3I59B

Crystal structure of mtbcrp in complex with n6-camp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
202
Chain Sequence
SHMDEILARAGIFQGVETKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLDVPGRVAKQLLQLAQRFGTLRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, Crp/Fnr family
publication title Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 47
structure length 202
sequence length 217
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00027 cNMP_binding Cyclic nucleotide-binding domain
B PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i59B02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i59B01
3K9TA 4UNOA 4U0YA 3R61A 1FI2A 4EWDA 1CAWB 1JE8A 3GUDA 4S05A 1H9GA 5DCMA 1ZG5A 5D5VB 4XFGA 3S7IA 5J6XA 5LHGA 1YWKA 3HSEA 5J8CA 1MD0A 2Z2SB 1Y3TA 1W7PB 2D5HA 2KJBA 3NW4A 3NRVA 1YFUA 4ESBA 2FE3A 1A04A 1HKQA 1XGOA 2DFIA 4BHPA 1TQPA 4P9UA 1Q3EA 3KP2A 2EK5A 4AVCA 3GFLA 2IA2A 1Q43A 4TLFA 1KU7A 1BBYA 2WV0A 4F8AA 5D4RA 4CGZA 1XGSA 1DZRA 2HOEA 2QQ9A 2DW4A 3CUQC 4WX9A 4L0YB 4BQAA 3J81K 1VR3A 2A5YB 1HW5A 1OR7A 4HF1A 3KZYA 4LFUA 4QGMA 1D5VA 2UXNA 2PQQA 2HGCA 1BI2A 3FMRA 2D40A 4YG2F 1ZX5A 4Z2YA 3HT2A 3SXYA 1D3YA 3R60A 1S3JA 5JFRA 3PNAA 4GGGA 2L4MA 2CAUA 1R1TA 3LSTA 1C0WA 4B29A 2BYVE 4R79A 2HKOA 2BV6A 3F8CA 4IEUA 5CLSA 4XBFA 2PHLA 4QGLA 1NHAA 2A61A 1O5LA 1Q5OA 3F72A 2PAEA 1QNTA 3FZ3A 4IRGA 5JR3A 4ENMA 1K78A 5ERIA 5J8FA 2DCTA 3BU7A 4AIJA 3GYHX 4G6QA 1I6XA 1KGSA 2ISZA 1OYWA 5ILVA 2CG4A 2MNGA 4FHTA 2VE8A 3ZMSA 2GAUA 5TRDA 2VOOA 2K86A 2F5DA 2VPVA 4CDGA 3EBRA 3RZZA 4Q0SA 1T2KA 1X7NA 3G3ZA 3P7NA 3T5XA 1SQ4A 4K2EA 2WTEA 3FXRA 3C18A 5BPIA 5BOXA 3KMHA 2DQRA 3WTYC 5T3NA 3LA3A 4IVNA 3E6BA 3ETQA 2HFHA 1JXSA 2ZJ2A 3ULQB 4HQEA 4MGZE 3HRMA 4N9HA 4ZU4A 4I01A 1FC3A 1RUNA 4CXFA 2PFBA 4XFBA 2A3SA 1YHFA 3SZTA 4BHCA 2NS0A 3FXUA 4ZYEA 5K5QA 3OV8A 2E1CA 3F6VA 1ZZBA 4L11A 3FX3A 3OOPA 5ILUA 3RYKA 1R5GA 1Z9CA 1EH8A 4G7OF 1ZNPA 4GYIA 5HVQC 4RS8A 5DD4A 1QWRA 3USSA 4FT8A 2EFOA 4E70A 4EJUA 3NL1A 2M30A 2XUBA 4ORFA 3FZVA 2RC4A 1RIOH 1PUEE 4GULA 2QYOA 4CHUA 4A12A 4GYGA 5I8YA 3U0ZA 2M8EA 1MJAA 2VBXA 3GBFA 3BPVA 3ACLA 4EJOA 4L18B 4OMZA 3SXWA 1SD4A 5D5XB 3J81Z 1H1MA 5J7MA 5ICGA 1YUDA 5D6FA 4RAYA 4BYYA 4ZYGA 3GVAA 5F64A 3RPQA 1DPRA 1BC7C 2HKXA 3IKTA 1YW8A 2VC0A 4AIKA 5E1RA 5I0SA 2PG4A 2QCSB 1QZYA 2JRTA 1SFNA 3ES4A 3H50A 2CFXA 4E2GA 2BBYA 4NHJA 2QUFA 3BROA 2CW0F 4HOBA 4KIBA 1VP6A 3Q9VA 2YPRA 2M5WA 1LNWA 2DAOA 1FYMA 4OIQF 2ET7A 1P4XA 3VEPA 4L9NA 2EV0A 3ZMDA 5DV5A 3VFZA 4KWLA 5K8SA 4LJZF 3MFKA 2CSOA 3O14A 2V09A 1PP7U 4LEJA 2D1HA 2P6TA 3K1MA 3V8LA 4WBBA 3BB6A 1RNLA 2GZWA 1IPJA 4MHGA 4OOIA 2B8MA 3MYXA 1YW7A 2JPBA 3SCHA 1O3QA 1LDDA 3BCWA 4OINF 3ZMTA 2IXLA 3EYYA 3HYIA 2UY9A 1XRUA 3CJXA 2RDPA 1RZ4A 2B0LA 1VJ2A 3O2PE 3CTAA 3L09A 1FBSA 3ES1A 3H7JA 2ZBKA 4NB5A 1ULYA 1UCRA 1ZYRF 3E6DA 2HQNA 5FB2A 5LBQA 4LA3A 1FSEA 3GXOA 4M74A 1J7KA 3LAGA 1QXRA 3C1DA 1G3YA 3L7WA 2COMA 4EJVA 1PMIA 3ELKA 1JGSA 3HTSB 4CYDA 4ZU5A 1Q1HA 1SD5A 1XCBA 2QBYB 1LEBA 1T98A 1G3TA 3UKNA 4MTEA 2XAJA 2K4JA 2LNBA 1H0MA 2IT0A 2GU9A 1NE4A 4MGIE 2IJLA 3R0AA 1XE8A 1YLLA 4YFNF 1QO0D 5L3EA 1U3EM 1HSJA 4J1XA 2DT5A 4O3MA 4PIYA 1IXRC 5KHJA 1V4RA 3KE2A 2GC1A 4IEYA 3DL3A 4XSZF 5E1WA 2QM3A 5LRSA 1ZRRA 5FPZA 1R00A 5I0UA 2VONA 2IVMA 4HSJA 5BPXA 2IXHA 5KBFA 4UHTA 4HVRA 3WW2A 2VT3A 1YS6A 2H6CA 2L4AA 1GXPA 5FLHA 1GVJA 1YFHA 1HKSA 1UD1A 1S29A 1RTVA 4XETA 4BHBA 1IAWA 1OYYA 3OGJA 4WF2A 3DXJF 2Q30A 4A5NA 5KHIA 1TQIA 5IT9K 1LDKB 4Y15A 3SHFA 1CF7A 5HDNA 3KFWX 3TKYA 1E2XA 3IL2A 1IUYA 4HF2A 2K7LA 1OFNA 1ZLJA 2Z3YA 5HDKA 1Z7UA 3GZ6A 1P4AA 2OQGA 4RD7A 3Q5FA 3JTHA 5DEQA 2PQ8A 3V4GA 2XLGA 3LAJA 3IKVA 4JTNA 4PGHA 5DYMA 1BC8C 3LQRA 1TQ5A 5BY5A 1U2WA 4UXNA 5BQTA 2L3DA 1RI7A 1UHWA 2CQKA 1YG2A 3I59B 2GQQA 2K02A 1SD6A 1JUHA 1KQ9A 4L9VA 3FE5A 3FHZA 2OU2A 1B1BA 3EYIA 1FP1D 3SMHA 5HDGA 1Y9QA 1UB9A 3J7AO 4UV9A 1JHFA 1FWZA 1GHCA 3ABTA 2A07F 2UYAA 5A2QK 4IHSA 1T39A 4AQ2A 2EV6A 4MH0E 5FQ0A 3LZZA 1X3UA 4P96A 5D8LB 3ZPLA 4EGZA 5I8SA 1WI9A 4HSLA 2ISYA 3KSCA 4O5VA 1JHHA 3RYPA 4WXCA 1EH6A 4IRIA 5FLXK 4KL1A 1ZRFA 3GWZA 3TDUC 2ELHA 3RYRA 4YFKF 1UIKA 2UXXA 2IA1A 3WG9A 2YU3A 2OA2A 4U88A 3FMSA 2F5FA 4IEQA 1TW3A 1HBXG 1WA4A 3DEUA 3GFJA 2ZKZA 2ETEA 1USSA 1J9IA 1L3LA 2FEZA 2IA0A 1U5TC 3DP7A 2ZNZA 4HMZA 1ZGJA 2MA3A 3EHKA 4XFFA 1P6RA 2PI0A 1IPKA 1X82A 4IETA 3HRTA 1IF1A 3E6MA 3C3WA 2XVCA 3D0SA 1J0RA 3WW4A 4QMAA 4CZZA 1H9TA 4EROA 1Z1DA 1XN7A 4X6RB 1FY7A 3W6JB 2ZFWA 1RGSA 4LTAA 1XGNA 5CVVA 3WGGA 5J3UA 5LLQA 5BPDA 4AQ6A 3S0MA 2XL7A 1ONVA 5LEKA 1J5YA 1D8JA 1WRJA 3CO7C 4HBLA 4WZCA 4Q0PA 4EMSA 3UKTA 2CV6A 4A2UA 1IW7F 5IT9Z 4FAGA 3GFMA 2J5OA 5FLJA 4G94A 4OFGA 1PP8F 4XF4A 2HDCA 2M1BA 3S7EA 1W7PA 3WTTC 3F8BA 2EJRA 2OBPA 3WTUC 3AAFA 4IEXA 2PYTA 2H6BA 3TO6A 4KT5C 4M73A 3F8FA 2EFPA 4XSXF 2BNOA 4ENKA 5DCMB 3FMQA 3M3IA 1QBJA 4UVBA 5D8KB 4MEYF 3H1WA 1ZREA 3KEOA 2STTA 1R22A 3WODF 2IPQX 4I02A 3KP7A 3DF8A 3E5UA 5LGNA 2B5HA 4I3PA 5CYVA 2M87A 2RKHA 2P6SA 5HS8A 3ZMZA 4IEZA 1IN6A 1XDSA 1U5TA 2E1NA 1Y0UA 5A2QZ 2IXJA 1O3TA 3HRUA 1L3JA 2ZMEA 1H1IA 4KA4A 4ZZDA 3OCPA 1SAXA 2CO5A 3FFQA 4MUVA 3VB2A 2D5FA 4WVZA 1ON1A 3BP8A 2AXLA 2XHKA 4HLTA 4G6DA 4I09A 3FXQA 1J58A 4N9IA 3IC7A 4YRDA 4QM8A 5FLXZ 2PAMA 2UWMA 3CLOA 2R3SA 3IRRA 2MLKA 4YNIA 4G7HF 5C6CA 1WSUA 4LK0F 2H27A 2HS5A 3BPXA 3E6CC 3SFZA 3G73A 2QVSB 2EFNA 3TGNA 4R8HA 5I93A 2QWWA 4RGRA 2WC2A 2A6EF 4RB3C 4D7SA 2EAAA 1ZG1A 2IW5A 2J5PA 1ZN2A 2PTMA 2ZNYA 3F21A 4QX5A 5ICEA 1J3QA 2WFPA 3KP5A 2QENA 3SZPA 4P9FA 1K78B 3R4KA 5L3BA 4AD9A 2F4PA 4AVPA 4HW0A 4KNYA 2D93A 4WCGA 2DK5A 2Q8KA 3E3VA 3MCZA 4KYWA 3QPHA 3ZP5A 4YFXF 2NNYA 4IPAA 1UW8A 3CUQA 2GH2A 1U8RA 3WU0A 1U78A 2XLFA 1K6OA 5BV6A 2W24A 4AVBA 3HQXA 3F8MA 3NVCA 2Q4SA 5DDGA 2DI3A 4P5OA 3L2HA 2ZCWA 4HA8A 3O3KA 4O9EA 4FX0A 1FZPB 2ADUA 4YARA 4HBNA 1O57A 3IRQA 1KYZA 2VBZA 3LA2A 1DGRA 3SCGA 4EGYA 3BDDA 4XFCA 1FX7A 3VODA 1XSDA 4UUVA 4Z07A 1J59A 4XF1A 3I4PA 1IN5A 2D1VA 4EQQA 1EY2A 1TNTA 3RDIA 4L9TA 1XSXA 1SFEA 4L0ZB 4ONUA 2DLLA 4ASNA 1O7FA 3SCFA 4U0WA 2Y0OA 2STWA 1R23A 5HS7A 1FP2A 1FNNA 1MJBA 4IEVA 2GA2A 3QACA 4AIHA 2DU9A 2C6YA 2H94A 2HTSA 2HR3A 2FF4A 2FMYA 2KJCA 4YIIA 4A0YA 1FYKA 1R1UA 3F23A 4Y13A 2Z33A 4FX4A 5FCCA 3H3UA 4JQFA 5ICFA 5LEJA 2MH9A 2VT2A 4B8XA 3GW2A 2O61A 2RQPA 4ZYHA 3HTUA 2YX7A 2Q1ZB 1S7AA 3CEWA 2PLYA 2DBBA 3N97A 2KRFA 3P9CA 3TO7A 4MGYE 2FA5A 2MBFA 2LSOA 4IXAA 4WK8F 3GFIA 2HWVA 1B6AA 4BXUA 3KEQA 2XRNA 2XAQA 4EM2A 3KLOA 3BALA 4KICA 1X8MA 3CO6C 2MD5A 3HSFA 2YX4A 4EJWA 2QQAA 2W85A 1R7JA 4IRHA 2JTVA 1FOKA 3CO2A 1DDNA 5L3CA 1IRFA 4FAHA 2XL9A 3VHRA 1HXDA 5HLGA 2FNAA 3NJZA 1USTA 5JI6A 3NKTA 5FO5A 4KMUX 4RGUA 4H0EA 2RVCA 3PFIA 5FD6A 4Q29A 2EV5A 5J48A 3T0YA 3WE3A 2DQLA 4OIRF 5E8GA 2P7VB 3R0JA 4HDUA 3BJAA 2HQRA 5LGTA 1HKTA 2K27A 4Q0VA 4HN1A 2XAGA 1UCXA 3K69A 3KP6A 1KA8A 4RB2C 3HUGA 3V7RA 4D0PA 3QP5A 3F3XA 3L9FA 5D1IA 5JCTA 2XAFA 1GQGA 1XGMA 4YIFA 1BN5A 5K1YA 1U6GA 2QLZA 2P5LC 5JSOA 4AWXB 2BEOA 4PIXA 4MZUA 1O4TA 2OYZA 4IJAA 1KU9A 4KMFA 1SMTA 3C7JA 4ENJA 4I7HA 5JAXA 5CVJA 5ILSA 5L3FA 2NNNA 2QBYA 3DFGA 3RJPA 1TTYA 2OZJA 1FYLA 4A5MA 5HS9A 2G9WA 2N7GA 2GC0A 5H6QA 3DN7A 3ZQ7A 3QU6A 2UZKA 4ENNA 3HT1A 3PVBB 2GC2A 5K5OA 4MX3A 4WWCA 2G7HA 1D8KA 5I0TA 5E8IA 1EV7A 3CDHA 3WU1B 4UXAA 2OAZA 1WGPA 1TQMA 1BIBA 5AIPA 5E1ZB 1LRHA 3UKVA 1L0OC 3BPZA 4MQVA 3EQLF 5ED4A 3ST7A 2IXCA 3CLPA 3I58A 4M71A 1ZZ6A 1SMYF 1I5ZA 4HLXA 3GYDA 3JTGA 3V7SA 2VC1A 3EJKA 2EFWA 1BM9A 4M9SA 1K7AA 4LUKA 1CAXA 1CAVA 1QXJA 2EVXA 3F22A 2O03A 2OA4A 2BNMA 1R1VA 1TLHB 3M8EA 3REOA 3G7DA 1ODDA 2NAZA 2E9QA 4I98B 4KU8A 2DPUA 1SEFA 2XIGA 2Y75A 2GXBA 3RKWA 2FMLA 3LFKA 1LVAA 4QWQA 5JVTA 2PJPA 3I0TA 1P92A 3DKWA 4XF3A 1S8NA 4UVCA 5L3DA 1EH7A 3ZMVA 1BI3A 2LDUA 5EFUA 1ZAOA 4ZH4F 2KIMA 1CF7B 1OD5A 3ZDSA 1IXSB 4IEOA 5HI0A 2L54A 4EWAA 4KWJA 3KP3A 4NVPA 2JSCA 1ZRCA 1FSHA 5FLIA 3I59A 4RAZA 1LQ1A 5H6RA 3WGHA 4RB0A 3FHIB 1B4AA 3ISPA 2GA1A 4ON0A 3K1PA 4ESFA 2RV8A 4A0ZA 4HQMA 5D5WB 2P8TA 5FDBA 5E1XA 5C8WA 3B02A 5E16A 2Y48A 4KIGA 3ML6A 3NQOA 4LA2A 5D6EA 4IESA 1UHMA 2CGPA 1LEAA 3FM3A 3WTWC 2XGXA 4I0AA 2ETHA 2GXGA 3BOQA 3JZVA 3H7YA 4M6XA 1F4KA 4ZU7A 3FF5A 3JW4A 1MDMA 1ZLKA 2B9UA 1HW2A 4LG0A 3MDPA 3TDZC 2MC3A 2ZKLA 3GZ5A 4IHTA 1O5UA 2DK8A 4E2SA 3OD0A 4LLGF 3CL1A 1XE7A 3TOBA 1QGPA 4HX8A 5HLHA 2P5VA 2IC1A 5EZWA 2L01A 3E5XA 1G4DA 1TNSA 2O3FA 5EEGA 4IEPA 1YYVA 5CVRA 3O6BB 1I1SA 3WTSC 2VE9A 1LJ9A 4HZFA 2W57A 1DP7P 2FU4A 2VQAA 3U2RA 4HF0A 4GCVA 1R58A 4PCQA 1CAUA 3T1BA 3DQVC 2H0VA 1NYWA 1WWXA 1LR5A 3QU3A 1QPMA 1XCVA 1EPZA 1REPC 2F2EA 2OPKA 1YW9A 1Z6RA 2P17A 1CAWA 4JTOA 3BWGA 1P2FA 4LGWA 4A6EA 1YTYA 2FSWA 1GXQA 1B9MA 3HSRA 1O7LA 2LF7A 2UYBA 2QQBA 3SHRA 1STZA 2JZYA 1B9NA 3H8UA 5DCFA 2FQPA 3MPBA 4HLYA 2D2WA 3BZ6A 4LB6B 1XDUA 2W25A 3D0JA 1BI1A 1WLTA 4Y17A 1T0FA 5HLIA 3LWCA 1YQAA 1KU3A 2GIVA 3GO5A 4HVQA 1W7PD 4I0BA 3TNPB 4ZZLA 5HOOA 1G6NA 2A6HF 4QXKA 4XFHA 3BY6A 1MKMA 4Q47A 5FFXA 1BI0A 3QP6A 2XROA 5JSPA 4UBGA 2LF8A 2C0ZA 5L3GA 2A69F 2V1DA 1I27A 3K2ZA 2IP2A 1YO5C 2LKPA 3WTVC 3GLXA 3RNSA 4M9XA 3I5UA 4P55A 3LAPA 4Q48A 4AXOA 2DO7A 2F5EA 1TBXA 3JAMK 2F5CA 4IEWA 2XAHA 3FM5A 3U11A 3R6SA 4DNCA 3L2CA 1CX4A 2G7UA 3RTRA 4E2QA 5KK1A 1J2XA 5AONA 3E97A 2KIFA 1ZZ8A 2CYYA 3PQJA 4S04A 3T8RA 4M9ZA 4NQWA 1VTNC 4RGXA 3MEXA 4JV4A 1QZZA 1W4MA 5AVPA 5FGMA 3J80K 2XV4S 2XKPA 3CUOA 4K8FA 1LDJA 1AWCA 2Z9OA 4D7TA 2VN2A 3ROUA 1J3RA 2FRHA 4PZJA 4CO8A 3H1YA 3EO6A 3WW3A 3HRSA 1U5TB 2ZXJA 4KFCA 2ZMEB 2V9VA 4PJYA 4UVAA 3EQEA 3TOAA 1FBUA 3BJ6A 2PEXA 2O8QA 2NYXA 1J75A 5E20A 4YSFA 2O0YA 4KIFA 4ETSA 1O3SA 3U1DA 2VBYA 2XLAA 4PDKA 3E5QA 4MNUA 1WQ2A 3RI4A 5LRRA 1LB2A 4XEZA 2ESHA 3ECHA 4MGRA 3V7CA 2PBIA 2X4HA 5BUVA 3H1MA 2O1QA 1OYIA 3FJSA 2QJVA 4LULA 4YYOA 1RC6A 4GXOA 2PMUA 2TDXA 4ZYDA 3DPTA 1P4WA 5KHGA 2BGCA 2BE5F 2ACJA 4CICA 4L5IA 4LUMA 4LD5A 5I8TA 2JPCA 3I64A 4HX7A 4OIOF 2JT1A 1FBQA 2HZTA 3DPLC 3LOIA 4MV2A 4GO1A 4LB5A 3W6KB 4L2NA 2DPDA 2RGVA 1KQ0A 3ABUA 4WXHA 5I91A 1KYWA 3LQQA 2PN6A 2IRFG 2X0LA 5KVRA 5F1RA 1MGTA 1ZRDA 5LHIA 3CUQB 1FXZA 3IBMA 2VXZA 4B09A 4QM9A 3KZZA 2Z5UA 3CJNA 4A6DA 3TQNA 2V1UA 5BMZA 3M70A 3P9IA 4Q0UA 3K1NA 5DUIA 3IIAA 3OF1A 5CJ9A 5E17F 3GEZA 2OD5A 1R36A 1V70A 4MQ9F 4Q5SF 1XB4A 4HDVA 3N4MA 2Z69A 1SFXA 4DQ2A 3I7DA 1R5HA 2VECA 2PFWA 2UY8A 5D5UB 4KDPA 1G3SA 3GF2A 2PHDA 4LMYA 2O8XA 3JAMZ 3COAC 1FPQA 5BXXA 1NXMA 2V1XA 3Q9SA 3F8NA 4OLLA 1XMAA 4J1WA 3LA7A 4L9JA 3ECOA 1DPUA 1ZARA 2Q0OA 1ZZCA 4HV6A 2ET1A 2EFQA 1W5SA 4R52A 3J80Z 2FBKA 4KN7X 3CF6E 2HEOA 4HV5A 1EYBA 3IHUA 2W84A 2D45A 3V8JA 2ZO4A 1OKRA 4OU0A 3D82A 3JSOA 4HVOA 2E7WA 1Z6TA 3M8FA 3VOEA 3U10A 3GX4X 2KKOA 1NE6A 1QY4A 3RKXA 2P4WA 5IT3A 1DZTA 3KLNA 4I2OA 4QLCU 1ON2A 3WTZA 2EA7A 4QGNA 4U7DA 2GC3A 1OPCA 3M7GA 1YFWA 1F9NA 4LLOA 2EA4A 2FBHA 4WXDA 4KU7A 1IRGA 2FQ3A 3ELNA 2I45A 3L00A 2PAKA 4OIPF 3RIRA 4Z82A 4AVAA 3IDBB 2CAVA 2QVOA 1IZ1A 2E7XA 5FPXA 2PA7A 1OMIA 1W5TA 4JBAA 1YFYA 2K9ZA 5DD8A 4A0XA 2V79A 3T8TA 2RNJA 2IXIA 3RPUA 2K0GA 1IN7A 3IWFA 1ZH5A 1HSTA 3H3ZA 1BJAA 3QOPA 5CVUA 2MPFA 4F7ZA 2RN7A 3F6OA 1NZCA 3MZYA 2O6GE 2CWEA 1SFUA 3TNQA 2P7CB 3FWEA 5CU1A 2K4BA 2PMHA 1U12A 1ZHFA 1E17A 4JK1X 4U0VA 1XD7A 5JHUA 4H7LA 2DTRA 3HIFA 3RKYA 3I71A 2VOPA 2ATFA 2VODA 3WGIA 3HOSA 1ZZ9A 2NRAC 3M9AA 2Z99A 5JSRA 1J1LA 4Q0QA 5LGUA 2XKOA 4MEXF 1XSVA 3ZN1A 3MQ0A 4FBFA 2MLGA 4EM0B 4HAMA 4UV8A 2R7DA 4M72A 3S2WA 2VBWA 3QPTA 4L5JA 4XLPF 2XASA 3BJOA 2KXLA 4XF0A 2A68F 1HQCA 4Q4ZF 4LK1F 4EWEA 1XMKA 5KHKA 4M6YA 4EM1A 2OZ6A 3JSPA 5CADA 1RL3A 1PDNC 4MGKE 1AOYA 2FNPA 3PQKA 1O3RA 2V6CA 1I1GA 1B59A 1S6LA 2YSRA 6PAXA 1DGWA 2QNKA 4IERA 1BIAA 3OTFA 4XF9A 4XFIA 3TO9A 1CAVB 1CAXB 1G3WA 1Z91A 2IXKA 1UPIA 5CVIA 2Y0MA 2AS5F 3PLQA 1YIOA 3QAHA 3KGZA 1Z05A 2KIUA 3V8KA 1RUOA 2HYGD 5BS6A 4BIFA 5AIQA 3HOTA 2HTJA 3ZMUA 4EJTA 1ZVFA 3QRFF 3EDPA 2GWRA 5EEHA 1S7OA 1DUXC 5TJJA 2Q2EA 1HW1A 4P9GA 1X8EA 4BAYA 1T6SA 1IXCA 1ZG3A 4EVIA 1GQHA 5K5RA 4META 4XFAA 4N0BA 3U9GA 1YS7A 4BNCA 2QZ8A 4DINB 1UIJA 3LWFA 3WE2A 4G8XA 3MZHA 3IWZA 4O6JA 1ZZ7A 5LHHA 4UBHA 3HHGA 2YR2A 4OMYA 5H20A 2EB7A 2QDRA 3KETA 2EA2A 3ERED 1TW2A 2BNNA 1OI6A 1FT9A 3DV8A 4EV0A 3P9KA 1UFMA 4PGGA 4MTDA 4BH9A 2HJIA 3I53A 1MZBA 3WW1A 1MJ9A 4HYEA 3D5LA 2FOKA 3B73A 1WKMA 3MAJA 3KP4A 4X6QB 3H9AA 4KN4X 5E18F 1LKNA 4TV7A 1F5TA 5FFZA 5FQ0B 1EP0A 1J3PA 3MWMA 2HYFA 3SQNA 3NSTA 1YFXA 4LLNA 3IDCB 2L02A 5ICCA 5DUKA 4R1HA 4RGSA 3EETA 1PM7A 4XRFA 1K79A 3ZN0A 1IN4A 3EUHA 1MDMB 2OQRA 1ZGAA 4JVAA 4G7ZF 5I0RA 1FLIA 2P5KA 4HN0A 4G9YA 4LG0B 1YLFA 3I54A 3K0LA 5FD5A 4KWKA 2H09A 3KGLA 1QQIA 1CGPA 4O9GA 2R7FA 1KU2A 4KUMA 4ESJA 3C3VA 3KCCA 3HHHA 5JR7B 1V3FA 1F1ZA 2FXAA 1IN8A 2Q0AA 2WWYA 4PIZA 4XLNF 1SD7A 4U7BA 5D4SA 4LLLA 2OZUA 3H92A 4IF4A 4RB1A 1BOAA 2FBIA 1KQ8A 4HX4A 1CAUB 3NEUA 2EWNA 2MH2A 3WTXC 5KHHA 3M1EA 1T38A 2M45A 2MHFA 2ESNA 5F6FA
chains in the Genus database with same CATH superfamily
2A5ZA 3AP9A 4U0YA 4EWDA 2BOIA 2KPMA 1ASJ1 1H9GA 3POGA 1H8TA 4K7JA 3C7FA 3BPSA 4XYXA 1VE0A 3HSEA 1QJY1 1W7PB 3W2AA 4NNJA 3N7MA 3TB0A 3M3EA 2R93J 1HKQA 2X48A 3U4XA 1JN2P 3KP2A 2EK5A 1ZQ3P 3ENRA 4IV1A 3ZPYA 1TEIA 1T56A 2Q1FA 3UJOA 4F8AA 1VPHA 4QDSA 3RRDA 3CUQC 4WX9A 2EALA 1WMDA 2JE7A 4WVMA 4BQAA 3ALQA 1HW5A 1CZVA 1OR7A 1G7YA 5CEHA 3OIQA 5B1BH 2VVEA 4LFUA 3C7HA 3FHAA 2C5DA 1LOFA 2PQQA 2AREA 4W50A 5F6KA 1COV2 4YGCA 5A80A 2XQRA 1Y8RB 2JMWA 1DCSA 1HA8A 2D40A 3U07A 2VW0A 4Z2YA 3DBHB 3AMQA 5JFRA 3PNAA 3K48A 2XMLA 2L4MA 2CAUA 3Q0UA 4E7IA 2BV6A 4IEUA 4JHTA 3HGGA 3VSLA 4XBFA 4FOVA 4ISQA 2PHLA 1UX6A 3I2DA 4MOAA 1D1AA 4XDPA 2WZ8A 1OA4A 4ENMA 1B8IB 5ERIA 1RINA 3VHPA 3GYHX 5FZLA 2ISZA 5B66C 1HB2A 2MNGA 4FHTA 2VMHA 5LY1A 5FZFA 1UELB 4RS5B 3RZZA 1OXCA 4Q0SA 2VJ5A 3G3ZA 3ZXEA 4K2EA 4RAFA 5BPIA 2TBVA 3WV6A 2AH2A 4N43C 3ZKUA 1S7EA 3SEEA 5T3NA 1UYZA 4IVNA 4AHYA 3HOYJ 1RUJ2 2QQMA 1CWPA 4MG2A 1BEV1 1FC3A 4CXFA 1W28A 1W6MA 3NO8A 2PFBA 4XFBA 2A3SA 3VBRC 1YHFA 2WQZC 1AX2A 5K5QA 3OY8B 3F6VA 1PUFA 3MUZ1 1X33A 3ZSMA 4L11A 4W97A 3AKRA 1RRJA 3FX3A 1X2NA 4BK5A 5ILUA 1EH8A 4G7OF 4MYEA 5HVQC 4CTEA 4AAPA 4E9KA 4C3JJ 5DD4A 1JHJA 4YIRX 1SLIA 2RS33 4OYUA 4Y26A 5FPBA 1WLCA 1W6OB 2VO5A 1JUMA 3NL1A 2WAEA 2XUBA 2LW8A 2LLKA 1HRV1 2Y2ZA 5JI7A 1BJZA 1NTCA 3OPWA 3U0ZA 1UYPA 4RHV3 4XILA 5C4XJ 1LECA 2ZX3A 4BWOA 4L18B 4GKYA 4OMZA 5D5XB 1H1MA 5LATA 4XCBA 5D6FA 4IE5A 2E60A 4ZYGA 2NVXJ 3RPQA 3AG4H 3G4SI 3S30A 1YW8A 5EYXA 1TP4A 3WF3A 2WNOA 4H4KC 3WX5A 5I0SA 2BRTA 1QZYA 2JRTA 1SC7A 3ES4A 2CFXA 2BBYA 1Z0XA 2QUFA 3BROA 4EEFG 2CW0F 1GZCA 2DUQA 1WJBA 4ARYA 1VP6A 1OD3A 4PJNA 2ET7A 1EV13 3ZMDA 3VFZA 5K8SA 1S0JA 2VGDA 1GOHA 5B2GB 4XUPA 2Y9YA 2XGEA 4LK7A 4A7KA 5IW0A 5F9TA 2HWB2 4BQXA 4OOIA 3BR5A 3UESA 2B8MA 2BFUL 4A3JJ 1AXZA 1LDDA 1D0ZA 2IXLA 2LG4A 3V0BA 2AQFA 4RGKA 1NG7A 2G9ZA 4BQYA 4NMIA 2HWD3 3POJA 2RDPA 3AMMA 5IAXA 4N53A 3CTAA 1OLTA 4A6SA 3HDDA 1WPKA 3H7JA 5HXVA 1ONAA 1ZYRF 5EJZB 1VRH1 3E6DA 4LO8A 2JA8J 3CP2A 4S2DA 1G59A 2WZR1 1EA3A 1FSEA 2OVUA 3WP3A 3GXOA 1QXRA 1H1AA 2D44A 2DMTA 3C1DA 3VBOC 2W48A 2ARBA 3L7WA 2TUNA 4D9JA 1Z7S3 2QGUA 2VZTA 3AFHA 1DLCA 1QVUA 3H42B 4P14A 1SD5A 3HD8B 4WM7A 3ESWB 2ENRA 1LEBA 3KF5A 4MTEA 2R5ZA 1WLWA 2XAJA 4FTBA 1OQDA 5ANQA 1V6JA 3R0AA 4E4DX 1JS9A 5FZ3A 1LTEA 2CQNA 1V4RA 2Y34A 3JCIA 5HPOA 1XNCA 4Y20A 4EATA 4CSWA 4A3CJ 3CCLI 5DABA 2QEXI 2VONA 1XYNA 1GZWA 2GN7A 2MW8A 4RM3A 3GTQJ 5KBFA 4UHTA 4IV3A 2RNGA 2VT3A 2P2KA 1YS6A 2M7AA 2P34A 1ASJ3 2Y6HA 1WMFA 3S2DJ 4V1PA 2RS51 4XETA 4BHBA 1IAWA 4UWDA 1OYYA 3O0XA 2PLV2 2FX0A 2Q30A 4A5NA 2E7TA 2RQQA 1TQIA 4CEWA 1WJCA 1KQRA 4RHV2 1VQNI 2YUSA 5HDNA 1UOBA 3KFWX 1X4OA 2VASA 1LKXA 1UXXX 1ZLJA 2Z3YA 3RCOA 2ZEZA 2OQGA 3IPVB 4RD7A 3LNQA 4XJ9A 4YRVA 4QD2A 2ZGKA 5EDNA 2QKDA 5J96B 4C2UA 4XNFA 5C8CC 5GAEJ 2ZGSA 1U2WA 3X29B 4YVWC 2L3DA 3A23A 1UHWA 1YG2A 3TEZA 3I59B 2K02A 1LPQA 3EYIA 1G9BA 1W2NA 5ACA2 1F36A 3MLKA 3NWKA 4ZDOA 1FNYA 2X10A 2M0CA 4CEYA 4HFSA 4AQ2A 4JDMA 4AYBN 1ZBE3 3WU2C 3ATGA 5D8LB 3ZPLA 3G1OA 5I8SA 4OQ9A 1S9HA 4CDQA 3Q3SA 3ZGKA 3KSCA 4CDXC 5FUPA 1JHHA 3RYPA 2WO1A 3OUJA 2P81A 5DAXA 1OH4A 3GWZA 2HWD2 1XC5A 3ON7A 2IA1A 3VBHA 2RJ2A 3NJVA 4CCJA 4BXFA 2QQPA 2OT7A 1JH5A 3DEUA 1USSA 4HPKA 1O4YA 3CCMI 1U5TC 1OCRH 3EHKA 3BR1A 2QCOA 2WWUA 2I07B 3ABZA 2GMEA 4IETA 3HRTA 3C3WA 2XVCA 2K3FA 1SFOJ 2Y30A 3RQ4A 2K9QA 3OOUA 4EROA 4XLAA 1XN7A 3J4UH 4X6RB 2ZFWA 2PJRA 1RGSA 2DFCA 3OSFA 1YI9A 2WA3A 3BR2A 5LEKA 1D8JA 4TTGA 3OR1C 5C3SA 3TEWA 4Q0PA 2DUPA 3UKTA 2RE9A 1XBFA 3WQ1A 3HWJA 4MHUA 3THDA 2TCTA 5IT9Z 3GFMA 5FLJA 1HRV3 5IOZA 3ZYRA 3ZRGA 3S1RJ 2HDCA 2M1BA 3S7EA 2JG9B 1W7PA 3WQ7A 3KIOA 3WTTC 2L7FP 2C4XA 2PHRA 2OBPA 1W99A 4FOWA 3OD4A 5A3LA 2KRCA 4IEXA 2PYTA 1BYHA 1UZ0A 4PLNA 2QQLA 3OYAA 4GWJA 4KT5C 4M73A 2V4VA 3HBKA 4OHVA 2Q1MA 2EFPA 4BGDA 3JB8A 5KXBA 5DCMB 2JDNA 2Y38A 2DVAA 4PJMA 1ASJ2 3KEOA 3L2RA 4JYKA 5IVVA 3BU0A 1R22A 2DDUA 1QJY2 4Q4Y1 4WM8B 3T2PA 4I02A 3KP7A 1PK6A 1MBEA 2YPJA 1SLAA 3M1HA 5JOWA 5GZEA 2B5HA 1QDCA 5CA6A 5CYVA 3NAPC 5DUUA 2RKHA 1GNYA 1Y39A 5HS8A 5A3UA 3ZMZA 3CJIB 3K2AA 1E3HA 3N7KA 1XSRA 1Y0UA 4FPYA 1H1IA 4KA4A 2Z79A 4IOCF 3ZFGA 2VLAA 2CO5A 4MUVA 1VQMI 1D4M1 2D5FA 4WVZA 4B7EA 4YM2A 4YW5A 1CZTA 4HLTA 2BHYA 3FXQA 3G1MA 1J58A 4JX4A 3IC7A 3C7OA 4YRDA 3CDIA 4QM8A 2PAMA 3CCYA 5HCFA 2B46X 2ZAAA 3CLOA 2R3SA 4BY1J 3ME2A 2W82A 4G7HF 2VXDA 2H27A 4LK0F 5A6ZA 2QVSB 5FY5A 2WYFA 2EFNA 3N7LA 2WC2A 3TW7A 4XKCA 2J5PA 4UW4A 3QLQA 3F21A 1AKHB 2MYSA 3JRBA 4EE2A 1J3QA 3KB5A 3MEPA 2JA6J 2QENA 1VRH3 4YGBA 3K4NA 2BBAA 4K21A 2F4PA 4WCGA 4LE3A 1AHSA 2DK5A 2DJNA 4OAYA 3E3VA 4BEHA 4F93B 5CAZA 3HOWJ 3IM0A 3BZCA 3MCZA 3WVJA 4DS0A 3A2KA 3OGSA 2F4OB 1ENRA 2KFDA 4LPLA 2NNYA 1UW8A 3CUQA 3VZLA 4AVVA 1U78A 2XLFA 3CMEI 3VKMA 5A3PA 5HCAA 5FYCA 3NVCA 1MNMC 3DBLB 2O9LA 2Q4SA 5DDGA 2X29A 4P5OA 2GM4A 1UY1A 1B35A 1QHHD 3WOGA 2IZWA 2ZCWA 3WUCA 3O3KA 4FX0A 1FZPB 4LOSA 1GOFA 1ND2C 1FNZA 4C8DA 4YW2A 2NMNA 2HYJA 2VC9A 3LA2A 4H7MA 5GALA 4EGYA 3BDDA 5FLVA 2IGMA 4AYBA 4XFCA 4Z07A 2IS4A 3ZQHA 4XF1A 5EYYA 2ZS6B 3VD7A 1IN5A 3JD71 3O7OA 2D1VA 4KJZA 1EY2A 5SV5A 2WQ4A 4FPGA 1QU3A 3SCFA 2STWA 1X9TA 3ACHA 5IVCA 3PVOA 2GA2A 2RS53 2DU9A 2FMYA 5BNPB 4YIIA 4A0YA 3VD5A 1HRV2 2XF6A 4Z1VA 4FX4A 5FCCA 3QPLA 5L9BA 4B8XA 3BR6A 2O61A 3HTUA 5JXHA 2YX7A 2Q1ZB 2XPUA 3FISA 1OLME 3CDLA 4JGYC 5H9QA 2ZEXA 2KRFA 3UGFA 2CDPA 4DFSA 2LSOA 3ZFEB 4IXAA 5K7FA 1E5HA 1H2KA 2XRNA 2XAQA 3KLOA 4KICA 1Z0HA 3ZOBA 1IS4A 1WZXA 4NHYA 4CZCA 1S0EA 5J4YA 2JENA 4FXGB 1F31A 3A7QA 3BTZA 5FKMA 1MBHA 1FOKA 2VZ1A 1W6NA 2VQLA 3CNAA 2XL9A 3VDAA 5JZGA 5JI6A 2W47A 4RGUA 5DMYA 3FLPA 3PFIA 4CH7A 4WV8A 3WNLA 3TW6A 2VQTA 1AL23 1JOPA 4BPZA 3AB0A 4RA0A 2LFBA 3AYAA 4XDQA 2WO2A 4N4OB 4Q0VA 4QDRA 1Z3XA 1RUF1 2ZGUA 1AYM3 1UY2A 3KP6A 5LA9A 4AHXA 4LLFA 1QVTA 1QH7A 1W8TA 4D0PA 3L9FA 2Y64A 5E3MA 3NKGA 3TN91 4Q4V1 5FZAA 1GQGA 4XM3A 3VKNA 4F91B 2D3SA 1ZELA 5JSOA 2P5BA 5FY7A 2UV1A 3RJRA 1BR4A 4I7HA 5HCBA 2YC2A 1CN1A 3DFGA 4BDYA 1VRH2 1TTYA 1W2TA 3JR9A 2JDPA 3KYDB 5DM6F 4RYDA 3ZQ7A 3RVHA 3HT1A 3PVBB 3FXJA 1XNBA 1Y9MA 2F4MB 5I0TA 5E8IA 2JSPA 1EV7A 4UXAA 2ZABA 4E27A 5APAA 5AIPA 2W94A 4KT6A 3K4DA 3BPZA 2F4LA 3KVBA 3JRFA 1GNZA 4ABZA 2A7AA 2IXCA 4QQLA 1VBA1 4QPIC 3I58A 3JU9A 1SHWB 2JDAA 1BKZA 1ZZ6A 2JX9A 4XLEA 4J19A 1UU4A 3EUKL 4MO7A 1AHDP 2VE1A 1Q8QA 2KD7A 3FBMA 1SBEA 2DVGA 1F9KA 1K7AA 5EZGA 4F3JA 2QSGX 3JCUC 1C1FA 4QX7A 1ODDA 2W9XA 2E9QA 4IE4A 4JHZA 1QQP3 4I98B 1SEFA 2FQ4A 2XIGA 2B39A 5A6QA 2VJ4A 4HRIA 3BG6A 3I2OA 4QWQA 5JVTA 3I0TA 1P92A 2RS52 2ZGRA 3K2OA 5A6YA 4D6SA 1EH7A 3WQBA 4N7IA 1ZBA3 2X5IA 4K8RB 3ZDSA 4C2TA 1IXSB 3AM2A 4Y1XA 2D6NA 2JICA 1LOEA 3KYLA 2XWJB 1UZCA 3I59A 4HANA 3U75A 5H6RA 1XSQA 5GM0A 3I2GA 2QTWB 2ZC2A 4AEDA 2GA1A 1D4M3 4ON0A 1ETQA 2ARXA 3H5NA 1H6XA 2QKMB 2DCJA 3WDYA 2P8TA 1UU5A 2YC4A 3IP4B 5EG0B 3ILFA 1I1EA 1W9WA 2VMDA 4O7XA 5D6EA 3AZVA 1HXS1 2CGPA 3FM3A 4DJAA 3WUDA 2J42A 3H5AA 4XLHA 2HPIA 4M6XA 2VZPA 2LTPA 4AFCA 3PO2J 2W39A 3N36A 1AL22 5IP7J 4CCMA 3JW4A 1ZLKA 1HW2A 4NRPA 3ZN6B 1URXA 1WWYA 1VIWB 3CL1A 1QGPA 2P5VA 1SPPA 5BNOA 2R5YA 2IC1A 5FMOS 5HBAA 3OS2A 3E5XA 1X9PA 1QNWA 4CCKA 1YYVA 2BXYA 2DJIA 3O6BB 4HXCA 2VE9A 3MW3A 5CFDB 4HG2A 2FU4A 4HF0A 4GXLA 3I2FA 2DCKA 1MMGA 2VULA 3PU8A 1ENSA 4RQPB 2QSFX 1X36A 3KWVA 1XXNA 3E0JB 1PZ8A 3DQVC 2H0VA 4L5EA 2JE8A 2BJSA 3EB7A 2MG4A 4I3GA 3V64A 1UF2C 2OPKA 2WA4A 5GLWA 1MVEA 1UKGA 2Q8OA 1PX4A 4RS5C 1UMHA 1P2FA 4A6EA 1I3QJ 1PGW1 1GXQA 3MW2A 1MBKA 3H35A 2VVDA 1O7LA 3HGYA 3C2UA 2V5DA 2WNVA 3H8UA 2D2WA 3BZ6A 1XDUA 2W25A 1WLTA 1YIFA 1T0FA 2GIVA 1LAJA 4V19K 2ECCA 1WCUA 3TNPB 4NC8A 3J7YJ 4XFHA 1X1PA 3CMYA 5FMDA 3GLLA 4WM8A 4MXWA 1S0CA 3QP6A 2C0ZA 3WG4A 5DDJ3 3CMMA 5L3GA 2V1DA 4Q5OA 2IP2A 4YFZA 2OCEA 3GLXA 4UW5A 3RNSA 3W5MA 4AI9A 5LW9A 1XB9A 2WO3A 4AXOA 3I4MJ 2F5EA 1TBXA 2F5CA 5FY4A 3U11A 2UUZA 3L2CA 1CX4A 2G7UA 3RTRA 5F5CA 1W0OA 1J2XA 5IJRA 2B7EA 5AONA 2XBO1 3E97A 3LGRA 1JZ8A 2JRMA 1ZZ8A 1A3KA 1V6IA 4Q4Y2 3T4VA 1UY0A 2JA7J 5CKQA 4XJUA 4UF0A 1ZBA2 3HMYA 4PJ0C 1AWCA 3GTGJ 1J3RA 4PZJA 4CO8A 1JBCA 1LOGA 3EO6A 5IPAA 5H9RA 3CZJA 2ZXJA 4IE6A 3SH3A 2ZMEB 4ZJZA 2V9VA 5FZCA 2XHNA 3WNOA 2MSYA 2QQJA 3NRUA 3EQEA 1LHNA 3BJ6A 2PEXA 3OUIA 2CQ7A 5FUIA 1N3QA 2DA3A 3HPHA 1D4M2 1RUF3 3KS7A 5FYYA 1J75A 2VQ0A 3VBSA 5GKAC 4ETSA 3AG3H 3Q8EA 4A4AA 2DT7B 4XTMA 2KQRA 4NUBA 3E5QA 4MNUA 3U1KA 3RI4A 5LRRA 1BL0A 2QQWA 2E2JJ 4Q4V3 3O1OA 4MGRA 4RFT0 2WY7Q 2JVGA 4K6BA 5BUVA 3H1MA 5IK8A 2O1QA 4CDUB 3FJSA 1FMWA 3AYCA 1Q1VA 4LULA 3BR3A 4ZYDA 4FFFA 3FKJA 1AR91 2ZHKA 5KHGA 1WCQA 4CICA 5FYTA 1KS4A 3PUSA 2JPCA 5FZ1A 3PIJA 2HZTA 3DPLC 2LTNA 1SZBA 1M06G 4DUWA 1F8VA 3ABUA 1KYWA 3LQQA 4AHZA 5AC91 5F1RA 1GKBA 4Y22A 4PJLA 4B09A 3CJNA 2DN0A 1HRI3 4XN0A 3AFGA 2WAFA 5HV4A 1PMHX 1S2KA 3M70A 3OF1A 3UGHA 5CJ9A 4CP2A 3RI9A 1V70A 4MQ9F 1MS3A 2B7YA 2Z69A 3FUQA 1SFXA 1F5JA 3NJYA 4XBQA 2W08A 3B5LB 4Y4YA 1BHGA 3HB9A 4COVA 3CCQI 3NV4A 2VECA 2PFWA 1JT0A 4QXCA 5D5UB 4KDPA 3GF2A 1SAUA 4LMYA 2O8XA 4H55A 4J00A 1WMEA 4TWTA 3SEQA 3JD72 1XMAA 3N35A 2VNVA 2X9DA 1DPUA 2QZ3A 2Q0OA 1PZ9A 2AGSA 1ETYA 5E6HA 1DQUA 1W5SA 2WNUB 3LKJA 4LKSA 4R52A 5C9AB 3S8PA 3J80Z 4GMP1 5F32A 1VQ6I 3CF6E 5F04A 1EYBA 1US2A 4OUSA 2BWCA 4JQRA 1PGL1 3IHUA 3J7LA 2D45A 5F08A 3ACFA 1OKRA 5GTHC 3HOXJ 4Y33A 2YPDA 3JSOA 4J25A 3OMYA 4M3CE 4OZXA 3M8FA 3VOEA 3RQ0A 2P4WA 3VB9A 1DZTA 2Y0SN 3G6JB 4BS9A 5JVGF 2XB5A 3EMRA 1ETOA 1W8HA 4Y3OA 3W2VA 1PO11 4PDWB 2W0XA 3IDAA 1IG3A 3GBGA 2FMDA 4B3NA 2FBHA 1YJWI 3D5OA 4Y24A 3E1F1 3ELNA 4NIHA 2M9HA 3RIRA 2VI6A 1HXS3 3FXOA 1RHI1 3HOVJ 1IZ1A 2E7XA 4AGVA 1NG6A 1J1TA 2VB6A 1W9SA 1CR7A 3PL8A 1W5TA 3TBIA 4CZSA 3MO4A 2C9KA 2V79A 2K0GA 1KDMA 1RUF2 1IGNA 3POSA 5J09A 3HUGB 1BJQA 4DXSA 2JG8B 5FRAA 4F7ZA 3VD3A 4D6RA 1NZCA 2O6GE 1LVKA 1YQCA 1S2BA 1SFUA 2EPFA 3TNQA 3TN92 4Q4V2 2P7CB 5CU1A 1OC1A 3NAUA 4XQDA 5FXXA 2PMHA 1MMSA 2XVLA 4DBRA 4XHBA 5EP9A 3HIFA 3RKYA 4RFRB 2RDSA 4RLFA 3ZSJA 1LCLA 3HOSA 2HDDA 2NRAC 2Z99A 3RSJA 3CCJI 4XIOA 2YBSA 1ZGWA 5LASA 4I76A 3QPTA 4L5JA 4XLPF 4GZ9A 2B42B 5G05L 4AI1A 4LK1F 1K45A 4EWEA 1JKQC 4BDZA 1XMKA 2OZ6A 3G1LA 4FE7A 2E5NA 3ZQQA 1VBA2 2DFBA 1UG2A 2CUEA 1B59A 1S6LA 2VTFA 2YSRA 5JPMB 4CCLA 1HOMA 2QNKA 4RL7A 3EUHC 1WA6X 1BK1A 4UOJA 5CVIA 5J1RA 3ACIA 2W1WA 3KGZA 1RXGA 4UFIA 5TSWA 1SEUA 4BIFA 2XGCA 5BS6A 2HOAA 1SMVA 2EF6A 5DUVA 5AIQA 1N1YA 4JX5A 2HTJA 2JB4A 4EJTA 1ZVFA 2QQIA 5D8AB 1FV2A 2OUMA 2GWRA 4D7YA 5LK5A 3RZGA 1HW1A 5JPNB 1X8EA 3HN1A 2JDYA 1IXCA 4META 2JG9C 4DINB 3IMMA 3ZQIA 2NS7A 1JOBA 4A3FJ 1ZZ7A 4D94A 1VBE1 2GALA 5LA1A 4GDFA 2OTJI 4RAGA 3ZR8X 4GWNA 2YR2A 4PHZA 4DY5A 4OMYA 2QDRA 4BU2A 2EA2A 2ZJCA 1TW2A 1OI6A 5AVAA 3VKFC 5F0CA 4BH9A 4FO9A 1XNKA 2VZOA 1SFPA 3I53A 4Q2FA 1JZ2A 3M3CA 3FC0A 4R4XA 5M0TA 3K4LA 4FPJA 3B73A 1D7PM 2E35A 2JIGA 3IMNA 1UWWA 3FIWA 4Q27A 4KN4X 3LEIA 3K4BA 5DUWA 4XMIA 1FYUA 5FQ0B 1J3PA 4E7HA 3CJIC 4GB33 2HYFA 3NSTA 1YFXA 5CFCA 1HXS2 3CHXA 3A22A 5ICCA 3TRSB 3P1IA 2CGOA 5CPRB 3VSKA 3A0KA 5FMOL 1K79A 3MKYB 3IH2A 1IN4A 1MDMB 2OQRA 1ETWA 4HN0A 1I6HJ 4CUCA 4B4CA 3CD6I 4FPEA 2Y0SA 3B3QE 2EIMH 2H09A 1CGPA 4P1WA 4FFGA 2QQKA 3KLSA 1KU2A 4KUMA 3HHHA 2WSUA 5JR7B 5AC93 2WWYA 3VZNA 1NOVA 3CZ6A 3JRIA 5JIAA 3N9OA 4U7BA 2OZUA 4DGWB 1DQ2A 3OS1A 1X58A 1CAUB 2O5RA 1BK0A 2EWNA 2XR4A 2MH2A 2ESNA 5F6FA 2NMOA 3K9TA 4UNOA 1WJFA 5GZCA 3R61A 1FI2A 4IO9F 1CAWB 2DCEA 2FDJA 3GUDA 4S05A 1OOPB 4LKDA 3POWA 1JKRC 5J6XA 5J8CA 2TEPA 3QD6A 4FPHA 1REFA 3L1PA 4ESBA 4A42A 1A78A 1PGW2 1A04A 1XGOA 2ZGQA 4BHPA 4EN0A 3LF7A 9ANTA 4BXXJ 4MFEA 1KU7A 1IOAA 1BBYA 1POV1 4DYQA 1VBB1 4XVHA 3SKJE 4ZXKA 4DZJA 1K5MB 3HJRA 2DW4A 3PJQA 4GJZA 3GCXA 5EEAA 3J81K 1X1AA 1VR3A 2BW8A 1ENXA 1WI3A 3ZVXA 4HF1A 4QGMA 1FTTA 2VBBA 1D5VA 2UXNA 2ZGTA 4BKXA 1B72B 2K85A 3OSDA 3ZN5A 1UMIA 1OT5A 4D1QA 4URTA 2CL2A 3HT2A 1NZIA 3SXYA 4Y52J 3R60A 4RBOA 4D0QA 1U9OA 1R1TA 3LSTA 5BNPC 2W5FA 1W06A 4R79A 2XBO2 1FJLA 2K46A 2PHUA 4QHBA 2Q8DA 1C8NA 2CSGA 4CYCB 5F6LB 3ZSLA 2VKVA 3T30A 2BTVC 2PAEA 3NNLA 5JR3A 3JUUA 4B4QA 1IPSA 1H4GA 5A7QA 5ILVA 2MEV1 2CG4A 5KHDA 4YFWA 2WBMA 3ZFEC 5EZHA 3UGGA 3G71I 2ZEWA 5K7PA 3QH6A 1V9U3 4FETA 4CDGA 4B4PA 3P7NA 1RETA 2BP6A 4BMEA 3C18A 2ZKNA 3KMHA 1JUIA 3K7AJ 1HJFA 1XNTA 2AENA 2YS9A 5FYUA 5FMCA 1DQ4A 3EPZA 3CCUI 1ZR2A 1HDDC 1JYXA 2ZJ2A 5DPNA 1A36A 2YBPA 2UWBA 4N9HA 5DQ0A 4D7NA 4RM2A 1NUKA 2CV1A 3MUY1 1RR7A 4UFJA 3OV8A 5DG2A 4CP9A 3M8JA 3MIDA 4UY8I 3OOPA 1FMD1 3RYKA 1Z9CA 2EIEA 5GPAA 4UUSB 2ICWG 2TRTA 2XF5A 4FTHA 3FBYA 1QWRA 3USSA 3RWKX 4COZA 4EJUA 2WT0A 3K4CA 2M30A 4ORFA 3FZVA 2WRAA 5AC92 1PUEE 4GULA 4QQOA 4ZPIA 5JI9A 2JA5J 3JBG1 1WH5A 4A12A 4NE9A 5I8YA 1VQ9I 1MJAA 2ECBA 2LKSA 2VBXA 3GTLJ 3GBFA 4FQ4A 1MH4A 2GOMA 2DXIA 2Y33A 3IAQA 2JWPA 5ICGA 2DCZA 2F17A 3S57A 1X3WB 5J37A 4HSTA 4RAYA 4HKLA 4BYYA 2HI3A 3MW4A 3V0AA 1DPRA 2WNUA 4YVSA 1XG1A 2F48A 1TZLA 1TMF1 2PG4A 2QCSB 2JJ7A 4QSHA 2ZMLA 4SLIA 1SBDA 4KIBA 3CKHA 1D2SA 3Q9VA 5K7HA 1JMUB 5C70A 2DAOA 2ADDA 4CPBA 1OCOH 1QEXA 5DV5A 2W52A 4DYRA 4KWLA 4M0HA 3OR2C 4LJZF 2ZFUA 5DN2A 3SDGA 2CSOA 4IGPA 4KMQA 2D1HA 1VBE3 1W6QA 4DW6A 3ETPA 2E71A 1PGL2 2GZWA 1IPJA 1IKQA 3MYXA 3RG0A 3LSGA 1JHNA 2CJJA 3BCWA 2PX9A 4IHYA 2WA0A 3IZOA 3HYIA 2J1RA 2MABA 3AP6A 4ZTJA 4HL0A 2BV4A 4CXWA 1R091 3O2PE 4MIMA 1L7LA 2M8GX 1PO12 3ES1A 1UOFA 4D7MA 3H9GA 2ZBKA 4XJZA 1YI2I 3O8GA 2HQNA 5FB2A 5LBQA 4IHXA 3POYA 2CQXA 4M74A 3M3YJ 1RHI2 2W2IA 3OYJA 3H0GJ 1G3YA 3KVAA 1UHSA 1ST8A 4YM0A 4EJVA 3RPUD 3ELKA 4COWA 1JGSA 1R083 5A70A 2VIXA 3OYBA 2FBEA 4DBQA 3INAA 1AXYA 2XUMA 1Q1HA 4WVVA 1OVPA 2QBYB 3VBFB 4GALA 4XAEA 3DYMA 2K4JA 1H0MA 2IT0A 1NE4A 3BZKA 2IJLA 1UZVA 1YLLA 1U3EM 1HSJA 4O3MA 1IXRC 3BG5A 1RUH1 3KE2A 2RS13 2NVUB 3DL3A 4FPOB 1GLNA 1XQNA 4JRAA 1ZRRA 1NG0A 1VQLI 3CCVI 5I0UA 2IVMA 4HSJA 2NZ9A 4DY3A 4A3BJ 1FEXA 1QKQA 4XORA 3WHCA 1NA1B 2CUFA 2H6CA 1AXKA 3IH4A 4BB3A 4FE4A 2L4AA 3NNJA 1GVJA 3DWLE 2R16A 1HKSA 1S29A 1QJZA 1QGLA 1GV2A 4RR3B 2H1LA 1GP5A 5CFDC 5E3OA 4RQPC 4N4NB 1LDKB 4Y15A 4F92B 4FPLA 1K4TA 1R4MB 3LIHA 5FO8B 3O1VA 4AVZA 1MMNA 1VBB3 1DP0A 3BIWE 1Z3YA 2ELKA 5FKKA 2WYSA 4LBQD 5ABJA 4LBQB 1JZ4A 4J01A 1CESA 3IKVA 3ZYFA 3DPUA 4PGHA 5KC5A 5KCMA 1C57A 3VN4A 2AYHA 2ILMA 2JDMA 1G9AA 5BQTA 4NBQA 1RI7A 2CQKA 2Q2EB 4KBZA 2LD5A 2IBDA 3HM5A 3G2BA 4HNTA 3B9IA 3PIGA 3BGAA 1UY4A 4A3LJ 2QQ8A 3SMHA 3WR0A 3WF2A 4MGTA 2ZJQF 2RVAA 5KAFC 2VCAA 3T0AA 1UB9A 1OPMA 3J7AO 4YW3A 1K42A 3ABTA 2A07F 4AE2A 5CYYA 1RUI3 2R32A 1AL0G 2A6TA 4IHSA 1RUC3 1VBE2 2R071 5AFBA 5CG9A 1T39A 5FQ0A 1X3UA 4P96A 1U9NA 3GGLA 2E19A 1I39A 2ISYA 1MR5A 1RUD3 4WXCA 4GJYA 1JXNA 5FLXK 1ZRFA 3TDUC 2ELHA 4G3YC 3WG9A 4QPGA 3NARA 1GANA 2CUJA 2YU3A 2PQSA 5JIUA 3GZUC 3FMSA 2F5FA 1V6NA 4AZZA 1TW3A 1HBXG 4CUAA 3OYMA 3GFJA 1DHKB 1L3LA 2WB1A 2ZNZA 1ETXA 2MA3A 2ZMEC 4RLQA 2NM1A 5BNQA 3K4MA 1IPKA 1X82A 1W36D 3WW4A 1H9TA 4A7YA 1Z1DA 1FY7A 1XGNA 1FAYA 1FMD3 3ZMNA 3R4SA 4HK9A 3AG2H 1APNA 4GIQA 4Y5Z0 4XK4A 2FDGA 5IVFA 5JUVA 2W7NA 2DU1A 1ONVA 3VKLA 5AFEA 1K3IA 3ZFFA 5IHRA 3VBUA 4EMSA 2CV6A 2V4JC 1W39A 2J5OA 1BBT1 4G94A 3K46A 4XW3A 4FSJA 1NCRA 1U0JA 2ZZQA 2YMZA 3F8BA 3J8F3 3WTUC 4EZHA 3AAFA 1KRIA 3A4UA 2RS12 4E7KA 1SDDB 3TO6A 3PNVA 3L2VA 3WF0A 4XSXF 2Y9ZA 5GZDA 1H8TB 4ENKA 1GDTA 1NXD1 3CF5F 4KGQA 1CPNA 2BU9A 1ZREA 2GNBA 1PO21 3WODF 4A45A 2EILH 2KHMA 1OF3A 2HWC1 2VZQA 3AFKA 3R05A 4IV1B 5LWBA 1YC61 1UYYA 3T2QA 3DKYA 3N9PA 2M87A 3FBNB 2YB7A 4QXHA 2RMU1 1YQ5A 2VU9A 4IEZA 1IN6A 1QJX1 4Y4RA 2K9SA 1VBB2 2R1DA 2E1NA 1DIWA 5A2QZ 4WVMB 3FXMA 4KITB 1L3JA 1X3ZB 1SAXA 3OGVA 3FFQA 2OX0A 1WHUA 3VB2A 1QPIA 3WXPA 2AXLA 1JYCA 2VMCA 3CMAI 3TEYA 2VXRA 3I3LA 2UWMA 1LU2A 2IWGB 4C0HA 4UFKA 1O8PA 3FDYA 3E6CC 1K61A 3G73A 1Y1VJ 2QQOA 3UR3C 2VZSA 2K5CA 1ULCA 1XE0A 1D2QA 3TGNA 4R8HA 5FYVA 1LFBA 1NH3A 2QWWA 4RGRA 5FO7B 3T2TA 5C9AC 2A6EF 1GR3A 3CF2A 4KGGA 2NXNB 2EAAA 3CU7A 1R093 1X2MA 3AZYA 3SFIA 4G9SB 5DUXA 4ASMB 4PFPA 3KP5A 1KZHA 4HKWA 1KGYA 1CVNA 3R4KA 5L3BA 4AD9A 4AVPA 1P7IA 1OPOA 1H89C 1JUPA 2Q8KA 2XUEA 3WDUA 2MEV2 3CESA 3POFA 3ZP5A 4YFXF 3TWIA 4IPAA 4PDWC 4A3MJ 2DDBA 2VW2A 2GH2A 1U8RA 3WU0A 1B09A 4NIGA 1IS6A 2JK3A 5FIXA 2DI3A 3TOJA 1ND3A 2AZ5A 2BY3A 3L2HA 1RXFA 1KD7A 4O9EA 3KT7A 1REEA 1D5YA 1W6MB 1NY71 3S1QJ 1W04A 1KYZA 1RUH3 4INDA 1DGRA 4P9LA 1PUFB 3GHNA 1XSDA 4UUVA 3PIPF 4LK6A 5DAPA 5A7PA 3V65A 5D21A 2YU2A 1FMD2 1Y56A 1TNTA 4AI8A 2JG8C 4L0ZB 5J1YA 1RUG1 4ONUA 3THCA 1VB4A 3BTYA 1O7FA 1R23A 2R7QA 4AGGA 1FP2A 4FTSA 4FFIA 1Q8OA 1W8FA 4LBMA 2H94A 4XJWA 1FYKA 1W05A 4Y13A 4V2GA 5F37A 3ZQGA 4QDQA 4JQFA 5ICFA 3DECA 4YZ4A 3KM5A 3JBG2 3WG7H 3ZXJA 1JYVA 4D8MA 4E7ZA 1YJKA 3BOPA 2XXZA 4ZYHA 2W87A 4U2AA 4FTEA 2G1MA 3CEWA 2DBBA 3N97A 4LG3A 5FOBB 2AR6A 4XIDA 1VI0A 3RI8A 2WWJA 3WHUA 3RFRA 4BUPA 4WK8F 3CIHA 4EM2A 1WD3A 1S0FA 3CO6C 5HXMA 3HSFA 4PCRA 3BQYA 4EJWA 3O8HA 2QQAA 2W85A 4IRHA 2ZSHB 2A5WA 3CO2A 1DDNA 1VAMA 4LOTA 4D5FA 4BDVB 1IRFA 4FAHA 1C28A 2RM21 2ZX2A 2AUYA 2HYXA 1DGLA 4KMUX 4H0EA 4DUXA 1GVDA 1Q8SA 3WE3A 4UFHA 2E63A 2HBTA 3FXKA 4OIRF 5G04L 1OA3A 4HDUA 1S4CA 3BJAA 3J9SA 4JKMA 1BW6A 1N1TA 3HOUJ 5FWJA 2R073 1WCMJ 1KA8A 1J09A 3O1RA 3V0BB 3R4DB 1AYN1 1X4PA 4HETA 5D8AC 3F3XA 2O8KA 5JCTA 2XAFA 4RSUA 2HNHA 3R4UA 4YIFA 3K3NA 4N53B 2D6OX 3KZ4C 1Y0NA 1U6GA 2P5LC 5FKLA 4AWXB 1R092 1O4TA 2OYZA 2ME0A 4KMFA 1SMTA 3C7JA 3TP0A 1FOD1 1BR2A 5CVJA 5ILSA 4P9WA 5L3FA 2NNNA 4ZYAA 2QBYA 2KRHA 2PHFA 5HS9A 2EIJH 2VZRA 3KQ4B 2G9WA 4XLCA 5H6QA 4DYCA 1WH7A 2G7HA 3CZUA 3K4ZA 3NV1A 3WU1B 2CW8A 1TQMA 2JDUA 3ZIWA 5E1ZB 3BODA 5FMBA 2GP3A 4ZKTB 2CQQA 1WCSA 2R5ZB 3ST7A 1JU3A 1A6CA 2HZDA 3ZYBA 2JD4A 1NA1A 4M71A 3ZCOA 3I3MA 3GTMJ 1AJKA 1WD4A 1ULFA 2VZ3A 2ZX0A 3JTGA 3V7SA 4QT6A 4Y20B 5BNGA 4QX2A 5T5LA 2LP0A 5C33A 1RUH2 2HLEA 1CAXA 1CAVA 1JI6A 4A3DJ 3Q8AA 3ZXAC 3THPA 1R1VA 4XUOA 1GZWB 3M8EA 2KMUA 2E7AA 3BC8A 1OSGA 3LDBA 4IV3B 2ZEYA 1WW4A 2LR8A 5F2SA 1XJAA 2Y75A 3GDBA 1F5FA 4EN6B 2GXBA 1PYVA 3RKWA 5IVYA 1QU0A 1N1VA 1WKYA 3AJZA 3MHZA 3LFKA 4PI0A 2PJPA 1CIYA 3V56A 1OUXA 4XF3A 3R0RA 4MLOA 1RVF1 5L3DA 3L2UA 4CEWB 2HWC3 2LDUA 1W0PA 4IE7A 5EFUA 2Q8CA 2FOWA 2O0OA 3OYLA 1XYPA 5HI0A 4EWAA 1O91A 2F6BA 4NVPA 1ZA7A 2F5VA 2JSCA 1ZRCA 2GMPA 2EZHA 1MMAA 3OSGA 3BIEA 3B93A 2WWSA 1OOPC 4XDOA 2H8WA 3VZOA 4XN3A 3LB9A 4RB0A 4LXLA 5GZGA 1B4AA 3H0OA 2ZGNA 3K1PA 5D5WB 2WN2A 4NRQA 5FDBA 5C8WA 1VQOI 1PZ7A 1OQEA 2Y48A 3T0DA 1S0DA 5E79C 4E8DA 5E88A 1K5MC 2ETHA 2GP5A 2IGOA 3H7YA 4BE0A 1R49A 4ZS2A 2RAEA 3MIGA 4Y1YA 4ZU7A 2JXAA 1H0BA 3FF5A 1S1AA 1IS5A 2L9LA 4AR2A 3OYWB 2B9UA 4CEYB 1MH3A 2P4EA 2UU8A 1RUJ3 2W95A 4LG0A 1W03A 3MDPA 5FZ0A 3O1PA 3GZ5A 2R072 1MQTA 1RIRA 3N9LA 5HLHA 1AZDA 2ZPXA 2L01A 2BZTA 1G4DA 1TWFJ 2O3FA 3DPRA 3VBHB 1D0HA 1GYKA 1R64A 5CBLA 5T54A 5FZEA 2VQAA 4C90A 1D0XA 1GLHA 1R58A 2FCVA 4HPKB 3NNFA 2DUOA 2P0WA 1NYWA 4KI5M 3NQHA 3QU3A 2IGKA 2BPA2 2B45X 2F2EA 3U21A 4A69C 1UAIA 3M1CA 1LULA 2ZBJA 5EJ1B 4A41A 5F27A 1B9MA 2XSJC 4B1LA 4FP2A 2LF7A 5FBJA 2C9AA 3UETA 2ZACA 1V5EA 2QQBA 2E2HJ 1STZA 4QB2A 3C8XA 1MNEA 1B9NA 2FQPA 1GP6A 1RUG3 2R7UA 2WDBA 5CKNA 3DTEA 5HLIA 1XYOA 3LWCA 1U5XA 3Q0WA 1W7PD 4I0BA 3U37A 2BW3A 2YBKA 3S6PA 5HOOA 1NQJA 3BY6A 3H8OA 4Q47A 3VGIA 4B4RA 3DKXA 4UBGA 4V2FA 2V7FA 2A69F 1SLLA 3K2ZA 1YO5C 5JOXA 1ULDA 1GMMA 2G9FA 1N47A 4QX3A 2IFWA 2A70A 4IDZA 3I5UA 3ILRA 3MIBA 3JAMK 4IHWA 2XAHA 2D98A 2RG4A 2K2SA 2ID4A 1PO22 2KIFA 2VUMJ 2L9VA 4BQOA 1PK6B 1DQ6A 2HWB3 4S04A 3PUAA 4NQWA 4JV4A 5AVPA 2X6XA 2HWC2 3LSEA 3BLYA 2XKPA 3CUOA 4CCOA 2R063 2RM23 3ZXFA 3T3YA 1LDJA 2Z9OA 2VN2A 3ROUA 1W8WA 3BOWA 2LVSA 2RV9A 1EKEA 3T09A 4NROA 1QJX2 4OWRB 3ZFGB 4UVAA 1S5LC 3JREA 2VPLA 2WBKA 4L9BA 4OZOA 4Z2WA 1YX5A 3ZR6A 2NYXA 5E20A 2I8DA 2JN6A 4JGZA 4KIFA 1O3SA 1LOAA 1AYN3 3G6EI 3VL9A 1C8M1 3ZR5A 3OS0A 4E4ZA 3PMEA 4PSXA 3J26N 1WJAA 1LB2A 2ESHA 5A33A 2VQGA 3ECHA 3A0BC 3WLUA 2DCYA 2QJVA 1RC6A 4AYUA 3LFIA 4XURA 2XWBB 1PIV3 4XOTA 2KL4A 1DGRM 1NK2P 4NIDA 5I8TA 1DQ1A 1VAVA 4HX7A 4OIOF 4MV2A 2CWMA 2GMMA 4BEHB 4LO4B 4Q4X1 4L2NA 4WXHA 2IRFG 2X0LA 1CX1A 3ZPOA 3CUQB 1FXZA 5B5EC 3FL7A 5C4WA 4PQQA 2VXZA 2X1DA 4QM9A 2Z5UA 2NOGA 5FR3A 1TL8A 3PDQA 2RR13 3I3DA 3P9IA 4Q0UA 5KXDA 3K1NA 5FXVA 3SLIA 3IIAA 1UQXA 1B35B 5A32A 1YYNA 3P5BA 1XB4A 4HDVA 3N4MA 5FZHA 1VBC3 1VBD1 2PELA 3I7DA 2PLV3 1APLC 1NY72 3OL3A 1DF0A 5FZMA 2OW4A 1G3SA 2IS6A 3HNYM 3OBTA 4BE2A 1FPQA 1JYWA 1NXMA 2L2OA 2V1XA 2J1VA 2R7WA 3VBFC 4JAAA 4J1WA 2VL8A 3ECOA 2EXIA 1VQPI 1ZARA 1RUG2 4KG0A 3VZJA 1LE8A 2F4IA 2AC1A 4HV6A 2HWE3 2EFQA 1GU3A 1GZ9A 1RVF3 3MFCA 1C3HA 2HEOA 1BVP1 4BBRJ 4BOWA 4GH4A 4CCDA 2KISA 2W84A 3AKPA 2ZO4A 3GHMA 1NKGA 5F5AA 3NNMA 3U10A 2KKOA 1Y6IA 2YY1A 4CDWA 5ACA3 1TME3 4QGNA 1OPCA 3M7GA 3QODA 4RR3C 1YFWA 2D6MA 5F2WA 2ID3A 1PNFA 2XF7A 2DYSH 2D97A 4LLOA 2EA4A 4WXDA 1CQ9A 2L9SA 1W6NB 4KU7A 1IRGA 2FQ3A 3LSHA 1L7RA 5JZGB 2I45A 4OIPF 3P5JA 1PMJX 2R062 2RM22 4Z82A 4AVAA 2CAVA 2Z4FA 2QVOA 2VMFA 5FPXA 2GOXB 2JE9A 2VCCA 1OMIA 5A3NA 1VLNA 3J7NA 1W1WE 1YFYA 5BNNA 4NHLA 2DFFA 4X8NA 2IXIA 1JW6A 4B8EA 1IN7A 5FYSA 4M3CA 3IWFA 3H3ZA 2M2EA 1BJAA 2OTLI 3Q8FA 3HOZJ 1AYN2 2RN7A 3MZYA 1W6PB 3HL2A 3OGGA 3BG3A 4XKWA 5IVBA 5FYBA 2IAIA 1U12A 1ZHFA 1XD7A 1YO8A 4H7LA 1TWGJ 2VOPA 1O59A 4LMFA 2VODA 4S0HB 3WGIA 1PIV2 1ZZ9A 1FOD2 5K0UA 1J1LA 3QCWA 5LGUA 4MEXF 1XSVA 3LPFA 4ZS3A 2M34A 2LUWA 4TLGA 2MLGA 4EM0B 4HAMA 3IN9A 1NLSA 1GP4A 3S2WA 5L7OA 1E5SA 1JYNA 5KHKA 4M6YA 4C91A 2RR12 3KYCB 2ZHNA 4OVEA 1O3RA 2V6CA 1I1GA 1GFF2 1NT0A 1QJY3 2B4KA 1VBC2 4OI1A 3OYGA 1W36C 1Z7LA 2WFF1 1ETKA 2NVQJ 4XONA 3QQAA 5E3LA 2O8OA 2Y0MA 4OHWA 1UJ8A 1E3PA 1VAKA 2KIUA 2HYGD 2L7KA 4ZZ5A 3BUCA 3OYNA 1GZTA 3P3PA 4H14A 4SBVA 4DB5A 3QRFF 2VMIA 1XU1A 4UFMA 5EEHA 5KAIC 3AP4A 1F43A 4BQ2A 2OV7A 4BAYA 1VALA 4DNYA 1GQHA 5K5RA 2HWE2 1SVMA 2R7TA 3Q8BA 3LSMA 5GAHJ 1R1A1 2QZ8A 3AMPA 2P37A 3MZHA 3IWZA 2X5IB 1RVF2 5JDBA 2VMEA 5LHHA 4AQSA 2DVDA 2X8KA 3PTRB 3RSNA 5JHFA 1YJ9I 1N75A 1OCTC 4X8PA 3KETA 4QQPA 1NLQA 2BNNA 3SITA 1OCZH 3H36A 1FT9A 3DV8A 3P9KA 1H8TC 4PGGA 4BISA 2FJ1A 4QIWN 2HJIA 4CA9A 2LBFA 5F0HA 1YCIA 4AEDB 1MZBA 2WNEA 4Y1ZA 1TME2 2GNMA 2ZXWH 3D5LA 4UW3A 2VNRA 1WKMA 4FASD 4XMAA 3OYWA 3KP4A 3J7AY 4IV1C 5L19A 2KM2A 1Z67A 5LY2A 4NHMA 2XQXA 1C8M3 5FY0A 3U14A 1GUUA 3LFMA 3ABLH 3SQNA 2BZDA 3IDCB 2L02A 5DUKA 5JLWA 2CU5A 1OR7C 3EETA 3I55I 2BOLA 5CQEA 3K70D 4HONA 1LOFC 1ZGAA 4JC1A 4G7ZF 3B6AA 2EIBA 5JXJA 2XPVA 4QX0A 3ZO0B 1I3AA 3PUIA 1AF9A 2DVFA 3F2ZA 4U87A 3KGLA 3VDDA 4O9GA 4R9AA 1SPPB 5BNOB 2R5YB 1BEV3 3MIEA 3USUA 2R7FA 4K1ZA 3C7EA 3V42A 1IN8A 3KX2A 2HOSA 2IGNA 5FK8A 1LNSA 4LLLA 1BQPA 2QQUA 2VJXA 4RB1A 1BOAA 2FBIA 1X19A 3NEUA 3MLJA 5I0DA 5KHHA 2CYFA 5FYIA 1IV6A 5C8CB 5FXZA 4XHXA 4YVWB 5GLUA 3PU3A 4OUEA 2BVMA 3O5SA 1MZFA 5D5VB 4XFGA 3I2HA 3S7IA 2WAAA 1HQNA 2Z2SB 2HEVF 3SEPA 3PSIA 5HNFA 3NRVA 1YFUA 5C5UA 4CU9A 1W5CC 2WNVB 1COV1 1TQPA 2BERA 3BTAA 3RZJA 2IA2A 3DCQA 4A3XA 2CMPA 5FP7A 1Q43A 2HPMA 3ZMOA 1GNHA 1DZRA 1MZ6A 2HOEA 3ABKH 4RDUA 1H4HA 4CDXB 4L0YB 1BVVA 2EXHA 3OG2A 2M7BA 3VLBB 4MXWB 2E51A 4QHOA 4XE9A 2KR2A 2G19A 3KZYA 2EIDA 4XQWA 2K40A 3GCWA 4DXZA 2JVHA 4OI0A 3RQIA 1KJLA 2V72A 3FMRA 3WT3A 5CKMA 4JDNA 3IAM2 2VG9A 2HVRA 4UT5A 1C0WA 2BYVE 1NCQA 1PVC1 5HV0A 4R9BA 3HNMA 2HKOA 2QF7A 2ZMKA 1GV9A 5TISC 2JECA 4UF0B 1NHAA 2A61A 2CWSA 2ZSIB 3F72A 1JGGA 3DXTA 1QNTA 4YW6A 4IRGA 5A3MA 4V2WA 1K78A 2R7ZJ 2BVVA 1S0BA 2OKXA 4AIJA 1K12A 4E7SA 2VCMA 1OYWA 2VE8A 2GAUA 5TRDA 2VOOA 1MSFC 2F5DA 2VPVA 3EBRA 4FOQA 4QWNA 1CIWA 1ETVA 4M3FA 1T2KA 2NVYJ 3T5XA 1SQ4A 4LHSA 3VBSB 2WTEA 5T55A 1KEXA 1UXZA 5BOXA 2WZR3 3TMOA 3WTYC 5KXCA 2D3RA 3AP7A 2Y6FA 5FV3A 4HPQA 2E2IJ 1C8M2 3E6BA 3ZX7A 2Q5TA 4PBPA 1JKOC 2HFHA 4P9YA 1ACCA 3ULQB 4HQEA 1QOSA 4MGZE 3HRMA 2E5ZA 3PJRA 3HKZN 4BHCA 2XJVA 3AZXA 5FFOC 2E1MB 5DM7F 2ZJRF 2E1CA 1MNDA 1UMQA 3KHCA 2EICA 1KDKA 5J40A 1W90A 4URAA 5DAWA 3VDBA 1F15A 5E8AA 1O4ZA 2WY8Q 4RS8A 4FT8A 2Z5WA 2BUKA 2EFOA 4E70A 1JJ8C 1BEV2 3F0CA 2B9VA 2L9RA 1ACIA 4XUTA 2DMNA 4Y22B 2RC4A 1VQ5I 2OPTA 3W59A 3RS6A 2ID6A 2G9GA 3O12A 2QYOA 1QOOA 1P8JA 3ZIXA 4GYGA 2XPWA 2M8EA 4COUA 1W0UA 3ACLA 4AAXA 1WJDA 4EJOA 1C5IA 3SXWA 4CP1A 1I3HA 1QOTA 2E32A 3CC2I 1AVBA 2JKBA 3CQZJ 3M7AA 3J7HA 1BC7C 3IKTA 1T6BX 2WFF3 4BQWA 3KT1A 2EZKA 4UAPA 5FPUA 3N9MA 1SFNA 4WM7C 3CC4I 4E2GA 4YG6A 4NHJA 3RKQA 2XB0X 4IE0A 1WVRA 2YPRA 3L2YA 1U5ZA 2GNTA 4N43A 1LNWA 4Y7NJ 1FYMA 3PUFA 2KA3A 1P4XA 2EV0A 4YGEA 3ZYHA 1R1A3 2HVQA 3T08A 5T5JA 3MFKA 2OQ7A 5BYNA 5ISLA 2XH6A 3VBRA 2V09A 1PP7U 5EV7A 1RB8G 4D5CA 5FZDA 4AL9A 2P6TA 3K1MA 4OCTA 2E34A 3BB6A 4IV3C 4XQ4A 4IZZA 1HQLA 5FPAA 3ZN4A 4OQ8A 1ZR4A 4QU2A 3JRCA 3ZMTA 3B69A 5KWRA 5FZBA 2UY9A 2DA6A 4Q1RA 5JOZA 1T8IA 2ELJA 1N1SA 1RZ4A 2B0LA 2F6CA 1KS5A 1QF3A 1YHQI 3AL5A 1VJ2A 1MS4A 4Q26A 4CEWC 1FBSA 1TWAJ 4LT5A 4QPYA 1UCRA 2HU9A 3KPHA 4BE3A 2ARAA 1G9CA 1W6PA 4QKDA 2QBXA 1ULGA 4F3QA 3S2HJ 3DU5A 2COMA 2ZGOA 3A0HC 1JZ7A 1YRNA 4E8CA 4QPQA 1N3OA 4S2FA 4CYDA 1VZ0A 1W9FA 3ZYJB 4ZU5A 1IQAA 1XCBA 3LSPA 1IQDC 4LBJA 1RKTA 2WZR2 4PT6A 2QDNA 3AMHA 4JGYB 2GU9A 4MGIE 1DQ5A 2KZGA 4IW3A 2DOAA 3ZKYA 1M1EB 1QO0D 1X50A 4PIYA 2RS31 1WCDJ 4HT1T 2GC1A 4IEYA 1CONA 4CVUA 4XSZF 5E1WA 4CEYC 3A01B 5FPZA 1KXGA 4JX6A 4RHV1 5BPXA 2A6YA 2ERFA 4CDQC 4AC0A 2EZIA 3W6VA 2FDKA 1H30A 5FLHA 4F83A 3IUOA 1H2LA 3VYRB 5EGOA 1YFHA 2A75A 4LO6B 1UD1A 1RTVA 2WINB 3VBHC 4LHLA 1G86A 1RR8C 2R7OA 3OGJA 3DXJF 1J83A 3AZWA 4AW7A 5KHIA 5IT9K 2CFOA 3SHFA 2J22A 1CF7A 3TKYA 1E2XA 3IL2A 1LGBA 3IH3A 3WY6A 3HKZA 4OAZA 3MN2A 1A34A 4HF2A 2K7LA 1OFNA 5K9YA 5FZOA 4RGGA 4ASKA 3GZ6A 3DEWA 1S0IA 1EV11 4G4FA 4Q4Y3 3VBOA 3Q5FA 5FYMA 2EH3A 5DEQA 2PQ8A 1N77A 2VTXJ 2WFF2 2XLGA 2CHHA 3Q0VA 4BIOA 4XLFA 4DXTA 4JOMA 4JTNA 2HVSA 1L7QA 1BC8C 3OYIA 3LQRA 1QH6A 1TQ5A 5BY5A 1IUFA 4M00A 4GWMA 2CGNA 3GZTB 2YFZA 4C9YA 1JZ6A 1ZA4A 2GQQA 4NO4A 1XTAA 3WEZA 1AX0A 3T4HB 4L9VA 3FHZA 2OU2A 1B1BA 3ZQLA 1FPN1 1GWKA 2W92A 2HWD1 1IO2A 4DRVA 1R1A2 5M3FJ 5KR7A 1JHFA 1GHCA 2UYAA 3DTIA 1P9QC 4AU7A 1GT0C 5EJ3A 4ITVA 4Y5TA 2P3JA 2R7VA 5C4JJ 3LZZA 2R7SA 3ZXSA 1WI9A 4HSLA 3D8CA 4O5VA 1W8UA 1EH6A 1WGXA 2VVFA 4KL1A 1RUE1 5DZFA 3MV11 4XAAA 1UIKA 2UXXA 1PK6C 4M3EA 2X6YA 1Z7S1 2OA2A 3B6CA 2LY2A 4U88A 3NMBA 1IGOA 4IEQA 1HLCA 4OHXA 3TBDA 4UB8C 4C30A 3GXUA 5CFCB 2FEZA 3AC0A 4X1EA 1ZGJA 2VOWA 4XFFA 1P6RA 3ZFGC 3A1YA 2FDIA 2HDWA 2DWRA 1SANA 5D2AA 5EWSA 3CJQB 4QMAA 4CZZA 3PUQA 5LK7B 3S5AA 1SBFA 2OXBA 2UWCA 3W6JB 3W21A 2XRLA 5CVVA 3WGGA 4N90A 5J3UA 5LLQA 5BPDA 4HEA2 4AQ6A 1TC3C 3S0MA 5C8CA 2EIGA 4YVWA 1VQKI 3CO7C 4WZCA 2BY2A 4A2UA 1JYTA 1AR61 5DZEA 4OFGA 4XF4A 1D1CA 2KIQA 4DO0A 4KH9A 1WBFA 3OYKA 2EJRA 1UMZA 5FJKA 3JD73 2VOXA 4FP3A 2H6BA 1H2NA 5L36A 3DEMA 5FY9A 2R041 1MEC1 3F8FA 4A3EJ 2BNOA 3FMQA 3ZDVA 1QBJA 4UVBA 4CDXA 4MEYF 3UNGC 3H1WA 3BTJA 1UOGA 5CQGA 5F1JA 2P1BA 2D43A 2FD5A 2ZOEB 2IPQX 4JKLA 2VTXA 1EF4A 3E5UA 3PMSA 2VW1A 1B35C 2PN5A 4ASLA 3CJTB 3T0BA 2P6SA 3GALA 5GAGJ 5EHDA 3C2GA 1XDSA 3BTXA 4AVTA 3I8TA 1U5TA 2V6EA 5J98B 2IXJA 2ZXQA 3HRUA 4ZZDA 2IS2A 1XX5A 1MBGA 1A5JA 1UNBA 2PHXA 4CXYA 3P3NA 1ON1A 1RMU1 2ARCA 3B00A 4A3GJ 4G6DA 3UL2A 4N9IA 4YW7A 1MZ5A 1YOVB 3S1MJ 2MLKA 5EIYB 4B3AA 4M4RA 1WSUA 3VDXA 3BPXA 1OLQA 2DTYA 5FREA 1ZBE1 2HBUA 5H9SA 4OMDA 5I93A 1OA2A 4D7SA 4KBBA 1ZG1A 1PVC2 3O0WA 1ZN2A 1A35A 2ZNYA 5FPVA 4BLJA 5FBZA 2PXJA 1N25A 5A3TA 4I6ZA 1J84A 3WG3A 1S0GA 2O14A 2UURA 3SZPA 3VYSB 3HPNA 4P9FA 5C3QA 2P6HA 1F4AA 4Q8LA 2D93A 3TN93 4EJRA 2VD7A 4A93J 3QPHA 2YROA 3D3AA 3KV4A 1WZ2A 4Y5SA 1MVQA 1K6OA 5BV6A 2W24A 4AVBA 2OUHA 3RZKA 5JZGC 4OHZA 2WAQA 4P9XA 3TL4X 4TSVA 3NAPA 4AK3A 2W1UA 4V2VA 2VL4A 2WLPA 4HA8A 3WDTA 1MBJA 1TT5B 2EBIA 2WUHA 4HBNA 4PQ9A 4M3BA 1SACA 2ORZA 4AM3A 3LSRA 3IRQA 3WSOA 2VBZA 3SCGA 4P5YA 4CP9B 3PVNA 5M5XJ 1DYKA 1J59A 3ABMH 4BM8A 4Z6YA 4JQTA 2KZVA 1VBA3 4EQQA 3QYEA 1SFEA 2DLLA 2Y0OA 2LC2A 3IB3A 5HS7A 2WIIB 1FNNA 1XC6A 3QACA 4AIHA 2C6YA 3KHBA 3LOBA 2HTSA 2HR3A 1IG0A 1R1UA 4L99A 3F23A 4QPOA 2DMPA 2Z33A 1QJFA 5EXOA 2DV9A 3AKSA 5LEJA 2RQPA 2X1EA 2XOMA 2JUCA 4C3HJ 2WJSA 4MFDA 3P9CA 1R71A 1CJDA 1D4VB 3V0AB 4K3UA 2FA5A 2P3IA 4YVSB 2XJUA 2DYRH 1V55H 4B43A 3GFIA 3C2BA 2HWVA 5C44J 3RZOJ 3KEQA 1N3PA 2AACA 2DTZA 4W6WA 3QYBA 2OPWA 5F3CA 2JTVA 5FZIA 5L3CA 1WJ5A 4M01A 4CPBD 2ZX4A 5HLGA 1BXHA 4JX0A 5M5YJ 3NKTA 5FO5A 2RVCA 2I74A 1FPN3 2DBIA 2DQLA 1LENA 5E8GA 1ND2A 4LE4A 4OULA 3R0JA 1W6QB 5C3PA 2HQRA 5LGTA 4YGDA 1HKTA 5CG8A 2K27A 4KNCA 1UCXA 4AI3A 3ITQA 3H1CA 4EYUA 3W58A 4IEJA 5A7WA 3POBA 3F9KA 4R9DA 3OWTA 3V7RA 4DPNA 2IUWA 3DKQA 3OPZA 3HEFA