4BZ4A

Cora is a surface-associated copper-binding protein important in methylomicrobium album bg8 copper acquisition
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
204
structure length
198
Chain Sequence
ATAISGTFFDKNNTSADMTVRAYSWYNLSMGYLGTHHSNWGFVKLKKGKPVTIALTTEVSGLHPSITVWYRAGAKNPKTLPYMNGHAYKQFGDIYEPNAEATPVKVGNIIMKFITNGFDRDGMGDALPAEYDQSQLYRVMDGVPGKLAITFTPPENGWYQFVVGAINPDIDSTAYGSGPGSGAGPATAHTVHVEVSIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Copper-binding protein
molecule keywords COPPER-REPRESSIBLE POLYPEPTIDE
publication title Cora is a Copper Repressible Surface-Associated Copper(I)-Binding Protein Produced in Methylomicrobium Album Bg8.
pubmed doi rcsb
total genus 44
structure length 198
sequence length 204
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18252 Cu_bind_CorA Copper(I)-binding protein CorA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1220 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bz4A00
4BZ4A 2VOVA 2VOWA 2VOXA
chains in the Genus database with same CATH superfamily
2D6PA 3RWKX 3KF3A 1CIYA 1RUD3 4RGKA 4UWDA 1IPJA 1S0CA 5I8SA 4LQRA 1COV2 4A7YA 2JECA 3PUSA 3Q8EA 4M3CE 4AF9A 2SLIA 4BXSV 4OCTA 4NWWA 2PLV1 3FFQA 5FY0A 3NW4A 4JKLA 1OKQA 5FZ8A 5IVVA 3DKWA 3VDAA 2FDFA 4XYXA 1JU4A 3RMYA 4PT6A 5BNPB 3K4ZA 1GSLA 4OZOA 4EQVA 2VH9A 4P9LA 1F31A 3RRDA 3OD0A 1S0BA 1HKDA 1HW5A 4UI9L 1FPN2 3T1LA 5LBCA 2IXKA 3OF1A 5C3QA 4KWUA 5FZHA 1ZNPA 4P5YA 2GNBA 3DXUA 3ZDVA 5JZGA 1V70A 1SLBA 1VBD2 1WLTA 2JDHA 1HN0A 1OXCA 5J98B 3UKVA 2V09A 1RJ8A 2VQ0A 2L9LA 4MXWB 2RS12 5HV4A 2XOMA 5ERLA 2Y6HA 3LFMA 2WSVA 2QQNA 1ZA4A 2ZGNA 3I49A 1F8VA 5HCFA 3VZMA 4P9JA 1S4CA 1OI6A 3VDDB 1PIV2 4YVSA 1QHDA 4XIKA 1H2MA 1W6PB 2RM23 5FYUA 2Q8OA 2YC0A 1WMFA 4XFFA 4A41A 2EXJA 2GMMA 3S7IA 3SCFA 1YFWA 5ISLA 1UCXA 1PGL1 3ZYPA 2AUYA 4LUMA 1LGCA 1X8MA 4YM1A 1C1FA 1MZEA 3KSCA 3QBQA 4Q1PA 3U78A 3AMHA 4XFAA 3BVCA 5DABA 4OZXA 1VBE3 1PZ8A 3USUB 1UX6A 1POV1 1SMVA 2WNOA 3H9AA 3TB0A 4ZY9A 1POQA 3K2OA 2J1SA 4FAHA 4WV8A 4FT8A 1OF4A 4RSUA 1UPIA 3T2PA 4R4ZA 1LOGA 4BB3A 2JDKA 3IDAA 2LM3A 3ASIA 2C9KA 1YQ5A 2EALA 4AQTA 4G9SB 3VBFA 3POIA 2VOXA 3M70A 4AEDC 1G86A 1LTEA 2BFUS 1N3QA 3C7FA 3F2ZA 1JHJA 3K3NA 3LQCA 4XJ9A 4CU8A 1TQ5A 2BV4A 4BPZA 4COUA 4PF1A 1RUC2 4BMBA 3TYJA 3LAGA 2V5DA 2X09A 2IZWA 2DYCA 2QKDA 3AMNA 2A6XA 1RUI2 2HWB2 3VD9A 5KHKA 2HWD2 2R30A 1LEMA 2YXSA 1KDMA 1CZSA 2C5DA 1RIRA 1OQ1A 4W50A 2FMYA 3WW4A 4AFCA 2DCJA 2IC1A 1ACCA 5D21A 5E1RA 2V73A 1NCRB 4AFBA 2BWCA 1K45A 5FYBA 5C71A 1WCKA 3O5SA 2HH9A 4EN8B 5JZGB 1ND2A 4XDQA 2WNUA 5FMOS 3OEAA 4LIVA 4Q4V2 1H0BA 2XG3A 4QPIB 1PO13 4YNIA 5DZEA 1AYN3 4PHZA 1HXS2 2WT0A 3BN6A 2GNDA 1OHFA 3OGGA 4LBMA 2VXRA 5DUVA 2O1QA 1TMF1 4P9WA 5BNQA 2BGOA 3MBWA 5C9AA 3CF6E 3W5MA 3E5XA 3LEKA 5FZEA 1EAH2 3I8TA 5FYSA 2YGMA 3N9QA 2D6KA 1QNYA 1XNCA 2XUEA 4YGDA 2W9XA 1QJFA 4ARXA 4COZA 1ULOA 1WA6X 2Y0OA 3NSTA 4LBKA 4QB2A 2IFRA 1DGLA 4GULA 4Y1ZA 4OMCA 2P3KA 2UYAA 1QH7A 4XILA 3WY6A 4DINB 1QGLA 2LALA 4BMEA 2FD8A 3ZXFA 2OPKA 4BK5A 1O59A 3WG4A 2YZ4A 1W3XA 3NL1A 5AC91 1QJY3 1Q5OA 5LWBA 5FP4A 3N7KA 3IPVA 3AZYA 3WNKA 3K46A 5ABJC 4CCNA 1ASJ1 4DO0A 4EYUA 1VRH3 1UIKA 5GLVA 5A3UA 1MVEA 4EV0A 2QZ2A 2MHFA 3OEBA 2WYSA 5DUXA 5LA1A 4WM8A 5FXWA 3AYCA 3OBZA 2VCAA 4P14A 3DYOA 4QX5A 2G9GA 2LRPA 1V9U2 2VOVA 4PI0A 1GP4A 1VAMA 3R0RA 4JX0A 3DGTA 1RUH2 4NN0A 1IPKA 3VBFB 2VMFA 4QGMA 4RHV1 2BOJA 2I74A 3AL6A 1I1EA 3C8XA 4AW7A 4E4DX 2VE1A 1MS8A 4MZUA 1EUUA 5GZCA 5FXVA 4AHZA 2VZRA 2HEYF 1R093 3IIAA 5DZGA 1AF9A 3UETA 4HVQA 1HB1A 3FUQA 1A6CA 3JZVA 3WDYA 2D6OX 4IE7A 3KT7A 2E63A 4PBPA 1QOTA 1OPMA 2BGCA 1DQ1A 1PO22 4J6GA 3PNAA 1ND3A 3HEIA 4W8JA 3KHCA 1N1TA 3WP4A 1FNZA 2RS53 2YFUA 1T6GC 1OSGA 1UW8A 1W8ZA 2BP6A 1B09A 2W08A 2XJVA 5AVAA 4CUBA 5IK5A 5FLJA 3CL1A 3WHUA 2HWE3 1FMD2 4ONUA 4ES9A 1ND2B 3OD4A 1C5HA 1WMXA 2GAUA 2VW0A 4A3ZA 2UY9A 4GWIA 2PFWA 4RFRB 3VKMA 3ZFFB 3LB9A 3WQ1A 3K75B 1UZYA 3ACHA 5C9AB 1NT0A 2HLEA 1AR91 3HQUA 5A1FA 5B4XA 1GFF2 4R9CA 5IVYA 1KD7A 2OIIA 1Q43A 4D3WA 4CZSA 5C3OA 2PLV3 1UF2C 4N7UA 5D2AA 1MS0A 1NCQB 3RS6A 4M4PA 4DEVA 1C8M1 3MYXA 3ZIWA 3JQWA 3USSA 4EROA 4LBJA 4QHOA 3C2UA 2JEMA 5JPMB 1F5FA 4ZS3A 5CFDC 4XTMA 4KL1A 3UGGA 3ELNA 1JYNA 2XH6A 3LEGA 3TNQA 3N36A 4GMP0 2WLQA 3AP7A 4WM8B 3AJYA 4UW3A 1JODA 3VGIA 4XABA 2DCZA 4YZ4A 5A1AA 2GSYA 3MGUA 4Q0VA 5LBEA 1HRV2 3W59A 1NQDA 2GN3A 3FJSA 2C1FA 5E88A 1DQ2A 4QD2A 4YPJA 4Y1UA 3U14A 2R043 1LENA 2JE9A 2CU5A 4CEWB 4KWLA 1GWMA 3VBHA 3AX4A 3AM2A 1EPWA 1GQGA 5A3PA 4OI4A 2F17A 1NE4A 3D3AA 3H3ZA 4DXRA 4EN9B 1UZWA 2HWC3 4O61A 1PVC1 4MG2A 5HV0A 4IEZA 5JVVA 5LASA 1YFXA 2CWSA 4AXOA 1ND3B 4QQLA 3RJ2X 1UZVA 2QE3A 2ILMA 3AP5A 3OCPA 4GA9A 4Q0SA 4C1WA 3W5NA 1RB8G 1NLRA 3MIHA 4Y3OA 5IK8A 2NLRA 3IBMA 4XBQA 2NM1A 1BKZA 2VNOA 3ENRA 1W9TA 1O6UA 5FPBA 5AFEA 2QTWB 5JLVA 4ZKTB 1O5LA 4RL7A 4R8HA 3E5UA 3POJA 5KHHA 4HPKA 4JVAA 2QCSB 3U4SA 1BHGA 1YXWA 2P5BA 3DXTA 3IAQA 3WLUA 3OPTA 2ZMLA 1GICA 2CYFA 4S2FA 3UJOA 4P08A 3FX3A 4LA3A 4QKFA 5LRRA 5FZ1A 1J58A 1W8OA 1FATA 2W91A 2FDKA 3N9PA 2YMZA 1OPOA 3A4UA 3TNPB 4EWDA 4ZXEA 1W8UA 1ZZCA 2VTFA 1XB9A 2YY1A 3SH4A 5M0TA 3NKTA 4LO4B 4AQ2A 2IXCA 3AP9A 1T2XA 5K4LA 1BK0A 4IESA 4YM3A 5F6KA 2P6CA 4YZ5A 1O4TA 4CDUB 4CCLA 4DNYA 4Q0UA 3ZFEA 5A7QA 4FBFA 5FYIA 1KS4A 1RUF1 1AR61 3ZYJB 2VQTA 1PX4A 4N9IA 3ZPOA 1PHMA 1W0NA 4ZU4A 1C3HA 1UQXA 3U07A 5F7UA 2XQRA 4FI9A 2VAUA 2XDVA 5FDBA 3AYEA 1SPPA 3WDWA 1SDWA 3DKQA 4WBBA 3H0OA 4D7SA 2ZX3A 1FV3A 1LOFC 2ZEXA 4X8NA 1MS1A 1NLQA 2OKXA 1OOPC 1IS5A 2QQMA 4QAWA 4K9SA 1GP5A 1XYOA 4C91A 5DAQA 1YHFA 1TMF3 4HSJA 1GP6A 1FX5A 5F39A 1EY2A 3VBHB 2ZZJA 3SKJE 4B4QA 4IGQA 3ZSMA 4LJHA 3K4DA 4JV4A 1GQPA 4IGPA 4K1YA 4I01A 3ZN5A 1W8TA 2G1MA 2PAMA 1D4M2 4UXAA 2R061 4CPBA 3HN3A 4QQHA 2PQQA 2E26A 5ANQA 2VULA 1CX1A 2YBSA 2WA4A 3ZSEA 5K0UC 1JZ3A 1ASJ3 4EZHA 3TN91 3A0NA 1U5ZA 3MW4A 5GM0A 5FYCA 1YWKA 1GOHA 2R32A 1FT9A 4LULA 4RR3C 1WMDA 2NPIA 4HPKB 4Q4X1 4UFLA 5L9VA 1R1A2 1BZWA 4XAAA 2CY6A 1RTVA 3KLSA 2WFF1 3LD8A 3OY8A 4RHV3 3JBG3 4FFGA 4N43A 4F3JA 1RUE1 1DQ4A 4FPEA 3E6CC 1EV12 3T08A 3HNYM 2WFPA 3GNEA 3KB5A 4ZZ5A 5A7PA 2OT7A 1C57A 4CEYC 4CUGA 4AI2A 2YROA 1J3RA 4LITA 4PQ9A 3ZFEB 3O1PA 2MEV2 3I3DA 2K2SA 4MOAA 4TYSA 1K42A 2ZKLA 2ZGPA 5KHGA 2GH8A 1AZDA 4YSFA 4UFJA 1CR7A 1ZBA2 2FMDA 1F9KA 4QB6A 3RVHA 2RG4A 4NE9A 1CAVA 3VHNA 2ATFA 3WNOA 3C7OA 1IG0A 4WVMA 1SPPB 1ULPA 3BPSA 1GZWA 4JGZC 4LO5B 4XHBA 4CDWC 5DG1A 2V72A 4WVWA 4BWOA 3DL3A 4P02B 3PJYA 4QMAA 3Q9OA 4EN7B 5FUPA 1IKPA 3KCYA 4O7XA 5EV7A 2BDRA 3MZHA 1Q56A 2P4EA 3IT8A 1MZFA 4UAPA 1WKYA 3HNMA 3M4FA 5FTTC 2Y0IA 1REEA 4CRQA 3RYKA 1RUJ1 4ATFA 4XF9A 1E5HA 4Q0QA 1XNAA 4CCEA 4I0AA 4CU9A 3PVBB 1GOFA 4IEPA 4UW5A 4YW3A 1JZ6A 3SXWA 1LAJA 4QDQA 1F35A 4IV1C 1FPN3 1C8M3 1QH6A 1UAIA 2ES3A 1PNGA 3NJYA 2FQPA 2DFCA 3OGVA 3RMXA 4LBQB 5FYVA 1Q3EA 1B35A 5SV5A 1PGW2 1RMU2 1RUD1 4D69A 1RHI2 1BYHA 4DMIA 3NJZA 2NZ9A 1H1IA 4Z82A 1Z7S2 1N3PA 2IXIA 5FY8A 2P3JA 2GNMA 1BQPA 4QPGB 1CAWA 2OQ6A 1W05A 3AVSA 3BTYA 3THCA 3M3EA 4YG6A 1S0IA 3RZZA 4GB32 4CP1A 2WWSA 4XUPA 1WW6A 3OY8B 3WF0A 2ZJCA 1PIV3 2QVSB 4U2AA 2UWBA 1UWWA 3JUUA 4N43B 3WQ7A 3R4UA 5JSPA 4JGYC 4AGVA 3TEZA 1HN1A 1NX9A 2Q0AA 3PUHA 5ANNA 3VB9A 4FOVA 1G9FA 2GP5A 2R16A 4LHKA 4FTEA 2A6VA 1DYOA 3KMHA 4TZDA 1PVC3 1W2TA 2DURA 2X5IA 3LE0A 3LFIA 1XPWA 5FPXA 4K7JA 2GNTA 3AC0A 2F6BA 4XHXA 5CKMA 1KS5A 3FBYA 1DFQA 4CXYA 1H6XA 3UK9A 4RGGA 4WVMB 3IDEA 2R1BA 4RN5A 1S2BA 3RWNA 4XC9A 1H1MA 1H2LA 1TEIA 1Y9MA 2ET7A 4H14A 1GZWB 5BYNA 5IK7A 1VBC2 1IQDC 1G9CA 1SDDB 3N7JA 5CKNA 4LHNA 5BNNA 1RUG2 2D93A 4YW7A 5F2WA 4H3WA 2XJPA 3CO2A 1PK6A 1RUC3 3PIGA 3VHRA 5KR7A 2WN2A 3HJRA 3MI8A 4NRMA 4Q4W2 1W6NA 2GMEA 5J3UA 5JUVA 2JDPA 1RUI3 5CG8A 4LHSA 1AVBA 1DP0A 2RVAA 1VBE1 2HWD3 3OBTA 2D5FA 3UGFA 2PTMA 2VOKA 2H0BA 3FHQA 1KXGA 3BTAA 4V2WA 1LOBA 1OKOA 4DUWA 5JDBA 5FZOA 5HXMA 2DTYA 1B35B 1RUF3 3RSJA 4QX2A 4A44A 4D6SA 2ADDA 1DGRA 4ET7A 1BMV1 3SH3A 3AB0A 2FDHA 1MEC2 3APBA 4URTA 1J1LA 2CTVA 5A3LA 1S0DA 4Q4V3 4BLIA 4ISQA 3MF9A 3VHOA 5T5OA 5CISA 2BPA2 2JG9C 1JYVA 1CAWB 4Y20A 4COYA 3POSA 2A5ZA 3OUHA 1I9RA 2QJVA 1EAH3 3CJIA 1FXZA 3OB8A 1ALYA 1TE1B 2Q30A 4A6OA 1PMHX 1QXJA 4AFAA 4F8AA 3GJAA 4QX0A 1UL9A 3EO6A 4B1LA 1W9SA 2ZMKA 3WINE 4AYUA 2Y33A 4PCRA 3UT0A 3VBRA 5CFCC 5C8CC 3B00A 2W46A 1HRI2 2WAOA 1W9YA 1VR3A 2B9UA 2NP0A 5F5IA 5KHJA 2A3XA 1L3JA 4CE8A 1OLRA 2ID4A 2X5IB 4XJWA 2NQYA 3VBOC 1G9AA 1TNFA 1YIPA 3J8F2 5F5QA 5F37A 1PO11 5A3NA 1V6IA 2WSUA 2CDOA 1U5XA 1GZCA 5C4WB 1JN2P 4XZUG 4DQAA 1V9U3 3I2JA 3C7GA 4UFIA 3U4XA 2P6HA 4MYEA 1RUH3 1QIQA 1BXHA 1AR72 1MS9A 2HWF2 4ZS2A 3GXUA 1HQWA 4Q4X3 5BNNB 3DUIA 4QGNA 4S2GA 1ZVFA 3L9JT 1XE0A 1PK6B 4RGAA 3PUQA 2E7TA 3VKNA 2PHTA 5BNPA 4DIQA 1US2A 1W6NB 3CEWA 3ZFGC 3LA7A 1O8PA 1LHVA 3I59A 1VRH1 2ARXA 3JD72 3POEA 3JQXA 3U37A 3DYPA 3KZ4C 4OI0A 2RR12 3WF4A 4HMZA 1KJLA 1S2KA 2CHHA 2YGLA 4G4FA 4B7KA 5EPAA 1W39A 4OULA 1ZBE2 2C9AA 3I2FA 5FZOB 4OHXA 2V4VA 4DFSA 1IOAA 2WO7A 3HWJA 2W3JA 4UFHA 5GLTA 2XJQA 1W6MA 1WLWA 2VZTA 1BLZA 1CAXA 3VBSC 3J4UH 3B69A 4CP9B 2WDBA 1D0GA 1U12A 1N47A 3PLQA 2VZ1A 4QPWA 1E5IA 3OGRA 2UWCA 1OBNA 3ZSKA 1KITA 2XBO1 4Y20B 1YQ8A 3J7LA 3WT3A 5K7PA 1TNRA 1R091 2YB7A 4XJAA 3RZGA 5DUUA 1BBT2 1ULDA 2D5HA 3CJIB 4QDRA 3TRSB 1MACA 5CBLA 4Q0PA 3V56A 2R0HA 4QHZA 2ET1A 4YGBA 3B94A 3T3YA 2C0ZA 4Y22A 1O3RA 4IL7A 2RS51 1CGPA 4QX8A 3IMNA 5JCTA 3VBRB 1CPNA 1OA3A 2B8MA 2UY8A 1OVPA 4GH4B 1RUJ3 1M06G 1QMJA 1VE0A 2HWE1 4MGQA 1AL23 4GD4A 4ZXKA 4I3GA 1PM7A 2NYYA 1I5PA 2EICA 4ORFA 3Q8CA 5C70A 4JKKA 2YU1A 3ILFA 2AEYA 1K5MC 4IEQA 1J59A 1ENSA 4I09A 4ASLA 2XJRA 2WAAA 2GALA 2BZDA 3B01A 5FZBA 4ARYA 3RI8A 4HN1A 4JTOA 1HRV3 2D97A 2WNVC 1HV0A 1MR5A 4B4PA 4R52A 3FFZA 2VPVA 4CUAA 2FZ2A 2D44A 3PU3A 3MW3A 4FPGA 4YW5A 1HB2A 1TME2 2R49A 5A7NA 3CBNA 4RQPC 3THPA 3MIGA 4BQ2A 2VBDA 5CU1A 4LK6A 3RG0A 2PHRA 3AP4A 3LDKA 4AEKA 1V6NA 1QQP2 2EIBA 4JDOA 3IKWA 3U0ZA 2W95A 4KGQA 3FBMA 5A32A 3I59B 2I07B 2BERA 4Y1YA 5E16A 5H9PA 4CSWA 1XNKA 1QOOA 4QDSA 1NCRA 2XWJB 4LR4A 2BJSA 1OMIA 2DVGA 1YLLA 3VKFC 2W2IA 2YPJA 3AMPA 1E57A 4A7KA 1P8JA 1W6MB 2DF7A 2WA3A 1CAXB 1X9PA 4LKDA 3J7MA 4QPIA 2QQPA 4Y5TA 2HEWF 1OT5A 2BVVA 3HR9A 3K51A 1UOGA 4I3PA 2R041 5JOYA 4YVWA 5BXXA 4XFBA 1SFPA 1SFYA 4A42A 5EJ3A 4AVBA 3DF0A 4AGGA 2PN5A 4WM7C 4AZZA 3R4SA 2QQUA 4B7EA 1JYCA 5JAXA 2DBNA 3PUAA 2HWC1 2P34A 2JG8C 3HT1A 3BALA 3WD5A 4LKEA 3I3EA 4N7IA 3KWVA 5FK7A 2EA7A 4Y22B 3IDBB 2VC9A 4YWAA 3ZN4A 3W58A 1RC6A 4MV2A 5C6CA 4Y33A 1HIXA 2D6MA 5IHRA 1IHMA 3RZKA 5F32A 3GJBA 1LEDA 3QOPA 1AYM2 5IVJA 2WZR1 4CTEA 4GZ9A 4JC1A 5FWEA 1UNBA 2Q1ZB 4CCDA 3ZMOA 4BHPA 4DXSA 5FO8B 3BI3A 3UL2A 4TLGA 1XOYA 2DWRA 1SLCA 1HV1A 1RVF2 3I4IA 3DN7A 1UY1A 1W2UA 4QT6A 4Z2WA 2VUJA 1JZ5A 2RDSA 1BCXA 5FREA 2OYZA 1OC1A 1Q8SA 1XSRA 1QWRA 4PIYA 5FYZA 1N1SA 4X6RB 2B42B 4AEDB 2GC3A 1IQAA 3WX5A 3CMGA 4FPHA 4Y24A 5E89A 3O1VA 3AMQA 4PIZA 5JSOA 2VR4A 1YCIA 2JDZA 2KM2A 1FOD2 4FSJA 3EXUA 4DEQA 4D0QA 1VBA1 4HSLA 3Q8FA 5CNAA 4LLOA 4O65A 2VBPA 2D98A 3NAPC 5A32B 5TSWA 4D6QA 1UXXX 2QQLA 5BNOA 3ZXAC 3NV1A 1X7NA 3JU9A 3LPGA 5FP7A 1UU4A 1DQ6A 2X8KA 2FDJA 4BYYA 2RJ2A 3ACLA 2WWJA 2WINB 5LY1A 5CADA 2XQXA 3LPFA 1WMEA 4C8DA 1O3QA 4IV3C 3RFRA 3ZFFA 4DOUA 2PHXA 4O9GA 4XBLA 4QXKA 4HG6B 4YVWB 2A3YA 3VD7A 4AEJA 4BISA 4DZGA 5JXJA 2WLPA 2BW8A 2C26A 4HVRA 5ACA1 1G6NA 3SEPA 1L7LA 3WCRA 1SCRA 1ZRFA 3RGBA 2O0OA 1RL3A 4AHYA 2QBXA 1NCQA 3GM8A 1IZ3A 2BVBA 5K8SA 2WS92 2RS32 1YUDA 5JMCA 3OPZA 2P3YA 4BE3A 4CCKA 4E4SA 3ZKYA 4TXWA 4AI1A 4QQPA 4AR2A 5KXBA 2VTXJ 4OYUA 5FLHA 3AJZA 3H50A 3VD5A 3ZXLA 5L36A 4YVSC 2VZUA 2UYBA 1ZBA3 4DRVA 5FZ6A 4QQOA 2JJ6A 5FZIA 5CB7A 3FUOA 5CFDA 1AHSA 2D6LX 2VZ3A 4NHMA 1CN1A 2AYHA 2ZX0A 3CZJA 3E97A 3VD4A 3IIIA 1REDA 1JOJA 1XYPA 2JB4A 3VZLA 1XYNA 4RYDA 2CGNA 2DFBA 1VBB2 4E2QA 3WQBA 4HANA 4QU1A 3S5QA 3I3QA 5FZFA 4XF3A 2LS6A 1J1TA 3E5QA 3J7NA 4KGGA 3JBG1 5DDJ1 5FLIA 1HQLA 2C24A 2CAVA 2GH2A 4Y1VA 3W21A 4LT5A 3DPRC 4CCMA 2HYXA 2XBO3 4CEWA 4DY3A 2A73B 1QJU1 5IVBA 4OQ9A 2VZOA 1RUOA 3MFAA 2W0XA 2JX9A 2GP3A 4BIFA 4XACA 4AI8A 2VG9A 4LA2A 3IN9A 1UYXA 4UBGA 5F3GA 2BGPA 1QJX2 1NOVA 1BEV2 2UWAA 3M3CA 2Y26A 5BNOB 3WG2A 1JBCA 1AUYA 5I0TA 2PHLA 2AH2A 2FBEA 3MPPG 1ENXA 2BYVE 1UMHA 2BRTA 5FOBB 3S57A 1RMU3 2D40A 3LDBA 3LWCA 4FAGA 2VGDA 4B1MA 1EP0A 1GUIA 3SNMA 1DQ5A 5FY7A 4ASMB 5J48A 1COV1 5DAWA 4B4RA 2A7AA 3N35A 1H9WA 4AQ6A 5DZFA 5IATA 3O1RA 1FI2A 1VP6A 2WZPP 5DXDA 3RDIA 2OS2A 3NVCA 1VIWB 4P9XA 3J9SA 5FIXA 5IJRA 5IW0A 2XUMA 4AQSA 1GYKA 2VCCA 3KGZA 4H7MA 3VKLA 2ZEZA 4OUEA 3KV4A 3VUOA 3U10A 3O1TA 3WG1A 2WNUC 4M0HA 3AKSA 1AL0G 3GBFA 4ZPIA 2JDUA 2VNRA 1N3OA 1FPN1 4L11A 4CDUA 1KQRA 1UD1A 5C3PA 2AZ5A 5C9AC 3ST7A 2VECA 2W1QA 5T5PA 3O1SA 3ZXDA 1G8WA 1NY72 4L97A 3PMEA 1VBD1 5DAPA 3WP6A 1H6YA 3WQ0A 4AHXA 2A71A 4DS0A 4XJZA 4UOJA 5CFDB 1MS3A 2VVFA 5LBBA 1NE6A 2RS11 2JXAA 3PUIA 3WW2A 1LHNA 2YPDA 4KWJA 3GBGA 1H9PA 3AZVA 4AK3A 1ENRA 2ZX1A 3ZYGA 1XSQA 2VOTA 5LW9A 4ZONA 1SFNA 2DCKA 3BB6A 3ZSLA 5JSRA 1W28A 1PIV1 4OHYA 1XE8A 4XFGA 3EQEA 1LOFA 2VUDA 1RUG3 3I3BA 2ZGKA 4XBNA 3OSDA 5A6ZA 3ES1A 3EBRA 3BIWE 4ZHNA 4U36A 1US3A 4Q4W3 1PZ7A 2VJXA 2XJUA 4BU2A 1WW7A 2WKKA 2UURA 1OA4A 4LORA 3K77A 1XU2A 4W6YA 1PVXA 1UMIA 3FWEA 4OFGA 2Y34A 5LEKA 3M1HA 1Z0HA 3H8OA 3F95A 2C6SA 4LOTA 1CD3G 4E2GA 2WRAA 2ARBA 4PLNA 1OD3A 3QACA 3U1XA 1LR5A 2IXLA 5FRAA 2E6VA 3CU7A 5EIYB 1KRIA 4JZRA 1H1AA 4K21A 1WCDJ 1S0EA 2W94A 4L99A 1MEC3 2WZR3 3WP3A 3LEMA 3O14A 2R0FA 1G9BA 3FHIB 3N3HA 4HXCA 5T54A 1IPSA 1ND3C 1NZIA 1T6BX 1RUC1 3KQRA 4RR3A 5T55A 2TEPA 1NUKA 4G3YC 2H6BA 1Q8QA 2VQUA 1FV2A 3PU8A 2D3RA 1X8EA 4MH0E 1A8DA 3WF3A 1O91A 2JDAA 1RUI1 2HWB1 4L2NA 3TOJA 3H8XA 3ZR6A 3N4MA 3M2MA 3Q8BA 4IE6A 1LU1A 1QF3A 1D2QA 2HWD1 4RA0A 1W04A 3MIDA 1DBNA 1HB3A 2AEZA 1X36A 2BNMA 4FFHA 3N9LA 4K40A 4PDWC 3V64A 4IEYA 5A80A 1AJKA 1HRI3 4GJZA 5FP8A 4NO4A 3T1MA 4LUKA 5EJZB 5FZCA 1VBA3 1VAKA 2PQSA 5K9YA 3VBUC 2TNFA 5FZDA 2EIDA 3VV1A 1WA4A 3WHTA 3T0AA 4XE9A 4XDPA 3S7EA 3K3OA 5L73A 2B5HA 4Q4V1 2J1UA 4P9GA 2ZBJA 3MICA 1HXS1 3ROUA 3Q8AA 2RM22 3DEMA 3NNMA 1J3QA 5BPXA 1R082 3LZZA 2YYOA 1EAH1 4BQYA 1JZ2A 2PMWB 4CCOA 4LKFA 2GN7A 1LCLA 5G04L 3WNNA 2OUJA 4MX3A 4CDWA 4L9BA 1DLLA 1UZ0A 3KCXA 1OOPB 2AACA 1QXRA 3BUCA 5T50A 4C1XA 4XMAA 1RINA 3S6PA 5ACA3 4XFCA 3NV3A 3TEXA 2P17A 2Y6LA 4H2AA 1W03A 1Q8PA 2RMU2 4JKMA 3RI9A 1NG0A 4XF4A 2D3SA 3JD73 4Q4Y2 5D1IA 2W5FA 1CIWA 1AX0A 2RR13 4FXKB 5J36A 4LBQA 1UXZA 1ZZBA 4NR1A 4DXTA 4P00B 1V9U1 4IV1A 5FCCA 2W52A 4CUCA 3P1IA 4XJ8A 4FFIA 1RUH1 4CXWA 1PM4A 1F15A 1LGBA 1Y43B 3I2HA 3IWZA 1MQTC 3QLQA 1D7PM 4OHWA 3TN93 3W9AA 4NAMA 4BJ0A 4QPGA 2PELA 3TEWA 5LB6A 3D0SA 1CAUA 4KMQA 4EZ4A 1AR82 1PGSA 4W6XA 5FY4A 2XVGA 4OI1A 2ZAHA 4RR3B 2W1UA 3MO4A 3GF6A 2WT2A 1BBT3 5EQUA 2AC1A 5DDJ3 2A70A 4NVPA 1KFXL 2R7EB 4XQWA 4D94A 5GKAC 2VD7A 1GZTA 2EIGA 3I2OA 1JTZX 1QJU3 5FUNA 2G19A 4JGYA 2WYFA 4L92A 4LO8A 1AYN2 5A3MA 3OPWA 3C3VA 2XLFA 4CDQC 3DV8A 1UX7A 1FMD1 4B8EA 4CEYB 5LA0A 1JYIA 2C4XA 4AOCA 1J83A 4A2UA 4A6SA 2AREA 3B02A 4K3UA 3VZNA 2IVIB 1ODNA 4OVEA 4Y4RA 1O8SA 4PBOA 3VLBB 3WF1A 4D8MA 3ZFEC 2R072 1GANA 1GBGA 3MF6A 5LK7B 1Y4WA 4XURA 2EVXA 2AENA 4TLFA 1COV3 1O3TA 2IUWA 1QJY2 4KG0A 4CDWB 3POYA 3ACIA 1UN1A 2D6NA 2XGXA 2XVKA 1E5SA 2QDNA 5C33A 1HJFA 4NUBA 1S0FA 4NHLA 5JOXA 4NIHA 3LCPA 1DDLA 1KDKA 5FJKA 2B7YA 2GC0A 5KC5A 1AL21 4YW6A 1WUVA 4OHZA 5LCWL 2CL2A 1V00A 2X10A 4X6QB 4AFDA 5JXHA 2BNNA 3MIEA 3H8RA 4PI2A 2Y6JA 2OPWA 3WW1A 3AK0A 4NPLA 5L7OC 1JYWA 1F4HA 2JDMA 3K4AA 1GV9A 4HKLA 2KD7A 4CDXC 4IV1B 1A78A 2UU8A 3H3LA 4GWJA 3M3OA 3NQHA 4LIUA 3NNJA 4FPCA 2GDFA 1HRV1 2OZ6A 1VBD3 4NPMA 3ZYHA 4IE0A 3QCWA 3UKNA 4OHVA 5J96B 1LOEA 2DTWA 4QWNA 3B9CA 4AE2A 2DVFA 2RS13 3KQ4B 1CAUB 3PVNA 3ZYBA 4XFIA 4COVA 5A6QA 3CDZB 4R9DA 3BOWA 3BKZA 5C5UA 3KVAA 4RS5A 5D8AC 4XCBA 4KWKA 2QDRA 3HAGA 1JOBA 4BOWA 1LU2A 2Q8DA 3AZZA 3KT4A 5FPZA 1R1ZA 3A21A 5FKBA 3WNLA 5HXVA 1MS5A 3GCWA 4COWA 4QXHA 3WDUA 1Q8OA 2I2SA 3WW3A 4JGYB 1GMMA 3URFA 5FQ0B 3SISA 4CPBD 4IEUA 2DUPA 1ST8A 2KA3A 3OGSA 1N1VA 1PMIA 3OG2A 5CFCA 4FTSA 4LBQD 3B7MA 1AYM3 1RUNA 1ZM1A 3V65A 2KXLA 4N43C 4NHYA 3BYWA 3BPZA 1POV0 2VMCA 1QDCA 2R1DA 5C4WA 1TZOA 4ZU5A 5JXGA 3TAYA 5E8AA 2PLV2 4XETA 3UYJA 1RVF3 4QKDA 4MGTA 2QQWA 3DCQA 3FMGA 5FPAA 2BFUL 1NA1A 3TBDA 3HQXA 5FKCA 1WWYA 4Z2AA 3FC0A 4LO6B 2G9ZA 3ZKUA 4GMP1 1OA2A 3MLLA 1A3KA 2DVBA 2VO5A 3MLJA 2ZHNA 3E1F1 3CZUA 3LA2A 2R6QA 4HLTA 5IUQA 1IS6A 2OA2A 3PURA 2HWB3 5LATA 1WD4A 1WZXA 1ZZ8A 2A1XA 2RDNA 1QKQA 4HKOA 3WDXA 1LNSA 1QJZA 1WCUA 1YQCA 4XF1A 5IVFA 5LZ6A 4IEWA 1VALA 2FHRA 3ZYFA 2AR6A 2RDRA 5FZ3A 5HBAA 4BZ4A 4IDZA 1L7RA 1NAEA 3J7HA 1CX4A 3AYDA 1RJ7A 4P5HA 3H3UA 3ZOIA 2JDYA 3DECA 4HETA 2ZHMA 5FMOL 4CP9A 1A8MA 2VVDA 4JCKA 2Q8CA 3FZ3A 3T2TA 5JMOA 1O3SA 1OLQA 1L7QA 1SCSA 1HXS3 2K46A 4OI2A 2E53A 2XMLA 3LIHA 4Q5OA 4OQ8A 1XNDA 3POBA 3I3MA 1UYPA 5AVPA 1VPHA 4XDOA 1PGL2 1V6KA 2JG9B 2DCYA 4RS5B 3HQRA 2VW1A 1W9WA 3ZPYA 2Z42A 4LBOA 5A3WA 1SEFA 1LECA 1IS4A 1J84A 1D4M1 4HT1T 2ENRA 5DPNA 3T4VA 4AG4A 1DCSA 2RV9A 2WS93 1W8NA 1HDKA 4HK9A 2RS33 5FK8A 5FYMA 3SEEA 4AVVA 3ZSJA 4B3NA 4KBBA 4GH4A 4L0PA 3ZXKA 3AFKA 1LOAA 3LGRA 2YC2A 4LEJA 5C8CB 5CFCB 2F4PA 1HQNA 1UZZA 1JW6A 3NWKA 3A7QA 1UOFA 2K9ZA 1YJKA 2BU9A 5C8WA 3P3PA 2VVEA 2IVJA 3WXPA 2BQPA 5JIAA 3FL7A 1XBFA 2EAAA 1NLSA 1WLCA 5GZGA 3O1OA 3VBOB 1BVP1 2W68A 4FPOB 4LLFA 4M0NA 2J1VA 1S1AA 1VMHA 4TN7A 2WZEA 4AI0A 4OUSA 5A6XA 1SZBA 1GQHA 1I5ZA 3ECQA 2W1SA 3RJRA 4PJYA 5F6LB 4YW2A 2YV8A 1NA1B 2V5YA 3WNMA 1SBDA 1XE7A 3GYDA 5GLZA 5FMBA 3UKTA 2X5IC 3WP5A 3ZXJA 3GALA 4YFZA 3SLIA 3QH7A 1EV11 4NRPA 3WSOA 5B4NA 4MGZE 2TUNA 1WW4A 2FDIA 3AXEA 5FY9A 5FPUA 4YW1A 2XLGA 1CQ9A 4BXFA 1M4WA 5EWSA 2EF6A 3HPNA 1UY0A 5CAZA 1DYPA 4FOQA 1PO23 1QJX3 1H8TC 2DUOA 3AFGA 1ZBA1 1BEV3 3I54A 2D7FA 4QQ2A 4E27A 3ZDSA 2DVAA 2O8QA 4WVVA 3U11A 1W3VA 1NZCA 3H1YA 4HFSA 4IETA 1QJEA 4UT5A 3PTRB 5FXXA 5LK5A 1FMD3 5FPLA 1JUHA 2Q1MA 1TMF2 5HI0A 3IM0A 4GQ7A 2HEVF 4KI5M 1DQ0A 1DF0A 1LHWA 1X33A 5FV3A 2VCMA 2VL4A 2WR9A 5F3CA 2HKXA 1Y7BA 1W8FA 2WC2A 2YU2A 2B46X 2ORZA 2YG0A 3VBSB 1QU0A 3ZLIA 1CESA 4QU2A 5FZ4A 3T30A 3ATGA 3T2OA 1IGOA 1I6XA 3RYRA 2AGSA 1S55A 5EYXA 3I2GA 5H9QA 5AC92 1F2NA 1YQ2A 3OOXA 3CJXA 2XVLA 5FZMA 4FP2A 1OURA 4AVTA 1ASJ2 3NV2A 4Q8KA 1WCSA 3AP6A 1RXFA 2ZS6B 2XPJA 1UOBA 2ZXQA 3VZOA 5DAXA 1H8VA 3N9NA 1ZZ7A 3M3QA 4BIOA 4K1ZA 1PGW1 1RMU1 2WQ4A 1ZRRA 3RZHA 1RHI1 5FYYA 4I0BA 5DQ0A 2RDQA 3ETPA 4LBLA 4K20A 3MIFA 4RHV2 5JR7B 5DMYA 3D6EA 3O0VA 2W39A 4MLOA 4OLLA 1CZVA 1WW5A 3FE5A 3NKGA 2CGOA 2J1EA 2TBVA 1K5MB 3G6JB 3VZJA 5C3SA 3BTZA 4N53C 1SQ4A 3D82A 4GB31 4Q1RA 1ZZ9A 3MW2A 4AI9A 2A3WA 4I30A 3LDRA 1SBEA 1UKRA 4AEDA 2Q8EA 3CKHA 3VD3A 5JIUA 1CWPA 3H42B 3ES4A 2DU0A 4M01A 5LA2A 5FZKA 5A33A 1D0HA 1NXMA 4IXLA 3I97A 4Y1XA 4LBNA 1BK1A 1O4ZA 4C90A 3MV11 4MGIE 5GZDA 4MXVA 4HZFA 3NAPA 2ZGQA 2OUHA 2ZEWA 5J37A 1JHNA 3T09A 5BNPC 2V4AA 3KD4A 1DHKB 1H4HA 1VBC1 4JQRA 3VKOA 1SLIA 1AR92 3D4KA 3ZN6A 1QEXA 4WVZA 1RUG1 1SLTA 4LMFA 4M4RA 5LA9A 2NMOA 4JQTA 2ARAA 4V1PA 3GZTB 3POGA 5EYYA 3LSEA 4I02A 2VQAA 4IV3A 5IVCA 1DZTA 1LESA 4Q4W1 1TG7A 1C8M2 4JHTA 5GZEA 4MSVA 3H1MA 1LGNA 2XL7A 4I2OA 2ARCA 4HL0A 4WM7B 4XPVA 2WWUA 2BOIA 4GMP3 2Y60A 5FAXA 2XJTA 4DB5A 2ZGLA 2JG8B 4NRQA 1OH4A 4IQPA 2XKPA 4TWTA 2QQJA 4FPKA 4XW3A 1BJQA 4P9YA 4S2DA 1AX1A 4BQ4A 3VDDC 3ALQA 3D0JA 4BQ1A 4YYOA 3N9OA 1MEC1 4YM2A 5T5JA 4XCAA 5ABJA 2ZCWA 3D8CA 4E4HA 4FQZA 4ES8A 1FAYA 4DRRA 3IMMA 4JRLA 3KS7A 1CJDA 2NMNA 3IB3A 2WIIB 2WQ8A 1WLDA 1OUSA 5C7GA 1R083 3GHMA 2WT1A 3GZEA 3ABZA 4LE4A 4BLJA 4W4ZA 3R4DB 4MUVA 4IEOA 3BTXA 1ZX5A 1UIJA 2EAKA 3ZM8A 1W9FA 2ZKNA 3MUZ1 2JB8A 1PVC2 2VW2A 2E9QA 4FCAA 4Q27A 3WDVA 5JI9A 3DPRA 4SLIA 2ZGOA 1V6MA 1HRI1 3WDTA 4KU8A 4NIIA 5F5CA 4META 5A33B 2RMU3 4UYBA 5CKQA 1RXGA 4J25A 4E8CA 1UKGA 2CNAA 3KM5A 4Q4Y3 1D4M3 2X05A 5KXDA 4GIQA 1OLMA 2Q5TA 3J8F1 4NPRA 5IYYA 2VZVA 2ZACA 1SBFA 3NAPB 2FZ1A 4S2HA 4XAEA 3HVDA 3DYMA 2JD9A 2ZHKA 1BVVA 4XEZA 3H8UA 5JOZA 2ZTNA 1MVQA 4NIDA 1AR71 3ZN6B 2HWF1 4XUOA 2CSGA 4GWNA 2WJSA 1DG6A 1R1A3 1X50A 3AL5A 3INAA 3L2YA 3NNGA 3AVRA 1NCRC 1AR83 4GAZA 4QB1A 4AHWA 4TSVA 5CVRA 3I2KA 3THDA 4DY5A 4IV3B 5FZ0A 3A22A 3GGLA 2JE8A 5JPNB 1JXNA 5A3TA 5JZGC 5IT6A 1N1YA 1RUF2 4Q8LA 4AFMA 5KWRA 1AR62 3JD71 2E51A 1D2SA 4Q29A 4QPIC 1EV13 2JICA 3ZVXA 5LEJA 2RR11 4KNCA 1C1LA 5FXZA 1OUXA 1C5IA 1JMUB 4YVWC 3QH6A 1ZBE1 3A23A 4YGEA 2MEV3 3HBZA 5T5LA 3BOPA 5FMDA 4SBVA 1DLCA 2VTXA 5A70A 3UV9A 1FYUA 1W0PA 1MPXA 4N8MA 3WF2A 2OVUA 5ABJB 3ORJA 2Y38A 4I0WB 3BCWA 1G7YA 1UMZA 5F1RA 4YVSB 2ZEYA 1ENQA 4QM8A 4R9BA 1VMFA 2B9VA 1JUIA 4FOWA 1S2EA 5KC6A 2D43A 1BBT1 1W8WA 2R073 2PXJA 4GXLA 4QM9A 4A3XA 5FPVA 2XB6C 4JRAA 1UPSA 2X29A 3N7LA 2XKOA 4MVTA 3OBAA 1DIWA 3PVEA 2VBBA 2ERFA 4LOSA 4HVOA 1V6OA 2LW8A 2VUAA 2XONA 2R062 3GHNA 3HBKA 3DPRB 1U5YA 5BV6A 4BCUA 2JKBA 5JOWA 4OUMA 1ULGA 1OH3A 3NV4A 2WQZC 4XUQA 2CGPA 4GKXA 1HX6A 2P37A 4ZZ8A 2PHUA 4LHLA 4NMIA 3OJBA 4IE4A 3VBFC 3JXSA 1G9DA 1A34A 1Y3TA 3MFCA 3ACFA 1YI9A 3FN9A 3O12A 1XU1A 1YJLA 2XXZA 2ADEA 4DPNA 4DXZA 5LRSA 3AKQA 1RITA 2PA7A 4GJYA 4E2SA 2QZ3A 4R4XA 3GZAA 4AVSA 5I8TA 1DGWX 4Q4X2 3B93A 4YZ2A 1CONA 3P6BA 4YFWA 1PX3A 1RHI3 1LRHA 2WFF2 2EIEA 1Z7S3 3HN1A 3PIJA 2ZGMA 4BK4A 5E6HA 4XUNA 2WO3A 3I2IA 4K8RB 4CP0A 4AVAA 3PDQA 2QUOA 4IERA 1XNBA 4X8PA 5BNOC 1RUE2 4FPLA 4QKBA 1TME1 5H9RA 4EN0A 4XTPA 3T0DA 3SH5A 1UO9A 4IUGA 2D3PA 5GLUA 2A6ZA 3KVBA 1WGPA 3GDBA 4GB33 5I0RA 2H0VA 2JDNA 4W6WA 4BQ3A 1QQP1 3WG3A 1ND2C 1PZ9A 3PHMA 1REFA 3OBRA 4YGCA 2VZQA 3SC7X 1E5RA 4KU7A 3TWIA 3V0BA 1EPZA 4V2VA 3HIFA 1HJGA 2DVDA 3LIGA 3ZFFC 1YFUA 3RNSA 4UFMA 3T4HB 2OXBA 3VL8A 2WNUB 2QQIA 1AXZA 3ZO0B 3PVOA 5KXCA 2JENA 4PDWA 1LOCA 2ZABA 4QX1A 1GLHA 3CNAA 1OD5A 2Z69A 3R6SA 3AZWA 2CWMA 5I91A 3ILRA 1NYWA 3TEYA 4JAAA 5EP9A 3X29B 3VBUA 4AL9A 3JB8A 2QQVA 1NCQC 1AXYA 5EZWA 5C3RA 2PAEA 4LO7A 5DAVA 5HCHA 3WUCA 4D7TA 3HD8B 2W87A 1VBC3 1UY4A 4FTBA 1WBLA 1NXD1 4YLZA 2BWAA 1RUJ2 1ZRIA 5DUWA 3NO8A 4CCCA 1OOPA 1AL22 3IPVB 4WM8C 5FY5A 1ZREA 4BM8A 4JDNA 1ULFA 5GZFA 4K6BA 1Q8VA 1H30A 4WZFA 2Z2SB 3D5OA 3RZJA 3ZR5A 1DGRN 3PJQA 3ZXEA 1K12A 5BY5A 1MZ5A 1RUD2 1AYM1 2EXHA 2P1BA 4ATEA 3UJQA 1XQNA 2DV9A 1W2AX 3HOBA 4P9IA 3AXDA 4RFT0 3O1MA 2ZGSA 4LXLA 4BQXA 1GR3A 3GCXA 3VDCA 4CEWC 3MEPA 3RZMA 1JI6A 2PHFA 3S30A 5FBJA 3UESA 5IFTA 1RVF1 2I45A 1YFYA 3CHXA 5FOJB 4QPYA 1Y9QA 5K0UA 2W47A 4Y26A 1CVNA 2HBTA 3J26N 4NWVA 4Q26A 3RYPA 4NHXA 5KXEA 4HOOA 5CEHA 3BODA 4XOGA 1MQTA 2LROA 2GMPA 1GKBA 4NIGA 2Y8KA 3OUJA 4XF0A 4CP2A 1FOD1 3GBWA 3SHRA 3R05A 4TTGA 1VB4A 3WVJA 3WNPA 2J1RA 3V0BB 3LOBA 3THTA 1FNYA 3EJKA 3ZYRA 2P2KA 2ZZQA 4QX7A 5A6YA 3UNPA 1POV3 1VJ2A 2VZPA 2VMIA 1UYYA 4MO3M 4PDWB 2A6WA 4CEYA 4PF5A 2HBUA 1AXKA 1IG3A 4ASKA 1OVSA 4XQ4A 4CDQA 2PYTA 1XJAA 3J8F3 4DUXA 3H7JA 4YM0A 3VBUB 5FYTA 2ETEA 1JU3A 1Z78A 4GKYA 5A7WA 4KQ7A 4ITCA 3ITQA 1JOPA 4QX3A 4CDUC 2G4IA 2N7GA 2WO2A 3FLTA 4A4AA 4A7ZA 3EHKA 1XXNA 5HCAA 4CVUA 5A3OA 2ORXA 3M3IA 2WUHA 1GZ9A 2Q1FA 2RHPA 1AR73 3CLPA 4JGZA 4RD7A 2HWF3 1C28A 2J1TA 3BU7A 4AWDA 5JI7A 2WBKA 3V0AA 1ULEA 2RJKA 1VBE2 5APAA 2WS91 4IE5A 2RS31 2FCTA 4MADA 1VAVA 3U75A 3MDPA 3SMHA 3P5BA 4FO9A 5F9TA 3AKRA 1W6OA 5L9BA 3WZ1A 4J1XA 4PLMA 5FZAA 1O4YA 3N7MA 4XZPA 4MGKE 4QGLA 3OGJA 3FLPA 4ZU7A 5IK4A 2JIGA 2NN8A 4Z07A 4E8DA 1BMV2 1OLME 1QNWA 1XC6A 3NNLA 4KG8A 1ZBE3 3O0XA 4XJUA 1YI7A 3ETQA 4HN0A 4LE3A 3VBHC 1CJPA 4M00A 4E4ZA 2Z5WA 1VBB1 1EYBA 1WCQA 2IFWA 5FMCA 5L9RA 4CXXA 5I0SA 4KH9A 5L7OA 4XXPA 3T0BA 2Y6FA 1LHUA 2YHJA 3OYWA 4YZ1A 4CDXA 5AFBA 5K0UB 5IAVA 2LUWA 4QKNA 1S0JA 4UW4A 1STMA 1JYTA 1ZZ6A 4CYDA 1RYYA 3AMMA 4O9EA 2E7QA 2P3IA 5IVEA 1QXPA 2ZGTA 1MQTB 1NQJA 1Y9GA 1DZQA 1ZA7A 2XHKA 4FP3A 4XXAA 3AZXA 4QXBA 3HT2A 1XNTA 5IAXA 2X53S 1GWLA 5AC93 3LOIA 4C0HA 2J7MA 1U5IA 1PO21 2RJLA 1QJX1 2OW4A 3EMRA 5CYYA 5D8AA 5H9SA 1BEV1 2B4KA 4MHRA 2PHDA 3OUIA 3AKPA 1UY2A 1APNA 3FLRA 4FFFA 3ZYIB 5J7MA 4N9HA 1V6JA 2WABA 1PO12 1OF3A 2QQOA 1GOGA 3JCIA 3ZMNA 5FP3A 5FQ0A 1LHOA 5I8YA 3NJXA 2BUKA 4IGOA 2VNGA 2XHNA 1PNFA 3VZKA 2YFZA 5A1LA 5JWPA 4MHUA 4CDQB 1JS9A 1UOJA 4LK7A 2OX0A 3QD6A 3FHAA 3KV6A 5FR3A 1KEXA 2RE9A 4PQQA 1ONAA 5A7WB 2A6YA 1KFUL 2VMGA 4Y5Z0 1SACA 1X9TA 3VN4A 4Z8BA 2XL9A 4AVCA 1DGWA 4INDA 5FWJA 5I0DA 2FCUA 1SLAA 2BEOA 1UU5A 4JGZB 1JZ8A 3V0AB 4LNVA 1W90A 3B5LB 2OZJA 1S0GA 1VRH2 1TME3 4HONA 1HB4A 1ZYBA 4D6RA 1F5JA 2MNGA 5FFOC 3NJVA 4CU6A 3RZLA 2E32A 5I93A 1OFSA 2Y6GA 2DCTA 3MLKA 5A7SA 3H7YA 2VU9A 1QQP3 1W6OB 5FZLA 5F3EA 2ZOEB 4MGYE 1NY71 2VM9A 2WNEA 4JTNA 3PMSA 1VB2A 4PLOA 2E31A 3WOGA 1ZRCA 2YBPA 1QOSA 4UF0A 3IZOA 4M3CA 2VUCA 2Y6KA 2VOWA 5FY1A 4YG3A 1WBFA 4HKWA 1J3PA 1F4AA 2XBO2 1H2NA 1W6QA 1R092 1YQ6A 4NOTA 5L7OB 3WV6A 1QY4A 3OYWB 4IEXA 1AR93 4CDXB 1W99A 3NNFA 3K48A 1K5JA 1UYZA 1K3IA 2B45X 2ZX4A 1YC61 4UFKA 4BQ5A 5FBZA 4URAA 2JG9A 4KBZA 2RS52 4Y4YA 4YG0A 2MPFA 2JWPA 4XUTA 2HJIA 3I7DA 2HWE2 3AKTA 5LBFA 3LF7A 1NKGA 1DYKA 1GWKA 5D8AB 1YIFA 2YC4A 2VMEA 2W1WA 3N9MA 4QPGC 4BH9A 4BQWA 3M7AA 3ZIXA 1EUTA 1H2KA 3WUDA 1X82A 4OMDA 4EE2A 4K8FA 3S5AA 5C8CA 1URXA 3VHPA 2VY0A 3KV5A 4E9KA 2CV6A 1U0AA 4FPYA 3G7DA 5EXOA 1GU3A 5J09A 2ZGUA 1WD3A 3CQOA 5F5AA 3VBOA 4YW4A 3MIBA 5FUIA 2QFEA 1W2NA 4YZ3A 2BNOA 2CAUA 4QXCA 1JZ4A 2Y64A 5EFUA 3KF5A 2FCVA 2VZSA 4QHBA 3O1UA 3I2DA 5FO9B 4AI3A 4EJRA 5FJHA 4M3CF 4EWEA 2ZMNA 1I3HA 3KV9A 1R64A 5CIRA 3VL9A 3B3QE 4XQDA 2XJSA 1SG3A 4AAXA 1KGYA 5HPOA 4Z92B 1CAVB 1FOD3 1RGSA 2K0GA 3LSDA 1C4RA 3WCSA 3P3NA 1C8NA 1PMJX 3ILNA 3LA3A 3POWA 2Z4FA 4FQ4A 3E6DA 3ZFGA 3RQ0A 5KBFA 3KHBA 1GNYA 1H8TA 5FZ9A 4H55A 2QNKA 2VMDA 2RM21 4FVVA 4M3CB 4UF0B 5LY2A 4B29A 5IWFA 2R042 2VNVA 3O7OA 1R081 2W92A 3ACGA 5HCBA 3B9IA 1W6QB 2Z79A 4Z1VA 2VCBA 1LULA 3HNBM 3ME2A 3ZXGA 4UBHA 3NMBA 5IFPA 2XLAA 1VMJA 1V0AA 2O14A 4ISRA 5FO7B 3VBSA 3IAPA 2HWC2 3BIEA 3EYPA 2A75A 2J1AA 4CU7A 1W0OA 4XIOA 4XVHA 1B35C 3H1WA 4YARA 1SHWB 1XRUA 4FPFA 3WR0A 4HBNA 3VDBA 4NJ4A 2FDGA 4IW3A 3AYAA 4H7LA 4NIAA 2O8OA 1V6LA 2RMU1 1YYNA 2JE7A 2G9FA 3RPQA 1AR63 3KCCA 3LEIA 1ZRDA 2GC1A 1AJOA 3PTYA 4Q4Y1 4CA9A 1HLCA 1IKQA 2LTNA 1AX2A 3SITA 1ULCA 4CCJA 2WZ8A 2JD4A 5I0UA 2J22A 2EXKA 2WN3A 2DBIA 2WZR2 4GALA 1D4VB 1H4GA 3BU0A 3C7EA 5KHIA 4XFHA 4BA6A 5T3NA 1UU6A 2OQ7A 2ZAAA 4RS5C 1LB2A 4LPLA 2GZWA 1JZ7A 3WEZA 2KR2A 1YNAA 5CA6A 4PIXA 1GNZA 5F3IA 3CIHA 1W2OA 4AEMA 3S0MA 1R1A1 1W06A 3KGLA 4IEVA 4EN6B 3POFA 1AR81 2YDEA 5FP9A 2HYKA 1JH5A 5DG2A 1K5MA 1VBB3 1CZTA 1VRBA 5EHDA 3JB4C 4FPJA 3HMYA 4MGSA 1LKNA 3T2QA 2DDUA 4R9AA 4N53A 4NAOA 1VBA2 2WNVA 3A0KA 5CZKA 3UGHA 1OQDA 2B39A 3L2HA 2BBVA 1TVGA 2H6CA 5C4WC 3M8LA 1SLLA 3C7HA 2YUEA 2R063 5GALA 2YBKA 2MEV1 1AYN1 4RQPA 4EWAA 1W8HA 2JIJA 1DZRA 5A7OA 1NA1C 4LTAA 3GZUC 2VMHA 2ZPXA 1LJ7A 3NRUA 4HK8A 2BTVC 2IXJA 5FYHA 2XR4A 3ZFGB 5BNNC 3SQOA 2WL1A 1YEWA 1PK6C 5L19A 1H8TB 5SV8A 5GLWA 1OQEA 4JHZA 2R071 2ZHLA 4FOYA 4A45A 4AGRA 1QDOA 2WFF3 1ODMA 2GC2A 2JKXA 4F83A 4GWMA 1QJY1 5ACA2 5JR2A 1GNHA 2ZA9A 2E33A 4Y5SA 4N90A 1MS4A 3O0WA 3ON7A 1RUE3 5G05L 2SBAA 3MUY1 4BDVB 3W20A 3ZX7A 1JYXA 5GJ6A 2ZGRA 2VXJA 4XMIA 1CPMA 1UY3A 2IXHA 4WM7A 4D7YA 4DUVA 1YO8A 5F2SA 2JG8A 1O7FA 4Q2FA 5T52A 3WNXA 4AAPA 1YRZA 5CG9A 5DN2A 2XWBB 3KT1A 3SCHA 3TN92 2CDPA 5EJ1B 3MV01 3SCGA 4MXWA 5BUVA 4UW6A 4LKSA 4NROA 2WO1A 4F7ZA 1IS3A 3CJIC 3LKJA 4J1WA 2J42A 1Z7S1 4YRDA 4L8QA 5FZGA 3VDDA 5DDJ2 5JXIA 3JBG2 1W6PA 2F4LA 2DUQA 1VLNA 2PAKA 5C5TA 3OTFA 3VBRC 2ZX2A 4GH4C 4NHKA 1OFNA 1LODA 3IDCB 2Q4SA 1QJU2 2IWGB 3E6BA 4W65A 2BBAA 3SKVA 1KJRA 3PL0A 2GU9A 2PHWA 4WZCA 4N53B 2QQKA 2WNVB 5J1XA 1O5UA 4FXGB 3EB7A 1DU3D 5FZ7A 3USUA 4C0BA 2E7AA 2EXIA 3MPBA 5B2GB 5F8PA 3BGAA 1MZ6A 3MHZA 4JDMA 4RQPB 2DU1A
chains in the Genus database with same CATH topology
2D6PA 1RUD3 1IPJA 1S0CA 5I8SA 1COV2 4A7YA 2JECA 4M3CE 4AF9A 2SLIA 4NWWA 2PLV1 3FFQA 3NW4A 1OKQA 3DKWA 4XYXA 3RMYA 5BNPB 1GSLA 2VH9A 4P9LA 1F31A 3RRDA 3OD0A 1S0BA 1HKDA 1HW5A 1FPN2 3T1LA 2IXKA 3OF1A 1ZNPA 2GNBA 5JZGA 1V70A 1SLBA 1VBD2 1WLTA 3UKVA 5J98B 2V09A 1RJ8A 2VQ0A 4MXWB 2RS12 2WSVA 1ZA4A 2ZGNA 5HCFA 3VZMA 4P9JA 3VDDB 1OI6A 1PIV2 4YVSA 1QHDA 4XIKA 1H2MA 1W6PB 2RM23 2Q8OA 2YC0A 1WMFA 4XFFA 2EXJA 2GMMA 3S7IA 3SCFA 1YFWA 1PGL1 1UCXA 3ZYPA 2AUYA 4LUMA 1LGCA 1X8MA 4YM1A 1C1FA 1MZEA 3KSCA 3QBQA 4Q1PA 3AMHA 4XFAA 4OZXA 1VBE3 1PZ8A 3USUB 1UX6A 1POV1 1SMVA 4E4ZA 3H9AA 3TB0A 4FAHA 4WV8A 4FT8A 4RSUA 1UPIA 4R4ZA 1LOGA 2LM3A 3ASIA 2EALA 4AQTA 4G9SB 3VBFA 2VOXA 3M70A 4AEDC 1G86A 1LTEA 2BFUS 1N3QA 5J3UA 4XJ9A 1TQ5A 4BPZA 4COUA 1RUC2 4BMBA 3TYJA 3LAGA 2IZWA 2DYCA 2QKDA 3AMNA 2A6XA 1RUI2 2HWB2 5KHKA 2HWD2 2R30A 1LEMA 2YXSA 1KDMA 2C5DA 4AFCA 1RIRA 1OQ1A 3WW4A 2FMYA 2DCJA 2IC1A 5E1RA 2V73A 1NCRB 4AFBA 2BWCA 1WCKA 3O5SA 4EN8B 5JZGB 1ND2A 4XDQA 2WNUA 5FMOS 4Q4V2 1H0BA 2XG3A 4QPIB 1PO13 4YNIA 5DZEA 1AYN3 1HXS2 2WT0A 4LBMA 2GNDA 1OHFA 3OGGA 2VXRA 5DUVA 2O1QA 1TMF1 4P9WA 5BNQA 5C9AA 3CF6E 3E5XA 1EAH2 3I8TA 2YGMA 2D6KA 1QNYA 1XNCA 4YGDA 4COZA 2Y0OA 4LBKA 3NSTA 2IFRA 1DGLA 4GULA 4Y1ZA 2P3KA 2UYAA 1QH7A 4XILA 3WY6A 4DINB 1QGLA 2LALA 4BMEA 3ZXFA 2OPKA 3WG4A 2YZ4A 3NL1A 5AC91 1QJY3 1Q5OA 3N7KA 3IPVA 3AZYA 5ABJC 1ASJ1 1VRH3 1UIKA 5GLVA 1MVEA 4EV0A 2QZ2A 2MHFA 5DUXA 4WM8A 3AYCA 4P14A 4QX5A 2G9GA 1V9U2 2VOVA 1VAMA 3R0RA 3DGTA 1RUH2 4NN0A 1IPKA 3VBFB 4RHV1 4QGMA 2I74A 1I1EA 4E4DX 1MS8A 4MZUA 5GZCA 4AHZA 5DZGA 2HEYF 1R093 3IIAA 1AF9A 4HVQA 3FUQA 1A6CA 3JZVA 3WDYA 2D6OX 3KT7A 2E63A 4PBPA 1QOTA 1OPMA 2BGCA 1DQ1A 1PO22 4J6GA 3PNAA 1ND3A 1N1TA 3WP4A 1FNZA 2RS53 1T6GC 1OSGA 1UW8A 2W08A 2XJVA 1B09A 5IK5A 5AVAA 5FLJA 3CL1A 3WHUA 2HWE3 1FMD2 4ONUA 4ES9A 1ND2B 3OD4A 1C5HA 2GAUA 2VW0A 2UY9A 2PFWA 3VKMA 3ZFFB 3LB9A 3WQ1A 1UZYA 5C9AB 1AR91 1GFF2 4R9CA 1KD7A 2OIIA 1Q43A 4D3WA 4CZSA 2PLV3 1UF2C 4N7UA 1MS0A 1NCQB 3RS6A 1C8M1 3MYXA 3ZIWA 3JQWA 3USSA 4EROA 4LBJA 3C2UA 2JEMA 5JPMB 1F5FA 5CFDC 4XTMA 4KL1A 3ELNA 2XH6A 3TNQA 3N36A 4GMP0 2WLQA 3AP7A 4WM8B 3AJYA 4UW3A 3VGIA 2DCZA 4YZ4A 2GSYA 3MGUA 4Q0VA 3W59A 1HRV2 1NQDA 2GN3A 3FJSA 2C1FA 5E88A 1DQ2A 4QD2A 4Y1UA 2R043 1LENA 2JE9A 4CEWB 4KWLA 3VBHA 3AX4A 3AM2A 1EPWA 1GQGA 4OI4A 1NE4A 3H3ZA 4EN9B 2HWC3 1PVC1 4IEZA 5JVVA 1YFXA 2CWSA 4AXOA 1ND3B 4QQLA 3RJ2X 2QE3A 2ILMA 3AP5A 3OCPA 4GA9A 4Q0SA 4C1WA 1RB8G 1NLRA 3MIHA 5IK8A 2NLRA 3IBMA 4XBQA 2NM1A 1BKZA 2VNOA 3ENRA 5JLVA 5AFEA 4ZKTB 1O5LA 4RL7A 4R8HA 3E5UA 5KHHA 4HPKA 4JVAA 2QCSB 1YXWA 3WLUA 2ZMLA 1GICA 2CYFA 4S2FA 3UJOA 3FX3A 4LA3A 5LRRA 1J58A 1FATA 2YMZA 1OPOA 3A4UA 3TNPB 4EWDA 1ZZCA 2YY1A 3SH4A 3NKTA 4LO4B 4AQ2A 2IXCA 3AP9A 4IESA 4YM3A 4YZ5A 5F6KA 1O4TA 4CDUB 4DNYA 4Q0UA 3ZFEA 4FBFA 1KS4A 1RUF1 1AR61 3ZYJB 4N9IA 1PHMA 4ZU4A 1C3HA 3U07A 5FDBA 3AYEA 3WDWA 1SDWA 4WBBA 3H0OA 4D7SA 2ZX3A 1FV3A 1LOFC 4X8NA 1MS1A 1OOPC 1IS5A 4K9SA 1XYOA 4C91A 1YHFA 1TMF3 4HSJA 1FX5A 1EY2A 3VBHB 2ZZJA 4B4QA 3ZSMA 4JV4A 4K1YA 4I01A 3ZN5A 2PAMA 1D4M2 4UXAA 2R061 4QQHA 2PQQA 2VULA 2WA4A 3ZSEA 5K0UC 1ASJ3 3A0NA 1U5ZA 3MW4A 5GM0A 1YWKA 2R32A 4LULA 1FT9A 4RR3C 1WMDA 2NPIA 4HPKB 4Q4X1 1R1A2 1BZWA 2CY6A 1RTVA 3KLSA 2WFF1 3OY8A 4RHV3 3JBG3 4F3JA 4N43A 1RUE1 1DQ4A 4FPEA 3E6CC 1EV12 2WFPA 3GNEA 3KB5A 4CEYC 1C57A 4AI2A 2YROA 1J3RA 4PQ9A 3ZFEB 2MEV2 2K2SA 4TYSA 2ZKLA 2ZGPA 5KHGA 2GH8A 1AZDA 4YSFA 1CR7A 1ZBA2 2FMDA 1F9KA 1CAVA 3VHNA 2ATFA 4WVMA 4JGZC 1GZWA 4LO5B 4XHBA 4CDWC 5DG1A 4WVWA 4BWOA 3DL3A 3PJYA 4QMAA 3Q9OA 4EN7B 1IKPA 3KCYA 5EV7A 3MZHA 1Q56A 3IT8A 1MZFA 3M4FA 5FTTC 2Y0IA 1REEA 4CRQA 3RYKA 1RUJ1 4ATFA 4XF9A 4Q0QA 4I0AA 3PVBB 4IEPA 4YW3A 4UW5A 3SXWA 4IV1C 4OHZA 1FPN3 1C8M3 1QH6A 1UAIA 2ES3A 1PNGA 3RMXA 2FQPA 2DFCA 4LBQB 1Q3EA 1B35A 5SV5A 1PGW2 1RMU2 1RUD1 4D69A 1RHI2 1BYHA 4DMIA 3NJZA 2NZ9A 1H1IA 4Z82A 1Z7S2 1N3PA 2IXIA 2P3JA 2GNMA 1BQPA 4QPGB 1CAWA 3M3EA 4YG6A 1S0IA 3RZZA 4GB32 4CP1A 2WWSA 1WW6A 3OY8B 2ZJCA 1PIV3 2QVSB 4U2AA 2UWBA 3JUUA 4N43B 3WQ7A 3R4UA 5JSPA 4JGYC 4AGVA 2Q0AA 4FOVA 1G9FA 2R16A 4LHKA 2A6VA 3KMHA 4TZDA 1PVC3 2DURA 2X5IA 5FPXA 4K7JA 2GNTA 2F6BA 4XHXA 1KS5A 3FBYA 1DFQA 3UK9A 4RGGA 4WVMB 3IDEA 2R1BA 1S2BA 3RWNA 1H1MA 1H2LA 1TEIA 2ET7A 4H14A 1GZWB 5IK7A 1VBC2 1G9CA 3N7JA 4LHNA 5BNNA 1RUG2 2D93A 4H3WA 2XJPA 3CO2A 1PK6A 1RUC3 3VHRA 3MI8A 4Q4W2 1W6NA 2GMEA 5CG8A 1RUI3 1AVBA 1VBE1 2HWD3 3OBTA 2D5FA 2PTMA 2VOKA 2H0BA 1KXGA 3BTAA 1LOBA 5JDBA 2DTYA 1B35B 1RUF3 3RSJA 1DGRA 1BMV1 3SH3A 3AB0A 1MEC2 3APBA 4URTA 1J1LA 2CTVA 5A3LA 1S0DA 4Q4V3 4BLIA 4ISQA 3MF9A 3VHOA 5T5OA 2BPA2 2JG9C 1CAWB 4Y20A 4COYA 3POSA 2A5ZA 1I9RA 2QJVA 1EAH3 3CJIA 1FXZA 1ALYA 1TE1B 2Q30A 1QXJA 4AFAA 4F8AA 1UL9A 3EO6A 2ZMKA 3WINE 4AYUA 4PCRA 3VBRA 5CFCC 5C8CC 3B00A 1HRI2 2B9UA 1VR3A 2NP0A 5KHJA 2A3XA 1L3JA 1OLRA 2X5IB 4XJWA 1G9AA 2NQYA 3VBOC 1TNFA 1YIPA 3J8F2 5F5QA 1PO11 1V6IA 2WSUA 1U5XA 1GZCA 5C4WB 1JN2P 4DQAA 1V9U3 3U4XA 4MYEA 1RUH3 1BXHA 1AR72 1MS9A 2HWF2 1HQWA 4Q4X3 5BNNB 3DUIA 4QGNA 4S2GA 1ZVFA 3L9JT 1PK6B 4RGAA 3VKNA 2E7TA 2PHTA 5BNPA 1W6NB 3CEWA 3ZFGC 3LA7A 1LHVA 3I59A 1VRH1 2ARXA 3JD72 3JQXA 4OI0A 3KZ4C 2RR12 4HMZA 1KJLA 1S2KA 4G4FA 2YGLA 4B7KA 1W39A 4OULA 1ZBE2 2C9AA 4OHXA 4DFSA 1IOAA 3HWJA 5GLTA 2XJQA 1W6MA 1WLWA 1CAXA 3VBSC 3J4UH 3B69A 1D0GA 1U12A 1N47A 3PLQA 2UWCA 3ZSKA 1KITA 2XBO1 4Y20B 3WT3A 5K7PA 1TNRA 1R091 4XJAA 5DUUA 1BBT2 1ULDA 2D5HA 3CJIB 3TRSB 1MACA 5CBLA 4Q0PA 3V56A 2R0HA 2ET1A 4YGBA 3B94A 2C0ZA 4Y22A 1O3RA 4IL7A 2RS51 1CGPA 3IMNA 5JCTA 3VBRB 1CPNA 1OA3A 2B8MA 2UY8A 4GH4B 1M06G 1RUJ3 1QMJA 2HWE1 1AL23 4ZXKA 4I3GA 1PM7A 2NYYA 4ORFA 3ILFA 1K5MC 4IEQA 1J59A 1ENSA 4I09A 4ASLA 2XJRA 3B01A 2GALA 3RI8A 4HN1A 4JTOA 1HRV3 2D97A 2WNVC 1HV0A 1MR5A 4B4PA 4R52A 3FFZA 2VPVA 2FZ2A 2D44A 3MW3A 4FPGA 4YW5A 2R49A 1TME2 4RQPC 3THPA 3MIGA 5CU1A 3RG0A 2PHRA 3AP4A 4AEKA 1V6NA 1QQP2 3U0ZA 4JDOA 3IKWA 4KGQA 3FBMA 5A32A 3I59B 2I07B 4Y1YA 5E16A 5H9PA 1XNKA 1QOOA 1NCRA 2XWJB 4LR4A 1OMIA 2DVGA 1YLLA 3VKFC 2YPJA 3AMPA 1E57A 4A7KA 1W6MB 2DF7A 2WA3A 1CAXB 4QPIA 2QQPA 2HEWF 2BVVA 3HR9A 3K51A 4I3PA 2R041 5JOYA 4YVWA 5BXXA 4XFBA 1SFYA 5EJ3A 4AVBA 3DF0A 4AGGA 2PN5A 4WM7C 4B7EA 3R4SA 1JYCA 5JAXA 2HWC1 2P34A 2JG8C 3HT1A 3BALA 3WD5A 4N7IA 2EA7A 4Y22B 3IDBB 3ZN4A 3W58A 1RC6A 4MV2A 5C6CA 1HIXA 2D6MA 1IHMA 1LEDA 3QOPA 1AYM2 2WZR1 4CTEA 4JC1A 2Q1ZB 3ZMOA 4BHPA 5FO8B 3UL2A 2DWRA 1SLCA 1HV1A 1RVF2 3I4IA 3DN7A 1W2UA 4QT6A 4Z2WA 2VUJA 5FREA 1BCXA 2OYZA 1Q8SA 1QWRA 4PIYA 1N1SA 4X6RB 2B42B 4AEDB 2GC3A 1IQAA 3WX5A 4FPHA 4Y24A 5E89A 3AMQA 4PIZA 5JSOA 1YCIA 2JDZA 2KM2A 1FOD2 4FSJA 3EXUA 1VBA1 4HSLA 5CNAA 4LLOA 5TSWA 5A32B 2D98A 3NAPC 5BNOA 3ZXAC 3NV1A 1X7NA 3JU9A 1UU4A 1DQ6A 2X8KA 3ACLA 2WINB 5CADA 1WMEA 1O3QA 4IV3C 3ZFFA 4DOUA 2PHXA 4O9GA 4XBLA 4QXKA 4YVWB 2A3YA 4AEJA 4DZGA 2WLPA 2BW8A 4HVRA 5ACA1 1G6NA 3WCRA 1SCRA 1ZRFA 2O0OA 1RL3A 4AHYA 1NCQA 1IZ3A 2BVBA 5K8SA 2WS92 2RS32 1YUDA 5JMCA 3OPZA 4BE3A 4E4SA 4AI1A 5KXBA 4QQPA 5FLHA 3AJZA 3H50A 3ZXLA 5L36A 4YVSC 2UYBA 1ZBA3 4DRVA 5CB7A 4QQOA 2JJ6A 5CFDA 3TN91 3FUOA 1AHSA 2D6LX 4NHMA 1CN1A 2AYHA 2ZX0A 3E97A 1REDA 1JOJA 1XYPA 3VZLA 1XYNA 2CGNA 2DFBA 1VBB2 4E2QA 4HANA 4XF3A 5FLIA 1J1TA 3E5QA 5DDJ1 4KGGA 3JBG1 1HQLA 4Y1VA 2CAVA 2GH2A 4LT5A 3DPRC 2XBO3 4CEWA 4DY3A 2A73B 1QJU1 1RUOA 3MFAA 2W0XA 2JX9A 4BIFA 4AI8A 2VG9A 4LA2A 3IN9A 4UBGA 1QJX2 1NOVA 1BEV2 2UWAA 3M3CA 2Y26A 5BNOB 3WG2A 1JBCA 1AUYA 5I0TA 2PHLA 2AH2A 2FBEA 3MPPG 1ENXA 2BYVE 5FOBB 1RMU3 2D40A 4FAGA 3LWCA 2VGDA 1EP0A 3SNMA 1DQ5A 5J48A 4ASMB 1COV1 4B4RA 2A7AA 3N35A 1H9WA 4AQ6A 5DZFA 1FI2A 1VP6A 2WZPP 5DXDA 3RDIA 3NVCA 1VIWB 4P9XA 3J9SA 2XUMA 4AQSA 1GYKA 3KGZA 4H7MA 3VKLA 3VUOA 3U10A 3WG1A 2WNUC 4M0HA 3AKSA 1AL0G 3GBFA 2VNRA 1N3OA 1FPN1 4L11A 4CDUA 1KQRA 1UD1A 2AZ5A 5C9AC 3ST7A 2VECA 5T5PA 3ZXDA 1G8WA 1NY72 4L97A 3PMEA 1VBD1 3WP6A 4AHXA 3WQ0A 4DS0A 2A71A 4XJZA 5CFDB 1MS3A 2VVFA 1NE6A 2RS11 2JXAA 3WW2A 1LHNA 4KWJA 3GBGA 1H9PA 3AZVA 4AK3A 1ENRA 2ZX1A 3ZYGA 1SFNA 2DCKA 3BB6A 3ZSLA 5JSRA 1PIV1 4OHYA 1XE8A 4XFGA 3EQEA 1LOFA 1RUG3 2ZGKA 4XBNA 3ES1A 3EBRA 3BIWE 4U36A 4Q4W3 1PZ7A 2XJUA 1WW7A 2WKKA 2UURA 1OA4A 1XU2A 4W6YA 1PVXA 3FWEA 4OFGA 5LEKA 3M1HA 1Z0HA 1CD3G 4E2GA 2ARBA 4PLNA 3QACA 1LR5A 2IXLA 5FRAA 2E6VA 3CU7A 1KRIA 1H1AA 4K21A 1WCDJ 1S0EA 4L99A 1MEC3 2WZR3 3WP3A 3O14A 2R0FA 1G9BA 3FHIB 3N3HA 5T54A 1ND3C 1RUC1 3KQRA 4RR3A 5T55A 2TEPA 4G3YC 2H6BA 1Q8QA 1FV2A 2D3RA 1X8EA 4MH0E 1A8DA 1O91A 1RUI1 2HWB1 4L2NA 3TOJA 3N4MA 3M2MA 1LU1A 1QF3A 1D2QA 2HWD1 4RA0A 3MIDA 1DBNA 1X36A 2BNMA 4PDWC 4K40A 3V64A 4IEYA 1AJKA 1HRI3 3T1MA 4NO4A 4LUKA 1VBA3 1VAKA 5K9YA 3VBUC 2TNFA 3WHTA 3VV1A 1WA4A 4XE9A 3S7EA 5L73A 2B5HA 4Q4V1 4P9GA 2ZBJA 3MICA 1HXS1 3ROUA 2RM22 1J3QA 5BPXA 1R082 3LZZA 2YYOA 1EAH1 2GN7A 1LCLA 2OUJA 4MX3A 4CDWA 4L9BA 1DLLA 3KCXA 1OOPB 1QXRA 5T50A 4C1XA 4XMAA 1RINA 3S6PA 5ACA3 4XFCA 3NV3A 2P17A 3RI9A 2RMU2 1Q8PA 1NG0A 4XF4A 2D3SA 3JD73 4Q4Y2 5D1IA 1CIWA 1AX0A 2RR13 4FXKB 5J36A 4LBQA 1ZZBA 4NR1A 1V9U1 4IV1A 5FCCA 2W52A 4XJ8A 1RUH1 1LGBA 1Y43B 3IWZA 4OHWA 1MQTC 3QLQA 3TN93 5BYNA 3W9AA 4QPGA 2PELA 3D0SA 1CAUA 1AR82 1PGSA 4W6XA 2XVGA 4OI1A 2ZAHA 4RR3B 3GF6A 2WT2A 1BBT3 5DDJ3 2A70A 4NVPA 1KFXL 4XQWA 4D94A 5GKAC 2EIGA 1JTZX 1QJU3 4JGYA 4L92A 5A3MA 4LO8A 1AYN2 3C3VA 2XLFA 4CDQC 3DV8A 1FMD1 4B8EA 4CEYB 1JYIA 4A2UA 2AREA 3B02A 4K3UA 3VZNA 4OVEA 3VLBB 4PBOA 3ZFEC 2R072 1GANA 1GBGA 3MF6A 5LK7B 2EVXA 2AENA 4TLFA 1COV3 1O3TA 1QJY2 4KG0A 4CDWB 3POYA 1UN1A 2D6NA 2XGXA 2XVKA 2QDNA 5C33A 5JOXA 1S0FA 4NHLA 3LCPA 1DDLA 1KDKA 2B7YA 2GC0A 5KC5A 1AL21 1WUVA 2CL2A 1V00A 4X6QB 4AFDA 2BNNA 3MIEA 3WW1A 5L7OC 3AK0A 1GV9A 4HKLA 4CDXC 4IV1B 1A78A 2UU8A 3M3OA 4FPCA 2GDFA 1HRV1 2OZ6A 1VBD3 5J96B 3UKNA 3QCWA 4OHVA 1LOEA 2DTWA 3B9CA 4AE2A 2DVFA 2RS13 1CAUB 3PVNA 4XFIA 4COVA 4R9DA 3BOWA 4RS5A 5D8AC 4KWKA 2QDRA 3HAGA 4BOWA 1LU2A 3AZZA 3KT4A 5FPZA 1R1ZA 5HXVA 1MS5A 4COWA 3WDUA 1Q8OA 2I2SA 3WW3A 4JGYB 3URFA 5FQ0B 3SISA 4IEUA 2DUPA 2KA3A 5CFCA 1N1VA 1PMIA 4FTSA 4LBQD 3B7MA 1AYM3 1RUNA 1ZM1A 3V65A 2KXLA 4N43C 3BPZA 1POV0 1QDCA 2R1DA 5C4WA 4ZU5A 3TAYA 5E8AA 2PLV2 4XETA 1RVF3 3FMGA 2BFUL 1NA1A 3TBDA 3HQXA 3FC0A 4LO6B 4GMP1 1OA2A 3MLLA 1A3KA 2DVBA 3MLJA 2ZHNA 3LA2A 2R6QA 4HLTA 5IUQA 1IS6A 2OA2A 2HWB3 1WD4A 1ZZ8A 1QKQA 4HKOA 3WDXA 1QJZA 4XF1A 4IEWA 1VALA 2FHRA 2AR6A 5HBAA 4BZ4A 1CX4A 3AYDA 1RJ7A 4P5HA 3H3UA 4HETA 2ZHMA 5FMOL 1A8MA 2VVDA 4JCKA 1O3SA 3FZ3A 3T2TA 1OLQA 1SCSA 1HXS3 4OI2A 2E53A 1XNDA 5AVPA 1PGL2 1V6KA 2JG9B 2DCYA 4RS5B 2VW1A 3ZPYA 2Z42A 4LBOA 1SEFA 1LECA 1IS4A 4FTEA 1D4M1 4HT1T 2ENRA 4AG4A 4AW7A 1F8VA 4HK9A 2WS93 1HDKA 2RS33 4AVVA 4B3NA 3ZSJA 4KBBA 4GH4A 3ZXKA 3AFKA 1LOAA 3LGRA 4LEJA 5C8CB 5CFCB 1HQNA 1UZZA 2F4PA 1JW6A 3NWKA 2K9ZA 1YJKA 5C8WA 3P3PA 2VVEA 3WXPA 2BQPA 5JIAA 2EAAA 1NLSA 1WLCA 5GZGA 3VBOB 1BVP1 2W68A 4FPOB 4LLFA 4M0NA 1S1AA 4AI0A 4OUSA 1GQHA 1I5ZA 3ECQA 3RJRA 4PJYA 5F6LB 4YW2A 2YV8A 1NA1B 2V5YA 1SBDA 1XE7A 3GYDA 5GLZA 3WP5A 3UKTA 2X5IC 3ZXJA 4YFZA 3GALA 3SLIA 3QH7A 1EV11 4MGZE 2TUNA 1WW4A 3AXEA 4YW1A 2XLGA 1CQ9A 1M4WA 5EWSA 2EF6A 5CAZA 1DYPA 4FOQA 1PO23 1QJX3 1H8TC 2DUOA 3AFGA 1ZBA1 1BEV3 3I54A 2D7FA 4QQ2A 4E27A 3ZDSA 2DVAA 2O8QA 4WVVA 3U11A 1NZCA 3H1YA 4HFSA 4IETA 5LK5A 5HI0A 1FMD3 1JUHA 2Q1MA 1TMF2 3IM0A 4GQ7A 2HEVF 1DQ0A 1DF0A 1LHWA 1X33A 2HKXA 1Y7BA 2WC2A 2B46X 3VBSB 1QU0A 1CESA 4QU2A 3ATGA 1IGOA 1I6XA 3RYRA 2AGSA 1S55A 5EYXA 5H9QA 5AC92 1F2NA 3CJXA 2XVLA 4FP2A 4AVTA 1ASJ2 3NV2A 4Q8KA 1WCSA 3AP6A 2ZS6B 2XPJA 3VZOA 1H8VA 1ZZ7A 3M3QA 4BIOA 4K1ZA 1PGW1 1RMU1 2WQ4A 1ZRRA 1RHI1 4I0BA 4LBLA 4K20A 3MIFA 4RHV2 5JR7B 3D6EA 3O0VA 2W39A 4MLOA 4OLLA 1WW5A 3FE5A 3NKGA 2CGOA 2TBVA 1K5MB 3G6JB 3VZJA 4N53C 1SQ4A 3D82A 4GB31 4Q1RA 1ZZ9A 3MW2A 2A3WA 4I30A 1SBEA 1UKRA 4AEDA 5JIUA 3ES4A 2DU0A 4M01A 5A33A 1D0HA 1NXMA 4IXLA 4Y1XA 4LBNA 1BK1A 1O4ZA 4C90A 4MGIE 5GZDA 4MXVA 4HZFA 3NAPA 2ZGQA 2OUHA 5J37A 1JHNA 5BNPC 3KD4A 1DHKB 1H4HA 1VBC1 4JQRA 3VKOA 1SLIA 1AR92 3D4KA 3ZN6A 4WVZA 1RUG1 1SLTA 2NMOA 4V1PA 3GZTB 5EYYA 3LSEA 4I02A 2VQAA 4IV3A 1DZTA 1LESA 4Q4W1 5GZEA 1C8M2 4MSVA 3H1MA 1LGNA 2XL7A 4I2OA 4HL0A 4WM7B 4XPVA 4GMP3 5FAXA 2XJTA 4DB5A 2ZGLA 2JG8B 4IQPA 2XKPA 4TWTA 4FPKA 4XW3A 1BJQA 4P9YA 4S2DA 1AX1A 3VDDC 3ALQA 3D0JA 4BQ1A 4YYOA 1MEC1 4YM2A 5T5JA 5ABJA 2ZCWA 3D8CA 4FQZA 4ES8A 1FAYA 4DRRA 4JRLA 3KS7A 1CJDA 2NMNA 2WIIB 1WLDA 1R083 3GHMA 2WT1A 4BLJA 4LE4A 3R4DB 4MUVA 4IEOA 1ZX5A 1UIJA 2EAKA 2ZKNA 4FCAA 1PVC2 2VW2A 2E9QA 4Q27A 3WDVA 5JI9A 3DPRA 4SLIA 2ZGOA 1V6MA 1HRI1 3WDTA 4KU8A 4META 5A33B 2RMU3 1UKGA 2CNAA 3KM5A 4Q4Y3 1D4M3 5KXDA 4GIQA 2Q5TA 3J8F1 4NPRA 2ZACA 1SBFA 3NAPB 2FZ1A 4S2HA 2ZHKA 1BVVA 4XEZA 3H8UA 5JOZA 2ZTNA 1MVQA 1AR71 3ZN6B 2HWF1 4GWNA 2WJSA 1DG6A 1R1A3 1X50A 3INAA 4AHWA 3L2YA 4BYYA 1NCRC 1AR83 4TSVA 5CVRA 4DY5A 4IV3B 5JPNB 1JXNA 5JZGC 5IT6A 1N1YA 1RUF2 4Q8LA 4AFMA 5KWRA 1AR62 3JD71 2E51A 1D2SA 4Q29A 4QPIC 1EV13 2JICA 3ZVXA 5LEJA 2RR11 4KNCA 1C1LA 1C5IA 4YVWC 3QH6A 1ZBE1 4YGEA 2MEV3 3HBZA 5T5LA 3BOPA 4SBVA 3UV9A 1FYUA 1W0PA 2OVUA 5ABJB 2Y38A 4I0WB 3BCWA 1G7YA 1UMZA 5F1RA 4YVSB 1ENQA 4QM8A 4R9BA 1JUIA 4FOWA 5KC6A 2D43A 1BBT1 2R073 4QM9A 4A3XA 4GXLA 2XB6C 4JRAA 1UPSA 2X29A 3N7LA 2XKOA 4MVTA 1DIWA 3PVEA 2ERFA 4HVOA 1V6OA 2VUAA 2R062 3GHNA 5BV6A 3DPRB 1U5YA 4BCUA 2JKBA 5JOWA 4OUMA 1ULGA 3NV4A 2WQZC 2CGPA 4GKXA 1HX6A 2P37A 2PHUA 4LHLA 3VBFC 3OJBA 1G9DA 1Y3TA 3MFCA 1YI9A 3O12A 1XU1A 1YJLA 4DPNA 4DXZA 5LRSA 3AKQA 1RITA 2PA7A 4E2SA 2QZ3A 4R4XA 3GZAA 4AVSA 5I8TA 1DGWX 4Q4X2 3B93A 4YZ2A 1CONA 4YFWA 1RHI3 1LRHA 2WFF2 1Z7S3 3HN1A 2ZGMA 4CP0A 4AVAA 4IERA 2QUOA 4X8PA 1XNBA 5BNOC 1RUE2 4FPLA 1TME1 5H9RA 4EN0A 4XTPA 3SH5A 2D3PA 5GLUA 2A6ZA 1WGPA 5I0RA 4GB33 2H0VA 4W6WA 1QQP1 3WG3A 1ND2C 1PZ9A 3PHMA 1REFA 3OBRA 4YGCA 3TWIA 3V0BA 4KU7A 1EPZA 3HIFA 2DVDA 3ZFFC 1YFUA 3RNSA 3VL8A 2WNUB 1AXZA 3ZO0B 3PVOA 5KXCA 2JENA 4PDWA 1LOCA 2ZABA 3R6SA 1GLHA 3CNAA 1OD5A 2Z69A