3ZM8A

Crystal structure of podospora anserina gh26-cbm35 beta-(1,4)- mannanase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
444
structure length
444
Chain Sequence
RDGPVTYEAEDAILTGTTVDTAQVGYTGRGYVTGFDEGSDKITFQISSATTKLYDLSIRYAAIYGDKRTNVVLNNGAVSEVFFPAGDSFTSVAAGQVLLNAGQNTIDIVNNWGWYLIDSITLTPSAPRPPHDINPNLNNPNADTNAKKLYSYLRSVYGNKIISGQQELHHAEWIRQQTGKTPALVAVDLMDYSPSRVERGTTSHAVEDAIAHHNAGGIVSVLWHWNAPVGLYDTEENKWWSGFYTRATDFDIAATLANPQGANYTLLIRDIDAIAVQLKRLEAAGVPVLWRPLHEAEGGWFWWGAKGPEPAKQLWDILYERLTVHHGLDNLIWVWNSILEDWYPGDDTVDILSADVYAQGNGPMSTQYNELIALGRDKKMIAAAEVGAAPLPGLLQAYQANWLWFAVWGDDFINNPSWNTVAVLNEIYNSDYVLTLDEIQGWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GH26 ENDO-BETA-1,4-MANNANASE
publication title Structural and Biochemical Analyses of Glycoside Hydrolase Families 5 and 26 Beta-(1,4)-Mannanases from Podospora Anserina Reveal Differences Upon Manno-Oligosaccharides Catalysis.
pubmed doi rcsb
source organism Podospora anserina
molecule tags Hydrolase
total genus 139
structure length 444
sequence length 444
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
A PF16990 CBM_35 Carbohydrate binding module (family 35)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3zm8A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3zm8A02
1WCGA 2XM1A 2WQ8A 1PX3A 2DT2A 1W32A 3WDQA 1H11A 1O8PA 5A6BD 3NQHA 1GZJA 2EQDA 2VRJA 2Y6KA 1FFRA 2GSJA 1ZB5A 3OEBA 5JBDA 3WBAA 5E9AA 7TAAA 1HJXA 1JDAA 3PUIA 1CEOA 4PMQA 4WLCA 5FCZA 2V4VA 1JZ7A 4TTUA 3TTOA 1E73M 3ACFA 5I23A 4ZZ5A 5JUVA 3KEHA 1B0IA 2BHUA 4A41A 1BVNP 3AIBA 3VTRA 3RJYA 4HU0A 4OUEA 1O8SA 1QHPA 1QNRA 3SIMA 1W3LA 3ALGA 4PMVA 4R5EA 1SR0A 4YHEA 2WAAA 1JDDA 3GZAA 2E8ZA 1BYBA 2J7BA 3RPMA 2CHOA 2Y6LA 1V6WA 1I1XA 2GJPA 3F5JA 1OD0A 4GQQA 3NUKA 3WDIA 1VJZA 2DSKA 2W1UA 2WM0A 4UFKA 3W4RA 4CN6A 4H8VA 4QLJA 4NI3A 4X0NA 1J18A 1WDPA 1W9TA 1EHNA 2DQXA 4TVCA 3MV11 4J3SA 3AXHA 1KQYA 1VF8A 3LPFA 1FHDA 1CGXA 3ACHA 3WMSA 1NAEA 2PWDA 1UZ4A 2FHCA 1UD3A 1EXPA 1B90A 3WDJA 1XRVA 5A1AA 1J84A 1BSIA 1E70M 2XFRA 1MQQA 4MNLA 2XTKA 4M1RA 1CDGA 3BLPX 2QQIA 2CESA 3ARZA 1CZSA 4NRSA 5JXJA 3CZEA 4BQ2A 3VD4A 2J7CA 3BGAA 3VX0A 1UWUA 4UR9A 5CZKA 1H0IA 5EFFA 1MVYA 4MAZA 2OWCA 4HZ8A 2R7EB 1H2JA 4P7RA 2J7MA 3WL1A 1V6YA 1UYXA 1WB0A 1OM0A 1UYQA 4UNIA 3C7EA 4MDPA 4UTFA 3T0AA 3OG2A 2GK1B 3RILA 1C92A 4JCMA 3T2QA 5DN2A 3VIIA 3AZRA 2VMDA 2W3JA 1W3KA 1BF2A 2CITA 3WUBA 1J83A 1ZU8A 2VCCA 1E71M 3F5KA 4C7DA 2YLAA 4GI8A 1H6XA 2HYXA 3MV01 2BXZA 4D6HA 4A3YA 2WMGA 4NRRA 2Y6HA 5I24A 1GNXA 1UZ0A 1GOOA 3CHCA 4JIEA 5CG0A 2Y4SA 3ZQ9A 1UY0A 3VDBA 5A69A 4W7WA 2A3AA 2V5CA 1UR2A 1GJWA 3VD9A 4DXSA 3WH5A 3QOMA 1J0ZA 2E9MA 4P8VA 2W87A 1K9EA 1LNSA 5D9OA 1SMDA 2WO2A 1JGIA 3LE0A 2ZICA 3ARUA 1ISZA 1EO7A 4GZ9A 2GFTA 3WMCA 2BY1A 4JKLA 1EDQA 2ZX6A 5D8WA 4MDOA 3UG5A 3RO8A 3EDEA 3ZMRA 3VGFA 3N18A 2QQJA 3SEEA 3WD2A 4PTWA 4M56A 1W9VA 4CU7A 3GH5A 4D6DA 3E1F1 4CUBA 1PMHX 1KBBA 3WNMA 1HF6A 2J79A 4P7QA 2YA1A 2EJ1A 3N17A 1GONA 4UQDA 1VFMA 1AQMA 4D8MA 3QHOA 4CN4A 1EGZA 4D6JA 3CH9A 1E6SM 1MWOA 2V3FA 3A4XA 3VILA 1VFUA 1E1EA 3ZM8A 1U2YA 2VZ1A 2J47A 3AMGA 2ZEXA 3VMNA 4LGXA 3RM4A 3RM9A 1HKKA 3UG4A 2EBNA 3C7OA 2D0FA 3BAXA 1MW2A 4HMCA 3TONA 1HVQA 1M03A 1OSEA 1UQZA 4FI9A 4EK7A 3AIRA 1KGWA 3T2OA 3WQBA 3GNPA 3VGHA 1V08A 3KWXA 3SCOA 3POHA 4ARXA 4IISA 3VUPA 3IJ8A 3NCOA 1P8JA 4PT6A 1CGVA 3ACGA 3A47A 4J28A 3CKHA 2V5DA 1XHGA 2HISA 5FKYA 1ZBWA 2J1AA 5I79A 1MYRA 1W1TA 5HPCA 3PZIA 4CVWA 2E8YA 5CYYA 4BDVB 3QGVA 3OZPA 2VX6A 1UA3A 4EKJA 4K68A 2QQOA 2XM2A 1KBKA 3CGTA 1BHGA 1LQ0A 4FLSA 2VO5A 1W2VA 3GBEA 1J01A 5FD0A 3GM8A 2EIBA 1HP4A 1WZLA 3ZJ7A 4DXTA 4CUCA 2VX7A 1UYZA 2XSAA 4W7UA 5AYBA 1QI0A 3PUHA 2YKKA 1UWRA 4GZIA 1X6LA 4XURA 2PF0A 2W1SA 2YLLA 4IUGA 3K4ZA 3OLEA 1GQKA 3WUFA 1XD1A 4W8JA 1XC6A 1QNOA 1LWJA 4GINA 2WMHA 2WLYA 3APGA 1IT0A 1QHZA 3VKKA 2WSKA 1Z32X 3SCNA 1JYVA 2Y24A 1SHWB 2VX5A 2ZX7A 1JI2A 3SUVA 2QPUA 2CBIA 1SMAA 2WVVB 1S46A 2WANA 2WZHA 2Y2WA 2ZXBA 5JBEA 1D7PM 1KGXA 2EPLX 3I2GA 4CVUA 1VIWA 1R86A 1BPLB 2E9BA 5JMOA 3C7FA 1NKGA 1KR0A 2X09A 1XSKA 3K77A 3WEMA 3AS2A 4P7NA 3T09A 1JU4A 3GXMA 3AMDA 1K42A 2BFGA 3ZOAA 3GH7A 4RE3A 1WZAA 3CUFA 4C7GA 1GQLA 2CHNA 2VZ3A 4XUYA 1V0LA 3CUIA 4XZBA 2VZOA 4OYUA 3FAWA 3SCUA 3CZUA 5A6JA 3AI0A 4PMOA 4UCFA 3GNRA 4AD1A 2WMIA 5EFDA 5E09A 2D3LA 2NSXA 1EHAA 4P02B 5HBFA 2DSVA 2WCAA 4PMNA 4Z2LA 2ZE0A 3BXWA 4WSJA 3VPLA 1EDGA 1BQCA 3WEOA 1L0PA 1ECEA 1DEDA 1QHOA 3L4ZA 5HDRA 2DSZA 4AD4A 1JZ5A 7A3HA 2EICA 3K1DA 3W28A 3CDZB 4DUWA 1MXDA 1EH9A 2J1RA 4JFTA 1ODUA 4MNKA 3O9NA 5M3WA 4LPLA 1UD6A 1JD9A 1GVIA 2CDOA 2CBUA 2DIJA 2BBAA 1NWSA 2CNCA 4AEEA 4QX2A 2J7HA 4UZUA 3B9EA 2YA0A 1VFFA 3MKKA 1XNAA 2BHZA 1VEOA 4DM2A 3VDAA 3VGEA 3WKZA 5JXGA 4DM1A 2ZOXA 1GOGA 1JZ8A 3MUY1 1E5JA 3AS3A 3WH7A 4AZ6A 3VIPA 4L0PA 5JBFA 4QDSA 1EIBA 5IXEA 2LS6A 2A3EA 5BRQA 3P6BA 5FOOA 4QB2A 4D6IA 4UFHA 4UQEA 1C8YA 1TA3A 4PTVA 2ZWYA 4M8UA 1JZ6A 2JIEA 1W9UA 5DFAA 2D23A 4ACZB 2DDUA 4AIEA 2YOCA 2O9PA 4ZENA 2WC4A 1D3CA 2VZSA 1DTUA 5ABHA 4FLOA 1CXHA 5I78A 2ORXA 4QDQA 4ZE5A 2WMJA 1UR4A 4AZ5A 2IXVA 1V6UA 3AXIA 3WH9A 2DPEA 2G3NA 2VX4A 3L4XA 2ZUVA 4FLQA 4AAXA 1TA3B 5A8OA 2L9LA 1JIBA 1FHLA 5BXPA 1UY1A 1J0HA 4OMDA 1RYYA 4WJXA 1OH4A 3DHUA 2NT0A 1KR1A 1HIZA 3VGDA 3AROA 2ZUMA 2W9XA 1OD3A 4QB1A 3K4AA 1E4IA 1VENA 4UQ9A 5FL1A 1QBAA 1Q6CA 3I2KA 2DSWA 2IXUA 3CUHA 4JFSA 1BGAA 2AMGA 2J74A 2IUZA 6CGTA 4JFWA 1B3VA 4UQBA 2J1VA 3TTSA 2VI0A 2WVTA 3AJ7A 2EPNA 3WD0A 3WFZA 3I3DA 4AG4A 3RJXA 4A42A 1M01A 3SUSA 2XONA 4YN5A 3JXSA 3WFLA 4DUXA 1T2XA 2ORZA 4ZXEA 3W0KA 4M29A 2E9LA 1JFXA 2J22A 1GQIA 1DWIM 1NOFA 1H49A 2OWXA 3SUTA 1VFOA 4BF7A 4QB6A 4XZWA 2D24A 4A4AA 1PPIA 4JFUA 1CENA 4UFLA 3VDHA 5A2AA 5JXHA 3WQ8A 2CETA 3GXFA 4EANA 3BC9A 3SCVA 1VBUA 5I6SA 3PZNA 1UKQA 5BXRA 4U5IA 1UWWA 4MGQA 3VNYA 3WBEA 3C8XA 8CGTA 4GI9A 1HKMA 5CJ5A 2XVPA 1O59A 1Q6EA 5D9NA 1FP8A 1LLOA 3ZT6A 2DCKA 7CGTA 3AIUA 1E15A 3ABZA 2C0HA 3MMWA 1OIMA 3OA5A 3PZVA 4XZUG 4HMEA 4PMUA 2VT0A 3VD7A 3IAPA 2A3CA 5E0FA 1IV8A 4PMRA 3CMJA 4Y7EA 2PB1A 3MU7A 4WKFA 2XHNA 4QCFA 1GPFA 1OGGA 2JIWA 2XVKA 1OIFA 4EE9A 1TVGA 5FIPA 1E6XM 4KGJA 4OBSA 9CGTA 4TUFA 1B3ZA 1JXKA 2WZIA 1KGUA 3EDJA 5A3HA 1UR9A 3OBAA 2WUHA 1CGTA 3OIHA 5CLTA 1EUTA 4JL1A 1B1YA 2W5FA 1O7AA 4PEEA 3SCWA 4A45A 1CBGA 4FK9A 2PBOA 3IAQA 1HNYA 4XUOA 1HKJA 2E4TA 4D0QA 5M17A 4YHGA 4H8HA 2E31A 2YC4A 1TMQA 4AD2A 3WNPA 1XCXA 1GORA 3F5LA 4HZ7A 2JF7A 5I0DA 2A3BA 1QI3A 4W85A 3TA9A 4N0RA 2WWDA 1GMMA 1RP9A 5LA1A 1UR0A 5BROA 1R7OA 2JE8A 4BCEA 4W4ZA 5E6YA 3QR3A 4X0VA 4BQ5A 3RIKA 4ATWA 2YFZA 3O2LA 8A3HA 3CZLA 4AWEA 3O6AA 1E6PA 2YB7A 5IJRA 4GO9A 3VIOA 3VD5A 1V0KA 3HNYM 1NP0A 2WMFA 1LG2A 1JF5A 1NH6A 4WKAA 4BK5A 2GVYA 4AXNA 3GXDA 3WMBA 5I5RA 5CPTA 1J11A 1GW1A 1MW3A 3I2IA 2G3IA 3SKVA 1JAEA 1EUUA 3M6DA 3CPUA 1JZ4A 4F79A 4F66A 3ZT5A 1MW1A 1E0XA 4XV0A 1LL6A 1V0MA 3L4WA 4PUEA 5AC4A 3D3AA 4QX0A 4WKHA 1UH4A 3W37A 3OLDA 3TOPA 4ZY9A 1B9ZA 2UWFA 5FL0A 2F61A 5LYRA 3LEGA 2DSUA 2YDQA 1M53A 3CHDA 5A2CA 1TG7A 5C8BB 1CXEA 5M5DA 4CD5A 1NOWA 4P8UA 1GJUA 2WNWA 3N04A 2X05A 1QBBA 4H2CA 1TE1A 1WZKA 5CQ1A 1WCQA 1FH8A 3BLKA 3SURA 4Z2JA 2PC8A 2E3ZA 2GJXA 2RVAA 1EQPA 4RE2A 2XPKA 3DECA 2ZEWA 1QNSA 1W9PA 1UH3A 3CUGA 1ODZA 3ZJ8A 3ARWA 2B4KA 5EB8A 1GVYA 1A3HA 1BYDA 2FHBA 3LPPA 3FNDA 3RDKA 5HPOA 1G01A 1E0VA 5CPQA 3GTNA 2D20A 4W8LA 1WDRA 4B15A 1OT2A 3BAKA 3DYMA 2ZX8A 1PEZA 1W9BM 2GJXB 4OKDA 1CXIA 2XIIA 4HP5A 5DO8A 2OYLA 4IM4A 4HZ6A 4KRTA 4W8BA 4LYQA 2O9RA 2WABA 3FAXA 2BNJA 1E6QM 5A95A 4PSPA 4QAWA 1ITCA 3OGVA 2A3HA 2WDBA 3NJ3A 4L4PA 1UUQA 2Y8KA 2WMKA 4HG6B 4PCTA 1EQCA 4AZCA 1EOMA 1W8NA 1EOKA 5D9MA 2V72A 1SG3A 3ZT7A 2EPKX 4LYRA 2FHFA 3OB8A 4E4PA 3RM8A 4AMCA 3T2PA 1QI2A 4A3ZA 2DT1A 2VRQA 2WLZA 1HJSA 2YFUA 4LYPA 2GDUA 5IFTA 2W62A 4GXPA 4MAVA 5G04L 3EDKA 1R64A 5EJZB 1GHRA 2YDRA 3FHAA 1DWGM 4LKSA 5AYIA 4P8XA 1QPKA 3WF4A 3N9KA 3FW6A 3HMCA 2J77A 3L4TA 1TVNA 2WN3A 4AZ7A 2W4XA 3PHAA 2ZWZA 1UWIA 1UZ1A 3AXXA 3BSHA 3AMLA 2YC2A 2OSYA 2ZIDA 2QQKA 4AISA 3L2LA 2WPGA 4W93A 2JKXA 2BXYA 2WW5A 3CLWA 4S3JA 3W24A 4M4RA 1HL8A 3AHXA 1TR1A 1C7SA 3MUZ1 2BHYA 4HOZA 3A7QA 2D0GA 1CGWA 1EO5A 1ULPA 2NT1A 3K75B 4OMCA 1VAHA 1V03A 3G6LA 2X2YA 2W61A 4HOWA 4QDMA 4UQAA 3SUWA 3ARTA 2WB5A 4KMQA 1V02A 1LWHA 4ATDA 4LPCA 1W99A 3CHFA 3IIIA 1W1PA 1PJ9A 4AY1A 2UY2A 2ZXQA 2YL8A 3C7GA 1YHTA 2WHKA 1TZ7A 2B31A 4W7VA 3CO4A 1DWJM 5AC5A 1JYXA 4TVUA 2X0HA 2CXGA 1UWQA 1JG9A 1PBGA 1E5NA 2WO3A 1W91A 4BK4A 1K45A 1LL4A 4Q7NA 3VM7A 1BFNA 2CKSA 5LA2A 4W5UA 1UYYA 1XH1A 4CD7A 3W26A 2JF6A 1I1WA 3QOKA 4HA1A 3SKJE 1B31A 2WBGA 1B3YA 1J10A 4QPWA 1JXJA 3WELA 1JL8A 1RD6A 3U5YA 1JD7A 2DH3A 4UOZA 4BQ3A 3DC0A 1H3GA 2BV9A 2E26A 1UKTA 3ARPA 3HJEA 1XPWA 1E55A 1H1NA 4TXEA 2QBXA 3A23A 4M81A 1BG4A 2G41A 1QVBA 3GYCA 1W8OA 3MO4A 3N1AA 3K46A 1V6XA 1ISXA 4JZ5A 1UWTA 2O9OA 4XX6A 2BVYA 1CXFA 4DWSA 2EPMX 2YL9A 5DPNA 3JUGA 1H6YA 3M07A 2EEXA 1OF3A 1BTCA 5AY7A 4AZIA 1FOBA 3N12A 1PMJX 4GWJA 3WNOA 2YIHA 4AEFA 4F8XA 4KWUA 3WNKA 3I2HA 4ARYA 4H7VA 3D5HA 2XOMA 3AFBA 1UR8A 4PMYA 4V2XA 4DWSC 3N13A 1UD2A 3ARRA 2XVGA 1WDSA 1PZ2A 3KL5A 2ZXDA 3I3BA 1GQPA 3VO0A 3AHVA 4DWSB 1ZJAA 3WQ5A 4ZZ8A 1G94A 5GPRA 3I3EA 4GKLA 5I77A 5DF0A 1WZMA 1E4NA 1E1FA 1MXGA 3UG3A 1W0NA 1W9XA 2DT3A 4NZCA 3ARYA 2Y64A 3U57A 3HNMA 3ZJKA 1XH0A 3II1A 4PQQA 1RPKA 3W82A 3NDZA 4AZGA 4NF7A 3VIJA 2EXOA 2WXDM 5A8NA 1GOMA 1UR1A 2VL4A 1UD8A 2DDXA 4TVDA 3WDRA 1WP6A 2J1SA 2EIDA 4HMDA 3AYSA 1DP0A 4EAMA 2VOTA 4TX6A 2F2HA 1TFVA 2FDMA 2VMEA 4GZJA 1GOHA 3AHYA 2QQLA 2EO7A 1CECA 1JYWA 2UY4A 1GOIA 3HPNA 5I2UA 2WCGA 1NWUA 2VZRA 3POCA 1FFQA 2Z4FA 2WMIB 1BYAA 1JI6A 2XGBA 5JIPA 4UQCA 3A4AA 4XUNA 1CNVA 2W95A 5B4NA 5A2BA 4QLKA 2W66A 3CZJA 3LQCA 3MBWA 2BS9A 3EBVA 4PUDA 3HNBM 2X10A 3VIMA 3NIYA 5GNXA 2VMCA 3HN3A 4QP0A 4AYSA 4W88A 3GNOA 1DHKA 1HX0A 2HLEA 4NSBA 1ISVA 4V27A 1QW9A 3LEIA 1ZS2A 3EDDA 4U5KA 5ABEA 2E33A 1ZBVA 3ARXA 3AHTA 1K6AA 1NWTA 5A8MA 1VRXA 3BAYA 2VR4A 4Z2HA 3FL7A 4PSRA 4CD4A 4OJYA 2QLYA 2PI6A 1UY2A 1JYNA 1NUKA 3LPOA 3SCRA 3IDAA 3OGRA 5CLWA 3I97A 1FP9A 1PAMA 5GQBA 2DH2A 2WBKA 3WN6A 3FN9A 1K9DA 1SDDB 3HEIA 1R8LA 3T0BA 4H41A 5CSYA 1UD5A 1CYGA 3UERA 4W50A 4LX4A 4AIUA 4GIAA 4PMDA 3G6MA 4J7RA 1CZVA 3WSOA 1J0JA 2CYGA 2YJQA 5HXMA 4Q22A 3EMQA 3IB3A 2XG9A 4A3HA 5EMYA 1CZTA 5GNZA 4D6GA 2J8GA 4M80A 1CZ1A 1FH9A 1XCWA 1NM9A 3A21A 1MQPA 1OBAA 4TX8A 5EJ1B 1D7FA 2G8ZA 3VIKA 2BGOA 1FH7A 5ABFA 2PWGA 1KXTA 3AICA 1UOKA 1QOXA 1VEMA 2E0PA 5BXTA 1PX4A 3OZOA 5BRPA 3CBWA 3PZOA 2BVDA 2VM9A 1LL7A 3VGBA 4ZXOA 5CSUA 1CTNA 3WUEA 2VQTA 5D8ZA 1QI5A 2CIPA 2ZEZA 4UFMA 5ABFB 1XYZA 2QQNA 5C7GA 1P6WA 1JAKA 1A47A 4D71A 1KCKA 2VNCA 2YBUA 1C91A 1ITXA 1YQ2A 1UHVA 3AQUA 2C7FA 1CX1A 3SCTA 3W81A 3PZQA 1CXLA 5LA0A 1C7TA 4TOQA 5DQ0A 4GZEA 3CQOA 1JHJA 4E8DA 2W63A 3F2ZA 2J7GA 1HKIA 1WDQA 3W38A 1TVPA 4QX3A 2OKXA 1UD4A 2XHYA 1W9WA 2RJ2A 4CUAA 4A6OA 5CGTA 3EMCA 2F8QA 4L4OA 2CDPA 3A3HA 4P00B 3ARQA 2JDAA 1LJYA 1N82A 1WAWA 3TTQA 4XB3A 3KL3A 4D72A 1GHSA 2WVUA 4MGSA 2CKRA 4JL2A 1VEPA 3ZSTA 1UX7A 1GOWA 4ZXLA 1HN1A 2QMJA 4KH2A 2ZUUA 1R87A 3SCSA 4AIOA 2VJXA 4Z2IA 2D22A 5JR2A 2G4FA 3AS1A 4A44A 1W1VA 1GNYA 2W91A 1BAGA 1K3IA 2VCAA 1U33A 4XUPA 3RMEA 2MANA 2WK2A 1WE5A 1OWQA 3VNZA 4W8AA 3PTKA 2BVTA 1E0WA 2VURA 3DYPA 5BXSA 3WF1A 1G9HA 1AMYA 1KQZA 4MNJA 1NQ6A 1U30A 2RGLA 3PTQA 2QQMA 4U3CA 2WHMA 1TUXA 1VB9A 3K8MA 3UEQA 3MANA 1SFSA 3WQ4A 5A6MA 2RGMA 3GH4A 3RCNA 2QHAA 5HOSA 4LQRA 3W5MA 3NSNA 4PF1A 1KXVA 3BAIA 5C70A 2ZX5A 4HA4A 1K12A 4AZBA 2J75A 3WD3A 4V28A 4MJ2A 3KZSA 2VQUA 1WKYA 4ACYA 4MJ4A 1J0IA 4PMZA 2VZQA 4BA0A 1OF4A 1CWYA 4AC1X 1C8QA 1E6ZA 1V3KA 4H8UA 1HJUA 3AZTA 2RV9A 4AW7A 4B9YA 1GOQA 3NNGA 4H04A 4J27A 3NJVA 1W3HA 4W84A 1IZKA 2X1IA 3OGSA 3WF2A 2J1EA 4QX1A 2J25A 2WSPA 1DWFM 3MMDA 3VMPA 4D1IA 2C9KA 4OOUA 1HJVA 2YG0A 1LG1A 3AMCA 4MADA 2D3NA 2WWCA 1JZ2A 1DYOA 3KL0A 1US3A 2E32A 2VUYA 2V3GA 4W5ZA 4M24A 1UKSA 1WNOA 3N15A 1UA7A 1CGUA 3OLGA 2XSBA 3M46A 2OYMA 2D0HA 2VVSA 5M03A 5B4XA 3AYRA 4IPNB 4KRUA 1F4AA 2XYLA 5A6SA 4BQ4A 1SYTA 1BG9A 3WDHA 1ZBKA 5J1XA 3PZ9A 3WF0A 1CPUA 2ZUTA 5E6ZA 3TTYA 3WUGA 1QI4A 5EBAA 1C90A 2WVSA 1EDTA 2GK1A 1JNDA 2J7EA 2KD7A 1BLIA 1OT5A 3IJ7A 1F4HA 3WENA 3AC0A 5IHRA 5KZ6A 1H5VA 1OB0A 3AIEA 3S2CA 4BJ0A 4UAPA 1DWHM 4RYDA 1HJWA 2YL6A 1GOFA 2Y5EA 3W25A 2WC3A 1JI1A 1R7AA 1CGYA 1ZL1A 2G3MA 3L4VA 5A6AA 3WDPP 3SCQA 3IK2A 3U7BA 3L4YA 5A6KA 2QMKA 5E0CA 2UY3A 4HTYA 2FGZA 4LQ1A 4LXFA 5CGMA 1MFVA 2J8FA 2XQXA 2XFFA 2Z1SA 2WYSA 4D1JA 1AVAA 1V3JA 2J4GA 1X1NA 1E3ZA 3BAJA 3ZO9A 2AAAA 4HPGA 4U3AA 5D4YA 1J12A 4DWSD 3UESA 5A8PA 4CD8A 2W92A 4YPJA 4TXWA 1WPCA 1E56A 1C8XA 1JU3A 3BCFA 4CN1A 1C3FA 4W89A 3SCPA 5G05L 1GQJA 4D6FA 4U31A 5A6BA 3TP4A 3VOCA 1OINA 5BCAA 1JNEA 3CIHA 2WHLA 3S6TA 2XGIA 5DMYA 4PTMA 1UKPA 2JFEX 5TD4A 4D6EA 1XV8A 2OLHA 3WNLA 4N42A 4MB5A 3A22A 1QNQA 2J7FA 3CHEA 1CXKA 4AD0A 2X8RA 4CU9A 4AZCB 1KXHA 1QNPA 2BERA 2PWFA 3WD4A 4PTXA 4JKMA 4FF5A 2XUCA 4U2YA 3VU2A 2VZTA 3MSGA 2ZUWA 3THCA 1K9TA 2TAAA 3VX1A 3WQWA 3WL0A 4KI5M 1UXZA 4E8CA 1H09A 2D1ZA 4MOAA 2WKLA 3DHPA 4B9ZA 3WH6A 1MW0A 1ZJBA 3W53A 3UETA 4M82A 3VIHA 4DEVA 4M4PA 3WIJA 1J0YA 4R27A 3AS0A 1B3XA 1B2YA 3MMUA 2ZUSA 3PZTA 4ET7A 1W2PA 4MB1A 3VIGA 3SEPA 1CLXA 3A6OA 3GXIA 3HU7A 2GUYA 3ZR5A 1XD0A 4P8WA 4J3WA 4PYSA 1ULOA 3FY1A 4U33A 3KE0A 2JALA 4GO8A 2VCBA 1ZBCA 3AZSA 2PWHA 1OD8A 3W29A 1ESWA 3NJXA 3DYOA 4Z2AA 3VGGA 2DGAA 2BY3A 3VIFA 3OEAA 4OZOA 3MS8A 1B3WA 3CUJA 3A4WA 4ML4A 4ATLA 1CIUA 1OT1A 2J7DA 3K8LA 2FGLA 1VJSA 1XSJA 2XWEA 3QHNA 1V3HA 3U37A 1PIGA 2YDSA 1XNTA 3CMGA 1DLCA 1NOUA 2Y8VA 1NX9A 2VTFA 1WO2A 4B16A 4GI6A 6TAAA 1X6NA 2Q8XA 5KEZA 4CCCA 4RE4A 3AOFA 1GCYA 3ALFA 3GBDA 5CPSA 1JZ3A 2W1QA 3HJRA 1G0CA 3ZR6A 5LCWL 1J9YA 1ISWA 2CBJA 4LHSA 3WF3A 5IDIA 1UMHA 1V02E 2ZXAA 2B9VA 3W5NA 2Z1KA 4U2ZA 2HVMA 3ZSSA 2OSXA 3AIWA 3WD1A 1C93A 2XVNA 1E9LA 1OCQA 2ZEYA 5C71A 1TCMA 2JEQA 1KWKA 3BH4A 1XYFA 1B30A 2VVNA 4ZE4A 4URIA 3WQVA 3ACIA 2WVVA 1JDCA 1MQRA 2PQSA 3P1IA 5GNYA 4CCDA 4DUVA 2XFYA 3AIQA 1E4LA 1VBRA 2VZVA 4B3KA 1BGGA 3VVGA 2CPUA 2OYKA 3UNPA 4BS0A 4MB4A 1HP5A 2O9TA 1G1YA 4P7OA 2OWWA 2J78A 4QLLA 4WIWA 4B3LA 4UZSA 2CEQA 1Q6GA 1UQYA 1KGYA 4XVHA 4BXSV 4JX0A 4MTVA 4ZFMA 3UR8A 1KFWA 2WN2A 1KB3A 1D2KA 2VRKA 4PBGA 4UFJA 1PZ3A 2W94A 2ESCA 4CD6A 4AZHA 1OGSA 3BMWA 2GJRA 1E3XA 4HPHA 3ARSA 1MPXA 2FH8A 1GOKA 2DEPA 1UKOA 2Y6GA 3NDYA 4PRWA 1W3JA 2PBGA 2VMFA 4GWIA 5EIYB 1Q4NX 3LEKA 4MNMA 3WNNA 3MSDA 3B9DA 4MO3M 2V3DA 1UXXX 3NYDA 4OBRA 5JIWA 1OGBA 3NSMA 4E2OA 1NWRA 3PTMA 1V3LA 2WHJA 5FUIA 4UOJA 4CKQA 3CZGA 4W87A 4P08A 2J62A 4HA3A 5IHSA 1K9FA 3BCDA 3VMOA 5HNNA 3WQ6A 1E6NA 3AISA 4GPNA 1BVZA 1L7RA 4PCSA 4FLRA 1NP2A 2ZUNA 2O92A 1L7QA 5DT5A 3W6MA 1HXJA 4D6CA 5BYWA 1UH2A 2WZ8A 4S3KA 2LW8A 3ZJ6A 3BMVA 2QV4A 1I5PA 2Y6JA 1M7XA 2PWEA 2C26A 3UCQA 5D9PA 2BY0A 3ARVA 4ACZA 5JXIA 2G3JA 5A94A 3SUUA 3MUIA 2WC7A 5F7UA 3L4UA 1JF6A 4HU8A 4KGLA 3WY1A 4JHZA 4GQRA 2WO1A 1MFUA 3T0DA 2UY5A 4UOQA 2ZX9A 4RL3A 2V38A 2DCJA 1HJQA 2DIEA 2E40A 1Q6FA 1AQHA 3LPGA 4Z2KA 3VINA 1V0NA 3CZ8A 2VC9A 3WEZA 4J3VA 2QPSA 4UFIA 3W6LA 5DEZA 3WSUA 4DEQA 1UMIA 1KEXA 2VZUA 3LMYA 3QHMA 4TTGA 4X9YA 4QDRA 1O6IA 1E40A 1E6RA 2VZPA 4JAWA 4MB3A 1V3MA 4WSKA 1EA9C 3U7VA 4W86A 3ETPA 3VD3A 3K8KA 2ID4A 3PZMA 1XSIA 3IJ9A 1RH9A 3OLIA 4JFVA 4F9JA 1GU3A 2JEPA 1LF1A 3GGLA 5BWFA 5E70A 2W46A 2WKGA 3NSXA 5ECUA 1QW8A 1L8NA 1W9DM 3ECQA 2EIEA 3GDBA 2OSWA 2W47A 2FH6A 4MPKA 2JD9A 5IFPA 3CZKA 2YL5A 1FA2A 1H4PA 6A3HA 3VM5A 2BGPA 4JHOA 1AQ0A 2DT0A 2CERA 3B8SA 4PMXA 4DXRA 1GUVA 2XVLA 4P7LA 1Q6DA 4JKKA 1E4MM 3EDFA 4CU8A 2J1UA 4PN2A 5A8QA 2W1WA 1V6VA 1G5AA 1I75A 4BZYA 3T08A 1V3IA 2X0YA 1H0GA 4J3XA 1E43A 3AHZA 1XH2A 4P5YA 1DWAM 2CCRA 3GXUA 4CU6A 1NARA 3FHQA 4F9DA 2GDVA 3AMKA 2VR5A 1KXQA 4XUTA 1CLVA 3EMZA 3F4VA 4AD5A 3J7HA 1CIYA 3EB7A 5DT7A 4AD3A 4J3UA 4C7FA 4CCEA 4CGTA 1GUIA 1JFHA 4QCEA 2V3EA 1HL9A 3C7HA 1HT6A 2WAOA 1XGZA 3EYPA 3BAWA 2BY2A 4OIFA 2W67A 1PIFA 3THDA 1UY4A 1UG6A 4OOZA 3I2FA 4FMVA 3B9AA 1H41A 1W9SA 1PX8A 1BYCA 1M04A 4RN5A 4HOXA 3PN8A 4QFUA 3PZUA 5I3DA 2XWDA 3AIVA 4J3TA 5A6LA 3BSGA 2XIBA 3MUAA 1E72M 5IYYA 1UY3A 2QF8A 3W27A 5ABGA 2AOSA 3U5UA 3BN6A 1HVXA 1UWSA 2EPOA 3I2JA 3ZIZA 2C8NA 3CIVA 1W1YA 3M7SA 1US2A 3UR7A 4Z2GA 4WF7A 3HOBA 2WAGA 2YA2A 2D2OA 3N11A 2NW0A 1Y7VA 5CXPA 3PZGA 2J1TA 2C4XA 3VDCA 1J0KA 3K4DA 3WH8A 3IANA 4XUQA 3L2MA 1IQDC 1ISYA 2XJ7A 3NRUA 1R85A 3CTTA 3FXYA 4ZEPA 1KCLA 2CBVA 2YBTA 1IZJA 4IPLA 4UI9L 3PBGA 4WK9A 1KWGA 1RP8A 2BZDA 2WCSA 4JCLA 2WZEA
chains in the Genus database with same CATH superfamily
1FVPA 3UL2A 4O0ZA 4P5UA 3NXLA 1H0BA 3QV9A 2WQ8A 1PX3A 3AO0A 1G69A 1H11A 1K8YA 1KM0A 4BMBA 3TW9A 2GSJA 3R8HA 2JX9A 5FPZA 5C4WB 5JBDA 3CF6E 4GJYA 3CM4A 3GVVA 3I65A 1J3PA 2QZ3A 1HJXA 2G95A 1JDAA 1EJSC 1WD4A 1JCLA 3PUIA 3V0BB 2A5ZA 1W1B1 5FCZA 1Q8PA 3ILNA 2WFF3 1ITUA 3ENLA 2RE9A 2RS51 3SBFA 3SAZA 4ZZ5A 5JUVA 1XYMA 3G6JB 3KEHA 1B0IA 3ICJA 3O6DA 4Q5OA 1F76A 3AIBA 1QNRA 1ZY9A 3EKZA 3AZZA 4C60A 4QE1A 1Y9QA 1TPWA 3TYCA 4ZU5A 2WAAA 2C18A 1NXMA 3MIDA 2OZ0A 3GZAA 1JDDA 3VE7A 4ERIA 1I6XA 1BYBA 4FNSA 2GJPA 2HEVF 1OD0A 2EIGA 3NUKA 3WDIA 2DSKA 1TMLA 2NQJA 1KJRA 3MF6A 2FZMA 5CC5A 4H8VA 2OOFA 4EN0A 1AH0A 4O57A 4QLJA 2DQXA 4F83A 5BNOA 4K38A 3MV11 3ST7A 3CWNA 2Z69A 3PVOA 1KQYA 3AXHA 3IGSA 2JDKA 1OFQA 4PIXA 4Z92B 2Y6ZA 1UZ4A 1NYWA 3IBMA 4UYBA 4FHAA 1WOAA 1PZ8A 5A1AA 1J84A 3F4WA 2P8BA 1E70M 4LAMA 4MNLA 4M1RA 2VBBA 2ZACA 2CFFA 3UQNA 5C6CA 3ARZA 1OD5A 2RAGA 3VD4A 2P10A 3USUB 3R6SA 3KRUA 2G50A 3UF9A 3CJIA 1RUNA 4UR9A 4MGZE 1BEUA 1P6CA 2H6RA 3WMLA 1MVYA 5L6UA 1EYWA 2R7EB 2WJSA 3E38A 4P7RA 3P5BA 1V6YA 1NELA 1XUZA 4LBMA 1WB0A 1EKOA 2I45A 3PPGA 3C7EA 2GK1B 1C92A 5DN2A 2H9AA 3SQMA 4FNRA 3CJIC 4TWTA 3WNXA 5K0UA 3AZRA 1QR7A 4V1YA 4TZDA 4C6EA 5IW0A 1H2KA 4GZ7A 2CITA 4OHZA 3WUBA 2FFIA 3VZOA 1ZU8A 1W6MB 3W7MA 2VCCA 3MYOA 5I0SA 2BOJA 2FZ8A 1H6XA 5FYSA 3NZ1A 2W39A 2NWRA 2WMGA 2BLEA 5FEPA 2Y89A 5I24A 4H9UA 4AGGA 4US5A 2DV9A 4F3JA 3CHCA 4JIEA 5AFEA 5CG0A 2CLPA 3O6CA 4QXHA 1ZENA 4O50A 4PTNA 3DFHA 4GKYA 1BXNA 4NPRA 1Z3NA 2A3AA 5I3IA 3I54A 2V5CA 4E4UA 4DXSA 3W2MA 1M5WA 3NZRA 4Q4PA 4FR1A 2A6LA 2QS8A 1LNSA 5F8PA 5HMEA 3V1HA 1CX4A 1OFRA 1REDA 2AGKA 3LX9A 3LE0A 5EY5A 1RD5A 1COV1 1GEHA 3G7DA 4OV9A 2ZGPA 2WNOA 1PKNA 5D8WA 4MDOA 1V6OA 4R7WA 4DF1A 3RO8A 3EDEA 3SEEA 1TV3A 4W4QA 4P9XA 1T0OA 2QCDA 4ZBCA 3H2CA 3GFXA 3GD6A 3KDNA 1CAVB 3IS4A 1W9VA 7XIMA 4CU7A 1W3TA 3E1F1 3CL7A 1E0UA 6ENLA 5TIMA 1MSSA 2FPYA 3BICA 1U83A 2R24A 3OBEA 3RMYA 5CKSA 4P7QA 3GW0A 4OHWA 3BDKA 2EJ1A 3AWOA 4Q0VA 2AGSA 1HG3A 3QHOA 4CN4A 1EGZA 1W3XA 3NAPB 7PTDA 4D6JA 4AVFA 2AKMA 1E6SM 3H4GA 3B0YA 5M1TA 6XIMA 1EX5A 1VFUA 1E1EA 3JD71 3R0RA 2J47A 3S9YA 2ZEXA 2BTVC 3N6JA 3RM4A 5LIUX 4HNCA 1A5SA 1MW2A 4DJFC 4LUKA 3KOWA 1OSEA 3QV7A 1GVOA 1PDZA 3EWDA 1QQP1 3RI9A 3VGHA 3G1XA 1QJY2 1S2AA 4ENLA 1C8M2 1O5RA 4ARXA 3PBUA 2DVDA 1TB3A 3UZ5A 4EWJA 2VUDA 1SFLA 9RUBA 3R4UA 3E5BA 3NCOA 1CGVA 3S0MA 1VBA1 3A47A 4LSBA 1KQRA 4J28A 3UV9A 3CKHA 1XIJA 3JU9A 1XHGA 2HISA 1FXZA 2ZRUA 1ZBWA 1W1TA 3L21A 5HPCA 3RITA 1VBJA 2ET1A 3PZIA 5CYYA 5AVPA 1JUEA 3HPZA 1YXWA 3QGVA 4Q4X3 2VGIA 4EKJA 1I9RA 2WJDA 3GNNA 1BHGA 3RX3A 1JYTA 4RHV2 3TCEA 1ZRCA 4LUIA 3ZXEA 1XF0A 3KGZA 1HP4A 1IGSA 1IXOA 1VZWA 3BLDA 2R1NA 2QNKA 4BFAA 4YVWB 5DXYA 4CEYB 3S6OA 4H4IA 4Q1PA 1ZRQA 3I3QA 3WLRA 3DZ1A 3PUHA 3OUIA 3N6HA 2NQLA 1ZYBA 3C3NA 4XJ8A 4NY2A 2CHRA 3OLEA 3JZUA 5FLHA 4FAHA 5L19A 1PK6A 4K1WA 2X5IB 1Y65A 1S5WA 3VC5A 3GC2A 4W8JA 2GPTA 3N9SA 4LA3A 2ON3A 1HQTA 3CV2A 1JYVA 2Y24A 5IVVA 1SHWB 4CCNA 2ZX7A 3VABA 1PK6C 3MTWA 3SUVA 4J4KA 1W06A 4AHZA 2R82A 4H7ZA 1SMAA 1ACCA 4NNBA 4Y8EA 2WA3A 5HMFA 1D7PM 1KGXA 3I2GA 1VIWA 3ZFEA 5C2CA 4JEJA 4PULA 3H8AA 1CJDA 1UZVA 3BK0A 4NOTA 5JMOA 2VDGA 4H6KA 5E1QA 3PTRB 4MXWB 2BQPA 1KR0A 3BLOA 5HR6A 2EALA 3AS2A 3WEMA 2GJLA 3B7MA 2A6ZA 1ONAA 2ZMLA 1VBHA 5D33A 5FY8A 1ZP3A 5CBLA 1YFUA 4POCA 1QXLA 1EJTC 2OA2A 4IL0A 2CHNA 2VMGA 4ADUA 3EA1A 4X8PA 4O11A 2A70A 5LNSA 3V65A 2H0VA 4FO9A 2JK2A 3FAWA 2ACUA 4GUFA 4MGKE 3NQDA 2XL7A 5T91A 4HK8A 4PMOA 4QROA 4J6GA 1TWSA 3GNRA 2XWJB 1DFQA 3ATZA 2YXGA 5HBFA 2DSVA 1EV12 2WCAA 3NWRA 3MDPA 4QDWA 4WSJA 4A7ZA 5FZCA 3IUHA 3VPLA 2PYTA 2D69A 1BVWA 3TYBA 3L4ZA 4QNWA 4AD4A 1JZ5A 7A3HA 4AR2A 2LLEA 2FZNA 1MEIA 1ENSA 1OUXA 2WQZC 4DUWA 3W28A 1GQGA 3DEMA 2J1RA 5IVYA 3R43A 1GWKA 5GLZA 3OGJA 1NF0A 2Q71A 1VKFA 1FPN2 4KWKA 3UXIA 3T44A 2EA7A 4XE9A 2DIJA 1DXIA 4YZ2A 2JDZA 3W74A 3B9EA 1OEPA 1VFFA 1QFEA 2P8CA 2YA0A 3V56A 1ASJ2 1QWGA 1BXHA 1L9WA 4N6FA 4DM1A 1HFBA 1GOGA 3VBFB 4V15A 2EXJA 3WH7A 4A2UA 4CXXA 3VIPA 1OXCA 1QPQA 3GKAA 1OFPA 3WLQA 2POZA 4Y5Z0 1TQ5A 1H1MA 1ML1A 4H2HA 1IS6A 3P6BA 2ES3A 4NU7A 5FOOA 4D6SA 4QB2A 4D6IA 4UFHA 4KWWA 3NPVA 3WDTA 3WQCA 2D23A 4Q8WA 3L9CA 4LS1A 4AIEA 2QDNA 4ZENA 3S5OA 2WC4A 3P80A 4ZS2A 2R041 1PKYA 3M0LA 4JTEA 1ZNNA 1AYM1 5JQ9A 1CXHA 5I78A 2ORXA 2C13A 2WMJA 1AJ0A 3RRXA 1PKLA 2B45X 3OVGA 2OU4A 3HZ3A 1HIXA 3GZTB 3Q8EA 3WH9A 3LSCA 5C9XA 3S1UA 2DPEA 2G3NA 1RCQA 3TR9A 4OUMA 1K3UA 1OYAA 4FALA 4AAXA 2HKXA 4Q4KA 4LW7A 5A8OA 2HWGA 1EA0A 1FHLA 4NZ5A 1RXOB 4AVNA 1AR81 3TN4A 3LTSA 4Q4X2 3EX3A 1RYYA 3GIPA 1XLAA 4E4DX 4Q27A 1WA3A 1KO0A 3W58A 2MUCA 3AUJA 2NT0A 3BTYA 1CAWB 2YPIA 3AROA 2ZUMA 2W9XA 3NM3A 3K4AA 2ATSA 1A5NC 2EAKA 2HROA 3QM3A 3WP5A 2JWPA 4X6RB 1O4ZA 5GZCA 1KDMA 2IXUA 2ADEA 2A7NA 2BODX 4PDWB 1ZRRA 1E5IA 4PB5A 4HKWA 3RR1A 3BSMA 4JFSA 1BGAA 2AMGA 4REQB 1J96A 5CAKA 1T99A 2E1DA 2IUZA 1MNZA 4MZ8A 4HVQA 5IT6A 3EX4A 2RDNA 4JFWA 4GH1A 4HOOA 1P0DA 3TTSA 4WVVA 5K9YA 2VI0A 3VKAA 3AJ7A 3NQVA 3R79A 3WD0A 2VD7A 4A2SA 5EJ3A 5HNRA 4META 1N55A 4A42A 2B5HA 4Q4V2 3EHKA 2FTYA 4O17A 2XONA 4IV3B 1T2XA 2ORZA 3ZFFB 1R38A 1XRUA 2E9LA 4O15A 1GQIA 1NOFA 1F61A 1H49A 2OWXA 3WW4A 1VFOA 3QVQA 2XGXA 4XZWA 3IMNA 3T4HB 1KNWA 5MKGB 5E6HA 1LESA 3LFIA 2WNVB 4JV4A 3UYCA 1CENA 3TQKA 4UFLA 1EP0A 4JZRA 3PURA 3GXFA 3NL3A 4Z1AA 1ADSA 5I3HA 3L5LA 4BE3A 2Y38A 2RM21 5FO8B 1UKQA 3AZXA 1R9XA 2JDMA 1TWDA 4MGQA 3VNYA 3WBEA 1YYNA 3NURA 1JRCA 4GE8A 1HKMA 5CJ5A 1J5TA 4BWOA 1FP8A 2DCKA 2ET7A 1E15A 4E2GA 4K1ZA 2C0HA 1MZ5A 4RV8A 3E97A 3HG5A 4HMEA 2HPMA 3VL9A 2VT0A 3IAPA 4I2OA 5A5WA 4OWGA 3E5UA 5E0FA 3CMJA 4JX4A 1XYNA 1XNCA 3QGKC 3TCSA 3CV6A 3MU7A 4HCDA 5EMLA 1OGGA 2JIWA 3TZFA 1OIFA 1UMLA 3VZZA 1NOVA 1TVGA 2IPWA 4US5D 3WQ0A 4KGJA 4OBSA 9CGTA 1VJIA 4I0BA 5FACA 4FVVA 1KGUA 2WZIA 4I90A 3MP3A 3RLGA 5HBAA 3SCWA 4FK9A 1HW5A 4O1FA 4BB3A 2E4TA 5M17A 1W5OA 1RCXB 4XILA 1TMQA 3HB9A 4EE2A 3WNPA 1V79A 5C8CB 2CZEA 3TWIA 1XCXA 1GORA 1H2MA 5FZFA 1F15A 1PGL2 1EAH2 4MYXA 4N0RA 3BQ6A 4UTJA 1BWLA 3B8VA 4ISQA 4BQ5A 5E6YA 4X0VA 3RIKA 1H7WA 4NVPA 1PO21 3KWVA 3KCYA 4PCRA 3VCCA 3B05A 3HNYM 3V36A 2VVFA 1QJZA 1XNDA 5A7PA 4I7WA 3JVAA 4WKAA 3R13A 5FZBA 3NJZA 1GW1A 4OQ8A 1LOBA 1W90A 3CAQA 4N53B 1JAEA 2F6BA 5BW6A 3LCLA 1MQTC 4WM7A 1QNYA 1M7JA 4F66A 4XV0A 2H6CA 1LL6A 2XHKA 4KG8A 5CB7A 4O1CA 4UNKA 4PUEA 4BH9A 1RV8A 4QX0A 1VPHA 3VZNA 2XH4A 3PMSA 2XUMA 2P0OA 1WCDJ 2QT3A 4M7SA 1OABA 1B9ZA 1S1PA 5J09A 1QU4A 4ZOBA 5FL0A 4Y22B 1FCQA 2X29A 3IUDA 1S0IA 2NV2A 3H2AA 4ASMB 4JTCA 2A6WA 5C8BB 5A2CA 3ZN4A 5D03A 4Z0JA 3P8IA 3WDUA 1NOWA 4P8UA 3TYDA 1GJUA 3N04A 3W7RA 1QBBA 4LCSA 1HB4A 3B02A 3PF3A 3IT8A 4XZ9A 1TME3 1QH7A 5HAOA 4Z2JA 1JBCA 4Q2FA 2E3ZA 5FI8A 3XIMA 1EQPA 4RE2A 2XPKA 2ZEWA 1QH6A 1W9PA 4GBDA 2DFBA 2ZAAA 5GLTA 3C61A 4M19A 3ON7A 2Y61A 1NE6A 3OPSA 2QDHA 5EB8A 3EOUA 1GP4A 3KWSA 1RUG3 3LPPA 1KA9F 1I2QA 2GGEA 2QKDA 3JB8A 4JTAA 1W6OB 5CJMA 2HWB3 2Y5SA 4F0KA 1TJPA 4MY8A 1QY4A 3BAKA 4DJEA 4AF0A 4JDMA 1DLLA 2XIIA 1ZBA3 5DO8A 1RJ8A 2QGHA 5XIMA 2PLV1 2ZAHA 3A3XA 3BO9A 3UPMA 4KRTA 5JH1A 3H22A 2WABA 5FUNA 2J9ZA 5IVJA 2BNJA 2ZZ1A 4B4FA 3S2NA 4F48A 2F2KA 3CQ0A 1ITCA 2A3HA 2WDBA 5FYUA 3CU2A 3I6EA 3NJ3A 1PHMA 1GT8A 4RZ4A 3WYZA 2FDHA 4AZCA 2WMKA 2RS31 3H54A 1EQCA 5DCBA 3S5YA 1EOKA 4ES8A 3ABOA 1SG3A 2NV1A 4IQDA 1NVMA 2B8MA 5A6TC 3POSA 5F5AA 4IW3A 4AMCA 1QI2A 4NZFA 4X8NA 5EBUA 1VBGA 2W08A 4OU1A 2YFUA 1PVNA 4LYPA 1PO12 2OZ3A 2IPFA 5I3JA 5JCTA 3TFXA 1QIQA 4HN8A 3TAKA 3VBRB 1VH7A 1Q8QA 3FW6A 1LCOA 5LRSA 3BU7A 2WN3A 1DQ5A 2W4XA 3L12A 3KP1A 4KESA 3ZZ1A 3GNEA 1RVGA 2OSYA 2OQ6A 2I5QA 3KS7A 1H63A 1DGLA 4W9TA 4XAPA 2R0HA 2FLIA 4XQWA 2JKXA 3CLWA 5GVJA 3FKRA 3U10A 1C7SA 4HOZA 4JIIX 4QGCA 1EO5A 1ULPA 3WK2A 3K75B 3WLHA 4IGNA 1W31A 1RL3A 1VC4A 1TPH1 4WZHA 1PIV3 2W61A 5LASA 4UQAA 1ZA4A 2WB5A 5CG8A 3QFWA 5L36A 4ATDA 1W99A 3CHFA 2WT2A 4YW4A 4Q29A 1QXPA 1PGW2 3D5OA 1GZTA 3C7GA 4RXFA 1YHTA 2UYBA 2CU0A 2I1OA 3OZMA 1VB4A 3NKTA 3IIZA 4J40A 4B5TA 1UYPA 3G1VA 2B31A 1AR72 1YJKA 4NWWA 1DWJM 3U8GA 5AC5A 1U1JA 3KBWA 4DXVA 4TVUA 2BVWA 2BYVE 1PBGA 5FP3A 1TMF3 2WO3A 3EA3A 3IN9A 1W91A 4BM8A 1LL4A 3LRKA 4LC6A 4RK8A 2Z27A 3P7YA 1UP3A 2JF6A 3SKJE 5HK4A 3HJZA 1B3YA 4CQAA 4HNTA 2P88A 5E93A 4QPWA 1PTGA 2AQOA 3WELA 4EVZA 1JD7A 2WWSA 2DH3A 4UOZA 4X60A 2XKPA 3VL8A 3LCWA 4BI7A 3UCCA 4CNNA 1UD1A 3IM0A 5FPBA 2OELA 1XS2A 1XPWA 1E55A 1H1NA 3DXTA 4NIDA 2YDEA 3TQ0A 4YSFA 3MB9A 2VC6A 3GE7A 3INPA 3STEA 2VOMA 1ISXA 2Y60A 1W54A 4JZ5A 2EXHA 1TUFA 4NZJA 1WXJA 4GYPA 5D2AA 4E4HA 4L92A 5DPNA 3PAOA 2A7RA 4QAIA 2O8QA 1XYCA 3GG8A 2HWD2 5AHLA 3DKWA 4GWJA 3M7AA 1PB0A 1E5RA 2BV4A 4FFGA 5BNPA 4KWUA 1PVC2 3C0JA 4RZ6A 3UJ2A 1KFUL 3D5HA 2XOMA 1E1CA 4MHBA 4HSNA 4GYPC 5CPLA 1JN2P 3OJBA 1PZ2A 3KL5A 1J59A 4OGZA 3I3BA 3JQWA 4XSLA 3KOYA 1NT0A 1LJ7A 3VCNA 3J4UH 3DGTA 1WBLA 1MR5A 1G94A 1MUMA 3T78A 1H2NA 4ATFA 3QKZA 3MIEA 1WW5A 3FLUA 1VBC1 3ZN6A 1EJUC 2GC0A 2J9XA 1ENXA 2C6SA 2DT3A 4O0KA 4NZCA 2DVAA 3U57A 4EWEA 1HQNA 3QYQA 3IDEA 3FZ3A 3THAA 1ENRA 4Y20A 3LHYA 1ULDA 3NDZA 4QITA 3LOIA 2AREA 4N8MA 3MY9A 3C5QA 5A8NA 1AR61 2AKZA 4RGGA 1JRBA 1GOMA 2GWGA 3BJTA 1H50A 5LNUA 2VL4A 1S2BA 4D7SA 3MICA 3WDRA 3GVGA 1DQ6A 1WP6A 7REQB 1GQHA 4IIBA 2NVCA 4DO0A 4JTRA 4TX6A 1OFDA 3WUDA 4JGZA 2DFCA 3GG1A 3QCWA 1VAKA 1XIGA 2ZA9A 1FDZA 2Y7DA 4GZJA 4LAKA 4O9EA 3GUGA 2XU2A 2GQ3A 2UY4A 3EOEA 3HPNA 4O1DA 3ZSMA 2F6XA 4PIZA 1JOBA 4S23A 2WMIB 4COZA 2WFPA 1DORA 1JI6A 5IK4A 3VKDA 2PU1A 4UQCA 4XUNA 1P7TB 2OQ7A 3H55A 3DHDA 5A2BA 5ABJC 4JGZC 2W66A 1GZCA 3CZJA 3LQCA 2BS9A 4PUDA 3HNBM 4MY9A 4FAMA 5GNXA 4JYDA 1AH3A 1MS0A 3HN3A 4QP0A 2XN2A 4AYSA 2QCSB 5CC6A 1ISVA 2JQXA 4JQRA 4L9YA 2CZDA 4E3VA 3DX5A 5IVEA 1EUAA 3LEIA 4FQZA 2QQWA 5CG7A 5ABEA 1DGRN 1HDKA 2K46A 2ZHKA 1K6AA 2R072 3BAYA 1R2RA 1PNFA 2PP3A 3N9OA 4Z2HA 2XH6A 4CD4A 4GGBA 4OJYA 2QLYA 4H7LA 4GULA 3LCXA 3LPOA 4JNZA 2QJJA 3V7PA 2DH2A 2WBKA 4C1LA 3FN9A 3W85A 4UW3A 4UW4A 5A33A 3ZLHA 2BNMA 1DHKB 5J96B 4Q4Y1 4A7YA 1Z78A 4BJHA 1EL3A 1LCLA 5FWJA 2B7OA 4BPZA 3G6MA 4J7RA 4Q22A 4A3HA 3ES4A 4Q8UA 5GNZA 1GKRA 1CZ1A 1FH9A 1XCWA 1NM9A 4LH8A 1TYGA 1UO9A 1QUMA 1WMDA 1BF6A 1UP0A 4HIBA 3WQFA 1FH7A 3EWYA 3LI0A 2OODA 5AHMA 1VBB1 1TSIA 2AACA 1YBQB 1Y8BA 3ZYPA 4DY3A 2E28A 1BBT1 3AVSA 2WSUA 2VQAA 2Z79A 4YFZA 5C9AC 3VA8A 2VM9A 1LL7A 1HV1A 2VOXA 2HCVA 3B93A 4KU7A 5CSUA 3T1GA 1KFXL 3KSCA 1A0DA 5D8ZA 1RUI1 2ZBJA 3SY8A 4LCRA 5ABFB 4IEPA 3NQ7A 4BU2A 1NDZA 3NGJA 4UXDA 1A47A 4AI2A 1H61A 2YBUA 1KLYA 4A3XA 2I9UA 2Z4GA 3TRSB 3CAKA 3QLDA 1G6CA 1RUE2 3NQMA 1YDOA 5LA0A 2HNEA 4H55A 5T5PA 3N4EA 1JUBA 3J7MA 1V5XA 4KEVA 3CQOA 4HJFA 1G7VA 3JB4C 5FMDA 1O94A 3DPRB 2W63A 3F2ZA 4DB7A 5AC92 2W27A 3DFYA 1WDQA 1TVPA 2IXHA 2XHYA 3FJLA 2RJ2A 4A6OA 2NLIA 1XLDA 4L4OA 1QJX1 4NL1A 2F6KA 2CDPA 1BEV2 4LTAA 2G5WA 3A3HA 1O1ZA 1LJYA 5DDJ2 1XYAA 3TTQA 1LBLA 5A7QA 4XFGA 4XB3A 4M6VA 1RJPA 3N2XA 1GICA 1RXGA 3BYWA 2WVUA 4MGSA 2CKRA 4JL2A 1VEPA 3ZSTA 1GOWA 1KXGA 1HN1A 1EF2A 3OUJA 4XXAA 1B4EA 4PF5A 3DU0A 3MYPA 5D8AB 4LBQA 3SFWA 4AIOA 1XDJA 2OPKA 1ZX5A 1AHSA 1LEDA 1W1VA 1GNYA 1AODA 3NNJA 3O0VA 2WK2A 3P0XA 2R6QA 1QO5A 3VNZA 1J93A 3WINE 4ZO9A 1L3JA 1HUVA 3DYPA 4BIFA 1UB3A 3WDXA 2XJQA 1JCYA 5G4WA 4ZOCA 1AMYA 4MNJA 2WHMA 3VN4A 1OLRA 1TUXA 1VB9A 3WLUA 3EGJA 3DV8A 5C4WA 5HOSA 4B7EA 4HHLA 4DZAA 1JR1A 3ZXLA 3BAIA 3R4DB 5C0QA 2VUCA 5GM0A 4BLJA 4GXLA 3V0BA 2E1WA 2PLJA 4RFRB 2BP1A 5TBOA 1K12A 1QJU3 4HHMA 1A4MA 1NFBA 3V5CA 1T96A 4MJ4A 5C4WC 4XF1A 1ZCOA 4BQYA 1J0IA 3TN6A 1RVF1 3D0CA 2YGLA 4ORFA 1GOQA 4GHRA 4QM8A 3LHVA 4J27A 5FPUA 4W84A 4OI1A 3NR0A 5CH9A 1DGWX 2W68A 1FDJA 5EA9A 5H9PA 2P1FA 3WF2A 2J1EA 4GYFA 4QX1A 2J25A 1DWFM 4FR6A 3MMDA 1QJFA 1VMJA 3VMPA 4YGDA 4KFNA 2OYZA 1VPXA 4D1IA 3FFZA 3VHNA 4DLMA 1LG1A 5FP4A 3CWOX 1WV2A 1BQPA 3M9YA 2PZ0A 4MADA 5IBXC 3IGHX 4C6QA 4QQPA 1JZ2A 2KX9A 1LOQA 2RS53 5J7MA 3PP7A 4H9YA 2YW3A 4WOQA 4QG9A 1WNOA 1VE0A 1CAUA 3N15A 1SPPB 1UU5A 5EZWA 5CBIA 3MQTA 2OYMA 4XCBA 2D0HA 5B4XA 5D2TA 1S39A 1OCNA 3PDQA 3USUA 4MJZA 1OQEA 3GFZA 3W23A 1YUDA 2XYLA 5JZGA 5G5IA 3SMHA 1UPSA 3OQEA 4LUMA 4F0HA 4JGDA 2ZUTA 3OD0A 2V68A 4XZIA 5E6ZA 1KFKA 3WUGA 2P0IA 1D8CA 1TZOA 3W7LA 3PB2A 2WVSA 2GK1A 1JOPA 2NLRA 4AWDA 2YPJA 1OC5A 2HVNA 2A1XA 2I56A 1YWKA 1JNDA 4LNVA 5JZGC 4QQLA 2BU9A 4IFRA 2PAEA 4JQTA 5IHRA 3QZ6A 1RINA 3AMMA 1TPB1 3S2CA 1GOFA 5H6HA 3KRBA 1U5ZA 4DNMA 3H1WA 1JI1A 5IATA 5K7JA 1W6MA 4N7UA 4EWND 5BZAA 4S2GA 4NILA 4QXCA 4JHTA 2VC7A 5HCBA 5A6AA 1IS4A 1MS4A 4HSLA 4G8TA 5C5YA 4LJHA 3W2JA 2PDQA 5FOBB 3B97A 2UY3A 5EL1A 5L7OA 1ME9A 4EIVA 4HTYA 1AZDA 4PQ9A 3ZWTA 3KV9A 4L61A 1MFVA 1HTIA 2XQXA 3FLTA 2HWF2 2WYSA 3IJLA 1OI6A 3W7QA 1PHWA 2PRHA 3ZO9A 5SV8A 4RNJA 1W6NB 1LOAA 4R33A 3UWQA 3O0KA 3KZ4C 5L7OC 4XQ4A 3NGFA 4F40A 2FDSA 3QW4B 3RSJA 4YPJA 1WW6A 2BUKA 2WJZA 4UTMA 4AF9A 1XU2A 3PHMA 3S3GA 3BCFA 3CO8A 5JMCA 2DW6A 5FAGA 5EMKA 5CEHA 2NVDA 4UTTC 1ZJHA 4ZOEA 4W89A 5G05L 1GQJA 2OX4A 3W1RA 2E5BA 3C86A 1VRH2 1RUF2 3VOCA 1CAVA 2J6XA 2P3ZA 4AG0A 5BCAA 1JNEA 4E2BA 1VMHA 4PTMA 4ZTXA 4RDWA 1TE6A 1Q63A 4LNCA 4QJ5B 3PB0A 1I45A 1IZ3A 1R091 3HTWA 3SADA 3T0CA 4RR3B 2F38A 4AD0A 1KXHA 1XYOA 4PTXA 5H2ZA 3VU2A 3NAPA 1RJRA 2ZUWA 2PE4A 3THCA 3U3HA 5DCEA 4L11A 5LRRA 3WQWA 5FJOA 4MOZA 2ZA2A 3G0UA 4RD7A 2D1ZA 3MT1A 3EO6A 4KT2A 1UN1A 1B3OA 5FA5A 3S83A 3TJXA 4IGMA 5AZ0A 3J9SA 1COV3 1MW0A 1A53A 3PFMA 1RZMA 1S2KA 3VIHA 4L4MA 1KTCA 1RBOB 4PCFA 3UR5A 4FXJA 1J0YA 4AB4A 2YCKX 4R27A 3AS0A 2FPVA 2ZUSA 4GY0A 1UUMA 3FXGA 4G6CA 4HVXA 2DVBA 4GXWA 3GXIA 3DIPA 2Q6ZA 2UZ9A 4IERA 1W5QA 3K4WA 3H24A 2PHDA 1XD0A 3KOXA 4XEZA 4J3WA 1ULOA 2DJLA 3FY1A 4EROA 1XIMA 2NMOA 2A7PA 4MWAC 1UC5A 3PPFA 4N4PA 3UY8A 5KHHA 4LE3A 4G3YC 2DGAA 2BY3A 3VIFA 2QIIA 1IEQA 3L68A 4HCLA 3JD73 4OZOA 3ZR4A 1SBDA 5FLJA 2XLGA 1B3WA 3A4WA 1CIUA 3L2IA 5DBUA 3LHZA 2FGLA 3B03A 4YVWA 1XSJA 4CEYA 2XWEA 1AL7A 1MDLA 1E5SA 2H90A 3QHNA 3UVIA 1PIGA 2D5FA 1T8QA 1R1A1 1QQP3 3RMJA 2Z26A 3P5ZA 3DCPA 3E6DA 3DN7A 4RE4A 3FSUA 1GCYA 5BOFA 4NJIA 2BXVA 1B09A 1VBA3 3STCA 3ZR6A 1ZLPA 2WZR3 4YVWC 1J9YA 2X5IA 3FUQA 2YX0A 4LHSA 3WF3A 5LHFA 4AX6A 3R8GA 4PC8A 4IEQA 1WLTA 1Q7ZA 4IMCA 1XI3A 4FSJA 2ZXAA 1QDOA 3RJ2X 3W5NA 2Z1KA 3L0NA 1C93A 4UUIA 2ZEYA 5F5QA 3FSTA 1JPHA 2D43A 5F2MA 1BVP1 1MEC2 2FZBA 3G22A 2O7QA 4KF1A 3ACIA 4XOGA 4LFYA 1MQRA 4N7QA 3WW3A 5FZ6A 5FXZA 5CA6A 3WCZA 3UYIA 2UWCA 1R1ZA 4MXWA 5FZMA 1UPMB 1UOZA 4V33A 3DF0A 5ACA1 2QUUA 5JI7A 1XBFA 1XLFA 3K3OA 5DLCA 3KTSA 2HK0A 2OYKA 1AH4A 1YMYA 4HD5A 1G1YA 2ZCWA 3QQWA 4IMGA 3UA4A 4WHBA 1NLSA 1M6JA 4WIWA 1S5NA 1W1IE 4GUHA 1KGYA 4ZFMA 3M5ZA 4GOAA 4HKPA 2CNAA 5LIKX 4EZ4A 2VRKA 4BHPA 4N9IA 1LRQA 2VTXJ 3W7DA 4CDQB 3D0SA 1PZ3A 2YU1A 4NXKA 1ND2C 2W94A 3C2YA 3BOWA 2PN5A 3F4DA 1OGSA 3ILRA 3R2GA 4HETA 4I09A 2BDQA 5LNWA 4HPJA 3ARSA 5GJNA 1A6CA 3C3UA 1UKOA 3NDYA 4LLOA 3TXVA 2HE8A 4D9PA 2VMFA 4GWIA 4MNMA 1LGCA 3WNNA 3DDMA 4V1XA 4M6UA 2V3DA 1Y7BA 2QDGA 4GJZA 1FOD2 3SCHA 5T8GA 4O0QA 4OBRA 2OUJA 4E2OA 5DAXA 3DC8A 1V3LA 3E2RA 5FUIA 2R30A 1XDMA 4PFHA 2C1IA 1F9CA 4I5XA 3P5YA 3E2SA 2ZDRA 4JN8A 2C19A 1DJGA 2BB0A 4ZQPA 3ABRA 1U12A 4S2CA 4JTNA 2OZ8A 4OHVA 2Z2AA 4RV3A 4FPSA 1GG0A 3WQ6A 3B5LB 2OT0A 4AHPA 1E6NA 5HMSA 2QGYA 1BVZA 1VHCA 4PCSA 4HN1A 2IXKA 2ISSA 5K2ZA 4AEDB 1L7QA 3E0VA 4LBQD 4WZCA 3VDDB 1A5LC 3BMVA 2Q30A 1TRDA 2PWEA 4RS5C 4SBVA 3RRAA 2GNMA 4E2DA 3UCQA 3CPGA 2NXIA 4M01A 1QOTA 3ARVA 2PLCA 1M06G 1QK2A 2XUEA 5A94A 1QJEA 2PHTA 3SUUA 5FZ0A 1XIIA 2WC7A 4C65A 4COWA 1JF6A 2A6XA 3WY1A 2VU9A 2ICSA 4Q6XA 2WO1A 4LB3A 5GLWA 2FDGA 3J26N 3RGTA 5C2XA 3LSBA 4NHMA 2DIEA 2PPGA 5FXWA 3A9BA 1AQHA 1D3GA 3LPGA 1EEPA 3R94A 3R7MA 2P53A 1ULEA 3BGJA 1DJWA 4L99A 2OEKA 2QPSA 4UFIA 3VBHB 5DEZA 5D32A 5KMYA 3I68A 5C5UA 2OB3A 2NP0A 2PFWA 4Q1RA 1UMIA 2VZUA 4TTGA 4HSOA 2WIIB 1CAWA 1XPYA 1FYUA 2VZPA 4JAWA 4UNLA 4DZHA 1IPSA 1EA9C 1LUCB 2G97A 3U7VA 3RX2A 1A3KA 5H91A 3U2ZA 5B7ZA 1LORA 4K1GA 4K3ZA 3EB4A 3PZMA 2LALA 3IJ9A 4JFVA 1GU3A 4PDWA 1LF1A 4PEKA 5BWFA 2R043 1AYM3 1QW8A 1W9DM 3OP2A 2EIEA 2ZZ3A 1YI7A 3KT4A 2JD9A 1QDCA 5IFPA 4EXQA 2YL5A 3NQFA 4LA2A 1PHQA 1FA2A 1H4PA 2WZR2 1SMVA 3G3DA 2BGPA 4E2QA 3GHNA 1YEWA 3HV9A 5EMJA 1AQ0A 2CERA 1DJYA 1L6FA 1XBXA 4UCGA 4YTSA 1Q6DA 3GTIA 4JKKA 1E4MM 3CEWA 4CU8A 1VBD2 1A0EA 2PDGA 3POEA 5BOEA 3I7QA 3DUGA 1TV8A 1AR83 5FOJB 4BZYA 3TV8A 4RQPB 1XWYA 2C15A 4IV3A 1H0GA 4J3XA 1MEWA 3AHZA 2GSHA 3ZFFA 4MUZA 5FZEA 3AKSA 3FLRA 1NARA 1VHNA 4PBEA 4F9DA 1NXD1 1IR2A 3GDLA 5MKGA 1WW7A 4AD3A 4J3UA 3LSDA 2E6VA 1GUIA 4CGTA 1JUHA 4DQAA 3UZWA 5ANNA 5L9FA 2JIGA 3OBTA 3AMQA 2WAOA 3DBNA 3QQ1A 1CGPA 1SQ7A 4US6A 4EXBA 2QVNA 1XE8A 2OX0A 1FNYA 5E1RA 1PIFA 1UG6A 4AI9A 1R9YA 4FMVA 1W05A 1H41A 1W9SA 1XLGA 3I7SA 3U14A 2AL1A 3AL6A 1GWJA 4XWUA 2YR1A 3PN8A 3PZUA 2XWDA 3H6OA 2XIBA 1Q8AA 2VFGA 1UY3A 2GUBA 2X40A 4I5RA 1OC1A 2QF8A 2VNVA 1BXBA 1W3VA 3AKRA 1RALA 3EXUA 5FKCA 3EWXA 2ACRA 1H1AA 2Q8LA 1X7NA 5FSEC 1YO8A 5EKYA 3VBSB 1HB2A 2YA2A 4XIOA 3V4BA 2XBO2 1TTQA 1BD0A 4BQ1A 3E02A 3HG2A 5ENLA 5CXPA 2RM23 2J1TA 2C4XA 3WH8A 3IANA 3NO5A 2EKGA 1ISYA 4D2JA 1MO0A 2XJSA 1SACA 1Y9MA 3FXYA 3LHWA 4ZEPA 2D93A 2YBTA 3LXBA 4DNHA 3H2FA 1SO6A 2ANUA 4IPLA 2GC3A 3WUCA 4QWNA 4A8NA 3PBGA 5I8TA 3T07A 1KWGA 1TX2A 2JG9B 1YADA 4GRSA 1OOPB 1SLIA 2OKTA 2Q8EA 4U10A 5GJMA 1ND3B 1FWGC 1W32A 3WDQA 1UIOA 2UV8G 2ZA1A 1RHCA 5JPNB 2EQDA 1QJY1 1C8M1 2Y6KA 3W7NA 2GGIA 2QCHA 4DMIA 4YVSB 1FFRA 1U22A 2QCMA 1KFJA 4Q33A 3OEBA 2I5GA 5K9DA 3WBAA 5HJLA 2Z1BA 5D05A 1NFPA 4H8NA 4R7OA 7TAAA 4OCTA 5A6YA 1ZRDA 3W9AA 3NVCA 5FYCA 3ZN5A 4PMQA 3RCYA 5G1MA 2V4VA 1JZ7A 1G9DA 2EF9A 1MI3A 4AXKA 3NOEA 5I23A 3VKOA 1JGMA 2G9GA 2BHUA 1ZBE2 1XIDA 4GXMA 5FTTC 5KITA 4A41A 1BVNP 3RJYA 1QHPA 1O6UA 2VVDA 4N53A 5M2FX 4LRSA 1W3LA 1H7OA 1TELA 2PDLA 2XH0A 1Z6KA 2YB1A 2D6LX 1ENQA 4YHEA 4RHV1 4HN0A 3WLIA 4HFSA 2E8ZA 3LNMA 2J7BA 4S3BA 1V6WA 3MUCA 4DINB 4GQQA 1EJWC 3KVJA 5DZGA 2W1UA 3W4RA 4CN6A 3CMFA 1I2RA 1VLNA 2JE9A 3LEPA 2JE7A 4Y22A 4WVMB 4R34A 1H30A 3N25A 3DXIA 4X0NA 3M3CA 4QKBA 1W9TA 1PO23 1DQUA 4MLJA 4TVCA 4YG3A 1F35A 2X2GA 2NQHA 1VF8A 4NYUA 3VUSA 4NJKA 3LPFA 1FHDA 3ACHA 4W6YA 2JG8C 1XUUA 5C7HA 3MZNA 4IEYA 4R8HA 2GH2A 4QKNA 1B90A 4OVEA 4I8DA 1BSIA 4NHYA 4C1XA 2XFRA 2GSYA 2FZ2A 4UTUA 2BFUS 6XIAA 4Z8BA 7ODCA 2ALRA 4MM1A 3QBUA 1BTMA 4KPLA 5LKYA 2J7CA 4LOCA 1ZAIA 3BGAA 3VX0A 1EPXA 1OQDA 3LDRA 1SZEA 3HV8A 3IUIA 1H0IA 1A5AA 3OYZA 5KINA 2QJMA 1W6OA 4HZ8A 2TBVA 1TPUA 2Y70A 1H2JA 4FPOB 2J7MA 2AQVA 4FEZA 3ONBA 1UYXA 4Q0UA 3B04A 2CWSA 3OG2A 4IE6A 4L2NA 1K03A 4MMWA 3RILA 2QKFA 5H8MA 1QJWA 1YDNA 3S30A 2VOVA 5F3IA 3VIIA 1KCXA 1S5TA 2VMDA 4CZSA 1B54A 3V16A 2YROA 3UGHA 4LO8A 4YYFA 1OBNA 1JPIA 2W3ZA 3CH0A 3CJIB 1B9BA 1TPEA 1UWAA 4DO7A 4E8GA 1E71M 4JYFA 3F5KA 4C7DA 3QKEA 2LROA 2Y88A 2YLAA 4JTUA 1N3OA 3SC7X 1EV11 1Z0HA 5JVVA 1ULGA 4CNUA 4K3UA 1GNXA 2A3WA 1W6PB 1GOOA 3LIHA 4H6QA 4QPIA 2OMAA 3LXCA 1UY0A 2AC1A 5G4EA 3G0XA 3Q8AA 4S1FA 3H12A 1UR2A 4KBZA 2WZPP 3VD9A 1UP2A 1AF9A 1SZBA 4QNEA 3VBRA 1FPN1 1FWJC 3O5SA 2W87A 2BX7A 2PLV3 3NOYA 4MJMA 3WK1A 4K1YA 3P82A 5CKNA 3BVJA 1SMDA 2WO2A 4QPIC 1JGIA 3ITYA 3HURA 4RL7A 4YW6A 2GFTA 2BY1A 1U5YA 1RGSA 2VFDA 2ZX6A 1ASJ1 3EKLA 3UG5A 3F2CA 3M5XA 2RS33 1ALYA 3WD2A 2VGBA 2Y85A 4Q8LA 1U5IA 2ZX1A 1VQTA 4M56A 3IKWA 4X2RA 3GH5A 2CLMA 3W86A 4D6DA 2JEMA 2PD9A 1Z48A 1KS5A 3BE7A 3DKJA 4XACA 1KBBA 2IQDA 1HF6A 2J79A 1AJOA 3H3ZA 5FZHA 4B92A 4S3FA 1OK6A 2YA1A 4HU3A 2Z29A 3N17A 4DZ5A 4AQ6A 4D8MA 2VDHA 3ZFGC 1MWOA 4H9VA 1N7KA 3TYZA 3AXDA 2I16A 3U4XA 3N34A 1XCFA 3ZM8A 4M1BA 1U2YA 3B0UX 4GVHA 3IIAA 4LGXA 2CWNA 1AX2A 2EBNA 5T54A 1MNSA 4LAOA 1HVQA 4YS1A 3TONA 1YFXA 5F4XA 4EK7A 4AHOA 1WBFA 1KGWA 4F0SA 1WKFA 3GNPA 3IEBA 1XBYA 1JS9A 2DUQA 5CKQA 1UU6A 2E63A 3VUPA 2W79A 2WNUC 3IJ8A 1XKYA 4D69A 3G0SA 4Q4X1 2V5DA 3VZXA 3V0AB 5FKYA 1UNBA 4B3ZA 2F4LA 1N3QA 2J1AA 1AL22 2W9MA 1MYRA 5PTDA 4O4WA 1SU5A 3GG7A 5D38A 2IQTA 3HOJA 3N3MA 4E3TA 3NA8A 3PSVA 2VX6A 3G1RA 1UA3A 3ZDSA 1W0MA 2P5NA 1LQ0A 3GK0A 4C6LA 2VO5A 3GBEA 1Q6OA 2EIBA 3FEQA 4CUCA 5LZ6A 3BI3A 3C8FA 4MHRA 3ZYGA 1E5HA 1QI0A 1X6LA 3LLXA 3GDMA 2VDIA 5KXDA 2W1SA 3N36A 2FZ9A 4Q4V1 2WQDA 3BANA 3VNDA 4IUGA 4FP1A 1QMJA 3UK9A 3N3TA 2G9FA 2XISA 3WUFA 1XD1A 3OQ8A 3AB0A 4IEWA 1UBPC 1QNOA 1FI2A 5BU6A 4GINA 2PLMA 2WMHA 2WLYA 5DQPA 5FK8A 1IT0A 3ITVA 5APAA 4K2SA 3RZZA 3HQPA 2WLQA 1I2NA 4DS0A 1AUYA 3PJYA 5F9TA 3OHIA 4IQLA 2VX5A 1D0HA 4W65A 2WSQA 4AZZA 4CP9B 1IWPA 2IC1A 2WZHA 2DY3A 1FQ0A 4MV2A 1NIUA 3RZMA 4HA0A 4M6QA 4L65A 1R86A 1BPLB 2V73A 4OFCA 4Z07A 1RUOA 4K8HA 2E9BA 2X1SA 1IYXA 1ZFJA 1XSKA 3RUBL 1V6NA 4AI3A 3LCIA 4P7NA 3SXWA 3T09A 4P2VA 4HK5A 5LATA 4HZFA 5GZFA 3AMDA 2GP5A 1J1TA 1K42A 3KD4A 4ZS3A 3ZOAA 3GH7A 3G24A 7REQA 4GB32 4EPBC 2GDQA 4XJZA 3DERA 3Q67A 4IESA 5FEZA 3MEPA 2ZRYA 1GQLA 1V0LA 3QGAC 3WLLA 3FYPA 4LOSA 2VZOA 1QHDA 3IVSA 4CA9A 4Y5SA 2WNEA 3U0HA 3BOXA 3DOPA 2ZKLA 1TV2A 4ZSTA 4UCFA 2WMIA 5EFDA 4IEZA 2VR2A 1XNBA 1H8VA 1VBC3 2ZGTA 4FBFA 1P7TA 3A9IA 4KWOA 4LV9A 1OH3A 2B7QA 1EDGA 1BQCA 4GABA 4JTLA 3MZ2A 1QHOA 3E2QA 1WW4A 3S9IA 4DZGA 1QWKA 4L1WA 2YHJA 4QPGC 4AVAA 1RA0A 2DZPA 1POV1 2EICA 3K1DA 4ZODA 5HDRA 1DQ0A 4COYA 3P3NA 1MXDA 2PCQA 5TAOA 1EH9A 5GLVA 1ODUA 4MZUA 2KZHA 5C6MA 4QM1A 4DY5A 1AR63 5LXXA 1LT8A 1JD9A 4KWJA 1CPMA 4ZSUA 2XL9A 2IQ0A 4BY3A 1FMD2 1PGL1 1EAH1 1OFSA 3FC0A 4AEEA 3LLFA 2J7HA 1TJRA 1XNAA 2BHZA 3WLPA 2OR2A 1PCWA 5FPXA 4DM2A 4D6QA 1LHNA 3WKZA 5GLUA 4UIOA 2QCLA 2EG8A 1KS4A 4JQ3A 2QJIA 4GUJA 1JZ8A 3MUY1 4XTIA 2NQ5A 4AZ6A 3FBMA 3TU9A 4MFEA 1W8WA 1HGWA 2ARBA 4R9OA 1O5KA 4O1AA 2R91A 3HGSA 3QZAA 3W88A 4ZO6A 1LB2A 4PTVA 3PJUA 3LI1A 1JZ6A 1G8WA 3UJOA 4B5VA 3MA8A 4D8AA 2YFOA 3TSMA 2DDUA 4XDPA 3W01A 2CWXA 1YBQA 4FLOA 5BNKA 4H01A 4ZE5A 2GVJA 5FZ8A 1UR4A 4AZ5A 2I57A 2IXVA 1V6UA 2D6NA 4CQCA 1GSLA 2ZZ4A 1P6BA 4FXFA 2YCJA 2VX4A 4AL9A 3B8DA 1DYPA 3N14A 3RPDA 3FOKA 3CJXA 3MHFA 5DUXA 4B4QA 1CX9A 4FLQA 3QZEA 4Q32A 4FOWA 1UY1A 4IUOA 1J0HA 4OMDA 2PU0A 3N7KA 1Z42A 2RUSA 1N1VA 4GMEA 2Y33A 1RUSA 3CB3A 5A32A 2V5JA 3PBYA 1RITA 1KR1A 1HIZA 4OT7A 3SZ8A 3VGDA 3H2EA 3TC6A 4XVDA 1JYIA 1LYXA 3NDOA 5FL1A 1Q6CA 3GWQA 2NV9A 4DRVA 1VBB3 3KZPA 5F5CA 2VD9A 1F74A 2ZZ7A 5JWPA 3H7VA 6CGTA 1BBT3 3WCRA 4YMZA 3URNA 4A3QA 4DOUA 3VUOA 2J1VA 1KLZA 3J7NA 4DI9A 2HBUA 1STMA 1VPQA 1QU0A 4XQDA 1RUI3 2VM8A 4C0BA 3VV1A 3LBMA 3S7EA 4O8AA 3R8RA 4IIDA 1KFCA 2IPJA 4ZXEA 2P3JA 4A3RA 1G4EA 4BF5A 5MF5A 3D47A 4DN1A 4YGBA 1JFXA 2J22A 2HWC3 1DWIM 1VYSX 2J8TA 3G1AA 1GVSA 5D8AA 3G77A 2VEMA 3JR2A 5H8PA 4B91A 1LOEA 3P93A 4YWAA 1LOFC 5BNNC 3H7JA 3QXBA 1VYPX 3STGA 4DPQA 3E12A 3LUTA 3W2UA 5BXRA 1PO11 1HXS2 4Z2WA 2WWJA 2IMRA 1YIFA 4N7IA 4PUWA 2Y62A 8XIMA 4GI9A 4TYSA 5FP7A 5LBCA 1QJX3 2WNNA 2FQPA 4LUYA 3WY6A 3I2OA 3OA5A 2KA3A 3PZVA 4XZUG 3AL5A 4WBBA 1Q3EA 5CSRA 2XKOA 1IV8A 4Y7EA 2B81A 3QYSA 1FV2A 4QCFA 2XVKA 4EE9A 4DAFA 1FWTA 3VNJA 5LEKA 3WHUA 4BQXA 4B7KA 1W37A 1FNZA 1TJ0A 2E6YA 2OGYA 2WM1A 4L9ZA 4C1KA 2IZWA 3OIHA 1FWEC 5CLTA 2EHHA 4EACA 2ZRZA 1EUTA 2ZPXA 1B1YA 2W5FA 1PGW1 2NQYA 1O7AA 1GLHA 1CLKA 4NWVA 3LTYA 4J3ZA 4PFMA 5KZDA 1HNYA 1HKJA 3W7GA 5C33A 4KU8A 2A7AA 1WUFA 3H2OA 4J9JA 1AR71 5FZLA 1GVQA 2E7AA 5LGZA 1VIZA 2JF7A 5I0DA 5JOZA 4H7CA 2XG3A 4L1XA 3CAWA 5LIXX 1N47A 4JIPA 5JI9A 1H8TC 1GMMA 3RI8A 5BROA 2ZABA 4W4ZA 2P4EA 1H1ZA 1UROA 4ATWA 2YFZA 1CD3G 1SPPA 1FX6A 5HCFA 3W1TA 3CZLA 2ABBA 1RVF3 4S3EA 4GO9A 3VIOA 1GYKA 4QQOA 3KBNA 1WLWA 4KIRA 2WMFA 1LG2A 3H9AA 1JF5A 1NH6A 1R9ZA 2ARCA 2YFNA 3DFNA 1U5VA 5AHEA 4AXNA 3GXDA 4QEHA 5I5RA 1O4YA 1K6WA 4QHBA 1CB2A 1F6YA 2FZ1A 3H4WA 3I2IA 4A21A 5HWNA 3W2NA 3CPUA 1FCBA 1V0AA 1JZ4A 1DJQA 1E0XA 1YJLA 3G8EA 5IOBA 2HVOA 4E27A 4O14A 3WG4A 4HSHA 2VWTA 3B01A 1LRTA 1MQTB 2HWD1 1Q43A 3RR4A 4UR8A 2UWFA 3KP0A 5LYRA 1PVC1 5FJRA 1VGAA 4LU0A 5AVHA 5A6XA 3W9ZA 3SI9A 4AYGA 3FFQA 1OX5A 2BTMA 2F84A 3K1GA 4UWMA 3MF9A 4MUPA 3QR0A 3AKTA 1WZKA 1B57A 3MSYA 3PUDA 5CQ1A 1WGPA 1WCQA 3NVDA 3W7EA 5HUPA 1FH8A 5BY5A 1WZXA 2GJXA 2PC8A 3ZVHA 2RVAA 1TTJA 2QNEA 4GGHA 5FZKA 3D6NA 3DECA 4GX9A 2ACQA 1W6NA 3QF0A 2INZA 1VS1A 1PVXA 2JXAA 4NVTA 3VYLA 3S47A 2FMOA 1ST8A 3VHRA 3O0WA 1T7LA 3ARWA 3ZJ8A 2B4KA 2R062 5F2LA 1EJ7L 2Z42A 4MG2A 2FHBA 3FNDA 5HPOA 4K36A 1E0VA 3GTNA 2D20A 4W8LA 1I5ZA 4B15A 5DG1A 3DYMA 3RLVA 4IX0A 4KIEA 4OKDA 1CXIA 4AIBA 2HWC2 4HZ6A 3MW2A 4LYQA 1PSCA 2O9RA 5IUQA 3ISIX 3KBSA 3HFYA 3FAXA 2IS7A 3SLIA 2X8KA 5A95A 4CPBA 4YVPA 4DJDC 3RDIA 5T55A 1RB8G 4L4PA 3FLPA 1UUQA 4TV6A 1LZOA 1NCRC 2BGCA 2D7FA 4WR3A 3B3QE 3GVWA 1Z44A 3ZT7A 4LYRA 1IT8A 4AF0B 1PV8A 3PUEA 4E4PA 5FZAA 1AYN2 4IEVA 4A3ZA 4LBLA 1U5XA 4ROQA 2VNOA 5CNAA 2WLZA 3RMXA 1HJSA 4E4FA 2HS6A 3VGIA 2HBXA 1FWRA 5IFTA 3O1OA 2GDUA 1Q8SA 4JS3A 1RVKA 3FHAA 1I2PA 3DFSA 2OLSA 2OPWA 4P8XA 4BK9A 1H4HA 4FNUA 5AC8A 1DZQA 2J77A 3L4TA 3B9IA 1NU5A 4AZ7A 4NJHA 3O06A 3PHAA 2R071 2YUEA 4NAEB 2TYSA 1UZ1A 3AXXA 2YBKA 2YC2A 3AMLA 4LO7A 4OHQA 3EBRA 4AISA 5CZTA 5ABTA 3L2LA 3OVPA 1R093 5LW9A 4W93A 5JH2A 2DUZA 1ONRA 4LNYA 3LZ3A 3ZMOA 4S3JA 3HN1A 3W24A 1HL8A 3GF6A 2FDJA 5TSWA 3MUZ1 1WDDA 3PUQA 3LWCA 3A7QA 1QPRA 1TR9A 1JDFA 2AUYA 1UPIA 2JICA 1VAHA 4FOUA 1EY2A 3AYDA 1OX6A 1R47A 1SW0A 3HBZA 4QDMA 5KSWA 3PVNA 1DE5A 1QGLA 2RS12 4O1BA 5F2SA 4LPCA 4IE5A 3GALA 3IIIA 1SFPA 1UC4A 1RUC2 4HKLA 4XIMA 3IPVB 1I0BA 4AY1A 3S2JA 2D2JA 1SO3A 4CCOA 3IV8A 1NDYA 2QVSB 3WXPA 5HQLA 1GW9A 4PL2A 4HN4A 3UJRA 1KM2A 1TZ7A 2ZCGA 4ERGA 3H8XA 1JYXA 3B69A 3W00A 4KCWA 2AYHA 2CXGA 1UWQA 1JG9A 3W6YA 2DVTA 2RR13 3HPXA 4G1NA