3ZM8A

Crystal structure of podospora anserina gh26-cbm35 beta-(1,4)- mannanase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
444
structure length
444
Chain Sequence
RDGPVTYEAEDAILTGTTVDTAQVGYTGRGYVTGFDEGSDKITFQISSATTKLYDLSIRYAAIYGDKRTNVVLNNGAVSEVFFPAGDSFTSVAAGQVLLNAGQNTIDIVNNWGWYLIDSITLTPSAPRPPHDINPNLNNPNADTNAKKLYSYLRSVYGNKIISGQQELHHAEWIRQQTGKTPALVAVDLMDYSPSRVERGTTSHAVEDAIAHHNAGGIVSVLWHWNAPVGLYDTEENKWWSGFYTRATDFDIAATLANPQGANYTLLIRDIDAIAVQLKRLEAAGVPVLWRPLHEAEGGWFWWGAKGPEPAKQLWDILYERLTVHHGLDNLIWVWNSILEDWYPGDDTVDILSADVYAQGNGPMSTQYNELIALGRDKKMIAAAEVGAAPLPGLLQAYQANWLWFAVWGDDFINNPSWNTVAVLNEIYNSDYVLTLDEIQGWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GH26 ENDO-BETA-1,4-MANNANASE
publication title Structural and Biochemical Analyses of Glycoside Hydrolase Families 5 and 26 Beta-(1,4)-Mannanases from Podospora Anserina Reveal Differences Upon Manno-Oligosaccharides Catalysis.
pubmed doi rcsb
source organism Podospora anserina
total genus 139
structure length 444
sequence length 444
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
A PF16990 CBM_35 Carbohydrate binding module (family 35)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3zm8A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3zm8A02
3A47A 3CZUA 1GOHA 4XZUG 1XGZA 3M46A 4HU0A 5BXSA 3ARRA 3W53A 1V6WA 3T0BA 1JYXA 1H1NA 1UWSA 5FOOA 2HISA 2DCKA 3CZJA 1UYQA 2PWEA 3TOPA 1EUTA 1VFUA 1XNTA 2FDMA 2QPSA 1WAWA 5G04L 1CLVA 2V38A 1QW9A 4H8UA 3GXDA 2WUHA 2WN3A 3PZUA 3FHQA 1GW1A 2BY0A 4GI6A 4D71A 1GOFA 5IHSA 4ZENA 2FHBA 1J9YA 4BS0A 4EKJA 3BAJA 3VILA 3WQ5A 4PN2A 4BK5A 5BRQA 1QI2A 1KR0A 4PT6A 3ARPA 4YHGA 2WCSA 2XTKA 4XB3A 3SCWA 2CETA 4IM4A 4LPCA 3IDAA 1EO5A 3M6DA 2WO1A 2YA0A 3GYCA 3C7OA 3L4ZA 2XOMA 3VX0A 5BWFA 4JFSA 2F61A 4J27A 4LQ1A 1O8SA 3W37A 3EDKA 3QR3A 2JEQA 4P7NA 1UZ4A 1AQ0A 5M5DA 1EIBA 5DO8A 4MB5A 1GOQA 2D3NA 1UD8A 2O9OA 2Y8VA 4ACZB 4PMVA 1B0IA 5ABFA 5CPSA 4XUYA 2CEQA 2ZWYA 5AYBA 1GUIA 5JBEA 2XSAA 2Y6JA 4S3KA 3BSHA 3K77A 3AYSA 3D5HA 3PTKA 4M24A 4UOQA 3ZR6A 3VIHA 4UQ9A 1W3LA 1EO7A 2J4GA 5BRPA 2EBNA 3SKJE 1FOBA 1W32A 1WDRA 1UKSA 3AFBA 1HN1A 3HPNA 2EO7A 2AAAA 1K42A 4GZIA 3WSOA 2CXGA 4CVUA 3GBDA 3JXSA 4AZCB 1SFSA 1VBRA 3CPUA 2VMDA 1E5JA 2RV9A 1CGVA 5IJRA 4NSBA 3POHA 4WIWA 5I77A 3AIBA 1OT2A 2FGLA 4M1RA 2LS6A 1ZBVA 3THDA 4OOUA 2Z1SA 3NRUA 3W38A 1O8PA 4QCFA 4NRRA 4QX3A 3CUGA 2CKRA 1WZLA 4WF7A 4CCDA 4LYQA 4PTMA 1ISZA 4XV0A 2QV4A 1J84A 3WEOA 1CX1A 3WDJA 2J75A 3WUGA 3WD4A 1JF5A 1QNPA 1QBAA 3U7BA 1CIUA 1HJQA 1UD2A 2VRJA 3U57A 2WMHA 3OLIA 2VRKA 4PQQA 1HXJA 3NDZA 1UYZA 3GH5A 4AD1A 2NT1A 5CSUA 2ZUWA 1KCKA 2ZICA 1XYFA 1UWQA 3HN3A 1UG6A 1L8NA 2Y2WA 1OF3A 2VMCA 2VVSA 2XWEA 1GU3A 3GXFA 1HJSA 2WHJA 2WZHA 1TVNA 3RM8A 1RPKA 1L7QA 5BYWA 2QQOA 1B3XA 1MXDA 5DT5A 3M07A 3II1A 1JZ2A 3AXXA 3KL3A 1ESWA 1GQJA 4GQRA 1FA2A 3K1DA 2WVUA 4LGXA 3ARUA 1VBUA 4HU8A 1EGZA 1G5AA 1XH2A 4V27A 3A22A 3TTSA 1E1EA 3HEIA 2Y64A 2QLYA 1CXEA 5CGMA 3PUIA 3F5JA 4F79A 2NW0A 1WPCA 2VQUA 2GK1A 2VZQA 3PBGA 4F8XA 2UY5A 2VO5A 4R27A 4YPJA 1KEXA 1JNEA 2GVYA 1E0XA 3G6LA 5A8MA 2WLZA 4EK7A 1HF6A 3A3HA 3AIUA 4FLQA 4OZOA 2E3ZA 4M4RA 4AZHA 4TTUA 1JDDA 4BCEA 3NQHA 4WKAA 4GINA 2WLYA 1OIFA 2XONA 2J79A 4DM1A 3ZT7A 4LKSA 2VZSA 3BH4A 3WF1A 4DXTA 1KBKA 1W1YA 1HT6A 4ML4A 1I1WA 2XFYA 2DQXA 2GJXB 1C7SA 5A2CA 4AZ5A 1QI5A 3VMOA 1E40A 2VUYA 4CU7A 1E70M 4W4ZA 2WAGA 1P8JA 1BYAA 3WUBA 1LLOA 3AIWA 3P6BA 1A47A 3OGRA 3WD2A 2ZX7A 2XWDA 1CXKA 4BA0A 3WBAA 1XPWA 1C90A 2LW8A 2VZPA 2C26A 5E70A 4QLJA 3QGVA 3NJXA 1NAEA 5EIYB 4FLOA 3L2LA 1CZ1A 5EFFA 3PZQA 3S2CA 2WMIA 5CG0A 1GOMA 2DDXA 1NM9A 5DPNA 1HIZA 2V3DA 4ZEPA 1GOOA 5JUVA 1Y7VA 4TVUA 1HJWA 4GO8A 1W1VA 1W9VA 1OBAA 4CU8A 4W7VA 3MS8A 4U31A 2EPKX 3FY1A 3VM5A 5JXGA 3PTMA 2WMGA 1U33A 2A3EA 4W7WA 3WIJA 3ACIA 3FXYA 1XSKA 3VD9A 1SMDA 3W0KA 1W3HA 1W2PA 3AC0A 2V3EA 3AIRA 4A4AA 3ZJ8A 1DWFM 2JALA 1HVQA 2ZUTA 2VT0A 1T2XA 1NOFA 2WM0A 3RILA 1JZ5A 1GPFA 1UA7A 5B4XA 1DYOA 4DXSA 4HZ8A 1EDQA 5A6LA 1OD3A 3AYRA 2WSPA 1NOUA 4UQDA 2NSXA 3ZSSA 4LX4A 4P8XA 2QPUA 5M17A 4KH2A 2CPUA 1UH4A 1ZS2A 2X10A 3G6MA 3SCVA 5CPTA 3TONA 3DECA 2ZXBA 2PBGA 3MKKA 3VNYA 1QHPA 3VGDA 2W95A 1E4IA 2G3MA 3CGTA 1WDQA 4AEFA 4CKQA 4L4OA 1C91A 3T2PA 2VTFA 3T2QA 5I6SA 5HBFA 3CKHA 3DYMA 3W5NA 2J1VA 2E4TA 3AMKA 3WL0A 4QDSA 3IJ8A 2WKLA 4MTVA 1RYYA 1CBGA 1J0HA 1J10A 1QBBA 2VRQA 5HXMA 1H6XA 4BZYA 3W6LA 3VD5A 3QOMA 4U2YA 3BXWA 4P7LA 5CZKA 2J78A 1FHLA 1B9ZA 2YB7A 2D0FA 2YIHA 3OGVA 3U37A 3MUZ1 3ZJ7A 3WDHA 1CXFA 3LPGA 4D6HA 1UY1A 5C7GA 3FL7A 3WD1A 3ARTA 1O7AA 4ATWA 2EJ1A 4PTVA 1UUQA 3AHVA 4QP0A 1QNOA 1X6NA 1K6AA 4W89A 1GVIA 2YFUA 3LE0A 2CBVA 4PMNA 1QW8A 4BF7A 3SCPA 2CBUA 2JDAA 4CU6A 1W3KA 3EDDA 3GTNA 1SHWB 4KGJA 1W9UA 1CGXA 2BY2A 4V28A 3BMVA 2O9TA 1SMAA 4E8CA 3GH4A 5LA1A 1K9DA 1QI3A 4UFLA 4CCCA 2WHKA 1J0KA 3O6AA 5FCZA 2ZX9A 2JD9A 4M82A 4H7VA 1NQ6A 2WC7A 3EMZA 1B2YA 2E9LA 3SKVA 5FIPA 2WHLA 5AYIA 2VZOA 1OT5A 3L4VA 1UY0A 5E0CA 2XSBA 2BHYA 5IHRA 4HP5A 1UQYA 2XVPA 4MAZA 4JZ5A 4R5EA 1DLCA 2ZE0A 2WAAA 3AHYA 3CZLA 4OKDA 2VR4A 8A3HA 1UH3A 3IK2A 5A8OA 3IAPA 1E4NA 2CERA 2WMJA 5CJ5A 2WZ8A 1GZJA 3CIVA 3WH6A 2DT2A 4J3WA 4MNMA 3PHAA 1F4AA 3WNPA 1E6RA 5FL1A 3A4AA 1RP8A 1QVBA 3ACFA 4V2XA 3PZGA 3WF2A 2WANA 2WVTA 3CUIA 4PEEA 3SUUA 3VIOA 1OM0A 4S3JA 2W3JA 2YBUA 4UFHA 1OCQA 4K68A 1W1TA 2YKKA 3U7VA 2C4XA 4PSPA 4XUOA 3MBWA 3C8XA 3SEEA 2G8ZA 1QNRA 2JE8A 2W94A 4HPHA 4Q22A 1CGUA 4UTFA 1M53A 5EBAA 1ULOA 3OBAA 2W1UA 2GUYA 5M3WA 1JDCA 1ODZA 3NJ3A 3BLKA 3ZQ9A 2ZUVA 2VNCA 3OGSA 3RIKA 3ZO9A 1O6IA 1CXHA 4J7RA 3LEGA 2EIBA 3BGAA 2BV9A 2WVVA 4HG6B 2XFRA 4W85A 4AZ7A 2VCBA 4OMCA 3WL1A 4JKLA 1V3MA 3VM7A 2ORZA 1VAHA 4Z2HA 3RMEA 5A8QA 3WDQA 5FL0A 3PZVA 1ZJBA 1D7FA 4GO9A 4PMZA 4RE2A 3SUTA 3VIGA 1Z32X 1VFFA 3W28A 4AY1A 3IIIA 1US2A 2QQKA 1KB3A 2YL5A 1E6NA 3B8SA 1NUKA 1QI4A 2PB1A 1JIBA 5JBDA 2VI0A 2QMJA 2O9PA 2YLAA 1UR9A 1MQRA 1UXZA 1JZ4A 4J28A 4MAVA 1UD5A 3T0DA 5BXPA 3VIPA 5E6YA 3K75B 2IXVA 4DUVA 5I3DA 3LEIA 2ZUNA 1B30A 2QQMA 1XHGA 5EFDA 5GNZA 4EAMA 4QPWA 1UR2A 1W91A 3DHPA 4TX6A 2OLHA 1UWUA 3WFZA 1IZKA 1WZKA 4UZSA 2EXOA 1CGYA 2WO2A 1CZSA 1Q4NX 1E3ZA 1CPUA 2BXYA 4Z2LA 2XJ7A 1HKKA 3N12A 1B3VA 3AIEA 3B9DA 5DF0A 1LNSA 1NWSA 3GNPA 4TVDA 2J1TA 3WNOA 3LMYA 1H3GA 4QLKA 2J1UA 4W8AA 1OD8A 1LL4A 1XRVA 3VGHA 3AS1A 3HNYM 2DCJA 3C7EA 1UR4A 4BK4A 2PI6A 3K4AA 4AD2A 2KD7A 2Y6LA 4GXPA 1U30A 1VJZA 4L4PA 3WDRA 2FHFA 1XSIA 3NCOA 3BAIA 2WBKA 4GWIA 4QX0A 3RPMA 1E1FA 1L0PA 4PF1A 1U2YA 2ZX5A 3PTQA 1B3YA 3WDIA 4AZIA 3L4UA 4P02B 3A4WA 2NT0A 2CHNA 3ARXA 2ZOXA 3ZR5A 2WMFA 2YFZA 2D20A 2JFEX 3L4YA 5FUIA 1E43A 1B3WA 1VEPA 3KL0A 3AHTA 5JXIA 4KMQA 3AICA 3DC0A 3I2JA 4HMCA 3WNLA 3WUEA 1JAKA 3RM9A 4TXWA 5A69A 2ZEZA 1JYVA 1BGGA 4MB4A 1C3FA 1V3JA 1L7RA 2X0HA 1WCGA 2CNCA 4NI3A 2FH6A 1W8NA 2O9RA 3A6OA 4W87A 5DFAA 1JZ7A 3CTTA 3EDJA 1JL8A 1IZJA 1JGIA 4ATLA 1QOXA 3VD4A 1C93A 1ZL1A 3TA9A 1R86A 1CLXA 4JFTA 2D3LA 5GQBA 4MJ2A 1WP6A 1HJXA 3OEAA 1W9XA 2UY2A 3L4WA 3WBEA 1QHOA 2E8YA 1KXHA 3RDKA 3VMPA 4BDVB 4W88A 4L0PA 4FLRA 5CGTA 3LEKA 2E31A 1OH4A 5A3HA 4KWUA 1E6PA 4X0VA 3MMDA 3WH8A 3WQ4A 1DP0A 4D0QA 1UKPA 1JG9A 4RE4A 2CCRA 2DSZA 3ARVA 2YL9A 4DWSA 2ZUMA 5D9NA 4MGQA 1R87A 3OIHA 4AEEA 3A7QA 3SCSA 3N15A 4PMUA 5ABGA 3ZIZA 5CQ1A 1J0JA 1KGYA 4URIA 1BFNA 3EB7A 2WZIA 1GMMA 1UXXX 1UZ1A 3T08A 1EA9C 3OEBA 2O92A 2VX5A 3CHFA 2FGZA 1V02E 4N0RA 4AMCA 1KFWA 2BGOA 2D22A 3VMNA 1EXPA 1LQ0A 2IUZA 1ISYA 3BAXA 1GONA 4GZJA 5GNXA 3QHOA 4H8VA 2W63A 3WD0A 1QHZA 1KXVA 1Q6DA 4OBSA 3SCNA 2BGPA 4CU9A 1JI6A 1HP5A 1GOGA 1MW0A 6A3HA 4JFWA 1R8LA 2FHCA 2D23A 3VX1A 2X09A 1WZMA 2E0PA 5D8ZA 1LWHA 4QFUA 3ARQA 4E2OA 1GCYA 1H2JA 3BAYA 4PMQA 4PMYA 2VZTA 2J1EA 3F5LA 4BJ0A 4JFUA 1LL6A 3AHXA 4F9DA 3MUY1 4FI9A 4PYSA 3P1IA 3THCA 3I2GA 4CCEA 2PWDA 1I1XA 3CBWA 2EQDA 6CGTA 2Y8KA 4D6JA 1UKTA 4KGLA 1GQKA 2WN2A 3VIJA 1JD7A 2VZRA 4UAPA 3N04A 4HOZA 4AD4A 1EHAA 4UFKA 4A3YA 1E6SM 4E4PA 5A2AA 1BG9A 4JAWA 1UD6A 4J3TA 3K8LA 4W7UA 2W9XA 1BYDA 3WH5A 2E26A 1JAEA 4ZFMA 4U5IA 4JKMA 2G4FA 3ALGA 4GWJA 2J47A 2VZ1A 3O9NA 1XCWA 3GM8A 2V5DA 1Q6EA 4DUXA 3UETA 3N11A 1OT1A 1PAMA 4UNIA 2OSWA 2VZ3A 3WNKA 4UFJA 2OYKA 3UG3A 1H4PA 3ETPA 2WMKA 4D6GA 3N18A 5ABEA 3CH9A 3QHNA 2VX4A 3A4XA 2QQJA 2WW5A 3AXHA 2X8RA 2EICA 2XM1A 2G3IA 1KCLA 2D2OA 1YHTA 2W62A 4AG4A 3B9EA 1PX8A 2DIEA 1TVGA 2ZXQA 2WPGA 1D2KA 1W8OA 3SUWA 3TTYA 2XPKA 3AI0A 3IB3A 1NKGA 2BHUA 2YJQA 1ITCA 1FHDA 2WDBA 1BF2A 3SCRA 4OJYA 1VFOA 2ZX8A 3MMWA 2CDOA 2QBXA 3A21A 4DWSD 1CDGA 4XZBA 5CPQA 1OF4A 4XURA 3WENA 3I3BA 5C70A 2BVYA 1JI2A 4W50A 1FH8A 1J0YA 3VGEA 5IYYA 4CN4A 1XV8A 3NYDA 4OMDA 3W26A 2A3BA 2VM9A 4Z2JA 2V4VA 3ACHA 4CUAA 2J1AA 3AROA 3ZOAA 4DM2A 1E6ZA 4GZ9A 1ITXA 4B9YA 3WMCA 1ZU8A 4B16A 2VZVA 4M4PA 3WKZA 2VMEA 2VC9A 3ABZA 3WEMA 3TTQA 2J7MA 1PZ2A 3T09A 2YOCA 4GPNA 1XCXA 1EOMA 3CMGA 1JYWA 1HKMA 1EDTA 2CESA 4LYRA 1TZ7A 1UWRA 4ZE4A 4W93A 1CZVA 4A6OA 1SR0A 3EBVA 3E1F1 4ET7A 2ESCA 1EQPA 5FD0A 1VJSA 2J1SA 4AZ6A 5JBFA 3FHAA 1GQIA 1TA3A 3POCA 3VGFA 3CZEA 2DGAA 2YA1A 1EQCA 3WNNA 1V02A 4CD8A 1QNSA 1MW1A 1JXJA 1TE1A 2XGBA 4M81A 5D9OA 4QCEA 2J1RA 4U33A 5ABFB 1XH1A 3BSGA 1QPKA 3VO0A 5IXEA 4PMOA 2OYMA 1JNDA 1PIFA 2VX7A 1CZTA 3U5YA 2VX6A 4A42A 2J7HA 2V3GA 1XD0A 3CHCA 1Q6GA 2ZWZA 5TD4A 2E9MA 3PZIA 3L4XA 3D3AA 3MV01 2VQTA 4MB3A 5A6BA 2CIPA 1BVZA 1J11A 1J0ZA 3L2MA 3I2HA 4QX1A 2CITA 2PWHA 3MO4A 3CQOA 2VZUA 4MNKA 1V3KA 5DQ0A 5I0DA 3I3DA 4DXRA 1E0WA 1V0LA 3UG4A 4C7DA 1DWAM 1DWJM 1Q6FA 4P7QA 4PMRA 5DT7A 1CECA 2CKSA 4AW7A 2IXUA 3N9KA 1X6LA 5J1XA 3WELA 5I5RA 2BXZA 6TAAA 3O2LA 4B15A 4UOZA 2XIBA 1D3CA 3CZGA 3I2FA 2A3CA 1RP9A 1MFUA 2W87A 4TTGA 4JCLA 4NF7A 1TG7A 2WYSA 5HOSA 5HNNA 1DTUA 1UD4A 2VURA 4WK9A 4ZZ8A 2WB5A 2ZX6A 1TCMA 2QHAA 5I78A 1UWIA 3OA5A 2W91A 1MQPA 3VD7A 2RGLA 4FF5A 4W5ZA 2XVKA 2OWXA 1PMJX 1EH9A 2W1QA 4DEVA 4UQEA 3BC9A 4HA1A 3RJXA 4C7GA 3ARYA 1PBGA 2J25A 4NRSA 4QB2A 1NP0A 4GI9A 4J3XA 1J0IA 3UR7A 1W9PA 3ARZA 4GKLA 3HOBA 3DYPA 1FP9A 1G0CA 1UOKA 1BYBA 4FLSA 2WC3A 3BCDA 4AD3A 1OB0A 4LXFA 3GXMA 3FN9A 3W5MA 2E9BA 3WQ6A 1OINA 1HP4A 4UFMA 4WSJA 1DEDA 3CUHA 1S46A 2EIDA 1HJVA 3GDBA 1CEOA 1K9TA 1UR8A 1H09A 3ZJ6A 4DUWA 4WKFA 2EPLX 3KEHA 2J7BA 2VVNA 4P8WA 3ALFA 1WKYA 1MW3A 2BBAA 7CGTA 2OWWA 5LA2A 3VDBA 3UNPA 3K8KA 4ACYA 4TOQA 2XIIA 4J3VA 4IPLA 3OB8A 1HL8A 2GK1B 1IT0A 3CHEA 4A45A 1GJUA 3N1AA 3W29A 1EUUA 1G94A 3W6MA 4HMEA 3T2OA 1M01A 1JZ3A 1R7AA 2BFGA 1WO2A 2YA2A 1Q6CA 3VIIA 4JHZA 4BQ4A 1CGTA 3WEZA 1E3XA 4ACZA 5HDRA 3WH9A 3SCUA 4AZBA 1OSEA 1V03A 1UWTA 1BHGA 5I24A 3BAWA 3PN8A 1ULPA 1W1PA 3PZOA 2DH2A 5A6BD 1KWKA 3IAQA 5A6JA 1N82A 3OZOA 2ID4A 2F8QA 2XHNA 2WBGA 2XG9A 4QDQA 4JL1A 3MU7A 3MMUA 1FP8A 4U5KA 1HKJA 2YBTA 1K9FA 3IANA 3BLPX 1D7PM 2UY4A 2VMFA 2G3JA 1HJUA 3AXIA 2J22A 2J7EA 4PSRA 4H41A 4D6DA 1GJWA 4AYSA 1VB9A 1UH2A 1MQQA 2BY3A 1FFRA 1OD0A 1KGUA 4AZCA 1NP2A 4RE3A 1CENA 2J8GA 1TMQA 2E40A 1XNAA 4TX8A 5BXRA 2MANA 1RH9A 3VD3A 2GFTA 2J7FA 1CGWA 2WMIB 3AS2A 2A3AA 4Z2KA 4UFIA 3W81A 4AISA 3PZTA 5IDIA 1BPLB 1RD6A 1VFMA 1GQLA 2VR5A 1TFVA 2J7GA 2BS9A 4B3KA 3WMBA 1O59A 1VENA 2HVMA 4PCTA 3AISA 2BZDA 2B4KA 3VIFA 3CLWA 4HTYA 4AIEA 1JXKA 2BVDA 2JF7A 4ZXLA 4W84A 1YQ2A 3DYOA 1UWWA 1UY2A 2W67A 5BCAA 1XYZA 2ZEXA 4XUQA 4UCFA 3PZMA 2OSYA 2W61A 4B3LA 3NDYA 1C8XA 2J77A 1JFHA 5FKYA 1NWRA 3NUKA 3W25A 4IPNB 1ISXA 1C8YA 2JIWA 4EE9A 2RVAA 4HMDA 4WLCA 2WO3A 1WDSA 4CD5A 5CSYA 2CBIA 4JKKA 1W9BM 2PBOA 3OLDA 3VIMA 3ECQA 1R85A 3QOKA 2C7FA 4D6FA 4MDOA 1J12A 2F2HA 1FH9A 3AHZA 4HOXA 1UR1A 1OGBA 1WE5A 2VCCA 3SCOA 4ZE5A 5C8BB 1VRXA 2DDUA 4DEQA 4KRUA 4X9YA 4BQ5A 3JUGA 1ISWA 5IFTA 3UG5A 3RO8A 4P8VA 4HOWA 1JF6A 2EPOA 2X2YA 4MJ4A 3VGGA 2CYGA 1G9HA 4HZ7A 2Y6GA 1E55A 4P08A 4Z2IA 1BQCA 1ZB5A 2PC8A 3AMGA 3QHMA 2OWCA 4AIUA 3BMWA 3UEQA 3SURA 3ZT5A 2CDPA 3LQCA 4A41A 4Y7EA 3OG2A 5A1AA 4TUFA 3I97A 4OUEA 4XVHA 1CNVA 3AIVA 3AOFA 1AVAA 4OIFA 1KQYA 4RYDA 1B3ZA 2GJXA 1W2VA 4UQCA 2BHZA 4XZWA 4ZZ5A 2HLEA 2UY3A 1NH6A 4QX2A 2GDUA 4UOJA 3GGLA 3OLGA 1PJ9A 1LWJA 1KGWA 4MO3M 1EDGA 2XVNA 2WKGA 4AAXA 4AD5A 1NWTA 2WC4A 4WKHA 3VIKA 1H49A 3I3EA 2ZUSA 4U2ZA 4AZGA 1NOWA 1M03A 1DWHM 1JU3A 4FK9A 4UQAA 2E33A 2DSKA 1WDPA 4UQBA 1V0MA 4GIAA 4ZXEA 1GVYA 1CTNA 3AS3A 1JZ6A 4B9ZA 7TAAA 1K45A 5CLTA 5AY7A 2CHOA 4TXEA 1I75A 3HU7A 4HA4A 2JF6A 3CDZB 1A3HA 1UMIA 1QI0A 3VGBA 4GZEA 4N42A 2WVSA 5JR2A 4P7RA 1UR0A 3F4VA 1C8QA 2WXDM 5D9MA 2J8FA 5KZ6A 5A95A 3UCQA 1H5VA 1V0KA 5DMYA 3AS0A 4PTXA 2WZEA 2EPMX 2YDQA 3AZTA 3WDPP 1MWOA 4P5YA 4XX6A 1HKIA 1B31A 3EMCA 2X0YA 2L9LA 4D6IA 5JXHA 1E72M 1WB0A 3MUIA 2JIEA 2XQXA 3WMSA 3AZRA 2Y6HA 3WF3A 2JKXA 2QMKA 2DT0A 3C7GA 3GNRA 5DEZA 3FNDA 4M29A 2OKXA 1OWQA 2UWFA 4PMDA 3BAKA 5CXPA 1PIGA 2QQIA 4FMVA 3RJYA 1B90A 5D8WA 1GHSA 3K8MA 1CIYA 4QB6A 2DSVA 1BSIA 1ZBCA 3VDCA 3WQVA 2TAAA 5LA0A 1PX4A 3EDFA 1KGXA 4ZXOA 2A3HA 3KE0A 3ZMRA 3K4DA 3CMJA 2WVVB 1J18A 3L4TA 3SUSA 4H04A 2D0HA 1NARA 4MOAA 1E15A 5E0FA 1PPIA 3VKKA 4LQRA 3LPPA 2BY1A 5ECUA 3NSMA 5ABHA 1UYYA 1R64A 2QQNA 4QB1A 1CXLA 2C0HA 3VOCA 1TR1A 4CN6A 3HMCA 4HZ6A 1GOWA 1R7OA 4Z2GA 4CD6A 1E6XM 1LJYA 5E9AA 3FAWA 3GXIA 4JCMA 5JMOA 4D6CA 3UERA 2VCAA 3AZSA 3B9AA 2E8ZA 3KL5A 4M56A 3KZSA 5CLWA 2D24A 3ZM8A 2WSKA 2Y4SA 1W9WA 4OBRA 1DWGM 1MFVA 4RL3A 5AC5A 4JHOA 1AMYA 2EIEA 5D4YA 1LG2A 4WJXA 2Y6KA 1PZ3A 5A94A 4Q7NA 2J74A 4W86A 4KRTA 4XUTA 1W9DM 3NIYA 3VPLA 1BG4A 1HX0A 4C7FA 3UESA 5KEZA 1F4HA 2W46A 1PEZA 1G01A 2W47A 5E6ZA 4QLLA 5JIPA 1AQHA 1OIMA 4D1IA 2E32A 1K3IA 4DWSC 1V6UA 1GNYA 1V6VA 1JU4A 5EMYA 1KQZA 3VDHA 2J7DA 4ARYA 1C92A 1UQZA 3WFLA 4AIOA 1SDDB 1W0NA 1W3JA 2DSUA 4H2CA 3ZJKA 3RCNA 1UZ0A 2V72A 3WH7A 4AXNA 3WQ8A 4JFVA 1CYGA 2W92A 4AWEA 2QF8A 3CZKA 2GDVA 1HVXA 3M7SA 1GUVA 3HJEA 2YG0A 5HPCA 1V3LA 1GORA 3MSGA 4HA3A 1MPXA 1UKOA 2Z1KA 1P6WA 4D8MA 5B4NA 4MGSA 4CUCA 3SCTA 2ZXAA 3SUVA 1FH7A 2PQSA 3GNOA 4PRWA 5F7UA 4ZY9A 5LCWL 1GNXA 4X0NA 5A8NA 2W4XA 4YHEA 4M8UA 5AC4A 4U3AA 1UD3A 5EJZB 2DH3A 3W4RA 4PTWA 4CN1A 4BQ3A 2B9VA 5IFPA 1OGGA 2DEPA 2ZEYA 3MV11 1JYNA 3ACGA 1E71M 2PWFA 9CGTA 4P00B 4TVCA 5EJ1B 4H8HA 5E09A 1V6YA 3AJ7A 2WQ8A 3GH7A 5A6SA 3APGA 3OZPA 2RGMA 3F5KA 1SYTA 2XYLA 3K46A 2X05A 1KR1A 2R7EB 2Z4FA 1E6QM 2YLLA 3VUPA 5I23A 2GJPA 3RM4A 2YDRA 3AMDA 3TTOA 1SG3A 2AMGA 1US3A 1JHJA 4KI5M 1DWIM 4GI8A 4P8UA 1UX7A 3GXUA 3KWXA 1PX3A 3MUAA 1BTCA 5A6AA 8CGTA 1IQDC 1GHRA 1H41A 4D1JA 3GZAA 2G3NA 3LPOA 5LYRA 4DWSB 4A44A 1E5NA 3WD3A 4NZCA 2C8NA 1WZAA 2EEXA 4J3SA 1JZ8A 4CD4A 3A23A 5A6MA 3NJVA 1EHNA 1MVYA 1IV8A 4W8JA 2XVGA 2C9KA 2FH8A 2XFFA 2YC4A 2BVTA 4RN5A 3WSUA 2OYLA 1G1YA 2ZUUA 4OYUA 4QAWA 4PMXA 4OOZA 4W5UA 4UR9A 4P7OA 2DIJA 3CHDA 1H6YA 2ZEWA 4W8BA 2VJXA 4YN5A 5BROA 3UR8A 1HNYA 4D72A 3C7FA 2WWCA 1V3IA 3EMQA 3SCQA 3CZ8A 2YDSA 1E73M 2ZXDA 1JI1A 5DN2A 3ARSA 3WF0A 4W8LA 3CIHA 3LPFA 1E4LA 1MXGA 1H11A 4AD0A 4D6EA 1KWGA 1UY4A 2DSWA 2J62A 5I79A 3N13A 4EANA 3EDEA 1VIWA 5JXJA 1UMHA 2ORXA 5G05L 3I2KA 2Q8XA 4A3ZA 2J7CA 4CGTA 5D9PA 3FW6A 1V3HA 3GBEA 2BERA 2ZIDA 4F9JA 4GQQA 3EYPA 1KXTA 3HNMA 2V3FA 2WHMA 1BLIA 2WAOA 2RJ2A 4WSKA 4UZUA 1W9TA 1UA3A 2OSXA 4HPGA 2PF0A 2PWGA 1UHVA 3NSXA 1PMHX 2DPEA 1ZBKA 1XC6A 3FAXA 4PCSA 4LYPA 2Y24A 3C7HA 4MB1A 1MYRA 3CUFA 4AC1X 4PUDA 1E9LA 1ECEA 1XH0A 1C7TA 2G41A 4U3CA 3K4ZA 4CVWA 3WF4A 5HPOA 1H0GA 1GQPA 2X1IA 4MPKA 3VTRA 4XUNA 4CUBA 5M03A 4J3UA 4A3HA 3WY1A 2XM2A 1ZBWA 4MADA 4MDPA 3IJ7A 3ZT6A 1UKQA 1UYXA 2D1ZA 3IJ9A 1TUXA 2WK2A 3VNZA 4PBGA 1M04A 2WNWA 1W99A 4XUPA 4MNJA 3U5UA 4F66A 1VEMA 1K9EA 2XVLA 1I5PA 2W1SA 1V0NA 1NX9A 3VDAA 4M80A 1ISVA 2HYXA 1UY3A 2GJRA 3ZSTA 1JDAA 2AOSA 1HL9A 1X1NA 3HNBM 5CYYA 2BNJA 4Z2AA 5A8PA 4JX0A 3F2ZA 1LL7A 2XHYA 4QDMA 1QNQA 1BVNP 5BXTA 3BN6A 2D0GA 3PZ9A 2JEPA 2W1WA 2WWDA 3WQWA 2VOTA 3AIQA 1JD9A 3SIMA 5A2BA 1LG1A 4JIEA 2QQLA 4MNLA 1J01A 5EB8A 1BYCA 5A6KA 3W24A 5GNYA 2W66A 4BQ2A 3W82A 4E8DA 2XGIA 3NSNA 1TA3B 2WABA 2WCGA 3HJRA 3AMCA 2YL8A 3WUFA 2V5CA 3N17A 1B1YA 1VEOA 1DHKA 1JFXA 1LF1A 1ZJAA 3BCFA 1KBBA 2WCAA 1WCQA 2B31A 4QDRA 1KXQA 3NNGA 4BXSV 2EPNA 1GOKA 4IISA 1XD1A 2W5FA 1E0VA 5I2UA 4ARXA 1TVPA 1VF8A 4IUGA 1XSJA 2CBJA 3AMLA 3T0AA 1AQMA 4LPLA 1V6XA 3J7HA 3VINA 3S6TA 3CO4A 2VL4A 1E56A 3W27A 3AQUA 4JL2A 3TP4A 1WNOA 1CXIA 1BGAA 3ARWA 3VVGA 3MSDA 3WN6A 1FFQA 3PZNA 2Y5EA 2YC2A 1MW2A 4PUEA 2YL6A 1K12A 3PUHA 1M7XA 5GPRA 2DT1A 3I2IA 1NWUA 3OLEA 1W9SA 4LHSA 3VU2A 3SEPA 1E4MM 1H0IA 1GOIA 4ATDA 1EOKA 2DT3A 7A3HA 1ODUA 1CWYA 5C71A 1BAGA 2GSJA 3WQBA 3MANA 1V08A 3DHUA 1OGSA 2XUCA 3WNMA 3CUJA 5JIWA 1J83A 4UI9L 4CD7A
chains in the Genus database with same CATH superfamily
4B4RA 4HNLA 5EGRA 1CD3G 1YDOA 1KDMA 3A47A 4O1CA 1GOHA 1XGZA 5LXEA 2XPJA 4DZAA 5BXSA 5LHEA 3IK4A 1JYXA 1S3HA 2K2SA 2ZABA 2CGNA 3WP4A 4JC1A 1EUTA 1VFUA 1XNTA 2P76A 3R2GA 1JRBA 5AZ1A 1KBIA 1QW9A 2Z00A 8RUCA 3UGFA 4GVGA 2XR4A 3PZUA 2WN3A 3RFRA 3QKEA 4GI6A 1L3JA 4ZMGA 5D8AB 1LBLA 5IHSA 2H90A 4DI9A 4FAMA 4IV1B 4XBLA 4L6HA 1ADDA 4HA0A 2P4EA 4BS0A 3N9PA 3Q67A 1UYPA 3VILA 4RW5A 1H4HA 4FOKA 1G9CA 4LKFA 3PNAA 1KR0A 4YHGA 5LNUA 5EZWA 4XB3A 3PVFA 3H50A 2BFUL 1WBJA 2PLJA 4Z42C 4HN4A 4LUSB 4FZIA 4I02A 3OO2A 2KAUC 4LAOA 3C7OA 3L4ZA 4BEUA 1ENXA 4DWDA 1JXNA 3BTAA 4NNBA 4C6NA 4M7TA 3B04A 5HK4A 1UZ4A 3S5NA 5M5DA 4E4UA 1OC5A 3D0SA 1TR9A 3PG8A 4CDWB 4B4FA 1UD8A 1GT8A 2O9OA 2Y8VA 4ACZB 3AFKA 4MKSA 4PMVA 1B0IA 1TTQA 1HRI3 3PFMA 4IMAA 2D93A 5BPXA 1HXS2 5FP4A 4GFIA 4PFMA 1GUIA 4LEQA 1FV2A 4S3KA 3AVSA 3K77A 5FWEA 4QKFA 5KZEA 3IVUA 3AYSA 3ZR6A 3VIHA 2DUPA 3BALA 1X50A 3K48A 2WZR1 1WLWA 5FK8A 2FMYA 3HIJA 2DZTA 3GB6A 1W32A 1WDRA 1UKSA 1V4YA 1DJIA 3ZN4A 2NN8A 3R43A 4C5ZA 4IE6A 1K42A 4GZIA 3WSOA 1EJTC 1VRBA 3NVTA 3WJXA 2L5HA 2XFWA 5GLTA 5IBXA 4FSJA 1ZZ6A 4JICA 1SFSA 2YBPA 2QYGA 3MKCA 3W9AA 2A2IA 4FOJA 3VBHC 3H2EA 3KOZA 4ADTA 4F2TA 2ZBTA 1LHOA 1PKYA 2YDEA 4YW2A 4B7KA 1UOFA 1W6QA 4AQSA 1OT2A 1Q7ZA 2A6XA 3THDA 4OOUA 3S9IA 4TLGA 1W3NA 4QX3A 4C6CA 1UZYA 3R05A 1DQ0A 3CC1A 4LYQA 4XF3A 2VQAA 2QV4A 3WEOA 1MQTA 5KBFA 1R5YA 5FJJA 2GALA 3FA5A 3G8RA 5CC3A 1RA0A 1QBAA 2B4GA 3S2MA 2DU1A 3U7BA 4AX6A 1HJQA 2VRJA 3U57A 1Q6LA 2WMHA 5LHFA 5CSUA 1UYZA 3GH5A 1RCQA 1KCKA 3CT2A 4Q3MA 4UUIA 4WM7C 3IUDA 5CPOA 1CI1A 1FV3A 3EXRA 4JX4A 5D2AA 3NQAA 4QDWA 4YFZA 4XAAA 3WQDA 1UG6A 3R89A 4XO6A 3CNAA 1RXFA 2YROA 5FEPA 4GI4A 3H7VA 5BNPB 3TJLA 4FPFA 1GU3A 1ZBA2 2P3IA 2XWEA 2WFF2 2YGYA 3V0TA 3CMFA 2Z2SB 2FB2A 3GXFA 4E38A 1DJGA 3QQ0A 1PVNA 3STCA 1SW3A 3GVGA 1A8MA 2QKDA 4YS1A 3M1ZA 3FS2A 2QQOA 1B3XA 5FAGA 1H50A 1SQ4A 5BMXA 4XK2A 4M3CA 3II1A 3LI1A 4HNVA 2RS52 4RR3B 4HKOA 4I0WB 1RINA 3NNTA 1ESWA 3GX9A 1GQJA 1M65A 2UY9A 1FA2A 3LCLA 4AWTA 4HU8A 1HGYA 3E0WA 1OADA 5AHIA 3A22A 4NKCA 1BXNA 4JRLA 1KV5A 3HEIA 2QLYA 2VP8A 4EN8B 4KWOA 2PHLA 1VAMA 1D2SA 3PUIA 3F5JA 2VFIA 4KH9A 2GK1A 3MPGA 1K77A 3PBGA 3FHIB 4RLIA 3AXEA 4R27A 1E0XA 3G6LA 1WDWA 4IGOA 2ZGQA 2HROA 3DUGA 4EK7A 4GH4C 2Z42A 3AIUA 2A3WA 1R3RA 3C2UA 4BCEA 1OIFA 3HPXA 4UMBA 2XONA 2J79A 4WBBA 3ZT7A 1S2BA 4O10A 3EXUA 1OC6A 4ES8A 4OT7A 3BH4A 2R8WA 4RQPC 3W1TA 4MSSA 3NGFA 3WF1A 2AAMA 4B5UA 4ML4A 4AXOA 1I1WA 3RYRA 2XFYA 5C7HA 1VRH1 2JENA 3HQ1A 1GANA 4IJBA 4GLEA 1M4WA 4WGXA 5A3MA 2WZR3 3STPA 1QI5A 4FPHA 1CAVB 3VOFA 2VUYA 1NY72 2C6SA 3QZEA 3MMTA 1W6PB 3WUBA 3IIPA 1NA1C 3BOPA 3OGRA 3WBAA 2D6MA 4LNVA 4ZS2A 2QTWB 1C90A 1RUJ2 2VZPA 2HMCA 1RUF2 4HVXA 4XFBA 4QLJA 1COV2 3OIXA 5F1UA 3VNMA 1IEIA 5EIYB 3NXFA 4FLOA 2XUMA 3M5ZA 3B4UA 1YRRA 2RJLA 3EB4A 1P1XA 2R1KA 1VBB2 3OOXA 4KPLA 1SZFA 2DDXA 4DF0A 2UYAA 4RFT0 5AYYA 3KS5A 4DEFA 4XJZA 1US0A 4EZHA 4W7VA 4R3UA 3VBUC 2BOFX 2E51A 5JXGA 3H1YA 3BVCA 4IXLA 3X29B 3AFGA 1H2MA 1PK6B 3WIJA 3FXYA 1SMDA 3KCLA 4AX7A 4PA8A 4FFGA 1PCKA 1QKQA 5K0UA 3P2VA 2V3EA 2QPXA 3EPNA 3SQLA 1ZQ5A 4K1ZA 4Z17A 2XSXA 2JALA 4NNAA 1HVQA 4EZ4A 2VT0A 5D38A 2K46A 2Q5TA 2WM0A 3RILA 4CEWA 3P3BA 1GPFA 4DS0A 3EJKA 1RY0A 4X22A 2OPKA 3J7LA 3WW1A 2NSXA 3KV4A 3BYWA 1I8JA 1YDVA 3IDCB 3MSYA 3L67A 2PTZA 2QPUA 4UW5A 3WHUA 3S46A 3TONA 4LVGA 5J37A 1WDDA 1BKSA 1WDQA 3RLHA 2PGFA 3VBFC 4L4OA 1EP2A 3RG6A 3H8OA 2Z1WA 1JUIA 3T2PA 2VTFA 4K8FA 4DIAA 4RS5B 3DEMA 4KCTA 5CG9A 4PFHA 3J9SA 4XEZA 1MS3A 4GUFA 3MIGA 2ADDA 3WZ0E 5HULA 5LNRA 1J0HA 4DNMA 4XIMA 3OW1A 3TNPB 4UTKA 1PHMA 5CPLA 3BXWA 1XG3A 2Y60A 4P7LA 3EXTA 4AE2A 3WP5A 1ZYBA 2YB7A 1B9ZA 4WX2A 2YIHA 4ZS3A 4NR1A 4A3UA 3ZJ7A 5FYCA 3NZ1A 4QE4A 3CJPA 3NZQA 2A4AA 2OLAA 3TLQA 1IXNA 1VRH3 3SN4A 3JBG1 4AGRA 1D8CA 3AHVA 3EWBX 4QP0A 2BWAA 3SISA 1K6AA 4W89A 5HMSA 2CU0A 2YFUA 3B0PA 3WQFA 4PMNA 4MUZA 1W90A 1XP3A 4Q7IA 2AEZA 4J25A 1W3KA 4JDMA 5D02A 3S5QA 1NFPA 3M1HA 3GJBA 3GTNA 4IFKB 3DPRC 1JQVA 1RBAA 5C9ZA 7TIMA 4JTCA 4YFWA 5HMDA 1LECA 4EN9B 3HM7A 4RK8A 4B3NA 4R52A 3J26N 2Y26A 2BG5A 3GXPA 2WNVC 4E8CA 5LA1A 1K9DA 4ZL1A 2DZVA 1LRQA 3O0KA 1IQ8A 1G9DA 2CY6A 5FCZA 2JD9A 4QSFA 3EMZA 4KRZA 1OFAA 4IMFA 2E9LA 4NY2A 2WSUA 4XKYA 2JX9A 3QH6A 1TJRA 2YXXA 1UY0A 3H22A 2OEMA 4HP5A 4MAZA 3THTA 2DW7A 4AVSA 4R5EA 4K1GA 4S3BA 3UD6A 1KFLA 3SITA 3CZLA 8A3HA 5A8OA 3O06A 3NURA 2Y8UA 5A8GA 2WMJA 4L1XA 1GZJA 4K7JA 4G2DA 3ZZ1A 2D40A 1W8SA 3PHAA 2AR6A 4HPKB 5CC7A 4FTEA 1IWAA 4B5TA 5FL1A 4WVMA 4N4PA 5A3NA 1M7OA 4QNEA 1WKDA 4V2XA 3BW4A 3PZGA 5KZDA 9RUBA 3PUAA 4GIRA 2CTVA 3SUUA 3VIOA 4L4LA 1H2LA 3BTZA 3VE9A 3WBWA 3S1GA 5FDBA 3U7VA 2YKKA 1LCOA 3K4WA 5G2WA 4ATFA 3P61A 3SEEA 2JE8A 1TO3A 4Q22A 2XIOA 2CFFA 3UF9A 2P5BA 1VR6A 5J48A 1MEHA 2JG9C 4K6BA 3MF6A 3G77A 1P0BA 4LCSA 5M3WA 4Z2WA 2C91A 5A7QA 1AYN3 1MS9A 2ZDSA 1AR62 3F4WA 4AHYA 2F6BA 3DN5A 2JB8A 3VFLA 2VC5A 1ZRQA 4JKLA 3WL1A 4RHV2 4A22A 1RVF1 1X8EA 1XU2A 5LATA 5FL0A 1ZJBA 3LOIA 2E6YA 1VFFA 3W28A 2Z79A 3IPWA 4Y96A 1PS9A 2YL5A 1OC7A 1PMIA 1HIXA 3WLSA 1QI4A 2BLEA 3WLHA 1JIBA 1I3HA 2VI0A 2O9PA 2YLAA 4BF9A 1JUHA 3V1HA 3LTSA 2QJVA 5LRRA 4MAVA 2WJZA 3WLLA 1UCXA 1YADA 1HRV2 4PUNA 3W2NA 5BXPA 3JBG3 1AA1B 2GNDA 1QNVA 3LCFA 4K2SA 2IXVA 3GVRA 1JBCA 3LEIA 1B30A 1W6NA 2E1DA 2PEVA 3VZXA 1EXBA 1XHGA 5GNZA 1ZA7A 3V0AB 4TR9A 3KOXA 3WFZA 2IFRA 1UWUA 2IWGB 1IZKA 4UZSA 1TV4A 4LW7A 2P0OA 3SIZA 2QNKA 1JPHA 1Q4NX 2NQHA 2OPWA 2OR2A 3N12A 3TIMA 2ZOEB 3WCSA 4OGZA 3AIEA 3B9DA 2R49A 1QJX1 5DF0A 3LHWA 4N43C 2IKJA 1LNSA 3GNPA 4YW4A 3VOIA 3WK3A 1ENQA 1QK2A 1PM7A 2J1TA 1H3GA 2OQHA 4QROA 4QLKA 3CPRA 2R30A 1V9U1 1A5BA 2PDIA 4Q4W2 3TZNA 3UNTA 3HNYM 4WM8B 2NVCA 3C7EA 2GLKA 1W54A 4I9AA 1E0TA 2RH9A 4BK4A 2PI6A 5T55A 3O1RA 4L4PA 2PP1A 3VBRB 3BAIA 5JOWA 4GWIA 2ARBA 3RPMA 4PF1A 4GNVA 1B3YA 2ZA9A 3N34A 3HBLA 4AZIA 1PWLA 4YVWC 2ISFA 4YZ2A 2VUDA 3A4WA 1QHDA 4FPJA 4IEVA 5GJNA 3VC5A 2OT0A 3ARXA 2OXBA 1QDOA 1TQXA 1TWWA 2D97A 1RY8A 2YFZA 3TNOA 2D20A 5FUIA 3D5OA 2WJDA 5JXIA 1VB2A 5I8YA 3LM3A 4CP9A 3I4KA 4HMCA 3TN92 2PC4A 3RM9A 3ZFGA 3WLNA 3AJZA 4MB4A 4IL2A 4NJIA 2X0HA 3T8QA 5K4LA 3TYDA 4CCJA 1JCLA 5A3PA 5DFAA 3ZXEA 1JZ7A 1ME8A 3CTTA 2VOKA 1MACA 2OX0A 1ZL1A 2ZZ2A 3HB9A 3GHUA 3VNJA 1BRLA 3COTA 4L99A 3D0JA 3OEAA 1FQ0A 3NWKA 4BLIA 1W9XA 1QHOA 2UY2A 4O16A 1KRCC 4IP7A 4WOQA 3VMPA 3PVNA 1X9TA 4W88A 5DBTA 4Z1DA 4CCMA 2VGIA 2AYHA 2E31A 1LUCA 4X0VA 1RBOB 2I9UA 2VULA 4QHRA 1XFCA 2Y0OA 3LLXA 4MHBA 4NUWA 1RVF3 4CCZA 4HSHA 1GZWB 2I5IA 2NXHA 3WQ4A 1UKPA 2GGJA 2HEVF 4R7OA 4RE4A 4S3CA 3ARVA 2YL9A 1VYSX 4I30A 1OHLA 5C9AC 2C3ZA 4QXHA 1U0AA 3SCSA 3VKNA 4K20A 3CUZA 3V65A 4CDXA 2F17A 1S1RA 4WRHA 3KM8A 2A6LA 4JD4A 3ZIZA 4UTIA 5CQ1A 1KGYA 1XQNA 4O0ZA 5FZOA 3EB7A 2WZIA 1MS1A 1UXXX 1Q8PA 1UZ1A 2CLKA 3BSMA 4LBRA 2VFGA 3PBUA 3ICJA 1NDWA 2WNUB 4YYOA 3Q8FA 4OI0A 4LV4A 4K1WA 4DJDD 1VJIA 3MLLA 2FFIA 4HQVA 1H5YA 1DU3D 4ZQMA 1SZNA 4LAKA 5A32B 2A75A 3BAXA 2BX7A 4GZJA 1B35C 2Z7KA 1SBDA 1HP5A 2C9AA 3ZYFA 1WBFA 1MW0A 4EPDC 3H42B 1R8LA 2D23A 3VX1A 3UA4A 3ITGA 1RUH1 3BJTA 4I8DA 1WZMA 2GN3A 4QTGA 3LM7A 3ARQA 5FZ6A 2GGHA 4AHPA 1QJZA 4PMQA 2P3KA 3KTXA 3VLBB 4C6EA 4YNIA 4E2VA 1YTKA 2YW3A 5HXVA 3N7JA 5F2MA 1S2UA 3KOWA 3R6SA 4BJ0A 3W7IA 3AHXA 1N47A 1UQXA 4ATEA 3MUY1 2OB3A 5FWJA 2X8KA 3PJUA 6CGTA 1GWJA 4O61A 1UKTA 2WN2A 5KHJA 1JD7A 4UAPA 4CCOA 3N04A 4HOZA 1EHAA 2R0HA 3C8FA 4E4PA 1S2TA 4JX5A 1BG9A 1UD6A 3RZZA 3OGJA 4I3PA 3R7MA 5AFBA 2DY3A 1EV12 2W9XA 4YCPA 1BYDA 4XETA 3QQ1A 1IHMA 4R8HA 5IVJA 4U5IA 4AEDC 3R4DB 2G4FA 4GWJA 3O5SA 1XYNA 1XCWA 2OZ0A 4DUXA 3UETA 2H9AB 3VCNA 3M0VA 1VFHA 4UNIA 3H0OA 2OSWA 3U4FA 2VZ3A 4UFJA 3HQRA 3WNKA 1H4PA 5LGZA 1FWWA 1VKFA 2K0GA 2I5QA 4UTWC 3EA2A 3J7MA 3UZ5A 2X53S 3MGUA 1XBYA 2XM1A 5H8PA 1KCLA 2D2OA 3CS2A 3N7LA 4HXCA 4D8ZA 4GG9A 1YHTA 2VTXJ 1O5KA 4Z8BA 2C1IA 3J8F2 1WW4A 1E1CA 5BNQA 1EBHA 5CBIA 1DIDA 1CAXA 2XPKA 3T1LA 1P0DA 2VGFA 2BHUA 1ITCA 4Q8VA 3LTYA 2OIIA 1W3TA 2IMRA 3SCRA 2B81A 2ZX8A 3MMWA 4S3GA 3VCCA 3S47A 1CDGA 2PD9A 1IT7A 2PZNA 4Y9OA 2Z69A 5FY5A 2OODA 5LIKX 3WT3A 1F5ZA 4XF4A 1NFGA 2J9XA 1XV8A 4OMDA 2A3BA 2A6YA 2VM9A 4AZZA 1VP5A 3ACHA 3ZYGA 3TOYA 2C0AA 1ITXA 3BWWA 5F3IA 3WMCA 4CDUB 1ZU8A 2VZVA 3TK7A 1FX6A 4GABA 3L0GA 1LU2A 2JDPA 2HEYF 2J7MA 3T09A 1R6WA 4O9EA 2WSVA 3GJAA 1XCXA 3BANA 2C16A 4JGYC 5HBAA 1ZREA 3QPZA 3VBOA 1UWRA 2NQYA 1QQP1 1XUUA 2OEKA 4W93A 1CZVA 1OKOA 2PMWB 4XABA 5FOJB 1FWIC 1SR0A 5HWJA 3AZYA 5ERLA 4ET7A 2ZGTA 4CNPA 4L9YA 4AZ6A 1RUH3 1DGWX 4OUIA 3CZEA 1K7XA 2DGAA 3ZO0B 2YR1A 3W7RA 1V02A 1QNSA 5M1TA 5D9OA 4QCEA 1W6MA 4U33A 1SCRA 1LHNA 1EJ7L 1GYKA 4H7ZA 5ANQA 1TPVA 4WZHA 4QEHA 1QPKA 3DKQA 2OYMA 3QOPA 3UXDA 2CLMA 3NNFA 4KFNA 2VX7A 2VX6A 5JSOA 3WQ0A 5FKCA 2A3XA 2G50A 3T81A 3PZIA 3L4XA 3D3AA 2Z28A 4MB3A 5A6BA 5FY9A 1ZCOA 2CIPA 1BVZA 1V6OA 1RR2A 4QX1A 4LC6A 1UKGA 7REQA 2PWHA 1RL3A 5C8CB 1A5CA 2VZUA 1ZFJA 4MNKA 3VB9A 1DIOA 1D4VB 5DQ0A 1F07A 5I0DA 1E0WA 5KZMA 1C5IA 1Q6FA 4N9CA 5DT7A 3LV5A 3STFA 2VKZG 3VGIA 3HGRA 2IXCA 5BY5A 2PDHA 5J1XA 1DORA 4GUIA 1NSJA 2W87A 2GMPA 4DJFA 1LENA 4POCA 1OD5A 3TJIA 1BXBA 4WHBA 2R1NA 2NZLA 2P6HA 2IKIA 3FXGA 1JCMP 4EACA 3OZMA 5B80A 4Y22B 1PVXA 1A6CA 4ZOEA 2QVNA 3HG4A 3IKWA 5AHFA 1ZAHA 5E9XA 1W5OA 3L12A 3OPSA 1TME3 3BLLA 4PTDA 1HXS1 1Z7S3 2OZ6A 2FLIA 4DEVA 3E2SA 4HA1A 4GUHA 5CFDB 3APTA 1ZRCA 4C7GA 3ARYA 2J25A 4NRSA 3AKRA 3W1AA 2X0SA 3CL1A 4GI9A 4J3XA 1SDWA 3UR7A 2EKGA 3ARZA 1YEWA 3DYPA 3MWAA 5F32A 1UOKA 3ILNA 3ZWSA 4FLSA 3S83A 3BCDA 1Q4WA 3GXMA 5H2ZA 3W5MA 1OINA 3FJSA 3I7RA 2VEMA 4WSJA 2FCTA 4YW5A 5D8AA 4MGZE 1OA4A 4IV1A 1K9TA 1BQGA 4FP1A 4O65A 4YXGA 1SLLA 3HA1A 1AL0G 4P9WA 3YPIA 5CCZA 1NDYA 3ZJ6A 1UBPC 4H14A 4IDZA 4DUWA 4V1PA 4WKFA 4Q27A 1M1BA 3TEXA 1S38A 1S3TC 2ZRXA 3HTWA 2F4LA 3WINE 4KG8A 4Q4OA 1XIEA 2BBAA 4LUSA 2FDJA 2R16A 1TYGA 3K8KA 3UNPA 1XLJA 4ASKA 4ISRA 3CHEA 4OI2A 1RCXB 3O15A 5FAJA 1F8IA 1WUVA 1JZ3A 3QZ6A 1R7AA 4JIIX 3H7UA 2YA2A 1V5XA 1J6OA 3VIIA 3B06A 4FPLA 4BQ4A 1M68A 4GIEA 4KWKA 7ENLA 1DQ5A 4CDWA 4ACZA 2IXJA 3WH9A 3SCUA 4AZBA 1SCSA 1V03A 1G4SA 2CLOA 1OVDA 1ZSXA 2PMQA 3SRHA 4US5A 2LALA 5JVLA 1ZBA1 5I24A 5I0TA 2WFF1 2PRLA 1J58A 3BAWA 3PN8A 4KWWA 3BOXA 2DH2A 3PZOA 3UY8A 2F6KA 4Y20B 1KWKA 3TLLA 5A6JA 2RDTA 1OF6A 4LF1A 2XHNA 3M3IA 4YVPA 2EF9A 2XG9A 3FDGA 4XSMA 5IDZA 4QDQA 4ZHNA 3Q37A 4H3DA 4AWUA 1VCGA 2RS51 2Y61A 3C0QA 1PIV3 1K9FA 1MEIA 4EPBC 3BQ6A 4LVDA 2VOXA 3AXIA 1AX2A 4H41A 1EYBA 4AYSA 4FIRA 2YB4A 1MQQA 1FFRA 1OD0A 1S2EA 1KJLA 3ZXGA 1NP2A 2VH9A 4GWEA 1XYPA 4ZB0A 2J8GA 2ABAA 1G7VA 3E9AA 4Q0UA 4JQTA 4TX8A 5BXRA 2XJSA 1CJDA 4C6BA 2MANA 4M5PA 1VBA2 1BK0A 2I45A 4R9CA 1CGWA 2J7FA 4LKDA 3GCXA 3E0VA 4NPMA 3CAVA 2A3AA 4RX0A 4LBKA 1QJEA 3WZ1A 4Y1YA 2AH2A 5IDIA 4NPRA 1N3OA 1BPLB 1W2TA 1YI9A 3TCEA 3CK5A 2WIIB 4DJEC 1NQDA 4L11A 3RJ2X 1AR83 2I7GA 3FYOA 4IEXA 4WV8A 2BS9A 1VENA 3SQMA 2WT2A 4PULA 4RNHA 4C1NB 3W01A 5I3FA 1W06A 4KWJA 3CLWA 4CDQB 2HE8A 1R9YA 2OZJA 1RQBA 3DYOA 2B7YA 2A5HA 1UWWA 5BNPA 2W67A 1J3PA 4LS2A 1LCLA 4MG2A 4LK7A 4YZ5A 1PVC3 2W61A 5FXXA 1NY71 1C8XA 2J77A 3IIOA 1ISXA 5C8WA 1C8YA 1YYNA 4I90A 3DCQA 4N2YA 4G4FA 4RR3A 4WLCA 4QJ3B 1W6TA 4KCWA 1GVEA 2QZ2A 1Q66A 4JKKA 1C57A 1RUJ1 5EXOA 3VBSB 1GNZA 1RUF1 3RGTA 4D6FA 1COV1 2ALRA 6XIAA 3WLOA 1UR1A 1XDJA 1WE5A 2FZMA 4DZ5A 4HYWA 1MEC2 2DDUA 4DEQA 1ZTVA 4BQ5A 1VBB1 3KTCA 2HSAA 3UG5A 1R2SA 4YIWA 1RUI2 4H55A 3QJAA 5B2GB 1XLFA 1TWSA 4GNJA 2R073 3QTGA 2XL7A 4W6WA 3W7MA 1G9HA 4P08A 5IAXA 5BNNC 5C2XA 5C3PA 4NO4A 5EMKA 5JH2A 2XJQA 4QPIC 3AMGA 5T5JA 3HAGA 2OWCA 2QCCA 3EB2A 3SURA 5DUUA 3ZVHB 2BUKA 5FYVA 4IL7A 3TR9A 5DABA 1EEPA 2CDPA 3BURA 4J4KA 5LB6A 4TUFA 2FPTA 1MUMA 3I97A 3BV4A 4BE3A 3DENA 2XJTA 5TSWA 3VZKA 1CNVA 4PMJA 4QQLA 2NLYA 1ITQA 4HD5A 1ZBA3 1MZHA 4CQ9A 1KQYA 1MXSA 3LCWA 3VV1A 2E6AA 3G5EA 3WY6A 4UQCA 2BHZA 3BUCA 4QHBA 5DG1A 4ZZ5A 4QQUA 4IGQA 2DVBA 1CAVA 4QX2A 3C2VA 2HWF3 2FZ9A 5REQB 1J6PA 3GGLA 2MNGA 4KESA 1FI2A 1W6PA 4AHOA 3ZYJB 5C9WA 4LUJA 3AZZA 1EDGA 1QAPA 3VZZA 1ZX5A 2ZUSA 1XBVA 3SY5A 1DWHM 4XQ4A 4BPZA 2A0NA 4JR5A 3EWDA 3RYKA 4UQBA 2G9FA 2XQRA 1CTNA 2GOUA 1K45A 4TXEA 2VW0A 4REQB 1A3HA 3DG6A 1UMIA 4YTUA 1H2KA 3U2OA 1GYLA 3VGBA 4GZEA 4EN6B 4NI8A 4NIIA 1OABA 2X7VA 4P7RA 1PK6A 1R091 1OKQA 3PFRA 3B9CA 4FPCA 1UR0A 5EA9A 4KU7A 3OQ8A 2IFWA 3G7DA 5C4WC 5DMYA 2JD4A 3ITLA 2WZEA 2GP3A 2YDQA 3AZTA 1T41A 1HKIA 1B31A 5E5CA 5JXHA 4YVWB 5C3OA 2YYUA 4EXQA 5C9XA 1VFSA 5I03A 2XHKA 3H12A 1GTEA 4N6EA 4C8DA 2H8ZA 3BO9A 2GC0A 2WA3A 4ZXKA 2QMKA 2JICA 1RQEA 3N25A 4NUBA 3SZ8A 1RUJ3 3E2QA 3W2JA 3MVIA 1RUF3 3A0KA 1COV3 4GIQA 4NAMA 1OA2A 2GSHA 3MCNA 4MKVA 1RUD2 2PHDA 4HT3A 4ZQOA 1W8FA 4GMP0 4LBSA 5EPAA 5EJ3A 2DSVA 2BXVA 3NZGA 4Y3OA 2FD8A 4DLMA 4XFFA 3UGRA 3WQVA 2QDDA 5LA0A 4QQOA 1KQRA 4RS5A 3WLTA 2O7SA 1KGXA 3NAPC 2H3DA 4TV6A 3CMJA 4EF9A 4XZPA 2P8BA 1XLDA 4H04A 4FFFA 4ROPA 3T8LA 4KWVA 3BU0A 4C0BA 1OYAA 1PO11 1AJZA 9XIMA 1GWMA 1PPIA 5I3IA 2CZEA 3VKKA 5LZLA 3KT1A 3LPPA 3TYCA 4P2VA 3NEVA 1G69A 1SLBA 4FCAA 3LDBA 2JG8A 2NLIA 5C2GA 5FF3A 1R64A 2QQNA 3CB3A 2Q8LA 2YYOA 3VOCA 1TR1A 1REDA 2A6NA 5LY1A 1LZOA 1LLZA 1E6XM 3SDOA 2OT7A 1H9WA 1XIDA 1KV8A 4FPGA 1UMYA 4IIFA 4B4QA 1GZ9A 4YVXA 4A2SA 2WNEA 2D5HA 2NZ9A 3PUOA 2B39A 4QGCA 1REQB 3LA2A 3V5FA 1UWAA 1O5XA 2FZBA 2Y4SA 4IFKA 2WA4A 5ACA2 3GK0A 4RL3A 5JLVA 3TW7A 4WZCA 2P10A 1R0MA 4WJXA 1P43A 1PZ3A 3E5BA 1VBC3 4LA3A 3PNUA 4W86A 1SZBA 3VE7A 3TCSA 4XUTA 1W9DM 4UR8A 1AR61 1WZXA 1BG4A 1EYWA 3NVDA 2ZAAA 4PCPA 3PBVA 3M5VA 2P3JA 5FMOL 3MIFA 2WQPA 1PEZA 3LXAA 2PDUA 1AR73 2W47A 3PK7A 3PUGA 4PLMA 4AWSA 2W79A 2AENA 5CKQA 2BNMA 4RHV1 4G1KA 1OIMA 5FJOA 1F3TA 4R7JA 4Y1ZA 3H2FA 3W1RA 1ZZ9A 1V6VA 1R093 1SBFA 1EPVA 2ZHMA 5EMYA 1UZDA 3R8GA 4FP2A 4ARYA 1VBE3 1ULEA 4AIOA 4DB5A 3NOEA 1SDDB 3L66A 4WDUA 1H51A 4HPKA 4COYA 1VFLA 1QW7A 2VD9A 3DDMA 3GU9A 3S5SA 3WH7A 3WQ8A 3KOYA 1HVXA 5XIMA 3NQBA 3OY8B 2YG0A 3ZSKA 1XLGA 1PGL2 3MW3A 2G5WA 3MSGA 3VKAA 3ZVIA 2Q4SA 1UKOA 5G4HC 3UWZA 2F38A 1NIUA 1R083 2UU8A 4CUCA 5B4NA 3ZFFB 4KBZA 3P84A 2ZXAA 1DE5A 2PQSA 3GNOA 3KFTA 2X5IC 1U5XA 1AL7A 3EKLA 5A8NA 4M8UA 3T4WA 5AC4A 1YQ6A 4U3AA 1W2UA 3SNMA 3BZGA 5EJZB 4CN1A 1YQ5A 4BQ3A 1SM9A 2ADEA 5HUOA 1RLDA 3GBWA 4GALA 2PWFA 2V63A 4AYGA 4H8HA 3WDTA 5E09A 3M4HA 5FP9A 2JDMA 4Q4W1 3PMEA 3GCWA 1K8ZA 4MVAA 3OZPA 1Q5OA 2R7EB 1OFRA 2UURA 1BMV2 2JEMA 2GJPA 3RM4A 1SFJA 3AMDA 4Z08A 1QDSA 1E5IA 4BR1A 1PO13 4KF1A 4EN7B 3MFAA 3K30A 4QJ1A 1E9YB 3PUEA 3ES1A 1UX7A 3Q8EA 3F7JA 4JNYA 3SN1A 1POV1 3APBA 4LIVA 2YB1A 3W1PA 1H41A 1JUBA 5LYRA 3TDFA 2R1PA 4Q8QA 3QMRA 4NZCA 5LBFA 1U1HA 3CU2A 3C56A 5CZJA 3M43A 4N6FA 5B7YA 3A0NA 2EEXA 3W9ZA 3U8GA 2CSGA 1OFBA 5AKQA 3TN91 3H21A 1QATA 2E28A 5U4NA 4W8JA 2XVGA 3ZXDA 5A7SA 4TZDA 3V0AA 1WUFA 5HMFA 4LUKA 1KM4A 3HQXA 1YFYA 5KWRA 3UL2A 3WSUA 1G1YA 1WOBA 4QAWA 4PMXA 4OOZA 1KM1A 4JQAA 7XIMA 2PYTA 5J98B 1UZWA 2DIJA 2HNHA 1ENSA 4HOOA 3T1MA 5T5LA 4D72A 1AR63 2C18A 1G4EA 3TA6A 3P14A 2ZXDA 1G7YA 4NZFA 2OQ7A 4DQAA 2ACQA 4JS3A 1JOJA 3S6OA 1HKWA 1EL3A 3WF0A 3VZNA 2R062 4WM8A 1H11A 1GK8A 2FFCA 5L7OC 4JRAA 3A5FA 3NZRA 2A73B 2XJUA 4M01A 2DSWA 2V6AA 3I6RA 5I79A 3VBRA 4EANA 3TKFA 4UNLA 3RAOA 3GHSA 1WOAA 2R1BA 1OCBA 1ND3B 2GC3A 4RZBA 3T7VA 4JV4A 3EX4A 3MHUA 3RX4A 4KEMA 2BNNA 1J1TA 2O0OA 3HOJA 1JTZX 3EX6A 5F4WA 4YMZA 1RJQA 2VMHA 4F9JA 3C2OA 4GQQA 3EYPA 1MDLA 3WP3A 3HNMA 2V3FA 5RUBA 4YM3A 3SQOA 4IW3A 5E1QA 4OQ8A 3H24A 3DFPA 1W9TA 1F74A 5FCCA 4CCNA 4XTDA 2PTMA 3E2RA 3QACA 4V33A 5JIUA 5DAVA 2WINB 5F6LB 3O6CA 1ZBKA 3FAXA 4R9DA 4YU1A 2BDRA 3LDRA 2Y24A 3LI0A 4QNWA 3CUFA 1E9LA 4MYAA 1ECEA 2YPIA 3WF4A 5HPOA 5KC5A 2E09A 2V2DA 3DHFA 3S2NA 2A6VA 1D9EA 2PCEA 5M03A 4HHHA 3M64A 4CXYA 4A3HA 3WY1A 4G56A 2DVAA 2R1DA 1BEV2 4XBNA 1V6TA 3PBMA 1HJGA 4C6MA 5J7MA 1RVGA 3ZSEA 5C7VA 4OHZA 1TUXA 4JTFA 4PBGA 1OOPC 1XUZA 2O0TA 1CR7A 1QJFA 4GD4A 4URTA 3ZLIA 1W8UA 1GZWA 1PM4A 4CEYC 2R91A 3LB0A 4M0XA 1X7FA 5FYMA 4Y4YA 2Y7EA 2HYXA 4DMIA 1EV11 4L97A 2ZJCA 5DRCA 1F9CA 4UBHA 4Z2AA 1O5LA 5A8PA 3F2ZA 2XHYA 4QDMA 1KFUL 3BN6A 3WNXA 1POJA 3H3LA 2WNUA 1KTBA 4H3WA 3AIQA 1JOBA 1R3YA 2IPFA 3KP1A 2WQ4A 4FPOB 3SIMA 3W7DA 5HCFA 5A32A 2CLLA 2Y62A 4JIEA 5CU1A 2PA6A 5AC93 1XIMA 1J01A 1K5JA 1W03A 5IVEA 2VNRA 1EX1A 5LEKA 1LEDA 3H2MA 2OS2A 2W66A 4BQ2A 2RM22 5FA5A 3J8F1 3UQNA 1TSIA 2R9RA 1SEFA 3LRLA 3STEA 3CLMA 3LOTA 1PL9A 3GXTA 2NQZA 2WABA 1PHQA 4MVTA 4NU7A 3AMCA 4FP3A 4GULA 3LYEA 4QISA 4E2GA 4JGZC 1WA3A 1B09A 1B1YA 1V0AA 1X6UA 2V5JA 4NHVA 3QY6A 3W73A 3BCFA 1KBBA 4Q0VA 1H1AA 5FRAA 3M7WA 1IEQA 2HEJA 2C79A 2YCIX 4BXSV 3GALA 3B8TA 3M0KA 3RZLA 2EPNA 4I5UA 2W5FA 1A5OC 5H6HA 1E0VA 1XSQA 3LHYA 1WBLA 1S0FA 3AMLA 3T0AA 4JZRA 4HYRA 3NVCA 3B9NA 3FOKA 3TU9A 5JPMB 5AVAA 1V6XA 1XS2A 5MHBA 4MG4A 3M0XA 3S6TA 4DYEA 5BOFA 4XFGA 1VMHA 1O3RA 3EOOA 4EROA 3VVGA 2H9AA 5FZ4A 1FFQA 4PLNA 2HVOA 3LQGA 4E4DX 3KZPA 1SJCA 1MW2A 4PUEA 3I2IA 5I3HA 3VKBA 1FNZA 1S55A 3WLKX 1X9PA 1NCRB 4F3HA 4AEOA 3SEPA 1UP0A 1E4MM 4ATDA 1GOIA 2G19A 4B4PA 2IPGA 4QU2A 1IZCA 4FEZA 3E49A 3ABOA 1C29A 4JIHA 1V08A 3DHUA 4MY8A 1DIEA 5FZ3A 3V5CA 3F4CA 4UI9L 4CD7A 4YVSB 5BNOB 1CESA 1ULDA 1U5ZA 1O7FA 4M3CE 3CZUA 4BB3A 4J3ZA 3M46A 1V6WA 3T0BA 3GKFA 1M3UA 4O17A 1SW7A 5AYXA 3UYCA 1UWSA 5FOOA 3RZGA 2HISA 3CZJA 1GFF2 1H7WA 1CX4A 2A5ZA 3WDXA 2Q1ZB 1DJNA 4AWDA 2DJXA 2PLV2 2V38A 5DXYA 5F5CA 5BW6A 2SFPA 3TN4A 4KS0A 5LNWA 1QJY2 5FPBA 3BG5A 2J66A 2BY0A 1GW1A 1OQDA 1GOFA 3WJZA 2WSYA 3HT1A 4H1ZA 2Q30A 1X8FA 1BKHA 2EJAA 2FHBA 4XCBA 4CDUA 1R3WA 3JD72 1P7TB 2X1UA 4CCKA 2YCEA 1AL22 1W28A 5AVNA 1QI2A 2YFOA 4A35A 3ARPA 2A71A 1YNAA 5I0UA 3BGJA 4IM4A 2J27A 3LGGA 3LS9A 4LE4A 1Q45A 3CL6A 2WO1A 3S5AA 2JDZA 4ZPIA 2FZ8A 1REEA 3H1WA 1XR2A 1KTNA 4NG3A 3W37A 1H8VA 1EC7A 2JEQA 2PDNA 4S3DA 1AQ0A 3C2RA 1LROA 4YGBA 3GLCA 1H8TB 4MB5A 1GOQA 3NQ6A 1Y5WA 2D3NA 2I1OA 3WJWA 4LBUA 1LOAA 5EP9A 4X60A 1DYPA 2H0BA 5CPSA 4ZOCA 1MNSA 4HN0A 1SW0A 3NR0A 3P80A 1YNPA 4QPGB 1MRAA 3TN5A 4HMZA 1WGPA 5FO7B 3ZWTA 4MGTA 1W56A 4UOQA 3PTKA 2XN2A 4IXHA 1W3LA 1J96A 1EO7A 2GVEA 1NAL1 2ANUA 2Y63A 3B8IA 4DJDC 5BRPA 4ZGYA 7PTDA 3L65A 2EBNA 3P81A 3NXLA 3SKJE 3I10A 4CNNA 5C8CA 3S2LA 2AAAA 1BEUA 3THPA 4CVUA 1Q6QA 4BIFA 3FMGA 4UF0B 3CPUA 2R1MA 3BIWE 2OX1A 4C1KA 1CGVA 3D6EA 3S7IA 4NSBA 3POHA 4YGCA 5I77A 1YKWA 1Y65A 3KVMA 4Z92B 3L68A 1NQJA 1E9ZB 1QPRA 3W38A 4ZSUA 3BIEA 1TMF2 4PTMA 1ISZA 2WZTA 1Y5VA 5B7ZA 2PURA 2QJGA 3DG7A 4RJEA 4Z1BA 3PJXA 5FJHA 3WUGA 2ES3A 1ITUA 1LT8A 2WQDA 2UWCA 1JF5A 1HB2A 1GEHA 4LO7A 3B00A 4Y22A 4OECA 1NEYA 2PDMA 3KHDA 2NT1A 3Q9OA 2PGEA 4X2PA 2JKAA 5CPMA 4EWJA 5L9RA 5FEZA 1EF3A 1S1PA 1R38A 1UWQA 3UZWA 3WG2A 3K5XA 5CFDA 2YYTA 3SH4A 1SFNA 3NPWA 4HONA 3B93A 4X8PA 2Y2WA 2Z27A 4IGMA 1OF3A 1EYEA 2VOVA 2E5BA 3RLGA 2H8XA 3P5YA 3TSBA 1HJSA 1H4GA 1U5YA 3AKSA 4O1FA 1DGWA 1TVNA 3RSJA 1OG0A 1K5MB 2DUAA 5CADA 1L7QA 1MXDA 4BH9A 5DT5A 1KA9F 1ZP4A 3OOQA 4YWAA 1W3VA 1VCFA 2AQWA 3KL3A 4M3CF 4E2DA 5C9RA 2CNAA 2OQYA 4IP4A 5HQMA 5HQLA 5IVCA 3AJYA 5LWBA 1H62A 3NQVA 2RHGA 2V5BA 5L73A 3GSMA 3FV9A 1YX1A 5CC6A 2D6LX 4XIAA 2Y64A 1VBA1 4YRDA 4DO6A 1AQFA 5CGMA 3MC5A 3NQCA 1YMYA 4F79A 3WO8A 1UCWA 2RDWA 2UY5A 3M3OA 1F2JA 4YPJA 2ZZ1A 4GCAA 1KEXA 4O12A 2PFHA 4MWAD 1TV8A 2WLZA 3B8VA 2ZDRA 4JYFA 3LY0A 4B5WA 2YZ4A 3ETQA 4FXJA 4OZOA 5FZIA 4J9JA 1XPGA 1W37A 2Y7DA 1QPOA 3ZSJA 1OPMA 1JDDA 5F1VA 1JMUB 3NQHA 4WKAA 2QUMA 3HN1A 2XIMA 3H4GA 4EV0A 4XKMA 1UU5A 1LYXA 2XU2A 1Q3NA 4XD6A 4DM1A 4CXWA 4Z0SA 3LCPA 2CXEA 5A7NA 4WVWA 1HRI2 4DXTA 3N4FA 4Y20A 1HT6A 1HQNA 1IS4A 1C7SA 1SJBA 1KDKA 4AZ5A 1KFKA 4ISQA 1RD5A 2ZRZA 3VMOA 4BI5A 3S1WA 1BYAA 1LLOA 3PNZA 3WD2A 5LIUX 1DGRA 4BA0A 1XPWA 1LR5A 5AFDA 4KFPA 2ZTKA 1MEC1 3UBPC 5KHHA 3TQVA 1PSCA 5FZAA 1AX0A 3NJXA 1XLKA 3H7YA 2YZ5A 3L2LA 4I6KA 4KEZA 1OPOA 1GVQA 4JXCA 3NL6A 5EFFA 4IGNA 2E67A 2RAGA 1GKRA 1GOMA 4LUMA 3DFTA 3H2OA 1NM9A 5DPNA 4MGKE 4PH6A 1NF0A 1W9VA 1O91A 1OBAA 1ZVFA 1IGOA 2VVEA 2ZRWA 1VPHA 3FY1A 3IUIA 4ORMA 4C90A 3THUA 1MS8A 1ZUAX 5F4SA 4XACA 4C1NA 4XTMA 1W2PA 5JMCA 2IZWA 3SXWA 4CDQA 4JEJA 2OOFA 4N4QA 3ZJ8A 2A1YA 2G96A 4IPJA 1DWFM 3MJYA 3TWBA 3OGGA 2QEZA 4DBEA 2ET1A 3WLUA 2HVNA 2QCGA 2Z6IA 3L23A 3QSRA 4GHRA 5AYZA 1XOYA 5B4XA 3JZUA 3LA3A 4RD7A 3EEZA 3RWKX 1JUEA 2BODX 4XUGA 1JGMA 4LX4A 1A0EA 4ZZ9A 4HKWA 3OA3A 4S2GA 4GQBA 4F2BA 3U9IA 3O0WA 3VBSA 1ZS2A 3OHMB 4DRSA 3BU7A 4PBFA 5L19A 3WYZA 2PU1A 4Q8NA 3MKKA 3WX7A 4R88A 1U12A 3VGDA 2CL2A 2Y7GA 3AP7A 4A21A 2XISA 5EYYA 1E4IA 2G3MA 2OT1A 3G0UA 3OBZA 4E0CA 4NZ5A 4AEFA 4P5HA 4XTPA 1MZFA 3GDLA 4XZHA 1TREA 1C91A 3CPGA 2Y85A 1I60A 3T2QA 1XYAA 2GQ8A 3MHGA 3MDUA 1VAVA 3W5NA 4QQ3A 2PCQA 3WL0A 4QDSA 3ZX7A 3FEMA 3IJ8A 4L6OA 2XGXA 3CQ0A 2VRQA 5F2WA 1H6XA 1EGVA 1A4MA 5CBLA 5HNRA 1QJU3 2AL2B 3U6WA 2QDRA 1FHLA 1OVPA 3QV9A 2FQIA 4M1BA 4MOZA 3U37A 1YPFA 2GC2A 2I5GA 3WDHA 4DF2A 1I9RA 3H54A 3LPGA 3FL7A 3ARTA 1O7AA 2CLEA 3FGCB 4PTVA 4AI3A 3N6HA 4XIOA 1UUQA 3REQB 1V6JA 1QNOA 3M0YA 3LE0A 5E8AA 5REQA 3MHZA 1QW8A 5DMNA 4GZ7A 5FZMA 3SCPA 2CBUA 5MKGB 3D8CA 5LASA 3EDDA 3STGA 1TB3A 1RUD1 1U22A 4PIYA 1MEC3 5FP3A 3W83A 4GB33 5FF7A 2PDFA 4O54A 3WCRA 4B8EA 2CZDA 4UFLA 3V56A 4FNRA 1DQUA 2NVDA 1J0KA 4LA2A 1HO1A 2WC7A 2EA7A 2IKHA 3QFWA 1NE4A 1JS9A 4JAAA 1B2YA 5DY3A 2CGPA 3SKVA 4REQA 1YWKA 1VLNA 2VNGA 4DY1A 1N8WA 3UA3A 5FPXA 3UGHA 4XHBA 1HLCA 5E0CA 3MB9A 3IIVA 2XVPA 1VE0A 5G1TA 3VKLA 4QG6A 4GC3A 3JZEA 5L7OB 3HMYA 3AHYA 3RG0A 4PBPA 4IEOA 3SAZA 4PDWC 1UH3A 3IK2A 3LSCA 3M0JA 3IAPA 1R2TA 1JDFA 5CJ5A 4KFOA 1O5UA 1BJQA 1WCSA 2WJEA 1W04A 4ZO8A 1THFD 1AR93 4HJWA 3A4AA 3U0ZA 3RCMA 4DUOA 4JQRA 1KKRA 3ACFA 3EOEA 3P3PA 2GUBA 2QIIA 1VYPX 4Z1AA 3WF2A 1FATA 3CUIA 1BWVA 4IIGA 3URFA 2W3JA 2YBUA 3UJOA 5ACA1 1XE7A 2OMAA 5GZDA 4TO8A 3TE9A 4AMAA 4PSPA 1QT1A 1SFYA 4XDQA 3GAYA 4EXBA 2Z24A 4Q4SA 3WG1A 3MBWA 3C8XA 2G8ZA 3S4TA 2OA2A 2W94A 4HPHA 5FPUA 4ZFCA 3U2EA 1W2NA 5DN1A 4XD5A 2WZMA 1YFXA 3A24A 3FKKA 1M53A 4PRTA 4PTNA 3OBAA 2GUYA 2GGEA 2ZE3A 3BLKA 1NT0A 1C8M2 2VNCA 4O50A 3RIKA 3ZO9A 4FNSA 1O6IA 4J7RA 3U2CA 4E3VA 3P6LA 1ZRFA 5JOYA 3AO0A 2OZ3A 2XFRA 3H70A 2QIWA 4ZODA 3R8RA 3TVAA 1CPMA 3FBYA 3NV1A 4O28A 2QQWA 5FZ8A 1VAHA 3RMEA 5A8QA 4IESA 3I2OA 4GO9A 4RE2A 5LXXA 1MS0A 1Z32X 4CYDA 3USSA 4AY1A 2NPIA 1US2A 1OK6A 1E6NA 3B8SA 3MBDA 2IXIA 1VH7A 1REFA 2QMJA 3HQNA 3MW4A 5FPAA 1HJFA 3O6YX 1Q8VA 1JZ4A 4XQWA 1UD5A 2BWCA 3T0DA 1GR3A 5AFEA 3VIPA 4IQJA 1SVDA 1PGL1 3BQ5A 5K7PA 2ZUNA 1TUFA 1TTJA 2QQMA 4FNUA 1REQA 2NMNA 2WS93 4HK8A 1K70A 1W91A 1FKWA 2OUJA 1OFEA 1SJAA 2OLHA 2PWUA 6XIMA 1WZKA 1NFBA 3UV9A 2G0WA 2R14A 2WO2A 4XTIA 1XKYA 4HK5A 1E3ZA 3VL8A 1GSLA 2G4IA 5D2VA 1ULFA 1AW2A 2HPIA 1N3QA 4H9YA 3R10A 4TVDA 5F2IA 4A2UA 2PE4A 3LXCA 4I09A 1TPB1 1TPH1 4B5VA 4W8AA 5CFCB 1T6GC 1LL4A 4JTTA 1BMV1 2BTVC 1ZJHA 2MUCA 4WDXA 3AS1A 5I00A 1UR4A 3SRKA 5DDJ3 3SM0A 1LU1A 4AD2A 2KD7A 2Y6LA 5AOUA 1XXNA 4ZU4A 1SZGA 1VYRA 3I54A 4TWTA 5KXCA 2QT3A 3TYJA 3MPPG 1E1FA 3PTQA 3PANA 1HG3A 2CHNA 4A2RA 4C60A 3LZ3A 4KETA 3HIFA 4IX2A 3L4YA 1VEPA 3KL0A 3BGGA 4ZQRA 3OTFA 3DX5A 3QLLA 3BPZA 5EKYA 3E0IA 3OY8A 1A3WA 3AL5A 5EBUA 5ACA3 4TXWA 4C6DA 3ZFFA 2ZEZA 1BGGA 2VEFA 1BSLA 1E51A 4LY8A 4NILA 1C3FA 2X29A 2Y1HA 1FXQA 1RK5A 1DF0A 3MJMA 4AI8A 2NQ9A 2J9YA 4EWAA 4M6VA 5XIAA 1EJSC 2Q09A 2ZGNA 4LMFA 1IZJA 4J1WA 1C93A 4Q4MA 2PAKA 4Q8OA 1R86A 2OELA 4DXXA 2B5HA 4MJ2A 1WP6A 1OQEA 5CSSA 1JW6A 2R061 3RVHA 4F40A 4IWWA 3AMPA 4L0PA 4FLRA 4H7MA 1AW1A 1DPMA 1AYN2 2Z2AA 1ASJ2 1Q8SA 2PTDA 1X39A 3K3NA 3VUSA 4IGSA 3WH8A 3NGJA 3H26A 2JDNA 3GFYA 5FY1A 3ENRA 3RLVA 2PLCA 1H9PA 5FK7A 1IWBA 3WQOA 2CCRA 2DSZA 4HNTA 3U75A 1EWEA 4JTHA 3O1PA 1M06G 2GU9A 1IEXA 4H7CA 5T9BG 2RE9A 4MGQA 2RMU3 1R87A 3A7QA 3RO6A 2VFHA 3SJ3A 3E6EA 3LRKA 1IT8A 4O52A 4PMUA 1A5KC 1VHCA 4Y1VA 2ACUA 5JCTA 3T08A 2LM3A 1UIKA 1F05A 1V7YA 3OEBA 2XH4A 2RKXA 3M0LA 3PMSA 4I5RA 1LOGA 2WO7A 1C9WA 2TEPA 2GZWA 1JPDX 2FGZA 4IQDA 4L1GA 1V02E 3VHRA 4N0RA 1XRSA 2VR2A 1PGW2 1KFWA 2BGOA 3KV6A 5LNVA 5KXBA 1ISYA 2VC6A 2GL5A 1HGWA 1D3HA 2QCLA 2W63A 4H8VA 1KXVA 2CW6A 4OBSA 3SCNA 2CAUA 1GOGA 2ZCWA 4JFWA 4IERA 2BYVE 1FWFC 1BEV1 5A5WA 4QFUA 1G9BA 3OODA 4E2OA 2BW8A 1H2JA 3BAYA 1XKJA 4PMYA 2VZTA 4DYJA 4FQ4A 3UJ2A 4XF0A 2XL9A 1JQXA 3ITXA 1F76A 5FP8A 2WR9A 5MF5A 1OXCA 3LTPA 5C54A 1L8PA 2PWDA 2DZXA 5KINA 3CBWA 2EQDA 3UPMA 1ND3A 2Y8KA 2RFGA 1WV2A 3I7QA 3KRSA 4LV9A 4QEEA 3VIJA 2P1BA 1A0DA 4AD4A 4ZB5A 2ADAA 3GNXA 4A29A 4CQCA 4Q5OA 4NZ3A 4JAWA 4XWUA 4QWNA 3M7AA 4QHZA 4IE5A 2ZYFA 3WH5A 1JAEA 3EEGA 4L6DA 4ZBCA 3GU1A 3R25A 3W2LA 5IAVA 3TYZA 2HTMA 3AP5A 1IOAA 4YCOA 2VZ1A 2CWXA 2JGQA 2IXHA 3DOPA 1Q6EA 5LK7B 3LRMA 1VFTA 1GWKA 2P37A 3W71A 5F3EA 3UXIA 3ETPA 4NHKA 3NW4A 3CH9A 4FTBA 5FMDA 2RM21 1UP2A 2QGHA 5IVVA 4KGQA 2WW5A 2X8RA 2V30A 2G3IA 4K39A 5FKBA 3WQPA 4WJEA 1KFJA 2R6OA 2W62A 4AG4A 2XLFA 4N9EA 1RSCA 2HYKA 2R063 1AZ2A 1JYIA 1ONAA 2Y6ZA 1CAUB 1W8OA 3SUWA 3TTYA 1LOEA 3UWVA 1ST8A 1ULCA 3GD6A 4FXFA 2PHWA 4FPEA 1FHDA 4Y5SA 3RDIA 4QJ5B 1BF2A 1VFOA 3WJYA 2EIGA 2QBXA 3A21A 4DWSD 4K3ZA 2ALDA 5CPQA 4BWLA 4XJAA 3WENA 2HNEA 3I3BA 4Y9PA 1GPWA 5GLWA 2E63A 4WZFA 1KM2A 2BVYA 1JI2A 3PTRB 1FH8A 3ZOIA 3ITVA 2I74A 3VGEA 5IBXC 3WW4A 3NYDA 1ULGA 2DTWA 1A5AA 3DERA 2VBDA 2HPMA 4Z2JA 5CAKA 1TX0A 4LEFA 2W27A 4GGHA 2VUAA 3KTSA 5EPDA 3LCXA 1QOQA 2OKOA 5I06A 4YM2A 3DFYA 4UWMA 5FO8B 3N9NA 3SB0A 2IKGA 3WKZA 4XF9A 3WEMA 2VBPA 3D4KA 4F0HA 4NMIA 1MQTC 3NAVA 1ENRA 1EOMA 1ZA4A 3CWOX 1HKMA 2CESA 4LYRA 4XW3A 3NPXA 3FIGA 1ND2B 1LRTA 4ZE4A 4A6OA 4LWWA 1MS4A