1R081

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 44
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1r08100
1C8M1 3M8LA 4EJRA 4N43A 4N43B 4LLFA 1ZBE3 3NAPA 2XPJA 1AR93 1VBE1 1AR63 1EV13 1X36A 1QJY2 5AC91 1VBA3 4NWWA 1PO13 2PLV2 1PGL1 1EAH2 1QJZA 4FTSA 5CFCB 1FMD3 1ZBE1 1RUH2 4Q4Y3 3VBHC 1AR91 1RMU3 4QPGA 1AR82 1NCQA 1COV2 1AR61 1QQP3 2RS11 5D8AC 1VBA1 4JGZC 1NCQB 1PO11 1X33A 1RHI3 4QPIB 5C8CA 1V9U1 1ASJ1 3VBRA 1FMD1 1AR73 3J8F2 4Q4Y1 4GB32 5C8CB 1RUI3 2RS31 1RMU1 4RFT0 1QQP1 2IZWA 3VBUA 5BNNA 1HQNA 5C4WC 1VBB3 3VBUB 4RHV3 3ZXAC 5BNNB 1BEV2 1ND3A 1F8VA 1RUC2 1PO23 1RUE3 1Z7S1 4Q4W2 1ND3B 2ZZQA 2WZR3 4GH4C 2RR11 4WM8A 1NY71 4AEDA 4WM8B 4RHV1 1IHMA 2BFUL 5CFCC 5L7OB 2RS53 4IV1A 1R1A1 1RUE1 1MEC1 4CEYA 5BNOB 4WM7A 3VBSC 3JD73 4CDXC 5DDJ3 1AYM2 2HWB2 1VBC2 4CEYB 1RUJ1 1PGW2 4NWVA 5ACA2 4QPIC 2R073 3JBG3 2RMU2 2R063 4JGYA 1K5MA 1RVF2 3VDDA 2BBVA 4CDWA 2HWE1 4JGYB 1FOD2 3VDDB 5DDJ1 1WCDJ 4Q4X1 1W39A 4CDWB 1PVC2 5C9AC 4CDQB 2R071 3JBG1 1AYN3 1TMF1 2R061 5JZGC 1TME3 2TBVA 5J96B 1MQTA 2R042 1RUG3 1HRI3 1AL23 2MEV3 3TN92 2HWF2 1MQTB 4RR3A 3CJIA 4N53A 1ZBA1 4CEWB 1SMVA 4YVWC 2HWC2 4RS5B 4RR3B 3CJIB 4N53B 1NA1C 3ZFGA 5L7OC 1TME1 4PDWA 3ZFGB 3VBOC 1AL21 5BNOC 2MEV1 4PDWB 2Y26A 1PIV2 2BPA2 2XBO1 1HXS2 1EAH3 5CFDA 2ZTNA 4CDUA 1VBD2 1RUH3 3IDEA 5CFDB 4Q4V1 2BFUS 1AR83 4CDUB 4FTBA 1COV3 1R082 3ZFEB 2BUKA 1QJU1 3DPRC 2RM22 5A32A 1VB2A 4CDQC 5FMOL 1BMV2 5A32B 1NCRA 3NAPB 3J8F3 4IV3A 1NCRB 1D4M2 1E57A 1COV1 1VRH2 4IV3B 5BNPC 1VAKA 1RB8G 3VBFC 1ND2C 4CEWC 4RS5C 1BEV3 4Y4YA 3J8F1 1EV11 4Q4W3 4QPGB 2X5IA 2WWSA 1C8M2 4GMP0 1R092 2WFF2 1DDLA 2X5IB 3ZFFC 4RQPA 5J98B 1HRV2 3VBRB 1BEV1 4RQPB 1VBE2 1RHI1 3ZFEC 2HWB3 1PGL2 1AR71 4N43C 1POV0 1RUI1 5ACA3 3JB8A 3NAPC 1AR92 1FPN3 2RS12 1FOD3 1VBA2 4FTEA 1PO12 1VBB1 1H8TA 4AEDB 1V9U2 1ASJ2 1PO21 5ACA1 1FPN1 2RS32 2WZR1 4IV1B 1RUF2 2R043 4QPGC 1QJX2 5FMOS 1QQP2 4WM7B 1NCQC 1FOD1 3TN93 1OOPA 2RS51 1OOPB 5C8CC 2HWC3 1B35A 1Z7S2 3VBRC 5ABJA 3JD71 1K5MB 4YVSA 3JB4C 5ABJB 1HX6A 2RR12 3TN91 4YVSB 5K0UA 1AUYA 1PIV3 1BBT3 3VBUC 5BNNC 4RHV2 5K0UB 1HXS3 1R1A2 1RUE2 1MEC2 1ND3C 1VBD3 2HWD2 1R083 1RUJ2 4WM8C 1BBT1 1AYN1 4AEDC 3LOBA 2RM23 1HXS1 5A33A 1RUG1 4GMP3 1HRI1 4IV1C 2HWE2 4CEYC 1QJY3 4Q4X2 4WM7C 2PLV3 5LK7B 2QQPA 3VBHA 1TMF2 2WS92 1BMV1 3VBHB 4JGYC 1K5MC 1RUD2 5D8AA 1POV3 2GSYA 4JGZA 3VDDC 1QJY1 4CDWC 2PLV1 5D8AB 4JGZB 1ZBA2 1EAH1 1R093 2WFF3 1RUH1 5FOJB 1TME2 4GB33 1HRV3 1AR81 1POV1 1MQTC 1AL22 5GKAC 2MEV2 5C4WA 1VBE3 2XBO2 5C4WB 1R091 1OPOA 2WFF1 3CJIC 4N53C 4RR3C 2FZ2A 1RUC3 4GB31 3ZFGC 1HRV1 4GH4A 4Z92B 4PDWC 4Q4V2 4GH4B 1OHFA 1QJU2 2RS13 5CFCA 1V9U3 1ASJ3 1RUC1 4Q4W1 4CDXA 3VBSA 5CFDC 4SBVA 3S6PA 4CDUC 2RS33 5AC92 1RUF3 3VBSB 1AYM3 4CDXB 1VBC3 4Y5Z0 1QJX3 3FBMA 4QPIA 1ZBE2 1M06G 2RMU3 1RVF3 1AR62 1EV12 1Z7S3 1NCRC 1RUF1 1AYM1 2HWB1 4IV3C 1VBC1 1C8NA 1QJX1 5C9AA 2RR13 1PVC3 1PGW1 1FMD2 5JZGA 5C9AB 4Q4Y2 1H8TB 2RMU1 1RMU2 1NOVA 1RVF1 5JZGB 1R1A3 1MEC3 2HWF3 1RHI2 2X5IC 4YVWA 1PVC1 2ZAHA 2HWD3 1NA1A 1AR72 5L7OA 1RUJ3 4BCUA 4YVWB 1RUI2 1A6CA 3HAGA 1NA1B 3VBOA 4RQPC 2R041 5BNOA 1B35B 1NY72 2HWF1 3VBOB 2HWE3 4Q4X3 1VBB2 2HWD1 2HWC1 1PO22 1TMF3 2WS93 1FPN2 2WZR2 1GFF2 1RUD3 3DPRA 1PIV1 4CDQA 3DPRB 2RS52 2VQ0A 1ZBA3 2FZ1A 1H8TC 1VBD1 2WS91 5A33B 3JD72 1CJDA 5DDJ2 5BNPA 1D4M3 1RUD1 1R081 1VRH3 3VBFA 2WLPA 1ND2A 4CEWA 5BNPB 1CD3G 2R072 2RM21 3JBG2 4RS5A 1VB4A 3VBFB 2XBO3 1OOPC 2R062 1ND2B 4GMP1 1B35C 1F2NA 5ABJC 1D4M1 4YVSC 4Q4V3 1AL0G 1C8M3 1VRH1 3ZFFA 1BBT2 1QJU3 2GH8A 5K0UC 1AYN2 3ZFFB 2DF7A 1RUG2 1HRI2 1NG0A 3ZFEA 5AC93 4FSJA
chains in the Genus database with same CATH superfamily
4KWUA 3M8LA 5FLJA 4JQTA 2JIJA 3PUHA 1RIRA 1NE6A 3ETQA 4JVAA 3Q9OA 4N43B 4K21A 1QWRA 3NAPA 2WR9A 1BCXA 3DF0A 4O9EA 2PTMA 2X05A 5FY9A 3PU8A 3QACA 2EIGA 4YGDA 3SLIA 2G19A 2JDAA 5A1FA 4QQPA 3SC7X 1X36A 2VQTA 4NWWA 1GANA 1ZRIA 3LA7A 4KH9A 1H2NA 3S5AA 1XB9A 4YGCA 3HNMA 1ZBE1 2DDUA 4N7IA 1RUH2 3UNPA 5FZ9A 2WWJA 3K77A 3OGJA 5FZMA 1TNRA 1O4YA 4IL7A 4QPGA 3NNJA 3W9AA 1X7NA 1QY4A 3DXUA 1MS0A 3DXTA 1QQP3 2AENA 3HIFA 2WNVA 1NCQB 5KC6A 2YBSA 1DBNA 1VLNA 4IEQA 4OI1A 4A42A 1V9U1 1WLTA 1RC6A 1UZ0A 1AR73 5FZEA 1UU4A 4LHNA 1IOAA 1IKPA 4MGKE 5KBFA 2ZGQA 2F6BA 2J22A 4A44A 1ZA4A 3N36A 2IZWA 3GBFA 2ZAAA 3MLKA 4DPNA 3O1MA 3VBUA 3PIGA 4DB5A 1W0OA 5EJZB 2E53A 2IXLA 3WOGA 3ZXAC 4C1XA 3ZMNA 2RDNA 3RQ0A 3KF3A 2NPIA 4AEKA 4Q0QA 1RUC2 1RUE3 1Z7S1 3C7HA 4Q4W2 3ZSJA 4BPZA 3MF9A 1RYYA 2DFCA 3V0BB 4QM9A 1QH6A 2A3XA 3D3AA 3R4DB 4CCLA 2ID4A 3P5BA 1OKQA 1NY71 1JYVA 2GN7A 4A7KA 4OHYA 1LU1A 2X29A 4UWDA 2O14A 4Z2WA 5CFCC 4COUA 4J1WA 5L9VA 3NJXA 3VUOA 1R1A1 3LDBA 4PIZA 3SH5A 2LM3A 1UY3A 1J3QA 1O59A 1PNFA 4CCCA 2Y8KA 5BNOB 3MW4A 2HWB2 2JG9A 3ECQA 3ZR6A 1NAEA 1WZXA 1ENSA 3B69A 5JMCA 2EXKA 1W8WA 1MS4A 4FPEA 4LUMA 4BYYA 5LA1A 3EBRA 4EV0A 4NWVA 3R4UA 4QPIC 3T2QA 3SKJE 1OFNA 1QDOA 4RFRB 4JGYA 5T55A 1RVF2 2GH2A 3ZYJB 5KWRA 1XRUA 1LHOA 3FWEA 4XFHA 4KG8A 4XQWA 3U37A 3W21A 2BBVA 2E63A 2HWE1 3VDDB 4FOVA 2D93A 2D6PA 2JICA 2YMZA 5L36A 4XBNA 2VQUA 2EXHA 4CDQB 1MS3A 2R071 1S0EA 5DG2A 2WN2A 3UKVA 3KVAA 5J7MA 1PVXA 1MQTA 1G86A 3U4XA 1RGSA 3O1TA 4M4PA 1G6NA 1HRI3 5B4XA 5IJRA 2QKDA 3NV2A 3IDCB 1IS3A 3KZ4C 1CONA 1U12A 2OYZA 4ITCA 4JKLA 3INAA 1Q43A 3MLLA 4RS5B 1DG6A 5AFBA 4P02B 3ZFGA 3KHCA 5FYCA 3ZSMA 4KGGA 1F5JA 1TME1 3R05A 4IDZA 1JH5A 4DXTA 2C26A 1YIFA 2JJ6A 2MEV1 1ENXA 3HOBA 4QGMA 4RN5A 4XIOA 4AHYA 4CU8A 2Y26A 4M3CA 4Y22B 4TSVA 1LOFA 1DGRN 2XBO1 3KHBA 2XJRA 2GP3A 1QOOA 1FT9A 3OPTA 5CA6A 2V5YA 4YW3A 2ZTNA 5I0UA 1RXGA 3MPPG 5GZFA 1RUH3 1W0NA 3KV6A 4XUNA 4Q4V1 4IE5A 4RGGA 1H9PA 1EY2A 4F8AA 4FTBA 1R082 1K3IA 3LEMA 2VD7A 3AZZA 3N9QA 2JEMA 3FLRA 1CZTA 5APAA 4A3XA 3H3LA 4FPGA 2FCTA 1S0FA 4AI2A 1ULFA 1KS4A 5A7WA 2FDGA 1XNBA 2DU0A 2GC2A 2JDKA 3PVNA 1S2KA 5DZFA 5FKCA 4AEMA 2P17A 4Y1XA 5FP7A 5FYMA 2YHJA 5BY5A 2AGSA 1NCRB 3ZO0B 4Q27A 4GWMA 2JG8A 1COV1 4BQ5A 4IV3B 2JDZA 4NIGA 1VAKA 5FZGA 2W9XA 3T0DA 1ND2C 4CEWC 5BPXA 4H2AA 5LBBA 1SFYA 4GZ9A 2CNAA 5JPNB 1YEWA 1S2BA 1QGLA 4OI0A 1EV11 3OB8A 4Q4W3 3T1MA 3ZXLA 2F17A 1BYHA 2CHHA 4EZHA 2X5IA 4LMFA 1GZWA 1UX7A 3GZTB 2WNEA 2QUOA 1UYXA 1R092 1LULA 1VPHA 3ES1A 2QQLA 1H30A 4IGQA 3ZXKA 1VMJA 4RA0A 1MS9A 4RQPA 5FOBB 3RZJA 4BOWA 2A6WA 4YLZA 5HBAA 1NYWA 4P14A 3B9IA 4MGZE 1H1MA 2AACA 5LBEA 5FJHA 4BB3A 2AEYA 1B09A 1RHI1 2DCKA 1U5XA 3N4MA 2HWB3 4GD4A 4LO7A 3RYRA 3C7OA 5IVFA 4R4ZA 4XETA 2Y33A 1OQDA 2A3WA 2IVIB 2OIIA 4ZXKA 1KQRA 1VMHA 2DTWA 3NL1A 4FAHA 3NAPC 2JD9A 2YV8A 3NV4A 4HVOA 4COVA 1HN1A 1MZFA 2NMOA 1MS1A 1NUKA 1JODA 1VBA2 4FXKB 1PO12 3IMNA 4PCRA 4LKFA 1JI6A 2YB7A 5LA0A 4AEDB 1KITA 1XYNA 3UJOA 3RSJA 4ARYA 4BQXA 4CSWA 1PO21 5CBLA 5IVBA 4XFGA 1LHNA 1QMJA 4PJYA 2JE8A 4XBLA 4Y20B 2OA2A 2WZR1 1H9WA 2E26A 1RUF2 4V2WA 4ZONA 4QPGC 1H8VA 2VZVA 1FOD1 2XL7A 3KLSA 4X8PA 3AKPA 3FHIB 3IM0A 3M2MA 4U2AA 5F5AA 1CX1A 1DQ5A 4HXCA 2W95A 2WNVC 3JQWA 4Q0UA 3WNMA 2WAOA 3E6CC 1O3QA 4AHXA 3A0NA 1B35A 2DCJA 2QQMA 3PLQA 5A3PA 1K5MB 1QEXA 1I3HA 2VGDA 4DO0A 1HX6A 2EICA 3IMMA 2BYVE 3HQUA 4PF5A 4QGLA 5DXDA 2W5FA 3TN91 1T6GC 5C3OA 2YYOA 3BB6A 2W92A 3PIJA 3VBUC 4QPWA 3WSOA 1SLCA 4CP0A 5HPOA 4RHV2 1OH4A 5K0UB 1OURA 2YXSA 2RJLA 2P34A 1KGYA 1MEC2 3QH7A 4OHXA 1F15A 5A7QA 1N3QA 3OY8A 4J6GA 4RD7A 3WQ7A 1IGOA 5I93A 1PHMA 4XJ9A 3ACLA 3U14A 3OPZA 4XQ4A 1KJLA 2DUPA 3OF1A 3BI3A 1R083 2BGCA 3O1PA 1SCRA 2VOWA 1CN1A 3D6EA 4QHZA 1HXS1 4AFMA 5FPUA 2QQNA 2EVXA 1YFWA 4UXAA 4OMCA 2TEPA 1BQPA 1H1AA 4LE4A 4U36A 5FZIA 4XMAA 4IGPA 4Q4X2 3KGZA 3ZMOA 2CYFA 3UGGA 3V0AB 2BU9A 2JG9C 1E5IA 4JRAA 4ONUA 4QKBA 3WT3A 2JE7A 2ZX4A 3H9AA 4HG6B 2W68A 4A6OA 4E4HA 1VR3A 4XTMA 4JAAA 3AMNA 1NXMA 3VBHB 2UWCA 4BXSV 4FFIA 4JGYC 1XNTA 1RUD2 1POV3 2GSYA 1JOBA 2VZ3A 1IQDC 3DKQA 3PL0A 1CAWA 2PLV1 5D8AB 4JGZB 3MW3A 3AL6A 2Y6LA 4UAPA 1HB4A 1JYNA 1EAH1 1R093 2XLAA 4CZSA 2H0BA 3GBWA 2DVBA 4DS0A 2RV9A 3MIHA 1L7RA 2WYFA 1AR81 3NKTA 1JHJA 1MQTC 1AL22 2ZGKA 5A7SA 3ZYFA 1S1AA 3IPVA 3VHOA 5C4WA 3A4UA 4JTOA 2FMYA 3PURA 4CUAA 4MXVA 5CKMA 4R52A 4O65A 3ASIA 3Q8CA 4Y33A 2ZBJA 3MI8A 2VAUA 3AZWA 5F5CA 4Q0SA 1LHWA 1GQPA 4QDRA 1GU3A 4PBPA 3U11A 1W9TA 5FZKA 1IPSA 1U5IA 1V70A 2UURA 2VZUA 1N3OA 3OBRA 4K8FA 1HRV1 4GH4A 4X8NA 5FPVA 5LA2A 3ZFGC 1S0IA 2AH2A 3LA3A 3PUSA 4QX2A 4Y5SA 4UI9L 3ZM8A 5T54A 5IK7A 3KQ4B 1Y9MA 1CESA 5IK4A 3ZYRA 5FY0A 3ACIA 2VCAA 4RYDA 4MGSA 2B39A 3HT2A 3OBZA 1RINA 1LOFC 4QT6A 1GP5A 4YG3A 4QGNA 4F7ZA 1YYNA 2ZGSA 1H2LA 3GZEA 4IW3A 3K4ZA 3VZMA 4XJAA 1CQ9A 1HQWA 1RUF3 5G04L 3DCQA 2WZ8A 4P08A 5FXZA 4CDXB 4R4XA 1VBC3 4K40A 3TEZA 3UV9A 3WQ1A 1W28A 3A0KA 2H6BA 1WBFA 4NR1A 2Y6GA 4P00B 4HT1T 1QDCA 3M70A 4DUXA 3NRUA 4NHKA 3RWKX 5KHGA 4AVCA 5F32A 5BXXA 4YW6A 1LRHA 3M3IA 4LHLA 3PVBB 3I2IA 4S2DA 2LRPA 3HJRA 3A7QA 1DIWA 4JZRA 2BWCA 3THTA 2X10A 5FO8B 1C8NA 2OUHA 4OZOA 1UMZA 3HVDA 2JG8C 3URFA 1OD3A 1FMD2 4NO4A 3RYPA 2VW2A 2XUEA 3WF3A 1OSGA 1R1ZA 5JZGB 1PK6B 1W0PA 1JXNA 4FPOB 1MEC3 3ZN6B 4HOOA 4N9IA 4CP9B 4TLFA 5FLIA 3F95A 2VZQA 4GIQA 1YI7A 3ST7A 1WA6X 1ZRFA 4LT5A 3I8TA 2EXJA 2XXZA 2V5DA 2X5IC 2HH9A 3VV1A 5FBJA 4Q0PA 5DABA 5FZOB 4NRPA 3QBQA 5JMOA 2AC1A 4YVWB 3BU0A 1NA1B 3VBOA 4RQPC 1GOGA 5BNOA 1A8DA 1O8PA 3MYXA 3ACFA 3AFKA 3JU9A 3VD3A 4LULA 3H50A 4QX0A 1ULDA 4XUTA 4FCAA 2VE1A 4Q4X3 3BODA 2JKBA 4BQ4A 2HWD1 3H8RA 2AR6A 1TQ5A 2HWC1 3UGFA 4AAPA 1FAYA 5CISA 2K46A 3NNLA 3VD7A 1ZZBA 2PHXA 3KCCA 3C7FA 4LEJA 1QJEA 1FPN2 2GP5A 1HV0A 1C5IA 1C5HA 1SDWA 1Q8VA 2XB6C 3U75A 2ZGOA 1RUD3 5EWSA 2DWRA 3W5NA 5F3GA 3C7GA 1SFPA 3LKJA 3R6SA 1Y43B 2FQPA 1LOCA 1POQA 1UOJA 3T4HB 1D2SA 4CDQA 3ZYIB 2RS52 5CEHA 4QB6A 5GLUA 2FZ1A 4MX3A 5FUIA 3SHRA 4AFBA 5A33B 3JD72 5DDJ2 1BVVA 3V65A 4XF1A 5EFUA 2WNUA 4COWA 1JZ6A 3POGA 5C8WA 5FFOC 3RZGA 3BIWE 5LBCA 2VUDA 4RS5A 2I07B 2QCSB 1VB4A 3VBFB 3ILRA 1EUUA 2PXJA 5JAXA 1XJAA 4PQ9A 4A7YA 4LBLA 2V72A 3T09A 2PHUA 1B35C 5KXCA 1F2NA 2ZGTA 1DZRA 1MVQA 3LSEA 1GLHA 4IE4A 3RPQA 1W03A 3SH4A 3V64A 1I1EA 4XAEA 3WDTA 2Q1FA 2JDNA 3OUHA 3VL9A 3FE5A 1HW5A 3KV5A 1BBT2 3OJBA 3MGUA 2ZX1A 1W6PB 2BNNA 1AYN2 4KQ7A 3VZLA 1OVSA 4PLOA 1OA3A 1CAVB 4NUBA 1ZX5A 4NMIA 1GP4A 3K3NA 4BXFA 1W2TA 4EQVA 4LO5B 1W6NA 2Y60A 2YU2A 1C8M1 2Y6JA 4M0HA 2ZGRA 4MYEA 4EJRA 1GUIA 3LB9A 4D69A 2ZMKA 3D0SA 4IEPA 5SV5A 3WHTA 2D3RA 4FPCA 2Z42A 5JOXA 4B7EA 4INDA 3MICA 2LROA 3NKGA 4NPRA 4NIDA 1ZYBA 1AR93 2ZJCA 4QM8A 1DGRA 3EJKA 4JKMA 1SBEA 5KXBA 1ODNA 2RJ2A 3Q8FA 1QJY2 5GALA 5EIYB 4Z2AA 1EP0A 1CJPA 1CAUA 1W3VA 4M3CE 5F1RA 4XABA 1M4WA 2XLGA 3ZIXA 4EROA 5L19A 1PGL1 1OQ1A 3O0XA 1FMD3 1LESA 1XNDA 2QQJA 3LA2A 2YBKA 2VVDA 4TYSA 4OI4A 3N3HA 3ZSKA 1JU3A 2HEVF 5F9TA 2UYAA 1QXPA 1XPWA 3LCPA 4SLIA 5JWPA 3AKRA 2RS11 3ZXGA 1BJQA 1X33A 4E4ZA 5IK5A 1YQ6A 3J26N 5C3SA 5C8CA 2P3JA 1ASJ1 5IHRA 1JHNA 3LPGA 1TZOA 3J8F2 1Y3TA 5FUPA 4NN0A 2GMEA 4GB32 2RS31 1ULGA 4LOTA 3WEZA 4W4ZA 2J1AA 1GZ9A 4P9GA 1OT5A 4GWIA 4I02A 5J37A 4AOCA 1QQP1 3LFIA 4XJ8A 1D2QA 4IETA 2BWAA 1AX1A 2CU5A 1NZCA 2XHKA 5BNNA 5JI9A 2O8OA 1HQNA 4JCKA 4META 2QZ3A 5C4WC 2XJPA 1PZ8A 1J3PA 1W8NA 4Q8LA 1W2NA 4Y1UA 2OKXA 1BEV2 2PAKA 1ND3A 1UZYA 3IN9A 5H9SA 3WQBA 1I6XA 1GR3A 4DRRA 1H4GA 2YUEA 2ZMNA 3OUJA 4GH4C 4LPLA 2WINB 4WM8A 5IVVA 2SLIA 5DMYA 5IWFA 4AVAA 2EF6A 2OS2A 3RG0A 4AEDA 1F4AA 2EIDA 3FFQA 3VLBB 1IHMA 4MOAA 1HQLA 2RS53 4XACA 1YNAA 4Y20A 1W6OB 2JDMA 1RUE1 4D8MA 3O1UA 2WO2A 4IEXA 4XF4A 1UZVA 2G1MA 1CZSA 2QZ2A 2XVGA 5I91A 3JD73 3B01A 4PLMA 4XF0A 1LCLA 1VMFA 1AYM2 5DDJ3 3CZJA 5FAXA 3FLPA 3WDUA 1IZ3A 3K48A 4ZPIA 3T3YA 4AG4A 4Y1YA 4CEYB 5CB7A 2JWPA 1JS9A 1OLMA 1SLAA 4OHVA 1PGW2 3ZKYA 3CMGA 3UGHA 4CPBA 2WWUA 3WLUA 2RMU2 1URXA 2F4PA 1W2OA 3LEKA 4BQYA 1K5MA 2PHLA 5LW9A 3AP6A 3WDWA 1HN0A 1D4VB 4CDWA 3ABZA 5KHJA 1CZVA 1OLRA 1WCDJ 2H0VA 4XPVA 4QX5A 2Y6KA 1FATA 1GYKA 3WCRA 4BHPA 1PVC2 1LHVA 2C6SA 4MXWB 3Q8EA 2WAAA 1O3TA 4ZXEA 5FYIA 2ILMA 1AYN3 1TMF1 4M4RA 4KWJA 3WZ1A 1S0BA 2TBVA 3I2JA 3I3DA 1KDKA 2V09A 3PTRB 3PVOA 5J96B 1NKGA 3U1XA 5FV3A 2HWF2 3I4IA 3JZVA 4NAMA 3WXPA 3CJIA 5BV6A 1ZBA1 1UYYA 3OYWA 4FPFA 4I2OA 3AYCA 1IS6A 4AE2A 4H14A 4RR3B 4N53B 1GNYA 4IGOA 3B5LB 4CU7A 4C91A 2W52A 3LSDA 1U5ZA 3HEIA 3QLQA 2XG3A 5H9RA 4E2SA 3VBOC 5BNOC 3WW3A 4PDWB 4M00A 1FYUA 5FYVA 3O5SA 5KXDA 2R16A 1Y4WA 3OGSA 2Q8CA 4GA9A 3WNOA 1C4RA 2XWBB 1SG3A 4IE7A 5A7OA 4LKEA 1PX4A 2ORZA 4KI5M 2YDEA 5A6XA 1WMEA 4E4DX 4XIKA 3WG2A 1Z0HA 4AHWA 3I3MA 5FY5A 1VBD2 1NQJA 4OVEA 5FJKA 4CDUA 3T0BA 3IDEA 3AZVA 1J83A 4YW7A 5CFDB 2B45X 3AP9A 4PQQA 3ZFEB 4YZ3A 4QDSA 1AF9A 2BUKA 4FPLA 3APBA 1JYTA 3THCA 1LU2A 2BGPA 2PYTA 4UW4A 4XW3A 3ROUA 3VKNA 2RM22 3W20A 4DINB 1ZREA 4CUBA 1WGPA 2ZGUA 1VB2A 3AKQA 1L3JA 4CDQC 2E32A 5FXXA 1DCSA 5CNAA 2XQRA 5A32B 4LA2A 3J8F3 5TSWA 1RITA 2VMEA 2R49A 1RL3A 1D4M2 3KWVA 2R1DA 4D3WA 2WO3A 1VRH2 2PN5A 1ZZ8A 1K12A 2WNUC 3LAGA 4XILA 5CKQA 3KV4A 5LEKA 4CUGA 4RS5C 2ES3A 2WABA 4FPYA 1QNWA 1BEV3 2A6ZA 2Q0AA 3KMHA 4FFHA 3N9PA 5JOYA 3IZOA 1OVPA 2Y64A 5GLVA 3ZYBA 4LTAA 4GXLA 1MS5A 2WWSA 4H7LA 2D98A 4AW7A 5JUVA 5FREA 4PI0A 4AEJA 2JDHA 2YGMA 4HZFA 1YIPA 1UIKA 4ZY9A 4D7TA 5F7UA 3VBRB 2N7GA 3EMRA 3ZPOA 3JXSA 4XOGA 4UYBA 5FCCA 1W05A 3PNAA 2UWAA 3KT1A 3SEEA 4CCOA 2JECA 5JXHA 2ZGPA 4P9IA 4LNVA 4YFZA 1YI9A 2XMLA 2ZS6B 1X8EA 1OXCA 2C9AA 2ADDA 1MZEA 1U5YA 2JB8A 4I0BA 2WL1A 2NM1A 1RUI1 5EV7A 3AK0A 3POJA 3I2FA 2Q8OA 2EAAA 1K42A 1QKQA 3H1YA 4AQSA 3E5UA 3J7HA 2QDNA 4KBBA 3P3PA 3I49A 2P2KA 4FTEA 1VBB1 1WLDA 3BGAA 3N7KA 2IXKA 5A7PA 3SCHA 3D5OA 1WBLA 4EWAA 4MSVA 1AX2A 1V9U2 4I09A 4QPYA 1DYKA 4BJ0A 2DCZA 3N9LA 5EHDA 5FOJB 1W9SA 3ILNA 4IV1B 3ZN6A 1N1VA 1A3KA 1TG7A 2G9ZA 4PT6A 3E6BA 3RJRA 4CP9A 5BNQA 1QJX2 2ZZJA 1ULOA 3B3QE 2DVGA 5FZOA 2AYHA 2W91A 2CV6A 2E9QA 4N8MA 5A7NA 5J1XA 3DKWA 1SEFA 2VQAA 3BPZA 1QOSA 1IPKA 1OOPB 3C2UA 3NNMA 4OUMA 4QX3A 3A22A 3RI9A 3U10A 1JTZX 1Z7S2 4PI2A 4DUVA 1D0HA 3PMSA 2VOKA 4GQ7A 3I2KA 3WV6A 1O7FA 3FBYA 4ZU4A 4A45A 5ABJB 4HLTA 4LBQA 4YVSB 3H8XA 3TWIA 2ERFA 5A80A 4KNCA 1LECA 1MPXA 5BNNC 3EQEA 3NMBA 4CCMA 2YC2A 1UZZA 1IG0A 1R1A2 3W58A 2JKXA 1ND3C 1VBD3 4KG0A 1W6QB 2D6KA 1REEA 4YZ5A 4K9SA 4GJZA 4AGVA 3SMHA 2ADEA 1JYXA 3WY6A 4WM8C 3M3CA 2PELA 2A6VA 2XL9A 1UOGA 2QQIA 2WSVA 3TBDA 4AEDC 4LHKA 2RM23 4DXRA 1O5UA 4XDOA 4M01A 4IERA 5A33A 1RUG1 2QBXA 4FOWA 4DNYA 4AI1A 1BK0A 3QH6A 3VZJA 3OGVA 4E8DA 4IEWA 4LBKA 4XE9A 2HWE2 4IUGA 3SKVA 4S2HA 5A70A 1GP6A 5K4LA 2D6NA 3TB0A 2B9UA 3I3BA 4LITA 1UYPA 3WNKA 4FP2A 3UKNA 3VKLA 4UBGA 3PDQA 3QOPA 4XF9A 3BU7A 2B8MA 2D40A 3OG2A 4L92A 2WS92 1LOGA 2B4KA 4DEQA 1ODMA 4JKKA 1UU5A 1K5MC 2O0OA 1ZA7A 2YU1A 4LE3A 1W6MB 4XXAA 1N3PA 4IEVA 3UYJA 3ZSLA 4CDWC 2ZEWA 5DAVA 4YZ1A 2CWSA 4NROA 1W6PA 5KHHA 4FOYA 1ULCA 2JD4A 2OVUA 3RI8A 4HMZA 4EN8B 3ATGA 4HPKA 3UL2A 1CAVA 2YC0A 2ZKNA 1TME2 4LHSA 4RGKA 3AKSA 3NV1A 4G9SB 4CXXA 4D94A 3MIGA 1BVP1 2ZHMA 4FVVA 1JOJA 1POV1 3WP4A 2MEV2 2YG0A 2A71A 2D6OX 3CEWA 4JX0A 4Y5TA 2IXJA 4FFFA 1NQDA 4E8CA 2WO7A 2B42B 2XBO2 5E88A 5F37A 3TEYA 3GGLA 1R091 1OPOA 3CJIC 3GNEA 1OPMA 1W90A 3VL8A 1WLWA 4YG0A 5EYYA 3WDXA 2W39A 1RUC3 3RZKA 3OTFA 2B46X 4WBBA 3FMGA 4Z92B 4Q4V2 1SLBA 5GZDA 3KS7A 4UW5A 4XUOA 1WCSA 2DV9A 5A3TA 1OHFA 1Q8SA 5FK7A 2ARBA 2I45A 3I2DA 3NQHA 2Q5TA 4H55A 2XH6A 4YM3A 3WF4A 1SPPB 3ME2A 3CDZB 1FNYA 5DQ0A 1V9U3 2O1QA 4ZU5A 3CL1A 3VBSA 1WD3A 3S6PA 2GALA 1WD4A 3H0OA 4AVVA 4CDUC 5AC92 4F83A 3TEXA 3F2ZA 4R9BA 3GXUA 4Y5Z0 1QJX3 3FBMA 2DVAA 4P9JA 5I0SA 4C0HA 3AFGA 3ZKUA 4N9HA 2Q1ZB 2RVAA 1DP0A 2VZSA 3B00A 5C5TA 3QCWA 4LKSA 1RVF3 1PM4A 3MPBA 4K3UA 5LB6A 1AR62 1EV12 1Z7S3 4BZ4A 5C5UA 4GKYA 3VHPA 4DFSA 1GV9A 1RUF1 3IIIA 3I59B 5IAXA 2AREA 1VBC1 5C9AA 2WQZC 3VGIA 4J1XA 1LGNA 4GWNA 3JUUA 3MV11 3DEMA 2BEOA 3ON7A 4Q4Y2 1H8TB 2CGPA 1RMU2 3AMQA 2VNVA 3J4UH 3K4AA 2C5DA 5F3EA 3AZYA 1R1A3 3USSA 3WX5A 1F5FA 1K5JA 2J1VA 3WVJA 2EIEA 3WQ0A 1WMDA 3HQXA 1RHI2 3AVRA 3VKMA 3PUQA 4PF1A 1J59A 3GYDA 4J25A 3WNNA 1J3RA 3DYMA 4AFAA 1XC6A 1DGLA 3AVSA 3GHMA 3WG3A 4BCUA 5C6CA 1O4TA 5FY1A 1GSLA 2K0GA 2QDRA 5E6HA 2R041 1HB3A 2W0XA 4HN0A 3T2TA 4CUCA 2NP0A 1RJ8A 2A6XA 5FO9B 4TLGA 1SQ4A 2P6CA 4H3WA 5JPMB 5FP8A 1XSQA 2HWE3 3POWA 4AFCA 2XJQA 1DF0A 2QQUA 1NE4A 3PJQA 4KGQA 3CHXA 4CCNA 4DQAA 3SCGA 1PO22 2D7FA 5FRAA 2VR4A 4ASLA 2QNKA 1YFUA 2HEWF 2WS93 2WZR2 2VXJA 1WKYA 2KM2A 3OUIA 1V6KA 1GFF2 1TEIA 2YBPA 1UKRA 2E51A 4A4AA 3DPRA 1PIV1 4EN0A 1VALA 1UMHA 2BZDA 5C3RA 1CX4A 3QD6A 2J1TA 3X29B 4BA6A 1JMUB 3VDCA 4EE2A 2P37A 1JUIA 2PHTA 4LKDA 5K9YA 1SCSA 4AR2A 4LBMA 2QE3A 4EYUA 1VE0A 1CJDA 5GLZA 3WW2A 3S7EA 3NJYA 1AXKA 5FLHA 5LASA 4JHZA 2ZEYA 5BNPA 1RUD1 4JDMA 5FZ4A 2VUCA 4COYA 4YGBA 3HPNA 5F3IA 4WVMB 3WP3A 1OLME 3JBG2 3AP7A 1E5HA 2XBO3 1GWMA 2R062 3L2HA 3USUA 4QWNA 1ND2B 4GMP1 3HBZA 3MBWA 2WSUA 4BLIA 1HLCA 2WN3A 2WA4A 3O12A 2FCUA 5FY4A 3L2YA 2VOXA 4HBNA 1OFSA 4Q4V3 3MLJA 4XURA 4QX1A 1N1TA 3ZFFA 1S2EA 4BK4A 3LFMA 1YQ8A 1YLLA 3U07A 3WNLA 2DF7A 3MW2A 5DAQA 2YPJA 3FUQA 5FK8A 3J7LA 4HK9A 2PAMA 4D6RA 1NG0A 3ZFEA 2ARAA 2FDJA 5AC93 2Q8DA 1WW4A 3WW4A 3E97A 4N43A 2PHRA 1OA2A 4Q5OA 1ZRDA 3ORJA 3LIHA 1JYCA 2J7MA 4LLFA 3OD4A 3WDYA 1UN1A 2DUQA 5H9PA 2XPJA 5IAVA 4A6SA 5F39A 1IS4A 3BPSA 1V6LA 4FQZA 4TWTA 1VBE1 1AR63 1EV13 3FUOA 1VBA3 1KFXL 1PO13 2PLV2 5LRRA 4E2GA 3ZLIA 1G9BA 1EAH2 1QJZA 2BTVC 1KRIA 4FFGA 3WP5A 4PIYA 2VCMA 4Q4Y3 2J1SA 1CPMA 2HEYF 3VD9A 1AR91 1RMU3 5JXIA 1AR82 1NCQA 1ST8A 4AAXA 3VKOA 1VJ2A 2P3IA 3RGBA 3SXWA 4QKNA 4XJUA 1QHDA 4ZHNA 5D2AA 4WZFA 5K7PA 3ETPA 1RHI3 2ZA9A 2PFWA 2WNVB 3VBRA 1FMD1 1NLQA 3K2OA 3K4DA 4QQ2A 5IK8A 3UKTA 5A6YA 2L9LA 4G3YC 4RFT0 5IVEA 3SEPA 1OQEA 2IC1A 3TYJA 4BK5A 1U0AA 2WT1A 2VMFA 3ZDVA 4QU2A 1KEXA 2E7QA 4BM8A 1W8UA 4RHV3 5CZKA 3VBUB 3OBAA 3V0BA 5FYBA 5BYNA 2R1BA 2BNOA 3IBMA 4JDNA 1V6JA 1F8VA 1PO23 4HETA 1DQ6A 1N47A 1QJFA 5FP9A 5FY7A 5IATA 2F4LA 2ZZQA 1BHGA 2OPWA 2WZR3 2WQ4A 3H3ZA 2RR11 5T5OA 4QX8A 2BBAA 3KVBA 2WJSA 1DU3D 1YQ5A 4YW4A 2VTXA 1YHFA 2G4IA 1UL9A 2BFUL 2GMPA 5L7OB 2PQSA 4IV1A 3ZYHA 1EPZA 3I3QA 2VULA 1EYBA 3PHMA 4NPLA 4IEZA 3BOWA 3VBSC 1JYIA 5LY1A 1LGCA 4L99A 4UW6A 1RUJ1 1J58A 2VMGA 3TAYA 1YFYA 5ACA2 3JBG3 2VC9A 3BIEA 4P9WA 5A3WA 1I9RA 1OA4A 2BOJA 2R063 4QX7A 3VDDA 4IXLA 4ZKTB 4YM2A 2DVDA 1DYPA 1PZ9A 3ZPYA 4A41A 4JGYB 2QJVA 1FV3A 1C57A 1UPIA 5DDJ1 3VDAA 4YM0A 1SLTA 3KQRA 1W39A 5LZ6A 3NNGA 1UF2C 3WD5A 1XE7A 5C9AC 3I7DA 3AP5A 2AUYA 3ITQA 1VAVA 1JZ7A 3D0JA 4YARA 5I8YA 5ERLA 5FR3A 1G9AA 4IESA 2XR4A 1H6XA 1CIYA 1STMA 4LIVA 2RJKA 3NWKA 2LALA 4Z1VA 1AL23 1ONAA 5FKBA 1MQTB 2Y34A 3WDVA 1DFQA 4DEVA 2OZJA 2XJTA 4XEZA 1UW8A 4EN6B 4AF9A 5C71A 1YRZA 3KV9A 1SMVA 4MO3M 2OUJA 4AK3A 1HV1A 2HWC2 4BISA 2PAEA 4YG6A 4Z82A 4QXCA 5JDBA 2ENRA 1YXWA 3ZFGB 4HSJA 4Y22A 4ZS3A 4Z8BA 1O3RA 3E1F1 5T5JA 2WKKA 2V4VA 2YFUA 3O7OA 4QHBA 2C1FA 3G6JB 1W8ZA 2RDSA 2B9VA 2VVEA 3S7IA 1QIQA 2IXCA 1E5SA 4B1LA 3P6BA 5FZ1A 2GZWA 2VZTA 1W99A 4B4PA 2VBPA 3MUY1 4K1ZA 3VN4A 4DRVA 1EAH3 3AMMA 1UOBA 1OF4A 3AP4A 4LK6A 1ZNPA 5A3NA 1Q8OA 3AL5A 2CY6A 2EIBA 2BFUS 1JN2P 1AR83 1EUTA 2H6CA 1Q56A 5GJ6A 2GC3A 1QJU1 1X50A 2VMCA 1S4CA 2VCCA 3DPRC 3ES4A 4COZA 1F9KA 5IW0A 3RMYA 1OF3A 4M3CF 5FMOL 2BVBA 1BMV2 5I8SA 5CYYA 1NCRA 4GULA 2ZGNA 3U4SA 3GALA 4XDPA 2RE9A 2W94A 3HBKA 3H42B 4IV3A 5F2WA 1FV2A 3ZYGA 4BE3A 2XQXA 5BNPC 4XZUG 1KS5A 2DCTA 4I3GA 3WF2A 1RB8G 4UFIA 4PBOA 1KFUL 2WIIB 3IAPA 5FZHA 1UQXA 3A23A 2XWJB 2WZPP 4MGIE 3J8F1 5CIRA 4CE8A 5FYTA 4ATFA 2JB4A 5C8CC 1GQHA 2W2IA 4OHZA 3IKWA 5JR2A 1C8M2 3FC0A 4MZUA 4GMP0 3BCWA 2KA3A 1YFXA 3MIDA 3N9MA 2WFF2 5L9BA 1DDLA 4K7JA 1SPPA 1UCXA 2BW8A 1GZWB 2ET7A 2R6QA 2X5IB 1NT0A 3ZFFC 5C3PA 3AJYA 1O6UA 4XFAA 1WUVA 1XXNA 1MZ6A 1BEV1 2VNGA 2E33A 4FAGA 1J1TA 1UXZA 2XDVA 3EB7A 4RQPB 5DAPA 2Y6FA 5EQUA 5FZCA 4LBJA 4E27A 3MO4A 2D3SA 5IVCA 3CQOA 4A7ZA 5C3QA 3ZFEC 3AC0A 2MPFA 5C33A 1V6OA 4AGRA 1PGL2 1XU2A 1AR71 4N43C 4YGEA 2WUHA 5ACA3 4QKFA 2XJVA 3NW4A 3DUIA 3FN9A 2WT2A 3IB3A 3JB8A 1FPN3 1MACA 4GALA 3AMHA 4ES8A 5ANQA 3I59A 1GMMA 4QQHA 1LOAA 3KF5A 2RS12 3VZKA 3W5MA 5FXVA 4Y1ZA 5DZEA 1X9TA 1H8TA 2IFWA 4JC1A 1GWLA 1H0BA 1ASJ2 4CA9A 2FDFA 1VAMA 2DBIA 1UU6A 2BVVA 4WVVA 2RS32 5FWEA 5JOWA 4CCJA 2CDOA 4ATEA 2X09A 4I30A 5EPAA 4HK8A 3ZR5A 3LD8A 3BVCA 1AJKA 5FMOS 1QQP2 4WM7B 4YRDA 1NCQC 4FO9A 4AI3A 5LEJA 1APNA 3G7DA 5HCBA 4ARXA 4P5HA 3ZN4A 3K75B 2E31A 2P3YA 3NO8A 2C4XA 1XYOA 1ZZCA 3VD4A 1JZ8A 5HXVA 2HWC3 4MGYE 1A8MA 3VBRC 1BXHA 4MGTA 4K20A 1UX6A 4RL7A 2QQOA 2ZACA 4NHYA 4YPJA 1O5LA 4NRMA 4NIHA 5K0UA 4HN1A 4BQ3A 2I2SA 1ULPA 1AUYA 4AI8A 2ATFA 4LA3A 1BBT3 3SH3A 4XHXA 1NX9A 2VMHA 1ULEA 1CWPA 1UY2A 3EYPA 4LUKA 2CL2A 3GDBA 5JXGA 1RUE2 5A3MA 3OGGA 2VU9A 3N7JA 1GOHA 3MV01 2BERA 2SBAA 4CRQA 2EA7A 3RS6A 4BIOA 3UK9A 3GJBA 3LWCA 1WCQA 4QDQA 4QXBA 5GZGA 1WW5A 1W9WA 1ZM1A 3OEBA 5JXJA 1S0JA 5GLTA 2DURA 1OMIA 1DLCA 3RZLA 3LOBA 2J42A 5FO7B 1XNAA 4X6RB 4ASMB 5KC5A 4CPBD 1FXZA 1HRI1 4IV1C 4TTGA 1TE1B 4BU2A 2RDQA 3V0AA 1UY1A 1CPNA 1QJY3 3NV3A 4AYUA 5JI7A 4KWKA 1HKDA 3LGRA 4W6WA 4MADA 1JZ2A 1IQAA 2R0FA 5LWBA 3LEGA 1G9FA 3ZIWA 3NJVA 2GU9A 3VBHA 5KHIA 3N9OA 1TMF2 2WQ8A 2VOTA 5FZ6A 3MZHA 3DN7A 2QQKA 3TEWA 3OBTA 3D4KA 4NHLA 5DUVA 1L7LA 4IQPA 5D8AA 5F2SA 4JGZA 1QNYA 3VDDC 1W2AX 1V6IA 1WCUA 4XUPA 1NZIA 4CXWA 1W8TA 2OT7A 1Q5OA 1X9PA 2R30A 3ACHA 1AX0A 1ZBA2 4OYUA 1DQ0A 3OGRA 2WFF3 2BOIA 3E5XA 1GBGA 2RG4A 2YC4A 1RUH1 3GCXA 2YZ4A 4GB33 4LXLA 5JLVA 4XCBA 1N1SA 3AKTA 4Q29A 2W1UA 3LEIA 3VHNA 4KL1A 1W3XA 1V6MA 2R32A 3IDAA 5GM0A 4AI9A 3IIAA 1UKGA 3DECA 5FXWA 4DY5A 3IPVB 5C4WB 1CIWA 3RMXA 4L0PA 2Y0OA 3RZMA 4LOSA 1J84A 3J7NA 3KCYA 4UFHA 4L2NA 1H6YA 3FHQA 5FZBA 2FZ2A 5T3NA 4GH4B 4AWDA 1H2KA 2O8QA 3LOIA 2RS13 4ZZ5A 4Y26A 3BKZA 4MLOA 3VD5A 5JCTA 2UWBA 3LPFA 4C8DA 4D7SA 4DXZA 1ASJ3 2HYXA 1LR5A 4CU6A 1RUC1 4Q4W1 4CDXA 2UU8A 4NHMA 3SNMA 2RS33 4NAOA 2ET1A 1KDMA 1KJRA 4FT8A 4QXHA 5A3UA 1AYM3 3SITA 4Y4RA 4YW2A 2A6YA 4LORA 2XVKA 4UW3A 4WVWA 4B3NA 1SLIA 1ZBE2 4MHRA 1LB2A 1W8FA 2RMU3 1UIJA 4AHZA 4K1YA 1NCRC 1LOBA 2IUWA 5IT6A 2HWB1 4IV3C 4A3ZA 1QJX1 5J3UA 4C90A 3B94A 4NE9A 1PVC3 4W6XA 2C0ZA 3WF0A 3BUCA 1OLQA 5DZGA 3OEAA 5JZGA 1PK6A 2BDRA 4ZU7A 4URAA 3AX4A 3K3OA 5G05L 1RVF1 2XUMA 3AB0A 1N1YA 2MNGA 1NLRA 5DUXA 1LODA 1OUSA 3T08A 1RUNA 1CAXB 1PX3A 4O7XA 5LATA 4O9GA 2HWF3 3UESA 1KXGA 1UMIA 4DUWA 1JZ3A 3DL3A 2VW0A 3HD8B 5CAZA 1D0GA 3POSA 4YVWA 1SDDB 4XCAA 1SBFA 2ZAHA 1H1IA 5E1RA 1NA1A 5L7OA 4BDVB 3IT8A 4HKOA 4YNIA 4JQRA 5FTTC 1YJKA 1RUI2 1A6CA 3RWNA 2NN8A 3VB9A 4CCKA 4ISQA 4BWOA 5FPLA 1OH3A 1C1FA 3BTXA 4UFLA 4TZDA 4CXYA 2BQPA 2Z2SB 3UT0A 1NY72 2ZXQA 3U0ZA 2ZPXA 3BTYA 3VBOB 5GZEA 2ZHNA 4XTPA 5M0TA 4P5YA 2W87A 1AZDA 5A3LA 1VBB2 5FIXA 1G9CA 4LBOA 3B7MA 2ZOEB 3N7MA 1G9DA 4GJYA 1T6BX 5FYUA 2Q4SA 1JYWA 1WW7A 3SQOA 2NLRA 5FZ8A 2IXIA 5LA9A 4E2QA 1TMF3 3EXUA 2PA7A 3MIEA 3RZZA 3POBA 3HN3A 4Q1RA 2IXHA 4LO8A 3HMYA 4UFJA 4WZCA 2VMDA 4FXGB 1JBCA 1E5RA 1QF3A 1VIWB 2GNMA 2FCVA 5HCFA 1ZBA3 4W6YA 3N9NA 1H8TC 3NNFA 2ZMLA 2BV4A 2WS91 2PQQA 1CVNA 4K8RB 5SV8A 2D6LX 2VUAA 5IVYA 5HV4A 1D4M3 1W9FA 5FQ0B 1R081 3H7JA 1VRH3 3VBFA 4AL9A 1FNZA 1ACCA 3H1MA 2R072 4LBQD 2WNUB 3ACGA 3GZAA 2OZ6A 3T30A 4P9YA 2WT0A 2PHWA 5CKNA 4FPJA 4OUSA 5E16A 5IFPA 1LTEA 1AVBA 1PMJX 2VCBA 1US3A 2A73B 4ZS2A 1WW6A 3T4VA 4EWEA 1GNHA 2YGLA 3GCWA 2VG9A 1AL0G 4YWAA 2B5HA 3FHAA 1JZ4A 1C28A 3ELNA 3VHRA 1IG3A 5K0UC 1RJ7A 2Z4FA 5F6LB 1A34A 4LIUA 4MV2A 4BH9A 1WA4A 1Y9QA 5FZLA 2WNOA 1RUG2 4EN7B 4XJWA 4C0BA 3PMEA 2YROA 3I3EA 2HJIA 4DXSA 3CZUA 4HONA 2A5ZA 5FDBA 4QAWA 1LKNA 4CYDA 2W1WA 4FSJA 1WMFA 4D7YA 1W6NB 2D5HA 1SZBA 2DCYA 2VECA 4HVQA 5A6ZA 2ARXA 4FI9A 4IE6A 1ZBE3 4JV4A 4BLJA 3PJYA 5LBFA 2JE9A 1J1LA 4FPHA 2WYSA 3RYKA 4GWJA 1H4HA 2VO5A 3WUDA 1YC61 4WV8A 1HJFA 1XNKA 5FZDA 3CKHA 3JCIA 3AZXA 5JSRA 3WW1A 5AC91 3IAQA 5KXEA 2YFZA 1LOEA 1YCIA 4AZZA 2DVFA 4XAAA 2XLFA 2WZEA 1US2A 3MF6A 4YYOA 3THDA 2ZHKA 5CFCB 2CDPA 1TVGA 2NMNA 4QXKA 1CAUB 5ISLA 3HNBM 4FTSA 2IWGB 5FMBA 3VBHC 3BTZA 2DBNA 1NLSA 4DOUA 4YZ4A 4E9KA 1COV2 1AR61 1S55A 3POEA 2WRAA 5D8AC 1VBA1 4JGZC 3AXEA 3WF1A 1PO11 4UFKA 3I2GA 2XGXA 3OD0A 4AVSA 2EXIA 2FMDA 3BN6A 3Q8AA 4QPIB 3KGLA 3GM8A 3BYWA 3FJSA 1ZVFA 4Q4Y1 2J1UA 3O1VA 2VTXJ 5C8CB 1RUI3 1RMU1 2A70A 3J7MA 2FBEA 5JVVA 3WG1A 5I8TA 2TUNA 1GOFA 3GZUC 3IDBB 1LHUA 2QTWB 3LIGA 3WNPA 1JZ5A 2WFPA 4RSUA 2Q30A 1VBB3 5BNNB 4Q26A 5FZ7A 3WP6A 4HSLA 3M1HA 5B2GB 5LY2A 2HLEA 1PNGA 1IS5A 1DHKB 2EAKA 5J48A 3W59A 1ND3B 2XJUA 4MGQA 1C1LA 1XYPA 3CNAA 2EALA 4NVPA 3ILFA 3THPA 3NJZA 4XVHA 1S0GA 3PTYA 3ZXFA 1GQGA 3DYOA 3O1SA 1LAJA 1W6OA 4LK7A 4WM8B 2JENA 3KT4A 1OC1A 2WBKA 4RHV1 3WG4A 4BMBA 5A6QA 1MS8A 3LF7A 2C9KA 1HIXA 3KB5A 1MEC1 2BNMA 4CEYA 4WM7A 5JIAA 4TXWA 5FP4A 4CDXC 3N35A 2VZOA 3LE0A 2GDFA 2W1QA 3WCSA 1YQ2A 5J09A 1VBC2 1XE8A 2Z69A 2YY1A 1GZCA 5T5LA 5K8SA 1LNSA 2NQYA 2R073 3Q8BA 3WUCA 5IFTA 2PMWB 1QXJA 3D8CA 4OHWA 2D5FA 4B1MA 2KR2A 1JUHA 1V00A 2JDYA 1HB2A 4O61A 3P1IA 5JIUA 3H3UA 3AM2A 4W50A 2OQ7A 1FOD2 4OUEA 1PMHX 4Q4X1 4MXWA 3AXDA 1VP6A 4FQ4A 2CGOA 5FYYA 4URTA 4MH0E 4CDWB 1X82A 2VM9A 2VZ1A 4L8QA 3JBG1 3I2OA 5EXOA 2R061 5JZGC 1TME3 1UPSA 4R9AA 3RDIA 1PK6C 3EHKA 2R042 1KD7A 1RUG3 3EO6A 2Q8EA 1MVEA 4KU8A 3ZSEA 1D7PM 2MEV3 3LQCA 5AVPA 2KD7A 3TN92 2IFRA 1QXRA 2HBTA 3FLTA 3MFCA 4Q1PA 4UOJA 3S30A 4RR3A 4N53A 5IUQA 3S57A 5DUUA 1MR5A 3BALA 4CEWB 5L73A 2KXLA 4YVWC 3T2OA 4FBFA 2BJSA 3CJIB 4CVUA 1NA1C 5L7OC 2HYKA 3OYWB 4PDWA 1MZ5A 2VZPA 5I0DA 1WMXA 3CO2A 3R4SA 5T50A 2VMIA 1AL21 1S0CA 1OI6A 2E7TA 1L7QA 1PIV2 4PHZA 2BPA2 1HDKA 3M4FA 3O14A 3IWZA 3DV8A 1OBNA 4HKLA 1A78A 4QQLA 4UF0B 3WINE 1HXS2 3WR0A 4F3JA 5HCHA 2FDHA 3MHZA 2RHPA 4B7KA 5CFDA 3KT7A 5FPAA 2VW1A 4QMAA 3FL7A 1FI2A 3ZVXA 1DLLA 2K2SA 3M3EA 4G4FA 5F5IA 2X53S 4CDUB 4V2VA 5FYSA 1COV3 3LDKA 4HFSA 1GNZA 3OCPA 4D6QA 2BRTA 5A32A 5CG9A 4XXPA 1UXXX 4GKXA 2VPVA 3GF6A 5FPBA 2R0HA 2VXRA 4W8JA 4Y3OA 4OMDA 5GZCA 3NAPB 4IEOA 5H9QA 1UZWA 3POYA 3O1OA 4XBQA 4HL0A 4I3PA 2Z5WA 4R9DA 4V1PA 1E57A 2A3YA 4XZPA 1XU1A 4Y1VA 2GMMA 4C1WA 3POIA 4OLLA 3VBFC 5F3CA 4ASKA 3MUZ1 2FDIA 4HANA 5E8AA 2Y0IA 2OPKA 1W2UA 5FUNA 1O91A 2ETEA 5A1LA 4Y4YA 3I97A 2K9ZA 3VZOA 3WHUA 1DQ4A 1O8SA 4BQ1A 4QPGB 5I0RA 2DFBA 2CAUA 2CAVA 2J1EA 2W47A 3E6DA 1T2XA 3AMPA 3NSTA 1DQ1A 5ANNA 1ZZ9A 3I54A 2MHFA 2NZ9A 4YFWA 3ZX7A 2HKXA 3SISA 1IPJA 1PM7A 1VRBA 1F4HA 1GKBA 4GAZA 4LO4B 5J98B 1HRV2 1XE0A 4KU7A 5CU1A 2XKPA 1S0DA 1ZZ7A 2JDUA 4AXOA 5JSPA 3D82A 3OSDA 1F31A 5F5QA 2JXAA 1VBE2 1X8MA 5B4NA 1UY4A 1UO9A 1V0AA 2WO1A 3WNXA 3FZ3A 2LS6A 3I2HA 1UY0A 3LZZA 5CVRA 2ZEZA 3RNSA 1POV0 2XKOA 2VH9A 3ALQA 4Z07A 4OQ9A 4AQ6A 2OQ6A 4CP1A 3E5QA 4LO6B 1AR92 3ZOIA 2P1BA 1WLCA 3M3OA 3ZXEA 2FHRA 2VNOA 3O0VA 5FZAA 5AFEA 5C70A 2QFEA 1Y9GA 2ZABA 2W46A 1FOD3 5T5PA 4XYXA 4Q8KA 1W06A 2ZGLA 3DGTA 3J9SA 2I74A 4QQOA 2A75A 4TN7A 5DAWA 3C8XA 5DAXA 5HV0A 2P4EA 4XUQA 5ACA1 4XFFA 2BGOA 1OKOA 1CAXA 1FPN1 3TNPB 2FDKA 2GNDA 5DPNA 1REDA 4AVBA 1BKZA 2R043 3B93A 3JQXA 3BTAA 3LDRA 2YPDA 4P9XA 4BQWA 3T0AA 3TN93 4UBHA 3ZN5A 2VNRA 2JG9B 4W65A 1NXD1 1PMIA 1OOPA 2WDBA 4CU9A 5HCAA 2QQWA 4ISRA 3ZXDA 2PHFA 2RS51 2W3JA 1GZTA 2VY0A 3AYDA 2ZX0A 3UJQA 1I5PA 3GBGA 1PGSA 3HNYM 5ABJA 3JD71 4PLNA 5FBZA 5EJ1B 4YVSA 4B4RA 2WC2A 3FFZA 4XJZA 1PZ7A 1UOFA 2QVSB 3JB4C 4AFDA 1QOTA 2R7EB 4DMIA 2RR12 4KWLA 4Q2FA 5EP9A 4NJ4A 4KMQA 1PIV3 1R64A 4N90A 5FP3A 5J36A 1ZRRA 4CP2A 1SACA 4LBQB 4B29A 4NPMA 2G9FA 4LR4A 1G7YA 1HXS3 3PVEA 5JR7B 3TRSB 1W6QA 1W8OA 1UWWA 4XFIA 1I5ZA 3MDPA 1BZWA 1ENRA 4JHTA 2VL4A 4IEYA 5C7GA 3RZHA 4I0WB 1F35A 1LJ7A 2J1RA 1AXYA 2HWD2 4XFCA 3PU3A 4AI0A 1RUJ2 1K45A 1BBT1 2ORXA 1AYN1 3RRDA 2W1SA 3KM5A 3M3QA 4BIFA 2NYYA 4GMP3 2E7AA 4BMEA 1UAIA 3AYAA 2XOMA 3H8UA 3KCXA 2V73A 4ET7A 5FQ0A 4I01A 2XJSA 1XSRA 2IVJA 3T2PA 4YSFA 4CEYC 3CJXA 4X6QB 4WM7C 3HT1A 4XMIA 5FZFA 2QQVA 1LGBA 2PLV3 1TNFA 4YM1A 3O1RA 1WWYA 1WCKA 1DZTA 3MIFA 4M3CB 5LK7B 4OQ8A 2QQPA 1ENQA 2X8KA 3GJAA 1QU0A 4I0AA 1W6MA 5JSOA 1BMV1 3VKFC 4D0QA 3CU7A 4MVTA 4FP3A 5T52A 1JW6A 1GICA 2JIGA 3K46A 3S5QA 4QB1A 1IKQA 5DG1A 4Y24A 1QJY1 1JU4A 1UYZA 2AZ5A 2Z79A 1UNBA 5HI0A 4H7MA 4ORFA 3CLPA 4AQTA 1JOPA 1RTVA 1W9YA 1ALYA 1FX5A 3HN1A 4OI2A 1REFA 1DGWX 4NIIA 2P6HA 4L11A 2VZRA 3V56A 3ZXJA 4AGGA 3C3VA 2GNBA 4UFMA 5A7WB 1CR7A 4JDOA 1HRV3 4XDQA 2FD8A 4HPKB 2DU1A 5GKAC 4B4QA 3B9CA 1VBE3 3KD4A 5CG8A 4NHXA 1YQCA 5FMCA 2JG8B 4IEUA 4EN9B 2ZKLA 4OULA 2CWMA 2DYCA 4K6BA 4S2GA 3T1LA 3DYPA 3HWJA 4RR3C 2WFF1 4N53C 4R9CA 2D43A 3AJZA 2ARCA 4QU1A 2B7YA 1OUXA 4GB31 3H8OA 2D97A 3HQRA 4BQ2A 4PDWC 1YUDA 1RXFA 5HXMA 2E6VA 2GNTA 2WLQA 1QJU2 1UD1A 5CFCA 1LEDA 4S2FA 1EPWA 1LENA 3MEPA 4D6SA 5KR7A 1BLZA 1YO8A 5IYYA 1HB1A 1DYOA 2JX9A 2GN3A 1DQ2A 1H2MA 2VJXA 5CFDC 4ZZ8A 4SBVA 4MG2A 3C7EA 4NIAA 2XONA 5I0TA 3MFAA 4KBZA 3ZDSA 3K51A 3VBSB 2V4AA 4AQ2A 2D6MA 5BUVA 3POFA 5LK5A 1Q8QA 3GHNA 3AYEA 3N7LA 2ZCWA 4QPIA 3SCFA 4DZGA 2ZHLA 2AEZA 1M06G 4IE0A 3KSCA 5JOZA 3TNQA 3OPWA 5FWJA 2ZGMA 1LEMA 4OCTA 5EJ3A 4XHBA 5FZ0A 4MHUA 1ZRCA 2CSGA 1YJLA 1AYM1 4R8HA 2P5BA 3FX3A 2RR13 2UY8A 1G8WA 4YW1A 1PGW1 2WA3A 2XHNA 5C9AB 1ZZ6A 4ES9A 2RMU1 1O4ZA 3PUIA 5A1AA 1NOVA 4N7UA 5D21A 4PIXA 2P3KA 2CGNA 2UY9A 2LTNA 1YWKA 1DZQA 2GAUA 2G9GA 5AVAA 1PVC1 1GWKA 2HWD3 3H7YA 1AR72 4LJHA 1RUJ3 5FYZA 3CIHA 2BP6A 5FYHA 3P3NA 2OW4A 5FPZA 2CTVA 2LUWA 3HAGA 4M0NA 2DTYA 2PHDA 5L9RA 5EZWA 5DN2A 2VTFA 1B35B 2ZX2A 3S0MA 1CGPA 2VBBA 4OFGA 4XFBA 4YW5A 4LLOA 5F8PA 3PUAA 2HWF1 1AXZA 2D44A 2W08A 4QD2A 2JDPA 4QB2A 5FMDA 2OXBA 3U78A 3VZNA 2VUJA 4LQRA 3H1WA 3R0RA 2OX0A 3BOPA 3NVCA 4JTNA 3UETA 2C24A 4OZXA 4E4SA 3RVHA 1HJGA 5FPXA 4CCEA 1XNCA 3OOXA 1AJOA 4XF3A 4EZ4A 4FOQA 5FY8A 4B8EA 1W8HA 3O0WA 4AVTA 4WVZA 1SLLA 3A21A 2TNFA 3OY8B 4L9BA 2GC1A 3MIBA 4HKWA 3RFRA 5IVJA 3VDBA 2D3PA 3ENRA 1C3HA 1OD5A 1V6NA 1W04A 2ZX3A 4NOTA 3DPRB 1Y7BA 1DGWA 2VQ0A 4XQDA 1XQNA 4P9LA 1VBD1 3HR9A 4A2UA 5LRSA 3B02A 4HVRA 4MUVA 5E89A 4WVMA 4JRLA 4NRQA 2VBDA 1XBFA 5GLWA 3CF6E 4DIQA 2WLPA 1QH7A 1ND2A 4Q0VA 4RGAA 4CEWA 5BNPB 3M7AA 1CD3G 2GC0A 2RM21 4FPKA 5F6KA 5LCWL 2VOVA 1OOPC 1XOYA 4LBNA 2ZEXA 1P8JA 4L97A 4DY3A 5CADA 5A3OA 1O3SA 1SBDA 2XVLA 2A1XA 2A7AA 2Q1MA 1SFNA 3USUB 4CCDA 5KHKA 4EWDA 5EYXA 1AHSA 5ABJC 2DUOA 1D4M1 3CBNA 4YVSC 1BK1A 5FZ3A 3RJ2X 1C8M3 1VRH1 2HBUA 2Y6HA 4UF0A 4QKDA 5D1IA 2LW8A 2UYBA 4UT5A 1CAWB 1QJU3 2GH8A 3ZYPA 4XC9A 4QHOA 5DUWA 4CTEA 1RUOA 1Z78A 3ZFFB 4YZ2A 2Y38A 3TOJA 3L9JT 1HRI2 1Q8PA 2RDRA 2VVFA 1SHWB 1Q3EA
chains in the Genus database with same CATH topology
3M8LA 5FLJA 1RIRA 1NE6A 3ETQA 4JVAA 3Q9OA 4N43B 4K21A 1QWRA 3NAPA 3DF0A 1BCXA 4O9EA 2PTMA 3QACA 2EIGA 4YGDA 3SLIA 4QQPA 1X36A 4NWWA 1GANA 3LA7A 4KH9A 1H2NA 4YGCA 1ZBE1 4N7IA 1RUH2 3OGJA 1TNRA 1O4YA 4IL7A 4QPGA 3W9AA 1X7NA 1QY4A 1MS0A 3HIFA 1QQP3 2AENA 2WNVA 1NCQB 5KC6A 1DBNA 1VLNA 4IEQA 4OI1A 1V9U1 1WLTA 1RC6A 1AR73 1UU4A 4LHNA 1IOAA 1IKPA 4MGKE 5KBFA 2ZGQA 2F6BA 1ZA4A 3N36A 2IZWA 3GBFA 2ZAAA 3MLKA 4DPNA 3VBUA 4DB5A 1W0OA 2E53A 2IXLA 3WOGA 3ZXAC 4C1XA 3ZMNA 3RQ0A 2NPIA 4AEKA 4Q0QA 1RUC2 1RUE3 1Z7S1 4Q4W2 3ZSJA 4BPZA 3MF9A 2DFCA 3V0BB 4QM9A 1QH6A 2A3XA 3R4DB 1OKQA 1NY71 2GN7A 4A7KA 4OHYA 1LU1A 2X29A 4Z2WA 5CFCC 4COUA 4J1WA 3VUOA 1R1A1 4PIZA 3SH5A 2LM3A 1J3QA 1PNFA 5BNOB 3MW4A 2HWB2 2JG9A 3ECQA 1ENSA 3B69A 5JMCA 2EXKA 4FPEA 1MS4A 4LUMA 4BYYA 3EBRA 4EV0A 4NWVA 3R4UA 4QPIC 1OFNA 1QDOA 4JGYA 5T55A 1RVF2 2GH2A 3ZYJB 5KWRA 1XRUA 1LHOA 3FWEA 4XFHA 4KG8A 4XQWA 2BBVA 2E63A 2HWE1 3VDDB 4FOVA 2D93A 2D6PA 2JICA 2YMZA 5L36A 4XBNA 2EXHA 4CDQB 1MS3A 2R071 1S0EA 5DG2A 3UKVA 5J7MA 3U4XA 1PVXA 1MQTA 1G86A 1RGSA 1G6NA 1HRI3 2QKDA 3NV2A 3IDCB 1IS3A 3KZ4C 1CONA 1U12A 2OYZA 4ITCA 3INAA 1Q43A 3MLLA 4RS5B 1DG6A 5AFBA 3ZFGA 3ZSMA 4KGGA 1F5JA 1TME1 3R05A 1JH5A 1YIFA 2JJ6A 2MEV1 1ENXA 4QGMA 4XIOA 4AHYA 2Y26A 4M3CA 4Y22B 4TSVA 1LOFA 1DGRN 2XBO1 2XJRA 1QOOA 1FT9A 5CA6A 2V5YA 4YW3A 2ZTNA 5I0UA 3MPPG 5GZFA 1RUH3 4Q4V1 4RGGA 1H9PA 1EY2A 4F8AA 4FTBA 1R082 3AZZA 2JEMA 3FLRA 4A3XA 4FPGA 1S0FA 4AI2A 1ULFA 1KS4A 1XNBA 2DU0A 2GC2A 3PVNA 1S2KA 5DZFA 4AEMA 2P17A 4Y1XA 5BY5A 2YHJA 2AGSA 1NCRB 3ZO0B 4Q27A 4GWMA 2JG8A 1COV1 4IV3B 2JDZA 1VAKA 1ND2C 4CEWC 5BPXA 1SFYA 2CNAA 5JPNB 1S2BA 1QGLA 4OI0A 1EV11 3T1MA 4Q4W3 3ZXLA 1BYHA 2X5IA 1GZWA 3GZTB 2WNEA 2QUOA 1R092 1LULA 3ES1A 3ZXKA 1H30A 4RA0A 1MS9A 4RQPA 5FOBB 4BOWA 2A6WA 4YLZA 5HBAA 1NYWA 4P14A 3B9IA 4MGZE 1H1MA 1B09A 1RHI1 2DCKA 1U5XA 3N4MA 2HWB3 4LO7A 3RYRA 4R4ZA 4XETA 1OQDA 2A3WA 2OIIA 4ZXKA 1KQRA 2DTWA 3NL1A 4FAHA 3NAPC 2YV8A 3NV4A 4HVOA 4COVA 1MZFA 2NMOA 1MS1A 1VBA2 4FXKB 1PO12 3IMNA 4PCRA 4AEDB 1KITA 1XYNA 3UJOA 3RSJA 1PO21 5CBLA 4XFGA 1LHNA 1QMJA 4PJYA 4XBLA 4Y20B 2OA2A 2WZR1 1H9WA 1RUF2 4QPGC 1H8VA 2XL7A 1FOD1 3KLSA 4X8PA 3AKPA 3FHIB 3IM0A 3M2MA 4U2AA 1DQ5A 2WNVC 3JQWA 4Q0UA 3E6CC 1O3QA 4AHXA 3A0NA 1B35A 2DCJA 3PLQA 1K5MB 1I3HA 2VGDA 1HX6A 5DXDA 2BYVE 4PF5A 4QGLA 3TN91 1T6GC 2YYOA 3BB6A 3VBUC 1SLCA 4CP0A 4RHV2 5K0UB 2YXSA 2RJLA 2P34A 1MEC2 3QH7A 4OHXA 1N3QA 3OY8A 4J6GA 4RD7A 3WQ7A 1IGOA 5I93A 1PHMA 4XJ9A 3ACLA 3OPZA 4XQ4A 1KJLA 2DUPA 3OF1A 1R083 2BGCA 1SCRA 2VOWA 1CN1A 3D6EA 1HXS1 4AFMA 4UXAA 2EVXA 1YFWA 2TEPA 1BQPA 1H1AA 4LE4A 4U36A 4XMAA 4Q4X2 3KGZA 3ZMOA 2CYFA 3V0AB 2JG9C 4JRAA 4ONUA 3WT3A 2JE7A 2ZX4A 3H9AA 2W68A 1VR3A 4XTMA 4JAAA 3AMNA 1NXMA 3VBHB 2UWCA 4JGYC 1RUD2 1POV3 2GSYA 1CAWA 2PLV1 5D8AB 4JGZB 3MW3A 1EAH1 1R093 2XLAA 4CZSA 2H0BA 3GBWA 2DVBA 4DS0A 3MIHA 1AR81 3NKTA 1MQTC 1AL22 2ZGKA 1S1AA 3IPVA 3VHOA 5C4WA 3A4UA 4JTOA 2FMYA 4MXVA 4R52A 3ASIA 2ZBJA 3MI8A 3AZWA 4Q0SA 1LHWA 4PBPA 3U11A 1V70A 1U5IA 2UURA 3OBRA 4K8FA 1N3OA 4X8NA 3ZFGC 1HRV1 4GH4A 1S0IA 2AH2A 3LA3A 5T54A 1CESA 5IK4A 3ZYRA 2B39A 3HT2A 1RINA 1LOFC 4QT6A 4YG3A 4QGNA 4F7ZA 1YYNA 2ZGSA 1H2LA 3VZMA 4XJAA 1CQ9A 1HQWA 1RUF3 4CDXB 4R4XA 1VBC3 4K40A 3UV9A 3WQ1A 3A0KA 2H6BA 1WBFA 4NR1A 4HT1T 1QDCA 3M70A 4NHKA 5KHGA 4AVCA 5BXXA 1LRHA 3M3IA 4LHLA 3PVBB 4S2DA 1DIWA 2BWCA 3THTA 5FO8B 1C8NA 2OUHA 1UMZA 2JG8C 3URFA 1FMD2 4NO4A 3RYPA 2VW2A 1OSGA 1R1ZA 5JZGB 1PK6B 1W0PA 1JXNA 4FPOB 1MEC3 3ZN6B 4N9IA 4TLFA 5FLIA 4GIQA 1YI7A 3ST7A 4LT5A 1ZRFA 3I8TA 2EXJA 2X5IC 3VV1A 4Q0PA 3QBQA 4YVWB 1NA1B 3VBOA 4RQPC 5BNOA 1A8DA 3MYXA 3AFKA 3JU9A 4LULA 3H50A 1ULDA 4FCAA 4Q4X3 3BODA 2JKBA 2HWD1 2AR6A 1TQ5A 2HWC1 1FAYA 1ZZBA 2PHXA 3KCCA 4LEJA 1FPN2 1HV0A 1C5IA 1C5HA 1SDWA 1Q8VA 2XB6C 2ZGOA 1RUD3 5EWSA 2DWRA 3R6SA 3LKJA 2FQPA 1Y43B 1LOCA 4CDQA 1D2SA 3ZYIB 2RS52 5GLUA 2FZ1A 4MX3A 3SHRA 4AFBA 5A33B 3JD72 5DDJ2 1BVVA 3V65A 4XF1A 5EFUA 2WNUA 4COWA 5C8WA 5FFOC 3BIWE 4RS5A 2I07B 2QCSB 1VB4A 3VBFB 3ILRA 5JAXA 4PQ9A 4A7YA 4LBLA 2PHUA 1B35C 5KXCA 1F2NA 2ZGTA 1DZRA 1MVQA 3LSEA 1GLHA 3RPQA 3SH4A 3V64A 1I1EA 5IK7A 3WDTA 3VL9A 3FE5A 1HW5A 1BBT2 3OJBA 3MGUA 2ZX1A 1W6PB 2BNNA 1AYN2 4KQ7A 3VZLA 4PLOA 1OA3A 1CAVB 1ZX5A 4LO5B 1W6NA 1C8M1 4MYEA 4M0HA 2ZGRA 4EJRA 3LB9A 4D69A 2ZMKA 3D0SA 4IEPA 5SV5A 3WHTA 2D3RA 4FPCA 2Z42A 5JOXA 4B7EA 4INDA 3MICA 4NPRA 3NKGA 1ZYBA 1AR93 2ZJCA 4QM8A 1DGRA 3EJKA 1SBEA 5KXBA 1QJY2 5GALA 1EP0A 1CJPA 1CAUA 4M3CE 5F1RA 5L19A 1M4WA 2XLGA 3ZIXA 4EROA 1PGL1 1OQ1A 3O0XA 1FMD3 1LESA 1XNDA 3LA2A 2VVDA 4TYSA 4OI4A 3N3HA 3ZSKA 2HEVF 5F9TA 2UYAA 1QXPA 3LCPA 4SLIA 5JWPA 3AKRA 2RS11 3ZXGA 1BJQA 1X33A 4E4ZA 5IK5A 3J26N 5C8CA 2P3JA 1ASJ1 1JHNA 3J8F2 1Y3TA 4NN0A 2GMEA 4GB32 2RS31 1ULGA 1GZ9A 4P9GA 5J37A 4I02A 1QQP1 4XJ8A 1D2QA 4IETA 2BWAA 1AX1A 5BNNA 1NZCA 2XHKA 5JI9A 2O8OA 1HQNA 4JCKA 4META 2QZ3A 5C4WC 2XJPA 1PZ8A 1J3PA 4Q8LA 4Y1UA 1BEV2 2PAKA 1ND3A 1UZYA 3IN9A 5H9SA 1I6XA 1GR3A 4DRRA 1H4GA 2YUEA 2ZMNA 4GH4C 2WINB 4WM8A 2SLIA 4AVAA 2EF6A 3RG0A 4AEDA 3FFQA 3VLBB 1IHMA 1HQLA 2RS53 1YNAA 4Y20A 1W6OB 1RUE1 4IEXA 4XF4A 2QZ2A 2XVGA 5I91A 3JD73 3B01A 4PLMA 4XF0A 1LCLA 5DDJ3 1AYM2 5FAXA 3FLPA 3WDUA 1IZ3A 3K48A 4AG4A 4CEYB 4Y1YA 5CB7A 1SLAA 4OHVA 1PGW2 3WLUA 2RMU2 1URXA 2F4PA 1K5MA 2PHLA 3AP6A 3WDWA 1D4VB 4CDWA 5KHJA 1OLRA 1WCDJ 2H0VA 4XPVA 4QX5A 1FATA 1GYKA 3WCRA 4BHPA 1PVC2 1LHVA 4MXWB 1O3TA 2ILMA 1AYN3 1TMF1 4KWJA 3WZ1A 1S0BA 2TBVA 1KDKA 2V09A 3PVOA 5J96B 2HWF2 3I4IA 3JZVA 3WXPA 3CJIA 5BV6A 1ZBA1 3OYWA 4I2OA 4FPFA 3AYCA 1IS6A 4AE2A 4H14A 4RR3B 4N53B 3B5LB 4C91A 2W52A 3LSDA 1U5ZA 3QLQA 2XG3A 5H9RA 4E2SA 3VBOC 5BNOC 3WW3A 4PDWB 4M00A 1FYUA 5KXDA 3O5SA 2R16A 4GA9A 1C4RA 2XWBB 2YDEA 1WMEA 4E4DX 4XIKA 3WG2A 1Z0HA 4AHWA 4CDUA 1VBD2 1NQJA 4OVEA 3IDEA 3AZVA 5CFDB 2B45X 3AP9A 3ZFEB 4YZ3A 1AF9A 2BUKA 4FPLA 3APBA 1LU2A 4UW4A 2PYTA 4XW3A 3ROUA 3VKNA 2RM22 4DINB 1ZREA 1WGPA 2ZGUA 1VB2A 3AKQA 1L3JA 4CDQC 5CNAA 5A32B 4LA2A 3J8F3 5TSWA 1RITA 2R49A 1RL3A 1D4M2 2R1DA 4D3WA 1VRH2 2PN5A 1ZZ8A 2WNUC 3LAGA 4XILA 5LEKA 4RS5C 2ES3A 4FPYA 1QNWA 1BEV3 2A6ZA 2Q0AA 3KMHA 5JOYA 5GLVA 4LTAA 4GXLA 1MS5A 2WWSA 4H7LA 2D98A 4AW7A 5FREA 4AEJA 2YGMA 4HZFA 1YIPA 1UIKA 4D7TA 3VBRB 2N7GA 4XOGA 5FCCA 3PNAA 2UWAA 3KT1A 2JECA 2ZGPA 4P9IA 4LNVA 4YFZA 1YI9A 2ZS6B 1X8EA 2C9AA 1MZEA 1U5YA 4I0BA 2WL1A 2NM1A 1RUI1 5EV7A 3AK0A 2Q8OA 2EAAA 1QKQA 3H1YA 4AQSA 3E5UA 2QDNA 4KBBA 3P3PA 2P2KA 4FTEA 1VBB1 1WLDA 3SCHA 3N7KA 2IXKA 3D5OA 1WBLA 4EWAA 4MSVA 1AX2A 1V9U2 4I09A 4QPYA 1DYKA 2DCZA 3ILNA 4IV1B 3ZN6A 1N1VA 1A3KA 3RJRA 3E6BA 5BNQA 1QJX2 2ZZJA 3B3QE 2DVGA 2AYHA 2CV6A 2E9QA 3DKWA 1SEFA 2VQAA 3BPZA 1QOSA 1IPKA 1OOPB 3C2UA 4OUMA 3RI9A 3U10A 4DZGA 5C8CC 1JTZX 1Z7S2 1D0HA 3PMSA 2VOKA 4GQ7A 3WV6A 1O7FA 3FBYA 4ZU4A 5ABJB 4HLTA 4LBQA 4YVSB 3TWIA 2ERFA 4KNCA 1LECA 5BNNC 3EQEA 1UZZA 1R1A2 3W58A 1ND3C 1VBD3 4KG0A 1W6QB 2D6KA 1REEA 4YZ5A 4K9SA 4AGVA 3SMHA 3WY6A 4WM8C 3M3CA 2PELA 2A6VA 2XL9A 2WSVA 3TBDA 4AEDC 4LHKA 2RM23 1O5UA 4M01A 4IERA 5A33A 1RUG1 4DNYA 4FOWA 4AI1A 3QH6A 3VZJA 4IEWA 4LBKA 4XE9A 2HWE2 4S2HA 3TB0A 2D6NA 2B9UA 4FP2A 3UKNA 3VKLA 4UBGA 3QOPA 4XF9A 3BU7A 2B8MA 2D40A 4L92A 2WS92 1LOGA 1UU5A 1K5MC 2O0OA 4XXAA 4LE3A 1W6MB 1N3PA 4IEVA 3ZSLA 4CDWC 4YZ1A 2CWSA 1W6PA 5KHHA 4FOYA 1ULCA 2JD4A 2OVUA 3RI8A 4HMZA 4EN8B 3ATGA 4HPKA 3UL2A 1CAVA 2YC0A 2ZKNA 1TME2 4D94A 5FOJB 3AKSA 3NV1A 4G9SB 3MIGA 1BVP1 2ZHMA 4FVVA 1JOJA 1POV1 3WP4A 2MEV2 2A71A 2D6OX 3CEWA 2IXJA 1NQDA 2B42B 2XBO2 5E88A 1R091 1OPOA 3CJIC 3GNEA 1OPMA 3VL8A 1WLWA 4YG0A 5EYYA 3WDXA 2W39A 1RUC3 3OTFA 2B46X 4WBBA 3FMGA 4Z92B 4Q4V2 1SLBA 5GZDA 3KS7A 4UW5A 1WCSA 2DV9A 1OHFA 1Q8SA 2ARBA 2I45A 3I2DA 2Q5TA 4H55A 2XH6A 4YM3A 3ME2A 1FNYA 1V9U3 2O1QA 4ZU5A 3CL1A 3VBSA 1WD3A 3S6PA 2GALA 1WD4A 3H0OA 4AVVA 4CDUC 5AC92 4F83A 4R9BA 4Y5Z0 1QJX3 3FBMA 2DVAA 4P9JA 5I0SA 4C0HA 3AFGA 4N9HA 2Q1ZB 3B00A 3QCWA 1RVF3 3MPBA 4K3UA 1AR62 1EV12 1Z7S3 4BZ4A 4GKYA 3VHPA 4DFSA 1GV9A 1RUF1 3I59B 2AREA 1VBC1 5C9AA 2WQZC 3VGIA 4J1XA 1LGNA 4GWNA 3JUUA 2BEOA 4Q4Y2 1H8TB 2CGPA 1RMU2 3AMQA 3J4UH 2C5DA 3USSA 3AZYA 1R1A3 3WX5A 1F5FA 3WVJA 3WQ0A 1WMDA 3HQXA 1RHI2 3VKMA 1J59A 3GYDA 1J3RA 4AFAA 1DGLA 3GHMA 3WG3A 4BCUA 5C6CA 1O4TA 1GSLA 2K0GA 2QDRA 2R041 2W0XA 4HN0A 3T2TA 2NP0A 1RJ8A 2A6XA 5FO9B 5JPMB 1SQ4A 4H3WA 2HWE3 3POWA 4AFCA 2XJQA 1DF0A 1NE4A 3PJQA 4KGQA 4DQAA 3SCGA 1PO22 2D7FA 5FRAA 4ASLA 2QNKA 1YFUA 2HEWF 2WS93 2WZR2 2KM2A 1V6KA 1GFF2 1TEIA 1UKRA 2E51A 3DPRA 1PIV1 4EN0A 1VALA 1CX4A 3QD6A 3X29B 4BA6A 2P37A 1JUIA 2PHTA 5K9YA 1SCSA 4LBMA 2QE3A 1CJDA 5GLZA 3WW2A 3S7EA 1AXKA 5FLHA 5BNPA 1RUD1 4JDMA 4COYA 4YGBA 4WVMB 3WP3A 3JBG2 3AP7A 2XBO3 2R062 3USUA 3L2HA 1ND2B 4GMP1 3HBZA 2WSUA 4BLIA 1HLCA 3O12A 2WA4A 3L2YA 2VOXA 4HBNA 1OFSA 4Q4V3 3MLJA 1N1TA 3ZFFA 1YLLA 3U07A 2DF7A 3MW2A 2YPJA 3FUQA 4HK9A 2PAMA 1NG0A 3ZFEA 5AC93 1WW4A 3WW4A 3E97A 4N43A 2PHRA 1OA2A 1ZRDA 1JYCA 4LLFA 3OD4A 3WDYA 1UN1A 2DUQA 5H9PA 2XPJA 1IS4A 4FQZA 1V6LA 4TWTA 1VBE1 1AR63 1EV13 3FUOA 1VBA3 1KFXL 1PO13 2PLV2 5LRRA 4E2GA 1G9BA 1EAH2 1QJZA 2BTVC 1KRIA 3WP5A 4PIYA 4Q4Y3 1CPMA 2HEYF 1AR91 1RMU3 1AR82 1NCQA 3VKOA 1VJ2A 2P3IA 3SXWA 4XJUA 1QHDA 4WZFA 5K7PA 1RHI3 2ZA9A 2PFWA 2WNVB 3VBRA 1FMD1 4QQ2A 5IK8A 3UKTA 4G3YC 4RFT0 1OQEA 2IC1A 3TYJA 1U0AA 2WT1A 4QU2A 2E7QA 4BM8A 3VBUB 4RHV3 3V0BA 5BYNA 2R1BA 2BNOA 3IBMA 4JDNA 1V6JA 1F8VA 1PO23 4HETA 1DQ6A 1N47A 2ZZQA 2WZR3 2WQ4A 3H3ZA 2RR11 5T5OA 2WJSA 1DU3D 4YW4A 1YHFA 2G4IA 1UL9A 2BFUL 2GMPA 5L7OB 4IV1A 1EPZA 2VULA 1EYBA 3PHMA 4IEZA 3BOWA 3VBSC 1JYIA 1LGCA 4L99A 4UW6A 1RUJ1 1J58A 2VMGA 3TAYA 1YFYA 5ACA2 3JBG3 4P9WA 1I9RA 1OA4A 2R063 3VDDA 4IXLA 4ZKTB 4YM2A 2DVDA 1DYPA 1PZ9A 3ZPYA 4JGYB 2QJVA 1FV3A 1C57A 1UPIA 5DDJ1 4YM0A 1SLTA 3KQRA 1W39A 1UF2C 3WD5A 1XE7A 5C9AC 3I7DA 3AP5A 2AUYA 1VAVA 3D0JA 4YARA 5I8YA 1G9AA 4IESA 2RJKA 3NWKA 2LALA 1AL23 1ONAA 1MQTB 3WDVA 1DFQA 2OZJA 2XJTA 4XEZA 1UW8A 4EN6B 4AF9A 1YRZA 1SMVA 2OUJA 4AK3A 1HV1A 2HWC2 2PAEA 4YG6A 4Z82A 5JDBA 2ENRA 1YXWA 3ZFGB 4HSJA 4Y22A 4Z8BA 1O3RA 5T5JA 2WKKA 3O7OA 4QHBA 2C1FA 3G6JB 2VVEA 3S7IA 2IXCA 2GZWA 4B4PA 3VN4A 4DRVA 4K1ZA 1EAH3 3AMMA 3AP4A 1ZNPA 1Q8OA 2CY6A 2BFUS 1JN2P 1AR83 2H6CA 1Q56A 5GJ6A 2GC3A 1QJU1 1X50A 3DPRC 3ES4A 4COZA 1F9KA 3RMYA 4M3CF 5FMOL 2BVBA 1BMV2 5I8SA 1NCRA 4GULA 2ZGNA 3GALA 2RE9A 4IV3A 1FV2A 3ZYGA 4BE3A 5BNPC 1KS5A 2DCTA 4I3GA 1RB8G 4PBOA 1KFUL 2WIIB 2XWJB 2WZPP 4MGIE 3J8F1 5CIRA 4ATFA