3I59B

Crystal structure of mtbcrp in complex with n6-camp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
202
Chain Sequence
SHMDEILARAGIFQGVETKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLDVPGRVAKQLLQLAQRFGTLRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
molecule keywords Transcriptional regulator, Crp/Fnr family
total genus 47
structure length 202
sequence length 217
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00027 cNMP_binding Cyclic nucleotide-binding domain
B PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i59B02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i59B01
4LA3A 2W25A 1XN7A 3TNPB 4KIFA 1WLTA 1BI0A 2STTA 2IXLA 3WTWC 3BJAA 3ML6A 4QGLA 4HF0A 4BAYA 3U1DA 1R00A 2X4HA 4CHUA 3R4KA 5C8WA 3DQVC 1BM9A 4EGYA 4KU7A 4XSZF 1HKSA 1IN5A 3VHRA 2ZKZA 3ZMSA 2O0YA 2A61A 4XF9A 4G9YA 1ZG3A 3PQJA 1GHCA 1ZGAA 1CGPA 5FO5A 2WFPA 1Q43A 3C18A 3BWGA 3VEPA 4A6EA 5BPXA 5CVUA 1XSVA 1UCXA 1J75A 2VBYA 4KL1A 5DEQA 1JE8A 3ZMVA 3E5UA 3J80Z 2VN2A 4IRHA 3NQOA 2KIFA 4RAYA 3JW4A 3ETQA 3IWZA 1FNNA 3LAJA 1T6SA 2D5HA 2PQQA 3PNAA 1GQGA 3NRVA 3T5XA 1BC8C 3V8KA 2VC1A 2MLKA 2L01A 4UXNA 1RUNA 4BNCA 5F64A 5ICGA 2Q8KA 4L9JA 2CSOA 5I8TA 2B0LA 1PDNC 3JAMK 4KFCA 2IA1A 1RC6A 4HZFA 4Q0VA 4XFFA 3HYIA 4E70A 3QP5A 1F1ZA 5D5XB 3IKVA 3M8EA 2E1CA 3FZ3A 4AVBA 2D93A 2HJIA 3OTFA 3CLOA 3SFZA 1UFMA 4O9GA 5KBFA 3ZMUA 4AIJA 4EJVA 4ONUA 3TO9A 3M70A 4XFCA 2HWVA 4X6QB 2O6GE 1G3TA 3SXWA 2WWYA 1Z6RA 2VBZA 2EFNA 5LLQA 1P2FA 2HYFA 1IF1A 3LOIA 2JZYA 5J7MA 4P9GA 1IZ1A 2TDXA 5D6EA 1PM7A 4LK0F 4O6JA 1YIOA 3GF2A 4OMYA 2KKOA 3MCZA 2DK8A 2P6SA 4PCQA 1AOYA 1MJAA 1CAWA 5E17F 1STZA 4G8XA 1OFNA 1J0RA 2PAMA 3BDDA 2D1VA 2X0LA 3MFKA 1XE7A 2XL7A 5I0TA 2V6CA 4A2UA 1J3RA 3HSRA 3BU7A 3F22A 3E3VA 1HW2A 4KMFA 3IBMA 2FMYA 3HIFA 4R8HA 4L9VA 1QBJA 3PVBB 4RGSA 1O57A 2O1QA 4KIBA 3IRRA 4UVAA 1I5ZA 3VODA 5FD5A 1T2KA 2OQGA 4IEVA 1QO0D 2M5WA 4G7ZF 2IXCA 3I54A 2XV4S 3ZQ7A 3O6BB 2O61A 3JZVA 5DD4A 1MZBA 2HKXA 3TKYA 3SCHA 1XSXA 2GIVA 2VC0A 2QWWA 1IUYA 4QGMA 1WWXA 3IHUA 1O4TA 2HKOA 1YQAA 3P9CA 1FYMA 3H1YA 1O3QA 4LMYA 3DKWA 3JAMZ 4YFNF 1W4MA 2Q0AA 4D7TA 2O8QA 1TNTA 4IESA 1PP8F 1YTYA 2P5KA 3K1NA 2PLYA 1FOKA 3BJOA 1ODDA 4DINB 3ZMZA 3I0TA 2ELHA 4KT5C 2VE9A 2P5LC 3FZVA 2P6TA 1ZG1A 3M3IA 1SFUA 1S7AA 2F5EA 5H6RA 1U5TB 3WTTC 2FF4A 4ORFA 3GVAA 1R1VA 1O7FA 2QBYB 2FBKA 1TQPA 1QWRA 4IJAA 5HDKA 1LEAA 2ATFA 4MZUA 1Z6TA 2DPUA 4LLGF 1QPMA 2ADUA 1CAVA 4RS8A 5TJJA 5L3BA 5L3CA 1CF7A 1F9NA 5LHGA 4HN1A 1IPJA 2FE3A 5FPZA 4G7OF 1H9TA 4L18B 1RL3A 1XB4A 2Y75A 1ZZ9A 1ZLKA 1YFYA 4ZYEA 2J5OA 2OA4A 2L3DA 1D8KA 1RUOA 1WGPA 4P55A 2J5PA 1XE8A 2CO5A 3P9KA 4CICA 1KYZA 3KP2A 1UIKA 4LULA 2HQRA 3O14A 1EP0A 3ISPA 4XRFA 2GC3A 2RKHA 1I27A 3EBRA 3KEOA 1TTYA 1USSA 3CO2A 2ZNZA 4M9XA 3HT1A 2A07F 1LDDA 3CL1A 1FSHA 4KWJA 2Y48A 3L9FA 1L3JA 2VXZA 1KQ8A 5FB2A 1X8EA 3ELKA 4PIYA 1LJ9A 5LRRA 1C0WA 1EH7A 2Y0OA 4AIHA 2Y0MA 5BV6A 1MD0A 4E2SA 3KSCA 2QDRA 1BI1A 2EFPA 5L3FA 2O03A 4X6RB 4I0AA 4Q4ZF 2RNJA 5BUVA 3LA2A 4HDVA 3PLQA 1FSEA 1ZZBA 4YYOA 1ZHFA 4J1WA 4IEUA 4OIRF 3C3WA 4CO8A 3GWZA 3D0JA 2ETEA 2V1DA 2V9VA 1XCBA 2RDPA 2H0VA 1W7PD 3QAHA 3T1BA 4LUKA 1ZRDA 4ASNA 4Q0UA 2BNMA 2PEXA 4FAGA 1FYKA 4N0BA 1HKTA 1IN7A 1TBXA 2H6CA 1HKQA 2G7HA 3OD0A 2Z69A 2F2EA 2HFHA 5JSRA 4XLPF 2ZKLA 5I91A 5KVRA 3HRTA 3T0YA 4Q0QA 2RC4A 5BS6A 2ZFWA 4ESJA 2DCTA 1YS6A 5EEGA 5LGUA 3H50A 3EYIA 4NHJA 4UVCA 1HSTA 1BI2A 1CX4A 2DTRA 4L2NA 5DUIA 1TNSA 2JTVA 4JTNA 2DI3A 4KIGA 1RI7A 3M1EA 1U6GA 4EM1A 3JSOA 2PA7A 2COMA 2DPDA 2GXGA 1NE4A 5DCFA 3TOBA 3NEUA 5CU1A 4AXOA 4I0BA 2E1NA 1SD6A 1KU7A 1ZRRA 4YSFA 1V4RA 4TLFA 1LQ1A 2OZJA 3S0MA 4KUMA 4KU8A 1AWCA 2M1BA 1WI9A 3SMHA 2V1UA 2H6BA 1A04A 2WTEA 1YFUA 2XAHA 1RIOH 1CAXB 4EJOA 3MWMA 2MPFA 3RDIA 1IRFA 4LJZF 3COAC 1UHWA 2Z3YA 5FCCA 3WTUC 4UXAA 4OFGA 1YHFA 4ZYGA 3DN7A 4IHSA 1G6NA 3H9AA 1OYYA 2BYVE 3V7CA 4L5JA 2QENA 1XDUA 2XL9A 3HOSA 1LB2A 4QLCU 5I8SA 5A2QK 1DUXC 5DCMB 4UHTA 2CW0F 4WVZA 1HSJA 3I71A 4MTEA 4MNUA 3VFZA 3MDPA 3P9IA 2MBFA 4A0YA 1WSUA 2QVSB 4LEJA 4PIZA 1UD1A 1MJBA 5EFUA 4AVCA 3QU3A 3LQRA 3E6BA 2JRTA 3E6DA 5F6FA 5IT3A 2NS0A 3SZPA 5HS7A 2EAAA 3R60A 4BIFA 3SCFA 1R1UA 2IP2A 1FLIA 2VQAA 3EHKA 4KN7X 4UNOA 5K5OA 4JTOA 3QOPA 3RKXA 1SFXA 2EFWA 2QCSB 2H09A 3RI4A 5E18F 4Q47A 4MHGA 1FBSA 4UBGA 4LUMA 2BNNA 2VE8A 1YW7A 3U11A 3U0ZA 2L4MA 2E9QA 3OGJA 2PFBA 4ZYDA 4XFIA 2KJBA 4WF2A 2QJVA 4QGNA 3KP7A 5K5RA 2RVCA 5LEKA 2DO7A 4MEXF 1FP2A 4L9TA 1LEBA 3HRUA 2EA4A 4KWKA 2P5VA 3DV8A 3I5UA 1UIJA 3KLOA 1BIBA 2ETHA 3F8CA 1UPIA 5BPDA 4U88A 5HS9A 5ED4A 2PAKA 1R7JA 5JCTA 3M7GA 2PN6A 2YX4A 4ZU4A 2EA2A 2L4AA 5J6XA 3CF6E 4EM2A 5TRDA 4WXCA 3OOPA 1T39A 3KMHA 1ZRCA 1CAWB 1IXCA 3U2RA 4RB2C 1P4AA 1MJ9A 5E1RA 2K4JA 4HMZA 5ILSA 3P7NA 2O8XA 3H92A 3RIRA 1QY4A 4N9HA 2HR3A 4KDPA 4L0YB 1YG2A 1O7LA 4EGZA 1EV7A 4LK1F 2CAVA 2PHDA 2CG4A 4MV2A 2QM3A 4OIQF 2PBIA 4IEOA 4AWXB 3E6CC 3H8UA 3FMSA 3FE5A 3D82A 3WGGA 4LLNA 3GFIA 5D5UB 1P4WA 1K78B 4B8XA 3HSFA 2IRFG 2G7UA 3IWFA 2L54A 1JHHA 4OIOF 1MDMA 3FXQA 2MLGA 2K4BA 4P9UA 3QP6A 5D4RA 2RQPA 4HYEA 1DZTA 4YNIA 3ABUA 5DDGA 3TDZC 4KMUX 5E1ZB 1ON1A 3GFMA 1F4KA 2OYZA 1PP7U 1JXSA 4IEZA 5FLIA 4DQ2A 1DZRA 3UKNA 1FXZA 1ZZ7A 2QQBA 2W84A 5BOXA 1K78A 3FF5A 2CGPA 4XBFA 1RZ4A 1SD7A 1QXJA 3KCCA 4M72A 3WTXC 4OLLA 4MGYE 4E2GA 3HSEA 2CYYA 4A5MA 2EV5A 2NYXA 4EJTA 4RGXA 4PJYA 4UUVA 2QNKA 2CQKA 2ZXJA 3N4MA 3H1WA 4GO1A 2GAUA 5CVVA 5I0SA 1JUHA 2Z2SB 3GLXA 5F1RA 3HTUA 4HSLA 1YLFA 4IEWA 1Q1HA 3E97A 4I3PA 1U5TA 2QZ8A 3ZPLA 2IVMA 2CWEA 1U2WA 5J8FA 2Z33A 4A6DA 2FRHA 4G6QA 3GO5A 1FI2A 3WE3A 1J3QA 4Q0SA 4I09A 1R5GA 1Z7UA 4KNYA 1KYWA 5ILVA 1FBQA 1ZLJA 4WBBA 3WW3A 3KP6A 2D45A 2JPBA 3IDCB 5JHUA 3EQEA 3C7JA 3FM5A 3GYDA 2OU2A 4BHCA 3SHFA 2PG4A 2MH2A 1NXMA 4FAHA 4LB6B 2HDCA 3GEZA 2JSCA 5LGTA 5FDBA 3S7IA 2HGCA 3T8RA 3WTVC 1D3YA 1K79A 1W5SA 1S29A 2XGXA 1FZPB 1BIAA 3QPTA 5CJ9A 3TDUC 4WZCA 3SXYA 3FHIB 1FBUA 2FNAA 5ILUA 1S6LA 1EH6A 2Q0OA 1SFNA 1XCVA 3RKYA 3HQXA 2P8TA 2UZKA 4QX5A 1BC7C 1R36A 3HHHA 3K1PA 3BPVA 3WTZA 1KU3A 4EROA 1JGSA 1SD5A 4Z2YA 2H27A 4O9EA 1YW8A 2C0ZA 2JT1A 4M71A 4YIIA 3B73A 2F5DA 2OAZA 5CYVA 2LNBA 4GGGA 3VB2A 4NQWA 4AQ6A 3DXJF 1GQHA 4H0EA 3U9GA 3GX4X 2FBHA 1RNLA 3BP8A 3DL3A 2OPKA 4EJWA 3K9TA 2PTMA 4XFBA 4HBLA 3ZMDA 2KJCA 2A69F 1XMKA 1YWKA 4FBFA 2DFIA 3F3XA 5KHKA 2K86A 1J2XA 5LRSA 3ZMTA 4HV6A 2YPRA 1OR7A 5IT9Z 2ZO4A 1ZGJA 3FX3A 2LSOA 2MC3A 1YFXA 3WTYC 1EY2A 2L02A 2UYBA 4GULA 2FBIA 2UXXA 1VR3A 1OYIA 4RGUA 4R1HA 1D5VA 4ESBA 1V3FA 3ABTA 2W57A 4M73A 1MGTA 3N97A 3KZYA 2ZMEB 1S3JA 3LA3A 1REPC 1J58A 4Z82A 3HUGA 3H3UA 1F5TA 4QM9A 4YIFA 3L2CA 5KK1A 1O3RA 5HLHA 3KGZA 2NNYA 4EWEA 1T38A 3CUQA 4YARA 1CAXA 3BOQA 2VONA 4OMZA 1NZCA 3IKTA 5A2QZ 2PJPA 3ACLA 1QXRA 3LQQA 3CLPA 3WE2A 3BB6A 2MD5A 1SAXA 3PFIA 2DQLA 3LSTA 3EO6A 3ZDSA 1J59A 4KICA 3RKWA 3EDPA 4PDKA 2VBWA 5DCMA 2EVXA 4ZYHA 2E7XA 4A0ZA 2OBPA 1SD4A 2LKPA 2EJRA 3WW4A 4A0XA 4CXFA 4J1XA 2K02A 2R7FA 3RPUA 1ZAOA 1B9NA 1MKMA 2H94A 3F8NA 4P9FA 4UV9A 2ZNYA 4CGZA 3WW2A 2ISZA 4GXOA 3NSTA 5HLGA 1BBYA 5EEHA 4ENMA 1OMIA 5KHGA 2GWRA 4LG0A 4U7DA 2Q1ZB 2B8MA 2DAOA 3CO6C 3E5QA 3ZP5A 2E7WA 4YG2F 1KGSA 3USSA 1YS7A 3F8FA 2XKOA 4I7HA 2EV6A 3EQLF 2Q2EA 4L5IA 4U0YA 1WKMA 4Q5SF 3DPLC 4R79A 1X3UA 5LHHA 2DQRA 4MGIE 3QRFF 5E1WA 2CFXA 1YO5C 3JTGA 1RGSA 5E1XA 3CUQB 2R7DA 3KFWX 3IC7A 1H9GA 1NE6A 1YYVA 4P96A 4CYDA 4Y17A 4EV0A 4HA8A 2BNOA 5I0UA 1FWZA 4Q48A 4XFAA 4S04A 1G3WA 1B4AA 1XGSA 4RB1A 2V79A 1IN6A 4PIXA 1D8JA 3CDHA 5FQ0B 4EWAA 5BQTA 4MGZE 1UB9A 2RGVA 1U3EM 4CDGA 1TW3A 2F4PA 3RYKA 4HDUA 1QGPA 3SQNA 3W6KB 2XVCA 4HOBA 3V7SA 1P4XA 1Y0UA 2XAQA 1O3SA 3H3ZA 3RZZA 5HVQC 2BGCA 4U0VA 1P92A 2P7CB 5E8GA 2FA5A 4QMAA 1FT9A 1Z9CA 2QBYA 1R23A 2QQ9A 5K8SA 2Z99A 2WV0A 1KQ9A 5HOOA 1Z05A 1UCRA 2BV6A 5JR3A 3HTSB 1TQMA 5HDGA 1S7OA 2IW5A 2M8EA 3FM3A 2VT3A 4RB3C 1I6XA 6PAXA 4WX9A 4LG0B 4I02A 2FU4A 2D1HA 1OI6A 3L2HA 4A5NA 3ST7A 1J7KA 2IA2A 4EWDA 3SHRA 1YUDA 2GA1A 1YLLA 3CUQC 1I1SA 2OZUA 1WA4A 2V1XA 1OD5A 3OF1A 1L3LA 2Z5UA 3G73A 3K2ZA 5E8IA 4JK1X 2KRFA 4YFKF 3BY6A 1SEFA 5D8KB 3KP3A 3RYPA 4IVNA 1H1MA 4H7LA 2XRNA 1NYWA 3B02A 4R52A 5J3UA 5FQ0A 5C6CA 3I58A 2GU9A 4I2OA 1QZYA 3O3KA 1WQ2A 3JSPA 4UBHA 3D0SA 4IEXA 4AVPA 1FPQA 3ZN0A 1O5UA 4ZU5A 4N9IA 3VOEA 3KLNA 3LAPA 2GC1A 2EB7A 2ZCWA 2OA2A 1CAVB 4EVIA 5CVJA 5H6QA 3FXUA 1QZZA 1CF7B 1G4DA 4PZJA 3GUDA 3REOA 3MPBA 3ERED 2LF8A 2IPQX 2UWMA 2PFWA 4UV8A 1ZYRF 4QXKA 3L7WA 4F7ZA 2ZJ2A 4MUVA 3F21A 1GXPA 1LDKB 2XKPA 1IPKA 1HW1A 2QLZA 3KP4A 5DV5A 4Y13A 3BALA 4L11A 2PYTA 4IEQA 2YX7A 1XMAA 2P17A 2B5HA 4LD5A 2IT0A 3I53A 3S2WA 1H1IA 4JVAA 2M30A 4FHTA 4Y15A 3UKTA 1CAUB 1DGRA 2XLAA 5D8LB 4K2EA 3BPXA 3AAFA 4OOIA 2PMHA 3WW1A 1IN8A 3HHGA 4AD9A 4BH9A 1TLHB 3NW4A 4HLTA 3JTHA 4M6XA 3V8LA 2K7LA 4ENJA 2OZ6A 2PI0A 2B9UA 1TW2A 1QNTA 2IXJA 2ESHA 3OCPA 1EYBA 5JFRA 4PGHA 3QU6A 3H7YA 1USTA 4WK8F 2YSRA 4ZZDA 2HZTA 5BXXA 1I1GA 4L9NA 1Q5OA 1FX7A 4OU0A 2AXLA 3FJSA 5KHIA 5H20A 1Q3EA 5HLIA 3TO7A 2DLLA 2FEZA 2VOOA 1KU9A 1BN5A 3Q9VA 3MQ0A 3Q9SA 1MDMB 2QVOA 1U78A 3FMQA 2UXNA 4I01A 2UYAA 3R0JA 4YFXF 1BI3A 4XEZA 3TQNA 3WGHA 1E2XA 3TNQA 1G3SA 3T8TA 2FOKA 4RB0A 3BPZA 4MQVA 4B09A 1IXRC 1B59A 1BOAA 1XRUA 2DU9A 1ZARA 1LVAA 3CTAA 3M8FA 4IEYA 2IXKA 5E20A 4WXDA 4M6YA 4HVOA 3GZ5A 4LLLA 4HAMA 3V8JA 1Y3TA 1RTVA 1U8RA 4Q29A 1SQ4A 3I4PA 2RN7A 3G3ZA 3ECOA 1VJ2A 4HLYA 2EV0A 1DPUA 3FMRA 5K1YA 3ULQB 4I98B 5LHIA 2K0GA 1HW5A 4WCGA 1FYLA 3S7EA 5I8YA 4XFGA 5HS8A 2PQ8A 2XAJA 4HF2A 1J3PA 1ZZ6A 4XF0A 2EFOA 2K27A 2P7VB 3UKVA 1JHFA 2YU3A 5L3EA 1ZN2A 4S05A 4ZH4F 2ET7A 2FXAA 4KYWA 4FX0A 3I59A 5HDNA 4AVAA 5ICEA 1YFHA 4UVBA 5AIPA 4HLXA 1O5LA 5DUKA 3RPQA 2Z9OA 5L3DA 1Z91A 1XSDA 1ZZCA 3QPHA 2IXIA 1IN4A 1VTNC 3WU1B 4BHBA 2BE5F 2F5FA 1KU2A 2QUFA 3CO7C 1LR5A 3MYXA 5KHHA 4LB5A 1XGMA 5I93A 3H7JA 3E6MA 2VPVA 2DBBA 2MA3A 5CADA 3WTSC 3K69A 2Q4SA 2FQPA 4IETA 5CLSA 3RTRA 2ET1A 4JV4A 2KIUA 3ES4A 4A12A 1OYWA 5FFXA 3GBFA 2FSWA 4OIPF 4HBNA 1HBXG 3GFJA 4NVPA 2KIMA 3SCGA 3FWEA 4HF1A 1ONVA 3DPTA 4LA2A 4RAZA 2P4WA 1FY7A 5AONA 2VT2A 4L0ZB 2DW4A 1S8NA 3GW2A 3I64A 2ZBKA 3C1DA 4U0WA 5I0RA 4TV7A 2MH9A 1B9MA 1TQ5A 1YFWA 2IXHA 4IXAA 3ELNA 2NAZA 1GVJA 3RYRA 3KZZA 3KP5A 3NJZA 3DF8A 3FXRA 4IF4A 3BROA 1H0MA 4O3MA 2GZWA 5CVRA 1K6OA 5T3NA 1R22A 2OQRA 5IT9K 2NRAC 2HTSA 1SMTA 4LTAA 2R3SA 2FNPA 3OV8A 1U12A 4IHTA 4MH0E 1ULYA 4NB5A 4RGRA 5AVPA 2QYOA 5JSOA 1G3YA 5JI6A 5FFZA 1J5YA 2QQAA 2WC2A 5AIQA 5E16A 1DP7P 2D5FA 2XLGA 2EFQA 1IAWA 5ICCA 1DGWA 3EETA 1NHAA 5D1IA 4Z07A 4XF4A 2XASA 3WG9A 3BCWA 2GC2A 3CJNA 5BMZA 3CJXA 1UW8A 3FFQA 3MEXA 2A3SA 1OPCA 1T0FA 2XHKA 4IERA 1LNWA 1K7AA 4JQFA 3GFLA 2A5YB 3NVCA 3R61A 4ETSA 5JR7B 5BPIA 4IPAA 2HQNA 4M9ZA 4RD7A 1T98A 2G9WA 1PUEE 2UY8A 1E17A 3CUOA 4KA4A 4XF3A 3R6SA 3HOTA 2W85A 2OD5A 2PAEA 1QQIA 3C3VA 5L3GA 4XFHA 2HOEA 4B29A 1J1LA 2JPCA 4EM0B 5JSPA 2IC1A 4XLNF 3IDBB 4LLOA 4CZZA 3ES1A 2EA7A 5FLJA 2D40A 1LDJA 5ERIA 1O3TA 1P6RA 3DFGA 2KXLA 1Z1DA 3F8BA 3QACA 5FPXA 3PQKA 1ZREA 3SZTA 5FLXZ 2ACJA 1W5TA 3G7DA 5CVIA 2CV6A 4HV5A 3L00A 2M45A 5D6FA 1FP1D 3F8MA 3HRMA 2BEOA 4KN4X 4FT8A 1EPZA 3I59B 3I7DA 3BZ6A 4YRDA 3F72A 2XUBA 1KQ0A 1HXDA 4META 1LKNA 1XDSA 4BXUA 4BQAA 2I45A 5DYMA 4HX4A 4G94A 2DK5A 2VBXA 4OINF 3WODF 3F23A 2A6EF 2IJLA 1WRJA 5JVTA 3EYYA 1ZH5A 3KE2A 3ZN1A 1DDNA 5D5VB 4ON0A 2NNNA 2CAUA 3J81Z 1X8MA 2DT5A 1IW7F 2HS5A 3MZHA 2XLFA 3D5LA 4MGKE 5EZWA 5D5WB 4GYIA 4HX7A 3ROUA 5DD8A 3RJPA 4EQQA 3GYHX 1ON2A 3U10A 2IA0A 3HRSA 3CEWA 1DPRA 1XD7A 2Q30A 3DP7A 2GC0A 4P5OA 3GZ6A 1IRGA 1Y9QA 2YR2A 3LA7A 5JAXA 3V4GA 2XAGA 5J8CA 2A6HF 4HW0A 1U5TC 2GA2A 3LFKA 4MEYF 4BHPA 3IRQA 1LRHA 2FMLA 2HTJA 4EMSA 1FC3A 1KA8A 4JBAA 4IEPA 4ENNA 3O2PE 2STWA 1VP6A 3DEUA 3WU0A 1XGOA 4MX3A 2A68F 3GXOA 3TGNA 4QM8A 4ZU7A 4O5VA 5LBQA 3IL2A 3LAGA 1R58A 3M9AA 1ZRFA 4Q0PA 2ZMEA 4AQ2A 4HVRA 1IXSB 1TQIA 1CAUA 1B1BA 3F6OA 2N7GA 3ECHA 2F5CA 1SFEA 1OKRA 4MGRA 4MTDA 4HN0A 2GH2A 2BBYA 2AS5F 5FLXK 2D2WA 2GXBA 4IRGA 4D7SA 3LZZA 3KGLA 1ZVFA 1ZX5A 1W7PA 1R1TA 4HQMA 3L09A 3MZYA 2MHFA 3HT2A 2GQQA 4MQ9F 5ICFA 3LWCA 3K0LA 5HI0A 4LFUA 1GXQA 1L0OC 4D0PA 2ISYA 1UHMA 1SMYF 1YW9A 4E2QA 4HX8A 4GYGA 2UY9A 5LGNA 2VOPA 3K1MA 1PMIA 2K9ZA 3WGIA 3MAJA 1ZZ8A 5BY5A 2W24A 2LF7A 2EWNA 3TOAA 4KWLA 3LWFA 1W7PB 2XAFA 1R5HA 3V7RA 3FHZA 4HSJA 3EJKA 3J81K 1XGNA 4M74A 5FLHA 5D4SA 4IRIA 2PMUA 4HQEA 4WWCA 5LEJA 4FX4A 4WXHA 1X82A 4F8AA 4EJUA 3J80K 2ESNA 3H1MA 2EK5A 3E5XA 4GCVA 3BJ6A 4XF1A 4G7HF 4K8FA 4ESFA 2XROA 4U7BA 5J48A 1EH8A 3TO6A 2FQ3A 3NKTA 2MNGA 1J9IA 5K5QA 2HYGD 4PGGA 4G6DA 5KHJA 3RNSA 1BJAA 1HQCA 2PHLA 4ZZLA 3EUHA 3KETA 1V70A 2M87A 3R0AA 4XSXF 5FGMA 2VODA 1ZG5A 2XIGA 4M9SA 3J7AO 2RV8A 2C6YA 3Q5FA 2VECA 4AIKA 3W6JB 3NL1A 4XETA 1B6AA 1ZNPA 4BYYA 3KEQA 3IIAA 4QWQA 2V09A 5FD6A 4HVQA 2O3FA 4ENKA 1X7NA 2LDUA 4LGWA 3F6VA 2HEOA 4DNCA
chains in the Genus database with same CATH superfamily
4LA3A 2X85A 2AACA 4UY8I 4YIRX 3WG4A 3OYAA 2IXLA 4CEWA 1SLIA 2EIKH 4O61A 2OIIA 1OCCH 4HF0A 2VKEA 4A42A 3JCIA 4XDOA 3R4KA 5F5IA 2XJPA 2BTVC 4MGQA 3AJYA 3ZMSA 3KB5A 1OQYA 4G9YA 4E4HA 1IUFA 5IFPA 4DOUA 1GHCA 3VN4A 2ZX4A 2WFF1 3C18A 2V4VA 2XG3A 5BPXA 4J01A 2XJUA 1W0PA 2R7WA 4D7YA 1XSVA 3LSGA 1U5XA 2A6YA 4L9BA 1BA5A 2R072 3E5UA 4IRHA 4BXSV 4L99A 2L7MP 5FKOA 4P9XA 3PNAA 4QX0A 1Q56A 1GQGA 1F31A 3V8KA 3M1CA 3ILRA 3Q8AA 1RUNA 4W1UA 1RUE3 3TWIA 1ULPA 3RZJA 1RETA 1PDNC 3SH3A 2KZVA 1RC6A 4Q0VA 4XFFA 2R7OA 2NS7A 4AAPA 3OUIA 1F1ZA 1D2QA 3GCWA 3OTFA 3CLOA 4RLQA 1UFMA 4NDLA 1HRI3 2WSVA 1LVKA 1RUG1 4A3MJ 4AIJA 4EJVA 2WAAA 3TO9A 3M70A 3VBHA 3SEEA 2AXTC 5GM0A 3AXDA 3M3OA 1M06G 2P34A 2VBZA 4A3KJ 5CNAA 3OYFA 2E71A 3LOIA 3HKZN 4B43A 1OD3A 2TDXA 2VL4A 5CAZA 4AHYA 4O6JA 4EYUA 1YIOA 4M0HA 1AXZA 5FJHA 1MJAA 1D2SA 3IB3A 2GNMA 5E17F 1OFNA 1LOBA 1CJDA 3MFKA 3HQUA 4A2UA 1OFCX 1CZSA 4NWVA 3F22A 1HW2A 3IBMA 1HKDA 3HIFA 4AF9A 4L9VA 1QBJA 3POFA 4RGSA 3AYAA 2PXJA 4UVAA 4IEVA 1E3OC 2IXCA 2JG9A 1FJLA 2WWSA 3WOGA 4I99C 3CZUA 2D3PA 3J7LA 3O6BB 4LE4A 2W7NA 1CZVA 4BQYA 4K1YA 3ZO0B 4XHXA 1YIPA 2ZMKA 2BWCA 2BQPA 4HNTA 2QWWA 5T5OA 1W2TA 4P02B 4ES8A 1YQAA 5LBEA 3TBDA 2KRCA 4DXRA 1OLRA 3KZ4C 4V2VA 1LGNA 1S7EA 1TNTA 4IESA 5FYHA 5JLVA 4FTEA 4MXWB 1PK6B 2P5KA 5CFDA 3K6GA 3ZMZA 3I0TA 2ELHA 1OT5A 2ZJQF 2F5EA 5CFDC 3RFRA 3HN1A 4ORFA 2ID6A 3GVAA 3T1LA 1YITI 4NC6A 2VW2A 1VBE3 1QWRA 5HDKA 1MNMC 1UPSA 2ATFA 4NC8A 4MZUA 5C3RA 4LLGF 3SFIA 1BVP1 2DBNA 1XXNA 1CAVA 2EQRA 2GN7A 1IRZA 1S0GA 5TJJA 2VZVA 3MPPG 5L3CA 1QU0A 2VZ3A 2DYCA 1WLCA 3KV6A 1BXHA 1PO11 3RQ0A 1W8FA 2Y75A 5DQ0A 2BY1A 4YGBA 1YFYA 4ZYEA 2J5OA 2OA4A 2QKDA 2WS92 2R063 1JKOC 1RMU1 1RB8G 4CICA 3O14A 5FPVA 2J1EA 1DU0A 1EP0A 2OW4A 2GC3A 2DUQA 2RKHA 3EBRA 4ZS2A 3KEOA 2P6HA 1USSA 2M7AA 4GWMA 3RQIA 4M9XA 3OR1C 1WBLA 4NIDA 1ZBE1 1LDDA 1FSHA 3L9FA 1KQ8A 1A8DA 5FRMA 1W5CC 4C91A 4Y22A 4UFLA 4XVHA 3RJ2X 2ARCA 2EIGA 2Y0OA 4QQ2A 3M4OJ 3C7HA 3CCJI 1RR7A 1NCRB 4QQHA 2E35A 5FZBA 3KSCA 3T30A 3L2QA 2HWC3 4G6TB 2O03A 4X6RB 5DDJ3 2WO2A 4H14A 2DVDA 3B9CA 3LA2A 4PK4A 4BWOA 1H0BA 1UMQA 1QJEA 3ALQA 4IEUA 4XMAA 3C3WA 4QAWA 2V1DA 1BR1A 2RDPA 2K46A 3T1BA 4ASNA 1FYKA 4QKNA 2W1QA 4EEFG 3ZLIA 5FZ9A 2Y0SA 2NQYA 1HXS3 1E5RA 2HFHA 3VZKA 5JSRA 2JX9A 4XLPF 2ZKLA 3VD7A 3HRTA 3T0YA 3IDEA 5A7SA 2BOLA 1YS6A 2GNTA 3J26N 1OUSA 2PLV3 3ASNH 5FIXA 3HPHA 3H50A 4NHJA 4UVCA 1HRV3 2CH0A 4GJYA 1NCQA 4YLZA 5ABJA 3VDXA 1QJU1 4OI4A 4P9IA 3W59A 4DEVA 4BQ1A 2WLPA 5DUIA 5FZ3A 4K6BA 4YZ2A 2JTVA 3L2YA 4BDZA 3OBZA 1AR82 3TEYA 4RGGA 4EM1A 2PA7A 2X53S 1NE4A 4JKLA 4XKCA 2D43A 2VQGA 2DCKA 2IVJA 4AXOA 1GZWA 4MG2A 3PHMA 4TLFA 1LQ1A 1IQDC 4D0QA 2CUEA 2L9NA 2OZJA 4QPQA 2BJSA 2JB8A 3S0MA 1PIV2 1AWCA 3CBNA 4W65A 5E3NA 2CV0A 4AEDC 4NHKA 4RFT0 1D4M1 3MEPA 1G2HA 1DIWA 2XAHA 4RR3B 1UX6A 1L7RA 3RDIA 4OHZA 4JRAA 1U0AA 3PUQA 5FCCA 2BGOA 5GP9A 4UXAA 4V2WA 2XJTA 1PGW2 2EIDA 4IHSA 1OYYA 1JYXA 5J1XA 1REFA 4ARXA 1NAEA 1XDUA 1DUXC 4HOOA 4NC7A 4UHTA 1T8IA 2CW0F 4XJUA 3BODA 1QQP2 3VFZA 3MDPA 3AZYA 5F6KA 2MBFA 2QVSB 1XNBA 1IV8A 3NWSA 4FPOB 4AVCA 3WR0A 1LFUP 3E6BA 4XJZA 3EUKL 1BK0A 1JUMA 2IGKA 2B9VA 1SPPA 2XRLA 1K45A 2HWF2 1YC61 2LROA 4HONA 3PSFA 1RUD2 2VQAA 4XAAA 3EHKA 5IVFA 4UNOA 5K5OA 4JTOA 2BFUS 4JCKA 2H09A 5FYTA 5IATA 5JZGC 2WO1A 2I8DA 5E18F 2W0XA 3VSKA 3CD6I 2LK2A 2LBFB 5C8CC 1FBSA 4NR1A 4LUMA 4MXWA 1COV1 2HDDA 5CPRB 5J4VA 1YX3A 3OGJA 2PFBA 2KJBA 4WF2A 2E5NA 1W1WE 2W1WA 1FMD3 2ZMLA 5LEKA 1ULFA 2IS2A 3POSA 1LEBA 2EA4A 3L2WA 4I3GA 3KLOA 4RHV3 4EN8B 3F8CA 1AJOA 5BPDA 2BZDA 4ISRA 4U88A 5HS9A 1IG7A 5HNFA 1VMJA 2EA2A 2L4AA 5LA1A 4A3LJ 1OC1A 1S5LC 1W8UA 2BZTA 3DPRB 2RM22 1VAVA 4FCYA 5FPLA 4JAAA 3CCYA 2CTVA 2OCCH 3A01A 4YG3A 5FXVA 3SKJE 4RYDA 2QKMB 2FZ1A 2M0MA 1R49A 1S55A 3KVAA 1VZ0A 2DT7B 4N7IA 4LK1F 4LBQA 4CXXA 1PJRA 4DZGA 2QM3A 3JD71 3H36A 2FHRA 4AWXB 1V6OA 5HV4A 2F48A 5CB7A 3FMSA 4JQRA 1MS5A 1DG6A 3GFIA 4NRMA 5D5UB 1OPMA 2PMZA 2IRFG 2G7UA 2WY7Q 2L54A 1JUSA 5FMOL 1BMV1 1QOOA 4B1RA 1MDMA 2MLGA 3IDAA 1V55H 1DQ6A 5D4RA 4HYEA 3S3OA 1DZTA 3JRCA 2ZHKA 3ABUA 4YNIA 1NG0A 4KMUX 1NA1B 1PP7U 4IEZA 1QVUA 5FLIA 4DQ2A 3FC0A 1FXZA 2WQ4A 5BOXA 1PX4A 1SLLA 1AHSA 1X4PA 5E88A 1SD7A 3KCCA 5G05L 4M72A 4N8MA 3E7LA 3H9JA 3HSEA 4COUA 1JJ8C 1VQPI 2YFZA 2EV5A 2NYXA 2GOMA 5C8CA 3IH2A 4B47A 2WNVB 2L9SA 1FTTA 5JIAA 1MBKA 2GAUA 5CVVA 1UKGA 5FPBA 1JUHA 2Z2SB 3O0XA 5F1RA 3HTUA 5C44J 1YLFA 4RAGA 1G8XA 5DZEA 1U2WA 3QOEA 3U78A 5J8FA 3WHCA 3K4JA 3GO5A 1FI2A 3WE3A 5IW0A 4Q0SA 4ITVA 3GGLA 4KNYA 1KYWA 1C4RA 4WBBA 5JPMB 2JPBA 2FCUA 3EQEA 5FZKA 2MH2A 1I50J 1JI8A 5DN2A 2HDCA 1OOPB 2TRTA 1W6NA 5FDBA 1AYN3 2B46X 1H9WA 1K79A 1E3PA 4MFEA 1BIAA 4BMBA 5FZ1A 4Y4RA 4QPIB 3SXYA 3MIHA 1FBUA 1LOAA 3VHNA 4YW3A 1LE8B 1S6LA 3W5NA 3AMPA 4BKXA 3DYOA 2G9ZA 1BC7C 4J19A 1D5YA 2I2SA 5C9AB 3HHHA 5IVVA 2F4IA 2VVFA 1JTZX 1KU3A 1SD5A 2H27A 2BOJA 4CDQA 1CQ9A 2OAZA 4W6WA 3DGTA 4FPFA 1TEIA 3VB2A 4NQWA 1HRV2 2B42B 3DXJF 4A4AA 2NPIA 5M3MJ 2FBHA 1RNLA 2OPKA 3K9TA 4XFBA 4CYCB 3ZMDA 4PDWA 1CIYA 5A7WA 2XF5A 1OKQA 5JMCA 3QPLA 3N7MA 2YC4A 3ZMTA 4Q1PA 4HV6A 2ZO4A 3WP4A 2WIIB 1H8TC 3M8LA 2R92J 1NKGA 2L02A 3QODA 2LW8A 1AR73 3IV5A 2MSYA 4QKDA 5EJCA 1AF9A 1V3FA 3N05A 3OS1A 5FYYA 1V5FA 3KZYA 1S3JA 3LA3A 3WINE 5IK7A 1REPC 4EATA 1UL9A 3L2UA 3AVRA 3D5SC 3HUGA 2TUNA 3H3UA 2WINB 1XTAA 2Y6LA 4QM9A 4YIFA 4WM7C 5EZHA 4X8PA 5HLHA 5T52A 2NS8A 3HVDA 4IKFA 3FBNB 3DEWA 2GP5A 4XRSG 4EN0A 1CAXA 3VUOA 2JB4A 3BOQA 3PSIA 4DOZA 2VONA 4OMZA 4LO7A 3ACLA 4AC0A 4QDRA 3M3CA 3LQQA 3T0DA 4AM3A 4ZDPA 5FZHA 1MR5A 2DA7A 4CDWB 2JA2A 1SAXA 3PFIA 3LSTA 3ZDSA 3IAS2 2WT2A 1ETVA 1BBT1 3RKWA 5FO8B 5SV8A 2A75A 2ZGNA 3PUHA 2YY1A 3DPRC 2VBWA 3AZZA 3N9MA 2HXOA 2FDHA 4A0ZA 1FPN1 4II2A 2M7BA 4A0XA 3I4IA 4CVUA 2E51A 3PIJA 4J1XA 2PHTA 3QQAA 5IP9J 4PLOA 3L2VA 1EAH3 1IDYA 1UU5A 4UV9A 1LTEA 3WW2A 2R7XA 2WZR1 3GZTB 1BBYA 3Q8FA 3CMGA 4XTMA 1OMIA 5DAXA 2GWRA 4LG0A 1RVF3 2Q1ZB 4BE2A 3Q8CA 3M7AA 3MFAA 3T2QA 4FTSA 2R0HA 3JRIA 3CO6C 4FXKB 2KT0A 3E5QA 3ZP5A 3CC4I 5A3NA 3WP6A 2TEPA 1SBFA 2DV9A 2XKOA 5C3SA 2WY8Q 2Q2EA 1RUG3 1ENXA 1WKMA 4BJTA 1MACA 2YC2A 2BP6A 1UOFA 5E1WA 1NUKA 2CFXA 2R49A 5TSWA 3UNPA 1W8OA 3O1RA 3PIPF 1C1LA 2HWF3 2VBPA 1UMZA 4XLFA 4Q48A 1X1CA 3LPFA 5FY7A 3SEQA 1G3WA 3O1MA 1IN6A 1BL0A 2E32A 3RMXA 5F08A 3ZFEB 4EWAA 5LY1A 2W47A 2WO7A 4OVEA 1Y1VJ 1TW3A 5LA0A 2CUZA 4HDUA 1QGPA 1LNSA 1IS4A 3V7SA 4UFHA 1Y56A 4YW4A 5HVQC 3R05A 3KPHA 3P1IA 1EJ9A 3MZ8A 1W2AX 1YE9A 2VMGA 2DVAA 1FT9A 1Z9CA 1YI7A 2NMNA 1R23A 3T1MA 5GZDA 4GJZA 1KQ9A 1RUI1 4GALA 1RUC3 4YFZA 1QNWA 2XB0X 2RDRA 5F04A 1I6XA 3U07A 6PAXA 4XACA 1RUC1 1MBEA 1VFCA 2FU4A 2JA8J 1WVRA 2VUJA 4A5NA 5FZ4A 5C9AA 1JODA 1QEXA 4QPIC 1PO23 1I1SA 4GXLA 1WA4A 1AR91 4AQSA 2UWAA 3ZXFA 1L3LA 3WDXA 3KP3A 1W2OA 3ZFGA 3FUQA 1H1MA 4H7LA 1VQ7I 5IVJA 2D7FA 1GWLA 1PK6C 4UBHA 4AW7A 3D0SA 3GTJJ 3RMYA 4IEXA 4AYBA 1I3HA 2VVEA 3B9IA 3VYSB 3ZYPA 4BQ2A 1CAVB 4EVIA 2DU1A 1PIV3 2JG9C 2HWB2 5H6QA 1IG3A 2MD0A 2R061 4JGYC 1XJAA 2VZUA 1AU7A 3O1OA 3HGGA 4BLIA 3MPBA 1H2LA 5KAFC 2PFWA 4Q4Y3 2JDYA 3F21A 1MEC2 1GXPA 5IYCJ 2JKBA 2XKPA 2QLZA 3KP4A 2Z4FA 2PYTA 3S1RJ 2YX7A 3D5OA 2P17A 2VUDA 1N1SA 4DJAA 1H1IA 1LGCA 1R9TJ 1ND3B 4Y15A 1HB2A 3UKTA 3HC7A 4IE6A 1CAUB 5CFCC 3KQ4B 3IIIA 3THPA 3BPXA 3AAFA 4OOIA 2VMDA 3OYGA 2LBFA 2TNFA 4AD9A 4BH9A 1VBB2 3NW4A 5H9PA 1AXKA 2OZ6A 3JRFA 5GZGA 1RPWA 4CP0A 3WDUA 2KMUA 1RUF3 2IXJA 4I0WB 1D1CA 3NV3A 3H7YA 3J8F2 4ZZDA 3S17J 5BXXA 2LD5A 2GIZA 2BDRA 1LKXA 4N4NB 1H8AC 3FJSA 4W6YA 2BW3A 1Q3EA 4JC1A 5HLIA 2D6KA 2KR2A 1DQUA 1ULEA 5LA9A 3URFA 2V72A 5B66C 2WA0A 2XF6A 3HUGB 2ORXA 3CHXA 3FMQA 1U78A 1OR7C 2UYAA 1BI3A 5G04L 4CE8A 1NA1C 3TNQA 1OCPA 1R082 1DP3A 3ZR6A 4NPMA 3H0GJ 2FOKA 3VBOC 4MQVA 5M5YJ 1DGWX 1BOAA 2HWC2 4L97A 1OJLA 5BNPB 2HWD3 1ZARA 2OQ6A 3M8FA 3AL6A 1OLMA 4CTEA 3ECQA 4LLLA 4HAMA 3GM8A 4LORA 3VPRA 3ECOA 3M2MA 4HLYA 4V1PA 4YPJA 3USUB 3ULQB 4WCGA 1TP4A 2D6MA 4XJ9A 5I8YA 2XAJA 4XMIA 3MV01 3VBSA 4E7SA 1G86A 5BNNA 1JHFA 2YU3A 5L3EA 4Y1VA 1UWWA 2H8WA 4ZH4F 2RMU1 5JXIA 1X58A 3HQRA 2V7FA 5ICEA 4B1MA 2XWJB 5L3DA 1UOGA 1XSDA 4MXVA 3C7OA 5HCHA 4D5CA 1Q8PA 3H1CA 3IH3A 1VTNC 2P6CA 1F35A 1B8IB 3BR6A 3W2VA 1GWMA 2JIGA 4DY5A 4PF5A 2GP3A 3E6MA 1Z7S3 3WTSC 2FQPA 4DBQA 3M1HA 3CDZB 2ET1A 4W4ZA 1LAJA 4CDWC 3JRDA 4AU7A 1PUFB 1JYCA 4BA6A 2E1OA 1G9BA 1C8M1 3HEFA 1YI9A 1SLAA 1BEV3 3SCGA 4SBVA 1NG7A 3FWEA 3I49A 2L0KA 3OD4A 4RAZA 2JN6A 4L0ZB 3G4SI 2XR4A 2GALA 4M3CA 3C1DA 5I0RA 2MH9A 2IXHA 2RDSA 1N1TA 3AYDA 3FXRA 4BOWA 1K12A 5CVRA 3BYWA 4G9SB 1UO9A 3H5NA 5IT9K 4H3WA 2NRAC 1Z77A 2HTSA 5K7HA 3ZCOA 3S32A 3F9KA 4IHTA 2ADDA 4MH0E 5IYYA 5AVPA 3GHMA 3WG7H 2HXIA 3J7YJ 1DP7P 5IFTA 1FYUA 1F43A 3U14A 1S2KA 2R041 3J7ZI 1EAH2 2VCMA 4XF4A 3CLQA 4OI1A 1BMV2 4YW5A 3S14J 1RUJ1 3OYMA 4E9KA 1K7AA 1OOPC 1GP5A 4NHYA 3NVCA 3VBHB 2ZJPF 5A33A 2WV1A 2DN0A 1O4ZA 2F17A 4LLFA 4HETA 4LKDA 1E17A 4XOGA 3BR0A 3HOTA 4CDXA 2QQKA 4XIOA 2W85A 3QYFA 1SFKA 4H55A 4E4DX 4XFHA 3I3MA 4RR3C 3K4KA 2AO9A 4PDWB 3ES1A 1LHWA 1XMXA 5F5QA 5FZCA 3HEIA 1O3TA 5LATA 2ADEA 2KXLA 3AFGA 2D44A 2JA5J 3G1MA 3VL9A 3QACA 5FYBA 1RRJA 3PQKA 2G1MA 4AZZA 3SZTA 3W58A 2X6XA 4ATFA 2WB1N 3K4MA 1MS0A 3POBA 4Q2FA 2W9XA 1I3QJ 4HV5A 3L00A 2Y6JA 3UETA 3W9AA 1TNRA 3HRMA 3KV4A 2BEOA 2QKLB 2JQ7A 4YVWA 2JJ7A 3O1PA 3I7DA 4JRLA 5FP7A 1S0CA 2A73B 4META 3H8XA 3OL3A 3BOPA 4D6SA 4UUSB 3B3QE 2DK5A 3F23A 2IJLA 5JVTA 3EYYA 1ZH5A 4Y1ZA 3DYMA 5D5VB 3J81Z 2YUSA 3HOYJ 3MZHA 3D5LA 3MUY1 2ZKNA 5EZWA 4GYIA 4ZYAA 1NCQC 1Q8VA 3G1LA 3RJPA 4EQQA 3H0OA 1ON2A 1FIPA 2ZSIB 3CEWA 1DPRA 5L9VA 4JDOA 5JVGF 4P5OA 1K5MC 3AG4H 3BI3A 5FZ7A 1T0FC 3LA7A 3V4GA 2XDVA 1TMF3 1U5TC 3CKHA 3PMSA 2B9SA 4NHLA 2AQEA 4MYEA 3IRQA 2WBMA 2RE9A 2SLIA 2JDNA 4EMSA 3ZYRA 1FC3A 1XOYA 1KQRA 4JBAA 2DBIA 2STWA 2IEKA 1ACIA 1VP6A 5ANQA 3LMMA 2A3YA 1VALA 3TGNA 2HOAA 2XBO1 4ZDLA 4E8DA 4AI1A 3DLLF 2EZLA 1IXSB 3OIPA 4QXHA 2F5CA 4F3JA 5EGOB 2WA4A 4KT6A 4LE3A 2D2WA 4D5FA 1POV3 1AHDP 4FOWA 2QTWB 5FZEA 2NOJB 2Y30A 1IC8A 1W8ZA 4IHXA 1A5JA 1ZX5A 1W7PA 4E7HA 3MZYA 2Y0IA 1QJU2 4LK6A 1GXQA 4BU2A 1UHMA 2E6VA 2P5BA 1AYN1 3NJXA 4HX8A 3QCWA 3ZXEA 3T0AA 5K0UB 1PMIA 2CL2A 2H0BA 2K9ZA 4FSJA 2FCVA 3A23A 2VIXA 1ZZ8A 5BY5A 2W24A 3S2HJ 4M3CF 2E2HJ 1JS9A 2XAFA 3OYIA 3V7RA 3EJKA 1DQ1A 1XGNA 2BHZA 3M3EA 1LOCA 4MO7A 1YOVB 3VB9A 2VMFA 2Y64A 2WADA 1TMF2 2ZPXA 3CF2A 3H1MA 3E5XA 4XOTA 4XF1A 4K8FA 2DCJA 4PUSA 4U36A 2FD8A 3JREA 3GBWA 4U7BA 3OY9A 1DYPA 1CONA 1SCSA 1W3VA 4NN0A 5FKKA 2HYXA 2MNGA 2V73A 3FKIJ 5K5QA 3TW6A 1KD7A 3ZN6A 4CCJA 3B01A 2QSHX 1Z0HA 4OUSA 2P3YA 2F6CA 5IP6A 1UXZA 1QIQA 3J7AO 2VECA 2HEWF 4AIKA 3W6JB 1GICA 4GB33 5FP4A 2I10A 3VBRA 4C1XA 4QWQA 2V09A 5CFDB 4FPKA 5FAXA 4JGZB 2ZFUA 4HVQA 2O3FA 1X7NA 2P3KA 2GNBA 3CJQB 4DNCA 3W6VA 4QX7A 3S30A 2LTPA 1AZDA 1WLTA 1BI0A 4LIVA 3D3AA 5DDJ1 3WTWC 3TRSB 1VQOI 2YGMA 3P5JA 2R7RA 4NIGA 2X4HA 4AFCA 4AL9A 3DQVC 2P3JA 1WJAA 1BM9A 4AIDA 4EGYA 2OC6A 3WQ0A 3K70D 3VHRA 5A3UA 2ZKZA 2IFRA 4XF9A 2NOGA 3ZYHA 3PIOF 1ZG3A 4QPOA 3PQJA 5F5CA 5EYYA 4A6SA 1ETQA 2QQVA 1PMJX 2IS6A 4K8RB 5DAQA 3MIBA 3OYJA 5CVUA 5FZFA 2Z5WA 4PSWA 2RHPA 2VBYA 2D6OX 2PHRA 4ZDOA 3MKWB 1JE8A 3ZMVA 3J80Z 3HR9A 4NIHA 2KIFA 2Z1DA 2LP0A 3JW4A 1RUI2 3ETQA 3IWZA 4DYQA 3JR9A 3LAJA 5KNLA 1T6SA 3ZQFA 1GP6A 3NRVA 1LFPA 1NX9A 4RS5B 1WJBA 1BC8C 1J84A 4C30A 4MO3M 4DXTA 3ETPA 3UESA 1HJFA 2CSOA 3KCXA 1X3ZB 2IAIA 2B0LA 3JAMK 5IVCA 4E70A 3W21A 3O1TA 3QP5A 4JZRA 4AVBA 3FZ3A 2HJIA 3SFZA 1WJDA 3RCOA 4BS9A 1BR4A 4SLIA 4YVWB 1GR3A 4E7LA 2HYKA 2VTXJ 2O6GE 3SXWA 3LEMA 5J96B 3V64A 2EFNA 2W48A 2EAKA 2QQNA 5D6EA 4OMYA 1N47A 1W0TA 2HBUA 2V6EA 5J37A 4PCQA 4A45A 3KF3A 2E60A 2R7UA 2YV8A 4FE4A 4FPLA 4G8XA 1J0RA 3MUZ1 2X1DA 4QIWN 4HG6B 5FZOA 5FPAA 5I0TA 3C2BA 2V6CA 1JBCA 5GPAA 4HK8A 1V5GA 5AC92 5FBJA 5A3PA 4KMFA 3DF0A 2TBVA 1S1AA 1PVC2 1Y1WJ 4R8HA 2JEMA 3KYDB 3PVBB 1GANA 5JOYA 4KIBA 3JRGA 3H9QA 5FD5A 5HXVA 1F2NA 4B4QA 2M5WA 2LS6A 3FXKA 3WX5A 3I54A 3DPUA 4KNCA 1B72B 1W8NA 4QPYA 1V6LA 3JZVA 1L7LA 2Y6HA 5JWPA 3FFZA 5DD4A 2VQUA 1KJLA 4PBOA 3TKYA 2RDNA 2XMLA 4D6QA 3SCHA 1H88C 3I2KA 3MI8A 4AI3A 3PDQA 4QGMA 1WWXA 3B6AA 1SDWA 3EUAA 1PO22 2HKOA 4NO4A 3H1YA 1O3QA 1SEUA 2HI3A 3DKWA 3OEAA 1MEC1 2C26A 4CP1A 2O8QA 4GWNA 1IGOA 5FOJB 3WDVA 3MF6A 2K85A 3UR3C 3OIQA 4DINB 2VE9A 3VGIA 2Y0SN 2P6TA 3ZSKA 2ZXWH 3LIHA 1S7AA 2FF4A 2AYHA 1R1VA 2FBKA 4XQ4A 1TQPA 2Y31A 4IJAA 1Z6TA 1H6YA 1HIXA 2BXZA 4RS8A 3M3YJ 1PX3A 4H2AA 1CF7A 2XJQA 4AI9A 5LHGA 1RUC2 4HN1A 1IZ3A 2FE3A 5B4XA 1WCKA 4CDUB 4Q26A 2JDMA 1RL3A 3ON7A 5J98B 4PBPA 4NRQA 4XKVA 2PHXA 1W6OA 3OGSA 3KQRA 4Z92B 1RUOA 2J5PA 4FP2A 3VL8A 2R32A 4LULA 1UIKA 2HQRA 4RHV1 3ZXSA 4XRFA 1I27A 1HRI2 5F6LB 4CCEA 3C8XA 4XBNA 3CO2A 2ZNZA 2DMUA 1V6KA 2R16A 3CL1A 4KWJA 2YROA 1L3JA 1DQ0A 2VXZA 1OF3A 5FB2A 3WNNA 3CJIA 1NH3A 4LHSA 2KZGA 3EUHC 2HPIA 3K70C 1C0WA 1EH7A 4AIHA 2R1BA 4OHXA 1W9SA 4UW3A 5L9RA 1MD0A 2QDRA 2WAQN 1BI1A 5L3FA 4N53A 3VBUB 2XPWA 3QWLA 2MYSA 5CIRA 4YYOA 1ZHFA 2PELA 3TN92 4IO9F 2VU9A 4LUKA 3QAHA 1DP0A 1XYOA 4LKFA 1O8SA 2K3FA 2F6BA 1QVTA 3RRDA 5EXOA 5GLTA 2G7HA 2AUYA 2Z69A 2WDBA 5KVRA 4Q0QA 3A4CA 1AL0G 1UYZA 1Z7S1 2ZOEB 4LOSA 2DCTA 2HWE2 2VY0A 1K6YA 1QU3A 1QH7A 3AKTA 3W2AA 3WUCA 5GLVA 1ASJ2 3HOZJ 1AR62 1UG2A 1VBB1 1RUI3 3BPSA 4LMFA 3V0BA 1Z7LA 2IUWA 3GNEA 4KIGA 2JDPA 3N3HA 5B1BH 2BWAA 2M8GX 2JG9B 5FLMJ 1VPHA 1C8M2 5CU1A 1TME3 2RS31 4I0BA 1SD6A 4QU2A 4TN7A 5DUVA 2M1BA 2BUKA 5FYVA 5FROA 5DG1A 3GF6A 2WTEA 4YFWA 1TWGJ 1CAXB 2V5YA 3WV6A 4RA2A 4CCCA 2DCYA 2WJSA 3LSJA 1H8TA 2LH9A 2MPFA 2JSPA 3H3VK 2PQSA 1NCRA 4BQNA 4Y4YA 5AFEA 4LJZF 2Z3YA 2VOTA 2J42A 3WTUC 4OFGA 4ZYGA 3DN7A 4B1LA 3WY6A 1ZR2A 4XM3A 2QENA 1LOGA 2D98A 1LB2A 2JDUA 5ACA1 3RVHA 3JBG3 4BK5A 2GBYA 3GTMJ 4MTEA 3MW3A 4M6VA 4LEJA 4A0YA 1WSUA 4PIZA 3MN2A 1MNEA 2GLOA 1MJBA 1XNAA 3E6DA 4AFBA 5F6FA 5IT3A 3P6BA 4FI9A 1WLDA 4BIFA 3RKQA 4F92B 1CX1A 1ONAA 4IV1B 3CESA 5K7FA 1OLQA 1X2NA 2X6WA 1REEA 3K7AJ 3RWKX 3RKXA 2EFWA 4XIKA 1RUE1 4RA0A 3RI4A 5A33B 4UF0A 2CU7A 4Q47A 2DDUA 1HLVA 2QSFX 1W04A 4UBGA 3KHCA 1PIV1 1YW7A 2HYJA 4QX1A 2OCEA 3U0ZA 1KGYA 5EWSA 2IBDA 3LE0A 4XUPA 2QJVA 4WVVA 4QGNA 3CMMA 2RVAA 4N43A 3RSJA 3UGFA 5C3PA 3KHBA 2RVCA 1VQ9I 1WCDJ 4G3YC 2XVGA 1SHWB 2E1MB 3HRUA 4X6AJ 4G4FA 1N1YA 3BG7A 3I5UA 5GZFA 3MVPA 1WMEA 1S0BA 1SMVA 4RR3A 3Q0UA 3ABMH 4LOCA 3LPGA 1MVEA 1V54H 2XB5A 1UU6A 2CWMA 5KC6A 4RQPB 5ED4A 3MLKA 2PAKA 2K3PA 4OYUA 1BEV2 1X50A 2YX4A 4ZU4A 4JX5A 5GADJ 1A35A 2OUHA 2R7ZJ 3WQ1A 4WXCA 2DA4A 3OOPA 4FPEA 1ZRCA 4FISA 4XZUG 1IXCA 4P9YA 3U2RA 4RB2C 1P4AA 3CIHA 2EIEA 5E1RA 4XC9A 1VI0A 2ME0A 3ZXLA 3RIRA 4B48A 4UFJA 3VBUC 4OI2A 4MADA 1YG2A 2L9VA 1O7LA 4IGPA 1EV7A 2CU5A 5J09A 3SZGA 3GZNB 1TVGA 2VUCA 3E6CC 2OUJA 1AX2A 2VZPA 3PMEA 3D82A 4FETA 1B35A 2VLAA 1FMD1 3WGGA 4A6OA 3AKSA 3PIGA 1K78B 1GKBA 5B2GB 4B8XA 3POGA 2NYYA 2XPJA 1GLHA 1AA7A 1FOXA 2XF7A 3IH4A 4DO0A 2W3JA 2N8GA 2VC9A 1EA3A 5E1ZB 3AYCA 1UELB 3O1SA 1ON1A 1F4KA 4XICA 1CJPA 1NT0A 1ZZ7A 4AI8A 2W84A 4WM8A 2IGNA 1BJQA 2CGPA 4BQ3A 5M0TA 1RZ4A 5C5TA 1MQTA 1UMHA 1KZHA 4OLLA 2OTJI 3E1SA 1YRZA 2X5IA 1AKHA 4E2GA 5HCBA 2MW8A 1AVBA 4X0GA 3GTGJ 5C4XJ 1YQ8A 4JHZA 1S0IA 4ZPIA 2CQKA 2ZXJA 1MBJA 4GO1A 4OI0A 4QX3A 1Y6IA 1VBD3 3PVOA 2PHWA 1RXGA 3E97A 3A01B 4I3PA 2QZ8A 3N9QA 4UB8C 4FPCA 1F5JA 4RFRB 4A6DA 3HBZA 3WXPA 3J7HA 2AEZA 2YU2A 1R5GA 4XQDA 3NO8A 1OA4A 2DFEA 1IOAA 3HPGA 2RDQA 3I2OA 2OT7A 3C7JA 2OU2A 4FAHA 4D7NA 1JHJA 2B63J 2JSCA 4PFOA 1KDKA 2HGCA 2GSYA 2AC1A 4IGQA 1S9HA 3WVJA 5CJ9A 5DAPA 1FTZA 2FNAA 5ILUA 1WKYA 3AG3H 1V5EA 1RUJ3 1EH6A 3F0CA 2L7KA 3OSDA 4PDWC 3UK9A 3RKYA 1YQ5A 1RUG2 2P4EA 1COV2 3M8JA 2WZR3 1R1ZA 4Q4X2 3CCQI 1ZGWA 1IG0A 3DECA 3CMYA 2FMDA 1PGL1 3WCSA 1LEDA 1JGSA 4Z2YA 3OMYA 2QCOA 2BW3B 4CCOA 2C0ZA 2JT1A 2XVLA 1UY1A 3B73A 3GJBA 2HH9A 4CEWB 2LNBA 2XVKA 4QXCA 4CRQA 4HPKB 4AQ6A 4M00A 3ESWB 1GQHA 2JG8C 3S1QJ 1W9FA 4IE4A 1O8PA 3RWNA 3DWLE 3AKZA 4XCBA 2KDZA 4EJWA 1A3KA 1XMKA 4BBRJ 2D3RA 2LY1A 5KHKA 1JZ2A 1JZ7A 4D6RA 4YELA 1NK3P 3H35A 2MC3A 2UYBA 1EY2A 3LSRA 5DXDA 3RG0A 4DBRA 1LOFA 5IVBA 1OYIA 2E34A 4QX8A 3ZFFC 5DUWA 2W92A 4R1HA 1D5VA 1RUH3 1EF4A 4XN3A 4MSVA 1HN0A 1MGTA 2ZMEB 4QQLA 5F9TA 4S0HB 4XUOA 1GOGA 1OA3A 2Q8CA 4BGDA 3K46A 4DPNA 5KK1A 1A6CA 3JD73 4LHNA 3LIGA 5CQGA 4CUCA 2NNYA 3CUQA 3O5SA 5KXCA 5H9QA 4XMYA 4JX4A 3AG2H 2PJPA 1YHQI 3VKNA 1PO13 2C1FA 1DCSA 4RN5A 3DKYA 3O0VA 2MEV3 3BB6A 2MD5A 2ZZQA 1J59A 2JJ6A 3PVEA 5FXZA 4HK9A 5C8CB 5DCMA 5A1AA 5FKCA 4COYA 3TEZA 4AK3A 1H8VA 4LBMA 4K1ZA 2LKPA 2EJRA 1XC6A 3WW4A 4YZ3A 2IVIB 1OKOA 2K02A 3RPUA 3IPVA 1AL23 1ZAOA 1FOWA 1MKMA 4P9FA 4CGZA 2M34A 3DXTA 3PUFA 2ZGOA 3CF5F 1ETKA 5D21A 3S57A 5KHGA 4QX2A 4AI0A 3KX2A 1S4CA 4U7DA 4RS5C 3ZYIB 1UJ8A 1W8HA 1TWFJ 3K4AA 3VKFC 2E7WA 1YS7A 3HOUJ 4BISA 1QJX2 1QJY2 4DNYA 3DPLC 3ZMNA 1RINA 4R79A 2RNGA 1X3UA 2DQRA 4MGIE 3BTZA 1X33A 1RR8C 4DIQA 1KFUL 5A32B 1YO5C 5FZ8A 2R7DA 1RITA 3KFWX 4CCKA 2R7SA 2WT0A 4E4ZA 3IC7A 4OZXA 2XC7A 2XONA 1JTYA 4P96A 1FNYA 4GA9A 4EV0A 4HA8A 3RSNA 5I0UA 1OQ1A 4UI9L 4RB1A 5FQ0B 3VYTB 2R7EB 2VJ5A 1WCQA 2IFWA 5AC91 2F4PA 2W00A 3RYKA 1CQTA 5CBLA 5EPAA 3W6KB 4A69C 4NQWB 1V00A 5A7OA 1P4XA 4GMP3 4DW6A 1GZCA 2EXJA 4JGYA 1P92A 4ES9A 1YJWI 1TG7A 2J22A 5T50A 4Y24A 3AKPA 2QQ9A 5K8SA 4KGQA 4BMEA 2YGLA 3VZLA 4D9JA 5HOOA 1TQMA 5HDGA 1S7OA 2IW5A 5C4JJ 4QPGA 2M8EA 4C8DA 3KIOA 1B8IA 5IHRA 1DU6A 4ABZA 2IS1A 4LG0B 1CD3G 2V4JC 3ILNA 4LBOA 1UAAA 4HKWA 3V0AA 3SHRA 2GA1A 5CKTA 2ZMNA 2O9LA 2OJED 2JE8A 1GZ9A 4PSXA 1VRBA 1GT0C 1JZ5A 2VG9A 5FYSA 3OF1A 4DUXA 1VBE1 3KCYA 3G73A 3JXSA 1OH4A 3LEGA 2IXSA 4IZZA 3POYA 2V1NA 3ABZA 3BY6A 1SEFA 2E2JJ 1P9QC 5D8KB 3RYPA 1JYTA 4P9LA 2XRNA 5FJKA 3TEDA 2XHNA 3I58A 1Y7BA 2GU9A 1QZYA 3O3KA 4UUSA 3BQYA 4Q8KA 3JSPA 1N3OA 3T3YA 4AVPA 3VDDC 3ZN0A 2VXJA 2EZKA 3G2BA 4IEJA 1F5FA 2ARAA 4YZ5A 4AVVA 2EB7A 2ZCWA 4CCDA 1PHMA 3FXUA 1CF7B 1G4DA 4FFIA 5A3LA 4BACA 1PVEA 2V9KA 1V9U1 1Y9MA 2R93J 3A0BC 1W0UA 3GUDA 4W8JA 5FRAA 2LF8A 4CCMA 1UZCA 2CS3A 3TN91 4UV8A 2EXKA 4CDXC 1ENHA 2AH2A 1WLWA 2VZRA 1FPN2 1IPKA 1RMU3 1HW1A 2FCTA 1RKTA 1YI2I 2A5ZA 1MS8A 2VW0A 2QBXA 5IYBJ 2AREA 3I53A 3HNYM 4PCRA 2HVQA 3S2WA 1G8WA 2J1AA 2M30A 1VMHA 1DGRA 2FQ4A 4D8MA 2A6VA 5HCFA 2JE7A 4JDMA 4CSWA 4K2EA 4C9YA 1AR71 2PMHA 3VDDA 4MHRA 1IN8A 3CJTB 2VJXA 3K77A 3A2KA 5LBBA 3GHNA 2ESHA 3OCPA 2QQOA 5JFRA 2R6QA 5HCAA 3QU6A 1LODA 4CP9B 1WD3A 1I1GA 1OLME 1X1PA 2AXLA 5KHIA 3I3BA 5CG9A 1ND3C 3TO7A 2VOKA 1GUIA 2DLLA 1RUD3 1KU9A 2JDZA 3MQ0A 1OSGA 1MDMB 2QVOA 4XKBA 4I01A 4IE5A 4WVMB 4CPBA 1W6QB 1DQ4A 1N3PA 3S5QA 1IXRC 1UYPA 3K2OA 2EINH 1JKRC 1LVAA 4IEYA 1Y8RB 3GZ5A 1QRYA 3GCMA 3V8JA 1U8RA 4Q29A 4GKXA 2TCTA 3I4PA 3G3ZA 1POGA 1VJ2A 2EV0A 2R0QC 4LHLA 4XABA 3FMRA 5BNQA 2A3XA 1OVSA 4IDZA 1W39A 1HW5A 1FYLA 3S7EA 3HNMA 2XQRA 5J4YA 1ZBA2 1T2XA 5GLZA 2VJ4A 1ND3A 3UKVA 1VQLI 1ZN2A 4S05A 4QXBA 1RVF1 4KYWA 4FX0A 3VBOA 4AQTA 3ZN5A 4AVAA 2Q8DA 1GFF2 4UVBA 2VTFA 5DUKA 3RPQA 3AMHA 3J8F1 1Z91A 3O12A 4M3GA 2G9GA 3CC2I 4BK4A 3EMRA 2IXIA 4YVSC 2VW1A 3RJRA 3KYLA 2Y9ZA 1AX0A 4Z2WA 2RV9A 4BHBA 2BE5F 2F5FA 2EXIA 1LR5A 2X09A 2QQMA 4LBNA 3TAYA 2DJNA 2ID3A 2VPVA 5DS9A 2NXNB 2MA3A 4JGYB 5CLSA 3RTRA 1QDCA 4ASMB 3LSMA 4A12A 5FFXA 3GBFA 2L9LA 2NVQJ 3E0JB 1W0NA 2YU1A 4JDNA 1QJU3 3SEZA 1HBXG 1WJFA 4NVPA 1XS9A 4URAA 1JYWA 2KIMA 1BCXA 4OQ9A 3LNQA 2ZGRA 4QPGB 1ND2A 3WG2A 1DYKA 4AEMA 3DPTA 3WHBA 4NMIA 1TWAJ 4OHVA 2DW4A 3QYBA 4TV7A 1XBFA 1RUE2 4FTHA 1YFWA 3HL2A 1DGLA 3UJQA 5JOWA 1W36C 3KZZA 3KP5A 2DUPA 3DF8A 2GZWA 1R22A 3TEWA 2R1DA 3AYEA 4OMCA 2ZGUA 1YRNA 4INDA 1WZ2A 2R3SA 3IAM2 1TZLA 2IGMA 2VMEA 3CMAI 3OYWB 4WM8C 3OV8A 3AZWA 3PNYA 2QQUA 4RGRA 5JSOA 1G3YA 5JI6A 5FFZA 1J5YA 2QQAA 5E16A 2WWJA 5AIQA 2XLGA 2EFQA 1FMD2 3PJRA 1JZ8A 1ETOA 5ICCA 3A22A 4ZY9A 2LC2A 4IV3C 4QB2A 4BEHA 3WG9A 4LBJA 3ZFFA 5CFCA 4E4SA 5APAA 3RZMA 4P14A 3CJNA 5BMZA 1UW8A 3FFQA 1LNWA 1UY2A 2GMMA 3LSDA 3LB9A 3GFLA 2A5YB 1B35C 1UNBA 4J00A 3BN6A 4GMP0 5JR7B 1X36A 4IPAA 1U9OA 3JRHA 1IKPA 2WN2A 1ULDA 2X10A 2XBO3 2VCBA 2A1XA 3V42A 4BDYA 4KA4A 3R6SA 3VBHC 1LOEA 4FFHA 2PAEA 2VCCA 3C3VA 5L3GA 2WZPP 4EM0B 4KGGA 1X1AA 3WP5A 5JSPA 3KS7A 2DODA 4A41A 2EA7A 5FLJA 4YZ1A 5FKMA 3GCXA 1LDJA 1BW6A 5FZOB 1WW4A 2E63A 4L5EA 2FZ2A 4IE0A 3OPZA 1PK6A 2DA1A 1JYVA 4OCTA 2PHUA 4DYCA 5FLXZ 3LEKA 1MIJA 3LSEA 2EXHA 1GV5A 4CA0A 1JI6A 2OPWA 2M45A 3OG2A 4E6KG 5D6FA 4I6ZA 3LGRA 3I3EA 1FP1D 3T2OA 3B5LB 3B69A 3BOWA 4QQOA 2ZGPA 2J1RA 1TE1B 5ERLA 4XJAA 2H1KA 1AKHB 4YRDA 2VOVA 3F72A 2XUBA 1HN1A 1B72A 1QJFA 3ACHA 1H89C 2FDKA 5ABJB 1YXWA 4IXLA 3NNLA 1XDSA 4Y1XA 4BQAA 4K3UA 3A21A 4G94A 4FPGA 2VBXA 4ARYA 2AR6A 2HQAA 5HNHA 3H42B 1DDNA 3NV4A 1A31A 2BVVA 2CAUA 2XLFA 3GTPJ 2DTWA 1ZR4A 4HX7A 1PGL2 5DD8A 2ME6A 3GYHX 3U10A 3D8CA 3SDBA 1GWKA 1POQA 4UB6C 2DA6A 3CCEI 1IRGA 3OJBA 2YR2A 2WN3A 4LG3A 3CCMI 1I39A 5J8CA 2A6HF 4HW0A 2YMZA 2ZBJA 4M3CB 3J7AY 2LRDA 3JUUA 2GA2A 4MEYF 1I6HJ 4GZ9A 4WVMA 3B6CA 4BHPA 5FWEA 1LRHA 2CQ7A 4QQPA 2VXRA 4LO4B 1ETWA 2W39A 2JXAA 3DEUA 3WU0A 1XGOA 2D6LX 2A68F 4GMP1 1ZKGA 1ZRFA 4Q0PA 4Z2AA 2DMPA 3OSFA 1TQIA 3JQXA 1B1BA 4AEDB 3OYLA 3Q9OA 3ECHA 4IOCF 4YM1A 3FHNA 5AC93 4LPLA 4XAEA 3CDLA 4MTDA 3M4FA 5DAVA 4P1WA 2NVUB 3KT4A 4ZZ8A 3ZVXA 1F15A 2RS12 1LHUA 3LZZA 5C4WB 2ZSHB 3AP6A 4S2DA 1OURA 2FDGA 4XBQA 1R1TA 4HQMA 3QLQA 4AYBN 1K4SA 4MQ9F 2R073 5ICFA 1DYOA 1R093 3LWCA 5HI0A 1F4AA 4LFUA 1LEMA 3OYCA 3I4MJ 1SMYF 1DGWY 4E2QA 3VBUA 5JLXA 3UGGA 3K4BA 1VBC2 5L7OA 1SFYA 2VOPA 3WGIA 2HVRA 1MMDA 1RC9A 2X9DA 2EWNA 5FYIA 2X1CA 1SC7A 1SVOA 3LWFA 4RGAA 1MSEC 3J81K 3WNLA 3S3NA 5FLHA 4IRIA 5JXHA 2E5ZA 3OYWA 2DT6A 3FHAA 3RZKA 4DQAA 4FX4A 1KXGA 4WXHA 4F8AA 2ESNA 3X2QH 2LVSA 4ESFA 2XROA 1K42A 1ULCA 4BQWA 3VKMA 3BG9A 5J48A 4IQ4A 4EZHA 3NQHA 2NMOA 5GLWA 2O5RA 4W50A 1ND2B 2Q5TA 3NKTA 1J9IA 1KS5A 2HYGD 2WR9A 1W05A 4E7KA 3HAGA 3I56I 4DUWA 2AQFA 2E1MC 5SV5A 4ZZLA 4CA9A 4M0NA 2R043 1A6IA 3R0AA 5FGMA 4C3HJ 2VODA 2W82A 1ZG5A 1X19A 2CGOA 4M9SA 2RV8A 3PUBA 4HSTA 2E2IJ 2C6YA 2DF7A 4RL7A 4XETA 5HODA 4LBQB 1ZNPA 1X2MA 3BCAA 3IIAA 1AR93 4BY7J 1APLC 5F27A 3K3NA 4IE7A 5KXDA 2WAEA 4OWRB 2HEOA 1EUUA 1O4YA 1XN7A 1W36D 1ERDA 4Q27A 2OKXA 1JZ6A 2MFZA 4KIFA 1W6PB 3WF2A 4PJLA 1ZBA3 2STTA 3PU3A 2HWB1 1OCZH 2LG4A 5DM7F 1W6MB 1DLLA 3ML6A 2YZ4A 4K40A 3BTJA 3U1DA 1YCIA 1R00A 4CHUA 1WPKA 3VZNA 5FMOS 2BY2A 2DFHA 4XSZF 3I3LA 3FMGA 5EDNA 1GNYA 1ZQ3P 1PNFA 3GALA 5J40A 1T6GC 2J1VA 2YFUA 1I3AA 1H2NA 1ZGAA 3NV1A 3LDRA 3U4XA 5FO5A 2YU9J 1AR81 1W9TA 1SLCA 3CP2A 4A6EA 4L92A 2OQ7A 1PYVA 2X1EA 4P08A 1J75A 4ZZ5A 4KL1A 5DEQA 1UZZA 4Q4W3 1V6NA 4IW3A 3G71I 1K3IA 2GM4A 1FNNA 3AP7A 2PQQA 1QHDA 4IV1A 2ENRA 3ZGKA 1S0DA 1Z0XA 3SJMA 1W8WA 4UXNA 5F64A 2LR8A 5ICGA 3CNAA 4RQPC 4Q4W2 2RS53 4H7MA 5I8TA 2ZACA 3OYEA 3HYIA 4M3CE 3JD72 1O6UA 1JKQC 5D5XB 2EIBA 3E1F1 2CUFA 3WP3A 3N9NA 2VBDA 3IKVA 3M8EA 2E1CA 5A3TA 4TYSA 4PQQA 3RZDJ 5TISC 1UHSA 5KBFA 3PJQA 5EV7A 2UWCA 3ZMUA 4H4KC 2DUOA 4NIIA 3AC0A 2DCZA 4XFCA 2HWVA 1G3TA 1KEXA 1KJRA 4CU7A 1OCTC 1LE8A 5LLQA 1P2FA 5M5WJ 4F83A 2JZYA 3NAUA 5J7MA 4MFDA 1IZ1A 2A3WA 1PM4A 4AVSA 1W9WA 1ENRA 3GF2A 3MCZA 4FASD 3AMQA 1MEC3 1AOYA 2DMNA 3ZYJB 4HNUA 1E3HA 3BDDA 2D1VA 2X0LA 1XE7A 1AR92 4PI2A 4AR2A 1J3RA 2O7OA 1IGNA 3BU7A 3J7MA 1WH5A 3E3VA 3UNGC 2PJRA 5IVYA 5FRNA 2P1BA 2BFUL 4GB32 4U2AA 4AHXA 1XG1A 1I5ZA 1T2KA 1QO0D 4G7ZF 5FY1A 5DAWA 3FKJA 1Y9GA 3LL7A 4KBBA 1COV3 3ZQQA 2O61A 2DCEA 1C8NA 2O8KA 2R0FA 3ZMOA 5IK8A 2VC0A 1SAUA 1V9U2 5K7PA 1O4TA 5KCMA 5C3OA 4DEQA 3P9CA 1FYMA 2GN3A 4FQZA 5FLVA 3JAMZ 4PQ9A 4YFNF 5DUXA 1Q1VA 1OISA 3U75A 4C1WA 1W4MA 2A05A 3PNVA 2Q0AA 4D7TA 5C3QA 3POWA 3K1NA 1FOKA 3OBTA 3BJOA 3WNKA 1ODDA 3KD4A 1C28A 3OBAA 3CZJA 2Y9YA 2DDBA 1ZG1A 4XXPA 5BNPA 5H6RA 3WTTC 3K3OA 1D0YA 2QBYB 1VBD1 4CDQB 3VYRB 1WCSA 1QPMA 2ADUA 1ZTRA 3AP9A 2VCAA 1XPXA 5L3BA 4MIMA 3WZ1A 1F9NA 1I9RA 5F8PA 3NRUA 1V6MA 4DXZA 3JB8A 1GYKA 3VBSB 5FPZA 5LD2C 4G7OF 2ZXIA 1H9TA 3ACIA 3LCPA 4AHWA 3WT3A 4A3BJ 1ZZ9A 4Y1UA 2ZC2A 4LIUA 1HV0A 4Y22B 2L3DA 3VBFC 2K9SA 1CESA 4OUMA 1WGPA 4P55A 1XE8A 2CO5A 3P9KA 2BRTA 2KISA 2LALA 1D7PM 3KP2A 5ANNA 5F2SA 3EB7A 1KITA 1TTYA 1DQ5A 5FXWA 1K4TA 4R4ZA 2ECBA 4LBLA 2Y48A 1X8EA 1GNHA 3ELKA 4PIYA 1LJ9A 5LRRA 2Q2EB 1PUFA 2Y0MA 2E7QA 1E5IA 5BV6A 2X29A 1X1BA 3PL0A 4I0AA 1LFBA 4Q4ZF 1K61A 3FLTA 2B7EA 4P9JA 4IX7A 5BUVA 3PLQA 1FSEA 1ZZBA 4UWDA 3AP5A 1PVXA 4CO8A 1M1EB 3D0JA 4UFMA 4KQ7A 1XCBA 5HBAA 1ZRDA 4FOYA 3C2UA 2E33A 4QSHA 1HKQA 2JIJA 4XHBA 3MO4A 2Q8OA 1PGW1 2DA5A 3LSHA 2F2EA 2DDAA 5FOBB 3PUIA 3RZOJ 4Q5OA 1R1A3 2O0OA 1ULGA 3WHUA 2RC4A 5BS6A 3WQBA 4ESJA 3RS6A 5IVEA 4I30A 4CZSA 3EYIA 3T4HB 1HSTA 4PJ0C 1CX4A 1ST8A 3DKXA 4L2NA 2DOFA 2OPTA 1XPWA 4AFAA 5FZ0A 1ENSA 1VRH2 1RHI2 1FMWA 3M1EA 1XNDA 1U6GA 4AFMA 1HB3A 3ILFA 3JSOA 5L36A 4WM7A 2Y6KA 4NUBA 2PMWB 5DCFA 1J09A 3TOBA 3NEUA 3FLPA 2X5IC 4B44A 2JVGA 1YQ6A 1KU7A 3OEBA 1ZRRA 4YSFA 1WBFA 1WW7A 2Y60A 1MQTC 1AR61 3OL4A 5JUVA 3SMHA 2V1UA 2H6BA 3KWVA 3Q3SA 4KITB 4EJOA 1VBC3 3AXEA 4QHBA 3MWMA 3BR5A 5E6HA 5J3LA 4XRMA 2FOWA 2UUZA 3COAC 1JZ4A 3K51A 2E26A 2ZEWA 3L2RA 1G6NA 3H9AA 1W3XA 1OHFA 2XL9A 4XZPA 3AKRA 2WWUA 4BQ5A 5A2QK 5DCMB 2ES3A 3I71A 1MZEA 4MNUA 5FJ8J 3P9IA 1DFQA 3WNXA 3LQRA 4K9SA 2X6OA 3W2WA 3M3QA 3R60A 5C71A 1URXA 1VIWB 4AVZA 4YEJA 4XUTA 2NVTJ 2YBPA 2KIQA 2WKKA 1F9KA 4ZXKA 3PNTA 1RXFA 2IP2A 1R71A 4KN7X 3QOPA 5AVAA 3FDYA 5E8AA 1FX5A 5B4NA 4B4CA 4MHGA 4HXCA 3FBMA 2BNNA 3HJRA 2VE8A 1OUXA 2VQCA 1BBT2 2L4MA 3LFMA 1D4M2 1TWHJ 3GMEA 2CQNA 5KXEA 4XFIA 5C70A 1QDOA 4A3JJ 3KP7A 2VBBA 1OXCA 4LK7A 4MEXF 1FP2A 4L9TA 1Y4WA 4BB3A 4J25A 1XQNA 3DV8A 1SLBA 3N35A 1UIJA 4BXFA 2ETHA 4XK4A 3OSGA 4YM3A 1QF3A 4LQRA 1R092 1R7JA 2LUWA 5JCTA 3QH7A 2HU9A 1FPN3 2X8KA 2DTZA 4XLHA 3RPUD 4EM2A 2ZHNA 2O14A 1T39A 3KMHA 3ZIXA 1CAWB 4Q4Y2 4NOTA 4XYXA 3JQWA 1MJ9A 5GTIC 2KLOA 1QY4A 4N9HA 2HR3A 1H6XA 4KDPA 3NNJA 4L0YB 4EGZA 2ID4A 2WLQA 1YEWA 3S6PA 2PHDA 2VNRA 4MV2A 1MW7A 3OYDA 2PBIA 4IEOA 1MBGA 1GQPA 3H8UA 1D0XA 3Q8EA 3FE5A 2LTNA 2I5UA 3VD5A 1UG0A 1JW6A 3Q8BA 2CSGA 4LLNA 4HRIA 2H8RA 4YGDA 4E7IA 1V0AA 3ZR8X 5A7PA 3PO3J 1JMUB 2ZX3A 3IWFA 2QQJA 4OIOF 4R9DA 2RMU2 2K4BA 1EV12 4P9UA 3QP6A 3ZKUA 5EP9A 2RQPA 2ARBA 4HPQA 3MIDA 5DDGA 3TDZC 2FBEA 1BBT3 2Y33A 3GFMA 1JXSA 3J8F3 1DZRA 2QQBA 2RS32 4AWDA 5FUPA 4CDUC 4RS5A 3JU9A 4LOTA 3HWJA 3GJAA 3VKOA 4A3EJ 3WTXC 1YIJI 1RIRA 2RAEA 2CYYA 1VBA2 3JBG2 4EJTA 1H8TB 3L9JT 3HPNA 4PJYA 4UUVA 4K20A 4NPRA 4OMDA 5F39A 2QNKA 2KM2A 3N4MA 1UX7A 3H1WA 2JUGA 2DYSH 5I0SA 5DG2A 2W08A 1QH6A 4JGZC 3GLXA 1JH5A 1BZWA 3K10A 4NE9A 4HSLA 2DOAA 3LSKA 1PZ7A 5F2WA 1U5TA 1HXS2 3ZSEA 5FZAA 2IVMA 1K5MB 3X29B 2FRHA 2E7TA 4G6QA 4JOMA 4I09A 2KHMA 2NVXJ 2LFBA 3LOCA 2NVYJ 4W6XA 1X1DA 1FBQA 1ZLJA 2BVMA 4FVVA 2XQXA 3WW3A 3KP6A 2D45A 5F5AA 5JHUA 3W20A 3TL4X 3VDDB 3HBKA 1NXMA 1MH4A 3ZIWA 2Y26A 3S7IA 4S2FA 4D7MA 3WTVC 2VKVA 2OV7A 1TT5B 3WU2C 4W97A 1HB4A 1SFPA 1W5SA 1S29A 4OHYA 4GD4A 3VBRC 4YGEA 1Z67A 4XL9A 4CP9A 4JX6A 3LSPA 3PUSA 4XRSA 5CEHA 2CFOA 2Q0OA 3BC8A 3S3MA 1SFNA 1QJX3 2ZGSA 1XCVA 3NV2A 3HQXA 2DVGA 2OUMA 2UZKA 3ZX7A 1ZBA1 1QPIA 2SBAA 1JJ6C 4BQXA 2JMWA 2PMZN 1GLNA 3BPVA 3WTZA 4EROA 1W6QA 4G12A 4JHTA 4M71A 4YIIA 5CYVA 1WGXA 2F5DA 2LKSA 3THDA 1D1BA 4GGGA 2D6NA 2X5IB 3HDDA 3U9GA 4LJHA 4BY1J 3JB4C 2C24A 2X05A 1MS9A 1ODNA 3UKGA 3BP8A 3DL3A 1NQJA 4HBLA 2VUMJ 2HDWA 3MD2A 1AR83 2JD4A 3CCSI 2DFIA 4CUAA 5IP7J 3AP4A 3F3XA 3GDBA 2K86A 4AAXA 1MSFC 3WNOA 4Q4Y1 2YPRA 1OR7A 4AOCA 3GZEA 4Y5SA 1ZGJA 3FX3A 2LSOA 4Q4V3 4GULA 3WTYC 3MW2A 3CC7I 1NLRA 5IK5A 2FBIA 1REDA 2B45X 1GMMA 3BTXA 2HPMA 3FBYA 4ESBA 3ONQA 1VB4A 1AL21 4Y33A 3ZYGA 4LT5A 4MGSA 2ZX1A 4XN0A 1RUF1 2COBA 1YJNI 1S2EA 3C2GA 1F5TA 2DFCA 2B4KA 2YHJA 2Y34A 5L9BA 2ECCA 4Y20A 4RGKA 1XX5A 3H5AA 3KGZA 5FKNA 1T38A 5M3FJ 4YARA 1S0EA 4AG4A 5LWBA 2MEV1 4ITCA 3IKTA 5FFOC 5FR3A 5A2QZ 1UZ0A 2KQRA 5A1LA 3CLPA 3BTLA 4YM2A 3WE2A 3DBHB 3ZSLA 1VMFA 3VHPA 2DQLA 3AK0A 3OGRA 5L73A 1XSQA 4KMQA 3WDTA 4E7ZA 3HB9A 2CHHA 2EVXA 4ZYHA 4QU1A 2E7XA 1AJKA 2OS2A 1NLQA 2OBPA 1UMIA 5F37A 2DFBA 4CXFA 4HEA2 3WHTA 3BTYA 1YJ9I 4A3IJ 4EN6B 3F8NA 2XUMA 3RZLA 4CDWA 2QQ8A 2ZNYA 2WUHA 2ISZA 5K0UC 2JENA 3NSTA 1D4M3 3B7MA 3BTCA 5HLGA 3MIFA 5FY5A 4ENMA 1FEXA 1PVC3 3DTEA 1GZTA 3QPSA 4IHWA 2DAOA 1CVNA 4YG2F 1KGSA 3F8FA 1HRI1 4QTRA 3LOBA 1HDPA 2EV6A 2EIJH 4U0YA 4AGGA 4B3NA 4RM3A 4Q5SF 5F0FA 4RMNA 2A5WA 3U1KA 2R7QA 4AE2A 5LHHA 2QEXI 2QGUA 3WDYA 3KEYA 5C5UA 3QRFF 4OQ8A 5F1JA 5ISLA 2ZJRF 5JLWA 2OXBA 2EZIA 3JTGA 1TWCJ 1RGSA 1E0EA