3I59B

Crystal structure of mtbcrp in complex with n6-camp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
202
Chain Sequence
b'SHMDEILARAGIFQGVETKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLDVPGRVAKQLLQLAQRFGTLRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, Crp/Fnr family
publication title Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 47
structure length 202
sequence length 217
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00027 cNMP_binding Cyclic nucleotide-binding domain
B PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i59B02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i59B01
3DKWA 1USTA 1YS7A 1P6RA 1U5TB 4F7ZA 4MX3A 4KMFA 4YNIA 3F6VA 2OZ6A 2NNNA 4UNOA 2HTJA 4S05A 5ILVA 2BV6A 3QU3A 3V8LA 4AVPA 2QQAA 1X8EA 2UYBA 4I0BA 3U10A 3SHFA 1TTYA 1B1BA 4Q0QA 1G3YA 1T98A 2JZYA 3D0JA 4ONUA 2ZKZA 2CYYA 2ETEA 4MNUA 1T39A 3FMRA 3CJNA 4EM1A 5FPZA 1XE8A 2O1QA 2HS5A 5DUKA 3U2RA 1VTNC 4KU7A 2I45A 4AVCA 2RDPA 1YHFA 4Y15A 5JSPA 2PHDA 1SD4A 4HDVA 2KIFA 3QAHA 3KFWX 1IRGA 3NJZA 3KP7A 2PN6A 4HDUA 1IZ1A 5I8SA 3CEWA 3K0LA 3EJKA 4XFHA 2KXLA 3KLNA 4LLNA 4KA4A 2P7VB 5DYMA 3U1DA 1QO0D 1DP7P 1REPC 3UKVA 3LQRA 4RB0A 3ZMZA 4Q29A 3LA3A 1LNWA 5D6EA 4ZU7A 3SHRA 4MGKE 4JQFA 1CGPA 1E2XA 4KWKA 2ZBKA 1HSJA 3LA7A 3OCPA 4HQMA 2IP2A 5K5OA 1DDNA 1D8JA 2VODA 5E8GA 1G3TA 1D5VA 2P5KA 3V8KA 4XLPF 2B9UA 3ZMDA 4XF9A 1FP1D 2UXNA 2X4HA 3T8TA 3KSCA 2VOOA 1F5TA 3HOSA 2XL7A 5LGUA 5LBQA 4AQ2A 4OFGA 1XRUA 2LF7A 4IVNA 3I7DA 1I6XA 1Y9QA 4UBHA 4META 1IN4A 3F8MA 4JBAA 3WU1B 1UHWA 4FAHA 5J7MA 3LZZA 1CAUB 2W84A 3HHHA 2ETHA 5DUIA 3KEOA 3DPTA 3CF6E 4JK1X 2FBIA 1YO5C 4EROA 3I59B 2M5WA 3VFZA 4XSXF 1RGSA 5T3NA 2H0VA 1B59A 1S8NA 2KKOA 2OU2A 1MKMA 4P5OA 4D7SA 3GYDA 3LA2A 1YFWA 3KEQA 1RUOA 1FP2A 2PEXA 1W7PA 4AXOA 3RYRA 3BZ6A 3IC7A 3JTHA 4Q5SF 2NYXA 2D2WA 2IXIA 5HLHA 5K1YA 2OZJA 5FGMA 4IPAA 2R3SA 5D8KB 3HQXA 3CUOA 3QP6A 2QZ8A 3MFKA 2BYVE 2VBZA 2HOEA 1K78B 4B29A 1IRFA 3F22A 3G7DA 2P4WA 3GW2A 4UV9A 2L01A 2VPVA 2MNGA 4UBGA 4UUVA 3P9KA 3N4MA 1CAXB 3F72A 1LRHA 3DQVC 2O0YA 1DUXC 4GGGA 4ZU4A 3NEUA 2DT5A 4PGHA 2EA2A 3F21A 2P5LC 2PMHA 4M74A 5D4SA 2PG4A 1ZAOA 3GFMA 3RPUA 3WGIA 1ZNPA 3NKTA 4U0YA 1EV7A 2FQ3A 5K5RA 1O3RA 3RIRA 3EO6A 1ZLJA 1T6SA 2FNAA 3T0YA 3KE2A 2V6CA 4Q0PA 3EBRA 1VP6A 1YUDA 3E6CC 3RKXA 4HYEA 5CYVA 2D5FA 4H0EA 4KIFA 4QM8A 1VJ2A 1FOKA 2F5FA 2CFXA 4XFGA 1XGMA 5LGTA 5ICCA 1T2KA 1YW7A 1ZGJA 2DFIA 1KQ8A 1HXDA 3TKYA 4M9SA 2HQNA 4QGLA 2VQAA 4OOIA 3GWZA 4G7HF 4MGZE 2ESNA 5FDBA 4QX5A 3QPHA 1LJ9A 2FBKA 2H6CA 2B5HA 3IHUA 3HRUA 5EZWA 4L9JA 2JRTA 2LDUA 4PJYA 1FWZA 2WWYA 3H7JA 3H9AA 3I58A 4H7LA 1QXJA 1FXZA 3DL3A 3OV8A 2GH2A 2CO5A 3CTAA 1ZG3A 2GAUA 3RZZA 2RGVA 5DV5A 1P4WA 2D5HA 3M8EA 3FHZA 3I53A 4RGXA 1L3LA 4L5JA 4CICA 3GXOA 2RV8A 3WW3A 3BB6A 3PQKA 3IDCB 3FM3A 1K6OA 2EFPA 1OR7A 3IL2A 5LEJA 1XN7A 3P7NA 1P4AA 3CUQA 4WWCA 4CHUA 3HT2A 2VC1A 2IRFG 3KP4A 3JSOA 4YFKF 1ZLKA 1WKMA 3MZHA 4G6QA 4MGIE 3V7SA 2NRAC 2QUFA 1H1IA 4Q0SA 4ENKA 4ETSA 2AS5F 1B9MA 2CSOA 2V79A 3BY6A 4AVBA 2V1XA 2ESHA 4Q47A 4LUKA 2M45A 4XFIA 1WA4A 4WX9A 1JGSA 4RGRA 3R60A 4AIJA 3OD0A 1OYIA 1LDDA 1ZZ7A 3IRQA 3TDZC 3BALA 3F8CA 4KWJA 2ZXJA 1Z6TA 3QACA 4XBFA 3T5XA 2Q4SA 2VBYA 4WF2A 4CO8A 4EJUA 4I7HA 1U5TA 3UKNA 3I0TA 4LMYA 2K0GA 1Z9CA 1BI2A 3J80Z 2STWA 4IEWA 4BXUA 2ELHA 2DPDA 1OI6A 1ZARA 1W4MA 2HEOA 4QXKA 1JHFA 4OMZA 1W7PB 2E7XA 2IXJA 4M6XA 1X8MA 1SFEA 2DBBA 5E1RA 2RQPA 1SD5A 3Q9VA 4N0BA 2DAOA 5J8FA 4M72A 3SCFA 3K1NA 3CL1A 3BJOA 4R52A 4HBLA 3GFJA 1FPQA 5BXXA 4LULA 2YX7A 3GO5A 3KP2A 1RUNA 1MD0A 4KN4X 1G4DA 1IPJA 2UY8A 3VB2A 4Q0UA 4LJZF 2YR2A 4EJVA 3BPXA 2B8MA 1FI2A 3SZPA 2PBIA 2D45A 3J80K 4A0ZA 3RPQA 3LAJA 3VOEA 2V1UA 2ZNYA 1NE6A 3VEPA 3GLXA 2Z9OA 2HKXA 4KN7X 5JR3A 4EJWA 1I5ZA 3E6MA 2W57A 5JCTA 2ZNZA 5H6RA 5HDNA 2XV4S 3LAPA 4BH9A 2C6YA 4OLLA 4EWDA 3SZTA 2YX4A 5H20A 4BHCA 1RI7A 3TNPB 1FT9A 2EB7A 1B9NA 2V1DA 2VN2A 4IERA 1BC8C 1XCVA 1QZZA 3ETQA 1KU3A 2K4JA 4HLTA 1RNLA 2WV0A 2GC3A 2J5OA 2Q30A 5I0SA 2VBWA 2A69F 1X3UA 2OQGA 4EVIA 2BNOA 1Y0UA 2QM3A 5E1ZB 3U0ZA 2H27A 2COMA 1ZZ8A 1BIAA 1Q5OA 4A5MA 2UZKA 1JE8A 1UFMA 4J1WA 3EYYA 3LWFA 1S7OA 5JVTA 4EJOA 3C3VA 5ERIA 3BJAA 1G6NA 3ES4A 1CAUA 4BYYA 3IWZA 1UCRA 3JAMZ 4CXFA 2YU3A 3ZMTA 1Z91A 5FFXA 2NS0A 2UYAA 1XE7A 3S2WA 2GQQA 1W5TA 2ZJ2A 4ESBA 2DW4A 3BOQA 1R1UA 4M73A 4I98B 2XKOA 3KGLA 3CDHA 2O8XA 2PAMA 2A68F 1V70A 2RN7A 3B02A 2QYOA 1G3SA 1DGWA 5D1IA 5BV6A 1KYZA 1V4RA 3R4KA 4YIIA 1QXRA 2OA4A 3CUQB 1YTYA 4HSJA 5BS6A 5E8IA 1NZCA 3RNSA 4RAZA 5BPDA 3KMHA 1YFXA 4IXAA 4G7ZF 3ML6A 1O7FA 1LEAA 3ZDSA 4GCVA 3ZQ7A 4A0YA 1F1ZA 2XHKA 1R22A 2OZUA 2R7DA 3JAMK 2EA7A 4GULA 2M30A 1E17A 3GEZA 1ULYA 3GFLA 3RYPA 1FSEA 1R36A 1WI9A 1XMKA 4EWEA 1UB9A 5I0RA 2DPUA 5J48A 2GZWA 2HZTA 3WW1A 2Z99A 3R6SA 2PA7A 4HVRA 1TQIA 3FM5A 4Q48A 5I91A 3D5LA 3S7IA 1J5YA 1HW1A 4GO1A 4OMYA 2FE3A 3WGHA 3MAJA 1O5UA 2DTRA 1CAWB 1BIBA 1EP0A 2QCSB 1J3PA 2E9QA 4O3MA 5E20A 1MJBA 3FX3A 1OMIA 1GQHA 4ORFA 4HF0A 4G8XA 4A0XA 3L00A 3ZMSA 3MWMA 2A61A 3OTFA 1ZH5A 1B6AA 2HQRA 4U7DA 1XSXA 1O7LA 4LD5A 1YQAA 1MDMB 1AOYA 4R1HA 3PFIA 4UV8A 4QGMA 3J81Z 3RDIA 2JPCA 5IT3A 4ZU5A 3DF8A 1O5LA 2M87A 3NL1A 4IESA 2L4AA 4KDPA 3MYXA 3ST7A 3V7CA 5F1RA 4HVQA 2DU9A 1QQIA 3FJSA 1H1MA 1U8RA 5DDGA 5LHIA 2GXGA 1SD7A 5F6FA 3HTSB 5DD4A 2XLAA 5DD8A 3HIFA 5FPXA 2F5CA 1BJAA 5H6QA 3LAGA 1IUYA 1Z1DA 4HMZA 2NNYA 4Z2YA 2CG4A 4YARA 2KJBA 2XGXA 5AVPA 2GA2A 3P9CA 3WTWC 1KQ9A 3H1WA 4KUMA 1W5SA 2FOKA 1GVJA 3IWFA 3LFKA 4NVPA 2BBYA 3RKWA 3MPBA 2QWWA 1NXMA 3S7EA 3WTTC 3SFZA 5CVJA 4B09A 4BHBA 2E1NA 3HSEA 3V4GA 4HX7A 2ZFWA 4WXDA 2IXCA 4ZH4F 4EM2A 2Q0AA 3PLQA 1I27A 3FXRA 3E5UA 2E7WA 2PHLA 4G94A 5CJ9A 4L5IA 3E5XA 4MEYF 3ISPA 3T8RA 2QBYB 2FA5A 2HGCA 1TBXA 4HOBA 1ZRDA 4MGRA 2P6TA 2Z33A 5J8CA 1ZRCA 4I02A 1IXSB 5LRSA 4FBFA 3WW2A 3VODA 2XAQA 1EH7A 5KBFA 2FEZA 1ZG1A 2GU9A 2M8EA 4KIGA 4G7OF 3C1DA 4OU0A 2ADUA 2MLGA 2P8TA 1J0RA 5L3FA 5AIPA 4WZCA 2Q1ZB 1ZYRF 3H1YA 2KRFA 3JW4A 3ECHA 4BQAA 3M3IA 3DPLC 3ES1A 4WK8F 2HTSA 2AXLA 3QU6A 4WBBA 4TLFA 2MD5A 2QVOA 2UWMA 2D40A 1OD5A 3E97A 5CVUA 3ULQB 5I8TA 4QMAA 3I71A 4PCQA 4IRIA 2VT3A 1PP8F 3MCZA 4KICA 4AQ6A 2RC4A 2XUBA 4ON0A 4IEUA 1HW5A 5ILSA 1CF7B 3GUDA 1T0FA 4P9FA 3HRMA 2DCTA 3P9IA 2XRNA 1D8KA 1Q1HA 2PI0A 4HF2A 4YRDA 2ZMEA 1HQCA 1HSTA 2IA0A 5D8LB 5E16A 4M9XA 4UVCA 4HA8A 1J2XA 4Q4ZF 1NHAA 4G9YA 4NB5A 4EQQA 5HDGA 4ZYDA 2GC1A 1FY7A 1ZZCA 2YSRA 2K02A 1SAXA 3BROA 3ACLA 2PJPA 1TQMA 1IW7F 4XFBA 4LA3A 2EV6A 1EH8A 5JHUA 2OBPA 2DQRA 1MJAA 4L9VA 4CZZA 3HRTA 4HN0A 4NQWA 4KNYA 4ZYHA 1UCXA 2G7HA 2DK8A 1P92A 2JT1A 2VOPA 1HKQA 2BEOA 5ICFA 2LF8A 2K9ZA 2GC0A 4AIHA 2A6HF 5FLJA 4A12A 1MGTA 5BY5A 5EEGA 5FO5A 4DINB 2A6EF 4WXCA 4IRGA 4EM0B 4QM9A 2IA2A 3DN7A 3UKTA 4AVAA 3ELNA 5CVVA 4XFFA 1U6GA 3BU7A 3BWGA 3RI4A 1IXRC 3G3ZA 3K9TA 4A2UA 4A6DA 2XAHA 2O6GE 3I64A 2GWRA 4FX4A 2PLYA 2PQQA 5HDKA 2IW5A 2YPRA 1CAVB 4BIFA 3HUGA 2J5PA 1SEFA 3FMQA 3LSTA 2Z2SB 2XROA 2OA2A 4MHGA 4U88A 4GYGA 3CO6C 2IXKA 4PGGA 1SMYF 3H3UA 2VE9A 4HLYA 3DXJF 1YFHA 4A6EA 4L2NA 4ZZLA 1YG2A 3O2PE 4M6YA 1TNSA 3ROUA 3BJ6A 1J3RA 3U9GA 2QNKA 4RD7A 2O3FA 1G3WA 3EUHA 2IT0A 1Z05A 2M1BA 4DNCA 2W85A 3F6OA 4U0VA 4MEXF 1A04A 2ISZA 2EVXA 3KGZA 3IKTA 4MZUA 2VE8A 4AD9A 2BNMA 1LEBA 3QOPA 3FWEA 4XF3A 3F8FA 4IEYA 1XD7A 5FCCA 2RNJA 3Q9SA 4IF4A 2VT2A 3EYIA 1FNNA 1J3QA 1H0MA 4WVZA 2BNNA 3ELKA 2Z69A 2BGCA 5ILUA 1RL3A 4EV0A 2FU4A 3GZ5A 2ET1A 5DEQA 4QLCU 2MA3A 1CAWA 3H92A 4E2SA 3FHIB 3PVBB 1H9TA 1RIOH 2EAAA 4QWQA 4L0YB 1YLFA 5JSOA 4YSFA 3BPZA 2IXHA 2JSCA 4HLXA 1FSHA 4RB3C 5C8WA 3T1BA 2XAJA 2R7FA 2HFHA 3W6KB 3B73A 1MDMA 4S04A 5I0UA 3LQQA 4LLLA 3FXUA 4JVAA 3CO7C 4R79A 3IRRA 2XL9A 3C7JA 2A07F 1K7AA 3EDPA 4N9IA 1KQ0A 1LB2A 3L7WA 3H3ZA 2X0LA 4M71A 3KETA 5HVQC 4O6JA 1S29A 3D0SA 1T38A 3COAC 5FB2A 2V09A 4UVAA 2ZMEB 1P4XA 1FC3A 4OIOF 5E1XA 3F8NA 1J59A 1L0OC 4CYDA 5IT9Z 2FRHA 1H9GA 1FX7A 2DO7A 3WTYC 2EK5A 1Y3TA 5ICEA 1ON2A 2JTVA 3C3WA 1OKRA 3NSTA 1QBJA 3V7RA 2PAKA 4MV2A 4OIPF 5CADA 1J58A 1FBUA 3TDUC 3OF1A 4L9NA 3JZVA 3DV8A 2HYGD 2FNPA 1KU9A 2O8QA 2QLZA 4K8FA 3FFQA 4FHTA 2NAZA 3WTUC 2OPKA 4Y13A 2PYTA 2MLKA 3KZZA 5D5VB 1GHCA 4MQ9F 4IEVA 1IPKA 1YIOA 3M1EA 1DZRA 5IT9K 2H6BA 4L9TA 5EFUA 4MUVA 2QBYA 4I0AA 1Q43A 3E6BA 2IPQX 1IN7A 1Z7UA 1W7PD 4UXNA 3GVAA 5D5UB 5LGNA 2HDCA 1S7AA 4KU8A 5BQTA 3L9FA 2EFWA 2HYFA 1KYWA 2HJIA 4PIXA 5FLHA 1YLLA 4OINF 1HKSA 4IHSA 4IHTA 5FQ0A 5D5XB 4PIYA 5FD5A 1XCBA 4RB1A 3I54A 2P6SA 3DFGA 2PFWA 3BCWA 1QGPA 3ZMUA 1S3JA 3F8BA 4XF0A 1STZA 1GQGA 2XLGA 1RTVA 2CAVA 1O57A 4HN1A 2QQBA 1U2WA 1PP7U 1U78A 3TO6A 3TO9A 5DCFA 4KT5C 2H94A 1LKNA 4L11A 2B0LA 2UXXA 1CF7A 1R23A 4XETA 1TW2A 2OYZA 1YW8A 3R61A 3REOA 4YFNF 1U12A 4WXHA 5CLSA 4BNCA 4Z07A 3HT1A 3SXYA 1LR5A 2QJVA 3NW4A 3S0MA 3TOAA 2K86A 3ABTA 1O4TA 3FZVA 2K7LA 2L4MA 2L3DA 5BPXA 4LB5A 3TOBA 3VHRA 1UIKA 3NVCA 4U0WA 1R00A 3TNQA 5LRRA 1ZREA 4ASNA 4ESFA 2PTMA 5HI0A 1FZPB 3N97A 3QRFF 3KZYA 4EGZA 5C6CA 1TLHB 3WGGA 2JPBA 3EQEA 2FMYA 5J3UA 2MH9A 1YFUA 4O9GA 4N9HA 1SD6A 2PAEA 2DQLA 1VR3A 2P17A 2MH2A 1HBXG 5KHJA 2O03A 4XF1A 4LG0B 1CAVA 3O3KA 3ZMVA 4KYWA 2VECA 2GA1A 4FX0A 1IN5A 1TW3A 2XASA 5L3BA 4GYIA 3I4PA 4G6DA 3ZP5A 2W25A 5F64A 1J75A 4P9GA 1J9IA 4HAMA 1BN5A 3J81K 1QWRA 1DGRA 2CQKA 2VXZA 1XDSA 4HQEA 1IN6A 4AWXB 4B8XA 3M70A 3WODF 1FYMA 2ZCWA 2DK5A 2CGPA 3WE3A 2D93A 2G7UA 2Y0OA 2RKHA 2IA1A 4WCGA 1JXSA 2KJCA 5KK1A 2L54A 3SXWA 4KL1A 4KIBA 2STTA 4E70A 4XFCA 4LB6B 4PDKA 2FF4A 4LLGF 2FQPA 3ZN0A 4IJAA 4HF1A 2P7CB 2XLFA 1BC7C 3K1MA 1R1VA 1KU2A 4IEOA 1BM9A 4YFXF 4RS8A 3MDPA 5E1WA 1Q3EA 3WW4A 2XAFA 3GBFA 3WG9A 2EFQA 4HBNA 1WSUA 4U7BA 3FE5A 4IEXA 5FLXZ 1EYBA 4IEZA 3GX4X 3EQLF 3L09A 2IVMA 2Y75A 3Q5FA 2PFBA 1QNTA 3U11A 1IF1A 2FBHA 1TQPA 3HYIA 1YFYA 2IC1A 2QVSB 2K4BA 3EETA 5J6XA 4YG2F 1PDNC 4HSLA 5FQ0B 5LHHA 1IXCA 4LA2A 3G73A 4XFAA 1GXPA 3TQNA 1R5HA 4CGZA 1I1SA 4K2EA 4UVBA 1BI3A 1X82A 1PMIA 1WLTA 1ZGAA 2F5DA 4F8AA 3LWCA 3WTSC 3WTVC 4EGYA 3WE2A 2QENA 3CUQC 1F4KA 5HLGA 1FYLA 3BPVA 2D1VA 4LK1F 2C0ZA 3L2CA 4KWLA 1UIJA 4XSZF 1R1TA 4JTNA 5JR7B 3K2ZA 6PAXA 3TO7A 5L3EA 4HZFA 2MPFA 3IKVA 5CVRA 4DQ2A 4MQVA 5FLXK 3GF2A 5JFRA 1JHHA 3IIAA 1O3SA 2BE5F 2HWVA 2HKOA 4FT8A 1R7JA 1SFXA 3WTXC 1SMTA 2VC0A 4LFUA 2OAZA 1FLIA 4P55A 1XSVA 1P2FA 3RYKA 4IRHA 4X6RB 3RKYA 4TV7A 2OQRA 2LNBA 1NE4A 1U5TC 4MGYE 2EV0A 2N7GA 1RZ4A 2IXLA 4IETA 1JUHA 3OGJA 3RJPA 4XLNF 1BI1A 2Q0OA 3JSPA 2Z5UA 1L3JA 1CX4A 3IBMA 5KHIA 2LSOA 3FF5A 3J7AO 5DCMA 1X7NA 4LUMA 3O6BB 4I01A 5D6FA 2PQ8A 1HKTA 4ZYGA 3H7YA 1YW9A 3I5UA 3BDDA 3SCGA 2F4PA 3M8FA 1OYYA 3DP7A 1EPZA 2ZO4A 1I1GA 2EFNA 5L3DA 5JAXA 1S6LA 4HV5A 1ZG5A 1FBQA 5KHKA 1ZZ6A 3KP5A 1SFNA 4I2OA 1FYKA 5D5WB 3DEUA 5KHHA 4ZYEA 1QY4A 1IAWA 3CO2A 4JTOA 5A2QZ 3H50A 3USSA 4L18B 2H09A 4X6QB 4LK0F 4XEZA 4LGWA 4XRFA 2EFOA 1ZRRA 1ZZ9A 3PNAA 1WQ2A 2FSWA 2CW0F 1SQ4A 5I93A 1ONVA 1WGPA 1ZHFA 1WRJA 3IDBB 1R58A 3R0JA 2WTEA 3W6JB 1XB4A 2V9VA 1KU7A 2DI3A 1XGOA 3NRVA 2VBXA 4Y17A 4UHTA 3F23A 2FXAA 4Z82A 4BHPA 1DPUA 3L2HA 4P9UA 1PM7A 5HS8A 1C0WA 1EH6A 2UY9A 4UXAA 2L02A 1DZTA 4IEPA 1DPRA 2OD5A 1HW2A 4HV6A 3MZYA 5A2QK 3KP3A 5KHGA 3E6DA 2XVCA 4PZJA 2Q2EA 1TNTA 3O14A 3HTUA 4OIRF 2TDXA 5FFZA 2WFPA 4FAGA 3CJXA 3SMHA 1XGSA 2O61A 3GFIA 1IN8A 2K27A 2EV5A 5JI6A 4GXOA 4RGUA 5L3GA 2A3SA 3BP8A 2HR3A 2EWNA 5TRDA 4ENNA 1ZN2A 2W24A 3KCCA 4QGNA 4D0PA 5FLIA 3M7GA 1J1LA 5EEHA 1ODDA 1OYWA 3EHKA 1O3TA 5CVIA 3QPTA 4M9ZA 1GXQA 4L0ZB 4EMSA 2GXBA 5K8SA 4ENJA 5D4RA 1QPMA 1KA8A 2DLLA 5FD6A 4CDGA 5HLIA 3R0AA 1YWKA 4MTEA 1EY2A 1UW8A 5JSRA 1O3QA 4HX4A 4A5NA 4E2GA 3SCHA 4MH0E 3H1MA 3C18A 1WWXA 4YIFA 1SFUA 5CU1A 1ZZBA 2LKPA 3ERED 4O9EA 3V8JA 4RB2C 3FZ3A 3RTRA 4HVOA 5BUVA 2IJLA 5HS9A 1UPIA 1TQ5A 1MJ9A 5ICGA 2MC3A 4LTAA 5E17F 3HSFA 3E3VA 4LG0A 4YYOA 3SQNA 1QZYA 3AAFA 1RC6A 4HW0A 4I09A 1ZRFA 1UD1A 3ZPLA 5HOOA 3HRSA 3WTZA 2Y0MA 1NYWA 2Y48A 2KIUA 3CLPA 4HX8A 5KVRA 2ZKLA 4I3PA 3FXQA 4D7TA 5LLQA 4E2QA 3D82A 2ISYA 4EWAA 5AIQA 5LHGA 4Q0VA 4XF4A 1ZVFA 3NQOA 3QP5A 4KFCA 3OOPA 3E5QA 1Z6RA 2VONA 3M9AA 1USSA 3TGNA 4RGSA 2CAUA 4RAYA 5DCMB 2GIVA 2MHFA 2Q8KA 2MBFA 2EJRA 4JV4A 2XKPA 2WC2A 3GYHX 3CLOA 2D1HA 4O5VA 2ET7A 3H8UA 5LEKA 3KLOA 2ATFA 5HS7A 4ENMA 5BMZA 1XDUA 4BAYA 3FMSA 2G9WA 3GZ6A 3ECOA 2PMUA 5TJJA 4LEJA 2RVCA 5L3CA 1OPCA 2F5EA 2ACJA 1R5GA 1BI0A 3ZN1A 1K79A 4ESJA 3K69A 2P5VA 3PQJA 2XIGA 4J1XA 2EA4A 1YS6A 3I59A 5BOXA 3F3XA 1D3YA 3HHGA 1PUEE 1V3FA 4EJTA 1BBYA 4KMUX 1LDJA 3KP6A 2QQ9A 2XAGA 1XGNA 3ABUA 5BPIA 2QDRA 3LOIA 1B4AA 1F9NA 3MQ0A 1LDKB 5I0TA 1FBSA 4NHJA 2FMLA 1OFNA 1J7KA 4ZZDA 2CWEA 2F2EA 4PIZA 1AWCA 5K5QA 1XSDA 1UHMA 5I8YA 1K78A 3JTGA 1MZBA 3K1PA 2Z3YA 4P96A 1ZX5A 1XMAA 5AONA 4IEQA 4R8HA 3HSRA 1LVAA 4MTDA 4AIKA 2KIMA 1U3EM 1CAXA 1YYVA 2GC2A 1BOAA 3HOTA 1KGSA 3WU0A 4OIQF 2A5YB 3MEXA 5E18F 1LQ1A 2CV6A 2E1CA 5ED4A 1ON1A 4LLOA
chains in the Genus database with same CATH superfamily
3MUZ1 3SNMA 2R5YB 3CJTB 3HGGA 3MFCA 4YNIA 2OZ6A 3CQOA 2HTJA 1RETA 4S05A 2DV9A 1OISA 2E34A 3QU3A 3V8LA 1O4ZA 5IPAA 1R64A 1X8EA 3C7HA 1W36D 2DTYA 3MW2A 1W9TA 4CDQC 2WZR3 1T98A 3CC4I 1W6PA 3A0HC 3D0JA 4ONUA 3DLAA 3PUBA 2CYYA 3NQHA 1T6GC 4IEJA 5CQGA 3I2HA 1RUG3 1PK6A 4ISRA 3FMRA 2VIXA 3CJNA 1TNFA 3BLYA 1W28A 1VTNC 1LNSA 1YHFA 1UZ0A 4AM3A 4XABA 3KFWX 1K12A 3MUY1 3KP7A 1T0FC 1HB4A 2QCOA 1IZ1A 5ACA2 1HN0A 4PJ0C 2JMWA 5EJZB 3WU2C 1VBB1 2P7VB 4S0HB 4NIAA 1QO0D 1REPC 2DMPA 3UKVA 3KM5A 3M3OA 4RB0A 4QXCA 1VMHA 1LNWA 1MR5A 3T4VA 1BQPA 4MGKE 1CGPA 3ZXKA 1E2XA 4PK4A 1KEXA 3OCPA 4MADA 1K4TA 5D8AC 3AP9A 2VODA 4JGZC 2OIIA 2CU7A 5EIYB 5JZGB 3PMSA 3CCVI 2P5KA 2DBNA 1W3XA 1CR7A 3KB5A 2X4HA 4DOZA 5CFCC 2HWB2 3ZYFA 2UUZA 1YRNA 3E1SA 5LBQA 1G8XA 1V00A 5J37A 3ILRA 3HBLA 1GOFA 2WZR2 2ID3A 5J7MA 3S32A 3KEOA 3DPTA 1AHSA 3CF6E 2IS6A 1APNA 2WUHA 1WJAA 4AUXA 2M5WA 1NQDA 1DQ6A 1RGSA 3NNGA 1XSQA 5FFOC 3ACHA 1B59A 3I2GA 5B1BH 1PUFB 5A32A 1S8NA 1IDZA 3LA2A 3KEQA 2OUMA 1FP2A 3ZXGA 2PEXA 1N3PA 3KCXA 4AXOA 1AXZA 5FMDA 3HVDA 4Q5SF 5T54A 3TAYA 2IXIA 4HFSA 3VKMA 2DFBA 5C8CC 2R3SA 2ZGOA 3CUOA 3QP6A 2W5FA 4RSUA 5FZOB 2HOEA 1W06A 3G7DA 5M0TA 2XVGA 3GW2A 3V0AA 4JKLA 2JA2A 4UBGA 1XC6A 1JZ8A 3I9V2 3P9KA 2K2SA 3N4MA 3KEYA 1LRHA 3DQVC 4NWWA 1PHMA 1DUXC 1NY71 2M9HA 4LBMA 3NJVA 3KT4A 3VBFB 3TEYA 5FP4A 2GM4A 4ITVA 5D4SA 4DFSA 2PG4A 1ZAOA 3GFMA 3WGIA 3IH3A 1NX9A 3IB3A 1X1DA 5M5XJ 4U0YA 1W1WE 1SZBA 3RIRA 1CQ9A 3ZYIB 1ZLJA 2KRHA 3KE2A 2YU1A 1VP6A 4PSXA 3E6CC 4AFMA 3RKXA 4HYEA 4IQPA 2D5FA 2L9NA 4QM8A 5DMYA 3ERMA 1XGMA 1S0IA 3VD4A 2LM3A 5ICCA 3HKZN 3Q3SA 4M9SA 1NCQB 2DVBA 2EXKA 2VZ1A 4MGZE 3GWZA 5FDBA 3LGRA 1UY1A 1LJ9A 3VBUA 3H5RA 1ZR2A 1K45A 2B5HA 3WVJA 5GM0A 2IS1A 3S3MA 2LDUA 1FWZA 2P34A 2HDWA 3H5AA 3I58A 3NAPA 1QXJA 2PHUA 2CO5A 2WADA 4LPLA 1ZELA 2GAUA 3RZZA 3FKIJ 3OYIA 3PIJA 1ASJ3 2D5HA 3PNTA 4RGXA 1L3LA 3ZR6A 2M34A 5F39A 4NBQA 2RS53 1HDKA 3R4SA 2W47A 1P9QC 2EQRA 3ZYBA 3PQKA 1E0EA 1JODA 1OLMA 2EFPA 5LEJA 1XN7A 3P7NA 3MN2A 2H0BA 2LR8A 2VC1A 3JSOA 5E3LA 4YFKF 4AI2A 1WKMA 2KT0A 4G6QA 3V7SA 2VU9A 1C28A 2ECCA 2M7BA 2KQRA 2FCVA 3AKRA 1WCUA 1B9MA 1GWKA 3TP3A 5BNNC 4AVBA 3BYWA 4LUKA 1ULFA 1BMV2 3NWSA 2KM2A 3MPPG 1QHDA 2CTVA 4AIJA 1LOCA 1SBFA 3N7KA 3IRQA 3I56I 3TDZC 4XRSA 3B3QE 2R7WA 4V2GA 4ATEA 3N36A 3G6JB 2WAOA 2W1QA 3K4JA 2W1UA 5LASA 5A70A 1BI2A 4DXSA 2WO7A 5FLVA 2LTNA 2Y6KA 4CEWA 3ZKUA 1JHFA 2E7XA 2IXJA 2FDFA 2Y9YA 5E1RA 4TN7A 2RQPA 2DAOA 5CKTA 3SCFA 4FPJA 3K1NA 1A5JA 2WNEA 1OF4A 3GFJA 2W4SA 2DMNA 2MYSA 1FV3A 3FBIB 2OTLI 2RS52 4Y5Z0 3UGGA 1QF3A 4Q0UA 1JU4A 4XONA 3BPXA 2X09A 2B8MA 3MIBA 2PBIA 1LU2A 4LITA 2ZNYA 1MBGA 3VEPA 4Y4YA 3GLXA 2Z9OA 2PHWA 4EJWA 1I5ZA 1T08B 4IW3A 5H6RA 1VBA3 3BIWE 3CCUI 2X5IB 1VBB2 2BXZA 5FZKA 4OLLA 3SZTA 3CU7A 4NNJA 2R30A 4A3BJ 2BFUL 2R32A 4XORA 2F4OB 3PU8A 3TBIA 1B9NA 2VN2A 5GTHC 4CDXC 4HKOA 1KFXL 4M00A 1RNLA 2WV0A 3C2GA 4ZZ5A 3X29B 4EVIA 2JJ7A 2QM3A 5E1ZB 4KG0A 3VDBA 1F9KA 4QSHA 3DF0A 2WINB 2ZKNA 3QWLA 4RFRB 3VHOA 3UJQA 3LWFA 4YW1A 4JRAA 2N8GA 3G6EI 3W9AA 3U21A 5ERIA 3VBOB 3KYCB 2P0WA 3BJAA 1NOVA 3UNGC 4BYYA 2DF7A 1V54H 4CXFA 4Y26A 2JA8J 2BZTA 2NVQJ 5K7PA 3AK0A 3PVEA 5FLMJ 1W5TA 2ZJ2A 3LL7A 4FPEA 5JUVA 4KGGA 4ESBA 4AGVA 3BOQA 4TXWA 2CHHA 4EN6B 2ZGMA 2A68F 1PUFA 3WDYA 3T30A 1FPN1 3W58A 3OEAA 1U0AA 3IDEA 3B02A 5KXBA 4H55A 2QYOA 5TISC 1G3SA 1DGWA 5D1IA 1HJGA 3FXLA 1V4RA 5A3WA 2YG0A 1QXRA 4OYUA 1NZCA 3RNSA 2E36A 1YFXA 4IXAA 1O7FA 4MXWB 2XHKA 1RPWA 5FZOA 3WG4A 1CPMA 1JHNA 3EUAA 1WJFA 3JAMK 2EA7A 4GULA 2M30A 3J7YJ 3GEZA 1PO23 5H9SA 1BZWA 3RYPA 3W5NA 3H9JA 4Y22B 4AEDB 1UB9A 5I0RA 2WNVC 3VKLA 2WB1A 5J48A 1U5IA 2GZWA 3L1PA 2PA7A 1NY72 4CU6A 2VMEA 5FR3A 3FM5A 2RM23 4CCJA 1AYN1 5I91A 5EJCA 1J5YA 2JB8A 1PYVA 2G1MA 4GO1A 1G9DA 1AX0A 2QZ2A 1ZR4A 3VV1A 5T52A 4AFDA 3MAJA 1OC1A 2DTRA 1CAWB 1BIBA 2AC1A 2QCSB 1J3PA 4OULA 1MJBA 2YB7A 1RUD1 4ZDPA 4KI5M 1MMNA 3L00A 3KV6A 1W6NB 5K9YA 5JLXA 4AFCA 5TSWA 1B6AA 3O1VA 4U7DA 4XUNA 4LD5A 3AL0B 4EN0A 1MDMB 4R1HA 4UV8A 1V9U3 1DYPA 2E1OA 2VM9A 3QYFA 1L7LA 2CGOA 2JSPA 4ZU5A 1LFBA 2LKSA 3NL1A 1YI2I 4HVQA 1DU6A 1QQIA 2R7VA 3WCSA 4V1PA 1H1MA 3HBZA 5LHIA 2JIJA 1JW6A 2JIGA 1AJKA 5DD8A 3HIFA 4UFLA 4RA0A 3JXSA 3LAGA 2K9LA 1IUYA 1ZBE1 4BL0B 3OBRA 5AVPA 1PO22 1S5LC 4NPRA 2OUHA 1UOBA 3FUQA 5FZ4A 4EEFG 4HETA 2LBFB 1FATA 3ZMOA 4NVPA 4FFGA 4O61A 3ILFA 2RM22 2YFZA 3N7MA 2R063 4MGSA 1MS9A 5E3OA 2QWWA 3IDAA 3LKJA 3S7EA 2ZGTA 5CVJA 1UZYA 3WHCA 1P8JA 3HSEA 4LXLA 3V4GA 2J22A 4HX7A 3HJRA 2ZFWA 4WXDA 1QJEA 4NHMA 1I27A 1YIFA 5L7OA 4UFMA 3E5UA 2E7WA 2OPWA 4OAYA 2ZGRA 4G94A 3NV1A 3KQ4B 1BYHA 3E5XA 5F2SA 4DUVA 3WNOA 3ISPA 3MMYB 1MBKA 2BVLA 2QBYB 4HOBA 4KH9A 5J8CA 4Z92B 1IXSB 1X2NA 3WF4A 2MC4A 1I9RA 2A6YA 4DB5A 3MBWA 1S0JA 3ZQQA 4AHZA 4XCBA 2ADUA 3O7OA 2ARXA 2K85A 4WZCA 1R091 2C9AA 2KRFA 4BQAA 1VAVA 4IO9F 4XDOA 1OA3A 3ZFEB 3C8XA 3J8F1 2HTSA 3M1HA 1VFCA 4UI9L 2DTZA 3CC7I 4WBBA 4NHLA 4TLFA 2MD5A 2UWMA 2TEPA 1OD5A 3VN4A 1Z7S3 2D5VA 3N9QA 4F91B 1H8TB 1DFQA 4QMAA 5FP3A 2VT3A 2TRTA 3ZOIA 2R1DA 4A3KJ 2BBVA 2RC4A 5GZFA 1GP4A 3GTJJ 1HW5A 4C2MJ 1X1BA 2YBKA 3TP0A 4P9FA 4JX5A 1SMVA 1D8KA 2PI0A 4HF2A 2IA0A 1HSTA 5E16A 2WZPP 2X5IA 4UVCA 4UF0B 5L9BA 4Q4ZF 1TZOA 1E5RA 2E1MB 5HDGA 4EQQA 1FY7A 1ZZCA 1KDKA 1WLDA 1SAXA 2Y6GA 4OHVA 2PJPA 1TQMA 4LA3A 4LKSA 2E35A 2G9GA 2NN8A 1SVOA 2OBPA 1H1AA 4LBKA 4HN0A 1UMQA 3OYAA 2R93J 2JT1A 4FE4A 2XH6A 4NPMA 4AHWA 4MHRA 2GC0A 4MO3M 2A6HF 3MIEA 2PJRB 1C8M3 4EM0B 4QM9A 1QMJA 2VZOA 3UKTA 2ZXQA 4ZPIA 3UGFA 4PJLA 1AX2A 2V9KA 2KDOA 2XAHA 1AKHB 3I64A 4FX4A 1NLRA 2YC0A 4ZZ8A 2PLYA 2SLIA 1XMXA 2J5PA 3FMQA 4II3A 2F48A 2Z2SB 1RUI3 3QCWA 2EIMH 2OA2A 4MHGA 2DBIA 4PGGA 1SMYF 2DOAA 3H3UA 2VE9A 4HLYA 3DXJF 3PSIA 5FXZA 2DFEA 2PHTA 1LENA 4DZGA 1DLLA 1F4AA 2LTPA 4L2NA 1W0TA 3M4OJ 1ERDA 2R071 4M6VA 1V6KA 1D2QA 1FOXA 3B6AA 3OPTA 2O3FA 5IT6A 3EUHA 2P81A 2W85A 3F6OA 2KRCA 5FYUA 1XPXA 1XNKA 3ZXEA 4GRIA 2EVXA 4N53C 3KPHA 1YQ8A 2LVSA 1GOGA 2JE8A 4Y22A 3QOPA 3FWEA 4AEDA 4XF3A 4IEYA 4Q4X3 3W2VA 5FCCA 1B35C 3HN1A 4Y5TA 1VQMI 2VT2A 2CSGA 3JREA 5BNPB 2KLOA 3OBAA 2CUZA 3S1MJ 2BGCA 2XQRA 3GZ5A 1TC3C 5DEQA 1N47A 2GNTA 3EB7A 1CAWA 4QX3A 4E2SA 3RQ0A 1RIOH 4QWQA 2QQ8A 5JSOA 4GD4A 5EPAA 2Q8OA 3DPRA 5JI7A 4PSWA 3DECA 4RB3C 2R7FA 3W6KB 3T1LA 5DTDA 1C1FA 1H9WA 5IVFA 4NIHA 5CFDB 1QU0A 1MDMA 1RUI2 5DPNA 2FMDA 4LLLA 3CO7C 4XE9A 4R79A 4KNCA 5EJ3A 5KR7A 3WSOA 4OI1A 5JOZA 2W1OA 1ZK8A 4XC9A 1GVDA 4NAMA 3BUCA 2J1UA 1S29A 4XCAA 2V5DA 2DJNA 4ASMB 2CFOA 1KFUL 2GNMA 4GWJA 1P4XA 1ZBE2 1FX7A 2DXIA 1AXYA 1XU2A 3QQAA 2DFHA 2BFUS 4M3EA 3OD4A 1WPKA 2M8GX 2RDNA 5FO7B 2CUFA 2LBFA 3BU0A 2A6TA 2R0QC 1QBJA 5LA9A 4A3MJ 2PAKA 4OIPF 3JRFA 2Y60A 5GPCA 3R4UA 4KMQA 4L9NA 4BISA 2HWF3 2QLZA 3WTUC 2IFWA 4JCKA 3BG3A 3KZZA 3N05A 1AR71 4E8DA 1I3AA 1QJX3 1NUKA 3I2JA 1T8IA 1PK6C 5IP9J 4C3IJ 3BOWA 2DU0A 2VOVA 4MUVA 4AG4A 4AL9A 2QBYA 5LBEA 3X2QH 1IN7A 1XNAA 3LEMA 4UXNA 1YYNA 1PIV3 3FDYA 1LCLA 1VQPI 2WYFA 5BQTA 3L9FA 4G4FA 2RMU2 5E6HA 3BR6A 1R092 1C4RA 1YLLA 2RQQA 3KVAA 2B7EA 3J8F2 4YRVA 4HG6B 4FCYA 1XCBA 2MFZA 3DFGA 3EPZA 4HNUA 3ZMUA 3DTIA 3RJRA 2RS33 3BCAA 1GQGA 1O57A 3I3BA 4BB3A 1W39A 1R1ZA 5JVGF 3TO9A 2H94A 4L11A 1R23A 1N1TA 4KG8A 2XMLA 2OYZA 3IAS2 1YW8A 1VMJA 5CLSA 4Z07A 3BG6A 3HT1A 3SXYA 4GB31 3NW4A 3S0MA 3TOAA 2ZFUA 2DDUA 4KBBA 2Z42A 1WLCA 4AYBN 1UJ8A 2WY8Q 3CZJA 3KT1A 1F31A 1O4TA 1ZYBA 1QJX2 2QKDA 2K7LA 1C8NA 1GANA 4QX8A 3ZXFA 4JAAA 2ZXHA 2K46A 3TOBA 1YRZA 3VHRA 5HLTA 1PIV2 3MF6A 5DZGA 4B4QA 4BM8A 4YIRX 5FZ0A 1CIWA 1FZPB 4DRRA 3TRSB 3N97A 5GLWA 5DG2A 3RG0A 1TLHB 2D7FA 4ES8A 2PJRA 5B66C 2HQ5A 2WSVA 2MH9A 5J1UA 4N9HA 2WIIB 3PHMA 2WAEA 2VMHA 2BGOA 2PAEA 1AKHA 2WA4A 2X6XA 1HBXG 4ITCA 2XOMA 1ULDA 3AZVA 3B00A 3AVRA 3U75A 1IC8A 3I3DA 4YFZA 3ZX7A 3RKQA 1W0PA 2RS32 4KYWA 2VECA 1MMAA 2JJ6A 1TW3A 3B7MA 5M3MJ 1UWWA 2ZHLA 2XASA 1BHGA 1SFOJ 4FFIA 5IOZA 1O4YA 5FZHA 3S1NJ 1MMSA 1J9IA 3S3OA 3FXKA 3BN6A 1UX7A 3LNQA 1DGRA 1QJZA 2CQKA 1QWRA 3UR3C 3TYJA 4HXCA 4HQEA 4AWXB 4OHWA 1MIJA 2A5WA 2HYXA 2QQMA 3POYA 1JTXA 1Q8VA 3VL9A 3TWIA 2ZCWA 1HA8A 1SLTA 3PU3A 3WE3A 2G7UA 1N1SA 2IVIB 3I8TA 1NCRA 1A3KA 4WCGA 1HB2A 3AL5A 3B5LB 4K3UA 5KK1A 4KL1A 4W4ZA 2W1SA 4AU7A 3DPUA 4QPGB 1JHJA 4NIGA 3POBA 2P7CB 3VBUC 5IWFA 2E26A 1R1VA 2EIEA 4RS8A 5FRNA 2XAFA 2VPLA 5DAVA 3GBFA 2EFQA 2WO2A 1WSUA 3NAPC 5FLXZ 1WMDA 2YROA 1X4PA 1VAMA 1IF1A 2FBHA 2RG4A 2BWCA 1YFYA 2IC1A 2K4BA 5FQ0B 4C1WA 3N7LA 1A6CA 4WVVA 4GH4B 4YFWA 1BI3A 1QRYA 1WLTA 1ZGAA 4LT5A 4Q5OA 3WXPA 1V6OA 3WE2A 2QENA 4D8MA 1N78A 2D1VA 1IG0A 4HKWA 3L2CA 1R6RA 4KWLA 4D7NA 3FHNA 5FZ3A 5FZ9A 1X1PA 3A2KA 2E5ZA 4JTNA 2EF6A 1V5GA 5AC92 4R4ZA 5H9RA 4MYEA 4DQ2A 1Z67A 5E3MA 3MFAA 5G05L 5AFBA 3CJIB 1IS5A 5J4YA 1R7JA 1ENRA 4LR4A 3PURA 2WN3A 1I5PA 4YZ2A 1P2FA 1CJPA 2VOKA 4A4AA 1QQP3 3TOJA 2HBUA 4TV7A 2LNBA 2P2KA 2ZGKA 4BQWA 1HRV2 4XLNF 4Q4Y3 2X1EA 2Z5UA 2JA5J 1CX4A 2DA3A 1YEWA 4CEWC 1V5EA 2IEKA 4BQQA 5DCMA 1Y0NA 4I01A 5D6FA 1HKTA 4IE7A 2DOFA 2O7OA 1UAIA 1YW9A 4LO8A 2NM1A 4OAZA 5HCAA 3QLQA 1OYYA 3DP7A 4KISA 1MS0A 1PGSA 4OQ8A 2EFNA 5JAXA 4HV5A 2AH2A 3KP5A 1HX6A 3DEUA 4ZYEA 1QY4A 3CO2A 2A71A 3USSA 4PUSA 4LK0F 1GZTA 2HI3A 3RQIA 4XAAA 2D98A 4BA6A 2ZABA 1EPWA 1WQ2A 2CW0F 1OLRA 3AM2A 1RRJA 4MO7A 5JR2A 2D6LX 3L2RA 2YBSA 4CP0A 4N7IA 1GLHA 1BR4A 1GNZA 2V9VA 1GICA 1XGOA 4Y17A 3W2AA 2FXAA 3FLRA 3RVHA 2VQHA 2VUAA 2A6WA 2R7OA 4N4OB 1C0WA 1W0OA 1OJLA 1JH5A 2A05A 3ZXSA 5E88A 2Q1MA 4QDQA 1OA4A 1R082 4ZTFA 2GP3A 1ND2A 2L9LA 3OYMA 1HN1A 3O14A 1UY4A 2Q8CA 4FAGA 2C9KA 2EV5A 4GFBA 5IAXA 5JI6A 1AL23 3ASIA 2A3SA 2GIZA 1RMU3 5TRDA 4ENNA 4QGNA 1HLVA 5FLIA 4E4SA 5EEHA 1O3TA 2EXIA 5KXEA 4FPKA 4EMSA 3JRAA 2QKMB 3NRUA 4WM8B 5D4RA 2BOJA 1XE0A 4JQRA 4CDGA 5HLIA 4MTEA 4QIWN 4FPLA 4B4RA 3URFA 5B4XA 5EYXA 2TNFA 2L2OA 2JKXA 3LSHA 3I3QA 4PBOA 4HX4A 4E4ZA 4A5NA 4BPZA 4MH0E 4QQ2A 4NHXA 5KXCA 4YIFA 2D3PA 5F0CA 1GQPA 2XBO1 1XNBA 4HVOA 3FLTA 3N9PA 1IG3A 2IJLA 1UPIA 4FOWA 2R061 1MS5A 3NAUA 2ARBA 5F37A 3E3VA 4WM7B 1AX1A 4AQSA 4Z2WA 1TMF3 5LBCA 1Y43B 3L2UA 2Y0MA 3CLPA 3ZOBA 5KVRA 4I3PA 4B3AA 4LO7A 4E2QA 1XNTA 2R7RA 3GM8A 3TMOA 3PL0A 2KIQA 5JDBA 4IV3B 5LHGA 1MBFA 3AG3H 1SANA 3NQOA 2DODA 4PLNA 1JU3A 3GGLA 1F2NA 3SH3A 1P7IA 1VPHA 2QE3A 4C91A 5A3PA 3SEPA 2ZZJA 1LOEA 1RMU2 2CAUA 4RAYA 2GIVA 1WA6X 2MHFA 2RNGA 3AC0A 2MBFA 3O1TA 2EJRA 4JV4A 4YELA 2G4IA 3CLOA 1BCXA 2ET7A 2F4LA 2R4GA 4QPGA 1UMHA 2Z4FA 1TT0A 5HNHA 4BACA 1MEC1 3FMSA 1QOOA 1BBT1 1T6BX 2LH9A 2PMUA 4GA9A 3C7OA 1F8VA 5HPOA 2R7QA 5TJJA 3KYLA 3ON7A 3WF1A 1UOGA 1X3WB 4DOUA 2XPUA 3JQXA 1H2MA 4P9YA 2LYCA 3S57A 3MEPA 4IL7A 1W6MB 4CVUA 1D4M1 2P5VA 2LREA 2BOLA 2M3AA 2YC4A 3HHGA 4QU1A 3POSA 1T33A 4KMUX 1TMF2 4B1RA 3LOBA 2QQ9A 3ABUA 1KXGA 4LBQB 2ZGPA 1IV6A 3LOIA 1B4AA 1F9NA 2VO5A 1LUJB 4E7LA 3K4NA 1AR61 1J7KA 5FYVA 4G6TB 4RDUA 1AWCA 3LIGA 5K5QA 3JTGA 1NT0A 5FZAA 5FKNA 2CWSA 2DA6A 5AONA 4LLFA 5L7OC 1IRXA 4IEQA 3VWBA 1IO2A 1AVBA 3CJIA 1LVAA 4MTDA 2KIMA 1U3EM 1ZA4A 2BY2A 1YYVA 2GC2A 3OSFA 4CCKA 5T5JA 5JLWA 1HV1A 3RZLA 4BBSJ 3SEQA 2A5YB 3MEXA 5DM6F 1PNFA 2E1CA 3WNLA 4BQ3A 5FJ8J 1H2NA 4G9SB 3WQ0A 1EA3A 1W9WA 1P6RA 2V5YA 4OWRB 2PLV3 3UL2A 3F6VA 2NNNA 5ILVA 4YLZA 2HEVF 2YS9A 2VNGA 2QQAA 2UYBA 3U10A 3SHFA 2X9DA 5GAHJ 2GN3A 2JDZA 2JZYA 1ULEA 2WB1N 2M0CA 3S93A 1T39A 5FZBA 5BNOA 2BVMA 3GZUC 5FPZA 4Z6YA 4KU7A 2VTFA 3VYTB 2DOEA 2ZMNA 1MMGA 2PHDA 1SD4A 3WY6A 2ERFA 1QNWA 2QQWA 3U4XA 2WT0A 4HDUA 3ACGA 4M3CB 5I8SA 4HANA 2XRLA 5LBBA 1AR83 2KXLA 3KLNA 3CHXA 2X5IC 4FOVA 1GUUA 4C1XA 2VAUA 1W8WA 1DP7P 3LQRA 4E7IA 2BZDA 3LA3A 2R043 2Y9ZA 2JX9A 5FKMA 3OSGA 4JQFA 1HSJA 1UZVA 3RMYA 4HQMA 2WLPA 1MZ5A 4FFHA 3VHPA 2VXDA 1DDNA 5FZ6A 2VW0A 1AA7A 4A3FJ 2Y0IA 3M8LA 1G3TA 3V8KA 1LU1A 4XF9A 4QPWA 4Q4V1 4FO9A 1DIWA 3TEWA 4E7JA 3T0AA 3KSCA 2BQPA 2PLV2 1ENSA 1F5TA 3HOSA 4LBJA 5JOYA 2TBVA 4CPBD 4AQ2A 4OFGA 1H6YA 3AMQA 1AL0G 1G9AA 3I7DA 3MKYB 4UBHA 3M07A 3HOXJ 4CDUC 3Q8BA 4FP2A 4D69A 3WDUA 3LZZA 1D1BA 4CA0A 4EYUA 1CAUB 3HHHA 3M1CA 3JRDA 1A36A 1JUIA 4WM8A 1YO5C 4CP1A 4EROA 3WT3A 3ZPYA 3CQZJ 1ZA7A 3I59B 3VFZA 3IIIA 4AZZA 4UAPA 5T3NA 5A7QA 2H0VA 5J40A 2E33A 4QD2A 3BR5A 5KXDA 2VG9A 2WZ8A 2OU2A 3GJAA 4EQVA 1YFWA 1RUOA 4EN7B 4EJRA 4GJZA 4CXYA 1WI3A 3IC7A 2BDRA 5JIAA 2LRDA 3EUHC 5HLHA 5K1YA 1S0DA 3W6VA 5D8KB 3HQXA 2MG4A 4R9CA 2VBZA 1GV5A 1K78B 1K42A 2R042 2UU8A 4WM7A 5B3SH 1AR93 2VPVA 3CKHA 1O8PA 1WVRA 4AEDC 1DGWX 2SBAA 3VSLA 3KVBA 4IQ4A 4QDSA 1N1YA 3H8RA 2O0YA 1VAKA 3IPVB 4GGGA 3HKZA 1RUH2 5IK4A 2DT5A 2ZXIA 4FOQA 3D6EA 2PMHA 3LDKA 4M74A 2I8DA 1ODMA 4RHV1 4IV3A 4PT6A 2VZRA 4Y1VA 2V7FA 2VI6A 3NKTA 3IMMA 2X8KA 5K5RA 1GYKA 3VDXA 3T0YA 4P9WA 3EBRA 3K77A 4OHZA 2FD8A 5IYDJ 3TB0A 3W59A 3DPRC 1RUC1 3NJYA 4AF9A 2F5FA 4EN9B 2VVDA 3POGA 5JLVA 5FYSA 4CCEA 3AL0C 5CG9A 1KQ8A 2XF5A 3PVOA 2HQNA 4QGLA 1PVC2 4RYDA 2NQYA 4OOIA 2ESNA 2WWUA 3FBNB 4QX5A 2ZHMA 4DY3A 1VQNI 2Y38A 3R4DB 1BBT2 4RFT0 2W95A 5HV4A 4AEJA 5A80A 1R1A1 4AYUA 1ORKA 3OUJA 2Z5WA 2FCUA 4PJYA 5C9AA 2XJSA 2WWYA 1W6MA 2DA2A 4DUWA 4O65A 1E5HA 2OXBA 3VLBB 5EP9A 4L92A 1K61A 3OYKA 3GTGJ 1LEDA 2JA6J 2Y6HA 1U5XA 2RS12 1Y9GA 4DBRA 4CICA 2VCAA 3BB6A 3KV5A 3IDCB 4M01A 4XRSG 1Z21A 2WQZC 4HPKB 1K6OA 1OR7A 3IL2A 1WMXA 4JX6A 3HAGA 5FZ1A 1IS4A 2ELJA 3HT2A 2HWE3 1ZLKA 2KZGA 1BLZA 1E5IA 1SAUA 4CUBA 3PSFA 2ENRA 2QUFA 1H1IA 2WZEA 5A3TA 2AS5F 1MNEA 1YXWA 2CSOA 5DABA 2WT2A 2RR13 4Q47A 2LRPA 3BIEA 3OY8B 1WJEA 3AYDA 1WA4A 1AYM1 4Q8LA 3AYEA 1PJRA 1WCDJ 1OYIA 2ELKA 1IOAA 1W6OB 3BALA 4B1MA 4IQJA 4KWJA 3QACA 1LGBA 2CNAA 3GHNA 5IHRA 4PJNA 3GCMA 4EJUA 4I7HA 5IVEA 3FIWA 3UKNA 2K0GA 1Z9CA 3RZDJ 3BOPA 1ZM1A 4IEWA 4F93B 4XIKA 2ELHA 2FQ4A 2BTVC 4UWDA 1W2NA 4XMAA 1W7PB 4YG6A 4II2A 3LSRA 2VMDA 4M6XA 1X8MA 2DBBA 3QH7A 4WVMA 2VQGA 3WDWA 1DG6A 2E5NA 3CZ6A 3O1RA 4N0BA 4I3GA 3CL1A 3BJOA 1K5MA 5BXXA 4YW5A 4MXVA 2ZEXA 3KP2A 2OJED 1RUNA 1YITI 2JXAA 2OW4A 2XJPA 3VD3A 2YR2A 3S30A 3SZPA 4FFFA 4HL0A 3JCUC 3A01B 3N9NA 3J80K 4A0ZA 3RPQA 4M3CA 3VOEA 3HWJA 1NE6A 2WJSA 5J47A 4XJ9A 1IQAA 1X9PA 2ZNZA 4CXWA 2E1MC 4R9AA 5HDNA 3LAPA 5A6XA 3VBRB 4YW7A 2VCMA 3W3CA 2LG4A 1OLQA 3B9CA 1Y1VJ 4BY7J 1WJBA 3TNPB 4C0HA 3OUIA 1QZZA 5IATA 5IYYA 4JYKA 2K4JA 4HLTA 5I0SA 2VBWA 1X3UA 2OQGA 4Y1XA 4Y4RA 2ARCA 2COMA 1BIAA 4OI0A 2V4AA 1UFMA 4J1WA 4CU7A 3EYYA 1S7OA 1Y6IA 3G2BA 3U37A 1HRI1 1V5FA 2ZHNA 4FI9A 3ES4A 1CAUA 2ZA9A 3OPZA 3ABZA 2E7AA 1EUUA 4FPOB 2B39A 4MG2A 4E4DX 5LBFA 3S2WA 2GQQA 4QKDA 3NV2A 2VBBA 3OYWB 1UNBA 4M73A 1AXKA 3MW3A 2XKOA 4JKKA 3WG3A 3N7JA 3WDXA 2O8XA 2PAMA 2LC2A 4ES9A 4XBNA 1I3QJ 3O1UA 1QJU1 4AAXA 2I5UA 3A4UA 5ABJB 5BV6A 1KYZA 4YIIA 2OA4A 3FBMA 3CUQB 1YTYA 5BS6A 2NP0A 1JTZX 3KMHA 2JD4A 2Y31A 4A0YA 1G9FA 1NCRC 2OZUA 1MBHA 1Y8QB 1VRH2 1KJLA 3K51A 2OVUA 2WFF1 4BIOA 2O5RA 4GMP1 1R36A 2R92J 1E57A 1WI9A 5DUXA 1QDCA 1AUYA 3WW1A 4HVRA 5HCBA 2J1TA 4DO0A 1W03A 3D5LA 2VQLA 4XUQA 5IK5A 3LSMA 4LK6A 3WP3A 3TEXA 3BR3A 1HLCA 4RAFA 4Q1RA 2DUPA 2CDOA 2P3JA 2KDZA 2DTWA 4O3MA 4DXTA 2V4VA 5E20A 3FX3A 1GQHA 4ORFA 3VZOA 4G8XA 1WKYA 2ZXWH 2G0EA 4IOAF 3BR1A 3ALQA 1U0JA 2A61A 1ZH5A 2HQRA 1XSXA 3HZJA 2E6VA 1O7LA 3LD8A 4QGMA 4C2UA 5GLVA 1FX5A 4LKDA 2JPCA 5HV0A 3PUSA 1R49A 2YU9J 2DDBA 4ISQA 2HXIA 3MYXA 2E2IJ 3BODA 5F1RA 1R1A2 1MS8A 4Q4W3 1ND3B 2QQNA 1VQ9I 4HNVA 4COYA 2GXGA 1SD7A 1BL0A 3NNLA 4E4HA 2F5CA 1BJAA 3ZFFB 4FASD 4JOMA 3BPSA 1XNCA 1I6HJ 1Z1DA 3G1MA 1RUF3 3OB8A 1R71A 1YQ6A 5IVBA 4GWMA 4YARA 5FUNA 2BW8A 4LE4A 3CZUA 4D6RA 4GKYA 2W08A 5FYYA 4HPKA 2JDPA 1B09A 3BTZA 2D6PA 3T08A 2BW3B 4AIDA 3LFKA 1S4CA 1TWFJ 2BBYA 2VULA 3E1F1 2ZEYA 3RZOJ 1EAH3 5FY0A 2GDFA 1J84A 2V6EA 1VBD1 4JZRA 4E9KA 1NXMA 4P14A 1AF9A 2B7YA 2HNHA 4FTBA 5TGTA 3ASNH 1UZZA 1IS3A 2DCKA 5A7WB 2Q0AA 3PLQA 2A3YA 4DYRA 4MOAA 2XPVA 2PHLA 2K9MA 2WV1A 4L5IA 1JKPC 4MEYF 5JOWA 2YC2A 1W6OA 2ZX4A 2K9SA 1RUJ1 4WVWA 4YM2A 1V55H 2HGCA 1TBXA 4MGRA 4ZHNA 1H6XA 4FBFA 4I02A 5LRSA 3WW2A 1OCTC 3VODA 1EH7A 5LA2A 1PX4A 1Z77A 1ZG1A 2GU9A 3PIGA 4OU0A 1HV0A 2XJUA 1YIPA 2MLGA 2ID6A 1J0RA 1ZYRF 4FCAA 2X85A 5FZIA 1WZXA 4N4NB 3JR9A 1IRZA 3OYBA 4FQGA 3E97A 3ULQB 5I8TA 3I71A 3VD7A 2XSJC 1FOD3 1ND2C 1N3OA 4IZZA 3MI8A 2W9XA 1GV9A 2D44A 2KZVA 3A01A 2XB6C 1UXXX 3VDDB 1H88C 1DP0A 5FMOL 3P9IA 3CDZB 1SVLA 4XUPA 2XRNA 5GTIC 3R0RA 2ZMEA 3S16J 4DZPA 3OGGA 1NHAA 4K40A 3VBRA 1MSFC 4NB5A 1NG0A 3RQ4A 2YSRA 4BJ0A 1U9NA 1HB3A 3PTYA 5CKMA 2VKHA 2XPWA 2C24A 4IV1B 5FZ8A 2EZIA 5K7ZA 4FOYA 2VZUA 1W2OA 4XNFA 5JHUA 3OYFA 4P1WA 1MJAA 1XB9A 3HRTA 4FTHA 1W90A 1FNZA 2WNUB 4L97A 3M3YJ 3LFMA 4M3FA 2OUJA 4GQ7A 2VOPA 4MIMA 4JDMA 4A93J 2QEXI 4A12A 3O1PA 5EEGA 2A6EF 3DU6A 4M4RA 4AOCA 2W7NA 2IA2A 3DN7A 2X05A 4M3CF 1OQDA 3ZFGB 4AVAA 1SFKA 4Z2AA 2LROA 3O1OA 3BWGA 3G3ZA 5C4JJ 4A6DA 3J7HA 4YM3A 5FREA 1UU6A 5IVYA 5K4LA 2PQQA 1XTAA 4HRIA 4BIFA 2YFUA 1SEFA 3BTLA 5DAQA 4BQXA 1FOD2 5J98B 1W2UA 3A1YA 2W39A 2A73B 5T55A 1YFHA 5ABJA 4OHYA 4XN0A 4Y7NJ 2DVGA 4A6EA 4ZZLA 1D7PM 3O2PE 2AREA 4RR3B 5DZFA 1FTZA 1S2BA 1TNSA 3BTYA 1BVP1 2HWD1 1XG1A 4FPYA 3U9GA 4RD7A 3JRCA 5LWBA 4P9LA 3WDTA 2RV9A 3KD4A 5B1AH 1A04A 2GMMA 2OCCH 2LP0A 4QQOA 1SLLA 4MZUA 3HN3A 1X33A 3DEEA 4AD9A 3C7FA 4QPGC 3CCMI 4BDVB 4S2DA 3WUCA 2VMFA 3F8FA 1XD7A 2YV8A 3LDRA 3PNVA 4OUMA 5FYZA 1PVXA 4WVZA 2BY3A 2DURA 5F2WA 1RL3A 1D0YA 5FYMA 4A3CJ 2MA3A 3NWTA 3SISA 3FHIB 4QB1A 1WUVA 3ZQIA 4L0YB 1YLFA 1VBC1 5CBLA 3BPZA 1AR81 2JSCA 4AVTA 1JYNA 3T1BA 4CDQB 2VQUA 4UFJA 3AZWA 1VMFA 4XTPA 1FMD3 2VKVA 1KS5A 1UMZA 4S04A 2FDIA 5I0UA 2LLKA 2YU2A 5JI9A 2YDEA 1Z0HA 1X50A 4XOTA 1PGL2 2B63J 1KQ0A 2X0LA 4BE0A 2E2JJ 1RKTA 4M71A 4DPNA 1NK3P 1UF2C 1GLNA 3COAC 5FB2A 2BVBA 3S8PA 3T4HB 3CJIC 4C2TA 4ZYAA 4LKFA 3IV5A 2NVYJ 5J3LA 4HT1T 2J1SA 4R9DA 5EZHA 1DU0A 1DCSA 1L0OC 5IT9Z 2P3YA 1E5SA 3WTYC 1GOHA 1TZLA 2EK5A 2X6YA 1QHGA 1NA1A 5ICEA 3L9JT 2VOXA 1NG6A 2BY0A 2JN6A 1TME2 3V7RA 1QOSA 3N9MA 1FBUA 4NQWB 1CQTA 4PFPA 3K7AJ 3AP6A 1VBD2 3JZVA 3DV8A 2FNPA 3VBSB 2P3IA 1BK0A 5CFCB 3SDGA 2NAZA 2GMPA 2MLKA 3AFKA 5DXDA 1SCRA 2A3WA 3WG7H 5DS9A 3JU9A 4IEVA 4JHTA 4QQPA 1YIOA 5BNOC 3ACFA 2O0OA 1SBEA 4L8QA 2IGKA 1YHQI 5F5AA 4L9TA 5EFUA 5F5IA 4JGYB 1FMD2 1NKGA 4I0AA 2VL4A 2IPQX 2B42B 5A7OA 1Z7UA 3HUGB 1M1EB 1SDDB 5D5UB 2LY1A 2CW8A 1OUXA 2Y6JA 3ZSEA 2EPFA 2Z16A 2HJIA 2W52A 1FYUA 4IHSA 5IVCA 4IHVA 2YPDA 2V26A 4K1ZA 5D5XB 4DRVA 2P6SA 2QUOA 1MNDA 3SDBA 1QGPA 3F8BA 2KD7A 5C8CB 3O8HA 4JDOA 4BQ4A 2CAVA 1BK1A 3RPUD 2ID4A 1XS9A 1U2WA 3MD2A 1U78A 4CEYB 3CF2A 3TO6A 4V19K 4Y24A 5ACA3 1YIJI 5FO9B 3LSPA 4XETA 3HEFA 2L7FP 3R61A 4Q26A 4WXHA 2XHNA 1POV1 1LR5A 2QJVA 5J4VA 2CQ7A 2X29A 3AYCA 4QQHA 3THCA 1MNMC 1VIWB 2VUJA 3DUIA 2G19A 4WM8C 5IYCJ 4ARYA 4BK5A 4LBOA 2MEV1 3OGSA 4LB5A 1UG0A 4CH7A 5IFPA 2HWB3 3NVCA 1JKRC 5FOJB 2WNUA 3LSIA 4U0WA 5GP9A 4QPOA 3HOWJ 2RVAA 1TWGJ 1R00A 5FKLA 1ZREA 2JK3A 3WV6A 3USUB 1WJCA 3QRFF 1IG7A 4BLIA 5C6CA 3WGGA 1W0NA 2JPBA 4P5YA 3WOGA 2FMYA 3T1MA 3ZDVA 5J3UA 3ZFGA 1YFUA 3S2HJ 5ANNA 2DT7B 3ZIXA 3TEDA 1SD6A 1S0GA 2E63A 2ZX0A 2ME0A 5FPVA 2ZX2A 4M4PA 4WM7C 1TWHJ 3M8JA 3T3YA 4LG0B 2BV4A 1PGW1 5DM7F 3O3KA 3PFYA 2OQ6A 2IGOA 2IGNA 1PVEA 1HXS3 4M0HA 1IN5A 2DYRH 1UYZA 4G6DA 4B4CA 5FMCA 4IV3C 1KZHA 5F64A 1NLSA 1J75A 1GUIA 4HAMA 1BN5A 2VZPA 1Q8OA 4RR3A 1XDSA 1OD3A 1DQ2A 2UWAA 1CZVA 1JMUB 3M70A 3KWVA 5F5QA 2HWD2 1FYMA 2QTWB 2DK5A 1GV2A 3BTJA 2Y64A 2D93A 1RHI1 3HBKA 1QZEA 1YJLA 1VB2A 3POFA 3QBQA 4EATA 1OCPA 1JXSA 4CU8A 2KJCA 1LOBA 3F95A 4KIBA 2STTA 1HDDC 3NKGA 5F1JA 5BNNB 4LB6B 1W9FA 3SH4A 1X4OA 4LLGF 5FY5A 3FKJA 2K5CA 2FQPA 2Q1FA 2VKDA 4RGAA 1FEXA 1BC7C 1JTYA 1BM9A 2X51A 3OL3A 4Q1PA 1Q3EA 1Y56A 4K20A 3WHTA 2LMDA 5C9AC 4DGWB 3WW4A 4JDNA 4HBNA 3AFGA 1SLIA 3FE5A 4IEXA 4IEZA 1QH7A 3EQLF 3CCSI 5FYHA 4QHOA 1DQ1A 1J1TA 2PFBA 3V0BA 1IJWC 1VBC2 3HYIA 2QVSB 4CDQA 4YG2F 4P9IA 2WR9A 4UUSB 4XFAA 4CCOA 3TQNA 4UVBA 1HXS2 2LW8A 1NLQA 2JD9A 4NN0A 1OR7C 3OSDA 3TN93 3WTSC 3WTVC 4B43A 4EGYA 1V6LA 5HLGA 3GTMJ 1KITA 3OIPA 1RUE2 2W68A 4XSZF 1G9CA 1R1TA 2X48A 1OF3A 3PL8A 2NPIA 3MKWB 3JD71 1ENXA 3LPGA 3IKVA 5FMOS 5CVRA 1ULOA 2QQPA 3GDBA 2VW1A 3FMGA 1JHHA 3J7MA 2JENA 2BE5F 1D1AA 3ZQLA 4DYQA 1IKQA 2HWVA 2HKOA 5FUPA 2C1FA 5CISA 3WTXC 1SMTA 2VC0A 1FLIA 4AI8A 2FOWA 4X6RB 5T50A 4IHWA 1D0HA 2N7GA 2IXLA 4IETA 1JUHA 5JXHA 1OQYA 4AHXA 1COV1 4L0PA 4A3GJ 3LE0A 1EV11 2C4XA 3VBSA 3O6BB 1JZ7A 2PQ8A 2B46X 5CFCA 1LVKA 2OKXA 1OH3A 1S2KA 4ZYGA 3H7YA 1XJAA 4QU2A 1K3IA 1X36A 1ZBA3 4IE5A 4D94A 3ACIA 3K4MA 1K5MC 4LIVA 1EPZA 5L3DA 1FBQA 4TSVA 3T2PA 1ZZ6A 5DDJ2 1SFNA 4I2OA 3C2UA 1N75A 2TCTA 1FYKA 4JGYA 1IAWA 3IZOA 4YVWB 4L18B 4XMIA 5FY7A 2QBXA 2H09A 3TN92 4XEZA 3INAA 2W0XA 4A3DJ 2P5BA 2FSWA 1ONVA 1WGPA 4JX0A 3JB4C 1ZHFA 2L7MP 1UYPA 2COBA 2YYOA 3R0JA 3CCRI 3LSKA 2BP6A 4QXBA 3FK6A 2V4JC 2D3RA 1SACA 4QAWA 2XSDC 5C8CA 4XL9A 3HD8B 4JC1A 2O9LA 3ZXDA 2L02A 3EYPA 1EKEA 4W6YA 1AHDP 1WLWA 1HW2A 5GLTA 2V9PA 1E3HA 4CEYA 5C3SA 2VH9A 5A2QK 1U5YA 4XJAA 4PZJA 1RJ7A 1TNTA 3HTUA 4OIRF 2W48A 2TDXA 2R7XA 2WFPA 3SFIA 1K83J 1XGSA 2OTJI 2R0FA 1IN8A 3C7GA 1VBB3 1MH3A 1YQCA 3ZLIA 1JZ5A 1VI0A 2IAIA 2YGLA 2JG8C 1W8HA 2W24A 2VZ3A 4C3JJ 3LB9A 1ZBA2 1G2HA 3OUHA 1ZQ3P 3IAQA 3MV11 5CVIA 2OV7A 2CQXA 3QPTA 3HB9A 5K8SA 1QPMA 1KA8A 2DLLA 2VL8A 3R0AA 1TL8A 3N9LA 5HBAA 4D0QA 2MEV2 4NR1A 1EY2A 2R5YA 2WBKA 2LS6A 3LSGA 1UW8A 3CD6I 4BMBA 1O3QA 1R4MB 2ZMKA 3M3CA 1FMWA 2VLAA 1RVF1 2JDYA 4BJ5C 1WWXA 5A1LA 3ERED 5B5EC 2FJ1A 4Z8BA 3FZ3A 3JBG1 4E6KG 4QHZA 5HS9A 1PM4A 4IXLA 1Y8RB 1TQ5A 2ZACA 3I4MJ 3I2FA 4DEVA 4LG0A 3SQNA 1QZYA 4ZONA 3MLLA 3FXOA 4C90A 1PGW2 4FTEA 5HOOA 4N7UA 2ZKLA 3WG1A 3FXQA 5FPBA 3ZYRA 4X8NA 3U07A 4D7TA 1GU3A 2YHJA 4OZXA 4B48A 5AIQA 3OS2A 2HH9A 4A3ZA 2Z1DA 3DEWA 3ITQA 3OOPA 1DQ4A 1DZQA 3AYAA 5BNQA 2VONA 1S9HA 3QD6A 2WS91 2DYCA 5A6ZA 3LPFA 2GSYA 2VY0A 4W97A 3AP7A 4AI9A 2XKPA 5JZGA 3ABKH 3GYHX 1LHUA 1VBE1 1UXZA 5B4NA 1POV0 1C57A 3PUIA 2ATFA 4BK4A 2QKLB 4ENMA 1XDUA 1G86A 3THTA 5LW9A 2G9WA 4C3HJ 2RDRA 3H3LA 2WO3A 5LA1A 4XTMA 5FXXA 5A7PA 4LEJA 2X10A 5C70A 1G9BA 2WDBA 4XLAA 3MLKA 3OG2A 5L3CA 5FYTA 5A1FA 1Z3XA 2NLRA 4BE2A 1MS1A 1R5GA 1LECA 5IJRA 1TT5B 5FBJA 1V6MA 4J1XA 2R6QA 3NV3A 1F5FA 3SJMA 4XJUA 5GLZA 2YMZA 5BOXA 1DHKB 2VZSA 4ET7A 3BKZA 4UUSA 1V3FA 3OYNA 1LHOA 4RGKA 1BBYA 1E3PA 2XWJB 4WZFA 2FCTA 1LEMA 1X2MA 4ANJA 2M4KA 3KP6A 3H5NA 1XGNA 1REEA 5CQEA 1TP4A 1C5IA 1W9SA 1M4WA 1LDKB 1S0EA 4NHJA 4AK3A 2FMLA 4ZZDA 3OYDA 4COZA 1XSDA 5I8YA 1YOVB 4H7MA 4ZKTB 2Z3YA 1ZX5A 4D9JA 3CJQB 2VB6A 1OUSA 4DXRA 4R8HA 5DUVA 1UMIA 1TWCJ 5JXIA 1OT5A 3VBFA 1UU5A 1UO9A 3WQBA 3WU0A 1LQ1A 2CV6A 4CCDA 3M4FA 5ED4A 1HIXA 4LLOA 3RZMA 3DKWA 1YS7A 1U5TB 1BEV1 4MX3A 1YI7A 2DU1A 4CCCA 3CP8A 1TVGA 3FBYA 4UNOA 1Z78A 2BV6A 1EV12 3FC0A 4AVPA 1JYXA 1VQ5I 1LOGA 2YXSA 4I0BA 1KONA 2DVDA 1TTYA 4YG3A 3P1IA 4Q0QA 2AUYA 4CUAA 2DUOA 4IGPA 1E3OC 3HDDA 2ETEA 3MHZA 2XJQA 5LY2A 2LFBA 4MNUA 2VXJA 1NCQA 3CCEI 5FROA 2ZHKA 4FPGA 4EM1A 5HNFA 4LKEA 4C0BA 1XE8A 2O1QA 1H8AC 4AVCA 2RDPA 4YVWA 4Y15A 4E7ZA 4HDVA 5IVJA 1DDLA 1XU1A 4A3XA 3P5JA 1HC8A 3GBGA 2PN6A 4M0NA 1NH3A 2RDSA 2NMOA 2ZMEC 4CZCA 4BZ4A 3K0LA 1HF0A 3EJKA 4ATFA 5FRMA 4LLNA 1BXHA 1DYOA 2E7TA 5DYMA 3VBRC 3U1DA 2MW8A 1BR1A 4ZU7A 3SHRA 4F83A 3DWLE 2QA4I 2ZBKA 3LA7A 3A21A 2IP2A 2WN2A 2BBAA 1D8JA 4LHNA 5FAXA 2PMZN 1H8VA 5E8GA 3K48A 2B9SA 1D5VA 4XLPF 2JG9B 1FP1D 1A31A 3T8TA 3HXLA 2QQIA 5M5WJ 4QPQA 1EJ9A 2GLOA 1JKQC 5FZMA 1B35B 3PUAA 4BQYA 1I6XA 3VKNA 1D1CA 3F8MA 4JBAA 1UHWA 2V73A 4H3WA 3V56A 4QX0A 5KCMA 4ZDLA 5D2AA 2ETHA 2FDKA 4JK1X 3OYEA 3ZVXA 2FBIA 4PF1A 1QJY1 1XBFA 2XJVA 2OCEA 2J1RA 4XLEA 4D6SA 4QT6A 2KR2A 3HR9A 1W8OA 1CN1A 1MKMA 4D7SA 1MZFA 3GYDA 5LD2C 5ABJC 2X6OA 1UN1A 2V72A 1IKPA 3RYRA 3BZ6A 3JTHA 3VYSB 4XIDA 2NYXA 2D2WA 5IUQA 4BE1A 2IZWA 1OSGA 3I4IA 4PCRA 4ABZA 4IPAA 1WZ2A 2QZ8A 3MFKA 2BYVE 2WAAA 5JWPA 4RAGA 3K2OA 3OMYA 4UV9A 3RJ2X 2WL1A 5FWEA 3UESA 2VBDA 5BYNA 2VJIA 1CAXB 3OYLA 4ZU4A 3NNJA 1UQXA 4ZDOA 4PGHA 2P5LC 3F21A 3WP4A 1NTCA 1MSEC 1UL9A 1Q8PA 2FBEA 3RPUA 3OYJA 1ZNPA 2UURA 1MZ6A 4ZJZA 2HEYF 5FV3A 2D6KA 1EV7A 1O3RA 3EO6A 1ETXA 2JDKA 1T6SA 2FNAA 5KC5A 3IKWA 4XHXA 2ZBJA 4CE8A 1VF9A 2FX0A 1YUDA 2TUNA 2WS92 3PO2J 2YZ4A 5IOYA 3KLSA 1QH6A 1W8TA 4H0EA 1OURA 4KIFA 2JUCA 1FOKA 4GKXA 3G1OA 5A3LA 4PLMA 2CFXA 2CV2A 4XFGA 4FTSA 1W6PB 3LFIA 5LGTA 3DYMA 1T2KA 1YW7A 1ETOA 1ZGJA 1VBE2 2F6BA 2VQAA 4J19A 1U5ZA 4G7HF 1SLCA 2HWC1 2Y34A 5J36A 2KMUA 1PO11 1ETVA 3UKGA 3ABMH 3QPHA 3VSKA 2FBKA 3WQ1A 4NMIA 1XYNA 3WNMA 3IHUA 3CESA 2IS4A 1ALYA 4L9JA 3HL2A 3VBOA 1ZRIA 3HNMA 4KWUA 3ZSLA 3H7JA 3GTPJ 2OQ7A 4CYCB 1H2KA 3DL3A 3OV8A 1RITA 2A1XA 2GH2A 4OCTA 3CTAA 1ULCA 2RGVA 2KP6A 3M8EA 3FHZA 3GCWA 3I53A 4LBNA 2HOAA 5IK8A 5IP6A 4CCNA 3CF5F 3GXOA 1JOBA 1NA1C 5LB6A 3WW3A 1FPN2 3FN9A 3FM3A 4P5HA 1JYCA 4XKWA 1W9YA 2F6CA 2RDQA 1OCRH 4LMFA 3LEGA 2IRFG 1SLAA 4D5CA 4J00A 3U14A 4NHYA 1WW4A 4MXWA 2EINH 1YRNB 4Q0SA 2L7KA 1ZBE3 2WZR1 1W04A 4QB6A 1D0XA 2XWBB 3VL8A 3C2BA 4DY5A 2WWJA 3D5RC 2I74A 3V42A 4RGRA 3R60A 1LDDA 4A7KA 1GZCA 3JRGA 3F8CA 1RUG1 5FZDA 3MVPA 3T5XA 1YNAA 2Q4SA 4WF2A 4CO8A 1BKZA 3H9GA 1AYN2 2OT7A 1U5TA 4LMYA 1BEV2 3ORJA 2GN7A 1N25A 3BQYA 2KFDA 4BXUA 1G7YA 5A32B 1OI6A 5LY1A 1ZARA 3ZQHA 1W4MA 2E2HJ 1MQTB 1LHNA 4XHBA 4HG2A 2XVLA 4OMZA 4GALA 1RUD2 5LATA 1W6NA 1SFEA 2A3XA 3Q9VA 2W91A 2WA3A 4R52A 1FPQA 3HOVJ 3AMPA 4LULA 4PJJA 3GO5A 1G8WA 1MD0A 4KN4X 1G4DA 2J1EA 1IPJA 2UY8A 1MVQA 4LJZF 2XGCA 1OQEA 3IN9A 2RMU3 1FI2A 3AMNA 1YJ9I 1R093 5FKKA 2D45A 3QYEA 3LAJA 3RI9A 2V1UA 3J8F3 2CQQA 1FOWA 2HKXA 3BG5A 5K7HA 1GBGA 3SH5A 2ZS6B 3E6MA 1REDA 5JCTA 2XPJA 5CEHA 2L9VA 4TZDA 2ZGSA 2Y33A 4BH9A 2C6YA 4L99A 1B72B 1ZKGA 3CBNA 1LGNA 2YX4A 1A35A 4BHCA 1V6NA 1RI7A 3ZIWA 5I0DA 4XJWA 4XJ8A 3ZQFA 2VGDA 4B47A 3VYUB 2V1DA 2VXRA 4YGEA 4IERA 2EIBA 4UFIA 1X9TA 2WNUC 1KU3A 4S2GA 2JG9A 3TW7A 2GC3A 4Y1UA 2J5OA 4LOSA 2ZSHB 2Q30A 5FKOA 2BNOA 1JOJA 5EQUA 3U0ZA 2XUEA 3J9SA 3ZYPA 1ZZ8A 1STMA 2J1VA 4A5MA 1JE8A 4OQ9A 4CP9B 3VBUB 1B8IB 5JVTA 3ZFGC 5KHDA 2DA1A 3C3VA 5C3QA 5HXVA 1UCRA 3JAMZ 2JDUA 1WJDA 1Z91A 5FFXA 3GCXA 5EV7A 3ONQA 2ZEZA 2DW4A 4A45A 2HPIA 4I98B 4OMDA 3KGLA 5J96B 4BMEA 1V70A 2RHPA 4XOPA 3QPSA 5CKQA 4A3LJ 4IUGA 5EG0B 4AR2A 3ZFEA 3I3MA 4TTGA 2WAQA 1QKQA 5F3GA 4LOCA 4HSJA 1H4GA 5E8IA 2MD0A 4G7ZF 3ML6A 1LEAA 3TL4X 4R9BA 4BDYA 1CJDA 1H8TA 4A3JJ 4NWVA 1P7JA 3FFZA 4W8JA 1YQ5A 4LE3A 1U9OA 4A69C 5E79C 2DA5A 3GFLA 3E0JB 4NC7A 1D0ZA 2ORXA 4AWDA 1LFUP 4EWEA 4IOCF 3PVNA 3GTKJ 4I0WB 2Z99A 3R6SA 1VRBA 5T5LA 4HEA2 1RR7A 4Q48A 2R073 2RJ2A 4UF0A 3ECQA 5M3FJ 2YY1A 2XF7A 1G59A 4JHZA 3OYCA 3WGHA 3J7LA 1BVVA 2QSFX 3H0GJ 1EP0A 2E9QA 4KQ7A 2IBDA 4CEWB 1HKDA 1Q1VA 1OMIA 4HF0A 5DQ0A 5CZKA 3B9IA 5GZDA 1ASJ1 2P6CA 1ONAA 1H9PA 1YQAA 4XACA 1AOYA 1DGLA 2KA3A 2RJKA 4YM1A 2RS51 1JZ4A 4UW4A 1UY0A 3RDIA 2HWC2 3KYDB 5IT3A 1PO12 3POEA 4XQFA 3AG2H 2JE9A 2DCYA 2L4AA 4KDPA 1SFYA 2DU9A 2LUWA 3QODA 3FJSA 1U8RA 3OJBA 1OQ1A 1WD3A 5DDGA 3ABLH 5F6FA 2XLAA 4CYCA 1GT0C 5C71A 2NZ9A 1RKWA 3WF3A 3HOUJ 4LBQD 4Y33A 4HMZA 2NNYA 1BR2A 2CG4A 2KJBA 3J26N 2XGXA 2GA2A 3P9CA 4FPCA 5K0UB 3WTWC 1H2LA 2F17A 1W2AX 3S1RJ 5IK7A 3SITA 2JDHA 2EZLA 3IWFA 5AC93 2QDNA 4OI4A 5AVAA 2R072 3VBSC 5FP9A 3MPBA 4PDWB 3C2HA 3WTTC 1V0AA 4XQ4A 3SFZA 4B09A 4UW3A 4COUA 3CCYA 2E1NA 3RFRA 2AEZA 4PLOA 2IXCA 4ZH4F 4EM2A 4GWIA 3FL7A 1A34A 3FXRA 3CCJI 1S2EA 3S1QJ 3HNBM 4JGYC 3OWTA 3T8RA 1HRV3 3HPNA 3DBHB 3M3EA 1O91A 1ZRDA 1RUG2 2P6TA 5BNPA 4QKNA 1HQLA 1JYVA 2GBYA 3C7EA 2WSUA 4G7OF 2P8TA 5L3FA 1WJ5A 1MQTA 1JT0A 4L9BA 4XK4A 2BWAA 3M3IA 1KRIA 3BI3A 3DPLC 3ES1A 1AR73 5FZFA 2AXLA 3QU6A 1DQUA 3DKQA 2Y0SA 1QGLA 1VBA1 2QVOA 2D40A 5CFDA 5KNLA 2KL4A 2AGSA 4ZC3A 1YO8A 4IRIA 2FD5A 4CEYC 1SG3A 4K6BA 4AQ6A 3WNKA 4GZ9A 2XUBA 4ON0A 1X1AA 2J42A 3WF2A 3VB9A 1XOYA 4BWOA 4HK8A 3AKPA 1QPIA 3WHUA 4HPQA 3HRMA 2DCTA 3OR2C 1FMVA 3AB0A 4Z1VA 3IT8A 5FZCA 1Q1HA 4I76A 4FE7A 4UUTA 4YRDA 1HQCA 3MICA 1XYOA 1J2XA 3AG1H 1B72A 4ZYDA 1D4VB 2GC1A 1YJWI 3ACLA 1R083 4W65A 1IW7F 4XFBA 2EV6A 4XKBA 1EH8A 2YUSA 1MS3A 2W2IA 5FZLA 4CZZA 3AKZA 2J1AA 2VNOA 1M06G 3M3QA 4ZYHA 1UCXA 2G7HA 2R49A 5SV8A 2ZX1A 3F0CA 2DK8A 1P92A 4RGGA 2BEOA 2DA7A 4GB33 2LF8A 4CP9A 5FLJA 1B8IA 1MGTA 4OUSA 5BY5A 4UYBA 1XNDA 3IP4B 5JXGA 4WXCA 5LFAA 3KZ4C 1AR72 5CVVA 2CUJA 4XFFA 3R05A 2O6GE 1IXRC 2E53A 3EXUA 2ZTNA 3VZJA 5HDKA 2IW5A 2E51A 5GKAC 4A42A 3LSTA 1RINA 2XROA 4R4XA 2IWGB 1PO21 4MSVA 1UOFA 1Y4WA 2BERA 4U88A 4GYGA 3UNPA 2IXKA 4B7EA 3RZGA 2R7TA 4K1YA 2ZGNA 3ZYHA 5EG0A 3J4UH 1SBDA 2RM21 3QYBA 1S0BA 4A6OA 3A0BC 1VQOI 3A23A 3AMHA 3ROUA 1ACIA