA 1C8M3 3ZYGA 4BMBA 1C1FA 1JOBA 2MPFA 2VZVA 4RR3A 1HRV1 1UOFA 3VBSA 1MS0A 4AEDC 1SPPA 2WNOA 1RUH1 2VO5A 4AGRA 4XTPA 3SH4A 1AJOA 5C7GA 3IMMA 2A6YA 4IE6A 5EP9A 2VOTA 5FZFA 3IN9A 4NIHA 4RL7A 1POV0 1UOBA 2AH2A 3KHBA 4UW4A 3AFKA 1APNA 1O8SA 5BNOB 1G9CA 1CAVB 4YW3A 5FPXA 2J1EA 4FI9A 4ZKTB 5ACA1 1NT0A 3RMXA 1SBFA 2PAMA 4WZFA 5FXZA 5BV6A 5I0DA 4X6QB 4FBFA 1JU4A 3FBMA 3OD4A 2RDNA 3IWZA 1MZ5A 4HK8A 1AVBA 1H4GA 3T4VA 4FOQA 2VZ1A 4XABA 3ZKUA 2YROA 2ZHLA 2YU1A 2Y8KA 2BEOA 4QQ2A 2PHRA 1JZ4A 3O1TA 1OLQA 3N9NA 3WZ1A 2WJSA 3H3LA 4NWVA 3DV8A 5EHDA 5F5AA 1PIV1 1ZZCA 2RS32 2HWD2 4B3NA 5LW9A 1R093 3FBYA 1LOEA 2K0GA 2XQXA 2EXKA 4QB1A 5JSOA 1JZ8A 2IXIA 3CKHA 4GH4A 1NLQA 2FBEA 4QQLA 5KHGA 1AL23 1EV13 4CUGA 4ATEA 3B00A 5A1AA 1IG3A 2ZZQA 4NHMA 3ENRA 2JKBA 4LJHA 5LRSA 4OHWA 4N53A 5T5JA 3PIGA 1OKOA 4Q0SA 1HDKA 4HPKB 5LA9A 1PZ8A 4COYA 4ARXA 2CTVA 4I30A 5IT6A 1RUE2 1UZ0A 3RDIA 1ZZ8A 3ZLIA 5DG2A 5ACA3 2J22A 1TMF3 3PJQA 3LE0A 3J7LA 3P5BA 5AVPA 5FO8B 4IE5A 2BYVE 4XJWA 3ZFEA 4BWOA 2MHFA 4NHXA 2HWF3 5JI7A 2ZX3A 4RHV2 1DGWX 2GC1A 3VN4A 1DDLA 1UY3A 2QQMA 3OEAA 5FZ8A 1A8DA 1OQDA 1UOJA 1ZVFA 1UZYA 4IL7A 3RZJA 1ZA4A 2VZRA 1NCQB 1UN1A 4QQPA 4YG3A 4EWDA 1XYOA 5HXMA 4IEOA 2SBAA 1MVEA 3B9IA 1QJFA 1AR83 3TYJA 4QPIC 2VZSA 4CCDA 1X9PA 4RA0A 3SMHA 2C0ZA 4Q4X3 4LUMA 5CKQA 2PLV3 1W6MB 1ULFA 4BMEA 3CZUA 4BQWA 5LASA 3ZFFA 3WP5A 5G04L 1AL0G 5BXXA 1UKRA 3VV1A 1NLRA 1YQCA 1RUI2 2P5BA 2UU8A 1MS8A 1I5PA 1YI9A 1GZWB 2GSYA 5C9AA 1H1MA 1H1AA 3ZR6A 2OA2A 3ZN4A 2Y38A 4M4RA 4Y5TA 4MSVA 1W6QB 1D4M1 4YW4A 1JS9A 3DXTA 3V0AB 3LQCA 3WNLA 1JH5A 3LIHA 5TSWA 5HCBA 3FLTA 1YUDA 2BGPA 3HR9A 3I49A 3ALQA 4YVWA 3O0WA 3D0SA 5CFDC 1UYPA 3UV9A 4KBZA 1AX1A 3ZDSA 3ZN6A 2G19A 4Z07A 3FUOA 1JYCA 2N7GA 3KVAA 4B29A 3WP4A 1I3HA 1KJRA 1W2AX 2V5YA 2WT2A 2Y26A 1HN1A 3OCPA 3SEEA 4BZ4A 5FXVA 5JSPA 3THTA 1Z78A 4I01A 5DUXA 4ZY9A 2RM21 1ULPA 5CG9A 5FZOA 4OULA 1OFSA 3VBHA 2LALA 3AKQA 3E6BA 2OQ7A 2H6CA 4IEWA 4A3ZA 4BE3A 3OBZA 1HX6A 3MZHA 4DRRA 2X10A 4BU2A 5ANNA 4FP2A 3N4MA 1QJY3 3FLRA 4UFKA 2HEYF 5I93A 1Z7S1 5CKMA 4K3UA 3K4ZA 4IXLA 3J8F1 3POIA 3QACA 4PIZA 5FR3A 2WZ8A 5ABJA 1J58A 4LBQD 1SLIA 2XLAA 1LGCA 1K5MA 1O3SA 2F4PA 2W94A 3NWKA 4O9GA 5J1XA 1MPXA 2WS92 3JXSA 1EPWA 2RJ2A 4FPYA 5DZEA 3LOBA 1POV1 5C5TA 1DGLA 4OUEA 5FZ1A 4D8MA 2E7AA 5I0SA 4CE8A 2VC9A 4M3CB 1LHUA 2OKXA 2OZJA 2RS31 4N90A 1QXPA 1VBB3 4ZU4A 1H2KA 4M4PA 5CFDB 2JEMA 3WDUA 1JYTA 1HXS1 4PDWA 3H8OA 4HKOA 1PMIA 1V70A 4JDOA 1K3IA 1SBDA 3DPRA 2Q1MA 2XHNA 3I2OA 4QD2A 1OLME 5FXXA 4RN5A 2UWCA 2PQSA 2IWGB 4YG6A 4P08A 1G9AA 4NIDA 2IVIB 2VW0A 1CONA 4YZ5A 3H42B 3OGVA 4LBLA 4A4AA 3OPWA 1YI7A 4DXTA 3RFRA 3NNJA 3GJBA 2PFWA 3ZFGC 3KT7A 4AFCA 5C71A 4P9WA 2D5FA 2D98A 4N7UA 3E1F1 2PHLA 2ZZJA 5F32A 2QQNA 2OXBA 3SITA 2XBO3 4RHV1 1KFXL 3ZYJB 4O7XA 1QDOA 2V5DA 3UESA 1NA1C 1SLTA 4G9SB 4XZUG 3LB9A 4LE4A 3V65A 1BMV1 4BB3A 4IE4A 5IFTA 5DUWA 1WGPA 5GALA 1TME1 2E51A 2E32A 3MIGA 1ULGA 3NNMA 3PHMA 3SQOA 1PVC3 2W0XA 2BP6A 4D6QA 3POFA 1VE0A 4P9GA 4BQ2A 2YU2A 3GCXA 1KRIA 1VLNA 1AZDA 3N9LA 2ZGMA 4XOGA 1RUG1 3I3QA 4NR1A 2JDNA 4O9EA 2EIDA 3BPZA 2UY8A 2W1WA 2BBVA 3KLSA 1DLLA 1IGOA 1M4WA 1OFNA 1IPSA 2HWE3 2V72A 1M06G 1RUI1 1A6CA 4UF0B 3O14A 4P9IA 3GHNA 2WA3A 1BKZA 2PAEA 3INAA 1PO22 1PZ9A 4CUAA 4QQOA 3RRDA 4YZ3A 2VMGA 3HT2A 4QX1A 2UYAA 1WW5A 4KMQA 3POJA 5LATA 2CAUA 4E2QA 1H8VA 3C2UA 2RHPA 1VB4A 2Z69A 3ETPA 4XUPA 3MW2A 5DABA 4QGNA 1QH7A 3ZSKA 3ZFGB 3OUHA 3TBDA 1LHNA 3AP4A 4HANA 1XNKA 5JIUA 4MXWA 2XJQA 3EXUA 4IESA 1LKNA 4W8JA 5DAPA 4XCBA 2A6VA 4V2WA 4IGOA 1HJFA 5FPZA 2VVEA 1NA1B 1VRH3 4Q4W3 2CY6A 4CDQA 4MG2A 1W05A 4CCMA 3D3AA 5IVFA 5F3GA 3L2HA 3QOPA 5A3NA 1VMHA 3NNFA 1VBC1 3GGLA 2TBVA 3M4FA 1I9RA 3AMPA 4NPLA 4URAA 2YBSA 3PVBB 1DYPA 4JC1A 1B35B 3IDCB 3VD4A 2GDFA 1FV3A 4LNVA 5F5QA 3U37A 2DUQA 3KV5A 3E6CC 2WR9A 4RQPC 5HI0A 1VIWB 4W6YA 2VW2A 1CZTA 5JR7B 2WT0A 4Y22B 1PO11 4AI9A 1W9WA 3BOWA 4LR4A 2FDHA 4PQ9A 1GOHA 5FYIA 4CP2A 3FLPA 5KBFA 3IAPA 4CDUC 2CGOA 2O8OA 1ZBE2 2X8KA 3O7OA 3OUIA 4XQDA 3NSTA 2X5IA 1ZZ6A 3FUQA 4AL9A 2A6ZA 5FYTA 4KU8A 4IV1C 3S57A 4IE0A 3D82A 4DO0A 5FP9A 4ISQA 1ACCA 3K75B 2E6VA 3TRSB 3O1SA 4CU6A 4P14A 1OUSA 4G3YC 2VCBA 3ST7A 4CYDA 4EQVA 3KV4A 1J84A 3AYEA 4PHZA 4J1XA 3S7EA 4A42A 3X29B 4R4ZA 5FP3A 4DUXA 1AYN2 2NPIA 3MLKA 2PTMA 2RS52 1URXA 4FFGA 2W92A 5JR2A 2VVDA 3CF6E 5I8SA 3DKQA 1GQGA 3M3QA 4AW7A 3ZXGA 2B39A 3WP6A 3DYMA 3FHAA 2Q8EA 2H0VA 2QZ2A 4KG8A 5DAWA 2V4VA 2W68A 1RB8G 2EXHA 4KNCA 4XURA 4K40A 2JE8A 3H50A 4L97A 1CJDA 2OVUA 1YFYA 4AI8A 2B46X 1ULEA 2ZX2A 1DQ1A 1PO13 2RS12 5FYUA 5KXEA 1AXZA 1YIPA 2GAUA 4Z92B 1S2BA 1CWPA 2BU9A 1H30A 1LOGA 4FVVA 4KWJA 3APBA 2OPKA 4PCRA 2WSVA 3WCSA 2JG8C 4ZXEA 4YZ4A 3Q8FA 4LBQA 4OUSA 1O6UA 1XSQA 3HPNA 3M3EA 4ISRA 1H8TA 1JI6A 5E88A 1RHI1 1S0CA 4OHVA 3VL8A 1GQPA 3CJIA 1AX0A 2ZBJA 1VR3A 3PUIA 2RMU2 2GC0A 4XDQA 2CSGA 4QX5A 3TOJA 3ZSJA 4CDUB 1WA4A 1CX1A 5BPXA 5T5PA 3A21A 4Q0QA 1O59A 2J42A 1OF3A 1J1TA 5FREA 1SACA 4IV1B 1ENSA 2WT1A 1WMEA 3VBOC 2ZGSA 4AVAA 2EF6A 1MS3A 4N43B 2E7TA 5CA6A 2W95A 5KXDA 4LLOA 2Y6KA 1AF9A 1DGWA 1GV9A 5F9TA 2JDZA 3T1LA 5I0TA 2PYTA 4K1YA 2CV6A 2WO2A
chains in the Genus database with same CATH topology
5IK8A 3CLPA 3MPBA 4ATFA 3NJZA 1X33A 1YNAA 3EBRA 2YYOA 1GYKA 4EN9B 1S1AA 3AP7A 2OW4A 2ZHKA 1LOAA 1IPKA 4FPCA 2AUYA 4DB5A 3PJYA 4XBLA 1U0AA 1W6OA 1RITA 3POWA 3IPVA 2D6OX 1LOCA 3JU9A 1GKBA 1NG0A 3CEWA 4EN0A 5C4WC 1XXNA 1F5JA 2JX9A 2JG8B 3LWCA 4DINB 1ZZ9A 2XUMA 3QD6A 2QQPA 1D0HA 1JBCA 1HRI1 1CAUA 1J3RA 2EA7A 1HIXA 2IC1A 1REEA 4J1WA 1SMVA 4BYYA 2BWAA 2HEVF 4IEZA 1R1A1 4YFWA 3VBOB 1FATA 4AGVA 5J36A 2WLQA 4AQSA 2DTWA 5E8AA 4YRDA 5JI9A 1PK6C 2PHWA 4EN6B 1N1VA 4LBKA 1QJU3 1Q8VA 4XF4A 4XXPA 2JICA 4FPGA 2DVAA 4XFHA 2ZGNA 2JD4A 3B9CA 2R0FA 1C4RA 4XMIA 2GNDA 4YVSA 1HQWA 1OOPB 3P3PA 2YV8A 4BIOA 4QPGC 4QM8A 2TUNA 5CAZA 1WCKA 3CU7A 1R082 1LEDA 3W59A 5KC5A 3N3HA 1OHFA 1AYN1 1FMD3 3WNXA 1W6NB 4MZUA 4AEMA 5C4WB 2IFRA 1KXGA 1FPN3 5K7PA 2DVFA 1LULA 3MLJA 2VW1A 4HBNA 3KT4A 3NV2A 5J3UA 2E53A 2JG9A 2R072 4LA3A 3UKTA 2XVGA 4I09A 4N9IA 3VZKA 3V0BA 4LULA 1Q43A 1VAMA 5KHKA 2LUWA 4D7SA 1W39A 3WQ1A 2QE3A 1V9U3 3H9AA 1AR93 3OPZA 1PK6B 2HWB2 4K7JA 1UPSA 1NLSA 3EJKA 4DZGA 2RMU1 4NPRA 1D0GA 1YYNA 4AVBA 4SLIA 4TZDA 4RGAA 4GA9A 1RUD3 4P9LA 1KJLA 4OUMA 3AMNA 5DDJ1 1GZCA 3URFA 4MYEA 3AM2A 4MLOA 3USUA 3E5QA 4AQTA 5C33A 2GN7A 3ACLA 3P3NA 1ASJ1 4XMAA 4M0NA 1CAXA 4B4QA 1ALYA 4BA6A 3B69A 3VDDC 5K0UB 3HIFA 1AR61 4XBQA 3RWNA 3ECQA 4EN7B 4LO4B 5FO9B 5K9YA 3ME2A 1ZM1A 3KCCA 4CP1A 5JMCA 1RMU1 3T1MA 2DWRA 1LU2A 5LRRA 2AR6A 1F8VA 4AEJA 4X6RB 5EXOA 5AFEA 4A7ZA 1MS9A 2XH6A 1T6GC 3M3CA 3PMEA 5F1RA 1AL22 1EV12 2DURA 1WLDA 3AXEA 3ELNA 3VZLA 1LU1A 1BVVA 4XEZA 1DQ2A 2KM2A 4D7YA 1U12A 3IM0A 2ZGQA 2A70A 1WW6A 3RSJA 2XJSA 2Z79A 2WC2A 4IEUA 1G6NA 1UCXA 1UZZA 1TMF2 4KWLA 4YFZA 4CDWA 4LE3A 5JZGA 3TB0A 4XFCA 2VY0A 1QJX1 4Z1VA 2ZHNA 1HQLA 2HWF2 1PVXA 4FXGB 5FBZA 3VZOA 2Q0AA 4COZA 4CEWC 4GMP3 4TLFA 3VDDB 1G7YA 5T55A 4YGCA 2UY9A 5DZGA 3ES1A 3LAGA 4W6XA 5CB7A 3M1HA 4Q4X2 2A6XA 2CGNA 2PLV2 4GB33 5EYYA 4ITCA 3BU7A 3SLIA 2A5ZA 4XJ9A 4Q4V3 3IMNA 5FTTC 1NOVA 2ILMA 5KXBA 1FI2A 3ZYIB 1ZZBA 2CNAA 4AFAA 4JVAA 2G9FA 1QOOA 4B7KA 5CVRA 3EHKA 3ZIXA 2VU9A 3FC0A 3RYPA 4F8AA 2XJVA 3NVCA 4MV2A 2PAKA 1Y7BA 3D8CA 1CPMA 5L19A 5KWRA 5FLIA 1GR3A 4YM2A 5BNNA 3VHOA 3I7DA 1XYNA 3ILNA 3RJ2X 4URTA 1GLHA 4WM7C 3TAYA 4D69A 4EN8B 4C1WA 2R062 4QPYA 3R4SA 5EZWA 1S0JA 2Q8OA 1KS5A 4YW5A 1Y9QA 1CQ9A 3E6DA 2R32A 4CEWB 3O5SA 1DIWA 5AC91 5JOZA 1QJY2 4Y20B 1FYUA 4RR3C 2D93A 1AXKA 3VBSC 1NE4A 1OSGA 1COV2 1LHWA 2JENA 3R05A 3OY8B 1PGL2 1VBE1 1CAVA 3N35A 2QJVA 4YM0A 4Y1XA 3A0NA 3TN93 2ZABA 4CDXB 1H1IA 3JB8A 3WQ7A 3B5LB 1W0OA 2Y0IA 3VBRB 1DGRN 1QOSA 1RVF3 2PN5A 2QNKA 3MW4A 3VKLA 3MGUA 3RYRA 2HWC3 1NQJA 1O5LA 5T3NA 4AYUA 5H9PA 3AZVA 4COVA 1I1EA 1X7NA 1A3KA 1AR73 1NXD1 4XFIA 4CRQA 4XF3A 1H9PA 3MIFA 1NCQC 5T52A 1FOD3 4IEQA 3PVOA 2D97A 4Q4Y3 2HKXA 2XJTA 3M7AA 4WM7B 4YW2A 4I2OA 1X8MA 4LBMA 1MEC3 2DUOA 4GH4C 3H1YA 3WQ0A 3RZZA 1OI6A 4AEDA 3NO8A 4S2FA 1LB2A 3GBWA 1HLCA 4N53C 4RR3B 3VBSB 1Q56A 5FDBA 4M0HA 1HRV3 2CWSA 1RUH3 2B9UA 3GZAA 5CIRA 2R042 3LA3A 1OA3A 2F6BA 5F6KA 2CL2A 1WLCA 4LO8A 3WW2A 4BLIA 3ZFEC 5CFCA 2JJ6A 1S0EA 4FOVA 4FPLA 3WDWA 1ENQA 1YO8A 4Q2FA 1XYPA 3JD71 1QXJA 1LR5A 4Y4YA 2GMMA 1DQ4A 1WD4A 1XRUA 1F9KA 1ULCA 2YY1A 3SISA 3V64A 4B4RA 3MICA 2EAKA 1BYHA 3MYXA 1D2QA 4C90A 1GZWA 5KHHA 2VULA 1PIV3 4WVWA 2VUJA 4HKLA 1HW5A 5D8AA 2FQPA 4GH4B 1QF3A 5F6LB 4B7EA 1YWKA 5C9AC 4RS5A 1D4VB 3FJSA 1EAH1 1NCRA 4AFBA 2FMYA 4GQ7A 4N53B 1ZREA 5GJ6A 1U5IA 1DU3D 4YVWC 4R9CA 2R061 2UURA 1A8MA 3MEPA 4Q4W2 3MDPA 4K6BA 1MS4A 2EXIA 1QNWA 1U5XA 2DYCA 3C3VA 3GZTB 3ZFEB 4V1PA 1FX5A 1COV1 4QPIA 3VBHC 1GBGA 1HKDA 3ZO0B 4FSJA 4Z8BA 5JCTA 1SBEA 3UKNA 3OJBA 3WHTA 2XLGA 3M2MA 4LEJA 4F3JA 4HKWA 2WQZC 2UYBA 5ABJC 4Y26A 3ZFFB 1K5MC 4DY3A 4A3XA 5KC6A 1H2NA 1SLBA 1XNCA 3ZVXA 3FX3A 4I0BA 5C9AB 3WT3A 4AXOA 1H4HA 4FP3A 5DXDA 5I91A 1OPMA 5GZGA 2VQ0A 5CFDA 3AKRA 3QH7A 4XIOA 2BUKA 4P5HA 1BEV2 4FAGA 2DV9A 4YNIA 1D4M3 4TWTA 3IDBB 1PGW2 2VNRA 4YVWB 3VBUA 3SH5A 2RE9A 4AFMA 3H7YA 3ZN6B 5IUQA 4Z2WA 5GM0A 3ZX7A 4MGZE 1V00A 4RSUA 2HWD1 1RUC2 3JUUA 3VHRA 3HD8B 2QZ3A 3BODA 1FAYA 2D6LX 1RC6A 3BOPA 1QKQA 2Q1ZB 3VBHB 2RM23 3OGGA 3M3OA 1LHOA 5LEJA 4IEYA 2R041 5CBLA 3G7DA 3W58A 4QXKA 3ZXEA 2QKDA 5JOXA 4QU2A 1RUE1 4J6GA 1Z7S3 1BBT2 2TEPA 5ABJB 2EXJA 1LENA 1CIWA 1K5MB 3J8F3 3LZZA 3VHPA 4OI0A 3PVNA 1E57A 1RIRA 1GZ9A 3H7JA 4JRAA 5E16A 1RL3A 5SV8A 1D2SA 4NO4A 2IXHA 2MEV2 1KITA 1POV3 4AI3A 3FHIB 3OD0A 2RS33 1B35C 2HWD3 1J3PA 4R4XA 3JBG2 3K51A 4PBPA 1Q8PA 5DUVA 3OGJA 3DPRB 3TWIA 1GNHA 1HXS3 3WG4A 2CAVA 2PHFA 3I2DA 4IEXA 3RYKA 1V6IA 3RMYA 3VBFA 2EAAA 1SCRA 3KCXA 5GLUA 3VZNA 4C1XA 1UU6A 5LEKA 2BVVA 2DCTA 2OIIA 5CADA 1X8EA 3IKWA 1O4YA 3I8TA 1V6KA 1IQAA 2VMHA 2WNUA 1Q8QA 4K21A 2HYKA 5I0RA 4CTEA 4RHV3 2XJRA 1SDWA 4KQ7A 2AZ5A 1NY72 3DGTA 4P9JA 1TME3 4XFFA 1OQEA 4AQ2A 3AZYA 3S30A 2WFPA 1ONAA 3PNAA 1JOJA 1QJU2 4AK3A 3MPPG 5IK5A 1VBA2 1ND3A 1Q5OA 1AYM2 1DQ0A 1UF2C 1RUG3 4QHBA 4R9DA 1QY4A 5BUVA 1RUI3 1EP0A 3NKTA 2VMIA 1QWRA 3WY6A 5FQ0A 2WS91 2ETEA 1W0PA 4AVTA 1PGW1 4COUA 4Q8LA 4ORFA 1FMD2 2PELA 4ZXKA 4WM8C 3Q9OA 5GLWA 4A2UA 3VZMA 1BCXA 2G9GA 1FPN2 4MXWB 1H2LA 1RUC1 3BCWA 1YCIA 4N43C 2R30A 2ZJCA 5BYNA 2WZR2 2W08A 2XWBB 3AFGA 4UXAA 5JPMB 5JWPA 4UBGA 4CDQB 3WVJA 2VXRA 5T54A 1CAWB 4QQHA 2P34A 3RI8A 3VKNA 2NP0A 1MZ6A 1WLTA 1RTVA 2VOWA 2JECA 1FXZA 1C5HA 5JPNB 2G4IA 1V9U2 1VBC3 3AXDA 4RQPA 1ZBA2 1AR92 2PHUA 3A0KA 1WCDJ 1OA2A 4GALA 5J98B 4MGYE 4DNYA 4WV8A 1PGSA 1EPZA 1HQNA 3KCYA 4FOYA 4PLMA 1RUD2 4MH0E 4XF0A 4ASLA 2BW8A 4YGEA 1H8TC 4IV1A 1DGRA 1QMJA 2MEV1 2Q4SA 2X5IB 3VGIA 3JB4C 3ZYRA 2CGPA 3OYWA 1BZWA 1LCLA 3FWEA 4XHXA 2FZ1A 3GBGA 3WHUA 4IEPA 3JBG1 4WM8B 5GLTA 1ZRRA 2D7FA 2VECA 2NYYA 3QLQA 1Z0HA 4JTOA 1DHKB 1MQTC 5BNPA 1YIFA 4JDNA 3T2TA 3KM5A 2W52A 2DFCA 2LM3A 3QH6A 2P37A 3SH3A 5BNQA 2DCZA 1ZRCA 3ES4A 3AKSA 4YZ2A 4HMZA 2OZ6A 3UL2A 1NE6A 5JOYA 1RUF2 1PO21 2DVDA 4XPVA 5C8CA 1CD3G 1C57A 2V73A 5A32A 1OOPC 5H9RA 2E9QA 2JG8A 4DOUA 4QMAA 2SLIA 2KXLA 1MZFA 4K9SA 1ZX5A 1QH6A 4GMP0 4A7KA 3I59B 2DVGA 3E5XA 2IXJA 3ZMNA 1VBD2 4LBQB 1G8WA 1RJ8A 2ZA9A 5DUUA 3OF1A 4MGIE 1H8TB 4S2HA 5IK4A 3POYA 3CJIB 2K2SA 3RI9A 1S2KA 4C0HA 4DRVA 1RHI3 2BGCA 1EYBA 2R1BA 1XQNA 2RR12 1VBA1 3PLQA 4LO7A 4BQ1A 2OYZA 1Q8OA 4FQ4A 5JIAA 1H0BA 2A75A 2E63A 3B3QE 4MGKE 2ET1A 1ZYBA 4YM3A 4JGYA 4XYXA 4BIFA 4E27A 3TNQA 4AI1A 5J96B 1O4TA 5JLVA 1MQTB 2RJLA 2XVLA 3WUDA 2ZAAA 4GB32 4N9HA 5BY5A 3NAPA 2GNBA 1GSLA 4OVEA 2VPVA 4Q4V2 1ZBE1 4RGGA 3AKPA 3JQXA 4H7MA 5CU1A 2PHXA 1YXWA 1LGBA 2GNTA 3AMQA 1CVNA 1W6OB 2DCYA 3H3UA 3IPVB 2WZR1 4XBNA 1N3PA 3AZZA 4DPNA 2BNNA 3I54A 1YRZA 2DCJA 4LBJA 1RUOA 4BHPA 3R4DB 2RS51 1QQP2 2JG9C 2WINB 3AZXA 3J26N 2PQQA 3ILFA 1ZBA1 1CAUB 5K0UC 1MZEA 4FT8A 3H1MA 1HRI3 2ZMKA 4B8EA 3VLBB 3WP3A 4DS0A 1CESA 1NQDA 1R1A3 1O5UA 1H9WA 2WFF2 1SLLA 4K20A 4CEYC 4BM8A 2RS11 1BK1A 4ES8A 5JDBA 4D94A 3WUCA 1G9DA 5J48A 4QPGA 1CX4A 1RUJ2 2GMPA 2ZGPA 1ZBE3 3KB5A 4ZU5A 2X29A 4KU7A 3IT8A 1LOFA 1C8M2 2XKOA 3H3ZA 4INDA 3TN92 4X8PA 2ZX4A 3WXPA 1OLRA 1N3OA 3DUIA 3H1WA 4FPHA 5GZEA 3MF9A 3B94A 1J1LA 2XKPA 1I5ZA 5DZFA 1UD1A 3AJYA 4SBVA 4S2GA 3RJRA 1RUNA 1UIJA 1AYN3 4H55A 2KA3A 4Z82A 1U5ZA 1AR72 4HZFA 1RUF1 3L9JT 1IKPA 2JG9B 2HEWF 1O4ZA 1FOD2 1DF0A 1DBNA 4JQRA 3V0BB 4Q4Y2 3HT1A 1KDMA 3OTFA 1LHVA 1MEC2 1G9FA 4FPFA 2HJIA 1OA4A 1JTZX 4CP0A 2WL1A 2RS13 4KG0A 2VOVA 2IZWA 1AUYA 1R092 5FRAA 2Q5TA 4L2NA 4CEYB 4PIXA 3POSA 4L92A 3DF0A 2P3IA 1SEFA 1S0DA 1XNBA 1HRV2 2RMU3 2RR11 5FOJB 2XL9A 1RUH2 2ZGKA 5A33A 4HK9A 2YXSA 1OQ1A 4NHKA 3UJOA 1LECA 2VGDA 4AG4A 4CDWC 5JZGC 3ZXJA 1BXHA 1JUIA 1S55A 2RJKA 2GC2A 2NN8A 3J9SA 3USUB 2GH8A 2B45X 2W39A 5DDJ3 3VDDA 3UKVA 5ACA2 4AHYA 1LOBA 1CAXB 3S0MA 3MLLA 1ASJ3 1LGNA 5D1IA 1XU1A 2QDRA 4Y24A 4JGZC 2EIGA 1AR63 2ZKLA 1O3QA 3GYDA 5I0UA 3RS6A 1AR82 3IBMA 1PIV2 1R081 2BPA2 1RMU3 2QDNA 3U11A 1ND2A 1OKQA 4UW5A 1JXNA 3AP6A 1NYWA 2O0OA 2WNVA 1S0BA 2D3RA 4XW3A 2P17A 1QQP1 3WV6A 4CDXC 1UU5A 1WMFA 2WIIB 4M00A 4I0WB 3VBRC 2QUOA 1LJ7A 1SLAA 4KGQA 1LESA 1G86A 2QFEA 3AP9A 4KBBA 4IETA 4YLZA 3V56A 4E4ZA 1V6NA 1PNFA 3KT1A 4XQWA 4PLNA 2R071 1IKQA 5L7OA 3HWJA 1YLLA 5JZGB 4CDWB 2WFF1 1W6PA 4ZU7A 4GXLA 5A3LA 2LTNA 3CJXA 4XJZA 1QJX3 4LLFA 3HN1A 1O91A 1RUJ1 4OI2A 4WVVA 3NKGA 2HWB1 4MXVA 4IV3C 5E1RA 1RGSA 1C8M1 1KD7A 2QVSB 2DVBA 3THPA 5FO7B 3H8UA 3U10A 4JGZB 2D6MA 4G4FA 3KGLA 4LT5A 5EFUA 1IHMA 3ZSEA 5C8WA 2GH2A 4XJ8A 5EV7A 3M8LA 4PBOA 1QU0A 2IFWA 4LHKA 4F7ZA 5BNOA 4TYSA 2PA7A 2GZWA 1CPNA 4GKXA 4WVMB 4XF9A 2WLPA 1XU2A 3AMMA 3QBQA 2ZCWA 1QDCA 3D0JA 1X82A 3M3IA 2R073 1WBFA 4FOWA 1UL9A 2BWCA 4HN0A 1JYIA 3WDTA 1LRHA 3D4KA 4PJYA 3WG3A 2WNEA 3ILRA 1TQ5A 3K48A 2ES3A 5BNNB 3ZPYA 3KSCA 3ZN5A 1R091 1WCSA 1V6MA 1VBB2 1JUHA 1C3HA 2XJUA 4AGRA 3KZ4C 1AL21 1EV11 2WWSA 4L11A 2RM22 4IV3B 5L36A 1YJLA 2B7YA 5L73A 3AB0A 3WINE 4EJRA 3ZXLA 5AC93 1UKGA 3O0VA 1O7FA 4NN0A 4HPKA 1SFYA 1Z7S2 3VKOA 3R4UA 1Y3TA 1TMF1 1N3QA 1VBE3 3J8F2 3WD5A 4R9BA 1FNZA 4OI4A 3DL3A 5H9SA 5GLVA 4AFDA 5CFCC 2HWF1 5CG8A 2XBO2 4LO6B 4HVRA 3HQXA 2YPJA 2ZGLA 4RD7A 4I02A 1G9BA 4OFGA 3ATGA 1PVC2 1AJKA 3AKTA 1N47A 1AR81 2P2KA 1NCQA 4JCKA 1TNRA 2B5HA 4LUKA 4FQZA 4OHYA 5DG1A 4Q4X1 3N7JA 2NZ9A 2PLV1 4WVZA 4ASMB 2D5HA 4AI2A 1QJZA 1HXS2 1W6MA 4C91A 4NOTA 2ZPXA 2ENRA 2HWE2 3RPQA 3MIDA 1GNZA 1WUVA 4KGGA 5D8AC 1FNYA 2GC3A 4K1ZA 4D3WA 4Q8KA 2WA4A 2Q30A 4AEDB 3NL1A 5HCAA 2XJPA 3VKMA 3ZFFC 4RS5C 4YM1A 1NCRC 1YFWA 4HETA 1W6QA 5T5LA 5HXVA 1KDKA 3V0AA 4LHLA 1JHNA 3SCFA 4YZ1A 3QCWA 3LGRA 3N7KA 5T50A 2A3XA 2D6KA 3UJQA 2YUEA 4KH9A 1BMV2 3GNEA 1Q3EA 5CFCB 1TME2 3ZYPA 1VRH2 1REDA 4JRLA 2YGMA 1J59A 4QM9A 4EWAA 1UX6A 3JD73 1QJY1 2MNGA 4R52A 1RUG2 1X50A 1MR5A 3MIHA 1PGL1 2IXCA 2ARXA 1OD5A 2DU1A 4GWMA 2R1DA 3SHRA 3ZXKA 3R6SA 2ZX1A 2QCSB 4XFAA 5D8AB 3MFCA 5EWSA 3KMHA 4H3WA 4XF1A 2WQ4A 4L99A 4UW3A 3VZJA 1SLCA 4RS5B 3ROUA 1NCRB 3SCGA 3NV3A 3WW1A 1REFA 3LSEA 4FTEA 2ATFA 4M3CA 1EAH3 1VBB1 2D44A 2NM1A 1OPOA 1SFNA 3VBUC 1L3JA 4AGGA 1WMDA 2R063 4N7IA 1MACA 1N1YA 2OUJA 2ZTNA 4HFSA 1AX2A 2ZGRA 4EWEA 1VBC2 4PDWC 2IXLA 3DPRC 4QPIB 2NMNA 2NMOA 1TNFA 1PHMA 4R8HA 1COV3 1N1TA 1A78A 1LTEA 2B42B 5KXCA 2D3PA 2YHJA 1BVP1 1HV1A 2NLRA 2YZ4A 5IK7A 2D3SA 4XJAA 1UW8A 2Z5WA 2XBO1 4GWNA 3MIBA 1PO12 5I8TA 2XVKA 4Y1YA 4COWA 1VB2A 4Q27A 1PVC1 2VVFA 4DQAA 3E97A 5FFOC 3LSDA 2EALA 1JN2P 2I45A 2D40A 3VKFC 4AI0A 3KGZA 4XTMA 2XL7A 3B01A 2R6QA 3ZMOA 4WZCA 2I74A 4IQPA 2O8QA 5SV5A 2HWE1 4HT1T 3VBUB 3LOIA 3ZXDA 4FPKA 4JDMA 4DFSA 3HMYA 2ZX0A 4IEVA 2EVXA 3FFQA 4PDWB 3JCIA 1QNYA 3VBFC 4AVCA 2JE7A 3B7MA 4MUVA 1QGLA 4GKYA 2PHDA 2ERFA 5CNAA 3OBRA 3E5UA 3ZFGA 4UW6A 3FE5A 2R043 3WR0A 1ENXA 2WNUC 1VRH1 4Q4W1 4PF5A 3LA7A 5EJ3A 2ZGOA 1RUE3 2JXAA 1NA1A 1RHI2 3WX5A 3WOGA 3AK0A 2Y0OA 4F83A 1FT9A 2DFBA 4DY5A 5K8SA 3B93A 3H0OA 5FAXA 1KS4A 4XQ4A 4I3GA 4HLTA 4CDQC 3VUOA 2C9AA 3IDEA 4XZPA 1ENRA 2DU0A 1B35A 1YJKA 4LO5B 1DQ6A 3IIAA 2BNOA 3B02A 4PIYA 3U4XA 3EQEA 4AVVA 4Q1RA 1ND3C 4E4SA 3WLUA 4AHZA 1CR7A 3GHMA 3WDYA 1C8NA 3ZSMA 1QXRA 4Y22A 4QGLA 1U5YA 1ZNPA 2BFUL 2GU9A 4RFT0 2P3JA 2A7AA 4I0AA 3VBFB 1IS3A 1TE1B 3S7IA 1Q8SA 3R0RA 2BNMA 3GF6A 2VH9A 1MS5A 4AF9A 2A73B 1ZZ7A 1IOAA 2X5IC 3RG0A 1BEV1 3LKJA 1CAWA 5FMOS 2WNUB 3M70A 3WG1A 2WSUA 1UPIA 2GALA 4HVQA 3MW3A 4FPOB 4Q0UA 1RJ7A 1HRI2 4TSVA 1XE7A 2V09A 2WKKA 1ULDA 5JAXA 1R1A2 2I2SA 4FAHA 4WBBA 2VOXA 4HL0A 4XILA 4META 4Q1PA 1IS4A 4OZXA 2XB6C 1ND3B 3HBZA 1S0IA 2VNOA 3N7LA 1BQPA 1BBT1 1S0FA 2UWAA 5FQ0B 3BTAA 4CDUA 5HCFA 3J4UH 1F31A 4WM8A 3USSA 2DF7A 4AVSA 1I6XA 5JSRA 2GN3A 1BEV3 2WS93 1XNDA 1PM7A 3CJIC 4N43A 3MF6A 1WBLA 5GLZA 5E89A 4NWWA 1N1SA 3AYAA 2XPJA 2B8MA 2IXKA 5BNPC 3KQRA 1RUC3 2C5DA 1SCSA 2XGXA 3A4UA 1QOTA 2GNMA 1PZ7A 1WW7A 2ZS6B 4FPEA 3S6PA 3I4IA 1ZRFA 5C8CC 1DFQA 5AVAA 3O12A 4OI1A 4UBHA 4RQPB 4HN1A 3I59A 3CO2A 3NV4A 5FLJA 4FTBA 4BOWA 2ZGUA 3SNMA 4HVOA 4JV4A 3NV1A 1UMZA 5J37A 2ARBA 4NVPA 4A7YA 2GMEA 1BBT3 3N36A 3PVEA 4P9XA 3WCRA 3WDXA 3U0ZA 1IZ3A 2VUAA 4H14A 4H7LA 4U36A 4E2GA 3OBTA 4FO9A 3WW4A 4FXKB 4FCAA 1KFUL 2D43A 4XHBA 3ZSLA 4CZSA 1NY71 5DDJ2 3OYWB 1NZCA 2MEV3 2C1FA 5AFBA 3GBFA 1VJ2A 3VBOA 1ASJ2 4Y1VA 1MQTA 1DQ5A 1QJU1 4JGYC 1UU4A 3JBG3 1AYM1 2DTYA 4KL1A 4YGDA 2R16A 4OHZA 4B4PA 5BNPB 1AR62 4LBOA 2OUHA 2ZGTA 3L2YA 4YG0A 3NAPC 1V6OA 4U2AA 2A3YA 2ZACA 4AEKA 3AX4A 5T5OA 4I3PA 3AP5A 1RMU2 1OOPA 4Q29A 3SCHA 5C8CB 2Z42A 2NQYA 2H6BA 1DZQA 2E7QA 3O0XA 2D6NA 2DCKA 1PO23 4YVSC 3RNSA 4YGBA 5A32B 1FMD1 3D6EA 4Y1UA 2ZMNA 3AJZA 4S2DA 2JE9A 3CNAA 4OHXA 1FPN1 1W6NA 4P9YA 2FHRA 5EYXA 2ZMLA 5C4WA 5GZCA 1F5FA 3D5OA 3JZVA 3KD4A 1C28A 3ZIWA 4M3CE 3W9AA 1B09A 1WLWA 1QHDA 3BALA 2R0HA 2A71A 2D6PA 1DZTA 4YW1A 3ZXFA 3EO6A 1QJX2 1V9U1 3G6JB 4AWDA 1VBA3 1MVQA 1AYM3 1GQHA 1AR91 1SQ4A 4GIQA 2YGLA 2Z2SB 1TEIA 4ONUA 4AHXA 4L9BA 4JGYB 1YHFA 1PK6A 1XE8A 1WW4A 2AYHA 2CWMA 1RUD1 1C5IA 2VG9A 3HAGA 1V6JA 5C6CA 2A6WA 3NAPB 1LOFC 5J7MA 2H0BA 3PMSA 1CN1A 1O3RA 1EY2A 2YC0A 3VL9A 3AZWA 3MI8A 3ASIA 5LK7B 4YVSB 4JTNA 2XWJB 1DG6A 4BPZA 4YSFA 1RVF2 1CJPA 1DYKA 2WZR3 5K0UA 4XE9A 3RQ0A 4DXZA 2CYFA 5GZFA 2HWC2 5LK5A 5FOBB 1PNGA 1MS1A 2BQPA 4LHNA 2RS53 1AXYA 3AYDA 1VAVA 1ZBA3 2AENA 3GZUC 5JVVA 4CEYA 4X8NA