3ZM8A

Crystal structure of podospora anserina gh26-cbm35 beta-(1,4)- mannanase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
444
structure length
444
Chain Sequence
b'RDGPVTYEAEDAILTGTTVDTAQVGYTGRGYVTGFDEGSDKITFQISSATTKLYDLSIRYAAIYGDKRTNVVLNNGAVSEVFFPAGDSFTSVAAGQVLLNAGQNTIDIVNNWGWYLIDSITLTPSAPRPPHDINPNLNNPNADTNAKKLYSYLRSVYGNKIISGQQELHHAEWIRQQTGKTPALVAVDLMDYSPSRVERGTTSHAVEDAIAHHNAGGIVSVLWHWNAPVGLYDTEENKWWSGFYTRATDFDIAATLANPQGANYTLLIRDIDAIAVQLKRLEAAGVPVLWRPLHEAEGGWFWWGAKGPEPAKQLWDILYERLTVHHGLDNLIWVWNSILEDWYPGDDTVDILSADVYAQGNGPMSTQYNELIALGRDKKMIAAAEVGAAPLPGLLQAYQANWLWFAVWGDDFINNPSWNTVAVLNEIYNSDYVLTLDEIQGWRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GH26 ENDO-BETA-1,4-MANNANASE
publication title Structural and Biochemical Analyses of Glycoside Hydrolase Families 5 and 26 Beta-(1,4)-Mannanases from Podospora Anserina Reveal Differences Upon Manno-Oligosaccharides Catalysis.
pubmed doi rcsb
source organism Podospora anserina
molecule tags Hydrolase
total genus 139
structure length 444
sequence length 444
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
A PF16990 CBM_35 Carbohydrate binding module (family 35)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3zm8A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3zm8A02
2HLEA 2WKLA 1PZ3A 2D2OA 3DHUA 4RYDA 1DWHM 1BSIA 1UWUA 4PMUA 2OWCA 4L0PA 1I5PA 2F61A 5JR2A 3ARVA 2PB1A 2WAAA 2D23A 2J1SA 3ARZA 4AAXA 1P6WA 3WQVA 1GW1A 1HJWA 2L9LA 4JHOA 1ZBKA 1JHJA 3F5JA 2Y64A 4Z2HA 3UG4A 1UZ1A 4UFKA 1M01A 1K6AA 2EPOA 5HPOA 3SUUA 4PMDA 4V2XA 2DDUA 1J0ZA 3ZSTA 1K9DA 2WKGA 1PX8A 4GKLA 2WDBA 1W3KA 3IJ9A 1UD3A 3ARTA 2J74A 1W1YA 1GQIA 3VX0A 4UR9A 3UERA 4ZE5A 4U5KA 1GJUA 4MDOA 4D6CA 3VDHA 1E9LA 3EDDA 1V3HA 4QLKA 1FH8A 2HVMA 3SIMA 2QLYA 3VIJA 4AISA 1UH4A 4X0VA 2O92A 1JFXA 1XCXA 1SMDA 4DWSA 1GNXA 1K9EA 1KBBA 4Z2GA 1XC6A 1LL7A 6CGTA 1OGSA 4W86A 2J7HA 4U2ZA 5KEZA 3S2CA 5TD4A 1ZBWA 3PZNA 3VGGA 5IHSA 5A8PA 1W3HA 4GO9A 2J79A 1UKSA 3AMGA 1MW0A 2WHMA 4TX8A 1EDTA 3WDQA 2WMIB 3CPUA 4AIEA 5DF0A 2ZXDA 4EE9A 5BCAA 3BCFA 4WIWA 1NOUA 4D71A 3VDBA 1R7OA 1TA3A 4HA4A 3APGA 4YPJA 3U7VA 3WH7A 4P8UA 2BV9A 1LG1A 4GIAA 4NI3A 2JKXA 2BGOA 3GBDA 2ZUMA 1PMJX 2NSXA 2W63A 3FNDA 1A3HA 4WK9A 4D72A 4J3SA 4W8BA 2VMFA 3ARXA 2V3EA 3W37A 1LG2A 1E0XA 2W67A 5AC5A 1C7SA 2VX5A 4XUYA 1UWTA 3K1DA 2QQKA 4UOZA 1UHVA 4ZXEA 3LQCA 1FA2A 1DYOA 5LCWL 4QX1A 2VJXA 2EIBA 3K4ZA 2Z1KA 2QQNA 2LS6A 4LXFA 1UR4A 1J10A 4AZIA 1E5JA 5BRQA 1AQMA 1UZ4A 3WH6A 1UWQA 4DXSA 4BF7A 2W1WA 3AFBA 1PAMA 3WBAA 4P8WA 1WZKA 1E4IA 5A6BA 2NT0A 2WNWA 2NW0A 3GNRA 1G9HA 2DSZA 7CGTA 1GOIA 1JZ2A 1UD2A 4AZCA 3IAQA 5HPCA 2RV9A 4GZJA 1US2A 1VEMA 2W5FA 3IJ7A 5A8NA 5IYYA 4XZWA 3BLKA 3EDKA 1HVQA 1KGUA 4M24A 1GU3A 2ZEZA 1HP4A 1HKIA 4BQ4A 3ACHA 2C0HA 3T2PA 1CXHA 2AMGA 1E55A 3WNLA 1MVYA 2BXYA 3LEIA 1G94A 4OYUA 3IB3A 4UQCA 1JD7A 5KZ6A 3F5LA 5JXHA 3U5UA 2OWWA 1MFVA 1CZVA 1WKYA 2ZWZA 2BXZA 1NOWA 4Z2AA 2YBTA 2Y6HA 1JL8A 3WEZA 1RYYA 2QPSA 3O9NA 4DWSD 3GH7A 3GM8A 3AROA 4P7QA 1E0WA 1CGYA 3TTYA 3WD4A 3RM8A 1QNPA 3C7EA 1C92A 4UI9L 2YKKA 1QI0A 2RVAA 4PN2A 2WVTA 1PX4A 1IT0A 4ZENA 3DC0A 2V4VA 5I23A 3VIMA 3POHA 2W91A 4B3LA 1PMHX 1JDAA 1H0GA 2Y8KA 3RIKA 2AAAA 3SCSA 3SEPA 2BVTA 3FHAA 1JNDA 1IZJA 5LYRA 3UR7A 1UYZA 4D6DA 4MADA 4LYRA 3BAJA 2EEXA 4ZEPA 4XUTA 2XOMA 3HNYM 1E6RA 3GXMA 1SYTA 3T2QA 4Q22A 4GXPA 1WZLA 4JL2A 2O9RA 1QBBA 4DM1A 2BHYA 1KCLA 3VPLA 1V0NA 1R85A 1CIYA 3PZTA 5HDRA 1EUUA 2WN3A 1TG7A 1Q6DA 1O8PA 1JGIA 1LNSA 1M53A 3D5HA 4AIUA 2VZTA 1J11A 1FFQA 4CU7A 1OF4A 3CKHA 5DPNA 3UESA 5I78A 1MXDA 2Y5EA 3W25A 4HZ8A 4A4AA 1J18A 4X9YA 1NOFA 2DCKA 1J12A 4CU8A 5A6BD 5CYYA 3QR3A 4Q7NA 4H2CA 2W87A 3WUBA 5CZKA 1K9TA 4L4OA 4BZYA 3WSOA 2JEPA 3CHCA 3VX1A 1UKPA 2BY1A 5BXRA 5A6KA 3U7BA 3GXUA 2WBKA 4UFLA 3F5KA 1W8NA 1J84A 4D6GA 2QQOA 3IIIA 2CERA 2FDMA 3POCA 2CXGA 4W88A 2VX7A 4FI9A 1E1FA 3P1IA 3WNOA 1BAGA 3NSNA 4JKKA 1B3XA 2Z1SA 1UQYA 5E0FA 3GNPA 3SCOA 5LA0A 1ECEA 1VRXA 3A6OA 4HPHA 1GUIA 4W93A 1QBAA 5D4YA 3U5YA 1RPKA 2GJXA 2IUZA 4P7LA 5ABFB 3NRUA 3WF1A 1L7QA 5FIPA 6A3HA 4JFTA 2WO1A 2EO7A 4JZ5A 1LLOA 3WQ8A 3W24A 1VJZA 5DO8A 3VD5A 3CGTA 3VGHA 4TVUA 3MS8A 2VQTA 3CZJA 2WMHA 1WO2A 3N9KA 4UZUA 4PQQA 4PRWA 1W99A 4AZBA 2J1UA 1PX3A 1MWOA 1Q6GA 2V3GA 3K75B 5D9PA 4MB3A 3NSXA 2G3NA 1HL9A 4GZIA 1C3FA 3WEOA 1UD5A 2WHJA 4ZE4A 3EBVA 3WQ5A 1QNOA 4CD5A 3LPFA 1JDDA 1VFOA 1YQ2A 1KWKA 1AMYA 1I1WA 4CVWA 3PZ9A 3AIQA 1EDGA 1W9XA 1ZJAA 5BXSA 5FL0A 5I6SA 4U5IA 4UQDA 4F9DA 2Y6KA 3K46A 1TZ7A 4R5EA 4P00B 1XD1A 2E31A 1BYBA 3SCPA 1B30A 5EJ1B 1Y7VA 3AS3A 5D8WA 4C7DA 4JFUA 1RP8A 4AC1X 3C7GA 3BSHA 4IM4A 2VCCA 1GOQA 2X0HA 3AXHA 4DXRA 2ZX8A 4LX4A 4W4ZA 3SCVA 4P02B 2ZWYA 3OG2A 3M6DA 3I97A 2XIIA 3WQ4A 4PMYA 4D6JA 2WZEA 4GPNA 5BWFA 3AMKA 1X6LA 3L4VA 3DYOA 3EMQA 2PF0A 3VMNA 1JAKA 2WCGA 5FOOA 2EIDA 2ZUSA 2GJPA 3U37A 3MANA 2WVVA 1K45A 2WBGA 1LJYA 1VEOA 2BS9A 1KB3A 2ZIDA 3PTMA 1PPIA 2CHOA 1E0VA 2E9LA 2FHBA 2VT0A 3VD4A 2W92A 2PBGA 2V3DA 3GZAA 4W7UA 3ZJ6A 1BVZA 1EO7A 1XNAA 3L4ZA 2C9KA 3L4WA 2D20A 2YOCA 3FL7A 3MUY1 1ISVA 5F7UA 1CGTA 1HIZA 3VILA 1FP8A 2ZUVA 3BMWA 3EB7A 3UETA 4YN5A 1G5AA 1GOGA 5A8OA 4Z2KA 1OIFA 2X0YA 3ALGA 4UOJA 1EDQA 1XCWA 1XYZA 1HNYA 1QI3A 1PBGA 1DWAM 1E5NA 4QDMA 5ABEA 1A47A 2J1AA 2O9PA 1JXKA 5A6SA 4LHSA 2DSVA 3ETPA 2ZX7A 3AHTA 4TTGA 1WDQA 4TX6A 3NDZA 1B9ZA 3OEBA 1KR1A 2J7GA 2CHNA 4HPGA 3ZT6A 1B1YA 4H8HA 7TAAA 5LA2A 3K8KA 8A3HA 4GO8A 2ZICA 4DWSB 1UYYA 1BFNA 2QBXA 3WMSA 4W8JA 3MUZ1 2EBNA 1UOKA 3SCUA 1JDCA 1UR0A 3QHMA 1VFMA 4PTXA 2BZDA 4W50A 2W66A 3SCTA 1HT6A 3WNMA 2J22A 5I79A 3VINA 5J1XA 3RCNA 2BBAA 4FMVA 4Z2JA 5EJZB 3CBWA 1TA3B 4A3YA 1JZ6A 1QNSA 2ORZA 1E40A 1UWIA 1V02A 1FH9A 4W5UA 3FAWA 3AZSA 3WD0A 3WY1A 3VD3A 3VNYA 3W81A 4A6OA 3VMOA 4GI8A 2XGIA 1JYWA 2WLZA 2VZ1A 1Q6CA 3L4XA 2QMKA 1CYGA 3HMCA 1UKOA 4NF7A 4PMQA 4GQQA 2V38A 1OF3A 1W9BM 3LPPA 2J7DA 3WL0A 4P8XA 3OEAA 4PMRA 4W85A 2D22A 3ABZA 3VTRA 2JIWA 1GOWA 3ECQA 2JIEA 3IDAA 3B9AA 1JYXA 1XGZA 4E2OA 2DIEA 1JU3A 1EIBA 1VBRA 2X05A 3OZPA 3VGBA 3A21A 2W4XA 1DTUA 4H7VA 1CWYA 5E70A 5GPRA 4CN6A 3NNGA 4AZCB 1R87A 2YL9A 4XUNA 3BAIA 1GHRA 4BDVB 1G0CA 4BK5A 1UWWA 1EQCA 4MNKA 4ZFMA 1UR2A 3VGEA 3T0AA 3CUHA 2ZXBA 2XTKA 1EHNA 2VC9A 3MUAA 3WD2A 5M3WA 2XM1A 1BVNP 4FLRA 2CYGA 4ML4A 2XFFA 5DEZA 4DUXA 5A2BA 3SCQA 1W9DM 2WSPA 5FD0A 3WFZA 3I2KA 3UG5A 2DDXA 1EXPA 4QB6A 3VIGA 1MW3A 3VO0A 2W9XA 2VM9A 3WFLA 3VU2A 1DWGM 2D1ZA 1JF5A 1GQJA 4ZZ8A 3THCA 4DXTA 5C70A 1QI5A 1UY0A 2B9VA 3VGDA 5HXMA 2CEQA 2YC4A 3PZOA 1FFRA 3KL5A 2VTFA 1JZ4A 3W26A 1I1XA 2E32A 3MUIA 2G41A 4MNMA 5IXEA 3WF0A 1L7RA 1TVPA 2Y2WA 1ZBCA 2YDRA 2JD9A 2EPLX 2ESCA 1JAEA 2EPMX 2Y6LA 1FHDA 2VMCA 4QPWA 1V3LA 4HA1A 4FLQA 4JFWA 1OGGA 2G3IA 4P08A 3I3BA 1CTNA 2J4GA 3G6LA 2VQUA 2VMEA 1UUQA 2W1UA 3O6AA 2WMJA 1V3MA 2QQLA 1R86A 1WAWA 1ODUA 4WF7A 2DCJA 1GVYA 1CEOA 3WUFA 1OINA 3WNPA 2XVGA 3GNOA 1RD6A 5CJ5A 2B4KA 4WSKA 1W2PA 3BAKA 3BAYA 5BYWA 1F4HA 1V0LA 4CUAA 5IDIA 1JI1A 4MNLA 3HJEA 3RILA 2VR5A 4LGXA 3L4YA 4Z2LA 1OM0A 3B9DA 3PUHA 2OLHA 3PTKA 3BSGA 4NRSA 3VDAA 1MXGA 2GFTA 3AMCA 4AEFA 3IJ8A 1GOKA 1JYVA 4CN4A 2CKSA 2G3MA 2WN2A 2J25A 1JYNA 5A6LA 3TTSA 2ZX5A 4AZ5A 2JF7A 2F2HA 4X0NA 5ABGA 1NAEA 1J0IA 2W1SA 1B3YA 3PZGA 2FGLA 3W82A 1VFUA 3CH9A 2EQDA 1CXKA 2WMKA 4AD0A 4CD7A 2WABA 4OOUA 3B8SA 2O9TA 1HJUA 1W9TA 2PWFA 2QQJA 4AZGA 1V0KA 4LYPA 3I3EA 3CQOA 1UD8A 2YLLA 1NARA 3WN6A 2WB5A 4UCFA 2ZUWA 1NKGA 2PWGA 2GJXB 5CGMA 1QW9A 4JCLA 2R7EB 1UA3A 4CVUA 3HEIA 5BXPA 1JG9A 4W5ZA 1GORA 1BGGA 4AMCA 2X8RA 4QAWA 3DECA 3TP4A 4KRTA 2WHLA 1JD9A 1J0JA 1KWGA 1E72M 2ZX6A 5A6JA 3AHVA 1CENA 3OGSA 4Z2IA 3ACGA 5AYBA 4DUVA 4PSRA 3OB8A 1UY3A 1UWRA 4AZHA 3ZJ8A 1G1YA 3NYDA 3LMYA 1C8YA 1AVAA 1ZL1A 4UAPA 2YA1A 4J3WA 3CUGA 4W7WA 1BYAA 1HVXA 2GK1A 1NWUA 4TTUA 4XUOA 3SCNA 2V5CA 3VM5A 1SMAA 2XPKA 1QW8A 3OA5A 2C8NA 4PMOA 4KRUA 5LA1A 2IXUA 2Y8VA 3OGRA 3HOBA 4MO3M 5DMYA 4MB4A 5BRPA 1DWIM 1JF6A 1QHZA 1JZ3A 4PUEA 2WUHA 3AYRA 4QX0A 1R8LA 2VZVA 1XHGA 1UH2A 2YG0A 1VB9A 3EDEA 3ZT7A 3WIJA 2G8ZA 4ZY9A 2ZUNA 2D0GA 2XM2A 2DSWA 4H41A 4TUFA 1OIMA 2YA2A 3BMVA 5HNNA 3SEEA 1V6VA 1UR9A 1W32A 1ULPA 2DEPA 4CN1A 1MYRA 3PZQA 4GI6A 3VM7A 4B3KA 2OYMA 2A3HA 1US3A 4W7VA 2B31A 3CTTA 2XG9A 2E8YA 1BG4A 4M4RA 4A3ZA 3W6LA 4URIA 2G3JA 1UD6A 1ODZA 2WCAA 1GCYA 4M56A 1DWFM 2VVSA 4LYQA 1CNVA 4RL3A 4CKQA 4EAMA 2YLAA 3N04A 3ZJKA 3FAXA 1W91A 3NDYA 1C7TA 5CSUA 4JIEA 3SUWA 2XVNA 1KGWA 4MPKA 1EH9A 3FHQA 2BNJA 1XPWA 3SKVA 2UY4A 4W8LA 2EXOA 3WH8A 3WF3A 4OIFA 4N42A 2E0PA 1LQ0A 2WZIA 5A95A 2J7BA 1UY1A 5CXPA 2GDVA 1E43A 3LEKA 2CBUA 1KXTA 3MO4A 3W5MA 3ZR5A 1WP6A 1W0NA 1WE5A 4BJ0A 1NWSA 1R64A 2F8QA 3GYCA 2WLYA 4GWJA 1QI4A 1TVGA 2CDPA 4ACYA 3M7SA 2DPEA 1KXVA 4A45A 3GXFA 1OT1A 2J77A 4CCDA 1W3JA 4TVCA 1IQDC 4CU6A 3K8LA 4JL1A 2W46A 1HJQA 2Z4FA 4PMNA 3KL0A 2E9MA 4ZXLA 2BFGA 3KZSA 1GMMA 2D0FA 2UY3A 4XZBA 3VIHA 3AIEA 2CBVA 3AOFA 2BY3A 1FP9A 2WW5A 2CPUA 2PWDA 3QHOA 1K42A 1KQZA 2J1EA 4CD6A 8CGTA 4MJ2A 1E1EA 3T2OA 1H1NA 1E6SM 4XUPA 4AZ7A 3EDJA 3WUGA 1U30A 1BYDA 2V3FA 4DM2A 4A42A 1ITXA 5I2UA 3CZKA 2W61A 1B2YA 2AOSA 5DT7A 3GGLA 1HF6A 2DQXA 1HJXA 5JXIA 2OYLA 3CO4A 2JE8A 3CZUA 5HOSA 3W29A 2WXDM 2WVSA 3W0KA 4ATWA 4B16A 5FL1A 3LPOA 1GVIA 3MMWA 3A4WA 4HMCA 2TAAA 2C7FA 1LL4A 3AISA 1UZ0A 1Q4NX 1RH9A 5M17A 1CECA 5CPQA 1HJVA 2EPKX 1GJWA 2VX6A 3FY1A 4LPLA 2E9BA 5GQBA 1PJ9A 5E9AA 1CZ1A 1M7XA 3CZGA 1T2XA 1ISXA 5GNYA 3VDCA 2CNCA 4JCMA 5IFPA 3FXYA 1CZSA 1MPXA 1EOMA 4ATLA 3I2HA 1SR0A 1MW1A 2X1IA 2W47A 3FW6A 1TMQA 3MSGA 3N18A 2WQ8A 1NH6A 1ZBVA 3W38A 1UKTA 3DHPA 6TAAA 4MGSA 2LW8A 2G4FA 1H6YA 2WHKA 1WCGA 3T09A 4W8AA 4MGQA 1HJSA 1UYQA 1SDDB 2E4TA 2OYKA 3N12A 1SFSA 2J8FA 3PTQA 4ET7A 5M5DA 1IV8A 2WC7A 2VZUA 1CLVA 1NP2A 1C8XA 4J3XA 2FH6A 3PZIA 4PSPA 2XHYA 3LEGA 3A47A 3RJXA 1GPFA 2J1VA 4CUBA 1WB0A 2DGAA 2X10A 1V6UA 5I0DA 2DH3A 3W5NA 1KGXA 1O59A 3L2LA 1E6NA 3VGFA 1MQPA 4LQRA 3SUSA 3VIFA 5A69A 1GQKA 2BHZA 2XHNA 4LPCA 5AY7A 2RGMA 5HBFA 2J7MA 4MB1A 3MMUA 1B0IA 1MW2A 3TOPA 3GBEA 4HU8A 3MU7A 3GDBA 3RM4A 2E40A 4E4PA 4C7GA 2UWFA 1XV8A 1JIBA 4FLOA 1V03A 4HA3A 4ACZA 4PF1A 1J0KA 4MB5A 5CLTA 2VO5A 1BTCA 1CGXA 4D0QA 3P6BA 9CGTA 2PBOA 4D6EA 2YA0A 2XSBA 3I2FA 1OBAA 5CGTA 3WDIA 1UR8A 5I5RA 5DT5A 3SUTA 3D3AA 2DH2A 4IUGA 3OLIA 3ARRA 1C8QA 2XFRA 3N1AA 1ESWA 5EMYA 1B90A 4HOWA 1GQPA 3GXIA 1WCQA 1ZJBA 3KWXA 3AC0A 3EYPA 4FF5A 5B4XA 3F4VA 3K4AA 4MJ4A 3ZR6A 1Q6FA 4DEQA 5DQ0A 3WH5A 4U31A 3AIWA 1EA9C 3VIOA 4AD3A 1O6IA 1V3JA 1W3LA 2J1TA 2VNCA 4QLJA 4HMDA 5CPTA 1EOKA 4BCEA 1OT5A 2XONA 4J3UA 3IAPA 3A3HA 1M03A 2CESA 2WMFA 3EDFA 4OUEA 1OCQA 3OGVA 1GOFA 2C4XA 1UD4A 3WL1A 3ACIA 3ZQ9A 1OD8A 1E70M 3GH4A 1UMIA 3QHNA 5FCZA 4QX3A 5CQ1A 1V6XA 2WC4A 1XH2A 4JAWA 2JF6A 3WQBA 4HP5A 5G05L 1EO5A 1X1NA 3VD7A 5E6YA 4EK7A 2ZX9A 2Y6GA 1TUXA 2J1RA 3BN6A 2UY5A 1KEXA 1CBGA 3WD3A 4HZ7A 3CHDA 4KGJA 2YFZA 3C8XA 1XSKA 4J7RA 2YIHA 4U2YA 4PBGA 1L8NA 4K68A 4PUDA 3TA9A 1J0YA 2XGBA 2WK2A 4C7FA 1UY2A 1BLIA 5I24A 1LWHA 4M29A 4E8DA 1C93A 4U3CA 5D8ZA 3MKKA 4OZOA 3G6MA 4L4PA 3C7HA 2BGPA 2WYSA 1KCKA 2W94A 1OWQA 1PIGA 1M04A 2V72A 1CXEA 4XV0A 5A3HA 4YHGA 1AQ0A 1C91A 4N0RA 1JZ8A 2ZUUA 4R27A 4CU9A 1CGUA 1UKQA 3CZEA 3CMJA 3HN3A 1XH0A 4KWUA 2HISA 3NCOA 4BQ3A 5BXTA 3WH9A 3WMCA 4U33A 1HX0A 2Q8XA 1XYFA 4F9JA 1W1PA 1E6XM 2A3EA 1XRVA 3O2LA 1VENA 3VIIA 3A22A 1KBKA 4DEVA 3PBGA 4W84A 1QOXA 4AYSA 1VEPA 2GK1B 1FOBA 5I77A 1Q6EA 3WNNA 1KQYA 4UQEA 5ECUA 2BY0A 5ABHA 5GNXA 2OWXA 3LPGA 2ZXQA 2VL4A 1PEZA 3HPNA 1CLXA 1BF2A 1H41A 1CZTA 1MQRA 4WKHA 4D1IA 1HL8A 3QOKA 1E15A 1JU4A 4S3JA 3PZUA 3AMDA 4WSJA 2QHAA 3TONA 1VFFA 4HG6B 1JI2A 5A1AA 2DSUA 2VZRA 1KXQA 2VUYA 1DP0A 2VX4A 2E33A 2HYXA 1J9YA 1QVBA 1ITCA 3K4DA 5C8BB 1KGYA 5E09A 1E56A 3AIUA 4WKFA 2J78A 4GWIA 1QPKA 1DEDA 2YL6A 5D9MA 1OD0A 4QX2A 2VI0A 4NSBA 3CMGA 3U57A 5JBDA 2CKRA 2WPGA 3WKZA 1W8OA 3IANA 4M80A 3IK2A 1UXZA 1V08A 3SKJE 4RN5A 3VKKA 1UQZA 1H4PA 3VVGA 4EANA 3W53A 1CDGA 3BAWA 1DWJM 4RE2A 2VRQA 4D6FA 3HNMA 5AYIA 3L4TA 4F8XA 3A7QA 3JUGA 2Y24A 4GI9A 3ALFA 4MAZA 4B9YA 2ZE0A 2WO3A 5JIPA 1V3KA 1L0PA 2VCAA 5E0CA 3ARWA 4OOZA 3ZO9A 2PWEA 3CUFA 3CHEA 4HOZA 3ZIZA 1ISYA 4BQ2A 4B9ZA 4OMDA 1E6ZA 2XVPA 3AI0A 1XSIA 3A4XA 2YL8A 5FUIA 2JALA 3AIRA 1FHLA 3CIHA 2XVKA 1V6YA 3NIYA 4P7OA 1QNQA 3VD9A 4BA0A 3NUKA 3WNKA 3NSMA 4AG4A 3AS0A 5CG0A 3J7HA 5CLWA 4UTFA 3ARUA 4JFVA 4J28A 4QB2A 5D9NA 1UX7A 1ISZA 4H8UA 1TE1A 3ZT5A 3A23A 5C7GA 3ZJ7A 5JMOA 1LWJA 3K77A 1DHKA 2VOTA 1NX9A 1WDSA 3AICA 2GUYA 4FK9A 4D6IA 4ARYA 3NJ3A 1GZJA 3QOMA 3AIVA 2YFUA 2GSJA 4KGLA 1E73M 1K3IA 4XVHA 4LQ1A 1H11A 2Y4SA 2BERA 2VVNA 4B15A 3WQ6A 4EKJA 1BHGA 4UFHA 3AS1A 3NJXA 1IZKA 1TCMA 3WENA 1I75A 2WZHA 2XIBA 2VCBA 5EIYB 5B4NA 2WZ8A 3BXWA 5EB8A 2VZOA 3CDZB 2FGZA 4MNJA 2WVUA 3K8MA 4QCEA 5EFDA 2W3JA 2VURA 3RO8A 2FHCA 1JFHA 1ZU8A 1UWSA 1JNEA 3ZOAA 4D6HA 4BXSV 4PTVA 2FHFA 4UZSA 3GXDA 3T0DA 3W4RA 3PN8A 4JKMA 2WM0A 3WELA 3BCDA 1H49A 2XWDA 3BGAA 3WSUA 3RDKA 1MQQA 3OBAA 3NQHA 2BVDA 3AQUA 3AHZA 3N13A 5FKYA 4LKSA 4RE4A 3W6MA 2X09A 4PYSA 1W9SA 1C90A 5DFAA 3MBWA 2VMDA 1U2YA 2J7EA 1RP9A 1E4NA 2E8ZA 4ZXOA 2WANA 2J7FA 1E71M 5IHRA 1CXIA 3HNBM 2BY2A 4TOQA 2YDQA 3N15A 3ZSSA 1WPCA 4D8MA 1HP5A 1XD0A 4PCTA 5DN2A 1NM9A 3ARQA 2ZEWA 2JFEX 3MMDA 3S6TA 2WVVB 1HKMA 5A8QA 1GNYA 4OBRA 1GOOA 3EMZA 3RJYA 2DT3A 3RM9A 3CUIA 4F66A 1S46A 1UG6A 3PZMA 4KMQA 5GNZA 5AC4A 1QHOA 2D0HA 1TR1A 2VZQA 3WDHA 4UQBA 4AEEA 1D3CA 5A2CA 4XX6A 1HKKA 5I3DA 1KR0A 4ATDA 4AWEA 3UR8A 3WUEA 1BQCA 2ZUTA 2CITA 4S3KA 4XB3A 2VZ3A 4GZEA 2EJ1A 1W1TA 4ACZB 3BC9A 5JBEA 2E26A 5C71A 2KD7A 1V3IA 3N11A 4QDQA 4PMZA 4Y7EA 2YB7A 5JXJA 1PZ2A 1J01A 1BYCA 3WDPP 1W2VA 2BHUA 3NJVA 1J0HA 1BGAA 1CX1A 1H2JA 2OSXA 1BG9A 4UOQA 1SHWB 1X6NA 3UNPA 2WMIA 4UFMA 1CXLA 1K12A 4M4PA 4HZ6A 5A8MA 4QDSA 2WC3A 4XURA 3ARSA 2JDAA 1E3XA 1ZB5A 4H04A 2WO2A 1UH3A 5M03A 3OIHA 4QP0A 2XSAA 1WZMA 1ULOA 5JIWA 4UQAA 2YDSA 1OB0A 3KL3A 4QDRA 1R7AA 1KXHA 2DIJA 3A4AA 3KEHA 4TVDA 3EMCA 1EUTA 2CIPA 1CPUA 1LF1A 2ORXA 2YC2A 3VMPA 2VRKA 4W89A 1B31A 3QGVA 2A3AA 3HJRA 4AXNA 1K9FA 4TXWA 4M82A 1F4AA 1JI6A 1UY4A 3MV11 2ZEYA 2WWDA 4HMEA 3HU7A 2DT0A 3GH5A 3VNZA 2X2YA 4JX0A 2QF8A 4OMCA 3TTOA 4HU0A 4CD8A 3CZLA 2OSYA 4WLCA 2WSKA 2CBIA 4W87A 4MDPA 3AXIA 3W27A 2XFYA 1NUKA 4AD5A 3AHYA 4PCSA 1QNRA 4WKAA 3PUIA 2W62A 2UY2A 2WAGA 2YL5A 4CCCA 1YHTA 1XSJA 3OLEA 1J83A 2JEQA 1D7FA 1NQ6A 2J62A 2J75A 1NP0A 4A44A 1GUVA 5D9OA 4WJXA 1OD3A 4H8VA 3THDA 1FH7A 3ZM8A 3DYPA 4YHEA 3AZRA 3PZVA 2YBUA 2XVLA 1U33A 2QMJA 2CCRA 4V27A 4M81A 2VZPA 2Y6JA 4J3TA 3AXXA 1EGZA 4JHZA 3AS2A 1B3VA 4QFUA 4UNIA 1LL6A 3MV01 3WDJA 4MTVA 2VRJA 3LE0A 4QB1A 1H3GA 2W95A 4AD1A 5A6MA 4ARXA 4BQ5A 3WF4A 1H0IA 5G04L 1GONA 3TTQA 2DT1A 1UA7A 3B9EA 2PQSA 1E6PA 3OLDA 4NRRA 3DYMA 3VUPA 5BROA 2QV4A 1GOMA 1EHAA 2DSKA 2PWHA 1D7PM 2QQIA 3W28A 5JUVA 3BAXA 4HOXA 4AZ6A 1OGBA 4GZ9A 1JZ5A 4IISA 1O8SA 4F79A 2PC8A 3PHAA 4BK4A 3KE0A 1XNTA 2O9OA 2XUCA 1D2KA 4DUWA 2GJRA 2FH8A 1N82A 2J8GA 1ZS2A 4XZUG 3SCWA 5CPSA 3GTNA 1ISWA 2CDOA 2CBJA 3T0BA 2XJ7A 1KFWA 4J3VA 5EBAA 1OSEA 1QHPA 3I3DA 1UMHA 1E6QM 3N17A 3CUJA 4MAVA 2EPNA 3ARYA 2XQXA 3UG3A 1HN1A 1Z32X 3T08A 2D24A 2GVYA 2WMGA 2V5DA 3FN9A 1V02E 1SG3A 3WBEA 4E8CA 3ACFA 1BPLB 2RGLA 3M07A 3II1A 3VOCA 1W9WA 4PTMA 5A2AA 1UYXA 1E3ZA 1E4LA 2C26A 1VIWA 5IFTA 1TFVA 3OLGA 2VR4A 3WDRA 5A94A 3MSDA 1HKJA 4MOAA 1H09A 4OBSA 4P5YA 3CLWA 3C7OA 2D3NA 3CZ8A 2EIEA 3ZMRA 5JXGA 1JZ7A 2YJQA 3ARPA 1GOHA 2IXVA 4CGTA 4ZZ5A 5EFFA 4QCFA 4V28A 3AHXA 3WF2A 1VBUA 1O7AA 3OZOA 1WNOA 4IPNB 3WQWA 1WDPA 3BLPX 2VZSA 4AD2A 1PIFA 3VIKA 1G01A 3UEQA 3RMEA 3I2IA 4FLSA 1MFUA 2WCSA 4DWSC 4JKLA 4TXEA 1WDRA 3M46A 1CGVA 3L4UA 3SUVA 4P8VA 2J7CA 4KI5M 4JFSA 4XUQA 1H5VA 5E6ZA 4OKDA 3WD1A 1VF8A 1OH4A 3E1F1 1W9UA 3AJ7A 1WZAA 2ZOXA 1XH1A 5ABFA 3AMLA 1W1VA 4PMVA 2XWEA 1CGWA 3UCQA 2NT1A 2PI6A 2DT2A 1E4MM 5A6AA 4P7RA 1NWRA 3AYSA 4PMXA 1V6WA 2GDUA 3L2MA 2A3BA 4GINA 3F2ZA 1JXJA 2MANA 3SURA 3VIPA 1HXJA 2RJ2A 1B3ZA 2BVYA 4U3AA 3I2GA 7A3HA 3AIBA 4HTYA 4OJYA 2XYLA 4M1RA 2W1QA 3I2JA 2WWCA 1H6XA 1GQLA 4AY1A 1TVNA 3C7FA 4M8UA 1V0MA 5CSYA 2E3ZA 1VAHA 5JBFA 1B3WA 4RE3A 4A41A 1W9PA 3SCRA 4CCEA 4D1JA 2WAOA 2D3LA 4UFJA 3AZTA 4J27A 2J47A 3CIVA 1DLCA 1EQPA 2OKXA 4AW7A 1GHSA 4BS0A 4IPLA 2ID4A 4AD4A 4CD4A 1P8JA 1UXXX 1CIUA 4A3HA 4P7NA 3JXSA 2ZXAA 4PTWA 3RPMA 5IJRA 2ZEXA 4PEEA 2OSWA 2EICA 4UFIA 1CXFA 1NWTA 4UQ9A 4AIOA 1AQHA 2QQMA 4GQRA 4QLLA 2QPUA 1OT2A 1UR1A 3CHFA 3BH4A 2A3CA 1QI2A 2CETA 3WMBA 4KH2A 1VJSA 1W9VA 4PT6A 3WEMA 4NZCA 4CUCA
chains in the Genus database with same CATH superfamily
3I4IA 2WKLA 3ITOA 4HKLA 1P43A 4IEPA 4ZSUA 3P60A 1XLBA 1BSIA 2YBSA 5A3UA 1I5PA 3KVAA 1OOPC 3ARVA 1VYPX 2PB1A 1QJX2 3JUUA 4JHOA 2BLEA 1JHJA 4YTQA 3BG3A 5CFCA 2EPOA 4JIQA 1FT9A 3MF9A 5ABJC 2PP3A 5A33B 4PMDA 2DVAA 4WJEA 3FIGA 1H9WA 1W3NA 3TLQA 4DYJA 3IJ9A 1UD3A 2R072 4E5TA 5AC92 1BVWA 3PVOA 1GQIA 1W1YA 1RALA 4ZE5A 3H2EA 2DZPA 3GQYA 3E5UA 4AGVA 3VDHA 4CP0A 3VOJA 1FH8A 2YV8A 3SIMA 4FSJA 3VIJA 1N8WA 3E0VA 3NQVA 5C7HA 4TV5A 2JKAA 4UTIA 3L2IA 4LO7A 2A7AA 5JZGC 5EV7A 4DINB 5M0TA 3H24A 4Z2GA 1XLCA 5D38A 2VFGA 1LL7A 1Z41A 2H0VA 3H42B 3SHRA 3G77A 4YVWC 3V56A 1OQ1A 4MSVA 2VMGA 4YWAA 4B4RA 3ANUA 1LTDA 4QDWA 1W3HA 1XNBA 2RS11 2HBXA 1UKSA 1UL9A 1ZZ6A 2FPTA 4GXLA 3GW3A 2V5LA 4X2RA 1YNPA 5DF0A 2WT0A 5BCAA 1YFYA 4V2VA 4XQ6A 3ZYZA 1SO5A 4C1NB 4FAMA 1CVNA 4ZO6A 1VFHA 2H8ZA 3VDBA 1Q8JA 4IV1A 3C2UA 4GIAA 2I9UA 2BGOA 3NG3A 1VR6A 3PB0A 2RFGA 1PMJX 4AXKA 4QGLA 3W37A 1AH0A 3PBYA 1LG2A 2Y7EA 4CUGA 1C7SA 1YI9A 2VOXA 5CAKA 2LALA 2QQKA 3QTGA 2XKPA 2EIBA 4I90A 1RUJ3 4GIRA 2QUVA 1PGW1 2C13A 2RS53 1H7RA 4N2YA 1KJLA 3T55A 4HT1T 2D2JA 5FOBB 4D69A 1REQB 4LNVA 4DXSA 6XIAA 1V9U2 4RZ5A 2BJSA 3WBAA 3BKZA 5FZ0A 1BSLA 4UW3A 2PAJA 1WZKA 4GI4A 3SN0A 3ZYGA 3RZJA 4XAAA 2NW0A 3GNRA 5FPLA 2DSZA 1ICPA 3HGJA 3P0WA 1TV2A 2KM2A 1R092 3KAOA 4HBKA 4YW3A 1ZAHA 1XINA 2SFPA 4GZJA 1KD0A 5KXBA 3CJIB 1SFTA 3QW3A 2QCCA 2GH2A 4XZWA 2WZR2 4CE8A 4XIKA 4YVVA 1HVQA 4M24A 1JPKA 1I9RA 2PA7A 4CCNA 2PDMA 3L0GA 1E55A 5I0UA 5CB7A 5H9RA 3LEIA 4H7LA 1G94A 1W6QA 3GDTA 5HMEA 1FDJA 1A78A 3IB3A 3S30A 2TUNA 3RG0A 2JIJA 1FQ0A 3CV7A 3PSVA 4UQCA 3VHOA 1I0DA 3WMLA 3DAQA 1AVBA 2IPGA 4UCGA 3U5UA 1CZVA 3U75A 3SCGA 4C65A 3ZIXA 3NR0A 1IS5A 5DZEA 5BMXA 5J09A 3AYAA 3IM0A 1A50A 3S5NA 2ZKNA 4Z2AA 3LCLA 2YBTA 2Y6HA 1UOZA 3O9NA 4MY8A 3FYOA 3GH7A 1QASA 1WW4A 2D93A 4WV8A 1OFNA 3IJLA 2ETEA 1EX5A 1SSDA 3ES1A 1ME7A 1H50A 3SN1A 5F3IA 1C92A 1PCKA 4RNIA 3NQ8A 5T9BG 3DC0A 2V4VA 5H8MA 3B8IA 2ICSA 3ITGA 4AEJA 1PMHX 1QATA 2WSVA 5AN7A 1H0GA 4GIQA 5C3OA 1HXS3 3SCSA 2BVTA 1REFA 3SB0A 3OTFA 3BQ5A 3UR7A 2XMLA 2KA3A 1PWLA 2WNZA 4D6DA 4YTSA 4LYRA 3RX4A 4YVXA 1ZHAA 2HEVF 5A6TC 3SR7A 2XGZA 4DEFA 4GVGA 2Y63A 3QH6A 3TYDA 1E6RA 4DXVA 4XKMA 4M51A 3UD6A 2HWF1 2NZ9A 5A7SA 3WD5A 5H8PA 2Q3RA 1AL7A 2O9RA 5K7PA 3BW2A 4NXKA 4AFDA 4DRRA 4RHV1 1AW2A 3DH7A 1XJAA 3RHGA 3LCWA 1DORA 4C6BA 3R79A 1CIYA 3ITQA 5HDRA 1EUUA 2MHFA 3GFYA 3VNDA 4HNUA 2A3WA 2WN3A 1TIWA 4ADTA 1O8PA 4O9EA 2XIOA 1V6KA 2OCZA 2PUZA 1M53A 3D5HA 1JPHA 3S7EA 3TV8A 1WA6X 1A0DA 1OF4A 5DPNA 2ACUA 3QD6A 4GYPA 5D2YA 1NU5A 1PMIA 2DVDA 2XDVA 1BVVA 3L0NA 2WLQA 1JJKA 4HPNA 5A3OA 1O3RA 1XX1A 1H1MA 4LC8A 3QR3A 4B7KA 1IQAA 4EQVA 4D7YA 1UC5A 2W87A 1RBLA 1A5UA 4KWJA 1W3TA 4L4OA 3WSOA 2BY1A 1LHWA 5C8CB 1RUC2 5A6KA 1UZHA 4OGZA 2GSEA 4HK6A 1K7XA 3G18A 1KS4A 1O7FA 3AVRA 4AEDB 4GCAA 4IF2A 3IIIA 3POCA 1QQP1 2CXGA 1R083 4FI9A 4N8MA 1JR1A 3LXBA 5F3EA 1B3XA 3KGLA 1U1JA 2K46A 5E0FA 3TMLA 1VRXA 4AU0A 4W93A 4US6A 5D4YA 3U5YA 1RPKA 5F39A 4D3WA 6A3HA 5KTLA 2B81A 4WDWA 3W2JA 3PVFA 3WQ8A 4URAA 3DX5A 5DO8A 3CGTA 1JPIA 4TVUA 3MS8A 5HUOA 2Z28A 5GJPA 4HTBA 4UZUA 1XUUA 1W99A 3QOPA 4KEUA 1MS0A 1EPZA 1RMU2 2R1BA 1RUOA 1MWOA 2WJEA 3K75B 5D9PA 1M7JA 2FVLA 2BBFA 1C8VA 4IE6A 1UD5A 2WHJA 1EJXC 1CWPA 5AHMA 3V16A 5JXQA 4UT5A 1XE7A 4JQ1A 4QNEA 1AMYA 3LM3A 3DXUA 5BXSA 1IF2A 2ALDA 2W6RA 4U5IA 2R32A 3QSTA 3TN4A 4QGNA 3AXMA 1Q85A 1J58A 2A1YA 4AVAA 2JIGA 4KH9A 4XJWA 3DBNA 5A6XA 4P00B 3Q37A 4R5EA 1QHDA 2ZQ0A 5IUQA 4V1PA 1BYBA 4L80A 3PTDA 3IVSA 1NLSA 2PZNA 3TNBA 3C56A 1QJWA 2ZGQA 3LHZA 5U4NA 1RP8A 4AC1X 2OQ7A 1URXA 4ASMB 2PEVA 3BSHA 3UJQA 2VCCA 3ZXFA 5DBTA 1ZZ9A 1FCBA 4DXRA 4H19A 2BMBA 3KM8A 4PLOA 3VBRA 1G67A 3FYPA 4PMJA 5LB6A 4HKWA 2QS8A 3WQ4A 2O55A 3WG4A 4J2MA 4D6JA 1K6WA 2WZEA 1M5WA 4WY0F 3VBOC 3DYOA 3EMQA 2PF0A 2B4GA 4FPSA 2BWAA 4L56A 5K0UB 3BOWA 1YXWA 4LVGA 2HH9A 2ZGMA 3I2DA 5I0RA 3U37A 3H3UA 4IIHA 1DFQA 1U22A 2JICA 1UX6A 1K45A 3AYCA 2A4AA 3UYCA 1PTGA 4NJHA 3QW4B 3CU7A 5KXCA 1Y9MA 4NE9A 4EZ4A 2CHOA 1SJDA 3UY7A 2FHBA 1YWKA 4JDOA 3VD4A 3GZAA 2V3DA 3PBVA 4FQZA 2GNDA 4NJIA 4YVSC 1XNAA 2C9KA 1K77A 5DQPA 4GALA 3CL7A 4PBPA 1FP8A 2NQYA 4Q4KA 5D37A 1Q56A 4Y20A 4GAZA 2D3PA 2IZWA 4ZU7A 1QJY3 3BMWA 2ZJCA 3UETA 3JW7A 1G5AA 2XINA 1TPVA 5DBUA 3O3RA 4GH4C 1OIFA 2G5WA 1QI3A 1DWAM 1ENSA 1ND2C 1A47A 2J1AA 4GUHA 4UC5A 2HVNA 1CESA 1JXKA 3C5QA 2VEGA 3CNAA 3AHTA 4F2TA 3N7JA 4TTGA 4TX6A 2Z26A 3VBSB 1B9ZA 3OEBA 2CL2A 2J7GA 3ZT6A 5DAXA 1B1YA 1FY6A 1LT7A 8A3HA 4GO8A 3W88A 2ZICA 5FY5A 2C71A 2BTMA 3BANA 1BFNA 3UJSA 1AZ2A 4W8JA 2D6PA 2WNUB 1UOKA 3ES7A 3UZ5A 4DJEA 2ZS6B 1JDCA 2EJAA 1FPN1 4MXVA 5T52A 3S2MA 1QUMA 1GYMA 1VFMA 2YPIA 2G9FA 4PTXA 3W22A 4GXWA 1OCBA 2SBAA 5CKNA 1EJSC 2W66A 3THAA 4YZ1A 5LIXX 5I79A 3T78A 1HO4A 4RCXA 4OV9A 3WO8A 4XBNA 3A9IA 5EJZB 3NQMA 1A0CA 5FF0A 3EOSA 1BEV3 3GKFA 1H51A 1TA3B 1PO23 2ORZA 4K39A 4QEEA 4W5UA 3I59A 3FAWA 2GC0A 3AZSA 3RITA 4JTEA 2O7QA 4GI8A 3D0SA 4I7UA 4K8HA 4L1WA 2VU9A 2VZ1A 5K9DA 4IMFA 3BLDA 4GY1A 2ZX0A 4ATEA 3L67A 2Y0OA 3HMCA 3VZXA 1UKOA 1POKA 5SWUA 3PVEA 3GR8A 3VB9A 4NIAA 1S0EA 4XC9A 4BKNA 4MV2A 1PYMA 3VTRA 1A5NC 4OI1A 2YGMA 3U07A 3ECQA 3V5FA 5ANQA 1GP6A 3O15A 1RXGA 5DMLA 1QPQA 3WJZA 1JYXA 5BNPB 2FD8A 2IFRA 4GNKB 2DIEA 3KUMA 4JGZA 3OZPA 5HNTA 3K51A 2WWUA 1FWJC 4CN6A 4AZCB 3T4CA 5E1RA 1R87A 1DHPA 3QPEA 4L65A 5EPAA 4M5PA 2DVBA 1IEIA 3NQDA 4GX8A 4FALA 1EQCA 1E9YB 2FMNA 2QQPA 2VGBA 4IGSA 3VGEA 5KZEA 3CUHA 2WNVC 2Z6IA 1UYPA 5I3KA 3SW6A 4XHXA 2YBPA 1A5CA 5M3WA 1J6OA 4WJ8A 4A22A 1IWBA 4FLRA 4A3UA 4F3HA 3SNMA 4DZIA 4TIMA 4NILA 5FZ8A 2A1XA 1Y8BA 3VOIA 4DUXA 1W9DM 5FP9A 2EIGA 1G7YA 3KZPA 3KV9A 4NJ4A 4D7TA 5EBUA 3R94A 1RUJ2 2V69A 4UTTC 2D1ZA 4O0ZA 1RV8A 1I6NA 3NKGA 3RN6A 3W02A 3THCA 4QDPA 5C70A 1UY0A 3JB4C 3CHXA 3UR5A 3PZOA 1VCFA 4PC8A 3RCYA 4YLZA 2P3YA 3W26A 1G4TA 1LU1A 4JGYC 3OGGA 4MNMA 3N29A 3TNOA 1TVPA 1XYLA 4FPLA 5I0SA 4KETA 5CC7A 1TPC1 4K38A 2ODOA 1FHDA 5H9QA 3JBG3 4ZTXA 3RR1A 2R061 1XLAA 1LB2A 3BTZA 2G3IA 5C4WA 4BHPA 3PG9A 3B0XA 4O0QA 5C9AC 5C9UA 2BVBA 4K1ZA 3UZJA 1OFQA 1XLKA 4HVRA 3LYEA 3ZKYA 4F7ZA 2BG5A 1EJ7L 3LAGA 1ODUA 2DCJA 4NYYA 2VG9A 1TNFA 4GY7A 4JOMA 4Q8QA 4R9CA 5A7OA 4JQ4A 3OD0A 1A53A 1CEOA 3WUFA 5HWJA 3BODA 4BCUA 3GNOA 4LO4B 1CJDA 1SLAA 5HCFA 1NXD1 3IJDA 2C9AA 3POBA 3JRKA 1T41A 1AXZA 1Q63A 2JG8B 5BYWA 3H6OA 4CUAA 4YYOA 4MNLA 1WXYA 1UP3A 1RVGA 4LGXA 4C6JA 1OM0A 5EMMA 4Q0QA 2I5QA 4QISA 4LHLA 1HW6A 1ZALA 4NRSA 1LP6A 4O1FA 3WG3A 5ERLA 4E4HA 2DZTA 2ZDSA 3K13A 3GDRA 3WG1A 4AEFA 3IJ8A 1GOKA 4CN4A 3VHRA 4I8YA 2G3MA 1JYNA 4HETA 1HXS2 4EWAA 1EXBA 4AZ5A 1EEPA 2JF7A 1FATA 3NV4A 1PDYA 2JDKA 2XL9A 1C1FA 1J0IA 2HJIA 3KT1A 1B3YA 4EF9A 3H2FA 4IL2A 2WMKA 5HR7A 3RLVA 4QQ2A 2X5IC 3W1XA 4P2VA 3GB6A 1LOSA 4XBQA 4TMBA 1QXRA 1SBDA 3HR9A 2QJIA 5TAOA 3LCPA 2YLLA 1NARA 1QXPA 3N7MA 2IVJA 4MGYE 4UCFA 3THQA 3B9IA 3L2YA 1NKGA 3AMPA 2ZUWA 4REQA 2GJXB 5HCHA 4DPNA 1QW9A 3DESA 5AC8A 3PPCA 5BXPA 1EAH1 4AMCA 1O5RA 3STGA 4G9PA 2WS91 4IX0A 2ZABA 4LKDA 3DECA 3OSDA 1WV2A 3SLIA 3EHKA 2Z00A 1XYOA 4XJ9A 3N3MA 4AOCA 5LASA 1MS9A 1JHNA 2P88A 1W6TA 1MSSA 1W6OB 1XNDA 4F0MA 1F15A 4K7JA 1SZGA 3DZ1A 1BJQA 3PWIA 4PR4A 4FNRA 4LUYA 4MHRA 1D4M3 3IGHX 2PAEA 1XLJA 3LMYA 1XC4A 4J35A 1RAKA 4UAPA 4NL1A 2YA1A 3NNFA 4U10A 4CTEA 5KHKA 1DVJA 1JYCA 3Q2DA 1W2TA 1BYAA 2DVUA 5CPLA 1HVXA 4GBUA 1DDLA 4B91A 3M64A 3P3PA 3VM5A 1R082 5C6MA 3R0UA 3LHWA 3BQ6A 1X9PA 1MNZA 4JN8A 1R3SA 3R2GA 5DMYA 2I5IA 4JIHA 1JZ3A 4PUEA 4LAUA 4IQJA 4QX0A 1ZYBA 3I4EA 5FY9A 4MFDA 4H6QA 2PTMA 1VB9A 3L68A 4O16A 3R8RA 1SUXA 3GU1A 1EYWA 1X1ZA 2G8ZA 3LM7A 1HKWA 1OIMA 1TX2A 3HQOA 5L9VA 3LHVA 3BMVA 3SEEA 2ZHNA 3FEMA 1Q2RA 3DG3A 2DEPA 4CN1A 1R2TA 1OA4A 1RINA 3LBOA 4W7VA 4CDXC 1JMUB 4B4FA 3FE5A 4LBKA 1K8XA 1AJZA 1BG4A 2E8YA 3NV1A 2P5BA 1QEXA 4FPGA 2PC4A 3TRSB 3QQ0A 1PVC1 2FDFA 4IFOA 8XIAA 4KBZA 2A5HA 1GZTA 4URIA 4Q0PA 2NWRA 5FYZA 4ERIA 3N2BA 3M4FA 4QM9A 1FCVA 1DWFM 4LYQA 4ZB0A 5A33A 3IVUA 4QSHA 3MPBA 3MFCA 4XF9A 3LU2A 2VC7A 4EAMA 1QPRA 3ZJKA 3N9SA 1PWMA 3B94A 3NDYA 2ACQA 3BG5A 2FCTA 4LTSA 4XAGA 1KGWA 1F5JA 4MPKA 4RZ6A 4AHZA 1OVPA 3ITTA 3FHQA 5IVFA 3KVLA 1H8TB 4AR2A 2VKZG 2YU1A 2E77A 1QJZA 3DL3A 2EXOA 3WH8A 2PTXA 5JLVA 1LQ0A 3WCRA 1QOPA 4IGHA 4NHMA 1E43A 3LEKA 1KXTA 5FXXA 1DYSA 3PVNA 3ZR5A 1WP6A 4GJ1A 1NWSA 3QN3A 2F8QA 4EN7B 1RK6A 4XO7A 5HA7A 4HVOA 4GWJA 3M7SA 4RZBA 4KBXA 3CASA 1B09A 4CU6A 3R8GA 2BOIA 1MEC3 2ZMLA 2Q8ZA 2Z4FA 3VBFB 3QC0A 4PMNA 4QXIA 1GZCA 2BFGA 4RGGA 5BNQA 1QXJA 4NOTA 1J59A 3VIHA 3ZN5A 3NJYA 1R46A 1KC7A 4IEQA 1I8JA 2ZRYA 4V33A 5LRSA 8CGTA 4K2SA 3TW6A 3T2OA 1H1NA 1E6SM 3T0CA 3CQKA 3AL5A 1U30A 3MHGA 1D8CA 4XD4A 3CZKA 4HK7A 3QPYA 1NCRA 4N9IA 1UMYA 1QJY2 3ATZA 4INDA 2OT1A 1KTCA 1UPMB 1HF6A 1YDOA 2DQXA 1R1A3 1REQA 3CEUA 2WXDM 3W0KA 4NHYA 2ADEA 2QE3A 5HWMA 3FBMA 3ALQA 2EG8A 3WX7A 2E68A 1J5TA 4GIYA 4KEMA 3HQNA 4WVMB 3AISA 1Q6RA 3RF9A 3W7HA 1CECA 1HJVA 2BOGX 4XTPA 2OQHA 1GJWA 3KF3A 4LPLA 1RHI3 3CJIA 2I74A 1S2TA 1D2QA 4DIAA 1NT0A 5T54A 3LK6A 1T2XA 1IWPA 1ISXA 1HJFA 3VABA 2RHGA 3MP3A 5GNYA 1L2QA 3PF3A 4L6OA 3VDCA 3W2UA 3TN6A 5CIRA 4Q8VA 1AL0G 3FXYA 1CZSA 4WQ6A 1M9HA 1EOMA 4NNCA 1IIHA 1MW1A 2X1IA 1SZBA 3BLOA 3DFYA 3VFCA 1LOCA 3MSGA 1VALA 3R05A 1NIUA 3A24A 4HN4A 4J2PA 1HTIA 2MEV1 3D82A 1ZX5A 2GDFA 2AKZA 3W7GA 1BEV2 1H6YA 2WHKA 1WCGA 2IVIB 1PO22 4XETA 2E4TA 1OQDA 3PTQA 4ET7A 4FO9A 1DZTA 3WW4A 1GZWA 1WXZA 1WQ5A 4K37A 4MHBA 5CAHA 2FH6A 4PSPA 2XHYA 4R34A 3LEGA 3N14A 1NA1A 1VS1A 3RJXA 5AB3A 4ZMGA 1WD3A 4G7EA 3T2TA 2TNFA 4HHHA 2MUCA 2JJ6A 3UW6A 5I0DA 1OFDA 3LOIA 2QDGA 5H8UA 1GQKA 4C6EA 2E67A 2BHZA 2XHNA 4HNVA 4LPCA 5AHEA 4A6GA 2YSWA 2XKOA 5HV0A 1LORA 4MB1A 4H9VA 1Q13A 4S2CA 3TOPA 3MU7A 4FI4A 3RM4A 1P7TB 1GP5A 1T8XA 4GJYA 1WLTA 4C7GA 4GACA 4WM7B 1XV8A 1JIBA 4ZFCA 4PF1A 5CNAA 3AJYA 2YYUA 4HSHA 4BHYA 4OE7A 3KW3A 1POQA 3GXTA 2YBVA 3D0JA 4MKNA 1UP2A 4IGOA 2OZJA 4Y1YA 4FZIA 4N9EA 4AI0A 3AP6A 4DX3A 3TE9A 4EXBA 1L6WA 5EHDA 4LUJA 1DJWA 2XFRA 2ZA2A 3M5ZA 3S57A 1B90A 3WZ1A 4HD5A 2CHRA 1QNWA 4FOWA 4C1XA 1SMVA 5LBEA 3EYPA 2QT3A 4ORFA 5FZOA 2AC1A 2QXWA 3WH5A 3AIWA 5DG2A 3FGCB 3G1RA 5C8CA 3PIGA 4ZU5A 1V3JA 3CJXA 1EOKA 4BCEA 1OZMA 2XONA 3DIPA 1M03A 4LOCA 1HRI1 1SO3A 2FZMA 4LW7A 3ZLIA 3JS3A 4XZ9A 1BRLB 3WL1A 1EEXA 3B9NA 3P62A 3ZQ9A 5C54A 1MRAA 2ARCA 1GVOA 4G3YC 3TWAA 3AP9A 3E6BA 5CQ1A 1V6XA 2WC4A 3TLLA 4W6YA 1YNQA 1PZ7A 1ONEA 3QJAA 3IPWA 5G1MA 1EO5A 1GZGA 2VYOA 4ZHNA 3TFXA 3TA6A 2ZX9A 1TUXA 3PWAA 3AXEA 4C6PA 4NNAA 3WD3A 3MYOA 4HZ7A 4TQTA 2YFZA 3W21A 4NZ5A 3C8XA 1XSKA 3UZYA 2YIHA 4AFYA 1DQXA 1Z42A 4COVA 4HU3A 1W90A 4R9BA 1H7PA 5FYUA 1RQBA 4EPDC 4CEWB 4E8DA 2Q02A 5D8ZA 3ZZ1A 3HG3A 1HN0A 1RUG3 3B9OA 3GF6A 3OIXA 3W7IA 5AHIA 2ZMNA 3HIFA 4LB3A 2OZ3A 1RITA 4ASLA 2XSXA 1AQ0A 2QVNA 1ACCA 1D3HA 1J2BA 2ZUUA 2RAGA 3IEBA 4R27A 3UXIA 1COV2 1SCSA 4YGEA 3VZJA 1CGUA 1UKQA 4KEZA 1S2BA 3HN3A 3OBTA 3WLIA 1SQ4A 4FOVA 3WMCA 5HCBA 4HMZA 1AYM1 1XE8A 1XYFA 4F9JA 4QJ1A 1W1PA 3OGJA 4FIQA 2CHHA 3FX3A 2QKDA 2V6AA 3O2LA 5G4HC 5KZDA 3VIIA 3A22A 1KBKA 4DEVA 4AYSA 2AH2A 2WL1A 3CYJA 3VNJA 3BVJA 4UQEA 1W5NA 4Z1AA 1OADA 3PJXA 1YDYA 2P4EA 5ABHA 4H9ZA 3KCXA 5CKMA 2OWXA 1PEZA 2ZXQA 3DEMA 3HPNA 3K3OA 5K0UA 1H61A 2XIMA 3EKZA 3LV5A 3H22A 1BF2A 5KC5A 3IGXA 2V09A 1QPOA 4O61A 1Q66A 3QOKA 1O1ZA 2UBPC 3CMFA 1E15A 4ENLA 1AR73 2RM22 2GQ9A 1JU4A 3PZUA 2NXGA 3OPSA 3AMDA 4WSJA 1BVP1 3PS7A 3TONA 4BF9A 1SCRA 1C4RA 1M1BA 5A7NA 2B5HA 2DZXA 4KU7A 2VX4A 2PMQA 1J9YA 1DQ4A 2AR6A 3JQWA 4AQLA 2E28A 5FZBA 1O4UA 1PIV3 4IMAA 2B7OA 4LHKA 4NROA 3E49A 2BP1A 3H4XA 3WQGA 2GVJA 2J78A 2EVXA 2OIIA 1D4M2 1UUOA 1DEDA 5D9MA 3G1VA 1OD0A 3TCSA 1LRHA 3R58A 4Y22B 4RPPA 2QJHA 1NSJA 4CYDA 3NEHA 4PRTA 4FPEA 4P9JA 1ZCCA 3IANA 4F0LA 4V1XA 3BZGA 3ZXGA 4G5DA 1V08A 1TELA 4ZO9A 1UQZA 1H4PA 1MUMA 3RS6A 3VBSA 1ML1A 4LK7A 3G0UA 4XZHA 4FPKA 2I17A 4WM8C 4OHZA 4RE2A 4D6FA 2H90A 3KLKA 2HJPA 1D9EA 4PULA 1H2MA 3AXKA 4GI9A 3UA3A 1ZY9A 3LEMA 1XKJA 2R041 4I2OA 1V3KA 1L0PA 2VCAA 3QY6A 4OOZA 4XF4A 3RRDA 2UYBA 1H1IA 5KR7A 4WBBA 1XIIA 3CHEA 1SFNA 4BQ2A 5L9BA 2Z2AA 2B7NA 3AI0A 1XSIA 4YWSA 4D7SA 3NO3A 4IGQA 1LROA 2JALA 2YMZA 3IKWA 1VPQA 3S4TA 4GA9A 1VBGA 4JAAA 3BOPA 3VD9A 2DFBA 3NUKA 1CAVB 4MG4A 3WNKA 4AG4A 1Z0HA 2FPVA 3PUOA 4WX2A 1XGEA 3PJYA 4J28A 2F4LA 4H8UA 1W5OA 2Q8LA 3DG7A 1JCXA 3UWQA 3EWUA 1FWAC 5DUUA 3RZLA 4QMAA 4XFIA 4QXHA 5FJTA 1WDSA 2PA6A 1ENQA 4OHVA 4Q4Y3 4YVPA 1EA0A 3E9AA 3G8RA 4XISA 1ENRA 3TYAA 5BUVA 3NJ3A 3NQ2A 1FWRA 2YFUA 5D2VA 2C91A 1W0PA 1E73M 3H2AA 3CV6A 1P1MA 2FZ8A 2BERA 1O3QA 3WQ6A 2JG9B 1R5YA 2DW6A 5BNPA 1H7NA 5FZ6A 3O6CA 4ZOEA 4CEYC 4BM8A 4LO5B 3GYEA 1NQDA 3OHMB 3ID7A 3RU6A 3LWCA 2ZZJA 3BG9A 5FPBA 1I75A 2VW2A 2VELA 4KCVA 2WZ8A 1SM9A 3O06A 1YFUA 3SRKA 4RV8A 2VZOA 4JXCA 2D43A 2CZDA 4JTNA 4QCEA 2PHFA 2ON3A 2PCEA 2VURA 4Q8MA 1JFHA 1UWSA 3ZOAA 2J66A 2FHFA 3H8XA 3T0DA 3W4RA 1MEC2 1OX5A 5M2FX 1AYN3 3LGDA 1A3XA 3BGAA 3VOGA 3M9YA 3RDKA 4AY7A 3AQUA 3AHZA 4UBPC 4Q1PA 3N13A 2ZZ2A 1IHIA 2IPWA 3OUJA 2VMDA 1S0GA 5FFOC 2J7EA 2ARBA 1E4NA 3DXIA 5D2AA 4QKBA 1AF9A 3URQA 1RVF3 3S9ZA 1Z48A 2YDQA 5CBBA 4PB3A 5FY0A 1XYCA 2JGYA 3N15A 3ZSSA 3ZFEB 1WPCA 4PCTA 2QAPA 4P5HA 4DS0A 1NM9A 1GANA 1UF2C 4NXSA 2WVVB 5FJJA 4HVQA 3LRLA 4YM1A 3VZMA 1N1SA 3WQCA 4MGIE 3Q8EA 3EMZA 4AWSA 3UXKA 4F66A 3RMYA 2HXUA 4KMQA 4RGKA 2YCLB 1RHI2 4MY9A 1QHOA 1ZCOA 1RXFA 2XLAA 4W9TA 4HZFA 2OO0A 1XIFA 4AEEA 3M3QA 1S0IA 2AL2B 2D2HA 4DZHA 5AHFA 5AECA 3KTXA 1AR83 3MF6A 1SFYA 4MZYA 5EKYA 2DUZA 2CITA 3EB4A 4S3AA 4S3KA 4IWWA 4UUIA 4C6OA 3WQOA 1W1TA 2FJKA 1VPHA 5C71A 2KD7A 3N11A 4QDQA 1DGWX 5CA6A 1XDJA 5JXJA 3EX3A 3KHDA 3P84A 1PZ2A 3T05A 1J01A 2VBDA 1XYMA 1ONXA 3WDPP 4QQLA 1SR9A 2QDHA 1VBA1 3SJ3A 1ULFA 3NJVA 4GMP1 1FKWA 3DKQA 1JRBA 2JG8A 1TMLA 2R1KA 3G1YA 4MM1A 4UOQA 3STFA 4YTRA 3FCPA 4RS5B 2X40A 1AZ1A 5AZ0A 5H91A 1D0GA 4XO6A 1CXLA 1Z7S1 2LM3A 4M4PA 4ZS2A 3IRSA 4HZ6A 1GGOA 5A8MA 2WC3A 3RK8A 5L19A 3MB9A 5FZ1A 4FXJA 4IQEA 1AH3A 4H04A 5M03A 1UH3A 4MXWA 1G9FA 2ZGKA 4NHVA 3J4UH 2G3FA 3GFXA 1ULOA 4LBUA 5F5CA 1KA9F 1NDVA 3H1YA 1ZVFA 4Y4YA 1KXHA 4GVHA 3WLJA 3MLJA 3A4AA 2HWD1 3GYDA 3HPFA 4BU2A 3EMCA 4DLFA 2W27A 4GB33 1QJU3 2NM1A 2R071 3FVDA 1SW7A 5H6HA 1ZJIA 4COWA 1DZRA 1N1YA 4EE2A 5KINA 3ILNA 4PUUA 3HJRA 4AXNA 4MSSA 3NURA 4TXWA 1HW5A 3C2FA 2QUTA 3VOHA 3MV11 1YDNA 4GKYA 4JX0A 3U78A 1OFRA 3TTOA 2BDRA 4AVSA 4O14A 3WFAA 4X6RB 3W27A 1QXLA 2XFYA 2XG3A 1XIMA 3EA2A 4LV4A 4AD5A 1QDCA 4PCSA 1XLDA 2W62A 2UY2A 5CZJA 4CCCA 4Q4V3 2BNOA 2WO5A 1QMLA 4S3BA 2LRPA 2PFWA 3TEVA 1J83A 4XVEA 3IJQA 1NQ6A 2E5DA 3EX1A 2J75A 5BU9A 2Q71A 2VEPA 4A44A 4WJXA 4WXZA 1FPN3 4HVXA 4H8VA 2CU5A 1W6OA 4FX8A 4G1NA 1FH7A 1YIFA 1LLWA 3QLDA 5D09A 3ZM8A 3DYPA 3O12A 1F76A 4YHEA 3AZRA 3PZVA 3SQMA 1DGLA 1OHFA 1B4EA 3QGKC 1C28A 4M81A 2Y6JA 3WBYA 3FVMA 5F37A 2H6CA 3B9CA 4O1AA 4UNIA 3MV01 3LD5A 3QKZA 4LCQA 3WDJA 4MTVA 4A2SA 3GNXA 2VRJA 4QB1A 1H3GA 4D8LA 3KRZA 2R0FA 2BSLA 4BQ5A 5A7WB 3WF4A 1H0IA 2FVMA 1TREA 4MUPA 4GUFA 1D4VB 1XNCA 4DN1A 1KJRA 3P5BA 5J3UA 1PNFA 3VUPA 2UURA 3QMSA 3DN5A 1EHAA 2HPMA 1D7PM 2QQIA 3W1UA 3BSMA 2CFFA 4HOXA 3VBUB 3PPFA 1JZ5A 5LGZA 1EJVC 1W1IE 4IEWA 1Q5MA 4F3JA 4S39A 5DRCA 3KE0A 1TZZA 3M3OA 5T26A 1QOSA 4LVAA 1B35B 3MSRA 3VDGA 2ZKMX 1T5AA 1N82A 1ZS2A 3SCWA 5BZAA 2BVWA 1JPMA 4J3VA 1RVKA 3ZFFB 2RS12 4K1WA 3N17A 3CUJA 3ARYA 2YYOA 2XQXA 2HRWA 5FQ0B 1RUG2 1RXOB 1JOBA 1ZUAX 2V5DA 3CBNA 4GYKA 3W87A 4RA0A 1WWYA 2Y60A 3B69A 5RUBA 3W7EA 1DIWA 2V67A 4QHZA 1W6PB 3URAA 1EJUC 5K9YA 4BR1A 1RJRA 4DYEA 5FPUA 3RAOA 3C7OA 3HBLA 1GQHA 2D3NA 3QKEA 2WZTA 1LODA 3VCRA 1Z7AA 3SRHA 1RUH1 1P6BA 3ZMRA 1UNBA 5JXGA 2YJQA 3DPRB 4FA3A 4BXFA 1GOHA 2IXVA 5JMUA 2P5NA 4OUMA 1PK6A 5LHFA 5SV5A 3BPZA 1TCDA 3H7VA 3V0AB 5ABTA 1HO1A 3WQWA 3LF7A 1HX6A 4DZAA 4FT8A 1HGYA 4AD2A 1WUFA 4D8ZA 3UEQA 4KNCA 2PDXA 3EWWA 1TPFA 3M70A 1W05A 1Y5VA 1AR72 3VBFA 1WDRA 1PXGA 3M46A 1CGVA 3ZLHA 1K5MC 3RZGA 3SUVA 5A3WA 3VKCA 3PUGA 2PD5A 2PDNA 3W9AA 1AUYA 2I07B 4C60A 4XUQA 1C8M3 4YGBA 3AJ7A 2FZ2A 1S0JA 4B5SA 1JN2P 2XWEA 3E97A 4XW3A 1CGWA 1DYPA 2NT1A 3NYZA 4ZBCA 2R0HA 1EZ2A 3U2ZA 1Q6LA 1E4MM 1PIV2 1RJPA 3RI8A 4E4FA 5LATA 3N6HA 1V6WA 5HJLA 1AD1A 2GDUA 3LCIA 2OX1A 4DRSA 3U48A 3W58A 1KM6A 1JXJA 4B2DA 1HXJA 2RJ2A 1FWEC 3KD4A 4XFFA 1B3ZA 4Y5TA 1VCVA 4U3AA 3PUSA 5FY7A 3H12A 3WLPA 2HVOA 3S0CA 2R30A 3ENRA 2YHJA 2XYLA 4XZNX 1FXPA 2XLGA 2W1QA 1AG1O 4EWEA 3VK5A 2XWBB 1PKYA 2DBNA 1LECA 2O4MA 2BBVA 2WWCA 4JQ2A 3HIJA 2RDUA 4CXXA 3KRSA 5FLHA 2OT7A 3I65A 4C1KA 2F6XA 1EV13 2J6XA 4XAPA 4M3CF 4JZRA 3V5CA 2E3ZA 3NXFA 4EF8A 3G0XA 4A41A 1BEUA 3NAPA 4D1JA 3WP4A 3ITYA 3CH0A 2J47A 4ZL1A 3KTCA 1IKQA 1EQPA 3SQOA 3RNSA 3HQUA 1QU4A 3WINE 4YCOA 3P6LA 4UNKA 2CLPA 2JKEA 2GDQA 4ONVA 4LLFA 1XLLA 1SVDA 2OKXA 4Z0SA 3W83A 2HWF2 2WINB 5BMWA 1YPXA 1UXXX 1SLCA 3TJLA 1CIUA 1AHSA 4G7FA 4P7NA 4A8IA 3HQPA 5IATA 3W72A 8XIMA 3RPMA 1XU2A 1ALYA 1W04A 2RMU1 2ZEXA 3CYVA 2JE7A 1O4YA 1GT8A 4PUMA 1JW6A 4UFIA 4A2RA 3ZN6B 1AQHA 4GQRA 1FV3A 3DCQA 1RUE3 3MZNA 1XIEA 4FXGB 4PTNA 1UR1A 3QFEA 3BH4A 3A0NA 5ACA3 2R9RA 2AGTA 4CDUB 1IXPA 4NI8A 4PT6A 4Q4Y2 2ADAA 2G96A 3DFPA 1ME9A 1PZ3A 3AP4A 1TKKA 1BLZA 4GJIA 4RYDA 2QTWB 3ME3A 4L0PA 2H9AB 4CCJA 2F61A 5JR2A 3H23A 5LKYA 4AAXA 1P6WA 3WQVA 4C6CA 2C79A 1HJWA 3KVMA 2Y64A 1UZ1A 4B5XA 1M01A 2ZZ3A 3GJAA 1RUF1 4V2XA 1I9CB 1W37A 3ONBA 1J0ZA 3ZSTA 5EYXA 1BBT3 1PX8A 1QO2A 4GKLA 2GUBA 2RDTA 1S0DA 4KRZA 4M1BA 5GALA 1V93A 4N7IA 4D9PA 4KFPA 3EX6A 4QLKA 1CD3G 1XR2A 3LOBA 5A70A 3GVVA 4X0VA 3MYPA 5BNOA 1I0BA 4HSJA 1WDDA 1K9EA 4IQDA 2BGCA 3W23A 6CGTA 1OGSA 5CZ0A 2J7HA 4TX9A 5KEZA 4E4SA 4D6QA 4NUBA 3N9RA 1DBNA 2XIQA 3PZNA 3KV6A 3U11A 4ZONA 3F1QA 2VDIA 4AVNA 3FGCA 3LSBA 4I30A 3FHIB 1WLWA 3FJSA 5D2WA 2WHMA 4TX8A 3WDQA 3CPUA 1RVF2 2AEYA 4AIEA 1VB2A 4DNYA 4ORIA 5AVNA 1PVC3 2PF8A 2VUAA 2FCVA 4D94A 4NJKA 2YCEA 4WIWA 1NOUA 3GFZA 4GYPC 1DZQA 1BRLA 1R7OA 1JVNA 1LG1A 3TEZA 5FZ7A 3PFRA 4PE8A 3GBDA 5E6HA 2ZUMA 2W63A 3RPDA 2C24A 4GQ7A 4D72A 4Y9NA 3SRFA 4J3SA 1SEFA 2NLYA 3M0HA 1XQKA 2Z2UA 1VD6A 1E0XA 2Q1ZB 2VD8A 3K1DA 4Q4W3 5DXDA 4XUGA 4UOZA 3SY5A 2CWSA 2OT0A 2Y5JA 3LQCA 2Q8DA 1DYOA 4QX1A 3T0TA 2QR6A 1IWAA 1JRCA 2Z1KA 4GVIA 5A5WA 1QWGA 1UR4A 3S46A 2EG7A 4LS1A 1AR82 4Q5OA 5BRQA 3MY9A 5MF5A 2HEJA 5D8AB 1UWQA 2BGSA 3EX4A 1V6MA 3UWYA 1PZ8A 1PAMA 4QD2A 4P8WA 5IVBA 4CEWA 2Z1WA 5KHGA 2NT0A 2WNWA 3WNXA 2WIIB 4CQ9A 1JZ2A 4GE8A 1XIDA 1A5LC 2GLKA 1TWIA 4LF1A 2AEZA 1VEMA 3IJ7A 3SISA 1OMIA 5A8NA 4YZ4A 3MHZA 2YY1A 1O5KA 5HK4A 2Y0FA 1N3QA 3POJA 1DQ0A 1U5YA 2ARAA 3XINA 1HP4A 1HKIA 2I16A 4BQ4A 3ACHA 2ZGOA 2C0HA 2PDYA 3AALA 4O4VA 1CXHA 2PPGA 5FP3A 5EL1A 3OW1A 5FJIA 1MVYA 3HZ3A 4N6EA 3ZPYA 4B5VA 3CT2A 5DX7A 3NTYA 3NZ1A 1JD7A 4IIBA 2ISVA 1J2WA 5FYTA 3MIFA 4R7JA 2OWWA 4OHYA 2WZMA 3DKLA 4L1XA 1QWRA 4GB32 5FMOL 1QJU2 2CSGA 3W76A 1WKDA 4WEVX 1ICQA 3E2RA 3O8AA 4GJJA 4R4XA 3NW4A 3R7MA 3RWKX 2QPSA 4Q4SA 4DWSD 1C9DA 4A3XA 4LBLA 3TN93 1LUCB 3AROA 3W84A 1F8MA 3TTYA 2PP1A 5HI0A 1LZOA 4WOZA 1QNPA 4XAZA 5FLIA 4AHOA 4UTKA 4UI9L 1B57A 1QI0A 1R2SA 2VUDA 1PX4A 3N7KA 3MW7A 4ZENA 3ST7A 2YX0A 1OCNA 1H62A 3NOEA 2FMYA 4GQBA 3VE9A 3VIMA 5I23A 4BQ1A 1DJNA 4FNQA 3LHUA 3VBRC 1Q6QA 3UCDA 3G1AA 5FF7A 3SEPA 5LYRA 3E96A 3CQ0A 3C3UA 3DXTA 3BAJA 3H3ZA 3TC7A 4HN0A 3I3MA 4XQWA 5FJOA 2XOMA 4UTWA 5I03A 3HNYM 1FPN2 1TTJA 3SDOA 4DF2A 3U1XA 4GXPA 4IIGA 1VZWA 5GLVA 3J8F1 2YGYA 4JL2A 3G3DA 5C9WA 5A3LA 3G22A 3D0CA 2FTPA 1MS3A 2FDKA 2D44A 1UBSA 1A4MA 4PBFA 3VPLA 3NKTA 4Y22A 1R85A 1V0NA 3S6PA 3FSTA 5L36A 3PLQA 3CO2A 2HE5A 3ISIX 2Q1MA 5J48A 2QNEA 4W65A 2X7VA 2OLAA 3LX9A 2D6KA 1Y5XA 3MVTA 1NQJA 2Y70A 1LOGA 3RFAA 1ZJHA 2VZTA 5FEZA 4MF4A 1TE6A 4FEZA 5I78A 3P80A 3W25A 3MEPA 4HZ8A 4X9YA 2OUHA 1RUJ1 1NOFA 4IQPA 3BUCA 2RS51 5A6BD 5CYYA 1GVSA 3F4CA 4Q7NA 1TO3A 3GK0A 4IL0A 4N9CA 3ELFA 1AJKA 1FOD3 1ZBA3 4BZYA 2E7QA 4B3NA 3TXVA 3MDWA 5AHNA 3W9ZA 1Q7QA 4HLTA 3AWOA 1KRAC 4CXWA 4YJ5A 4QXBA 2PTZA 1W8NA 2XFWA 3SC7X 1P0NA 4UYBA 1RB8G 1OZQA 1CONA 4J3ZA 3OQEA 1CAVA 3B01A 1VH7A 2EXHA 3P1IA 1E1FA 2HBVA 2Z1SA 2YB1A 3HFYA 3GNPA 4DJEC 4ZQOA 2Q8EA 1AX2A 1ECEA 1AW5A 2XIJA 3A6OA 2UWCA 4JDNA 3W75A 5LW9A 1QBAA 1L8PA 2RJHA 1SPPA 3OVRA 5HJXA 2VVEA 3OO2A 4NIIA 4JFTA 1RK5A 1A5AA 4JZ5A 2Z7KA 4NAEB 4P61A 2VQ0A 1PZ9A 2A6WA 2J88A 4I5RA 1F05A 3TH6A 4C1LA 1VBE3 3CZJA 4CNOA 1WO2A 2E5CA 2C0AA 4PRWA 3UFYA 5AKQA 2J1UA 1Q6GA 3CAQA 3A9BA 1BZWA 4KESA 3S7IA 4MB3A 2EKCA 2G3NA 2NX9A 4GZIA 1C3FA 5HINA 3H70A 4HU4A 4IV3B 4PHZA 4GUGA 1CAXA 5CCZA 4CD5A 2Z4GA 3ZFHA 4KIEA 3LPFA 3O1OA 3VZYA 3NL3A 1JDDA 2JE9A 1OA3A 1KWKA 1I1WA 3M0YA 1X97A 2BEOA 2VP8A 1I60A 2FPYA 1LU2A 5FUNA 5G2IA 1S39A 1HXS1 1I2NA 4Q8OA 3A13A 3T8QA 1W9YA 2HBUA 2X1SA 1TZ7A 3B8DA 3SCPA 1UKGA 1B30A 3AS3A 2PLMA 2PHRA 4OI0A 1W28A 4C7DA 4JFUA 3V4BA 3EA3A 3C7GA 1Q3EA 4IM4A 5FBJA 2R062 4JGZC 1GOQA 3S5YA 5GVJA 4FOUA 2GMPA 5FMCA 4Q1RA 3PJTA 4CNUA 2RDWA 5FYVA 4AHWA 4LX4A 1MZEA 1DQ6A 5T50A 4P02B 2F2KA 3M6DA 4KCTA 2W9MA 2EALA 2B9UA 4H9TA 4PCRA 3NEVA 3AMKA 1TV3A 5JU6A 1CPNA 3VMNA 1JAKA 4CQAA 2WCGA 4CNTA 3HMYA 3ZFEA 1EIXA 3HV8A 5BOEA 2VD7A 3UGRA 3MANA 3B02A 1POV3 2WVVA 2WBGA 1R0MA 4A3QA 4RGAA 2NQHA 5A3MA 4YLWA 1N47A 3D5OA 2BS9A 1DQWA 1PPIA 4KT2A 2V5YA 4LUSA 3HAGA 3P3NA 3NNJA 2E9LA 3WJXA 1HB3A 2VT0A 3ZJ6A 2W92A 2YCLA 4FHAA 1BVZA 5CPOA 2PGFA 4NIHA 3NQGA 2D20A 2VENA 3HQRA 2YOCA 3RX2A 2Z0IA 1HIZA 3BTXA 4EVZA 3UK9A 1SLLA 2JXAA 1XDMA 4L61A 2ZUVA 2PWVA 3RLGA 1W3XA 5FYHA 5CFCB 3AZXA 5FO9B 3EB7A 4YN5A 4L5ZA 3WLRA 5CSRA 3KBJA 4UOJA 1XYZA 3C3VA 1PBGA 5ABEA 4N53C 4LHSA 5JDBA 1H60A 1MDRA 2ENRA 2QJVA 1LHUA 1TJRA 2WSYA 3JU9A 1YDVA 1KR1A 5C4WC 1N2VA 4Q3MA 4RS5A 2OU4A 5FYCA 4QJ3B 4JCKA 2O0OA 4XFBA 4H8HA 1FI2A 3W2MA 1EAH2 4DRVA 1KFJA 3VKNA 3LA7A 4XKYA 2QBXA 4OUSA 3T1GA 1LRNA 3GU9A 3MUZ1 1R2RA 2BGNE 4QX4A 1OYAA 5ACA2 2VVDA 4FOKA 1OURA 1UR0A 3QHMA 1PTDA 2BZDA 1OLMA 3THTA 2R6QA 2PN5A 3S6OA 3VV1A 4L2NA 4RQPB 1ENUA 1HT6A 3WQEA 3GZUC 4HK8A 4K3UA 2UV8G 3RCNA 4CQ8A 4WSHA 4Z2JA 1Q5OA 5DMNA 4A3YA 1DQUA 4BEQA 5FZ9A 4IV1B 4FAGA 1QNSA 1E40A 1UWIA 1V02A 1GVQA 1WW6A 1FH9A 1ZBE3 3VDDA 5FJRA 1BXHA 1U5IA 3DHDA 4K40A 4XHBA 3WY1A 1BBT2 4A6OA 4LV9A 2DU2A 2P8CA 1JYWA 3R6IA 1Q6CA 4A05A 1F8IA 3QC3A 1AD4A 2Y7GA 4LKFA 3O05A 4IJRA 1E0UA 4JY8A 5L9RA 2QMKA 2C1GA 4NF7A 1XM3A 1ZFJA 1W9BM 2QUMA 3AKPA 3LPPA 3QZ6A 1S55A 3M1HA 3V36A 1H1ZA 3BLEA 4O15A 1OFBA 5FMBA 4CCOA 2D22A 3ABZA 1OK6A 2R043 1GOWA 5CBIA 3M5YA 3VKJA 4FCAA 4QM1A 3B9AA 1J3QA 2RDXA 1R47A 4Z1VA 1GG1A 3IDCB 2W3ZA 2DW7A 3WBWA 1FAYA 3BB6A 5B7ZA 2BW8A 1VBRA 1FYUA 4XF0A 4YFZA 4H7VA 1NDYA 5GPRA 4JTHA 3NNGA 4C6FA 2YL9A 2GQ8A 2IUWA 4YG0A 3AAMA 1PVC2 4DIQA 4DBWA 1G0CA 1UWWA 2NYYA 4XPVA 5A7WA 1KRCC 3KF5A 3CLMA 1ICSA 4YM3A 2OPJA 4X8PA 2ZXBA 3L65A 5IVJA 4IMEA 3GHUA 2VC9A 4Q4X1 2DV9A 2XM1A 3ZLFA 2QDRA 5G2WA 3V75A 3G2GA 3BE7A 3GTIA 2CYGA 1W6QB 2W08A 3U2OA 1QJY1 3MC5A 3PB2A 3GZ3A 4JTGA 5A2BA 3VBUA 3TW7A 3UG5A 4LJHA 4PDWB 4AHYA 1OUSA 5A6QA 5T3NA 2JKBA 3MIDA 3LZ3A 3OYXA 3WFLA 2HCVA 3M41A 1B35A 1DOSA 1JF5A 4QE1A 4ZZ8A 3UG8A 3TIMA 4XBJA 2CEQA 2O0TA 4N7UA 3W7DA 4S2BA 3AUOA 1JTZX 1NDWA 5F1UA 1XKYA 1JOPA 5FQ0A 1UIOA 1YC61 4B5WA 2Z1XA 1YRRA 2YDRA 3GHSA 2F6KA 1DQ5A 1TJPA 5FEPA 2XJPA 4LR4A 3E3HA 4FLQA 3BW4A 1TMF3 2F7FA 3J7MA 2VUNA 4P08A 3T1MA 2FQPA 2J4GA 2VMEA 1UUQA 4Y1UA 1V3MA 1BEV1 1R86A 1PO21 2QQVA 4L7ZA 2N7GA 1JCNA 3UVAA 4UTLA 1XNKA 2ACSA 3V1HA 4X6QB 5CJ5A 2DZWA 2B4KA 4GNJA 4A7ZA 4S3FA 3HJEA 3KQ4B 5LXXA 1GNZA 3TN92 2VR5A 3L4YA 2O1QA 4ICMA 4Z2LA 3B9DA 3K4WA 2OLHA 4LANA 1T8QA 1Q8AA 4JTOA 4H2HA 3VDAA 1YEWA 1ZA7A 4XZIA 4Q4RA 1TPUA 4HNTA 4Y26A 1JYVA 2CKSA 3CPGA 2J25A 4O10A 3RVHA 5A6LA 3ZLGA 5ABGA 1AK5A 2R1MA 2DY3A 2FGLA 4Q8LA 2W2IA 1BXCA 1VFUA 2PDBA 5M1TA 2XJRA 3CH9A 2EQDA 3QPZA 1F35A 5EU9A 4E3TA 3T44A 1V6TA 3B8SA 1PKLA 5K9XA 1HJUA 1W9TA 1O4TA 4XAFA 3AP7A 4LYPA 3I3EA 3PUAA 4NAMA 1N1VA 1UD8A 3PNAA 4QPGB 2MEV2 1U5ZA 2PTWA 2WB5A 1QNYA 3WR0A 2CLFA 3UQNA 3NQFA 4I7WA 1UA3A 1YX1A 3HEIA 2IWGB 4YNGA 1JG9A 1NY72 4W5ZA 1GORA 2EPHA 3STEA 4MIMA 2CLMA 2NMNA 2WJZA 3ORWA 1HB1A 4IEUA 2VNRA 2NVDA 3FSUA 1NDZA 2PRMA 2PELA 1VJIA 3CAKA 5A6JA 9XIAA 5FTTC 4AMAA 3GXNA 2OGYA 1Z8AA 3OGSA 4XOGA 5AYBA 4FBFA 3EPNA 2P1FA 3NFUA 1J5SA 2B7PA 5FY1A 2X42A 3UZZA 5I93A 4MWAE 1FOD2 2RUSA 1ZBA2 3ZJ8A 3FDGA 5DCEA 3RI9A 4AWDA 1J79A 1C8YA 1AVAA 1O66A 1ZL1A 4IP7A 5XIMA 3SO7A 2PDJA 3N34A 3LGGA 6ALDA 2NQ9A 4ECLA 2GN3A 5K7JA 4W7WA 2VPVA 4QROA 2OS2A 4FP1A 1GYKA 3CJIC 1ZZMA 2R1PA 4TTUA 3SCNA 2V5CA 1TWWA 3JBG1 3RDIA 3OA5A 4A8LA 3WLNA 2ARXA 5IW0A 2IXUA 2Y8VA 3HOBA 1OOPA 5D1IA 5A80A 1XQNA 3R25A 2A79A 3GSMA 1JF6A 4TSVA 1A49A 3JU2A 5ECVA 4QWNA 4LBQD 3N36A 4HCLA 4HA0A 2VZVA 3Q8BA 3VI2A 5I02A 1SPQA 2FQIA 4RL7A 2YG0A 5TSWA 2Q30A 4FS9A 2VFHA 1W3VA 2XM2A 2ZUNA 3LXAA 3VGIA 2DSWA 4H41A 4GOAA 2WKKA 2OUJA 5HULA 2FVKA 2FB3A 3AYEA 1XG3A 1ULPA 3MI6A 4ZXKA 3PUEA 1O60A 2OYMA 4Q6JA 1US3A 2ANUA 1FTXA 2XG9A 3VAVA 3PJQA 3DERA 2V2HA 1D0HA 1NJJA 3W6LA 1NZIA 4WVWA 2V2CA 4I5XA 2G3JA 1ODZA 3JD73 1E1CB 2Y33A 1CNVA 2Q8OA 1Q7MA 4RL3A 3E5QA 4ZOBA 4AF9A 5IK4A 1VBJA 4Y2WA 2YLAA 1HRI2 4YVWA 1W91A 1OC7A 1ZRRA 2VOVA 3A5FA 1EH9A 5MHBA 4OECA 2BNJA 1O3SA 1XPWA 3SKVA 1VBHA 3QY7A 2UY4A 5C2XA 1W06A 2VE1A 4W8LA 4ROPA 4K8EA 1KFCA 5K2ZA 1EFZA 4KWKA 2ZAAA 5CXPA 4ZB5A 3H4GA 1W8TA 4AEMA 2CLEA 5EPDA 2JWPA 3MO4A 3T42A 2ZA9A 1WE5A 2TYSA 1R64A 4TYSA 1SW0A 1V6NA 2WLYA 2AQWA 3GVQA 2VOWA 4O9GA 3W7LA 1QI4A 2CDPA 1X8MA 5I06A 1KXVA 1TIMA 2ZZQA 5HANA 2ZHLA 2ZC1A 1OBNA