3I59B

Crystal structure of mtbcrp in complex with n6-camp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
202
Chain Sequence
SHMDEILARAGIFQGVETKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLDVPGRVAKQLLQLAQRFGTLRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Transcriptional regulator, Crp/Fnr family
publication title Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 47
structure length 202
sequence length 217
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00027 cNMP_binding Cyclic nucleotide-binding domain
B PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i59B02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i59B01
4MGKE 4AIKA 4E2SA 5E18F 4G7HF 2G9WA 1LQ1A 2QYOA 4S05A 4D7SA 4LA3A 3BPVA 3M70A 5FLXZ 3ZPLA 4OIRF 3ETQA 2K27A 1KU3A 4DINB 4HX7A 4AQ2A 3HOSA 2KIUA 2HKOA 4EWDA 4ON0A 3IDBB 3O3KA 2LF8A 3LQRA 5D4RA 4U0WA 3N4MA 4MNUA 2J5PA 3BPXA 3DKWA 3V7SA 4EMSA 1YIOA 4MGYE 1MGTA 3HRMA 4KWKA 4IVNA 1QWRA 4A5MA 2HEOA 4PZJA 4PIZA 1J58A 3R6SA 3E6BA 4HV6A 4XFBA 3JW4A 4MTEA 4HLXA 4BHCA 4ZYGA 2B9UA 2IP2A 1FY7A 1EY2A 3T0YA 3SHFA 2STWA 1FXZA 3KP2A 3SCHA 4P9UA 5J8CA 3WTXC 1R5HA 3DXJF 4LG0A 3VFZA 1KU7A 3Q5FA 2DO7A 4E2QA 3F6VA 4I09A 1XMAA 2MH9A 1U5TA 4F8AA 4HBNA 5I91A 1ZZ7A 1QXJA 4BQAA 3SHRA 4A2UA 1H9TA 2PTMA 5H20A 5E8IA 4EJUA 2RKHA 4HF2A 1H9GA 3JTGA 2GA2A 4XSZF 4HLYA 3CO7C 5LEKA 4XF9A 2JPBA 4M6YA 4E2GA 2MHFA 6PAXA 5BMZA 3C18A 3IRRA 1W7PB 1X8EA 2IXIA 3KGLA 3SCGA 1LDDA 2QWWA 1O7LA 1YFXA 3H50A 4EJVA 2DFIA 5LHIA 3GYHX 2FRHA 5CVVA 4GGGA 2XAGA 1K79A 4EJOA 1ZGAA 4MH0E 2O3FA 5IT9K 3IKVA 3IRQA 4LEJA 4LK1F 2CWEA 3SXYA 1QGPA 5HS7A 2ETEA 3FXRA 1CAVB 5E1ZB 5BPDA 2UXNA 3GVAA 1K6OA 4M9XA 4UXAA 1S6LA 3LQQA 5BOXA 3TKYA 1PP7U 1BC7C 4Z2YA 2V79A 2YU3A 1YTYA 1NZCA 3EQEA 5LRRA 4KIGA 3C3WA 1XD7A 2JTVA 1IAWA 4WF2A 3PVBB 3SCFA 4OU0A 3D0SA 3E5UA 3OD0A 3ST7A 4Q0VA 1FBQA 2HFHA 3H3ZA 4IERA 1QY4A 3G7DA 3BU7A 5LHGA 1PM7A 1QXRA 3CJNA 4KA4A 2OPKA 3MYXA 4JK1X 5K5OA 2HS5A 1NE6A 3H1YA 1ONVA 3TO7A 4EGYA 2M30A 5JSRA 3JSPA 3WW3A 1PMIA 4FBFA 2Q0AA 3RI4A 2FBHA 4KFCA 2EJRA 2RN7A 3I53A 4WXCA 1R1TA 3MEXA 3KLNA 5K5RA 1XCVA 5FPXA 3KE2A 3I4PA 2E9QA 1J3RA 3B73A 5CVUA 2VBYA 1FYKA 2C6YA 3RKXA 3RDIA 4L18B 3SFZA 3JTHA 4XETA 4ZU5A 5AVPA 5FB2A 3L9FA 1X3UA 4RGSA 4KWJA 1ZHFA 2K02A 3V8KA 2STTA 1G3TA 4ETSA 1FT9A 4IHSA 4PIYA 4ESBA 4Q4ZF 1RIOH 1K7AA 5HI0A 2EA7A 5K8SA 3KETA 4UV9A 2XAQA 4HDVA 2O1QA 3V4GA 3CUQA 1GHCA 1IN8A 1YW7A 3DV8A 1FYMA 4L9JA 4WXHA 4AVPA 2V1UA 3CEWA 1YW9A 1CAVA 1LEAA 1GVJA 2PEXA 1EV7A 2W25A 1ZARA 1KYZA 3FMSA 1Q5OA 2PI0A 4TLFA 1KQ9A 5CLSA 5ERIA 3J80Z 2OAZA 1G4DA 1P4WA 2M45A 5DCMB 1ZAOA 1TQIA 2V6CA 4BIFA 3K1PA 2FSWA 4Q0PA 3EYYA 2OA2A 3WTZA 2VODA 1A04A 3IWFA 5CADA 4QM9A 2DW4A 2IT0A 2O03A 1XGNA 2G7UA 5BQTA 4UUVA 5BUVA 2HQNA 3WTYC 1ON1A 3U10A 1NYWA 2EV5A 3KCCA 2A3SA 3ZMDA 3GYDA 2CAVA 1YQAA 3OTFA 3ELNA 3BOQA 3EUHA 2QUFA 1BI1A 4MGIE 4IF4A 2GIVA 1F9NA 5E8GA 2GC3A 4R8HA 2MC3A 1OYWA 4YIFA 3WU1B 3AAFA 1DPRA 1KQ0A 3R61A 2D1VA 5FLJA 2HTSA 1U3EM 3E3VA 1F1ZA 1BBYA 4QGNA 1SFXA 3R4KA 3M7GA 1MD0A 3OF1A 5I0SA 4QMAA 2UYAA 1R1VA 4KMFA 1G3YA 3TO9A 3RPQA 3EJKA 1WGPA 1K78B 2Z5UA 4DQ2A 5CJ9A 2QQ9A 4U7DA 1J7KA 2PN6A 4XF0A 1YFWA 2ZKLA 2HWVA 3HRTA 3K1MA 3HYIA 4KWLA 2MLGA 2YSRA 1BI0A 3MWMA 4QWQA 1D8JA 3KZZA 2DAOA 1HW5A 4PGGA 2DPDA 3C3VA 2CQKA 5D6EA 3ZMVA 4B8XA 5LGTA 4OIPF 3D5LA 1R36A 4LB6B 2K0GA 3S7IA 4ENKA 3F8BA 2PQ8A 3ISPA 3ELKA 3WTVC 2BYVE 2ZO4A 2ATFA 3H92A 4P96A 2QBYB 2ZCWA 3KP6A 2P5KA 1O5LA 3DFGA 1UPIA 2EA2A 3LA3A 1T98A 1QO0D 2CYYA 4XFIA 4EROA 3ULQB 1LEBA 2LDUA 3RNSA 2ZKZA 2VXZA 4UNOA 3DPTA 4OMYA 4R79A 1P4AA 2GA1A 4RGUA 2DU9A 4LLGF 3NQOA 4ESFA 2K4JA 4LLNA 3WW2A 2BNMA 3ACLA 2GC1A 4FT8A 3J81Z 3CUOA 3WTSC 2GQQA 1YS7A 1S8NA 3CTAA 2IXCA 1FOKA 2JRTA 1RUNA 2H09A 4WWCA 1FWZA 2Q1ZB 1J3PA 2EAAA 4HLTA 3LA7A 1LJ9A 1KYWA 1ZRDA 4IRHA 4HOBA 5E1XA 5J7MA 5K1YA 1LB2A 1SFUA 2QCSB 2GH2A 1D5VA 3FXUA 1P92A 4Q47A 3BALA 3F8CA 1OR7A 5HS8A 1GQHA 3FM3A 5E1RA 2NS0A 3PQKA 4MX3A 1EH6A 4IEOA 3BJ6A 3TQNA 3FM5A 1O3TA 4PDKA 4RAZA 4UVCA 3K2ZA 4Q0SA 4HN0A 1IN5A 4J1XA 1S29A 1E2XA 1WKMA 2BE5F 1AOYA 3K0LA 2D5FA 3GFLA 2XRNA 3F23A 4DNCA 3CLOA 3FFQA 1OMIA 3J7AO 5BPIA 2IPQX 2ZMEA 5EEGA 1I27A 2FQPA 1RL3A 3HRSA 2D1HA 3W6KB 2QQBA 1CAUB 1YFHA 1DPUA 3GF2A 5I8TA 3HHHA 4IEQA 1RNLA 3QAHA 4KMUX 2WTEA 3SQNA 3LWCA 1YW8A 2QENA 3WODF 2QBYA 1D3YA 1WWXA 1V70A 1RI7A 2Y0MA 4JQFA 3JAMZ 4RGXA 3L7WA 2XAHA 2V9VA 2Z33A 5CVJA 2VONA 5BXXA 1B4AA 4KL1A 3M8FA 5CVIA 3ECHA 4XFGA 3E6MA 2GXGA 3TOBA 3CO2A 5FPZA 3WTUC 4U0VA 4EWEA 5FGMA 1ZREA 5F64A 2B5HA 1QQIA 4KUMA 1EH7A 3U9GA 2PAEA 1Q3EA 1DZTA 2XKOA 4BXUA 3HUGA 2PG4A 1IXRC 3PLQA 1I1SA 3E5XA 4HF0A 1ZZ8A 1YUDA 1PP8F 1ZG1A 3VOEA 4N0BA 3ECOA 1ZZ6A 4Y13A 2M87A 3WGIA 3MQ0A 1P6RA 5L3DA 2Z9OA 1ZVFA 2H94A 3KGZA 4L5JA 1ZG3A 3KP4A 4UVBA 1UCXA 3I59A 3ZN0A 4WXDA 3TNQA 1YWKA 2XVCA 3R0AA 1U78A 3U0ZA 4BYYA 1XGOA 2NRAC 1ZYRF 5HOOA 4RS8A 4U7BA 2BNNA 2XUBA 5FFZA 2UY9A 3UKNA 3B02A 2DI3A 4G7OF 4L9NA 1YFYA 1HKSA 1T38A 2H27A 3K69A 4AXOA 2K4BA 4HA8A 3IHUA 1OI6A 4UVAA 2B8MA 5T3NA 1J9IA 2IXKA 2H6BA 3VHRA 1WLTA 5LGUA 4CDGA 4HF1A 3OOPA 4HX4A 4Z82A 3SXWA 4M72A 3HSEA 2F4PA 2WFPA 2A5YB 2O8QA 1TW2A 1CAWA 4GYGA 2OU2A 2YX4A 1UD1A 4UXNA 1QBJA 4G9YA 3WG9A 3H7JA 4HQMA 5KHGA 4Y17A 4IJAA 4LB5A 1LDKB 3QP5A 5E17F 2ZFWA 1TLHB 3G73A 2P5LC 5HVQC 1IRGA 5LRSA 4GCVA 1Y9QA 4X6RB 1HSTA 2DLLA 3MPBA 4YIIA 3V7RA 3H7YA 4QXKA 1DP7P 5F1RA 2MA3A 2XL7A 1HXDA 3H8UA 2HZTA 4RAYA 2AS5F 1WSUA 5JSOA 3ZN1A 4HYEA 3V7CA 2P7VB 3CUQC 2VOPA 1ZRCA 2L3DA 3O6BB 2QJVA 1Z9CA 1QZYA 3KLOA 1H1IA 2DQRA 2R3SA 1MZBA 4RB0A 1SMTA 1YHFA 1FPQA 4YRDA 1WA4A 2UY8A 4BHPA 3L2CA 2RGVA 2M8EA 1BIAA 4PJYA 3LWFA 5DUKA 3BWGA 2ESNA 2K7LA 3WTTC 3W6JB 4FX0A 4RGRA 4XBFA 2O8XA 1ZZ9A 5JR3A 3D82A 3RYPA 3F6OA 3NEUA 3NRVA 1OD5A 2FQ3A 2HGCA 3E6CC 4LJZF 2PAKA 1HKQA 3RJPA 4IXAA 3PNAA 2PQQA 3BPZA 2PA7A 1SD7A 3GEZA 4EGZA 5I8YA 1B9NA 3TDUC 3DPLC 3U1DA 4YFKF 4M73A 3FMQA 4BNCA 2JZYA 4PGHA 4KU7A 3RYKA 5HDNA 1QNTA 5JHUA 1FP1D 5D4SA 4LMYA 3P7NA 2Y48A 2VC1A 3KP3A 4KIFA 4IEVA 5FFXA 3TOAA 1UHWA 4XFCA 3Q9SA 1IRFA 2VT2A 2P6TA 2EFQA 3WW1A 4FAGA 4NHJA 5JR7B 1IXCA 1P2FA 1S3JA 1ZLKA 2GAUA 4LULA 3LOIA 4G6QA 3U2RA 1IW7F 4QGMA 2NAZA 1WRJA 1YS6A 2M1BA 4F7ZA 2QDRA 5FDBA 4N9IA 1J0RA 1XDSA 4M71A 3EO6A 2LNBA 1ZZCA 5ICEA 1JGSA 1T6SA 4I0AA 1XGSA 1YG2A 3E5QA 4MEYF 5ICCA 1E17A 1KA8A 3H9AA 4ZYDA 2L54A 1B1BA 1J1LA 1YFUA 4L5IA 2EB7A 3GW2A 4ZU7A 4WVZA 3QPTA 3TO6A 1W7PA 2JT1A 3EDPA 1SEFA 4E70A 2IXJA 1QPMA 5KHJA 2QM3A 1IN4A 2IC1A 4G94A 1J59A 5HLHA 1RZ4A 1GQGA 4YYOA 3IDCB 2Y75A 1R5GA 4QX5A 4YNIA 1CX4A 4OIQF 1NE4A 2MNGA 4NVPA 5JCTA 4XSXF 3T8TA 2FE3A 2PMHA 4D0PA 5I0UA 1RC6A 4XLPF 2IVMA 2V1DA 2VE8A 4IRIA 4RB1A 3SMHA 4O6JA 1ZZBA 4Q5SF 3MDPA 2FMLA 1O3RA 4MHGA 2YPRA 2DTRA 1CAXB 2QQAA 4LLOA 1W4MA 5ICFA 4ZYEA 3L2HA 2CGPA 5J3UA 2CFXA 3M1EA 3FMRA 3UKTA 5KBFA 5AONA 3TNPB 3F8MA 2XHKA 2ACJA 3ES1A 3V8LA 2P6SA 2ET1A 4AWXB 2OYZA 1F4KA 5AIPA 3REOA 1FC3A 2QNKA 1XMKA 2E7XA 2GZWA 5K5QA 3BP8A 5J48A 1ZRFA 2M5WA 4MZUA 5FD6A 4O9EA 4IETA 4LGWA 5FQ0B 1Z91A 2FOKA 2N7GA 3ZMUA 3WE3A 4ZZDA 3CO6C 3QRFF 4M6XA 3I54A 3M9AA 4LFUA 4HZFA 2HTJA 4G6DA 3ZMZA 4OIOF 4L9TA 2O61A 2QZ8A 5HLIA 4EQQA 2L4AA 2GXBA 2XLGA 4LTAA 1SFEA 5FLXK 2HJIA 1D8KA 2PYTA 4S04A 1Q1HA 1B9MA 4A6DA 4ZZLA 5LLQA 3ROUA 5IT9Z 1MDMB 3P9CA 5JI6A 1RUOA 1EP0A 1X8MA 2DCTA 2VBXA 4PIXA 3P9KA 4P9FA 4ORFA 3F8NA 2UYBA 2K86A 4CYDA 3DEUA 3HRUA 4HMZA 1W5SA 5JAXA 3BJOA 4IHTA 4Q0UA 2GU9A 5FLIA 2VBWA 4BHBA 2ELHA 3OV8A 1EH8A 1RTVA 3FZ3A 3SZPA 1FI2A 4I98B 1ZG5A 2XASA 4UV8A 5DCMA 5IT3A 1Z6RA 2X0LA 2QVSB 2G7HA 3DP7A 4P9GA 1SFNA 3O14A 1R7JA 1XCBA 3L00A 3I64A 3I5UA 3DL3A 3V8JA 4HVRA 2ISZA 3L09A 4KT5C 2JPCA 4B29A 4XLNF 2E1CA 1C0WA 3HOTA 2CW0F 3ZMTA 3VEPA 1TQPA 4I01A 1AWCA 2RDPA 4EV0A 3EBRA 5JFRA 3R60A 3NW4A 2A68F 2VQAA 2K9ZA 4AVCA 3JSOA 1MJAA 2LKPA 2L02A 2ZJ2A 1LKNA 3IC7A 2Q0OA 2NNNA 1DDNA 1T39A 1CF7B 5ILUA 2O6GE 4AIHA 2IRFG 4CXFA 2NNYA 5FO5A 5DEQA 4Q0QA 2IA1A 4O3MA 5DD8A 3S7EA 1XN7A 2KJBA 1O4TA 1R23A 5L3CA 4OFGA 2IXHA 1RGSA 1I1GA 3I71A 3BZ6A 5EEHA 4KIBA 2CAUA 1K78A 2UWMA 5DDGA 5J6XA 1MJBA 1H0MA 1VP6A 2KRFA 2XLFA 1DZRA 4I3PA 4A5NA 3CLPA 4LUKA 1R1UA 3BCWA 4RB2C 1F5TA 4I02A 4GXOA 3ZMSA 1UHMA 1IUYA 2HDCA 5J8FA 2RC4A 2W84A 4HSLA 3RZZA 4Q48A 4I0BA 4U0YA 4N9HA 1YO5C 4YARA 3GZ6A 3MAJA 3BDDA 4KU8A 3HTUA 4WBBA 1XSDA 3HSFA 2MPFA 3JZVA 2X4HA 3PQJA 5DD4A 2O0YA 2XROA 2P17A 1HKTA 2R7FA 5ED4A 2F5CA 4HAMA 4YFXF 4CHUA 4P55A 3T1BA 3E97A 1KGSA 1YLFA 1ODDA 1TW3A 3GLXA 2ZNZA 3R0JA 4TV7A 3RIRA 1T2KA 3LAJA 5A2QZ 4XRFA 1L3JA 1HBXG 5E20A 1JHHA 1J75A 3SZTA 4EWAA 4KN7X 4A6EA 1L3LA 1DUXC 1Z05A 1USTA 4YG2F 4YFNF 2ZXJA 3S2WA 1ON2A 2OBPA 2ESHA 4JBAA 2ET7A 3QACA 4LG0B 2I45A 2KXLA 2B0LA 2GC2A 1UB9A 1U5TB 4GULA 2H6CA 2OA4A 2PHLA 2W85A 4O5VA 3GZ5A 1KQ8A 1BI3A 4H0EA 1T0FA 4IEPA 1WQ2A 2Q2EA 3KSCA 2XIGA 4LK0F 3IIAA 2DK8A 3C1DA 5D5UB 2WWYA 3DN7A 4A0ZA 4A12A 2FNAA 4IEZA 1HW2A 2CV6A 2RNJA 4L9VA 3MZHA 4KYWA 1FSEA 4U88A 2D40A 1V4RA 4XFFA 5C8WA 3PFIA 2RVCA 4HV5A 3GFMA 2MBFA 3OGJA 5KHHA 2IA0A 3GO5A 3FJSA 3F3XA 2EFWA 2PMUA 5TRDA 2D2WA 3RKYA 5F6FA 2VECA 4LLLA 2OZJA 4BH9A 3H1MA 4QM8A 4GYIA 4HQEA 3M8EA 4JTOA 4Q29A 3HHGA 2Q30A 3IKTA 2D5HA 5LGNA 3WU0A 2J5OA 3F72A 1CGPA 4ONUA 2CSOA 5JVTA 1ZRRA 4AVBA 2FNPA 5KK1A 3J80K 1CAUA 2H0VA 2WC2A 2IJLA 2E1NA 1G3SA 1UW8A 1BN5A 5HS9A 1DGRA 3F8FA 2OZ6A 1FLIA 3MCZA 3LAGA 1IPKA 3LAPA 2MD5A 1V3FA 3MFKA 5EFUA 4MV2A 2BNOA 4WCGA 3RTRA 4KDPA 2ZBKA 5D8LB 4CO8A 4MGRA 2Q4SA 1JE8A 1USSA 5BY5A 2EFOA 5E1WA 3HT2A 1UCRA 2VC0A 2FXAA 1J2XA 5L3EA 3U11A 4YSFA 3KEOA 2PHDA 3GBFA 1TNTA 5BV6A 5LEJA 5HLGA 2XV4S 1Z7UA 4ENNA 2P7CB 1YYVA 4D7TA 2RV8A 4X6QB 1X82A 4K2EA 2W24A 2TDXA 1OYYA 5TJJA 1X7NA 3BB6A 5I8SA 3QPHA 2A6EF 5H6QA 4META 3ZDSA 2L4MA 2VBZA 1B6AA 3LSTA 3KZYA 4CICA 4MGZE 1ZNPA 2R7DA 1TNSA 3WTWC 3IL2A 2DQLA 2P4WA 2OZUA 2XKPA 3EQLF 1ZH5A 4HX8A 3CUQB 2Y0OA 3M3IA 2PJPA 2XL9A 5DYMA 2EFPA 4P5OA 2DT5A 3VB2A 1SMYF 3GX4X 2V1XA 1Y3TA 4KICA 4AD9A 1P4XA 4EVIA 3HT1A 1FBUA 3K9TA 4GO1A 3USSA 3KP5A 2BBYA 1R00A 4EM2A 4QLCU 2VN2A 3LZZA 2WV0A 4IEYA 3QOPA 4EJTA 1JXSA 4I7HA 3G3ZA 3HTSB 3F22A 4ESJA 4M74A 3T8RA 3IWZA 1TBXA 2EVXA 3NL1A 1OPCA 4UBGA 4AVAA 2UXXA 1U2WA 4NB5A 3TDZC 2BGCA 2XGXA 1OFNA 1W7PD 4L2NA 1WI9A 1IPJA 5ICGA 3TGNA 3GWZA 2W57A 2HR3A 2IW5A 4MQ9F 4HVQA 3EHKA 3CJXA 1PDNC 1G3WA 4MQVA 1BJAA 3GFIA 3J81K 4B09A 4WK8F 2ISYA 3LA2A 2KIFA 2HQRA 1B59A 2HKXA 4ZYHA 2AXLA 4HDUA 3UKVA 2EK5A 4ZH4F 2GC0A 2MLKA 2PBIA 2DBBA 3VODA 3GFJA 1J5YA 2DK5A 5D1IA 5CVRA 1DGWA 2CO5A 1U8RA 1LDJA 5DV5A 2MH2A 4UBHA 1XSVA 4M9SA 4KN4X 3WGGA 1O3SA 2VOOA 5L3GA 2P8TA 2ETHA 3I0TA 4XFHA 1LVAA 1VJ2A 5D6FA 1SD5A 5KVRA 2EV0A 3GUDA 3S0MA 1UIJA 2F5FA 5ILSA 2Z2SB 3ABUA 3EYIA 2Z99A 5FCCA 3T5XA 5JSPA 4BAYA 2FBKA 1ZGJA 1SD4A 2E7WA 3BROA 2QLZA 4XFAA 3HSRA 4AIJA 1BI2A 2Z3YA 4XF3A 2GWRA 1HSJA 1O5UA 3WGHA 1R58A 2PFBA 3BY6A 4AQ6A 4KNYA 2V09A 3JAMK 3QU3A 3RYRA 3KFWX 5A2QK 2DPUA 4H7LA 2FBIA 2Q8KA 4IEUA 2F5EA 2A6HF 2EWNA 5EZWA 2A07F 1VR3A 4LD5A 4EM0B 1UIKA 1XE8A 2XAJA 1XSXA 1JHFA 4PCQA 5FLHA 4NQWA 1O3QA 1I6XA 1BIBA 4JV4A 2VT3A 2VPVA 5L3BA 3ES4A 2BEOA 5E16A 3ZP5A 1FNNA 3NJZA 2LF7A 2QVOA 4ENMA 4R1HA 3I58A 1IXSB 2FMYA 4IRGA 2D93A 4OOIA 2PAMA 3FF5A 3ERED 1TQ5A 4FAHA 5C6CA 2FEZA 3BJAA 4ZU4A 5D5XB 1IN6A 1HQCA 1MJ9A 1XGMA 3ZQ7A 3Q9VA 3KMHA 1I5ZA 4Y15A 3I7DA 5FD5A 2JSCA 4MTDA 5DUIA 1ZX5A 5DCFA 2IA2A 2EFNA 3K1NA 3NVCA 3WW4A 1Y0UA 2KKOA 1LNWA 3FHIB 4HN1A 2HYGD 3FWEA 1GXQA 1ULYA 2CG4A 5BS6A 5HDGA 2F5DA 1Z6TA 3FE5A 3MZYA 2A61A 3DQVC 2HOEA 1LRHA 1XB4A 1NHAA 1KU9A 1R22A 4QGLA 4HSJA 4G7ZF 5I0RA 5BPXA 3HQXA 1XDUA 1FP2A 5CYVA 2ZMEB 2YR2A 1IN7A 4OMZA 1OYIA 2XAFA 4XF1A 5AIQA 3COAC 2Z69A 1QZZA 1IF1A 1H1MA 4IEWA 4R52A 1ZN2A 1CAXA 1EPZA 3CF6E 1O7FA 3ML6A 3QU6A 2FF4A 3HIFA 3H1WA 2HYFA 1J3QA 3QP6A 3FXQA 1SAXA 4MUVA 5D5WB 4LA2A 4A0YA 3CDHA 4JVAA 4FHTA 2FA5A 2ZNYA 3F21A 1REPC 4LUMA 2NYXA 3E6DA 2EV6A 1HW1A 5ILVA 5FQ0A 2A69F 1OKRA 4EM1A 4UHTA 3C7JA 1JUHA 4IPAA 2OQGA 3O2PE 2OD5A 2VE9A 3NSTA 1FZPB 1XRUA 4JTNA 1BM9A 1L0OC 3CL1A 4A0XA 2OQRA 1Z1DA 5D8KB 3FX3A 1VTNC 3EETA 1FBSA 4FX4A 4RD7A 2FU4A 1U12A 1SD6A 2IXLA 3I59B 4ASNA 4OINF 1GXPA 2C0ZA 5LBQA 4O9GA 1Q43A 2ADUA 3D0JA 3N97A 5H6RA 2D45A 1TQMA 4ENJA 3FHZA 1YLLA 3P9IA 4J1WA 1PUEE 2UZKA 5I0TA 4I2OA 4K8FA 3RKWA 1ZLJA 2P5VA 1EYBA 3GXOA 1S7AA 1S7OA 3KP7A 1MDMA 1BC8C 4L11A 1BOAA 2LSOA 1FX7A 3KEQA 4L0YB 5LHHA 2KJCA 3OCPA 4IESA 2PLYA 1TTYA 5L3FA 1U5TC 5HDKA 2COMA 1CAWB 4G8XA 3RPUA 1UFMA 1FYLA 2KIMA 4CGZA 1G6NA 1MKMA 4HBLA 3H3UA 3NKTA 5I93A 2PFWA 4L0ZB 2EA4A 2L01A 2YX7A 3DF8A 2XLAA 3WE2A 4MEXF 1STZA 1SQ4A 4HW0A 4EJWA 1W5TA 3LFKA 3FZVA 4HVOA 1XE7A 5KHIA 4CZZA 5KHKA 4XF4A 3ABTA 4WZCA 4M9ZA 1FSHA 1IZ1A 3IBMA 1NXMA 4OLLA 1O57A 2F2EA 4Z07A 2BV6A 4IEXA 5CU1A 5D5VB 4RB3C 4XEZA 1LR5A 1KU2A 2RQPA 4WX9A 1U6GA 1CF7A
chains in the Genus database with same CATH superfamily
2BVBA 4MSVA 4E2SA 3NWSA 2YZ4A 2G9WA 1LQ1A 3GBWA 4LA3A 3DCFA 1H6XA 2GNDA 2C24A 1BVP1 2L9SA 3POFA 5FLXZ 2WRAA 4OIRF 1JXNA 2P34A 1TG7A 1NCRB 3K4ZA 1ZRIA 2JWTA 2BOIA 3K77A 2NS7A 1S5LC 1PMHX 4BOWA 2ZAAA 3GTPJ 2HKOA 4G12A 4EWDA 1WLWA 4RAFA 3IIIA 5AFBA 2DMPA 3OS1A 4FOVA 2F5VA 4HKOA 3HGYA 2E1MC 3N4MA 2XVKA 4FO9A 3V7SA 4NC6A 1YIOA 1MGTA 2D7FA 4HK8A 3HRMA 2A6XA 2J22A 1QVTA 1W3XA 2VMFA 2HEOA 4PZJA 2FOWA 4YWAA 4CP0A 1JZ8A 1IPSA 2WLQA 5AFEA 4MTEA 4BHCA 5AVAA 5FYSA 2QKMB 2EIBA 1FY7A 4D9JA 1JGGA 5H9SA 1XX5A 1BJZA 3KP2A 1ULCA 3SCHA 5J8CA 3WTXC 3VFZA 4PHZA 4I09A 4CDQC 3RKQA 2LY9A 1U5TA 5IW0A 4F8AA 3J7HA 1D0ZA 4BQAA 3NAPC 1PX4A 1WCSA 2RR11 5F7UA 4AEJA 2XGCA 2PMWB 5GZEA 4EJUA 5LCWL 1CIYA 4QDQA 4BDZA 4KITB 2K2SA 4IE4A 4CEYC 4IOCF 5FY1A 2MHFA 6PAXA 2P6HA 3KGLA 2QWWA 3H50A 2JB4A 1WW6A 2DFIA 1X1DA 2OT7A 3SLIA 4GGGA 1H6YA 1NCQC 4EJOA 5IT9K 4LKSA 3T2TA 5IAVA 4BQ1A 2YDEA 3LPGA 5DG2A 4N4OB 3DEEA 2CWEA 5A7SA 1UZZA 1WD4A 1DLLA 1T6BX 4TN7A 2F17A 5HXMA 1TNFA 1K6OA 3CCMI 3B3QE 4MO7A 5C4WA 1PP7U 1BC7C 5FYHA 2WWUA 2JUCA 2PHXA 5LRRA 1UYZA 1COV3 2E60A 4BCUA 1XD7A 4CU7A 5FZHA 3PVBB 1X33A 4OU0A 2PMZN 2AC1A 4XR6A 3OD0A 2C9KA 4LLFA 1DG6A 2QBXA 2YROA 2HFHA 3H3ZA 1I50J 3ZX7A 1QY4A 2CQNA 5C9AB 3BU7A 1QXRA 4D3WA 3CJNA 1YHQI 2M0MA 2P0WA 2EPFA 1NE6A 4QTRA 1UG0A 1O91A 2GOXB 4MFEA 2A6YA 1W0UA 3Q9OA 4PDWB 2FD8A 2O8KA 1HRI2 3RI4A 4ZY9A 5GADJ 1RITA 1VBA3 2RN7A 4Q4W1 4WXCA 4KQ7A 3SDBA 3ALQA 5CFCB 1H2LA 3IH4A 2W95A 1XCVA 5FPXA 1CQTA 1MBGA 4HNVA 3UGFA 2M2EA 1J3RA 4LNVA 2VBYA 2C6YA 5H2FC 3SKJE 4YM1A 5E3MA 4XIDA 1UAAA 3KHCA 5GLVA 1A8DA 2JDZA 4CUGA 3PL8A 2B9SA 2F4MB 2ZKNA 4A3GJ 5J1UA 4PIYA 4ESBA 2F4LA 2EA7A 2VMCA 1SFYA 2Y69H 4BDVB 2Q1MA 5FZ3A 5IVVA 2O1QA 2X85A 1ZKGA 5A1LA 1FIPA 3GZNB 4TXWA 1IN8A 2B63J 1KFUL 1W28A 4L9JA 4WXHA 4AVPA 1XB9A 3AP5A 2DTWA 3PUHA 2DWRA 1CAVA 4ARYA 4ISRA 5GZCA 4BPZA 4BWOA 2PEXA 5K7ZA 1BK1A 1L7QA 4KI5M 2W25A 2EIEA 3FMSA 1AXYA 3GZEA 4HPKB 3IAM2 2BJSA 3ZFFB 3J80Z 2OAZA 2MABA 1G4DA 1P4WA 1RUH3 5DCMB 4W65A 1TQIA 2FSWA 3EYYA 4A3EJ 1W2NA 2WT1A 2OA2A 3TN91 2KISA 1OVPA 3P1IA 3IWFA 2HEWF 5CADA 2G9ZA 3C8XA 2GSYA 3TN93 2G7UA 4ZS3A 4UUVA 5M3MJ 2DMTA 1G8WA 1F35A 1ON1A 2EV5A 3KCCA 2A3SA 3N36A 1MS1A 3GYDA 3BR0A 4GFBA 3ZPYA 3OTFA 1C1LA 2ZMLA 4AFDA 4IF4A 1V6IA 3A01A 2Y6FA 2GC3A 3WU1B 3VKNA 5JWPA 4V2WA 2D1VA 5FLJA 5A7OA 1U3EM 1FJLA 2B45X 2D3SA 1VFCA 1BBYA 3R4KA 3M7GA 4LOCA 5I0SA 1P9QC 4FTSA 4C3JJ 3OUIA 3GJAA 5CJ9A 2Y26A 4U7DA 3T08A 1G8XA 1LE8A 1W05A 3PJQA 3RJRA 2JA2A 4KT6A 3MWMA 4YVSB 3AZVA 3D5RC 5D6EA 3ZMVA 5LGTA 3B94A 4OIPF 1RMU2 2YMZA 3M8LA 1FMD1 1YIPA 3WDXA 1K83J 2R93J 2SBAA 2DBIA 2ATFA 4P96A 2QBYB 4C2MJ 2RDNA 1JTXA 3M3EA 2P5KA 1RB8G 3LA3A 1HB1A 1ONAA 4EROA 1JYVA 1D7PM 2WAFA 1LEBA 1SAUA 1FOWA 3ZN4A 4OMYA 2E63A 2DU9A 2Q8CA 2WWJA 2R062 1W1WE 3CZJA 3WF2A 1AJKA 2BNMA 2W47A 2JDUA 4IEJA 1OVSA 5HCBA 5IHRA 1JUMA 1S55A 3HPNA 4CP9B 4MFDA 2JRTA 2B4KA 3RZOJ 1PGW1 2EAAA 2EH3A 3A0KA 4S0HB 2RMU1 1Z77A 4HLTA 1BOBA 3LA7A 4UW3A 1X1PA 1N1VA 2WAOA 1NQDA 3VBUC 2IAIA 3H5NA 2GH2A 2YXSA 5CZKA 2RMU3 3BALA 3H9QA 5HS8A 1H8VA 1AHDP 1EH6A 3LD8A 3AM2A 3TQNA 3FM5A 3APBA 4RAZA 4DUXA 2GMMA 3ZFEB 3DYPA 1K5MA 3HKZA 1HV1A 2RJLA 4HN0A 4Q0SA 4EZ4A 1WKMA 4PSWA 2BE5F 3AZWA 3U4XA 4BA6A 4AI0A 1AOYA 2DVAA 2X53S 3AYDA 2XRNA 3F23A 3Q8CA 2YU1A 3MPPG 4GJZA 4A6SA 1X58A 3TBDA 4K21A 5HBAA 2IFRA 3CESA 1OMIA 3J7AO 3K4NA 3UYJA 2ZMEA 2ZEXA 4N53C 1RL3A 3HRSA 2D1HA 2QQBA 1CAUB 1DPUA 2D3RA 1YJWI 1ZM1A 2YUEA 3H5RA 5IP6A 1TWCJ 3JCIA 4KMUX 2QQVA 1G86A 1FYUA 1C1FA 1RI7A 2Y0MA 3N7MA 3JAMZ 2ES3A 3PJYA 1N78A 1KDKA 2XAHA 1VRH1 1WCKA 5JZGB 3QPSA 3AG3H 5CVJA 2VONA 5BXXA 3U78A 3WR0A 5CVIA 4I0WB 1YRNB 1GZWB 1RVF1 2EZIA 4P9YA 1V54H 2L7MP 2LVSA 2W5FA 1GANA 1QQIA 3KZIC 1RVF3 5HNHA 1GNYA 1OOPB 4C3HJ 3IAPA 4QX3A 2JENA 3AC0A 4FETA 4DIQA 3LL7A 3BYWA 1YUDA 1PP8F 4M3DA 5BNPB 3VOEA 4B4PA 1JT6A 3ECOA 1S2EA 4Y13A 1RESA 2M87A 2CQ7A 2DURA 2B7EA 3MQ0A 2EIKH 1VQ5I 4YG0A 2Z9OA 4QQLA 1R092 1ZVFA 2H94A 3KGZA 3S5QA 3DKQA 4UVBA 5IK4A 1YI2I 3EMRA 2ZACA 4EN6B 4WXDA 1UKGA 1YWKA 3JD71 1NA1C 1U78A 3U0ZA 4BYYA 2DVDA 3CDIA 3HBZA 5CG8A 3VZNA 5FFZA 3DUIA 2DBNA 3UKNA 2DI3A 1LU1A 3OBTA 1HKSA 4AXOA 2JXAA 1FPN3 4UVAA 4GAZA 1P7IA 2B8MA 3KEYA 3W20A 2CW7A 1QMJA 3WG3A 3HSEA 1POV0 2WFPA 4GYGA 3RQ4A 3FLPA 2YX4A 1OA3A 1ND3C 4G9YA 5KHGA 4Y17A 3QP5A 1TLHB 1X2NA 1H30A 5HVQC 1A5JA 3H0OA 1Y9QA 3CP2A 1UKRA 4E4SA 3MPBA 2OQ7A 3AL6A 3MV11 4TWTA 2KR2A 2PHTA 3V7RA 3VBSA 5C71A 3UGGA 1US2A 1AF9A 1DP7P 2E1MB 2VJJA 2YU9J 1YYNA 2X6YA 4RS5A 3H8UA 5G05L 5A32A 2P7VB 2UV1A 2R042 1ZRCA 1HA8A 4RGAA 2WNOA 3O6BB 1QZYA 2QTWB 3F2ZA 1JTYA 3VZKA 1QNYA 2ZB9A 4H14A 5GTHC 1SMTA 3JRCA 2WR9A 1HQNA 1GWMA 4B4RA 3D5OA 2VOKA 4BHPA 3O7OA 3L2CA 1UZ0A 4AM3A 3JQWA 4YIRX 2L9VA 4QXHA 5DUKA 3W6JB 4FX0A 3OY9A 1NK3P 5J1XA 1YIFA 4CDQB 1NCRA 2ZAHA 4PJMA 3MKYB 1GU3A 3QYBA 5FRNA 2NOGA 3PMSA 2R7ZJ 1OD5A 1ITYA 1VBE1 1RUJ1 2HGCA 1UYXA 3H8OA 4LJZF 1CONA 4R9DA 2E26A 3PNAA 3BPZA 3JREA 4CEYB 1VBE3 1RUJ3 4RAGA 1GOHA 1GZCA 3C7OA 5C3EJ 3USUA 3EUHC 1SDWA 3RYKA 4YFZA 4LMYA 1NCQB 2ZA9A 2IGOA 3KP3A 4GWMA 2ZTNA 5J09A 4P1WA 2BY0A 2HWC2 3OGRA 2EZLA 2VT2A 1S0BA 2EFQA 5CPRB 3ZYIB 4X8PA 4FE7A 5JR7B 4QPGC 1E3HA 1S3JA 1ZLKA 4OI4A 1OH3A 3PO2J 2GAUA 1ULPA 4LULA 3LOIA 1G9DA 1IW7F 2VZUA 1WRJA 3AYAA 2M1BA 3S3NA 4NIIA 4BK4A 4AI3A 1ZQ3P 4F7ZA 1U5YA 5FDBA 4N9IA 3PNYA 1HXS2 1ZZCA 2XAUA 5B3SH 1JGSA 4IKFA 4GKYA 4OMDA 2VZ3A 3GXUA 2PLV1 2KHMA 4BEHB 3N9MA 3W59A 3U21A 3KF5A 2M0CA 1KA8A 3H9AA 2E71A 2PHWA 2PLV3 4XRSG 2O8OA 1EUUA 1J1LA 1YFUA 1RPWA 4INDA 3GW2A 4GDFA 1X36A 3KIOA 1WVRA 1UY2A 1EV12 1QPMA 4YVWA 3RS6A 2IC1A 4UUTA 5SV8A 5HLHA 1RZ4A 1GQGA 4LBLA 1QIQA 2Y75A 3NO8A 3T0DA 1CX4A 5JCTA 1NLRA 4XSXF 2FE3A 2PMHA 1RUF2 1BEV1 1H0BA 2V1DA 3UV9A 2VE8A 2MSYA 2FZ1A 4RB1A 4Q5SF 2XXZA 5LK7B 1LHWA 1BEV3 1O3RA 1DHKB 2DTRA 2F6CA 1P7JA 1DZQA 1W4MA 3HB9A 3SEEA 4ZYEA 2CGPA 1H8AC 3FMRA 1C57A 4WM8A 2LD5A 5FMOL 1AYM2 2ARAA 1OBNA 5EPAA 2ZX3A 4E7IA 3LSHA 3VYTB 2JE9A 2J1VA 1XMKA 4MADA 1MMDA 5FMOS 4MOAA 4MZUA 5C9AA 4YGEA 5FQ0B 2MGQA 3BCBA 3OPWA 4LR4A 3M4OJ 1EJ9A 4Y5SA 2GOMA 4PDWA 3CO6C 4M6XA 3GTGJ 2A70A 1NAEA 5EP9A 4NJ4A 2EALA 2WIIB 5CFCA 5HLIA 1WH5A 4CYCA 2P3KA 2TEPA 1G9FA 2L4AA 4R4ZA 3B6AA 3KT7A 3WCSA 5F2SA 2ZJCA 2C4XA 1YJKA 1YNAA 1D8KA 4CEWB 4X0GA 4LXLA 4HXCA 4IZZA 2X1EA 3B9IA 1BCXA 3WNNA 3LMMA 3LSDA 2ZX4A 3FMGA 2JA5J 2XPWA 3ROUA 4W6XA 5H9QA 3P9CA 1RUOA 3AP7A 5LD2C 2Y60A 2DCTA 4GXLA 2VBXA 5T54A 2ELJA 1O8PA 4CYDA 4ASKA 4HMZA 2CJJA 1GV9A 1W5SA 3AZXA 3BJOA 4W1UA 2GLOA 4JC1A 4MIMA 2JKXA 4IXLA 4HPKA 1UNBA 3FZ3A 3SZPA 3FBYA 1FI2A 2XUEA 4C91A 3V65A 5DCMA 3ZQHA 3PUIA 1Z7S1 2X0LA 3VBRB 4OI1A 3FXKA 4L5EA 3TWIA 3DP7A 1RUI2 3O14A 3NWKA 3HOYJ 3I64A 1Z7S3 4NROA 3BTCA 3V8JA 2ISZA 3L09A 2JPCA 2M4KA 2JDYA 1O4YA 2VNGA 3VEPA 1HLVA 2V5YA 2CWSA 2QQLA 2MD0A 3R60A 2XJRA 3NW4A 5JI7A 3VV1A 3GTOJ 1MJAA 3IC7A 1RRJA 4OZOA 2Q0OA 1HIXA 5GAEJ 2WFF2 4BQNA 3VKMA 1OISA 4AIHA 4CXFA 4Q0QA 4E9KA 2VO5A 5KCMA 1MBFA 3EB7A 2D6LX 4A3ZA 3FHNA 3BZ6A 2ZHKA 5EEHA 4CCEA 5J98B 5DAWA 1IHMA 1G9BA 4RR3C 1H0MA 2KRFA 4I3PA 2BQPA 5D2AA 4YVSA 3QH6A 4HNTA 1PX3A 5J8FA 1XU2A 2RC4A 3RZZA 3DPRC 4U0YA 2Z16A 1ZTRA 5DG1A 3BPSA 1Q8PA 3SH4A 3HQUA 3BDDA 3CCYA 4A3BJ 2D6KA 4KU8A 4WBBA 2MPFA 3LCPA 3VBUB 2O5RA 3PQJA 1S72I 2O0YA 4XMIA 5FWJA 2P17A 2ICWG 4XNFA 2F5CA 3OJBA 4FASD 2HQAA 4P55A 4FISA 1XYPA 2EF6A 4TV7A 1RETA 1WD3A 2QQIA 2RJ2A 4YZ3A 1HBXG 5EZGA 3UGHA 4A6EA 3VZLA 5FTTC 1Z05A 1USTA 4B7KA 4YFNF 2ZXJA 3S2WA 2JD4A 3VZMA 4JBAA 1QOTA 2D6OX 2I45A 2B0LA 2NZ9A 1T95A 2X9DA 3GGLA 3POYA 2PHLA 2W85A 5IT6A 4HNUA 4N53B 2BVLA 1OLQA 2O14A 2ZZJA 3GMEA 3KSCA 4AGGA 5GZDA 3C1DA 2WWYA 1U8BA 4P02B 2JWPA 4CP9A 4RQPB 2JJ6A 4A12A 1G9AA 1HW2A 3S5AA 2HPIA 4KYWA 5F3GA 1QZEA 1SPPB 1UY1A 5FBZA 4ZZ8A 4D8MA 5E88A 4PJLA 5B1AH 4LG3A 3SITA 3OGJA 2DXIA 1PNGA 3GO5A 2MC4A 1ZGWA 3G1OA 3F3XA 4DZPA 3ORJA 2EFWA 5FMDA 1GNHA 3ZFEA 2D2WA 3RKYA 2VECA 2OZJA 4BH9A 4QM8A 1PVC1 4HQEA 3M8EA 5F39A 3GALA 3AKRA 4Q29A 2VBPA 3PUAA 3NNMA 3L9JT 4Q5OA 4QHZA 3T2QA 1PVC3 5LGNA 3FL7A 1LGBA 1CGPA 3OPZA 4ONUA 1TZLA 4IHWA 1O8SA 1ZRRA 2QE3A 3MIBA 1DLCA 2FNPA 3AP9A 1CAUA 2ZEZA 1GP6A 3MUY1 4H7MA 1DGRA 3ON7A 2FQ4A 3J26N 1FX5A 3LAGA 1NA1B 2Y0SA 2R30A 1Q8VA 1TWAJ 2WDBA 2MD5A 1V3FA 1D1BA 2BNOA 1AU7A 3RTRA 3DBLB 4QIWN 4Q4X2 2JA6J 5JZGA 4DZGA 1HRI1 1JE8A 2HBUA 1YRNA 5DAQA 1GZWA 5FKNA 3I8TA 2Z1DA 5FZEA 1TP4A 2R6QA 1J2XA 1QH7A 1LFPA 2VUCA 2RS12 1OOPA 1RHI3 5BV6A 4D6RA 5DUWA 1ND3B 2XV4S 4PCRA 1OCTC 1FOXA 1NZIA 2W24A 5TSWA 2TDXA 4BZ4A 3J9SA 3LSEA 5IVCA 5GPAA 1J09A 5I8SA 2A6EF 5H6QA 4META 4EATA 4C90A 4UY8I 1YO8A 1GR3A 1AYN1 4MGZE 4IHYA 1BYHA 4CH7A 4MHRA 1ZNPA 4LK6A 5GLWA 2R7DA 1TNSA 5F5IA 2A6ZA 2XKPA 1AYN3 5JI9A 1S0GA 1UO9A 2FDIA 3T4VA 2Y0OA 2JDHA 2ZOEB 4KNCA 1K4TA 2B39A 3M3QA 5FWEA 5DYMA 3S14J 4RLQA 3VB2A 2P3IA 3OYBA 4XLEA 3S1RJ 3E1F1 2V1XA 1FBUA 3I3LA 3K9TA 2LALA 4FTBA 5FY7A 3S3OA 2W87A 2X8KA 3CDZB 4AI8A 4EM2A 5EYYA 4QLCU 4IV1C 5FXXA 3ILFA 2CL2A 3QOPA 1B72B 1OKOA 3G3ZA 3HTSB 1SCSA 1KONA 4ESJA 4M74A 2EVXA 2W92A 1Q56A 4GZ9A 3HAGA 1PM4A 5IUQA 5F5CA 2UXXA 4FPKA 4AVAA 3CMMA 3TBIA 4L2NA 2DFEA 1WI9A 1IPJA 1ULGA 4ZONA 5FK7A 3OYKA 3DBRB 3AFGA 5DDJ1 1NX9A 3CJXA 2XJTA 4MQVA 4CZSA 4WK8F 2H1LA 2W39A 2X5IB 2V9KA 4LKFA 2JRMA 2JVHA 5K7HA 5DDJ3 4XOGA 4NAOA 1ETKA 3JRBA 4ZYHA 2ZABA 4FFHA 3MV01 2EK5A 4K7JA 2PBIA 1W9YA 3S1MJ 4XJWA 3RZKA 1JYTA 2LOOA 3LQCA 3PTYA 4ATEA 5CVRA 1GSLA 4JX0A 2CO5A 2HOSA 1D2SA 1LDJA 5DV5A 4UBHA 4DGWB 5CNAA 2QQKA 4M9SA 4KN4X 2CRGA 3WGGA 1O3SA 1MZ6A 4QPGB 3K3OA 2QSFX 3FXOA 1C8NA 3LSJA 3K4JA 4GA9A 3ZXJA 4CDQA 4Y22B 3EYIA 4A4AA 2Z99A 4Z1VA 1V00A 5F5QA 5DABA 4MO3M 5JSPA 1CQ9A 2DFHA 2ZBJA 2BBAA 5FZ4A 3NAPA 5M0TA 2HEVF 4QSHA 2WAAA 2E7WA 4XUQA 1W9WA 2PXJA 4XFAA 4YELA 1ACIA 4AIJA 4W6YA 3ZKYA 3MZ8A 2WA3A 1BI2A 4CEYA 1QJY2 2VPLA 5CKTA 1HSJA 1GYKA 1O5UA 2PFBA 3S6PA 2COBA 3KM5A 4OAZA 4GB32 1IV8A 2P37A 2G4IA 2JKBA 3LSIA 3RYRA 1ULEA 1NCQA 1LODA 2FBIA 1LJ7A 2FCTA 1ZYBA 1BBT1 4AUXA 4R9AA 2VBDA 1POQA 2FDFA 2XAJA 4YRVA 4G3YC 1BBT3 3RZJA 2WB1A 1X19A 4CU9A 4Y4RA 2VPVA 1IS6A 1JHNA 5L3BA 2BEOA 1Z0XA 5K0UC 1JUSA 3DXTA 3NJZA 3W2AA 2VNOA 4ENMA 3I4NJ 3IAQA 5LBBA 1PK6C 1E57A 4IE6A 4BEHA 3NNGA 2D93A 4FOQA 3FF5A 3ERED 3O1PA 5CA6A 5D5XB 1MJ9A 3KMHA 1N3QA 2V4VA 3RQIA 5FD5A 1IDZA 4MTDA 4LHSA 5DUIA 2R7TA 1ZX5A 2IA2A 3K1NA 4HN1A 2HYGD 2DOAA 4NNJA 5BS6A 3MZYA 2XQXA 2LRPA 1MW7A 1O4ZA 4UT5A 4K8RB 3I97A 1R22A 1FP2A 2WZR1 5E3LA 3NNLA 2YR2A 3CZUA 5J36A 1JZ2A 5IP7J 1OYIA 1T0FC 2XAFA 4XF1A 1PZ7A 1RUG1 1R4NB 2R7WA 2Z69A 2WZR3 1ZN2A 5FPVA 3CF6E 2E53A 2PHUA 3QU6A 3ZLIA 1RUG3 4JHZA 2YPDA 2FF4A 3HIFA 3HKZN 3KCXA 3SEPA 3WNPA 2WO3A 3AL0B 4N43C 3QWLA 3AFKA 3S1QJ 5K7PA 2W68A 1VAMA 1NLQA 3PJRA 1G9CA 4CUAA 2KA3A 2FA5A 5CQEA 3CD6I 2HWF2 2ZNYA 1RJ7A 3QCWA 2IBDA 3E6DA 5M5WJ 3KB5A 5EYXA 3NQHA 5ILVA 1VBD1 5FQ0A 3HUGB 5FPLA 2EZKA 1JUHA 4IPAA 1K45A 3AFHA 3O2PE 1ODNA 2OD5A 4HK9A 3NSTA 1JODA 1BM9A 4COVA 1DU6A 1Z1DA 3M4FA 1VTNC 3IZOA 4FX4A 4RD7A 1BL0A 4NAMA 5L7OC 1HKDA 2FU4A 4M3BA 1UOFA 3I59B 2LUWA 2W3JA 3RPUD 3D0JA 1D0YA 1TQMA 3P9IA 4LHNA 4KBZA 1V6NA 5FO9B 5FREA 2UZKA 5I0TA 4I2OA 5DM6F 1B09A 3K6GA 3WSOA 3RKWA 4I3GA 1IRZA 3QH7A 1S7OA 1SEUA 3QYEA 4QU1A 3KEQA 5LHHA 2BFUL 3BR6A 4IESA 3VBOC 2PLYA 1U5TC 2JMWA 1CAWB 2VU9A 1UFMA 4EE2A 1UELB 3DU6A 2KQRA 2BFUS 1KZHA 2HWD3 2PFWA 4JRLA 5F2WA 1NOVA 5EXOA 2BY3A 4XILA 2XLAA 4RR3B 1STZA 4CDWC 1RKTA 1UZWA 5KR7A 4HW0A 3VBRA 4KG8A 3K4AA 4GJYA 4OI2A 3BTAA 3CMEI 1VBB1 1V9U2 5FZ6A 1X4PA 2B46X 4E7SA 3A21A 3IBMA 3I56I 1VBB3 2F2EA 4Z07A 2BV6A 2JJ7A 4OAYA 4FP3A 3CDLA 3IDEA 2TNFA 1W03A 4LE3A 4HSRA 1B8IA 3H36A 4MGKE 1KRIA 3OGGA 5E18F 4G7HF 4S2FA 1UY3A 5FZ0A 1E5IA 2DVGA 3VUOA 4CCJA 3JRFA 2Y33A 2HWE1 4DINB 5JXHA 4HX7A 3U4SA 1W9TA 4Y1UA 2HWE3 1H8TB 3IDBB 1T56A 2LF8A 3POEA 4U0WA 3H5AA 5KAIC 4MNUA 3KQ4B 4UOJA 3OYMA 4EMSA 4MGYE 5F0FA 4XMYA 3K2OA 2ZZQA 4KWKA 4IVNA 3VBUA 3NV3A 1E5HA 1VI0A 1MEC1 1J58A 3SQOA 4BGDA 5A6YA 1LHOA 1I3AA 4XFBA 3JW4A 1ZBE2 4GD4A 1MEC3 4XK4A 3U14A 2ZXHA 2AZ5A 5JPNB 3T0YA 3SHFA 3VSLA 2LTNA 2QKLB 2LMDA 1HB4A 4J00A 4IQJA 3DXJF 3PUFA 3LSRA 3N3HA 3MF6A 4TTGA 4E2QA 3F6VA 3Q8BA 2MH9A 4Y1ZA 4WVMB 4HBNA 3BTIA 1ZZ7A 4K3UA 4FCYA 2JD9A 1QXJA 4N53A 1H9TA 3UR3C 2RS51 1S4CA 3I3QA 1RKWA 1I1EA 3JTGA 3MEPA 4RQPA 4XSZF 5E3NA 3ZVXA 3N9NA 2RS53 5LEKA 2JPBA 4M6YA 1SPPA 4XPVA 3IRRA 5EJ1B 1NY72 1X8EA 2IXIA 4LO5B 1LDDA 1ETQA 3O1MA 4EJVA 5LHIA 2FX0A 1Y43B 1LCLA 1WH7A 1K79A 2L7KA 2GNBA 1ZGAA 4MH0E 5IK8A 3IKVA 3IRQA 2ID6A 2NS8A 4U36A 3BIWE 1QGPA 5HCAA 4BU2A 4FE4A 4QDSA 2G9FA 4DFSA 2YV8A 1VQ7I 5C3RA 3CCJI 1TWHJ 3VGIA 4UXAA 1F36A 3AL5A 3LQQA 1DQ6A 3H1CA 3HMYA 5BOXA 1PGL1 1LULA 3HGGA 2ZPXA 3WEZA 3TKYA 2VKVA 1KJLA 5LA1A 3DF0A 4Z2YA 1SVMA 1JZ6A 2YU3A 2CDPA 1YTYA 4M4RA 4CDXC 3C3WA 3RRDA 4FFGA 2JTVA 4WF2A 5IOZA 3D0SA 4Q1PA 4E8CA 3LFMA 3TP3A 2EQRA 4ET7A 1NA1A 4DBRA 4OUMA 3B9CA 4E7ZA 2YGLA 2ZMNA 3ST7A 5J40A 4JZRA 5EDNA 3G7DA 4JK1X 3NARA 1CESA 2HS5A 2RQQA 5FLMJ 4UUSB 2DFCA 2WQZC 2M30A 1AL21 3WW3A 1K61A 2FBHA 2R7EB 1HN0A 3I53A 2DA4A 4Q4V1 3VPRA 2QZ3A 1ND3A 5J3LA 1AL23 3RFRA 3B73A 1E0EA 3ZR6A 4Q4V3 2VQLA 2JB8A 5JOWA 4ZU5A 2WNUB 1GP5A 5FB2A 4ZJZA 4CUCA 1ZHFA 2RR12 2K02A 4FPLA 4XYXA 3V8KA 3NMBA 2STTA 1YIJI 4QX7A 3N7JA 4ETSA 3I55I 5F04A 4YM2A 1MVQA 3DBHB 2C26A 3MO4A 2V4AA 2RAEA 4UV9A 1LU2A 2XAQA 3OR1C 3AKPA 1ETWA 1AR91 4AGVA 3X29B 1YW7A 3O1RA 4AHYA 3ETPA 2JICA 4AAXA 2L0KA 1KFXL 5FOJB 3MKZA 5I0DA 2JA7J 1EV7A 3T1LA 3SFIA 4PQ9A 2DU1A 1AR93 5F37A 1L7LA 3OGVA 2PI0A 5B4NA 3IH2A 4TLFA 2ILMA 2JX9A 2VZQA 4QXBA 5CLSA 5ERIA 1W8HA 5EEAA 1B72A 2M45A 2DT7B 4YGBA 1UOBA 2XC7A 4Q0PA 2DYRH 3AMMA 2QSHX 2HDDA 2WZEA 1A04A 1OCZH 4QM9A 1ZA7A 1CIWA 5A3OA 4LIVA 2CUEA 2A7AA 2OF7A 4X8NA 3FIWA 1YQAA 2X1DA 2ZSHB 3ELNA 3BOQA 3EUHA 5T5OA 2RDRA 2J1UA 2VG9A 2GIVA 1D4M1 3KV5A 1VBA2 2XUMA 2HTSA 3LNQA 1GBGA 2Y6GA 2FUG2 3G2BA 1QJEA 3E3VA 1F1ZA 1D4M3 4QGNA 4YPJA 2WS91 1JTZX 3OF1A 4FPCA 5FRAA 1R1VA 1G3YA 4Q4W2 3EJKA 1I39A 2Z5UA 4DQ2A 1FOD1 5J1YA 5GM0A 4QPGA 1WPKA 2PN6A 1JOPA 2UUZA 1XNTA 2WS93 2HWVA 3HRTA 3B93A 4XRSA 4ABZA 2YSRA 3HL2A 4QWQA 1D8JA 4IE5A 1FOD3 2DAOA 1HW5A 3C3VA 1GFF2 1W0PA 3D5LA 1R36A 3MKLA 1PK6B 2GBYA 3ISPA 2JG9B 3ELKA 5GLUA 5C33A 4X6AJ 5KWRA 4K6BA 4LBQD 2XPJA 4D5FA 4XUTA 2ZCWA 1W99A 4YW4A 1QHGA 3HPHA 2P3JA 3T4HB 2AQFA 2CYYA 1IRXA 3GHMA 2DJNA 1R64A 2LDUA 3RNSA 2XJVA 2ZKZA 4BE3A 2HH9A 1RUH2 4UNOA 2WAQA 3HJEA 1SDDB 2LBFB 1MBEA 3CKHA 3ACLA 2HVRA 2OUJA 2VM9A 5FJHA 3J81Z 2Q2EB 1Y1WJ 3TN92 1YS7A 1BR4A 1UHSA 3MF9A 1S8NA 3CTAA 4A3CJ 3AMQA 1LOCA 1OKQA 1RUNA 2H09A 4WWCA 2Q1ZB 3BG3A 3JUUA 1H4GA 5L73A 4OWRB 3KT4A 5FPBA 4XVHA 5J7MA 1LB2A 4N43B 1D5VA 4W8JA 4XUNA 5E1RA 3FM3A 5FY8A 2NS0A 2FDHA 2WL1A 3PQKA 4MX3A 3BJ6A 4QAWA 1O3TA 4H4KC 5EZHA 4NHXA 5FV3A 4PDKA 4UVCA 5BNNC 1IN5A 4J1XA 1S29A 1E2XA 2K40A 1B35C 4ITVA 4C9YA 3TB0A 3CP8A 1K6YA 3K0LA 4DB5A 4QPOA 3VZJA 3RSJA 4DNCA 3T2OA 5BPIA 1HQLA 5L7OB 4KBBA 3E1SA 4ZXEA 5IJRA 3ZXKA 5DUXA 1RNLA 3QAHA 2BY1A 4UFMA 1YW8A 2QENA 3WODF 1VQMI 1D3YA 3LIGA 4RGXA 1WZ2A 1FMD2 1ZK8A 4GWJA 1OLMA 3BG7A 2GH8A 5FP7A 4XLAA 2PHRA 3M8FA 4IX7A 4G4FA 3BLYA 4D0QA 3ECHA 5E79C 4HG6B 4XFGA 1CX1A 1W0NA 2VGDA 3IV5A 3TOBA 3CO2A 3VD4A 3A2KA 5FGMA 1ZREA 3VBOB 4A3XA 4EWEA 4BE0A 4IHVA 2PAEA 3BUCA 2VVFA 1DZTA 4BXUA 3HUGA 2PG4A 1OCPA 2DVFA 3PLQA 1QJX1 4HF0A 4N4NB 3C2GA 2LKSA 5C3SA 2KRCA 2WYFA 2Y0SN 4CVUA 1S1AA 2KLOA 2WNVB 1US3A 5L9BA 1V6OA 1YQ5A 1VQLI 3I59A 4BXXJ 3ZN0A 3W6VA 3PO3J 2VQHA 3R0AA 5JVVA 4AYBN 2UURA 2F48A 2Y9YA 5D8AB 1PGW2 1NTCA 2Y64A 3X2QH 5HOOA 2RMU2 5C8CC 2UY9A 2O9LA 4G7OF 1UX6A 2VLAA 2H27A 4PI2A 4HA8A 4XONA 3IHUA 4AWDA 1OI6A 1TE1B 5CKNA 2RDQA 1REFA 5GLTA 5T3NA 2IXKA 5DAVA 3VHRA 5LGUA 4CDGA 4HF1A 3M3YJ 1SACA 4AE2A 3FISA 4Y1XA 4CPBD 1UZCA 2PHFA 3KWVA 3OSFA 1CAWA 3THPA 1UD1A 2AACA 1IQDC 1VLNA 1DGWY 3G73A 3S16J 4AVVA 3S3MA 5LRSA 3HOUJ 4RR3A 3LSGA 2IS2A 1GV5A 5EWSA 4XIKA 4BQ2A 3P3NA 5F1RA 2VMGA 3WP6A 1SVOA 3DPRA 2VASA 2XL7A 5FYYA 4RAYA 1Z67A 3VDAA 3ZN1A 1C28A 3FBMA 1VRH2 4RBOA 1WGXA 2W46A 1OCRH 1MBJA 3RMXA 1BVVA 4IE7A 1ALYA 1RVF2 2R3SA 1UY4A 4COZA 1HLCA 4LO6B 3DCQA 4F93B 1YHFA 4YRDA 1LPQA 1QJZA 1LAJA 2AXTC 3F0CA 3ILNA 2RGVA 3CLQA 3VBFC 4NN0A 3TYJA 4LJHA 4PJYA 3LWFA 3A0NA 3BWGA 3WTTC 2IXSA 2I07B 3UK9A 4XBFA 3ZFGC 2IVIB 5JR3A 2CUJA 3OPTA 3WNKA 1U9OA 1CN1A 3D82A 1S2KA 2MYSA 1AR61 1MZ5A 2ZGRA 5EHDA 3WNXA 3HN1A 3QYFA 4S2HA 1SMVA 3WG7H 1AR63 2VJXA 2R7QA 1HKQA 4IHXA 2AQEA 3M3OA 4IXAA 4A42A 3R4DB 5C9AC 2PA7A 3GEZA 5IVFA 4JQTA 4BM8A 2EXIA 5FMCA 2YC4A 3U1DA 2BUKA 2MW8A 2CYFA 1X3WB 4BNCA 2CUFA 2JZYA 4KU7A 3BODA 1QNTA 2DMNA 5FZOA 5EQUA 5FKBA 4BJTA 2R7VA 1X1CA 3GBGA 1XJAA 2CTVA 2RREA 2LR8A 5FFXA 2J1AA 3L2WA 2NVYJ 1IRFA 5M5YJ 2HVSA 3WW1A 2E1OA 1P2FA 3VKFC 4NQWB 3THDA 5F3EA 2NAZA 1Q8QA 1I9RA 3LSPA 2XB6C 3RZHA 4RFRB 3UL2A 1POV1 1XDSA 3EO6A 4DQAA 4MGQA 4DMIA 5F3CA 1T6SA 2JDNA 2DA2A 1MQTC 4ZPIA 4E27A 4CDXB 1W36C 1D5YA 1XGSA 1YG2A 4NPMA 1POV3 3ESWB 5ICCA 4DXZA 1E17A 1LGCA 2BP6A 4YW7A 1TMF1 5IYCJ 4ZU7A 5ABJC 4XBQA 4FCAA 1D0XA 1PIV1 3TO6A 4J01A 5FZ9A 4XORA 1L7RA 2JT1A 3EDPA 2BGOA 4LHKA 2IXJA 1ETYA 1TMF3 3ZFFC 1TWGJ 1IN4A 2R5YB 5L9RA 1PIV3 1W90A 3IDCB 1DYPA 1PO11 4QX5A 4YNIA 1JI8A 4M3CB 1NG0A 3OYWB 3L2RA 3BG5A 2A71A 2CU5A 2R32A 1PO13 3K48A 2GNMA 5FLVA 4AU7A 2X6XA 4O6JA 1WFXA 3K51A 1WJDA 2YPRA 1CAXB 1MVEA 4LLOA 3L2HA 5J3UA 2R071 5KBFA 5JHFA 1VBE2 1RUJ2 2HWB1 1V6KA 3SDGA 3F8MA 2XHKA 2RDSA 2ACJA 2LH9A 4WM7C 2P6SA 3W5NA 5EYRA 3REOA 1FC3A 4HT1T 2R073 2R92J 2I5UA 3HR9A 1YJNI 1UWWA 2HWB3 3BP8A 1H1AA 3J8F1 1OR7C 2CU7A 2YG0A 1C4RA 1GICA 1QEXA 4O9EA 4NR1A 2VD7A 2N7GA 3PU8A 4UUSA 2ECCA 1UU6A 1OUSA 3AZZA 4LBQB 1W2UA 3WE3A 2QUOA 2X1CA 3I54A 4IV1A 3ZRGA 1U5IA 3WCRA 3DLLF 4Y52J 2HTJA 4G6DA 2BRTA 4OIOF 4L9TA 4EQQA 3K75B 2XLGA 1SFEA 2YY1A 1H2MA 2BVVA 5J4YA 2HJIA 1RUE1 5B1BH 2WNUA 3I2IA 3MLJA 4S04A 3MHZA 2PLV2 5FY4A 1SFKA 1RUE3 4ZZLA 2VMIA 1NQJA 1QRYA 2E2IJ 5IT9Z 2VULA 5JI6A 4DZJA 1X8MA 2R7UA 2V26A 4PIXA 1FIAA 1OQDA 4XOPA 3OYHA 4P9FA 2R7OA 3F8NA 4AI1A 2UYBA 5JAXA 2EIJH 2Y30A 4QKNA 2HYKA 4IHTA 1WJFA 2LK2A 5FLIA 4Z92B 4ZYAA 3LIHA 3VWBA 4BHBA 2ELHA 3MFCA 2AGSA 3POSA 3WY6A 3S32A 1RTVA 1F5FA 1BEV2 2VTXA 2ADDA 1RUD1 2XASA 4UV8A 2OV7A 2ZC2A 4RM3A 1VMFA 2P4EA 1EAH1 4BACA 4SLIA 1Z6RA 3J7MA 4A44A 4P9GA 5JOXA 1RUD3 2AENA 2FBEA 3L2VA 1EAH3 3LOCA 4HVRA 1U0AA 2HXIA 2E1CA 2GM4A 3JB8A 4AG4A 2QKDA 1AWCA 3EBRA 5JFRA 1HRV1 2K9ZA 3JSOA 4AVTA 2LKPA 2L02A 4LORA 5C5TA 4PBPA 5F1JA 3M1CA 1DDNA 1VB4A 3HNYM 2O6GE 1SFOJ 1DQUA 2IRFG 3E0JB 2NNYA 4F55A 5DD8A 2J1SA 2KJBA 5ISLA 2BU9A 4FPOB 2VCBA 3I71A 3J7LA 4KIBA 4CP2A 2DMUA 4YM3A 4PLMA 4AEDC 2J1TA 2Q8DA 5FYBA 2OTLI 2UWMA 1W0OA 5DDGA 5J6XA 1MJBA 1JYNA 1VP6A 4U87A 4C2TA 1DZRA 4PLNA 4GH4C 3CLPA 4LUKA 5J47A 3T1MA 1F5TA 4I02A 4GXOA 1W8TA 1O4XA 1IUYA 1KGYA 4OVEA 5JZGC 3LEMA 4OI0A 1YO5C 4YARA 3WNLA 1FV2A 4MGSA 1PK6A 4P9WA 3JZVA 5DD4A 1DIWA 2Z42A 1HKTA 5ED4A 3POGA 4JX6A 4HAMA 4YFXF 1YLFA 4BE1A 1ODDA 1TW3A 1H88C 3R0JA 3RIRA 1T2KA 4LOSA 1JZ4A 3RVHA 2IGMA 1L3JA 5BNNB 3OIOA 5BNPC 1JHHA 1HDKA 4AK3A 1B35B 4JHTA 5FZCA 1W6QB 5HLTA 3CU7A 2ET7A 3QACA 2HZDA 1N1YA 5FIXA 3SISA 5AC91 2YB7A 4GULA 4XIOA 2OA4A 2LBFA 4BMEA 3JBG1 3OYGA 1KQ8A 2A73B 1BI3A 4H0EA 5FPUA 1T0FA 1Z7S2 1XNAA 3ZYGA 2Q2EA 4ZTJA 4NIAA 2XIGA 2G9GA 3PSIA 5D5UB 3QQAA 3JBG3 2GNTA 3ECQA 2ADEA 5KXBA 3LSMA 1JT0A 2BGPA 2CV6A 2RNJA 5FYCA 2BW3B 3T3YA 2RE9A 4XQ4A 2LG4A 4BS9A 1GZ9A 3HWJA 5C8WA 4KMQA 1SCRA 5JMCA 1LHNA 4HV5A 2LS6A 2V6EA 4N43A 5KHHA 2IA0A 2CGOA 1JUIA 3TOJA 3INAA 3WINE 5F8PA 1IJWC 1JMUB 3AKQA 5TRDA 5F6FA 3H1MA 3I2DA 3HHGA 4DXRA 4CUBA 1M4WA 2CSOA 4LBOA 5JVTA 2VXDA 4MXWA 1TL8A 3IPVB 5L7OA 4AVBA 1GQPA 2LFBA 4RA2A 5FZDA 5KAFC 2WC2A 1G3SA 1UW8A 3HN3A 4UW6A 4XXPA 3F8FA 5HV4A 4GQ7A 1Z21A 3BR2A 3NJVA 4CCOA 3D1NI 3JQXA 1F9KA 5E6HA 3MFKA 5C8CB 2P6CA 1W3VA 1YITI 2W1WA 1T08B 3BTLA 2ME0A 2EFOA 1Z0HA 4PF5A 3HT2A 3WP4A 2AEZA 2FXAA 1UMHA 2G19A 3ZOIA 3VBOA 3OY8B 4QX8A 1H2KA 3GBFA 4I76A 4BBRJ 1Z7UA 1TNRA 4Q8LA 4CCLA 4X6QB 4DY3A 4IO9F 5DAPA 4S2DA 4OMCA 3OOXA 2HU9A 2QQWA 3I3MA 3QPHA 4HL0A 5H9PA 2J7MA 4CDWA 5DQ0A 3L2YA 3LSTA 1S9HA 1UZYA 1RUF3 5FYUA 3CCUI 1QJU1 3MIEA 3EQLF 5D8AA 4PLOA 4HX8A 2IEKA 3CQOA 1XC6A 1QJU3 3LEKA 1W8ZA 2EFPA 3M3CA 2DT5A 4RA0A 3VDBA 3DU5A 4HONA 4PT6A 4GO1A 3CC2I 3KP5A 5L36A 2VN2A 4A3IJ 1COV1 3VBFB 3N7LA 2Q5TA 2XOMA 4I7HA 1PVC2 1G2HA 3F22A 2KD7A 3T8RA 3AVSA 4XQDA 3IWZA 3ZFGB 5DN2A 3NV2A 5FZLA 3FK6A 3NL1A 1C5IA 2VZTA 4UBGA 2XWBB 5FO7B 4NB5A 3TDZC 1W7PD 4NO4A 5ICGA 3KX2A 4HEA2 2HR3A 1QQP1 1AR71 3HNMA 4HVQA 1YQ8A 4GWNA 1PDNC 1G3WA 2BOLA 2ISYA 2VKHA 1VBA1 1QQP3 2HQRA 1AR73 2XSDC 2DUQA 1H2NA 2W1QA 2AXLA 2E7TA 4ZH4F 2GC0A 1CWPA 3AK0A 1OLRA 1WW4A 2Q8OA 3KF3A 3N9LA 3ZQQA 1XSVA 2DDUA 3B5LB 3BTYA 3D6EA 4DS0A 2ETHA 1ACCA 1LVAA 1VJ2A 3BU0A 5L9VA 4CSWA 3GUDA 1DFQA 3PIGA 1UIJA 2F5FA 5ILSA 1YQCA 3V56A 3ABUA 1BR1A 2BDRA 5LK5A 3T5XA 5EGOB 4BAYA 3K46A 1MQTB 3OYNA 2BW8A 2R0QC 1AYN2 3LKJA 3IKWA 2QLZA 4NRQA 4ZTFA 1DU3D 2VOTA 1VIWB 2P2KA 2E19A 4BUPA 1U5XA 5ABJB 3DXUA 1R58A 2Y31A 3JRAA 1RUH1 4IV3C 2FDJA 1ASJ1 3SH3A 3DLAA 1VBC1 3I9V2 4AQ6A 4KNYA 3QU3A 2N8GA 3CCLI 5EIYB 3PUBA 3HOVJ 2DPUA 4H7LA 3WDTA 1ASJ3 2F5EA 1VBC3 2EWNA 2NQYA 4LD5A 4EM0B 2DA5A 4CRQA 4WVVA 2VPRA 2JEMA 3FKIJ 3H35A 5GALA 1EA3A 4Y20B 4NQWA 4CEWC 1I6XA 5FXZA 2VL4A 5T55A 4II2A 4AI2A 3WHCA 3D3AA 3K4LA 1AX0A 3ZP5A 3P3PA 4QQ2A 3J7AY 4LBKA 4WZFA 4R1HA 4BY1J 1IXSB 2VMDA 4CDXA 3BVCA 2FMYA 4IRGA 3A02A 5DDJ2 4WM7B 5GLZA 4P08A 4OOIA 2PAMA 1H4HA 1XTAA 4BXFA 4ZU4A 5LB6A 1YQ2A 3Q9VA 1A6QA 2WAQN 5FP4A 2K9LA 3AMHA 3WQ0A 5DCFA 3NVCA 2EFNA 1KJRA 1Y0UA 1REDA 1YX3A 3BR1A 1SHWB 3EYPA 1TVGA 3O1SA 3FWEA 4ZS2A 5HDGA 1GP4A 1JKPC 1Z6TA 2R5YA 3GZTB 1JUPA 3WUCA 3OUJA 1LRHA 2MEV1 4NHKA 3VBRC 4M3CA 4G7ZF 5FR3A 5BPXA 4IQPA 5GAHJ 2EINH 2A3YA 1XDUA 5CYVA 3ZYPA 3ZSJA 2EIGA 1ZR2A 2MEV3 2VNRA 1D0HA 2QQUA 4AR2A 3JRHA 2X05A 4LO7A 1CZVA 3G6EI 1CAXA 4YZ2A 1J1TA 2VQTA 1Y9GA 3Q8AA 2ZGOA 3H1WA 4E7JA 1SFPA 3EUAA 2XJUA 1DYKA 4YW5A 2NVQJ 1IO2A 1KITA 4COUA 5KC5A 5C7GA 3CDHA 4J25A 3RI8A 4JVAA 3F21A 2X29A 4FP2A 1QF3A 2GIZA 4CA0A 3OB8A 4RMNA 1HW1A 2A69F 1OKRA 4J6GA 4NUBA 1W6OB 1MMGA 1AXKA 1BBT2 4LBQA 2L7ZA 1IV6A 4Z2AA 1ZBA1 1AX1A 1P8JA 1OF4A 3CL1A 2OQRA 3CJQB 4UAPA 1E3PA 2ARXA 5TISC 1FNYA 2V9PA 2W08A 1U12A 1ZBA3 1SD6A 5DS9A 3WT3A 1ZA4A 3ZQGA 4NIGA 1VE0A 1WMXA 2EAKA 1Q43A 3N97A 2D45A 1SBEA 3FHZA 3GTJJ 1WW5A 1VZ0A 2Y38A 4J1WA 1PUEE 4E8DA 1PZ8A 4F91B 4M01A 3ABMH 1ZLJA 2DTZA 1S7AA 3KP7A 2K85A 4L11A 1LFBA 1BOAA 2LSOA 3BC8A 2Y9ZA 4L8QA 4OHXA 3FDYA 3O1TA 1RUC1 2KJCA 4AL9A 4R9CA 4V19K 4XTMA 1TTYA 4PJJA 2KIMA 4CGZA 1RUC3 1G6NA 3H3UA 4Q27A 1DQ2A 4AEDB 3WHUA 3VDXA 2VXJA 2LRDA 3ZYRA 2OVUA 1Y0NA 2YX7A 4RQPC 5FZ8A 2WZR2 4K1YA 3WE2A 4MEXF 2H8RA 4V2FA 1DQ5A 4GH4B 5FROA 4TZDA 3ASOH 3NAUA 3MN2A 1KEXA 1RUG2 3FXJA 4HVOA 1WI3A 1XE7A 4GKXA 4CZZA 1HB2A 5T5PA 5KHKA 3OYDA 4PSXA 1N3OA 2WSUA 4E7HA 4M9ZA 2Q1FA 4OLLA 5JPMB 5IVYA 5A3PA 2EILH 5D5VB 5DXDA 2XJQA 4XEZA 4D7NA 2DT6A 4NOTA 2IGKA 1VBD2 4D7SA 5FZBA 1SANA 4QB6A 3BPVA 3M70A 4BLJA 2OJED 2KDZA 1NH3A 3DYOA 4MYEA 4JGZC 1FPN1 2KIUA 1R5ID 1GWKA 4AGRA 4ON0A 3KVAA 4KGGA 5C4WB 3D8CA 2NN8A 2OTJI 5IYBJ 2J5PA 3DKWA 2A1XA 3CJIC 2R7RA 1M06G 3PDQA 4KG0A 4XKVA 4HV6A 3VHOA 1YRZA 4ZYGA 1DQ0A 2B9UA 4PJNA 4DRRA 3WD5A 2OX0A 5BNNA 2XJSA 1B35A 3O0VA 5FZKA 3AMPA 4P9UA 5GAGJ 1I3HA 1R5HA 4Q26A 4D1QA 3S2HJ 5B2GB 1XMAA 5FMBA 1AZDA 1WMFA 4BJ6C 1N75A 1JJ6C 4CPBA 2F4IA 1S2BA 3MIHA 4NC8A 5H20A 5E8IA 5JXJA 2YU2A 2R0FA 2RKHA 4HF2A 1TME1 4B47A 2OXBA 5A7QA 4HLYA 2LC2A 1VBB2 4RL7A 5HV0A 2BW3A 3CO7C 4XF9A 1WHUA 1E5SA 2CW8A 5SV5A 3C18A 2CNAA 1TME3 5EV7A 1W7PB 1ENXA 1O7LA 4Z2WA 1VQ8I 3G1MA 1XU1A 5CVVA 2XAGA 2O3FA 1LESA 1QXPA 3HM5A 4LEJA 4LK1F 3CJRB 2ETEA 2AHQA 1UQXA 3FXRA 1CAVB 4MGTA 3NRUA 5E1ZB 2UXNA 2XVGA 4GB33 2FDKA 4M9XA 1S6LA 2VQUA 3FN9A 2I10A 2K9SA 1GUUA 2HWE2 5IYYA 1ETXA 3N05A 4QXCA 2KDOA 5CFDC 2L9LA 4ZDOA 4QQOA 4E4DX 4DOUA 3HOZJ 2V79A 2X5IC 3IPVA 1NZCA 1R49A 3EQEA 4KIGA 1LHUA 4FTHA 2A6WA 3ZXLA 2CH0A 2ELKA 3TEXA 4Q0VA 5C8CA 1FBQA 3WQ1A 3BQYA 4N7UA 1HJFA 1MEC2 1PM7A 3AP4A 4KA4A 2OPKA 1W2TA 3MYXA 5EJ3A 1YJ9I 3WDWA 2KM2A 1ONVA 3TO7A 4NBQA 4EGYA 4DYQA 3OR2C 3DGTA 3JSPA 4A7KA 4FBFA 1PMIA 2Q0AA 1IS5A 4JDNA 3A1YA 2EJRA 3OY8A 2VCCA 1R1TA 3Q8FA 3MEXA 4RGGA 2RHPA 4QX1A 3VSKA 3FHAA 1K42A 3KE2A 3I4PA 1U0JA 2D43A 5CVUA 4ZDLA 3BZCA 3RDIA 4L18B 3AP6A 5ERLA 1GLHA 5AVPA 1IC8A 3L9FA 4RGSA 4KWJA 2RS52 5DM7F 1FT9A 1RIOH 5HI0A 4B44A 5K8SA 2YFZA 3KETA 1MACA 1VQOI 4HDVA 3POJA 3WF3A 4C8DA 1GHCA 2RJKA 4NDLA 3DV8A 5FZMA 1OUXA 1JKOC 2V1UA 2EICA 1YW9A 3CCVI 1LEAA 1MIJA 1O6UA 1GVJA 3AB0A 5GJ6A 4HSTA 1UYPA 2EXJA 1WLDA 1ZARA 4Y3OA 1Q5OA 4JDMA 3O1VA 3IN9A 3VBFA 1KQ9A 3M7AA 5F6LB 1R71A 4CCMA 4E6KG 3SC7X 2ZEYA 3ZFGA 3K1PA 3BR5A 5JVGF 1PGL2 3AXDA 3IMMA 3THCA 4LBNA 2ZGKA 2DW4A 2IT0A 4D5CA 2BWCA 4B8EA 4GALA 1HQWA 4ES9A 2O03A 1XGNA 5BQTA 1YEWA 2NLRA 2K9QA 3SNMA 3ONQA 4M3FA 4B1RA 1BLZA 3WF1A 3U10A 1NYWA 3WF0A 3AMNA 3ZMDA 3KLSA 2HVQA 2CAVA 4GIQA 4IV3B 1BI1A 1NG6A 4MGIE 1ENSA 3R05A 3GTMJ 1F9NA 4UF0B 1QU3A 2MC3A 2OS2A 5HPOA 3OS0A 1SLTA 1KQ0A 3R61A 4NRMA 3TMOA 1W2AX 3OL4A 2RM21 3GHNA 1SFXA 1AL22 3FFZA 1HC8A 2UYAA 3MFAA 4KMFA 1HF0A 3ZXSA 1N77A 4Q4V2 1YC61 2RM23 4Q8KA 1J7KA 4XF0A 1YFWA 3OG2A 4B4CA 2ZKLA 3K1MA 2MLGA 3O0WA 3KZZA 3MICA 3GCWA 1W5CC 4BLIA 5LZ6A 5EGOA 4B8XA 3NKGA 3AL0C 2LKXA 5A3NA 5BNOB 1DGRM 3C2HA 3CMYA 4ENKA 1MQTA 3S7IA 3ME2A 5JDBA 5FZ1A 3WTVC 2VQ0A 2BYVE 4QPQA 2ZO4A 3IM0A 3U07A 1ERDA 3H92A 1JZ5A 2BWAA 2YC0A 2CHHA 4L97A 5ABJA 2FJ1A 1UPIA 1AR92 2LM3A 2TCTA 1FAYA 1PO21 5FZGA 3ZFFA 1WKYA 1SVLA 5A3LA 2V1NA 1IGOA 1JYXA 2VXZA 4EQVA 1XXNA 1MBKA 2TRTA 1PO23 1AR81 5A7PA 4R79A 1X50A 2GA1A 4RGUA 1MBHA 1Y1VJ 4LLGF 3WW2A 4TSVA 4HANA 4Y20A 5EG0B 1AR83 2YHJA 1R081 4CU6A 4UYBA 4ZC3A 3ZIXA 4FT8A 2RG4A 4QPYA 2IZWA 1T2XA 3ZMNA 1LEDA 1CJDA 1FOKA 4XJAA 1R083 3HOXJ 4XM3A 1QVUA 4AZZA 3I49A 4XCBA 2BHYA 2QF7A 3JRGA 4PUSA 4JX5A 1CD3G 1LJ9A 3FLRA 4WM7A 2VCAA 4F83A 3NJXA 4HOBA 2X6WA 4Q47A 2HQ5A 1BHGA 1OR7A 4RHV1 1D4M2 3K2ZA 3JB4C 2W91A 3TW7A 1OQ1A 3NNJA 2LY2A 3VDCA 4BY7J 4RHV3 4LK7A 1UAIA 2D5FA 2WS92 4NHYA 1OXCA 4FVVA 3FFQA 1FOD2 3BQZA 4LQRA 5EEGA 1I27A 1LKXA 2FQPA 1TT5B 3OYAA 3W21A 3J4UH 1A35A 3GF2A 3KV6A 5I8TA 3HHHA 3AG1H 4IEQA 3T30A 3LE0A 3SQNA 3LWCA 2VJ4A 3I2FA 4BJ5C 1Q8OA 4RDUA 3I2HA 2DA7A 2QBYA 3H0DA 1V70A 4JQFA 1V6MA 1BMV1 3RQ0A 1W2OA 2V9VA 4FI9A 1B4AA 4KL1A 4IL7A 4QPIB 4P9LA 2YYOA 2GXGA 5IAXA 2JK3A 4CXXA 3WTUC 4U0VA 3ZQFA 4CZCA 3ACFA 2B5HA 4DNYA 1W8UA 4KUMA 1Q3EA 4CCCA 2VMHA 2XKOA 1WZXA 1IXRC 5DZEA 1KS4A 3IAS2 2C9AA 1T6GC 3WNOA 1W06A 2UU8A 1W9FA 1ZZ6A 4QB2A 2NPIA 1GNZA 1Y9MA 1H8TC 1WCMJ 5CKQA 2CS3A 1GDTA 1GUIA 3VD5A 2ENRA 4Y1YA 5L3DA 3RWKX 4L5JA 5FXVA 2K46A 4XJ9A 3KP4A 1UCXA 2WA4A 1SZBA 3SKVA 3ZYBA 3TNQA 4M0HA 1CZTA 4BQ4A 2XVCA 2Z4FA 2KRHA 3VBHC 2NRAC 1ZYRF 2BNNA 4NHLA 3A0BC 4AFBA 4JCKA 1QHDA 5H9RA 5JXIA 3AYCA 4P00B 1YFYA 3K69A 2K4BA 4A93J 5JIAA 1JOBA 2D6NA 2JIJA 1WLTA 2DDBA 3UESA 3USUB 3OOPA 4HX4A 3TP0A 4Z82A 5A7WB 4I30A 1KQRA 2O8QA 3GTQJ 4DO0A 1TW2A 1MH3A 3VB9A 4CCKA 2VQCA 4UXNA 1QBJA 2YPJA 3WG9A 4HQMA 4B1MA 4LB5A 4IJAA 1LDKB 2VTXJ 4AEDA 2ZFWA 5M3FJ 2BTVC 3WLUA 4XKCA 2KIQA 4OZXA 1YI9A 3VDDB 4JGZB 4GH4A 1X4OA 4AEKA 3OYCA 2QEXI 4EN0A 1W8OA 4YIIA 3H7YA 4UWDA 1LHVA 2GDFA 3GJBA 1LOFA 4QDRA 1I3QJ 1Y4WA 4AYBA 2HZTA 1I6HJ 2V72A 3CJIB 1RHI1 3V0BB 1V55H 3S2DJ 3V7CA 3B00A 3CUQC 1QDCA 2VC9A 2L3DA 2DV9A 3OEAA 3KLOA 2RR13 1WWYA 1V0AA 2OUHA 1FPQA 3VYRB 1JU4A 1WA4A 1RR7A 3O1UA 2WYSA 3FLTA 5BNPA 2UY8A 4RLFA 2M8EA 1BIAA 4IW3A 3POBA 1U9NA 4YVWB 2JDMA 4XHXA 2K7LA 4JAAA 1QJX2 4RGRA 2O8XA 4CCNA 4QQPA 3RYPA 4XJZA 1OQYA 4A45A 3F6OA 3NRVA 4ISQA 1IUFA 2FQ3A 2XH6A 1X1AA 5KXEA 4AQSA 3E6CC 1WA6X 2R5ZB 5CB7A 1PNFA 2PQQA 1XPXA 5I8YA 5CG9A 2XMLA 1PJRA 4WM8B 3PSFA 3WG4A 4YZ1A 4YFKF 1BQPA 3FMQA 4IOAF 3JU9A 4XUPA 5HDNA 5JHUA 5D4SA 3P7NA 2VC1A 3ABKH 2KZGA 3POIA 2RS31 2TBVA 2HDWA 4KIFA 4IEVA 5HCFA 2K3FA 2A75A 4C0HA 2RS33 4NHJA 1A8MA 4FPHA 3VL9A 1LNSA 2XGDA 2BY2A 2G1MA 2WNUC 2X10A 1MMAA 3U2RA 4QGMA 5FP3A 1ENHA 4NMIA 5CFDB 3FBIB 1FMWA 2L7FP 2V7FA 2GMEA 4KH9A 1CJPA 1WLCA 4M71A 1OJLA 3ZSLA 4CYCB 5LBEA 1OCCH 4OUSA 4Q4W3 2HNHA 3E5QA 5J1RA 2HYXA 5DPNA 1ETVA 2H8WA 3M07A 2L54A 2QQOA 3CCEI 4E7KA 2EB7A 4XZPA 1X9TA 4XLFA 1W7PA 4JP0A 4QHOA 2XF5A 3P6BA 4XBNA 1AHSA 2HYJA 4E70A 1JH5A 2QM3A 4PF1A 4P9XA 3PIOF