3I59B

Crystal structure of mtbcrp in complex with n6-camp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
202
Chain Sequence
SHMDEILARAGIFQGVETKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLDVPGRVAKQLLQLAQRFGTLRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
molecule keywords Transcriptional regulator, Crp/Fnr family
total genus 47
structure length 202
sequence length 217
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00027 cNMP_binding Cyclic nucleotide-binding domain
B PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i59B02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i59B01
4XEZA 4ASNA 5ICEA 1I6XA 1DZRA 4U7BA 1REPC 5D8KB 1XMAA 4QMAA 2HOEA 2ACJA 3ECHA 1ZLKA 1BM9A 4N9IA 1IXSB 2NYXA 3GBFA 4HLTA 2D1VA 2HQNA 1SFXA 4MTDA 2IXCA 5J48A 5KK1A 4N9HA 3ZN1A 3IBMA 1I1GA 1O5LA 1CGPA 3P7NA 4XF0A 1XSDA 3K0LA 4BHCA 3FXQA 3GUDA 2HWVA 3EQEA 1TQIA 1YS6A 4F7ZA 4MX3A 4META 1HW1A 2STTA 4HF1A 3SCGA 4I3PA 1RTVA 1RI7A 1X8EA 2RKHA 3RYKA 1ZRRA 3EYIA 1W4MA 2RVCA 3R60A 1XN7A 2XAQA 1MJ9A 1KU3A 5LGUA 4P9UA 2DAOA 3BY6A 4E2QA 1WA4A 5D1IA 3W6KB 5F6FA 2QYOA 2ELHA 4G8XA 3OCPA 4KIFA 2ISYA 3I4PA 5JR3A 1MDMA 2ZKZA 3O3KA 1IN7A 1HKTA 1HKQA 1ZYRF 1P6RA 4YFNF 4L11A 2XKPA 2D1HA 3KP4A 3O14A 2IA1A 4U0YA 1J7KA 1K7AA 1CF7A 1EH8A 4MGZE 3J81Z 3GFLA 4IEXA 3ML6A 2FNAA 2OD5A 5LRRA 1T38A 1Z6RA 2KIUA 2Y0MA 3U11A 1D5VA 4IJAA 3N4MA 3LAPA 2Z99A 4A0YA 2PQQA 4CZZA 4LK1F 3E6CC 1LQ1A 1FI2A 2IA0A 4OOIA 2FBKA 3L7WA 4AQ6A 2MC3A 3HIFA 1G6NA 2WFPA 2J5PA 2VC1A 2ZJ2A 2ZNYA 3OV8A 2W25A 3FMRA 4TV7A 1IF1A 4JQFA 3E6DA 5AIPA 1IRGA 4MUVA 4B09A 2EA7A 3NSTA 5L3BA 2EK5A 4JK1X 4CGZA 1XCBA 3L00A 4FHTA 4P9FA 3DKWA 3K9TA 4KWKA 2QBYA 1KQ9A 3ST7A 3QRFF 4ON0A 1O3QA 1ZREA 5HDNA 3KETA 3C3WA 2PMUA 1EY2A 3M8FA 2VQAA 2PFBA 1WSUA 1KYZA 2V6CA 4AWXB 2FMYA 4OIPF 3H92A 5TJJA 3DFGA 3KE2A 3BROA 2B5HA 5K5RA 4RAYA 4ETSA 4X6RB 1DUXC 4YFXF 4Q47A 2IXLA 4LULA 4KMUX 3W6JB 2LNBA 2WWYA 1LDDA 4KT5C 2F5CA 2QCSB 4QXKA 4RB2C 2VT3A 1UFMA 4MQVA 3EO6A 2PG4A 3V7SA 2M30A 1KA8A 1SD5A 3EJKA 1LKNA 2KJCA 4H0EA 2UXNA 2IXKA 2JTVA 4XBFA 1Z1DA 6PAXA 4EWAA 1FXZA 4I01A 1TBXA 2FQPA 2VBXA 3HRMA 3WU0A 3TO9A 1O7LA 5EZWA 1XGOA 1KU2A 1EV7A 1WGPA 4AD9A 4HQEA 4IRHA 5F64A 3F3XA 1BJAA 3RJPA 3R0AA 1USTA 4IEOA 3MZHA 1HSJA 4Y15A 4EGZA 1FSHA 1FBSA 1U5TC 1VR3A 3BP8A 2XVCA 3ZMVA 5ILSA 1V70A 5TRDA 5E8IA 3ZN0A 1PP7U 4YSFA 1B6AA 3CJXA 4HF0A 2XAGA 4XFGA 1FP1D 1B59A 3ECOA 2DK5A 3GFIA 2IW5A 4R8HA 5FFZA 1BOAA 1QGPA 2RV8A 3BU7A 3FF5A 5E17F 1UCRA 1LDJA 5LEJA 4L0ZB 3DEUA 2XV4S 4I2OA 4QGMA 4LG0A 3IRRA 4IEQA 2Y0OA 2P5KA 5I0SA 1J9IA 1WQ2A 2GU9A 2A68F 3LA2A 4UVAA 2MPFA 2V09A 2XL9A 3DP7A 3LQRA 2CYYA 1G3SA 1C0WA 4BXUA 3HHHA 3V8KA 4CYDA 3I59B 2UWMA 1CAVB 4LLOA 2DK8A 1LVAA 5D5XB 3BDDA 5LGTA 1D8JA 3WW3A 2YX4A 5A2QK 3O6BB 1ZG5A 4LLNA 3SZPA 4JTNA 3FXRA 5KHHA 3F8CA 4M9ZA 3P9CA 1MKMA 2W57A 4M73A 2EV5A 3CF6E 2DQLA 4QLCU 4G7HF 1U8RA 1IXCA 3CLPA 3KP2A 5E8GA 4ZYGA 4S04A 2IJLA 2OA4A 1X82A 3QOPA 2VOOA 1GXQA 1LEAA 2QVOA 3L9FA 4K2EA 3BPVA 3PQKA 1E17A 4HMZA 4YARA 5KHKA 5DUIA 2EJRA 4OFGA 4FAHA 1YYVA 4KIGA 1H1MA 4OMZA 3DF8A 4BAYA 1S29A 5I8SA 4LJZF 3GXOA 5JSPA 3ERED 1FY7A 1KU7A 1FNNA 1Q3EA 4LB5A 4EVIA 4LUMA 5D8LB 5I8TA 4IEYA 1ONVA 3C1DA 3FHIB 1DDNA 2BV6A 3NRVA 1TW3A 3NKTA 5CVIA 1GHCA 1YW9A 1QWRA 3LQQA 2LF8A 3T0YA 1YFUA 3IL2A 3KEOA 1VP6A 1ZRFA 4HVOA 1HXDA 4AIJA 4KN4X 4AXOA 2ZKLA 4M74A 1FBUA 2R7DA 4IEZA 2F5EA 3BPZA 1LEBA 3ZMSA 3BJ6A 4IEPA 2MH2A 3RKWA 3JTGA 3HYIA 4A5MA 1GXPA 4PJYA 2CSOA 1YW7A 2VC0A 5L3CA 3GX4X 2FEZA 1J59A 3TO6A 2PEXA 3L09A 2OU2A 1UIKA 2PAKA 2COMA 2UY9A 1R5GA 3G7DA 1IZ1A 2DI3A 4WX9A 4L5IA 2A61A 2Z69A 2CO5A 4HX8A 2EFPA 3SQNA 5FLIA 2P6TA 5LRSA 4DINB 1YFYA 3C3VA 3HTUA 2E9QA 1EP0A 1Z7UA 5JAXA 4GGGA 3GFJA 2EV0A 1Q43A 4EJWA 4KL1A 3NL1A 3IHUA 2JRTA 3CTAA 2Y75A 4OIOF 5FQ0B 2W24A 1XMKA 2P5LC 4IESA 2PI0A 2VN2A 3G73A 5JSRA 5EEGA 3GF2A 3WGGA 4D7SA 2MH9A 1X3UA 2B9UA 4KA4A 1Z9CA 3WW1A 4RB1A 2PQ8A 3WGHA 5K5QA 2ZO4A 3FM5A 3B73A 2KKOA 2QBYB 2P5VA 4EROA 4HSJA 2MLGA 4A12A 3KFWX 2QZ8A 3BB6A 2RDPA 3VEPA 1JXSA 2PN6A 4IVNA 2XHKA 3WW4A 2D93A 3LWFA 1U5TA 3KGLA 4I02A 2FA5A 4J1WA 1S7OA 2O6GE 4L0YB 3GZ5A 1ZZ7A 2IXIA 2ADUA 1FP2A 4UV8A 3CUOA 2XUBA 5IT9K 4HV6A 4XSXF 1WWXA 1R58A 3K1MA 3KGZA 1DZTA 2VONA 1BIBA 4I0BA 3LA7A 3EETA 5KHJA 5AIQA 2Q8KA 4EJTA 5DD4A 5JI6A 2NS0A 4IPAA 4XFBA 1OPCA 3NEUA 2VXZA 3SXWA 1R1UA 3LAJA 4FBFA 5FLXK 5I91A 1SEFA 5CADA 1L0OC 2D2WA 4YG2F 2D5FA 2DLLA 1JGSA 1CF7B 5LGNA 1IPKA 2RQPA 2B0LA 4KNYA 4UUVA 3R4KA 4I0AA 1PM7A 3E5QA 1H1IA 3RKXA 3ISPA 4ZYEA 4XFCA 5EEHA 5DUKA 1BC7C 1O4TA 3CUQA 1JUHA 2MBFA 1CAWB 2OQRA 2FXAA 3V8LA 4Q48A 4IETA 3PLQA 1MZBA 3CO6C 4ESJA 1BI3A 3L2CA 1BN5A 2ETEA 2BYVE 1U3EM 1H9TA 1LRHA 3PVBB 1KQ8A 1MD0A 5D4RA 4Q0PA 3KEQA 2O61A 1F4KA 2M8EA 5C6CA 2MLKA 4U0VA 4E70A 4XF4A 1P4AA 4LA2A 2QNKA 3DN7A 2HS5A 2H27A 2O8QA 4HN1A 4O6JA 4CDGA 2OPKA 3I53A 3WTWC 2EAAA 2JPBA 5I93A 4LFUA 3MYXA 1TQPA 1H0MA 3H1YA 3VHRA 4AVCA 2VBYA 1P92A 2E1NA 4N0BA 4AVAA 4BHPA 3IIAA 3GFMA 1YLFA 3LZZA 2A6EF 4RGUA 2C6YA 1ZG3A 2RNJA 2XLGA 1FYLA 4CO8A 3VB2A 2P7VB 3DPTA 2MD5A 4ESBA 3LAGA 3E5UA 3O2PE 2Y48A 2CWEA 3CL1A 3KCCA 2CFXA 4WZCA 3RKYA 3I58A 1J5YA 5FB2A 1CAXA 3IRQA 2P6SA 3FMSA 3V8JA 4RGSA 3ZMZA 3DXJF 2PA7A 5FD6A 1QQIA 3OF1A 1J0RA 1J3RA 2NNNA 1BI1A 2OA2A 4KWLA 2M45A 1S7AA 5HS8A 5HLHA 1J2XA 2HKXA 3P9IA 1ON1A 4Q5SF 3I0TA 5BUVA 1XE7A 3ES1A 2OZJA 1NXMA 3KLOA 4ZYDA 3QACA 5D6FA 3ROUA 4K8FA 2F5FA 1HSTA 2ZMEB 4GO1A 4UVCA 1D8KA 2HDCA 3FHZA 3WTUC 2IC1A 3I71A 1PP8F 4GXOA 4WBBA 2VPVA 5BPXA 2LDUA 4LA3A 1IRFA 2DPUA 1Y0UA 3EQLF 1QZZA 4KU7A 4WXCA 1XSXA 1BC8C 2ISZA 4ENNA 2JSCA 3V7RA 1DGWA 4WXDA 2E1CA 4IRGA 2XAJA 4BIFA 5A2QZ 2GA2A 3ACLA 3E97A 4KUMA 3NW4A 1Q5OA 2Q1ZB 2F2EA 2L54A 2XAHA 4H7LA 3C18A 1RZ4A 3CO7C 3QPHA 1DGRA 1ZX5A 4I7HA 2PFWA 3M70A 1MGTA 1O57A 4MTEA 1RUNA 2IXJA 1UHMA 3GYDA 4XF3A 3BALA 2ESNA 1JHHA 2KJBA 1B4AA 1YIOA 2GC1A 2X0LA 1PDNC 1VJ2A 5K1YA 4G7OF 3WU1B 3SCHA 3VOEA 3OTFA 5LEKA 5F1RA 2ET7A 1Z05A 2QLZA 4PIZA 3SHFA 1SD6A 1YHFA 3F6VA 1IAWA 3ZMDA 1KQ0A 2DBBA 4BQAA 3JTHA 4HAMA 1SMTA 4FX4A 1SAXA 4L2NA 1EPZA 4IEVA 5ED4A 2E7WA 4NB5A 5IT9Z 4JVAA 1ZZ9A 2Z2SB 4IERA 5H6QA 4HQMA 2K27A 2XLFA 1XDUA 3T5XA 2OBPA 1SFEA 5ICGA 2YX7A 5J6XA 2HYGD 1IN6A 1G3YA 3USSA 2QENA 4D7TA 4XSZF 5DDGA 4ORFA 1T6SA 3RYRA 1IN4A 3KLNA 2XASA 2M1BA 2GIVA 2FSWA 1HQCA 3B02A 3F8FA 4PCQA 1RIOH 3EBRA 5KBFA 3E6BA 5LHGA 2EVXA 3DL3A 5FLJA 4GCVA 2FNPA 3WTXC 5FCCA 3GYHX 2MHFA 5DYMA 5E1XA 3ABUA 2P8TA 4R1HA 1ZZ6A 1QXRA 2O0YA 3JW4A 2BE5F 3F21A 4UV9A 1X8MA 2VODA 2K7LA 3FE5A 2CW0F 4QWQA 1ZZ8A 2EB7A 2WV0A 1W5TA 4KDPA 4EJOA 3BPXA 4RGXA 4HLYA 2V1DA 1E2XA 2IP2A 5D5VB 2F5DA 4L9NA 3UKNA 4MGYE 1RC6A 2WC2A 4LGWA 2IVMA 2ZNZA 4M9SA 3FFQA 2QVSB 2GC0A 4JBAA 3ULQB 2M5WA 2DTRA 3FX3A 3I59A 4LTAA 2ZFWA 2FF4A 4LK0F 1XB4A 3TNPB 1ZRCA 1GQHA 3LOIA 2RN7A 1XRUA 1V3FA 4MEXF 1XSVA 4I98B 4ZZLA 1XE8A 3QAHA 3IDBB 4XLPF 5CVRA 2Q2EA 3RTRA 2V79A 5CVUA 4EM1A 2RGVA 2O03A 4MEYF 2O1QA 5E16A 4BNCA 5J8CA 2FRHA 3R0JA 2WTEA 3ZMUA 3R6SA 1U6GA 3IWZA 3WE3A 3BZ6A 1J75A 5FPXA 3LSTA 3CUQC 4HSLA 1D3YA 3S7IA 2E7XA 3JZVA 1NE4A 3MCZA 5CJ9A 3IWFA 4YNIA 2CAUA 4WCGA 4HYEA 5J3UA 3ZQ7A 4EM2A 3PFIA 2Q4SA 2KIMA 1WLTA 3I5UA 2PBIA 2VT2A 2QWWA 5HDKA 3TQNA 5K5OA 3K1NA 4CXFA 2Q0AA 3L2HA 4Q0VA 2K0GA 1FSEA 2PAEA 4U0WA 1H9GA 3MWMA 4L9JA 5HLIA 2JPCA 2YPRA 5KHGA 5JCTA 2Q0OA 1FZPB 3K1PA 4RB3C 4GYGA 1ZVFA 3F72A 3S7EA 5DV5A 3HUGA 2DCTA 5ICFA 1T2KA 5ILVA 3J80Z 2VBZA 3MZYA 1O5UA 1R1TA 1TQ5A 4A0ZA 1KU9A 2IPQX 5ILUA 3ES4A 3KP6A 2X4HA 5CVVA 4OU0A 4ZH4F 4UHTA 1J3QA 3H7JA 3ZDSA 3WTZA 5I0RA 1YQAA 2K4BA 1MJBA 2R7FA 5ICCA 3TKYA 4YRDA 1R00A 4IEWA 1W5SA 1X7NA 1LDKB 5D4SA 1NZCA 2H09A 1T39A 1R1VA 3I54A 4L18B 5FD5A 3MDPA 1TNTA 3RPQA 3EUHA 1T0FA 3LA3A 1FT9A 4BHBA 5BV6A 1SMYF 2LSOA 5LLQA 5BXXA 3HRTA 5C8WA 2L4AA 4O9EA 3FZ3A 2ATFA 4ESFA 3ZP5A 3CDHA 5FLXZ 1IN8A 1SQ4A 3I7DA 2OZUA 2A5YB 2M87A 2LF7A 1SFUA 3TO7A 4KFCA 3TDUC 3LFKA 3Q5FA 3ABTA 2XLAA 4PGGA 3RZZA 2EFWA 3GVAA 3IKTA 3T1BA 2XL7A 2N7GA 4CHUA 4EJVA 1ULYA 1O3TA 1RGSA 4RD7A 2HKOA 3VFZA 1B9NA 2BEOA 4OIQF 4YYOA 5DCMB 3D0SA 4A6DA 3I64A 2QQ9A 4HZFA 4P55A 3NVCA 3OGJA 3HRUA 2QQAA 3EDPA 4ENKA 1QZYA 4HLXA 2H94A 2UYAA 2EFNA 1Q1HA 1G3TA 3S2WA 5I8YA 3F6OA 4MGRA 3K69A 1LJ9A 3J81K 5K8SA 2Q30A 2H0VA 4YIFA 5BS6A 3U10A 2D5HA 3T8RA 1MJAA 3QU3A 2IXHA 1YG2A 2AS5F 3WE2A 3HTSB 2KXLA 2HR3A 2OYZA 2DO7A 1T98A 2YSRA 2A6HF 3S0MA 4PZJA 4X6QB 1RNLA 3BCWA 4ZYHA 4XFIA 2DFIA 1B9MA 5J8FA 1XGNA 2EFOA 3NQOA 1I1SA 3TOBA 1I27A 1R23A 3R61A 4A2UA 2STWA 2JZYA 4HOBA 4RGRA 5JSOA 1K78B 2ETHA 1QBJA 4HF2A 1YTYA 1R7JA 5HS7A 4A6EA 3F8MA 3TDZC 2UXXA 1ZN2A 1VTNC 1UD1A 2CG4A 5BY5A 3F8BA 3IKVA 4LLLA 3HQXA 4L9VA 3WODF 1YFXA 2PHDA 3KSCA 3QU6A 3TGNA 3BWGA 1TW2A 2V1UA 4G6QA 3H9AA 2EFQA 2FBHA 4XF9A 3D82A 1TTYA 5LHHA 1U2WA 2DU9A 5I0UA 3ELNA 4S05A 3FMQA 2LKPA 1ZHFA 2DT5A 2OAZA 3IDCB 3DV8A 1BI0A 5E20A 3ETQA 5BPDA 2VE8A 3RPUA 4HDUA 1OR7A 3FM3A 2CV6A 3HT2A 2L4MA 1K6OA 2ET1A 3JSOA 3PQJA 1B1BA 3F8NA 2BNMA 5JR7B 4MZUA 5D6EA 2NAZA 2PHLA 4UXAA 1SD7A 4GULA 1G3WA 4JV4A 1U5TB 4HV5A 5BQTA 1S6LA 4M72A 1O3RA 2K02A 1G4DA 5EFUA 3HT1A 4Y13A 1CAUA 1IPJA 1YWKA 4XFAA 3UKVA 3KZYA 2A3SA 2HTJA 2UZKA 2V9VA 4RB0A 4JTOA 1JE8A 2XIGA 1GQGA 1TLHB 3HRSA 3OD0A 4HVRA 2H6CA 1K78A 4HA8A 3RIRA 4NVPA 2GXGA 5E1WA 1S8NA 4PIYA 1YO5C 3CEWA 4XRFA 3HSFA 5HDGA 2YR2A 4OMYA 4QX5A 1ZRDA 4IEUA 1W7PA 4M9XA 3WGIA 2K86A 3RYPA 1OYWA 5IT3A 5E1RA 1YW8A 4M6YA 2AXLA 4ENJA 4HVQA 4EQQA 1UHWA 1HW5A 2QM3A 5KVRA 4DNCA 1QNTA 3E3VA 4E2SA 4MNUA 5L3GA 2L3DA 1O7FA 2PAMA 4MV2A 5H6RA 5J7MA 1R22A 3JAMK 3U1DA 2Z33A 1OMIA 4R52A 2GA1A 1HW2A 3N97A 3TOAA 1R5HA 2IT0A 3WTVC 3H3ZA 1K79A 3E6MA 2FOKA 1AWCA 3AAFA 1ZLJA 4A5NA 4KMFA 4O3MA 1Z6TA 5DCMA 2R3SA 4XFHA 3H8UA 5CYVA 4EGYA 1OI6A 4I09A 4LLGF 3OOPA 2MNGA 3GZ6A 2VOPA 2GXBA 3CO2A 1F5TA 1R36A 2PMHA 4PDKA 3GO5A 4L5JA 1XD7A 4KU8A 2FU4A 1IN5A 3P9KA 4G9YA 2TDXA 4U88A 3WTYC 5LHIA 4EWDA 4HDVA 2EA2A 4FT8A 2YU3A 2HEOA 3MPBA 2GZWA 4XLNF 3MEXA 1BI2A 5HI0A 1EYBA 1ZH5A 3DQVC 1IW7F 3QP5A 1FPQA 4KWJA 2W85A 1UPIA 2JT1A 1YLLA 3DPLC 4LUKA 2QUFA 2A69F 3GLXA 1NHAA 2EV6A 4OLLA 2QQBA 2RC4A 4IHTA 3Q9VA 3M1EA 2XRNA 1ZG1A 1OKRA 2UYBA 4F8AA 2NNYA 1DP7P 4HX4A 2EA4A 1CX4A 2GAUA 3M8EA 4HW0A 1A04A 3J80K 1P4WA 3UKTA 2DW4A 3BOQA 4Z07A 2D40A 1CAVA 3EHKA 1KGSA 2G7HA 1YS7A 1ODDA 1IXRC 1DPUA 2Z5UA 2IRFG 2XGXA 5HLGA 1HBXG 1OYIA 4AVPA 4R79A 1S3JA 4ZU5A 1SD4A 1OFNA 4QGNA 1ZGAA 2DPDA 5FQ0A 2B8MA 4LG0B 2FE3A 5D5UB 4OIRF 5FDBA 4LMYA 4LB6B 3GWZA 2F4PA 2ZBKA 4RAZA 3EYYA 3M3IA 4MGIE 4YIIA 3JSPA 1F1ZA 1YUDA 4G94A 4P5OA 1UB9A 2UY8A 3U0ZA 4AQ2A 3H7YA 2Z3YA 3U9GA 2Z9OA 1ZGJA 5FFXA 1RL3A 4MHGA 1TNSA 3RDIA 5HOOA 2ZCWA 5BPIA 1F9NA 3KP7A 4BYYA 1FLIA 1SFNA 3BJAA 2PYTA 2HYFA 3VODA 4QGLA 2MA3A 3HOSA 5JHUA 1LR5A 3GEZA 1XCVA 4MQ9F 5FGMA 5ERIA 1XGSA 2P4WA 3BJOA 1YFWA 4EV0A 2QJVA 4A0XA 5LBQA 4Q0UA 4PGHA 4UVBA 2BNOA 5FO5A 1U12A 1Y3TA 1P2FA 4LD5A 3H50A 1Z91A 4GYIA 4PIXA 4WK8F 5DCFA 3RI4A 4YFKF 2HFHA 4ZU7A 2D45A 1UW8A 3REOA 3C7JA 2VE9A 5AVPA 5E1ZB 4BH9A 1FOKA 4Y17A 4EM0B 2P7CB 1NE6A 4UNOA 4M71A 5CU1A 4IHSA 3TNQA 4KYWA 2HJIA 2OQGA 3H3UA 3H1MA 1WKMA 2J5OA 1I5ZA 2ZXJA 5BOXA 1U78A 1LNWA 2O8XA 5CLSA 3SFZA 3HHGA 3QP6A 3D5LA 4HBNA 4EJUA 4Q29A 5L3EA 1J1LA 3ZPLA 1NYWA 3ELKA 5KHIA 2KIFA 4FX0A 5JVTA 3KP5A 4OINF 4MGKE 2FQ3A 4XF1A 1ZNPA 4G6DA 2A07F 4KIBA 3J7AO 2ZMEA 3COAC 1FYMA 2HQRA 4QM8A 3FXUA 2V1XA 4EWEA 5CVJA 1FYKA 4U7DA 1USSA 2BNNA 4ZU4A 4L9TA 3NJZA 3MAJA 1GVJA 3H1WA 4P9GA 4Z2YA 4IXAA 3SXYA 4WWCA 4UXNA 2XKOA 1LB2A 5H20A 3FWEA 2GQQA 2BGCA 4NQWA 3GW2A 5FLHA 4UBHA 4XFFA 1CAXB 2G9WA 4DQ2A 3PNAA 2K9ZA 2L01A 1FC3A 2G7UA 4M6XA 5D5WB 1IUYA 4NHJA 1FX7A 4Q0SA 2FMLA 3KMHA 4AIKA 4UBGA 1BIAA 1V4RA 3Q9SA 3CLOA 4QM9A 4RS8A 1W7PD 1YFHA 2HGCA 2GC3A 3WW2A 3SCFA 4O9GA 5DD8A 5AONA 1WI9A 2P17A 2VBWA 2NRAC 1UCXA 2XAFA 3HSRA 3SMHA 1DPRA 2W84A 4P96A 1O3SA 4WVZA 2EWNA 1ZZCA 3LWCA 1XGMA 4HBLA 2FBIA 4EMSA 3HOTA 5BMZA 1QY4A 4B29A 3WG9A 1QXJA 5I0TA 4WF2A 1QO0D 1ON2A 4Z82A 1Y9QA 3KP3A 2I45A 3V4GA 1JHFA 2DQRA 4MH0E 4Q4ZF 3K2ZA 3ZMTA 3KZZA 1MDMB 2XROA 3G3ZA 1ZARA 1FWZA 4HX7A 1PMIA 2QDRA 3SZTA 1CAWA 1W7PB 5JFRA 2HZTA 3CUQB 4KICA 3E5XA 2CQKA 2C0ZA 1EH7A 4ENMA 2PLYA 5DEQA 1BBYA 4LEJA 2CAVA 3JAMZ 4E2GA 3FZVA 3M7GA 4D0PA 1UIJA 2GH2A 1ZZBA 3SHRA 3F22A 5L3FA 5T3NA 1WRJA 4XETA 1AOYA 3IC7A 1EH6A 2GWRA 5L3DA 2PTMA 1J3PA 1CAUB 5HVQC 2IA2A 3T8TA 2KRFA 5E18F 4B8XA 2GC2A 1KYWA 1RUOA 1OD5A 1L3JA 4Q0QA 1ZAOA 3FJSA 4IRIA 2BBYA 4IF4A 3V7CA 3MFKA 3U2RA 3F23A 1L3LA 4G7ZF 3WTTC 4CICA 4AIHA 3D0JA 2CGPA 1STZA 2O3FA 4WXHA 4ONUA 3QPTA 1J58A 1FBQA 2ESHA 4J1XA 4KN7X 5HS9A 3RNSA 4FAGA 1PUEE 1HKSA 2OZ6A 1OYYA 3M9AA 3WTSC 2VECA 3MQ0A 3CJNA 4ZZDA 1TQMA 1P4XA 2HTSA 3HSEA 4AVBA 4O5VA 1XDSA 2H6BA 2L02A 5FPZA 4TLFA 2PJPA 2K4JA 4HN0A 1QPMA
chains in the Genus database with same CATH superfamily
4XEZA 4YLZA 5ICEA 1I6XA 3SDBA 4WVWA 1REPC 1G59A 3KB5A 1XMAA 4QMAA 3AC0A 2R30A 5C70A 3LSIA 4YW6A 1LESA 4EN0A 2NYXA 2WAOA 5K4LA 4BS9A 4HLTA 2D1VA 2LK2A 1SFXA 4MTDA 2KRCA 3ZXGA 5J48A 4N9HA 2D6PA 3ZN1A 4R4XA 4Z1VA 1TWAJ 1O5LA 4DQAA 5DN2A 3POYA 3EQEA 1TQIA 1YS6A 4RR3B 1T08B 4XQWA 3VDAA 5CYYA 1RTVA 1UZCA 1ZRRA 2BY0A 2LW8A 5LBCA 3IAQA 5ISLA 2RVCA 1XN7A 1LHNA 3OGSA 2DU0A 3IB3A 3BY6A 1BMV1 5D1IA 5F6FA 4QPWA 1MQTB 1S5LC 4CEWA 4G8XA 1U0AA 1GYKA 4KIFA 1ENRA 4CCLA 1MDMA 2ZKZA 3O3KA 4C3HJ 1HKTA 2NM1A 1F15A 3KT1A 1ENXA 1J7KA 5A6XA 1D0ZA 4EEFG 4JHTA 3ASOH 4PJMA 5DAWA 3GBWA 4QXHA 4ZS2A 4AI3A 2OF7A 4CPBA 1Z6RA 1ND3A 5DG2A 2Y0MA 1BW5A 4II3A 2G1MA 2PQQA 3UGFA 1FI2A 2IA0A 3VBFC 2MC3A 3HIFA 4XJZA 2ZGPA 3OWTA 3Q8AA 4LOTA 2ZJ2A 2WYSA 5DUXA 2DT7B 4Q4Y2 3E6DA 1HB3A 3U14A 4MUVA 2VKEA 2QQKA 2EA7A 1XCBA 4FHTA 5JDBA 4D69A 1AU7A 2QBYA 1OCRH 1IOAA 1FOWA 3ST7A 1SHWB 1ZGWA 1GMMA 1JYVA 2ZGSA 3KETA 2VU9A 1RUI3 4HKLA 3C3WA 4C1WA 3KHBA 4BJTA 3ENRA 3OGRA 1MSEC 1MNDA 1E3HA 2PFBA 2BVLA 3I55I 1S0IA 2LRPA 5FIXA 4NPLA 3MW4A 2X6WA 1Y7BA 3H92A 3OBZA 5KR7A 3DFGA 3JBG2 4PFOA 4LJHA 5FPLA 4HKWA 5K5RA 2P6CA 4ETSA 2HWB2 2E1MC 3KQ4B 2W7NA 2WAFA 4DYQA 4Q47A 4ZDPA 1ALYA 2IXLA 3WDTA 3ILRA 2H8RA 2GNBA 3BC8A 4QXKA 3T1MA 4OZOA 3EO6A 3OR2C 2VL8A 3V7SA 4CZCA 3J8F1 5LY1A 4P14A 3VBUB 1SD5A 3IH4A 4JX4A 4AI1A 1ASJ3 1Z1DA 4D7YA 4PFPA 4EWAA 2AO9A 1TBXA 2FQPA 2ENRA 2VTXA 2DCZA 3WU0A 2Y34A 3VKLA 2DVGA 4RR3C 1WGPA 4AD9A 5ANNA 3RJPA 4PQQA 3ZFEA 3VBSB 1X1DA 3ZLIA 1USTA 2Q1MA 2HDWA 1JKQC 1DYKA 2X9DA 3MZHA 3OYHA 3B5LB 2QQMA 5KNLA 1FSHA 3ABZA 1GOHA 3ZYHA 1A31A 1OOPA 4Y24A 4CCEA 5ILSA 2BW3A 2RMU3 4D3WA 5FBJA 1RHI3 3FISA 4HNVA 4YG6A 3ZN0A 4PUSA 3CJXA 4HF0A 1G8WA 2NMOA 1B59A 2C5DA 3ECOA 3MFCA 2VMFA 3I3EA 3GFIA 3BR5A 3GZNB 4BACA 2W91A 3NV3A 4MVTA 1VQ6I 1V54H 2R7XA 1IQDC 1SACA 1MMGA 4QPGC 3DEUA 1COV3 2HWF3 3LSEA 1RMU1 2QQ8A 3CC4I 3MIGA 2A6TA 3B69A 4RA0A 1R4MB 2P5KA 1HQNA 5JPMB 1V6LA 3S93A 1J9IA 1OQ1A 3IMNA 3NAPA 2JDPA 4Q1RA 1VQKI 1OHFA 2CYYA 3RWKX 3HHHA 1OF3A 2UWMA 2DMPA 1YJWI 1W0PA 5D5XB 4E8DA 2J1SA 3JB4C 5LGTA 2YBSA 1S0CA 1D8JA 5A3NA 5JZGB 5A2QK 4OHYA 3O6BB 2D3SA 1FNZA 4AI2A 3U78A 4BQ2A 1YRNA 4JTNA 4QKBA 2XPUA 1I3QJ 1FMD2 1M06G 1BMV2 4XTMA 2QUOA 1BZWA 5DS9A 3CF6E 4QLCU 2CW7A 1U5YA 2AENA 2VASA 4CA9A 4KITB 1T33A 2NN8A 1S9HA 2KP6A 1NA1B 2E7QA 2IJLA 4C2MJ 2PMZA 3Q3SA 1UZYA 2RAEA 1O8PA 4ET7A 4W8JA 4A3EJ 1GXQA 4BE2A 2ZHNA 5LFAA 3G1MA 2HVRA 2ZMLA 3L9FA 1RR7A 5JR2A 3S15J 3AMNA 1BCXA 4YARA 4OFGA 2VXJA 1YYVA 4YGBA 1W0NA 1SAUA 1TWFJ 1X36A 5F8PA 4LBQD 1S29A 5I8SA 3ZXDA 3OYMA 3ERED 1RUD3 2BW3B 1FY7A 2WKKA 2DJNA 4LB5A 1MW7A 4LUMA 3SH3A 5D8LB 1LGNA 1ONVA 1AXYA 2GN3A 4FFFA 5DDJ1 1N78A 3NRVA 5CVIA 4XW3A 2QKDA 2LF8A 3T0YA 1RESA 3A03A 1A6IA 4KN4X 3TW6A 2VZSA 4M74A 2R7DA 1YXWA 4N7UA 1LEBA 3KVBA 2VOVA 4IEPA 4CEYC 5A32B 1H8VA 4BCUA 1U9OA 1I5PA 2CSOA 1XYOA 1GSLA 4AVTA 1S55A 1WMDA 1J59A 5GPCA 3E7LA 3VSKA 2PAKA 2IGNA 2ADDA 2L7MP 3WX5A 1UY4A 3CJIB 4L5IA 1HQWA 1NCRA 3S1RJ 4V1PA 3ZSEA 2GSYA 1FOYA 3BIEA 2IGKA 1U5IA 4IGPA 3HOWJ 3HTUA 1WUVA 4GGGA 3GFJA 1E3PA 4NHKA 4EJWA 5J37A 3NL1A 1CQ9A 4OHZA 3CTAA 2QBXA 5FQ0B 2EILH 2XR4A 2LY2A 1JBCA 4RGKA 2E34A 2E60A 2MH9A 1BYHA 1JZ8A 1JKRC 4KA4A 1DQUA 3WW1A 5K9YA 2PQ8A 4II2A 3D5OA 3FBMA 5LZ6A 2QBYB 4XQDA 3Q8EA 4HSJA 2MLGA 2CV0A 2PN6A 3L2QA 1AYN1 3WW4A 2ZTNA 1U5TA 1S7OA 5SV5A 1CZTA 1HJFA 3TBDA 1ZZ7A 2IXIA 2ADUA 4DMIA 4UV8A 1WW7A 3CUOA 4BDZA 4B3NA 1WBFA 1V6OA 4GMP1 1S2EA 1SCRA 4FISA 4HEA2 1VBE2 5IVEA 2PMZN 4PF5A 3LOBA 3RJRA 4HPQA 2IBDA 3LA7A 3CCSI 5AIQA 4CEYA 2XF7A 5DD4A 2IFRA 3HOZJ 4ATFA 1R1UA 1AX2A 3LAJA 2O0OA 5CADA 3ZVXA 3OYJA 2D5FA 4DGWB 1ZA7A 2DLLA 1JGSA 2E36A 1IPKA 1NLRA 2XSDC 4E7LA 3TP0A 4I0AA 3SYTA 3E5QA 3VBUC 2DA7A 5EEHA 5DUKA 4DEVA 1BC7C 1OPMA 2YROA 4KNCA 2JQ7A 2K9QA 2FXAA 1OC1A 4QU2A 4A3LJ 1MZBA 2IS6A 2W87A 4ZXKA 3ZYBA 1BN5A 2G9GA 2BYVE 3WQBA 3CCVI 3PVBB 3CQZJ 3WCRA 3KEQA 4FP3A 1H0BA 2QNKA 2HS5A 2Y0IA 4LO6B 2CYFA 4HN1A 5DZGA 4M3GA 3HBLA 2SBAA 4CDGA 2OPKA 2EAAA 3MYXA 3OIOA 3WNLA 3VHRA 1W36C 4AVCA 1P92A 2DYCA 2E32A 2HBUA 3LNQA 3LZZA 1UZ0A 4NC8A 1DQ1A 4B4PA 3A0HC 4A3FJ 3WNOA 2MD5A 3OGGA 3VLBB 4M3BA 1MZFA 3THCA 5KXCA 1ZR4A 3LFUA 3O2PE 3J7NA 4XCAA 5EQUA 3RKYA 3D1NI 1QJU2 4J6GA 2E31A 2P6SA 3FMSA 3AVSA 1UY0A 3ZSJA 3V8JA 3PURA 2PA7A 3VZLA 1QQIA 3OF1A 2KMUA 1JKOC 1ENSA 1ETKA 5F27A 3VD4A 3BG7A 2W0XA 2Y6GA 1BI1A 2OA2A 3GM8A 2BV4A 1UYYA 4HKOA 3LFIA 2M45A 1S7AA 2HKXA 3S2DJ 3HB9A 1ON1A 3I0TA 5BUVA 5GLZA 1XE7A 4N53B 3KLOA 4ATEA 3DEMA 2IGMA 3WTUC 1PP8F 2ID3A 2MFZA 4GXOA 1OOPC 1O4ZA 3S1QJ 4XBQA 2VPVA 3PJQA 2A73B 3F0CA 4W4ZA 4LA3A 1Y0UA 4EYUA 1BC8C 4BXSV 2ISZA 3OEAA 4BK4A 1NCRB 2JSCA 2CS3A 2YPDA 5FYBA 4K1YA 2R49A 4GQ7A 4FE7A 2ADEA 2OC6A 1NAEA 3AM2A 1Q5OA 3NW4A 2WV1A 1X1BA 1VQPI 2QE3A 1N25A 5CG8A 3PIJA 1DCSA 2XAHA 5JXJA 1K4TA 3QPHA 5F0FA 5GKAC 2XVLA 2EF6A 3QPSA 1N1VA 4COUA 3KQRA 1DU6A 1TNRA 1G86A 1LOAA 5J1YA 4IHVA 1CN1A 4UW6A 4LO8A 2L9NA 1YIOA 3AKPA 4XUTA 5C8CC 4Q4Y3 2XQXA 3J7ZI 5B66C 5B1AH 2BZDA 3WU1B 4UT5A 3VOEA 3HOYJ 1W2NA 3ZOIA 3QWLA 3BVCA 1QU0A 2QLZA 2XPWA 3GTKJ 1YHFA 4L92A 4HAMA 1SMTA 4FX4A 1SAXA 1EPZA 5FKOA 4XN0A 4C91A 1QNWA 3J9SA 2NP0A 2E7WA 2IS1A 4NB5A 2Z2SB 3S3MA 4IERA 5DAQA 3Q8BA 2ZACA 2LTNA 2FUG2 3A01B 1CVNA 4NNJA 3OYKA 3PVNA 3T5XA 4GH4C 5J6XA 2Z4FA 3IH2A 3WDYA 1IN6A 3N9QA 3JXSA 2QENA 4XZUG 3GNEA 4AFBA 3HMYA 2L9RA 3ZX7A 2A70A 3IZOA 1T6SA 2LKSA 5HV0A 1POV0 4MO3M 3ZMNA 4CDWC 1C5IA 5FK7A 5KBFA 1YX5A 1V00A 2JWTA 3DL3A 5FLJA 3K77A 3NQHA 3P5JA 1MS1A 1R081 1DHKB 2VAUA 4F91B 1DIWA 4M00A 2X6XA 2O0YA 5GADJ 4D5FA 4UOJA 5FY4A 2VQUA 1RUE3 4UV9A 1JU3A 2OTJI 4BE1A 1HN0A 2K7LA 3FE5A 2CW0F 4QHBA 1QDCA 1Z0XA 3I9V2 3BPXA 2Y38A 2BTVC 4HLYA 2IP2A 3WCSA 1T6GC 4L9NA 1RC6A 1GP4A 1P7JA 2C9KA 4RM3A 4FPGA 2OW4A 3I59A 1QOTA 2ZPXA 3FHAA 1EF4A 4AG4A 3N7KA 4AZZA 2JIGA 4AHWA 5KXEA 3T1LA 3S2HJ 4OYUA 1XRUA 3WHTA 1OKOA 1K45A 4ZZLA 3MF9A 1PVC3 1WJCA 4E7HA 3AJYA 4XTPA 1SG3A 4EM1A 2RGVA 2K2SA 2XOMA 3CJIC 3HEFA 2O1QA 5J8CA 2JB4A 3T4VA 3WZ1A 2BVBA 3WE3A 5FPXA 4HSLA 3S7IA 4DY3A 1X3WB 1NE4A 3OUJA 2VQTA 2WO3A 2C1FA 2WB1N 1VAMA 1ULPA 1W6MA 4PJLA 1XNTA 2JDYA 3CMYA 2JKBA 4A7ZA 2WL1A 1JN2P 3PFIA 2KIMA 2HWE1 4BBRJ 1YX3A 2A5WA 5K5OA 4CXFA 3FN9A 3L2HA 5JMCA 5LA0A 2DODA 1R1A2 4XOGA 2R32A 2PAEA 4U0WA 2W5FA 2VZ1A 4QB2A 5FUPA 4L9JA 5HLIA 3TP3A 4UUSA 5JCTA 2EIBA 4QX3A 3ZQFA 4XJWA 3K1PA 4LIVA 4RB3C 4GYGA 1E5SA 5EF6A 5IYCJ 4C90A 4QHOA 5M0TA 1G7YA 3OYLA 1QHDA 1UXZA 3WG3A 3RS6A 1XSRA 3JBG3 3O1TA 1XU2A 3VBRB 3A23A 1Q8OA 4NJ4A 1HB4A 3RQ0A 1WJBA 5FZBA 1MVEA 4GMP3 4BEHB 2V4AA 3POSA 2YS9A 2CV2A 2W1QA 1W5SA 4BISA 5F32A 1R092 1X7NA 5A3MA 1ND2C 1NZCA 1T39A 1MS3A 4LK6A 4M3EA 4YZ5A 1DLLA 3ACGA 3Q0WA 1Y4WA 4KWUA 3GTQJ 4XMAA 5FV3A 5FZDA 5JI7A 3TN91 4RGAA 5EGOB 5FXZA 2V72A 5FLXZ 2OZUA 5A3UA 3CC7I 5HXMA 1SFUA 4BPZA 3ACHA 2X1DA 3KHCA 5FKMA 1BK0A 3RI9A 2GLOA 2ZAHA 4JKLA 2WO7A 3KS7A 4PGGA 1JUPA 3ZSLA 3IKTA 1VRH3 3G1OA 1PVEA 2AHQA 3CCLI 4AVZA 5JIUA 4S2GA 3C7HA 4CHUA 4IE0A 4A7YA 1ULYA 5ERLA 1O3TA 1Y8QB 4HPKB 2K9NA 4OIQF 2YB7A 5DCMB 3D0SA 3I64A 5C71A 5BNOA 3NV1A 4HZFA 2HNHA 5FP8A 4CEWB 3NVCA 3HRUA 1MQTA 5T5LA 4CRQA 4MXVA 3OYNA 1V9U1 4NC7A 3S2WA 4YW7A 5I8YA 3K69A 1LJ9A 3KYCB 4N53C 3CESA 5BS6A 3U10A 5DXDA 3T8RA 2PHUA 2R7TA 3W59A 5FO8B 3WE2A 3HTSB 4Q4Y1 2YSRA 2YFZA 1B72B 2A6HF 2K9LA 3AX4A 2JA2A 1B72A 2C26A 2VCAA 1G9FA 4ZYHA 4XFIA 2DFIA 1B9MA 5J8FA 3GBGA 5DDJ3 3NQOA 1I1SA 3TOBA 1YITI 3RGBA 1E5IA 4TN7A 4KGQA 4A2UA 1MS4A 4RGRA 1OD3A 1K78B 1QBJA 5FY0A 3BZKA 1TL8A 4JKKA 1RUH3 3PUAA 2BXZA 1B35C 1VTNC 2CUFA 3LSJA 4JP0A 4L9VA 2PHDA 1RUF2 1TW2A 1DQ2A 4G6QA 3URFA 1QEXA 4LOCA 4K8RB 1KONA 1TWGJ 2FBHA 4XF9A 1MVQA 1HB1A 2VJJA 1U2WA 1K5JA 2A6ZA 2CGOA 2LKPA 1IS5A 2OAZA 3DV8A 1OA4A 5GAEJ 5BPDA 4V2FA 3PIOF 2P37A 4HDUA 3IIIA 1G9AA 1FOD3 3AG4H 5JLVA 2ECBA 3CHXA 3AG3H 1K6OA 2ET1A 3WP6A 1LOEA 3L2RA 1X50A 3F8NA 1WLCA 4QXBA 4CSWA 4Y3OA 1GV2A 1NXD1 2PHLA 2A3YA 4UXAA 2RG4A 4LG3A 4XUOA 1U5TB 2JDUA 1S6LA 2CWSA 5FLVA 1UWWA 1O3RA 2K02A 3OUHA 4ANJA 1RETA 3I4NJ 2Z5WA 1R1A1 5BNPB 4XFAA 3AK0A 4CU9A 2BW8A 3THPA 5EG0B 1LHWA 4XURA 4COYA 1JOPA 4JTOA 1GQGA 3HRSA 1W9WA 3RIRA 4LBNA 5FFOC 1JOJA 1S8NA 3BGAA 4NR1A 2YR2A 1H88C 5GZDA 1W7PA 4XR6A 4AEJA 4LKDA 4K7JA 4ZZ5A 3HZJA 3RYPA 5E1RA 2B9VA 5CFCA 1UAAA 1PM4A 5A80A 3VZNA 1CWPA 5FYYA 4HVQA 4EQQA 5KVRA 4DNCA 3K6GA 4HK9A 4E2SA 5L3GA 3BIWE 3KD4A 2ZGKA 4MV2A 5H6RA 2ZMEC 4W97A 1R22A 2Z33A 1OMIA 4CA0A 3G6JB 2K85A 4BJ6C 4MHUA 1IS6A 5LD2C 2VY0A 2IT0A 2HI3A 3HVDA 2A5ZA 4CU8A 1UNBA 4DBRA 1LHUA 4B3XA 3VZOA 3BG3A 1H30A 3O5SA 4B3AA 3LPFA 1YNAA 3OOPA 2MNGA 3GZ6A 2VOPA 2RJLA 3ZRGA 3CO2A 1VBD2 2LRDA 1T2XA 1WKYA 4PDKA 2VIXA 3PTRB 1IN5A 2VW1A 2TDXA 3WTYC 5LHIA 2YU3A 2XC7A 1WI3A 5FBZA 5KC6A 1IRXA 3O1RA 1JXNA 4CEWC 1EYBA 1PGW1 3TEWA 2XPVA 3QP5A 2ARAA 1X4PA 3RZLA 3MICA 3CIHA 3PVOA 3K51A 4AYBA 4LUKA 2A69F 2HPIA 2O8KA 1X9TA 3MF6A 3M1EA 5T55A 1ZG1A 4J19A 2UYBA 4HX4A 3H0OA 2EA4A 2G4IA 4Y22B 4IV3B 4B1MA 5TISC 1DFQA 3AZXA 1VBC1 3C7OA 2DN0A 2M0MA 3EHKA 3T0DA 2G7HA 1ODDA 1WGXA 3AL0C 1DPUA 5FP4A 1OYIA 2DUOA 4CCMA 4D5CA 1D0HA 1SD4A 4PSXA 1VBA2 1YRNB 2DPDA 2EAKA 2F4OB 3DEEA 2IWGB 2FE3A 4OIRF 5FDBA 4LMYA 4A3JJ 2DA3A 2VMIA 1AR81 1MZEA 4RAZA 4AYUA 1WW5A 4Q8KA 1AUYA 3KCYA 5J1RA 3HDDA 3VD7A 3DKYA 1YUDA 4RHV1 4G94A 2UY8A 4AQ2A 3J7AY 5FK8A 1B8IB 1RL3A 1TNSA 3MKLA 3RDIA 5HOOA 5D8AA 2ZCWA 1T6BX 3ZR8X 5BPIA 4ARXA 4FETA 3CKHA 4ZC3A 1A34A 2A7AA 4FTSA 3PMEA 1A35A 1FLIA 2VUJA 3BJAA 2PYTA 2CRGA 3VODA 3QYBA 4K1ZA 4CXYA 3CJTB 4U2AA 5D21A 1LR5A 3GEZA 5DAVA 4GKXA 2GM4A 2CQQA 2K3FA 4EV0A 1UOFA 3S3OA 4BXXJ 1K61A 3FXOA 4UVBA 4F52A 1Y3TA 4LD5A 4JGZB 1N1TA 2HDDA 3UGGA 3AL6A 1UOGA 3KYDB 2JB8A 2A6VA 5A3WA 3DECA 3HAGA 4YFKF 1W8TA 4A3XA 4FO9A 5IY5H 3ZFEB 3I4MJ 1IV8A 1OCOH 1SVOA 5ABJB 1VZ0A 3N7JA 3C7JA 4I76A 2ZBJA 1Z77A 1FOKA 3SITA 4D6SA 1GOGA 4BA6A 2N8GA 3SLIA 5CU1A 1BVP1 4XKVA 2HJIA 5E8AA 5H9PA 4D1QA 2ZSIB 4QPIC 4CCDA 2ZXJA 3UETA 3NV4A 1MMNA 1BR4A 4QX0A 2CV1A 2FCVA 3D5LA 1AHDP 1J1LA 1YI2I 1FTTA 2JRMA 5JVTA 3KP5A 4XJ9A 1V55H 2PHXA 4MGKE 1ZNPA 3DBLB 1QIQA 4KIBA 5HCFA 2HQRA 3JR9A 2V1XA 4J25A 4EWEA 3LQCA 4XJAA 5CVJA 5D2AA 2VZVA 2W48A 4ZU4A 3OB8A 1WCQA 2LG4A 5CB7A 3SQOA 4XUNA 3VZJA 3H1WA 4QPGA 1W5CC 1NKGA 3FC0A 3SXYA 1FV2A 2DVAA 2CFOA 4GB33 2RJKA 1QNYA 2W08A 3BR1A 4NQWA 3NNMA 2G9WA 5GAHJ 1HV0A 3B00A 2L01A 2NVUB 5AFBA 2G7UA 2XVKA 4M6XA 1UMHA 2FMLA 1H6YA 3KMHA 4UBGA 1XNKA 4P9JA 4QPQA 1EUTA 3BUCA 5IYDJ 5GP9A 2IGOA 4QM9A 5M5YJ 4NWWA 3TW7A 5HXVA 3JCUC 3GZEA 5DD8A 4NIIA 2P17A 4N43A 4R9DA 3OUIA 4XIDA 2VBWA 1JYTA 2XAFA 1RRJA 2RS31 1IUFA 3SMHA 4A3ZA 2DOEA 4P96A 1LODA 1IKPA 1YIFA 2M2EA 4CE8A 4HBLA 2FBIA 5E88A 3W2WA 1QY4A 4BQQA 3WG9A 1ULDA 1QXJA 1RXFA 1ON2A 4Z82A 1V6NA 2I45A 1QQP3 4DNYA 3H3VK 4DS0A 3KZZA 1YEWA 3B93A 1MDMB 3V0BB 2XROA 2JDNA 3MMYB 4HX7A 4MGSA 3IN9A 2QDRA 1W6PA 2NPIA 1KD7A 1X33A 3LPGA 5JFRA 4XHBA 2HZTA 2CQKA 1EH7A 1UU6A 4ENMA 5DEQA 5EXOA 5E79C 1H8TB 1QOSA 4IV1A 1I1EA 3JAMZ 2JENA 3FZVA 4YRVA 1ZZBA 4A6SA 5FXXA 4WM7B 4XETA 1AOYA 1FMD1 3M3OA 2NOGA 2PTMA 1GDTA 1J3PA 1OPOA 2WLPA 4RR3A 3T8TA 2KRFA 5JWPA 1RUOA 1PMJX 3F2ZA 2W95A 3CMEI 4IF4A 4AFCA 4BDVB 1TME2 2PQSA 2VZTA 4RSUA 1L3LA 1JUSA 3H42B 1OISA 1REDA 3UT0A 2CGPA 4PF1A 1VBD3 3OS1A 1LE8A 1LHOA 3QPTA 4KN7X 2OCEA 1PUEE 2V4VA 2DBNA 1I6HJ 3MQ0A 1IZ3A 3CJNA 4XONA 1AR92 1P4XA 2L7FP 3HSEA 1PO13 4DUXA 3VBFB 2H6BA 4YGEA 2WB1A 1PIV3 1PZ9A 4MIMA 4WM8C 2DDAA 1WJAA 4JAAA 2ZAAA 3NO8A 2MW8A 2GN7A 1BR2A 3AL5A 5DM6F 2KISA 1SFKA 2DA6A 3VHPA 1R71A 2ZZJA 1UKRA 5FY7A 4XKCA 3I49A 2HOEA 3ECHA 3OSGA 1BM9A 5CKQA 3RCOA 1IO2A 5L19A 1S7EA 4GWJA 2VNRA 2VKDA 2IXCA 3AKRA 5CKMA 3ZN4A 3CQOA 3BODA 5T52A 4D8MA 1CGPA 4BHCA 2HWVA 3CZUA 4FOYA 2VC9A 4META 4I3PA 4DXSA 2R073 2YY1A 3CJIA 1X8EA 4F92B 5E89A 5M5WJ 4U36A 4XBLA 3J8F2 4KG8A 3U21A 4BXFA 1PVC2 1RUJ3 3ZYRA 2JA6J 5LGUA 1MACA 4E2QA 1RUD1 3JRDA 4WZFA 2F6CA 1G2HA 3W6KB 1BXHA 2R7RA 1UN1A 3WT3A 2ELHA 1JTXA 1V6JA 2Q8DA 2IVIB 2VUCA 1C5HA 2P4EA 1P6RA 5FZGA 3VKFC 3GZTB 2YUSA 2IA1A 1VALA 2ZX4A 5C4WC 1WVRA 3GFLA 1HRV3 4W6XA 3ZKYA 4IO9F 3U11A 1C8NA 3FFZA 3G71I 3OBRA 2MEV2 4BLJA 1GWKA 4TZDA 4CZZA 1LQ1A 2WA3A 4C1XA 5CFDA 5D8AC 3JUUA 3OYAA 2VZRA 1G6NA 3CMAI 1QJFA 2J5PA 4JDNA 3OEBA 5FKKA 3A4UA 2VC1A 5GZFA 3OL4A 3OV8A 3FMRA 3A2KA 1EV13 3IPVA 4JQFA 5AIPA 4E7KA 2WYFA 3THTA 2YU9J 2JDMA 1ZBA2 3TMOA 5BNGA 3NSTA 3EMRA 1ERDA 2KM2A 4UAPA 2V9PA 4P9FA 3MPPG 5EZHA 1LE8B 3K9TA 3AP7A 3K7AJ 2VJ5A 2EZIA 2LROA 4RL7A 2EXJA 2DYRH 5DTDA 2VQAA 4QD2A 5L7OA 5HPOA 2GXAA 1S4CA 2FMYA 1RHI2 4NWVA 3N36A 2YFUA 2ZGUA 2KZVA 3KE2A 2WR9A 3ZN6B 5FRAA 1DUXC 4NHYA 4B47A 4YPJA 2RMU1 1B09A 4LULA 4KMUX 3W6JB 1YYNA 2LNBA 4KT5C 2RDSA 4RLFA 2HU9A 1UFMA 4G6TB 1PO22 4LHSA 2I5UA 1PJRA 2KJCA 4H0EA 2C6SA 4XBFA 6PAXA 1MIJA 1AJOA 1FXZA 4HK8A 1ZQ3P 2YYOA 1LENA 3TO9A 5H2FC 4C3JJ 1CQTA 4UFJA 3PFYA 1YQ8A 4HQEA 4IRHA 3W20A 1BJAA 5C9AC 3CCUI 1N3QA 1XSQA 5FZ0A 2BP6A 1HSJA 4Y15A 4FPYA 2B4KA 4Q26A 3APBA 2EIJH 3MN2A 2XVCA 3LSMA 1RYYA 3MIFA 3VV1A 3KF5A 2BVVA 1PP7U 2WSVA 4F55A 2XAGA 3T2TA 3O1MA 2R16A 2E53A 4M0HA 1TME1 2IW5A 4R8HA 1DQ5A 4C2TA 4YZ1A 4B8EA 3BU7A 5LBFA 2RM23 1JT0A 4FFIA 5F37A 4I2OA 4QGMA 4PLNA 4XYXA 1TZLA 2X1EA 1W9SA 2MPFA 2XL9A 2VB6A 5FY9A 3ZIWA 1OQYA 3QD6A 4QIWN 3WLUA 4P08A 4YW4A 3O1OA 1Q8SA 4LLOA 3POGA 2VMHA 3WW3A 3SISA 5A6QA 3LEGA 3DYOA 3FXRA 4MLOA 4DFSA 5GTHC 2R7UA 5K7PA 5KHHA 3O1PA 3F8CA 5M3MJ 1SBFA 4NHMA 1VLNA 5C4WB 3N7LA 5FYUA 2B7EA 5CAZA 1IXCA 4UY8I 3KP2A 5E8GA 3WG4A 4ZYGA 4S04A 2E71A 1X82A 2DTZA 5T5PA 5FZOB 5LA1A 3LDBA 1BA5A 4RHV2 1AR91 1LEAA 2JMWA 2QSFX 2ZMKA 1J83A 2WNOA 2RQQA 5IYYA 2YU2A 4K2EA 3BPVA 3LDKA 4AQTA 1E17A 1Z7S1 4BAYA 1LNSA 2BVMA 4LJZF 4MADA 3VBHC 3BT9A 4EVIA 1ZBE3 5I8TA 2R072 1QRYA 1NCQB 1DDNA 2CJJA 3VL9A 3NKTA 2Z1DA 1HRI3 1GHCA 3LQQA 3H0DA 1SCSA 1WH7A 3KEOA 1VP6A 1HXDA 1AF9A 2ZKLA 2R062 3BTLA 3TEXA 3BPZA 1RUF3 2VQGA 2NS7A 1I9RA 2QQJA 3JTGA 3HYIA 4A5MA 1GXPA 4PJYA 1YW7A 5L3CA 2PEXA 3L09A 3OYEA 1PNFA 1UIKA 4BE3A 2IFWA 3K4BA 4L99A 2ELKA 3PU8A 2QQVA 4BQ1A 2CO5A 3D5SC 2ICWG 5IP7J 3IDEA 3L2WA 2P6TA 5LRSA 1YFYA 3S1MJ 1CR7A 1EP0A 2DV9A 1IHMA 2BUKA 1Q43A 3DXTA 4KBZA 3JD73 4KL1A 3FXMA 3IHUA 4TSVA 2Y9ZA 1WMXA 5C3PA 1N1SA 2OS2A 2Y30A 2Y75A 4M3CA 1OCCH 4XRSG 4AEDC 4CDQA 3G73A 3FMGA 1QH6A 2WBMA 3GF2A 4D7SA 4MFDA 1OLQA 2LOOA 4PLOA 2B9UA 1GUIA 2MSYA 4NPMA 4IHWA 4OVEA 4RB1A 5K5QA 3FM5A 4COZA 4SBVA 1JKPC 3I2FA 5HNFA 2KKOA 3HPHA 1JYIA 1MEC2 1TT0A 3LSKA 4A12A 2Z16A 3LL7A 3BB6A 2RDPA 4BBSJ 1RB8G 1JXSA 4WM8B 5CQGA 4JRLA 2GMEA 2AACA 1PK6B 4DOUA 2L5QA 5CNAA 1HQLA 3KGLA 1QZEA 4I02A 1MH4A 4FCYA 1V5FA 4CDWA 3GZ5A 1XBFA 3OYGA 3N9MA 2ZS6B 4M01A 5IT9K 4HV6A 1Q56A 4YGCA 3ZKUA 1R58A 2JE7A 3KGZA 1W8NA 3H0GJ 4Y26A 1DZTA 1BIBA 3ILNA 3AYCA 5KHJA 4PJ0C 2Q8KA 4EJTA 1KS4A 5JI6A 2VXZA 3SXWA 2XJRA 2R7WA 1SEFA 2D2WA 2R7VA 4GZ9A 1CF7B 2M3AA 3ZXJA 4KNYA 3DTEA 3R4KA 3LB9A 4MFEA 1Y8RB 3ISPA 3J8F3 1D1BA 1JUIA 5CBLA 1APLC 1O4TA 5JVGF 1L7RA 5GJ6A 3V8LA 4Q48A 2P3IA 1HA8A 1G9DA 4URTA 3CO6C 2BGOA 4ESJA 1TEIA 4PI0A 3FLRA 3PTYA 3L2CA 2VNGA 1H9TA 4PDWC 2WBKA 2WWUA 1WJEA 1Z3XA 1RXGA 1OLTA 1KQ8A 1MD0A 2LD5A 3K48A 5D4RA 1UYPA 2KZGA 3M8JA 3WDXA 4M4PA 1OUXA 4CDQC 2M8EA 4U0VA 1UOBA 1P4AA 5EWSA 4LA2A 3DN7A 4K9SA 1GV5A 2O8QA 2VZ3A 2EZLA 3JRGA 4O6JA 4UFMA 3GF6A 2VQ0A 2WNVC 1QQP1 2D6OX 3J26N 1H0MA 3SZGA 2VBYA 4A69C 3QCWA 4AVAA 4BHPA 1YLFA 5F1JA 2ME6A 3JRBA 4BQNA 1YC61 5GLUA 1FYLA 2R5ZA 3KYLA 2DVFA 3LAGA 1US3A 5FMBA 2HQ5A 5J36A 3NKGA 2Y48A 3CL1A 2CFXA 4O7XA 3OS0A 1RUG1 2GP5A 2RHPA 2X48A 2BRTA 3KCXA 4E7JA 4YFWA 1CAXA 3IRQA 2W1UA 4BQ3A 4CDUA 4RGSA 5FWEA 3T2OA 4ZDOA 1AXKA 1R6RA 2B9SA 4ZJZA 3HOXJ 4PI2A 5HLHA 2HWB1 5F0HA 3MIDA 4B7KA 1F4HA 1PVC1 4KH9A 2V7FA 4Q5SF 3P1IA 1VFCA 3ME2A 2MC4A 4Q4V2 5GZEA 1NXMA 3H9QA 5D6FA 3ROUA 4LBMA 1HSTA 4GO1A 4UVCA 2DMQA 3FHZA 2AYHA 4WBBA 4V2GA 1F35A 3OOXA 5FY8A 2DPUA 3EQLF 1WPKA 1I3HA 4KU7A 2R5YB 5JXGA 1XSXA 3GTGJ 1WJDA 5AFEA 4DEQA 2VOKA 2BBVA 4FQZA 3WUDA 4WXDA 2E1CA 2QGUA 2XAJA 3PUFA 4JGZC 2XUEA 5FPBA 4FTBA 3USUA 1ODMA 4KUMA 3TB0A 2Q1ZB 2Q5TA 2D98A 3CO7C 1O57A 2DWRA 1JHNA 4AK3A 2GALA 2ESNA 3EUHC 1B4AA 1PDNC 2JECA 4HRIA 1O91A 2P0WA 3HGGA 2X05A 4X0GA 3F6VA 3ZMDA 1KQ0A 3T2PA 3JTHA 2VQCA 2F4LA 3ALQA 3FLTA 4IEVA 3O7OA 5H6QA 3G6EI 1NCQA 3J7LA 3W5MA 4HQMA 4A3KJ 2R7OA 4BQWA 2ZX0A 2I8DA 1XDUA 2OBPA 3A0BC 2D3RA 4HPKA 3JQXA 4FTHA 3IAM2 5DDGA 4ORFA 3ZXSA 2W47A 4IV1C 1D7PM 2DMUA 2D7FA 1NK3P 4YVSA 1US2A 2ZHKA 4PCQA 4M3DA 4QPGB 4PLMA 2DCKA 3FKIJ 3B3QE 3E6BA 2JD4A 3GMEA 4B4QA 1EA3A 4KJZA 5EGOA 1UU5A 2VVFA 3ZXEA 2P8TA 3HN3A 4RGGA 3IDAA 2G9FA 4JGYA 1ZZ8A 2EB7A 1VBB2 4CH7A 4P5YA 2I2SA 1W5TA 4KDPA 4IGOA 4UFKA 3N35A 4OMDA 4ITCA 2V1DA 2F5DA 1UG0A 5D5VB 3HQRA 4INDA 1O4XA 1LFPA 2WC2A 3AL0B 2FD5A 2IVMA 1GP6A 4MGTA 4BEHA 4FI9A 3ULQB 3GTMJ 2M5WA 9ANTA 3WQ1A 4LTAA 2FF4A 3B01A 2HVQA 4ABZA 4QT6A 5FAXA 4QX1A 4YVSB 3LOIA 2LR8A 2JE9A 1V3FA 4MEXF 1UMIA 4I98B 3QAHA 4NMIA 4EATA 2HEYF 4IE5A 2TNFA 5FZ6A 1DU0A 2XB5A 1GT0C 3F95A 2RS11 2V79A 3FUOA 2LFBA 1MEC3 2O03A 1TC3C 4PBOA 4F93B 5A3TA 3QBQA 1RUI2 3ACFA 5E16A 4S0HB 4AQSA 2ZEYA 1KS5A 3BZ6A 1J75A 3BLYA 3LSTA 3M4OJ 3CUQC 2BDRA 1D3YA 4K3UA 4HSTA 3MCZA 5GAGJ 3IWFA 4Y4RA 4F3QA 2CAUA 3OPTA 1ZM1A 2RDRA 3DXUA 5J3UA 4D6RA 2P3YA 4LO4B 3WNPA 1B8IA 4XUPA 1WLTA 5FP9A 4YW1A 4I6ZA 4UW4A 3SDGA 3TQNA 5GLWA 4EN7B 3PO3J 4OUMA 2E2HJ 4Q0VA 4X8NA 1H9GA 3MWMA 2B46X 2Y0SN 5FJKA 3LIGA 3UJQA 3VZMA 2XJPA 4JGYC 4SLIA 3F72A 1WJ5A 5DV5A 3HUGA 2DCTA 5ICFA 3FXJA 3VKMA 2VBZA 3MZYA 1O5UA 4UB8C 1R1TA 2HOSA 1TQ5A 2HWF2 1NH3A 3K4NA 3KP6A 4NN0A 2WZ8A 2E19A 4ZH4F 2COBA 2WSUA 3JD72 3WTZA 1C8M1 1AR61 2X29A 3MFAA 3TKYA 3AXDA 3C7EA 1RUG3 4IEWA 1DF0A 2QQOA 3CF2A 3CJRB 2B7YA 4A44A 1R1VA 3ERMA 1ZTRA 2RM21 3MDPA 2HLEA 3RPQA 2ZGNA 4W6WA 3LA3A 1GV9A 1HRV2 2Y9YA 5BV6A 3K4CA 2WUHA 2A3XA 5LLQA 1W36D 4RN5A 3HRTA 2YC4A 1MS9A 4O9EA 3PNVA 4ESFA 1W6NA 3I2HA 1AR63 2WS92 1IN8A 1SQ4A 1W2TA 2VXDA 4XOPA 4HG6B 3TO7A 5BNQA 5LATA 1AX0A 3ABTA 3VSLA 2W82A 3M2MA 4RDUA 2VLAA 3GVAA 1Q8QA 2ORXA 1F36A 3T1BA 4A3CJ 1LUJB 2N7GA 4Q5OA 5BNNA 4XXAA 1RGSA 4LHNA 3A01A 4QQPA 3VKOA 3ABMH 5IUQA 5CKTA 1VNDA 2QQ9A 5KAFC 5F3EA 5FZAA 1GOFA 2VD7A 1D0XA 2M8GX 1VRH2 2VE1A 2EPFA 2QQAA 3EDPA 4R4ZA 4ENKA 2V26A 1YQ5A 2UYAA 2VMDA 3OPZA 3UNGC 3MKZA 4TWTA 2BJSA 3F6OA 4MGRA 5K8SA 4R9AA 1MZ5A 2H0VA 4YIFA 1W2OA 4E4DX 2D5HA 1MJAA 2RS13 1YG2A 4DYRA 2BY3A 2FDJA 3MW2A 3DTKA 1JUMA 3S0MA 5DABA 2MYSA 1ZBA1 3OS2A 1VBB1 3BPSA 3S6PA 2EFOA 2GMPA 4EZ4A 3R61A 1WFXA 2STWA 2NVQJ 5JSOA 3AZVA 2ETHA 5C9AA 1WCDJ 5HS7A 1REEA 1XC5A 1K83J 4K20A 3OBTA 2UXXA 1UD1A 2CG4A 3D5RC 4O61A 3OYCA 1D2QA 3OYDA 3F8BA 5LA9A 1QJU1 3GTJJ 4P9IA 2CU5A 3KSCA 3D4KA 1RVF1 1YQCA 5FZKA 1VIWB 4BDYA 2HEWF 1KDKA 3H9AA 2ZKNA 5DAXA 4H4KC 1MS8A 5L7OC 4C2UA 3GZAA 3K2AA 4IOCF 1MBEA 3WP3A 5LHHA 2BOIA 2DU9A 5I0UA 4S05A 3FMQA 4P9YA 2DT5A 2FOWA 3IDCB 1F5JA 3ETQA 2RNGA 2VE8A 4IZZA 2PLV3 2ECCA 4W6YA 3V0AB 4XNFA 1DQ6A 4L97A 4I99C 3LOCA 2CV6A 3HT2A 1PO21 2FHRA 3JSOA 3PQJA 2BNMA 4P9WA 3R4UA 4MZUA 1XX5A 2IVJA 5A1FA 2XGDA 4HV5A 2GNMA 1RPWA 1U5ZA 4E8CA 4M72A 3LSHA 4Y13A 1CAUA 1KFUL 5IVCA 1IPJA 4DZJA 3UKVA 3KZYA 2A3SA 4XKBA 1JE8A 4OUSA 4LKSA 4HVRA 2H6CA 1K78A 2EBIA 4HA8A 5IFPA 4XRFA 4N4NB 3ORJA 3HSFA 2ZOEB 4OMYA 1TWCJ 1LCLA 1ZRDA 2NZ9A 4M9XA 3WGIA 4HSRA 3GJAA 1CZVA 4PCRA 1SBDA 3OL3A 2KDZA 3RZMA 2AC1A 4ENJA 1FPN3 1UHWA 2G19A 3DU6A 1QNTA 1JJ6C 1GZWA 2HWD1 4LKFA 1H8TA 3BTCA 4XPVA 4Q4X1 5J7MA 3JAMK 3MV11 4H3WA 1W3XA 5F5IA 1OQEA 4M6VA 1FIPA 2ZXQA 1R5HA 3WTVC 3H3ZA 2E2JJ 1K79A 5IOYA 5IT6A 1AWCA 5A3PA 4A5NA 4RMNA 1Z6TA 5DCMA 2FBEA 5CYVA 4I09A 3N9NA 3FDYA 4LLFA 4B4CA 4GAZA 3M3CA 1XYNA 3MIHA 4IHXA 4OHWA 4QPIB 2GXBA 1T95A 5DQ0A 4E4ZA 1NQDA 3B9CA 3GO5A 2FU4A 4HDVA 4FT8A 2WO1A 4CEYB 2GZWA 1AR71 4XLNF 3JRCA 1KJRA 4N43B 3DQVC 1XNCA 5LWBA 4KWJA 5FZOA 2W85A 5B3SH 1W3VA 1DG6A 2JT1A 5AC92 1CX1A 3HL2A 3CMMA 4W65A 2W1WA 1YLLA 5LBBA 1R5ID 1TZOA 3DPLC 4NIDA 3BTJA 3GLXA 1NHAA 5C4WA 2XHNA 1NLSA 1PZ7A 2RC4A 3Q9VA 4JOMA 2K46A 1N75A 4GA9A 4XXPA 2C4XA 3M8EA 3J80K 4NQWB 3DWLE 3UKTA 1BQPA 2DW4A 4P00B 1LVKA 2Z5UA 2X10A 1JU4A 3TN93 1VPHA 2QFEA 3S3NA 4AVPA 2OCCH 3AP5A 4NPRA 3W21A 3N9LA 4E6KG 3DPRB 1OFNA 3WP4A 4QGNA 3BTXA 5FQ0A 1BEV3 1BBT3 5B4NA 2AQEA 4IEJA 2MEV3 5D5UB 3KV9A 2EIGA 3W6VA 3D8CA 2CUZA 1VRH1 3WR0A 2ZBKA 2LVSA 2XVGA 2F5VA 1LEMA 4S2FA 1VMJA 2BWAA 4OUEA 1RKWA 4P5OA 1UB9A 3U0ZA 2AEYA 2EH3A 3H7YA 4LORA 1W0TA 1ZGJA 4A6OA 2CUEA 1QVUA 5FFXA 5FZ8A 2W94A 3AMQA 3I2IA 4P1WA 4JQTA 2WAQN 1FNYA 2HWC3 2YC2A 5A32A 1TME3 2MA3A 3HOSA 5JHUA 1XCVA 3T30A 4CP9B 3O1SA 4MQ9F 2WAEA 5ERIA 5ABJA 1XGSA 2P4WA 1FOXA 2MD0A 3BJOA 4GIQA 1VQ7I 4A0XA 5LBQA 2TBVA 4HL0A 2W9XA 1COV1 2BNOA 3CU7A 1P2FA 4H2AA 3H50A 4AHZA 4TYSA 3DGTA 4GYIA 1TWHJ 3CCEI 4PDWA 1WJFA 2VZPA 2DMNA 5C4XJ 2HFHA 1T0FC 3JCIA 1CZSA 1PHMA 3NARA 1OUSA 2VE9A 1BEV1 3UV9A 2NMNA 4BH9A 4RLQA 3KWVA 3OSDA 2P7CB 1NE6A 3B6CA 4M71A 3PL8A 2VBDA 3H1MA 1TG7A 1WKMA 5FPUA 3G1LA 3PIGA 2Q2EB 1U78A 4EJUA 3AFKA 1ZR2A 2C9AA 3T2QA 2I10A 2KIFA 4FX0A 4OINF 3I3QA 3NJVA 5L7OB 4G6DA 2LBFB 1VQOI 1KQRA 1SMVA 5F7UA 2KRHA 2ZMEA 1FYMA 4OCTA 5F5AA 2ZGLA 1BL0A 2PHRA 1FYKA 4I30A 1USSA 2BNNA 3LEIA 1HXS3 3NJZA 3MAJA 1GVJA 2WO2A 2J7MA 4P9GA 1IKQA 3H3LA 2RREA 3WOGA 3K70C 1TNFA 4XC9A 3SFIA 3NAPB 3IPVB 3ZPYA 1E57A 2CQNA 3FWEA 4QX7A 2GQQA 5J1UA 4RYDA 4IV3A 3OMYA 4I0WB 2VPRA 2Y0SA 1S0JA 4FVVA 1YRZA 3C2HA 2E26A 2LYCA 4D6QA 1EPWA 1R083 4NHJA 2D44A 4OULA 5BNPC 1ZBA3 3V64A 4BY1J 4XE9A 5IK5A 1V4RA 3Q9SA 1H4GA 3ZXAC 4CCJA 4FPHA 1RUJ1 5GTIC 3SCFA 2HWF1 2JG8B 2XWBB 3KV4A 3V65A 1OOPB 3VYRB 4EN8B 2Y26A 3NNJA 3GHNA 1D4M1 2XBO3 2JG9A 2NRAC 1UCXA 3BTAA 4XLFA 2I07B 3WDVA 1IC8A 2EWNA 5B1BH 3VBSA 4XHXA 1VQMI 3AFGA 5IATA 3RKQA 3HOTA 5FKNA 1Y9GA 1RUJ2 5I0TA 3WNXA 4L8QA 4GWNA 3BOWA 1Y9QA 2PLV2 4GH4A 1LULA 4COWA 2CQXA 2DQRA 5JXHA 5H9QA 5F6LB 1QJX2 1MBHA 1X9PA 1AR93 5FMCA 3G3ZA 3ABLH 4KG0A 2ZB9A 5A7PA 3WHBA 1WBLA 1FWZA 3CCRI 3SZTA 5DUUA 1Y6IA 3CUQB 4KICA 2RS33 3E5XA 3ZXKA 2PLYA 3GZUC 2ZZQA 2E7TA 2CAVA 1C1FA 3OIPA 3AP6A 3H5AA 1VRBA 4D0PA 3W9AA 2GH2A 2VJXA 3LSGA 1WRJA 4LIUA 4RS5B 4A3BJ 1EH6A 5L3DA 2VKHA 3CC2I 1J09A 2IA2A 1TMF2 1QJY1 2LREA 1L3JA 4RAGA 4OHVA 1OLMA 5FO7B 3FJSA 1O8SA 5B5EC 2DMTA 4L9BA 3KLSA 2E6VA 1JYNA 3V7CA 1RUE1 3F23A 4QQOA 3WTTC 1QOOA 4CICA 3D0JA 2DA4A 4BU2A 4FQGA 5HS9A 4FAGA 3DUIA 2OZ6A 1D1CA 1W6OB 3WTSC 4XVHA 4ISQA 2NXNB 1QHHD 2E5NA 5ACA2 4FE4A 3P3NA 1XDSA 1NLQA 2R041 4AHXA 4BIOA 4GALA 1ND2B 1H6XA 4AIDA 4A3MJ 2PJPA 3ESWB 4HN0A 3TOJA 1QPMA 1NG0A 2ZX2A 4YGDA 1BBT2 1VQNI 5IOZA 4Z6YA 2WNUB 4XIKA 1DP3A 4B44A 1SLBA 4QQLA 2BFUS 5D8KB 5DZFA 5BNNC 1SC7A 3RJ2X 4ZPIA 1YOVB 2ACJA 1ZLKA 3AVRA 4WM7A 4EJRA 2AH2A 3GBFA 1OVPA 3MLJA 2HQNA 4IV1B 5IW0A 2R7ZJ 3VBRC 2HXIA 5T50A 4V2VA 3IBMA 5L9VA 4MG2A 5FKLA 2WNEA 5CZKA 3VDBA 3P7NA 4YM0A 1WD3A 3WD5A 3VD3A 4F7ZA 4MX3A 1IS3A 1HW1A 1NCQC 1UKGA 3SCGA 1YI7A 1RI7A 4IQPA 3RYKA 3EYIA 3V0BA 3JREA 3ZSMA 1W9TA 2VXRA 3AZWA 4ZYAA 4Y4YA 5AC93 3LF7A 1MMAA 2V4JC 4Z8BA 1ETXA 4P9UA 4PSWA 4B48A 1WA4A 5L9BA 2C24A 2F4MB 1F4AA 2QYOA 4DO0A 3ZSKA 1Q8VA 2JE8A 3OCPA 2ZXHA 4FOVA 1OVSA 2ISYA 3I4PA 3KZIC 1IN7A 1ZYRF 5HLTA 4L11A 2XKPA 2D1HA 1ACCA 3O14A 4OI0A 2ZJQF 4GDFA 1K7AA 4A41A 1ETOA 4FPKA 1CPMA 3ZXLA 4IEXA 3X2QH 4COVA 2OD5A 1T38A 2YBPA 4EE2A 5EHDA 2KIUA 2P3JA 2V5DA 1MBKA 4IJAA 3QOEA 3CCJI 5BNOB 2Z99A 4A0YA 2RDQA 4JHZA 2YC0A 4LK1F 1R093 4OOIA 3L7WA 4AQ6A 1T56A 3U1KA 3CJQB 1FJLA 2BOJA 2WY8Q 2W25A 2RR12 3CCQI 1IRGA 4DBQA 4R9CA 3DF0A 4B09A 2A75A 5C5UA 5ABJC 1Y1VJ 4HG2A 2VO5A 4JK1X 4TXWA 3L00A 3ZFEC 1ASJ1 1IS4A 2J1VA 3DKWA 4KWKA 1KQ9A 3OD4A 1QVTA 2DDUA 4GD4A 1EY2A 2LS6A 3M8FA 3ZCOA 1WSUA 2ES3A 3WXPA 5EJZB 3ZMOA 2V6CA 4AWXB 4FPOB 3W5NA 1FMWA 2O9LA 4OIPF 2W2IA 2D5VA 4LKEA 5TJJA 3MEPA 1PUFA 4AR2A 5FYIA 3JB8A 3BROA 4OI4A 5HV4A 4ZZ8A 4RAYA 3K4MA 1K42A 1AYM1 2LKXA 3PSFA 1RC9A 4YFXF 3A22A 1GZ9A 3A4CA 1UY3A 2F5CA 2XDVA 3DCQA 2VT3A 3B6AA 3CP8A 3SH5A 1WCKA 2NVTJ 2PG4A 2ID4A 3FLPA 1W6QA 2ZGTA 5JLXA 3EJKA 1QJZA 1SEUA 3AKQA 1LKNA 2UXNA 3PJYA 1Z0HA 4U87A 4I01A 3K4JA 1LOBA 4UUSB 2VBXA 2PJRA 2VOXA 4JGZA 3HRMA 3ECQA 4E4HA 1EV7A 4XLHA 2XWJB 4C0HA 1TP4A 5F64A 3F3XA 1AX1A 4XM3A 3R0AA 1AHSA 4D94A 5EIYB 2XONA 4EGZA 4XICA 4YVWA 2D3PA 3ZFFB 2OTLI 1H2MA 3PUIA 5JXIA 2OQ6A 3ZMVA 3IKWA 1UPSA 5D8AB 1VQ9I 1V70A 2QDNA 3R0RA 2WLQA 3LSRA 2DYSH 4YSFA 1B6AA 5IVYA 4XFGA 2RJ2A 1RUE2 5LCWL 1F5FA 4C3IJ 1JZ4A 1R082 5C4JJ 5FFZA 1DGWY 2EXHA 1BOAA 1UXXX 5HODA 2RV8A 4Q4V1 3FF5A 1I50J 5E17F 2JICA 1PGSA 5LEJA 4L0ZB 2CUJA 3K3OA 4AE2A 4IEQA 4BOWA 1XJAA 5A7NA 2O14A 1VBE3 2Y0OA 5I0SA 5F39A 2W00A 1WQ2A 4UVAA 2CSGA 2V09A 1W9FA 3ACIA 3LQRA 2DT6A 3AZYA 1C0WA 1UX7A 3POIA 3V8KA 3I59B 2DK8A 3BDDA 4N7IA 4BUPA 2YX4A 4Y22A 3A1YA 3A0KA 4FFHA 1ZG5A 3CF5F 4LLNA 1LOCA 2CHHA 1MS5A 1SFOJ 3T0BA 2KL4A 1DGRM 4M9ZA 1MKMA 2W57A 2DA2A 1YIJI 3MKWB 4G7HF 1U8RA 3O8HA 1VBE1 2VMGA 1FV3A 2E51A 1UYZA 3QOPA 1D5YA 4Q27A 4PJNA 4BWOA 1UO9A 3C2GA 3S5QA 2QVOA 2XB6C 2ERFA 2DFBA 4A3DJ 2P81A 5KHKA 4MOAA 5ANQA 2DCJA 2EJRA 4Q4V3 4KIGA 3QYFA 1XNBA 4OMZA 1Y56A 1AXZA 3QLQA 4Y52J 4KMQA 3GXOA 1PVXA 4AW7A 1KU7A 4WVMA 3WQ0A 3OYWA 2YU1A 2RV9A 1Z3YA 4IEYA 1X4OA 5FYTA 3C1DA 3FHIB 3ZFFA 1W8UA 2BV6A 3NNFA 1TW3A 1YW9A 2Y6LA 2P3KA 5C8CA 1YFUA 3IL2A 1URXA 3VD9A 3EPZA 4AIJA 2M4KA 4AXOA 1FBUA 5KAIC 2K9SA 2F5EA 1POQA 1RVF2 5FY5A 3BJ6A 2MH2A 1QHGA 2UWCA 2IS2A 3GX4X 2FEZA 1MQTC 5HCHA 4XLCA 5A70A 1PK6C 2OU2A 3OG2A 1BLZA 1R5GA 1IZ1A 4YIRX 4FOWA 2Z69A 5FZHA 1FOD1 4DRRA 4IE4A 1LTEA 4HX8A 3VBOA 2E9QA 2ARXA 5LK7B 1Z7UA 1VE0A 3N7MA 1PIV2 2JRTA 1UZVA 4OIOF 2W24A 1XYPA 3RMXA 1XMKA 4GJYA 3AKSA 2PI0A 5EEGA 1WH5A 1HOMA 3TN92 5A33B 4ISRA 2WN3A 2QSHX 3WG1A 4FTEA 2ZO4A 3HM5A 4Y1YA 4ASMB 3O1UA 3L2UA 2P5VA 4MHRA 4EROA 2DF7A 5DDJ2 3KFWX 2QZ8A 4QKNA 4AFAA 4IVNA 2XHKA 2D93A 5IK4A 1ND3B 4CCCA 3LWFA 5C5TA 2HEVF 4OMCA 2FA5A 5IVBA 2O6GE 1SDDB 2XUBA 4AI9A 5JLWA 3MLKA 3AP9A 2VKVA 4B1RA 1HC8A 2UURA 3P5BA 1UX6A 4I0BA 1MNEA 2VM9A 5IVVA 5A7SA 2QQIA 4IPAA 4XFBA 1OPCA 4CP2A 3K46A 2VJIA 3LSDA 3AKTA 4WVVA 2OPWA 4D7NA 2RQPA 2NOJB 4M0NA 2JD9A 3HEIA 4UUVA 4GKYA 1PM7A 3T08A 4ZYEA 4XFCA 1QJU3 1QKQA 2VMCA 1NY71 2WT1A 3R4SA 3VDDB 4AF9A 1CAWB 1W90A 2WAAA 2YPJA 5E3MA 3QH6A 2DVDA 4Z2AA 1J84A 4IETA 3PLQA 1G9CA 3H36A 1C8M2 1U3EM 1GNHA 1LRHA 3POFA 3HKZA 2WZEA 2J42A 2O61A 2GOMA 1M4WA 2DBIA 2MLKA 4LNVA 1SFYA 3BYWA 4XCBA 2JPBA 1UL9A 4LFUA 3AMMA 2RDNA 3JQWA 1TQPA 3H1YA 3NNLA 3UYJA 5JIAA 2PXJA 2E1NA 2WQZC 4IGQA 4OAYA 1PNGA 1Y43B 4XORA 4QDQA 1LPQA 4LO5B 3GFMA 4E27A 2C6YA 4QX8A 5FZCA 3AG1H 2RNJA 3I3LA 3OPWA 4Q4W3 4CO8A 1RUC3 2CH0A 3THDA 3WDUA 2ZX1A 1NG7A 4AEMA 4DW6A 1LEDA 3U75A 2CWEA 4H55A 1GLHA 1NA1C 2OQ7A 2XJVA 1W0UA 3JBG1 2XUMA 3I58A 2QCOA 1J5YA 5FB2A 3ZMZA 4RQPB 3DCFA 4QPYA 5FD6A 1MMSA 1J0RA 3L9JT 2CU7A 4PBPA 5JZGC 5IJRA 2JDZA 3ABKH 2XF6A 3EB7A 4KWLA 1PX3A 4Y20A 3CBNA 3P9IA 5SV8A 2J1AA 4RQPC 3UNPA 2BPA2 5IYBJ 3ASIA 4CP1A 2EZKA 4H7MA 4JZRA 3CD6I 2OZJA 2VG9A 4ZYDA 4HNUA 1HCRA 1RITA 2BWCA 3QACA 2B63J 3HC7A 4N43C 1RUH1 3R4DB 4K8FA 2VZUA 2BQPA 2IC1A 4NIHA 5BPXA 2VGDA 1IRFA 4BGDA 2W1SA 1VMFA 5FYCA 2DXIA 3DKXA 1VAKA 4WXCA 2GNTA 1M1EB 4JDMA 4BE0A 4ENNA 3V7RA 1DGWA 2CMPA 1W0OA 4IRGA 1Z78A 5K7FA 2GA2A 3OBAA 4Q4W1 3WG7H 3ACLA 4AI0A 2K9MA 1N77A 3PIPF 3C8XA 5FZ4A 3M1CA 2JKXA 1A78A 1YE9A 2L54A 3HJRA 3G4SI 1ZX5A 1DGRA 2M34A 5EZGA 2PFWA 1C3HA 4XRMA 1F43A 1RUNA 1BJQA 2IXJA 2KD7A 2V73A 1S0BA 3LDRA 4LBJA 4MXWB 1UHMA 3V56A 4FFGA 1W8WA 4AEDA 3ZQIA 4QSHA 2HVSA 2GC1A 5K1YA 1HJGA 1FOD2 3SCHA 2QSGX 2XF5A 4GH4B 3BOPA 3BU0A 5LEKA 1Z05A 4PIZA 3SHFA 1GNYA 1PGW2 2DBBA 2XJSA 4FSJA 3RZKA 4XAAA 4RS5C 5IT9Z 4JVAA 1I39A 1VB4A 1B35A 2K27A 1UOJA 2XLFA 3W2VA 1SFEA 5ICGA 2YX7A 1G3YA 2HWD3 3USSA 2Y6KA 4D7TA 4XSZF 4XJ8A 1GICA 3RYRA 4ZONA 1ZELA 3MUY1 3KLNA 2XASA 2M1BA 1OF4A 2GDFA 2GIVA 4QDSA 4LT5A 1SANA 1VB2A 3MKYB 1HQCA 2E1MB 3TEZA 4XN3A 1EV12 1RIOH 1VQLI 4J00A 5A1LA 4XOTA 2CY6A 4OI1A 2M4GA 5GPAA 4GCVA 4G9SB 2FNPA 3WTXC 5FCCA 4JCKA 5DYMA 5E1XA 1QXRA 5JVVA 3JW4A 1OSGA 2VBPA 1BW6A 1JGGA 3F21A 1EUUA 1LU1A 2OUMA 2ZEXA 1X8MA 3GALA 3VUOA 3O0VA 3RZGA 4EJOA 3QYEA 4M3CF 1DYPA 3U1XA 1E2XA 4DB5A 2D97A 4MGYE 4GRIA 4NC6A 1SLIA 3CDIA 1FYUA 4YZ3A 4LGWA 4FQ4A 1Q1VA 5IP9J 3FFQA 2GC0A 2PELA 4QX2A 1VQ8I 2QTWB 4V2WA 2DTRA 3VBSC 3VD5A 2ZX3A 3ZM8A 4YZ4A 1TVGA 1V6KA 2W1OA 1GQHA 2K3PA 2L9LA 1XSVA 4ARYA 1DBNA 4EQVA 3VBOC 3TRSB 2Q2EA 3PUSA 4S2HA 4AU7A 3I4IA 5GLTA 3LCPA