3ZM8A

Crystal structure of podospora anserina gh26-cbm35 beta-(1,4)- mannanase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
444
structure length
444
Chain Sequence
RDGPVTYEAEDAILTGTTVDTAQVGYTGRGYVTGFDEGSDKITFQISSATTKLYDLSIRYAAIYGDKRTNVVLNNGAVSEVFFPAGDSFTSVAAGQVLLNAGQNTIDIVNNWGWYLIDSITLTPSAPRPPHDINPNLNNPNADTNAKKLYSYLRSVYGNKIISGQQELHHAEWIRQQTGKTPALVAVDLMDYSPSRVERGTTSHAVEDAIAHHNAGGIVSVLWHWNAPVGLYDTEENKWWSGFYTRATDFDIAATLANPQGANYTLLIRDIDAIAVQLKRLEAAGVPVLWRPLHEAEGGWFWWGAKGPEPAKQLWDILYERLTVHHGLDNLIWVWNSILEDWYPGDDTVDILSADVYAQGNGPMSTQYNELIALGRDKKMIAAAEVGAAPLPGLLQAYQANWLWFAVWGDDFINNPSWNTVAVLNEIYNSDYVLTLDEIQGWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Analyses of Glycoside Hydrolase Families 5 and 26 Beta-(1,4)-Mannanases from Podospora Anserina Reveal Differences Upon Manno-Oligosaccharides Catalysis.
pubmed doi rcsb
source organism Podospora anserina
molecule tags Hydrolase
molecule keywords GH26 ENDO-BETA-1,4-MANNANASE
total genus 139
structure length 444
sequence length 444
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
A PF16990 CBM_35 Carbohydrate binding module (family 35)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3zm8A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3zm8A02
1JZ6A 3M46A 2E33A 2YA0A 2OSXA 4Y7EA 2VOTA 4LKSA 1MW1A 2ZUSA 1JI2A 4D0QA 3CUJA 2EIDA 2J7MA 2VM9A 2VZUA 2CXGA 3QHNA 3W27A 3U7BA 3WNKA 3C7HA 3QR3A 1J12A 1J0HA 2XJ7A 4AD0A 2YLLA 4GQRA 3PZVA 3ACHA 1TUXA 1V3IA 1VENA 2CDPA 2VR5A 2JFEX 2BVDA 2WHLA 2X8RA 2XVGA 3CUHA 4D6FA 2X09A 3LPFA 1W91A 2BHUA 2B4KA 3ARVA 4ATLA 2BERA 3WDPP 5I6SA 1J0ZA 3SCPA 1EXPA 1PIGA 1JYWA 3ZM8A 2VT0A 2AAAA 3UCQA 1R86A 2W1WA 3HNYM 3SCSA 1XSJA 4BA0A 3L4ZA 4QX1A 2DQXA 1W9VA 2XTKA 4DXRA 4XZWA 3GH4A 4PSRA 1BYDA 3F5LA 1SFSA 1VEOA 4AEFA 2VI0A 3VPLA 4H8VA 2G8ZA 3CHFA 2VZTA 4HPHA 3OZPA 3PZTA 2YDRA 3BGAA 1MFVA 4BF7A 1JU3A 2ZXBA 1ZS2A 4M4PA 4Q7NA 1GPFA 3W5MA 3WQWA 4WKFA 3ACGA 3DYPA 1WDSA 1A47A 2RJ2A 1C8QA 3EMQA 5ABEA 8A3HA 3NDZA 1WZLA 1E15A 3A4AA 4HTYA 3PZNA 4W7UA 3ACIA 3IJ9A 3D3AA 3NCOA 3WF0A 2G3IA 2UY2A 5JUVA 3W6LA 1CDGA 3VD4A 2ZWZA 5A6JA 1JAKA 4ACZB 2ZUMA 4IM4A 3VVGA 1BG9A 1P6WA 3ZR6A 1JZ5A 1H4PA 3AMLA 3WH8A 4UQEA 3C7OA 4MOAA 1PPIA 3HN3A 1V02E 3RDKA 1EO7A 3HMCA 2VCAA 1KBKA 1VB9A 3MMUA 4U3CA 4TVCA 1SHWB 4RL3A 3EDDA 2YFZA 1XPWA 1NAEA 2V3EA 4QLJA 2JF6A 4V27A 2DT0A 4E2OA 2QLYA 4XUYA 1UD5A 3CO4A 2J7HA 3CKHA 1MW3A 4XV0A 3MKKA 4LQ1A 3GDBA 3GTNA 1AQMA 3N15A 3WF3A 3EBVA 5A8OA 2BNJA 2WPGA 4W8LA 1VEPA 2G3JA 4E4PA 2VZRA 4EKJA 1NP2A 5CSYA 1J84A 1JU4A 1M7XA 4J7RA 1J18A 3AMDA 1O7AA 1VJSA 1D7FA 4PF1A 4AZIA 2VMEA 1HXJA 4QLKA 4A6OA 1E55A 4PUEA 2Y6HA 1KXQA 2VL4A 1BTCA 1MYRA 1GU3A 3AMKA 4CCEA 2GDUA 3PTQA 1V3MA 1W9DM 1OIMA 4FMVA 4PYSA 4EAMA 1OIFA 3WELA 1UD4A 5LA1A 3VD3A 1LNSA 1L0PA 7A3HA 1QI4A 2DSWA 1GVYA 2CBUA 4B3LA 2F2HA 1CWYA 4Z2AA 4J3XA 5E0FA 5CG0A 1VRXA 3AFBA 1WPCA 4ZE4A 2C8NA 2J78A 2PWDA 1VFOA 3F4VA 4BZYA 2PBOA 4WKHA 3VX1A 4D6IA 4W7VA 4CCDA 3SKJE 4H41A 1SYTA 4AG4A 4W93A 1KQYA 3D5HA 3LEKA 4TTGA 1GNXA 2ORZA 5A69A 2D24A 2DDUA 5AC4A 1QI0A 3B9EA 1XRVA 4HZ7A 1IQDC 2ZUWA 2XUCA 3VIPA 5CLWA 4KRUA 1UR4A 4TXEA 1V3HA 2VO5A 1K3IA 5M17A 3VM7A 2ESCA 2ID4A 3N12A 2WK2A 4E8DA 3RM9A 2JKXA 2VVSA 3ARRA 4GZEA 4CU9A 1FP8A 2XM1A 4D1IA 2WZ8A 5AYIA 2D0FA 1K45A 2QQMA 1LL4A 3WDHA 3WDIA 2W67A 1GOHA 3DYMA 4ET7A 1G5AA 1CECA 3ZT6A 1C92A 1MVYA 4TVUA 1E6RA 4D71A 5HDRA 5A8QA 5CGMA 3CZJA 5CSUA 1WP6A 4P08A 2WBKA 1B3ZA 3U7VA 1EUUA 4BQ2A 3CHEA 4CD7A 2CPUA 3SUTA 2HISA 4QFUA 2BXZA 1U33A 1TZ7A 1JD7A 2VRQA 1XNAA 3AHTA 1JGIA 1W1VA 1IT0A 2J25A 2WAGA 5M5DA 3KL5A 4XUPA 2WDBA 1W9TA 1PAMA 1CZTA 1PX8A 1UMIA 1GOOA 5JBEA 3MMWA 2PWGA 1OWQA 2J8FA 1V0LA 3W37A 3AIVA 3P1IA 3VD5A 4JCLA 5DF0A 2DPEA 2QMJA 2GSJA 4YPJA 5JBFA 2VMFA 5HXMA 2FDMA 3THDA 1UD3A 3MUIA 3NYDA 3BCDA 1R85A 1TFVA 2E0PA 5FKYA 1C93A 3BMWA 1UR9A 2VZ1A 4V2XA 1KXHA 2J8GA 4PT6A 2GJXA 2X1IA 2QMKA 2ZXDA 1EA9C 4MB3A 4S3KA 3SUWA 3OZOA 3MUZ1 4IISA 2YBTA 3L4WA 3EYPA 3PTMA 4PTMA 4DWSB 1UWTA 5JXGA 1EDGA 4ZXEA 1BGGA 2C4XA 3PUHA 3OLEA 4HOXA 5A6KA 1BVNP 2DSVA 3WMSA 4P8VA 3PHAA 5DEZA 3LPOA 2NT1A 4ZFMA 3ALGA 3CGTA 1G9HA 1JHJA 3U5UA 1RH9A 4CGTA 3N18A 3KL3A 1PX4A 3VIFA 5E09A 3IK2A 3VIKA 4JKLA 3N1AA 4IPLA 5FUIA 2GFTA 2CBJA 4W5ZA 4U3AA 3ZJKA 5A2BA 2ZUUA 2VUYA 2EO7A 1BQCA 3A6OA 4JKKA 1Y7VA 3WQBA 4JFTA 4U2ZA 1CXLA 3ARPA 3BC9A 4FF5A 2WUHA 1B31A 4JFUA 2W1SA 1FOBA 1J9YA 3AIUA 4JFWA 4AISA 4TTUA 2WMHA 2VX7A 2XQXA 1MW2A 3M07A 4W4ZA 1F4AA 2D3LA 3NIYA 2VVNA 3A22A 3HOBA 2XGBA 3EDKA 1HJXA 4MJ4A 3WD4A 3GXIA 2PF0A 1VF8A 1UR1A 3AS3A 1WZKA 4H7VA 4QP0A 1KWGA 3VKKA 3KL0A 3MV01 1E6NA 5A6BA 4CN1A 4ML4A 3PZGA 3WSOA 2BZDA 2W94A 3PZOA 3WF4A 2EEXA 2OKXA 3W25A 3SUUA 3F5KA 1UWRA 3ZO9A 5FCZA 2PC8A 2WAOA 1W3LA 2EXOA 2YDSA 3VGFA 4RN5A 3AIRA 1V3KA 2EPOA 1HL8A 3GBDA 3CTTA 1SR0A 3BN6A 3APGA 1JNDA 3ALFA 1HIZA 3VIGA 1DWJM 4HG6B 1GQIA 3NNGA 2V5DA 3NDYA 1QBAA 5A8PA 5HPCA 3VNYA 3WH9A 4J28A 4ZXLA 5C7GA 1OINA 1EO5A 2VZOA 1GONA 1JAEA 2PWEA 3IJ7A 3UG5A 4ACYA 3B9DA 4D6HA 2VNCA 3AJ7A 4LXFA 4UFKA 3WH5A 2CERA 4QAWA 1ZBVA 1H5VA 4OOUA 1W9XA 1V08A 3CHCA 2JF7A 3AIEA 2J7FA 4ARXA 3A4XA 2WWDA 2GJXB 2JEQA 2V4VA 1C90A 3FAWA 4TUFA 2WANA 4GXPA 1HVQA 1O59A 2Y6GA 1IV8A 2JIEA 4XUQA 1UH2A 4JFSA 5TD4A 1UD8A 2YC2A 2CBIA 2J77A 4J3UA 2WWCA 2WMIB 1UWWA 3KEHA 1FH9A 4HU8A 4GO8A 1L8NA 3I3BA 1AQHA 4A3ZA 4PMQA 1H6YA 3P6BA 4P5YA 1GW1A 1XC6A 1UOKA 3K8KA 1TCMA 2XHNA 1ZJAA 3AS0A 3CMJA 5D9PA 1GZJA 3W38A 4ZY9A 2WMKA 1FA2A 2J1VA 5C71A 4BS0A 3VIHA 3VOCA 4DXSA 3N9KA 2ZUVA 4FI9A 1W9UA 4PMNA 1E6SM 2E26A 4HPGA 2Y5EA 5LYRA 2C7FA 4A42A 3W28A 4CU7A 1W1PA 4D6GA 1WZMA 3AIBA 4HOWA 4U5IA 3CZUA 5BCAA 1JI1A 3ZT7A 2DCJA 1UA3A 7CGTA 1W3KA 5IXEA 4ARYA 3SCQA 5ECUA 2W95A 2WN2A 1JFXA 1PZ3A 3A21A 2TAAA 1CGWA 1LQ0A 1UKPA 1UKSA 1QBBA 3OIHA 4UQBA 1M03A 1BGAA 1UR2A 1E73M 2WMJA 3PUIA 1B30A 2V38A 2XSAA 3PZUA 5CXPA 4KI5M 4ATDA 2DCKA 4UI9L 3T0AA 1NX9A 2FHBA 2WYSA 4JX0A 4EK7A 1CZSA 2J4GA 2X0YA 3SCWA 4ZENA 3WNLA 3VGGA 1BPLB 4J3TA 2MANA 5D9MA 2WW5A 2FGLA 2VX6A 4A44A 2NT0A 2HLEA 4PMYA 3W4RA 1HKJA 2BFGA 2QQJA 2RVAA 2E8ZA 2XWDA 5EMYA 4QDQA 2G3MA 4PMOA 1HP5A 5EJZB 1WNOA 3OEAA 3VX0A 3IANA 1QI2A 2RGMA 3QHOA 5JXJA 1W9SA 3CLWA 1EDTA 3W26A 1GUVA 4W7WA 2YL6A 4URIA 1OF3A 4AZHA 1ZBWA 4UAPA 4JKMA 2CKRA 1BYCA 1CGVA 3WQVA 1CXKA 1ISVA 3UEQA 5JR2A 3ETPA 1LG2A 1E4LA 2YL5A 2CHNA 1TG7A 5AY7A 3THCA 4MNKA 1QI3A 4UCFA 5I24A 1JI6A 1MXDA 1SG3A 1UYYA 2B9VA 3ARXA 4GPNA 1PEZA 2JD9A 1JYNA 3QHMA 2QHAA 2OYLA 2Z1KA 1ZBCA 4WIWA 1H1NA 2WVVB 3CUIA 1W1YA 1XSKA 1E5JA 4W50A 3CZGA 4M29A 4XVHA 1R8LA 1W9BM 3BAKA 4QB6A 2ZX9A 5M03A 2QF8A 4UFIA 2W61A 3NJXA 3BAWA 1B2YA 2D2OA 4AZCA 3L4VA 3NSMA 5CLTA 3GGLA 3IAQA 4MDOA 3CH9A 1E9LA 3C7EA 3WDJA 4MPKA 1E6PA 4PMVA 3HU7A 4L4OA 3I2HA 2EIEA 3PZMA 1CGXA 3CBWA 5I5RA 1V6WA 2A3BA 4IUGA 3ARSA 2J74A 3VINA 3POCA 4W8BA 2NW0A 2J1EA 1JDAA 1CGUA 1H09A 3VDHA 1UQZA 3AXHA 3WMCA 4P7LA 5D9OA 1MQRA 1VIWA 1B3WA 4CD4A 4QDSA 1GJUA 2CYGA 4EE9A 4CN4A 4A4AA 1JZ3A 5A94A 2YG0A 4JAWA 4BDVB 5A8MA 1JF6A 1SDDB 2O9OA 2W5FA 2VQTA 3RJXA 2CDOA 1WB0A 3VD7A 3GNRA 1DEDA 1GHRA 4B3KA 5JBDA 4UOJA 4MB5A 1J10A 4F79A 4UQDA 1YQ2A 1KR0A 3FY1A 2BXYA 3AHYA 4BK5A 1UYZA 4W5UA 1CZ1A 4TXWA 2XVKA 3GNPA 3I3DA 1TVPA 1C3FA 3W6MA 4GI9A 4UFJA 3L4UA 3NUKA 1C7SA 2WZEA 1LL6A 1HJVA 4N0RA 4ZEPA 1MPXA 3NQHA 2WCAA 4F8XA 2WO1A 4F9JA 4J3SA 2BVTA 3I97A 1TVNA 2WHJA 2BHZA 5GPRA 1NARA 4MB1A 2VMCA 3VU2A 2DEPA 3A3HA 3II1A 3OLDA 3GZAA 4DWSD 4S3JA 3AC0A 2W3JA 1JDCA 4NRSA 4UQ9A 4CKQA 2XIIA 3WF1A 2WNWA 2X2YA 3W53A 3K1DA 3I2JA 3WNOA 3AZSA 1UQYA 1BYBA 1V6VA 1HVXA 2YDQA 3GH5A 3WEOA 2QPUA 1H41A 1O8PA 2X10A 3DYOA 1PX3A 2W47A 1PMJX 3DHUA 3RMEA 4QB2A 2BHYA 1W3JA 1A3HA 1OCQA 4J3VA 5D9NA 1BHGA 1OD3A 1B9ZA 2ZEYA 1K6AA 4CUCA 3AS2A 3RJYA 3CZKA 1CLXA 5BROA 2C26A 3S6TA 4GIAA 4MDPA 3DC0A 3UR7A 3W0KA 1HKIA 3AHXA 1C7TA 1QNSA 3PBGA 4X0NA 1QNRA 5E6YA 4DUWA 2D0HA 1JDDA 1EOKA 2CESA 5E9AA 4CU6A 3N13A 1OT5A 1K9EA 3G6MA 3L4YA 2ZX7A 4E8CA 4GZIA 4OMCA 2FH6A 3HNBM 3HNMA 2W66A 1ITXA 4XUTA 1UH3A 3MS8A 1XCXA 5DPNA 1AVAA 4ZZ5A 1W8OA 3SCUA 4PMUA 2W91A 2WZHA 2O9PA 4DM2A 3BH4A 4PMZA 4H04A 3WSUA 2WSPA 1HJWA 1JF5A 1BF2A 4D6JA 1NWRA 5A1AA 3W82A 4TVDA 1DWGM 4AZCB 4B9YA 3PTKA 2JALA 2WCSA 2DIJA 2J1RA 4AYSA 1G94A 2L9LA 3WQ4A 4KMQA 4TX6A 1E1EA 2IXVA 1R64A 2Z1SA 2WVSA 4LPLA 4M80A 1GOIA 4PSPA 1NWTA 5DO8A 5EJ1B 3AMGA 5FD0A 3F2ZA 2WKGA 1TA3B 2GJPA 2W1UA 3GM8A 1CYGA 2XVLA 3WD2A 2OWWA 3T0DA 1DHKA 2V72A 4CVUA 4BK4A 2Y64A 1JD9A 1UKQA 1ISYA 3J7HA 2A3HA 4NI3A 2JDAA 1H0IA 4H8UA 2D22A 2BGOA 3WNPA 2EQDA 1NKGA 4GWJA 1MQPA 1NH6A 2EPNA 1OD8A 3K4ZA 1FP9A 4UZUA 5A6SA 7TAAA 1J0IA 1ISWA 1BFNA 4LYRA 4W85A 2Z4FA 1E5NA 4AZGA 2NSXA 5EBAA 1WCQA 4AY1A 4M8UA 2OYMA 1Q4NX 1UWIA 2XVNA 2YJQA 4QLLA 1KXVA 4IPNB 3WH7A 1CIUA 4AMCA 1EQPA 1CNVA 3MO4A 1H49A 2VR4A 3AZTA 3WDRA 1O6IA 2OWXA 3ARUA 1QW8A 2D0GA 2ORXA 2UY5A 2ZEZA 1H3GA 1YHTA 3OB8A 1Q6CA 1ZBKA 1V3LA 4HA1A 1XCWA 1QOXA 1E4IA 4UFMA 2WHKA 5EFDA 2E9LA 1QVBA 4ATWA 4W88A 3SCOA 1OGGA 4DEQA 5FIPA 3E1F1 5DQ0A 4LYQA 2VURA 2E9MA 4PMXA 2F8QA 3VGDA 4P02B 2PBGA 1N82A 3WQ6A 2IUZA 4U31A 1GOFA 2WABA 2YKKA 4FLOA 4PMRA 1ZL1A 3PZQA 2IXUA 3BLPX 3WD3A 2Y8KA 3OLIA 4B16A 3GH7A 4PTWA 5LA2A 1ISZA 5JIPA 2E4TA 1E56A 1J83A 2XG9A 2XONA 5D4YA 2EJ1A 4ZZ8A 1GQKA 1WE5A 2XFRA 2WHMA 4AZ5A 3OLGA 3WQ8A 2O9TA 1MXGA 2LS6A 5BXSA 5I77A 2O9RA 1VFUA 4L4PA 4MNMA 2WVUA 1B3VA 1UMHA 1XV8A 4XB3A 1JZ8A 2C0HA 3AIWA 3WBAA 1I1WA 3WFZA 4XUNA 1CIYA 2V3DA 1K9FA 2Y24A 2XOMA 5F7UA 1GOQA 4KRTA 1DWIM 4MO3M 2XWEA 4BJ0A 3TTSA 2G4FA 1DP0A 4Q22A 3VMOA 1U30A 3K4AA 2YOCA 3WEMA 4Z2LA 5IJRA 2A3CA 4QPWA 3TTOA 1FFRA 1H11A 3O2LA 1UA7A 2J7GA 5A6MA 3B9AA 1VAHA 1V0NA 2AOSA 3WN6A 3ZSSA 1T2XA 3T2OA 5E70A 1US3A 1LLOA 2OWCA 3AXXA 1RYYA 3CQOA 4CUBA 3A7QA 1HNYA 1OT2A 3BXWA 3MU7A 1UZ4A 2DT1A 4DM1A 2XSBA 3FHAA 1Q6FA 1MW0A 4RYDA 3VDCA 2B31A 2WM0A 2HYXA 1HKMA 1M04A 2EPMX 3LE0A 3ARQA 4UOQA 2XIBA 4NRRA 1WKYA 2CEQA 1GOGA 2VRKA 3IB3A 1LWHA 3GBEA 1NM9A 1BYAA 1VFMA 4AD3A 4AD2A 2W62A 4OMDA 2VCCA 3WUBA 3SUSA 4CU8A 4XURA 3FL7A 3PZ9A 4RE2A 1G0CA 1XHGA 3OG2A 3ARWA 1U2YA 2V3GA 3ARYA 2QQIA 2J1AA 4QDRA 4BQ4A 2GK1B 2Y6JA 1IZJA 1HL9A 3CIHA 1K9DA 5HBFA 1HJUA 4XZUG 3T2PA 2WO2A 4MGSA 3QOMA 4FK9A 4MB4A 2WSKA 3U57A 5BXTA 4XZBA 1OGBA 3POHA 1CTNA 1RD6A 2EIBA 3IIIA 1XSIA 3WD0A 3B8SA 3BCFA 4OYUA 1E6ZA 1QW9A 5G05L 3SCNA 1US2A 1X6NA 4UFHA 1R7AA 1WCGA 5ABGA 4OIFA 3JXSA 4AIOA 3SEEA 1UWSA 1V6XA 2AMGA 1VFFA 1W1TA 2WC3A 2J79A 3T0BA 3FHQA 3WUFA 3BMVA 2DH2A 2XFFA 5I0DA 2GK1A 5BYWA 3S2CA 4DEVA 1XNTA 3I2FA 3AHZA 3FAXA 1G01A 2QQOA 1OT1A 3HEIA 4B9ZA 4W89A 2VZPA 3RM8A 2WLYA 2ZE0A 3MUY1 5I78A 5DN2A 4PBGA 2ZUNA 1W0NA 5B4NA 4HMDA 2A3EA 4JIEA 1ECEA 2VC9A 4ACZA 1BAGA 1EHNA 2VZSA 4OUEA 4RE4A 4GINA 3A4WA 1GJWA 5B4XA 2PWFA 4AZ7A 2O92A 3CUFA 8CGTA 2JIWA 2ZXQA 1W9PA 4H8HA 3AYSA 2J1UA 1JZ2A 3BAXA 4AXNA 1TA3A 3K8LA 2ZICA 3PZIA 4MADA 1TMQA 3AYRA 5IYYA 1E43A 1Q6EA 3GXDA 4MAZA 4GZ9A 4P8WA 2FH8A 3K4DA 4D6CA 3CZLA 1CX1A 3AQUA 5A6AA 1VBRA 4DWSA 3NRUA 2JEPA 3UETA 2WB5A 4JFVA 3VNZA 3VIJA 4HZ6A 5CPQA 4AEEA 5ABFA 2PQSA 2EPKX 5C70A 4JZ5A 5I79A 2XM2A 1DWFM 2Y8VA 4Z2KA 1WAWA 1I1XA 1E40A 1E71M 1I5PA 4AZ6A 2WMFA 2Y2WA 4CD5A 2E32A 3K46A 1NWSA 1OBAA 4JL1A 1KCKA 2UY4A 2WO3A 1KR1A 2XVPA 1UY4A 1X6LA 4QB1A 4DWSC 3VIIA 4KH2A 1NOFA 2VQUA 2YL9A 3PN8A 1OSEA 4J3WA 1VBUA 1CPUA 3ZMRA 4AZBA 3I2GA 4N42A 2YLAA 1W99A 3TTQA 4M56A 1TVGA 4A45A 5IHRA 4A41A 4MNLA 1KEXA 3MSGA 3AICA 2CNCA 2BS9A 2J62A 5IFTA 4MTVA 1R7OA 4UQAA 1E3ZA 1JFHA 1W32A 5M3WA 3SURA 1XYFA 3N17A 3AS1A 3CIVA 5CPTA 3WNNA 4Z2JA 1CXIA 1HJQA 2DIEA 3GYCA 4W8JA 3MSDA 4MJ2A 4PCTA 2OSWA 2VX4A 1ZB5A 1WDPA 4LGXA 4D8MA 4LYPA 1CZVA 4X9YA 1LWJA 2LW8A 3BSHA 4TOQA 2WAAA 1X1NA 4W87A 3WMBA 1FHLA 1HJSA 2GUYA 1CXFA 2VZVA 4R5EA 4UNIA 5ABHA 1RP9A 3WDQA 3NJVA 4QDMA 3UG4A 4OKDA 2WZIA 1K12A 4YHGA 3ARTA 3L2LA 4FLQA 3OGSA 2J7DA 4AAXA 2DH3A 4PQQA 3U37A 2WMGA 2VMDA 5BXPA 6CGTA 1E6XM 3VILA 3ZJ8A 3GXFA 1HF6A 1CGTA 3AOFA 2FGZA 5E0CA 1UXZA 4BCEA 2OLHA 3K77A 4WLCA 2E40A 2Y6KA 5A8NA 1KGXA 1DYOA 4MNJA 5C8BB 1W2VA 3VMNA 2W46A 4DUVA 1KXTA 1ULOA 1PZ2A 4CCCA 3TTYA 1UX7A 4QX3A 1W8NA 1EOMA 1HN1A 1KCLA 3SUVA 1EUTA 1L7RA 1JXJA 4LPCA 4LX4A 1JL8A 4JCMA 4NF7A 4GO9A 1OF4A 4V28A 5A6LA 3RPMA 2RV9A 1LG1A 4W8AA 4KWUA 1GORA 3A23A 3WF2A 2YA2A 3ZOAA 2W63A 1BG4A 2DGAA 1D3CA 4HA3A 1WO2A 3EDEA 5GNYA 2YFUA 4GZJA 1J0YA 1DLCA 1UZ1A 2J1TA 4D6DA 3VGHA 1Q6DA 5FOOA 4CD8A 3RM4A 1XGZA 3WBEA 1C8YA 3NSNA 3UERA 3VTRA 3WUEA 4HMCA 1OH4A 5CGTA 4L0PA 5IDIA 3LPGA 4EANA 3VIMA 3HPNA 5G04L 1GQLA 4PUDA 3G6LA 1PBGA 2C9KA 1H2JA 3BLKA 1D7PM 2VZQA 4AIEA 1SMDA 3TONA 1GOWA 2QQKA 1VEMA 3ZT5A 1M53A 4WKAA 4JHOA 3AZRA 4PTVA 2J47A 4NSBA 5AC5A 2UY3A 4FLSA 5I23A 1NP0A 1JXKA 3T2QA 1KGYA 2FHCA 3BAYA 1UWUA 5CYYA 2YBUA 3IDAA 3K8MA 2D20A 4PRWA 1FHDA 2ZIDA 1JIBA 5FL1A 2E8YA 4WJXA 3ZQ9A 3UESA 5HNNA 4PMDA 1IZKA 1UR8A 2J7CA 4GWIA 2PB1A 4MAVA 2YB7A 2J75A 2W9XA 3M7SA 5GQBA 4AD4A 6TAAA 4OJYA 1VJZA 2YA1A 4D1JA 3A47A 1J0KA 2QBXA 4C7FA 1W9WA 3GNOA 4KGJA 3WIJA 2E3ZA 1UY2A 2WMIA 3ABZA 2EPLX 3F5JA 2WC4A 2W1QA 3HJRA 4WSJA 4AW7A 3LQCA 2ZXAA 2DDXA 2WKLA 5IFPA 3CZEA 2ZUTA 1UY3A 2CITA 3ACFA 4HZ8A 4K68A 1JG9A 3VGEA 2YC4A 2J1SA 4WF7A 3UG3A 1MFUA 3BSGA 4CN6A 1K9TA 3HJEA 1DTUA 6A3HA 2Y6LA 2WVTA 3NSXA 5JXIA 4GKLA 5I3DA 4PTXA 3LPPA 1NQ6A 5HOSA 1ISXA 2UWFA 2XGIA 1GMMA 4CUAA 1CLVA 3WL1A 3CMGA 1KWKA 5A2AA 4GQQA 1WDRA 4DUXA 3CHDA 5DMYA 3C7FA 3I2IA 2Y4SA 2VTFA 5HPOA 2WBGA 5A3HA 5KEZA 1EQCA 3VDAA 1EHAA 1KB3A 4J27A 4C7GA 1OGSA 4GI8A 2CKSA 1UYQA 1H0GA 3WNMA 5E6ZA 5JMOA 2WQ8A 1HT6A 4F66A 2BY2A 2D23A 1UKOA 1E0VA 4NZCA 1KGUA 4LQRA 5A95A 1EH9A 3EDJA 3DECA 3KE0A 1ITCA 1UD2A 4WSKA 1ZJBA 2VX5A 3T08A 4OOZA 4Z2IA 2OSYA 2BY1A 3CUGA 3T09A 3SCTA 1J01A 2ZWYA 2VJXA 2E31A 4A3YA 2FHFA 2VRJA 4RE3A 3AISA 3L4TA 2GVYA 2XYLA 1O8SA 2QQNA 2ZEXA 1KBBA 3WY1A 2ZEWA 3OEBA 2BY3A 3M6DA 3EMZA 2WCGA 1KFWA 4U5KA 4JL2A 2G41A 9CGTA 4QCFA 1LJYA 3I3EA 2F61A 1Q6GA 1XH2A 2EICA 3WENA 1G1YA 3MANA 5I2UA 1QNQA 4UTFA 3FW6A 3TP4A 2J22A 2DSUA 3MBWA 3ECQA 1B1YA 3OGVA 2DSKA 1LL7A 2QQLA 1ZU8A 1EIBA 1UD6A 4CD6A 4P7NA 3ZSTA 5KZ6A 3EMCA 1GCYA 2BGPA 1S46A 2G3NA 2RGLA 4UFLA 2QV4A 2PI6A 3BAJA 4ZXOA 1B3YA 4QCEA 1E72M 3OA5A 1E6QM 1UH4A 2HVMA 3CDZB 1RPKA 2BBAA 4HU0A 3ARZA 3W81A 3VD9A 4HA4A 1F4HA 4YN5A 5CJ5A 2OYKA 1SMAA 5D8WA 4CVWA 4YHEA 5EIYB 4GI6A 5DT5A 1UZ0A 1L7QA 1UUQA 2WC7A 3VGBA 3VM5A 1OB0A 5CZKA 5A2CA 5DFAA 1B3XA 1DWAM 1HX0A 5LA0A 1JYVA 3ZJ6A 2ZOXA 2A3AA 2YL8A 1UYXA 4BXSV 1LF1A 2XFYA 3TA9A 2WXDM 4BQ3A 3U5YA 1WZAA 4OBSA 3CPUA 4W84A 1PMHX 2CETA 3AI0A 4P8UA 1D2KA 1FFQA 4A3HA 2E9BA 3VO0A 2BY0A 1OD0A 3GXMA 5JXHA 2VZ3A 2GDVA 5BRPA 4M24A 2KD7A 2J7BA 1QNPA 4FLRA 4U33A 4JHZA 1B0IA 4TX8A 3W29A 3C8XA 3EDFA 3FNDA 1GOMA 4BQ5A 4XUOA 1ULPA 1UY1A 1BSIA 3FN9A 4M82A 3SEPA 1NOUA 5GNXA 5BWFA 3ZIZA 2W92A 1FH8A 1QNOA 1QPKA 1V6YA 1XYZA 5GNZA 5DT7A 1V0MA 2W4XA 1GNYA 4QX2A 3MV11 4UR9A 4UZSA 4ZE5A 5CPSA 1QHZA 3KZSA 1J11A 1E3XA 2QPSA 3OBAA 1XD0A 4OZOA 3RIKA 1JNEA 1RP8A 1GVIA 1P8JA 3UR8A 1R87A 3RILA 3CZ8A 4PCSA 1HKKA 2VCBA 3L2MA 1ODZA 3WQ5A 3MUAA 5J1XA 4LHSA 2J7EA 2XPKA 2R7EB 4HP5A 4M1RA 4P7RA 1XH0A 1EGZA 1OM0A 3TOPA 2WVVA 1DWHM 5FL0A 5ABFB 1HP4A 4W86A 2V5CA 3AXIA 5EB8A 3RO8A 2X05A 3RCNA 1GQJA 1E4MM 3GXUA 1XD1A 5JIWA 3FXYA 4R27A 4HMEA 3VUPA 3OGRA 1FH7A 1GQPA 1JYXA 4M4RA 3MMDA 3ZJ7A 4KGLA 4XX6A 4P7OA 1NUKA 1JZ4A 1C8XA 2CIPA 1JZ7A 2Q8XA 4P00B 3LEGA 1E0XA 1E4NA 3W24A 1CENA 2BVYA 3WD1A 3WEZA 1CXEA 1BLIA 1XH1A 4AD5A 3SKVA 1CGYA 1V02A 2WN3A 3AHVA 3VIOA 4OBRA 3WUGA 4F9DA 3AROA 4M81A 1CXHA 1V03A 3O9NA 2W87A 5BRQA 1GUIA 4AD1A 3UNPA 2DSZA 3SCVA 5IHSA 3N11A 4Z2HA 2XHYA 4PEEA 2V3FA 1E70M 1UHVA 4MGQA 2D1ZA 4C7DA 3SIMA 2DT3A 1PIFA 3ZR5A 1W2PA 3BAIA 1V6UA 1UWQA 5EFFA 2PWHA 1W3HA 1EDQA 2X0HA 2ZX8A 2GJRA 2ZX5A 2EBNA 3KWXA 3WKZA 4DXTA 3AIQA 1UY0A 3VDBA 1MQQA 1AMYA 1WDQA 1UXXX 4AC1X 4QX0A 1NWUA 1H6XA 1QI5A 3AMCA 1GHSA 1NOWA 3WH6A 1GOKA 1M01A 3IJ8A 3SCRA 3K75B 5CQ1A 1E0WA 1QHOA 1BVZA 3I2KA 1MWOA 3DHPA 1AQ0A 1K42A 3C7GA 4H2CA 3JUGA 1KQZA 3O6AA 4X0VA 4D72A 4PN2A 1UR0A 3WL0A 4Z2GA 1PJ9A 2YIHA 2ZX6A 4HOZA 5D8ZA 5AYBA 1J0JA 3WFLA 1ODUA 1QHPA 1CBGA 2BV9A 4AIUA 4D6EA 5BXRA 3IAPA 4P7QA 2D3NA 3EB7A 1V3JA 1C91A 4UQCA 2JE8A 5A6BD 1I75A 4UOZA 3QOKA 1TR1A 4AWEA 3VMPA 3LEIA 3N04A 4B15A 1E1FA 2CHOA 3QGVA 4P8XA 1V0KA 3LMYA 1UKTA 5LCWL 2CBVA 2CCRA 1Z32X 4U2YA 3L4XA 3NJ3A 1ESWA 3W5NA 1TE1A 1KGWA 1B90A 2DT2A 4WK9A 1CEOA 1UG6A 2WLZA
chains in the Genus database with same CATH superfamily
2EF9A 3M46A 2E33A 2VGFA 1KM3A 1FWGC 5EKYA 2JG8A 3W7EA 3M3EA 5L9BA 2TODA 2BP1A 4BEQA 1J12A 1J0HA 4HVQA 3JB4C 1SPQA 3PZVA 3ACHA 3THPA 3K5XA 2P37A 1V3IA 2VR5A 2X8RA 3WQCA 1DQWA 4FEZA 2JG9A 4CLMA 1UOZA 2Z1BA 2ISWA 1RSCA 2AL2A 4DY5A 1DHKB 2Z6IA 5AHFA 2B4KA 4H9XA 2AQOA 1NJJA 1WBJA 1J0ZA 1AL7A 4R7JA 4NIHA 4UNLA 1A8DA 4A7KA 4XOGA 1EXPA 1AJKA 4O9EA 1YBQB 1KTBA 3ZM8A 1VYRA 2VT0A 4JTTA 2OOFA 1AG1O 4N6FA 2W1WA 2PF8A 5CFCA 3FE5A 4H9TA 1VFLA 4IH3A 3PL0A 3QH7A 1TMHA 4BA0A 3L4ZA 4QX1A 3I54A 2DQXA 4AGRA 1F31A 3GH4A 2ISDA 1BYDA 4AEFA 2B5HA 5FZDA 3VPLA 4E9KA 4DO0A 2X7VA 4H6KA 4XAZA 2VZTA 1LRQA 2YDRA 3KV6A 1X9PA 4LO4B 5FZ8A 3GF6A 3LQGA 3AZVA 1YPIA 2HDJA 3VL8A 4M4PA 4LIUA 4PIYA 3WLUA 2BGCA 4AZZA 1RVKA 1WA4A 2WJDA 4GXMA 1C8QA 3EMQA 4K39A 3LA7A 4QJ3B 4HTYA 4W7UA 3W88A 4Y33A 2WO5A 2YW3A 5D2TA 3ACIA 3NCOA 5FCCA 2HWD2 2UY2A 3OGGA 5JUVA 1B3OA 4KCTA 1S3HA 1D8WA 4GH4C 3R25A 3UZXA 3VD4A 3WW4A 3RG0A 3ZR6A 3MIEA 3P60A 4FOWA 4UQEA 2VW2A 4MOAA 2FMOA 3HN3A 3AU6A 5HQMA 1XYOA 3BZGA 4GC3A 3BYWA 4N7QA 4ADTA 3OBRA 1PDYA 1VB9A 4YARA 4GD4A 4RL3A 2WZTA 3W84A 3YPIA 2DT0A 3P62A 4Q0PA 2QLYA 4XUYA 1UD5A 2Y7DA 3CO4A 3H24A 4QKBA 3LM3A 1MW3A 4W9TA 2VTXJ 1XSQA 1BD0A 1WKFA 3GDBA 3GTNA 1PO21 5FEPA 3U07A 3S5NA 4C60A 5A8OA 4XO6A 1SVDA 4LUTA 4O1AA 2BNJA 2N7GA 4XD4A 3NZ1A 4RNJA 2VZRA 1F6KA 1VPQA 4EKJA 1NP2A 3KRUA 5M1TA 4J7RA 3CEWA 1J18A 3D82A 5G4EA 2FHRA 3KBWA 2OQ7A 2ZKMX 2Y6HA 3UGHA 3B8VA 1VBHA 4ASLA 2VL4A 3V0BA 3NQFA 4MHUA 4YWSA 3LDKA 4LBQD 2OXNA 2WNZA 5C3PA 4QM9A 2NX9A 5FEZA 6REQA 1TPB1 2B39A 5CSSA 4ZONA 4PYSA 1EJTC 3OBZA 2HE8A 3TJLA 1UD4A 5AC8A 1SLAA 2PE4A 1L0PA 4PUMA 4AB4A 3N25A 3H9AA 3CH0A 4ZU4A 4F48A 3UK9A 2DSWA 1XE8A 1NLRA 2CBUA 2Z2SB 1PTAA 3DEQA 1CWYA 4Z2AA 1RMU1 2DUOA 5E0FA 3GXTA 2Q0AA 3OJGA 4WD0A 4JGYA 5JDBA 1B4KA 1ZENA 4MWAC 4WVWA 2PWDA 1VFOA 4I9JA 4LE4A 3TR2A 4WM8B 3U11A 3WQGA 4TN7A 4W7VA 3SKJE 3ZPYA 1ONWA 1SYTA 1XCFA 3PUGA 4O17A 1KQYA 4XF0A 3LEKA 3S6OA 2BW8A 3SMHA 2DDUA 1FYUA 1QI0A 3B9EA 3QGAC 3W7JA 5E88A 3ATYA 3QOPA 5C4WB 5GLVA 1IQDC 4A8IA 5FUPA 4KRUA 4TXEA 4YCOA 1V3HA 2V2CA 5M17A 3K30A 2C24A 1TE6A 2ZZ1A 4KIRA 4B2DA 1IPSA 5D2AA 4E8DA 3ARRA 5DQPA 3POIA 1TNFA 5JXQA 4PI0A 1THFD 2KR2A 5GZGA 1W3IA 2Z1XA 4HPNA 5AYIA 3ABRA 1K45A 1ND3C 2QQMA 2V73A 2ZTNA 4FPCA 3MB9A 3AVRA 2W67A 4HD5A 3LM7A 3GFYA 1W03A 4LC8A 1MVYA 4YU1A 3C2EA 4FR1A 5A8QA 4R52A 3HFTA 4YLZA 4ASKA 4IMGA 1B54A 4P08A 3V1PA 1QPQA 4QBXA 1YXDA 3CHEA 1VHCA 4CD7A 5A5WA 2CPUA 1VMFA 2E25A 4BJHA 4S2GA 2WOQA 1MS1A 2HBTA 1PKLA 5FZ1A 1KKOA 2QDEA 4QROA 1XNAA 1UW8A 1W1VA 2ZBTA 4RNFA 5DDJ1 5M5DA 3UJSA 5L9RA 1GR3A 4XUPA 3A0NA 2WDBA 4PH6A 3Q8EA 5FKBA 1PX8A 1UMIA 3WDVA 1KXGA 3J7NA 3LOIA 3VD5A 1RIRA 1SDWA 2O1QA 3ZYZA 1KRMA 1CAWA 5I0UA 1XLDA 5HMFA 2FMNA 4AVCA 4QQPA 2VMFA 2FDMA 1NA1C 3Q58A 1OG0A 3NYDA 1Q65A 4HYWA 4MHBA 1TFVA 2WPBA 5AHIA 5FKYA 1HTIA 2POZA 4K8FA 3BMWA 1QGLA 1UR9A 4JTNA 1A5LC 3T9PA 1W6PB 5JI9A 4HBKA 3TWBA 3WLLA 4LBQB 2YBTA 5H8UA 2BOGX 3PTMA 1VFHA 3QF0A 2VEGA 1UWTA 5JXGA 2XBO2 4UTWA 1IWAA 4MY9A 1VYPX 5ECVA 2NN8A 2ZGNA 2DSVA 1K3UA 4FOVA 3F2CA 2RR13 2ZGLA 4FTBA 3RG6A 2NT1A 1DJWA 4ZFMA 3BIEA 1G9HA 1DIOA 1ZM1A 4YW1A 1R1ZA 1ZBA1 2GVGA 3P61A 1F7BA 3LCHA 2QYGA 4IFRA 1A4MA 2FPTA 3GAYA 5FPXA 2BFUS 4CGTA 3S9ZA 5LXEA 1PX4A 5GJ6A 4TO8A 1D2SA 3VIFA 2WKJA 3VKJA 4JX5A 5KETA 4UMCA 3F4NA 1EYBA 1NDZA 4Z1DA 3VUSA 2ILMA 4PR4A 3IK2A 3LCFA 4JKLA 3NJYA 3N1AA 1ZZ9A 5HMEA 4HVOA 2CBJA 4W5ZA 2V4AA 5EJ3A 1H51A 2VUYA 3WCSA 1V9U1 4EPEC 2PLKA 4Q4Y1 1YNYA 3WQBA 2IFRA 1NCQB 3C3NA 4XDPA 2OU4A 4L9XA 2IW0A 4HNNA 4FF5A 3WX7A 3W7HA 2DCYA 1T8QA 3GJBA 3QYQA 3AKTA 4JFUA 4DAFA 4GJYA 2XIQA 4C6DA 4Y1XA 1RUG2 3MW4A 1RQHA 2VOMA 2HWD3 4W4ZA 3W7IA 1F4AA 4LAOA 3HOBA 2JKBA 2B7OA 3LXBA 4B3ZA 4RPPA 1SJDA 3L65A 3RSJA 1PS9A 4NX0A 2PDHA 2ERFA 5TBOA 5E89A 3AZYA 5FYSA 3KL0A 4YVPA 1YYAA 5A6BA 5G1MA 2Q8EA 4H2AA 1AJZA 1T7LA 2UURA 1ZBE2 4LVGA 1PVC3 4UCGA 4C6IA 5LW9A 3NL5A 3PZOA 4GX8A 3OEXA 2I74A 3H2OA 3RN6A 3TAKA 2VULA 1FWJC 4DO4A 5FCZA 1AR73 2PC8A 2WAOA 3FDGA 1W3LA 4Q7IA 5H1WA 3HT2A 1SCSA 2YDSA 3TQKA 4G2DA 1CQ9A 2YGYA 1V3KA 1HL8A 2FDFA 2FDHA 4DBDA 3CEPA 1W6QA 3BN6A 3KT4A 2O7QA 3ALFA 1SFYA 3IDEA 4HSLA 1XUUA 1IIHA 3NNGA 2V5DA 3RMJA 5EP9A 3HQXA 3MYOA 3FGCA 3VNYA 3UXDA 3PVOA 3BLIA 2PMWB 1V00A 2D98A 3AZWA 1EO5A 3IJ7A 1LGNA 4EN8B 3GSMA 1ICPA 4QQLA 4M01A 5J96B 2AGKA 4UFKA 1S3TC 2YHJA 3E2SA 2CERA 1T0OA 3IPVA 3CEUA 4QAWA 2CLOA 4OOUA 1TV4A 4RX0A 1W9XA 2R94A 3LNPA 1F35A 3OG3A 3AIEA 2J7FA 1VH7A 1PK6B 2ZBJA 2VUNA 4K7YA 2WWDA 1P5BA 4LEJA 3GHMA 2A7AA 2V4VA 3C86A 4AVTA 2CGPA 5TQLA 3H7YA 4GXPA 5FXVA 4JFSA 2JIEA 4XUQA 3NXFA 1W17A 3RX4A 2AGTA 1RUE2 1OC6A 3QZ6A 3GNNA 1CCWB 1URXA 3KLKA 2CBIA 4R4ZA 7XIMA 1Y3TA 3KVAA 1KM6A 3VN4A 4EE2A 1IKQA 1UWWA 3HZ3A 1C9DA 1KNWA 1YDYA 4GUGA 4KEZA 4GBUA 1AQHA 1TJ0A 1ND2C 4PMQA 4P5YA 4K2SA 1XC6A 3K8KA 3WT3A 1XIIA 2AEYA 1REDA 3UA3A 4ZY9A 4XXAA 5C71A 2PURA 2QCDB 1FPN3 1TQ5A 2XDVA 3N9KA 1G7YA 4GFSA 2RAGA 3O15A 2E26A 4IE0A 3M43A 3FBYA 2FFCA 4Y9PA 1W1PA 5F3IA 3DHFA 3HGRA 3ABSA 2QFEA 1F2NA 2RH9A 4S38A 4HOWA 3HG2A 3CZUA 4URTA 1HB3A 5AB3A 2W39A 2QQWA 1UKGA 4POCA 4QDWA 4Y1YA 4AK3A 7CGTA 2XL9A 3PULA 1JPMA 4Q26A 4CDWB 1JFXA 1R083 1PZ3A 3A21A 3VKAA 1WCKA 4XPVA 3O12A 1LQ0A 1UCXA 1CAUA 4C0HA 4RJEA 4NPMA 2FZMA 5EFUA 2NX3A 4LC6A 1BGAA 2XGXA 4O52A 2V9DA 2JWPA 1E73M 2HK1A 2WMJA 3PUIA 3PZUA 5CXPA 1J2WA 2DCKA 1EX5A 2C19A 5CIRA 3HJZA 2R16A 4ISQA 3URFA 1O4UA 3SCWA 2R0HA 1JUEA 4ZENA 3WNLA 1SLBA 4CDXA 3TQPA 3VGGA 1E0TA 4JGYC 2VDHA 3B0YA 4J3TA 2Q1FA 2E28A 2VX6A 4JS3A 1YFXA 5JOXA 2HLEA 3TC3A 1J5SA 1HKJA 4JV4A 4DJED 2QQJA 4KEMA 1GZ1A 5EMYA 3NNJA 1HRV2 2AKZA 3GU2A 3UKVA 3OHIA 3ZVHA 3MDWA 1JODA 4L8QA 2RG4A 1WMEA 2EXHA 2Z1VA 1UBSA 6XIAA 3CJPA 3PHMA 3OEAA 4NWVA 3IANA 1YJLA 1QI2A 4CP9A 4NAFA 3QHOA 2DUXA 3VOIA 1EP1A 1EJWC 1KCXA 4YRDA 2PELA 2YL6A 5JVLA 1OF3A 4AZHA 4UAPA 3I6TA 5K0UB 3R43A 1CGVA 4Y5TA 1YX1A 1KBJA 4S3BA 4ILSA 1IPKA 1ECQA 1VPXA 1RALA 4YMZA 3NQMA 2JE9A 4A8RA 4KBZA 2YL5A 2NP0A 5AY7A 1D3GA 4MNKA 1RVF1 1JI6A 1V0AA 2OJPA 1UZYA 1JYNA 2Y5JA 2Z1KA 5SWUA 1NFPA 5D8AB 3ZFFA 3BUCA 2RE9A 1JN2P 1BCXA 3CZGA 1OH3A 1PYFA 3A12A 2A71A 2X1UA 3D3FA 4G4FA 3BAKA 1QJU3 4Y22A 3R5EA 2AH2A 5BMWA 3N2OA 5LBFA 3W9AA 2WJZA 4O16A 3O1UA 4LV9A 3BAWA 1OLQA 3I6EA 1RR2A 4AZCA 3L4VA 1BJQA 2ZGSA 1QDOA 1FAYA 2ZGTA 3GGLA 4B4QA 4MDOA 3MIBA 4DLMA 1KFBA 2HWC2 3ZKUA 2E9QA 1Y0EA 4LT9A 3NQAA 4PMVA 3C2UA 4LKFA 4L99A 3I2HA 3ZOIA 4GA8A 4PGLA 1CGXA 3CBWA 2UV8G 4ZZ9A 1A34A 2DYCA 4MY8A 4HCDA 1V6WA 1V6JA 2EJAA 4FB7A 3UR2A 3ARSA 1GJPA 2XU2A 4RHV1 1W9FA 4AU0A 4W8BA 4CPBA 3LSDA 4WVMA 3TN92 4NR1A 5F4SA 4IQJA 1RXFA 5L19A 5D9OA 2DFCA 1B3WA 5LNRA 2YFNA 3KX6A 4GHRA 1XYAA 2CYGA 4UTHA 4A4AA 5A94A 4QWNA 2Z24A 2FZ8A 4BDVB 3N9QA 1PZ9A 2CDOA 3ZLHA 5EWSA 1S2TA 4XKMA 5FAGA 3NGJA 4XAYA 2NQHA 1GHRA 3NR0A 2ES3A 3HBLA 3U6WA 4UOJA 3G1YA 4TLGA 3QZAA 3ZYIB 2FZNA 2CAUA 3BOFA 5A6XA 3NQDA 2G1MA 4XQ6A 2H0VA 2PFHA 4W5UA 4AVNA 4E8GA 3GVQA 4EX4A 4TXWA 2XVKA 3AYEA 4X3ZA 3GNPA 2P88A 2R071 3NAPA 5H9SA 3CWOX 3N14A 4HU3A 3W6MA 1ME7A 3VBOB 1FWAC 4UFJA 3ZFEA 4HK5A 3SRHA 1X39A 3E2QA 3TYZA 1F61A 4QX8A 3ITLA 2BVTA 2VW0A 5GPRA 4DF1A 1O3RA 1FI2A 4WM7A 1IGWA 2V6AA 1VLWA 3LI1A 3LU2A 4W6YA 5F4WA 2OFJA 3OLDA 3ORJA 3ORWA 3TK7A 4S3JA 1JDCA 2W3JA 4UQ9A 4NRSA 1G4EA 2HWC1 1NDVA 1ICSA 2WNWA 3KF3A 4KGQA 2YCKX 5D05A 3HQUA 1V51A 3NQEA 3ZWSA 3WNOA 1DQ1A 1G69A 2WT1A 1RB8G 4XHBA 4ZS2A 4H9ZA 5A6ZA 4M7SA 1HVXA 2X5IB 4Q2FA 2YDQA 3GH5A 5EYXA 1N1YA 2XDFA 2FKPA 2QPUA 1KJRA 3KCXA 1O8PA 2YU1A 1PX3A 3U9IA 1YFYA 1ZUAX 4DXXA 3LZ3A 3WLQA 1XISA 3V0AA 1IR2A 2YMZA 3IJQA 1RUJ2 4RQPB 1J1TA 1OD3A 2DV9A 1S2AA 4GAZA 2ANUA 2RS11 2ZKLA 3NQBA 4C6BA 1EX1A 2R82A 5BROA 1TWDA 3R94A 3S6TA 5RUBA 4MDPA 4Q8UA 4HT3A 1F2JA 4NIRA 3UR7A 3NZRA 4HXCA 1S0JA 1HKIA 1KV5A 4UW4A 3FJ6A 1KBIA 3AHXA 2P3ZA 1QNRA 4DUWA 2GQAA 1QNVA 5HQLA 1TWWA 4CU6A 3UD6A 3GBGA 3TEXA 5A3PA 3G6MA 3L4YA 4LTAA 4E8CA 4OMCA 1QEXA 2HPMA 2FH6A 3B7MA 3HNBM 5BNNB 1ZA4A 3E5XA 1TYGA 1QJY2 3N2XA 2OEKA 4AIBA 1SZEA 4PBEA 1XG4A 1UASA 4XKYB 2E53A 4AOCA 1Q8VA 2PGRA 3SCUA 4HCHA 1GTEA 2WZHA 3NO1A 4KWVA 4DM2A 4N9CA 4MXWA 3C2OA 4JNZA 3EX6A 3RR4A 1JF5A 1U5IA 4BQ1A 3H70A 1TCDA 1IQAA 3S5ZA 4TVDA 5HXVA 1DWGM 4AZCB 2JALA 4AYSA 4LHKA 1G94A 1OK4A 3WQ4A 1WD4A 5I0SA 4UMAA 1R64A 1CN1A 2ATMA 1GOIA 3SY5A 3NQ2A 1NWTA 1W0MA 1T6MA 3H7RA 3PBMA 5FD0A 3D6EA 1TA3B 1LENA 2W1UA 3GM8A 2XVLA 3WD2A 3M0JA 2V72A 1RCXB 4WY0B 1RUI1 3C0JA 3W85A 3ENRA 1QU4A 3LBMA 4EZHA 4FP1A 1G7UA 3M5YA 2UU8A 1H0IA 3CMFA 3S8HA 1HQWA 4HB7A 2YUEA 1R1A2 5FK7A 4AX7A 1NKGA 2WJFA 3L9CA 3TAYA 2EPNA 5FF7A 4YTTA 1M41A 1T6BX 1J0IA 4IPIA 1ISWA 1BFNA 4JTAA 4B5TA 1E5NA 2NSXA 3NZGA 1WCQA 4GMEA 4U10A 5EBAA 4Q4W3 2FVKA 3S2MA 1LOEA 2PA7A 3VBSB 1XOYA 4X8PA 3SH4A 1J58A 2CGOA 4IGHA 5T3NA 1UW9A 2D3PA 4Q8KA 4IPNB 1UF2C 2MEV1 1CIUA 3QV8A 1PKYA 2GOKA 4LF2A 5F6LB 1PO12 1H49A 4IQLA 1WUVA 2PP3A 3R4IA 1Y9GA 3ARUA 4KBXA 2UY5A 2ALDA 5DG1A 2IQTA 2CGNA 2Z1WA 1XWYA 1ZBKA 4YM1A 1G86A 2QDRA 1BKZA 3BLOA 1E4IA 4UFMA 5L7OC 1QVBA 4MSSA 5AFBA 4UTMA 2VY0A 4J1WA 1DE6A 5FIPA 4ERIA 3OYWB 3PJQA 2TRSA 3B0XA 3ZFGB 2E9MA 3FYPA 1VRH3 3OVQA 4U31A 4YVVA 1GOFA 3ZYGA 2YYUA 1VLIA 2Z28A 2WABA 4RA0A 4E4SA 3BLPX 3KBJA 1UNBA 1N1TA 3VBOC 2YBPA 1N47A 4JQAA 4WEVX 2C1FA 3OLIA 1NE4A 5K4XA 1GQKA 3VFCA 4AZ5A 3OLGA 4OI4A 5C7VA 3WQ8A 2VG9A 3QD6A 4LO5B 1MXGA 1NIUA 4E6MA 1BBT3 3FIGA 5FPAA 1QWGA 1RK6A 2WVUA 3I2DA 5F6KA 1T99A 2PFWA 4UIOA 4EZ4A 1YLLA 1K4GA 4AEDA 1A0EA 3ILNA 3Q8CA 1RUJ1 4YZ4A 1GVRA 1UZWA 5F2WA 4CDQB 1KFLA 3KZPA 4LAZA 1QJU1 3DPRB 1LQ2A 4PQ9A 1TWIA 4LE3A 1DWIM 3W7KA 1REQB 4ZO7A 3RRDA 4BJ0A 2NQLA 2DUQA 4OZXA 1U30A 5T8GA 2YOCA 2LLEA 1GBGA 1DQUA 3DV8A 2IXKA 5HV4A 3O2LA 3ZXLA 4AEJA 4AYUA 5A6MA 1M65A 1V0NA 2X2GA 3ZSSA 2WO7A 5E70A 2HSAA 2OWCA 5EQUA 1OF8A 1LUCB 3MHUA 3AXXA 5KZEA 1RYYA 1NF7A 2OR2A 4RV8A 4C6LA 4CUBA 3E0LA 3H6OA 1HNYA 1OEPA 1OT2A 3BXWA 4AHWA 2WYFA 4DM1A 4MIMA 3O0WA 4FAGA 2CAVA 2DVBA 3FHAA 1NFGA 4RYDA 4ASMB 1UC4A 3NA8A 2ZVIA 2JEMA 4NHLA 2V5LA 3ID7A 4YNGA 2CEQA 3IB3A 2PTWA 1SJCA 4AD2A 3T1MA 2UY8A 2W62A 4ZQMA 1XNBA 3MWCA 5EL1A 4B7KA 5I02A 3GCWA 3PZ9A 2QQPA 1XHGA 5CC3A 3E2VA 4GB33 3BWWA 3BG3A 4Z0JA 4PB3A 5FY8A 4O4VA 3G3DA 2YU2A 2OQHA 3ARYA 4N8MA 4AHZA 1EFZA 1IZJA 1OSGA 1HL9A 2NLIA 4O0KA 1RV8A 1GZGA 3CXOA 1VRBA 3E5PA 4Q4V2 4BH9A 4RLIA 4XACA 3WD5A 5AYXA 3PBUA 5GZEA 3EOUA 2C91A 4FXSA 3QOMA 1KQRA 4QNEA 5GJNA 4MB4A 4Z08A 1Z7AA 3U57A 4XZBA 1XG3A 1X1OA 2AR6A 4I5RA 2OOGA 3B8SA 4HSOA 2PDWA 3DX5A 4AWDA 4UFHA 4GB31 4YG6A 4QPGB 3H4XA 4DPQA 4TR9A 3C2FA 3S5SA 4QSHA 2PXJA 4Z1AA 4OIFA 4OI1A 4OHQA 2BWGA 4AIOA 1HZYA 1FWBC 4E4DX 2OUJA 1V6XA 2AMGA 6PTDA 5F5IA 1PV8A 3T0BA 3LLDA 4GH3A 4WY0F 3WUFA 1NTHA 4M0NA 1LOAA 5I0DA 1G7VA 1ZY9A 5DCEA 1Q5OA 2QQOA 1OT1A 3HEIA 5H9PA 3ZN4A 4S3DA 2JB4A 4CA9A 3DFTA 2YR1A 5HINA 1O6UA 3OYWA 1YTKA 5I3JA 3N9OA 3MI8A 1N1SA 1V7YA 4DZHA 3BICA 1C28A 4RFT0 1MZHA 2GGHA 2WT2A 2VFHA 3R13A 1XINA 5FI8A 3U1XA 4CEUC 2VZSA 4GINA 1A6CA 1AYN1 5DAWA 1H1IA 1W9YA 5B4XA 4MYXA 1WLTA 5C9WA 2CHHA 3CV1A 3HFYA 5KMYA 3M8LA 5T5JA 1X7IA 2GAUA 3AYSA 1IKPA 2J1UA 1X9TA 5C0QA 4S3GA 4R9CA 4MADA 2X42A 5J37A 4JGDA 2ZTJA 4L11A 4WBBA 4MAZA 4LYKA 1O5XA 1OYAA 5KHIA 3R12A 4D6CA 1NYWA 3AQUA 5IK8A 1Z6KA 1MVEA 2RDNA 4HNCA 1H1YA 2BRTA 3VOHA 3R8HA 2JDHA 3UETA 1OKQA 3LENA 2GMEA 3VNZA 4HZ6A 1VBE3 4OHWA 4AEEA 4LNVA 2XM2A 1FWNA 2GL5A 1SBFA 1VBJA 3M5XA 4F2BA 4UTTA 5FQ0B 1NWSA 4Z1YA 3MI2A 2ZE3A 1EJRC 1KCKA 1AR82 2R24A 3L5AA 2WO3A 3GIPA 5LY1A 1GTHA 2JDKA 3ZXFA 1CI1A 3LERA 1MZEA 3P14A 4YIWA 2Q3RA 1OSEA 2JIJA 1VBUA 4M3CE 1LDCA 4YW4A 2EHHA 4K6AA 1AR63 1X6UA 5HQEA 1W99A 2CLFA 1REEA 4XF1A 1TVGA 4A45A 3DL3A 2MNGA 4V15A 2NYYA 3GC2A 3C3UA 5FK8A 4WM7B 3RYKA 3HIFA 1IGOA 5DAPA 4UQAA 4H6QA 1CVNA 2QCLA 4EAYA 4F2TA 4GX9A 3WNNA 3H8UA 2GNDA 3K4WA 3GYCA 2DIEA 3MSDA 4MJ2A 1FPN2 1TRDA 3GBFA 4YZ5A 2PAMA 3SCFA 2VX4A 3OBTA 3CQ0A 1CZVA 1LWJA 4JIRA 3T81A 2LW8A 3FHIB 2CHRA 2ZRYA 4HNTA 4WZCA 5H9QA 1Y65A 3S1XA 1HJSA 3NNLA 4UNIA 1RP9A 3WDQA 4AAJA 4BFAA 4S23A 4YHGA 3AKSA 4FLQA 2J66A 2VELA 1Q56A 2DH3A 3U37A 1E6XM 3VILA 4Q4X3 5HNUA 3GXFA 2Q02A 3A13A 3RXZA 5HWNA 2ZX4A 3AOFA 4BWOA 2NVCA 1YPFA 1UXZA 3O1NA 5A8NA 2NPIA 1XNKA 2ZX1A 4ICMA 2Y6ZA 1BSLA 1R092 4COZA 3ICJA 2NQ9A 4DUVA 1EC8A 2F2KA 3BODA 3LHZA 1PZ2A 1TWSA 3TTYA 3B0PA 1UX7A 4QX3A 1UCWA 4XJUA 2F38A 3SUVA 3TROA 3FV9A 1P0KA 1WBHA 1L6GA 3SW6A 4NNCA 3B8IA 4JEJA 1KFKA 3GZ3A 1I8JA 4V28A 3SRDA 5A6LA 2EXIA 1NY1A 3LRKA 4L64A 1LG1A 1RLCL 3PB0A 1TJRA 4LVFA 2GZXA 3EPNA 3A23A 1J8VA 3M47A 1CWPA 2WZR2 3EDEA 4XIMA 2YFUA 2H0BA 4LCSA 3QY8A 1J0YA 1AZ2A 2V63A 4Q4Y2 3PB2A 4Q4KA 4C65A 1RAKA 4AFCA 3DKJA 4RK8A 1DXFA 3STPA 4CD8A 2ZZJA 3RM4A 3I8TA 4B5XA 4K38A 3IMMA 3WUEA 2DZAA 3VTRA 4HMCA 5CGTA 5IDIA 1XB9A 1XBFA 1OQDA 2KA3A 3B02A 4AXKA 4XEZA 4EANA 3M2MA 3HPNA 4UBPC 3BANA 3ZIXA 2XH7A 4PB4A 1ZBE3 3T2TA 1WDWA 3SADA 3TNBA 1RUI2 2C9KA 4J2MA 1QXPA 2HBUA 1MUMA 3BLKA 4AIEA 3A5VA 4NIAA 3PURA 1VBA3 4LUIA 1DOSA 1K5MB 1D4M3 4UXDA 4LBUA 4PTVA 5FZMA 5AC5A 4FLSA 1NP0A 1JXKA 1ND2A 4PDWB 1KGYA 3BAYA 3UA4A 3VKMA 2VKZG 2V0TA 1ZFJA 1CAXA 3NPWA 3C0QA 4GH4A 1AYM1 3T4HB 2ZIDA 1G6CA 1YXYA 1TPFA 1J93A 5HNNA 4C6JA 2ZABA 4E2VA 4H3DA 2J7CA 1IG3A 5LIKX 4EWEA 2P3JA 5CAKA 3UP8A 1UO9A 3U0HA 4FSJA 4LKEA 1TMLA 3MYPA 4QJ5B 2IXJA 2EPLX 2BLEA 1LU1A 4ZU5A 4R7OA 3HJRA 4WSJA 3BQ5A 3B69A 1IPJA 4DBWA 1A78A 1DKWA 2JD4A 3HV8A 3CZEA 3BPWA 2ZUTA 3KCYA 4QG6A 3P8JA 1EJVC 5JU6A 4HZ8A 5J98B 1EAH2 4BYYA 1JG9A 5FEXA 4CEXC 1WUEA 2O8QA 2J1SA 2IVIB 4K21A 1W28A 1MFUA 3FFSA 4FNUA 4LNCA 4WF7A 1AR91 2JXAA 3IEBA 1XYPA 3SRFA 3HJEA 3IIPA 1DTUA 1QKQA 5AHEA 2Y6LA 4PTXA 3NXLA 1NQ6A 1ISXA 3AXMA 1WA3A 5K7PA 1J96A 1E9IA 4IIFA 1JCTA 1A5MC 4QITA 2V81A 3CHDA 2VAUA 5TIMA 3UKNA 4S3CA 1S1RA 2Y4SA 4NJKA 2VTFA 4DOUA 4O7XA 5KEZA 4DO7A 5A7PA 3VDAA 1F76A 1EHAA 1KB3A 3HG5A 3VBSC 2Y6FA 3R4UA 2IPFA 3WNMA 4FXRA 2WQ8A 4F66A 2BY2A 4ALDA 1AX1A 3KCJA 4IHCA 4EPKA 5KITA 4XG1A 1EH9A 3DECA 1GK8A 1JCLA 4COYA 1XLKA 9XIMA 1ULGA 1QNYA 4GVGA 3WNXA 3Q8AA 3WQEA 1VCGA 3RZZA 3HQRA 2WSVA 4HU4A 2VX5A 3OD0A 4OOZA 1EY2A 4QAIA 4MH0E 3USSA 2BY1A 3SJNA 2ZWYA 3W21A 5LASA 2VTXA 2FHFA 3E97A 2YCLA 1KFXL 3PG9A 5DUWA 3ENLA 5DELA 9RUBA 1KBBA 2HV5A 4O8AA 1OFDA 4FNQA 2PZNA 2BY3A 1LT8A 3TWAA 3OW1A 2Y0OA 3M6DA 3OBEA 3FA3A 4JL2A 9CGTA 4RR3C 4ZS3A 3LMZA 4IIHA 4Y20A 1KO0A 2RMU2 3PMSA 3SZ8A 4C1LA 4LY4A 4TV5A 4GE8A 1QQP2 1W5NA 2O8OA 2WFF2 1PGW2 2F9RA 3GTXA 5E1RA 3B5LB 3UZYA 3RO6A 1AW2A 2ZGKA 4MKSA 5BY5A 3MF6A 5T50A 4P7NA 4XIAA 2GSHA 1GCYA 2D97A 4UFLA 1IQ8A 2QV4A 4ZXOA 4I0WB 1XRTA 5H91A 4NRQA 2QUMA 4Y24A 1BWLA 1UH4A 4DJFA 2UY9A 1RPKA 5D09A 3ARZA 3M0HA 1V8EA 4IEQA 4YN5A 3O16A 1IXNA 1I6NA 2CTVA 1SMAA 4YFZA 1FKWA 1P0BA 5AN7A 1BVWA 1VBD1 3RZJA 3NQ8A 2B0MA 3EPMA 4M0XA 1JYIA 1KJLA 2DUPA 1UUQA 2PDGA 2BBFA 4EWJA 5CZKA 3MPBA 3ZO0B 1DWAM 3BU0A 4PLMA 1HX0A 4HVRA 5LA0A 1GEHA 1DZQA 3VNLA 2A3AA 1BRLA 3MCMA 1B9BA 4LBQA 1K1DA 4QGCA 1HXS3 4BQ3A 2WFPA 3PWIA 4KKXA 4IJBA 1WZAA 3EWDA 3ZXEA 4D3WA 3S2LA 2CETA 3JQXA 3S1UA 1D2KA 2E09A 2BY0A 2AGSA 4E2QA 1WKDA 3QY6A 1N8FA 3OP2A 1MMFA 3V0SA 3GXMA 2VZ3A 2J24A 2KD7A 5AHLA 1B0IA 2XSXA 2ON3A 3A9IA 3EDFA 5A6YA 2IKGA 4BQ5A 2MPFA 4XUOA 1ULPA 2NZLA 4M82A 5H8MA 5LGZA 1V6OA 3B9CA 3BURA 3FUOA 4MYEA 1BTMA 3DBPA 1AR92 1DXEA 1O1ZA 3ZIZA 4JRAA 3GFZA 4A3RA 1V6YA 3ZXGA 4QPGC 1KM4A 4FIQA 2B45X 4H7MA 3MIHA 4WV8A 1W6NB 2IXCA 3MEPA 5DUUA 1WKEA 4H00A 3OBAA 4GOAA 3U3HA 1QOOA 3ITQA 2G3FA 3MUCA 5IDZA 1AD1A 1RP8A 2BNOA 2I14A 1P8JA 3KGLA 1QR7A 1R87A 1LOCA 3UR8A 1R1A1 4PCSA 1NELA 1ODZA 1TME3 2BYVE 5B7YA 4WSHA 1OM0A 1Z41A 1S2VA 1W2OA 3AUOA 2WVVA 2Y0IA 5FL0A 1HP4A 4A2RA 3P5YA 2V5CA 4GALA 3AXIA 3MWAA 5EB8A 1PB0A 2PZ0A 1E4MM 2PTZA 3I59B 3KV5A 2IPWA 3OSDA 2P0OA 1TQJA 4QQ3A 1SFTA 4AMAA 2Q8DA 3OGRA 3ZLGA 4M4RA 2Z0IA 3GHUA 4OV4A 3ZJ7A 3KOFA 4KGLA 4P7OA 1OXCA 3T44A 1C8XA 1JZ7A 4JNYA 1GVOA 1E4NA 4ERGA 4QS6A 2O0TA 1K8ZA 3OTFA 3D5OA 5F2GA 3ZXKA 1C8NA 1ZRRA 2NLYA 1CXEA 1BLIA 1HQNA 1PHMA 4IXXA 4AD5A 2Q1MA 1V02A 3O0VA 3BLFA 2WN3A 1Y43B 1XBZA 4F9DA 4M81A 2UYAA 3BB6A 1CXHA 1V03A 3O9NA 3V65A 3PPHA 4LJ3A 1OOPA 1U5XA 3BG5A 5FYBA 1YTEA 4MFDA 5HA7A 4UW6A 3UNPA 4OVXA 1POV0 4Q8TA 4Z92B 1ULFA 1TKKA 3ZLFA 1E70M 3USUA 1UHVA 4MGYE 2D1ZA 4N7IA 4C7DA 4ORIA 4O53A 1B57A 1J3QA 4NG3A 4JDBA 1UWQA 1UX6A 2PWHA 5DDJ2 3I7QA 1ODNA 2GJRA 4V2VA 1WCSA 5EPAA 2ZX5A 2EBNA 1MUCA 4G8TA 3EWXA 3VDBA 5A3OA 1V9U3 1HB4A 3KTXA 1C1FA 1UXXX 4IE5A 3FZ3A 1H6XA 1OG6A 1GOKA 4LLFA 3IJ8A 3K75B 4DO5A 3VCCA 1K42A 3C7GA 2HNEA 1AUSL 2OG9A 3JUGA 3SDOA 4BK9A 4MWAD 5FYYA 2RHGA 1KQZA 5D03A 4D72A 1EPWA 4ZL1A 4Z2GA 4HOZA 3IMNA 5DAVA 5D8ZA 3DXUA 2PA6A 2VWTA 5ISLA 1BK0A 4CCKA 5K4LA 4XW3A 4LFYA 1P48A 3N4AA 4H6EA 3IAPA 4P7QA 4N43A 4D8AA 5A3WA 2ET1A 3K48A 3VL9A 1US0A 2D3NA 3ZYRA 3MBFA 1QCWA 3PS7A 5J5DA 2VBDA 1C91A 2JE8A 4M3CB 5A6BD 3R0KA 1I75A 4UOZA 3P3PA 1GLHA 3ITCA 3S7EA 1TR1A 3VMPA 2D69A 4NWWA 1V5XA 3LDRA 4IGPA 1S2CA 4XD3A 2QJJA 4B15A 1FWHC 2A5ZA 1E1FA 2POTA 3VCRA 5CC7A 3LMYA 4LUSB 2A1XA 3MHZA 1Z32X 3L4XA 3EOEA 3NJ3A 3W5NA 1X8EA 2VFDA 2GGEA 1B90A 2DT2A 4WK9A 4OFCA 4DVOA 2B7NA 3M7WA 2WSUA 1EBGA 2YA0A 2OSXA 4LKSA 3O0KA 2ZUSA 2EIDA 2VM9A 3QFEA 1JRCA 3W27A 3U7BA 4Q8PA 3QVQA 2XJ7A 1WAUA 2OGJA 3TV8A 4JGZB 4GQRA 4WXZA 3TZFA 1VENA 3DOPA 2CDPA 2JFEX 5JIAA 2B7QA 2BVDA 2X09A 3FWEA 2PWUA 3LPFA 2GVJA 4Z42C 4FOUA 2J8TA 4ATLA 5FZLA 1CB2A 3MDUA 4JTFA 3FFQA 1W2TA 2MEV3 4OLLA 3I4KA 4O4WA 4WVZA 4JC1A 3UCQA 4I2OA 3GNEA 3SCSA 1XSJA 4CEYB 3HM7A 1F6YA 4R88A 3HMYA 4RXFA 4DXRA 3BTXA 4PSRA 2C6QA 2PDYA 5JH1A 1AYM2 2OPJA 4H8VA 1UZZA 4MUVA 1RA5A 2G8ZA 4JIHA 4IE7A 4HPHA 3PZTA 5F5AA 4NOTA 2V2HA 2PDKA 4MUPA 3VI2A 3W5MA 4LUMA 4WKFA 1QJEA 1R46A 3WP4A 2FDJA 1WDSA 3TW7A 2RJ2A 1Y5XA 5FLJA 5ABEA 1H4GA 1RVGA 1E15A 3A4AA 3B9NA 3D3AA 2P3YA 4NQ1A 3RWNA 1K03A 1OUSA 1AA1B 4LXLA 2Z4GA 4KFPA 3WLIA 2PAJA 5IBXA 4ACZB 3OA3A 5CJNA 4IM4A 3VVGA 1XR2A 3AZXA 4N9EA 2WLQA 3H8XA 5FTTC 3MHFA 3WH8A 2AL2B 2RS33 2Z5WA 4GUJA 2RM23 2CLIA 4GYFA 1PPIA 3RPTA 3USUB 1V02E 4L65A 3KD4A 3HMCA 4NZFA 2VCAA 1KBKA 1IXOA 2NUWA 5E93A 3PUOA 3EDDA 3FOKA 5FZAA 5BV6A 3BGJA 4QLJA 4V27A 2HJPA 4Q8OA 4XFAA 2CZFA 1OX6A 5K7JA 1UU5A 1GANA 1AXYA 3PUAA 1S5WA 3MKKA 3N9RA 3N15A 4RW3A 3WF3A 4AY7A 3U78A 4LWWA 3CBNA 5U7SA 1Q8PA 2WPGA 2G3JA 2OZJA 4TZDA 2Y63A 5KR7A 3NKGA 3N34A 3ME3A 3TJXA 1M7XA 2XINA 3P80A 3M3OA 4AFMA 3GYDA 2GZWA 4LVAA 3ZN6B 6ENLA 1G4SA 1O7AA 1VJSA 5A7OA 4PDWC 2ZJCA 4LUSA 3H3ZA 4ZTXA 3T7VA 1HXJA 2DIKA 2WQZC 1E55A 5FYVA 1EV13 1OC7A 1YXCA 4HL0A 1F05A 4JZRA 1OCBA 3AMKA 4SLIA 3QLLA 4CCEA 5GVJA 1UAIA 3NL3A 3KBNA 1S0FA 5I0RA 1YYNA 3WK3A 3OTRA 3WELA 1RUC3 5BNQA 2GGIA 7A3HA 1EIXA 1RHI1 2MHFA 2ZZ7A 3ZX7A 1R3RA 4INFA 1SFJA 2PLJA 4RW5A 1O1HA 3VZMA 4J3XA 4H3WA 1Z78A 4IEPA 4GH1A 3AFBA 3XIMA 2HWC3 3B97A 5CG0A 1RUG3 2Z29A 2J78A 3O5SA 3TYAA 3F4VA 4K3ZA 2AYHA 4XBQA 4XF9A 3VX1A 4H41A 2D2HA 1SBDA 1GKQA 5I07A 3PC0A 2ZX0A 1EB3A 1U12A 3JZVA 1FMD2 2Y26A 2R0FA 4TTGA 4LVBA 1CPMA 1GNXA 1OFEA 5A69A 5AC4A 1HDKA 1EZWA 1IZCA 2H6CA 3LA3A 4ADUA 1Z9AA 1EPZA 1J5TA 3GHRA 3T4CA 3CV6A 5FY7A 1UR4A 3VM7A 4XSMA 1AHSA 3RM9A 3N4FA 3F7JA 1XW8A 5D02A 4XZIA 4QM8A 3GVRA 4RR3A 3UNDA 3SR7A 5FBJA 1YIPA 1FV3A 5A1LA 3G1SA 4PHZA 4MZ8A 1MZFA 3PVNA 1C92A 3IIOA 1MEC3 4TVUA 1MS3A 1E6RA 2Y70A 3MICA 1SPPA 3I2OA 3STFA 2ARAA 1WP6A 3HWJA 2JGYA 4BQ2A 3VC5A 4WZFA 3EWZA 1AJ0A 4LO7A 2HISA 2BXZA 1U33A 3KWSA 1JD7A 4RV3A 2ZMKA 3GW0A 4FSAA 4ZFCA 2BTVC 3M3QA 4J5NA 2ZAHA 4ZSTA 2BOIA 2LTNA 5FXZA 1IT0A 4Y1VA 1EEXA 1XIFA 3M64A 3KL5A 4QQHA 3H2FA 2DTYA 5LSMA 3ES1A 1WQ5A 3PJWA 3UJOA 3CL6A 4RS5A 1OWQA 2J8FA 3LXCA 3W37A 2Z2BA 5FY4A 3O6YX 1OFNA 3GNXA 4JCLA 2BV4A 4YL2A 4NXSA 3GW3A 4AHQA 2JDZA 5A6QA 1KCZA 4H7LA 4KWKA 4IV1C 3C0SA 1SR9A 4HN1A 3VKCA 1LOLA 1FMD1 4GD0A 4UTLA 3BV4A 1U5ZA 2GGGA 3R0UA 1F74A 2G4JA 4H9UA 4NZ1A 1RJQA 3AU2A 1SZGA 1C93A 3E6CC 3SSZA 4PT6A 5FZEA 1IEIA 2GJXA 5TNVA 4MB3A 3SUWA 1JEZA 3V5CA 4IISA 1DQ6A 1YNQA 3L4WA 4L9BA 4H9YA 5GJPA 1BQPA 4PTMA 2FB2A 4CCOA 2PHFA 3LFIA 3PUHA 1C8M2 3DGTA 4HOXA 4GI4A 5A6KA 2GYIA 5DMNA 3FVMA 3TX9A 4IESA 4P8VA 3KCLA 1YI7A 5IK5A 5DEZA 3LPOA 3CGTA 3MYXA 4MJMA 3X29B 1LAJA 1X98A 5IATA 4JGYB 5E09A 4NZJA 5ANNA 1OFBA 3VNMA 5I0TA 1TV5A 2PU0A 4Y4RA 1SFPA 2NV9A 2VUCA 2IWGB 4IQDA 4GRSA 5FUIA 4P9XA 4PTDA 4ORMA 2EO7A 1BQCA 1Y7VA 3J7MA 1AJ2A 4X22A 3V1HA 1UQXA 4U2ZA 1PCWA 1CXLA 2RS32 4C1XA 5CGQA 5GZDA 3VOGA 2FTWA 3WLOA 2Y62A 4HNUA 2W1SA 1ASJ3 1EJXC 3AIUA 4JFWA 5BWAA 2IMRA 4TTUA 1H9PA 4N6EA 3J9SA 2X30A 1MW2A 3M07A 1OVDA 4X6QB 2VVNA 2XGBA 3PK7A 3N6HA 3RDIA 3EDKA 3KOYA 3O1PA 4MJ4A 1MACA 2PF0A 4DAIA 4XJZA 1CJPA 4ZODA 3TEVA 1F8IA 3WP6A 3F95A 1RUH3 2HVOA 3VKKA 4EROA 4NJIA 3MV01 2MEV2 3MHGA 3AKRA 4K36A 5FREA 1K5MA 2OT0A 1SBEA 3STEA 4ZVJA 3EEZA 4INDA 2VW1A 3TN93 5LGXA 1UWRA 4XBJA 3ZO9A 2PODA 4PDWA 3WQFA 3N7LA 2R9RA 4RDYA 4N9IA 1BVP1 1RPXA 1AD4A 2D6LX 3EA2A 2EPOA 1MSSA 3U75A 3FMGA 1GVFA 3DU0A 3CTTA 1SR0A 4B5UA 1XE7A 1IIGA 1Q6OA 2DORA 3S5YA 1JNDA 3RGBA 1QOSA 3LWCA 3N9SA 1HIZA 3VIGA 4WVXA 4GVIA 3TCEA 1H1AA 2OYZA 4MVAA 3MSYA 1UR3M 5HPCA 4J28A 4ZXLA 2JG9B 3P7YA 5EMMA 4F3JA 2VZOA 1JAEA 2WFF3 2BASA 2D6PA 1XRFA 1D8CA 3KHJA 3M44A 4LXFA 2YX0A 5AYYA 4WDUA 1DLLA 1UC5A 4CNUA 1Q5MA 2UZ9A 3P93A 4GUIA 4CXWA 5J3UA 1ZBVA 1H5VA 1SCRA 1O3QA 3RFRA 3GZEA 4ARXA 5IVEA 3RFAA 3A4XA 3BQ6A 2AQWA 2JQXA 3P3NA 1TSIA 1F8MA 4PCFA 1M68A 1PHWA 2WANA 5IM51 5KXCA 1HVQA 2NV2A 4UTTC 4YW5A 1UD8A 2AMXA 3UWUA 1NU5A 4A6SA 2A21A 1QJX1 3N3TA 3UWVA 1DZRA 2J77A 1YQ5A 5I7GA 4R34A 3WW2A 2WWCA 3HT1A 3AYTA 2XXZA 3WQ0A 1FH9A 2RDUA 4NVTA 1R1A3 3IRDA 2DZPA 4HU8A 3IWZA 4JN6A 3CF6E 2DW6A 1L8NA 1Q7MA 4AEMA 1YQ8A 1COV3 4C91A 1UOKA 4DNMA 3ZMOA 5C54A 1GZJA 4URAA 1AW1A 2WMKA 1IR1A 3MP4A 4PCRA 1L9WA 2J1VA 2V2DA 3ITTA 5FPLA 3ZN5A 4AGVA 5CAHA 1UMYA 3TJ4A 4JIPA 4YTUA 4BU2A 4HN0A 3VOCA 3UGRA 4I8DA 1W9UA 1E6SM 5LYRA 2C7FA 1DTNA 1RHCA 5K3VA 3U4FA 4QHZA 2AL1A 3W28A 3AP6A 1DJIA 2NQJA 3NMBA 3MLJA 4U5IA 4B1MA 4A2SA 5FZOB 4XD5A 4BXFA 4US6A 1ALYA 3W87A 4IX0A 3TBDA 1R2TA 5IXEA 4ARYA 4NAMA 1PVC1 5FJKA 3CU7A 3LOTA 5ECUA 3G5EA 3WLKX 1QJX2 1FHUA 4B5NA 3OIHA 2A70A 2YROA 5AC91 2YCJA 2QCCA 4CQBA 5DZEA 2YBKA 3E0WA 3NKTA 1PDZA 3ST7A 1NX9A 3E74A 3NZQA 3P8IA 5I3IA 5EA9A 4EK7A 5D2WA 2QCSB 2RS51 3RK8A 3NPXA 2FDKA 4KRZA 5JSOA 4GBDA 4OI0A 2Y88A 3K51A 4ZKTB 3WLJA 1H1MA 3LTYA 4WR3A 1PIIA 2WW5A 2FGLA 2QEZA 5D9MA 4I01A 3G1AA 5BNPA 3KS7A 4CCLA 5F8PA 2NT0A 5BNOB 3W4RA 3JBG3 3UW6A 3CJIA 4Q3MA 2RVAA 1IEVA 2QS8A 5GKAC 3E6BA 3NURA 3E2RA 2Y38A 3KBSA 1VBD3 2DZWA 4PMOA 4NAEB 4V1PA 3GUWA 2VH9A 2RGMA 1U5HA 4PC8A 3CLWA 1P1XA 2KX9A 4ES8A 3JD71 2XKOA 4JKMA 3RVHA 4BQWA 4ZB5A 3J8F2 3TNOA 1CXKA 4BM8A 5DABA 3N9LA 3UEQA 1KITA 4G1NA 3ETPA 3SGZA 3GFXA 3EB2A 2YV8A 3W1NA 3THCA 4KIEA 5I24A 1WGPA 5C3OA 2ABBA 1MXDA 3WJSA 2TBVA 2ATFA 4I3PA 3L0KA 5CKQA 1U5VA 3ZMNA 1GWKA 4TQTA 1ZBCA 2HPIA 3Q67A 2WNVC 2WWUA 4DPNA 4Q1PA 3WHTA 3EXUA 2PTDA 3O3RA 2BZNA 4FAMA 1W9BM 3G8RA 1YQ6A 4DZGA 3QSRA 2TYSA 1V4YA 4WZHA 5DBUA 4L61A 2QF8A 1QF3A 2GJNA 2W61A 1B2YA 3C2RA 5XIMA 4YYFA 1OX5A 1KTCA 3NG3A 1A0CA 3NSMA 5E1QA 1H5YA 2XH0A 4I7VA 1BF6A 2YY1A 3RF9A 1EV11 3AAMA 4AYGA 3C7EA 1S2WA 4MPKA 4XTDA 2CXEA 3W02A 5L7OB 1K8XA 1HB1A 3PDQA 3PZMA 1UZHA 2PDJA 4IV1A 3ALQA 4QEHA 3FX4A 2A3BA 4IGOA 4IUGA 3GIYA 3VINA 1EP2A 3O14A 3ZLIA 4HSJA 2NW0A 1JDAA 1CGUA 4NJJA 1UQZA 4AAPA 1TV2A 3AXHA 1GV9A 1XNCA 4P7LA 1VIWA 4MF4A 4IICA 5LHEA 1WLWA 4Z8BA 3DG6A 4QDSA 1GJUA 1JZ3A 5LNWA 3GTIA 3I4EA 1FWEC 4JAWA 2ZGRA 3PUDA 1MRQA 2O9OA 2W5FA 2VQTA 4U36A 1WB0A 2HXTA 1OCJA 4B5VA 2PTMA 4A6GA 1J6PA 4H9VA 4ZO9A 3CL7A 1J79A 4IFKA 5JBDA 5FAJA 1J10A 3AMNA 2JECA 4UQDA 1RUD3 3URQA 2X0SA 1KR0A 5F32A 3DC8A 3VABA 4WDXA 2DW7A 2PDFA 2ZGUA 4PL1A 1TIWA 4UNKA 4C6OA 1KDKA 2I45A 3NV4A 1QQP1 4I9TA 3GO2A 1CZ1A 1JXNA 2P3KA 1D7KA 4I02A 5C6MA 1GKRA 3LSBA 3IIAA 2NMOA 1W8ZA 5K9YA 2PRMA 4GI9A 4HT1T 5ACA3 1T41A 2EVXA 2ZDRA 1OHFA 8TIMA 4IEXA 1H7XA 4ZEPA 4RDWA 1Z7S3 1AXZA 3DN5A 2WCAA 1NLQA 4F9JA 3I97A 3CAKA 2BHZA 1SLLA 2F4PA 1SO6A 2VMCA 4XWUA 4QG8A 2DEPA 3A3HA 2GMPA 5CG9A 2RM22 4DNHA 2CLEA 3KRZA 2CZEA 1OYCA 1W8UA 3N4EA 1YIFA 3WF1A 2H9AB 2X2YA 4D6QA 2ZFAA 3LEMA 4GH4B 3K1DA 3B06A 3O1VA 5IT6A 1XL9A 5FZ4A 4B3NA 3KZ4C 2GQ8A 2XQRA 2P17A 1EWDA 1RJPA 2EKGA 1UOBA 4PULA 3QKEA 4NUBA 1LOSA 2ENRA 2Z42A 2P1FA 3EKGA 2W47A 4Z0SA 3VXGA 4BMBA 4LBSA 2PGEA 2QAFA 3RMEA 2A6ZA 4G5DA 4FOQA 4GABA 2J6VA 1OCQA 4J3VA 4DJFD 5D9NA 3RPQA 2H6RA 2NV1A 1BHGA 2XFWA 1LM1A 3MW2A 2ZEYA 3RITA 1K6AA 2A7RA 3RJYA 1KRAC 3VBRB 3CZKA 3WJYA 1XLAA 2C26A 4GIAA 3O63A 4DINB 1IHIA 3DC0A 3W0KA 4Q4V3 2HWE2 3AP7A 3PBGA 5BNNA 1NDYA 2XHKA 1VBGA 4X0NA 5AECA 4FNTA 2C1GA 3OU8A 3HVDA 1OKOA 1X36A 3AM2A 5DAQA 1J3RA 1JDDA 2X1RA 3TA6A 1R2RA 2IPGA 2FTYA 2HRWA 2ZX3A 2ACSA 3F03K 3UF9A 2D6NA 1Z48A 2P3IA 1F8VA 3N3MA 3AYDA 4X8NA 3A5FA 3WCRA 4ICNA 3H26A 5L7OA 1XCXA 3TKFA 5DPNA 3QQWA 1W8OA 4WRHA 1TMF1 1F3XA 2W91A 2R042 4K8EA 2DCZA 3VBHA 3H54A 4IGMA 4DJFC 5FYZA 1HX6A 3BH4A 4H04A 3L2IA 4FA3A 3VHOA 1JOBA 2BBVA 2WSPA 3I6RA 3KP1A 3V0AB 4D6JA 1NWRA 1OJXA 1OX4B 2IKHA 4XAAA 4H19A 3FEQA 4B9YA 3PTKA 4K1YA 2WCSA 1GSLA 2CLKA 2E68A 1E1EA 2CFFA 3SFKA 5DN1A 4HFSA 1RVF3 1UUMA 4DQAA 2P34A 5DO8A 5EJ1B 3AMGA 3F2ZA 2WKGA 2GJPA 1DHKA 4LBOA 5K9CA 4CVUA 3H3LA 4IJRA 2QCFA 5BOOA 2Y64A 5HWJA 2ZOEB 2ALRA 5AHMA 1QUMA 2A3HA 3LV5A 2JDAA 4UR8A 5DANA 4H8UA 1E57A 2XBO1 3KBMA 2VXJA 4BQXA 2EQDA 4M3PA 5GZCA 1MQPA 1NH6A 4DB7