3ZM8A

Crystal structure of podospora anserina gh26-cbm35 beta-(1,4)- mannanase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
444
structure length
444
Chain Sequence
RDGPVTYEAEDAILTGTTVDTAQVGYTGRGYVTGFDEGSDKITFQISSATTKLYDLSIRYAAIYGDKRTNVVLNNGAVSEVFFPAGDSFTSVAAGQVLLNAGQNTIDIVNNWGWYLIDSITLTPSAPRPPHDINPNLNNPNADTNAKKLYSYLRSVYGNKIISGQQELHHAEWIRQQTGKTPALVAVDLMDYSPSRVERGTTSHAVEDAIAHHNAGGIVSVLWHWNAPVGLYDTEENKWWSGFYTRATDFDIAATLANPQGANYTLLIRDIDAIAVQLKRLEAAGVPVLWRPLHEAEGGWFWWGAKGPEPAKQLWDILYERLTVHHGLDNLIWVWNSILEDWYPGDDTVDILSADVYAQGNGPMSTQYNELIALGRDKKMIAAAEVGAAPLPGLLQAYQANWLWFAVWGDDFINNPSWNTVAVLNEIYNSDYVLTLDEIQGWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Analyses of Glycoside Hydrolase Families 5 and 26 Beta-(1,4)-Mannanases from Podospora Anserina Reveal Differences Upon Manno-Oligosaccharides Catalysis.
pubmed doi rcsb
source organism Podospora anserina
molecule tags Hydrolase
molecule keywords GH26 ENDO-BETA-1,4-MANNANASE
total genus 139
structure length 444
sequence length 444
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
A PF16990 CBM_35 Carbohydrate binding module (family 35)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3zm8A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3zm8A02
1W9PA 4AC1X 1GVIA 1DWJM 4D6CA 1EHNA 2W3JA 4W86A 1BYCA 1W0NA 1UA7A 1P6WA 1RPKA 4H8UA 4JX0A 4ZZ8A 3WFLA 2W95A 3I3EA 4UAPA 4Z2AA 1UUQA 3A3HA 3WH8A 1QI2A 4U2ZA 3PZ9A 4RN5A 2W5FA 1UKQA 3AS0A 2G3MA 4W7VA 3L4TA 2C26A 1Q6EA 1IZJA 5CQ1A 4PSRA 2PI6A 2QQKA 1WKYA 2YDSA 3WENA 4R27A 1E6SM 3VDCA 2J74A 4UFLA 5A8PA 1XV8A 2L9LA 1ITXA 3VIHA 1ZL1A 4HMDA 1CGWA 3WF0A 3WH6A 1FH7A 2A3HA 3RJXA 2ZEXA 1E55A 3U5YA 3W4RA 3BGAA 2QQOA 1WDSA 3BLKA 5DN2A 1E71M 1R7OA 7A3HA 3WF2A 1MW1A 1Q4NX 4D71A 5FKYA 1HN1A 2ZE0A 3CZUA 4PMNA 2EPNA 3AMLA 2ZUVA 1ISVA 1UWTA 4QCFA 4WKAA 3OGRA 4ML4A 3WQ5A 3BMVA 1VEMA 4LPCA 5EIYB 1Y7VA 1VENA 2WQ8A 2E8ZA 3AS2A 1GNYA 3OBAA 1FFRA 1WCGA 4QCEA 5I5RA 4FF5A 4U33A 1AQ0A 2VZVA 3WSOA 2DH3A 4W8BA 1JFHA 1QNRA 2WCSA 3D5HA 4CD8A 2WO3A 5E9AA 4ET7A 1UG6A 3VNYA 5A69A 3U7BA 3K8LA 3L2LA 4CN4A 1CZSA 2BZDA 1HIZA 2J7FA 3W29A 4E2OA 1MYRA 1W1PA 1X6LA 1JZ2A 1E6RA 1TZ7A 3LPGA 1UR8A 4PT6A 3SEPA 1S46A 4PEEA 3GH4A 4P7NA 4M8UA 1TA3A 5M3WA 3WF3A 4ARXA 3OGVA 1RYYA 1WDPA 2YL9A 3CHFA 1EGZA 2G4FA 1TMQA 4GINA 1BAGA 3PZGA 4HG6B 3EDJA 2BVDA 3RIKA 1KBKA 3WDHA 3W53A 1CGVA 2A3CA 3BMWA 4CCEA 4MB1A 4JFVA 1UH4A 3FAXA 3DYPA 2QLYA 1JU4A 2VZRA 2PQSA 4MGQA 4H41A 4W8LA 4QX1A 2BHZA 4A3HA 2YC2A 3TA9A 2XOMA 3KL5A 1KGUA 2J1TA 1GQKA 1JI6A 3WQ8A 4J3VA 2MANA 3VX0A 1FA2A 3N1AA 2CBJA 2EXOA 1UXZA 5IHRA 1UH2A 1JL8A 4RE2A 1E0XA 1LG1A 1MXDA 1V0NA 2XFRA 1VBUA 3PZMA 4LYQA 1WE5A 3RCNA 4W84A 3U37A 2VRQA 4AEFA 2J78A 5BROA 1J10A 4QDQA 3B9EA 3BCDA 4A3ZA 4CUBA 4JFSA 5CXPA 1H3GA 3WUEA 3BSGA 3VDAA 1MQQA 2EIBA 1WDRA 5BWFA 2WVVB 5AC4A 3N17A 4N42A 2E0PA 3WMSA 4HU8A 3CGTA 3F4VA 1QNSA 3VIOA 3CQOA 2JALA 2XHNA 1G0CA 2ZX9A 2VMEA 2WHKA 1HKJA 3VGFA 3CHDA 1JIBA 4AD3A 5HBFA 5BYWA 3F5KA 1VJSA 3PTMA 1UHVA 4JCLA 4W4ZA 3WF1A 1O8PA 4HA1A 2Y5EA 2ZWZA 4BQ4A 3WH9A 4QX3A 1V3JA 3WDJA 5C71A 1LG2A 1LNSA 2ZIDA 1K6AA 5BRPA 2AAAA 2Y24A 2JEQA 4B16A 1OGSA 2WVSA 2W66A 4CVUA 4LKSA 4H8HA 2V4VA 2XONA 4QP0A 2E32A 2WMHA 1P8JA 3FN9A 3APGA 1XHGA 2EJ1A 4ZXLA 3CUFA 1WCQA 3PTKA 1UY4A 4WLCA 4KRUA 1QHPA 2VQUA 1J0IA 3OB8A 3SUVA 1L7RA 3OGSA 3QOKA 3WQ4A 1YHTA 3DECA 5DT7A 3RM8A 1MXGA 1UMHA 1UYZA 1I1WA 2JD9A 2EBNA 4RYDA 1DWHM 5FUIA 1CGYA 1W8NA 3T2OA 4Y7EA 4M80A 1UYYA 1V3LA 1E6ZA 2WK2A 3ZJ6A 1WNOA 4ZZ5A 1J18A 5FCZA 1B30A 2VNCA 3NIYA 1JDAA 1XYZA 1JYNA 3VX1A 4BCEA 3BCFA 3WMCA 2DPEA 3WELA 2EIEA 2G3JA 1W1VA 3ZQ9A 4KI5M 3WEOA 5CYYA 4LXFA 4OKDA 3ZO9A 5CG0A 1JXJA 2WLZA 2WMKA 4DUVA 3WD4A 1UQYA 1QI4A 2O9RA 3QR3A 2YBUA 4U2YA 1R86A 2VUYA 4UOJA 4K68A 3NDZA 5I78A 1NARA 2QBXA 2G3NA 2VRJA 2W94A 1OD8A 3KWXA 4QLKA 2JF6A 1KEXA 4LQRA 3WIJA 2VZPA 3WKZA 4JCMA 3A21A 3W38A 2E31A 4XUNA 2WZ8A 2UY3A 5D9OA 2IXVA 2WCGA 3WD1A 3VM7A 3IAQA 1V08A 1KR0A 1V6YA 2CETA 3K46A 1LL7A 1W9DM 4LHSA 1NAEA 4C7GA 2V38A 1PMHX 1SMAA 5DF0A 2J7DA 2C8NA 2VMCA 4BXSV 4JL2A 2XFYA 1US3A 4JL1A 3WL1A 4UQ9A 4GXPA 1EUTA 1L8NA 5A6AA 3BAKA 1VIWA 3HN3A 2A3BA 1M01A 3NJVA 3GH5A 4Z2JA 4X9YA 5GNZA 2GDUA 1TUXA 5B4NA 9CGTA 3VNZA 3ZSSA 4W93A 1D7PM 5E70A 2OYKA 1SDDB 1V6WA 3EDFA 1WAWA 4W8JA 1VFMA 1T2XA 4PF1A 2RGMA 5FL1A 3EDDA 2PB1A 2J25A 3QHNA 2ZXAA 1OSEA 2C4XA 1W2VA 2UWFA 4FK9A 4PYSA 2D20A 4NRRA 4W8AA 4D6DA 2CBUA 2UY5A 3IJ9A 5A6MA 2V5DA 4CN1A 2W47A 3RJYA 4ACZB 4L4OA 4WKHA 2XVGA 1GMMA 5LA0A 3POHA 1E4LA 2ZUMA 1PAMA 2QV4A 3BAWA 4V28A 1DWIM 4MNLA 3VDHA 1M03A 1K3IA 3I2GA 1A3HA 2YA0A 1PIGA 1QW8A 1Q6CA 2FHFA 4QX0A 1EQCA 2VM9A 2WO1A 5C7GA 1HL8A 4JIEA 1V02A 3OZOA 3AMDA 2BXYA 1GORA 2JIEA 1ZBWA 3IIIA 1E56A 3MV11 4AZIA 2FGZA 4DEVA 4FLRA 4HTYA 3W25A 2DSUA 3MS8A 4QDMA 1GHRA 2WPGA 4Z2KA 4GI8A 1BYDA 1NWSA 3BN6A 3W6LA 2YDRA 2XUCA 2VVSA 1J0JA 4MJ2A 2Y6GA 4AD1A 2VX6A 1ZBCA 3UERA 3L4ZA 2WKLA 1TA3B 3EB7A 3N13A 3VU2A 3WD3A 3IJ8A 3TONA 4A45A 2XSBA 1WPCA 3HOBA 1W9UA 3AIQA 1UR0A 5JUVA 5A2CA 3KE0A 2XJ7A 5ABFA 3SCVA 4DEQA 1B3YA 1M04A 4P02B 5A1AA 4LGXA 4GZIA 2DDXA 3VD7A 4PTVA 3N9KA 2VX7A 4NZCA 3ALGA 2NSXA 1JZ5A 3WH7A 5HPOA 3HMCA 1UWIA 1XD1A 5IFPA 2Y6LA 1FHLA 1HT6A 2J1UA 4A44A 1KGXA 3VVGA 2X8RA 1EIBA 4YPJA 4KGLA 5DFAA 4B9YA 2ZX8A 1W91A 1MW0A 3HNBM 1US2A 1V3IA 2RV9A 4M56A 3KEHA 1GQLA 3MMUA 4A4AA 5LA1A 3K75B 4P7LA 1OF3A 1E3XA 2WHMA 1JI2A 2OLHA 4JKLA 1GOQA 2HVMA 3OEAA 1C8YA 3WL0A 3C7OA 1CTNA 1V3MA 2QMKA 2ZEZA 3AIUA 2FHCA 2OKXA 4FLSA 3WNNA 3JXSA 3VGHA 3ZJ7A 2WC7A 1TR1A 3TTQA 1XCXA 1N82A 4OUEA 3W26A 4W5ZA 4JFUA 2DEPA 3CUJA 2XWEA 5I6SA 3GXUA 3WNOA 2CKSA 1CGTA 1DLCA 3OEBA 4PUDA 4OMDA 2A3EA 2V3GA 3VIKA 2WC3A 4QLLA 2YLAA 2V3FA 2GK1A 4B3KA 3T2QA 2GJPA 1PX8A 1B0IA 4U5IA 1OT5A 2WB5A 1HVQA 1W2PA 3A47A 1BYBA 1ZBVA 3PZVA 3RMEA 4XUTA 2PWHA 4H8VA 5JBEA 3LPPA 4URIA 1IZKA 4Z2HA 2JKXA 1EQPA 4H04A 7CGTA 1JFXA 3ARPA 2XVPA 4UQDA 1XH2A 2EQDA 4L0PA 2J77A 2WVUA 4TVDA 1I5PA 2XPKA 4P8VA 3I2IA 2CCRA 1HX0A 1CXEA 4P7RA 2ESCA 4BJ0A 3BAXA 5BCAA 4AW7A 2Y4SA 3MMDA 5GNXA 5LYRA 1FOBA 2OSYA 4B15A 1G5AA 4Z2GA 3VDBA 1XRVA 5BXPA 4DWSA 4OIFA 5ABEA 4MTVA 4JHZA 3MSDA 5JXHA 1AQMA 4HU0A 4EE9A 3M6DA 3WNPA 2VR4A 2W1SA 3PUIA 2D24A 2F61A 4AD2A 1V6VA 3KL3A 4QFUA 4XZWA 3WEZA 2W67A 1E1EA 3BC9A 3W28A 2AMGA 2WMJA 2OSXA 3WQVA 2Z1KA 5FL0A 5DEZA 3ALFA 1G9HA 3ETPA 4J7RA 3UG5A 4HP5A 3LEGA 3VIPA 2RJ2A 3AMCA 4KWUA 4CD6A 2DT1A 4NRSA 4U5KA 2GJXB 3WUBA 4ATWA 1VBRA 3IK2A 2J7EA 2NT0A 1OD0A 3MUZ1 1CGXA 4P8WA 1JYXA 2G3IA 3B8SA 1B3VA 1EH9A 5AYIA 2IUZA 4UFKA 3VIMA 1K9FA 3HEIA 2WUHA 4XVHA 4DWSC 1GOHA 1UY1A 4J3SA 4PMRA 5HDRA 1GUVA 1QNOA 1NP0A 2FHBA 2YFUA 5CZKA 5IJRA 3MUIA 1CENA 3OLGA 4C7FA 1OT2A 4AY1A 3VPLA 2NT1A 4D8MA 1GOWA 5A6KA 2XWDA 1VFOA 5E09A 1X6NA 2WN2A 1C93A 1NOWA 4D6IA 4V2XA 3SCOA 1VFFA 5IYYA 5BXSA 2PBOA 4PMZA 1KWKA 1J12A 1UWSA 1LL6A 5CPTA 3NSMA 3L4YA 5I77A 5JR2A 4W7WA 3KL0A 1OBAA 1R87A 2QQJA 2WCAA 4CU7A 3VM5A 1TG7A 3GTNA 1GJUA 1UY3A 1LWJA 2CBVA 1CZ1A 2EICA 5A6BD 2Y2WA 5IXEA 4UQAA 3I2HA 1UD4A 4XB3A 3VGGA 2CIPA 2OYLA 4J3UA 1GOIA 1ZB5A 3ARSA 1UQZA 2YOCA 2JEPA 3BAIA 1K12A 3WN6A 1V02E 2J1SA 1EO5A 2DT2A 3PN8A 4H7VA 3L4XA 1E73M 5E6ZA 3MBWA 1ZU8A 4MB4A 1KXVA 3VTRA 4HOZA 4M24A 3ZT5A 1CXIA 1JNDA 1QHZA 1SHWB 2YC4A 1PX4A 3MSGA 4MOAA 5A2AA 4AZ5A 1BYAA 2CESA 3FAWA 1OWQA 5JMOA 3SCUA 2NW0A 1KXHA 2HYXA 2W1UA 2E40A 1E6NA 2QMJA 1OF4A 2B4KA 1RH9A 1W1YA 4J27A 1GOGA 4GI6A 4P7OA 3PBGA 3ZT7A 1UD2A 2XTKA 4MB3A 1F4AA 2WAGA 1UKTA 4LX4A 3WQ6A 4AD0A 3GH7A 3ACGA 3A6OA 2E4TA 4ZXEA 1B2YA 1GOOA 2XVKA 2J8FA 2WSPA 3SUWA 4S3JA 2BY2A 4D6JA 2QPSA 4B3LA 1WZLA 3IDAA 2EEXA 4KGJA 5EB8A 2XM1A 1XSJA 4HZ6A 3SUSA 2CKRA 4UTFA 1B90A 4W87A 5CPQA 3CBWA 4M82A 3UR8A 5G05L 3LEKA 1PZ2A 4UQEA 1VFUA 1B3WA 4AZHA 2W1WA 1E5JA 1H6YA 3AIVA 4LQ1A 2YBTA 1DWGM 2J4GA 2W62A 4M81A 3VILA 3M46A 3GXMA 5D4YA 4TOQA 5I23A 1EA9C 3HJEA 4BQ2A 2D23A 1ISZA 4PTMA 1UR9A 3AFBA 4JAWA 1W3KA 2ZX5A 4ZY9A 3ZSTA 1R7AA 4F9DA 1AMYA 5CPSA 2W4XA 3SCTA 4JKMA 3T0DA 1B31A 1XSIA 5D9NA 3OIHA 2YFZA 4UFJA 4AZGA 3OA5A 1W32A 3UNPA 2JIWA 2UY4A 5D8ZA 3WD0A 3C7FA 4GZ9A 1NUKA 5EMYA 1BG4A 4U3CA 4DUXA 5DO8A 1UX7A 3ARQA 1E4NA 5M5DA 4AISA 1Q6GA 2Y8KA 1UR1A 2D1ZA 3IB3A 1HJXA 1MFVA 3U7VA 1MW2A 2Y6HA 2V3DA 1GPFA 1QBAA 3DYMA 1U30A 1KFWA 3F5JA 4IM4A 3RM4A 4GZEA 1JGIA 4XV0A 5JXIA 4MAZA 1V0MA 2AOSA 1C7TA 3AHXA 4MDPA 2CPUA 4RL3A 2CYGA 4LYPA 3WDPP 2WHLA 1C8XA 5A6JA 2J79A 1SG3A 6CGTA 4TVUA 1J0YA 3BAJA 1DTUA 5E0CA 4PN2A 2BS9A 3AHZA 1RD6A 3NSXA 2W87A 3N18A 5CSYA 2CBIA 2FDMA 2ZICA 3MUAA 2RVAA 1SR0A 3QHOA 1KGYA 4HZ8A 4D1JA 4AIOA 4OZOA 3SCSA 2RGLA 2YB7A 1H0GA 3WDRA 1CYGA 3AZSA 1GQIA 3AYSA 2B9VA 4ACZA 3SUUA 2J22A 4P8XA 2O9OA 3L4WA 1JF5A 1UZ1A 3WD2A 4AZ6A 2EPLX 1QI0A 1VJZA 1NWRA 4W50A 4E8CA 2JDAA 1Q6DA 4BZYA 5A94A 2DIEA 1VB9A 4DWSB 2DCKA 5DQ0A 1CZTA 3VMPA 3SCPA 3W82A 4JZ5A 3N15A 5GQBA 4AIEA 1L0PA 4PMQA 4DM1A 1EXPA 3NNGA 1KCLA 3IJ7A 3S6TA 4D0QA 2WMIA 8A3HA 2D0HA 2VQTA 3LQCA 7TAAA 1WZAA 1JZ6A 3PZIA 1QOXA 1B3ZA 4WF7A 1PZ3A 5FOOA 1HJQA 1WO2A 2YA2A 3WUGA 4MB5A 3PZUA 4UFMA 1EOMA 1J0HA 2G8ZA 2C0HA 2WAOA 3GYCA 3DHPA 2UY2A 1EDTA 3K4AA 5ABFB 2ZX6A 1NH6A 1UZ0A 3L4VA 1V6XA 4FLQA 2W9XA 1BPLB 4PMUA 3OLDA 1HKMA 3C8XA 4XUPA 1I1XA 5HXMA 4IISA 2Y6JA 1UY0A 3VOCA 1Q6FA 4Q7NA 1E5NA 2J7HA 2VR5A 4UFIA 3M7SA 4D6HA 3VMNA 3VGBA 2J7MA 2V72A 1XC6A 4ARYA 5M03A 2GSJA 2GUYA 4X0NA 4TVCA 2XYLA 2DIJA 1EO7A 4CCDA 2D3NA 2OWCA 4WIWA 5EBAA 2WO2A 5A8OA 1KXQA 3AIBA 3CUHA 4UOQA 5I0DA 1LWHA 1C90A 1GU3A 1PMJX 3GDBA 5EJZB 1QBBA 3AC0A 4XZBA 2F8QA 1MFUA 4Z2IA 1TVGA 2VX5A 4CKQA 2PF0A 3QGVA 2YIHA 3T08A 5DPNA 1EOKA 4ZE4A 2YL8A 1ESWA 4BK4A 2ID4A 2BVYA 1HNYA 3J7HA 2CERA 2CDOA 1TE1A 2GFTA 1UD6A 1W9XA 4PQQA 4QDRA 1NKGA 2PWGA 3NCOA 3EBVA 2QHAA 2WWCA 2E33A 3WNMA 2VT0A 4UQCA 2VTFA 3LE0A 3WSUA 1HKKA 1W9TA 3ARYA 4TXEA 4OYUA 4C7DA 4CD7A 3F2ZA 1OM0A 1UOKA 3W37A 3ZJ8A 2VZSA 3CZEA 3WDIA 4AMCA 2WZEA 4AIUA 4BS0A 3VINA 3SKJE 3ACFA 3CHEA 2XIBA 3QOMA 2D0GA 5DMYA 3UEQA 5LCWL 1TFVA 3AI0A 5AY7A 4OMCA 4GPNA 2VURA 4TXWA 3CUGA 2X2YA 3CZKA 3CO4A 4CN6A 5HPCA 4E4PA 4D6EA 2HISA 4UFHA 3SCRA 4QPWA 2WVVA 1F4HA 1CECA 3ZIZA 3PUHA 3QHMA 2Q8XA 1W9VA 2VCCA 2W46A 3ZM8A 3T09A 1D3CA 4EAMA 4D6FA 2XVNA 3AIWA 1QI3A 3CMJA 4F79A 4P5YA 2QPUA 2WXDM 4D72A 1C7SA 3K77A 2ZX7A 1QVBA 4W89A 4BF7A 3WNLA 3CMGA 2WYSA 5HNNA 1W9SA 3GGLA 1B9ZA 3AMGA 2WKGA 4AD4A 2CITA 3ARTA 3HJRA 1E43A 3CZJA 4R5EA 5CLWA 5CJ5A 3OZPA 1GUIA 2W92A 1GONA 2EPKX 3WMBA 2VCAA 4NSBA 3W5NA 2XFFA 2XSAA 3HPNA 2BHYA 1EHAA 1OD3A 1VEPA 2E3ZA 4PMVA 1MPXA 3CH9A 2ZUWA 1J01A 1UWRA 3CZGA 1XH0A 1OGGA 5JBDA 2VJXA 2PWDA 1GJWA 2LW8A 1IQDC 1WDQA 2JFEX 4ZFMA 2VRKA 2OWXA 1J83A 2FGLA 4AYSA 2GJRA 2VO5A 3MU7A 2YDQA 3WBEA 2J1VA 1ULPA 4TX8A 1DHKA 4MO3M 3ZR5A 5D9PA 1W9WA 3HU7A 2QQNA 2D3LA 1HL9A 2EIDA 5B4XA 4J3WA 1C92A 3WQWA 1QPKA 3LPOA 5A6LA 1WZMA 3M07A 3ABZA 1MVYA 3W24A 4V27A 1JZ4A 2QQLA 3SKVA 1B3XA 4RE3A 4CU6A 1WP6A 1PJ9A 1XGZA 1ZJAA 1W8OA 2BFGA 4CVWA 5E6YA 1CIUA 1L7QA 2ORZA 1V3HA 1E70M 4DWSD 2X05A 2ZOXA 3HNMA 4GO9A 1LL4A 2JE8A 3L2MA 2E26A 3WDQA 4HOXA 1BQCA 1V0KA 4KH2A 4PUEA 4HA3A 1PIFA 3NYDA 2WZHA 1JZ8A 3TOPA 5A95A 1JF6A 2CHOA 1JNEA 2CXGA 5GNYA 3MUY1 1MQRA 4HMCA 2G41A 2TAAA 1JDCA 1W3JA 3VD4A 3F5LA 4AD5A 3EMQA 3TTSA 1H49A 4Z2LA 1JXKA 2VZQA 4OBSA 4UR9A 2VCBA 4BQ3A 3FXYA 3FW6A 4UZUA 1QW9A 1VAHA 1PEZA 2WLYA 1PPIA 4QAWA 3GBDA 2ZXDA 1JD9A 1UZ4A 1GHSA 2YKKA 4QB6A 5IHSA 5JIPA 4AZCB 2VX4A 1MQPA 2X09A 3VD9A 4FLOA 4M1RA 4RE4A 3RM9A 4QDSA 1R64A 3ACIA 2PWFA 1FFQA 3B9DA 4TTUA 2X0YA 4S3KA 4AEEA 2ZUSA 2VZOA 1TVNA 4UNIA 1MW3A 2J75A 2D22A 4ZEPA 3K4ZA 4GQRA 3C7GA 1G94A 1CWYA 1KR1A 2EO7A 1K9DA 1HF6A 3FL7A 1W99A 3UG4A 2WMIB 3AYRA 1J9YA 3ZT6A 5C70A 6A3HA 1BTCA 3W0KA 1G01A 3ZOAA 1GOFA 1TCMA 1D7FA 1K42A 4BQ5A 1V3KA 4W85A 2ZEWA 5A2BA 4OOUA 3POCA 1V03A 4QB2A 3AXIA 4DM2A 4M4RA 5BXRA 8CGTA 1TVPA 1XSKA 2X10A 1KB3A 3CLWA 4A41A 4JHOA 2V3EA 1YQ2A 2Y64A 2VVNA 2XHYA 4WSKA 4F8XA 4XUOA 4J3XA 3O6AA 1QNQA 4ZXOA 3SCNA 1JZ7A 3ARZA 4ZENA 1U33A 4AAXA 3OG2A 3UCQA 1E0VA 4MPKA 5IDIA 2Z1SA 4F9JA 1FH9A 1XCWA 2WBKA 2ZWYA 1OIMA 2O9PA 3P1IA 2PBGA 4D1IA 4GWIA 2BVTA 3NRUA 4MADA 1E72M 4HPGA 4J3TA 1JU3A 4P08A 2X1IA 4U31A 4OJYA 4ZE5A 4PTXA 1FH8A 1H5VA 2DDUA 3NJ3A 1HJUA 1RP9A 1E15A 4MAVA 4TX6A 4TUFA 4F66A 3MV01 2BV9A 3PTQA 5A6SA 3AXXA 4GO8A 4CUCA 5G04L 1H09A 1R8LA 3VGDA 3AJ7A 3SUTA 2VI0A 4PRWA 3MMWA 2CDPA 3PZNA 1E3ZA 4PCTA 2DSKA 2BY3A 4H2CA 2E9LA 3DC0A 1EDQA 2J62A 2WM0A 3CIVA 4NF7A 4KMQA 4A6OA 1E9LA 1GQJA 3S2CA 2VZUA 3U57A 2ZUNA 2OYMA 1U2YA 3A4AA 3THDA 4DUWA 1CNVA 2J1EA 3CIHA 1VEOA 2FH6A 3ZJKA 6TAAA 2YL6A 3C7EA 4ATDA 4PBGA 5F7UA 3O9NA 1H6XA 2VZ1A 4CGTA 2GVYA 3ARXA 3D3AA 1JYWA 5CLTA 2YLLA 4GIAA 1M53A 1W1TA 1FHDA 4QB1A 2BGPA 5C8BB 3PZQA 4FI9A 3WBAA 1HJSA 2XVLA 3AHTA 4YN5A 2EPMX 3W27A 2WNWA 2VMFA 3VUPA 1LJYA 1HJVA 2YA1A 1NWUA 4JFWA 2W63A 3JUGA 4TTGA 3ACHA 1HKIA 1UA3A 3U5UA 1CPUA 1ECEA 3AISA 4D6GA 5AC5A 5EFDA 2JF7A 3LEIA 3CZLA 1CX1A 3MANA 3TTOA 3UR7A 1DEDA 3AS1A 1NX9A 3NQHA 1ZBKA 2WDBA 3WQBA 1DWAM 3O2LA 3I3BA 3WH5A 5FIPA 1BHGA 2J7GA 2YJQA 3K8KA 1V0LA 2QQIA 2XQXA 1UKPA 5I24A 3T0BA 4FMVA 3SIMA 1CEOA 2F2HA 3VO0A 1IV8A 3CTTA 2BY1A 1ZS2A 4JFTA 1HXJA 3DYOA 5A6BA 3WNKA 3VMOA 3ARVA 1NWTA 1OINA 1ISYA 2ZUUA 1E4IA 4CUAA 3NSNA 2BNJA 4MNJA 2W61A 1BVZA 5CGMA 1KBBA 1KQYA 1SMDA 3AXHA 3AHVA 2J1RA 3GNPA 3I2JA 1H11A 3WF4A 3EMCA 5JBFA 2DQXA 3T0AA 2DGAA 4HOWA 5JXJA 4PCSA 1XNAA 3N11A 3ARWA 1QHOA 2D2OA 4PMOA 1XH1A 1W9BM 1CXFA 1UKSA 2O9TA 3UG3A 5A8QA 3GNRA 1BFNA 1BG9A 1D2KA 1VF8A 1I75A 4P7QA 5D8WA 3GXFA 3GM8A 1C3FA 4A42A 3IANA 3LMYA 2DSZA 4U3AA 2XG9A 3BAYA 5CGTA 2GK1B 4AZ7A 2DSWA 1NM9A 4GKLA 4HMEA 1V6UA 2C9KA 1UD3A 1UYXA 2DH2A 3NDYA 4UCFA 2VL4A 1H41A 2IXUA 5M17A 2CNCA 1CXKA 2KD7A 1QI5A 4CD4A 1CDGA 3WEMA 3AZRA 4DXSA 1K9TA 3AZTA 1E1FA 5EJ1B 1IT0A 1SFSA 1X1NA 1OIFA 1KQZA 2ZUTA 1PBGA 1H1NA 4WKFA 2WC4A 2E9BA 4X0VA 3THCA 2OWWA 1O6IA 3RDKA 5A8NA 1EDGA 4YHGA 1OCQA 3SURA 1R85A 1JAEA 1H2JA 3UESA 3HNYM 1SYTA 4MGSA 3TP4A 5I79A 1CZVA 1E4MM 1GQPA 1PX3A 1LQ0A 4EKJA 3KZSA 1CXLA 4ATLA 2WVTA 2A3AA 4OBRA 3PZTA 5I3DA 2ZEYA 1E40A 4N0RA 1BGGA 1BGAA 4AZCA 3AHYA 3NUKA 1JYVA 2QQMA 2VMDA 2V5CA 4GI9A 2XIIA 3K1DA 2WMGA 4WJXA 1UWQA 1ISWA 1ITCA 4CU9A 5HOSA 3LPFA 1BVNP 2WABA 1AVAA 1GCYA 2WZIA 4WSJA 5ABHA 1CLVA 3E1F1 2CHNA 3L4UA 4UI9L 3OLIA 5LA2A 5CSUA 4L4PA 3RO8A 2R7EB 4QLJA 2GJXA 1H4PA 1A47A 3WY1A 3VD3A 1C8QA 3N04A 1BF2A 2O92A 3EDEA 3G6MA 4P8UA 1ODZA 3PHAA 3AROA 4WK9A 1UWWA 1DYOA 3FNDA 2VZ3A 1H0IA 3ARUA 4IPNB 1C91A 1OB0A 4MDOA 2QF8A 2J8GA 1UY2A 3EYPA 1VRXA 2E9MA 1GZJA 2J47A 2WN3A 1J84A 1EUUA 3GBEA 4PSPA 3ECQA 2WWDA 2WHJA 4XURA 2DCJA 3CKHA 2VC9A 1E6XM 2WAAA 1JDDA 4AXNA 1CXHA 3AIRA 3I2FA 4EK7A 4M4PA 1JZ3A 2FH8A 3PZOA 1Z32X 3ARRA 1JI1A 3UETA 1HVXA 3VIFA 3N12A 1GOMA 4Q22A 4PMYA 1ISXA 2BERA 4JKKA 3A23A 1UD5A 5IFTA 1DP0A 2Z4FA 1NP2A 2XGIA 5GPRA 4UOZA 4LPLA 4XUQA 4ACYA 3AMKA 4MJ4A 2ZXQA 2X0HA 1QNPA 3RPMA 1XPWA 4W5UA 2J7BA 3I2KA 1CIYA 1NQ6A 2Y6KA 4CCCA 1NOUA 1E6PA 2CEQA 1J0KA 2J7CA 4GZJA 3B9AA 2HLEA 1M7XA 2PC8A 2DT3A 3I97A 2BXZA 4W88A 4OOZA 1HJWA 1K9EA 1KWGA 3AS3A 2C7FA 1JD7A 5JXGA 2BBAA 2VZTA 3EDKA 2E8YA 4XZUG 4AG4A 2ZXBA 2PWEA 1J0ZA 3WUFA 2B31A 3A22A 1FP9A 5BRQA 4E8DA 3VKKA 5FD0A 1ULOA 1O59A 4P00B 1GOKA 3BLPX 5EFFA 3A7QA 4CU8A 2DT0A 4MNMA 2WANA 5DT5A 1UWUA 4PMDA 2WBGA 4AWEA 5D9MA 3BXWA 4UZSA 1UR4A 4W7UA 4BDVB 1OH4A 1XYFA 1MWOA 2YL5A 3VIGA 4B9ZA 1BLIA 2WW5A 3CZ8A 2W1QA 1GW1A 1KGWA 5TD4A 1W3LA 3A4WA 1UXXX 2BGOA 3IAPA 5JIWA 3DHUA 5A3HA 4J28A 1RP8A 2D0FA 3W5MA 3EMZA 3I3DA 3FHQA 1LLOA 4CD5A 1KXTA 1XNTA 1ZJBA 3CPUA 2EPOA 3CUIA 3FY1A 1CGUA 2WMFA 2LS6A 3OLEA 5E0FA 2J1AA 4YHEA 1O8SA 1XD0A 3VIJA 3ZMRA 4XUYA 3TTYA 1WB0A 4HZ7A 5J1XA 4DXTA 2XGBA 1UR2A 1W3HA 1OT1A 3VD5A 1KCKA 1FP8A 3NJXA 1OGBA 1HP5A 4NI3A 4GWJA 1E0WA 2GDVA 3K8MA 1AQHA 3SCQA 4LYRA 2VOTA 1UH3A 1HP4A 3GXIA 3AIEA 1ODUA 5ABGA 2WSKA 4IPLA 1UKOA 5KEZA 1JG9A 4KRTA 1B1YA 4A3YA 2YG0A 3AICA 1GNXA 4XX6A 2W91A 3MKKA 1WZKA 3GZAA 1BSIA 2ORXA 4DXRA 5ECUA 3SEEA 3FHAA 1CBGA 3ZR6A 4IUGA 3A4XA 3AOFA 3MO4A 1GVYA 2DSVA 3AQUA 3G6LA 4HA4A 2OSWA 1K45A 1E6QM 3VIIA 1JAKA 1DWFM 4BK5A 4GQQA 3SCWA 1JHJA 2BY0A 1O7AA 5AYBA 2BHUA 3BH4A 3RILA 3T2PA 5I2UA 4HPHA 1CLXA 4BA0A 3CDZB 3C7HA 1J11A 5A8MA 3VGEA 1G1YA 3GNOA 3WFZA 3W6MA 4PTWA 1LF1A 3W81A 5BXTA 1UMIA 4AZBA 4EANA 3GXDA 4QX2A 1NOFA 5KZ6A 3CHCA 1UD8A 3II1A 2XM2A 4PMXA 4MNKA 3K4DA 3P6BA 3BSHA 2Y8VA 4M29A 1UYQA 4UQBA
chains in the Genus database with same CATH superfamily
4AC1X 4ADTA 1GVIA 4K1ZA 1MS3A 3QH7A 4QNWA 4OFGA 3R43A 2WNZA 3S46A 1DJQA 2IXCA 3P3PA 1BJQA 2ERFA 4AR2A 1EHNA 1PM7A 4N4PA 1BYCA 1YTKA 1OA4A 4CSWA 4GYJA 5ACA2 1P6WA 1Q6OA 3KT1A 2YU1A 3N4EA 1VH7A 4JX0A 4ZZ8A 4XF9A 2CGPA 3WFLA 3W22A 3GHSA 4V2VA 2W95A 4UAPA 3QZEA 2QDDA 4U2ZA 4C6MA 2WNUA 1F9CA 1OQEA 3MYXA 3CL1A 2C26A 3A9BA 4PSRA 3W1UA 4ILSA 1SPQA 1WKYA 3VKDA 4LBQB 3WENA 4R27A 3VXGA 3TOYA 2EALA 1O94A 5G2WA 2LLEA 4M51A 3BTXA 2L9LA 4OT7A 3VIHA 3O14A 4CQ9A 5FKCA 1XIBA 2YBVA 4IMAA 2C9AA 2FZDA 4D2JA 2ZEXA 2VGIA 4X9SA 2LRPA 2YPJA 3AZYA 2QQOA 1LBFA 1AL0G 1WDSA 1TIMA 5DN2A 5DUUA 1EYWA 4XVDA 3WHUA 4RZBA 1MW1A 3VKLA 3WHTA 1J8VA 1UP0A 5FKYA 2IKJA 1MZRA 2RDQA 3MF9A 3QKEA 3TROA 1ISVA 4QCFA 3B02A 3OGRA 4WKAA 4ML4A 3TCSA 4M6QA 1VEMA 3MW7A 5F6LB 3VZNA 3HG5A 4HD5A 1Y7VA 3M9YA 1VENA 2WQ8A 4XFHA 4XF3A 4EPEC 5FPUA 4QCEA 4XJ9A 2B9UA 5FPLA 3TZNA 5JPNB 1VALA 1BXCA 1AQ0A 3TEVA 3C0SA 2JQXA 1TPUA 4EAYA 3WSOA 2IUWA 1TPVA 4DBEA 3LXCA 3S7EA 3MHZA 4FEZA 4IX2A 5BU9A 3UKTA 2VENA 3EWZA 3D5HA 5CBBA 4I8DA 4A22A 4JCKA 4COWA 4UC5A 3K8LA 3URBA 1XRUA 3Q8CA 2NQZA 7ODCA 1HIZA 4Q8TA 3LCGA 4E2OA 2RMU1 1EZWA 1W1PA 3VDGA 5FBZA 2XLFA 2YBPA 4MGKE 1E6RA 2QVSB 1YDVA 3LPGA 3T0CA 3ZYZA 1DFQA 4PT6A 3SEPA 2A6NA 1S46A 4PEEA 1Z41A 3GH4A 4JV4A 2TYSA 4RPPA 5F2MA 2QQUA 2IW0A 1WDPA 1EGZA 4PEKA 1TMQA 3NZQA 1W17A 3W1QA 3CJPA 2CC0A 2BVDA 4Q4W1 2FVLA 5LIYX 5A80A 3QH2A 4EWJA 5FSDC 3HV9A 3SIZA 4MB1A 4JFVA 1UH4A 1PSCA 1NCQA 3WT3A 4UTIA 1JU4A 5HWJA 3JR2A 4DFSA 5LZLA 2PTWA 2QDNA 3FYPA 4AF9A 5FJIA 2DU1A 3N2OA 3KL5A 4IUOA 4XTPA 5JOWA 1FWEC 3QRHA 3LK6A 4C5ZA 3VBSB 4YLZA 3N1AA 1UXZA 1R1A1 4NRQA 1LG1A 1CD3G 2BDRA 2Z2UA 3U4AA 1WE5A 1X98A 3NO5A 3VBFB 1G4PA 2VOVA 3VLBB 3B9EA 3BCDA 4JFSA 2NX9A 3WVJA 4B91A 1FHVA 3BSGA 5LRRA 1MQQA 5AC8A 1FCQA 5BWFA 4RQPA 3VBUA 4IMDA 3N3TA 5MKGA 5FRAA 2E0PA 5A6QA 5EPAA 3F4VA 1R6WA 1QNSA 3VIOA 3IIPA 3CQOA 1D7KA 3BZGA 4DBDA 3CAQA 4AVNA 1EX5A 3IRSA 2FZBA 5LNSA 2UBPC 4YYFA 3VGFA 1Q3NA 1JIBA 4OHXA 1VJSA 1RBOB 1WA3A 4W4ZA 5EBUA 4NYYA 4BQ4A 3BMXA 3NWKA 4DIAA 1LNSA 3FLUA 4HNNA 1K6AA 2Y24A 3KHJA 3RITA 1VFLA 4K37A 4XTIA 3T3YA 2W66A 4CVUA 3M0JA 4H8HA 2V4VA 1RHCA 3GZUC 5FMDA 3COTA 2E32A 2QCDA 2W27A 2PDQA 3FN9A 4NAMA 2H0VA 2BOEX 2P3JA 3GDRA 3LLXA 2IKHA 1IT7A 5AFBA 4DO0A 5FYHA 1ND2A 4AYUA 3LA4A 1QHPA 1BBT2 1R083 5BMXA 1NEYA 1CVNA 4AEMA 4HHHA 1L7RA 4JGYB 5I06A 3PVEA 3QOKA 2VKZG 1OPMA 1MXGA 1UYZA 2VECA 2YV8A 3IUDA 4IFKA 3FBYA 4YW1A 2EBNA 5BZAA 1TEIA 2G50A 1XE8A 1UBSA 1W8NA 1TPWA 4M80A 1RIRA 1E6ZA 1V3LA 1VBJA 4LO7A 1X39A 2WSUA 1KRBC 5FCZA 3LBMA 4NAOA 4HN1A 1XYZA 5H6HA 2E9QA 3BCFA 3WMCA 3LN3A 4PLNA 3SCGA 2VXJA 2DPEA 4BQWA 3B9IA 1Q8VA 2D40A 1UOFA 1ZZ6A 5AFDA 3H4XA 4WGXA 3WEOA 5CEWA 1MSSA 4DYJA 1M9HA 1JXJA 2WLZA 1H5YA 2WMKA 2QNEA 2PU1A 3MF6A 2GGHA 4XEZA 3G22A 3KDNA 4MGIE 4LS0A 3VN4A 4Z0JA 5I78A 3S30A 1AL23 2W94A 1OD8A 4FPCA 2AGTA 3P5YA 5C54A 2F4PA 4Q2FA 4R9XA 3R5EA 4LQRA 3WIJA 1OVSA 4YNGA 3WJXA 4P9LA 2X8KA 4IICA 3DC8A 3T2TA 1YI9A 3A21A 3W38A 2TNFA 3M3OA 4R33A 2UY3A 2IXVA 1FKWA 1V08A 1WUFA 2CWXA 2PTXA 2QXWA 1V6YA 3URFA 5TSWA 4WZCA 3WDUA 1KFCA 4ZGYA 1NAEA 5ANQA 2VEKA 1SUXA 1Q66A 5DF0A 5FACA 3G0UA 2J7DA 1NLRA 2V69A 2REQB 4YTTA 4LOTA 4XQDA 1ONEA 1V8EA 4JL2A 4JZRA 2XFYA 1H51A 4JGDA 4HT1T 1GVOA 3BAKA 1S2TA 4Z1AA 2GQ8A 4L9ZA 4HPJA 5H91A 5IK4A 1DHKB 3NJVA 1G9BA 2VQ0A 4HN8A 3GALA 2YW4A 4NUBA 4G7EA 2GDUA 5B4NA 4X8NA 2CLLA 5FZAA 1UPIA 1IWAA 2OO6A 3VNZA 1QQP2 4DPNA 3LENA 4W93A 3EX4A 3RLVA 5C9AC 1LDCA 4Q8NA 4KPLA 3VBHC 4ROPA 5E70A 1SDDB 2VUDA 1V6WA 2ETEA 2HROA 5FAJA 4GIYA 2ABBA 1G9DA 4W8JA 1NDZA 4PF1A 5FL1A 4WRHA 1LU1A 3QHNA 1SDWA 3TNQA 3HQ1A 2HE5A 5J5DA 2D20A 2CBUA 2P3IA 2UY5A 4XE9A 4K38A 1UL9A 2EAWA 1QT1A 3IJ9A 1SQ4A 5ABJA 5DG1A 1RALA 4GI4A 3GIPA 2XVGA 3PVOA 5EFUA 2ZUMA 4HIBA 3D0CA 1CX4A 1LQ2A 1N8WA 4V28A 3M3EA 3VDHA 1W90A 3I2GA 1PIGA 2PLV2 3BK0A 3AU2A 4PZVA 1EQCA 2VM9A 5EA9A 4QGCA 4Q27A 3OZOA 3DH7A 2JIEA 4HCLA 3BTNA 1ZBWA 4AZIA 2WFF1 5FOJB 4FLRA 4PCFA 2IMRA 5LIWX 3M0HA 4Z2KA 4GI8A 2WJEA 3F1QA 1NWSA 3HT2A 4K1YA 3R8GA 2XUCA 4EPBC 4AD1A 1H8TB 4H9ZA 3LBOA 3C2YA 4LUTB 5FYZA 3UERA 2DVAA 3L4ZA 3N13A 1MS9A 2VWSA 3MI2A 2ASHA 4YRDA 3NO1A 1KW1A 1JODA 3WP4A 3F2CA 2XSBA 2C1GA 4Y8FA 2WNVB 1WPCA 3WW3A 1GV9A 1NY71 1WMEA 3VNKA 1UR0A 3E2QA 1W5OA 3GNDA 3UJOA 2XJ7A 4DEQA 4LUSB 3L12A 3W76A 3BQ5A 1TPB1 4DO7A 1VJ2A 1ZZMA 3CJIA 5FZ3A 4WXZA 2OZJA 2PQQA 1OUSA 4GZIA 4QRNA 2C1HA 2A73B 2ZAHA 3U14A 2VX7A 3N9KA 4Y6GA 3D3FA 1UJPA 1VRBA 5L73A 3H26A 1T5AA 3A64A 1H62A 3HMCA 1HT6A 4WJEA 4MF4A 1IS4A 4C8DA 1W8HA 2A6XA 3NQCA 5FZHA 1EIBA 1Z44A 4KGLA 3TAKA 4GRSA 3OGJA 4N90A 3RPQA 1W91A 1KM1A 1N1SA 1VPXA 4CDXB 3P14A 4LK6A 4Q4QA 1VBA3 3TQ0A 4ICNA 3B7MA 2O56A 5F4XA 2QAFA 3MMUA 1O3TA 4BKNA 4B4HA 1YNQA 2QJJA 4P7LA 1XDMA 3VHNA 4G3YC 5U4NA 4UB9A 3IIZA 2ZEZA 3NXLA 1XSQA 4B5NA 1OFEA 2BW8A 3V5OA 3H8UA 1V79A 3WNNA 4QGMA 5D2XA 4RQPB 1SO5A 2FJUB 4C6FA 4P9XA 3HAGA 1A8DA 1ULEA 3ZJ7A 1XE0A 4GOAA 5AZ1A 2AQOA 3TTQA 1XCXA 2EF9A 2E1DA 4JFUA 2P50A 3CUJA 3HGSA 4AHPA 2QPXA 3I65A 3GXUA 4AVCA 1XR2A 2OPWA 3GZ3A 4J1WA 1QJX1 2CKSA 4PUDA 3LXBA 2QIIA 2HK1A 2V3GA 2NQLA 3PPFA 4QLLA 1IS6A 4LORA 1DKWA 4Y4YA 5GZGA 1IGSA 2P10A 4X22A 5I3HA 4B3KA 3S2MA 3ITXA 4U5IA 1B0IA 2WNOA 1HVQA 4GMP3 2G37A 3M1ZA 3CQKA 3G0SA 3RMEA 3G2GA 2X0SA 3VDDC 2FDJA 5CC7A 2HVNA 3C56A 4Z2HA 4IGNA 4NMIA 4XK2A 3TWIA 2XVPA 4UQDA 2P1FA 4N6EA 5D21A 4OUIA 4LT5A 1BZWA 4KBXA 4K21A 2Q1ZB 2RDWA 1IKQA 4P8VA 4XD3A 2CCRA 2HZGA 1OLQA 1S2UA 4Y9NA 4HBNA 4MOZA 3LHVA 3T9PA 1P0DA 3TVAA 2OB3A 3BAXA 1AJOA 4ITCA 4AW7A 1SPPA 2F6BA 4Y5Z0 2Y4SA 5AECA 4XUGA 3I3QA 3MMDA 3EEGA 1KM0A 4IQEA 3VDBA 4YVWA 2J27A 5BXPA 3BWWA 1PYMA 4CXYA 4QJ5B 1LOEA 2EXIA 4O9GA 4OIFA 3VBSC 5JXHA 2Q01A 1TIWA 3M6DA 4GJJA 2VR4A 4FP2A 2PAMA 1BRLB 4O1BA 1YLVA 3KL3A 4QFUA 4UTTA 2XISA 2DFBA 1E1EA 2OZ3A 1LQAA 2WMJA 1HB1A 5AB3A 3FMGA 3ALFA 3CXOA 2OS2A 4Z8BA 4E3VA 2NXHA 2RJ2A 2IVJA 1WKEA 5FF3A 3V3WA 4K6BA 3GJAA 4YM2A 4NRSA 4YS1A 5D1IA 2E68A 4GQGA 3WUBA 4ATWA 3WQPA 3IK2A 4EPDC 4TR9A 4Q6JA 3NVCA 1EC8A 3VL8A 1LRNA 2QCLA 1JYXA 2G3IA 2JKBA 3M2MA 1QPNA 3DG3A 5AYIA 4MHBA 3VIMA 3AM2A 4GC3A 4GZ7A 3VKFC 2C15A 4UUIA 2ZHLA 1S5NA 4FSAA 4PMRA 5EMJA 3KQ4B 2FHBA 2YFUA 3KCYA 2ZVRA 3V0AA 4L11A 1MXSA 3MUIA 4C7FA 4ZQMA 3HIJA 2NT1A 3KTXA 1M6JA 4O7XA 5BNOC 2XWDA 4MKVA 1ZY9A 5E09A 2WN2A 3WX7A 1AH3A 1E0TA 4FPFA 3U75A 3TN93 2Q4SA 1VFFA 3R4IA 3LA2A 4B5WA 4PMZA 4XAAA 5FZDA 1F74A 2GMMA 1UWSA 1LL6A 3E6DA 3S42A 3WDYA 1OLME 4LAKA 5HWNA 3L4YA 3ASIA 3PPHA 4MXWB 3EOOA 3CIXA 2QQJA 4IDZA 2WCAA 4BF9A 4BA6A 4KG0A 3PPGA 4N53A 1KTCA 1TG7A 1U5HA 3GTNA 1RQHA 3CB8A 1UY3A 1LWJA 1NA1C 5GLZA 5IXEA 1EA0A 4UQAA 1UD4A 4XB3A 4MJMA 3WG6A 2CIPA 2OYLA 5IVBA 4M3PA 4YWIA 1GOIA 4A8LA 3U0HA 1YC61 4LBMA 2YOCA 4PC8A 4JTNA 2C71A 3KQRA 3FBMA 1EAH1 5FPVA 5FZ1A 4H7VA 3A0NA 3MBWA 1ZU8A 3OYWA 1JCTA 3W84A 3NL5A 5CSRA 4HOZA 1FDJA 4D8AA 2G9FA 4LH8A 1SHWB 1YIFA 1ZENA 1PX4A 4Y33A 4CDUC 2K9ZA 4MOAA 3UJEA 3BO9A 3PFMA 2D6MA 4L5ZA 5A1LA 5PTDA 5JMOA 2NW0A 1RVKA 2YC0A 3H50A 1DJWA 2E40A 3A5VA 3R12A 1OF4A 1ZA4A 3H3ZA 3GTFA 2B4KA 1RH9A 4CNOA 4J27A 1G67A 4P7OA 4NY2A 1H9WA 4UBPC 3IS4A 1LBLA 2DUOA 2HWC2 2WAGA 4A8RA 2WNVC 4RDZA 2BNNA 1UKTA 3UP8A 4K36A 2X53S 3ORWA 1QNYA 2A3XA 2WZR1 1YFXA 4ZXEA 3PTRB 1GOOA 2GWGA 4QEEA 8RUCA 3OBZA 4ORIA 3SRKA 3B8WA 4S3JA 1AL7A 1SW3A 1SFTA 4O0KA 1WZLA 1PO23 3IDAA 1C4RA 1VRH2 3K48A 3C2OA 4J3ZA 3AWOA 1F2JA 1PDYA 4UTFA 5D8AA 2DZPA 4M82A 2XBO1 2XIJA 1JXNA 4BZ4A 2QS8A 2FQPA 4W6XA 1B3WA 3NJYA 1E5JA 1H6YA 2FTPA 3AIVA 4AG0A 1JCJA 3PMSA 4HPKB 2W62A 3R0DA 3MDPA 3VILA 3KXQA 4XAZA 5I93A 4TOQA 2XUMA 4JS3A 3CWNA 3HJEA 5FAGA 1V51A 4BQ2A 1ISZA 1DIEA 3V0BB 3BLFA 1PO13 4CDXC 4OHZA 5HV4A 1F15A 3GNEA 1WBFA 3QGAC 1HQWA 3SY1A 1DQ4A 1EV11 1W3KA 2Y34A 4HPXA 2ZX5A 1FWTA 4GH4C 3LRKA 5K2ZA 3ZSTA 1DZTA 4JRLA 1FATA 2OGYA 1SJBA 5CPSA 3LGDA 4OQVA 4OULA 1OJXA 2YCJA 4XCBA 4WV8A 3T0DA 4H9UA 5HMDA 1W8UA 1NY72 2OEJA 2YXSA 2YFZA 3B69A 4IZGA 1XIDA 1RL3A 3S5OA 3W21A 3UNPA 4F0HA 1T40A 2Y7GA 3G77A 5HNRA 4GZ9A 1NUKA 2BVWA 4U3CA 1UX7A 3LM7A 4PHZA 1RD5A 3TEYA 1Q6GA 2Y8KA 5E16A 4JQRA 5TNVA 4GY7A 2SBAA 3EX2A 2ZGQA 4NN0A 3NQDA 4BJHA 3IZOA 1IWPA 2VNOA 1ZZBA 4B1LA 1U30A 1ZNNA 3QMSA 5GJMA 3RM4A 4Q4W2 9XIAA 1VAVA 3SH3A 1W1IE 3T55A 4FNPA 4EN0A 5EKYA 3MA8A 4X3ZA 4PLMA 2QUTA 1BBT1 1MZFA 4XZ9A 2RR12 1WDWA 3S6PA 3VBHA 1QJEA 3AB0A 4DF0A 3BAJA 5FY1A 1RD6A 3NSXA 3SFKA 5CSYA 3CV7A 2ZICA 3F95A 5FYBA 3FS2A 1B3OA 4YTUA 1AXKA 4OZOA 3EX3A 2P37A 3D46A 3ITYA 3JUUA 3H21A 5GJPA 2MPFA 3UY7A 1CYGA 3AYSA 2B9VA 4Y2WA 3SUUA 2J22A 4RK8A 4XF4A 2V09A 1UZ1A 3WD2A 5HQLA 1W8GA 5CPLA 3UGGA 2DZBA 5MHBA 3CV6A 1OQFA 4I5UA 3KZPA 1LGBA 1IHMA 1VJZA 3IWPA 4FX8A 4W50A 4YVWB 4E8CA 1SGJA 1XXXA 4Z1VA 4H2AA 1JMUB 1CZTA 2R072 4AY8A 1SLBA 2VD7A 5FOBB 4L6HA 4ADUA 4DM1A 3NNGA 1GNZA 2WMIA 3N4AA 1TV3A 3LI0A 1GWLA 3I49A 4TMCA 1RVF1 3WK1A 7TAAA 3CL8A 1WZAA 1JZ6A 2JDNA 3PZIA 2JD4A 1QOXA 1W6PA 2QQVA 1GKPA 1A4MA 1PZ3A 3J4UH 2IQTA 4DQWA 2P0IA 2WZR3 5DCDA 1WO2A 4LO8A 1WCDJ 3HA1A 3T0TA 5DCEA 3TQPA 4J2PA 2PHWA 3M16A 3PSWA 4I9AA 4HMZA 4PDWC 3C8FA 3OG3A 2QZ2A 2D69A 3C3NA 5ABFB 3S8HA 1XLCA 2Q1MA 3BALA 2MEV3 3TNOA 4JVAA 4LBJA 1FDYA 1XSRA 4LAOA 4IQPA 4PE8A 1Z7S3 3GYDA 1R082 1FY6A 4MWAC 3P82A 4IISA 2BDQA 3V5CA 4Q4V1 2BFUS 3LAGA 1AH0A 5L7OC 1VHNA 5CIRA 5L7OB 4D6HA 3O6YX 1JH5A 4OU1A 4EOUA 2V72A 1GVSA 2JBMA 1XBXA 1AVBA 2O8QA 4JQTA 4JQ4A 3OPZA 1CCWB 5ACA1 2PRHA 1RVGA 2X29A 4AGGA 4WIWA 2PA6A 3RZJA 5F2SA 3RZKA 2CW6A 4UOQA 3WXPA 3DCPA 1GU3A 1XIHA 4E2GA 1PMJX 4XJ8A 2WKKA 3GDBA 3APYA 4XZBA 3A3WA 1LT7A 1ZUAX 1PDZA 1GKQA 2VX5A 4G5DA 4KKXA 4CKQA 3DFQA 2PF0A 1IGOA 1WMFA 5DPNA 3T1MA 1ADOA 4K40A 1PHWA 3HG4A 3NNTA 3M0YA 5CSSA 1RCOB 2WS92 3EWUA 4FIRA 4YGDA 1UD6A 1W9XA 5CZSA 4X2PA 1G4EA 3W23A 1DQ1A 3T7VA 3G1SA 4AXKA 4XBNA 4G9SB 1I1EA 4COZA 3WNMA 4AI2A 2VT0A 1JPIA 3I54A 3SQSA 3LE0A 3TFCA 2GDFA 1W9TA 4HSLA 4EWEA 4BM8A 4CD7A 4C6JA 4GXWA 2RS53 1GYMA 3CZEA 4KFNA 4IIGA 4EJRA 4RCXA 3ZZ1A 3UPBA 2HBXA 1HV0A 3BOWA 3OBEA 6TIMA 2J13A 1F35A 1AL8A 3ACFA 1V6JA 4F3JA 1BBT3 1NQJA 2D0GA 3LGGA 2YPDA 1HJFA 4UMBA 3VBFA 2VURA 3NZ1A 2XJPA 4FOKA 1FXQA 1SFNA 1AG1O 1TMLA 2E7FA 4XSLA 3CZKA 4D6SA 5FLHA 3IGHX 1ZVFA 4E4PA 4D6EA 1MEC1 1LU2A 1NVMA 3TTEA 4QPWA 1YPXA 3THPA 2WVVA 4QKFA 3BUVA 4JQ3A 3QHMA 2PHDA 4NHYA 1W9VA 3KOWA 1HQLA 5FF2A 3CBNA 1QXJA 3IPVB 2AH2A 1JDEA 1OCNA 3K4WA 5DUWA 2WXDM 5HAOA 3WYZA 4WY0A 4D72A 5A7PA 5F3GA 3O12A 5HNNA 3G7DA 4AH7A 1B9ZA 1R3QA 1VBE2 5A7QA 4AD4A 3KP1A 4KBBA 4KIEA 2CITA 1RQBA 3ARTA 1NCRB 1JS9A 3CQJA 1PUDA 1RUI3 2IFWA 3OZPA 4MWAD 5CJ5A 1W0PA 1VBC2 1IXPA 2W92A 1L9WA 1ULFA 2Z28A 3WMBA 2VCAA 3PVNA 3W5NA 1DCSA 4L4LA 2A6WA 3VZOA 2E5DA 2AC1A 1QRQA 1UW9A 2NN8A 3G5EA 4IMCA 2ZUWA 5CNAA 1UWRA 3CZGA 3E0FA 4BB3A 5I3FA 4O19A 4D6QA 5FPBA 1RQEA 3W86A 2KM2A 3R58A 1LGNA 4AYSA 3R2GA 2GWNA 5FP9A 2VO5A 2YDQA 3WBEA 1ND2B 3BG3A 1RV8A 5CKMA 2J1VA 4IL2A 1T41A 3DEQA 1H1MA 4JY8A 1OFSA 3ZR5A 1RUSA 3DAQA 2IPJA 1W9WA 3HU7A 5KXCA 2EIDA 5B4XA 3M5ZA 1YJKA 3LTYA 4BXFA 4PCPA 3RMXA 5FYIA 5ABTA 1WZMA 3ABZA 3IEBA 4HJWA 5DMNA 1B3XA 3EJKA 4CU6A 1DJGA 1VR6A 1XGZA 1RUF3 3PTDA 1S1RA 2ORZA 1ZBA3 2HWD2 2IPGA 1TRIA 2ZOXA 3OHIA 4GO9A 4UW3A 5D38A 2DW7A 2E28A 5D37A 1XLGA 4ZTYA 1BQCA 2HEYF 4PUEA 2GH8A 4WGHA 1K02A 2J6VA 4HKPA 3NYZA 3ELFA 1JZ8A 2GZWA 1JNEA 1OADA 3DUGA 3MUY1 1MQRA 4HMCA 1DXIA 2RS11 1GTHA 3PBYA 4PL2A 4PTNA 2WNUC 3GHRA 3VOIA 2R061 4AOCA 1PKNA 4Z2LA 3BPSA 5AHNA 4LRTA 2NUXA 4OBSA 1RUD1 2VCBA 4RNHA 3E38A 4ZOEA 3FW6A 4XJZA 5LA9A 1XBFA 1PEZA 1PPIA 3GHUA 3WR0A 2VC6A 4XPVA 1EFZA 4B92A 2Y85A 1F31A 1UZ4A 4URAA 5DZFA 3S5SA 2DTWA 5H8PA 2EPHA 5JIPA 3DESA 2Z1VA 3GLCA 3RM9A 3RX2A 3DPRC 3CNYA 3S2JA 1FVPA 1AA1B 2X7WA 2X0YA 4E2SA 5IUQA 2I5QA 2ZUSA 1TVNA 5E9XA 3FC0A 3O06A 1Z8AA 1PO22 4E2VA 1MW3A 1J4EA 4GVGA 1AK5A 3E5PA 3WV6A 2A0NA 4GQRA 4RR4A 3N6JA 1KR1A 1RBAA 5MKGB 1DQ6A 2CLKA 5SWUA 2OQYA 1D2QA 1GOFA 5AVAA 1F9KA 1EGMA 4S3FA 4W85A 3ENRA 3U78A 5FCCA 1V03A 4M4RA 2D3SA 3ES7A 1TVPA 5BXRA 1XSKA 1KB3A 3CLWA 4GNJA 4CDQA 2VVNA 1LOQA 5F5IA 5DAVA 5H9QA 5IVVA 3UVAA 4HYWA 5HINA 3SCNA 5AFEA 4XOGA 3OG2A 3DGRA 4MPKA 3CV1A 3T4CA 2Z1SA 2RG4A 4IJBA 2FLIA 2OUJA 3NPUA 3LY0A 4UTWC 5FZ7A 1BEV1 2ZWYA 2R1DA 1PVC3 1OIMA 2O9PA 2Q6ZA 5A5WA 4N7QA 1UZWA 1DE5A 3WG1A 2BVTA 4MADA 4META 3ZFGC 4CCLA 4P08A 1T7LA 3BOXA 3ABXA 4NUWA 3TLQA 4BIFA 2DDUA 3TFXA 3NJ3A 2VMGA 5C7HA 4QXCA 5APAA 1N2VA 2OVUA 1TZ9A 4H00A 4FQZA 2E5BA 2BV9A 4F66A 3LFIA 4CUCA 5G04L 3TKFA 3FHIB 1H09A 1NCQC 1U0AA 4DBSA 3QVQA 3AJ7A 2VI0A 4AZZA 3O15A 4D7TA 1IKPA 1ZRQA 3PZNA 4MVAA 1OX5A 4PCTA 2V8ZA 4KWLA 1J6PA 4N9BA 2BG5A 2ZDRA 5TF0A 2VEPA 4H2CA 4IEOA 1EDQA 4I0AA 5F3IA 2J62A 2L5HA 1ULCA 2X1RA 3ORJA 3MP4A 4KMQA 4A6OA 2UWCA 2VZUA 3U57A 3IJ6A 3MT1A 4PUKA 1RUJ1 2OYMA 2PHUA 5FK8A 5L6UA 4L6DA 3I7DA 3E74A 4NAEA 2YL6A 3C7EA 1YNYA 3PJYA 3XINA 3TYCA 4DI9A 4LBQA 4PBGA 5F7UA 3W1PA 4GH1A 4IMGA 2RUSA 4BWLC 2ARBA 3GQYA 2GVYA 1AXZA 1QWGA 1JYWA 5A3OA 1M53A 2QJNA 1GK8A 1QEXA 2BGPA 1R2RA 2AEZA 1NA1B 4FI9A 1Y5VA 3WBAA 5AYYA 4R9AA 2YX0A 4YN5A 2AKMA 3W27A 1KFLA 3AALA 3NV3A 5XINA 4MX3A 1PO9A 1HJVA 3CAVA 3B3QE 1V7AA 2W63A 2E6AA 4D7SA 1SZBA 1HKIA 1LCOA 1O3SA 1CPUA 2DVTA 2PDPA 3BJTA 1UBPC 3WG2A 5FSEC 5T52A 2VGBA 2JF7A 4QMAA 4GUGA 1CX1A 2QDRA 3O1VA 2VELA 1DEDA 3LA7A 2NQYA 3UYJA 5K9XA 3WQBA 4LXLA 1ME7A 3HMJG 4GULA 1ZLPA 1BSLA 3QC0A 4ALDA 3B03A 3F4CA 4N43B 1JPHA 2VNVA 2QQIA 4NZ1A 2ZADA 5F5QA 2BODX 3T0BA 1HB2A 1ZBA2 2HWD3 3SIMA 3UVIA 1KM2A 3CTTA 2BY1A 3ITLA 5CG8A 3INAA 4K8HA 4FXJA 4OWGA 3SW6A 3UR5A 4JFTA 3MDWA 5G5IA 1U22A 4MVTA 3NOYA 2XGXA 4WDTA 1XKJA 1VBE1 2BNJA 4MNJA 3EMRA 4XXPA 2W61A 3FDKA 4FPKA 2QUNA 2JDYA 2ENRA 3LHUA 3SJ3A 1S2EA 1SMDA 2XZ7A 3QN3A 2BASA 2J1RA 3VFCA 1H11A 4CEUC 3EMCA 2C1IA 2DQXA 3T0AA 2DGAA 3F4DA 4C1NB 1W9YA 3T1GA 5JXJA 3M4HA 4WX2A 1XNAA 4WZFA 4I8YA 1OOPA 1D4VB 5LEJA 2D2OA 4PMOA 1XICA 1XH1A 3J8F2 1UKSA 2O9TA 4I3PA 1ODNA 3GNRA 1IHIA 1A5BA 1EBGA 3V75A 3S1WA 1UZZA 1MNZA 4WSHA 5F4WA 1I75A 2TSYA 4P7QA 3PNAA 5T9BG 2Z1WA 3LMYA 2R043 4IEVA 3ZDVA 4ZBCA 2OKTA 1F6KA 3H2EA 2W6RA 2GK1B 1ENSA 2AAMA 1LKNA 2DSWA 1KBJA 5I0UA 3EB2A 1XGDA 4Q33A 1CAXB 1RY8A 1O60A 4TYSA 1G7UA 1V6UA 4HNLA 3T8QA 2VEMA 1JOJA 1UD3A 1UYXA 1WLTA 5CEHA 4F0KA 5DLCA 2DVUA 2UURA 4L65A 2ZBTA 3WEMA 4XFFA 1FOD2 4IV3A 1TYGA 2OXNA 2PFHA 1IT0A 4D7YA 4HYVA 4GGHA 4FXRA 4WKFA 2Q3OA 5A8NA 3MC5A 3O6DA 5D02A 4GNVA 2D6OX 4DRVA 1H2JA 1VQTA 5H2ZA 1THFD 4MGSA 3PC0A 4AEDC 4SBVA 1EP3A 3BIWE 2R6OA 1GQPA 2D44A 3C0LA 3I2DA 1LQ0A 3KZSA 2OT0A 5L36A 1RJ7A 4XFGA 3BYWA 1OX6A 1TPFA 3FZ3A 3BOPA 4OBRA 2ZEYA 2V2HA 4XD5A 4QQ2A 4N0RA 1BGGA 2PP1A 2X7VA 2X42A 2V5CA 3GBWA 2ACUA 3B94A 3W7RA 2XIIA 1NY1A 1ISWA 5HOSA 3LPFA 1PZ1A 4R4ZA 1BVNP 1GCYA 2Y7FA 2AENA 1XOYA 2CHNA 1CAUA 4UI9L 2WNQA 1CJPA 3L5MA 4E2DA 3JD72 3KRZA 3RO8A 4DINB 5FZIA 3KOZA 2YYUA 1H4PA 1UC4A 3WY1A 1GNHA 2GQ9A 1FMD1 1KFBA 2FCVA 1QF3A 1TO3A 3G6MA 1NOVA 5D32A 4O4VA 5AHLA 4ZFCA 3MJYA 1H0IA 3ARUA 1ZBE3 3TAOA 1C91A 1BEUA 1TV4A 2ZC1A 4RS5C 2QF8A 3JRKA 1IE7C 1FHUA 1R3YA 2QKDA 1UY2A 2J8GA 2OOFA 2E9MA 1A49A 1VB4A 1X50A 1J84A 1UIJA 3ECQA 2J42A 1R38A 1WGPA 2H90A 1HRI3 2VC9A 1E6XM 3TN4A 2WAAA 4IQJA 5LIKX 3CL7A 3O1NA 2EG7A 1EIXA 4GIEA 4E6MA 4BQXA 1JI1A 3W88A 1KRMA 3VIFA 3N12A 3ZLHA 1GOMA 4PMYA 1P6BA 3W7JA 4Y1VA 3OPWA 3KHDA 2X1TA 3MIDA 2XGIA 3OIXA 4ACYA 4N53B 1VGAA 4KBZA 4MJ4A 4R7JA 3PY2A 3KS7A 3SECA 1SPPB 1XPWA 3HVDA 1W8SA 3MIGA 4B4PA 3GIQA 4PDWB 3J7MA 5I00A 3I2KA 2MNGA 4CCCA 2Y6KA 1NQ6A 1RY0A 3FUOA 2DFCA 2GQ3A 2BNMA 1NOUA 4IP4A 1E6PA 1KC7A 2JGQA 1C29A 3O63A 2X40A 1V0AA 3KOXA 2HLEA 1M7XA 2PURA 2DT3A 2GLKA 4BHYA 4JGZB 4OOZA 1K9EA 1VBHA 1JD7A 4ZVJA 4GUHA 4XZUG 1XFCA 1X38A 4WDXA 2DIKA 3FFSA 3JCIA 3HJZA 1OEPA 3WOGA 1SO3A 4NROA 3BKZA 3A7QA 2C91A 3V0BA 4CU8A 2PDKA 3LU2A 5F6KA 4N8MA 3UWYA 5D9MA 1XRFA 4LR4A 3CIWA 4UZSA 4IEXA 3STEA 5T8GA 4NP7A 1LTDA 1MWOA 2YL5A 3KV4A 2DU2A 2R9RA 4NHXA 3CZ8A 1HG3A 4JIRA 3RJRA 1G4TA 3J7NA 3M0LA 1UXXX 2IXJA 2GGJA 2BGOA 2HWF1 2JIJA 5JIWA 1QDOA 1RK5A 1SZGA 1RP8A 3B8VA 3D0SA 2ALRA 3S9ZA 1UZHA 3EMZA 3I3DA 1LLOA 4V33A 3CPUA 3CUIA 3FY1A 4YG0A 1Q2SA 3NM1A 2AREA 2NMNA 2FYMA 1XYAA 4YHEA 2NXGA 2R91A 1GWMA 2XJRA 2PPGA 3THUA 3TTYA 1WB0A 5FF7A 5C5UA 1S55A 1I2RA 4FT8A 3NTYA 1FP8A 2PWVA 2HWB1 1OGBA 1EV12 1W9FA 1POKA 1VHCA 4O15A 3HBKA 4IPPA 5G1YA 3C4UA 1MZHA 2XINA 2VOTA 5I3KA 1QH6A 3ERPA 2AYHA 2FPTA 1KTNA 3GXIA 3KFTA 2EG8A 4QEHA 4US5A 4HPNA 1YHFA 4KRTA 2ZHNA 1YI7A 1R46A 2Y61A 4A3YA 3TJ4A 4TIMA 4XX6A 4BWOA 3B01A 3GZAA 3BARA 3G6JB 1FMD3 3A4XA 1G4SA 1TELA 5LY1A 1ZAJA 1XQNA 3AVSA 4HONA 1ZBE1 3LHYA 2WSVA 5AVPA 3AQUA 4JQAA 2D3PA 2I56A 1FRBA 4M01A 1W2OA 2AKZA 2GSHA 4HA4A 1WDDA 5D2TA 4AB4A 3I7SA 3L66A 4LUTA 3OSDA 4K2SA 1QJU1 3DU0A 4JX6A 5FZMA 4GQQA 2DUZA 2HEJA 1HKDA 1H7NA 1QPOA 1FV2A 5C5TA 2JG9C 3RILA 1HRI1 3N9MA 3K2GA 2CFFA 3VNDA 2WOQA 1QOOA 4OV4A 4BA0A 2WLQA 3CDZB 3BCJA 1BVWA 4Q8PA 3Q8BA 1QPQA 3SFWA 3W6MA 4PTWA 4L61A 5KSWA 1QJFA 5FFOC 4PB3A 5DXDA 4DZGA 4EANA 2O4QA 4QX2A 1OX4A 1NOFA 3ZN5A 4IEWA 5BOEA 3GZTB 3VI2A 3ES1A 4PMXA 3P6BA 1R081 1W9PA 1FNYA 1DWJM 3KBMA 4ICMA 5BWAA 3IBMA 5CFCA 4D6CA 5D8AB 2VULA 4XXAA 1QGLA 3EWDA 5FQ0A 1MACA 3GKAA 4AFDA 4QJ4B 1W0NA 1QY4A 2FMDA 1DVJA 2FFIA 4PR4A 3ZIWA 3V1PA 4CCJA 3LKJA 1QI2A 5ANNA 3FA5A 4RN5A 2W5FA 1UKQA 3NQBA 2G3MA 4W7VA 1H1AA 3L4TA 3W7GA 1MRQA 2OZ8A 5CQ1A 1JULA 2PI6A 4JX5A 1K7XA 4H01A 5BNPB 2YDSA 3GCWA 3NQAA 5JSRA 1GYKA 2NP0A 3VDCA 1KFUL 5T5OA 4XISA 1H4GA 4DAIA 3OBTA 1ZL1A 3AKTA 4QXBA 4RGGA 1XBYA 3H4WA 1MQTC 1W5PA 1CGWA 3WF0A 4H83A 3ZIXA 1VFHA 1FH7A 3T05A 1ZTVA 2PHXA 3WLTA 1GR3A 1OCJA 4KESA 3IIOA 1E55A 3U5YA 1PIV1 4Q4PA 5DELA 3BGAA 1AL21 3TB0A 3GNXA 1FWSA 3BLKA 3AO0A 3TW9A 1QH7A 1LOGA 2D3RA 4XZPA 1XQKA 5T55A 5K3VA 2E6DA 3H1MA 4K8EA 4MLOA 4MGZE 4QU2A 1B57A 2ZE0A 3E49A 4PMNA 2EPNA 1VP5A 3WLHA 4L1WA 1YNAA 3L9CA 4JPGA 5DRCA 4QPIA 3WQ5A 3GRIA 4ZSUA 4DJEC 3BMVA 3AKSA 4LPCA 2FZ2A 4DO5A 4LRSA 4QT6A 1LOSA 3POEA 2I74A 4OUSA 3OBAA 5FA5A 3H3LA 4KH9A 5I5RA 1H50A 3PJUA 2KA3A 3G0XA 1VMFA 4H6QA 6ENLA 1FDZA 3HMYA 1C1LA 2DH3A 2JK2A 3X29B 1JFHA 1W37A 4DYEA 1QNRA 4O11A 1NZCA 1TZOA 2Y26A 1I2QA 3GY1A 3FX4A 5HNUA 5A69A 1GLHA 3RLUA 4NIGA 2ET1A 3S9YA 2BZDA 5L19A 4XFAA 2DVGA 3HG3A 3EOSA 4MLJA 3AXDA 1JZ2A 1TZ7A 1KNWA 1FWBC 4L1GA 5FZ8A 1DJIA 1UR8A 2ANUA 2NXIA 5T91A 2PDWA 1NXD1 3M5YA 5EMLA 4Z1DA 2A71A 3TBDA 4M8UA 1TA3A 2BP6A 3V35A 1QMJA 3KRBA 1TX2A 3EQEA 2YL9A 4DIQA 4Q29A 2YZRA 4D8ZA 5DZGA 4GINA 2IXLA 3A4UA 4PBFA 3MKCA 3NJZA 1QJU3 3WDHA 1AHSA 3W53A 2E7TA 4FPLA 4IE4A 5DRIA 4CCEA 3NL1A 1XS2A 2QLYA 1AF9A 4O1AA 4JTHA 3SB0A 3ZFEC 3H22A 2VZRA 3P84A 1NTHA 4MGQA 4H41A 2G4IA 2XIOA 2BHZA 4A3HA 3NM3A 5BOOA 3F7JA 1NCRA 2XOMA 5JSOA 2VUNA 3UZWA 5SV5A 1W6PB 3N2MA 2CL2A 1W5NA 1J3RA 1Q8JA 4J3VA 2WT0A 5KZEA 1FA2A 4H7ZA 1JL8A 1MXDA 4HTBA 1SZEA 3MVIA 1V0NA 1TWZA 2XFRA 1VBUA 2ZCGA 3U37A 4AEFA 4N6FA 2PRLA 2R6QA 1VS1A 4FXKB 5CXPA 5LK5A 4O53A 4EWND 5BPXA 3HURA 3VDAA 1WDRA 4MIMA 4ZMGA 5K9YA 2WVVB 1XLEA 3CF6E 3GU1A 2R1PA 3ZFEA 3PBVA 1ZNPA 5AC4A 1S1AA 4Q0UA 3THAA 2RKXA 5FXVA 1A0DA 4AVBA 2VWTA 3W87A 2JALA 4J2MA 3N2TA 1DE6A 4R8HA 3G24A 4AQ6A 5I0TA 4O14A 1R093 2JEMA 3UGFA 2WHKA 1S0EA 2ZGMA 2D6KA 2ZGUA 5LNUA 1C8M3 3CL6A 2FCUA 5HBFA 4LKFA 1TV8A 4LTSA 5BYWA 2E6YA 3GG0A 3PTMA 1UHVA 1L6SA 3WF1A 3O1OA 2ZA2A 4RV3A 2Y5EA 2ZWZA 3WH9A 3KCCA 3NR0A 1H9PA 4A7YA 4GACA 4AVVA 1Y4WA 4YTSA 2C1FA 3TYUA 5C33A 1QIQA 3Q8AA 4PUNA 2Q5TA 4B16A 1O5LA 1XYBA 3WLJA 1TMF3 1DQUA 3VOGA 4QP0A 4O52A 3PIJA 2EKGA 3MFCA 1SEFA 4JD4A 2WMHA 5C3RA 2Z7KA 1YQCA 5JZGB 1TE6A 3APGA 2QW5A 5EMUA 1JCMP 2EJ1A 3CUFA 3ZVXA 1SMVA 3GKFA 1NELA 5KZDA 1SLLA 4KW2A 3LEPA 3W74A 3OUHA 2I17A 2F84A 3QBUA 1QJX3 5FBJA 2HTMA 3SUVA 4D8LA 2YGLA 4XDPA 3LCFA 3TYAA 3DECA 1WXZA 1COV2 5I8YA 5DT7A 3R8RA 5IW0A 1Y65A 3MCOA 1FUYA 3TV8A 1I1WA 2JD9A 4LCSA 1UP2A 5FYSA 3RI9A 3MKVA 1FCVA 1HTIA 1MS1A 1EF2A 1MZEA 1UYYA 3ZJ6A 4ZZ5A 4FFGA 1OFNA 1J18A 3CS2A 1QOSA 1X33A 3NIYA 1JDAA 1EYBA 3VHRA 3ZOIA 1KLZA 1EAH2 2YGMA 2F6UA 3MPGA 4GCAA 4HPKA 1CB2A 4L97A 3CU2A 1WAUA 3WELA 2EIEA 1RUG3 5CYYA 4OKDA 4NOTA 1H8VA 3ZO9A 5CG0A 3PAOA 3IVSA 3WD4A 4OHYA 1K6WA 2J24A 1QI4A 3NZRA 8XIMA 3QR3A 1GBGA 2GZXA 4OVEA 4HSNA 5CJNA 4W65A 1O6UA 2BB0A 1I60A 5FQ0B 1XYPA 1K03A 4W6YA 3KWXA 4QLKA 4XKYB 2B7QA 4FNQA 2FD8A 4IIFA 1CONA 3WBXA 1ZZ9A 3N9RA 3OZMA 2VZPA 5A3PA 3FJLA 1BQGA 3WKZA 4NKCA 4JCMA 4AU0A 2E31A 4HMNA 1OF8A 3ITGA 3WD1A 3F03K 2SFPA 2IFRA 1RGSA 3IAQA 2IPWA 4YVVA 1LL7A 2A3LA 3JQXA 4C7GA 2QIWA 2V38A 1PMHX 4NWWA 5A7OA 1OFBA 5FIXA 3TQVA 2VGFA 3DBNA 4BXSV 4GQ7A 3GR8A 7REQA 4EZHA 1OABA 3PJQA 1X9PA 4JTIA 4L1XA 1IXQA 1EUTA 4DJDA 5JH2A 4IOTA 5JI9A 3V0TA 2XB6C 3HN3A 3UWEA 1M01A 1Y9GA 4DJFA 1DGRN 3GH5A 1JYCA 4X9YA 2JXAA 3KF3A 1TUXA 2OPJA 2GNDA 3BGJA 4HVOA 3DENA 1RK6A 5FZKA 4E3TA 5CAZA 3OUIA 1D7PM 3W7NA 2XDFA 4JR5A 3EDFA 4XHXA 1AR93 1KXGA 4MZYA 1VFMA 1T2XA 3M5VA 1GZWB 1EP1A 5HR7A 4BCUA 2ZXAA 2ZGOA 4XJWA 3E6CC 2BTMA 2C4XA 1W2VA 2UWFA 5AYZA 3NEVA 4ZB2A 4FK9A 1Z89A 4NRRA 2TMDA 1BEV2 2QNKA 4CEYC 2VEFA 5A6MA 4OVXA 2QCEA 2X1SA 3NPVA 2O8OA 4L4OA 5JSPA 4LF1A 1UZVA 5LA0A 5CZTA 2RDSA 1SBDA 1PAMA 1TTPA 2QV4A 3BAWA 1DWIM 5FJKA 1OFDA 1XYMA 4TLGA 1A3HA 3DV8A 1V5XA 5LHFA 1DBNA 4RLIA 1HL8A 2P5BA 4PUUA 4QAIA 3M41A 1E56A 4DEVA 4DAFA 4GGBA 2WS91 1EAH3 4CDWC 2PELA 4XD4A 4WM7A 4ASTA 1EBHA 1POV0 4DX3A 1POV3 1ONAA 2YDRA 5H1WA 2VVSA 2XN1A 3ATZA 2VX6A 1QPRA 5J7MA 1ZBCA 4G6CA 5FJUA 5KC6A 3CV2A 4S3EA 3ZSJA 5C4WC 3UJ2A 4WVMA 2VG9A 1LLWA 3VU2A 1AD1A 4CNUA 5K7PA 4WY0F 4LW7A 3TONA 1N8FA 1RA0A 3KRSA 3R0UA 1FBAA 4FOUA 3UZJA 4R9BA 1MZ5A 3LOBA 5JUVA 4QBXA 3KE0A 5ABFA 3SCVA 4JXCA 1ZRIA 4ZHNA 1X7IA 3H12A 1QO2A 1M04A 5BNKA 4AFBA 3GTHA 1MQTB 3WNXA 4I9MA 4Z2WA 3C61A 4Q0VA 4SLIA 3VD7A 1GEQA 2DJXA 4NZCA 4AWTA 4LBLA 4FIQA 1OI6A 3WH7A 2D43A 5DZEA 4BQYA 1MS8A 2KAUC 1M7OA 2R073 1UWIA 1J5TA 2Z6JA 3RCYA 3WO8A 2RJHA 3L0NA 3POGA 1E51A 2J1UA 1K5MB 2UV8G 2R0HA 1YCIA 3AX4A 3AJZA 4B9YA 1POJA 2ZX8A 1MW0A 4RZ4A 1UMLA 1US2A 4IE5A 4K8RB 4CDQB 1V3IA 2QGYA 1HX6A 1GQLA 2G0WA 5G1MA 1W1B1 1OF3A 1JOPA 4JKLA 1GOQA 3E5UA 3UWWA 4QHRA 2QMKA 4L56A 4C65A 1FPN3 5CC3A 2OGJA 1XC4A 3DIPA 1YXYA 3GU2A 1AR82 4IF2A 4R53A 3DFHA 2VEIA 3VGHA 1CGPA 1OQ1A 1AZ2A 2WC7A 4GKXA 2DQWA 1Z42A 5C8CA 1QOPA 5EQUA 1RUE3 2P8BA 3U07A 4OUEA 4CP0A 4XABA 1OYCA 3W7QA 2HXTA 2DEPA 3BQ6A 3B0UX 5CCZA 2C13A 5I6SA 3FLPA 1FAYA 5B7YA 1A0EA 2G9GA 1CGTA 1R0MA 3GDLA 4GUIA 1A8MA 2VBPA 2Q8ZA 1XLFA 3VIKA 2WC3A 4LUMA 1FWWA 2WSYA 3N3HA 2V3FA 1Y0EA 3DGTA 3POWA 3SO7A 2GJPA 4Q26A 1W2PA 3A47A 1BYBA 5J5RA 1XLMA 5RUBA 2PWHA 2JGYA 4QQOA 5JBEA 1IZKA 7CGTA 2R16A 4I3GA 4XQWA 5DN1A 3ZR4A 1XH2A 3H2FA 4L0PA 1LUCA 1EB3A 2H6BA 3SBFA 5FAXA 4TVDA 3AU6A 4WBBA 1I5PA 2XPKA 3BL3A 2TUNA 2WQZC 1XIGA 2Y7EA 4P7RA 1DQ2A 3H8RA 3ZXEA 2AL2B 4NAEB 1OPOA 3DG7A 3TH6A 1LODA 2QUMA 3EOUA 3NQ2A 2ZGSA 2QCGA 4B15A 4XJUA 1C8VA 3MSDA 1AQMA 5BYNA 3WNPA 4LAUA 4LALA 4XZWA 5D2YA 3B06A 3BC9A 3ETQA 2OSXA 4PQ9A 1POQA 1HQTA 1ICQA 4XIKA 4CZSA 1PGL1 4HP5A 3UCCA 4HHPA 3KB5A 3MFAA 4JTSA 4COYA 4KWUA 3AWNA 4CD6A 4HVQA 1D4M2 2R94A 4N53C 4EE2A 2DT1A 1QQP1 2XL9A 3LIHA 4RDYA 3LLFA 2VPVA 1VFSA 3O0KA 5KWRA 2J7EA 2YCKX 2NT0A 5K9DA 1OD0A 3BB6A 1AQFA 1WBHA 2UZ9A 1HXS2 2RDTA 3NQEA 1T6BX 4QGLA 2RDXA 1M5WA 3KCXA 4Y26A 2WUHA 1RA5A 1XP3A 2PGWA 4R3UA 2QF7A 3ZFGA 3POYA 4J3SA 2ONEA 1M41A 1GUVA 3FIGA 1G6NA 1NP0A 1P6CA 2HSAA 2PTDA 4DBUA 5CZKA 1P48A 4QQHA 1DGWA 1Q8OA 1GVRA 3LSBA 3VBOA 3WW2A 3AVRA 3IUHA 1OT2A 3GJBA 1P0EA 4D8MA 5T9CE 2PDNA 5A6KA 1VFOA 1US0A 5HCBA 3HQPA 1BQPA 1YEYA 4D6IA 3SCOA 2R071 3I4EA 3I8TA 4TV5A 2PBOA 1J12A 3UXAA 2XXZA 5CPTA 4AK3A 1MUWA 3ES4A 2VEGA 3KL0A 1OBAA 3F2BA 5EMMA 3ICJA 3OA3A 1QWRA 3LSDA 1WCKA 2RS52 3ZXLA 3GD6A 1OOPB 1GJUA 3O1PA 2CY6A 2CBVA 1KFKA 2Y2WA 4AX6A 2D2HA 3UWVA 1VCGA 5CG7A 2VMHA 3HTWA 5TBOA 3RRAA 1S39A 1UQZA 5IVJA 5CC6A 2WINB 5IATA 2JEPA 1NLQA 1K12A 1EJXC 2J1SA 1SQ7A 2DT2A 2EF6A 4QS5A 4AI8A 4JGZA 5E6ZA 1A6CA 2VC5A 1I9RA 1RUE1 3OZYA 1AR92 1XI3A 1KXVA 3ZT5A 4LU0A 1Y5XA 4HYRA 1JNDA 4CXXA 2YC4A 4CQ8A 4HK7A 2QQ6A 1AYM3 1O5RA 1BYAA 3O1MA 2CESA 2Z1XA 1BKZA 3P8IA 3HFTA 3ZPOA 1UAIA 4ISRA 2GMEA 3SCUA 2QE3A 1I6XA 1KXHA 3E0VA 1HB4A 3T1LA 2W1UA 2XDVA 4AVTA 1QU0A 3AZZA 2QMJA 5K9CA 2AR6A 4FOJA 1W1YA 4S2FA 4O0ZA 5E0KA 4DPPA 5D09A 1A5KC 2YMZA 3RGBA 3ZT7A 3DX5A 3DL3A 2ZC8A 4JDNA 3VAVA 2CXEA 1R9ZA 1F4AA 1YQ8A 4IGQA 3KP0A 5C4WB 1LENA 3GUGA 2C16A 3GH7A 2R8WA 2HWC3 2E4TA 3KBVA 1H60A 1B2YA 2BGQA 2C14A 3DOPA 1Z7S2 2WSPA 3SUWA 4D6JA 4AGVA 3IJQA 2OEKA 4KGJA 3LCIA 2DP3A 2BOJA 4YVPA 5A33B 5AC91 4OHQA 4I6VA 1IIHA 4ZO6A 4FO4A 3LEKA 2CZ5A 4LNYA 4UQEA 3FWEA 1GQNA 7TIMA 2Z0IA 4IEZA 3EOEA 2DCYA 1DWGM 2J4GA 5GKAC 3FYYA 5D4YA 2A7PA 3H9AA 3USUB 1RCQA 1A50A 1R9XA 1MEC3 4C1LA 4OFCA 2RM23 5HNTA 1PGL2 1UR9A 5A3LA 3LD8A 4R34A 4Y22B 3S57A 3SQMA 3LSEA 3CLPA 3JU2A 3TUUA 4YW6A 3LSCA 4ZY9A 3HQUA 1R7AA 3OO2A 3OQEA 4NIHA 4F9DA 3IWZA 4YFWA 1PTDA 1W2NA 1VRH1 1SFLA 4Q1RA 1COV3 6XIMA 2ZZ3A 2VDHA 4GWEA 5D9NA 3IGXA 3T4WA 4LFYA 1GZCA 3N9SA 4QQPA 3WUDA 4YVSB 3SY8A 2UY4A 4NG3A 1SCRA 5J96B 2PDXA 1EX1A 3LF7A 5A7WA 5GALA 1L2QA 3C7FA 3OCPA 5BOFA 5DO8A 4DUXA 3W20A 5BNNA 4GK8A 3TEZA 3BUCA 1VAKA 3VA8A 3IGUA 5BNPC 4NHVA 1ZX5A 2UWBA 4CP2A 4D6RA 3LHWA 1PHQA 2VM8A 2W3ZA 3KCLA 1RR2A 3RYRA 2OOGA 2NX1A 2PDGA 1QBAA 3DYMA 2I1OA 3CLMA 1KFWA 4IM4A 4CP9B 4JGYC 3DERA 1IOAA 1MS4A 3JU9A 4LUJA 1AW5A 3KT7A 1XDLA 2QCCA 3AHXA 2CPUA 4MDP