3I59B

Crystal structure of mtbcrp in complex with n6-camp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
202
Chain Sequence
SHMDEILARAGIFQGVETKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLDVPGRVAKQLLQLAQRFGTLRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, Crp/Fnr family
publication title Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 47
structure length 202
sequence length 217
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00027 cNMP_binding Cyclic nucleotide-binding domain
B PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i59B02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i59B01
3BPXA 5HOOA 3MYXA 4MHGA 3SHRA 4L2NA 4EQQA 1O3TA 2H09A 1PP8F 3UKVA 4IESA 1O3SA 3I4PA 2DBBA 2A68F 3G73A 3NVCA 5LEJA 4I2OA 1IAWA 2MA3A 1EPZA 2QVOA 1AOYA 1GXQA 3I71A 1OYIA 4LK1F 4OMYA 1ZX5A 5JSRA 4LUMA 1DZRA 1K78B 3TO6A 1WSUA 1QWRA 4FBFA 3KEQA 4U0WA 3IKVA 3GBFA 2FSWA 2PLYA 3C7JA 2F5FA 3QP6A 1ZREA 4XF9A 4META 2ELHA 5KHKA 4L9VA 2MC3A 2EFPA 3ES1A 1LKNA 1B59A 1PMIA 1ZG3A 4WBBA 2YU3A 3VODA 4M6YA 4LG0A 4YYOA 4Q0PA 2EWNA 2A6EF 4LLGF 1XGOA 1Q3EA 1FOKA 1BI2A 3GX4X 1JHHA 3DL3A 1D8JA 1YQAA 3SZPA 3GZ5A 3VHRA 2W25A 2E1CA 1W5SA 3NSTA 2OZUA 2UXNA 3R6SA 4FAGA 4P96A 2XL7A 1CGPA 1ZYRF 4EGZA 2HFHA 3WW2A 2RC4A 1TTYA 3R60A 1ZGAA 4MZUA 3FMQA 2N7GA 1LDKB 2G9WA 3CUOA 2UY9A 3R0AA 1CX4A 3ML6A 3KP3A 2F5DA 2DPDA 5JSPA 3UKNA 4QGNA 3F8CA 1RZ4A 4QMAA 3T5XA 5FFXA 5EEGA 4LFUA 5D4SA 3H7YA 4PIXA 2K02A 2FBHA 2LF8A 2VQAA 3RYKA 3L00A 3I7DA 2HJIA 1VP6A 3RDIA 4RGSA 1FP2A 2C6YA 5LBQA 1LRHA 1X82A 4HV5A 2GA1A 2KIFA 4M9SA 2V79A 4IETA 2D93A 3BPVA 2JZYA 4ONUA 3E6BA 2QDRA 4BIFA 1UD1A 3PQJA 2D1HA 3V7RA 4AIKA 5IT9K 4IERA 4UXAA 2PMHA 4CXFA 2EV0A 2P5LC 3HRSA 1UCXA 2NNNA 2JSCA 4EJWA 3DEUA 3SHFA 1ZRRA 1W7PD 2V09A 3DFGA 5I8TA 4ZYGA 1RI7A 4KIGA 5CVRA 2Z2SB 3T8TA 1DGRA 1I27A 4RAZA 1CAWA 4G9YA 2HDCA 4H0EA 4ASNA 3BCWA 3WGGA 3J81K 3ZDSA 4E2GA 3VFZA 3GFIA 1QBJA 2IPQX 2YPRA 1FLIA 4IEUA 1QZZA 4KIBA 1XSDA 5FLXZ 1NE4A 1R36A 4G7ZF 5CVIA 1FSHA 1RL3A 4XF3A 2ISZA 4O3MA 3RKXA 3V7CA 1FZPB 3I54A 1YS7A 4P55A 3DP7A 2HTSA 1EP0A 1UW8A 5BY5A 1BOAA 2IVMA 2WV0A 2A3SA 1FNNA 2GWRA 4IHTA 5E17F 1Z7UA 1BC7C 1X8EA 1DUXC 4EV0A 4MGIE 2EFWA 2WWYA 3ZMZA 5HDKA 1XDUA 4L0ZB 2HQRA 4I09A 3NRVA 4UV8A 3L7WA 5LHGA 1IN5A 4YFXF 4MGZE 4AVBA 4XFIA 2JPCA 3HSRA 4B8XA 2Q0AA 2FE3A 4I3PA 3EBRA 2E7WA 4BHBA 3BROA 4ENKA 5DEQA 2EFQA 1J59A 4F8AA 1XGSA 2PMUA 2XLGA 3LQRA 1XGNA 4A2UA 4GULA 4G6DA 3WTXC 1R22A 2BV6A 2K4JA 3TGNA 3T0YA 4CO8A 1WGPA 2DW4A 2P8TA 4JV4A 4LMYA 3ABUA 3IHUA 4RGXA 5T3NA 5FB2A 1QPMA 1ZHFA 1J1LA 1IN8A 2XL9A 3RI4A 4UHTA 3QOPA 2D2WA 3EUHA 5AONA 1NE6A 5BV6A 3ACLA 1E17A 3H50A 3KEOA 2XVCA 1S8NA 4GXOA 4HX8A 2IA0A 1KQ9A 3JAMK 1IRGA 4XFFA 1UPIA 1YW8A 2IJLA 1SD7A 4EGYA 1QZYA 3ELKA 1MZBA 3TO7A 1XCBA 2ATFA 1FYLA 3OD0A 2PYTA 3REOA 1LEAA 4DQ2A 1LQ1A 5CLSA 2QQAA 2UWMA 5D4RA 1Z6TA 2FU4A 3GEZA 3KP2A 2F2EA 5HDNA 5K5QA 5TRDA 5KHJA 2PAKA 3WW1A 3C1DA 2GIVA 1ZH5A 4M71A 5I0TA 5BPIA 3G3ZA 2VOOA 4JBAA 3L2CA 1IUYA 4LA3A 3U11A 3CEWA 1U5TA 3QU6A 3WE3A 1FI2A 3D5LA 2QQ9A 3K1PA 3LQQA 3ECHA 1YLFA 2Y0OA 4P9UA 4LB5A 5DD4A 5LGTA 5ERIA 4R1HA 4YIIA 4B09A 4A0YA 2FNPA 5D5VB 4LG0B 1HSJA 2H6BA 2A07F 1BN5A 2FRHA 1J5YA 4MGKE 4NHJA 4HVQA 2G7HA 1R23A 1B9NA 1MKMA 1SD4A 2CQKA 2NAZA 4HX4A 4A5NA 2V9VA 1UFMA 4KWLA 1TQ5A 1U12A 3TKYA 1G3WA 5H20A 3N97A 1RNLA 1F5TA 5LLQA 5FFZA 1UHWA 5HLGA 5JAXA 1TNTA 1WQ2A 4QLCU 3E3VA 1D8KA 3M1EA 4FT8A 2D45A 2BGCA 4QGMA 2ESHA 1X7NA 2ET7A 2PA7A 1A04A 2M5WA 2RV8A 1HSTA 2MLKA 5A2QK 2OQRA 2EA2A 1HQCA 1U78A 1F4KA 5ILUA 4IEWA 5KK1A 4BXUA 2J5PA 3VB2A 4X6QB 4ZU5A 5EFUA 1XD7A 4P9GA 2YR2A 4RB2C 5DUIA 1O3QA 2FOKA 4YSFA 2BNNA 2PAEA 1F9NA 4IRGA 3ZPLA 1UCRA 2EVXA 4I0AA 4L9TA 3FHIB 3SXYA 1CF7B 1ZGJA 4GGGA 4ZZLA 1RGSA 1K6OA 2WTEA 2XKOA 4HYEA 1H9TA 5EZWA 3NL1A 3KZZA 4O9GA 4PZJA 5L3FA 4U0YA 4Q0SA 3TDZC 2GZWA 3SFZA 1S3JA 3RZZA 2XHKA 3ZN0A 4UNOA 3SXWA 2PFBA 4A0ZA 4RAYA 3D82A 2XUBA 2HGCA 4MTEA 5LHHA 1ZZBA 1BJAA 1SFXA 1YIOA 1V4RA 4N0BA 2FQPA 3KETA 3RKWA 5D8LB 4ESFA 1P92A 4M73A 3ZMSA 4KL1A 1ON2A 5HI0A 1MJBA 4LLLA 1EY2A 2ADUA 3KGLA 2OAZA 4U7DA 2RDPA 5KHIA 3CLPA 4IRIA 5HDGA 3ZMTA 2PHDA 4O5VA 2LNBA 1TW2A 3RIRA 4HN1A 1TBXA 2P5VA 4MUVA 1J9IA 1KU7A 2VBWA 3H8UA 4KMUX 5H6QA 2VXZA 4KN4X 3FFQA 2MD5A 2LDUA 4EJOA 3RYPA 4F7ZA 3I59A 2OD5A 3TNQA 3KE2A 3H3ZA 5JR3A 2QVSB 2Y48A 2H6CA 4FAHA 2CFXA 5BUVA 5CYVA 5ICEA 4XF4A 3MFKA 2K4BA 4L9JA 2ZKLA 3MZHA 2EFOA 5LRSA 2Q4SA 2RQPA 3W6JB 3BZ6A 1Z9CA 4FX0A 3ABTA 3EYYA 1D5VA 2D5HA 1YFXA 1EV7A 4I01A 4RB0A 3H1WA 3E6DA 2NS0A 4XLPF 2YX4A 4ENNA 2FA5A 1SAXA 1YTYA 4MGRA 3IRRA 1P4WA 2DO7A 3ERED 3DQVC 4AQ6A 5EEHA 4PJYA 2P6SA 4N9IA 1XMAA 3WODF 5I0UA 3M70A 4Q0VA 1SFNA 2ACJA 4ZYEA 3E6MA 4JVAA 2V1XA 1O57A 4Q47A 3HOTA 2M30A 3W6KB 3J80Z 1OI6A 2DT5A 3WE2A 4G8XA 4CICA 3FXRA 3LAPA 2XLAA 2ZNYA 2VPVA 3FE5A 4AXOA 1WLTA 1KA8A 2UYAA 4ENMA 1MJ9A 1YHFA 4LLOA 3R61A 1S6LA 1EH6A 3I64A 5E8GA 3F6OA 1QNTA 3I53A 4Z2YA 3U9GA 1ZRFA 2HKOA 3MZYA 3E97A 1SFUA 1LVAA 4KN7X 4E2SA 4M9XA 5I8YA 3M7GA 4E2QA 5K8SA 5BXXA 4PIZA 3CO6C 5CVUA 3VOEA 4KMFA 2XLFA 3HTUA 4KUMA 1CAVA 4MEXF 2L54A 1ZZ8A 5JHUA 4JK1X 4YARA 1HKSA 5J8FA 5DV5A 4XFAA 4LEJA 4EMSA 4ORFA 1J3RA 3FZVA 3OOPA 2M45A 2QCSB 1QQIA 2K0GA 1ONVA 1LNWA 5LGNA 4LGWA 1ZLKA 3PLQA 3SCHA 2IW5A 1TQIA 3KGZA 5I8SA 2DQRA 4HV6A 1SD5A 3CLOA 2JT1A 1DP7P 1STZA 4CYDA 3LOIA 3HUGA 1YW9A 1W5TA 3ZQ7A 1MDMA 4Q48A 1Q43A 4HLTA 1RC6A 4BYYA 3BB6A 1UIJA 5BPXA 3USSA 5J48A 3QPTA 4L9NA 5KVRA 1ZZCA 5CJ9A 2DTRA 5H6RA 3H92A 2HS5A 2VT3A 2X4HA 3C3WA 2ZXJA 5I0SA 4Y15A 3HSFA 1MGTA 2M8EA 2F5EA 5AIQA 3QPHA 4OOIA 4HMZA 2HYFA 3MQ0A 1SMYF 4XFGA 3JSOA 4KIFA 4HSLA 3QAHA 1OYYA 1W4MA 2XASA 3L9FA 3WTWC 1PM7A 2STWA 1GXPA 2VONA 2PI0A 4Q5SF 1WI9A 4Z82A 4EWEA 1T2KA 2FMYA 2GC0A 4X6RB 1IN7A 5BS6A 2VE9A 1ZAOA 4XSZF 1X3UA 5CVVA 3O3KA 5IT3A 1GVJA 4BHPA 2MBFA 1IPKA 2CGPA 4YG2F 4YIFA 4Y13A 3LA7A 5FCCA 1SMTA 4KFCA 3CUQC 5HS8A 3WU1B 2QYOA 3BJOA 1DGWA 2RNJA 3QP5A 4WVZA 4EM0B 1WWXA 2OBPA 1YLLA 4R52A 2GA2A 4HBNA 1R1TA 3RJPA 3GWZA 4JQFA 4ZZDA 3ES4A 1CAUB 2VODA 1G4DA 4WK8F 4NB5A 1NYWA 3EYIA 2Z5UA 3C18A 4PCQA 2ZNZA 1J3QA 3HRMA 4EROA 2VT2A 5E1ZB 1IN4A 5E1WA 2GXGA 4OU0A 4HQEA 1KU2A 5FGMA 5KHHA 1U2WA 5FQ0A 2RN7A 1USTA 2L02A 4G7OF 3S2WA 1OKRA 1XMKA 5F1RA 4ESBA 4LK0F 1FT9A 1XB4A 4RGUA 2NYXA 1WA4A 4I02A 5I93A 1FSEA 5F64A 2XAGA 1J58A 1O4TA 2BYVE 3LZZA 3KZYA 2ZFWA 1VR3A 2IP2A 2UXXA 5HLIA 4QXKA 3N4MA 5C8WA 4OMZA 4Q4ZF 3M9AA 4IF4A 3F23A 5CADA 3FJSA 3FM5A 2IXJA 1AWCA 1P4XA 2V1UA 3HHHA 4IEYA 2A5YB 4WXCA 2EFNA 4HW0A 5BQTA 2RVCA 2Z33A 5AIPA 5D1IA 3SQNA 2ET1A 3ELNA 3ULQB 1W7PB 5FLJA 2HQNA 2Q1ZB 2ZMEB 3GW2A 1R58A 2P7VB 2WFPA 1FXZA 2UY8A 4U88A 5FPXA 4EWDA 1BI3A 2B8MA 4PIYA 3F8BA 3KP6A 3V7SA 5L3EA 3L09A 1IF1A 4S05A 2FF4A 1V70A 1OFNA 1YUDA 1XRUA 3BWGA 5IT9Z 1HW1A 4AVCA 1ZN2A 4HDUA 2R3SA 3E5UA 2ETEA 4IEXA 3H1MA 2G7UA 3LAJA 1YFUA 3TO9A 3F3XA 4KWJA 1V3FA 2M1BA 4XFBA 2DK8A 4HBLA 1REPC 1RTVA 2FQ3A 1XSVA 3J81Z 3LA3A 1OMIA 5FDBA 4CGZA 3H7JA 2NNYA 2OU2A 3KLNA 1B4AA 2E7XA 2BBYA 2Q30A 2V1DA 4E70A 1U6GA 3MCZA 3FZ3A 2PQQA 2QUFA 1K78A 4HX7A 4LB6B 1CAVB 5JI6A 1EH7A 4AIJA 4EM2A 5DCMA 4HSJA 3FMSA 1E2XA 1KU9A 4OIPF 2QBYA 4U0VA 1WKMA 3HRTA 1QGPA 5E8IA 3U0ZA 4RB1A 2RGVA 1G6NA 3KFWX 1LDDA 1O5UA 3M3IA 3FWEA 1XN7A 2ZBKA 3GYHX 1Y3TA 2MLGA 4KU7A 5J3UA 4ZYDA 4ZH4F 3V8KA 4HAMA 1DPUA 3F8MA 1L0OC 3L2HA 2ZO4A 4IEQA 4MV2A 1LB2A 4NVPA 4WF2A 4XF0A 2IA2A 2QQBA 4RGRA 2HTJA 3MWMA 4M6XA 5L3GA 3BY6A 4MX3A 1I1SA 2QLZA 3B02A 5KBFA 3ZP5A 1YS6A 1R5GA 4KA4A 3P7NA 2COMA 3EHKA 2Z99A 3I0TA 4OINF 2O3FA 3O6BB 5JVTA 1D3YA 3PNAA 3HHGA 1R1VA 4AVAA 1L3JA 2RKHA 1RUOA 3JAMZ 2EV6A 4Q0QA 1C0WA 4RS8A 3MEXA 4KNYA 4WWCA 4ETSA 1YW7A 1PDNC 3ETQA 3TNPB 2X0LA 3LWCA 2Z3YA 4HLXA 1BIAA 2CYYA 3PVBB 1JGSA 3WGIA 4LD5A 1T98A 1DDNA 2VOPA 4UXNA 2CWEA 2BEOA 3S0MA 2HOEA 2W85A 1QXJA 3C3VA 3UKTA 4O9EA 3HIFA 2HKXA 3FX3A 3IWZA 3SCFA 3HYIA 5D6FA 3GXOA 4MGYE 3TOAA 2DU9A 1IXCA 1HKQA 1S29A 3U1DA 3DPTA 4YNIA 4LA2A 1FWZA 3IDBB 1CAWB 2CO5A 1GQGA 2O61A 5D5XB 1RUNA 5ED4A 2C0ZA 1MJAA 3EO6A 3V8JA 4HF0A 4L5JA 4EJVA 1VTNC 4KT5C 1XGMA 3GO5A 3KSCA 3LWFA 2R7FA 3F6VA 2Q2EA 2JRTA 4WXDA 2YSRA 3M8FA 5DD8A 1HKTA 3CO2A 2FNAA 1JE8A 5FQ0B 3DKWA 4WZCA 2EK5A 2D1VA 4A5MA 3D0SA 3ZMUA 5BOXA 4DNCA 3GLXA 3WG9A 2HEOA 1SEFA 3QRFF 4LUKA 4KDPA 4L0YB 4UVCA 4I0BA 1FYMA 5JCTA 3S7EA 5JSOA 1J0RA 4I98B 1VJ2A 4QM9A 4RB3C 2IRFG 3U2RA 4HF1A 1Q5OA 4OLLA 2L4AA 5A2QZ 2PAMA 4YFNF 1ZRDA 4EJUA 2PEXA 4BH9A 2QM3A 3JW4A 2BNOA 3K1NA 4A0XA 1ZZ6A 3CUQA 1F1ZA 2QZ8A 2OZ6A 3GYDA 2K9ZA 5TJJA 2FBKA 3IBMA 3HOSA 2DAOA 3IL2A 2I45A 2OA4A 2E1NA 2EB7A 2IC1A 2DFIA 3TDUC 1FBSA 1IN6A 3QU3A 3CTAA 2DLLA 3CO7C 5LHIA 4XEZA 4A6EA 1TW3A 1LR5A 3JSPA 1ODDA 1R5HA 1FX7A 1IXRC 2XV4S 3ZN1A 3NQOA 4NQWA 1B9MA 4BNCA 2M87A 2DQLA 5AVPA 2GQQA 3F8NA 5E20A 3PFIA 4HDVA 1IRFA 4EJTA 1NZCA 3WTTC 2L3DA 1Z6RA 4TV7A 2PG4A 1PP7U 4XFCA 2UZKA 4BHCA 4S04A 1O7LA 4HVOA 2F5CA 4IJAA 3F22A 3P9KA 3OF1A 3SZTA 4Q29A 3HQXA 3WTVC 1L3LA 1ZZ7A 1OD5A 4XETA 1ZG5A 2L01A 3SMHA 1Z05A 2D5FA 1U3EM 3LSTA 2EAAA 1Y9QA 2YX7A 4KYWA 3GUDA 2EV5A 1LDJA 2LSOA 4KWKA 4HLYA 1K79A 4IRHA 1IZ1A 5K5RA 2FBIA 3SCGA 1EYBA 3MPBA 1U5TB 3HSEA 3ECOA 1YWKA 3ST7A 3DV8A 2GC2A 5DCMB 1WRJA 1UB9A 5L3DA 4HA8A 5DDGA 2LKPA 1YFYA 4WCGA 2QBYB 2EJRA 4UUVA 1T0FA 2AS5F 4EM1A 4OFGA 3BP8A 2ESNA 3WTSC 5ICGA 2EA7A 3FMRA 2HWVA 2VC1A 2CG4A 2DPUA 3M8EA 3WTUC 1ZARA 3BDDA 4GYIA 5FLXK 1K7AA 4IEVA 5E18F 2E9QA 4GYGA 3K2ZA 4LJZF 5HVQC 2WC2A 1YYVA 2W24A 4QWQA 3IIAA 4MQ9F 4D7TA 2Y75A 2KJBA 3H3UA 3E5QA 2FEZA 2VECA 5ILVA 3BJ6A 4JTOA 3ISPA 4XBFA 5J6XA 1U8RA 1FBQA 2VBXA 2XAFA 1UHMA 1MD0A 4MTDA 5HLHA 4KU8A 3HTSB 2STTA 5FLIA 2KXLA 2KIMA 3KLOA 3ZMDA 4UVBA 2QNKA 3CL1A 2ZKZA 3RNSA 3TQNA 3WU0A 2QWWA 1Y0UA 3F8FA 1BC8C 1KU3A 2P4WA 2XIGA 3K69A 3NEUA 4K2EA 2GH2A 3I58A 3LAGA 3FF5A 1O7FA 1IW7F 3I5UA 2Q8KA 2PTMA 5LRRA 1YFHA 4HVRA 1DPRA 2ZCWA 1HW2A 1BI0A 1T38A 1FYKA 4QM8A 2R7DA 5KHGA 4O6JA 4PDKA 1CF7A 3T8RA 2J5OA 4XFHA 3NJZA 2P7CB 1I1GA 1OYWA 3GF2A 2XKPA 3V8LA 2OQGA 4AQ2A 3K0LA 4IXAA 1P6RA 2BE5F 2XGXA 3CF6E 3F72A 2P6TA 3IDCB 1T39A 5F6FA 1J7KA 4ZU7A 1Z1DA 3T1BA 1SQ4A 2H94A 4D0PA 1TQPA 1UIKA 2OYZA 2IXLA 2MNGA 3RYRA 1QXRA 4BQAA 3DN7A 2MH2A 2HZTA 2B9UA 3K1MA 5HS7A 3WTZA 2QJVA 1R00A 4N9HA 4L11A 2F4PA 2O8XA 3EDPA 4Q0UA 2ZJ2A 1NXMA 2XRNA 4CDGA 1H1MA 4DINB 4YFKF 4LTAA 1X8MA 1R1UA 3LA2A 1XCVA 3LFKA 3I59B 4L5IA 1USSA 4M9ZA 1G3YA 1XDSA 4IPAA 3AAFA 4G6QA 3R0JA 1B1BA 2IXHA 4IEZA 2VN2A 4G7HF 4GO1A 3Q9VA 2XAJA 1ULYA 2GXBA 4CZZA 5DCFA 4XF1A 1HW5A 5FO5A 2A69F 1FPQA 1Q1HA 4JTNA 4WX9A 4P5OA 1O5LA 1BI1A 4XSXF 1O3RA 5CU1A 2VBYA 2IT0A 3O2PE 5BMZA 2PBIA 3CUQB 4BAYA 4ENJA 1GQHA 3WGHA 1IXSB 5FD6A 4AD9A 2ETHA 2K86A 2Y0MA 2K27A 1QY4A 3RTRA 3E5XA 3OCPA 3K9TA 3IC7A 4AVPA 4MH0E 2CW0F 4R79A 4OIRF 1CAXA 1QO0D 1P2FA 5E1XA 5K1YA 2OPKA 3EQLF 4HQMA 5FPZA 4UBGA 5FD5A 1IPJA 2P17A 3JZVA 2O1QA 3NKTA 3CJNA 2EA4A 4ZYHA 3HRUA 3NW4A 3EQEA 2B0LA 3V4GA 1BM9A 1ZG1A 2CSOA 3COAC 4XRFA 1LEBA 5L3CA 1OR7A 3MDPA 5D6EA 2K7LA 1KQ8A 4ON0A 4MNUA 1SFEA 3KCCA 4FX4A 2VE8A 3GVAA 4IHSA 4OIOF 2HYGD 1J2XA 5FLHA 1KGSA 1RIOH 3RKYA 4AIHA 3KP7A 1R7JA 4HOBA 3GFLA 3DPLC 2NRAC 5ICCA 1S7AA 1J75A 4RD7A 4AWXB 2Z69A 2IXKA 2IA1A 1S7OA 3O14A 3IWFA 1SD6A 3WTYC 3VEPA 3ROUA 4XLNF 3DF8A 5J7MA 3OTFA 5D8KB 2O0YA 4ESJA 3GFMA 2GC3A 5D5UB 3P9CA 2XAHA 3G7DA 3BU7A 2OZJA 3RPUA 1HBXG 2MPFA 3S7IA 1BBYA 2KKOA 3GZ6A 1MDMB 4GCVA 4MEYF 2B5HA 2UYBA 2VC0A 4HZFA 4TLFA 6PAXA 4Y17A 4YRDA 4PGHA 2LF7A 4CHUA 2KRFA 3BJAA 3MAJA 3R4KA 2KIUA 3Q5FA 1ZZ9A 1GHCA 3JTGA 2L4MA 1YFWA 5ICFA 4G94A 4U7BA 3CJXA 4Z07A 4OIQF 1OPCA 2V6CA 2MH9A 5E16A 3ZMVA 1FC3A 2XAQA 1ZNPA 1P4AA 4HN0A 2PJPA 3BOQA 1ON1A 2H0VA 3EJKA 4M74A 1Z91A 4HF2A 1PUEE 3KMHA 1TQMA 2PHLA 3BALA 1NHAA 4LLNA 2A61A 2P5KA 4L18B 2DK5A 2GU9A 5I0RA 1LJ9A 3CDHA 2XROA 3U10A 3KP5A 2GC1A 4B29A 2D40A 4H7LA 1H1IA 3RPQA 3FHZA 3PQKA 1ZRCA 4QGLA 2MHFA 4IEOA 1KYZA 5DUKA 5JFRA 1TLHB 3J80K 5HS9A 2IXIA 5I91A 1XSXA 2O6GE 1FBUA 2OA2A 5J8CA 1CAUA 2TDXA 2CAVA 4K8FA 1ZLJA 2W57A 3H1YA 2O03A 3H9AA 5K5OA 1EH8A 1I6XA 2VBZA 3KP4A 4PGGA 1JXSA 2JPBA 2HR3A 2PFWA 5JR7B 4IEPA 5C6CA 3BPZA 3QACA 4KICA 2H27A 2GAUA 4IVNA 2CV6A 2CAUA 4I7HA 2KJCA 2AXLA 5DYMA 4UV9A 4EVIA 5L3BA 4EWAA 2JTVA 4UBHA 3IRQA 1HXDA 3Q9SA 2FXAA 2FMLA 4WXHA 3OV8A 4LULA 3E6CC 2PQ8A 3FXUA 1T6SA 2ISYA 3GFJA 4ZU4A 1JUHA 1U5TC 1YG2A 1B6AA 3DXJF 3P9IA 5BPDA 3FM3A 2QENA 3FXQA 4P9FA 3HT1A 4J1XA 3WW4A 5D5WB 1H0MA 3HT2A 1W7PA 4MQVA 4A6DA 2BNMA 2DI3A 2ZMEA 3F21A 1G3TA 1KQ0A 1J3PA 4D7SA 2Q0OA 1I5ZA 2Z9OA 4UVAA 4M72A 3OGJA 1YO5C 3J7AO 3TOBA 3D0JA 5CVJA 5E1RA 3IKTA 1FP1D 1JHFA 3EETA 5ILSA 1KYWA 1XE7A 3WW3A 1XE8A 1ZVFA 1FY7A 4J1WA 1CAXB 1DZTA 2PN6A 1H9GA 1BIBA 4FHTA 1G3SA 1TNSA 2A6HF 4A12A 2IXCA 4R8HA 3JTHA 2O8QA 2W84A 3B73A 2DCTA 4QX5A 5LEKA 5LGUA
chains in the Genus database with same CATH superfamily
3BPXA 2IVJA 3SHRA 5FZ4A 5DG2A 1ZR4A 2JDYA 2M4GA 4X0GA 5F3IA 3AMNA 5ANQA 3WF4A 2DBBA 5LEJA 4QQOA 2MA3A 2EPFA 3CJQB 3OS2A 1EPZA 1RUI1 1AOYA 2LTPA 4AOCA 3I71A 4NR1A 1MS3A 4Q4Y3 1PO22 1WSUA 1G9FA 1K5MB 4S2GA 1VBE2 5DZFA 3AZVA 1W06A 4JGYB 4BXFA 4UT5A 1A78A 1REFA 2YZ4A 4COVA 1CX1A 2PLYA 5LA1A 2F5FA 4XDPA 1GUIA 4QXHA 2GN7A 3ES1A 3IMMA 2XB6C 1ZBE1 3VBFB 2W68A 1NA1B 1ZG3A 4NBQA 1ETWA 2GOMA 4XZUG 2YU3A 1FATA 3MEPA 3VODA 4M6YA 4Q0PA 2JDNA 3A0BC 2CGNA 5H9RA 1FOKA 2BY3A 3GZ5A 1RMU2 1H2NA 2GXAA 2VMDA 1KQRA 2ZTNA 5HCHA 3QOEA 5FBZA 5FZHA 1XYNA 1YI7A 3NNGA 4D1QA 1F31A 4G6TB 2X29A 3OYAA 1XX5A 1TTYA 3CIHA 3R60A 4MZUA 5C71A 3FMQA 1FOD3 3J7LA 4YZ3A 1LDKB 4YVWC 3I3QA 4IHYA 4EN0A 2UY9A 2ZZQA 4N53B 3ML6A 3HGGA 1WW6A 2ARXA 5FIXA 2JVGA 2OX0A 2RVAA 3F8CA 3ILRA 3K4JA 3ASNH 1SACA 3M3OA 4RS5A 3H8OA 5D4SA 4PT6A 4JX4A 1NZIA 2K02A 4A4AA 2O7OA 1X33A 1YQ6A 3WR0A 1ZELA 1RVF3 3OPZA 2QQPA 2HJIA 3RDIA 2JVHA 3KPHA 2E1OA 2QQWA 5FYTA 5BNGA 1ZYBA 3ZPOA 1LRHA 4M3BA 4NHXA 4M9SA 4IETA 1NCRB 3CMAI 2VKVA 1D4M1 2D93A 1DP0A 3RRDA 3VHNA 2HQ5A 3E6BA 2QDRA 4BIFA 5A32B 1A3KA 4D5CA 5IT9K 4CXFA 1BQPA 3B6CA 4HFSA 3HRSA 4XKVA 1UCXA 1RXFA 1GNYA 4EJWA 5DAVA 2KR2A 3DFGA 1RI7A 1BBT1 4KIGA 1AXKA 3DU5A 4GQ7A 1I27A 4RAZA 1KITA 4E4ZA 2HDCA 1U5ZA 5A1LA 3WGGA 5FZFA 1T6GC 2F4OB 3VFZA 3GFIA 4RGAA 4XONA 4IEUA 1QZZA 2ARAA 2VR4A 3GTOJ 3WDXA 2B4KA 3UGGA 3P3PA 4B4PA 2QKDA 2X53S 1NE4A 3R4SA 3J7YJ 2ISZA 3DXUA 2BVLA 1YS7A 1EP0A 2EIGA 2A3SA 1FNNA 4BGDA 4B3XA 2P3IA 2LW8A 4HG6B 3VDAA 1TME1 4D8MA 4WVVA 4R4XA 2EFWA 4RQPB 4MXVA 4H7MA 5J3LA 5LHGA 2W47A 3HNBM 1JT6A 3S3MA 2Q0AA 4I3PA 3R0RA 4FQ4A 3CKHA 2L9NA 3BR6A 3HG9A 3H9JA 3UYJA 1E3HA 1YRNA 4F8AA 4YW2A 2LYCA 4EYUA 2OF7A 4G6DA 3WTXC 1S72I 3MUY1 1R22A 1AR63 4PBPA 5EYRA 1RB8G 3SH4A 3QWLA 2R7OA 1ZHFA 2O9LA 2JG9C 1J1LA 1WJ5A 2QSFX 4UHTA 5AONA 1NE6A 3M8JA 5J1UA 4EZHA 4NQWB 4Y5TA 3WP4A 3KEOA 2XVCA 1S8NA 2XBO1 3B5LB 2BHZA 2IA0A 3ENRA 5CFDB 1R081 5B2GB 4XFFA 5T52A 2RJKA 5B66C 2RJ2A 1D0ZA 2GDFA 2E31A 2E2HJ 3WQ0A 2IJLA 3WCRA 1ZA4A 1WCDJ 3ELKA 4K1ZA 5CQEA 1MZBA 4LBOA 3IB3A 2RR11 1POQA 1UU4A 3REOA 3OBZA 5CLSA 2QQAA 5GZFA 3GEZA 4F3JA 2F2EA 5HDNA 1PVEA 2P3KA 3JBG2 2V73A 1ZH5A 4M71A 1VLNA 5BPIA 4XUTA 3L2CA 3U11A 5C9AA 1Z0XA 2WQ8A 2YU1A 3D5LA 3BTYA 3K1PA 4RGKA 3ECHA 1YLFA 1K12A 2Y0OA 4P9UA 1RUI3 1XE0A 2Y6JA 3IPVB 4KBBA 3IMNA 5D5VB 2Y31A 1US2A 3AL6A 3VYSB 3VN4A 1BN5A 5GM0A 1MZ6A 4NHJA 4I6ZA 2BOIA 1SD4A 2NMOA 1NLRA 3ZFEA 4BBSJ 4A5NA 5F5IA 3T0AA 4ES9A 4YFWA 1U12A 1MMGA 2Y6KA 1RNLA 1IGNA 2ZKNA 2WSVA 3KV4A 5JWPA 2P3JA 3AG3H 5BNNC 1UHWA 2WR9A 4Z1VA 2ORXA 3URFA 3E3VA 1D8KA 3CC2I 2WWJA 4QGMA 2ESHA 3IAM2 1FNYA 2ET7A 1S0JA 2PA7A 1JZ7A 3WNNA 4ZKTB 5A2QK 2OQRA 4LO4B 1E5RA 3S32A 2UU8A 4QPIC 3PSIA 4ZU5A 3BT9A 3M1CA 2RS51 2FJ1A 2FOKA 1MSEC 3I4MJ 2E7AA 2BNNA 2PAEA 4URAA 1F9NA 3ZPLA 3GJBA 4L0PA 4LMFA 3VBSC 3FHIB 1TZLA 1NQDA 5FY0A 3SXYA 2Y9YA 3PU3A 4GGGA 1K6OA 2WTEA 2XKOA 3LSMA 2NVQJ 3ZYGA 3KZZA 1NUKA 5FROA 2GZWA 2GMPA 3LOBA 2PFBA 4MTEA 1BJAA 4M3EA 1D4M3 3KETA 4BMBA 2MD0A 5D8LB 4ESFA 3DLLF 1ENXA 3PHMA 1MJBA 1RR7A 3U14A 4Q4W3 4LLLA 1UY0A 3ZFFA 3SQOA 5FZDA 5FY9A 3ZMTA 2LNBA 1BBT3 5FYHA 3S8PA 1J9IA 3JCIA 1AXYA 5F2SA 3BZKA 4KN4X 3BQZA 2Q1MA 3SZGA 3BG3A 2MD5A 3VZMA 1GR3A 2CU7A 1PGL1 2YMZA 1GNZA 3ACIA 4IQJA 4PFPA 1JKOC 2KQRA 2HYJA 3CMMA 5A6QA 3DWLE 1XNBA 3B6AA 3GTMJ 1ND3A 2DCEA 3A0KA 4FPFA 3TN91 4Q4V2 2K4BA 4L9JA 5G05L 2XQXA 3MZHA 2EFOA 3H5AA 2A75A 3W6JB 5M5XJ 2HXOA 4V2GA 1D5VA 2XJSA 3E6DA 2NS0A 5CG9A 2JJ7A 2YX4A 3VZJA 4RR3A 2OPTA 3IRRA 1WD3A 3ERED 5EEHA 4PJYA 4N9IA 1XMAA 5FPAA 5I0UA 3E1SA 5FY1A 2ACJA 4Y22B 2Y64A 2NS7A 4JVAA 3H8XA 4Q47A 2YY1A 3B3QE 4CXYA 4FFHA 2M30A 3W6KB 2ME6A 3IUOA 3DEEA 2RM23 2JK3A 3FXRA 4CICA 1S0CA 3BLYA 2VPVA 4AXOA 1PYVA 1MJ9A 1KD7A 4LLOA 1S6LA 1EH6A 3I53A 4Z2YA 2W39A 1ZRFA 3E97A 4CU6A 1GWLA 4KN7X 1RUF2 3VBOB 5A33A 2OTJI 3RI9A 5I8YA 2XBO3 2BBAA 5FMCA 1MBHA 1VQ4I 1STMA 3T4HB 5CVUA 4KMFA 4NIGA 2X9DA 2VMGA 1GV5A 2L54A 3S3OA 5JHUA 3O1TA 4JK1X 4YARA 3NV2A 1HKSA 5ANNA 5DV5A 1GMMA 4QSHA 2RR13 4LEJA 3N9QA 3NNFA 2HNHA 4ORFA 3WG4A 3AKRA 1J3RA 3WG3A 4AEJA 2QCSB 1W9SA 1QQIA 5JZGC 5FKOA 3PLQA 2IW5A 1TQIA 3NWSA 1DBNA 2DU0A 1UX7A 4CDXC 4HNUA 4FCYA 3I49A 1SD5A 3CLOA 1Q8VA 2JT1A 4CYDA 5DABA 4FE4A 3HUGA 4UF0A 2JENA 1Y4WA 1MDMA 2JB4A 2DTZA 1T95A 2ZPXA 2WNVA 5GAGJ 5CJ9A 2ZEWA 5GLTA 5B4XA 4FFGA 1R092 1LGCA 2LS6A 1RKTA 2X4HA 4ZZ8A 3PO2J 2ZXJA 5I0SA 4A3KJ 4C2UA 4Y15A 1CPMA 1Z78A 4AE2A 1GV2A 1QJX3 1N3QA 1FEXA 1SMYF 4AHYA 5ABJA 1GZWB 3VZNA 4E7JA 1V55H 3LEIA 1AX1A 4LK6A 4OZXA 1GXPA 2X6YA 4Q5SF 1JUMA 2QQMA 5JR2A 2GC0A 1IN7A 5CISA 4XSZF 4Y4RA 3ZYPA 2DJNA 3GM8A 1BEV1 3E7LA 4BHPA 1UKRA 2IUWA 5EGOA 5IAVA 3LL7A 5EZHA 4BEHB 1FAYA 2J1TA 3V0BA 2LRPA 5HS8A 3WU1B 1OOPA 3NV4A 5E6HA 2RNJA 4WVZA 3OYBA 2DA5A 2JQ7A 4QQHA 2MGQA 2GA2A 4HBNA 1GLHA 1MVQA 3GWZA 4JQFA 4ZZDA 4YG3A 1CAUB 3V64A 3T08A 4RLFA 4XCBA 2Z5UA 3DKYA 1PO21 3CDZB 4GALA 4PCQA 1VBE1 1AUYA 5BNOC 2K40A 4EROA 2VT2A 2XF7A 3J7AY 5E1WA 1W03A 1KU2A 5FGMA 4J19A 3PUQA 2RN7A 2ZX3A 4H14A 1USTA 2L02A 4L8QA 1C4RA 3S1NJ 3DBLB 4DYCA 3BN6A 4ESBA 2NYXA 3JB4C 4YVWB 1S2EA 4RAFA 1D1AA 4XBQA 3NAUA 1ETVA 1VR3A 2IP2A 5K0UA 2Q8CA 5C8WA 3DXTA 4IF4A 3U07A 1MEC1 4UW3A 3FJSA 3FM5A 3UL2A 1UL9A 1P4XA 2ELJA 3FISA 4WXCA 3JRCA 5AIPA 5LBCA 4BPZA 1B35A 2ET1A 3ELNA 3DGTA 5FLJA 1ITYA 2JXAA 1JZ4A 2JWTA 2EXIA 4CTEA 3JREA 1HA8A 4AI3A 2WFPA 1FXZA 3K4AA 1W0TA 1GU3A 2YBKA 4C91A 3TN93 1REEA 4PSXA 3V7SA 3L09A 1IF1A 1US3A 4TXWA 1FTTA 5J1YA 2W91A 1PGW2 4UFJA 1XRUA 1WZXA 4Y5Z0 1TT0A 4DEVA 3AMHA 3VV1A 2M8GX 1K83J 1ZN2A 4HDUA 2R3SA 4AM3A 3LAJA 4JHTA 3TRSB 1ETYA 3G2BA 4PQ9A 4JP0A 2WS93 3F3XA 1V3FA 2FDHA 2HBTA 4HBLA 1REPC 3LA3A 5JLVA 4BOWA 2Y6HA 1N77A 1VBD2 3TW6A 4LK7A 2OU2A 1B4AA 3A21A 3VBRA 2BBYA 1YIFA 4YW4A 2K9SA 2D44A 4LOCA 2KT0A 2PQQA 3JRIA 3BCAA 1JI6A 3UT0A 5GZDA 5L9RA 5A1AA 3HMYA 2TBVA 3OY9A 3W6VA 2QTWB 2PHUA 4B3AA 3O8GA 4U0VA 3DYMA 3GGLA 3H42B 5E8IA 4RB1A 1KS4A 2K2SA 3JQWA 1LDDA 4PDWA 4IQPA 2J42A 3W3CA 4NOTA 5CKTA 1L7LA 1P9QC 4XORA 1ASJ3 3CESA 1XYPA 2X5IB 4HAMA 4P9LA 3F8MA 5EJCA 3CJIC 2F17A 5F8PA 3I4IA 2QQBA 2MYSA 3MWMA 3BY6A 5F04A 4MX3A 1UY2A 3A0HC 3LB9A 1U0AA 1YS6A 1DYKA 1WJEA 3O6BB 3ZXKA 5JVTA 2R7ZJ 2WT2A 3S57A 3J8F1 4Y5SA 1R1VA 4EN9B 4YEJA 2WZEA 2RKHA 1RUOA 2Y38A 4PLMA 3GZEA 2BOLA 3JUUA 2EIEA 4PK4A 1ZTRA 4KNYA 4OUMA 4K9SA 3ETQA 3TNPB 2X0LA 4NAMA 1AVBA 3HPGA 1VQKI 2CYYA 1GNHA 2R1DA 4CEYB 1CONA 4QKNA 5FYSA 4L99A 2EF6A 4Y20B 2XGCA 5HCFA 2LMDA 2Q8EA 3C3VA 2WO3A 3UKTA 4A3EJ 2LUWA 4BDVB 3HYIA 5EPAA 2VQCA 1HKQA 4FPKA 5LK5A 1BEV3 4W6WA 1IDZA 1JYIA 4L9BA 4IW3A 2CJJA 1GQGA 4WM8A 5D5XB 4AEMA 4DRVA 5ED4A 2W00A 1MJAA 4C9YA 4KT5C 3GO5A 2P6HA 2DA1A 1OLME 2EBIA 2R7FA 2Q2EA 1UMIA 3BGAA 1X19A 4EN7B 3H5RA 4X8PA 2BVMA 2YSRA 3M8FA 5FXXA 4XW3A 1KEXA 5FQ0B 1X4PA 5JVGF 5F3CA 5BNNB 3BI3A 3WG9A 1PO23 3SDGA 1VBE3 5EXOA 1VBA1 1IHMA 3QRFF 4FPLA 5C5TA 4AIDA 2M9HA 4BQ2A 4I0BA 2E53A 5BNPA 5JSOA 2BZDA 1W6QB 4XJ9A 4QPIB 2QDNA 3U2RA 1SMVA 1Z21A 1QMJA 3KQ4B 4XACA 2WBKA 3JD71 2OUHA 4MVTA 4AYBA 4YFNF 1D0HA 2A1XA 3FUQA 2R071 2PEXA 2EIBA 3JW4A 1RMU3 2BNOA 4IV3C 3K1NA 4A0XA 2N8GA 2OZ6A 3O7OA 5FKKA 4IL7A 2FBKA 1EUUA 3IBMA 4C0HA 2O0OA 2DAOA 2I45A 3HOBA 4ZDPA 2E1NA 2IC1A 2DFIA 3TDUC 1FBSA 1IN6A 4A3CJ 2Y6GA 1RR8C 4DOUA 3CTAA 2PQSA 1UNBA 1SFOJ 4HNVA 4GKYA 3S30A 3S1MJ 3UGHA 1R5HA 2XV4S 1BZWA 2PMZA 1B9MA 4U2AA 2NVYJ 4AGGA 1Z6RA 4TV7A 2PG4A 2F5CA 4IJAA 3P9KA 3VSKA 3WTVC 1S7EA 4IZZA 2D6KA 4LR4A 2PHWA 2L01A 2WNEA 1OLTA 5C3RA 1U3EM 3LSTA 3PUAA 1SC7A 3O1SA 4PJMA 1OQEA 3GUDA 2EV5A 1LDJA 2WZR2 4IRHA 2GBYA 4UUSB 1IZ1A 4COWA 9ANTA 3ZYJB 1Z7LA 1EYBA 3MPBA 3PVNA 4ZS3A 4QDQA 4E7ZA 2PJRB 3DU6A 3ST7A 2WT1A 2OCCH 5HODA 1OA4A 3U37A 5L3DA 2LKPA 2QBYB 2EJRA 5GPCA 2B39A 2AS5F 5A3MA 4EM1A 3G4SI 3WTSC 4AQTA 4K3UA 5ICGA 3LSPA 4Y52J 3WTUC 3BDDA 1W2NA 4C1WA 4GYIA 1JOPA 3HOYJ 2DTWA 3J9SA 4JX0A 3EUAA 3OYKA 4O61A 3K2ZA 1UG0A 3OYHA 4A3JJ 3ZFGB 4IE7A 2C4XA 4QDSA 1VE0A 3AKQA 2K3FA 4MQ9F 3IIAA 3LPGA 2Y75A 1AYN2 3E5QA 1JYCA 1SBDA 4RHV2 1SANA 2ZJQF 2VECA 5HCBA 3M4FA 2XF5A 2VIXA 5J6XA 1U8RA 4NJ4A 1PVC1 4KU8A 2STTA 5DG1A 4QHZA 2ZS6B 4CU7A 2KIMA 3ZMDA 3QLQA 4JCKA 2PHTA 4XZPA 1P7IA 3FXLA 5FZOB 5FRNA 2WWSA 3WU0A 4LBQD 5IWFA 1OPOA 3CJTB 2QA4I 4CCLA 2NYYA 3NEUA 4K2EA 4C3IJ 3I58A 2VQTA 1LOFC 4XBNA 2WY7Q 4OWRB 3AXDA 2Q8KA 4CDQC 3J26N 5FV3A 3A4UA 3OWTA 2ZGRA 2OUMA 1R4MB 2XWBB 3ZVXA 4CDWA 1W36D 1Y56A 4QM8A 5EYXA 3V42A 2CUJA 4PDKA 1JKPC 3B94A 3D5SC 1WPKA 3T8RA 3VGIA 4DPNA 1H0BA 3V8LA 2RDNA 2NVXJ 4V2VA 1I1EA 3CF6E 3F72A 4GZ9A 1T39A 3VKOA 3K46A 1Z1DA 4Q1RA 2HYKA 2J1VA 1T33A 2IXLA 4COZA 2FD5A 2XB5A 5C4WA 3K1MA 5HS7A 2ID3A 2O8XA 3EDPA 3S2DJ 4CDGA 4FTEA 5F7UA 4DINB 1Z7S2 2IEKA 3JBG3 2W95A 2W92A 2XJRA 1R1UA 4JGZC 3PTRB 3I59B 1MS4A 4IPAA 3IT8A 5FWJA 2OTLI 3LSDA 3O0WA 5TSWA 2P34A 4UY8I 5LZ6A 1LGBA 3QODA 2XAJA 2VCBA 1OF3A 3ZO0B 5DCFA 1ACIA 4UB6C 2O14A 3WUCA 1WCUA 4RBOA 1KXGA 4WX9A 1U9OA 1R1A2 1R091 2R5ZA 4G12A 1IKQA 4NHYA 5GZCA 5CU1A 5FZ1A 1V9U2 1MVEA 1GZCA 3FDYA 3HDDA 1O6UA 2JG8C 1X4OA 3KV6A 3MIFA 2K86A 2Y0MA 2H1LA 1SLTA 3OCPA 2RQQA 4AVPA 2CW0F 4OIRF 3VBHC 5GP9A 3LDBA 2D6MA 1WMXA 5K1YA 1N3PA 3USUA 5FD5A 4IE4A 4MHRA 2VZ3A 3GZTB 3NKTA 3CJNA 1YI9A 2W3JA 3HRUA 1VQ5I 5FWEA 3T2PA 1FJLA 1OUSA 1B8IB 4FQGA 5A3NA 5JOZA 5DM7F 1OR7A 3MDPA 2ZHLA 1JKQC 4ON0A 4KG0A 3P6BA 2VUAA 1X36A 2UWBA 4KMQA 2MEV2 4OIOF 2HYGD 5IP7J 1IS5A 1KGSA 3RKYA 4AIHA 2WAOA 4G4FA 4JGYA 1BJZA 2B45X 4S0HB 2YGMA 4A3IJ 4AEDB 3RJ2X 3NARA 4OUEA 4ZC3A 5FPVA 3VEPA 1HKDA 4XLNF 4QTRA 1YQ2A 3OTFA 1LODA 1OHFA 1UYXA 5DUWA 1NLQA 2B7EA 3P9CA 2AENA 4NRQA 3BU7A 4LIVA 2QQOA 2KKOA 4NAOA 2ZGQA 2EIMH 4XMYA 2RS12 4XILA 3WNKA 2UYBA 5DAPA 3A1YA 1VPHA 2AR6A 4UUTA 4BM8A 6PAXA 1VF9A 2XSJC 5IW0A 2LF7A 1C3HA 2KRFA 3BJAA 3MAJA 5DS9A 1NKGA 2DTYA 2JMWA 1ZZ9A 4OMCA 3WF1A 3AP7A 3WNLA 3JTGA 1CZSA 3I9V2 4KG8A 4N53A 3OOUA 3TBIA 3CJXA 4WM7C 2DT6A 2GALA 2V6CA 4EN8B 2DU1A 2XAQA 1ZNPA 1P4AA 4HN0A 3VDDA 4Q4V3 2XPJA 2D7FA 4X8NA 4URTA 3EJKA 1HDDC 1A34A 2DMQA 3UJQA 5DZEA 4HF2A 4JKMA 2GH8A 3NRUA 3N9PA 2E71A 3FIWA 1NCRA 3ECQA 2VJJA 1Y9MA 2GU9A 2CDPA 3CDHA 2XROA 3KP5A 2IGOA 3K70C 4KGQA 1H1IA 2ZGLA 1SDWA 1JJ6C 3VBUC 3PMSA 4UI9L 4IEOA 3P1IA 4Y4YA 3PJYA 5FKLA 1H2LA 3B00A 1TLHB 5HS9A 1WLCA 1RUE2 1VQ6I 4GMP0 5J8CA 2TDXA 4GWIA 4XAEA 1DLCA 3ZQLA 2CAVA 3HGYA 4K8FA 4W6YA 2AZ5A 1HLVA 1EH8A 3CJIB 2WADA 2JICA 4XLEA 3RG0A 3KP4A 2F6CA 2ICWG 3BTIA 1RUF3 4PHZA 3QACA 4IVNA 2CV6A 3ABZA 2P4EA 3ABMH 3BC8A 3MKZA 2RE9A 3ZQHA 4LJHA 2KJCA 5DYMA 3K6GA 1VMFA 5J98B 2HDWA 4AK3A 5L3BA 3I2IA 5CFCA 1OLQA 2FMLA 4BQYA 5IP6A 2MFZA 5HV4A 3OV8A 4RQPA 3A2KA 2PQ8A 1AF9A 1D1CA 3QPLA 3HPNA 1XPXA 2JDAA 1CQ9A 4B4RA 1U5TC 5DUVA 1YG2A 2LR8A 4LBLA 3KF3A 1JZ5A 4Y26A 1SEUA 2BNMA 4R9BA 2ZMEA 2RDRA 5C4JJ 4B48A 5F3EA 1HRI1 4I76A 3MFAA 2EIJH 3WHTA 4N7IA 2M7AA 4CA0A 1VRBA 5FK7A 2JDZA 3FKIJ 3J7AO 1R093 3D0JA 4YW3A 2AUYA 5E1RA 1FP1D 1D0GA 1XU2A 3LD8A 1MNDA 1ZVFA 4J1WA 1VI0A 4OI0A 1BR1A 3BTJA 2A6HF 2ZC2A 3Q8BA 4CDUB 4A12A 1W8HA 4MO3M 2IXCA 4O7XA 5F27A 3JTHA 1UYZA 3B73A 1XOYA 3OD4A 1UMQA 5FP7A 5FZ8A 3T2TA 5LGUA 3CCMI 4MHGA 2ENRA 3BTCA 4EQQA 1O3TA 3AZWA 1VRH2 1H30A 2A68F 3G73A 2P37A 4I2OA 1IAWA 2P1BA 1TNRA 1DQ0A 1WI3A 4DUXA 1MBFA 1ULDA 1GXQA 1CIWA 1UWWA 4OMYA 1LGNA 4QX2A 3O5SA 1QWRA 1DYOA 1NG0A 4NRPA 1H88C 2FSWA 4XF9A 3SEEA 2ELHA 4G9SB 3DYOA 3QCWA 1RETA 5APAA 5FMOS 1RUJ1 3NO8A 2MC3A 2I2SA 4RFRB 2KP6A 1AYM1 1PMIA 4HK9A 4WBBA 3GMEA 4IDZA 4RDUA 2QEXI 4BDZA 4YYOA 1NY71 1Y8RB 2A6EF 1NCQC 4IV3B 3OIQA 3VKNA 1XGOA 4CUBA 1V0AA 2LRDA 3SZPA 2E1CA 4XK4A 3FC0A 4ZDLA 3MD2A 5L7OC 2AEZA 3I2GA 1IS6A 2RC4A 3NKGA 4XLFA 1TEIA 3BIEA 1LEDA 1O59A 3HVDA 4NRMA 2YB7A 2P6CA 1SLCA 3R0AA 3B01A 5F5AA 1CX4A 4B1LA 2GNDA 3GTKJ 4QU2A 4HL0A 5A3WA 2X10A 1W8TA 4ZONA 1PNFA 3T5XA 5IK8A 3DKQA 3IM0A 4PIXA 2BGPA 5C7GA 1DU6A 2VQAA 2ZA9A 3WNXA 2X85A 2DCZA 1VP6A 1FP2A 3X29B 5LBQA 1JTXA 3MW4A 1EJ9A 2GA1A 2KIFA 5FO7B 2V79A 3R05A 3T2QA 3GTGJ 4ONUA 1YITI 3NNJA 1UD1A 3PQJA 3V7RA 5E3OA 1RUD1 1A36A 2W7NA 2PMHA 2EV0A 2NNNA 2JSCA 2AXTC 3DEUA 3SHFA 4K40A 1ZRRA 2V09A 5I8TA 1OFCX 4HEA2 4WVWA 3OY8B 4JZRA 4CCEA 1CAWA 3CP2A 2YU9J 2ZMNA 5DN2A 1AL21 3POWA 5LASA 1AR81 2DFBA 4A6SA 2ZMKA 1NLSA 4CPBA 3ZDSA 2YPRA 1WCSA 1KGYA 1VBD3 5B3SH 1C28A 4C1XA 5FLXZ 4LBQB 1TWHJ 4XF3A 2OUJA 2RREA 2Z4FA 3V7CA 1A6CA 4P55A 3DP7A 4I30A 1RINA 3WLUA 2E1MC 5DDJ1 3OBAA 2O8KA 1UW8A 4LE4A 2IVMA 2XVKA 4IOAF 4P08A 3HQUA 5DZGA 2ILMA 2VBPA 2GWRA 4IHTA 3POIA 1ZA7A 1Z7UA 1BC7C 4MGIE 3C2HA 2WWYA 2ZGMA 3PU8A 3ZMZA 5KXBA 4HETA 4I09A 5LY2A 4UV8A 4BBRJ 2VH9A 3INAA 1D0YA 1QVTA 3FKJA 4YFXF 2AEYA 4XFIA 2JPCA 1S0FA 3DPRC 4B8XA 4ITVA 2FE3A 3EBRA 4RHV1 4FTBA 2E7WA 4CDQB 3G1LA 1F35A 1FNZA 4ENKA 1ODMA 1UAAA 3BPSA 4IQ4A 2Y6LA 5DEQA 4OHZA 1J59A 4EJRA 1XGSA 4WZFA 2VJ4A 3LQRA 2WN2A 2XQRA 3CQOA 4GULA 4A2UA 2Y6FA 1FX5A 2W1SA 2OIIA 4M6VA 2VM9A 3S6PA 2WB1A 2DFFA 3CF2A 4LMYA 5GALA 1O4YA 3LSJA 2XSDC 1QA6A 2XL9A 3RI4A 5A3OA 5FY7A 2D2WA 3EUHA 1PZ9A 1E17A 3ACLA 3H50A 1HDKA 2ZEYA 2UURA 3J7MA 1KQ9A 3F9KA 3G6EI 1IRGA 3ZYBA 3J4UH 3O12A 3BVCA 3HD8B 4QPYA 4RS5C 1AR72 1QZYA 4XIOA 3TWIA 3LNQA 2ID4A 2WQZC 2PYTA 4XRSG 1LEAA 2QQKA 3IDEA 1QQP2 5B1BH 4AGRA 2FU4A 3LEKA 5IFTA 5K7PA 5K5QA 5KHJA 5GLUA 3HNMA 3C1DA 2HWF2 2D3PA 2R49A 2VCAA 3AVRA 2CV0A 3CEWA 5KXDA 1OURA 1FPN1 2QQ9A 1PZ8A 1RRJA 2X1DA 2BBVA 1Y1VJ 4E7LA 1Z7S1 1ND2C 1UO9A 5LGTA 5ERIA 3RWNA 3K4BA 1M06G 2FNPA 4LG0B 2OC6A 2XGEA 2IFWA 4CCNA 4AFMA 1HSJA 2H6BA 2A07F 1BMV2 2R7WA 2FRHA 1FMD2 3O0XA 3VYUB 3PO3J 2EZKA 2D6NA 1H9PA 1DDLA 1MKMA 3M3QA 2DUPA 2CQKA 2DBIA 4HX4A 4M00A 2XC7A 5CZKA 2P2KA 1UFMA 4KWLA 2CDOA 1GUUA 2GP3A 3L2QA 2EXJA 3I2HA 3ZXAC 5H20A 3N97A 1BL0A 1F5TA 1H2MA 1ZKGA 4W1UA 1GZ9A 5FFZA 2OT7A 5HLGA 4B7EA 5JAXA 1WQ2A 1V9U1 5KR7A 1ERDA 3GF6A 4NO4A 3M1EA 4H3WA 1GZWA 2RV8A 1HSTA 2CGOA 2MLKA 1Z3YA 1U78A 1F4KA 4QX1A 3H35A 5KK1A 4BXUA 3PVOA 4OVEA 3VB2A 4X6QB 1XD7A 1KJRA 2YR2A 1LPQA 4LITA 1V00A 4BEHA 3PTYA 3AFGA 4X6AJ 2VW1A 1CF7B 4ZZLA 1RUH1 1X1AA 4DIQA 4PZJA 5L3FA 4YG0A 4U0YA 1MBKA 2OV7A 3TDZC 2ME0A 1I3HA 3KHBA 5A6XA 4P5HA 3SXWA 4A0ZA 2XUBA 2HGCA 2MEV1 4N0BA 3RKWA 2Z16A 1LOCA 3ZMSA 1ON2A 1XTAA 3EUKL 4MXWB 1HV0A 3FBYA 5J47A 3D3AA 2F48A 1PO11 1QKQA 2ZX0A 5KHIA 4CYCA 3S2HJ 1DF0A 1G59A 2R7RA 4O5VA 3ZYIB 4GMP3 3ZGKA 4NN0A 4ASLA 1TW2A 3RIRA 4HN1A 4YVWA 2P5VA 1N1SA 1BK0A 1BJQA 2EALA 3MPPG 2DV9A 4KMUX 2WZR3 4A7YA 4WM7B 3FUOA 3RYPA 3K3NA 4E4DX 3HNYM 2RS11 3H3ZA 5J09A 1UOJA 2QVSB 2IS4A 1K5MC 2CFXA 4BJ0A 4GWMA 2K9NA 1T2XA 1F5JA 4XF4A 2ZKLA 5CBLA 5FUNA 5DDJ3 3ZQIA 3QYBA 3OSGA 1A5JA 5LRSA 3RZHA 3QQAA 1G2HA 4GA9A 3VBFC 4FX0A 3ABTA 1W99A 4ATEA 3K10A 1YNAA 2RS32 4DBQA 2D5HA 1YFXA 4I01A 1URXA 4DNYA 3SITA 2ZJPF 3H1WA 3ZQCA 1OD3A 1RUC2 1ENSA 4ENNA 3GZNB 3OR2C 2ZGPA 4MGRA 3ZFEC 2W1UA 4CP0A 1QF3A 1LOAA 4BCUA 1AYN3 4AQ6A 4RHV3 3HM5A 1SFNA 2CUEA 4HPKA 1O57A 3DBRB 1YJLA 3PL0A 3UNPA 3HOTA 2A6ZA 4QX0A 3ZXJA 5TISC 1S0EA 3FE5A 1WLTA 1KA8A 2E60A 2HYXA 3WV6A 4GB32 1YHFA 3JRFA 5FZKA 3LDKA 1JHNA 4CEWA 3MZYA 4A7KA 1LVAA 1IQAA 2SLIA 4DJAA 1SPPA 1RUE1 5IOYA 4E2SA 1KRIA 5A7QA 2HEVF 2BWCA 3I8TA 2KRHA 3FHNA 3CZJA 3VOEA 2XLFA 3OYWA 3HTUA 1UX6A 3JRGA 2F6BA 4MEXF 1ZZ8A 1WH7A 1QU3A 1DZQA 4HKWA 4EMSA 3AFKA 5FXZA 4OULA 3OOPA 1QH6A 3ZN4A 3GHNA 4H2AA 1ONVA 2R1BA 5C8CC 5LGNA 2BW3B 4QXCA 3KGZA 5I8SA 3VZKA 4AW7A 1W39A 1JJ8C 3S5AA 4P1WA 3KZIC 5CKQA 1Q43A 4Q48A 2X48A 1VAKA 3BB6A 4WV8A 4NNJA 1UIJA 3USSA 5J48A 1Z7S3 3A02A 5KVRA 2Y9ZA 1S0IA 2JG9A 1LE8A 5H6RA 1E3OC 1REDA 3H92A 2YHJA 3M7AA 4B1RA 1JYXA 4MOAA 3HSFA 4BLJA 4XRSA 1EUTA 4S2DA 1MGTA 2M8EA 3C8XA 2F5EA 5AIQA 1GP4A 4P9JA 3FBIB 3QPHA 1OCTC 3CDLA 4E8CA 1OYYA 2XASA 1R1A3 3NMBA 1EAH2 2WNOA 3HJEA 3ON7A 1PM7A 2IVIB 2STWA 3O0VA 1WI9A 2ERFA 1F4HA 1V9U3 4MFEA 1X3UA 5CVVA 2HVRA 4JDOA 5LWBA 2MBFA 4YG2F 4Y13A 3LA7A 4Y20A 3BU0A 3JRHA 1K61A 3CUQC 1CN1A 5EP9A 4RR3C 2VNOA 4YZ5A 2QYOA 1JHJA 3POYA 1SZBA 3T0DA 4RN5A 1Y0NA 2HQAA 1R1TA 1W9WA 3OGGA 4BMEA 1SLIA 2JD9A 4A3DJ 2JX9A 5JIUA 3R4UA 2DDBA 3ES4A 4IE0A 2KLOA 3CQZJ 4L97A 4NB5A 4BE3A 3EYIA 3RS6A 1F9KA 2W1WA 3MGUA 2ZNZA 2GXGA 5L7OB 3FBNB 3B7MA 3FXKA 4D7MA 5FQ0A 2KMUA 5CFDC 2VXRA 2J1SA 5F1RA 5AC92 2MEV3 1EPWA 4W8JA 2QQ8A 4AR2A 1FT9A 1XB4A 1B72B 1JTZX 1GP5A 2PXJA 1PUFA 3L2VA 5LBEA 2XAGA 1O4TA 1OLMA 3KZYA 4E7HA 1IV8A 5HLIA 1O91A 2RDQA 3N4MA 2HZDA 1W6QA 4Q4ZF 3O1OA 4QPIA 1QDOA 5CADA 3DTIA 1D1BA 3KYLA 3BZCA 5E89A 2YUSA 4IGPA 3HHHA 4IEYA 1X9TA 2A5YB 4HW0A 4A3FJ 3TEXA 2WZPP 3PNVA 1HQWA 3H9QA 2XB0X 4OMDA 3VBSA 2JD4A 1XNCA 5FUIA 1YOVB 5A3TA 3BYWA 2RS13 3S1QJ 2KZVA 3WDTA 5LK7B 1BI3A 3GLLA 4AI8A 4PIYA 3V65A 4M3FA 1UELB 2XUMA 4JX6A 1WCMJ 2C6SA 2PMZN 1A8DA 4S05A 2FF4A 3ONQA 4RLQA 1LHVA 4XDOA 1YUDA 3ZN6B 4P9IA 1QOSA 4AVCA 1G9DA 2JA6J 4IEXA 5AFEA 2G7UA 4LHKA 4B3NA 2A3YA 4BZ4A 3VZLA 1SFYA 1YC61 1OFSA 3TO9A 5ABJC 4KWJA 3PL8A 4XFBA 1RTVA 4A3XA 3KHCA 1XSVA 4Q4Y1 3J81Z 5FDBA 3ZSKA 4CGZA 2WO2A 3OOXA 2VKEA 5C3EJ 1MH3A 2E7XA 2E1MB 5CPRB 2Q30A 4FPEA 3MIEA 1C5IA 2V1DA 1YJNI 2QSGX 3MCZA 2WL1A 4PSWA 4NPRA 1K78A 3RJRA 2AREA 2K85A 4IKFA 4HX7A 2PJRA 2V4AA 2ZEZA 3PUFA 3CCUI 4Q1PA 4JHZA 4QPQA 4EM2A 1SLBA 2A5WA 3FMSA 1KU9A 5FZ3A 1RUE3 4ZPIA 4D94A 3DPRB 2QBYA 4M4RA 1WKMA 2HWE2 1OQYA 1YIPA 3A7QA 2IS1A 3W2WA 1QGPA 1XS9A 3N7KA 1W6MB 4EZ4A 4NPLA 1YYNA 5JI7A 3UV9A 3OGSA 4OHVA 3M3IA 4OI1A 3FWEA 1XN7A 2ZBKA 4S2HA 2MLGA 5H9PA 5J3UA 1W0OA 4ZYDA 3ZLIA 1TL8A 5GZGA 4W65A 4BACA 1FOD1 3CP8A 3AZXA 3L2HA 1WH5A 3AL5A 1PJRA 4NIIA 4NVPA 4WF2A 2RMU2 3T4VA 4HSRA 5GLWA 4JDMA 3POEA 4A6OA 2BFUS 2QLZA 5KBFA 3N9MA 4K1YA 2J1EA 2FD8A 5KC6A 2Z99A 3I0TA 4NWVA 2VTXJ 5K0UC 1RVF1 1YCIA 3ZSLA 5GAEJ 4RS5B 4IOCF 3CCYA 1L3JA 3F2ZA 2VI6A 4Q0QA 3W5NA 1W6OB 3HXLA 2FBEA 4W6XA 4RS8A 1GQPA 4B47A 4WWCA 1A31A 1S0BA 4RA2A 1YW7A 1PDNC 4K6BA 2Z3YA 1H9WA 1BYHA 1BIAA 2LROA 1YO8A 2R4GA 1JGSA 3K2AA 1O8SA 3NJVA 2EAKA 4LD5A 1T98A 1DDNA 3SH5A 4UXNA 3QBQA 4BQ5A 2VNVA 2BEOA 2L0KA 5FRAA 5DAWA 2W85A 4YGEA 1UOFA 1HN1A 1RXGA 3JRBA 4Z6YA 4O9EA 2PX9A 3L9JT 4M3CE 2HKXA 1GV9A 3KEYA 3IWZA 3SCFA 5D6FA 3GXOA 5JZGA 4MGYE 5FZMA 1AR71 1SG3A 2W2IA 4C0BA 1ND2B 4CDXA 4LORA 3U1DA 3DPTA 1I3QJ 3G1MA 2VBDA 2DYSH 1FWZA 3HL2A 2H0BA 3IDBB 3OSFA 5FREA 3P3NA 2CO5A 2FX0A 2O61A 5L19A 1RUNA 2HWF1 4M3CB 4HF0A 4L5JA 1VTNC 3B9IA 3GXUA 1WJBA 5FP4A 1XGMA 1SLAA 2R7EB 3KSCA 4CA9A 1OC1A 4V19K 1VRH3 3F6VA 4IGQA 3K4ZA 2WSUA 3QYFA 1VBB2 3U78A 3VD4A 4WXDA 5DD8A 4BQQA 4A41A 4XQWA 1QHGA 4WZCA 2JA7J 3MIGA 1W90A 5CKNA 3D0SA 3ZMUA 5BOXA 4WVMA 3BR0A 5A3LA 2VJIA 1C57A 2BTVC 4P00B 4KDPA 4L0YB 1GFF2 3VBOC 1FMD1 4D6RA 5B5EC 5JCTA 1FTZA 1BHGA 1J0RA 1BOBA 1YJ9I 2VTFA 1DU3D 3D5OA 4QM9A 4TZDA 2QQIA 4E7SA 4HF1A 4OLLA 4AWDA 1H4GA 3W2VA 1KDKA 1ZRDA 4Z2AA 3KYDB 3D4KA 4BH9A 2QM3A 1AR61 4LPLA 4CCCA 3BTLA 3OUIA 2QZ8A 1CJDA 4Y33A 2K9ZA 4OHXA 5KWRA 2R7VA 2OA4A 2EB7A 2VPRA 3FLTA 4OQ9A 2G9GA 2I10A 2JDMA 1LHOA 4BIOA 4AHWA 4XEZA 4DXTA 4A6EA 1SVLA 4BY7J 1IXRC 4XJZA 2BWAA 2XVLA 5BNOA 1W1WE 2Z79A 4PJLA 2QUOA 2GQQA 2PHXA 1IRFA 1NZCA 3N7MA 3WTTC 2RG4A 1B8IA 1POV0 1PP7U 4BHCA 1O7LA 1LOGA 3SZTA 2NOGA 1J84A 5C3SA 1ZZ7A 2G4IA 2K9MA 4DMIA 1JI8A 4XETA 3ZOBA 1ZG5A 3SMHA 1Z05A 5FMBA 4CP9B 2YDEA 2YX7A 1ZK8A 1HB2A 4KYWA 2CW7A 3TMOA 4HLYA 1UY3A 5A3PA 1WGXA 3RZMA 2JDUA 5E3NA 4FXKB 1IPSA 3APBA 3ECOA 3OR1C 3DV8A 5DCMB 2CV1A 2ZGOA 1WRJA 5DDGA 2VKHA 5FYIA 5J36A 4I0WB 3L2WA 4Q27A 5CAZA 2L2OA 2O8OA 4M4PA 3KYCB 3FMRA 3SEQA 5EJ1B 1VZ0A 3MI8A 3IP4B 3M8EA 3EXUA 1ZARA 2M4KA 2W9XA 5FLXK 1XMXA 3ZFEB 3BG6A 1K7AA 4XE9A 3ILNA 1QHHD 5DTDA 5IVYA 1OUXA 3LGRA 5HVQC 1YYVA 1LFPA 4XOTA 1KONA 2I5UA 4D7TA 1JKRC 2WFF2 4KITB 5FXWA 3H3UA 3H5NA 2GM4A 1GKBA 1UY4A 1W6PB 3BJ6A 1PMJX 2RS31 1FBQA 1UHMA 4MTDA 3NV1A 4UVBA 5LY1A 5CYYA 2FDFA 1HF0A 3PNYA 1A6QA 5M5YJ 1BC8C 1W6NB 1OBNA 2OXBA 1KU3A 2HU9A 2P4WA 2XIGA 3K69A 2CWMA 3LAGA 1TWFJ 1I5PA 1WHUA 1NK3P 3S15J 4Y1XA 2Y34A 4AHXA 1O7FA 1DGWY 2NM1A 2WWUA 2PTMA 5IY5H 3VYTB 4QPGC 1YFHA 4HVRA 2IAIA 1DPRA 3RMXA 2VVDA 4GB31 4J25A 2VVFA 2ZHKA 1IUFA 2J5OA 4AQ2A 4IXAA 4Q4W1 2XGXA 2P6TA 5C8CB 4FQZA 4BQWA 4ZU7A 1C8NA 1X1CA 1RUG2 2H94A 3H0DA 4D0PA 1JU3A 2YBSA 1TQPA 1QNYA 2B9SA 1LHUA 1RYYA 3CJIA 3ZFFB 1Z3XA 1AR92 3DN7A 5FZGA 5GLZA 2MH2A 2A6WA 1AR73 4XUNA 1N25A 4QQ2A 4FP2A 4L11A 4XJAA 1QQP3 3AZZA 4TSVA 1SFPA 3ASIA 5A7WB 1OVPA 1GLNA 1IS4A 3C7EA 3WG2A 3U21A 2HWF3 3DEMA 2FQ4A 4LKSA 1ULPA 1TWGJ 2JJ6A 1TZOA 5HBAA 2VOKA 3MIDA 5C33A 4G6QA 2IXHA 4IEZA 2HWD2 2L7KA 4BXXJ 2V9PA 3Q9VA 2QQJA 2DA7A 1ULYA 4J00A 2FDJA 1OJLA 1HW5A 2DDAA 2A69F 3H0GJ 4H4KC 4LKDA 5T5JA 4PI2A 3OPWA 3UR3C 1IG0A 4P5OA 4XSXF 1YQ8A 3POJA 1ZBA2 1FMD3 3W58A 4AAPA 4XVHA 4MO7A 3MBWA 1NX9A 3O2PE 2WZ8A 3CUQB 3GHMA 4MGSA 1IJWC 4ENJA 4RR3B 5ERLA 2UWAA 1AXZA 4CU8A 2WV1A 5KAFC 2X5IC 2K27A 1EAH1 4UW4A 3E5XA 2RM21 3AKTA 3C2GA 4FPJA 2BERA 2CS3A 5D2AA 4AFBA 4FTSA 5F08A 1X1BA 5FXVA 1FIPA 2M2EA 1HQNA 3LF7A 4BQ4A 3EQLF 5FPZA 2WNUC 2BV4A 1SDDB 4O65A 4UBGA 3JZVA 1Z67A 2D6PA 3OS0A 3NW4A 2B0LA 4A45A 2L9RA 2BY0A 2CSOA 3COAC 2A71A 1GWMA 1CPNA 5HV0A 5A33B 1XJAA 4AQSA 3HAGA 2VE8A 3GDBA 3GVAA 4IHSA 2R7SA 5FTTC 1RIOH 1RJ8A 4NUBA 1DQUA 1R7JA 3ZXGA 4DW6A 2W82A 5CG8A 1S7AA 3WOGA 4AWXB 2QZ3A 4CEYC 4QHBA 2IXKA 2IA1A 3RSNA 1LHNA 5F5CA 2HH9A 3ROUA 1DP3A 1QJFA 3DF8A 1WMEA 2ZHNA 3HOVJ 2FDGA 1YHQI 5FMDA 4IV3A 4NHKA 2EQRA 2GC3A 2MABA 5FO8B 4IEJA 2WO1A 1C1LA 3OSDA 3I2JA 1HBXG 1XU1A 3HUGB 3LMMA 3S7IA 2R7TA 3GZ6A 1HJGA 1MDMB 4GCVA 4MEYF 5C4WC 1HDPA 4YIRX 1WKYA 2VC0A 4HZFA 3D5RC 3CJRB 2MW8A 4FPCA 1QJX1 4GDFA 4Y17A 4YRDA 4PGHA 4CXXA 2W1QA 4CCKA 3KWVA 5LB6A 2ZSIB 1UPSA 1MACA 1D7PM 5ICFA 1W8OA 4U7BA 1LU1A 4Z07A 5ISLA 4OIQF 1OPCA 3JRAA 5ABJB 1N1YA 2MH9A 5E16A 5HNFA 1MS8A 4P9WA 5LA2A 1FC3A 1F5FA 2VD7A 3OYJA 3BOQA 1ON1A 5IYBJ 3MFCA 3Q8AA 2CQXA 1Z91A 3WQBA 2RS33 2H8RA 3KMHA 1QU0A 2YBPA 1JYTA 2WY8Q 5EGOB 1NH3A 1LJ7A 2DK5A 5JMCA 5I0RA 3V0BB 1UZZA 5F6KA 5DAXA 2GC1A 4B29A 1OOPB 2D40A 1S2KA 3OUHA 2DUQA 1YQCA 1ZRCA 4W97A 1R9TJ 2Y33A 3VKLA 4QGLA 1Z0HA 2UV1A 1KYZA 2DT7B 3AYAA 2L9VA 5JFRA 5FAXA 1K45A 2O6GE 1NQJA 4SLIA 2A3WA 2KRCA 4AF9A 4GB33 5A7NA 1HCRA 1I6XA 3CDIA 3S3NA 2BDRA 3QPSA 1ZBE2 3PUBA 4A3GJ 1JXSA 2BY1A 2VO5A 2TEPA 4LBQA 2PFWA 2GP5A 4IEPA 5JR7B 5C6CA 2HWE1 2DODA 4YLZA 4FPOB 5IK4A 2WBMA 4BKXA 3OYCA 4I7HA 3I3MA 1SVMA 4ZJZA 4ABZA 4D5FA 4EWAA 2JTVA 5K0UB 1HXDA 3LFMA 1WW5A 1BXHA 3TAYA 3FXJA 4B8EA 4N8MA 3E6CC 3OYLA 2DBNA 1OISA 1ENRA 2RMU1 4XQ4A 1F2NA 5T55A 5IT6A 1U8BA 3WQ1A 1QGLA 1DGRM 3GTQJ 3K7AJ 1LOFA 1FOWA 2LY2A 4IE5A 3P9IA 4CDQA 4P9FA 1ULEA 3WW4A 2R0HA 3FL7A 1W7PA 3AL0B 3LEMA 1SBFA 2DI3A 3F21A 3ZM8A 2WB1N 2DMNA 3GCXA 2W1OA 4QDRA 1J3PA 3WDYA 4XURA 1V5FA 4Q4X2 1I5ZA 3HOWJ 1YO5C 2E26A 3B69A 3TOBA 2XF6A 3ETPA 3IKTA 1X1PA 2WS91 3EETA 2LTNA 2DVAA 3WW3A 3HBLA 1XE8A 3GBWA 4XRMA 3ZFGC 2PN6A 2JA5J 1H9GA 1OSGA 1QJZA 5IUQA 1G3SA 3N35A 1TNSA 3T09A 2X51A 4BQ3A 2G9FA 4GXLA 4UFHA 4R8HA 1EAH3 2DCTA 4QX5A 3K77A 5HOOA 2X8KA 4XXAA 3MYXA 2XR4A 4L2NA 2WAEA 1KJLA 2H09A 1PP8F 3HPHA 3ITQA 4IESA 5J96B 1ETKA 5J4VA 4JGZA 3BG5A 2LH9A 2VQ0A 3SNMA 4IX7A 1W0PA 3WVJA 2QVOA 2JDPA 1OYIA 3UETA 1ZX5A 5JSRA 1DZRA 2QQVA 3KEQA 3OIOA 1AJKA 4XIKA 4U0WA 3SH3A 1VMHA 3AVSA 4ET7A 1DQ1A 2Y30A 3EPZA 3C7JA 3QP6A 1ZREA 4META 4OAYA 4L9VA 1XXNA 1NTCA 5KHKA 1ASJ1 2EFPA 4LG0A 4CP1A 5FLVA 1TT5B 5FZ6A 4R9AA 1C8M2 4KQ7A 2KIQA 3ASOH 2DF7A 4XUOA 1Q3EA 2JG8A 1TME2 3K4LA 1JHHA 1DU0A 1H8AC 3HWJA 3CHXA 5FKCA 2W25A 2CNAA 5IVEA 1W5SA 2UXNA 3R6SA 5AC93 4P96A 2XUEA 1PGSA 1ZYRF 1MZFA 3CMYA 4EGZA 2HFHA 5IATA 3VBHA 3IH2A 4BA6A 2M3AA 3LEGA 5DPNA 3N3HA 2N7GA 1NT0A 3M3EA 3CUOA 3GBGA 4UW6A 3BOPA 1SBEA 4Q5OA 4AI9A 3KP3A 2DPDA 5JSPA 2W0XA 2WDBA 2D6OX 4Y3OA 1I6HJ 4QMAA 5A6YA 5FFXA 2FMDA 2CRGA 3K48A 4LFUA 3OYNA 2JECA 4QPWA 2CHHA 2K3PA 1HIXA 1LUJB 4RGSA 4N43C 5IOZA 3OB8A 3ATGA 3AP6A 1R082 2C26A 4YM0A 2V72A 3ZR5A 3K3OA 3SLIA 5M3FJ 1OLRA 2P3YA 1OPMA 2GLOA 5D21A 1WMFA 3FHQA 1U0JA 4AIKA 4FXGB 3ACHA 5C70A 4UXAA 4D6SA 3WHBA 4DB5A 2P5LC 1QOTA 3ZYRA 5IYYA 2E63A 3HQRA 5CVRA 4CXWA 4QD2A 3T8TA 1DGRA 1CD3G 2V26A 4MXWA 2OW4A 4GWNA 1ETOA 4DO0A 3BCWA 2P5BA 2Q2EB 3J81K 2ZX1A 2IPQX 1FLIA 5FLMJ 2WRAA 1WJAA 4KIBA 3NWTA 5HXMA 3A4CA 5CVIA 1FSHA 1RL3A 2TUNA 5DUUA 4BU2A 4XTPA 4WM7A 4O3MA 3RKXA 1OF4A 2DFHA 4BQ1A 5FYZA 2HTSA 2XG3A 3X2QH 1MSFC 4AEKA 1BOAA 1Y43B 3AFHA 4QB6A 3MKYB 1UF2C 5JOXA 4NE9A 1LVKA 1ALYA 2YYOA 1DUXC 4EV0A 1RMU1 2A6VA 5HDKA 2HWE3 1Y9GA 1OKQA 1Z77A 5J1XA 4AEDC 1APNA 3HEIA 4MGZE 4AVBA 3HSRA 3AKSA 2WFF1 2QKMB 3RQIA 5A7SA 2C9KA 5A7OA 4FCAA 1KS5A 1V6LA 4QPGB 2PMUA 2RMU3 1XSRA 5AFBA 3VBUA 2PLV2 1XGNA 4DXZA 2BV6A 1UZ0A 3ABKH 2RS52 3T0YA 2XPUA 2ZABA 4K20A 2P8TA 2X1EA 4JV4A 3O8HA 3ABUA 3IHUA 1BLZA 3T1MA 2Q8DA 5J4YA 2ZJRF 1RJ7A 2CWSA 4IUGA 3QOPA 4NIDA 2YXSA 5FZIA 4HX8A 3VD7A 2WAFA 1OVSA 4QX8A 3K75B 1I3AA 4GH4C 1Q8QA 3AM2A 2R32A 2VZTA 4YZ4A 5DMYA 4AVSA 4EGYA 2LP0A 1QNWA 1HOMA 1XCBA 5KNLA 1FYLA 4XICA 3M3CA 3OD0A 3MMYB 4DQ2A 2BP6A 1LQ1A 2W52A 3POGA 4RM2A 5TRDA 3JQXA 3MLKA 1H2KA 4AI0A 3WW1A 5CKMA 2GIVA 1OKOA 1AR91 2YPJA 5I0TA 2DFEA 3G3ZA 4JBAA 2VOOA 2JE8A 3PIGA 3RGBA 1IUYA 4LA3A 2B42B 1U5TA 3WE3A 4PLOA 5T50A 4DRRA 4E4SA 4FSJA 4LB5A 5DD4A 2BW3A 4FE7A 4LO5B 5D8AC 5EHDA 3CNAA 2YV8A 1VBC2 3HOZJ 1VFCA 3AMPA 1H4HA 2XJVA 1VBB3 5FUPA 4MGKE 3C7OA 2VVEA 4AFCA 1B9NA 1LEMA 4RA0A 1JXNA 1TQ5A 2FZ2A 3TKYA 1G3WA 1JN2P 2WAQA 2E7QA 1ZBA1 4A3MJ 3BOWA 2WNUB 4CPBD 2D45A 1X7NA 5HLTA 2R062 1A04A 4LHLA 5E88A 3TP3A 3AK0A 2L7ZA 5ILUA 2ZGSA 4IEWA 3AMMA 3MO4A 2NXNB 2J5PA 5EFUA 2NOJB 4P9GA 4RB2C 4M01A 1JZ8A 3KVBA 4YELA 4QQPA 3CC7I 2DYRH 4XQDA 2TNFA 4C8DA 1UCRA 3UK9A 4CDWB 3WP5A 3KS7A 2HWB2 2UUZA 4AVZA 5E79C 4QT6A 4S2FA 2C1FA 3MKWB 5EZWA 1POGA 1H9TA 3BR2A 2CY6A 2R5YB 2WN3A 2A73B 3RVHA 4Q0SA 1OCCH 2JA2A 1G9BA 3WXPA 3LPFA 1S3JA 1NCQA 3MLJA 1S0DA 3IIIA 3RZZA 1IRZA 3ZN0A 3OYFA 4UNOA 4GKXA 3D82A 2WLPA 1ZZBA 3WX5A 1PK6C 2LG4A 1SFXA 1W04A 5B4NA 1YIOA 1V4RA 2FQPA 1ULOA 2EINH 3BODA 1P92A 2VXDA 4KL1A 3WZ1A 3TEDA 4BISA 5C4WB 2VOWA 4GWJA 2ADUA 5L7OA 4AC0A 3JBG1 2LKXA 4QKBA 2OAZA 2QQUA 1NOVA 2B7YA 4U7DA 2RDPA 3ZXEA 3IH4A 2JE9A 4IRIA 3KQRA 2PHDA 1T08B 4CDUC 2B63J 4JC1A 3VD3A 1TBXA 3I2DA 3S93A 1KU7A 3H8UA 1QZEA 1TMF2 5H6QA 5IVVA 3FFQA 1HB4A 3IDAA 4F7ZA 2OD5A 3TNQA 4OYUA 3KE2A 4OZOA 1WD4A 4PJNA 5IJRA 1XNKA 2EZIA 5JR3A 3MV11 3S17J 1ULCA 1ULFA 2H6CA 5CYVA 1R1ZA 3AKPA 4YRVA 4NIHA 2R5ZB 4BJ5C 5JXGA 5FKMA 5A7PA 2DA4A 4LHSA 2Q4SA 2RQPA 3BZ6A 2VZSA 3H0OA 1Z9CA 4DXRA 4KISA 3EYYA 4YVSA 3PM1A 2HWC2 4RB0A 2NLRA 4PI0A 4YW1A 1MBGA 1I9RA 4XLPF 2ADEA 2GOXB 5GTHC 1SAXA 2E6VA 4YGCA 5C3PA 1P4WA 2DO7A 1MBJA 2VG9A 3TEYA 1LESA 3MLLA 2WFF3 5FZLA 4NC8A 3WINE 3ZN6A 3DF0A 3M70A 4Q0VA 3ILFA 1OCOH 3VL9A 1LAJA 3HKZA 2V1XA 2XGDA 3J80Z 2XDVA 1OI6A 1AKHA 4G8XA 3LAPA 1H8TA 2XLAA 2BXYA 3A03A 1E5SA 2VXJA 2UYAA 2XONA 3TYJA 1YX3A 1QJY2 1MZEA 4YW7A 2VQUA 3WCSA 1K3IA 1FIAA 5FZEA 3A01A 3O1VA 3U9GA 2YGLA 4F3QA 1WW7A 3N9LA 3JB8A 4YW5A 2QQLA 5K7HA 3CCJI 1Y1WJ 4NROA 4E2QA 3P5JA 5BXXA 3CO6C 1HLCA 4OQ8A 5A3UA 2X6XA 2WLQA 2VJXA 4QB1A 5E3LA 1R64A 5EG0A 3D1NI 5ACA2 3M1HA 4XFAA 3BTXA 3N05A 2XPVA 3DPRA 2CTVA 2M45A 2HBUA 1RUG3 2K0GA 2EICA 4KT6A 1W6MA 2ARBA 1AR93 4HV6A 2NQYA 3MICA 3POFA 4HPQA 4ES8A 4ZXKA 1S1AA 1MEC2 5EWSA 5J40A 1W5TA 4BLIA 4HLTA 1U5YA 3LSKA 4CSWA 3H8RA 5BPXA 3QPTA 4L9NA 4CCJA 3ZSEA 1HC8A 1PMHX 4HOOA 2GNBA 3FK6A 3MUZ1 2HS5A 4Q4V1 2DCKA 1G8WA 2LC2A 5JHFA 2HWD3 4PF1A 3THCA 4PF5A 3PMEA 2CQQA 4OOIA 3A23A 3MQ0A 4OI2A 1MNMC 3DPUA 3VDDB 2YU2A 4P14A 4HSLA 3QAHA 4TLGA 5LATA 4Q4X1 1W4MA 3IAQA 5FPBA 1W6OA 2ZGTA 3L9FA 2O5RA 3WTWC 1W36C 2VONA 1ZBA3 5E3MA 1HN0A 4Z82A 3OYMA 1T2KA 2ZXQA 1ZAOA 1JYNA 3HR9A 3OYGA 1GVJA 3S14J 3ZRGA 1SMTA 1IZ3A 2XMLA 3TL4X 3DBHB 4ARXA 3EYPA 1DGWA 4EM0B 1ND2A 1WWXA 3FXMA 1YLLA 3FLRA 3WG1A 3I3LA 5JXHA 4IHWA 4NIAA 1JGGA 5IVCA 4WK8F 1RUF1 4M3CA 5B1AH 1LTEA 5K7FA 3ZX7A 3C18A 2W5FA 1J3QA 3MIBA 3Q8CA 4XR6A 4AYUA 2EILH 5E1ZB 1IN4A 1K5JA 1W9FA 5E8AA 4OU0A 4P02B 4HQEA 5KHHA 1U2WA 3M07A 2WINB 4G7OF 3S2WA 1XMKA 1WJDA 4CEWC 1OA2A 5K4LA 3VDXA 4I02A 4QKFA 2QFEA 5I93A 1FSEA 3MN2A 5F64A 1C8M1 3U1XA 4JOMA 5CFCB 4OAZA 5LBFA 1GBGA 2K9LA 4MFDA 4V2FA 3F23A 3O1PA 1VAVA 2IXJA 2VC9A 1AWCA 4XQFA 1HQLA 1ETXA 4QX3A 2ZGNA 4DS0A 3HEFA 2EFNA 1TNFA 3MW2A 4IV1A 3MZ8A 3SQNA 4N43B 4PBOA 1X9PA 4B43A 3PVEA 3ULQB 2HQNA 1S2BA 2ZMEB 3GW2A 2LFBA 1T0FC 1R58A 4DUWA 3J8F2 2CW8A 2UY8A 3SEZA 1QXPA 1MQTC 4EWDA 2VL8A 1LECA 2B8MA 1UOGA 3RZDJ 2J7MA 1GP6A 3F8BA 3KP6A 2XOMA 3NAPC