3ZM8A

Crystal structure of podospora anserina gh26-cbm35 beta-(1,4)- mannanase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
444
structure length
444
Chain Sequence
RDGPVTYEAEDAILTGTTVDTAQVGYTGRGYVTGFDEGSDKITFQISSATTKLYDLSIRYAAIYGDKRTNVVLNNGAVSEVFFPAGDSFTSVAAGQVLLNAGQNTIDIVNNWGWYLIDSITLTPSAPRPPHDINPNLNNPNADTNAKKLYSYLRSVYGNKIISGQQELHHAEWIRQQTGKTPALVAVDLMDYSPSRVERGTTSHAVEDAIAHHNAGGIVSVLWHWNAPVGLYDTEENKWWSGFYTRATDFDIAATLANPQGANYTLLIRDIDAIAVQLKRLEAAGVPVLWRPLHEAEGGWFWWGAKGPEPAKQLWDILYERLTVHHGLDNLIWVWNSILEDWYPGDDTVDILSADVYAQGNGPMSTQYNELIALGRDKKMIAAAEVGAAPLPGLLQAYQANWLWFAVWGDDFINNPSWNTVAVLNEIYNSDYVLTLDEIQGWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Analyses of Glycoside Hydrolase Families 5 and 26 Beta-(1,4)-Mannanases from Podospora Anserina Reveal Differences Upon Manno-Oligosaccharides Catalysis.
pubmed doi rcsb
source organism Podospora anserina
molecule tags Hydrolase
molecule keywords GH26 ENDO-BETA-1,4-MANNANASE
total genus 139
structure length 444
sequence length 444
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
A PF16990 CBM_35 Carbohydrate binding module (family 35)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3zm8A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3zm8A02
4ZE5A 5A6MA 4W5UA 2WN3A 3F5JA 3K4AA 1K9DA 4GI9A 1W1TA 4MGSA 1EOMA 1ZJAA 1TUXA 4P7LA 1UZ0A 1EDTA 3HU7A 5DT5A 4HPHA 1JZ2A 4OJYA 3VGFA 1UZ4A 3I2IA 2WMHA 1WCGA 1DLCA 4P7OA 1BHGA 4DXRA 1VEOA 5E6ZA 1PIFA 1TA3A 2G3IA 3CHFA 1MYRA 3DHUA 2O9RA 3EB7A 3IAPA 5KEZA 4GZIA 1FH9A 1UY1A 2CYGA 1OCQA 4RL3A 2DT3A 1XSIA 1HNYA 3DYMA 1CGXA 2OYLA 1BF2A 1TR1A 1ZS2A 5G04L 1VBRA 2QPSA 4GQRA 4JCLA 1YHTA 3NSNA 3AS3A 4FLSA 3ZR5A 5EJ1B 1UWTA 4RE3A 2BVTA 1W9WA 1JYNA 3RJYA 2VO5A 4X0VA 3AOFA 1TG7A 1WDPA 1PX4A 4A3HA 3AQUA 5IJRA 1OD3A 1EHAA 2JEQA 4HA3A 3VGBA 5M3WA 4MB5A 1E0VA 1QW8A 3VD5A 3AJ7A 2WW5A 4M24A 2DEPA 5GNZA 3K4ZA 1NWUA 1AQ0A 2EIDA 1CTNA 3RIKA 1KXTA 3EBVA 3VILA 4LX4A 3WNNA 1P6WA 4KRUA 4A41A 2EPLX 2R7EB 1OIMA 4Z2LA 4HTYA 1W9BM 2OWCA 1E40A 3QHOA 3B9DA 1J0IA 3PTQA 2BGOA 1KQYA 4URIA 4D6JA 3WH5A 2UY2A 1DHKA 1W3JA 1NKGA 2E9MA 1XD0A 3CZLA 1UYQA 4MNMA 1KQZA 2CIPA 3AIVA 3ZT7A 1HKKA 4H2CA 1PZ3A 1HVQA 2YL6A 1V02A 3WN6A 3OIHA 3ARRA 2ZWZA 3SCNA 4B9ZA 3W38A 4ACZA 1OT5A 2J8GA 5B4NA 4PMRA 3AMCA 2JF6A 3AIEA 4CD8A 2OYKA 4CVUA 1CGTA 2XGIA 2E3ZA 4HG6B 2DDXA 2WVSA 1FP9A 4UNIA 2C26A 2E33A 3AMDA 3WFLA 3OLGA 5DF0A 3LEKA 3PZQA 3TTSA 1OGSA 4UCFA 1TZ7A 2J1SA 2ZWYA 1JNDA 1XNTA 2AOSA 4FLRA 4N0RA 2CEQA 2GFTA 1J0JA 1CXKA 1AQHA 3VD4A 2VZOA 1W9XA 4LHSA 2DDUA 3OGVA 1NP0A 2YL5A 1MQQA 2BXYA 3MU7A 1ZBVA 1QW9A 2DCKA 3N18A 1UY0A 2CBUA 4OKDA 5FL1A 3N04A 1RPKA 3WQBA 4W86A 5CPTA 2CBJA 1FFQA 4CKQA 3CGTA 1HT6A 2ZE0A 4AZCB 2GSJA 4Q22A 3AHVA 2XM1A 2QQNA 2FHFA 5A2AA 2D0HA 4MOAA 3OGRA 4MTVA 2VZUA 5DT7A 3WD1A 4UQEA 4XUPA 1E4IA 1UWRA 3VIPA 5IYYA 1DWHM 1JDDA 1LWHA 4NI3A 3SCOA 4PYSA 4AZGA 3VGGA 2VI0A 2XUCA 2VOTA 5M03A 1J01A 4UI9L 1GQKA 4P7RA 1BFNA 5BYWA 1ISXA 3RM9A 4XZWA 2WBGA 5BRQA 3JUGA 1PMJX 1G94A 1XH1A 3K46A 3THDA 5LYRA 2C9KA 4A42A 3DC0A 3SUSA 1H11A 1GORA 2E0PA 2G3MA 2PWGA 3HN3A 4XX6A 3UR8A 2YIHA 4W87A 5E6YA 5KZ6A 1DP0A 3LPPA 3L4XA 4F66A 2VZTA 3VUPA 2WAAA 3OLEA 4UR9A 3POHA 4U3CA 2LS6A 1LQ0A 3VKKA 3RCNA 2BERA 3CHCA 4DEVA 1QI2A 1JFXA 1MW2A 2GJXB 3AMGA 3HPNA 2QF8A 5A6BA 3WQ8A 1OB0A 1W9PA 2WZHA 3L4WA 1KXHA 1VFOA 2VMFA 4IPNB 4TVDA 3A23A 3W26A 1DTUA 2WSKA 1JZ5A 1G0CA 4DWSD 2QLYA 4OMDA 4PSPA 1XHGA 1RYYA 3VGDA 2WMGA 5JUVA 2DSVA 2AMGA 2OSYA 3TTOA 2QQMA 5HBFA 2WLZA 1OH4A 1OT2A 1S46A 4LYRA 4K68A 1JDAA 1ISZA 4AEEA 2GDVA 5JIPA 3CBWA 4XVHA 5ABFB 3QOMA 3CLWA 2XPKA 2ESCA 1MW1A 4D6EA 3VIJA 1J84A 2XFRA 2FDMA 4W7UA 2W62A 2WMJA 2FH6A 2HYXA 3EMQA 1I5PA 4PTWA 4YHEA 2WM0A 1J0ZA 1XH0A 4BQ2A 3EDKA 3WNLA 2E32A 1SG3A 3VD7A 2Y6KA 1W1PA 3WD0A 3MSGA 1KWGA 2W46A 1ODUA 2QQOA 4HOXA 3IK2A 1B3ZA 3WH7A 2UY4A 2VZ1A 4QB2A 3PZMA 5A8MA 3II1A 4GIAA 1UMIA 3C7FA 4PMUA 3WNKA 4DUVA 1PPIA 1AQMA 4KH2A 1NUKA 1E6QM 4GWIA 1OF4A 1UWIA 2WBKA 2XSAA 2CBIA 2NT0A 2VNCA 3OEBA 1HF6A 3VMOA 1M7XA 4HOWA 1GPFA 1Y7VA 5E0CA 3W5NA 3EDEA 3IDAA 1WB0A 5AC4A 2EPKX 3MUZ1 2J1EA 1KGWA 4GO8A 3ABZA 4PEEA 3C7GA 1UR8A 3PZVA 4ZXEA 1GQPA 4IM4A 3AMLA 5GNYA 4YPJA 1ZBWA 3AFBA 2ZUTA 8A3HA 5HPCA 1I75A 3ACIA 4H8HA 1CGVA 1M03A 3PBGA 1E5NA 3WL0A 4W8BA 3BAYA 2VR5A 4BXSV 1XSKA 1K3IA 1AMYA 2X0HA 4ZZ5A 4UAPA 4LQ1A 3UG3A 1OF3A 3MMUA 3A22A 4CUCA 1NWTA 4TTUA 2PBGA 4QX2A 1E6ZA 1CZSA 4CUAA 2PB1A 4W84A 4UQ9A 3CZ8A 4MNKA 2ZIDA 1TVNA 1XCXA 1C7TA 2WDBA 1W3HA 2W1SA 4R27A 3TTYA 3RJXA 1DWAM 2CITA 3WQ6A 1C91A 3NIYA 3CZJA 1W1VA 4PCSA 2HISA 1CZTA 4OIFA 2WC3A 4TX6A 4XZBA 3NYDA 4AZ5A 1XRVA 2YFZA 5JXJA 4GI6A 1CNVA 1UXXX 4HZ6A 1BTCA 4CCDA 5FOOA 2QBXA 3WF1A 1JI1A 3WQWA 1V6YA 3WL1A 2WN2A 3OGSA 3SEEA 2XVKA 2ZXDA 5IHRA 5A6AA 2VMCA 2D23A 3AHTA 2ZXQA 1TE1A 1VFFA 2B4KA 1IV8A 3BAJA 4AZ6A 2A3AA 2EJ1A 4AD4A 3ARQA 4UQCA 4OOZA 3EYPA 1B3YA 4M1RA 2BVDA 2VZSA 2L9LA 3VX0A 4WK9A 1ITCA 1FA2A 2GK1B 2EXOA 5EMYA 4J3XA 1W9SA 1EIBA 3VIGA 1JYWA 1JNEA 4PF1A 4ZZ8A 4CCEA 4P08A 2XWEA 1ITXA 4BQ4A 1R7OA 1O6IA 4D6CA 4J28A 1R85A 2ZX7A 1LNSA 2BY2A 4A3YA 1B9ZA 2WHKA 3MUAA 1G1YA 1E6NA 1UKOA 3JXSA 3GTNA 4J3WA 2A3BA 1K42A 1E6RA 5A8OA 1KCLA 4M82A 3LPGA 3KZSA 4OYUA 4ACYA 1QNPA 4NF7A 1J0KA 3FN9A 2PBOA 1CGUA 2BHZA 2J1TA 3I97A 3KL3A 1E0XA 1EO5A 3ARZA 4CD5A 3WF2A 3AXXA 2VZ3A 3HNYM 3VNYA 1US3A 2CKSA 2ZX8A 1ODZA 4KGJA 5J1XA 4YN5A 5C70A 2WWDA 1UWWA 5D9OA 2F2HA 1UR2A 2X8RA 1WCQA 3AZTA 3HJRA 5IXEA 1JZ8A 1UD2A 3VO0A 5M5DA 3VPLA 3BXWA 2VZPA 3GH4A 1EOKA 3GXUA 3BAXA 1UR9A 1ZU8A 3VD3A 1WAWA 5A6JA 2UY3A 4AD0A 1H6YA 1PZ2A 3ACHA 4HA1A 3BH4A 3C7OA 3WMBA 1J11A 2FHCA 4JFSA 3K8LA 1QNSA 1TCMA 3RPMA 4IISA 2YL9A 1K6AA 4TUFA 5CGTA 3U7VA 3WNOA 3HJEA 3TOPA 3VIMA 4D6FA 4L4OA 5ABHA 2E8YA 2JF7A 1ULPA 3CTTA 1E5JA 5GPRA 1EH9A 3SUUA 3ZJ8A 5BRPA 1CYGA 2WMKA 2EO7A 2VRQA 3BAKA 1WDRA 3N1AA 1EHNA 3IIIA 2BV9A 1K45A 4A6OA 1B0IA 3RDKA 3PZ9A 3VDBA 1U2YA 5DEZA 3VIIA 3AS0A 3L2MA 3P6BA 2D3LA 4F79A 4AEFA 4ATDA 4H41A 1WPCA 3VINA 3VGEA 4ATLA 1HKJA 2PWDA 2QPUA 7A3HA 1P8JA 4P5YA 1E1EA 1H0IA 3ARPA 2VR4A 1FOBA 3WH9A 4J3TA 3AIUA 5D4YA 4DUWA 2VQUA 1XYFA 1UKSA 2W9XA 1BVZA 3CKHA 3M7SA 3WMCA 1B1YA 2XFFA 5E9AA 1JI6A 5E09A 2WPGA 1L7RA 3TP4A 4U33A 3F2ZA 1QOXA 5A95A 1NAEA 2EICA 2J78A 5A8PA 1HN1A 2YLLA 2CHOA 4MB4A 3OA5A 1OSEA 3OB8A 3S6TA 1TMQA 2V38A 1ISWA 1GJUA 1HVXA 3VMPA 1CECA 2EIEA 1C7SA 5I24A 5A69A 4QX1A 1W3KA 1WP6A 2DH3A 1KR0A 4MNJA 1J83A 4PMOA 4P00B 2WB5A 3AC0A 2J25A 3SURA 4AZCA 3MBWA 1VJSA 3MANA 3U5UA 1O59A 3ACFA 5A2BA 5FL0A 2JE8A 1C93A 3F4VA 5JBEA 4GQQA 4RYDA 2WQ8A 1UH2A 4B3KA 1OGBA 3LMYA 3WEZA 3VDCA 2QMJA 4B9YA 2WMIB 3BCFA 3SCVA 1G9HA 2J22A 5HNNA 1I1WA 1V6VA 3SIMA 1J18A 4QB6A 1J0YA 1ISYA 2TAAA 1V03A 3QR3A 1LL6A 3AXHA 3GYCA 2J7HA 4WF7A 1OINA 4UFIA 4QLJA 2W91A 4JKKA 4TVUA 3ZJ7A 3K8MA 1CZ1A 2D24A 2QMKA 3D3AA 1E15A 2OWWA 3L4ZA 4PMQA 1KEXA 4HP5A 2XHNA 4LPLA 1M53A 3CMJA 4PRWA 3AHZA 1E0WA 3ARTA 4HZ8A 1E43A 3MMWA 3RILA 2W1WA 2VX6A 2WCAA 4AWEA 1BSIA 2CBVA 2Y6JA 4AMCA 1QVBA 1RD6A 2X1IA 5I79A 1V3LA 3VIFA 3CZGA 3ARWA 5FKYA 1QHPA 3OZPA 3VX1A 4HMEA 3N15A 1O8PA 1HJWA 1KXQA 4B16A 3A4AA 1UX7A 2WUHA 4WJXA 2WKLA 9CGTA 3ARSA 1V3JA 4W89A 2BBAA 2BGPA 3WUBA 3WDPP 2YL8A 1MQRA 5CPSA 2YC2A 5CLWA 1OD8A 5BROA 5AY7A 4AC1X 2WMIA 1EXPA 1UXZA 1KGUA 4ARYA 3MV11 4AAXA 2WO1A 4Z2AA 2ZXAA 4JIEA 1JYXA 4L4PA 4UZUA 3AIRA 1QI5A 5IFTA 2IUZA 3MSDA 1V3MA 3ZT5A 3W27A 3MKKA 1F4HA 4W8LA 4MDPA 1QPKA 1WZAA 2ZUWA 3L2LA 2C4XA 4B15A 4OMCA 5CG0A 3FHAA 3UETA 3WDHA 3ALGA 4BQ5A 1CGWA 2YA2A 3UEQA 2J7GA 1B2YA 2J75A 1LG1A 3ARYA 3ZM8A 3I2GA 4PTVA 2ZOXA 2LW8A 2WLYA 4ZE4A 3AI0A 4D0QA 1XYZA 4P7QA 2JIEA 5E0FA 1EGZA 4TVCA 4A45A 4OZOA 2VVSA 1E56A 3SUTA 3SKJE 3OZOA 2Y4SA 1BVNP 4M4RA 1DWFM 1W9UA 2VM9A 3GZAA 4PMVA 2J7FA 4D6GA 1UWSA 3KE0A 4M80A 3NSMA 2WC7A 4AZHA 2EPOA 1VFUA 3QOKA 5CZKA 2BY0A 2Z1KA 4CD6A 4PMDA 2WVUA 4PUDA 4X0NA 4PBGA 1Q6GA 2J4GA 4HPGA 4U2YA 4BK4A 3CUHA 3EMCA 2G3NA 1H41A 4EE9A 3WUEA 2HVMA 2NT1A 4D1JA 1H49A 2RGLA 3B9EA 1LF1A 4WLCA 4QB1A 1KCKA 1J9YA 4TXEA 4H8VA 3QHMA 4EAMA 3FAWA 2WZEA 5BXPA 1B30A 3GDBA 3C7HA 2WWCA 1JXKA 1WZMA 1UA3A 1CLVA 3GH5A 3MS8A 1EA9C 3HNMA 5IDIA 4MO3M 2DGAA 3O6AA 4MB1A 1MFVA 6TAAA 4LQRA 2XJ7A 1CEOA 5GQBA 1UHVA 2JKXA 2WO3A 1W32A 1WE5A 4GZEA 4D6DA 3VGHA 1E72M 2ZUMA 4U2ZA 5CJ5A 2XG9A 2WCGA 2JDAA 4BCEA 4QLKA 2XYLA 1SMAA 3WDQA 5IHSA 2W87A 3W53A 3GH7A 2X05A 1V3HA 1JZ6A 1KBKA 1UWQA 1W8NA 4AD5A 1H09A 3WUFA 2GJRA 1UMHA 1CBGA 5AYBA 2BZDA 1NH6A 3W4RA 1CXFA 2NSXA 3NSXA 5I2UA 1W3LA 5D8WA 3W0KA 2PWFA 2G3JA 4DXTA 2E26A 1JF6A 2C7FA 1E4LA 4QCFA 2DSZA 4LKSA 4CUBA 1KB3A 1UR0A 1V3KA 4EK7A 2C0HA 3WDRA 2D20A 2WK2A 5FUIA 2E9LA 5GNXA 1TFVA 2W1UA 3CHEA 3THCA 3CQOA 3G6MA 3ARXA 2VZQA 4P8WA 1R8LA 3IANA 2Y5EA 1E3XA 1PBGA 4QDMA 3KEHA 3O2LA 3TONA 3HEIA 4MGQA 4CCCA 2EPMX 1GQIA 3P1IA 3VIOA 3ZSTA 1GOOA 4D72A 4MB3A 5I0DA 4QLLA 3HMCA 1QI4A 1JYVA 1H6XA 1X6NA 1QHZA 2WHLA 4AYSA 2GDUA 3APGA 2ZEYA 4U5KA 2CHNA 3W5MA 4MADA 2Y6GA 1HX0A 1PJ9A 1KFWA 4JHZA 4NRSA 3SCPA 1LL7A 3KWXA 4BDVB 1G5AA 4QDRA 1QNRA 2ZEWA 5CSYA 2PC8A 3RM4A 1WNOA 3WF0A 1FH7A 3WQ4A 1FH8A 3CIHA 4CN4A 5F7UA 5EBAA 2OYMA 1J0HA 4DWSC 3ZJKA 1NM9A 1V6UA 3NQHA 3PZOA 2X09A 2Y64A 4XUYA 2VURA 5CGMA 4AY1A 3VDHA 3ZSSA 4CD7A 1QHOA 2W47A 1C8YA 4HZ7A 2VRJA 3DHPA 2BHYA 1RH9A 2J77A 3VIHA 1BYBA 2ORXA 2JEPA 3CPUA 2VZRA 1M01A 1UKTA 1FHDA 1HKMA 3ZOAA 1PEZA 2WVTA 2ZUVA 2Q8XA 1NX9A 5JXHA 5IFPA 2CPUA 3A6OA 5I3DA 3E1F1 3I3BA 1NOFA 4ZEPA 1EUTA 4W4ZA 3FNDA 2JIWA 1WKYA 3A47A 6A3HA 2ZX6A 2IXUA 3RO8A 5DPNA 2V5DA 4IUGA 2W61A 1B3VA 2YDRA 1XCWA 1GOKA 1TVPA 3N17A 1JL8A 4FI9A 5EIYB 1CWYA 2DT2A 2FH8A 5E70A 2VC9A 3L4UA 5JIWA 3WMSA 2A3HA 2XTKA 4PN2A 4PT6A 1EUUA 2VZVA 1QI0A 2ZX5A 3AIWA 4XURA 3CO4A 3HNBM 1VRXA 4JCMA 2OSXA 7CGTA 2CDOA 2VCCA 1QNQA 1XGZA 4QDQA 3ZO9A 3UESA 2XVNA 3AROA 2XIIA 5CYYA 1IZKA 3NDYA 1HXJA 4QCEA 3EMZA 1NQ6A 1V0KA 3MUY1 1LLOA 4BQ3A 4QX0A 4NRRA 1SYTA 3AIQA 1HJVA 4XZUG 2CDPA 2YKKA 4RE4A 2VUYA 4W8AA 4CN6A 3EDJA 4AZIA 2WABA 4DXSA 3W81A 2WAOA 4HA4A 3M6DA 4QP0A 4N42A 3AYSA 2A3CA 3TA9A 2W92A 1Z32X 1UOKA 1HIZA 2V4VA 1H2JA 1JXJA 3C8XA 1KBBA 1HJUA 3BC9A 4JZ5A 1GJWA 1QI3A 2VX7A 5JBFA 5JXIA 1HL8A 2O9OA 1BGGA 2YA1A 5AC5A 3LPOA 3WF3A 1UWUA 2V3EA 2W66A 4Z2HA 1O7AA 1J12A 3LQCA 2J7EA 3N9KA 2RVAA 2ZEZA 1PAMA 3WH8A 4XUTA 3ZIZA 3HOBA 2J1AA 2ZICA 5ECUA 3C7EA 1JZ7A 4JX0A 3AHYA 4E8CA 3MUIA 4BJ0A 4KMQA 1ECEA 4AD1A 3WEMA 1V6WA 1Q4NX 3CIVA 1WDQA 4PTMA 3OBAA 1UY4A 5DFAA 2XFYA 3AS1A 2X2YA 3W6MA 5B4XA 4HOZA 4AISA 4CU6A 2QQJA 2EEXA 1GUVA 4GZJA 3RM8A 3B8SA 1BYAA 2V3GA 2OSWA 3WD2A 2PWHA 4D8MA 3U5YA 4UQAA 5ABEA 4PMXA 1UY2A 1DWIM 5ABGA 3SCUA 1WZLA 1JDCA 2J74A 1UH3A 2CXGA 2X10A 1LWJA 4W7WA 1HP5A 4V2XA 1SDDB 3K4DA 1NWSA 3CZUA 1WDSA 1JHJA 2XVLA 3LEIA 5DN2A 1E4NA 3L4TA 1W9VA 4UFJA 3CUGA 4C7GA 4CU7A 3T0BA 4JFWA 5BXRA 2JALA 5LA2A 1VF8A 1W99A 1GZJA 2Y6HA 1UD8A 4ET7A 4FF5A 1D7FA 2QQIA 3UCQA 1U33A 4Z2IA 3EDDA 1EDQA 3CUJA 4BA0A 1GOHA 1JI2A 3ALFA 3AICA 3PTKA 4U3AA 1W2PA 5A6BD 1LL4A 4OUEA 3CUIA 3FW6A 4E4PA 2ORZA 4TXWA 2J7CA 4ML4A 2QHAA 4WIWA 1FHLA 2YBUA 4X9YA 3W25A 1GOWA 3WSUA 2RGMA 2FGZA 1UA7A 3W28A 1V0MA 4DWSA 2VCAA 1VAHA 5C8BB 2W5FA 2DSWA 2XGBA 3PTMA 1XV8A 4DM1A 1J10A 4M81A 1GHSA 1IZJA 4PUEA 1CPUA 3K8KA 4GXPA 3UR7A 3WDIA 2WAGA 1CXEA 1W1YA 1E6PA 4E8DA 2W3JA 4UOQA 4A4AA 1US2A 3T2OA 2CERA 1RP8A 5D8ZA 1ZBKA 2WNWA 1HJQA 1JF5A 2YG0A 2GK1A 3WQ5A 1JIBA 2VVNA 4J7RA 2GVYA 2O9TA 5I23A 1HL9A 1CDGA 2XOMA 1MXGA 2CETA 3WELA 1UG6A 3A4WA 4GKLA 3S2CA 2W94A 5BXTA 5BWFA 4FLOA 2BXZA 2W95A 1MW0A 3LEGA 2VX5A 4OOUA 4JFTA 3VTRA 2GJXA 2G4FA 4QAWA 4JL2A 1C92A 1UR1A 2QV4A 5CPQA 2YDSA 4PMNA 3NUKA 4Z2KA 3SUWA 1UYXA 3T2QA 2YA0A 5DMYA 5I6SA 3K1DA 4AZBA 4FMVA 1L8NA 5JMOA 1EQPA 3VNZA 4B3LA 3TTQA 3W6LA 1EQCA 1GQJA 2WZIA 3BSHA 3M07A 1MW3A 4IPLA 5A6KA 4W5ZA 2BY3A 1HJSA 5HPOA 4UQDA 3SKVA 3L4YA 2ZEXA 2J7MA 4AXNA 2XIBA 2J8FA 3BMWA 5D9NA 3WD3A 4D1IA 2DT1A 1GNYA 1PIGA 3G6LA 2DSUA 1EDGA 4KRTA 1B3WA 4JL1A 3PUHA 3T0DA 1H5VA 1V08A 1E9LA 3AHXA 4BF7A 2E31A 1CLXA 2WKGA 2YB7A 1JZ3A 1MQPA 4QPWA 4ACZB 2GJPA 1W91A 2B31A 3A4XA 2WVVA 4JKMA 5EJZB 4FK9A 3SCWA 4OBRA 4BS0A 4WSKA 3WIJA 4DWSB 1GOMA 1EO7A 3VVGA 3LE0A 1C8XA 2O92A 2WMFA 1GOFA 1F4AA 4RN5A 3ECQA 4AD2A 4BZYA 1V02E 1L7QA 3WNMA 1R7AA 4YHGA 5I77A 5HDRA 1UUQA 1NOWA 2Y8VA 1R86A 4RE2A 1BG9A 1GVIA 4WSJA 1KR1A 4GO9A 4XUQA 1JGIA 3BLKA 4PCTA 2VL4A 5LA1A 4LGXA 1NP2A 3MMDA 3NJVA 1VEMA 4UFKA 5DO8A 1XPWA 5LA0A 3BAIA 3BCDA 1KXVA 1D3CA 4DUXA 5JBDA 5EB8A 5HXMA 4XV0A 4CU9A 1VFMA 4P8VA 2VCBA 3FXYA 2CNCA 3K75B 2E4TA 5I5RA 1FFRA 1GU3A 4A44A 1GCYA 2PI6A 2DIEA 3T09A 2QQLA 4D6HA 1IQDC 1VB9A 3GXMA 2BY1A 2J79A 2V3FA 3F5KA 3IJ7A 1CX1A 4U5IA 1D2KA 4ZENA 4NZCA 4NSBA 1SFSA 1UD3A 2MANA 1QBBA 5A1AA 3WBAA 4M56A 2A3EA 2PF0A 2V5CA 3PUIA 2W4XA 3WBEA 2WZ8A 4JFUA 3VM7A 3BLPX 3VDAA 4PTXA 3NRUA 2G41A 2ZUSA 3N12A 3KL5A 5G05L 1PX3A 1MWOA 4S3JA 4AIUA 2XHYA 8CGTA 1XC6A 2D1ZA 1OWQA 3U37A 3N11A 1KGXA 3GNOA 4GWJA 2UY5A 2Z4FA 1JFHA 1I1XA 5A94A 2ZUUA 3CZEA 3PHAA 4KGLA 4U31A 1HKIA 3AZRA 3BGAA 4F8XA 1K9EA 1U30A 1UQZA 1B90A 4P8UA 4L0PA 4LXFA 3N13A 1JU3A 4P02B 3WEOA 1GONA 2YOCA 3CHDA 2RV9A 2BHUA 3D5HA 1Q6EA 3LPFA 2WXDM 3QGVA 2Y24A 3KL0A 5D9MA 3I3DA 2FHBA 1E55A 1MXDA 1UR4A 3IB3A 1N82A 1NWRA 3I2KA 3VIKA 3NDZA 4AG4A 3OEAA 3MO4A 3M46A 3L4VA 1ULOA 2E9BA 5BXSA 1GHRA 1CXIA 3NCOA 2D22A 2VX4A 1FP8A 1OD0A 3SCTA 4M8UA 2FGLA 1BYCA 4EANA 3FHQA 2WSPA 3BSGA 3AS2A 1ZBCA 3FAXA 4UQBA 1XNAA 1L0PA 1DEDA 1H4PA 1R64A 3VOCA 5CXPA 2J1VA 5CQ1A 3AZSA 4Q7NA 4XUOA 2F8QA 4UTFA 1BQCA 3UG5A 4AW7A 4AIEA 2Y2WA 3OG2A 1JAEA 3WNPA 2VQTA 1E71M 4D6IA 3ETPA 4J27A 4Z2JA 2UWFA 2WHMA 4V28A 2ID4A 2V72A 4F9JA 1OM0A 4LYQA 2VTFA 3SUVA 2CKRA 4CVWA 3W29A 3IJ9A 4CN1A 5FD0A 3SEPA 1Q6DA 2QQKA 2D0GA 4LPCA 1WZKA 2WVVB 3VMNA 4H8UA 2BNJA 1E6XM 4A3ZA 2JFEX 1BGAA 1ZJBA 3WD4A 2AAAA 1E70M 1H0GA 4DEQA 1UD6A 5CSUA 1CENA 1D7PM 2DCJA 2VJXA 2YFUA 1M04A 4ATWA 3ARVA 2J7BA 4PSRA 2EPNA 1O8SA 1C3FA 3NJ3A 2RJ2A 4UOZA 1W9DM 4QX3A 1TA3B 2V3DA 3GNRA 1H1NA 1BLIA 1C8QA 4ZXLA 1Q6FA 2J1UA 1HP4A 1VBUA 4ZFMA 3EDFA 4W88A 4AZ7A 1WO2A 1HJXA 3T2PA 3BMVA 1GOIA 3OLDA 4M29A 2E40A 1SMDA 4WKAA 3AYRA 5FCZA 5AYIA 3CH9A 4WKHA 5M17A 5A8NA 4EKJA 5BCAA 1CXHA 4W93A 3PN8A 1GUIA 3GXDA 3GM8A 3PZUA 4R5EA 3VM5A 1ZB5A 3AXIA 3F5LA 4MJ2A 1A47A 4HU8A 4UZSA 4W50A 1VJZA 1VEPA 3VD9A 2WANA 3I2HA 1CIYA 2O9PA 2VRKA 1E4MM 2XWDA 3PZTA 4MNLA 2XQXA 4KWUA 1BYDA 4CU8A 2KD7A 4H04A 3WUGA 4AIOA 1MPXA 3ACGA 2B9VA 4GPNA 2VMDA 1R87A 3T0AA 3QHNA 5DQ0A 5C7GA 5HOSA 4P8XA 3SCSA 2OKXA 1JAKA 4BK5A 1JZ4A 7TAAA 1E73M 1H3GA 3UNPA 4JHOA 3UERA 4J3SA 1V3IA 3O9NA 3WDJA 3GBEA 2ZX9A 4QDSA 3ZT6A 2WYSA 3WENA 1UYZA 2C8NA 1SR0A 3FY1A 4V27A 1CZVA 1X1NA 4UFHA 4CGTA 3ZR6A 1JU4A 1YQ2A 1LJYA 1V6XA 4ZXOA 5JR2A 3ZJ6A 3GXFA 1UD5A 1CIUA 3U57A 1SHWB 1CGYA 3CDZB 3WKZA 3SCRA 1V0LA 1MVYA 2Y8KA 2WC4A 2IXVA 1E6SM 1BG4A 2XSBA 1KWKA 1UKQA 1B3XA 2BFGA 2D0FA 3CZKA 4UFMA 1W2VA 3PZNA 1ISVA 1UY3A 4HMCA 3I2JA 1ZL1A 3VU2A 1E3ZA 1XD1A 5A3HA 3B9AA 3NJXA 2PWEA 2J62A 1E1FA 1K9TA 3WSOA 2DT0A 5A6LA 3GGLA 5ABFA 2CESA 5I78A 2EQDA 5A6SA 4CD4A 1XSJA 2WCSA 3NNGA 4LYPA 4E2OA 1ESWA 3T08A 3I2FA 4XB3A 2WHJA 3BN6A 3CUFA 4UOJA 2YJQA 1QBAA 2GUYA 2Z1SA 2G8ZA 1UD4A 2DH2A 2F61A 2W1QA 4C7FA 4ARXA 4TTGA 2XM2A 2ZXBA 5A8QA 4JKLA 1DWJM 4GINA 3RMEA 1XH2A 4MJ4A 3W24A 3W37A 2XONA 1CXLA 3ZQ9A 4D71A 5EFFA 1BPLB 1QNOA 1UQYA 3DYPA 4MDOA 2J47A 5EFDA 1IT0A 4M4PA 2YBTA 2XVPA 2W63A 3A3HA 2DQXA 6CGTA 4W7VA 1GMMA 2OLHA 3CMGA 2NW0A 4W8JA 5LCWL 2D2OA 1OIFA 3ZMRA 4HMDA 2HLEA 4JAWA 3WY1A 1W9TA 1PMHX 1TVGA 3A21A 3UG4A 4MAVA 1V0NA 1C90A 1B31A 2YDQA 1OT1A 5TD4A 1AVAA 1G01A 2DIJA 4J3UA 2J7DA 3GXIA 4QFUA 4TX8A 4Y7EA 1DWGM 4OBSA 4WKFA 1Q6CA 1NOUA 4FLQA 2X0YA 5FIPA 5D9PA 1GQLA 3PZGA 2BS9A 3OLIA 4XUNA 4F9DA 2EIBA 4MPKA 1KGYA 3IAQA 4PMZA 3WQVA 4P7NA 3J7HA 1LG2A 3BAWA 4TOQA 2DPEA 4GZ9A 2VMEA 4DM2A 1PX8A 3WH6A 3MV01 1UKPA 3SCQA 2CCRA 3PZIA 4GI8A 1K9FA 1MFUA 2JD9A 4KI5M 3ARUA 5CLTA 4Z2GA 1A3HA 3A7QA 2YLAA 1BAGA 1GVYA 1K12A 1UYYA 1GW1A 3DECA 1X6LA 2PQSA 2EBNA 1UZ1A 2DSKA 4MAZA 1NARA 2XVGA 4JFVA 1T2XA 1JD7A 1OGGA 3AIBA 2YC4A 1OBAA 2Y6LA 4H7VA 4J3VA 2OWXA 1GOGA 3IJ8A 3U7BA 1VIWA 3W82A 3FL7A 3GBDA 4AD3A 3POCA 4W85A 1VENA 1W0NA 3GNPA 2J1RA 3WF4A 4HU0A 1JG9A 5C71A 4UFLA 1JD9A 4PQQA 2WO2A 1UH4A 2BVYA 5A2CA 3K77A 1RP9A 4S3KA 4ZY9A 2D3NA 3DYOA 3WFZA 3AISA 2ZUNA 1GOQA 4C7DA 2VT0A 2E8ZA 3AMKA 2W67A 1DYOA 1W8OA 5JXGA 3I3EA 1GNXA 4PMYA
chains in the Genus database with same CATH superfamily
4DZHA 1ZZCA 3HBKA 2RFGA 3V0AA 1FCBA 2ARXA 1W2NA 1FWTA 1D9EA 3K4AA 3G0SA 2OT1A 4OVEA 1VMFA 3PAOA 3KLLA 3QZ6A 4GY1A 3WG4A 3U4AA 4AVVA 1EDTA 5EHDA 5AOUA 5CH9A 4E4SA 2VWTA 1KM4A 1TR9A 3G1RA 2WWSA 3VGFA 4A3RA 5DUVA 1C28A 3LXAA 4MG4A 4Q4Y3 3PJYA 4BIOA 3BIWE 1MEHA 4IPIA 2GNMA 2UYAA 2Z1XA 4DXRA 4AXKA 5FPVA 1PIFA 1A8DA 4JDMA 1FOD3 4C1XA 4K38A 2G3IA 3ES4A 3RLVA 4QGMA 5I0UA 4ERGA 1XR2A 1JH5A 1MMFA 1YADA 1JUEA 4RL3A 5LBEA 1A80A 3HJZA 4LBNA 2DT3A 4L6DA 2DURA 3PSWA 5FQ0B 2P17A 1K77A 5L9RA 1V79A 1M1BA 1ZS2A 2IQTA 5CSSA 3W01A 1VBRA 4N7QA 2DYCA 1SJCA 1VB2A 3B93A 5DAPA 2XJVA 1YHTA 3ZYGA 4JDNA 2GH2A 4XF3A 4JNYA 1W9WA 1JYNA 3M1ZA 1YQ8A 2F6XA 1FPN3 2VO5A 3Q9OA 2XU2A 1N3OA 3D5OA 4RHV1 1OPOA 4YW4A 4QPGB 5KHGA 2ALRA 3AQUA 4A3HA 4BY3A 2Y89A 1QW7A 3VGBA 4MWAB 1LTDA 2OPWA 4MFDA 3VGIA 3VD5A 3AJ7A 1F6KA 1GPWA 5FAGA 2XGZA 5GNZA 1GG1A 1NWUA 4QJ1A 2EIDA 2PTWA 2W79A 1AYM2 3RIKA 3VILA 1SZFA 2R32A 4A41A 1XG4A 2EPLX 3TMLA 4Z0JA 5C7VA 5L36A 1YNPA 5KINA 1ASJ1 2E5CA 2OWCA 3B9DA 1J0IA 2ADEA 4LE3A 4HK9A 4RS5A 5I8TA 1TV4A 1QJY2 1FWDC 4UXAA 2BGOA 3K51A 5LRSA 3I2OA 3G8RA 4UTJA 4XMIA 4WVXA 1KD0A 1FCQA 4Y9OA 1W3JA 1NIUA 4HPNA 2I17A 4NJJA 3QBQA 3MDUA 1CGPA 1ZRRA 1IQ8A 1N55A 2CIPA 4CDXA 1HKKA 1W1B1 3ASIA 3UFYA 4O1CA 3A9BA 3TNOA 1L6FA 2YL6A 1V02A 4IJCA 4F0SA 3F4NA 3VZMA 4IQJA 1SO6A 3OIHA 3HGJA 4Y4RA 1UUMA 3OZYA 1EP3A 2D6KA 3PTRB 3MCOA 4RW5A 5FMBA 1OT5A 3AX4A 5B4NA 5KC5A 1UIPA 5F9TA 4MY9A 3T1GA 2RG4A 3QV8A 3AIEA 5AHIA 4E3VA 1MZ6A 1QNVA 1CGTA 1LHVA 3I59B 2E3ZA 2DDXA 4XK2A 1FP9A 4NIDA 2CZVA 2WZR2 1KD7A 3NZ1A 4GB33 4U10A 5E9XA 4I09A 4XD5A 3LEKA 3PZQA 4WZCA 3C2OA 1GFF2 3HPXA 1QOQA 4K40A 3GXNA 5LNRA 2CZFA 1TZ7A 2AOSA 2I57A 5M0TA 1CXKA 1ZBA2 2I14A 2HWB3 3OGVA 4MZYA 1MQQA 1O7FA 3VKCA 4B92A 1RV8A 4K37A 3HA1A 1TPUA 3E0VA 2BOIA 3ITQA 3HWJA 1JCLA 4TYSA 4JTRA 4A6GA 2ZGLA 2DVTA 5EA9A 5D05A 4IESA 1O4YA 3SCHA 5CKMA 2A3LA 3TOJA 1HT6A 2MNRA 2ZE0A 4AZCB 1OX5A 3W23A 3AHVA 1P6CA 2O7QA 2XM1A 3HG5A 2D0HA 3DFPA 1XNKA 3OGRA 4XTMA 2VZUA 2QE3A 1RUI1 4XUPA 2Q8CA 2NQZA 2DZTA 4IH3A 5F5AA 3SH4A 3VGGA 4ITCA 4WM7C 1W54A 2VOTA 5FO7B 3E02A 3V0UA 4CLMA 5FJHA 5ISLA 3UJOA 3ZYRA 1SBDA 2P1FA 5GZGA 4E38A 1PMJX 1F6PA 1G94A 1RQBA 1Z41A 2DZXA 1KRAC 4P5UA 2W6RA 4TV5A 2ZDRA 1H11A 1GORA 2E0PA 2R062 3EEGA 3IV8A 3SQOA 1S0DA 5KZ6A 1DP0A 4DPPA 3L4XA 2VZTA 3OPZA 2VEKA 4LB4A 1A0DA 1NFGA 4IV1B 2LS6A 4AHXA 3E0WA 2ZZQA 2VNOA 2F84A 2VU9A 4IG2A 4DBWA 4DEVA 3Q8CA 3W1NA 1UIJA 3HGRA 3BTXA 1Y0EA 3N2OA 1JFXA 3N4AA 3AMGA 5U4NA 3HPNA 3WDWA 2DU0A 1H8TC 1I9CB 1ZLPA 1G69A 4BKNA 2QF8A 4K1GA 2CLFA 5FIXA 2YYUA 3L4WA 1U5ZA 1KXHA 2VGBA 3CU7A 2QJIA 1ACCA 3NQGA 3AMQA 2RJLA 4DWSD 3N9NA 3P0WA 4XFIA 1IXOA 1RYYA 4K1WA 4DPQA 5JUVA 5CPOA 4TMBA 3QFWA 1OT2A 3WQ0A 3THUA 4LYRA 1JDAA 1ISZA 2EA7A 2GDVA 4M7TA 3GY1A 3HAGA 1B09A 2A7AA 1BVWA 1RCXB 1VC4A 2XPKA 4L11A 4IFKA 5J5RA 1HKWA 2ET1A 4HB7A 1TJRA 3I7SA 5K0UC 2W62A 2FH6A 2Y88A 4W7UA 3BVCA 4LOCA 3EMQA 3L21A 3BTNA 3ABSA 4Y4YA 2Z7GA 3M5YA 1XH0A 3WNLA 4IPJA 5EYWA 1LM1A 1VBC3 1NY71 2Y6KA 3KWSA 1ND2C 2ARBA 5FYHA 5T5PA 2XZ9A 3LLXA 1XDLA 1GANA 2UYBA 4UUIA 1TMLA 4HHLA 3APBA 3WH7A 5FJKA 1VBC1 2UY4A 4EVZA 3LAGA 4IGNA 4CDQB 4H2AA 3PZMA 3TNPB 3CM4A 4UTTC 3II1A 4H2HA 3O1RA 1V4YA 1W6MB 4OLLA 1Z0HA 1NCQC 1PPIA 1RUF1 3ABRA 3ID7A 5J48A 1K3UA 4LUSB 4Y9PA 3J8F2 3OEBA 3FMGA 3VMOA 5FSDC 1OSGA 3ZFEC 4IFRA 2Y6FA 2DQWA 2HRWA 4OGZA 5E0CA 4QJ4B 5HMEA 5IATA 5DXXA 4K8HA 2EPKX 3LYEA 3MUZ1 3NM3A 4PEEA 1JOJA 4KKXA 5T3NA 4JNMA 1GQPA 3AMLA 1M7PA 3O3RA 5CBBA 1KDKA 4ZSTA 1RXGA 3N34A 4HONA 4O61A 1AG1O 4DXXA 4MJZA 3NWKA 3BJSA 3TJ4A 4AFBA 1O94A 8RUCA 3PBGA 4XKYA 3BAYA 4BXSV 2HJIA 2NWSA 1PCKA 4ZZ5A 2VC7A 4GUIA 5KSWA 2V09A 1MEC1 2GC3A 3A22A 2Y8UA 4WD0A 1HRV1 5T5LA 1DPMA 2YYTA 2E68A 1WLDA 1WMFA 3OJGA 1TWZA 1CZSA 1IZCA 4E4UA 4HKLA 4HXCA 2C71A 5F5IA 2JWPA 1DXEA 1H7WA 1VCFA 4MKSA 4XBSA 2RR11 2QQPA 1C7TA 4ML9A 1URXA 1JUIA 1W3HA 3S1VA 1CD3G 3PSVA 3NIYA 4XABA 3ERPA 3FBYA 4N02A 4IHCA 3LM3A 4QWNA 1CZTA 4HSLA 3ZXLA 4AZ5A 4YU1A 3U14A 2BOFX 3QGKC 4LBQD 1XRVA 1T6BX 4BA6A 1DV7A 3H42B 1UXXX 2PHLA 4Y1UA 3FJSA 1BTCA 3BLEA 2QBXA 3CPGA 3WQWA 4UYBA 3VZZA 1V6YA 5CG9A 3CUXA 2PODA 5ACA1 2LROA 3BPZA 4C0HA 2VMCA 4PLNA 4XBKA 5K9YA 1N8FA 4IMAA 1K5MB 1QPNA 3UXDA 4W4QA 1TE1A 4XF0A 2QF7A 3GNDA 1TWIA 1B3YA 3QZEA 1H4GA 3UVIA 1OUSA 4LIVA 1FA2A 2GK1B 4M1BA 4J3XA 3PVFA 3UPWA 2VM8A 1JNEA 1S5MA 3O0VA 3B8IA 3TEVA 4CCEA 4XDQA 3RCYA 3M43A 4P08A 3EXUA 2AGKA 3LQLA 3PM6A 4Z08A 4Q4W3 1R7OA 5HMSA 3USZA 4BFAA 3LHZA 2WHKA 2FZMA 4CYDA 3P3BA 1G1YA 4E5TA 1UKOA 1R3RA 3GTNA 5JXQA 3SY5A 3RVHA 1UU5A 4QMAA 3M7AA 4I9MA 2A3BA 3NW4A 1CJDA 3PU8A 1Z9AA 3ENLA 1OZMA 4S38A 4WVWA 2VOVA 5AKQA 1RSCA 1W5PA 4HNTA 2BHZA 4AVOA 2Z1WA 3WZ1A 1EO5A 1GVOA 3ARZA 3HQUA 2VVFA 2VZ3A 3EA2A 3HNYM 3TC6A 1XE7A 1BSLA 3VNYA 4Q6JA 1HQLA 4QITA 1KM3A 1DGWA 4IE7A 2JX9A 4DO0A 2F2HA 1EBGA 2X8RA 1P0DA 3ZYFA 5DANA 1XYPA 1K02A 1S39A 2PHWA 2FPVA 2A6LA 1DQ2A 2ZMLA 3GH4A 3MWCA 1N2VA 2FMDA 1VGAA 4MUZA 4AD0A 4LMFA 2VEMA 5H9QA 1UZYA 3C7OA 4J25A 3UPMA 4LNYA 3WMBA 1ZCCA 2FHCA 3ES8A 3BURA 5EKYA 4KW2A 4X8NA 4JQTA 2ABAA 4YTTA 3J7MA 2RS11 2FMNA 2GQ9A 3POYA 4IISA 3VKOA 3NQFA 2VOKA 2YL9A 4TUFA 2CWSA 5CGTA 4GWNA 3WNOA 2DFAA 3NJZA 3WLJA 3ES1A 1BD0A 3TOPA 2AKZA 3SR7A 3VIMA 4D6FA 1REQB 4L4OA 4MF4A 5D2AA 1JQXA 3EBRA 1FX5A 1ULEA 1ULPA 3CTTA 1WLTA 3UXKA 5GPRA 4PL1A 4AFAA 2WMKA 2VRQA 3BAKA 5H9SA 2BV9A 1K45A 3W1RA 3VDBA 1PWMA 3P5BA 3BKZA 1IS6A 3VIIA 1RXOB 4UIOA 4YWAA 5T5OA 1LWIA 4I5XA 3L2MA 3P6BA 4FX8A 4AEFA 4H41A 2IS7A 4LV4A 4O1FA 3WYZA 1LOLA 4JIHA 2QPUA 3DFHA 2JK2A 4P5YA 1EX1A 3BDKA 1S3TC 4J3TA 2VVDA 4C6EA 1ITQA 3QH2A 4DUWA 3M4FA 1ST8A 3EXSA 4M5PA 3W00A 5D2VA 4AHYA 1APNA 1BVZA 1VR3A 3CKHA 4ZO9A 2XFFA 5E9AA 1JI6A 3IVUA 1L7RA 2VMGA 3CHVA 3BLLA 2G19A 2H3BA 4EN0A 1XLAA 4A7KA 2EICA 3H55A 2Z2AA 2A6VA 2J78A 1HN1A 3P82A 5A3OA 3MTWA 3B04A 3OB8A 2VUDA 3S6TA 2PCQA 4PQ9A 3BANA 3GG1A 3P14A 1CECA 2EIEA 2Q3RA 5K4ZA 5ABJC 1WA6X 2WNVA 5F2SA 2WB5A 3AC0A 4YM0A 3MBWA 1Q56A 2VFEA 1PGSA 1OVSA 4OBTA 1DDLA 4DJEC 1J96A 1JCXA 4ICNA 3KVJA 2Z25A 5A2BA 4A6SA 5JBEA 3BGGA 4B3KA 2WKJA 5JIUA 1IIHA 1LLWA 2QCMA 4HCHA 1EEXA 4DYKA 4UTUA 1E9IA 3CBNA 1WXJA 2GP5A 2DBNA 3SCVA 4CDXC 3R4SA 2PDLA 3MUCA 2PFWA 3NOYA 3SIMA 5CAZA 5EZWA 3F7JA 4B8EA 3GCWA 3ONBA 1ISYA 4I9AA 4X6QB 1FPN2 3QR3A 4XAGA 4YIWA 3RRXA 1LL6A 3AXHA 4XHBA 4Z17A 4Q5OA 4UFIA 1OINA 3MP5A 4TVUA 4RQPC 1EGVA 3GTIA 1TX0A 4BQ1A 3T4HB 4KRZA 4XBJA 4XKMA 3CJIA 4HP5A 3SH5A 3ZSKA 2PLV1 4AU0A 4RGGA 3NZGA 3AHZA 1E0WA 4LE4A 5C3RA 4HZ8A 1E43A 4MUVA 4AVNA 2W1WA 5CSRA 5JZGA 3H70A 1RA0A 1NZCA 1FWRA 3UVAA 1TQ5A 2GUBA 2PLV3 3RX4A 1Z42A 4I9JA 2YXSA 1RD6A 2X1IA 4LHKA 3KMHA 3VIFA 5FP4A 3RX2A 2QCFA 3OZPA 1TME2 3G1YA 2P50A 7TIMA 3N15A 5A8GA 3PJTA 4LUSA 4DNMA 4WJXA 1ZRIA 1J1TA 2XJSA 4FPFA 4QR6A 1AR83 4K8EA 2BGPA 3FGCB 1QH6A 4Y5TA 5CLWA 5I06A 1QKQA 5BNNB 3AP5A 1HJFA 3NNFA 3W07A 4AC1X 2DUZA 1EXPA 1UXZA 1KFJA 4R7OA 3QC0A 4MLRA 3OYWB 4IIDA 3MV11 2ZX2A 4D69A 2WO1A 3LLDA 4JXCA 1RUC3 5DRCA 4UZUA 2PHRA 5IFTA 1PZ0A 4URTA 3W27A 4XZLX 4NVPA 2BGNE 1A0EA 4W8LA 4MDPA 1QPKA 4Y8EA 3T3YA 4YFWA 3FHAA 3S8HA 4NHYA 3WDHA 2V2CA 3LBOA 3ALGA 5CISA 2WNQA 4ZVJA 4PBOA 3D4KA 4KCUA 2R1KA 4ZTXA 1X8CA 3IUDA 2CLPA 2ZOXA 2WLYA 4ZE4A 2AQOA 1XYZA 3LGGA 4N6FA 3OVPA 4TVCA 3MIGA 1Q3NA 3E0FA 2Z42A 4DBUA 4ZOBA 4BIFA 1DOSA 4UMBA 4XF1A 2ZCGA 5DAWA 3S5SA 4AK3A 3SKJE 2PMWB 2Y4SA 1W9UA 2VM9A 3GZAA 3QLDA 1CR7A 4LUTA 4JTGA 4S2HA 4I6KA 3AWOA 4ASMB 5KXBA 2AEZA 2IVJA 2E6AA 2WC7A 4AQTA 4AZHA 1BBT3 4XCAA 1VFUA 2WZMA 3DUGA 3QOKA 2P3KA 4NZJA 3LUTA 3WD5A 4Q8VA 1V6NA 1P5BA 2BY0A 2FJKA 2OKOA 4CD6A 2AZ5A 4LKEA 3CASA 4PUDA 4X0NA 2PSNA 4PBGA 2J4GA 4U2YA 4WGXA 4BCUA 1K7FA 4XVEA 5LK5A 2NUXA 5IOBA 2W68A 4EE9A 1H49A 2OEKA 4WDXA 1VRH3 4Y20A 2FKPA 4WLCA 1VBE3 4Y33A 1W90A 1J9YA 4H8VA 5BOOA 3Q4DA 4DJFD 5BXPA 1TJ2A 4OUSA 3GDBA 1KCXA 4JTFA 3DH7A 1JXKA 1HRI1 3CC1A 1UA3A 2QQUA 3MS8A 1EA9C 3HNMA 3KVBA 5IDIA 3CAVA 4HETA 2ZHNA 5HK4A 4NJHA 1CEOA 1QJU1 1UHVA 2GOUA 1SACA 2WO3A 3MIDA 1WE5A 2XWJB 3DOPA 4GZEA 3U2CA 1B4EA 3IK4A 3N35A 3C2VA 3O15A 3TQ0A 3HPFA 3RMXA 2C24A 2XG9A 5J8LA 1VBD2 4QLKA 5FZ4A 1ENSA 5IHSA 3W53A 3MW7A 1MS1A 4JGYC 2C6SA 5RUBA 2X05A 2HTMA 1JZ6A 3R6IA 3T07A 1L8PA 3BOLA 4AD5A 2GJRA 1UMHA 1KM2A 2GSEA 5FOBB 4QNWA 4AWSA 4Q4X1 1XUUA 1AR93 3HV8A 1NDVA 3NSXA 3CO2A 4A7ZA 5I2UA 1UCXA 1W3LA 5D8WA 4ERIA 3O1PA 3RJRA 3B0VC 4N53A 1TKKA 2G3FA 5TF0A 3EGJA 2NMOA 1I8JA 5CFDC 4LKSA 4CUBA 3RZMA 5C6CA 4YGEA 1KB3A 1EV13 3WDRA 2BASA 5D2YA 5FUPA 4QEEA 2V5BA 4XZNX 4JQ4A 3SQSA 4KERA 1XSRA 4FPGA 3ARXA 4Q4V2 4O19A 1N7KA 1VBHA 3LDVA 1WXYA 3KEHA 3NQ6A 3H1WA 1CLKA 1GQIA 3UP8A 1GYMA 4BWLC 1VJ2A 4PHZA 3VIOA 2ZX0A 1GOOA 4D72A 4MB3A 4L92A 3DIPA 2RM22 1X6NA 5L7OB 1BRLA 4FI4A 3APGA 4IXHA 4U5KA 1FHUA 4DO6A 3N9LA 1HX0A 1YYAA 1OC5A 4QAIA 3ITLA 3KWXA 4BDVB 1RALA 1QO5A 1OOPA 1QNRA 1HRV2 1FWGC 2ZEWA 1JCJA 1PTDA 1RIRA 3WF0A 1FH7A 2QZ3A 3ILNA 1RA5A 5EBAA 2OYMA 1PK6B 1J0HA 2WJFA 4YVVA 1KTNA 2AC1A 5J7MA 1PKYA 1OLRA 3CTLA 1E5IA 2I2SA 4QXCA 3PZOA 2X09A 2Y64A 1TZ9A 3WK2A 2WM1A 4AY1A 1A53A 4HZ7A 4FTEA 2POZA 3UXLA 5E5CA 1S38A 1GKRA 2CHHA 5EBUA 4GQGA 2WVTA 4CNOA 2NQJA 4D7YA 4RS5B 2CLLA 1M7JA 1NX9A 5JXHA 3DERA 1LGCA 3E1F1 1DGRN 2X53S 4AGGA 3I3BA 1EC8A 2H3DA 1A5NC 2AEYA 3P7YA 4KCTA 4REQB 4PLMA 1QH7A 3FYYA 1DORA 3ZXFA 1YXWA 2ZX6A 5GZEA 2IXUA 1UX6A 6A3HA 4HKPA 5DPNA 2OT7A 1F5ZA 4YVWC 3W1QA 3IARA 4DNHA 4YTQA 3M7WA 2W61A 4WHBA 1LQAA 2E77A 2XIJA 4GIQA 1GOKA 1TVPA 3N17A 4YM1A 5C2CA 1QJU3 1COV2 1DIWA 2VC9A 2IQ0A 5DMLA 4PT6A 5FWEA 3EOEA 3IDBB 2FYMA 1EUUA 2XDVA 1QI0A 4X6RB 2ZX5A 1IR2A 4IJRA 5FY0A 5AHNA 3LGEA 3WLHA 4Y3OA 2HS6A 3F2BA 4DY5A 3GAKA 1HXS1 5TSWA 2OSXA 4BF5A 4XAYA 4QPIC 2XINA 4QDQA 5IBXC 4UTKA 1R082 2NV2A 2XIIA 3HG2A 1SJAA 5H1WA 5CYYA 2TEPA 1SJDA 3GVWA 4XFHA 1Q43A 3R25A 2MUCA 2FDGA 4TZDA 3V5CA 1QK0A 4WM8B 3W7PA 3TYUA 3VNKA 4AVAA 4HJWA 5JOZA 3D3FA 3LIHA 4IEZA 4AQLA 4XZUG 2CDPA 4RE4A 4Y9NA 3T8LA 1O91A 3B9CA 5FCCA 4CN6A 2IFRA 1JEZA 2WAOA 2H6BA 1R9XA 4RQPB 3DN7A 2VENA 3HM7A 4EWDA 3XIMA 2A3CA 3TA9A 1CN1A 2XFWA 2O0OA 2V4VA 1H2JA 1JXJA 3UK9A 3BTZA 1AW5A 1CCWB 3MP4A 4X9SA 4O65A 2IKIA 3UF9A 4Y2WA 2CLKA 3BQ6A 4Q4KA 1O3QA 1HL8A 3N6HA 3BICA 1HKVA 1V9U3 3LB0A 2V3EA 3O0WA 1UZVA 3LQCA 1JW6A 2RVAA 1PAMA 2GC0A 1XE8A 3ZSMA 3ZIZA 4GH3A 5ECUA 2D3RA 2OX4A 4JX0A 5T52A 4E8CA 3AHYA 3ITOA 4BJ0A 4QTGA 3S9ZA 1FY6A 5AFBA 1ECEA 4YVSB 3B7MA 1V6WA 4H1ZA 1WDQA 1PK6A 1UY4A 5C8CA 4PBPA 3AS1A 2A21A 3L9JT 2OO6A 4ZQRA 2X2YA 3W6MA 3PU3A 5B4XA 5EPAA 3Q65A 1KRCC 4AUBA 2EEXA 1GUVA 4GZJA 4QM1A 3VZJA 3B8SA 3RM8A 3VC6A 2OSWA 2VC6A 2V2DA 3WD2A 2PWHA 3U5YA 5ABEA 1W6PB 1DWIM 5L6UA 4LCSA 3PBYA 1LGBA 1JDCA 1F8VA 4GKTA 3GNXA 1LWJA 4V2XA 3K4DA 2PDPA 2ZTKA 1X6UA 2Y62A 3BO9A 5JCTA 3LEIA 3KHCA 3L4TA 1W9VA 1VYRA 1JXNA 1SBFA 3KDOA 2VXNA 3GG8A 5LA2A 5AHMA 3EEZA 1RUJ1 2E7AA 2Y6HA 2ZA3A 4XWUA 3IEBA 4EPBC 3LSDA 2WKKA 3FV9A 3ST7A 4Z2IA 4AEKA 1BEV2 2RS12 4ZA0A 3GHUA 3CQKA 4NP7A 4Y9MA 1W03A 4ZQMA 4LYKA 1TQXA 2ORZA 1EF3A 1S3HA 4WIWA 2A3XA 1QQP3 3KB5A 1QXJA 2FGZA 4Y6GA 2IW0A 2YPJA 4DWSA 2TSYA 1U12A 1Z44A 1VAHA 3V0SA 4BHYA 3NV2A 4AE2A 2DSWA 4FO9A 2XGBA 4EF8A 5BNNA 5HMFA 4PGLA 3V0TA 2JDPA 2VOWA 1B35C 4AEDC 1J10A 1M3UA 4PUEA 2JKEA 3NNMA 2E67A 1IS4A 3UR7A 1PKNA 4YW2A 4KGGA 4O1DA 1E6PA 2WNVC 3PNZA 5D8AB 2W3JA 4UOQA 1A49A 4NAEA 5E1RA 4R9BA 4CQAA 1RP8A 5FOJB 3L9CA 4L64A 2WNWA 1OCNA 1V7AA 4LT5A 4DAIA 4YVSC 2GK1A 3WQ5A 4Q4OA 3SSZA 2GVYA 3QYQA 2QAFA 5I23A 3LHWA 1Q6LA 2FVLA 1HL9A 2BUKA 5C8CB 3B5LB 4Y96A 2HWD1 1IG0A 4WBBA 2E5DA 4QQOA 2FZDA 5GZCA 3UZ5A 2W94A 3QV7A 3NXLA 1WX0A 1SPPB 1NA1A 3N9SA 2GJXA 4QAWA 3WQDA 1C92A 1UR1A 2YDSA 4PMNA 1DJGA 1UYXA 3T2QA 1S2AA 4AXOA 5I6SA 4AZBA 3FKRA 3M0KA 4WDTA 2VGGA 3STEA 5AECA 2YW3A 3UJ2A 3UWZA 5FZKA 3VZYA 4WGHA 4J1WA 5A6KA 1BMV2 1FCVA 3JD72 3PF3A 2DV0A 1HJSA 5HPOA 2Q8ZA 2VMHA 2RDRA 2V5KA 2E7FA 4F83A 3L4YA 4NYYA 3MICA 4AXNA 2XIBA 5D9NA 3WD3A 3HQXA 4YARA 2DT1A 2RJGA 1QJEA 1H5VA 3T0DA 1C8NA 1F8IA 3DI0A 4Q0QA 3LA7A 4Z2WA 2E31A 2JKAA 4LAUA 4AVSA 4NIRA 5A6TC 1WW5A 3VNDA 3ISIX 4J2PA 4AEJA 3O1OA 2ZRYA 4ZO7A 2B31A 4AYUA 2WVVA 1IIGA 1RUH1 1TRIA 2OOGA 4OBRA 5FP9A 2O4QA 3KP0A 4Q4W2 4D94A 2FFCA 3EJKA 3VBUB 4GE8A 4H9VA 3LE0A 2HBTA 1TPB1 3AYEA 3PPFA 4A2UA 3E6BA 1MRAA 3GB6A 1DG6A 4NROA 4BZ4A 1V02E 5GJPA 3FDGA 3C86A 4GVFA 4RX0A 5EWSA 1L7QA 1XDMA 4FPYA 1IWAA 4MKNA 5HDRA 4C6JA 1BG9A 2P6HA 4WSJA 4C6PA 1MZRA 2OELA 1HW5A 2BBVA 2ZMKA 2TODA 4FSAA 1B5TA 2XBO3 3NJVA 4UFKA 3LCWA 1XPWA 3G5EA 5LA0A 3BAIA 3VOGA 2UWAA 3ZFEB 3BCDA 4A3UA 1KXVA 2JDKA 1D3CA 3CL7A 4DUXA 3A3XA 3WV6A 4LBQA 4XV0A 3IRDA 1VFMA 4NHXA 1A5BA 3FXYA 2CNCA 3K75B 2GVLA 1RUI3 5D2TA 2BJSA 4FBFA 5CVRA 1GU3A 2PI6A 2DIEA 4LC8A 3HPSA 2O14A 3UWEA 4ADTA 1GJPA 1IQDC 2J79A 5EMMA 4OFGA 1D2KA 3POIA 5FYSA 1HTIA 4NSBA 2FTYA 5HWNA 1G7YA 1UD3A 4QE5A 2ONEA 4A8IA 4GB32 2G9GA 2VR2A 1ZM1A 5I93A 2Z27A 2Y6ZA 3VM7A 1G86A 3BLPX 3RYKA 3W59A 3VDAA 2WJSA 3OA3A 5G2HA 5FYMA 2ZUSA 3KL5A 5FACA 5G05L 4QDWA 1PX3A 4QPIA 2X1UA 3GG0A 2BVVA 8CGTA 2Q09A 3UBPC 1XC6A 2D1ZA 3PBUA 1A3KA 1FI2A 1X50A 3A9IA 2RS13 2PC4A 1BEV3 1CONA 3ZXGA 4CXWA 1JFHA 4ZQNA 1I1XA 3I2DA 5FY7A 3AZRA 1RY0A 4H8NA 1AR81 4N9EA 4QM8A 1B90A 1K8ZA 3U2OA 5FZMA 4J1XA 3O1TA 1R30A 2GDQA 3QOPA 1R3SA 4QE1A 2ALDA 4MVTA 1GONA 2UV8G 3DENA 4UR7A 4H9XA 3SH3A 4UTWA 4MMWA 1NLRA 3QGVA 2A6NA 3SXWA 1Q6OA 3QLLA 1E55A 2FDSA 4HNNA 3I2KA 4IQDA 1R3WA 4MWAA 3U4FA 1AR63 2ZZ1A 5L73A 1W17A 2I1OA 3J8F3 3UGGA 3HR9A 3NM1A 4Z8BA 1EL3A 3PUOA 2FZ2A 2QVHA 4JYDA 3T4WA 3NCOA 4LY8A 1YQ5A 4MSSA 2VX4A 1VCVA 1QGLA 3LOBA 3GAYA 2GWGA 4M8UA 2QV5A 2WSPA 2OO0A 4DO7A 4CQBA 5HBAA 1AJZA 2V82A 1B9BA 2KA3A 2RE9A 1H4PA 2OIIA 3H2NA 2E6YA 3E5QA 1AJ0A 1BXBA 3GIPA 4KEUA 1GBGA 3IGHX 5CQ1A 4Q7NA 4LIUA 4JIPA 5K0UB 3QQ0A 3ZXDA 3CV2A 1H1MA 2R072 4H9UA 3MI6A 4A3QA 1VIWB 5CFDA 1XLIA 4EJRA 1PSCA 3OG2A 4JEJA 1K8XA 1E71M 2VQTA 3S2LA 1GZ9A 1KQRA 4XJAA 1ZENA 3U2ZA 3MVIA 1LZOA 4QHBA 2DVXA 2HDJA 4L99A 4AVBA 1F2JA 4NNAA 2V72A 4QS5A 2VBDA 1RUI2 3C0SA 2GMEA 2VULA 2Y7EA 3RU8X 4GUJA 3FLPA 3W29A 2C18A 3VBUA 4X2PA 3VFLA 4JIIX 4C6MA 4CNSA 3BGJA 3SEPA 3ZSJA 3TA6A 3VMNA 4C6CA 4H8UA 2BNJA 3HMYA 1E6XM 2ACUA 4AQSA 1EF2A 4TO8A 1J3QA 3BZGA 3VKMA 3KHDA 1ECQA 3WLRA 4HN0A 5C3QA 2IWGB 1E70M 2Y0IA 4QX8A 1XYLA 4NPLA 1UD6A 1CENA 1XI3A 3EWYA 1AF9A 1R083 2VJXA 2YFUA 2QYGA 1ZZBA 4DINB 1C3FA 4UOZA 1EAH3 3TN3A 3GO2A 1ADSA 2PP1A 3FE5A 5DAQA 3IRSA 1Q6FA 1OG0A 3OGJA 4IIGA 1HP4A 2WFF1 5L9VA 2B8MA 4OHZA 4JDBA 4XIAA 2VMIA 4W88A 1ITUA 3OBRA 1GKPA 2A6ZA 4AEDA 1WO2A 4DZAA 3C6CA 4M29A 3UGHA 3VCCA 4WKAA 2PLJA 3I65A 3NPUA 4LV9A 1UPIA 5DMNA 4EKJA 4NZ4A 5BCAA 4W93A 3TU9A 4FVVA 4QKNA 3GXDA 1LOFA 2B5HA 1JYTA 2VVEA 3ZVHB 4IE0A 3H2CA 1F3EA 5F3GA 3MJMA 4E2BA 3AYAA 1A47A 4YVSA 4W50A 1VJZA 3FC0A 2NUWA 2WANA 2VPVA 1EKOA 3I2HA 1FVPA 1QJZA 1CIYA 1E4MM 3N2XA 2XWDA 2H8ZA 2HWF1 5HNRA 1BYDA 1U5YA 1CB2A 4PEKA 4IQLA 3ACGA 1GYNA 1JCMP 4XZIA 1XQNA 1QJY1 2LALA 1R87A 1EJ7L 4LUKA 4Y22A 2QDHA 3BU0A 4NZ1A 5HOSA 2ZZ3A 2R24A 5MF5A 2QKDA 1JPIA 4EZ4A 4Y90A 1JAKA 4BK5A 3VXGA 7TAAA 1F3WA 1Z3NA 2A1XA 5M2FX 1V3IA 1XLDA 5CKQA 1DQ6A 2EG6A 3LLFA 3O1SA 2AH2A 3ZFEA 2HSAA 4RE0A 4Z92B 4GWMA 3H1YA 4QDSA 1F74A 1SR0A 3FY1A 4V27A 4CGTA 4UFHA 1YDNA 5JIAA 4OUMA 3DGTA 1LJYA 1P0BA 3WP4A 5A6ZA 1LUCB 3ZJ6A 3W58A 4Y22B 1CGYA 1NFBA 4O17A 4FPLA 2HVOA 5K9XA 1S0FA 3TCEA 4ZZ9A 4XO6A 2R043 3VBHA 1JPHA 2YYOA 1XLBA 3RZKA 3GIYA 1XW8A 1W2VA 4UTLA 2GH8A 1BTMA 4L56A 4S2DA 2X7WA 4HMCA 3RR4A 4EXBA 4LORA 5FK8A 3FEMA 1XD1A 3A3WA 4GA9A 3B9AA 4GGHA 4I9TA 2J62A 4JQRA 1K9TA 4PF5A 2PGWA 3NO1A 1G67A 5AVNA 3VBSB 5A6SA 4RGKA 4H3DA 5JI7A 4RGAA 1NQJA 3PMEA 1YRRA 2B4GA 4LYPA 2AACA 4FPJA 2I74A 3IMMA 3I2FA 5FPUA 1HX6A 4JHMA 5C5YA 3U07A 2G8ZA 2B7YA 5LKYA 1UD4A 5CFCA 2YW4A 1NCRA 4CEYA 2ZXBA 2ZACA 1QJX1 3DFOA 4R34A 3TNQA 1BF6A 2X40A 2ATMA 2Y38A 2Y7FA 3SRDA 1V5XA 4JTAA 1O4UA 4AG0A 1FDJA 2JIJA 4AOCA 1GKQA 1UQYA 1HZYA 4WY0A 5CB7A 3TIMA 3DXUA 2XVPA 3S46A 5AFEA 1LUCA 2YROA 1GQNA 2W63A 4UB9A 3LBMA 2DUPA 3NXFA 3CLPA 1GMMA 2J42A 2OLHA 5HR7A 1YIFA 3CMGA 4BQWA 4W8JA 4FHAA 3WLIA 5CKNA 3OPWA 1MEWA 2X30A 2D43A 1W9TA 1XQKA 1PMHX 2NPIA 4NJIA 4NKCA 3WZ0E 4LCRA 1UCWA 3ZYPA 1C90A 1B31A 4LW7A 4HPKA 3C0LA 5FF4A 4NRMA 3AALA 1YO8A 4J3UA 4MH0E 4O0KA 4O54A 3UJRA 3NNLA 1AVBA 5AZ0A 1F07A 5I91A 4Y7EA 1SJBA 2R30A 4JGZA 3V64A 1Q6CA 3WDXA 2IPGA 3G1FA 3GZTB 2HZGA 1AR62 4AI8A 5CA6A 5FIPA 3OY8A 3LRLA 4F9DA 4V33A 3KM5A 2VY0A 3ORJA 4PMZA 1RJRA 1TTJA 4LS2A 3BAWA 4TOQA 3QMRA 4DLFA 4WY0F 1FV3A 4GZ9A 4C6NA 4DM2A 1XICA 1RUNA 1UKPA 1AL21 2A5ZA 2IC1A 4EPKA 1KRIA 1VZWA 1MDLA 4DJFA 2JD9A 1K12A 3S6PA 4QRNA 1EJXC 3M44A 1UYYA 2ZRVA 1VE0A 3ELNA 4KNCA 1DXFA 3WUDA 1X6LA 3OG3A 2DSKA 5JPNB 3ATZA 3V35A 2E51A 2VBBA 4C6LA 4QQPA 1OGGA 5EV7A 2YC4A 4G1KA 1JUKA 1X36A 3NGFA 2OWXA 1QT1A 2OEJA 3GKFA 3IJ8A 4RZBA 1T6GC 4ZQPA 3AYDA 1SFJA 5EMLA 4AFCA 2G97A 4R7JA 3SN4A 2J1RA 4AY7A 4GAZA 3SLIA 2WO2A 3TK7A 1I4NA 4N53B 4YZ1A 3S1GA 1OURA 2VDHA 4L4MA 2ISFA 1A5OC 1VFLA 4YVPA 4ZY9A 4JGYA 5JH2A 3AISA 1BBT1 3S42A 5F39A 2W0XA 1ONEA 3ANVA 3KP1A 1ZA4A 4TX9A 4C7DA 4O14A 2E8ZA 3AMKA 1DYOA 3TSBA 4HLTA 3MW4A 5KHIA 3CQJA 4ZE5A 4CXXA 2ACSA 3P84A 4QXHA 4RZ6A 4I5UA 1DZRA 1W1TA 5FMOS 1JRBA 1W8HA 1QOPA 3QM3A 2P3JA 4ATFA 5K7PA 4FNPA 4ATEA 4HPHA 5BUVA 3NURA 3V0BA 1VKFA 1JTZX 3GDLA 3LG3A 4QGCA 3C3NA 1UZ4A 4ZO8A 1I5ZA 3QY6A 3A4JA 1TMF3 1NLQA 1AR82 1KS4A 3W7OA 1R38A 1XYCA 4PB5A 5BU6A 1JUBA 2HS8A 1RMU2 1VEOA 4GJ1A 5CGQA 4PI0A 1SM9A 2OT0A 2QCDB 3CHFA 1C1LA 4XJWA 2PDFA 3EX3A 2O9RA 3WNXA 1ZHAA 2PLV2 3ZFHA 2NQYA 3DAQA 3IAPA 4GZIA 5HQMA 2DCYA 1EBHA 4H9YA 4DYJA 4LFYA 2CYGA 1OCQA 1DHKB 1M41A 3S4TA 1XSIA 2RDSA 1HNYA 3KS6A 1S2KA 2GQ8A 5JDBA 1C5IA 4CRQA 5GVJA 1SZBA 1FPN1 1TR1A 5C9AC 1EXBA 1U5HA 1AR91 1VPYA 3ZR5A 1MNSA 3W7JA 4E2DA 3AP6A 3RO6A 4JTHA 2HWF2 3ZFFA 3KQRA 1WKEA 1TG7A 4A21A 3M0IA 1ND3C 4U2AA 1WDPA 3VBRC 3OUHA 2OKTA 3UGFA 4KWJA 3EO6A 5IJRA 1UPMB 1XIGA 1ME7A 3GJBA 4HA3A 3SGZA 1AW2A 5M3WA 4LH8A 2ABBA 5LIUX 4DS0A 3C8FA 5BV6A 2WW5A 1AD4A 4Q2FA 3PANA 4NY2A 1ZBE3 1CTNA 1ZREA 1KCZA 1SO3A 3EBVA 1RUC1 1YPIA 1OIMA 4RUBA 4Z2LA 3HIJA 3UA4A 1G9AA 4ECLA 1UMLA 5I03A 4HTYA 1FBAA 5FI8A 2RDTA 1W9BM 4XBQA 3KDNA 1EAH2 1J59A 4O13A 3O0FA 1H50A 3PTQA 1JGMA 3HPAA 4URIA 4D6JA 1REEA 2A5HA 4MGYE 4NL1A 2AMXA 3KF3A 3ITVA 4S3CA 4WM8C 2VGIA 4MNMA 1KQZA 3AIVA 2YV8A 3EWCA 4H2CA 2I45A 2ON3A 1HVQA 3ATYA 1DHPA 3TEZA 4BB3A 4HOOA 1XLMA 1KFLA 3ARRA 4BI7A 1QRQA 3RZGA 3SW6A 1OLQA 3SCNA 4M3CE 4B9ZA 3W38A 3OD4A 2ATSA 2BOEX 4J6GA 4FS9A 3QR1A 3RU6A 5LEJA 2DVBA 4CD8A 4FOYA 2H90A 2C14A 4ERAA 3T6CA 1Q8PA 2WVSA 2Q30A 4E9KA 3TW9A 2PCEA 3G2GA 2E33A 1QWRA 2H6CA 3AMDA 4IDZA 4XF4A 2QDGA 3C2RA 4V2WA 5DF0A 3I59A 4JTTA 2BMBA 4XJ8A 4HU3A 1VBB1 3LEMA 3RYSA 5JPMB 3BVJA 5A80A 3TSMA 2Y26A 2DCZA 2ZWYA 3H54A 1XNTA 3RWNA 1NY1A 2R073 3IV3A 4LVDA 4N0RA 2CEQA 1J0JA 2VZOA 4LHSA 1NP0A 3TDFA 1ZBVA 1UN1A 1YI7A 2GAUA 3U1XA 3W20A 1A5KC 5FL1A 3NWRA 4HSHA 3GXPA 3WDTA 3N04A 1I45A 1OOPB 3JQXA 2GQ3A 2Z2UA 3OODA 2ZJCA 1SFNA 5D02A 3P80A 1O1HA 3RX3A 3HGOA 3I4EA 4CKQA 2D6OX 3CGTA 2VDIA 1XYBA 2GSJA 3LDBA 3MIHA 1SLCA 3NPVA 1O5KA 4E4DX 4YG0A 3WW3A 3V5OA 1OQFA 4M3CF 4LEQA 4OECA 2XLFA 3CNYA 4XQ4A 3WD1A 1XBXA 4UQEA 2XPJA 1E4IA 1UWRA 3G0XA 5IYYA 3VIPA 3ZFFB 1JDDA 4S3GA 2ZGPA 1W0OA 3I7RA 2P5BA 2C1IA 4UI9L 5BYWA 4P7RA 1O3SA 3RM9A 5TAOA 3W76A 2WBGA 5BRQA 2WZR1 3OIXA 4GXWA 2PLCA 3FIGA 1XH1A 3I6EA 5FMDA 3B97A 5C6MA 4MLJA 4QBXA 3H1MA 5DN1A 2B7NA 3GYEA 3CPRA 2FPTA 2WQZC 3W7HA 5MKGA 4DI9A 4XX6A 2VEFA 1ND3B 3AXEA 2YIHA 1WYIA 3ORWA 4F66A 5BMXA 3VUPA 2Q1ZB 1PO21 2XUMA 4JTUA 4UR9A 3POHA 4U3CA 1LQ0A 3VKKA 3WQFA 2BERA 5E1QA 2EG8A 3AXMA 2OMAA 2QPXA 2GUUA 1RQEA 1XYNA 2GJXB 3Q8FA 3R12A 2P3IA 1YW1A 3F03K 1QU4A 3D6NA 5A6BA 3WQ8A 1OB0A 1NY72 4EF9A 4K1ZA 4C8DA 1W9PA 1VFOA 2QUUA 4E8GA 3SY8A 4TVDA 3HQ1A 1ZY9A 1FXZA 1IGWA 2WSKA 1JZ5A 1WBFA 1TWSA 2BFUL 4IIHA 3PVOA 1PIV3 3OSDA 3FFQA 2BSLA 1AYM1 3WDYA 2UY9A 1W37A 1X96A 2I56A 4ZSUA 1UOJA 4JZRA 5F6LB 3CB3A 1XHGA 4RPPA 3VGDA 3DESA 4IP5A 4NPRA 2AMGA 2OSYA 2MEV1 4B5UA 2W27A 4O0QA 1YIPA 4IGMA 1FATA 1OH4A 4L6HA 1S46A 2D93A 2VG9A 5JIPA 3M70A 4XVHA 3MEPA 2ESCA 4GUGA 2D69A 3TYDA 1YX1A 4D6EA 5CC7A 3IGUA 4QD2A 2EVXA 3CWOX 1TNFA 4PTWA 2VGFA 4CNUA 4PBFA 2WM0A 1TWDA 2R071 3WLTA 2VTXJ 2N7GA 3MP3A 4BQ2A 3EDKA 2E32A 1SG3A 5IW0A 1WUVA 2YXXA 5K9DA 4P9JA 3WD0A 1RL3A 3MSGA 2W46A 1ODUA 2O8QA 4HOXA 3PUQA 1FWCC 1ZJHA 4FNUA 3ZPOA 1P48A 4NAFB 3V36A 3OVGA 4GMP0 2X2GA 1U5IA 4ASTA 5HINA 3AXKA 4B90A 3CAWA 1UMIA 1REFA 3NO3A 2QUNA 4IEQA 4DWDA 3O07A 3P67A 3PWIA 2VUNA 3W7NA 5FO8B 4KH2A 3JD73 2CAUA 1OF4A 1RQHA 2WBKA 5A3UA 2NT0A 3G77A 2A85A 1SLIA 2PU0A 1HF6A 4PUMA 4Y1XA 1GPFA 3UYJA 4MV2A 3W5NA 1O1ZA 1WB0A 5AC4A 1EGMA 4GO8A 2QJVA 3BUCA 3C7GA 5REQB 1S1AA 1UR8A 1OCBA 5JU6A 3L66A 4H7ZA 3E2RA 1C1FA 5JR7B 2GJNA 3H53A 3UW6A 1RHI2 4QHZA 1CGVA 2MEV2 3HO8A 1V51A 1HRV3 3NKTA 2EF9A 5HV0A 1EJTC 3O5SA 3GU2A 1T8QA 4Z1DA 1K3IA 1AMYA 2X0HA 4V1YA 4ZOEA 2CW6A 4UF0B 1O4TA 2ACQA 3R5EA 3WDVA 1PGW2 2QS8A 3MMUA 3ZO0B 3TUUA 1TPWA 3VZXA 2PBGA 4QX2A 5T26A 1E6ZA 1C8VA 4C6IA 4GLEA 1M6JA 4HZMA 5ECVA 2QIWA 5BNPC 4MNKA 3BPSA 1YLVA 2ZIDA 4O7XA 1TVNA 4QXBA 5CG7A 4C91A 1YRZA 1RAKA 1Q2RA 3RJXA 3N9QA 2CITA 1C91A 3ZWTA 1S2CA 2GL5A 3JZVA 4AHZA 3B3QE 4E0CA 2WC3A 1C8M1 2ZHLA 1V9U1 4XZBA 3NYDA 5JXJA 4Q4QA 1OI6A 3CJXA 3VBSA 3K2GA 5CBIA 2PRMA 1H30A 3GVVA 4HZ6A 2PDYA 1EJUC 5FEWA 4CCDA 5FOOA 1XGEA 3CV7A 3N2MA 4FIQA 3HBLA 3WL1A 2XVKA 3SEEA 5IHRA 4Q29A 3ZXAC 3RPTA 4YNIA 2B4KA 4AZ6A 2A3AA 3G22A 2FZNA 4Y1ZA 3KLKA 4G56A 4EOUA 3MQTA 3W7MA 4LA3A 2Y1HA 3M4HA 3JUUA 1RUH3 2L9LA 3VX0A 1WUFA 2YGLA 3CHXA 4QXKA 4JQ2A 4NHVA 1F6YA 3M6YA 4PF1A 1EP1A 4L9YA 1POKA 5DDJ1 1VHCA 3BOFA 2XWEA 5AVPA 3AKSA 1ITXA 5BXXA 2A3WA 2B45X 2GGHA 1F76A 4J28A 1SO5A 4A3YA 4B4QA 1GQGA 1B9ZA 5HCAA 2DZPA 3PR2A 3MKVA 1GTEA 4J2MA 4NXSA 3OPTA 2V2HA 5G2IA 1SQ4A 4Q4V1 1YFUA 2WINB 3Q8AA 4J3WA 1DVJA 1S5TA 4HU4A 1DU3D 2EXJA 1HGYA 4DHGA 1Y9GA 1IEWA 3KZSA 4O10A 1IT7A 3WBYA 5FXXA 1CGUA 2J1TA 1H9PA 3I97A 2P6CA 3KL3A 4EWJA 1C3HA 2BTVC 2JG8C 3WF2A 2G96A 2QCDA 1W28A 1BMV1 1US3A 2ZX8A 1BKZA 1ODZA 2JICA 3G24A 4XF9A 3RYRA 1BKHA 4MWAD 3MW2A 5D9OA 1P1MA 1OPMA 4HBNA 4L97A 2H9AA 1ZYBA 4OZXA 4MY8A 4ZHNA 1VMJA 3BODA 3VO0A 1XJAA 3AMHA 1W8TA 3OO2A 5C9ZA 4FXRA 4C6QA 3BAXA 2Q8DA 5C3OA 1UR9A 5A6JA 2FDIA 1ALYA 2UY3A 1PZ2A 4ES4A 3GBGA 3BW2A 1ZA7A 2IXIA 1D4M2 4XDPA 4BK9A 4PIXA 3GDRA 4IPPA 4JFSA 4AEMA 3LBCA 3LXCA 1QY4A 1TCMA 1FOD2 3DG6A 3RPMA 3R6SA 4XZMX 1J6PA 5GM0A 5DXYA 1LEMA 1H1AA 2NX1A 1K6AA 4LITA 2PPGA 2IXCA 3U7VA 1ZBA1 1W6QB 3NA8A 1TMF2 5ABHA 3IT8A 3NJYA 1YE4A 1MUWA 1HB2A 2FZ1A 4YTSA 1E5JA 3P2VA 2MNGA 4NIAA 1PIV2 2RR13 1EH9A 2QJNA 1ZBA3 2EO7A 1WDRA 1DBNA 3R05A 3MPBA 1FWNA 4LAMA 3RG6A 3B0UX 3RDKA 1L2QA 1VLWA 5I7GA 3ILRA 2VDGA 3S5OA 1I0BA 4KCWA 1POQA 1XX1A 3W7KA 2BDRA 3AS0A 1YPXA 3TFXA 2ZZ2A 2E7QA 2D3LA 4F79A 1IPJA 5A33B 1WPCA 3NZPA 3VBHB 4ATLA 2BPA2 1R1A2 4AHPA 4AL9A 4AVCA 7A3HA 5FP7A 3W74A 1RUF2 1E1EA 1WBHA 1RUD3 4QQHA 1GEHA 3TROA 1RTVA 5CC6A 3WLKX 1KA9F 4YG3A 1BKSA 5D4YA 4Z0SA 5FYTA 2WWJA 5AC8A 4RR3A 4RL7A 2XL7A 3B69A 1SFPA 4KWKA 3B4UA 1W06A 5ABTA 4F2TA 5E09A 4G7EA 3M0VA 5BNOC 4NAEB 2ZZ5A 3GFXA 2JEMA 3F2ZA 3VBRA 1QOXA 3LSCA 2ZGUA 1JRCA 4DZ5A 4JC1A 4DELA 3AL5A 3H8AA 4JY8A 3W88A 4MB4A 3CJPA 3P74A 4HL0A 4XAAA 2YXGA 1GJUA 3LIGA 4CP1A 3VMPA 5A69A 1RUOA 2BWCA 2LUWA 2W2IA 5IVJA 4PMOA 1YTEA 2OTDA 2R0HA 3SURA 2NXIA 1P43A 3W21A 4WR3A 1VJSA 3WINE 5A7NA 3W1MA 5A3NA 3LM7A 3HN1A 1AA1B 1RMU1 2E25A 5D2WA 1Q13A 1XRTA 1OGBA 3WEZA 5JZGB 3VDCA 1O5XA 2PAMA 4XXAA 4NAMA 3KBNA 4LVGA 4IIBA 4XHXA 3MY9A 3V0BB 1G9HA 1UNBA 5KMYA 4JYFA 1LOAA 3WLPA 3APTA 1J18A 1TE6A 4G2DA 2V4AA 3LEPA 3ZVHA 4FXSA 4KWOA 1V03A 2P8CA 2ZA2A 4ZTYA 3VBOB 4OQVA 4UTTA 1OX4B 2DZAA 4GD4A 4Q8QA 4WF7A 3GYCA 1I3HA 2J7HA 4UMCA 4DXZA 2D24A 4RCXA 4QKDA 1E15A 1W6NB 3L4ZA 4LF1A 4PMQA 3T30A 3B0XA 1KEXA 5FZHA 3TN93 5JWPA 2WA4A 3IZOA 5FESA 1YXDA 3BTAA 1M53A 1W2TA 2JIGA 3BLIA 1XBYA 3IJQA 1NF0A 4RDYA 3ARTA 2JE9A 3JCIA 1OFQA 4RNJA 1O60A 1IEIA 1GNZA 4JTSA 1FUYA 3LXBA 1AL22 2I5QA 2CBVA 2Y6JA 4AMCA 2IKGA 1CW2A 2D7FA 5I79A 3WFAA 4YW5A 5AYYA 3USUB 1W8GA 3ARWA 3CZGA 2C16A 5FKYA 3GQYA 2FCVA 3VX1A 5EPDA 1O8PA 3VNMA 4B16A 4LAOA 1JPKA 2WUHA 1LESA 4NUBA 2INEA 1AQFA 1OFDA 2BBAA 3WDPP 4B5NA 4WJEA 5LIWX 2F6UA 1OD8A 2QW5A 4WXYA 2WMIA 3FWEA 4EWAA 1EB3A 1K03A 1Y5XA 3GIQA 3GD6A 2BVWA 1X9TA 1Y5WA 1LT7A 1OA4A 5ANNA 3JBG3 3AIRA 4META 3MSDA 4DRSA 2QQWA 1NT0A 4FAHA 3MKKA 2INFA 1TX2A 4OMCA 2PLMA 5LRRA 5F4WA 1JN2P 4UTHA 4Q3MA 4F8AA 3JBG1 2VTXA 4M51A 4RR4A 4WM7A 1QJU2 1YEWA 4L9ZA 1D7KA 3UEQA 2J7GA 1B57A 4HA0A 2BU9A 1ICSA 1SFTA 4RPQA 1DJXA 1PK6C 2DU1A 3ZM8A 4PTVA 2X5IA 3VABA 5KHJA 1KM0A 3PL0A 2CU0A 2VFGA 3MO7A 2JIEA 1EGZA 3MI3A 3WQGA 1TIWA 1S0BA 4OZOA 1TWWA 3CJIB 3OZOA 1Q5OA 1P6BA 2PMQA 4GC4A 3N6QA 3QKZA 3URQA 5G4HC 2J7FA 4NJGA 1ZZ8A 4WOQA 3KE0A 1FV2A 4RSUA 1BK0A 2JG9B 3H8UA 2D3SA 5CZKA 4LOSA 2YBVA 5AC7A 5DG2A 2Z1KA 3PS7A 5EYXA 1Q6GA 1XKJA 1H8TA 4BK4A 3EMCA 1PM7A 2G3NA 3AJZA 4ZB5A 1H41A 5GZFA 4MGZE 1AODA 4OV9A 4JTIA 1L6SA 3GC5A 3ITXA 1LT8A 2RGLA 1IG3A 3AFKA 4MZUA 2ERFA 3GR4A 4B3NA 1FKWA 1X7IA 3TKFA 1MUCA 5PTDA 4R53A 3RAOA 3ROUA 1B30A 1IPKA 1EX5A 3SRHA 3C7HA 2WWCA 2Y34A 1WZMA 5C4WB 1CLVA 3GH5A 4K39A 3O6AA 1MFVA 3JR2A 3AZWA 4LQRA 2INZA 4FX6M 5GQBA 1ONRA 1MSSA 1H2MA 1KFEA 2WFF3 1E72M 2JD4A 1VRD