1R081

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 44
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1r08100
4NWWA 1R1A1 3VBOB 2RMU2 1COV2 3VBFA 2RM21 4AEDC 1EAH3 1ZBE1 4AEDB 3ZFEC 3J8F3 1NG0A 1B35A 1NY72 1BBT2 1C8M1 3ZFEB 1NCQC 5ACA1 1NCQB 1VBE3 3S6PA 4JGZA 1AYM2 2PLV1 1AR92 4CDWC 4GB33 4CDWB 1AR62 3ZXAC 1PVC1 1VBD2 1VRH2 3NAPA 2HWF3 3DPRC 2FZ2A 3JD72 3TN92 4CDUC 4N53C 3LOBA 1WCDJ 3DPRB 1D4M2 5JZGA 4CDUB 4CDXC 4N53B 4Y4YA 4Q4Y1 5AC93 1PO23 1VBA1 4QPGC 4CDXB 3ZFFA 5CFCC 1BEV2 4CDQA 4FTSA 2WWSA 4QPGB 5CFCB 1VBB3 5CFDC 1FPN1 5C9AC 1VBC3 2RS32 1R1A3 1ND3A 5C9AB 5CFDB 1POV1 1RUF1 2RM23 1HXS1 1PO11 1NOVA 1ZBE3 1VB2A 3VBUC 4WM7C 3VBRC 2BPA2 2XBO2 1RUJ2 1CJDA 2VQ0A 1QJZA 3VBUB 2RS12 4IV3A 1C8M3 4WM7B 3VBRB 5A33B 2RMU1 5ACA3 2HWD2 3ZFEA 1AL21 1HQNA 2R062 5BNPC 5C4WC 1MEC2 1NCQA 2PLV3 5BNPB 5C4WB 1RB8G 4QPIC 4RQPA 1BBT1 1RUC2 4JGYC 1QJU2 4QPIB 1NA1A 1PVC3 1VAKA 4JGYB 4GH4C 1RVF2 1ZBA2 2HWE1 4GH4B 5ABJC 3FBMA 2X5IA 1AYM1 1AR91 2HWC2 1DDLA 5ABJB 1QQP2 1ASJ1 4Q4Y3 1OPOA 1AR61 3DPRA 1X36A 1RUG2 4CDUA 4N53A 1VBD1 1VRH1 4Q4W2 3M8LA 5J98B 2WZR2 4Q4V2 1FPN3 3JD71 3TN91 5BNOC 2IZWA 4QPGA 5CFCA 5BNOB 1POV3 1RUF3 1AL0G 4YVWC 1HXS3 2BFUS 5CFDA 5C9AA 1PO13 4YVWB 2ZAHA 1BEV1 1PIV2 5J96B 5D8AC 1FMD2 1QJY2 1RUH2 2RS52 2RS31 5D8AB 2RMU3 4FTEA 2XPJA 3VBUA 4WM7A 5A33A 3VBRA 4SBVA 3JB8A 1FOD2 1AL23 2ZTNA 1R092 1RUJ1 4EJRA 1POV0 1R082 1BBT3 5BNPA 1AUYA 5C4WA 2HWD1 1EAH2 2WS92 2ZZQA 1RUI2 5L7OC 2HWE3 3JB4C 1C8NA 5L7OB 1MEC1 1AYM3 1AR93 1PGW2 1ASJ3 1RUC1 4GH4A 1RMU2 4WM8C 1AR63 5ABJA 2HWB1 4CEYC 5FMOS 1RVF1 4WM8B 1ZBA1 1VBD3 1VRH3 2DF7A 4CEYB 1TME2 2GSYA 4PDWC 3JD73 3TN93 2HWC1 4PDWB 1HRV2 4FTBA 1F2NA 1QQP1 5K0UC 1MQTA 3IDEA 5K0UB 1BEV3 5DDJ2 4Q4W1 4Y5Z0 2WZR1 4Q4V1 1QJX2 4YVWA 4LLFA 4YVSC 2RS33 5AC92 2BUKA 2RR12 3VBOA 1HX6A 1AR72 4YVSB 1H8TC 4RS5C 1RHI2 2BFUL 1HRI2 5D8AA 4GMP1 1TMF2 1H8TB 4RS5B 1VB4A 1PIV1 1BMV2 1RUD2 1SMVA 4AEDA 1VBC2 1FMD1 1X33A 1QJY1 1RUJ3 1RUH1 1IHMA 1GFF2 1COV1 1V9U2 2RS51 1AYN2 3VBHC 2HWD3 1EV12 3VBHB 3VBFC 1FOD1 3JBG2 1R091 1NY71 1MEC3 3VBFB 2TBVA 4RHV2 2WLPA 2R042 1R081 2Y26A 1RUC3 3ZFGC 5ACA2 5L7OA 4Q4X2 4CDWA 1B35C 3ZFGB 2HWB3 2WS91 5LK7B 1RUI1 1CD3G 1RVF3 1B35B 1ZBA3 2PLV2 1PGW1 2HWC3 1PGL2 1OOPC 1QQP3 1RMU1 1OOPB 4PDWA 1Z7S2 2WFF2 5FMOL 4CDXA 2R072 1NCRC 4CEWC 4Q4W3 1TME1 2WZR3 4Q4V3 1NCRB 1D4M1 4CEWB 1HRV1 1VBA2 5GKAC 1AR82 5JZGC 4GMP3 3CJIC 2BBVA 4YVSA 3VBSC 1PIV3 5DDJ1 5JZGB 1RUE2 3VDDC 3CJIB 1QJX1 3VBSB 1FMD3 1H8TA 1QJY3 4RS5A 1RUH3 3VDDB 1COV3 1OHFA 2RS53 2RR11 2FZ1A 1RHI1 1HRI1 1ND3C 2MEV2 4Z92B 1TMF1 1FOD3 2XBO1 1ND3B 1BMV1 1RUD1 1R093 3VBHA 2RS11 4RFT0 1R083 1V9U1 1W39A 1AYN1 1ND2C 4GMP0 2R061 4IV3C 4QPIA 2WS93 1EV11 1RUI3 1AL22 1ND2B 3J8F2 4JGYA 4IV3B 3ZFGA 3JBG1 4RHV1 4FSJA 1QJU1 2R041 4Q4X1 1VBE2 1RMU3 4RQPC 2HWE2 4N43C 4RQPB 1NA1C 1OOPA 1TME3 4GB32 4N43B 1D4M3 1NA1B 1ASJ2 1PGL1 1HRV3 5C8CC 1NCRA 1RUG1 2X5IC 4CEWA 5BNOA 2HWF2 5C8CB 4IV1C 1A6CA 1Z7S1 2WFF1 2X5IB 5BNNC 2R071 4IV1B 5DDJ3 5BNNB 1QJX3 1PO22 5A32B 3CJIA 2RR13 3VBSA 1AR73 1AR81 3VDDA 1RHI3 1HRI3 1VBB2 1K5MC 1TMF3 2XBO3 1R1A2 1RUD3 1RUE1 1K5MB 2RS13 4RR3C 2RM22 1V9U3 1AYN3 4RR3B 1ZBE2 2R063 1EV13 2MEV1 1C8M2 3JBG3 1ND2A 4RHV3 1QJU3 2R043 2GH8A 2QQPA 1EAH1 4Q4X3 3J8F1 1M06G 4BCUA 4WM8A 4CEYA 4JGZC 4JGZB 1PVC2 4N43A 1RUG3 1VBE1 2HWB2 3HAGA 1Z7S3 2WFF3 2R073 5K0UA 5C8CA 3NAPC 4GB31 4Q4Y2 1F8VA 3NAPB 4IV1A 5BNNA 1VBA3 5A32A 1AR83 2HWF1 1FPN2 3ZFFC 4NWVA 4CDQC 1MQTC 3ZFFB 1RUE3 5AC91 4CDQB 1MQTB 1RUF2 1E57A 1AR71 1PO21 1HXS2 1PO12 1K5MA 5FOJB 1VBB1 3VBOC 2MEV3 4RR3A 1VBC1
chains in the Genus database with same CATH superfamily
1JU4A 4NWWA 4GWIA 3VBOB 2QQOA 5GLTA 3E97A 4E4DX 1COV2 3T1MA 4JQTA 5C6CA 5IHRA 4DEVA 1C5IA 1EAH3 4XJAA 1H1IA 3WG1A 1CN1A 4LHLA 3AKRA 1ZX5A 3PTRB 1STMA 1REFA 1IS5A 1WKYA 4QDSA 3JU9A 5FLJA 1E5RA 1NG0A 1S0IA 4LBMA 5FP3A 5T54A 1C8M1 4XJWA 3G7DA 1JU3A 1QH6A 3ZFEB 3BIEA 1S55A 2WNOA 1HQLA 2ET7A 1NCQC 2K46A 2QBXA 1OFSA 2YGMA 2HBUA 5ACA1 3PUAA 5BNPC 4DO0A 4S2DA 1I5PA 4FP3A 4MLOA 5FYTA 3KV6A 4RSUA 3ROUA 2B42B 3V0BA 3O0WA 1EUUA 4MZUA 4AF9A 3LFIA 3ZR6A 5LWBA 1AYM2 2PLV1 1NXD1 3ZOIA 1GP4A 2EIEA 3O1MA 4ASKA 2JKBA 3RS6A 3MYXA 2VZTA 3H1YA 2VM9A 3ACLA 3IZOA 4CDWB 4UFLA 5GZGA 4G3YC 2XVLA 3H8UA 4AHZA 4NPRA 3K46A 1VBD2 1X8MA 3NWKA 4R4ZA 2B45X 3UESA 4SLIA 1YQ6A 5CEHA 2HWF3 3FHIB 3LFMA 1RYYA 4OMCA 4AWDA 1OI6A 1W8HA 3H8OA 4CDUC 1DQ2A 3U4XA 2FZ2A 2VZ3A 4Y22B 4MHUA 3DECA 2ZMNA 1W9SA 2DUQA 5GALA 4LO8A 3SH5A 4FOYA 2KR2A 2AENA 4CDXB 2OW4A 4XMAA 1REDA 5FMBA 3OBRA 3WDTA 1FPN1 5JI7A 1E5IA 4GZ9A 1QU0A 1M4WA 3BB6A 2O8OA 2HJIA 5CFDB 3AYDA 3MIEA 2I07B 2JJ6A 3Q8CA 1IKPA 1POV1 1VALA 1Z0HA 2A6ZA 1RUF1 4OHXA 1YQCA 3OB8A 3WX5A 1HXS1 1UKGA 3O7OA 4KBZA 4CXXA 1VB2A 5CZKA 5FY7A 5ISLA 2ZMKA 2WC2A 2PHLA 3NKGA 2XQXA 5C3SA 3VBUC 3LEMA 3R0RA 4WM7C 1KJRA 5T5LA 1AX0A 3UK9A 1K12A 4QAWA 1CJDA 2E63A 4HBNA 4UAPA 2RS12 4FP2A 2HLEA 2D43A 3VBRB 3WUDA 2Z5WA 2WQ8A 2DCTA 2RMU1 4OLLA 1G86A 2RDNA 3O1SA 1OD3A 1JYXA 4IGOA 1H6YA 3O0XA 2JE9A 3ZFEA 4E8DA 4BLIA 4YM0A 1HDKA 3CZUA 3WQBA 3ZXEA 1HQNA 2XJRA 3KGZA 5A70A 5JWPA 3WCRA 3EHKA 3B94A 2V5YA 3JXSA 5GLZA 1YRZA 3A0NA 4A7ZA 2E31A 1GANA 2P17A 3O1UA 5LA9A 3VN4A 1SACA 2VNVA 3RMXA 4Q0VA 5C4WB 4FVVA 1KGYA 1UZ0A 4NIIA 1MS9A 2YZ4A 4JC1A 4A7YA 2PQQA 1VRBA 4XF4A 1PVC3 2P1BA 4B4RA 5B4NA 3ELNA 4IE6A 2KA3A 1RVF2 4JGYB 2BTVC 1N3OA 4O9EA 4S2GA 4LBQA 2NMOA 1G8WA 1IPJA 3ATGA 4XIOA 1NE6A 3FBMA 4QPWA 1SCRA 4BYYA 1Q8OA 1H1MA 1UQXA 3QBQA 4AVBA 3GCWA 4DY3A 4FPOB 3IIAA 1AR61 4ASLA 1W8UA 4Y22A 2OZJA 4AI1A 1GBGA 4ET7A 2ZGMA 3ES1A 3TYJA 4WVMB 4XFAA 4FAGA 5J98B 2VBBA 4FCAA 4A6SA 1J3RA 3AKTA 1XOYA 3JD71 3TN91 2Z69A 2D3RA 1GICA 2P5BA 3HT1A 3GM8A 3MV01 4ZU7A 2Q5TA 3U14A 2WYFA 4YVWC 2GZWA 1UOBA 2W1WA 1Y9MA 5DUWA 5CFDA 2WLQA 5F5AA 3SKJE 4TLFA 2ZAHA 4C8DA 1W8TA 2ZX3A 5FZ9A 3TEXA 1UIKA 4V1PA 1ULFA 3AM2A 4WVZA 4Y1ZA 5D8AC 1Y9QA 4BXFA 2CWMA 3NJVA 1BJQA 3N36A 4QPYA 2RS52 5JOZA 3WUCA 2MHFA 2I2SA 2ZCWA 2XPJA 4DXZA 4QQLA 2VJXA 1PMHX 3PHMA 3VBRA 1SCSA 5FZBA 1FOD2 4AI2A 4HVOA 1UMHA 3MIGA 4M3CE 1R092 2VUCA 5FREA 4AVTA 5FPUA 5J36A 2D5FA 3C7OA 1UZVA 2JG8C 4IEYA 3PL0A 3Q9OA 1J84A 1BBT3 4IGPA 4OI1A 1KDMA 2QZ3A 1ZA7A 2JENA 1AUYA 3POEA 2I74A 2HWD1 2ZZQA 3M7AA 5C4WA 1BLZA 5HPOA 1F9KA 1V6JA 3HQXA 5FZMA 3WQ0A 5F7UA 3W21A 1C8NA 2BBAA 1W9WA 3KZ4C 5L7OB 4DS0A 1UW8A 3J7NA 5FZGA 4L11A 5IFPA 1LCLA 2O1QA 4FQZA 5J1XA 3VD9A 2XR4A 3GBWA 2ZGSA 1O4YA 2C0ZA 3NJYA 1UYPA 1S1AA 2OYZA 1ZBA1 4XFCA 1VRH3 2YGLA 4KWKA 1TME2 4M00A 2GSYA 2WN3A 4PDWC 4BIFA 4WVMA 2BJSA 2EXIA 3KT4A 1FNZA 2K9ZA 4Q0PA 3ZMNA 4LUMA 4GA9A 3VZOA 4CCNA 3ON7A 4IE5A 1GNHA 1XQNA 5FYBA 5K7PA 5FFOC 3RMYA 5FOBB 3OPZA 2V4VA 4JRAA 4NHMA 4MGZE 5L73A 1BEV3 2VBDA 1I5ZA 3ES4A 4Q4W1 3SQOA 3HQUA 1T6GC 4I01A 3AFKA 2WZR1 4KWUA 2B5HA 4YZ1A 3NNFA 5JXHA 4PCRA 4LLFA 4AI9A 3D0JA 5D2AA 1QHDA 3HT2A 5HV4A 4Q1RA 1HX6A 4YZ3A 1H8TC 1SEFA 2EXHA 3M3QA 2J1SA 2FDKA 4CCLA 1K42A 1A78A 3LA2A 4K1ZA 1TMF2 4LEJA 5F5CA 5H9QA 3ZYIB 4JKMA 1ENSA 5A1LA 3MDPA 1RUD2 3V0AB 2ZAAA 3PJYA 1YQ5A 4INDA 1VBC2 3POSA 4JZRA 2QZ2A 1FMD1 1X33A 4CCOA 4B7EA 1C4RA 1NZCA 3BU0A 2W87A 2VZVA 3KQRA 3KSCA 5A7WB 5A6XA 2VGDA 3VZLA 2DURA 4BXSV 2W52A 4YGEA 1XNKA 3LB9A 3U78A 3VBFC 2G1MA 5CA6A 5KXBA 4XJZA 5H9RA 5BXXA 2VMIA 4E2SA 2XHKA 1US3A 2R042 2WLPA 4JRLA 2Y34A 4YLZA 2EALA 1RUC3 3LPGA 3ZYPA 4E2QA 5L7OA 3LSDA 5A7OA 2W91A 3THTA 4QKBA 3BIWE 1OKOA 5FQ0B 2HWB3 3HIFA 1OBNA 4K8FA 5IK7A 5LK5A 1CX1A 5LBEA 4LORA 1N3PA 2Y0OA 3M3EA 5FYZA 5EYYA 1UX6A 3IM0A 4WZCA 1UF2C 5H9PA 1GOFA 4MXWA 2FMDA 2NM1A 3HNYM 1OOPB 3AZYA 3GHNA 4P02B 2WFF2 5FZKA 4B3NA 5FWJA 5JXIA 5A7NA 2YBKA 5FY9A 3VHRA 3W59A 1G9CA 4MH0E 2HEYF 2ZX0A 3MW4A 5C3OA 4HSLA 3Q8EA 4FPGA 4Q4V3 1NCRB 1NQDA 2F6BA 4CEWB 3K4DA 3MLJA 1D7PM 2ZGRA 3UGHA 4OI0A 1GZTA 1MVQA 4D69A 3S5AA 1GR3A 4HVRA 4NAOA 3RYKA 3CQOA 4NRPA 4GMP3 4WZFA 3AYCA 4W6WA 2DTWA 2MPFA 5APAA 5JZGB 1RUE2 1APNA 3VDDC 1QJX1 4AAPA 4YWAA 2A3XA 1QJY3 1RUH3 4J1XA 1CAWB 5EIYB 1COV3 2WA3A 4AVSA 3V0AA 2RJLA 4AXOA 3ECQA 2G19A 3MF6A 2VTFA 1DLLA 1RHI1 4X6QB 1HRI1 1ND3C 3W5NA 1OSGA 3JCIA 4Z92B 4NIGA 1SDDB 2JD9A 3BODA 1KS4A 1UPIA 4IW3A 3BPSA 5A7WA 4CU6A 5J3UA 1JUIA 4XYXA 2A5ZA 4GALA 1L3JA 2VH9A 2X8KA 5IATA 1R083 1W9YA 1IS6A 1CJPA 5KXEA 1AYN1 3TAYA 4PLMA 1ND2C 4RGKA 4IV3C 2C1FA 2WS93 1Y7BA 3D3AA 3C7EA 3FWEA 1RUI3 4KGQA 1AL22 2W47A 2VZPA 4DRVA 4PBPA 1TEIA 4OQ8A 5SV5A 1XSRA 5FQ0A 3JBG1 5FMCA 5LRRA 5JCTA 1PNGA 1QJU1 3N9OA 3QH6A 4MHRA 1JZ2A 1V00A 2W9XA 2YMZA 1Q3EA 4JQRA 2EF6A 3T2QA 1RMU3 4RQPC 2E51A 3K51A 2HWE2 4N43C 1JHNA 1OVSA 4NRMA 1LHWA 4OHZA 1LEDA 4JKKA 1WMFA 1OOPA 4MSVA 4PIXA 5KC5A 1V6MA 3DCQA 3F95A 1OLMA 4LBJA 3WCSA 2K2SA 4UT5A 3AL6A 1ASJ2 1GOHA 2ZA9A 4CU8A 2QVSB 1HRV3 1PK6C 3VHNA 1NCRA 1U5XA 1F5FA 3ME2A 4AI3A 4AVVA 4CEWA 2HWF2 1S0DA 3WQ7A 5I0DA 2R071 1OXCA 3SH3A 4ATFA 2A71A 5DDJ3 1BXHA 2A73B 5FY8A 3HN3A 5IVCA 2RJ2A 4XACA 5EYXA 2RDQA 1VAVA 2E53A 3H0OA 4IUGA 1PX3A 4LQRA 1O3SA 3H3LA 2VZRA 3KHBA 3JUUA 1C1FA 4XJUA 3CZJA 5F3IA 1DGLA 1UZYA 1WMEA 2DCJA 3I97A 2XB6C 2WNVC 3UGFA 5HCAA 4DXSA 2EICA 3GZEA 3FFQA 1HN1A 2RS13 2ZABA 4I0WB 5FWEA 4XZPA 3H1WA 5DG1A 2YG0A 2X05A 1Q43A 1W9FA 1JZ8A 4FFIA 5FPAA 4A3XA 5BY5A 2SLIA 2OIIA 1EV13 2MEV1 2VUJA 2XDVA 4LE4A 4Q5OA 2FCVA 3MGUA 1NQJA 2Z79A 1DBNA 3INAA 1S0JA 2XWBB 4XF9A 1IG3A 2NQYA 4HONA 3MPBA 5E8AA 4A42A 4ZZ5A 1X50A 3POGA 4QHBA 4RHV3 5FZ8A 1SLAA 3ZSKA 5C5TA 2XKPA 1A3KA 3GZUC 2FDFA 5G04L 3PVOA 4Q4X3 1QXPA 4B1LA 2XLFA 4CSWA 3K3OA 1MS0A 5GM0A 1RJ7A 2VQAA 1BQPA 4AEJA 3M2MA 3WF2A 1XNCA 4BCUA 4XETA 3K4AA 4Q26A 2VNOA 5T5OA 3B01A 1PVC2 2Y0IA 1NKGA 4QX7A 1FV3A 2A3YA 3T4HB 4I0BA 4EWDA 1VBE1 4LO5B 1AXZA 4AW7A 1MS5A 3HEIA 3OD0A 5EJ1B 4META 1BZWA 4HT1T 1GQGA 4JV4A 5LW9A 4DB5A 3B93A 3G6JB 4U2AA 2EIGA 2RV9A 3HPNA 4RN5A 4X8PA 1MZEA 3CJXA 1W2NA 1NT0A 1O4ZA 5FDBA 4QGMA 5FIXA 1W6OB 1AR83 1A8DA 2Z2SB 5FYMA 5D1IA 3E6BA 3KV9A 3KT7A 1OLQA 4NPLA 4HKOA 1UXXX 2R30A 4AQTA 1H9WA 2CWSA 4BQ3A 3GZTB 3Q8BA 4CDQB 1VP6A 1E57A 2P3IA 4LK6A 4LIVA 1AR71 2B8MA 3C3VA 4YW7A 5SV8A 2PHFA 4LOSA 2GDFA 3K48A 4YGCA 2RHPA 2VZ1A 1L7RA 1UKRA 1VBB1 3A0KA 4LULA 4QKNA 5BPXA 3VBOC 5BNQA 5LY1A 4NIDA 2VL4A 2WRAA 5L9BA 5EJ3A 5DAVA 1R1A1 5LBCA 4DMIA 1ZA4A 3AP4A 2RDSA 4BQXA 1U5YA 3VBFA 5GJ6A 2RM21 3UKNA 5JPMB 1ZBE1 5DUVA 2BGPA 1RXFA 5A3MA 5FP9A 2QQVA 4AEDB 1D4VB 3BVCA 4LBQD 3ZFEC 3J8F3 5CKMA 1BBT2 2VVEA 3DN7A 4G4FA 4ARYA 4CTEA 2A6YA 2W0XA 3QLQA 4D6SA 4QXCA 4HG6B 3AB0A 1MACA 2XJTA 4AQSA 2I45A 3MIFA 4TWTA 3GCXA 2R16A 3HMYA 5ANQA 3RZGA 5F37A 5C3RA 4QU1A 1JYIA 3D5OA 4MOAA 1SG3A 3CKHA 4CDWC 2YROA 1UZWA 1UPSA 4GB33 2J1TA 3IPVB 4Q29A 4R9DA 3OF1A 2VCCA 4XBLA 3UGGA 3WT3A 4A7KA 1H2MA 3L2HA 2PMWB 1FATA 1VRH2 4COYA 3AZZA 4AL9A 2B46X 4FFGA 3DXUA 2P6HA 4TYSA 3WP3A 3LOBA 1UYYA 1WCDJ 3DPRB 3N9QA 2CGNA 1YYNA 2GC2A 2VZQA 4LHNA 5GZFA 1W05A 1W8WA 4N53B 4CDXC 4JAAA 4XF0A 2E7QA 3PIGA 1DFQA 3VHOA 1VBA1 4XQWA 1QIQA 1FXZA 2H0BA 3GNEA 4OI4A 3U1XA 5LBFA 1BEV2 1JBCA 2GMMA 3HNBM 4FPLA 4CDQA 4Y1YA 4QPGB 5JIAA 4XFBA 4BWOA 4GD4A 4V2VA 3SCGA 5CFCB 5CFDC 3VDAA 1VBC3 3DGTA 4KBBA 4YM1A 3ENRA 3I2OA 3RZHA 1ND3A 3F2ZA 2R6QA 3H7JA 1PO11 2JD4A 3PTYA 1NOVA 1TE1B 2BZDA 2TEPA 1HQWA 3N7KA 4UW4A 4LJHA 1H8VA 2JB4A 2EIDA 2JXAA 5DXDA 2ZGTA 5CG9A 1JYNA 2D93A 1HJFA 3KMHA 3VBRC 4XABA 3PVBB 4EQVA 4E8CA 1QJZA 5KHIA 1AJOA 2Q8CA 4IV3A 3T3YA 2W5FA 5FO8B 4RYDA 4HSJA 1JUHA 3WEZA 4CP1A 5FPVA 2R49A 1EP0A 1W6NA 1CPNA 3NL1A 5T5PA 5DAWA 4TN7A 1TVGA 4QKDA 1AHSA 1DGWX 1Q56A 2WZPP 2IXLA 4AEKA 4CCJA 3A23A 3ILNA 5I91A 4UFHA 5C4WC 2ARXA 1XNAA 4R52A 3O1PA 3K75B 3MUY1 5I0RA 1TNRA 4Y1XA 1CWPA 2EAKA 1W3VA 2N7GA 2ZZJA 4RQPA 5FZOB 1RUC2 2OKXA 3I8TA 1W99A 4JGYC 3CIHA 4QPIB 1IPKA 2W39A 2YU1A 1ALYA 1LOEA 1VAKA 3IPVA 2XUMA 2ADEA 2QQWA 3LEGA 2AGSA 3SNMA 2ZHKA 4GH4B 5CKNA 1UWWA 2A7AA 3UKVA 4CCKA 1AYM1 3P6BA 4O61A 4BMEA 3RVHA 4XW3A 1GQHA 4UW6A 4W4ZA 2PHXA 1W90A 3AJYA 4Q4Y3 4XHXA 4EWEA 1WLTA 3H1MA 2J1RA 3DPRA 1C3HA 4ARXA 1O3QA 3ZKYA 5FKBA 1GU3A 2JIJA 3ASIA 4AOCA 4N53A 3TEZA 4TTGA 1VBD1 5FXWA 1HV0A 2J7MA 2A1XA 2JDNA 3GHMA 3NV4A 3T0AA 2Q1MA 3HVDA 3GGLA 4Q4V2 3VKMA 3OGJA 1FYUA 1SPPB 5I8TA 3C8XA 4RL7A 4QPGA 2F4LA 3U10A 2GMPA 4Q0QA 1V6OA 3FL7A 5CFCA 1G9BA 4HVQA 5BNOB 2BNMA 3VUOA 2XJUA 4FAHA 3E6CC 4YG0A 1F5JA 4IEVA 1LU1A 2QE3A 3C7HA 5GZDA 3VLBB 5FUPA 1JYWA 4XFGA 3IAQA 3GXUA 4TLGA 1YQ2A 1QJY2 1OH4A 1RUH2 3UETA 4NVPA 3P3PA 4P5YA 2P4EA 4D6RA 1ULOA 2YYOA 1J58A 2E7AA 5T52A 5CB7A 4FTEA 4XDQA 4BE3A 1W8ZA 2JDAA 2ZHNA 2VW0A 3CNAA 4SBVA 4MX3A 1AL23 4TXWA 1XE8A 2VCMA 2XG3A 4Y5SA 4FBFA 2LUWA 2G9FA 3WP6A 4EJRA 1IQAA 4KI5M 4QX1A 1POV0 1R082 5JPNB 2DCZA 3LIGA 4QGNA 1WMDA 2QQUA 2VMDA 4UOJA 2ID4A 4NUBA 5FYSA 1EPZA 3VD7A 1F4HA 3JQXA 2ZJCA 2WS92 4LKDA 1NAEA 5FZOA 3R6SA 1RUI2 1CONA 3GALA 4PI2A 2J1EA 5IYYA 5CG8A 5L7OC 1V6NA 2HWE3 5C7GA 2B7YA 5IVBA 5FKCA 3IDAA 2NN8A 4AAXA 1JZ3A 3WNLA 1AR93 2P3JA 3OJBA 3ZSEA 1ASJ3 2DBNA 4GH4A 3AK0A 4R9AA 1KD7A 1DGWA 1IGOA 1RMU2 3OUJA 5I8SA 3ZXJA 4DUWA 3NW4A 3WF1A 2V5DA 1RVF1 2XLAA 2YDEA 4EZ4A 3T2PA 2WL1A 1YJKA 1A8MA 4FPEA 1YJLA 5E89A 5F39A 1HKDA 2J22A 3WDUA 5FXXA 4B7KA 5FXVA 3ZSLA 4QT6A 1HRV2 1F2NA 1GNZA 2WAOA 4LE3A 2Z4FA 3PJQA 3MLLA 5I93A 4CE8A 3OPWA 4Q0UA 5K0UB 5B2GB 5DDJ2 2YC0A 1FX5A 2W95A 3I2HA 4Y5Z0 5DZGA 4JDMA 4EROA 2NZ9A 2GNTA 3UL2A 4LK7A 1JMUB 3D8CA 3WOGA 4E4ZA 2BV4A 2RS33 2V4AA 2BUKA 2WNUB 4HK8A 5LA2A 3VBOA 3VGIA 5AC92 1O5LA 2D6PA 2QNKA 4YVSB 3U11A 3H42B 4EN9B 3AX4A 1DHKB 2R1BA 3BKZA 3FLTA 1LOAA 2HBTA 4L2NA 4OUEA 4RS5B 3ZDSA 4K1YA 1ULEA 1RUJ3 4QHOA 4XURA 1JXNA 3A21A 2RS51 3I4IA 4COZA 3O0VA 1HB3A 2D6LX 3AFGA 3VKNA 1EV12 1F15A 3VBHB 3WZ1A 5JIUA 3IB3A 1FOD1 4EWAA 4NE9A 5I8YA 1R091 4NIHA 2VZOA 1OQ1A 4P5HA 1NY71 2G9ZA 1WCUA 1O59A 1MEC3 2HKXA 4M0NA 2Q8EA 3WINE 5A3TA 1Q8QA 1Y9GA 2TBVA 4RHV2 2Y26A 4RA0A 5A6YA 5ACA2 3DEMA 4Q4X2 4LBNA 3ETPA 4CDWA 3NV1A 1JOPA 2Q8DA 3ZFGB 1JYTA 4JTNA 2PHDA 2IXCA 2C26A 3TOJA 4JCKA 1LJ7A 4LKEA 1B35B 4Z07A 4NRQA 5IK8A 1RL3A 1S2EA 1WA4A 2EAAA 2PLV2 3L9JT 3M3CA 5AVAA 5FPBA 3SEPA 1SDWA 4D94A 2HWC3 2W3JA 3GYDA 5T55A 1PGL2 1OOPC 1QQP3 2UWCA 3FX3A 2C24A 1CQ9A 4E4HA 4Y26A 5CADA 1ZZ8A 4CP9B 5FY1A 3S30A 5C70A 1SBEA 1XE7A 2QDNA 4CDXA 1NCRC 2X53S 3ITQA 4LIUA 4AGVA 4LO7A 4CEWC 1TME1 1CESA 3IN9A 2WNEA 1OA4A 2PELA 4LMFA 1D4M1 1POQA 1UOJA 3V64A 1SLCA 1O5UA 4O65A 5FYHA 4URTA 2YBPA 3WW2A 1DP0A 2AYHA 3N3HA 3AP7A 4RD7A 2LS6A 1BMV1 5GKAC 1AR82 2H0VA 4NOTA 1UY3A 4L99A 4XF3A 5JZGC 2WNUA 1AXKA 2ETEA 4W8JA 3I3MA 4YVSA 4ZPIA 1PIV3 3TBDA 1N1TA 2ZHLA 3VHPA 4AQ6A 4EN0A 3VBSB 1LGNA 4RS5A 3V56A 2ORXA 4CPBA 4LPLA 3MW3A 4YG6A 4U36A 3BCWA 1CIWA 4A45A 2FZ1A 3SITA 3PMEA 2VAUA 1UXZA 1VE0A 3KGLA 1TMF1 4F7ZA 2DV9A 2XBO1 1UU5A 2VTXJ 1BK1A 1RUD1 5CYYA 3VBHA 4COWA 1BCXA 4IEUA 2OT7A 4CA9A 1RGSA 2JIGA 3N9LA 4XXAA 2WINB 1W39A 2VY0A 3IT8A 4HXCA 2R061 2E6VA 4N90A 1FAYA 1ENXA 1UY0A 3J8F2 4JGYA 4XILA 3ZFGA 2XL7A 3H7YA 4MYEA 4NHYA 2W2IA 3ZLIA 4K40A 3WG2A 2ZX1A 5GZEA 2R041 2JG9B 2ZKLA 2WQ4A 3DKQA 3EMRA 3H9AA 2P2KA 4QQHA 3RSJA 2YUEA 4MGTA 2ERFA 2WO3A 4DRRA 5LATA 1VR3A 4TZDA 1KS5A 5CVRA 4A3ZA 1WLDA 4NJ4A 2XVKA 4LO6B 1J3PA 4GB32 4B29A 4CP9A 4LHKA 4M01A 5AFEA 3RGBA 1NUKA 4K21A 1W8NA 2BDRA 4PF5A 1NA1B 5HCBA 1SQ4A 1XU1A 3L2YA 4UYBA 4CXWA 1OT5A 4EN7B 1ZZ9A 3RYRA 4BH9A 1RUG1 1UOGA 3I2DA 1XXNA 3P3NA 5C8CB 5J09A 4KU7A 5LASA 2WFF1 2X5IB 5J7MA 1NYWA 4QQOA 2GH2A 1YIFA 4IV1B 4P14A 2YC2A 2IVJA 4LLOA 5BNNB 3KT1A 2J1AA 5GLVA 4PLNA 3N35A 1WA6X 5A32B 3RG0A 2JE7A 2RR13 3A22A 4LNVA 1IKQA 3UT0A 3VBSA 1AR73 4QXBA 1JHJA 5GLWA 1AVBA 2W1UA 3B9CA 3CBNA 5FO7B 4UXAA 2QQLA 1RUE1 3FLPA 1K5MB 5JLVA 5CAZA 2ZGOA 2PYTA 3EBRA 2X10A 3HNMA 4FPJA 1HN0A 5FRAA 1QF3A 4YSFA 5KHHA 1V9U3 2V73A 3TB0A 3VD3A 2E33A 4RR3B 1RIRA 3O12A 4I2OA 1GOGA 5KBFA 4UW3A 2JICA 5FP7A 2YY1A 1K5JA 2QQJA 4K3UA 1KDKA 1W6PB 3NNLA 4BZ4A 3OCPA 2P6CA 4YM3A 5LEJA 2KD7A 3VD4A 1NLQA 4EN6B 3BTXA 2W1QA 3KB5A 4CUCA 4J1WA 1K3IA 4PIYA 3U07A 3WF3A 4OCTA 2QQPA 1EAH1 4L0PA 4FPFA 1O3RA 2PHWA 1S4CA 5BV6A 2JG9A 3MIHA 3WDXA 3IBMA 2HEVF 3PMSA 1F35A 3AP6A 1UY4A 1LULA 2RVAA 2W92A 1OF3A 1YNAA 3DUIA 4JGZB 2VD7A 4P08A 5CNAA 3SMHA 1QNWA 2NP0A 3BALA 2C6SA 3U4SA 2D3SA 3MZHA 3BGAA 3J9SA 2FDGA 3LOIA 4NR1A 4AGRA 4C0BA 1Z7S3 2XJPA 2YXSA 3WY6A 5JVVA 2P34A 4GQ7A 3ZPYA 5C8CA 5F32A 4KMQA 2D6KA 4XOGA 3B5LB 3WD5A 3HWJA 4Q4Y2 2VE1A 4HLTA 1YXWA 4AG4A 1OA3A 4K7JA 3NAPB 4IV1A 4QM9A 1GZCA 1SLBA 3ZXLA 4AVCA 1RINA 2C4XA 3AKPA 4PF1A 4XXPA 2A70A 5BNNA 3WQ1A 3RWKX 4XTMA 1HIXA 1VBA3 5A32A 1TG7A 2HWF1 2GMEA 4CXYA 1S2KA 1XNTA 4LKFA 4P9IA 2ZEXA 2XKOA 1PZ7A 4NWVA 4CDQC 1URXA 2XWJB 4HZFA 1JZ6A 1Y3TA 2CDOA 3ZFFB 1MQTB 2ZACA 4I02A 2D97A 1PM4A 4ISQA 2EVXA 1VIWB 2YV8A 2ZX2A 3AL5A 4HFSA 1K5MA 4NHKA 3R05A 1WW7A 1OLME 3O14A 3ST7A 1JZ7A 2G4IA 1QOOA 1A34A 4ZXKA 5IVJA 4RR3A 4RFRB 5IUQA 2BVBA 4BQ4A 1SLLA 4YZ2A 1J59A 3WDVA 5IVYA 4WVVA 4UFIA 4YW2A 4GKXA 4QDRA 4HOOA 2W94A 1UOFA 1W6PA 4L97A 1VLNA 4YFWA 3VD5A 3T0DA 2RDRA 4OFGA 4AEDC 3ZMOA 2D6OX 3LWCA 4KQ7A 5FP8A 1LNSA 2L9LA 5DN2A 3GJAA 1U12A 3LIHA 2WFPA 4XJ8A 3UYJA 1BVVA 1Q8VA 3AP9A 5JI9A 4NAMA 3E5UA 2DCYA 5DUXA 2D98A 1OPMA 1JTZX 2VW1A 1O4TA 4XJ9A 2GC3A 3QOPA 1LOGA 3R4SA 1W3XA 4JGZA 5FUNA 1XSQA 5AVPA 3I54A 2HYKA 2RJKA 1AR92 1IS3A 4FQ4A 1WUVA 5A1FA 2VR4A 1W28A 4Y3OA 1WW4A 1Q5OA 1UIJA 2PHRA 2XHNA 1CPMA 4IE0A 1NLSA 1KFUL 1QOSA 4GAZA 1PVC1 2DUOA 3WHTA 2WWJA 3NAPA 1W0NA 1O8PA 3DPRC 4GWJA 3ORJA 4LBOA 2OUHA 3OGVA 4N53C 4I3GA 3WDYA 1VJ2A 2WT1A 2A6VA 2XOMA 4LR4A 5JZGA 1XRUA 1H30A 4GULA 2YFUA 5AC93 3LDRA 3RZLA 2LW8A 3LD8A 1PO23 4QXKA 1ODMA 4V2WA 4QPGC 4A4AA 1W0PA 1CAWA 3ZFFA 3HQRA 3KCXA 4AHXA 1LHOA 5CFCC 1S0GA 2YFZA 1U5ZA 1RUNA 4COVA 3B3QE 2B4KA 4HKLA 4QX0A 1S0BA 2ADDA 4D3WA 2C9KA 2VG9A 5GLUA 1D0HA 4KWLA 2RS32 3IAPA 5C9AB 3BTZA 3MIBA 4NPMA 1GYKA 1UU6A 1H2KA 4FPHA 4QHZA 1W2UA 4QWNA 4XFFA 3NO8A 4D8MA 1W6MB 2F4PA 2VO5A 4LT5A 1HLCA 3IDCB 3J7LA 3ZR5A 2VQTA 3P5BA 2VOWA 4YW6A 4XCBA 3VKFC 1LOFC 1RUJ2 4NROA 3DF0A 2JB8A 4H7MA 2Q30A 1C8M3 3K2OA 4LOTA 5HCHA 2QDRA 4GJYA 1DZQA 4NN0A 3I3BA 5A80A 5ACA3 3C2UA 4GIQA 3RQ0A 4MGSA 1FT9A 5EXOA 4ZU5A 3NNJA 3X29B 2W08A 1JZ4A 3LDKA 3OG2A 1MEC2 2PLV3 2ZEYA 4KGGA 2XMLA 3PVNA 2PQSA 3CHXA 4QPIC 1BBT1 5FTTC 2FHRA 1R1ZA 3POFA 4QDQA 4AI8A 4BK4A 3KCCA 4RGAA 1QJU2 1S0CA 2UY8A 3RJRA 4AHYA 2WSVA 2JDPA 4FPYA 1AJKA 4HPKB 4GH4C 2BEOA 2BW8A 2SBAA 3WNKA 4QQ2A 3EXUA 4H7LA 2HWC2 4L8QA 5C33A 3QCWA 5ABJB 1QQP2 4TSVA 2Q8OA 3WNMA 1OPOA 1PZ8A 4ISRA 1W6QB 1X36A 2ARBA 1KITA 3LF7A 2J1UA 4C0HA 1VRH1 5FP4A 2FCUA 3AMPA 3E5QA 5K4LA 1WLCA 5L9VA 3ILFA 2WT2A 1FPN3 4OI2A 4M0HA 3VL9A 1UYZA 2IZWA 3PIJA 5BNOC 1V6IA 5C5UA 1OD5A 4K9SA 2BQPA 1POV3 3VZJA 1YWKA 1RUF3 1AL0G 1C5HA 1HXS3 3OY8B 3AJZA 4KU8A 5C9AA 1WLWA 2ZS6B 3FMGA 3MEPA 4Y1VA 1BEV1 5ANNA 3WVJA 2BGOA 1PIV2 4FT8A 2XL9A 5C8WA 1W6MA 3OTFA 1V0AA 3TRSB 1W2AX 3W9AA 1X8EA 2BWAA 3SCHA 3UJOA 2G9GA 1ULDA 2GN7A 2WQZC 4L9BA 2RMU3 3WNXA 4QXHA 3H3ZA 4R4XA 4XUTA 1WZXA 4ZZ8A 2VW2A 3IIIA 5FJKA 4F8AA 1OQDA 5A7PA 3JB8A 3RJ2X 2ZEWA 1F31A 4BM8A 4EE2A 5JDBA 2D6MA 5FCCA 3E5XA 3AKSA 2GN3A 4FOQA 3AKQA 1WW6A 2AH2A 2BNNA 1XYOA 2DCKA 2GNBA 2JDHA 4KG0A 1S2BA 4CUGA 3QH7A 4EV0A 1W2OA 3AYAA 4YFZA 2VZSA 5FPLA 4AI0A 1B09A 2QCSB 4AQ2A 4MO3M 3OPTA 5IVVA 1CIYA 1H1AA 4M4PA 1P8JA 2VU9A 3JB4C 1ENQA 1BK0A 4HPKA 4BDVB 2QJVA 2WJSA 2E26A 2OS2A 3FC0A 2YB7A 3SLIA 1PGW2 2VXJA 1W9TA 3AVSA 1RUC1 1N3QA 3A7QA 4Y4RA 3ZXGA 3Q8FA 3RZJA 1HJGA 2R1DA 1AR63 3THPA 1UMIA 2CV6A 2HWB1 2CDPA 2X09A 3I2FA 3PUSA 5ABJA 2VOVA 5HV0A 3SCFA 1PX4A 4WM8B 2DF7A 4CEYB 4DEQA 1JS9A 5FMDA 1W6QA 1W6OA 4Q8KA 4ITCA 3JD73 3LZZA 3TN93 3NRUA 4IDZA 4CYDA 1GWMA 1K45A 1UO9A 4X6RB 5KC6A 2R0FA 4XE9A 4CPBD 5K0UC 5I0SA 2JKXA 5FPXA 2CL2A 3IDEA 4UFJA 2JWPA 2WO2A 2AEYA 1KEXA 3ZM8A 2LALA 3JQWA 3OY8A 1IS4A 4IE4A 1RXGA 4IQPA 4LO4B 2WNUC 4Q4V1 4UFKA 4UFMA 2FD8A 4YPJA 2BERA 1XE0A 5F3GA 4P9WA 4YVSC 5HBAA 3N9NA 1GLHA 3KLSA 4AGGA 2KM2A 2RR12 4XHBA 3SH4A 5FJHA 1AR72 2Y6JA 3SHRA 3URFA 2ZKNA 4RS5C 1DU3D 2VVFA 3USUB 4YRDA 4GMP1 1CGPA 1QY4A 4MGYE 1UMZA 1VB4A 2R7EB 3WHUA 2JE8A 3FN9A 5F3EA 1BMV2 1SBDA 1S0FA 3N7JA 4AEDA 4IL7A 4YG3A 1I1EA 1QJY1 1RUH1 2DFCA 1CZSA 1COV1 1V9U2 1QKQA 1H6XA 3LKJA 3VBHC 3UNPA 4Z8BA 4H3WA 1GV9A 2VULA 3GJBA 3LPFA 4XUNA 5FZCA 2VC9A 1JW6A 2HWD3 5K9YA 1SFYA 3APBA 2YPJA 4Y24A 2VCAA 2ARCA 2TNFA 4QB1A 3EQEA 3CLPA 5FY0A 1GUIA 1G9DA 1PVXA 3S7EA 2V72A 4CCMA 4UF0B 2AREA 1R081 1DG6A 3HR9A 4UW5A 3ZFGC 4FPCA 4PIZA 1DQ4A 1ZRFA 4PI0A 4CCCA 5JXJA 5HXVA 3NNMA 4IETA 1B35C 1DQ6A 2WS91 1ZYBA 1RUI1 1JOJA 2DUPA 4PQQA 2ZX4A 1ZBA3 2GC1A 3WLUA 5FZ4A 2VMEA 4LTAA 1TNFA 4WBBA 2VMFA 1H4GA 4H55A 4XUQA 2HEWF 5A6ZA 5FUIA 1ZNPA 5BUVA 1SZBA 1XNBA 4MGIE 2WYSA 1ZRIA 3V0BB 2A6XA 1OMIA 3NNGA 5J37A 1RMU1 1LRHA 4AFAA 1ZRRA 2WABA 1Z7S2 4YM2A 4NIAA 1YQ8A 3I3EA 2PAEA 5EV7A 3VZNA 5IAVA 5M0TA 2XJVA 3KWVA 4Q4W3 3MPPG 2WZR3 1O6UA 1VPHA 2XONA 3OGSA 2QKDA 2D44A 1HRV1 5FXZA 1VBA2 2PTMA 3WW1A 1OUXA 4MUVA 5F6LB 1YHFA 3N4MA 1ZVFA 5DZEA 2BBVA 3VBSC 4AFDA 4UBGA 5DDJ1 3EYPA 5FZEA 3OUHA 3TEYA 2XGXA 3USUA 3CJIB 1PGSA 1FMD3 1YFUA 5E1RA 1T2XA 3I2GA 4DY5A 1KQRA 2CNAA 1WCSA 1DQ1A 3ZSJA 1DQ0A 3NV2A 3MLKA 1LOFA 2BRTA 2OUJA 4OHWA 2QQNA 3I2IA 3WF0A 3PLQA 1X9TA 1WCKA 4FPKA 4XDOA 2ZGUA 3ACIA 5FZHA 2RS11 3PURA 4XEZA 3AC0A 3ZPOA 1XBFA 4Z2WA 4FXKB 3H8XA 2GNMA 3WNPA 2VUDA 2Y6HA 4C90A 1RITA 2DVGA 1AF9A 3S0MA 5K8SA 2PA7A 1MPXA 2PXJA 4HL0A 1QMJA 4Y33A 4UF0A 5KWRA 2WZEA 4QPIA 1YUDA 3RZZA 1EV11 4CVUA 1HB4A 3HBZA 4F3JA 4NMIA 1Q8PA 3AMHA 3OYWB 3T08A 2JG9C 4MADA 3ZN6B 4RHV1 5FBJA 4H14A 2XUEA 4K20A 4XDPA 5FZLA 4Q4X1 1JOBA 2OZ6A 3I3QA 5C71A 3MF9A 2AUYA 2FCTA 1VMJA 2WBKA 5IJRA 3WDWA 2DVDA 4NHLA 1IPSA 1NA1C 3B02A 3SC7X 3ZYJB 3OBAA 1ZREA 2AACA 1GP6A 1UCXA 2A6WA 2VBPA 3O1RA 1SPPA 3OBTA 4XTPA 1PGL1 5C8CC 5A3LA 3H3UA 2X5IC 1OA2A 4LBQB 4A6OA 5F3CA 1GSLA 3KF3A 3IDBB 5BNOA 1RUOA 4IV1C 1A6CA 3FLRA 5BNNC 1YEWA 3FUOA 5IAXA 1MS1A 1ZZBA 2VOKA 2WSUA 4XUPA 1DYKA 3RYPA 3AZVA 3GDBA 3ZXDA 5A1AA 1QJX3 2B9VA 2DTYA 2ORZA 2Y6LA 5FZ0A 3M70A 1PO22 3SXWA 2Z42A 5FYYA 3THDA 4CP0A 4DXRA 3CJIA 3PNAA 2BGCA 5FY5A 4BA6A 2GALA 2DVBA 1AR81 4Q0SA 4QM8A 1RHI3 2AC1A 2Y60A 1HRI3 2ZPXA 3SEEA 4GXLA 1V70A 4MVTA 1K5MC 2IXJA 3POYA 3ZN4A 3CL1A 3QACA 2JEMA 2WZ8A 4ZU4A 5FO9B 3BTYA 3SKVA 5JOYA 2LRPA 1H4HA 2DYCA 4RR3C 3ZO0B 1ZRCA 2FMYA 4JHTA 5EQUA 3UV9A 1FNYA 4WV8A 1DIWA 1AYN3 1REEA 3JZVA 4M3CF 5FLHA 4XAAA 2AR6A 3MUZ1 4EN8B 2P37A 4DUVA 3FZ3A 1LHUA 3USSA 2VOTA 1G7YA 2FBEA 3ZVXA 1C8M2 3PU8A 3JBG3 3SISA 1D2QA 1O8SA 1QDCA 1G9FA 4LA3A 1QDOA 2TUNA 1QJU3 3OYWA 4CCEA 2E32A 3ZN6A 1CZVA 4E9KA 1WCQA 2PHTA 2Q0AA 1DLCA 3TWIA 1UYXA 3EJKA 1UZZA 3J8F1 1KFXL 3KF5A 4FXGB 4GJZA 3U37A 5J48A 2WO7A 4JGZC 1YFXA 5FBZA 5FPZA 3W58A 5F6KA 4OMDA 2CTVA 2EXKA 3CDZB 1CAVB 1MS8A 1AX2A 2DVAA 3HAGA 3IMMA 3BYWA 4N9IA 2YC4A 1YFYA 2BOIA 2R073 2Y8KA 2P3YA 5K0UA 2E7TA 3NAPC 3NQHA 4GB31 3IWZA 3ILRA 5KHGA 2FDHA 4FFHA 4Q27A 4PJYA 5KR7A 1DCSA 3AXEA 2VVDA 4BU2A 3ETQA 1HW5A 3DV8A 5EP9A 3LDBA 4JDNA 4D6QA 5IW0A 4IEOA 5KHKA 1FPN2 4M3CB 4YYOA 3ZFFC 5JR2A 2CYFA 2P3KA 1YIPA 1MQTC 2NYYA 3NVCA 4YZ5A 1GZWB 1YI9A 5DAXA 3WNOA 1RUF2 5A3UA 2JDUA 2DBIA 3T1LA 1HXS2 2VMHA 3ZYFA 2IXKA 5FOJB 4CU9A 3RZKA 3EO6A 3NMBA 3U0ZA 4FI9A 1L7QA 1UU4A 1LOBA 5E16A 3AMNA 5A7QA 3UJQA 5DMYA 1LAJA 4E27A 2MEV3 4Z82A 1MVEA 4BOWA 1VBC1 1XYNA 5IVFA 4B4QA 2NPIA 5DUUA 4MGKE 2RMU2 3VKLA 4AVAA 1QJEA 3CEWA 1GWKA 4BIOA 1NZIA 3S5QA 3D0SA 3WNNA 4P00B 4Z1VA 1LR5A 3MIDA 4M4RA 4OZXA 4B4PA 3D82A 4JX0A 2Y6KA 4BLJA 2UWAA 1I9RA 2CGPA 5FY4A 2QQKA 1H0BA 4S2HA 4ZONA 1O3TA 1B35A 1NY72 2ET1A 3KV5A 4IXLA 1J1LA 3R4UA 5FZIA 3DYMA 3KM5A 3E1F1 3DYOA 1FV2A 4LITA 5DG2A 3T0BA 1SLTA 2EXJA 1NCQB 2Y38A 3POJA 4HN0A 1DYOA 2VTXA 1Y4WA 1VBE3 3S6PA 2IXIA 1SHWB 4JVAA 1CAVA 4QU2A 3J4UH 2W68A 1YI7A 2A3WA 5FZDA 1V6LA 2D7FA 1ZZ6A 1LHVA 2ATFA 4OUMA 2UYAA 5FZFA 3WF4A 4S2FA 5A3PA 4E4SA 1AR62 4DIQA 1VMFA 2FDJA 2XH6A 5JR7B 3ZXAC 5IVEA 5FZAA 4MXVA 2NMNA 1R64A 5A7SA 2UY9A 3C7FA 3GZAA 3PUQA 1WMXA 1X82A 1WGPA 1LHNA 3JD72 3TN92 4MXWB 3N7MA 4ZY9A 5HCFA 3WR0A 1LGCA 2WO1A 4N8MA 1D4M2 5IK5A 3KV4A 4CDUB 1NLRA 1EPWA 4Y4YA 4M3CA 1LU2A 4Q4Y1 3W5MA 3MICA 5HI0A 3ZYRA 4LA2A 3NKTA 2A75A 4K8RB 4QGLA 1GZWA 1RJ8A 2DU0A 4FTSA 4MG2A 2WWSA 1QH7A 4HMZA 1PMJX 4AFMA 4IGQA 1GKBA 4AE2A 1HB1A 2UU8A 1VBB3 3WSOA 4D7YA 5C9AC 4JHZA 2VECA 3AVRA 3I7DA 5EWSA 1PHMA 5KHJA 1R1A3 3U75A 5LZ6A 2IWGB 3LQCA 2LROA 2V09A 4CP2A 2RM23 5CBLA 2VNGA 4H2AA 2CY6A 4ZS2A 2UWBA 3O5SA 1ZBE3 3MFAA 3RPQA 4Q1PA 3ZXKA 1OLRA 4AHWA 1E5HA 2BVVA 1MZ6A 2R0HA 1EUTA 2BPA2 2XBO2 4O7XA 1AZDA 2YPDA 2VQ0A 1OH3A 1ST8A 3M1HA 3VBUA 3DYPA 3VBUB 4COUA 4KL1A 4WM7B 5A33B 4ZKTB 2VPVA 4YNIA 5DZFA 3OUIA 4YW5A 4N7UA 4FOWA 4ORFA 3I3DA 1W04A 2HWD2 4YZ4A 4IE7A 4CZSA 4ZHNA 2BNOA 2VOXA 5F2WA 4AEMA 1ODNA 1C57A 1U0AA 4GWNA 1CX4A 4IEXA 4DFSA 1CR7A 2D40A 1AL21 2O8QA 2R062 3OD4A 4BB3A 2HYXA 1NCQA 1NE4A 2J42A 1MZ5A 2FDIA 5BNPB 3T4VA 3VV1A 1RB8G 2Y6GA 1U5IA 4AR2A 2DVFA 4CCDA 5IWFA 1NA1A 2XXZA 1XNDA 1UD1A 2OPWA 1JI6A 4QX5A 3VZMA 5EHDA 1ZBA2 2HWE1 2ZXQA 4XUOA 5LBBA 3B9IA 5ABJC 1LEMA 3BOPA 2X5IA 2ZBJA 4OUSA 3IMNA 1AR91 1DDLA 1RTVA 5FV3A 2ZMLA 4QKFA 4QD2A 1ASJ1 2AEZA 2QTWB 5HXMA 4QX2A 1WBFA 4QMAA 3M3OA 3MV11 3T2OA 4XBQA 1RUG2 2DWRA 4CDUA 3PU3A 2ILMA 4R8HA 4Q4W2 3M8LA 1IOAA 3KVBA 1UNBA 2WZR2 3J26N 1YFWA 1OVPA 3IKWA 1X9PA 2YHJA 1G6NA 3AZWA 5ERLA 2Q1ZB 3EB7A 4DZGA 5EFUA 2UYBA 4XBNA 4ZXEA 1QWRA 1US2A 3M4FA 2FQPA 5JMCA 3VZKA 1DYPA 5D21A 5KXDA 2BFUS 3WP4A 3O1OA 1PO13 1MS3A 1NXMA 1Y43B 2R32A 3LEKA 1AXYA 4Y20B 4YVWB 1UY1A 1YLLA 4EZHA 4OHYA 4C1XA 1N1YA 1YC61 1OUSA 5J96B 5BYNA 1FMD2 1WD4A 2QFEA 2WKKA 4I30A 4BQ1A 1Q8SA 2RS31 3E6DA 5D8AB 3WG4A 1S0EA 4LUKA 3C7GA 3I2JA 1MR5A 2JECA 2XJQA 4P9GA 1GQPA 3ACGA 4XAEA 3LSEA 1W03A 1JN2P 3ACHA 1QXJA 4LBKA 4WM7A 5A33A 4B8EA 1XYPA 3BTAA 2VCBA 2ZEZA 3DL3A 2ZTNA 4D7SA 2CU5A 4KH9A 3N7LA 3LEIA 2CAUA 4KWJA 1XC6A 1RUJ1 4HK9A 2C5DA 1OC1A 3FUQA 4WVWA 1JZ5A 2JG8B 5BNPA 3LA7A 4CUAA 2GAUA 1EAH2 2ZGNA 1TQ5A 1ZM1A 1DQ5A 4N9HA 2GP5A 2XLGA 3T09A 1JYCA 1JYVA 5C3QA 1WD3A 5JXGA 4AFBA 1MEC1 5EJZB 1UX7A 1O7FA 5CIRA 4I09A 1AYM3 3MO4A 1G9AA 5F1RA 4Q8LA 1SLIA 2BU9A 3WG3A 5L36A 1IQDC 5A6QA 1CAUB 2OPKA 4WM8C 4XF1A 3J7MA 4DQAA 4CEYC 2VNRA 5I0TA 5FYVA 3VB9A 5FMOS 5LB6A 1VBD3 3AYEA 5JMOA 4NO4A 1E5SA 1W8OA 1ZRDA 1DZTA 1IZ3A 3H50A 4XCAA 4EYUA 3WV6A 2HWC1 3RWNA 4PDWB 4FTBA 2X29A 1LESA 1QQP1 1XPWA 4DINB 1I3HA 1NX9A 3LA3A 2BOJA 5JUVA 1H9PA 2JDMA 1MQTA 3HOBA 4AZZA 4XC9A 4BHPA 2QQMA 4D0QA 3I59B 1LGBA 4A44A 1H2NA 2B39A 3OSDA 5JOXA 3KS7A 1LECA 3AP5A 4J6GA 4UI9L 4W6YA 1SBFA 1QJX2 4PQ9A 2WR9A 4Y20A 4YVWA 2BYVE 1UAIA 4AFCA 4CU7A 5AFBA 1D0GA 1EY2A 2PN5A 3LGRA 5JSPA 5L19A 2J1VA 4UBHA 1PM7A 5B4XA 2Y64A 1RHI2 5T3NA 2BFUL 1HRI2 3KVAA 2JDZA 1T6BX 1FI2A 5LA0A 5D8AA 3ZXFA 1EYBA 1ONAA 1H8TB 3B00A 1PIV1 5F8PA 4K6BA 1SMVA 3N9MA 4XIKA 3O1TA 4KNCA 1IHMA 1GFF2 4IEWA 4YW3A 4Z2AA 2CAVA 2Q1FA 5DABA 4HANA 3AZXA 1AYN2 1DGRA 3NJXA 3HBKA 2BWCA 2PAMA 4QX3A 5GZCA 4LBLA 5JSOA 3BOWA 2JG8A 4XZUG 2RG4A 2PFWA 3JBG2 5H9SA 1OFNA 3VBFB 5LCWL 2PHUA 4ES8A 4CUBA 4YW1A 3R4DB 5T5JA 3ZYGA 3I49A 1ZZCA 3MBWA 3BI3A 1J3QA 2Q4SA 3FJSA 2ZHMA 1BYHA 3K4ZA 3VKOA 3K3NA 1SFNA 1XU2A 2D3PA 5JOWA 1QJFA 2IC1A 4JDOA 1GZ9A 5LK7B 4LHSA 2DU1A 1CAUA 1CD3G 1RVF3 3K77A 3PUHA 1PNFA 5FZ1A 3VL8A 3ZIXA 3S57A 4GKYA 3T2TA 4BK5A 1KJLA 1W0OA 3D4KA 5FK8A 2ZGLA 2ARAA 1PGW1 4JKLA 5LA1A 4Y1UA 3ZKUA 3PUIA 4OQ9A 5FZ6A 3ABZA 3M3IA 2VXRA 3LCPA 4PDWA 4F83A 3RNSA 3GBGA 5FMOL 5FYUA 2DFBA 2R072 3ZYBA 2H6BA 4XQDA 5E88A 1XB9A 4R9CA 2VMCA 2W1SA 2QUOA 3I59A 4BISA 2ENRA 5F5QA 2WA4A 2VUAA 1RC6A 4BMBA 4C91A 2GNDA 3PDQA 3ZN5A 3H8RA 2JDKA 1J1TA 5FYCA 1D2SA 5LY2A 3WW4A 2XVGA 2IFRA 4C1WA 3RRDA 3CJIC 1TZOA 4YARA 4YGDA 2KXLA 5A3WA 3ZDVA 2B9UA 5F9TA 2AZ5A 1J83A 3OGRA 3OEAA 4JTOA 3VDCA 1H8TA 2PAKA 3N9PA 5E6HA 5EPAA 3VDDB 4A2UA 1OHFA 2RS53 4BPZA 4XVHA 2RR11 5F5IA 1L7LA 1N1VA 5C3PA 2OQ6A 4BQ5A 1QNYA 1OQEA 2WN2A 2MEV2 4ATEA 1W8FA 3GF6A 1SFPA 4A41A 4QB2A 1FOD3 2F17A 1JODA 1IG0A 1ND3B 1QEXA 4I3PA 4IESA 5FYIA 1R093 2Y33A 2YU2A 5T50A 4KG8A 4L92A 2IXHA 4MV2A 1DGRN 3OBZA 3AMQA 4R9BA 4RFT0 1V9U1 1OURA 1UY2A 2UURA 1CZTA 3GBFA 5DAQA 1KRIA 4FOVA 4YW4A 1ENRA 2IUWA 4GMP0 3WXPA 3FHAA 3NJZA 1GMMA 2GC0A 2D6NA 3D6EA 1QOTA 1W2TA 1ND2B 2LM3A 4X8NA 1XJAA 4NHXA 4PLOA 4IV3B 1C28A 5F2SA 4P9LA 1W06A 1ULGA 2WAAA 1VMHA 3MI8A 4URAA 2Y6FA 4B1MA 1W6NB 2WUHA 4FSJA 4XFHA 1WW5A 4UWDA 5FR3A 3CU7A 1ZZ7A 2BP6A 2HH9A 1VBE2 3BN6A 1VAMA 1LODA 4Y5TA 1CAXB 3TNPB 1WWYA 2OVUA 3POIA 3RI9A 4HKWA 2IFWA 4RQPB 4OYUA 2WT0A 4XMIA 1TME3 5IFTA 4N43B 2NLRA 1D4M3 4BQ2A 4DNYA 4W6XA 5FZ3A 1LENA 4HN1A 2MNGA 3OOXA 3POBA 3S7IA 1PK6B 4P9JA 1BKZA 1Z7S1 3I2KA 4QB6A 1X7NA 3POWA 5IT6A 4IEPA 2H6CA 4IERA 1C1LA 5IK4A 5FZ7A 5A3OA 2JX9A 5FLIA 3A4UA 2XJSA 4N7IA 5FAXA 1LTEA 4CRQA 1BHGA 1LKNA 2QQIA 4XFIA 1LOCA 2RE9A 1MZFA 3ZYHA 1ULCA 5JAXA 2CGOA 3FFZA 3HD8B 4GWMA 1UN1A 4AYUA 3TEWA 3VDDA 1VBB2 3AMMA 3TNQA 5A3NA 1TMF3 3WW3A 3T30A 2VMGA 1I6XA 2XBO3 3ACFA 1R1A2 4PHZA 1RUD3 2WNVB 3QD6A 4QQPA 1UL9A 1F4AA 4AK3A 5JSRA 2JDYA 3MFCA 4DPNA 1MS4A 4BJ0A 1DZRA 2RM22 3RZMA 4P9XA 2E9QA 1ZBE2 3MW2A 3BPZA 4BQWA 3CMGA 5LEKA 3THCA 2C9AA 2R063 4DOUA 1WBLA 3UKTA 1QXRA 2IVIB 3MHZA 4ONUA 3O1VA 2OA2A 3P1IA 2CSGA 3HJRA 3LE0A 3W20A 4DUXA 3RI8A 2ZGQA 1ND2A 3BU7A 1DF0A 5DQ0A 1ULPA 2OXBA 4BQYA 3FE5A 2R043 2GH8A 3NV3A 4PT6A 4P9YA 3FBYA 2XQRA 5DAPA 5LRSA 5CKQA 1QGLA 2K0GA 2O14A 3LAGA 3ZX7A 5FK7A 1YO8A 4MGQA 3ZSMA 4RGGA 2OQ7A 4E2GA 4HETA 1PMIA 2WDBA 1BVP1 3FHQA 5DPNA 4WM8A 2GU9A 2VQUA 1CAXA 5TSWA 5CISA 1M06G 4CEYA 3RFRA 4J25A 1HB2A 3J7HA 3VDBA 3KD4A 4FFFA 5I0UA 4DXTA 4PBOA 1PZ9A 3DKWA 4LXLA 4Q2FA 2DDUA 4N43A 1CVNA 2ZGPA 3RDIA 1RUG3 3BUCA 1KXGA 3OGGA 1GWLA 1N1SA 2HWB2 4G9SB 4ZS3A 4IEQA 2ES3A 2WFF3 5L9RA 5KXCA 1O91A 5CU1A 4ES9A 5G05L 4FO9A 1YCIA 2ZGKA 4O9GA 4OHVA 2OX0A 3CO2A 5EZWA 1PK6A 1ACCA 4ASMB 3KCYA 1H2LA 1JH5A 1F8VA 3HN1A 4XPVA 3AXDA 3V65A 2YBSA 2O0OA 4W65A 2CHHA 1LB2A 1GP5A 3PVEA 3B7MA 4LKSA 4OULA 3Q8AA 1HV1A 2WWUA 4W50A 4OZOA 2W46A 2D5HA 2VZUA 4XQ4A 2EIBA 4YGBA 3WP5A 1RUE3 1OKQA 4I0AA 5AC91 3ALQA 3NSTA 3CF6E 1GNYA 4OVEA 3KHCA 1PO21 3OEBA 1N47A 1Z78A 1PO12 2WNVA 1OF4A 2EA7A 4QX8A 3B69A 1V6KA 3ZIWA 2WIIB 1AX1A 4IEZA 4D7TA 2LTNA 3DXTA 3KQ4B 2ZOEB 2GP3A
chains in the Genus database with same CATH topology
4NWWA 3VBOB 5GLTA 3E97A 4E4DX 1COV2 3T1MA 5C6CA 1C5IA 1EAH3 4XJAA 1H1IA 3WG1A 1CN1A 4LHLA 3AKRA 1ZX5A 1REFA 1IS5A 3JU9A 5FLJA 4LBMA 1NG0A 1S0IA 5T54A 1C8M1 4XJWA 3G7DA 3ZFEB 1QH6A 1S55A 1HQLA 2ET7A 1NCQC 2YGMA 1OFSA 5ACA1 4S2DA 4FP3A 4MLOA 4RSUA 3ROUA 2B42B 3V0BA 3O0WA 4MZUA 4AF9A 1AYM2 2PLV1 1NXD1 2JKBA 3RS6A 3MYXA 3H1YA 3ACLA 4CDWB 5GZGA 4G3YC 2XVLA 3H8UA 4AHZA 4NPRA 1VBD2 1X8MA 3NWKA 4R4ZA 2B45X 4SLIA 2HWF3 3FHIB 4AWDA 1OI6A 2FZ2A 4CDUC 1DQ2A 3U4XA 4Y22B 2ZMNA 2DUQA 5GALA 4LO8A 3SH5A 4FOYA 2AENA 4CDXB 2OW4A 4XMAA 1REDA 3OBRA 3WDTA 1FPN1 5JI7A 1QU0A 1M4WA 3BB6A 2O8OA 2HJIA 5CFDB 3AYDA 3MIEA 2I07B 2JJ6A 1IKPA 1POV1 1VALA 1Z0HA 2A6ZA 1RUF1 4OHXA 3WX5A 1HXS1 1UKGA 3O7OA 1VB2A 2ZMKA 2WC2A 2PHLA 3NKGA 3VBUC 5T5LA 3R0RA 4WM7C 1KJRA 1AX0A 3UK9A 1CJDA 2E63A 4HBNA 2RS12 4FP2A 2D43A 3VBRB 3WUDA 2Z5WA 2DCTA 2RMU1 4OLLA 1G86A 3ZFEA 3O0XA 2JE9A 4BLIA 4YM0A 1HDKA 3ZXEA 1HQNA 2XJRA 3KGZA 5JWPA 3WCRA 3EHKA 3B94A 2V5YA 5GLZA 4A7ZA 1YRZA 3A0NA 5BNPC 2P17A 1GANA 3VN4A 1SACA 3RMXA 5C4WB 4Q0VA 4FVVA 1MS9A 2YZ4A 4JC1A 4A7YA 2PQQA 4XF4A 1PVC3 4B4RA 3ELNA 4JGYB 2KA3A 1RVF2 4O9EA 2BTVC 1N3OA 4S2GA 4LBQA 2NMOA 1G8WA 1IPJA 3ATGA 4XIOA 1NE6A 3FBMA 1SCRA 4BYYA 1Q8OA 1H1MA 4AVBA 3QBQA 4DY3A 4FPOB 3IIAA 1AR61 4ASLA 4Y22A 4AI1A 2OZJA 1GBGA 2ZGMA 3ES1A 3TYJA 4WVMB 4XFAA 4FAGA 5J98B 4FCAA 1J3RA 3AKTA 3JD71 3TN91 2Z69A 2D3RA 1GICA 3HT1A 4ZU7A 2Q5TA 4YVWC 2GZWA 5DUWA 5CFDA 2WLQA 4TLFA 2ZAHA 2ZX3A 1UIKA 4V1PA 1ULFA 3AM2A 4WVZA 4Y1ZA 5D8AC 1Y9QA 2CWMA 1BJQA 3N36A 4QPYA 2RS52 5JOZA 3WUCA 2MHFA 2I2SA 2ZCWA 2XPJA 4DXZA 4QQLA 3PHMA 3VBRA 1SCSA 4AI2A 1FOD2 4HVOA 3MIGA 4M3CE 1R092 5FREA 4AVTA 5J36A 2D5FA 2JG8C 4IEYA 3Q9OA 1BBT3 4OI1A 1KDMA 2QZ3A 2JENA 1AUYA 5C4WA 2I74A 2HWD1 2ZZQA 3M7AA 1F9KA 1V6JA 3HQXA 3WQ0A 1C8NA 3KZ4C 5L7OB 4DS0A 1UW8A 4L11A 1LCLA 2O1QA 4FQZA 3GBWA 2ZGSA 1O4YA 2C0ZA 1S1AA 2OYZA 1ZBA1 4XFCA 1VRH3 2YGLA 4KWKA 1TME2 4M00A 2GSYA 4PDWC 4BIFA 4WVMA 2EXIA 3KT4A 1FNZA 2K9ZA 4Q0PA 3ZMNA 4LUMA 4GA9A 3VZOA 1GNHA 1XQNA 5K7PA 5FFOC 3RMYA 5FOBB 3OPZA 4JRAA 4NHMA 4MGZE 5L73A 1BEV3 1I5ZA 3ES4A 4Q4W1 1T6GC 4I01A 3AFKA 2WZR1 4YZ1A 2B5HA 4PCRA 4LLFA 3D0JA 1QHDA 3HT2A 4Q1RA 1HX6A 4YZ3A 1H8TC 1SEFA 2EXHA 3M3QA 1A78A 3LA2A 4K1ZA 1TMF2 4LEJA 5H9QA 3ZYIB 1ENSA 3MDPA 1RUD2 3V0AB 2ZAAA 3PJYA 4INDA 1VBC2 3POSA 2QZ2A 1FMD1 1X33A 4B7EA 1C4RA 1NZCA 3KQRA 3KSCA 2VGDA 3VZLA 2DURA 2W52A 4YGEA 1XNKA 3LB9A 3VBFC 5CA6A 5KXBA 4XJZA 5H9RA 5BXXA 2VMIA 4E2SA 2XHKA 2WLPA 2R042 4JRLA 4YLZA 2EALA 1RUC3 3ZYPA 4E2QA 5L7OA 3LSDA 3THTA 3BIWE 5FQ0B 2HWB3 3HIFA 4K8FA 5IK7A 5LK5A 1N3PA 2Y0OA 3M3EA 5EYYA 1UX6A 3IM0A 4WZCA 1UF2C 5H9PA 4MXWA 2FMDA 2NM1A 1OOPB 3AZYA 3GHNA 2WFF2 4B3NA 3W59A 1G9CA 3VHRA 4MH0E 2HEYF 2ZX0A 3MW4A 4HSLA 4FPGA 4Q4V3 1NCRB 1NQDA 2F6BA 4CEWB 3MLJA 2ZGRA 4OI0A 4D69A 1MVQA 1GR3A 4HVRA 3RYKA 4GMP3 4WZFA 3AYCA 4W6WA 2DTWA 2MPFA 5JZGB 1RUE2 1APNA 3VDDC 1QJX1 1QJY3 2A3XA 1RUH3 4J1XA 1CAWB 1COV3 2WA3A 4AVSA 3V0AA 2RJLA 4AXOA 3ECQA 3MF6A 1DLLA 1RHI1 4X6QB 1HRI1 1ND3C 1OSGA 3JCIA 4Z92B 3BODA 5J3UA 1KS4A 1UPIA 1JUIA 4XYXA 2A5ZA 4GALA 1L3JA 2VH9A 2X8KA 1R083 1IS6A 1CJPA 5KXEA 1AYN1 3TAYA 4PLMA 1ND2C 4IV3C 2C1FA 2WS93 1Y7BA 3FWEA 1RUI3 4KGQA 1AL22 4DRVA 4PBPA 1TEIA 5SV5A 5FQ0A 3JBG1 5LRRA 5JCTA 1PNGA 1QJU1 3QH6A 1V00A 2YMZA 1Q3EA 4JQRA 2EF6A 1RMU3 4RQPC 2E51A 3K51A 2HWE2 4N43C 1JHNA 1LHWA 4OHZA 1LEDA 1WMFA 1OOPA 4MSVA 4PIXA 5KC5A 1V6MA 4LBJA 3WCSA 2K2SA 1ASJ2 2ZA9A 2QVSB 1HRV3 1PK6C 3VHNA 1NCRA 1U5XA 1F5FA 3ME2A 4AI3A 4AVVA 4CEWA 2HWF2 1S0DA 3WQ7A 2R071 3SH3A 4ATFA 2A71A 5DDJ3 1BXHA 2A73B 5EYXA 1VAVA 2E53A 3H0OA 1O3SA 3JUUA 1C1FA 4XJUA 1DGLA 1UZYA 1WMEA 2DCJA 2XB6C 2WNVC 5HCAA 3FFQA 2ZABA 2RS13 4I0WB 4XZPA 3H1WA 5DG1A 1Q43A 4A3XA 5BY5A 2SLIA 2OIIA 1EV13 2MEV1 2VUJA 4LE4A 3MGUA 1NQJA 2Z79A 1DBNA 3INAA 1S0JA 2XWBB 4XF9A 2NQYA 5E8AA 3MPBA 1X50A 4QHBA 4RHV3 1SLAA 3ZSKA 2XKPA 1A3KA 3GZUC 3PVOA 4Q4X3 1QXPA 2XLFA 1MS0A 5GM0A 1RJ7A 2VQAA 1BQPA 4AEJA 3M2MA 1XNCA 4BCUA 4XETA 4Q26A 2VNOA 5T5OA 3B01A 1PVC2 2Y0IA 4EWDA 1FV3A 2A3YA 4I0BA 1VBE1 4LO5B 1AXZA 4AW7A 1MS5A 3OD0A 4META 1BZWA 4HT1T 1GQGA 4JV4A 4DB5A 3B93A 3G6JB 4U2AA 2EIGA 4X8PA 1MZEA 3CJXA 1O4ZA 5FDBA 4QGMA 1W6OB 1AR83 1A8DA 2Z2SB 5D1IA 3E6BA 3KT7A 1OLQA 4HKOA 2R30A 4AQTA 1H9WA 2CWSA 3GZTB 4CDQB 1VP6A 1E57A 2P3IA 1AR71 2B8MA 3C3VA 2PHFA 2GDFA 3K48A 4YGCA 2RHPA 1UKRA 1VBB1 3A0KA 4LULA 5BPXA 3VBOC 5BNQA 5I8TA 4DMIA 5EJ3A 1R1A1 1ZA4A 3AP4A 1U5YA 3VBFA 5GJ6A 2RM21 3UKNA 5JPMB 1ZBE1 5DUVA 5A3MA 4AEDB 1D4VB 4LBQD 3ZFEC 3J8F3 1BBT2 2VVEA 3DN7A 4G4FA 4CTEA 2A6YA 2W0XA 3QLQA 3AB0A 1MACA 2XJTA 4AQSA 2I45A 3MIFA 4TWTA 2R16A 3HMYA 1JYIA 3D5OA 4CDWC 2YROA 1UPSA 4GB33 3IPVB 4Q29A 4R9DA 3OF1A 4XBLA 3WT3A 4A7KA 1H2MA 3L2HA 1FATA 1VRH2 4COYA 3AZZA 2B46X 4TYSA 3WP3A 3LOBA 1WCDJ 3DPRB 2CGNA 1YYNA 2GC2A 4LHNA 5GZFA 4CDXC 4N53B 4JAAA 4XF0A 2E7QA 3VHOA 1DFQA 1VBA1 4XQWA 1FXZA 2H0BA 3GNEA 4OI4A 1BEV2 1JBCA 2GMMA 4FPLA 4CDQA 4Y1YA 4QPGB 5JIAA 4XFBA 4BWOA 3SCGA 5CFCB 5CFDC 1VBC3 3DGTA 4KBBA 4YM1A 3ENRA 1ND3A 2R6QA 3H7JA 1PO11 2JD4A 3PTYA 1NOVA 1TE1B 2TEPA 4UW4A 1HQWA 3N7KA 1H8VA 2JXAA 5DXDA 5CG9A 2ZGTA 2D93A 3KMHA 3VBRC 3PVBB 5KHIA 1QJZA 1AJOA 5FO8B 4IV3A 4HSJA 1JUHA 4CP1A 2R49A 1EP0A 1W6NA 1CPNA 3NL1A 5T5PA 1AHSA 1DGWX 1Q56A 2WZPP 2IXLA 4AEKA 3ILNA 5I91A 5C4WC 2ARXA 4R52A 5I0RA 1TNRA 4Y1XA 2EAKA 2N7GA 2ZZJA 4RQPA 1RUC2 3I8TA 4JGYC 4QPIB 1IPKA 2W39A 1ALYA 1LOEA 1VAKA 3IPVA 2XUMA 2AGSA 3SNMA 2ZHKA 4GH4B 2A7AA 3UKVA 1AYM1 4BMEA 4XW3A 1GQHA 4UW6A 2PHXA 4EWEA 3AJYA 4Q4Y3 4XHXA 1WLTA 3H1MA 1O3QA 3DPRA 1C3HA 3ASIA 4N53A 1VBD1 1HV0A 3GHMA 3NV4A 2Q1MA 4Q4V2 3VKMA 3OGJA 1FYUA 4RL7A 4QPGA 3U10A 2GMPA 4Q0QA 1V6OA 5CFCA 1G9BA 4HVQA 5BNOB 2BNMA 3VUOA 2XJUA 4FAHA 4YG0A 1F5JA 4IEVA 1LU1A 2QE3A 5GZDA 3VLBB 4XFGA 1QJY2 1RUH2 4NVPA 3P3PA 2YYOA 1J58A 2E7AA 5T52A 5CB7A 4FTEA 4XDQA 4BE3A 2ZHNA 2VW0A 3CNAA 4SBVA 4MX3A 1AL23 1XE8A 2XG3A 4FBFA 2LUWA 2G9FA 3WP6A 4EJRA 1IQAA 5JPNB 1POV0 1R082 2DCZA 4QGNA 1WMDA 1EPZA 3ZXDA 3JQXA 2ZJCA 2WS92 3R6SA 1RUI2 1CONA 3GALA 5CG8A 5L7OC 1V6NA 2HWE3 2B7YA 2NN8A 1AR93 2P3JA 3OJBA 3ZSEA 1ASJ3 4GH4A 3AK0A 4R9AA 1KD7A 1DGWA 1IGOA 1RMU2 5I8SA 3ZXJA 3NW4A 1RVF1 2XLAA 2YDEA 2WL1A 1YJKA 1A8MA 4FPEA 1YJLA 5E89A 1HKDA 3WDUA 4B7KA 3ZSLA 4QT6A 1HRV2 1F2NA 1GNZA 4LE3A 3PJQA 3MLLA 5I93A 4Q0UA 5K0UB 5B2GB 5DDJ2 2YC0A 1FX5A 4Y5Z0 5DZGA 4JDMA 4EROA 2NZ9A 2GNTA 3UL2A 3D8CA 3WOGA 4E4ZA 2RS33 2WNUB 2BUKA 4HK8A 5AC92 3VBOA 3VGIA 1O5LA 2D6PA 2QNKA 4YVSB 3U11A 4EN9B 3AX4A 1DHKB 2R1BA 3FLTA 1LOAA 4L2NA 4RS5B 3ZDSA 4K1YA 1ULEA 1RUJ3 1JXNA 2RS51 3I4IA 4COZA 3O0VA 3WZ1A 2D6LX 3AFGA 3VKNA 1EV12 3VBHB 5JIUA 1FOD1 4EWAA 5I8YA 1R091 1OQ1A 4P5HA 1NY71 4M0NA 1MEC3 2HKXA 3WINE 1Q8QA 2TBVA 4RHV2 2Y26A 4RA0A 5ACA2 4Q4X2 4LBNA 4CDWA 3NV1A 3ZFGB 4JTNA 2PHDA 2IXCA 3TOJA 4JCKA 1LJ7A 1B35B 4Z07A 5IK8A 1RL3A 1WA4A 2EAAA 2PLV2 3L9JT 3M3CA 5AVAA 1SDWA 4D94A 2HWC3 3GYDA 5T55A 1PGL2 1OOPC 1QQP3 2UWCA 3FX3A 1CQ9A 4Y26A 5CADA 1ZZ8A 3S30A 1SBEA 1XE7A 2QDNA 4CDXA 1NCRC 2X53S 4CEWC 4AGVA 4LO7A 1TME1 1CESA 3IN9A 2WNEA 1OA4A 2PELA 1D4M1 3V64A 1SLCA 1O5UA 4URTA 3WW2A 2AYHA 3N3HA 3AP7A 4RD7A 5GKAC 1AR82 2H0VA 4NOTA 4L99A 4XF3A 5JZGC 2WNUA 1AXKA 2ETEA 4YVSA 3TBDA 1PIV3 1N1TA 2ZHLA 3VHPA 4AQ6A 4EN0A 3VBSB 1LGNA 4RS5A 3V56A 3MW3A 4YG6A 4U36A 3BCWA 1CIWA 2FZ1A 3SITA 3PMEA 3KGLA 1TMF1 4F7ZA 2DV9A 2XBO1 1UU5A 1BK1A 1RUD1 3VBHA 4COWA 1BCXA 4IEUA 1RGSA 4XXAA 2WINB 1W39A 2VY0A 3IT8A 2R061 2E6VA 4N90A 1FAYA 1ENXA 3J8F2 4JGYA 4XILA 3ZFGA 2XL7A 3H7YA 4MYEA 4K40A 3WG2A 2ZX1A 5GZEA 2R041 2JG9B 2ZKLA 2WQ4A 3H9AA 2P2KA 4QQHA 3RSJA 2YUEA 2ERFA 4DRRA 1VR3A 4TZDA 1KS5A 5CVRA 1WLDA 4B29A 2XVKA 4LO6B 1J3PA 4GB32 5AFEA 4LHKA 4M01A 5HCBA 4K21A 4PF5A 1NA1B 1SQ4A 1XU1A 3L2YA 4EN7B 1ZZ9A 3RYRA 4BH9A 1RUG1 3I2DA 1XXNA 3P3NA 5C8CB 5J09A 4KU7A 2WFF1 2X5IB 5J7MA 1NYWA 4QQOA 2GH2A 1YIFA 4IV1B 4P14A 4LLOA 5BNNB 3KT1A 5GLVA 4PLNA 3N35A 5A32B 3RG0A 2JE7A 2RR13 4LNVA 3VBSA 1IKQA 1AR73 5GLWA 1AVBA 3B9CA 5FO7B 4UXAA 1RUE1 3FLPA 1K5MB 5JLVA 5CAZA 2ZGOA 2PYTA 3EBRA 5FRAA 4FPJA 4YSFA 1QF3A 5KHHA 1V9U3 2V73A 3TB0A 4RR3B 1RIRA 3O12A 4I2OA 5KBFA 4UW3A 2JICA 2YY1A 4K3UA 1KDKA 1W6PB 4BZ4A 3OCPA 4YM3A 5LEJA 4EN6B 3KB5A 4J1WA 4PIYA 3U07A 2QQPA 1EAH1 4FPFA 1O3RA 2PHWA 5BV6A 2JG9A 3MIHA 3WDXA 3IBMA 2HEVF 3PMSA 3AP6A 1LULA 1YNAA 3DUIA 4JGZB 5CNAA 3SMHA 1QNWA 2NP0A 3BALA 2D3SA 3MZHA 3J9SA 3LOIA 4NR1A 4AGRA 4C0BA 1Z7S3 2XJPA 2YXSA 5JVVA 2P34A 4GQ7A 3ZPYA 5C8CA 2D6KA 4XOGA 3B5LB 3WD5A 3HWJA 4Q4Y2 4HLTA 4AG4A 1YXWA 1OA3A 4K7JA 3NAPB 4IV1A 4QM9A 1GZCA 1SLBA 3ZXLA 4AVCA 1RINA 3AKPA 4XXPA 5BNNA 2A70A 3WQ1A 4XTMA 1HIXA 1VBA3 5A32A 2HWF1 2GMEA 1S2KA 4P9IA 2XKOA 1PZ7A 4NWVA 4CDQC 1URXA 2XWJB 4HZFA 1Y3TA 3ZFFB 1MQTB 2ZACA 4I02A 2D97A 4ISQA 2EVXA 2YV8A 1VIWB 2ZX2A 4NHKA 4HFSA 1K5MA 3R05A 1WW7A 3O14A 3ST7A 2G4IA 1QOOA 4ZXKA 4RR3A 5IUQA 2BVBA 1SLLA 4YZ2A 1J59A 3WDVA 4WVVA 4YW2A 4GKXA 1W6PA 4L97A 1VLNA 4YFWA 4OFGA 4AEDC 3ZMOA 2D6OX 3LWCA 4KQ7A 1U12A 2WFPA 4XJ8A 1BVVA 1Q8VA 3AP9A 5JI9A 3E5UA 2DCYA 5DUXA 2D98A 1OPMA 1JTZX 2VW1A 1O4TA 4XJ9A 2GC3A 3QOPA 1LOGA 3R4SA 4JGZA 5AVPA 3I54A 2HYKA 2RJKA 1AR92 1IS3A 4FQ4A 1WUVA 1WW4A 1Q5OA 1UIJA 2PHRA 1CPMA 1NLSA 1KFUL 1QOSA 1PVC1 2DUOA 3WHTA 3NAPA 3DPRC 4LBOA 2OUHA 4N53C 3WDYA 4I3GA 1VJ2A 2WT1A 2A6VA 4LR4A 5JZGA 1XRUA 1H30A 4GULA 5AC93 1PO23 4QXKA 4QPGC 1W0PA 1CAWA 3ZFFA 4AHXA 3KCXA 1LHOA 5CFCC 1S0GA 1U5ZA 1RUNA 4COVA 3B3QE 4HKLA 1S0BA 4D3WA 2VG9A 5GLUA 1D0HA 4KWLA 2RS32 5C9AB 3MIBA 1GYKA 1UU6A 1H2KA 4FPHA 4XFFA 1W2UA 3NO8A 1W6MB 2F4PA 4LT5A 1HLCA 3IDCB 2VOWA 3VKFC 1LOFC 1RUJ2 3DF0A 4H7MA 2Q30A 1C8M3 2QDRA 1DZQA 4NN0A 5ACA3 3C2UA 4GIQA 3RQ0A 1FT9A 5EXOA 4ZU5A 3X29B 2W08A 1MEC2 2PLV3 4KGGA 3PVNA 4QPIC 1BBT1 5FTTC 2FHRA 1R1ZA 4AI8A 3KCCA 4RGAA 1QJU2 1S0CA 2UY8A 3RJRA 4AHYA 2WSVA 4FPYA 1AJKA 4HPKB 4GH4C 2BEOA 2BW8A 2SBAA 4QQ2A 3EXUA 4H7LA 2HWC2 4L8QA 5C33A 3QCWA 5ABJB 1QQP2 4TSVA 2Q8OA 1OPOA 1PZ8A 4ISRA 1W6QB 1X36A 2ARBA 1KITA 4C0HA 1VRH1 3AMPA 3E5QA 1WLCA 3ILFA 2WT2A 1FPN3 4OI2A 4M0HA 3VL9A 2IZWA 5BNOC 1V6IA 1OD5A 4K9SA 2BQPA 1POV3 3VZJA 1YWKA 1RUF3 1AL0G 1C5HA 1HXS3 3OY8B 3AJZA 4KU8A 5C9AA 1WLWA 2ZS6B 3FMGA 3MEPA 4Y1VA 1BEV1 3WVJA 1PIV2 4FT8A 2XL9A 5C8WA 1W6MA 3OTFA 3TRSB 3W9AA 1X8EA 2BWAA 3SCHA 3UJOA 2G9GA 1ULDA 2GN7A 2WQZC 4L9BA 2RMU3 3WNXA 4R4XA 3H3ZA 2VW2A 4F8AA 1OQDA 3JB8A 3RJ2X 1F31A 4BM8A 5JDBA 2D6MA 5FCCA 3E5XA 3AKSA 2GN3A 4FOQA 3AKQA 1WW6A 2AH2A 2BNNA