3ZM8A

Crystal structure of podospora anserina gh26-cbm35 beta-(1,4)- mannanase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
444
structure length
444
Chain Sequence
RDGPVTYEAEDAILTGTTVDTAQVGYTGRGYVTGFDEGSDKITFQISSATTKLYDLSIRYAAIYGDKRTNVVLNNGAVSEVFFPAGDSFTSVAAGQVLLNAGQNTIDIVNNWGWYLIDSITLTPSAPRPPHDINPNLNNPNADTNAKKLYSYLRSVYGNKIISGQQELHHAEWIRQQTGKTPALVAVDLMDYSPSRVERGTTSHAVEDAIAHHNAGGIVSVLWHWNAPVGLYDTEENKWWSGFYTRATDFDIAATLANPQGANYTLLIRDIDAIAVQLKRLEAAGVPVLWRPLHEAEGGWFWWGAKGPEPAKQLWDILYERLTVHHGLDNLIWVWNSILEDWYPGDDTVDILSADVYAQGNGPMSTQYNELIALGRDKKMIAAAEVGAAPLPGLLQAYQANWLWFAVWGDDFINNPSWNTVAVLNEIYNSDYVLTLDEIQGWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Analyses of Glycoside Hydrolase Families 5 and 26 Beta-(1,4)-Mannanases from Podospora Anserina Reveal Differences Upon Manno-Oligosaccharides Catalysis.
pubmed doi rcsb
source organism Podospora anserina
molecule tags Hydrolase
molecule keywords GH26 ENDO-BETA-1,4-MANNANASE
total genus 139
structure length 444
sequence length 444
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
A PF16990 CBM_35 Carbohydrate binding module (family 35)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3zm8A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3zm8A02
1KWGA 2DDUA 3WKZA 4B9ZA 3A4AA 4XZUG 2ZUNA 4DWSD 1CGXA 1B3WA 4OJYA 2E3ZA 3U5UA 3LMYA 4OMCA 4L0PA 1JU4A 2UY5A 4AY1A 4AD1A 5JIWA 2J8GA 3G6MA 2CNCA 1EQPA 3VU2A 2VC9A 2XUCA 2D0GA 4AZBA 3UG3A 2ZXAA 1G9HA 5DF0A 3VGHA 1UG6A 3NSNA 4MNJA 2ZEZA 2FH6A 3AHZA 2EPMX 1H6YA 2XVLA 5IHRA 2VZTA 3NUKA 4Z2IA 4LHSA 5I0DA 4XX6A 3WUBA 2GFTA 2W47A 4BXSV 1E6QM 3EDJA 2VOTA 4WIWA 4C7DA 4DM2A 1XC6A 1ZBVA 3ACFA 4BK5A 4DXSA 1KGYA 2ZUVA 5HBFA 3AIUA 3IAQA 4DXTA 4UQDA 1G5AA 1Q6FA 1V03A 4MDOA 4JHOA 2J7CA 2VCBA 1B3VA 7A3HA 4PMYA 1OT1A 1EO7A 1VB9A 3AIBA 1R8LA 9CGTA 4UFJA 3WSUA 4BA0A 4KH2A 3NJXA 1FFQA 1HXJA 4D6EA 1OF3A 2E32A 4C7FA 3PZNA 3UG5A 3P6BA 1UQYA 2QQMA 2CBJA 4ZE4A 1C7TA 4FLOA 5DQ0A 3FNDA 3PUHA 1BYBA 1V0NA 1UH4A 1OB0A 1J0IA 2VX6A 5BRPA 3LEKA 4P02B 3FXYA 2WQ8A 3OZOA 1WDQA 2BZDA 1CGTA 5I79A 3AS1A 3AS2A 2YA0A 3AHVA 5HPOA 4MNLA 2V5DA 2VURA 4M4RA 2VMEA 4W8AA 2WAOA 3SCWA 1HKIA 4PMUA 1MXGA 3MUZ1 3K4ZA 5DT7A 3VIHA 4WLCA 2W87A 1OGSA 4PCSA 4MB3A 5B4NA 4CD5A 1JNDA 3WF3A 5CLTA 2XWDA 2HLEA 4XUPA 1CECA 4X0VA 2JALA 4CUAA 1WCQA 5G04L 1UX7A 1GCYA 3WD0A 1J10A 1O6IA 2RVAA 5JXHA 1QNRA 1BLIA 1JI6A 1GQPA 4QLLA 1UYZA 1DWGM 1W9BM 1QPKA 1BHGA 2XIBA 4HOXA 3OLGA 1MVYA 3SCRA 4JKLA 1XHGA 3VM5A 4BQ3A 3AIVA 2B9VA 1GQIA 3G6LA 4JHZA 4LX4A 1CIYA 1GOFA 4F66A 1UYYA 4AD0A 5A8QA 1AQ0A 1R7AA 1GJWA 1H49A 2B4KA 4WF7A 3RILA 5FL1A 4PYSA 4UTFA 4CCCA 2E9BA 3W0KA 1W9WA 4M8UA 3E1F1 3VGBA 1KCKA 1NP0A 1NP2A 1VENA 1XH0A 2D24A 5EFFA 3SCTA 2WVTA 5CGMA 3WY1A 3VD9A 5GPRA 3BH4A 3N9KA 4Z2GA 1JIBA 2XOMA 3AXHA 2GJXB 3SURA 2ZX7A 3HN3A 1I1XA 3I3EA 1H0GA 1GU3A 1UWIA 3KZSA 4ZFMA 2VUYA 1UYQA 2WAGA 2BS9A 5BXRA 1E40A 1TMQA 2WMGA 1UWQA 4QX0A 5A94A 4R5EA 1CX1A 3VD3A 2O9TA 2J77A 3WQWA 3QHNA 4PN2A 4U33A 1UKSA 3NQHA 3PZ9A 3CKHA 4Z2HA 4M81A 2BVTA 2J1SA 3W29A 1OWQA 5DT5A 3K77A 1OM0A 1J0YA 4GI8A 1VFMA 4UR9A 2PI6A 3ZT5A 4MJ2A 4MADA 1NAEA 4IM4A 1J0ZA 5IFTA 1ZBKA 3A47A 4H04A 2ZUSA 4V2XA 2YDRA 3FHQA 4BQ4A 1LLOA 5E0CA 1O8PA 1ZBCA 2DIJA 2E0PA 2EIBA 2QQIA 1UH3A 5JIPA 1VEPA 1WZLA 2JE8A 1N82A 4K68A 5CQ1A 3AHYA 2XVPA 1US2A 1M04A 4UQCA 2TAAA 1UZ4A 1UD8A 2E33A 1W0NA 1ESWA 2VT0A 3RCNA 1DWFM 4J3WA 1CGUA 1GVYA 1JFHA 1B30A 2EPNA 1ECEA 3WL0A 2ZWYA 2CYGA 4QB6A 1C8YA 3I2JA 5AY7A 2FDMA 2ZEWA 4HA4A 1UD2A 2Z1KA 1KXQA 4W88A 4LQ1A 4CU9A 4JCMA 4WSKA 3FL7A 2ZX9A 5D9MA 2RGLA 1GNYA 4GZIA 1HJUA 4UFIA 5A69A 3WQ5A 4PTVA 2G3NA 4GWIA 4UI9L 1JYVA 4W5ZA 3MSDA 3BAKA 2PB1A 4W7WA 2X09A 1E1FA 1DEDA 4P00B 3WNMA 3K46A 4MAZA 2VCAA 3VIIA 4QB2A 3HJRA 1QI2A 4W8JA 4GPNA 4PUDA 1BYDA 3W25A 2FHCA 3VGDA 3VMPA 1I1WA 4H41A 3CBWA 2XSAA 4PRWA 3LPOA 3AROA 2D0FA 1J0JA 4OZOA 2VVSA 5F7UA 1BVZA 3WIJA 4DUVA 1FFRA 1V6XA 5LYRA 1H5VA 4GQQA 4OBSA 5A8OA 4J3XA 3F2ZA 5GQBA 2VZ1A 1E0XA 4JL1A 3WSOA 2EJ1A 1JD9A 3SIMA 4A3HA 1UWTA 4QX3A 1KWKA 1CZTA 3C7GA 2O9RA 2BVDA 3DYPA 3RJYA 1AMYA 1B3XA 4XUQA 2W62A 4RN5A 4D6GA 3AHTA 4J3SA 3VIJA 3GXIA 2WNWA 3OBAA 3AIQA 4MB5A 3ZIZA 1CXIA 2W46A 2VNCA 1JDDA 2D2OA 3TTSA 4AD5A 3WQVA 3VIMA 1JZ2A 3WBEA 1JI1A 3N04A 3CZEA 1V3HA 4KMQA 1B9ZA 1UR0A 2HVMA 1EOMA 3PHAA 4BDVB 1BYCA 3HU7A 5HOSA 2JD9A 2WMIA 4F79A 4ET7A 3PZQA 3PN8A 1W2PA 3NDYA 1CENA 2XTKA 2J7HA 2PWEA 1HF6A 2D3LA 1CGYA 1BGAA 3EDKA 4QFUA 3POHA 4ZEPA 1H4PA 3EYPA 2CESA 4L4OA 1LG2A 1XV8A 4MO3M 1ZS2A 1MW3A 3DHUA 4GI6A 1JYXA 2DGAA 4KGJA 3CO4A 5EB8A 4B3KA 1X6NA 3GXFA 1M53A 1QHZA 1CIUA 2W91A 1C8XA 1P6WA 4JFSA 2UWFA 2VZSA 5HDRA 1UD5A 3AS3A 3GNPA 4GQRA 4V27A 3AIEA 4BCEA 1M03A 1ZL1A 3ZT6A 4AZCB 3L4YA 3K75B 3ZR5A 5C71A 1UMHA 3I97A 3CZGA 3ACHA 4ZXLA 2YC2A 1GHRA 1KGUA 2XQXA 3WDJA 2Q8XA 1OF4A 1DWIM 1VAHA 1PZ3A 1V0KA 3K4AA 3BLKA 4DM1A 3WBAA 1B0IA 1NWUA 2CBUA 1SMAA 1TA3B 3AZTA 1RP8A 1TVPA 3CQOA 1PBGA 3VUPA 1NOUA 5E0FA 4J3TA 1UXZA 3UCQA 3CIVA 3QOMA 4HMDA 4S3JA 1JXKA 2VR4A 4ATWA 2J78A 4HOWA 1US3A 4ZENA 5A2BA 1UZ1A 3W24A 4TUFA 5IDIA 3VIKA 3WF0A 5A6BD 3L4ZA 2J62A 4EK7A 2OLHA 3AXIA 4CD6A 5ABFA 1JGIA 1OD8A 3MMDA 5LA1A 1FOBA 4KGLA 4HU8A 2DSVA 1RYYA 2WN3A 4Q22A 3ARQA 1UKPA 2EQDA 1CDGA 3RO8A 1W1YA 1J11A 3M6DA 5B4XA 3VDAA 2JIEA 4UQBA 4OKDA 3CDZB 1NWRA 2XHNA 3ARYA 5I24A 2CKSA 2W63A 3C7FA 3WQ4A 3I2IA 5DMYA 3GZAA 2IXVA 1M01A 5CLWA 3M07A 3BXWA 1BQCA 4KRUA 2OWWA 4A3ZA 3UEQA 1V08A 2XVGA 3B8SA 1CWYA 1TFVA 3ZJ8A 4AZCA 3D3AA 3QOKA 3VDHA 3WUEA 1LF1A 4C7GA 2ZE0A 4OMDA 1QNSA 4NZCA 3VKKA 2E8YA 3AI0A 2YJQA 3OB8A 2O92A 4JZ5A 2W5FA 1VEOA 3I2GA 3II1A 2XWEA 4CD7A 5I77A 1E3ZA 7TAAA 4PTXA 1QI5A 1XSIA 3I2FA 2Y6LA 1MW1A 4PMDA 1B3YA 2X8RA 1NX9A 1W3JA 2YLLA 1ISWA 2W92A 4QDMA 4QAWA 3CUHA 5GNZA 5ECUA 1QBAA 3AOFA 2XFYA 1UKTA 1HNYA 1R86A 2X2YA 1F4HA 2ZWZA 5FOOA 1LL4A 2X0HA 3C7OA 4UAPA 1RP9A 3BMWA 3VIGA 4AISA 3ABZA 1JNEA 1CZVA 3GXMA 2BY3A 1UUQA 1JAEA 1CXLA 1WP6A 4ACYA 3FW6A 3OGRA 1JHJA 4PEEA 3OLIA 4JKMA 3AQUA 2WN2A 1UH2A 1UZ0A 1VJZA 2L9LA 1L8NA 4TX8A 4H8VA 4J28A 1NWSA 1GNXA 2Y8KA 1QW9A 2C8NA 2E9MA 1TR1A 1I75A 4U5IA 1SG3A 2EICA 3TP4A 3WNPA 4IISA 2ESCA 2WDBA 1YQ2A 2J7FA 4TVDA 2WVVB 1SFSA 3EDEA 4JIEA 3A7QA 1MW0A 2WK2A 3GH5A 2CDOA 4L4PA 1VEMA 2XFFA 2UY2A 4WKFA 1QHOA 1QVBA 2WSPA 3MKKA 5FCZA 5EFDA 3ARWA 1Q4NX 3W82A 2VX7A 3TONA 1Q6GA 3CZLA 1WDSA 3W53A 5CPTA 3C7EA 3VD5A 2ZX8A 4MB1A 4U3AA 2J4GA 2RV9A 3RMEA 1WNOA 4W50A 1BG9A 5A8NA 1TZ7A 3AXXA 3GYCA 1J01A 3MANA 4TXWA 4UOQA 5I78A 3HPNA 4URIA 2FHBA 4CUBA 4PSPA 1GVIA 2WUHA 2CHNA 4TVUA 3NSXA 2YL6A 5CJ5A 2WM0A 1XSKA 4A44A 3K8KA 2J8FA 2ORZA 2VRKA 1UMIA 2W3JA 3PZGA 4JFWA 2YB7A 3EDFA 4CN4A 2Y5EA 1LJYA 1UQZA 1JF5A 3RDKA 1CLVA 1CTNA 2G4FA 2RJ2A 4JX0A 2ID4A 2WO3A 1H11A 4U5KA 5A8PA 1ISVA 1XYZA 2WVUA 8CGTA 1A3HA 1J83A 3W6MA 4XUTA 2YDQA 2GJXA 2BERA 1E0WA 2BXYA 3OIHA 1E4IA 4GKLA 3AMGA 2Y2WA 1JDCA 5M03A 2Y6KA 4GZ9A 2GJPA 2J1UA 2WPGA 3TTYA 3ZQ9A 3ALGA 4D6JA 3GTNA 3WF1A 1K9TA 4N42A 3A3HA 5AYBA 4AIOA 3AJ7A 2VQTA 3SEPA 4JCLA 4MNMA 2QPSA 4GZEA 2ZICA 2Y6HA 4W4ZA 5BXPA 5CGTA 4AEFA 2C4XA 4NI3A 2XJ7A 3NJ3A 4PBGA 2PQSA 1EHAA 1EIBA 5BROA 5D8ZA 1Z32X 3ALFA 1W3LA 3WDRA 4JKKA 2GDVA 4EAMA 4LPCA 1CZSA 3NIYA 3LPGA 1O8SA 4UQ9A 3N13A 1VJSA 1JG9A 1LWHA 4GI9A 1C90A 5DPNA 2EBNA 1HL8A 2OKXA 1VFOA 1XGZA 2OYKA 5AC4A 5CYYA 4Z2AA 3WQ6A 1PMHX 3W6LA 1H41A 3WNNA 1C8QA 2W94A 1CLXA 2WXDM 3THCA 3BSHA 2A3AA 3VM7A 1K12A 1KXVA 1KXTA 3WQBA 4H8UA 1F4AA 2BNJA 4QLKA 1JZ5A 1W8OA 2WSKA 4Z2KA 3MMWA 3KE0A 1OT5A 3A22A 2WZIA 2WWDA 4CVWA 1JU3A 4DEVA 2WC7A 3VX1A 2WAAA 2JKXA 4DUXA 2RGMA 4UNIA 4DWSA 4AEEA 2DQXA 3GH7A 1IT0A 5FIPA 3IJ9A 5C8BB 1QOXA 1TA3A 4A3YA 3L4WA 2QHAA 1XSJA 2VMDA 4U2YA 1TVNA 3NSMA 5LA0A 1HJQA 1W99A 1K9FA 2E40A 2WCSA 3VX0A 4W5UA 4D71A 3RM8A 1D7PM 1XH1A 1HP4A 3ZJ7A 2WO1A 2WKLA 1SHWB 3NRUA 3F5JA 4D1JA 5BRQA 3BC9A 1UR4A 1E5JA 4AZ5A 4P8UA 3ARVA 2CXGA 3GBEA 4LXFA 1XRVA 2DDXA 4KWUA 4MDPA 3SCOA 3MV11 3UR8A 5I5RA 1U2YA 5A6MA 1L7QA 4HP5A 1BPLB 1GOQA 4GWJA 1JZ4A 1ZJAA 4XB3A 2X10A 2CEQA 3N17A 3ARXA 1XD0A 4W84A 1JFXA 1HKMA 1VF8A 3WEOA 2WYSA 5FD0A 1K45A 4ZXEA 3MUIA 1J0KA 2VZRA 2O9PA 3UR7A 1KR1A 1E4LA 3ZJ6A 3CLWA 3I2HA 1MXDA 1QI4A 1BAGA 2LW8A 1ISXA 4UQAA 4CVUA 2GDUA 2WMFA 3IIIA 2CIPA 3T08A 3W5MA 1WDRA 2ZOXA 2CBVA 1CXKA 4AZ6A 3PUIA 2J1AA 3LEIA 4GZJA 4LYPA 3BN6A 2ZUWA 4U3CA 4U31A 1KQYA 3KEHA 3AMDA 3IDAA 3PTMA 1JZ3A 1NQ6A 5A8MA 3VDBA 1UYXA 1VFFA 1W3KA 2A3EA 3S6TA 3QHMA 2XYLA 3IAPA 1K42A 3KL0A 3WL1A 3PBGA 2XFRA 5A2CA 1W91A 1W9DM 2WMKA 1NH6A 1UY1A 3VTRA 2BBAA 1V02A 4E4PA 3T0BA 4PSRA 5FKYA 2ZXQA 3CZ8A 3VGFA 2D3NA 4ZE5A 1MFUA 1OINA 1X6LA 4MTVA 3VDCA 2G3JA 2WC4A 4OOUA 1QHPA 1JYNA 2QBXA 1C7SA 1KBKA 2WHJA 2XHYA 2EIDA 1GOHA 3OEAA 1V3IA 5IYYA 5M17A 4D72A 4DWSC 1J12A 3U5YA 3PZUA 2YBTA 2W1WA 4WSJA 4UOJA 2CETA 3TTQA 2J79A 2WMJA 1CGVA 2YG0A 1E70M 3D5HA 2EPLX 2JEPA 2EPOA 2X0YA 3RM9A 4ATDA 1O7AA 3LPPA 1UWUA 4ATLA 3FAWA 4U2ZA 3MV01 1KGXA 2XM1A 4TTUA 1WE5A 3T2PA 3A6OA 1E5NA 1GHSA 5KZ6A 1V3KA 4QX1A 3ECQA 1E4MM 4A6OA 4PT6A 2VX5A 5CXPA 2AOSA 6A3HA 2WC3A 1GQLA 3CPUA 2V3FA 3BAWA 3A23A 4BZYA 3CHEA 1E43A 5E09A 4AG4A 1XCWA 3UESA 3SUUA 1GQKA 1EQCA 2W4XA 3HNYM 2J1EA 3MBWA 2J25A 2YA1A 4MPKA 2BV9A 1CYGA 1E55A 1MW2A 5A6BA 3W5NA 2VVNA 1W9SA 5J1XA 3GM8A 3O9NA 3VIOA 4QPWA 1ISYA 1V02E 1UWSA 4H7VA 4AD4A 3ZM8A 5E9AA 4CUCA 1GUIA 3UETA 1TVGA 4E8CA 2VL4A 4PMQA 1WB0A 2V38A 3SCQA 1DWJM 5ABHA 1JL8A 3GNOA 5HXMA 2XSBA 4M80A 4GO9A 1P8JA 1QW8A 4M4PA 2A3BA 3F5LA 1ZJBA 2CITA 2F2HA 2YOCA 2V5CA 2WCGA 1DYOA 2BHYA 1JXJA 1W32A 3MO4A 5E6YA 3WD4A 2A3CA 2LS6A 2VI0A 2ZUUA 2NT1A 4MJ4A 4W93A 5A95A 4CKQA 3ARUA 1J0HA 1W9TA 3ETPA 5A3HA 1E73M 1AQHA 4D1IA 4P7LA 2GJRA 4UFHA 4JAWA 3FY1A 2Z4FA 1W1VA 2J7EA 1V6WA 1O59A 4PMNA 5JUVA 1KXHA 2XM2A 3WDQA 1TG7A 1J84A 2W66A 3PTKA 4JFUA 4QCFA 2E26A 1C91A 3L4VA 1E6SM 3OLDA 4NRRA 3SUWA 4PQQA 2PWDA 1Q6CA 1EDGA 1X1NA 2BFGA 2ZX5A 3WMCA 3AYRA 3ARRA 3S2CA 3PZVA 1BYAA 1PIFA 3W81A 2WHKA 3PTQA 3M46A 2J1VA 4CD4A 3GXUA 1W9VA 5I2UA 1KBBA 4X9YA 4UOZA 1HJVA 1FH7A 1VBRA 2OSYA 2O9OA 2YL9A 2ZEYA 1BTCA 2G8ZA 2WZEA 1DP0A 2WZHA 2XPKA 2Z1SA 4HU0A 3W27A 3C7HA 1QNOA 1KFWA 1U30A 2QQJA 2JFEX 2DSWA 4TOQA 2YFZA 1WDPA 4NSBA 3AZSA 3VINA 1KCLA 5I6SA 2WB5A 2ZIDA 2HISA 3T0AA 3KL5A 3IANA 4A4AA 1C92A 4D6DA 5EJZB 3IJ7A 3TTOA 1UHVA 5IXEA 4LPLA 4XUNA 1V6VA 4AC1X 2EO7A 4LGXA 4ACZB 1UY2A 2JF7A 2ZXBA 2X05A 1NKGA 1EGZA 1UR8A 4B16A 1HN1A 1C3FA 3K4DA 5JBFA 3DYMA 1E0VA 4W85A 4RE2A 3U57A 3HNBM 3VPLA 4HA3A 1IZKA 3ZT7A 5D4YA 3VOCA 3T09A 3TOPA 2V72A 4ZXOA 3SCNA 5CSUA 2GSJA 5BXSA 3NJVA 1E6XM 1H09A 1V3LA 3OZPA 3U7BA 2XGIA 3GBDA 2GK1B 3SCPA 2W61A 2BY0A 1W9UA 2VZVA 2PF0A 4QP0A 1MQQA 3WEZA 1OIMA 4M29A 3EMCA 3GGLA 1B90A 4YHGA 1W2VA 2IXUA 1NOFA 1ULOA 1GOWA 1BG4A 3BCDA 2WBGA 3N15A 3CZKA 2WANA 2QF8A 2XGBA 2ZX6A 1FHDA 3VGGA 4BF7A 1V6YA 2YA2A 2XONA 3WQ8A 4RE4A 2JEQA 4B3LA 2CPUA 4AAXA 3OGVA 4PUEA 3ZJKA 5D9NA 1GMMA 1LNSA 3W38A 5G05L 1V6UA 2DPEA 3VILA 2EEXA 8A3HA 1EH9A 1GW1A 4CU8A 1ODZA 4D8MA 3QHOA 3THDA 1PX4A 2QMKA 1BGGA 4J3UA 2OWXA 3VVGA 1ZU8A 2DCJA 1ITXA 3CZJA 1LL7A 3MSGA 1UA7A 1OIFA 3IB3A 1HJXA 1LG1A 4CU6A 1E4NA 3BGAA 5JXGA 2J1TA 4R27A 1OGGA 3ZMRA 3WN6A 5A6LA 4LQRA 1JYWA 2QQOA 1UR2A 3U37A 3GH4A 3K8MA 1PIGA 3OLEA 4M1RA 5HNNA 1DLCA 3A4XA 5DN2A 2E8ZA 1CEOA 2WZ8A 3AFBA 2V3DA 3TA9A 5TD4A 3KWXA 1UOKA 1SMDA 1HJWA 3UG4A 4J7RA 1OBAA 2G41A 3L4XA 1D2KA 3K8LA 5ABFB 1WKYA 2QQNA 1GOKA 3ARPA 2OYMA 4B15A 2AMGA 2G3IA 3SCSA 2PC8A 1J9YA 1E1EA 1E6ZA 2FGZA 4XZBA 2G3MA 1PX3A 4LYRA 2VMCA 1FHLA 1WAWA 4PMRA 5JXJA 2F61A 2WKGA 4DUWA 2WW5A 4HOZA 3MU7A 3AIWA 1DWHM 4LKSA 2BVYA 1HVXA 2ORXA 4MAVA 2CERA 4Z2JA 1ITCA 1SDDB 1JZ8A 3VIFA 2W1UA 4MNKA 3HJEA 1ZB5A 4FLSA 2VRQA 5JR2A 1FP8A 2Y8VA 2Y24A 1R85A 2Y64A 1I5PA 3IJ8A 2GUYA 5E6ZA 1EA9C 1EOKA 1VBUA 3IK2A 5M5DA 1MQRA 3AISA 3WUGA 2DT1A 4UZUA 5A2AA 3DHPA 3B9EA 1OD0A 1VFUA 2VTFA 3WDIA 3AS0A 4MGSA 1HX0A 1HP5A 3CH9A 4CCEA 4OBRA 2NSXA 2A3HA 4B9YA 3CMJA 1MYRA 2DSZA 4W8LA 2ZUMA 1AVAA 2WLZA 4RYDA 2WCAA 1W1TA 4JL2A 4QDQA 4F8XA 2WWCA 1W1PA 3WH6A 2XG9A 3CUJA 4TTGA 4P7NA 4GINA 3VO0A 1WZMA 3SEEA 3ARSA 4P8WA 3FN9A 4RL3A 5C70A 2PBOA 1HKJA 3WH8A 2NT0A 2W1SA 4IUGA 2J7BA 3CUFA 3SCUA 4HA1A 2E31A 1WZAA 1Y7VA 4AZHA 5IHSA 2B31A 1GOIA 1PPIA 3B9AA 2CDPA 1KEXA 1G01A 1CZ1A 1GORA 1NUKA 2V3EA 1E72M 1WCGA 1UR1A 4Q7NA 2VM9A 4M56A 3BCFA 1W9PA 2J7GA 2C9KA 1D3CA 1PAMA 1E6PA 4FLQA 5JMOA 2ZEXA 4P7QA 4W87A 1EHNA 2FHFA 1ODUA 4AW7A 2W95A 3AHXA 4PMZA 3ACGA 1XYFA 1LQ0A 3BAIA 2UY3A 1JAKA 3PZOA 3I3DA 3W28A 2XVKA 3WD2A 3NCOA 3O6AA 4ML4A 3OA5A 4BJ0A 4F9DA 2WABA 2WLYA 1J18A 1JDAA 1JI2A 1VRXA 5EIYB 5HPCA 3OG2A 5JXIA 2DH2A 3LE0A 1E9LA 2Y6GA 1OSEA 2J74A 4P7RA 4AXNA 5AC5A 4N0RA 4W86A 1NARA 3U7VA 1XNTA 3T2QA 2QLYA 2D20A 2DT3A 4HTYA 4D6CA 1V3JA 5DEZA 3W26A 1W3HA 2QPUA 3I3BA 1GJUA 3VMOA 3VD7A 3W4RA 3WENA 4MB4A 2VX4A 1HT6A 2J1RA 4J3VA 2YKKA 4W8BA 1OD3A 1GPFA 2F8QA 1HJSA 2WMHA 5IFPA 1K9EA 4AZIA 1CBGA 2YC4A 4AWEA 1C93A 4XV0A 2VZQA 1VIWA 4V28A 5DFAA 1PJ9A 4Z2LA 2OWCA 2E9LA 1GUVA 5CPQA 3P1IA 4CGTA 3GXDA 1UY0A 1BFNA 5D9PA 4AD2A 4A45A 4AZ7A 2WO2A 2PWGA 1XPWA 1R87A 3AZRA 1FH8A 4OIFA 4P5YA 1UA3A 2DIEA 1GONA 3PZMA 2VZUA 1QI0A 5IJRA 2YFUA 3WDPP 1GZJA 1H2JA 4W89A 1CXHA 4E2OA 3VIPA 4AZGA 1KR0A 1H3GA 1HVQA 1FP9A 1KGWA 3WFZA 4UFLA 4H2CA 3BAYA 5ABEA 4XUOA 2QQKA 1BVNP 2ZUTA 1HIZA 1HL9A 3WEMA 4AIEA 4FMVA 3WH9A 5A6AA 4QB1A 1NOWA 1UKQA 3SUSA 4QX2A 1EUTA 4CU7A 1UKOA 4RE3A 2E4TA 5AYIA 3MMUA 3RPMA 2C0HA 4QCEA 4ARYA 3O2LA 3CUGA 2VJXA 3MS8A 4TX6A 1CXEA 2CCRA 2WVVA 2QQLA 5E70A 1H6XA 2W67A 1E15A 1XCXA 3WMBA 2JF6A 2YIHA 3ZSSA 4FK9A 3ZR6A 4X0NA 3WMSA 5C7GA 4A42A 4NF7A 1DWAM 5I23A 5EMYA 1G1YA 1PZ2A 3WF4A 1JF6A 5D9OA 1V3MA 4MOAA 1W9XA 2WHMA 1NM9A 2CKRA 3T0DA 3HEIA 1R64A 2DCKA 1AQMA 1QNQA 2CHOA 2J7MA 1H1NA 3AC0A 5DO8A 4M82A 1MFVA 4KI5M 2JIWA 4Y7EA 1WZKA 1GOOA 3ACIA 5A1AA 3UERA 3N11A 5LCWL 1FH9A 1UY3A 1A47A 1G94A 3M7SA 1IQDC 4D6IA 3AYSA 5A6JA 1UWWA 5BYWA 4WJXA 3ZO9A 1UR9A 3CHFA 4D0QA 4DEQA 5A6KA 3L4TA 4XVHA 4TXEA 3BMVA 3GNRA 1SR0A 3HNMA 5GNYA 4QDSA 1HKKA 4W7UA 1Q6DA 4GXPA 4D6FA 4CD8A 2W9XA 3NNGA 1H0IA 1XH2A 4HZ6A 4EE9A 2C26A 3AMLA 4OOZA 1TCMA 4XUYA 1L0PA 1UD3A 2VZOA 3WD3A 2BXZA 3CMGA 3WFLA 4CCDA 1CXFA 1TE1A 4WKHA 3SKVA 4HMEA 2FH8A 3F4VA 3FAXA 1CGWA 4J27A 4F9JA 3WD1A 4FI9A 4ZZ5A 1Q6EA 3A21A 3EMZA 4E8DA 1K9DA 4NRSA 1T2XA 1W8NA 4BS0A 1MPXA 3WNKA 1S46A 3SKJE 1OH4A 2VCCA 5LA2A 1JZ6A 4HZ8A 4YPJA 5A6SA 2R7EB 3VNYA 5EBAA 2X1IA 1ZBWA 3CHDA 2DSUA 5BCAA 5CPSA 3RIKA 2BGOA 1M7XA 1IZJA 1XD1A 4AMCA 5EJ1B 1B1YA 2EXOA 3EDDA 4EANA 2WBKA 1PEZA 1BF2A 1UD6A 1B3ZA 4DXRA 1E71M 4GO8A 1DTUA 1PMJX 3MUAA 4AIUA 1OCQA 4H8HA 4W7VA 3JXSA 3UNPA 4P7OA 2WMIB 4P08A 2KD7A 2AAAA 1SYTA 4ZZ8A 3OGSA 5D8WA 1GOMA 2D23A 2YBUA 3ARZA 4FLRA 3QGVA 1QBBA 2BHUA 4UZSA 2Y4SA 3BAXA 4KRTA 4PMVA 2PBGA 3JUGA 3WELA 2DT0A 2VRJA 3MUY1 2OYLA 4D6HA 3CGTA 4CN1A 1CNVA 1RPKA 5BXTA 4AD3A 4CN6A 4FF5A 1OT2A 2WHLA 3SCVA 2Y6JA 2OSXA 1D7FA 2VMFA 2YL5A 5JBDA 4ACZA 3ZSTA 3HOBA 1PX8A 1EDQA 2V4VA 1EDTA 3BSGA 4HMCA 2J75A 3LPFA 4LYQA 3B9DA 6TAAA 2V3GA 2EIEA 1MQPA 1E56A 3WDHA 1E6NA 4PCTA 2QV4A 2DEPA 4OYUA 1BSIA 2JDAA 4BQ5A 4MGQA 1LL6A 4PTMA 1U33A 3L2LA 3DYOA 4PMOA 5M3WA 1WO2A 7CGTA 3VD4A 2HYXA 2PWHA 4WKAA 5CG0A 2BY1A 3N12A 2QMJA 2DH3A 1IV8A 3ARTA 5KEZA 2XVNA 3CHCA 4XZWA 2YDSA 3OEBA 4IPNB 4ZY9A 4P8XA 1R7OA 2YLAA 4PTWA 3WF2A 1YHTA 4WK9A 3T2OA 1QNPA 3AICA 3I2KA 4GIAA 1NWTA 5CZKA 1ISZA 1B2YA 3AMKA 3EB7A 4UFMA 1CPUA 1DHKA 4JFVA 2OSWA 3VGEA 3L4UA 3POCA 3WNOA 3K1DA 3SUTA 1V0LA 3N18A 1V0MA 3CIHA 1G0CA 5BWFA 3WH5A 4XURA 3WUFA 3ZOAA 3J7HA 3AIRA 4OUEA 2FGLA 3EBVA 3DECA 3APGA 1B31A 3NDZA 2C7FA 2UY4A 5FUIA 2IUZA 3BLPX 2D1ZA 4PMXA 2D22A 4BK4A 1E6RA 3WH7A 3RM4A 2YL8A 1RD6A 4S3KA 3NYDA 3VMNA 2NW0A 3QR3A 3PZTA 3LEGA 2MANA 1WPCA 4HPHA 3CUIA 2VO5A 4ARXA 3GDBA 5CSYA 3HMCA 4UCFA 2GVYA 4A41A 3SUVA 4JFTA 4M24A 3CZUA 4UFKA 2GK1A 4HPGA 4AYSA 4YN5A 5FL0A 2PWFA 1UWRA 4TVCA 1UY4A 3DC0A 1EUUA 1OGBA 3N1AA 3WNLA 3PZIA 3RJXA 4IPLA 2EPKX 2J22A 1JZ7A 1UD4A 2W1QA 3CTTA 3KL3A 1TUXA 3VNZA 2D0HA 3EMQA 1GOGA 2CBIA 3F5KA 1E3XA 1KB3A 2J47A 3A4WA 2BY2A 1K3IA 1MWOA 2BHZA 2VZ3A 4UQEA 1FA2A 2VZPA 4BQ2A 4HZ7A 1EXPA 2WVSA 3W37A 3L2MA 1K6AA 1QI3A 2VR5A 4HG6B 4QDRA 1LWJA 4EKJA 5ABGA 4YHEA 2XIIA 4P8VA 4DWSB 1ULPA 3FHAA 1RH9A 2ZXDA 5GNXA 5I3DA 1EO5A 1JD7A 5JBEA 2DT2A 3AMCA 2DSKA 1GQJA 2J7DA 4QLJA 1KQZA 6CGTA 1L7RA 4PF1A 3C8XA 2BGPA 3LQCA 3BAJA 1XNAA 1UXXX 2VQUA
chains in the Genus database with same CATH superfamily
1R1ZA 4Q0PA 1DPMA 4QE1A 4XAPA 1EAH1 4BPZA 4CP0A 3C3VA 2R072 2C1HA 2ZHLA 3H8UA 3U5UA 1G8WA 2GDFA 5FYHA 4NJ4A 3XINA 1Y8BA 4M6QA 2LROA 3NO8A 2Z2SB 2B7YA 1EQPA 2FMDA 3VU2A 5D38A 4JNZA 4PEKA 1H1YA 1F5ZA 1RA5A 2TRSA 3DFQA 3SCHA 3I3QA 1G9HA 4X8PA 3TYEA 4JS3A 5IM51 4MNJA 2ZEZA 4IE0A 1H6YA 3NDOA 2IW0A 4F8AA 1LGNA 4RPPA 1LOAA 2GFTA 4D7YA 1OVPA 2FYMA 1R3RA 3ZYRA 1JMUB 1EFZA 1QJU3 2QUTA 4DM2A 1NXMA 2XLAA 4BK5A 3THTA 2FZ8A 4DXSA 4L6OA 2ZUVA 3AIUA 2RS12 2EIGA 1GEHA 5CNAA 1G5AA 1Q6FA 3TN3A 1IXNA 4JHOA 3UWEA 5HJXA 5F5QA 1FV3A 1D3HA 3DFHA 4HD5A 7A3HA 1JW6A 2DZUA 1EO7A 4BQWA 4EN0A 5CFCB 4B2DA 4KH2A 4ZO7A 3NJXA 2WSRA 3VZJA 4D6EA 1OF3A 4L1XA 4C7FA 5FZ4A 4JDYA 3GS6A 5AOUA 1UQYA 1FWJC 1AJOA 1I6NA 2QQMA 4Q8KA 4K39A 3W86A 3HD8B 5I09A 4QU2A 2NLRA 4CEWC 1NY1A 1TQXA 3WDVA 1V0NA 4AYUA 3H4XA 3PG9A 5FI8A 1J0IA 5BRPA 3QF0A 3L5MA 2C1GA 2PDYA 3OZOA 3IWZA 4OI0A 2BZDA 5FACA 3ZX7A 2Q8ZA 3MYXA 2JDPA 2VFFA 1VQTA 3AS2A 1XQNA 5FZDA 4J3ZA 1WYIA 2QDRA 2YA0A 2GAUA 4QKBA 5EMJA 4AWUA 2IKIA 2XISA 5FXXA 2WAOA 1UR3M 1HKIA 2DJLA 4OZXA 3TAKA 4PMUA 1MXGA 3E3HA 1GKPA 3VA8A 4WLCA 1OGSA 4IE6A 2ACRA 3KDNA 2KA3A 4Q32A 4E4ZA 3R0DA 4MB3A 5B4NA 1JNDA 1VBB3 2ZGKA 5IVBA 3EB3A 3B00A 5JDBA 3WF3A 5CLTA 5AYZA 1XIFA 3VXGA 3VN4A 1QJY3 4CUAA 5G2WA 3ACLA 2AGKA 4K8RB 3B3DA 3QZ6A 4H6RA 5AKQA 2RVAA 1RQHA 3D8CA 1QNRA 2XN0A 1V6OA 4FEZA 1K8YA 1OA2A 1GQPA 4L4MA 1UYZA 3O07A 3S2JA 4XBJA 1WGPA 3DPRC 1FQ0A 3KT4A 4K1YA 4IXLA 4Y4YA 4BQ3A 2B9VA 2Q1FA 3G6LA 4LX4A 1XKYA 5G2IA 5BNOB 4AY7A 4F66A 5A8QA 4GKYA 2QJIA 3N7MA 1ND3B 4RHV1 1DIEA 1GJWA 1ZALA 1H49A 2B4KA 1DQ4A 1P6BA 3RILA 1N1YA 5I3JA 2WNVC 1RVF3 4CEYA 4GH4A 5I3HA 3I7RA 1FWBC 3CV2A 2GDQA 4XIMA 4LANA 1GZWA 3DXIA 2RDQA 1KFEA 5GPRA 5FF4A 4Z2GA 1JIBA 3SGUA 1TV7A 1HRI2 1Z89A 3B03A 3WDXA 3GZEA 3EX4A 4XDOA 3B8UA 2XINA 3O7UA 2FZBA 3I3EA 3KZSA 1F61A 5F4XA 5BXRA 2GC1A 1OFPA 4AXOA 4QX0A 1UWQA 4Z0JA 3TQPA 4R5EA 1CX1A 3O1RA 2EF9A 2FMNA 3QHNA 1KRCC 3TSMA 1D8CA 4NZ3A 1E1CA 4Z2HA 2BVTA 2HK0A 1MZFA 4J6GA 1VBE1 1U5YA 2CLHA 4MKSA 1K6WA 1H5YA 1TME3 5H1WA 3DDMA 1RUD1 3QGAC 3IZOA 1TELA 3EX2A 3BGJA 4A2UA 1XIIA 4H04A 2HWE1 4RDVA 1W2NA 1OFRA 1GW9A 1LLOA 5E0CA 4BK9A 3QV8A 5JSPA 1E5SA 1XYLA 4XD3A 1VEPA 3ICJA 2JE8A 5T9BG 2JDYA 1DXEA 3C56A 5CQ1A 3L12A 3AHYA 1US2A 4LKFA 2XBO1 2TAAA 1AX0A 2TODA 1UZ4A 3WLPA 1C8VA 4LUTA 1MEC1 2WS93 3G0XA 2ZBTA 2XWBB 4GACA 1ELSA 1JFHA 4H6EA 4Z82A 2ANUA 4MGYE 3IEBA 1X1ZA 4L9XA 4XABA 2FDMA 1OPOA 3R25A 4UTTA 4HA4A 4RR3A 3P81A 3REQB 2Z1KA 1KXQA 3OPZA 5FKCA 3PVFA 4CU9A 3RNDA 3NEHA 4WSKA 3LHVA 1E1CB 4MFDA 3KTCA 2J9ZA 1HJUA 5A69A 2QKDA 3WQ5A 2KXLA 5A3MA 2F38A 2XN2A 4Y26A 2AACA 4GWIA 4UI9L 4ECLA 1SVDA 1HRV3 1UP2A 1XICA 4FOVA 4W7WA 4QQUA 2GVJA 2ISVA 4U10A 1DEDA 3D47A 2XFWA 2VEIA 1XRTA 4QB2A 3HJRA 1SMVA 1JCLA 1US0A 2CTVA 1A5BA 2VNGA 2H8XA 2R073 1TPDA 3CT2A 3IVTA 4GJIA 4GPNA 4PUDA 4MXVA 2ZX3A 2DU0A 4AVCA 2FHCA 5FAGA 3VGDA 4IH3A 2X30A 3BPWA 3H50A 1XE8A 3NR0A 3QH7A 1BVZA 4LBQA 3KV6A 2ZX4A 1FFRA 1V6XA 5LYRA 3T55A 4OBSA 4GY0A 1ZHAA 3VKAA 5FZ6A 1PMIA 1XCFA 5E88A 1UZYA 3F2ZA 5LHFA 1H1MA 1Z69A 1E0XA 4JL1A 3WSOA 1QJWA 2NX1A 2AENA 2EJ1A 1JD9A 2EJAA 1PE1A 1V6JA 1MACA 3EX1A 2YCKX 1MS9A 3GNNA 5E5CA 1KWKA 4FR1A 1CZTA 1TWWA 3C7GA 4Y2WA 3W9AA 2O9RA 4WJEA 3ES7A 2DVUA 4XUQA 4RZ5A 4S39A 3KS7A 3BOXA 2OZ0A 4D6GA 1IGOA 4ZO8A 3AHTA 4J3SA 3R4IA 2CAVA 3VIJA 2WNWA 3AIQA 5FJKA 4B91A 1EJWC 2DZWA 1LECA 4IIFA 5LASA 1MXSA 1JDDA 4IEVA 3ATZA 3GFZA 5C9AC 3VBFC 3WQVA 3W7KA 4RDYA 1WLDA 3N3TA 2J6XA 3VLBB 5I8SA 5LBEA 3W1AA 1HRI1 2DBNA 4GLEA 4LORA 1LLZA 3PHAA 1AR61 3HU7A 3AKPA 2JD9A 2WMIA 4F79A 4QQ2A 4JQRA 2F17A 3DOPA 2WFF3 1F35A 1NQJA 2BVVA 2D3LA 4UR7A 1CGYA 1LAJA 1BGAA 3EDKA 3SQMA 4EN7B 1QJZA 1C8M2 4FAGA 1CAVA 1H4PA 4K6BA 1Q8PA 1TX2A 4GWEA 3OUIA 1JYXA 1C3HA 3N4AA 3NMBA 1X6NA 4HZFA 2ARAA 4HPKA 2W91A 1C8XA 1DJYA 3ZSEA 1GT8A 4K21A 1HGYA 1H7PA 5M0TA 3P6LA 1R3VA 3AIEA 1ZL1A 4Y1XA 3AYVA 4Y96A 3BZJA 1MQTA 4F83A 4M7SA 3C2VA 1MZ6A 4IERA 3ZR5A 3I97A 1EPVA 1CLKA 5B2GB 2ISFA 2CL2A 4IFKA 3OODA 1LCOA 4PLNA 3RITA 1XNDA 4FP3A 2FZ1A 2GH8A 1V0KA 3SI9A 1ZTVA 1EF2A 4HT1T 3OBZA 4TLGA 4DM1A 2HZGA 1JUKA 1SMAA 1TA3B 5XIMA 2J8TA 1TVPA 1ZLPA 4CQDA 3BWWA 3VUPA 1QH7A 1V7AA 3TH6A 1XLGA 3T6CA 1PVC3 1W8HA 3OUJA 3W20A 1VRBA 4OT7A 3CO8A 2CLPA 3PLQA 2QPXA 4NRPA 3CH0A 5A2BA 5MKGB 1HQLA 4FNQA 4KGGA 3VIKA 4Q8TA 4DF0A 1LGCA 3OBRA 1XLAA 4FXJA 5LNVA 4GVGA 4IV3B 4DLFA 5LA1A 1CAXA 2DSVA 2BW8A 3IV3A 5AC93 1LRQA 4ZQNA 5BNOA 1AR72 2QVHA 2V5BA 4HK7A 2EQDA 1W1YA 3CL6A 4QNEA 3M6DA 2BQPA 1J8VA 3LDRA 2JIEA 4WVMA 1BRLA 3M0JA 2PRMA 4BR1A 2FZ2A 1Z0HA 3TX9A 2IPGA 4HVXA 2ACSA 3I2IA 1X33A 4Q4X3 1K02A 3HV9A 3BW2A 5DXDA 3BXWA 1XYMA 4AI0A 2ZC8A 1AODA 1D4M2 4FO4A 2OWWA 1PCWA 1V08A 2Z4GA 1ZPTA 3MBFA 2MNRA 1OKQA 4AZCA 3D3AA 1M7JA 1H1ZA 1QJY1 5AFBA 4YVWB 5HV4A 4AEKA 1LF1A 2YZ4A 2IXIA 1KFUL 4O9GA 4B4QA 3DFOA 5CADA 1VCVA 4JZ5A 2G19A 3ZSJA 1WBFA 1VEOA 3GJAA 3I2GA 3GX9A 3TYUA 1KFLA 2GP5A 7TAAA 1C28A 1GK8A 1GSLA 1TWSA 1R6WA 1GVRA 1XE0A 3T4WA 3ILRA 2EF6A 1KCZA 3H21A 1CAWB 1UAIA 3EEGA 1ISWA 1GNHA 5BNOC 3HQUA 5A3UA 4B2DD 1K4GA 3QXBA 3EMRA 1GG1A 3CWNA 1RQEA 4FFGA 1XIJA 1NFGA 1LRTA 3OP2A 2FKPA 3C0QA 3W58A 2ZWZA 5FOOA 2FJKA 4UAPA 4QAIA 4C6FA 3ABZA 3MYPA 1Y9GA 4CDUB 1CZVA 3F1QA 4Y9MA 2BNNA 1UUQA 5C2GA 1FWEC 1WBJA 4YWAA 4CYDA 3ZXLA 1WP6A 3OGRA 4IGPA 3E6CC 4YFZA 4PEEA 1BVP1 4LY4A 3URAA 1SW7A 1WUEA 2XH2A 2FFCA 5FP3A 1YDNA 4R7OA 2VHLA 4NNAA 5G1TA 4H8VA 4J28A 3O63A 2PRHA 2Y8KA 4C5YA 1MS5A 1QW9A 3FYPA 4RXFA 2CLLA 1FWCC 3TP4A 3DEMA 1LU2A 4NAFA 3V1HA 2J7FA 4J35A 1UYPA 4TVDA 1LEDA 2H6BA 2V82A 2WK2A 5D2XA 2E6AA 5E93A 4M01A 2OKTA 3I54A 2AEYA 4HOOA 2UY2A 3PTDA 3PUQA 3MY9A 1BXHA 3ARWA 2VX7A 2XH4A 3CIXA 3TONA 1EYWA 4DJDD 4IL2A 2FZDA 3CZLA 4XZ9A 1UIJA 4YNIA 1WDSA 3W53A 3M43A 2ZX8A 4U3AA 1VGAA 3STFA 4W50A 3RZJA 1BG9A 4LHLA 1AR73 2NXGA 1R3TA 4MMWA 5I7GA 1J01A 5D30A 3TC3A 4RNFA 1ENQA 3QN3A 2FHBA 3UA4A 5GALA 4ZO9A 4MGKE 1KQRA 1HB4A 1K8XA 4BMEA 1GLHA 4F4RA 1YXDA 5F3CA 1XPYA 4JN8A 3S5OA 4DF2A 5C33A 1Z8AA 2VRKA 1VBHA 2FPTA 2D40A 3RGBA 1RAKA 3PZGA 4AVNA 2YB7A 4Q0UA 2QDGA 4CN4A 2Y5EA 1A8MA 3BLOA 1QF3A 1CLVA 1PYMA 5LK7B 4R7JA 1VAKA 4P9LA 8CGTA 1IYXA 1HTIA 2C1FA 4XUTA 3W6MA 3UR5A 3F2BA 1Q6RA 1JVNA 2HRWA 1WKEA 3VOFA 4UW6A 1PDZA 2NQ9A 1XJBA 4DBSA 4ZQPA 4CUGA 5D21A 3GBFA 1E4IA 3ANYA 4GKLA 5AB3A 1S5VA 3ZFGC 4I0WB 4ASMB 2WPGA 1Q8AA 3GTNA 4IQLA 3FYYA 4IP5A 5AYBA 4AIOA 4EWJA 6REQB 2VFGA 3AJ7A 1RXFA 4E4DX 1ZY9A 4MNMA 3OO2A 4S3BA 4GZEA 2OTDA 3GD6A 4DQAA 1C9WA 2BGQA 3KTSA 2XH7A 4JTJA 4GX9A 1Q7ZA 3LRMA 3ITXA 1R081 4PCPA 4PBGA 1EHAA 3IUIA 1FWHC 2FVKA 5D8ZA 1W3LA 2ZADA 4EAMA 5A80A 2QJGA 4Q7IA 1D8WA 4UQ9A 1EBGA 4Z1DA 1XYOA 3PK7A 3N13A 4NT0A 4XTIA 1C1FA 2A6NA 5DPNA 1TCDA 1NELA 3UWUA 1LBMA 2FZMA 1VFOA 2Z26A 4FPEA 1EC9A 4NI8A 1WV2A 3CV6A 4G1KA 4HPJA 4EPDC 3NURA 4RHV2 5CYYA 4KWWA 1QOQA 3I6EA 4QS6A 4Z2AA 4S38A 5FJTA 5FJPA 3OY8A 3ZVXA 1PMHX 5A3WA 4MWAD 1JRBA 1OY0A 4I02A 3ZLGA 1CLXA 4DYEA 3V5CA 1DJWA 4JTQA 4KFOA 1K12A 1KXTA 1RUJ1 1VRH3 1XM3A 3QR0A 4P14A 1VHCA 3S9YA 3MMWA 5F4WA 1RXOB 4RCXA 2YC0A 3DG6A 4A35A 3A22A 3GCXA 1F5FA 1JU3A 4DEVA 2WAAA 4DUXA 3IGHX 5EBUA 5FWJA 2DQXA 4EP8C 3MVTA 2HK1A 3TNPB 5C8BB 1F31A 4A3YA 3NM1A 4PR4A 2QHAA 3T8QA 4UW3A 2YDAA 1COV2 2V4AA 4AGVA 3S5SA 3AJYA 4GKXA 2QCSB 1OVSA 3SC7X 3RZKA 5C3RA 3NSMA 5CVRA 1HJQA 3H3UA 3T3YA 2E40A 3EOLA 1B35A 1TX0A 4W5UA 1EYBA 4D71A 4X2RA 4D69A 1HP4A 3LGDA 4HSNA 4YIWA 2RE9A 3H22A 5H6HA 1PGW2 4ZQOA 1SJDA 1SHWB 1G7UA 4YARA 1W5PA 3OEXA 2QZ3A 1T6GC 4Q4RA 3B0VC 4D1JA 4WM7A 3V3WA 3ABXA 2Y0OA 4DHGA 2DVDA 4CDQA 3DFPA 3SCOA 3A13A 4MDPA 3UR8A 4WUIA 4LBJA 4RGKA 3ZKYA 3JR2A 3PBWA 5A6MA 1AX1A 3APTA 4A7YA 4W84A 1PZ7A 4F2UA 1HL2A 1QTWA 1FX5A 2Y7EA 1TZZA 4AC7C 3LAGA 2I14A 1XX1A 4A22A 4PFHA 2ZMKA 3DFTA 2VZRA 4L7ZA 4XKYB 4PE8A 4XIOA 4LAMA 2GQ8A 1E4LA 2QJNA 4UQAA 1BAGA 1ISXA 2CIPA 3V1PA 3W5MA 1WDRA 1FPN3 4JTLA 3C4UA 8XIMA 4C6JA 5A6QA 2C13A 2Z79A 3LEIA 2XJPA 2ZUWA 2WR9A 1DORA 1PZ9A 2D3PA 3BB6A 3GTXA 1JZ3A 1ZUAX 2VEMA 3QEZA 5A8MA 1UYXA 2A3EA 1K42A 3WL1A 3J8F3 3V75A 3PBGA 2XFRA 3PS7A 3OYXA 2LLEA 2YR1A 1GG0A 2PCEA 4E4PA 2VMGA 1Q63A 2ZXQA 1B35C 3VGFA 5F3EA 2D3NA 4FQZA 4DOUA 3OD0A 2A6XA 1QQP2 3M0MA 3VDCA 4JTIA 5C4WA 1JYNA 1SPQA 2PP3A 1PKLA 5L36A 2EIDA 1FPN1 1GOHA 3C2FA 4RR4A 1ZBA1 3E38A 3G0UA 3QM3A 2WA3A 3W7PA 3ITOA 4MUZA 1A5AA 3E2VA 1R3YA 1B4KA 4YVSB 1N8FA 3PZUA 4K3ZA 2QNEA 2NQJA 4YVPA 4V33A 4ZU7A 1SW0A 4PB4A 3Q2DA 2KAUC 2REQB 4R7WA 2IXJA 2WMJA 1GYNA 3TTQA 4FT8A 4CEYB 4KBBA 1XIHA 1OF6A 4W6WA 3WK0A 5A6XA 3G1DA 2FMYA 5KZEA 5K9YA 4DI9A 4UUIA 2PLCA 4YG0A 4M5PA 2RJLA 1YADA 4Y1VA 3DX5A 4LB4A 1JR1A 4EWEA 1KGXA 2TSYA 4U2ZA 4NAFB 3T2PA 4LVDA 4C1NA 1YJKA 1DZRA 3A6OA 1GHSA 4ZQRA 4QX1A 3ECQA 5CXPA 2VX5A 3RSJA 4DPPA 2AOSA 1WCSA 1E9ZB 4XTMA 2WC3A 3M64A 6A3HA 1SZGA 2XLGA 3KP0A 4WGXA 1T6BX 2VGGA 5DN1A 4DBDA 3NZQA 3SUUA 5BPXA 3HNYM 1BBT2 2J25A 3MDPA 1RVKA 1CYGA 3VZMA 2VVNA 4NO4A 3N6QA 3IPVA 1LP6A 4LH8A 2YBSA 1V9U2 3NJYA 3TSDA 2XIQA 1PGL2 2ON3A 2A75A 1UWSA 4LK6A 5LKYA 3GXNA 3A3XA 3W7CA 1UZWA 3ZM8A 3KGLA 3HM7A 2MEV1 1BWKA 4PMQA 4OHYA 1VBC1 3M3EA 1DJHA 1JL8A 5J36A 3GNOA 5APAA 3HQNA 3C2YA 5HXMA 2XSBA 4GO9A 3RDIA 2A3BA 3F5LA 3LG3A 3ITYA 2YOCA 2WCGA 1DJXA 1UUMA 3QFEA 1SLTA 2JG9B 2ZBJA 1EJSC 2XG3A 3ZXFA 4CP9A 4S3GA 4LF1A 2AC1A 5KTLA 3RS6A 5A7QA 2ZUUA 4M7TA 2V69A 1L6SA 1YJLA 2EGZA 2CU5A 3LGGA 5A95A 4IIGA 4G7FA 4JYEA 5FY9A 2AQVA 4D1IA 3DGBA 2MUCA 1MVEA 1KKRA 1OA3A 2R063 2Z4FA 4M6UA 1W8TA 4N43B 3OYWB 3MIGA 4AH7A 3DXTA 4YS1A 2XJQA 1KXHA 4AI3A 1RUC1 2Q71A 1TG7A 3BV7A 3U8GA 3KF5A 3P3BA 1MUMA 2OLAA 5FPUA 4IW3A 4C6IA 3ZPOA 2V73A 3UNTA 1H0BA 4NRRA 1MEWA 5CG7A 1R083 1EDGA 2HWB1 2ZX5A 2GMMA 5KXBA 1GYLA 3ARRA 4IETA 3PZVA 1PIFA 3W81A 3PTQA 3O1OA 2PQQA 2QQPA 2VTXA 1W9VA 2QGHA 3JU9A 5ENLA 1FH7A 2QVNA 3RX3A 1DU3D 5FF2A 5FDBA 2OSYA 3LFMA 2YL9A 1EJ7L 4RGGA 4IIDA 1UIOA 2Z1SA 1DP0A 3OJBA 1BMV1 3DEQA 4YU1A 1U30A 2DSWA 2JFEX 4ASTA 4TOQA 1A5CA 2YFZA 1WDPA 3CUXA 3B9NA 4Y1ZA 3TN91 1JOJA 5LIKX 3M0XA 3W1MA 3IANA 4Y24A 2PHLA 3NO5A 5FF7A 2ATFA 4D6DA 1MZHA 3BJFA 3TTOA 1Q2RA 3BURA 1PS9A 4B5XA 3SGGA 1O5XA 2RR12 1Q2SA 2R91A 1FOD3 1W8ZA 4LGXA 1RJRA 2HS6A 1HKWA 1W6OB 2ZXBA 2FDKA 1A3XA 4B16A 5JBFA 1HG3A 3DYMA 1E0VA 1UROA 4XD4A 4RE2A 3B69A 2UURA 3S8HA 1QR7A 4QT6A 3PULA 5D4YA 4OI1A 1REQB 3TOPA 3KZ4C 4Q27A 3XISA 4LUIA 2YHJA 4XZLX 3E0LA 3RG0A 1JUIA 1E6XM 3U7BA 3TJLA 4QPGA 3AWNA 2GK1B 4AVTA 2W61A 5C3PA 3H2AA 4PA8A 4QP0A 1MQQA 1OIMA 4M29A 1DBTA 1IHMA 3EMCA 1L3JA 4BYYA 3MWCA 4I7VA 3F7JA 1X7NA 2V63A 5ANQA 4K2SA 1VD6A 1DQ0A 4JTSA 3N15A 3CZKA 3C0LA 1A53A 3E5UA 4UNKA 1OYCA 3S1VA 1FATA 1LZOA 3LBOA 4JY8A 2V5KA 1V6YA 1NQDA 5LBBA 2YA2A 2C0ZA 2INEA 4XZNX 2XONA 1RUI1 3T07A 3WQ8A 4PL1A 5K4XA 3H7YA 2ZX1A 4A7ZA 4WR3A 2Y60A 3VZNA 1S3TC 1AYN2 4MPQA 4US5D 1LNSA 3W38A 3LD5A 1V6UA 3KCXA 4TMCA 3VILA 2ADAA 1YE6A 4NAEA 2EEXA 2DFBA 2QAPA 2CLIA 2QE3A 1PX4A 2UBPC 2JKPA 1PZ8A 2GH2A 3EWWA 4CXWA 4NZ5A 3N4MA 1R9YA 1J58A 4KF1A 4DX3A 5FBZA 3EB2A 3PFMA 4E2SA 1NCQA 4IV3C 4CU6A 4YZ1A 3S6OA 1QGLA 4J2PA 1W6MA 1DQWA 2AZ5A 2J1TA 1DTNA 2OZTA 3C2UA 2OQLA 3EZ4A 4PRRA 1H7XA 1OGGA 1IE7C 3ZMRA 5H8MA 4LQRA 3TAOA 2YXSA 2PRLA 4ZGYA 3PBMA 3U37A 1DQ1A 2JDKA 1PIGA 3MKVA 4M1RA 1DLCA 3DH7A 2RMU3 1BEV2 5EPDA 4DO5A 4R9AA 2AQWA 5TD4A 1RUNA 1UOKA 3SRKA 1HJWA 5IVYA 1YXCA 1XLKA 3ME3A 4J9JA 4NZJA 5FZKA 2PLV1 1CB2A 3OZMA 4H9YA 2PGFA 1QJEA 3EPMA 1Q3EA 4TSVA 4NIGA 3ARPA 4B15A 4AEMA 1QIQA 5CH9A 1E1EA 1TTJA 4O57A 4NWWA 3U75A 4CCKA 2C0AA 4LAZA 1PX3A 4X60A 3CQKA 4DBWA 1G9DA 1FHLA 3T42A 3J26N 3ELFA 5JXJA 1XS2A 2WKGA 4DUWA 4AVOA 5FXVA 1DWHM 3H55A 3SR7A 3VYLA 3INPA 5C4WB 2WJZA 4JPGA 5D33A 1JZ8A 2W1UA 3HJEA 3Q37A 3ZVHA 5DY3A 3HVDA 2IXKA 2Y24A 1R85A 4JC1A 2Y64A 1GP5A 5E6ZA 4QGMA 1EOKA 1VBUA 3C0JA 1A0CA 3ATYA 3IK2A 4S2GA 1NY72 3WUGA 4LY8A 3NVDA 5DBUA 4G7EB 4FFFA 5J48A 3DUIA 1ASJ1 4WBBA 4FZIA 4AHXA 2REQA 2ZZ4A 4QXKA 1HX0A 1LUCB 5E6HA 1YQ5A 2DSZA 2ZUMA 2CWSA 1AVAA 5JVLA 2WLZA 3HIJA 4XEZA 2PDJA 4JL2A 5L7OA 1W1PA 4HHLA 1LR5A 2XG9A 4P7NA 4WD0A 3KFTA 2Q8OA 5H9QA 3DUGA 1X8EA 4GBDA 4O7XA 3KDOA 4QPGB 2EXIA 2JJ6A 3TC6A 2P37A 2BB0A 3NAPA 3O3RA 2WFPA 1H1AA 2CU0A 4CPBD 4K40A 3WH8A 1S39A 4C0HA 2NT0A 3CUFA 4HA1A 1H7NA 1WZAA 1W6NA 2HMCA 5F1RA 2AQOA 5DRCA 4PJYA 3LDBA 2INZA 3VOIA 3ZWTA 3B9AA 3QSTA 2ZGPA 3AJZA 1SJBA 4KKXA 4RKAA 1G01A 2BVBA 1UR1A 4Q7NA 4MIMA 2GSEA 4LA3A 2PDLA 5GVJA 1AJ2A 1D3CA 3LSCA 4LOTA 3KLSA 2PDCA 4GUHA 4IGOA 3FYOA 5JMOA 3PVNA 2ZEXA 1QOTA 2FDHA 3KCOA 2H8ZA 4W87A 4Q4W1 1XRFA 1E0UA 3AHXA 4IL0A 1O7FA 1YFWA 2Y26A 1R0MA 1XYFA 1TPFA 3BAIA 1F5JA 1PNGA 2GN3A 3WD2A 2XVKA 2VMIA 3NCOA 3WDWA 1PV8A 3CHXA 1ZZBA 1KRMA 2HQAA 3RR4A 1JI2A 5EIYB 4PBFA 4US6A 3FEMA 3LE0A 1JBCA 1DF0A 3G7DA 2OGJA 2PDWA 5C0QA 5I0RA 4AXNA 1WDDA 2P53A 2WQPA 2GNBA 3KWVA 3N6JA 2JX9A 3M0LA 2DT3A 1J2BA 3WP4A 1G9CA 4PQ9A 3U6WA 1GJUA 2PP1A 4R33A 1POKA 1ALDA 5F32A 1SLCA 3VD7A 1HRI3 3U48A 3WENA 4MB4A 4YCPA 4WJ8A 2VX4A 2VTXJ 4GXMA 2PDPA 1G4EA 3M0ZA 2YKKA 4W8BA 4UT5A 4MH0E 1ICPA 3HBLA 1UQXA 2RJHA 1FVPA 4HBKA 1IXQA 3W1PA 1XDMA 4LUKA 2DCTA 1AJ0A 3I4EA 3CL1A 1MUWA 3ENRA 2NVDA 4ZVJA 1ULEA 1BKZA 5D9PA 4AZ7A 1I2NA 4O1EA 4LUTB 4A2RA 3LCWA 4JTUA 3FCPA 1CQ9A 4IMAA 1GONA 2HBXA 2C15A 4INFA 2QCDA 1ZFJA 1QI0A 3N9RA 3PJTA 3LCGA 2OX1A 4EXBA 4FQ4A 4C6OA 1F8MA 1CXHA 1RA0A 3TW9A 4AZGA 1KR0A 3USUA 4Q4Y1 4E4UA 1FP9A 1KGWA 2DORA 2CW6A 3FFSA 3W7DA 1FXZA 2POZA 1AZDA 4KCVA 1NDZA 1RJPA 1UCWA 4HSOA 2ZUTA 4FMVA 3WH9A 2JD4A 3GUGA 1NOWA 4AEDB 4CU7A 1EUTA 4NJGA 1VBD2 4RE3A 4HLTA 3YPIA 4C8DA 2C0HA 4L11A 5HV0A 3RHGA 1RUI3 3LMZA 5A1LA 1MS4A 4XAEA 2HWGA 5CB7A 3MS8A 1RLCL 3CO2A 3EXTA 1H6XA 2W67A 3MSRA 1XCXA 4HBNA 2QULA 2ACQA 1O4ZA 3F4CA 1WXZA 3SISA 3VBRC 3ZXAC 3PNUA 3R2GA 3DG7A 4XVEA 3JBG2 2GGEA 4BB3A 3FLUA 3OBEA 4O13A 3IUDA 1PZ2A 1LQ2A 4N02A 5D09A 3IJIA 4MOAA 4JTAA 3MIFA 1S1RA 1R64A 4S2CA 4WY0A 2PDXA 4REQB 1KJLA 1UC5A 1DZQA 1AW5A 1UX6A 4OHWA 2XGXA 5FZ3A 3AC0A 2NVAA 1YFXA 5TSWA 5DO8A 2PE4A 1V6KA 4KETA 1WZKA 3UERA 1EC8A 3C8NA 5KZMA 2PAEA 1FOD1 1UY3A 2WNVA 3NKTA 4I9MA 4D6IA 3AYSA 2ZACA 4WJXA 4AAPA 1UR9A 3O1UA 1Z9AA 4JQ1A 1DIWA 3FBYA 5FV3A 4NIAA 4DJFA 5GNYA 4QDSA 3WW4A 3HR9A 4UXAA 1F7BA 4D6FA 2W9XA 3NNGA 5JOYA 4JTFA 3I65A 1XH2A 4O12A 3FJSA 2C26A 3AMLA 3CUZA 3I68A 4HHMA 4OOZA 4BF5A 1AXZA 4AUBA 4AR2A 3ZFFC 3OGJA 1LGBA 4HCLA 1Q6LA 2OKOA 4HN4A 1IQAA 4QE5A 5DUVA 3KBJA 1VIZA 2E1WA 2E7QA 1VMFA 4GNVA 4DEFA 3RG6A 3WLTA 1ZBA2 1PHWA 4NRSA 2OMAA 1OPMA 5FUPA 5FO8B 2KM2A 3WNKA 3MWAA 4TIMA 3E12A 4A6GA 4C1LA 5JSOA 3EOSA 4CDQB 1BBT1 1OOPA 3HA1A 3CMFA 5EBAA 4BEQA 2X1IA 3CAQA 2DSUA 5BCAA 3G2GA 4IE7A 1V6TA 1B1YA 2R061 4EANA 2WBKA 3GE7A 3R58A 3MUAA 1PMJX 1R2SA 3TQ0A 3PFRA 4JIHA 2WNVB 3JXSA 2VOKA 4GQ0A 3TJXA 1BYHA 3UF9A 2BWAA 5KXCA 4RDZA 3ZLHA 1DJGA 2Z6JA 3QY8A 3Q45A 2D23A 2OVLA 3QGVA 4CTEA 3PUDA 3J7NA 1H8TC 2PBGA 3NQ6A 3IN9A 2ATMA 3MUY1 3UWWA 2OYLA 3VCNA 3ZVHB 1RINA 1LT8A 2RMU2 1WXYA 4IXXA 2G0WA 4CN1A 2O56A 4AD3A 4CN6A 1ML1A 4FF5A 1HJGA 1UF2C 2VOVA 2WHLA 1IEWA 2Y6JA 5LWBA 3EO6A 3U0HA 1Q8VA 3TW6A 2VMFA 1GBGA 3WCSA 3CAWA 5HCBA 1S2KA 1U22A 1RUI2 2V4VA 4HMCA 5F2MA 1JPDX 3V0SA 4LYQA 3B9DA 6TAAA 3SZ8A 4Q4V2 4NIHA 3TEZA 4ZHNA 3SECA 2QV4A 2DEPA 4IFKB 1F2JA 2C71A 2QCFA 2ZDSA 1XE7A 2HROA 4HNCA 1PO23 4GG9A 1U33A 3L2LA 4LNCA 2GGJA 4B5VA 4DJED 7CGTA 1D0HA 2O7SA 1RCOB 5AHIA 2DY3A 2BY1A 1GNZA 4XJ9A 3TRSB 2OW4A 2HWF1 5FQ0A 4O52A 1MVQA 3B8DA 5EMMA 3NL1A 2GOUA 4L92A 5FZBA 5K4LA 4IQJA 2P3KA 1R7OA 4PTWA 3UJ2A 1FNZA 1DQ2A 3S83A 1XNBA 1QNPA 3I2KA 2FDSA 5KSWA 1NWTA 2PWUA 4NHMA 4PLOA 2ACUA 1UOGA 4DLMA 4MZYA 4RUBA 4I3PA 5H9SA 1IG0A 1SO4A 4J25A 4G8TA 3VKDA 5FYZA 3VNMA 5FMCA 4US5A 1ZBE3 1OX6A 2H0VA 4JFVA 3PIJA 3N18A 1GYKA 3GR4A 5BWFA 3M5ZA 3WUFA 5I93A 1QXPA 3Q58A 1RBAA 3PJUA 4UW4A 1B31A 3WLKX 1C29A 2C14A 1OYBA 5FZOB 3RQ0A 4LE3A 1W1B1 2UY4A 1LODA 2D22A 3N73A 1D4M3 3N7LA 2E68A 1RD6A 3NYDA 2ISWA 2NW0A 2VVFA 3R8HA 2MANA 3W7JA 5FJHA 4XTDA 5KHKA 4HNVA 1SBDA 2DUXA 3TTEA 4GMP0 1EZ2A 1GWLA 3FOKA 4GKTA 3DZ1A 4A41A 3SUVA 4C1KA 3CZUA 3CU2A 4HPGA 4AYSA 3M9YA 2PWFA 4IT1A 1UWRA 1UY4A 3DC0A 2NLIA 3WNLA 3PZIA 3RJXA 3RZLA 1EC7A 1L8PA 4FSAA 3KF3A 3PNAA 1JZ7A 1DJQA 5DELA 4NOTA 1SGJA 1VPYA 5BNPC 4O28A 1KM2A 3GG1A 4GABA 4O1DA 5U4NA 3HB9A 3TN6A 3DGRA 3E2QA 1J6OA 1E3XA 1KB3A 2AL2B 2QUOA 1OSGA 2XXZA 1UIPA 1EAH3 1MWOA 1V51A 2BHZA 5IVCA 1ZA4A 4FX8A 2HKXA 5GLUA 5AYYA 2E53A 1EXPA 4NAEB 2VGDA 3SFWA 2YFNA 3E2RA 1RLDA 2OPWA 3L2MA 3UZXA 1QI3A 1WBHA 2BODX 4PIZA 1W37A 2PD9A 5CBJA 5LXEA 4HG6B 1W5QA 3N14A 1TNFA 3HTWA 4BY3A 3MUXA 1EV13 2PD5A 3FHAA 1FY6A 5FZEA 1RJ7A 4OE7A 5DZEA 3W59A 1NCRA 5IBXC 1N47A 2DSKA 2VELA 1QWGA 1L7RA 2D7FA 4PF1A 1MQTC 3R4SA 3A0KA 2VFHA 1UXXX 3VVGA 1K8CA 1KWGA 2DDUA 4NJHA 2BBFA 2WWSA 4H3WA 2PDMA 2PAJA 2JG9A 5AC91 3VL8A 4OJYA 3I3MA 1M7OA 3LMYA 4LV9A 2RR13 3BQ5A 4OMCA 4HN1A 1JU4A 2UY5A 5FY4A 4K7VA 4XBSA 1LJ7A 4AFCA 2QIIA 3CWHA 3G6MA 2CNCA 2PDIA 1OX4B 1BBT3 2AL1A 2O55A 3VDDC 2NUXA 3IMMA 3ZYBA 4ALDA 2ZXAA 4GGHA 2AREA 3NSNA 1HRV2 5F2LA 3KOWA 2P4EA 1LHVA 3H8XA 1OK4A 2X2GA 4FXFA 4J1OA 3AUOA 3NUKA 4Z2IA 4LHSA 5CAHA 3A0NA 3K2OA 3BSMA 1BCXA 3WNXA 4CEWB 4AQSA 2CWNA 1KM4A 1NZIA 1E6QM 3QMSA 4B1MA 3OVRA 3QC3A 1XC6A 3RU6A 3ACFA 3NO3A 5T3NA 2VY0A 4LWWA 4UXDA 4DBUA 4Q4QA 1DHPA 5A33B 5C9UA 1T8XA 3INAA 3T2TA 1B3VA 3GZUC 1RK6A 4HL0A 1OHFA 1R8LA 1WW5A 1AD1A 1PTGA 1ST8A 3DKJA 4WY0F 4C1NB 1URXA 3PZNA 3GW3A 5FPLA 4OVXA 4I7WA 2GGGA 3W1UA 2CYFA 4GD0A 1M41A 3FNDA 4NROA 3IGSA 3PUHA 3IVUA 2ZRUA 1UH4A 4MJMA 3MIBA 4R9DA 4MX3A 3DKWA 2HWC3 5MHBA 4JIIX 2VX6A 3LEKA 3I7SA 2R6QA 2VBPA 3NPXA 1A5KC 5KZDA 1UUOA 3QOPA 3M6YA 3IRDA 1XOYA 1WKFA 3VBSA 1ZQ5A 1EX5A 3AS1A 5BZAA 1MZRA 4R9XA 3AHVA 4MNLA 2V5DA 1JULA 3H24A 1WDWA 1GGOA 2PAKA 3SCWA 3DF0A 3P5BA 5B80A 5HI0A 3MUZ1 4YLWA 3HJZA 1P4CA 1NTHA 3KD4A 4CD5A 2Z29A 2HE8A 3H4WA 1DLLA 3N2CA 1UOBA 2P3YA 4RHV3 2GZXA 4GE8A 1NDYA 2B8MA 1PWMA 2XWDA 3R05A 1EV12 3KRZA 3KVAA 2DVTA 4ISRA 3KVLA 2Q3OA 1WCQA 3RYKA 5G04L 1GCYA 3FJLA 5BXXA 4OUSA 3NTYA 4K3UA 1EUAA 4Q4V1 1HZYA 2Y61A 1FDYA 4YTQA 1R5YA 3VABA 3RLVA 1BHGA 3DN7A 4LA2A 1QPRA 4XZPA 1MVYA 3OLGA 1PZ1A 3SCRA 1XHGA 1DQUA 3VM5A 3EWXA 4JHZA 1ZZ7A 4QKFA 4AD0A 1AQ0A 1W3XA 3OU8A 5G4EA 1R7AA 2VD9A 3E0WA 2YCIX 4WF7A 2YBVA 4PYSA 3W7OA 4CCCA 3M4HA 1ADSA 1KCKA 1W2AX 1XSRA 1NP0A 2OO6A 1JEZA 1ME9A 5C9XA 3WLOA 1UB3A 4XDQA 3GCWA 5CGMA 1UW8A 4GD4A 3BH4A 4QX4A 4ROPA 2BWGA 5H8UA 1KTNA 2YV8A 4CDWB 3SURA 4AHZA 3MCNA 3W7EA 3HN3A 1QY4A 4ZFMA 1GU3A 2VUYA 2YUEA 2XSXA 3I6TA 2WAGA 4QS5A 1E40A 2HNEA 1TMQA 2WMGA 3E5BA 5HNTA 5A94A 2CLEA 2QNKA 4IV1C 5K9DA 2O9TA 1RALA 2J77A 2NX9A 4HJWA 3POSA 4ASLA 3NQHA 3K5XA 2P76A 2QZ2A 3PZ9A 3CKHA 4COUA 1K5JA 2J1SA 2YROA 3W29A 2ZQ0A 1OWQA 5CC6A 4H9UA 2B46X 1LOSA 4DIAA 1J0YA 1X9PA 5A8GA 3V56A 3HG3A 1VFMA 4DO4A 2PI6A 3ZXWA 5F2IA 5IFTA 3V0AA 1ZBKA 4V2XA 2YDRA 3I2OA 4HPNA 2DIJA 1JDEA 4HCHA 2QW5A 3A9BA 1IQ8A 4NXKA 4QBXA 3OF1A 1WZLA 4LRTA 4KFPA 1N82A 4KCWA 4OI4A 1PSCA 4K68A 1VPXA 4UQCA 1JYCA 1TME1 4ISQA 3DPRA 3POEA 1AR62 4CP9B 4LC6A 2ZGRA 1ESWA 2A5HA 2VT0A 1DWFM 4KWOA 1GVYA 1B30A 1ECEA 5E89A 1C8YA 3I2JA 5AY7A 3AFKA 1G7YA 2ZMLA 4Q1RA 1TTQA 4YVVA 2GUUA 1G4TA 1UD2A 3MF9A 1IR2A 2J24A 4LTSA 4MYAA 3V0BA 2HWF3 1KM6A 3DIPA 1JXNA 4JCMA 2JICA 1A5UA 2NP0A 1UD1A 2ZX9A 4GZIA 2V2CA 3NA8A 3B9IA 2ZCGA 4D7SA 4PTVA 2PS2A 5ABJC 4WM7B 2CAUA 3ZIWA 3MSDA 1HO1A 2PB1A 1E1FA 2XIJA 2BTMA 5L9BA 1EZWA 2WQZC 4JTRA 2VCAA 4HU3A 1QI2A 4W8JA 1RVF1 5LHEA 1K3UA 3BDKA 3W25A 2NN8A 2VDHA 3OIXA 2RDUA 1LCLA 3AROA 4DIQA 3GDLA 4ZS3A 2VVSA 3WIJA 3ZFEA 3P93A 1YDYA 4Q4X1 4J3XA 5T8GA 5EV7A 3HN1A 1EV11 2OQ6A 4AQTA 1QNYA 1RJ8A 4IGMA 2JB4A 1H2LA 1SZFA 4IPPA 3K3OA 1TJ2A 1BSLA 1AR93 2PLJA 3S42A 3I6RA 4FPOB 2UWBA 2BVDA 3GTIA 1IS6A 1AMYA 4CCZA 4DO6A 4EF8A 1E5RA 1REDA 4LEFA 2W62A 4GVIA 1TPVA 1S5WA 4RN5A 4INDA 4CQAA 1Q7QA 3OBAA 3ONBA 4MB5A 5GJPA 2VENA 5GJ6A 1CXIA 4LVFA 2RDSA 3WBYA 1LBLA 4MWAB 4NY2A 3TTSA 4N6FA 1MZEA 2IFRA 3VIMA 1SDWA 1JZ2A 4UTUA 3N04A 5LATA 1LHWA 2GL5A 4E4SA 2R14A 3F4WA 4KMQA 4D6SA 4JX5A 1B9ZA 4UW5A 1EOMA 2HVMA 1KM5A 3UL2A 1LRNA 4O10A 1W0OA 1BYCA 1LU1A 1ITUA 4I6KA 1OADA 3PZQA 2V5LA 3NDYA 3HT1A 3S2MA 2YYOA 1FBAA 2A7RA 3KBSA 3QMTA 3TV8A 1QOOA 3QLQA 2VG9A 4KEVA 3POHA 3PB2A 3BE7A 1TVLA 2OS2A 4YTRA 3EYPA 1QXLA 2OYZA 2PELA 3AXDA 1RUC2 5JR7B 1JPHA 4E27A 2P1FA 4WX2A 2HWE2 4B3KA 1U5JA 5EMKA 2GZWA 4PBOA 4LBUA 1UO9A 1M53A 1QHZA 1P6WA 4EWAA 4JFSA 2OZ6A 5LK5A 2VZSA 4FO9A 1LQAA 4Y20A 3T1MA 1UD5A 3B9OA 5HDRA 4B4FA 3VHRA 2ZAAA 1H62A 4V27A 5ACA1 1M3UA 1D4M1 3ZT6A 4BCEA 5FP9A 1G4PA 4AZCB 2Y34A 3L4YA 1JH5A 1AYN3 2VXNA 2VFEA 2R8WA 3MZNA 5DANA 1RCXB 3P67A 2IXCA 3V64A 3C0SA 4IE4A 3BG3A 1IZ3A 1Q8JA 3GG8A 1JYTA 3RYPA 1KRAC 2UZ9A 2AYHA 1V8EA 1LOFA 3JB8A 1VAHA 1ZJHA 2ZS6B 2XQRA 4I9JA 1YO8A 2R32A 1OYAA 3LLFA 3BLKA 3WJZA 3MP3A 3WBAA 4EPEC 1NWUA 1PHMA 4LO6B 1RP8A 1VYPX 5REQB 2OXNA 2BPA2 2OJPA 3B7MA 2R9RA 1NOUA 2F9RA 1S1PA 3U3HA 3C8FA 4FOJA 4RW5A 4Y9OA 4ATWA 1WOBA 4IIEA 4I2OA 3ANUA 1J96A 1W5NA 5IK5A 4OCTA 3W24A 5IDIA 3WF0A 5C9ZA 1C1LA 1EPZA 1QMLA 4IL7A 3AXIA 3ZDVA 5KC6A 1ASJ2 1JGIA 1T6MA 1YUDA 1TR9A 1FOBA 1YBQA 4GIQA 4F0LA 5JZGB 1RYYA 1PO21 3W83A 3NSTA 3NYZA 4YFWA 1D7KA 2GJLA 1SBEA 3W1TA 3PPGA 2PODA 4XQDA 1D4VB 1H2NA 3W3OA 2WL1A 1RUG2 4FOQA 2XHNA 2XBO2 4Q4Y3 1I1EA 2CKSA 3FWEA 4JTDA 3E49A 2NV9A 3B3QE 1VBGA 4JEQA 1GVOA 2IXVA 4LLOA 3BYWA 2HEWF 1M01A 4YWSA 1M9HA 2OQYA 2PTXA 4GXWA 4KRUA 5AC8A 2DVXA 5IAVA 4A3ZA 3UEQA 2Z1XA 3QKZA 1H1IA 5FY7A 3IGUA 1CWYA 2HVNA 4ZOBA 4I0AA 3S5AA 3RK8A 2D6KA 1MQTB 4AVVA 2Y1HA 3VDHA 4GH1A 4KEMA 3CU7A 3Q9OA 4YZ5A 2ZE0A 1J3QA 4N7IA 1CX9A 2G9FA 3WDUA 3VL9A 2QQVA 5AC92 3TYZA 3OB8A 2O92A 3HPAA 3W07A 1SO6A 4HK8A 4V2VA 3H3ZA 3SY8A 5I77A 4IDZA 3H2MA 2PDGA 4PTXA 3Q67A 1BLZA 1B3YA 2X8RA 3AKQA 3DGTA 5JI7A 4I8YA 1LOEA 5T5JA 1IT7A 3U2OA 1W3JA 7ENLA 1AL22 1CD3G 2W92A 1EWDA 4QAWA 4BQ1A 4IOTA 2ZTNA 3W72A 5GNZA 5ECUA 1W06A 1QBAA 4AVBA 3AOFA 1GWMA 1WA4A 3O15A 3HO8A 3AL6A 3BPZA 1R86A 1Z41A 1F4HA 4BI7A 1XRUA 1LL4A 3C7OA 2IKJA 4E8GA 3BMWA 1WLTA 2RDXA 4XVDA 3THPA 3I4IA 3ITVA 2BNMA 4N7UA 2HBVA 3IWPA 3PF3A 1L7LA 4DYJA 2ZRXA 3UYIA 4JGDA 4IP7A 2X1UA 4C60A 5PTDA 4ACYA 1GVFA 2QIWA 4F0KA 5D2AA 2IS7A 1VBA3 4JKMA 3UJOA 3AQUA 4JDOA 3TAYA 1UH2A 1XJAA 1VJZA 1JYIA 2A2IA 1L8NA 4M3CE 2P3IA 5CIRA 5IVVA 1JCXA 3UWYA 1GNXA 3P8JA 2DFAA 3G77A 5JPNB 1TR1A 2DZPA 3UT0A 1I75A 3O1VA 1SG3A 1R9ZA 1AYM2 3WD5A 3PU8A 5J04A 3EDEA 4JIEA 1EGMA 4L4PA 3PL0A 5GZFA 2XFFA 1OCBA 1WMXA 5EWSA 3CTLA 3IJ6A 3KAOA 2NZLA 2IZWA 1HQNA 3JBG1 5FQ0B 3UJSA 4WKFA 1QHOA 1CN1A 5DDJ1 5FCZA 4HHHA 5FO9B 1Q6GA 1Q85A 4F2BA 3RVHA 3FSUA 6XIAA 4LTAA 5I0SA 1V70A 2OZ8A 3EQEA 5CPTA 4TR9A 1DYPA 1YYNA 5CKSA 2VW1A 1TZ7A 3AXXA 4K8HA 1S0EA 1S4CA 1YQ6A 3W22A 4UOQA 3JUUA 4X3ZA 4YLZA 2PWVA 2SFPA 4CUBA 4OV4A 1I5ZA 2YPDA 2D73A 1F3TA 4DFSA 4PSPA 4WV8A 3SLIA 3AM2A 1VLIA 3V65A 4TVUA 2OPKA 4MZUA 3NSXA 3TUUA 2YL6A 4TV5A 4O18A 4A44A 3K8KA 2OX0A 4WGHA 3TXZA 4AXKA 2DU1A 3B02A 4N43C 3IPWA 4RDWA 4JFWA 5CZTA 4D3WA 2QAFA 4QXBA 1T41A 4CDUA 3MKCA 1VYSX 3W01A 3MTWA 2R94A 2G4FA 1VJIA 1GP4A 4JX0A 2WO3A 1I45A 4U5KA 1ISVA 1DBNA 1OUXA 1XYZA 2YCLB 1LULA 4QSHA 5FJIA 1EB3A 2YDQA 4GOAA 5G1MA 5HWMA 4NKCA 4N53C 5EHDA 2BERA 1GVQA 3HPFA 3PR2A 5FMDA 3EPNA 2YB1A 4EYUA 3TW7A 1LEMA 5RUBA 4XQ4A 4DN1A 4NRQA 2GJPA 3JRKA 4YVWC 3N4EA 3ME2A 1PGW1 3H7UA 4PUJA 3N9MA 1K9TA 3VC6A 1XBVA 4N42A 1ZENA 2D2HA 3AMQA 3A3HA 4R4ZA 3M0YA 3MP5A 1H9WA 4Y9PA 4JCLA 3SHRA 2JBMA 4X6QB 1U83A 2Y6HA 5L7OC 5E1RA 3FJ6A 1AL8A 4W4ZA 1VRH2 5CGTA 4AEFA 2C4XA 3NJ3A 3V16A 2LALA 1U1JA 1IT8A 1EIBA 1IPKA 3BL3A 3DG3A 5BROA 2RS33 3EKLA 2RG4A 2GDVA 1DGLA 1CZSA 3NIYA 3S9IA 5DDJ2 3LPGA 1O8SA 4M3CB 4JTKA 4AF0A 4UTMA 3OOXA 4LVAA 1LWHA 4FALA 4QPIB 4NQ1A 3KLLA 5BV6A 1HL8A 1YIFA 2UWAA 4IV1B 4CDUC 2O1QA 1TMHA 5AC4A 4IE5A 1Q6OA 4DJEC 3GQYA 2C18A 3D4KA 4HPKB 2Y6ZA 2XKPA 3WNNA 3IMNA 1WBLA 2GN7A 5H9RA 3THCA 3A3WA 5JCTA 5LY1A 4KW2A 2Y7FA 2OA2A 4H8UA 1VE0A 4ICNA 4HVOA 1Z7AA 3NNFA 3CV7A 4JTTA 2BP1A 2WZR1 2MHFA 5FP4A 1JZ5A 1W8OA 3NGFA 2I16A 2E5BA 3KE0A 5DCDA 1T8QA 1ZBE1 4FR6A 4LBKA 2F6XA 4CVWA 3VX1A 1N8IA 5BNPA 4DWSA 4UNIA 5DABA 2RGMA 4XZMX 1YBQB 4ADSA 1TV8A 4LHNA 4A3RA 3W2LA 4PRTA 1IT0A 2EAAA 1BK0A 3HURA 3IJ9A 2GC0A 5T26A 3WW3A 4HNUA 1TA3A 4PLMA 2ILMA 3BQ6A 4HYWA 3FHIB 4YWIA 4JNYA 2PEVA 3H7JA 4U2YA 1JQXA 1XBXA 5ANNA 3WT3A 1TMF2 3LU2A 3AAMA 4CCJA 4HK9A 5LA0A 3KS6A 3AMMA 4DINB 3RM8A 1A6CA 1QUMA 1O3RA 4O14A 4XYXA 5CBLA 3NRUA 3RRDA 1NCQC 4IV3A 2WQ4A 4COYA 5J3UA 3USUB 3HV8A 5BRQA 3BC9A 4P8UA 4YVSA 3WLMA 2CXGA 3GBEA 4I09A 5AC6A 2PZNA 3I49A 2AKZA 3W75A 4R9BA 1DFQA 4OGZA 5I5RA 1SCSA 3CEUA 1XINA 3EOUA 1RMU3 1YFYA 4HP5A 1GOQA 4GWJA 2CEQA 3AK0A 4JIPA 1DYKA 1HKMA 2CY6A 4DY5A 1DCSA 1PKMA 2ALRA 4XF4A 3DKQA 4IEYA 2WYSA 3KQRA 4ZXEA 3MUIA 2HPMA 1A3KA 3UR7A 5HMSA 1KR1A 2A3XA 4ZXKA 1W8FA 3C3UA 4WZFA 1UZHA 3S46A 4TX9A 4CVUA 2WMFA 3RR1A 5DMNA 3LM7A 3T08A 1RUE1 3VDDA 4EPKA 1N1TA 4IJBA 4ONVA 4R34A 4AZ6A 3PUIA 2XH0A 4LYPA 4U31A 2ZA2A 5HQEA 3W7IA 2ZRWA 5JMCA 4O53A 3AMDA 4K20A 3GUWA 3E6EA 3IDAA 3MFAA 1NQ6A 3VDBA 3N2MA 1W3KA 1OLRA 3D0CA 3KL0A 4AVAA 3H53A 1FXQA 3MPPG 1JQVA 1CX4A 5A2CA 3ZVIA 1DGWA 4LALA 4TQTA 3GRIA 4S2FA 4JN7A 1NA1A 4Y8FA 1RUC3 1QK2A 3IBMA 5F3GA 4DAFA 4Q6JA 5FKYA 4RK8A 4DRVA 3C86A 3M0IA 4M0XA 4PI0A 1AMKA 1X6LA 5CAZA 4L1GA 2QQ6A 1SFYA 3VZXA 1C7SA 1KBKA 2WHJA 2XHYA 4ZO6A 1RUE3 1RUF1 1V3IA 1AYM1 2XZ9A 4H8NA 1ZP3A 3J9SA 1RSC