3RZGA

Duplex interrogation by a direct dna repair protein in the search of damage
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
204
structure length
204
Chain Sequence
MSWRHIRAEGLDSSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVLINRYKDGSDHICEHRDDERDLAPGSPIASVSFGASRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2
publication title Duplex interrogation by a direct DNA repair protein in search of base damage
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/dna
total genus 52
structure length 204
sequence length 204
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3rzgA00
5F8PA 3H8RA 3H8XA 4RFRB 4NIHA 3KHBA 3I3MA 3BTZA 4IE0A 3O1UA 4OCTA 3T4VA 3BI3A 4NRMA 3H8OA 4QKBA 4NIGA 3RZKA 5DABA 3O1SA 4ZS3A 4NPMA 4IDZA 3LFMA 4CXYA 3O1MA 4IE7A 3BTXA 3RZGA 2FDKA 3T4HB 4CXXA 4IE5A 2FDIA 3O1OA 3I49A 4QKFA 3BIEA 3I3QA 4ZHNA 4MGTA 4NIIA 4NROA 4QKNA 4MG2A 3BUCA 3KHCA 4O7XA 3BU0A 3O1TA 4JHTA 3S5AA 3S57A 4O61A 4CXWA 4NPLA 2IUWA 3BKZA 3O1RA 4ZS2A 3RZMA 3RZHA 3O1PA 4QHOA 3RZLA 4IE6A 4IE4A 4NJ4A 3O1VA 3I2OA 2FDHA 3T3YA 4NIDA 2FDFA 4QKDA 4NRQA 2FD8A 4NRPA 2FDJA 3BTYA 3RZJA 2FDGA
chains in the Genus database with same CATH superfamily
4FCAA 4FPEA 1IS6A 5JXJA 2J22A 4MGYE 2Q1ZB 3OGSA 4XXPA 1H1IA 3IWZA 1GQHA 1UIJA 4ZU4A 1OMIA 4AEDC 1VIWB 4UF0A 1BBT1 1S0DA 2BDRA 2NPIA 5E89A 1U5YA 2B45X 4A3XA 3BTZA 4DINB 5BXXA 3B94A 3WQ0A 2F6BA 4M4RA 5F6LB 4QGNA 5CKQA 2WSVA 3ACHA 4LUKA 2RS31 1NE6A 1ST8A 4RGGA 1BVVA 5D21A 1RHI2 2ZPXA 4BYYA 3WD5A 3JUUA 2VU9A 2WFF3 2R16A 4LBJA 2ZACA 1VJ2A 3CF6E 2E31A 4BXFA 4QHZA 1W9FA 1Z7S3 4B4PA 5FYCA 5FLJA 2DCTA 2VOVA 4I3GA 2HBTA 2H6BA 2MEV2 4UXAA 4E4ZA 3OYWB 3R4DB 1RUF2 4PLNA 4SLIA 4MOAA 3EQEA 4XCAA 3M3OA 3RPQA 3BCWA 1BLZA 2WZR3 5FZAA 4GKYA 4BIFA 5ANNA 5IVYA 3VZJA 1UKRA 5FY9A 4CSWA 1W9YA 1SFYA 2D93A 5FMOL 4CCNA 1NUKA 5SV8A 5A3WA 1OOPA 2VTXJ 3U1XA 3OSDA 3WW2A 3GZUC 1RUE2 1SFPA 5JOZA 1BJQA 1CAWA 3EXUA 5IFPA 1SLAA 4MV2A 4YW7A 1G9AA 1HV1A 3U0ZA 1UN1A 3S0MA 4JRAA 2ARAA 3CJIC 5L7OB 3WR0A 3BUCA 4CEWB 3AL5A 2ZXQA 1QH7A 5LEJA 5DAPA 1K5MA 2YY1A 2ZABA 3AZVA 1OQEA 1ZZ7A 5C4WB 1W8HA 5I93A 3PIGA 1PK6B 4FPKA 1AL22 1ZBE2 1NLQA 2YFZA 4LBMA 4P9JA 2BPA2 1XNBA 3PUHA 4LJHA 4L8QA 1AX2A 5ACA2 4AVSA 5IAXA 4CXWA 5A6YA 1O3SA 4HK8A 4D7SA 3MICA 4M01A 4Z1VA 3WNMA 1PVC3 5JIAA 2D43A 3SEEA 1CAXB 2V4VA 5DZFA 4AWDA 4BB3A 1AR72 2CL2A 2XH6A 4ISQA 1CGPA 4BWOA 2PMWB 2VZOA 1ZBA3 3KV4A 3LGRA 1Y3TA 1KGYA 1JZ4A 1O7FA 2DV9A 1RTVA 4HMZA 5AVAA 2W1WA 4IEUA 3MPBA 1J58A 2NN8A 3CQOA 3VKNA 3RZLA 4RR3A 3OY8A 1VBD3 1PM7A 1K3IA 2Q1MA 4ZU5A 4A4AA 1AR62 4X6QB 2Q8OA 1QOOA 3VL9A 2OUJA 3H3ZA 3KD4A 3O12A 5D8AB 4EYUA 3LF7A 1AR82 1PX3A 5FKCA 3VBHA 1UYXA 3H1YA 2D7FA 3NW4A 1RUH3 4JDOA 3AMHA 4Y3OA 5E6HA 5FQ0B 2V73A 1O3TA 3J7HA 4TWTA 5T55A 3WF4A 5KC5A 2D5FA 1ZRIA 3ZR6A 1PGSA 2W95A 1YI9A 1C8M1 3D0SA 4KL1A 4NRPA 5CBLA 4GALA 4Y5TA 3FMGA 3VZLA 2YBKA 2BNMA 3EBRA 2BYVE 4JTOA 2XBO2 2VZVA 4EN0A 3USUB 2K9ZA 1AR92 1I9RA 3IDEA 4LQRA 5F8PA 1FMD3 4AHXA 4AYUA 4XOGA 4YARA 1EAH1 4XZUG 4ATFA 1AYN2 2VTFA 2P37A 5DDJ2 1ULFA 1ND3C 1WBLA 2WLPA 3EYPA 1VRH3 3M1HA 4Q2FA 3VHNA 4FTBA 4WZFA 5EJZB 3B5LB 3W21A 1JI6A 4AVBA 1H30A 4UBHA 2TUNA 2WA4A 1HDKA 4URAA 5L7OC 3D6EA 3K4DA 2AACA 2QKDA 4XJZA 5L9BA 4SBVA 2DU1A 5G05L 4CEWC 5CKMA 4CCMA 4Q4Y2 1VBB2 5I8SA 3RYPA 3MZHA 2XPJA 1S0IA 4JDNA 1EPWA 2E6VA 4E4DX 5C4WC 1VMHA 2ZGNA 2BGPA 4HXCA 2E26A 1VAVA 1PK6C 2PHTA 3POYA 4U2AA 4UFJA 5C5UA 5C70A 3RZKA 1RVF3 1UNBA 1GOGA 3WQBA 5IVEA 3LFMA 3DKQA 3NV3A 2BEOA 5A3NA 4Y22B 2WNEA 1XU2A 2QZ2A 5EV7A 3M3QA 5FWEA 4BLIA 4D69A 2DVBA 2JICA 2LTNA 2HWC1 2W52A 4XABA 2P4EA 2R073 4OUEA 4AFDA 2DURA 2CV6A 3ATGA 2W2IA 3MEPA 3MLJA 1NA1A 3W20A 4AVVA 3WNOA 1YFWA 1XYOA 4QQLA 5IHRA 3O1OA 5E8AA 1W28A 1WW5A 4Q4W1 1WMFA 2ARCA 2ZX4A 1LODA 5F2SA 3A0NA 5F3IA 5LBBA 1Q8SA 1WLCA 5JI7A 1WCUA 1MEC1 3OF1A 3RG0A 1MS9A 4FPHA 5D8AC 3WF1A 4HOOA 2Z79A 3V65A 4OI2A 4UYBA 1AYM1 2XKPA 3NWKA 5FXZA 3OD0A 2GN7A 4LO4B 3TYJA 3VZMA 1KEXA 3S6PA 1I5PA 4XUTA 2WWJA 3CMGA 5F7UA 4E2GA 3D8CA 1I6XA 1R081 1VBC2 2RDQA 2WIIB 4XIKA 5SV5A 3GJBA 1VBE2 2D6NA 4EROA 1YQ8A 2B7YA 3D82A 4IGQA 4CCOA 4EWEA 1GNZA 2HWE1 2LALA 4UFHA 1OKQA 4O61A 4BM8A 1GKBA 3N9OA 2P6HA 4WM7B 3IZOA 2ZKNA 1RUJ1 4FQZA 2E33A 4XHBA 2BFUL 1YHFA 3B00A 3N36A 4HVQA 3UGHA 2C0ZA 3ACGA 4M0NA 4GB32 2RVAA 3ZFGB 1U5IA 4LBOA 3VBFA 4M3CB 4QDRA 1DZRA 4XMIA 5B4XA 5LA0A 1LECA 4CUCA 1HXS3 1ND2B 3URFA 2W94A 3O5SA 3AVSA 4BJ0A 5AFBA 4CTEA 4NHLA 1RUG2 3POGA 1HB1A 2G19A 5CISA 2D6LX 3ZFFC 3VD9A 2UWBA 4QX2A 3NAPA 2E7QA 3NSTA 1JYCA 4YM0A 2YFUA 3KCCA 1QJZA 5FO8B 4AVAA 5JR2A 4W6YA 4LMFA 4XFBA 1YFUA 3C8XA 4C8DA 3VBSB 4UFKA 5FP7A 4AL9A 1NZCA 1RMU1 2AEZA 3B01A 3Q8AA 4FVVA 4LTAA 3AP9A 5GZCA 3T2TA 3QBQA 3ZM8A 2RS53 3H8XA 3LOIA 2QQOA 5LY2A 3BVCA 2PQSA 1F5JA 5AC92 4C90A 1OA4A 3H50A 5F3GA 5A32A 5HXVA 3IDBB 4NIHA 3ZXJA 3HQUA 5IATA 1XNAA 4IEZA 4JDMA 4DQAA 4PIXA 2QBXA 3TN93 3U75A 1ENXA 1FPN2 1G7YA 3OGGA 5C3PA 3VL8A 4QXHA 3OPTA 1NCQB 5JSPA 2V5DA 1R1ZA 3IB3A 1CPMA 1EV13 3LA7A 5HCFA 4E2SA 4CDUB 4QD2A 2PN5A 3VZKA 4Y26A 2VM9A 1RUI3 4KGQA 4XIOA 2C1FA 2RV9A 2ZX1A 2RM22 4LKEA 2X09A 4HFSA 3ZSMA 4L11A 1C5HA 3AYEA 4XPVA 4XAAA 3ZYHA 3PMEA 2VW1A 3C7FA 1ZX5A 3OCPA 4IDZA 3AXEA 4CXYA 4HONA 2A6XA 4KG0A 3WVJA 5A33B 4WM7C 5A1LA 5H9PA 1JYWA 2FDKA 1C3HA 1UYPA 1FOD1 1KQRA 2YC0A 3NKTA 2GNBA 2A7AA 5FZMA 1EPZA 2VL4A 1AXZA 1V6NA 2FMYA 4ASKA 5BPXA 5A3PA 5BNPA 4YW6A 3AKPA 4PLMA 3ZFGC 2WNOA 3NRUA 1POV3 2P5BA 3OPWA 3HNMA 1RJ7A 2EA7A 5F9TA 3H1MA 1XNTA 3ZYIB 1ND2C 2VVEA 5CKNA 4XJ8A 5CFDB 1QF3A 1UZVA 1V6LA 4FPYA 3WHTA 4PQ9A 2VR4A 3MGUA 5A7WA 5FPZA 5C7GA 1IKQA 5K8SA 3OEAA 4HN1A 3SNMA 4OHYA 2D97A 1COV3 3AJYA 4Q0QA 4XETA 2DU0A 1PX4A 3CJXA 1HV0A 2B9UA 3POSA 4FO9A 1UOFA 4LA3A 5CYYA 5JZGB 3LB9A 5LBEA 5I0UA 1MZ6A 1H6XA 3KF3A 2ADEA 2PLV3 1LHNA 1W2TA 2XLAA 5F32A 1YQCA 3I59B 2BBAA 1LOFC 2DBIA 4RQPB 1SLLA 5IUQA 3GXUA 1PIV1 1Y7BA 2B42B 2JXAA 2HWB3 1ULEA 2XVGA 4OUMA 4IV1B 1U0AA 1H0BA 2LROA 2VXRA 3B9IA 1KRIA 2JX9A 3T1LA 2WLQA 3O0WA 2OUHA 3H42B 4Q4V2 2OKXA 5C8CA 2RDNA 2HEYF 2WKKA 1NCQC 1YCIA 1BEV1 1WLDA 2NM1A 4IEPA 1HX6A 4XFAA 1MVQA 1QJX3 4XTMA 1CAUA 1G86A 2VPVA 4CDUC 4CYDA 1VBA2 1ZA4A 1ZZBA 4NJ4A 4QM9A 1VBD2 1W8UA 5DG2A 4F3JA 4Z82A 2FDFA 2VMCA 1CJPA 3DN7A 4Q0SA 4M3CF 4WVVA 1H2MA 3S5QA 1RUC2 3VB9A 4CDXA 4LBQD 2RR13 4P14A 4MGIE 5FK8A 1RUH2 4FOWA 1LOGA 1UMHA 4LR4A 2X29A 3E5QA 1DG6A 1H1AA 1S0EA 1V00A 4FOVA 4IEWA 2ZGMA 4IL7A 4YPJA 3F2ZA 5BNOA 1RHI1 1XNKA 3ZN4A 3NQHA 4EN7B 2ZEXA 2QUOA 4AR2A 3KVAA 2NP0A 3KT1A 4GH4B 3H8UA 3WNPA 5F3EA 4GD4A 4KWKA 5B2GB 5FLHA 4Q29A 5JI9A 4IE0A 1LTEA 4URTA 3USSA 1D0GA 3AP7A 2Q4SA 4ASMB 2UU8A 4YGCA 5CFDC 4OCTA 3IPVA 1QJEA 1DGRN 4IEVA 2MEV1 2HWD3 4I0WB 1AXKA 1L7RA 1WMEA 2A6WA 1H9PA 1RUF1 1UD1A 1VRH2 5JSOA 1DYKA 4D0QA 2QZ3A 5A7PA 3HAGA 1EUTA 4BK4A 4PI0A 3AP6A 3WP3A 4GJYA 3ZFEA 1E5SA 3OBZA 1OLQA 2DBNA 5FY4A 4IEQA 3AK0A 2KD7A 5JZGC 1F15A 1RUE1 4AOCA 3OBAA 5A7SA 1RUD3 4CU6A 2XHNA 1A8DA 4C0BA 3PVOA 2HYXA 3MV01 1GZCA 4KU8A 3SQOA 4RQPC 2CY6A 3KT7A 5EYXA 1SCRA 1IKPA 4IV1C 5I8YA 4V2VA 2XJQA 3OUIA 1LENA 3AMQA 4A7ZA 1JZ7A 3T2OA 4QB1A 3I49A 1AL21 1APNA 4IXLA 5J7MA 5EPAA 5ABJA 1ZBE1 3KT4A 3P5BA 3MIFA 1W9SA 4B3NA 5ACA1 5HBAA 3EJKA 3N7MA 4ZU7A 3LFIA 1N1VA 1Q8VA 2TEPA 3C7OA 4TLFA 5K0UB 1OD3A 1V9U2 4GXLA 2E7TA 2QJVA 1KJRA 3I54A 5JAXA 1AR71 3ILNA 3ZPOA 2VC9A 1LU1A 2CAUA 3FN9A 3CKHA 4B1MA 1LOAA 3DECA 3ENRA 4IV3B 5FOJB 4UWDA 5FTTC 4ZKTB 3IN9A 3K3NA 4HSLA 3ECQA 4YW1A 4C1XA 5H9SA 1HN0A 2RMU3 5K9YA 2F4LA 3AKQA 4QU2A 2VZUA 3AP4A 1NT0A 1QJY2 2WQ4A 1AR61 1AX0A 1ALYA 3FLRA 1VP6A 3JZVA 4KWUA 1AR81 3M2MA 3NV2A 4RS5B 5LBCA 5FYHA 2ID4A 2B4KA 5FZKA 4GH4C 1PZ7A 2QE3A 3A7QA 3KM5A 4GWIA 5I0DA 3I7DA 2PQQA 2XJUA 3O1PA 4QHOA 2E32A 5FMDA 5BNNC 5CA6A 3NVCA 4UF0B 2VTXA 1PO13 2RS12 3CEWA 3UETA 1IHMA 4COUA 3RQ0A 1NCRA 1S0GA 3AKSA 3NL1A 3I8TA 1UL9A 2XBO1 3AMNA 5FPLA 1MS3A 3S30A 1GWLA 3K75B 4MXVA 4YW4A 1AR91 4YM1A 3VDDB 2J1VA 3PUQA 4LKDA 2BWAA 4HKOA 2PYTA 4AGRA 2I07B 4FPOB 4D8MA 3WSOA 1AYN1 2R7EB 2A70A 2JJ6A 2YHJA 5DDJ1 1QMJA 3OD4A 3ZXGA 3BIWE 3VBUA 1J84A 2ZGQA 1WUVA 1LKNA 3K48A 1BKZA 1D0HA 4QX1A 2JEMA 3R05A 5FYTA 2CTVA 2JWPA 3GZTB 2I74A 4L97A 4DXZA 5AFEA 1CIYA 4L2NA 2YGMA 4YZ4A 4QX5A 4QPIB 2WRAA 4IGPA 4L0PA 3AFGA 2UURA 2FDGA 5FZBA 1WMXA 4Q4Y1 1VBB1 5TSWA 1B35B 5DUUA 2UYBA 2Y6KA 4UOJA 5I91A 2DUPA 3AC0A 1LRHA 1VMJA 5FPXA 5DG1A 4KNCA 4TXWA 2IXJA 1SEFA 3TB0A 1ZA7A 2OX0A 2PXJA 1OOPB 3N9MA 5FMOS 5T50A 3LE0A 4LO8A 1RITA 1UY4A 1D2SA 1HN1A 1JBCA 4CP2A 4OHWA 5FZ0A 5K0UC 4LA2A 4AI2A 1H8VA 2XVKA 3FBYA 1D4M3 3NNLA 3C3VA 2I45A 3K2OA 1MR5A 1GLHA 1XPWA 4IV3C 4YVWA 3AKRA 1YFYA 3HMYA 1K5MB 1LB2A 3N7KA 4AF9A 2WT2A 2Y6LA 4QGMA 1WCSA 1O8SA 3DPRA 4UW4A 1O8PA 3LEMA 3AKTA 2QCSB 4JAAA 5J98B 3H7JA 4RS5C 3RZGA 5C3RA 3PHMA 3WF3A 4CU8A 1XOYA 1DZQA 3NO8A 1RB8G 3UL2A 2GNDA 4QT6A 4Q4X2 4BLJA 1R1A3 4A41A 4D3WA 3FUQA 1VBC1 3POBA 3L9JT 1ASJ2 2W91A 2YU1A 4BQ2A 1VBE1 1JYIA 2AZ5A 1W99A 1QOTA 2WZEA 1HLCA 1PHMA 2EF6A 3J8F3 4KMQA 5FFOC 3UGGA 4CDQC 3VKLA 2DWRA 3I3BA 3UKVA 2D6MA 3KSCA 3OY8B 4RR3B 3VDDC 2JKXA 3E97A 5KBFA 3Q8BA 2CSGA 2JIGA 2ZGUA 1SMVA 4XBLA 3GCWA 2E7AA 3NKGA 3P1IA 4LOSA 3VBHB 3ON7A 5L9VA 2QQUA 2VW2A 4GB31 4LOTA 4ZY9A 4YZ2A 3SH4A 4AGGA 1CAVA 1IQAA 4EWAA 3BPZA 2ZX3A 4QPIC 5DXDA 2JKBA 1XYPA 4ARYA 3L2HA 1UX7A 4B4QA 1C5IA 1GP5A 5FCCA 2Y6GA 2PAKA 1B35C 3PJQA 4EZHA 5KXDA 4JX0A 1RUG1 4OMCA 4LPLA 2KA3A 2PHFA 2XUMA 4D6SA 2XJRA 1GZWB 1W6QA 1OOPC 2ZHKA 3QH6A 4QMAA 2IFRA 1LHWA 2YUEA 2ZS6B 5FYBA 1UZ0A 4LIUA 2VMHA 2BUKA 1IS5A 5DUVA 4XF4A 2DCKA 2VCMA 3ZO0B 4LUMA 2X5IA 4OULA 4WBBA 1OQDA 2BNOA 4ITCA 4R9DA 1ZRDA 2HH9A 3O1VA 5FDBA 1GU3A 4Q26A 4YVSA 1W06A 3T3YA 3TEZA 2W0XA 4H14A 1K5MC 3TRSB 5AC91 1UX6A 4AW7A 4Q27A 2FD8A 2EICA 2E63A 3V0BA 5FZ8A 2R043 3RYRA 1W2AX 1FPN1 4YZ1A 4YW5A 1VE0A 1H4HA 1QJU3 4I01A 5F39A 3KGZA 1J1TA 4KWLA 1W9TA 3AZYA 4P9YA 4IUGA 1SLTA 4XCBA 3RZZA 1QQP3 3VKFC 2BVVA 3RSJA 4Y5SA 1HRI2 3NNFA 2RM21 5LWBA 2P3IA 1D7PM 1NA1B 1YJLA 2QQVA 4RHV2 5FXWA 4AHYA 4BQ3A 4R9CA 5IJRA 1TME3 5KR7A 2VW0A 2OA2A 4HKWA 4RR3C 4H3WA 5C8WA 1Z7S1 2VCAA 2ZEWA 1W3VA 4OHXA 4UI9L 4XE9A 3ZVXA 1O5LA 3HOBA 4PI2A 3HT2A 1STMA 3VBHC 4CP0A 1UY1A 2LW8A 4FQ4A 3ITQA 4LKFA 4CA9A 5CFCC 3LIHA 1QDOA 4OVEA 3C7EA 3WG4A 2O14A 3DEMA 4N53A 4Q5OA 4YLZA 1G9CA 2NZ9A 4XDOA 2IFWA 1UAIA 3P3PA 2BJSA 3Q9OA 3WW4A 4RD7A 3K46A 3ES1A 2GMEA 2VMGA 4QB2A 2JDNA 1SPPA 5IVVA 4P00B 3ZN6A 2BU9A 3JBG2 3M7AA 5HCAA 2VMDA 3I3EA 2XLGA 2Z4FA 4N7UA 3INAA 5A80A 4EJRA 4XJ9A 1R093 2D6KA 3N7JA 4K8FA 2WNUA 2BFUS 2QQMA 3LEKA 4ZHNA 5KHKA 1PGL2 4MXWA 3WHUA 4XUNA 3VBFB 5FWJA 4A7YA 3P6BA 3Q8CA 2WQZC 4I3PA 4LK7A 4META 5K7PA 5T54A 2VVDA 2EAKA 2BTVC 4QHBA 3KVBA 2A3XA 4O7XA 4WVWA 1W8WA 4XF1A 2J1UA 1PO22 1PVC1 4XW3A 5EQUA 3ZN5A 5F37A 5JWPA 4Q4V1 4C1WA 2KM2A 3KV5A 5EWSA 4AHWA 3I2FA 1YEWA 4XFFA 5FZGA 3PTRB 1NQJA 5FBJA 3RGBA 1UU4A 4B1LA 5L19A 1VBA1 2UWAA 4W6XA 3DYOA 1NKGA 1VBD1 1AUYA 3MV11 4V2WA 4DMIA 3T1MA 3ZR5A 3ACFA 1WA6X 2ZGPA 1NA1C 2ZZJA 3S7IA 5HI0A 3HEIA 3T30A 1Y43B 4CU9A 5A70A 1OBNA 1RUC1 2Q8DA 4JVAA 1KD7A 2CWSA 2G9GA 2OPKA 3AZWA 1JYTA 1RUH1 4O65A 5J09A 4AI0A 1V6IA 5GLTA 3VV1A 4DEVA 4HVOA 2A71A 3AZZA 5CNAA 1BXHA 3ZDVA 4XDPA 1O6UA 2ERFA 3BOPA 3WXPA 4LO5B 1LEMA 4AZZA 4MGZE 1BBT3 2PHLA 1F35A 3HD8B 5FR3A 4XXAA 1A34A 1W39A 3BN6A 5FYIA 4XC9A 4BQ5A 4K3UA 5FO7B 2R062 3ACIA 1DLCA 5K4LA 1NY72 1ZZ9A 4ZZ8A 4JGYA 1DQ5A 1UKGA 1VRH1 4DY3A 1XBFA 2JDYA 2RS33 3WUCA 1CVNA 5JLVA 1AXYA 3N7LA 2AR6A 3WCRA 1CIWA 2VNRA 1UPIA 4K9SA 1JZ8A 1O4YA 1SQ4A 2J1TA 2GNMA 2YGLA 4AI1A 4CPBA 3H7YA 5KHHA 4D6QA 5BNPB 2WINB 2VZTA 1UXXX 1POQA 2C4XA 3PU8A 4BQ1A 1WCQA 3VBFC 1NX9A 2ZHLA 4DPNA 2BGOA 4W6WA 3V64A 1SBDA 5D2AA 1RVF1 2EIDA 1LHUA 1DQ6A 2Y6HA 4CP9B 4J6GA 4H2AA 1W6OA 2XLFA 1NAEA 2JE7A 1UOGA 1FI2A 1BMV2 1G9DA 4WZCA 1ENSA 4BOWA 1BK0A 5DABA 3VLBB 1D4M2 1LHVA 1N1SA 3CDZB 5T5PA 1F8VA 4UT5A 1J3QA 1WD3A 2J1SA 3LDBA 2RDSA 1LGNA 4FOYA 4CUGA 1WLWA 3J7NA 3T4HB 4WM8A 3T2PA 1V9U1 5JUVA 1OLRA 3ZSJA 3ZXAC 2QQIA 4X8NA 4R4ZA 2P34A 4HG6B 3JD72 1MQTA 2VOTA 3B69A 3WLUA 3PUAA 3RI8A 2DUOA 4CDWB 3GBGA 4XJUA 3UGFA 3N9LA 2YC2A 5DPNA 1FXZA 2WZ8A 3LEGA 4E8DA 5C8CB 1R1A2 3ZYJB 4XF9A 1QJY1 4AFBA 4YYOA 3T0BA 3J7LA 1QKQA 3IM0A 5GZGA 2FCVA 1DQ1A 3PVBB 1M06G 4NHMA 4EQVA 3KHCA 2PHXA 4OZXA 1RXFA 2QQJA 1O4ZA 4D7TA 5HCHA 5IK7A 3ILFA 4HSJA 5C5TA 2BP6A 4UFIA 2OIIA 1JZ2A 3VD3A 1ZZCA 3O14A 3GZEA 2RS11 2Y33A 4KQ7A 5JSRA 2C9KA 4AG4A 2VQTA 3AP5A 1UY2A 2ZGSA 2G9ZA 2WNVA 3AFKA 2ZCWA 3PVEA 4Y1YA 2VGDA 3ZLIA 4CE8A 5KWRA 1JU4A 3CZUA 4IEOA 2WS92 4AI9A 4CEYB 3O1RA 1SDWA 1C1FA 1FV2A 4Q0UA 2C9AA 3H0OA 3N9QA 3RZMA 1ZRCA 5BNPC 4X6RB 3RI9A 4ORFA 1C8M3 4XJAA 1DIWA 5IYYA 2YBPA 1N1TA 2JIJA 3IPVB 2XDVA 3WOGA 4BMEA 4ZXKA 4MGKE 1EAH3 3T0DA 5E16A 5CU1A 5M0TA 1MS1A 1TQ5A 4UW5A 3ZFEB 5T5OA 3R0RA 4XTPA 3DXTA 5J48A 3CLPA 1YXWA 2R0FA 1W0PA 2MHFA 1HB4A 4Z2AA 4I09A 2ZJCA 1REEA 1UF2C 2JDHA 4MUVA 1Z0HA 2Z69A 4ATEA 4DUWA 4FAHA 3VHRA 3VD7A 2W08A 4GWJA 4E9KA 5FV3A 4Q0PA 1Y9MA 2G4IA 1GOHA 1OI6A 1ZM1A 3OGRA 4H7MA 4FPLA 4CDWC 2ZHNA 2QDRA 1KXGA 1HIXA 2N7GA 4NVPA 4AQ6A 2VH9A 1H1MA 5C8CC 5ABJB 2GNTA 2G1MA 1GANA 3C7HA 3WV6A 3JQWA 3U4XA 2ZMLA 4NOTA 3DCQA 1LHOA 3MIBA 1WMDA 3LPGA 4LE3A 3RRDA 4D7YA 3ALQA 1BQPA 2HWC3 2A5ZA 4JTNA 1QNYA 4WVZA 3IIAA 2WYFA 3K51A 5G04L 2VG9A 4Q4X1 4QX8A 4NIGA 2WAOA 4R8HA 1RINA 1VMFA 3KZ4C 1ASJ1 2C6SA 4GMP1 4Q4W3 3O1SA 5BV6A 1I5ZA 2QTWB 2R1BA 1MEC3 1NXD1 1ZRRA 2GZWA 1VLNA 5FZOB 5IWFA 3UYJA 3NNGA 4IETA 4ES9A 2ORZA 3SLIA 3GZAA 4CEYC 3B02A 3ZX7A 1OURA 1AYM3 2HWF3 5CB7A 1PGW2 4XHXA 2WQ8A 1X50A 5CG9A 1JTZX 1OA3A 1T6BX 2P3YA 1US2A 3RYKA 2DCYA 3WP4A 3ZSEA 4NHYA 1J1LA 2Q1FA 1U12A 2JG8A 4ET7A 5F6KA 5C33A 1GUIA 2ZMNA 4A6OA 1CQ9A 2JDPA 1ND3A 2D3PA 1ULPA 1S2BA 2HWE3 3POEA 4OZOA 4K20A 3FZ3A 1OKOA 1XRUA 2XQRA 3DYMA 4EE2A 1NCRB 3RMXA 2OXBA 1QNWA 1SBEA 1RUJ3 3ZYPA 2VZRA 3E6DA 1WW6A 2WFF2 5A6ZA 3ZFEC 2JDKA 5LW9A 3VKMA 2XUEA 1YI7A 1Z7S2 4YM2A 3R4SA 1O5UA 2HWB1 2ZAHA 2B46X 4HT1T 3VBUB 3Q8EA 1K12A 3IT8A 3KF5A 1AJKA 1MPXA 1WKYA 5FZ3A 3VBRA 1MS4A 4FFIA 3CHXA 3LQCA 1UMIA 2OYZA 4B29A 4BDVB 4DB5A 3TOJA 4OI4A 5JXGA 1CESA 2QQLA 3FHIB 2WZR2 4JZRA 5EJ1B 5FJHA 5FYMA 5HV4A 1OA2A 1YNAA 3MLLA 4ZS2A 5FMCA 4F7ZA 5DN2A 2C5DA 2B5HA 4Z07A 2FMDA 4Y20A 1O3QA 5ABJC 1D4VB 1OPOA 3FHQA 5FZLA 4XQ4A 2FQPA 1OVPA 2ZAAA 2CWMA 5BY5A 1RMU3 1GP4A 3AX4A 2ES3A 1H9WA 4FP3A 4XYXA 2W92A 4KBBA 4JQRA 4CUAA 4YZ5A 3B93A 3VBSC 4JC1A 1BHGA 2ZEYA 1UWWA 3IBMA 1SZBA 5D8AA 1HRI1 5DAVA 1GP6A 4GWNA 4B4RA 4NIDA 3IMNA 3SMHA 2RJ2A 2W1SA 1H8TB 4EZ4A 5CG8A 1F5FA 4YVWB 1NXMA 4RHV1 1UCXA 1DP0A 4WVMA 5DZGA 2JE8A 3ZSLA 4AQTA 1LOBA 2JENA 3TBDA 5FZCA 3KQ4B 2VZSA 4TZDA 2VBPA 3K77A 4YG0A 3T0AA 1FT9A 4QXBA 4Q1RA 4GA9A 4K1ZA 3RZJA 2YXSA 1PVC2 3OUJA 4P9XA 2WDBA 5JOYA 3H8RA 1DYOA 1S1AA 4EN9B 1Z78A 1ZBA2 1ZNPA 5GZEA 5IW0A 3X29B 1LU2A 3I3MA 1W8OA 3THDA 2QQKA 1S4CA 5KXBA 2WR9A 1F4HA 1WW4A 1V6MA 1SDDB 3WUDA 1W6PA 3JXSA 1NCRC 5H9QA 2IVIB 5DZEA 4AEJA 2FCTA 3HBKA 4PBPA 4S2HA 3NJZA 1I1EA 1FOD3 2GP5A 1GSLA 2NQYA 4L99A 3H9AA 1QXPA 1AVBA 4XFCA 2RJKA 1OLMA 2VQUA 3NNJA 3JBG1 4KBZA 2VZ3A 5FZ1A 1DGWA 4QKBA 2FZ1A 1QEXA 2XL9A 3BB6A 2P1BA 4HL0A 1T6GC 1N1YA 3VBUC 3ZFFA 3APBA 1KJLA 4ZXEA 3NMBA 5ANQA 1PGL1 4UFMA 5JPMB 3T08A 4PCRA 1H2LA 3KQRA 3WNLA 1CPNA 4YFWA 4A7KA 4MVTA 4Y22A 1FMD2 1B09A 3LD8A 4NO4A 2ATFA 4F83A 5JXIA 3GBFA 2JDUA 4DRVA 5HCBA 1PMIA 1J59A 2AC1A 3HR9A 2W1UA 1PO21 1BVP1 1TMF3 3JQXA 1LAJA 4IQPA 2XJSA 1SACA 2EIEA 4O9GA 4Y4RA 1ULCA 2XOMA 3HNBM 3BU7A 4HPKA 3RWNA 4INDA 3GHMA 4PDWB 4PIYA 4A42A 3LSEA 3SCFA 4AFAA 5C9AA 2D6PA 3CZJA 3WCSA 2X5IB 1PIV3 5FZ9A 3ZIXA 2VNGA 2JG9A 2VUAA 3CIHA 4NAOA 1WCKA 1H8TC 2EIGA 2P3KA 3ELNA 4YVSB 4YVWC 3RWKX 1RVF2 2C24A 2GMPA 2VECA 4J25A 3WW1A 3I4IA 1YLLA 3VD4A 2XMLA 4Y33A 3SHRA 2D44A 4XAEA 4XF3A 1A3KA 2VMEA 4AQSA 5IK4A 4BK5A 1BEV3 3V0BB 1FATA 5CIRA 1XE7A 2GN3A 2K46A 3ORJA 2QDNA 5FY7A 3IDAA 3HN1A 2RG4A 1LEDA 1OSGA 5J3UA 1REFA 2R072 4WM7A 1PNGA 3GF6A 5I0RA 3SEPA 4FSJA 2WWUA 1TNRA 4AFMA 3D0JA 3TNQA 2UWCA 4FBFA 4CCCA 4MLOA 2MNGA 1VRBA 4QQOA 2F17A 4M4PA 4XMAA 1DF0A 2AYHA 2R061 5A3OA 1UOJA 5JOWA 3ZFGA 1NY71 4XFHA 5FYZA 5J1XA 2HLEA 3MW4A 1JOBA 2GALA 4IE4A 2I2SA 2YU2A 1RHI3 1UZWA 1ND2A 3J4UH 2JE9A 2JD9A 4CUBA 1GBGA 2FCUA 3WY6A 4MYEA 4AVTA 3ZKYA 3MIHA 5I8TA 4AE2A 4COYA 4MADA 4NHXA 4FTSA 3HVDA 2VE1A 4QQPA 3KS7A 3G6JB 4P02B 1ZREA 1XE8A 2FDJA 5GLVA 4N53B 2VD7A 2MEV3 1RUF3 2R1DA 3RVHA 1N47A 1ZRFA 1U5ZA 2ETEA 3KCXA 3WEZA 2YYOA 3V0AA 4FP2A 3T2QA 4NMIA 5F5QA 1ZVFA 5FP3A 1BMV1 1RYYA 1SPPB 3GJAA 2Z2SB 3N9NA 5LY1A 1CR7A 3ETPA 1O91A 4R52A 1D4M1 4OI0A 1RUE3 3CBNA 2EXJA 1S0CA 2GSYA 2WNUB 3FJSA 1W03A 2VY0A 4PDWC 1HB2A 3WP5A 2D3SA 1SG3A 2YPJA 5FY1A 1HXS2 2UY8A 3DL3A 2D40A 3BI3A 5DUXA 2EAAA 2X5IC 2OPWA 1Y9GA 1DZTA 2JB8A 1D2QA 4NRMA 3N4MA 3WT3A 1QXJA 2GDFA 1UOBA 4YVSC 1JHJA 3MIEA 3NJVA 2Y38A 2Y8KA 5L73A 4C0HA 5DMYA 2A6YA 1AL23 1UU6A 3JD71 1DBNA 1UYZA 2PFWA 1H2NA 2ET7A 3OEBA 5BNQA 2IXCA 2O1QA 1WA4A 1KS5A 5ACA3 5IK8A 2WN3A 1TG7A 1R64A 1R1A1 1JN2P 2L9LA 2ZGTA 3A21A 3JB4C 3UKNA 4BQXA 1E5IA 5A6QA 3ZOIA 2PAEA 2ZMKA 3J8F1 2J7MA 1AR73 2RS52 3POJA 4K40A 2Z5WA 3VZOA 4TTGA 4GMP0 2VBBA 3ZXEA 3Q8FA 3I2GA 2DTWA 1CAWB 2PHRA 4IERA 3FHAA 5ISLA 1UZYA 3TN92 4PT6A 4L92A 4NROA 4LORA 4PLOA 3AMPA 4Q1PA 3PVNA 2C26A 1UY0A 1W2OA 2Q8EA 4DXTA 2GC3A 2XWJB 5FK7A 1ENQA 1AR83 1EV12 1U5XA 2DFCA 2WS91 4A3ZA 4AK3A 2J1AA 5E88A 5GM0A 1RUI2 3MW2A 3PMSA 3WQ7A 4PF5A 3TNPB 2OZ6A 2WA3A 3ABZA 2OVUA 4N53C 2X05A 2XGXA 1GZTA 4LXLA 5A1AA 4FFGA 4R9BA 1LOCA 1CZTA 2XBO3 3SCGA 3THTA 3S57A 4XEZA 1MZEA 2W47A 3THCA 2IUWA 2OT7A 1LESA 1YC61 4JGYB 3BKZA 1OD5A 4MO3M 5GLUA 5DAWA 2JD4A 4QPGA 4NR1A 4QX0A 1PNFA 1UIKA 2VOXA 3OBRA 5DDJ3 4AEMA 1ULDA 3RZHA 1PZ9A 2WWSA 5FUIA 2LS6A 2WNUC 1WCDJ 5CVRA 1W2UA 1MACA 2IXLA 4IE6A 5AVPA 3MLKA 1X8EA 1YFXA 2WAAA 4LKSA 4CVUA 2YV8A 1XXNA 4Q4Y3 4OYUA 1VBB3 3ZMNA 3HPNA 4FFHA 3R6SA 2SLIA 2DVDA 5FZDA 3WF0A 4D6RA 1WGPA 4LHKA 3RMYA 4KG8A 1W6OB 1IOAA 3UJOA 3MFAA 4HETA 2YB7A 2PA7A 5A7NA 1JYNA 1COV2 5FP8A 1Q8QA 1V70A 1S0BA 2PHDA 1QIQA 5FKBA 4ZONA 4YGEA 5FIXA 3FL7A 2B39A 2VUJA 3U78A 3ZXFA 2PLV2 2YMZA 5EFUA 2R32A 3NNMA 3DUIA 3RFRA 2CGOA 2P2KA 2HWB2 4WM8B 1FNYA 1UU5A 4LNVA 3LKJA 4GQ7A 3HIFA 1Q8PA 2R49A 3VBOA 3TEXA 1SHWB 4JKMA 3GM8A 2YPDA 3K4AA 3O1UA 1MQTB 3ZDSA 1H6YA 3D3AA 3GALA 3LEIA 2VXJA 1W05A 1QGLA 3AJZA 3IMMA 4I0BA 1QJX2 5BNNA 1W6MA 3PDQA 4FXKB 2EIBA 2PHUA 5FUPA 1PGW1 5FYSA 5FPAA 3H8OA 3IAPA 5C3SA 5A6XA 2P17A 3LDKA 4HK9A 1JW6A 4YG6A 5JOXA 3KGLA 3QLQA 1CWPA 1CJDA 4I30A 1VBC3 2QQWA 3BGAA 1ZYBA 4G4FA 4JGZA 4PQQA 5EJ3A 4QQ2A 2RR12 4LBLA 1UY3A 1ZZ6A 5FY8A 1X33A 3VD5A 3SKJE 3DXUA 5I0SA 3O1MA 3PUSA 2Y0OA 4JGYC 4BQ4A 3BTXA 4MZUA 4XURA 5A3MA 2PELA 2WO2A 2WNVB 4N43A 1SCSA 1SLCA 3LSDA 3AYDA 1HRV3 4IE5A 5FP4A 2WFF1 4P5YA 4AQ2A 5EHDA 5CADA 1GYKA 2JDZA 2VNVA 4GB33 4QKFA 3I3QA 1HJFA 4BCUA 2VUCA 1DGLA 1IZ3A 5IVFA 4QDQA 4NIIA 4DFSA 2VULA 4NN0A 2D98A 1C1LA 2HWD2 3B9CA 4K8RB 4W65A 1TMF2 3WG3A 1WBFA 1IQDC 4HN0A 1RUG3 5KHGA 4HBNA 1REDA 2WZR1 1H4GA 4RYDA 1RXGA 3E6BA 5HXMA 1S55A 1S2KA 1S0FA 1XU1A 2GC2A 4TYSA 4UAPA 3WNXA 2DFBA 2RHPA 1F9KA 3EMRA 3M3EA 5EXOA 1RUD2 4COWA 2VNOA 3FX3A 4BPZA 3CU7A 3I2IA 3G7DA 3WDXA 4E4SA 2Q5TA 5F1RA 4EWDA 1JU3A 1CZSA 2BWCA 2CDOA 3MI8A 2HEVF 2ZX0A 5AC93 4AHZA 2Q0AA 1CX4A 1GNYA 3WDUA 3M3IA 4IGOA 4BA6A 2CU5A 3E6CC 3PUIA 4FT8A 1MQTC 2ZOEB 1FPN3 1XQNA 5A3TA 1V0AA 3NJXA 5JR7B 1I3HA 2WUHA 1DDLA 3U10A 1G6NA 3NV4A 1O3RA 3NAPB 2ZGLA 3ASIA 2D3RA 2UY9A 4P9WA 4X8PA 2ILMA 4YW2A 4CDQA 1ODNA 3LZZA 4QGLA 5EYYA 2G9FA 3PURA 1GICA 3BOWA 4IW3A 1ZBA1 2EALA 4LBQA 4QX7A 3VDDA 2H6CA 2RM23 4NRQA 5DQ0A 5JVVA 2V72A 3SCHA 4YRDA 1IS4A 4CRQA 1DU3D 1YQ6A 2AGSA 4FOQA 3I2JA 4NE9A 4TN7A 4ZPIA 3UNPA 4O9EA 3MF6A 2RMU2 1G8WA 3ZXKA 3V56A 2ZEZA 5L36A 2BOIA 1YQ5A 3LWCA 1W8TA 4XQDA 5FZ7A 1S0JA 2WNVC 2GH8A 3W59A 4NPRA 2JB4A 4QPIA 2BW8A 5A32B 3GYDA 5GLWA 4LK6A 3U07A 5C3QA 1B35A 2BNNA 3N3HA 1XC6A 3KHBA 4J1WA 4KI5M 5LRSA 1N3OA 5LEKA 2Y0IA 2P3JA 3POWA 2XJVA 2QVSB 3RS6A 5A3LA 1PO12 2JG8B 4DXSA 1VPHA 1YQ2A 4LE4A 4JCKA 2XJTA 3UV9A 1ND3B 3T4VA 3FLTA 3MIGA 5LASA 1C57A 5LA1A 1FMD1 4JHZA 3AZXA 5FLIA 4CCDA 4DUVA 1QU0A 4K6BA 5L9RA 2BBVA 4A45A 1US3A 3VUOA 1ENRA 1Q5OA 1IPSA 3LCPA 1C8NA 4RFT0 4ASLA 4P9IA 3FFQA 3ZIWA 1V6JA 5JMCA 3WG1A 1W6NA 4BZ4A 2XHKA 1SLIA 4Q8LA 3KV9A 4I2OA 1XSRA 4ONUA 3LAGA 2ZGRA 4HANA 4B7KA 1GNHA 2BERA 4G9SB 2ARXA 3VBRB 4COZA 3BODA 4CCJA 4LO6B 1W8NA 1DLLA 2IWGB 3LA3A 4AGVA 2FDIA 5IVBA 3W5MA 3IIIA 4IEYA 4Q4V3 4E27A 5FMBA 4DY5A 5JPNB 3SH5A 2Q8CA 4Y20B 5T52A 2F4PA 1YYNA 3NJYA 1QDCA 3ZXLA 3NAPC 5A7WB 4Z2WA 4MG2A 1JODA 4M0HA 1OT5A 3EO6A 4YG3A 1VBA3 1CD3G 2Q30A 2R071 4E8CA 5J37A 2OQ6A 2B8MA 4E4HA 1PMJX 3ZYRA 2K0GA 2PHWA 5F5IA 3M70A 4YW3A 3VN4A 4XJWA 1RUC3 1TZOA 1NZIA 5C3OA 2P6CA 4LT5A 5CFCA 4WVMB 2VMFA 4NPLA 4RGAA 3PTYA 2AH2A 1P8JA 1WW7A 2D6OX 3C7GA 2B9VA 4W4ZA 3SH3A 5DUWA 2YG0A 3K3OA 4XQWA 4AEDA 5EP9A 1OPMA 2IZWA 4N8MA 5EIYB 1VB2A 4HLTA 2JG8C 1GZWA 3J8F2 5JCTA 2HEWF 1CAUB 2UYAA 3KLSA 5F3CA 3RDIA 5CAZA 1W6PB 4MH0E 5F2WA 5C6CA 3UT0A 2Y64A 5FUNA 2VOWA 1ONAA 2PTMA 4Z92B 2ZA9A 1ACCA 3I2OA 1F4AA 1X9TA 1YJKA 4LEJA 4FPCA 5D1IA 1VB4A 1AJOA 3O0VA 3WDTA 1JHNA 2BRTA 2WO7A 3ST7A 4CDXB 5FP9A 2A6VA 1X8MA 1MZ5A 1JXNA 1FAYA 2IVJA 3F95A 1J3RA 3D4KA 4XVHA 4I0AA 3MBWA 4DUXA 5I0TA 1X36A 1XB9A 1DCSA 3MF9A 5BNOB 2DUQA 5IVJA 1HXS1 3B7MA 3GNEA 2AREA 4DIQA 1GR3A 3VBRC 5LK7B 3VDBA 3HN3A 4V1PA 3QOPA 2XG3A 2AEYA 2CHHA 2OQ7A 4RFRB 4EV0A 3FLPA 2O0OA 3O7OA 4GKXA 4BIOA 1V6KA 3OTFA 1UXZA 1OXCA 5CZKA 1IG0A 2VCCA 3AMMA 5A1FA 2H0VA 2YBSA 3CJIA 2BQPA 4GZ9A 4Y4YA 5FY0A 2A3YA 2WZPP 4AFCA 1WZXA 4HPKB 2LUWA 1LGBA 1JOJA 1V9U3 1VAMA 3M4FA 2RS51 4YGBA 4XFGA 5C9AB 4RA0A 2X8KA 5A7QA 4FPJA 3ZYGA 4YNIA 2TNFA 2HJIA 2YC4A 3CNAA 3T09A 2QFEA 2JG9B 4COVA 1OHFA 2HWF1 2SBAA 2VCBA 2WL1A 4NPMA 3J9SA 4ZS3A 3S7EA 4Y1ZA 3TN91 2R042 3WW3A 2ZKLA 5EZWA 1LJ7A 2BVBA 2DF7A 1QJU2 1QJY3 1N3QA 2DDUA 5FBZA 1T2XA 3AYAA 3JB8A 3KMHA 3QACA 4W8JA 4DXRA 1EV11 1QQP2 3AB0A 1JZ5A 2VVFA 4CXXA 3TEWA 5FRAA 5A7OA 2FZ2A 2ZBJA 5LB6A 1RUI1 5LBFA 3H3UA 4ZZ5A 5KHIA 1KFUL 2GP3A 5GZFA 4MGTA 1HRV2 2BV4A 2RS13 4DRRA 2ARBA 1TME2 4P5HA 3BYWA 1NQDA 5H9RA 2VJXA 3D5OA 3UK9A 5IT6A 4CZSA 1CX1A 4CCKA 2D5HA 5F5CA 4YM3A 1RUOA 3IKWA 4H55A 4LBNA 2IXHA 1FYUA 5B4NA 1IPKA 4XUPA 3PIJA 4CDXC 3BU0A 4W50A 3OOXA 1AX1A 3VHOA 3FUOA 3MUY1 1POV1 3POFA 4FFFA 5FY5A 2GC0A 2TBVA 5BYNA 2Y6JA 2RE9A 1ODMA 3OYWA 5BNOC 1J3PA 3S5AA 2ENRA 1NLRA 1Y9QA 4ES8A 3RNSA 2V4AA 2CYFA 2QNKA 1AZDA 1X9PA 1R083 4LLFA 2VQ0A 3OB8A 1MS8A 3A22A 2J1EA 3V0AB 4OHVA 2EVXA 3GDBA 3ZSKA 4OFGA 2WBKA 1COV1 2GMMA 2IC1A 1R092 2XQXA 3ACLA 4Y1XA 3FE5A 1WWYA 3TEYA 1RC6A 3K4ZA 1OLME 3MHZA 5L7OA 4XILA 3ZKUA 1EYBA 3MFCA 2PLV1 4CEWA 4XZPA 5JMOA 3FBMA 3OBTA 4MGSA 4XF0A 5C9AC 4QPYA 4Y1UA 5C4WA 4TLGA 4MHUA 2VZQA 1PK6A 2FDHA 3DV8A 1W3XA 4GULA 3OG2A 4QKDA 2JG9C 3H3LA 5T5JA 3U14A 1CN1A 1F31A 1NOVA 2HYKA 5T5LA 3L2YA 1UW8A 3LA2A 4BMBA 1JOPA 1JUHA 3SISA 1GMMA 3AVRA 4GWMA 4MHRA 4P08A 4S2DA 5JIUA 1CAXA 1QJX1 1UPSA 2O8QA 3DKWA 3QCWA 4UW6A 2ZGOA 5FJKA 3HNYM 3MDPA 2FHRA 3JU9A 4ARXA 3M3CA 1LGCA 1L7LA 1XYNA 3P3NA 4PHZA 1JUIA 4Q4X3 1CONA 4HKLA 4GMP3 1ASJ3 4QB6A 4A6SA 4AI3A 4BXSV 2DVGA 4RGKA 1OUSA 2RR11 1XNCA 2QQNA 1OF4A 1ULOA 2PAMA 4YZ3A 4AXOA 1NG0A 3FC0A 4B7EA 4BU2A 3QD6A 4QDSA 2VQAA 5FPVA 2JECA 1AL0G 5FZHA 1FV3A 2HBUA 1V6OA 1HQWA 2BZDA 3J7MA 4FPGA 5FQ0A 4CP9A 1K5JA 5FPUA 2E9QA 2GU9A 3LOBA 2OZJA 1LCLA 2ZTNA 5GALA 1BBT2 1GQPA 2IXKA 3AL6A 3DPRB 1W0OA 1OH3A 4AAPA 5IFTA 1X7NA 3EB7A 5DAXA 4JQTA 1OF3A 3USUA 2A75A 2MPFA 2HWD1 4WV8A 1OUXA 5J96B 1TMF1 4QQHA 1JS9A 2RS32 1DGWX 4N7IA 4AEKA 2J1RA 4GJZA 2X53S 2NYYA 1AF9A 4M3CE 2V5YA 5GLZA 3THPA 3VDCA 4QPGB 1JH5A 5LCWL 2WABA 4RSUA 2QQPA 1RL3A 3MYXA 1F2NA 1URXA 4DNYA 1RUD1 1EUUA 4G3YC 1NLSA 4EN6B 4QKNA 4F8AA 5BUVA 3OUHA 4CDWA 2CGPA 3M8LA 4IESA 1QWRA 5GJ6A 1ULGA 2W46A 4BH9A 3BPSA 5A3UA 1HKDA 1CAVB 1KS4A 1MS5A 1YRZA 2GC1A 2KR2A 3MIDA 4IEXA 1RJ8A 3U4SA 1W0NA 1QH6A 1O4TA 3MUZ1 4MGQA 3GBWA 2VAUA 1OQ1A 3OJBA 3POIA 4J1XA 1UYYA 3PJYA 1JYXA 3UJQA 1W6QB 1HRI3 2Z42A 4CEYA 1Q3EA 3U37A 4RHV3 3OGJA 1VAKA 4XBQA 5FZ6A 4N9HA 1GZ9A 1BCXA 3CL1A 3EHKA 3VBOB 2X10A 2H0BA 2RMU1 1WLTA 2RDRA 4Z8BA 2EXHA 1FNZA 1A78A 1DQ4A 3AYCA 1GV9A 1GWKA 3W58A 1DGRA 1UMZA 3HBZA 4C91A 5BNNB 2W1QA 3SXWA 3ZXDA 3I97A 1W6MB 3UKTA 4TSVA 5IAVA 4EN8B 1TNFA 4QXKA 4AVCA 2FBEA 3DPRC 3WF2A 4XUOA 3VKOA 1QHDA 3DF0A 3DYPA 1PO11 2WC2A 4D94A 3PL0A 1BK1A 4FI9A 4JGZB 5J36A 3E5UA 4QM8A 4JV4A 4YGDA 4S2GA 1KITA 1SFNA 3GCXA 5KC6A 4HZFA 3JBG3 4JRLA 2DVFA 3B3QE 5LA2A 3PNAA 3WP6A 4N43B 4QPGC 5FYYA 4XBNA 4K21A 2A73B 4OUSA 4M3CA 3CO2A 4HVRA 1WD4A 5HPOA 2JDMA 1C8M2 4OI1A 5HV0A 4CU7A 1LNSA 4GIQA 1YO8A 2R0HA 4LITA 1Y4WA 4PBOA 2CNAA 1UQXA 4CPBD 1TVGA 2JDAA 3WZ1A 1GOFA 5LATA 3WNKA 1GFF2 3AXDA 1EAH2 2A6ZA 4LIVA 2ET1A 2DTYA 3C2UA 2VUDA 1MZFA 4L9BA 1PO23 2Y26A 4UBGA 3VBSA 2ADDA 2XKOA 3KCYA 1NYWA 4ISRA 1AHSA 5LZ6A 4IE7A 2VBDA 3E1F1 1LOFA 3ILRA 3ZN6B 5FZOA 1OC1A 4U36A 3HWJA 3U11A 2IXIA 2E53A 3I2DA 2HKXA 4K7JA 2Y6FA 3A4UA 2AENA 3SC7X 4MXWB 1DQ0A 1OVSA 2WJSA 3MPPG 3BIEA 3I3DA 3VBOC 5FAXA 1Q43A 1NCQA 1YUDA 3HT1A 2EXIA 1XSQA 2CDPA 4N9IA 4AI8A 1G9BA 4CDUA 2WT0A 4LHLA 2BGCA 5C71A 2HWC2 4OHZA 1ZBE3 1PMHX 2WN2A 4NWWA 2EXKA 5T3NA 4CDQB 1S2EA 5FZFA 5IK5A 1BYHA 4XUQA 3TWIA 4NAMA 4DO0A 4KGGA 5FREA 3WINE 1K45A 2LRPA 2W39A 2R30A 4LBQB 5FPBA 1IPJA 3ZFFB 4S2FA 4Q4W2 5FXVA 2R063 4JHTA 3FFZA 5A33A 4JGZC 1N3PA 4QAWA 3SITA 2ORXA 4Y1VA 1KDMA 1MEC2 2O8OA 1J83A 3MO4A 5DAQA 1X82A 1XJAA 4LBKA 1FX5A 3H1WA 3DGTA 1W9WA 3VDAA 2Y34A 5FO9B 1JZ3A 1AYM2 2HWF2 2NMOA 5FZIA 2VZ1A 1Q8OA 4N43C 1H2KA 1POV0 2WFPA 1VR3A 4Y24A 1IGOA 5LK5A 2KXLA 1A6CA 4K1YA 4KU7A 4OMDA 1AR63 1R082 1DFQA 1QJFA 2ZGKA 4LULA 4YWAA 5CFDA 4JKLA 1PVXA 2HWE2 2W9XA 3RJRA 4MX3A 1BZWA 4DS0A 4B8EA 1E57A 2XJPA 4LHNA 2DCJA 1W8ZA 4M00A 1RUJ2 4FPFA 2VMIA 1VALA 3WNNA 1SLBA 3IAQA 1O59A 3ZPYA 4FTEA 5JZGA 3SKVA 1AR93 2XB6C 1H8TA 4NUBA 2E51A 4DOUA 4LLOA 3I59A 2VO5A 1AYN3 4RQPA 1KFXL 5GZDA 3BTYA 3WX5A 2DCZA 4XACA 3WDWA 5E1RA 1PZ8A 3W9AA 1W6NB 4IV1A 3ZYBA 4UW3A 4YSFA 1GQGA 1YWKA 4PIZA 4Q0VA 4R9AA 1E5HA 3PLQA 1OH4A 1KDKA 2W68A 2ZX2A 2WSUA 3JD73 4QWNA 4CP1A 4LHSA 4JKKA 3HQXA 1JMUB 3QH7A 1EP0A 2R041 2YROA 1DQ2A 4BHPA 1DHKB 1QJU1 2NLRA 1XNDA 3R4UA 5ERLA 1RMU2 2VOKA 4E2QA 4Q8KA 1YIFA 2WO1A 2AUYA 4LO7A 5JXHA 2CGNA 3W5NA 1QQP1 4RL7A 2XVLA 4DEQA 1HQLA 2LM3A 1EY2A 2GAUA 4KWJA 4PJYA 2J42A 2YZ4A 1TE1B 3KV6A 3OGVA 1QXRA 1UO9A 3OPZA 4QU1A 3JCIA 3UESA 3WG2A 1JYVA 1A8MA 3HQRA 1HB3A 5FYVA 3VHPA 5KXCA 4BQYA 4MSVA 4OLLA 1HRV1 4OQ9A 2GH2A 5FOBB 1TME1 4NWVA 1UZZA 3E5XA 5FZ4A 2VZPA 1G9FA 5CFCB 4H7LA 5JDBA 3IDCB 2WO3A 1L3JA 1DYPA 3KWVA 3O0XA 2WS93 4YFZA 4P9LA 4GH4A 4BQWA 3AM2A 3ZMOA 4NHKA 3A0KA 4KH9A 3ETQA 3WDYA 2XWBB 3GHNA 5LRRA 3VGIA 3I2KA 2WT1A 2XXZA 3J26N 4AEDB 1PM4A 1RGSA 4FXGB 2XL7A 1LULA 2W3JA 2ZHMA 1MVEA 1TEIA 3KB5A 1FOD2 4BISA 4PDWA 4NIAA 5FXXA 1CZVA 1VBE3 2CAVA 1MS0A 3RJ2X 4A2UA 3N9PA 5GKAC 1JZ6A 3I2HA 3O1TA 1C28A 1XE0A 1R091 3PU3A 5F5AA 4CCEA 5KXEA 2R6QA 2RJLA 4DZGA 3HJRA 1W2NA 5FYUA 2NMNA 1HW5A 1NE4A 3LPFA 3TAYA 1LR5A 1QY4A 3LIGA 2V09A 1OFSA 3BTAA 3NV1A 4R4XA 4XFIA 4CCLA 1W90A 4XDQA 2A1XA 5LA9A 5FZEA 1C4RA 1Q56A 1RIRA 1W04A 4UFLA 4QX3A 2A3WA 2DVAA 4GAZA 2ZZQA 3WDVA 5CEHA 3LDRA 3VZNA 2DYCA 1E5RA 4RN5A 2XR4A 4A44A 4AAXA 2YDEA 5KHJA 1RUNA 3ES4A 1YIPA 4FAGA 1W8FA 1IS3A 1IG3A 1QOSA 2BOJA 5K0UA 5APAA 1SBFA 1ZZ8A 3BALA 3CJIB 3FWEA 3GGLA 1M4WA 1PIV2 2W87A 3ME2A 4Y5Z0 4IV3A 2Y60A 4QPWA 2OW4A 3A23A 4I02A 1OFNA 2WYSA 3MW3A 4BE3A 1HQNA 3ROUA 4PF1A 2OS2A 3ZYFA 1LOEA 5IVCA 4P9GA 3N35A 4N90A 4WM8C 1K42A 2XONA 1BEV2 4OQ8A 1HJGA 2K2SA 4QXCA 4RS5A 1GWMA 3WQ1A 1L7QA 2W5FA
chains in the Genus database with same CATH topology
5F8PA 3H8RA 3H8XA 4RFRB 4NIHA 3KHBA 3I3MA 3BTZA 4IE0A 3O1UA 4OCTA 3T4VA 3BI3A 4NRMA 3H8OA 4QKBA 4NIGA 3RZKA 5DABA 3O1SA 4ZS3A 4NPMA 4IDZA 3LFMA 4CXYA 3O1MA 4IE7A 3BTXA 3RZGA 2FDKA 3T4HB 4CXXA 4IE5A 2FDIA 3O1OA 3I49A 4QKFA 3BIEA 3I3QA 4ZHNA 4MGTA 4NIIA 4NROA 4QKNA 4MG2A 3BUCA 3KHCA 4O7XA 3BU0A 3O1TA 4JHTA 3S5AA 3S57A 4O61A 4CXWA 4NPLA 2IUWA 3BKZA 3O1RA 4ZS2A 3RZMA 3RZHA 3O1PA 4QHOA 3RZLA 4IE6A 4IE4A 4NJ4A 3O1VA 3I2OA 2FDHA 3T3YA 4NIDA 2FDFA 4QKDA 4NRQA 2FD8A 4NRPA 2FDJA 3BTYA 3RZJA 2FDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F8P A;  3H8R A;  3H8X A;  4RFR B;  4NIH A;  3KHB A;  3I3M A;  3BTZ A;  4IE0 A;  3O1U A;  4OCT A;  3T4V A;  3BI3 A;  4NRM A;  3H8O A;  4QKB A;  4NIG A;  3RZK A;  5DAB A;  3O1S A;  4ZS3 A;  4NPM A;  4IDZ A;  3LFM A;  4CXY A;  3O1M A;  4IE7 A;  3BTX A;  3RZG A;  2FDK A;  3T4H B;  4CXX A;  4IE5 A;  2FDI A;  3O1O A;  3I49 A;  4QKF A;  3BIE A;  3I3Q A;  4ZHN A;  4MGT A;  4NII A;  4NRO A;  4QKN A;  4MG2 A;  3BUC A;  3KHC A;  4O7X A;  3BU0 A;  3O1T A;  4JHT A;  3S5A A;  3S57 A;  4O61 A;  4CXW A;  4NPL A;  2IUW A;  3BKZ A;  3O1R A;  4ZS2 A;  3RZM A;  3RZH A;  3O1P A;  4QHO A;  3RZL A;  4IE6 A;  4IE4 A;  4NJ4 A;  3O1V A;  3I2O A;  2FDH A;  3T3Y A;  4NID A;  2FDF A;  4QKD A;  4NRQ A;  2FD8 A;  4NRP A;  2FDJ A;  3BTY A;  3RZJ A;  2FDG A; 
#chains in the Genus database with same CATH topology
 4FCA A;  4FPE A;  1IS6 A;  5JXJ A;  2J22 A;  4MGY E;  2Q1Z B;  3OGS A;  4XXP A;  1H1I A;  3IWZ A;  1GQH A;  1UIJ A;  4ZU4 A;  1OMI A;  4AED C;  1VIW B;  4UF0 A;  1BBT 1;  1S0D A;  2BDR A;  2NPI A;  5E89 A;  1U5Y A;  2B45 X;  4A3X A;  3BTZ A;  4DIN B;  5BXX A;  3B94 A;  3WQ0 A;  2F6B A;  4M4R A;  5F6L B;  4QGN A;  5CKQ A;  2WSV A;  3ACH A;  4LUK A;  2RS3 1;  1NE6 A;  1ST8 A;  4RGG A;  1BVV A;  5D21 A;  1RHI 2;  2ZPX A;  4BYY A;  3WD5 A;  3JUU A;  2VU9 A;  2WFF 3;  2R16 A;  4LBJ A;  2ZAC A;  1VJ2 A;  3CF6 E;  2E31 A;  4BXF A;  4QHZ A;  1W9F A;  1Z7S 3;  4B4P A;  5FYC A;  5FLJ A;  2DCT A;  2VOV A;  4I3G A;  2HBT A;  2H6B A;  2MEV 2;  4UXA A;  4E4Z A;  3OYW B;  3R4D B;  1RUF 2;  4PLN A;  4SLI A;  4MOA A;  3EQE A;  4XCA A;  3M3O A;  3RPQ A;  3BCW A;  1BLZ A;  2WZR 3;  5FZA A;  4GKY A;  4BIF A;  5ANN A;  5IVY A;  3VZJ A;  1UKR A;  5FY9 A;  4CSW A;  1W9Y A;  1SFY A;  2D93 A;  5FMO L;  4CCN A;  1NUK A;  5SV8 A;  5A3W A;  1OOP A;  2VTX J;  3U1X A;  3OSD A;  3WW2 A;  3GZU C;  1RUE 2;  1SFP A;  5JOZ A;  1BJQ A;  1CAW A;  3EXU A;  5IFP A;  1SLA A;  4MV2 A;  4YW7 A;  1G9A A;  1HV1 A;  3U0Z A;  1UN1 A;  3S0M A;  4JRA A;  2ARA A;  3CJI C;  5L7O B;  3WR0 A;  3BUC A;  4CEW B;  3AL5 A;  2ZXQ A;  1QH7 A;  5LEJ A;  5DAP A;  1K5M A;  2YY1 A;  2ZAB A;  3AZV A;  1OQE A;  1ZZ7 A;  5C4W B;  1W8H A;  5I93 A;  3PIG A;  1PK6 B;  4FPK A;  1AL2 2;  1ZBE 2;  1NLQ A;  2YFZ A;  4LBM A;  4P9J A;  2BPA 2;  1XNB A;  3PUH A;  4LJH A;  4L8Q A;  1AX2 A;  5ACA 2;  4AVS A;  5IAX A;  4CXW A;  5A6Y A;  1O3S A;  4HK8 A;  4D7S A;  3MIC A;  4M01 A;  4Z1V A;  3WNM A;  1PVC 3;  5JIA A;  2D43 A;  3SEE A;  1CAX B;  2V4V A;  5DZF A;  4AWD A;  4BB3 A;  1AR7 2;  2CL2 A;  2XH6 A;  4ISQ A;  1CGP A;  4BWO A;  2PMW B;  2VZO A;  1ZBA 3;  3KV4 A;  3LGR A;  1Y3T A;  1KGY A;  1JZ4 A;  1O7F A;  2DV9 A;  1RTV A;  4HMZ A;  5AVA A;  2W1W A;  4IEU A;  3MPB A;  1J58 A;  2NN8 A;  3CQO A;  3VKN A;  3RZL A;  4RR3 A;  3OY8 A;  1VBD 3;  1PM7 A;  1K3I A;  2Q1M A;  4ZU5 A;  4A4A A;  1AR6 2;  4X6Q B;  2Q8O A;  1QOO A;  3VL9 A;  2OUJ A;  3H3Z A;  3KD4 A;  3O12 A;  5D8A B;  4EYU A;  3LF7 A;  1AR8 2;  1PX3 A;  5FKC A;  3VBH A;  1UYX A;  3H1Y A;  2D7F A;  3NW4 A;  1RUH 3;  4JDO A;  3AMH A;  4Y3O A;  5E6H A;  5FQ0 B;  2V73 A;  1O3T A;  3J7H A;  4TWT A;  5T55 A;  3WF4 A;  5KC5 A;  2D5F A;  1ZRI A;  3ZR6 A;  1PGS A;  2W95 A;  1YI9 A;  1C8M 1;  3D0S A;  4KL1 A;  4NRP A;  5CBL A;  4GAL A;  4Y5T A;  3FMG A;  3VZL A;  2YBK A;  2BNM A;  3EBR A;  2BYV E;  4JTO A;  2XBO 2;  2VZV A;  4EN0 A;  3USU B;  2K9Z A;  1AR9 2;  1I9R A;  3IDE A;  4LQR A;  5F8P A;  1FMD 3;  4AHX A;  4AYU A;  4XOG A;  4YAR A;  1EAH 1;  4XZU G;  4ATF A;  1AYN 2;  2VTF A;  2P37 A;  5DDJ 2;  1ULF A;  1ND3 C;  1WBL A;  2WLP A;  3EYP A;  1VRH 3;  3M1H A;  4Q2F A;  3VHN A;  4FTB A;  4WZF A;  5EJZ B;  3B5L B;  3W21 A;  1JI6 A;  4AVB A;  1H30 A;  4UBH A;  2TUN A;  2WA4 A;  1HDK A;  4URA A;  5L7O C;  3D6E A;  3K4D A;  2AAC A;  2QKD A;  4XJZ A;  5L9B A;  4SBV A;  2DU1 A;  5G05 L;  4CEW C;  5CKM A;  4CCM A;  4Q4Y 2;  1VBB 2;  5I8S A;  3RYP A;  3MZH A;  2XPJ A;  1S0I A;  4JDN A;  1EPW A;  2E6V A;  4E4D X;  5C4W C;  1VMH A;  2ZGN A;  2BGP A;  4HXC A;  2E26 A;  1VAV A;  1PK6 C;  2PHT A;  3POY A;  4U2A A;  4UFJ A;  5C5U A;  5C70 A;  3RZK A;  1RVF 3;  1UNB A;  1GOG A;  3WQB A;  5IVE A;  3LFM A;  3DKQ A;  3NV3 A;  2BEO A;  5A3N A;  4Y22 B;  2WNE A;  1XU2 A;  2QZ2 A;  5EV7 A;  3M3Q A;  5FWE A;  4BLI A;  4D69 A;  2DVB A;  2JIC A;  2LTN A;  2HWC 1;  2W52 A;  4XAB A;  2P4E A;  2R07 3;  4OUE A;  4AFD A;  2DUR A;  2CV6 A;  3ATG A;  2W2I A;  3MEP A;  3MLJ A;  1NA1 A;  3W20 A;  4AVV A;  3WNO A;  1YFW A;  1XYO A;  4QQL A;  5IHR A;  3O1O A;  5E8A A;  1W28 A;  1WW5 A;  4Q4W 1;  1WMF A;  2ARC A;  2ZX4 A;  1LOD A;  5F2S A;  3A0N A;  5F3I A;  5LBB A;  1Q8S A;  1WLC A;  5JI7 A;  1WCU A;  1MEC 1;  3OF1 A;  3RG0 A;  1MS9 A;  4FPH A;  5D8A C;  3WF1 A;  4HOO A;  2Z79 A;  3V65 A;  4OI2 A;  4UYB A;  1AYM 1;  2XKP A;  3NWK A;  5FXZ A;  3OD0 A;  2GN7 A;  4LO4 B;  3TYJ A;  3VZM A;  1KEX A;  3S6P A;  1I5P A;  4XUT A;  2WWJ A;  3CMG A;  5F7U A;  4E2G A;  3D8C A;  1I6X A;  1R08 1;  1VBC 2;  2RDQ A;  2WII B;  4XIK A;  5SV5 A;  3GJB A;  1VBE 2;  2D6N A;  4ERO A;  1YQ8 A;  2B7Y A;  3D82 A;  4IGQ A;  4CCO A;  4EWE A;  1GNZ A;  2HWE 1;  2LAL A;  4UFH A;  1OKQ A;  4O61 A;  4BM8 A;  1GKB A;  3N9O A;  2P6H A;  4WM7 B;  3IZO A;  2ZKN A;  1RUJ 1;  4FQZ A;  2E33 A;  4XHB A;  2BFU L;  1YHF A;  3B00 A;  3N36 A;  4HVQ A;  3UGH A;  2C0Z A;  3ACG A;  4M0N A;  4GB3 2;  2RVA A;  3ZFG B;  1U5I A;  4LBO A;  3VBF A;  4M3C B;  4QDR A;  1DZR A;  4XMI A;  5B4X A;  5LA0 A;  1LEC A;  4CUC A;  1HXS 3;  1ND2 B;  3URF A;  2W94 A;  3O5S A;  3AVS A;  4BJ0 A;  5AFB A;  4CTE A;  4NHL A;  1RUG 2;  3POG A;  1HB1 A;  2G19 A;  5CIS A;  2D6L X;  3ZFF C;  3VD9 A;  2UWB A;  4QX2 A;  3NAP A;  2E7Q A;  3NST A;  1JYC A;  4YM0 A;  2YFU A;  3KCC A;  1QJZ A;  5FO8 B;  4AVA A;  5JR2 A;  4W6Y A;  4LMF A;  4XFB A;  1YFU A;  3C8X A;  4C8D A;  3VBS B;  4UFK A;  5FP7 A;  4AL9 A;  1NZC A;  1RMU 1;  2AEZ A;  3B01 A;  3Q8A A;  4FVV A;  4LTA A;  3AP9 A;  5GZC A;  3T2T A;  3QBQ A;  3ZM8 A;  2RS5 3;  3H8X A;  3LOI A;  2QQO A;  5LY2 A;  3BVC A;  2PQS A;  1F5J A;  5AC9 2;  4C90 A;  1OA4 A;  3H50 A;  5F3G A;  5A32 A;  5HXV A;  3IDB B;  4NIH A;  3ZXJ A;  3HQU A;  5IAT A;  1XNA A;  4IEZ A;  4JDM A;  4DQA A;  4PIX A;  2QBX A;  3TN9 3;  3U75 A;  1ENX A;  1FPN 2;  1G7Y A;  3OGG A;  5C3P A;  3VL8 A;  4QXH A;  3OPT A;  1NCQ B;  5JSP A;  2V5D A;  1R1Z A;  3IB3 A;  1CPM A;  1EV1 3;  3LA7 A;  5HCF A;  4E2S A;  4CDU B;  4QD2 A;  2PN5 A;  3VZK A;  4Y26 A;  2VM9 A;  1RUI 3;  4KGQ A;  4XIO A;  2C1F A;  2RV9 A;  2ZX1 A;  2RM2 2;  4LKE A;  2X09 A;  4HFS A;  3ZSM A;  4L11 A;  1C5H A;  3AYE A;  4XPV A;  4XAA A;  3ZYH A;  3PME A;  2VW1 A;  3C7F A;  1ZX5 A;  3OCP A;  4IDZ A;  3AXE A;  4CXY A;  4HON A;  2A6X A;  4KG0 A;  3WVJ A;  5A33 B;  4WM7 C;  5A1L A;  5H9P A;  1JYW A;  2FDK A;  1C3H A;  1UYP A;  1FOD 1;  1KQR A;  2YC0 A;  3NKT A;  2GNB A;  2A7A A;  5FZM A;  1EPZ A;  2VL4 A;  1AXZ A;  1V6N A;  2FMY A;  4ASK A;  5BPX A;  5A3P A;  5BNP A;  4YW6 A;  3AKP A;  4PLM A;  3ZFG C;  2WNO A;  3NRU A;  1POV 3;  2P5B A;  3OPW A;  3HNM A;  1RJ7 A;  2EA7 A;  5F9T A;  3H1M A;  1XNT A;  3ZYI B;  1ND2 C;  2VVE A;  5CKN A;  4XJ8 A;  5CFD B;  1QF3 A;  1UZV A;  1V6L A;  4FPY A;  3WHT A;  4PQ9 A;  2VR4 A;  3MGU A;  5A7W A;  5FPZ A;  5C7G A;  1IKQ A;  5K8S A;  3OEA A;  4HN1 A;  3SNM A;  4OHY A;  2D97 A;  1COV 3;  3AJY A;  4Q0Q A;  4XET A;  2DU0 A;  1PX4 A;  3CJX A;  1HV0 A;  2B9U A;  3POS A;  4FO9 A;  1UOF A;  4LA3 A;  5CYY A;  5JZG B;  3LB9 A;  5LBE A;  5I0U A;  1MZ6 A;  1H6X A;  3KF3 A;  2ADE A;  2PLV 3;  1LHN A;  1W2T A;  2XLA A;  5F32 A;  1YQC A;  3I59 B;  2BBA A;  1LOF C;  2DBI A;  4RQP B;  1SLL A;  5IUQ A;  3GXU A;  1PIV 1;  1Y7B A;  2B42 B;  2JXA A;  2HWB 3;  1ULE A;  2XVG A;  4OUM A;  4IV1 B;  1U0A A;  1H0B A;  2LRO A;  2VXR A;  3B9I A;  1KRI A;  2JX9 A;  3T1L A;  2WLQ A;  3O0W A;  2OUH A;  3H42 B;  4Q4V 2;  2OKX A;  5C8C A;  2RDN A;  2HEY F;  2WKK A;  1NCQ C;  1YCI A;  1BEV 1;  1WLD A;  2NM1 A;  4IEP A;  1HX6 A;  4XFA A;  1MVQ A;  1QJX 3;  4XTM A;  1CAU A;  1G86 A;  2VPV A;  4CDU C;  4CYD A;  1VBA 2;  1ZA4 A;  1ZZB A;  4NJ4 A;  4QM9 A;  1VBD 2;  1W8U A;  5DG2 A;  4F3J A;  4Z82 A;  2FDF A;  2VMC A;  1CJP A;  3DN7 A;  4Q0S A;  4M3C F;  4WVV A;  1H2M A;  3S5Q A;  1RUC 2;  3VB9 A;  4CDX A;  4LBQ D;  2RR1 3;  4P14 A;  4MGI E;  5FK8 A;  1RUH 2;  4FOW A;  1LOG A;  1UMH A;  4LR4 A;  2X29 A;  3E5Q A;  1DG6 A;  1H1A A;  1S0E A;  1V00 A;  4FOV A;  4IEW A;  2ZGM A;  4IL7 A;  4YPJ A;  3F2Z A;  5BNO A;  1RHI 1;  1XNK A;  3ZN4 A;  3NQH A;  4EN7 B;  2ZEX A;  2QUO A;  4AR2 A;  3KVA A;  2NP0 A;  3KT1 A;  4GH4 B;  3H8U A;  3WNP A;  5F3E A;  4GD4 A;  4KWK A;  5B2G B;  5FLH A;  4Q29 A;  5JI9 A;  4IE0 A;  1LTE A;  4URT A;  3USS A;  1D0G A;  3AP7 A;  2Q4S A;  4ASM B;  2UU8 A;  4YGC A;  5CFD C;  4OCT A;  3IPV A;  1QJE A;  1DGR N;  4IEV A;  2MEV 1;  2HWD 3;  4I0W B;  1AXK A;  1L7R A;  1WME A;  2A6W A;  1H9P A;  1RUF 1;  1UD1 A;  1VRH 2;  5JSO A;  1DYK A;  4D0Q A;  2QZ3 A;  5A7P A;  3HAG A;  1EUT A;  4BK4 A;  4PI0 A;  3AP6 A;  3WP3 A;  4GJY A;  3ZFE A;  1E5S A;  3OBZ A;  1OLQ A;  2DBN A;  5FY4 A;  4IEQ A;  3AK0 A;  2KD7 A;  5JZG C;  1F15 A;  1RUE 1;  4AOC A;  3OBA A;  5A7S A;  1RUD 3;  4CU6 A;  2XHN A;  1A8D A;  4C0B A;  3PVO A;  2HYX A;  3MV0 1;  1GZC A;  4KU8 A;  3SQO A;  4RQP C;  2CY6 A;  3KT7 A;  5EYX A;  1SCR A;  1IKP A;  4IV1 C;  5I8Y A;  4V2V A;  2XJQ A;  3OUI A;  1LEN A;  3AMQ A;  4A7Z A;  1JZ7 A;  3T2O A;  4QB1 A;  3I49 A;  1AL2 1;  1APN A;  4IXL A;  5J7M A;  5EPA A;  5ABJ A;  1ZBE 1;  3KT4 A;  3P5B A;  3MIF A;  1W9S A;  4B3N A;  5ACA 1;  5HBA A;  3EJK A;  3N7M A;  4ZU7 A;  3LFI A;  1N1V A;  1Q8V A;  2TEP A;  3C7O A;  4TLF A;  5K0U B;  1OD3 A;  1V9U 2;  4GXL A;  2E7T A;  2QJV A;  1KJR A;  3I54 A;  5JAX A;  1AR7 1;  3ILN A;  3ZPO A;  2VC9 A;  1LU1 A;  2CAU A;  3FN9 A;  3CKH A;  4B1M A;  1LOA A;  3DEC A;  3ENR A;  4IV3 B;  5FOJ B;  4UWD A;  5FTT C;  4ZKT B;  3IN9 A;  3K3N A;  4HSL A;  3ECQ A;  4YW1 A;  4C1X A;  5H9S A;  1HN0 A;  2RMU 3;  5K9Y A;  2F4L A;  3AKQ A;  4QU2 A;  2VZU A;  3AP4 A;  1NT0 A;  1QJY 2;  2WQ4 A;  1AR6 1;  1AX0 A;  1ALY A;  3FLR A;  1VP6 A;  3JZV A;  4KWU A;  1AR8 1;  3M2M A;  3NV2 A;  4RS5 B;  5LBC A;  5FYH A;  2ID4 A;  2B4K A;  5FZK A;  4GH4 C;  1PZ7 A;  2QE3 A;  3A7Q A;  3KM5 A;  4GWI A;  5I0D A;  3I7D A;  2PQQ A;  2XJU A;  3O1P A;  4QHO A;  2E32 A;  5FMD A;  5BNN C;  5CA6 A;  3NVC A;  4UF0 B;  2VTX A;  1PO1 3;  2RS1 2;  3CEW A;  3UET A;  1IHM A;  4COU A;  3RQ0 A;  1NCR A;  1S0G A;  3AKS A;  3NL1 A;  3I8T A;  1UL9 A;  2XBO 1;  3AMN A;  5FPL A;  1MS3 A;  3S30 A;  1GWL A;  3K75 B;  4MXV A;  4YW4 A;  1AR9 1;  4YM1 A;  3VDD B;  2J1V A;  3PUQ A;  4LKD A;  2BWA A;  4HKO A;  2PYT A;  4AGR A;  2I07 B;  4FPO B;  4D8M A;  3WSO A;  1AYN 1;  2R7E B;  2A70 A;  2JJ6 A;  2YHJ A;  5DDJ 1;  1QMJ A;  3OD4 A;  3ZXG A;  3BIW E;  3VBU A;  1J84 A;  2ZGQ A;  1WUV A;  1LKN A;  3K48 A;  1BKZ A;  1D0H A;  4QX1 A;  2JEM A;  3R05 A;  5FYT A;  2CTV A;  2JWP A;  3GZT B;  2I74 A;  4L97 A;  4DXZ A;  5AFE A;  1CIY A;  4L2N A;  2YGM A;  4YZ4 A;  4QX5 A;  4QPI B;  2WRA A;  4IGP A;  4L0P A;  3AFG A;  2UUR A;  2FDG A;  5FZB A;  1WMX A;  4Q4Y 1;  1VBB 1;  5TSW A;  1B35 B;  5DUU A;  2UYB A;  2Y6K A;  4UOJ A;  5I91 A;  2DUP A;  3AC0 A;  1LRH A;  1VMJ A;  5FPX A;  5DG1 A;  4KNC A;  4TXW A;  2IXJ A;  1SEF A;  3TB0 A;  1ZA7 A;  2OX0 A;  2PXJ A;  1OOP B;  3N9M A;  5FMO S;  5T50 A;  3LE0 A;  4LO8 A;  1RIT A;  1UY4 A;  1D2S A;  1HN1 A;  1JBC A;  4CP2 A;  4OHW A;  5FZ0 A;  5K0U C;  4LA2 A;  4AI2 A;  1H8V A;  2XVK A;  3FBY A;  1D4M 3;  3NNL A;  3C3V A;  2I45 A;  3K2O A;  1MR5 A;  1GLH A;  1XPW A;  4IV3 C;  4YVW A;  3AKR A;  1YFY A;  3HMY A;  1K5M B;  1LB2 A;  3N7K A;  4AF9 A;  2WT2 A;  2Y6L A;  4QGM A;  1WCS A;  1O8S A;  3DPR A;  4UW4 A;  1O8P A;  3LEM A;  3AKT A;  2QCS B;  4JAA A;  5J98 B;  3H7J A;  4RS5 C;  3RZG A;  5C3R A;  3PHM A;  3WF3 A;  4CU8 A;  1XOY A;  1DZQ A;  3NO8 A;  1RB8 G;  3UL2 A;  2GND A;  4QT6 A;  4Q4X 2;  4BLJ A;  1R1A 3;  4A41 A;  4D3W A;  3FUQ A;  1VBC 1;  3POB A;  3L9J T;  1ASJ 2;  2W91 A;  2YU1 A;  4BQ2 A;  1VBE 1;  1JYI A;  2AZ5 A;  1W99 A;  1QOT A;  2WZE A;  1HLC A;  1PHM A;  2EF6 A;  3J8F 3;  4KMQ A;  5FFO C;  3UGG A;  4CDQ C;  3VKL A;  2DWR A;  3I3B A;  3UKV A;  2D6M A;  3KSC A;  3OY8 B;  4RR3 B;  3VDD C;  2JKX A;  3E97 A;  5KBF A;  3Q8B A;  2CSG A;  2JIG A;  2ZGU A;  1SMV A;  4XBL A;  3GCW A;  2E7A A;  3NKG A;  3P1I A;  4LOS A;  3VBH B;  3ON7 A;  5L9V A;  2QQU A;  2VW2 A;  4GB3 1;  4LOT A;  4ZY9 A;  4YZ2 A;  3SH4 A;  4AGG A;  1CAV A;  1IQA A;  4EWA A;  3BPZ A;  2ZX3 A;  4QPI C;  5DXD A;  2JKB A;  1XYP A;  4ARY A;  3L2H A;  1UX7 A;  4B4Q A;  1C5I A;  1GP5 A;  5FCC A;  2Y6G A;  2PAK A;  1B35 C;  3PJQ A;  4EZH A;  5KXD A;  4JX0 A;  1RUG 1;  4OMC A;  4LPL A;  2KA3 A;  2PHF A;  2XUM A;  4D6S A;  2XJR A;  1GZW B;  1W6Q A;  1OOP C;  2ZHK A;  3QH6 A;  4QMA A;  2IFR A;  1LHW A;  2YUE A;  2ZS6 B;  5FYB A;  1UZ0 A;  4LIU A;  2VMH A;  2BUK A;  1IS5 A;  5DUV A;  4XF4 A;  2DCK A;  2VCM A;  3ZO0 B;  4LUM A;  2X5I A;  4OUL A;  4WBB A;  1OQD A;  2BNO A;  4ITC A;  4R9D A;  1ZRD A;  2HH9 A;  3O1V A;  5FDB A;  1GU3 A;  4Q26 A;  4YVS A;  1W06 A;  3T3Y A;  3TEZ A;  2W0X A;  4H14 A;  1K5M C;  3TRS B;  5AC9 1;  1UX6 A;  4AW7 A;  4Q27 A;  2FD8 A;  2EIC A;  2E63 A;  3V0B A;  5FZ8 A;  2R04 3;  3RYR A;  1W2A X;  1FPN 1;  4YZ1 A;  4YW5 A;  1VE0 A;  1H4H A;  1QJU 3;  4I01 A;  5F39 A;  3KGZ A;  1J1T A;  4KWL A;  1W9T A;  3AZY A;  4P9Y A;  4IUG A;  1SLT A;  4XCB A;  3RZZ A;  1QQP 3;  3VKF C;  2BVV A;  3RSJ A;  4Y5S A;  1HRI 2;  3NNF A;  2RM2 1;  5LWB A;  2P3I A;  1D7P M;  1NA1 B;  1YJL A;  2QQV A;  4RHV 2;  5FXW A;  4AHY A;  4BQ3 A;  4R9C A;  5IJR A;  1TME 3;  5KR7 A;  2VW0 A;  2OA2 A;  4HKW A;  4RR3 C;  4H3W A;  5C8W A;  1Z7S 1;  2VCA A;  2ZEW A;  1W3V A;  4OHX A;  4UI9 L;  4XE9 A;  3ZVX A;  1O5L A;  3HOB A;  4PI2 A;  3HT2 A;  1STM A;  3VBH C;  4CP0 A;  1UY1 A;  2LW8 A;  4FQ4 A;  3ITQ A;  4LKF A;  4CA9 A;  5CFC C;  3LIH A;  1QDO A;  4OVE A;  3C7E A;  3WG4 A;  2O14 A;  3DEM A;  4N53 A;  4Q5O A;  4YLZ A;  1G9C A;  2NZ9 A;  4XDO A;  2IFW A;  1UAI A;  3P3P A;  2BJS A;  3Q9O A;  3WW4 A;  4RD7 A;  3K46 A;  3ES1 A;  2GME A;  2VMG A;  4QB2 A;  2JDN A;  1SPP A;  5IVV A;  4P00 B;  3ZN6 A;  2BU9 A;  3JBG 2;  3M7A A;  5HCA A;  2VMD A;  3I3E A;  2XLG A;  2Z4F A;  4N7U A;  3INA A;  5A80 A;  4EJR A;  4XJ9 A;  1R09 3;  2D6K A;  3N7J A;  4K8F A;  2WNU A;  2BFU S;  2QQM A;  3LEK A;  4ZHN A;  5KHK A;  1PGL 2;  4MXW A;  3WHU A;  4XUN A;  3VBF B;  5FWJ A;  4A7Y A;  3P6B A;  3Q8C A;  2WQZ C;  4I3P A;  4LK7 A;  4MET A;  5K7P A;  5T54 A;  2VVD A;  2EAK A;  2BTV C;  4QHB A;  3KVB A;  2A3X A;  4O7X A;  4WVW A;  1W8W A;  4XF1 A;  2J1U A;  1PO2 2;  1PVC 1;  4XW3 A;  5EQU A;  3ZN5 A;  5F37 A;  5JWP A;  4Q4V 1;  4C1W A;  2KM2 A;  3KV5 A;  5EWS A;  4AHW A;  3I2F A;  1YEW A;  4XFF A;  5FZG A;  3PTR B;  1NQJ A;  5FBJ A;  3RGB A;  1UU4 A;  4B1L A;  5L19 A;  1VBA 1;  2UWA A;  4W6X A;  3DYO A;  1NKG A;  1VBD 1;  1AUY A;  3MV1 1;  4V2W A;  4DMI A;  3T1M A;  3ZR5 A;  3ACF A;  1WA6 X;  2ZGP A;  1NA1 C;  2ZZJ A;  3S7I A;  5HI0 A;  3HEI A;  3T30 A;  1Y43 B;  4CU9 A;  5A70 A;  1OBN A;  1RUC 1;  2Q8D A;  4JVA A;  1KD7 A;  2CWS A;  2G9G A;  2OPK A;  3AZW A;  1JYT A;  1RUH 1;  4O65 A;  5J09 A;  4AI0 A;  1V6I A;  5GLT A;  3VV1 A;  4DEV A;  4HVO A;  2A71 A;  3AZZ A;  5CNA A;  1BXH A;  3ZDV A;  4XDP A;  1O6U A;  2ERF A;  3BOP A;  3WXP A;  4LO5 B;  1LEM A;  4AZZ A;  4MGZ E;  1BBT 3;  2PHL A;  1F35 A;  3HD8 B;  5FR3 A;  4XXA A;  1A34 A;  1W39 A;  3BN6 A;  5FYI A;  4XC9 A;  4BQ5 A;  4K3U A;  5FO7 B;  2R06 2;  3ACI A;  1DLC A;  5K4L A;  1NY7 2;  1ZZ9 A;  4ZZ8 A;  4JGY A;  1DQ5 A;  1UKG A;  1VRH 1;  4DY3 A;  1XBF A;  2JDY A;  2RS3 3;  3WUC A;  1CVN A;  5JLV A;  1AXY A;  3N7L A;  2AR6 A;  3WCR A;  1CIW A;  2VNR A;  1UPI A;  4K9S A;  1JZ8 A;  1O4Y A;  1SQ4 A;  2J1T A;  2GNM A;  2YGL A;  4AI1 A;  4CPB A;  3H7Y A;  5KHH A;  4D6Q A;  5BNP B;  2WIN B;  2VZT A;  1UXX X;  1POQ A;  2C4X A;  3PU8 A;  4BQ1 A;  1WCQ A;  3VBF C;  1NX9 A;  2ZHL A;  4DPN A;  2BGO A;  4W6W A;  3V64 A;  1SBD A;  5D2A A;  1RVF 1;  2EID A;  1LHU A;  1DQ6 A;  2Y6H A;  4CP9 B;  4J6G A;  4H2A A;  1W6O A;  2XLF A;  1NAE A;  2JE7 A;  1UOG A;  1FI2 A;  1BMV 2;  1G9D A;  4WZC A;  1ENS A;  4BOW A;  1BK0 A;  5DAB A;  3VLB B;  1D4M 2;  1LHV A;  1N1S A;  3CDZ B;  5T5P A;  1F8V A;  4UT5 A;  1J3Q A;  1WD3 A;  2J1S A;  3LDB A;  2RDS A;  1LGN A;  4FOY A;  4CUG A;  1WLW A;  3J7N A;  3T4H B;  4WM8 A;  3T2P A;  1V9U 1;  5JUV A;  1OLR A;  3ZSJ A;  3ZXA C;  2QQI A;  4X8N A;  4R4Z A;  2P34 A;  4HG6 B;  3JD7 2;  1MQT A;  2VOT A;  3B69 A;  3WLU A;  3PUA A;  3RI8 A;  2DUO A;  4CDW B;  3GBG A;  4XJU A;  3UGF A;  3N9L A;  2YC2 A;  5DPN A;  1FXZ A;  2WZ8 A;  3LEG A;  4E8D A;  5C8C B;  1R1A 2;  3ZYJ B;  4XF9 A;  1QJY 1;  4AFB A;  4YYO A;  3T0B A;  3J7L A;  1QKQ A;  3IM0 A;  5GZG A;  2FCV A;  1DQ1 A;  3PVB B;  1M06 G;  4NHM A;  4EQV A;  3KHC A;  2PHX A;  4OZX A;  1RXF A;  2QQJ A;  1O4Z A;  4D7T A;  5HCH A;  5IK7 A;  3ILF A;  4HSJ A;  5C5T A;  2BP6 A;  4UFI A;  2OII A;  1JZ2 A;  3VD3 A;  1ZZC A;  3O14 A;  3GZE A;  2RS1 1;  2Y33 A;  4KQ7 A;  5JSR A;  2C9K A;  4AG4 A;  2VQT A;  3AP5 A;  1UY2 A;  2ZGS A;  2G9Z A;  2WNV A;  3AFK A;  2ZCW A;  3PVE A;  4Y1Y A;  2VGD A;  3ZLI A;  4CE8 A;  5KWR A;  1JU4 A;  3CZU A;  4IEO A;  2WS9 2;  4AI9 A;  4CEY B;  3O1R A;  1SDW A;  1C1F A;  1FV2 A;  4Q0U A;  2C9A A;  3H0O A;  3N9Q A;  3RZM A;  1ZRC A;  5BNP C;  4X6R B;  3RI9 A;  4ORF A;  1C8M 3;  4XJA A;  1DIW A;  5IYY A;  2YBP A;  1N1T A;  2JIJ A;  3IPV B;  2XDV A;  3WOG A;  4BME A;  4ZXK A;  4MGK E;  1EAH 3;  3T0D A;  5E16 A;  5CU1 A;  5M0T A;  1MS1 A;  1TQ5 A;  4UW5 A;  3ZFE B;  5T5O A;  3R0R A;  4XTP A;  3DXT A;  5J48 A;  3CLP A;  1YXW A;  2R0F A;  1W0P A;  2MHF A;  1HB4 A;  4Z2A A;  4I09 A;  2ZJC A;  1REE A;  1UF2 C;  2JDH A;  4MUV A;  1Z0H A;  2Z69 A;  4ATE A;  4DUW A;  4FAH A;  3VHR A;  3VD7 A;  2W08 A;  4GWJ A;  4E9K A;  5FV3 A;  4Q0P A;  1Y9M A;  2G4I A;  1GOH A;  1OI6 A;  1ZM1 A;  3OGR A;  4H7M A;  4FPL A;  4CDW C;  2ZHN A;  2QDR A;  1KXG A;  1HIX A;  2N7G A;  4NVP A;  4AQ6 A;  2VH9 A;  1H1M A;  5C8C C;  5ABJ B;  2GNT A;  2G1M A;  1GAN A;  3C7H A;  3WV6 A;  3JQW A;  3U4X A;  2ZML A;  4NOT A;  3DCQ A;  1LHO A;  3MIB A;  1WMD A;  3LPG A;  4LE3 A;  3RRD A;  4D7Y A;  3ALQ A;  1BQP A;  2HWC 3;  2A5Z A;  4JTN A;  1QNY A;  4WVZ A;  3IIA A;  2WYF A;  3K51 A;  5G04 L;  2VG9 A;  4Q4X 1;  4QX8 A;  4NIG A;  2WAO A;  4R8H A;  1RIN A;  1VMF A;  3KZ4 C;  1ASJ 1;  2C6S A;  4GMP 1;  4Q4W 3;  3O1S A;  5BV6 A;  1I5Z A;  2QTW B;  2R1B A;  1MEC 3;  1NXD 1;  1ZRR A;  2GZW A;  1VLN A;  5FZO B;  5IWF A;  3UYJ A;  3NNG A;  4IET A;  4ES9 A;  2ORZ A;  3SLI A;  3GZA A;  4CEY C;  3B02 A;  3ZX7 A;  1OUR A;  1AYM 3;  2HWF 3;  5CB7 A;  1PGW 2;  4XHX A;  2WQ8 A;  1X50 A;  5CG9 A;  1JTZ X;  1OA3 A;  1T6B X;  2P3Y A;  1US2 A;  3RYK A;  2DCY A;  3WP4 A;  3ZSE A;  4NHY A;  1J1L A;  2Q1F A;  1U12 A;  2JG8 A;  4ET7 A;  5F6K A;  5C33 A;  1GUI A;  2ZMN A;  4A6O A;  1CQ9 A;  2JDP A;  1ND3 A;  2D3P A;  1ULP A;  1S2B A;  2HWE 3;  3POE A;  4OZO A;  4K20 A;  3FZ3 A;  1OKO A;  1XRU A;  2XQR A;  3DYM A;  4EE2 A;  1NCR B;  3RMX A;  2OXB A;  1QNW A;  1SBE A;  1RUJ 3;  3ZYP A;  2VZR A;  3E6D A;  1WW6 A;  2WFF 2;  5A6Z A;  3ZFE C;  2JDK A;  5LW9 A;  3VKM A;  2XUE A;  1YI7 A;  1Z7S 2;  4YM2 A;  3R4S A;  1O5U A;  2HWB 1;  2ZAH A;  2B46 X;  4HT1 T;  3VBU B;  3Q8E A;  1K12 A;  3IT8 A;  3KF5 A;  1AJK A;  1MPX A;  1WKY A;  5FZ3 A;  3VBR A;  1MS4 A;  4FFI A;  3CHX A;  3LQC A;  1UMI A;  2OYZ A;  4B29 A;  4BDV B;  4DB5 A;  3TOJ A;  4OI4 A;  5JXG A;  1CES A;  2QQL A;  3FHI B;  2WZR 2;  4JZR A;  5EJ1 B;  5FJH A;  5FYM A;  5HV4 A;  1OA2 A;  1YNA A;  3MLL A;  4ZS2 A;  5FMC A;  4F7Z A;  5DN2 A;  2C5D A;  2B5H A;  4Z07 A;  2FMD A;  4Y20 A;  1O3Q A;  5ABJ C;  1D4V B;  1OPO A;  3FHQ A;  5FZL A;  4XQ4 A;  2FQP A;  1OVP A;  2ZAA A;  2CWM A;  5BY5 A;  1RMU 3;  1GP4 A;  3AX4 A;  2ES3 A;  1H9W A;  4FP3 A;  4XYX A;  2W92 A;  4KBB A;  4JQR A;  4CUA A;  4YZ5 A;  3B93 A;  3VBS C;  4JC1 A;  1BHG A;  2ZEY A;  1UWW A;  3IBM A;  1SZB A;  5D8A A;  1HRI 1;  5DAV A;  1GP6 A;  4GWN A;  4B4R A;  4NID A;  3IMN A;  3SMH A;  2RJ2 A;  2W1S A;  1H8T B;  4EZ4 A;  5CG8 A;  1F5F A;  4YVW B;  1NXM A;  4RHV 1;  1UCX A;  1DP0 A;  4WVM A;  5DZG A;  2JE8 A;  3ZSL A;  4AQT A;  1LOB A;  2JEN A;  3TBD A;  5FZC A;  3KQ4 B;  2VZS A;  4TZD A;  2VBP A;  3K77 A;  4YG0 A;  3T0A A;  1FT9 A;  4QXB A;  4Q1R A;  4GA9 A;  4K1Z A;  3RZJ A;  2YXS A;  1PVC 2;  3OUJ A;  4P9X A;  2WDB A;  5JOY A;  3H8R A;  1DYO A;  1S1A A;  4EN9 B;  1Z78 A;  1ZBA 2;  1ZNP A;  5GZE A;  5IW0 A;  3X29 B;  1LU2 A;  3I3M A;  1W8O A;  3THD A;  2QQK A;  1S4C A;  5KXB A;  2WR9 A;  1F4H A;  1WW4 A;  1V6M A;  1SDD B;  3WUD A;  1W6P A;  3JXS A;  1NCR C;  5H9Q A;  2IVI B;  5DZE A;  4AEJ A;  2FCT A;  3HBK A;  4PBP A;  4S2H A;  3NJZ A;  1I1E A;  1FOD 3;  2GP5 A;  1GSL A;  2NQY A;  4L99 A;  3H9A A;  1QXP A;  1AVB A;  4XFC A;  2RJK A;  1OLM A;  2VQU A;  3NNJ A;  3JBG 1;  4KBZ A;  2VZ3 A;  5FZ1 A;  1DGW A;  4QKB A;  2FZ1 A;  1QEX A;  2XL9 A;  3BB6 A;  2P1B A;  4HL0 A;  1T6G C;  1N1Y A;  3VBU C;  3ZFF A;  3APB A;  1KJL A;  4ZXE A;  3NMB A;  5ANQ A;  1PGL 1;  4UFM A;  5JPM B;  3T08 A;  4PCR A;  1H2L A;  3KQR A;  3WNL A;  1CPN A;  4YFW A;  4A7K A;  4MVT A;  4Y22 A;  1FMD 2;  1B09 A;  3LD8 A;  4NO4 A;  2ATF A;  4F83 A;  5JXI A;  3GBF A;  2JDU A;  4DRV A;  5HCB A;  1PMI A;  1J59 A;  2AC1 A;  3HR9 A;  2W1U A;  1PO2 1;  1BVP 1;  1TMF 3;  3JQX A;  1LAJ A;  4IQP A;  2XJS A;  1SAC A;  2EIE A;  4O9G A;  4Y4R A;  1ULC A;  2XOM A;  3HNB M;  3BU7 A;  4HPK A;  3RWN A;  4IND A;  3GHM A;  4PDW B;  4PIY A;  4A42 A;  3LSE A;  3SCF A;  4AFA A;  5C9A A;  2D6P A;  3CZJ A;  3WCS A;  2X5I B;  1PIV 3;  5FZ9 A;  3ZIX A;  2VNG A;  2JG9 A;  2VUA A;  3CIH A;  4NAO A;  1WCK A;  1H8T C;  2EIG A;  2P3K A;  3ELN A;  4YVS B;  4YVW C;  3RWK X;  1RVF 2;  2C24 A;  2GMP A;  2VEC A;  4J25 A;  3WW1 A;  3I4I A;  1YLL A;  3VD4 A;  2XML A;  4Y33 A;  3SHR A;  2D44 A;  4XAE A;  4XF3 A;  1A3K A;  2VME A;  4AQS A;  5IK4 A;  4BK5 A;  1BEV 3;  3V0B B;  1FAT A;  5CIR A;  1XE7 A;  2GN3 A;  2K46 A;  3ORJ A;  2QDN A;  5FY7 A;  3IDA A;  3HN1 A;  2RG4 A;  1LED A;  1OSG A;  5J3U A;  1REF A;  2R07 2;  4WM7 A;  1PNG A;  3GF6 A;  5I0R A;  3SEP A;  4FSJ A;  2WWU A;  1TNR A;  4AFM A;  3D0J A;  3TNQ A;  2UWC A;  4FBF A;  4CCC A;  4MLO A;  2MNG A;  1VRB A;  4QQO A;  2F17 A;  4M4P A;  4XMA A;  1DF0 A;  2AYH A;  2R06 1;  5A3O A;  1UOJ A;  5JOW A;  3ZFG A;  1NY7 1;  4XFH A;  5FYZ A;  5J1X A;  2HLE A;  3MW4 A;  1JOB A;  2GAL A;  4IE4 A;  2I2S A;  2YU2 A;  1RHI 3;  1UZW A;  1ND2 A;  3J4U H;  2JE9 A;  2JD9 A;  4CUB A;  1GBG A;  2FCU A;  3WY6 A;  4MYE A;  4AVT A;  3ZKY A;  3MIH A;  5I8T A;  4AE2 A;  4COY A;  4MAD A;  4NHX A;  4FTS A;  3HVD A;  2VE1 A;  4QQP A;  3KS7 A;  3G6J B;  4P02 B;  1ZRE A;  1XE8 A;  2FDJ A;  5GLV A;  4N53 B;  2VD7 A;  2MEV 3;  1RUF 3;  2R1D A;  3RVH A;  1N47 A;  1ZRF A;  1U5Z A;  2ETE A;  3KCX A;  3WEZ A;  2YYO A;  3V0A A;  4FP2 A;  3T2Q A;  4NMI A;  5F5Q A;  1ZVF A;  5FP3 A;  1BMV 1;  1RYY A;  1SPP B;  3GJA A;  2Z2S B;  3N9N A;  5LY1 A;  1CR7 A;  3ETP A;  1O91 A;  4R52 A;  1D4M 1;  4OI0 A;  1RUE 3;  3CBN A;  2EXJ A;  1S0C A;  2GSY A;  2WNU B;  3FJS A;  1W03 A;  2VY0 A;  4PDW C;  1HB2 A;  3WP5 A;  2D3S A;  1SG3 A;  2YPJ A;  5FY1 A;  1HXS 2;  2UY8 A;  3DL3 A;  2D40 A;  3BI3 A;  5DUX A;  2EAA A;  2X5I C;  2OPW A;  1Y9G A;  1DZT A;  2JB8 A;  1D2Q A;  4NRM A;  3N4M A;  3WT3 A;  1QXJ A;  2GDF A;  1UOB A;  4YVS C;  1JHJ A;  3MIE A;  3NJV A;  2Y38 A;  2Y8K A;  5L73 A;  4C0H A;  5DMY A;  2A6Y A;  1AL2 3;  1UU6 A;  3JD7 1;  1DBN A;  1UYZ A;  2PFW A;  1H2N A;  2ET7 A;  3OEB A;  5BNQ A;  2IXC A;  2O1Q A;  1WA4 A;  1KS5 A;  5ACA 3;  5IK8 A;  2WN3 A;  1TG7 A;  1R64 A;  1R1A 1;  1JN2 P;  2L9L A;  2ZGT A;  3A21 A;  3JB4 C;  3UKN A;  4BQX A;  1E5I A;  5A6Q A;  3ZOI A;  2PAE A;  2ZMK A;  3J8F 1;  2J7M A;  1AR7 3;  2RS5 2;  3POJ A;  4K40 A;  2Z5W A;  3VZO A;  4TTG A;  4GMP 0;  2VBB A;  3ZXE A;  3Q8F A;  3I2G A;  2DTW A;  1CAW B;  2PHR A;  4IER A;  3FHA A;  5ISL A;  1UZY A;  3TN9 2;  4PT6 A;  4L92 A;  4NRO A;  4LOR A;  4PLO A;  3AMP A;  4Q1P A;  3PVN A;  2C26 A;  1UY0 A;  1W2O A;  2Q8E A;  4DXT A;  2GC3 A;  2XWJ B;  5FK7 A;  1ENQ A;  1AR8 3;  1EV1 2;  1U5X A;  2DFC A;  2WS9 1;  4A3Z A;  4AK3 A;  2J1A A;  5E88 A;  5GM0 A;  1RUI 2;  3MW2 A;  3PMS A;  3WQ7 A;  4PF5 A;  3TNP B;  2OZ6 A;  2WA3 A;  3ABZ A;  2OVU A;  4N53 C;  2X05 A;  2XGX A;  1GZT A;  4LXL A;  5A1A A;  4FFG A;  4R9B A;  1LOC A;  1CZT A;  2XBO 3;  3SCG A;  3THT A;  3S57 A;  4XEZ A;  1MZE A;  2W47 A;  3THC A;  2IUW A;  2OT7 A;  1LES A;  1YC6 1;  4JGY B;  3BKZ A;  1OD5 A;  4MO3 M;  5GLU A;  5DAW A;  2JD4 A;  4QPG A;  4NR1 A;  4QX0 A;  1PNF A;  1UIK A;  2VOX A;  3OBR A;  5DDJ 3;  4AEM A;  1ULD A;  3RZH A;  1PZ9 A;  2WWS A;  5FUI A;  2LS6 A;  2WNU C;  1WCD J;  5CVR A;  1W2U A;  1MAC A;  2IXL A;  4IE6 A;  5AVP A;  3MLK A;  1X8E A;  1YFX A;  2WAA A;  4LKS A;  4CVU A;  2YV8 A;  1XXN A;  4Q4Y 3;  4OYU A;  1VBB 3;  3ZMN A;  3HPN A;  4FFH A;  3R6S A;  2SLI A;  2DVD A;  5FZD A;  3WF0 A;  4D6R A;  1WGP A;  4LHK A;  3RMY A;  4KG8 A;  1W6O B;  1IOA A;  3UJO A;  3MFA A;  4HET A;  2YB7 A;  2PA7 A;  5A7N A;  1JYN A;  1COV 2;  5FP8 A;  1Q8Q A;  1V70 A;  1S0B A;  2PHD A;  1QIQ A;  5FKB A;  4ZON A;  4YGE A;  5FIX A;  3FL7 A;  2B39 A;  2VUJ A;  3U78 A;  3ZXF A;  2PLV 2;  2YMZ A;  5EFU A;  2R32 A;  3NNM A;  3DUI A;  3RFR A;  2CGO A;  2P2K A;  2HWB 2;  4WM8 B;  1FNY A;  1UU5 A;  4LNV A;  3LKJ A;  4GQ7 A;  3HIF A;  1Q8P A;  2R49 A;  3VBO A;  3TEX A;  1SHW B;  4JKM A;  3GM8 A;  2YPD A;  3K4A A;  3O1U A;  1MQT B;  3ZDS A;  1H6Y A;  3D3A A;  3GAL A;  3LEI A;  2VXJ A;  1W05 A;  1QGL A;  3AJZ A;  3IMM A;  4I0B A;  1QJX 2;  5BNN A;  1W6M A;  3PDQ A;  4FXK B;  2EIB A;  2PHU A;  5FUP A;  1PGW 1;  5FYS A;  5FPA A;  3H8O A;  3IAP A;  5C3S A;  5A6X A;  2P17 A;  3LDK A;  4HK9 A;  1JW6 A;  4YG6 A;  5JOX A;  3KGL A;  3QLQ A;  1CWP A;  1CJD A;  4I30 A;  1VBC 3;  2QQW A;  3BGA A;  1ZYB A;  4G4F A;  4JGZ A;  4PQQ A;  5EJ3 A;  4QQ2 A;  2RR1 2;  4LBL A;  1UY3 A;  1ZZ6 A;  5FY8 A;  1X33 A;  3VD5 A;  3SKJ E;  3DXU A;  5I0S A;  3O1M A;  3PUS A;  2Y0O A;  4JGY C;  4BQ4 A;  3BTX A;  4MZU A;  4XUR A;  5A3M A;  2PEL A;  2WO2 A;  2WNV B;  4N43 A;  1SCS A;  1SLC A;  3LSD A;  3AYD A;  1HRV 3;  4IE5 A;  5FP4 A;  2WFF 1;  4P5Y A;  4AQ2 A;  5EHD A;  5CAD A;  1GYK A;  2JDZ A;  2VNV A;  4GB3 3;  4QKF A;  3I3Q A;  1HJF A;  4BCU A;  2VUC A;  1DGL A;  1IZ3 A;  5IVF A;  4QDQ A;  4NII A;  4DFS A;  2VUL A;  4NN0 A;  2D98 A;  1C1L A;  2HWD 2;  3B9C A;  4K8R B;  4W65 A;  1TMF 2;  3WG3 A;  1WBF A;  1IQD C;  4HN0 A;  1RUG 3;  5KHG A;  4HBN A;  1RED A;  2WZR 1;  1H4G A;  4RYD A;  1RXG A;  3E6B A;  5HXM A;  1S55 A;  1S2K A;  1S0F A;  1XU1 A;  2GC2 A;  4TYS A;  4UAP A;  3WNX A;  2DFB A;  2RHP A;  1F9K A;  3EMR A;  3M3E A;  5EXO A;  1RUD 2;  4COW A;  2VNO A;  3FX3 A;  4BPZ A;  3CU7 A;  3I2I A;  3G7D A;  3WDX A;  4E4S A;  2Q5T A;  5F1R A;  4EWD A;  1JU3 A;  1CZS A;  2BWC A;  2CDO A;  3MI8 A;  2HEV F;  2ZX0 A;  5AC9 3;  4AHZ A;  2Q0A A;  1CX4 A;  1GNY A;  3WDU A;  3M3I A;  4IGO A;  4BA6 A;  2CU5 A;  3E6C C;  3PUI A;  4FT8 A;  1MQT C;  2ZOE B;  1FPN 3;  1XQN A;  5A3T A;  1V0A A;  3NJX A;  5JR7 B;  1I3H A;  2WUH A;  1DDL A;  3U10 A;  1G6N A;  3NV4 A;  1O3R A;  3NAP B;  2ZGL A;  3ASI A;  2D3R A;  2UY9 A;  4P9W A;  4X8P A;  2ILM A;  4YW2 A;  4CDQ A;  1ODN A;  3LZZ A;  4QGL A;  5EYY A;  2G9F A;  3PUR A;  1GIC A;  3BOW A;  4IW3 A;  1ZBA 1;  2EAL A;  4LBQ A;  4QX7 A;  3VDD A;  2H6C A;  2RM2 3;  4NRQ A;  5DQ0 A;  5JVV A;  2V72 A;  3SCH A;  4YRD A;  1IS4 A;  4CRQ A;  1DU3 D;  1YQ6 A;  2AGS A;  4FOQ A;  3I2J A;  4NE9 A;  4TN7 A;  4ZPI A;  3UNP A;  4O9E A;  3MF6 A;  2RMU 2;  1G8W A;  3ZXK A;  3V56 A;  2ZEZ A;  5L36 A;  2BOI A;  1YQ5 A;  3LWC A;  1W8T A;  4XQD A;  5FZ7 A;  1S0J A;  2WNV C;  2GH8 A;  3W59 A;  4NPR A;  2JB4 A;  4QPI A;  2BW8 A;  5A32 B;  3GYD A;  5GLW A;  4LK6 A;  3U07 A;  5C3Q A;  1B35 A;  2BNN A;  3N3H A;  1XC6 A;  3KHB A;  4J1W A;  4KI5 M;  5LRS A;  1N3O A;  5LEK A;  2Y0I A;  2P3J A;  3POW A;  2XJV A;  2QVS B;  3RS6 A;  5A3L A;  1PO1 2;  2JG8 B;  4DXS A;  1VPH A;  1YQ2 A;  4LE4 A;  4JCK A;  2XJT A;  3UV9 A;  1ND3 B;  3T4V A;  3FLT A;  3MIG A;  5LAS A;  1C57 A;  5LA1 A;  1FMD 1;  4JHZ A;  3AZX A;  5FLI A;  4CCD A;  4DUV A;  1QU0 A;  4K6B A;  5L9R A;  2BBV A;  4A45 A;  1US3 A;  3VUO A;  1ENR A;  1Q5O A;  1IPS A;  3LCP A;  1C8N A;  4RFT 0;  4ASL A;  4P9I A;  3FFQ A;  3ZIW A;  1V6J A;  5JMC A;  3WG1 A;  1W6N A;  4BZ4 A;  2XHK A;  1SLI A;  4Q8L A;  3KV9 A;  4I2O A;  1XSR A;  4ONU A;  3LAG A;  2ZGR A;  4HAN A;  4B7K A;  1GNH A;  2BER A;  4G9S B;  2ARX A;  3VBR B;  4COZ A;  3BOD A;  4CCJ A;  4LO6 B;  1W8N A;  1DLL A;  2IWG B;  3LA3 A;  4AGV A;  2FDI A;  5IVB A;  3W5M A;  3III A;  4IEY A;  4Q4V 3;  4E27 A;  5FMB A;  4DY5 A;  5JPN B;  3SH5 A;  2Q8C A;  4Y20 B;  5T52 A;  2F4P A;  1YYN A;  3NJY A;  1QDC A;  3ZXL A;  3NAP C;  5A7W B;  4Z2W A;  4MG2 A;  1JOD A;  4M0H A;  1OT5 A;  3EO6 A;  4YG3 A;  1VBA 3;  1CD3 G;  2Q30 A;  2R07 1;  4E8C A;  5J37 A;  2OQ6 A;  2B8M A;  4E4H A;  1PMJ X;  3ZYR A;  2K0G A;  2PHW A;  5F5I A;  3M70 A;  4YW3 A;  3VN4 A;  4XJW A;  1RUC 3;  1TZO A;  1NZI A;  5C3O A;  2P6C A;  4LT5 A;  5CFC A;  4WVM B;  2VMF A;  4NPL A;  4RGA A;  3PTY A;  2AH2 A;  1P8J A;  1WW7 A;  2D6O X;  3C7G A;  2B9V A;  4W4Z A;  3SH3 A;  5DUW A;  2YG0 A;  3K3O A;  4XQW A;  4AED A;  5EP9 A;  1OPM A;  2IZW A;  4N8M A;  5EIY B;  1VB2 A;  4HLT A;  2JG8 C;  1GZW A;  3J8F 2;  5JCT A;  2HEW F;  1CAU B;  2UYA A;  3KLS A;  5F3C A;  3RDI A;  5CAZ A;  1W6P B;  4MH0 E;  5F2W A;  5C6C A;  3UT0 A;  2Y64 A;  5FUN A;  2VOW A;  1ONA A;  2PTM A;  4Z92 B;  2ZA9 A;  1ACC A;  3I2O A;  1F4A A;  1X9T A;  1YJK A;  4LEJ A;  4FPC A;  5D1I A;  1VB4 A;  1AJO A;  3O0V A;  3WDT A;  1JHN A;  2BRT A;  2WO7 A;  3ST7 A;  4CDX B;  5FP9 A;  2A6V A;  1X8M A;  1MZ5 A;  1JXN A;  1FAY A;  2IVJ A;  3F95 A;  1J3R A;  3D4K A;  4XVH A;  4I0A A;  3MBW A;  4DUX A;  5I0T A;  1X36 A;  1XB9 A;  1DCS A;  3MF9 A;  5BNO B;  2DUQ A;  5IVJ A;  1HXS 1;  3B7M A;  3GNE A;  2ARE A;  4DIQ A;  1GR3 A;  3VBR C;  5LK7 B;  3VDB A;  3HN3 A;  4V1P A;  3QOP A;  2XG3 A;  2AEY A;  2CHH A;  2OQ7 A;  4RFR B;  4EV0 A;  3FLP A;  2O0O A;  3O7O A;  4GKX A;  4BIO A;  1V6K A;  3OTF A;  1UXZ A;  1OXC A;  5CZK A;  1IG0 A;  2VCC A;  3AMM A;  5A1F A;  2H0V A;  2YBS A;  3CJI A;  2BQP A;  4GZ9 A;  4Y4Y A;  5FY0 A;  2A3Y A;  2WZP P;  4AFC A;  1WZX A;  4HPK B;  2LUW A;  1LGB A;  1JOJ A;  1V9U 3;  1VAM A;  3M4F A;  2RS5 1;  4YGB A;  4XFG A;  5C9A B;  4RA0 A;  2X8K A;  5A7Q A;  4FPJ A;  3ZYG A;  4YNI A;  2TNF A;  2HJI A;  2YC4 A;  3CNA A;  3T09 A;  2QFE A;  2JG9 B;  4COV A;  1OHF A;  2HWF 1;  2SBA A;  2VCB A;  2WL1 A;  4NPM A;  3J9S A;  4ZS3 A;  3S7E A;  4Y1Z A;  3TN9 1;  2R04 2;  3WW3 A;  2ZKL A;  5EZW A;  1LJ7 A;  2BVB A;  2DF7 A;  1QJU 2;  1QJY 3;  1N3Q A;  2DDU A;  5FBZ A;  1T2X A;  3AYA A;  3JB8 A;  3KMH A;  3QAC A;  4W8J A;  4DXR A;  1EV1 1;  1QQP 2;  3AB0 A;  1JZ5 A;  2VVF A;  4CXX A;  3TEW A;  5FRA A;  5A7O A;  2FZ2 A;  2ZBJ A;  5LB6 A;  1RUI 1;  5LBF A;  3H3U A;  4ZZ5 A;  5KHI A;  1KFU L;  2GP3 A;  5GZF A;  4MGT A;  1HRV 2;  2BV4 A;  2RS1 3;  4DRR A;  2ARB A;  1TME 2;  4P5H A;  3BYW A;  1NQD A;  5H9R A;  2VJX A;  3D5O A;  3UK9 A;  5IT6 A;  4CZS A;  1CX1 A;  4CCK A;  2D5H A;  5F5C A;  4YM3 A;  1RUO A;  3IKW A;  4H55 A;  4LBN A;  2IXH A;  1FYU A;  5B4N A;  1IPK A;  4XUP A;  3PIJ A;  4CDX C;  3BU0 A;  4W50 A;  3OOX A;  1AX1 A;  3VHO A;  3FUO A;  3MUY 1;  1POV 1;  3POF A;  4FFF A;  5FY5 A;  2GC0 A;  2TBV A;  5BYN A;  2Y6J A;  2RE9 A;  1ODM A;  3OYW A;  5BNO C;  1J3P A;  3S5A A;  2ENR A;  1NLR A;  1Y9Q A;  4ES8 A;  3RNS A;  2V4A A;  2CYF A;  2QNK A;  1AZD A;  1X9P A;  1R08 3;  4LLF A;  2VQ0 A;  3OB8 A;  1MS8 A;  3A22 A;  2J1E A;  3V0A B;  4OHV A;  2EVX A;  3GDB A;  3ZSK A;  4OFG A;  2WBK A;  1COV 1;  2GMM A;  2IC1 A;  1R09 2;  2XQX A;  3ACL A;  4Y1X A;  3FE5 A;  1WWY A;  3TEY A;  1RC6 A;  3K4Z A;  1OLM E;  3MHZ A;  5L7O A;  4XIL A;  3ZKU A;  1EYB A;  3MFC A;  2PLV 1;  4CEW A;  4XZP A;  5JMO A;  3FBM A;  3OBT A;  4MGS A;  4XF0 A;  5C9A C;  4QPY A;  4Y1U A;  5C4W A;  4TLG A;  4MHU A;  2VZQ A;  1PK6 A;  2FDH A;  3DV8 A;  1W3X A;  4GUL A;  3OG2 A;  4QKD A;  2JG9 C;  3H3L A;  5T5J A;  3U14 A;  1CN1 A;  1F31 A;  1NOV A;  2HYK A;  5T5L A;  3L2Y A;  1UW8 A;  3LA2 A;  4BMB A;  1JOP A;  1JUH A;  3SIS A;  1GMM A;  3AVR A;  4GWM A;  4MHR A;  4P08 A;  4S2D A;  5JIU A;  1CAX A;  1QJX 1;  1UPS A;  2O8Q A;  3DKW A;  3QCW A;  4UW6 A;  2ZGO A;  5FJK A;  3HNY M;  3MDP A;  2FHR A;  3JU9 A;  4ARX A;  3M3C A;  1LGC A;  1L7L A;  1XYN A;  3P3N A;  4PHZ A;  1JUI A;  4Q4X 3;  1CON A;  4HKL A;  4GMP 3;  1ASJ 3;  4QB6 A;  4A6S A;  4AI3 A;  4BXS V;  2DVG A;  4RGK A;  1OUS A;  2RR1 1;  1XNC A;  2QQN A;  1OF4 A;  1ULO A;  2PAM A;  4YZ3 A;  4AXO A;  1NG0 A;  3FC0 A;  4B7E A;  4BU2 A;  3QD6 A;  4QDS A;  2VQA A;  5FPV A;  2JEC A;  1AL0 G;  5FZH A;  1FV3 A;  2HBU A;  1V6O A;  1HQW A;  2BZD A;  3J7M A;  4FPG A;  5FQ0 A;  4CP9 A;  1K5J A;  5FPU A;  2E9Q A;  2GU9 A;  3LOB A;  2OZJ A;  1LCL A;  2ZTN A;  5GAL A;  1BBT 2;  1GQP A;  2IXK A;  3AL6 A;  3DPR B;  1W0O A;  1OH3 A;  4AAP A;  5IFT A;  1X7N A;  3EB7 A;  5DAX A;  4JQT A;  1OF3 A;  3USU A;  2A75 A;  2MPF A;  2HWD 1;  4WV8 A;  1OUX A;  5J96 B;  1TMF 1;  4QQH A;  1JS9 A;  2RS3 2;  1DGW X;  4N7I A;  4AEK A;  2J1R A;  4GJZ A;  2X53 S;  2NYY A;  1AF9 A;  4M3C E;  2V5Y A;  5GLZ A;  3THP A;  3VDC A;  4QPG B;  1JH5 A;  5LCW L;  2WAB A;  4RSU A;  2QQP A;  1RL3 A;  3MYX A;  1F2N A;  1URX A;  4DNY A;  1RUD 1;  1EUU A;  4G3Y C;  1NLS A;  4EN6 B;  4QKN A;  4F8A A;  5BUV A;  3OUH A;  4CDW A;  2CGP A;  3M8L A;  4IES A;  1QWR A;  5GJ6 A;  1ULG A;  2W46 A;  4BH9 A;  3BPS A;  5A3U A;  1HKD A;  1CAV B;  1KS4 A;  1MS5 A;  1YRZ A;  2GC1 A;  2KR2 A;  3MID A;  4IEX A;  1RJ8 A;  3U4S A;  1W0N A;  1QH6 A;  1O4T A;  3MUZ 1;  4MGQ A;  3GBW A;  2VAU A;  1OQ1 A;  3OJB A;  3POI A;  4J1X A;  1UYY A;  3PJY A;  1JYX A;  3UJQ A;  1W6Q B;  1HRI 3;  2Z42 A;  4CEY A;  1Q3E A;  3U37 A;  4RHV 3;  3OGJ A;  1VAK A;  4XBQ A;  5FZ6 A;  4N9H A;  1GZ9 A;  1BCX A;  3CL1 A;  3EHK A;  3VBO B;  2X10 A;  2H0B A;  2RMU 1;  1WLT A;  2RDR A;  4Z8B A;  2EXH A;  1FNZ A;  1A78 A;  1DQ4 A;  3AYC A;  1GV9 A;  1GWK A;  3W58 A;  1DGR A;  1UMZ A;  3HBZ A;  4C91 A;  5BNN B;  2W1Q A;  3SXW A;  3ZXD A;  3I97 A;  1W6M B;  3UKT A;  4TSV A;  5IAV A;  4EN8 B;  1TNF A;  4QXK A;  4AVC A;  2FBE A;  3DPR C;  3WF2 A;  4XUO A;  3VKO A;  1QHD A;  3DF0 A;  3DYP A;  1PO1 1;  2WC2 A;  4D94 A;  3PL0 A;  1BK1 A;  4FI9 A;  4JGZ B;  5J36 A;  3E5U A;  4QM8 A;  4JV4 A;  4YGD A;  4S2G A;  1KIT A;  1SFN A;  3GCX A;  5KC6 A;  4HZF A;  3JBG 3;  4JRL A;  2DVF A;  3B3Q E;  5LA2 A;  3PNA A;  3WP6 A;  4N43 B;  4QPG C;  5FYY A;  4XBN A;  4K21 A;  2A73 B;  4OUS A;  4M3C A;  3CO2 A;  4HVR A;  1WD4 A;  5HPO A;  2JDM A;  1C8M 2;  4OI1 A;  5HV0 A;  4CU7 A;  1LNS A;  4GIQ A;  1YO8 A;  2R0H A;  4LIT A;  1Y4W A;  4PBO A;  2CNA A;  1UQX A;  4CPB D;  1TVG A;  2JDA A;  3WZ1 A;  1GOF A;  5LAT A;  3WNK A;  1GFF 2;  3AXD A;  1EAH 2;  2A6Z A;  4LIV A;  2ET1 A;  2DTY A;  3C2U A;  2VUD A;  1MZF A;  4L9B A;  1PO2 3;  2Y26 A;  4UBG A;  3VBS A;  2ADD A;  2XKO A;  3KCY A;  1NYW A;  4ISR A;  1AHS A;  5LZ6 A;  4IE7 A;  2VBD A;  3E1F 1;  1LOF A;  3ILR A;  3ZN6 B;  5FZO A;  1OC1 A;  4U36 A;  3HWJ A;  3U11 A;  2IXI A;  2E53 A;  3I2D A;  2HKX A;  4K7J A;  2Y6F A;  3A4U A;  2AEN A;  3SC7 X;  4MXW B;  1DQ0 A;  1OVS A;  2WJS A;  3MPP G;  3BIE A;  3I3D A;  3VBO C;  5FAX A;  1Q43 A;  1NCQ A;  1YUD A;  3HT1 A;  2EXI A;  1XSQ A;  2CDP A;  4N9I A;  4AI8 A;  1G9B A;  4CDU A;  2WT0 A;  4LHL A;  2BGC A;  5C71 A;  2HWC 2;  4OHZ A;  1ZBE 3;  1PMH X;  2WN2 A;  4NWW A;  2EXK A;  5T3N A;  4CDQ B;  1S2E A;  5FZF A;  5IK5 A;  1BYH A;  4XUQ A;  3TWI A;  4NAM A;  4DO0 A;  4KGG A;  5FRE A;  3WIN E;  1K45 A;  2LRP A;  2W39 A;  2R30 A;  4LBQ B;  5FPB A;  1IPJ A;  3ZFF B;  4S2F A;  4Q4W 2;  5FXV A;  2R06 3;  4JHT A;  3FFZ A;  5A33 A;  4JGZ C;  1N3P A;  4QAW A;  3SIT A;  2ORX A;  4Y1V A;  1KDM A;  1MEC 2;  2O8O A;  1J83 A;  3MO4 A;  5DAQ A;  1X82 A;  1XJA A;  4LBK A;  1FX5 A;  3H1W A;  3DGT A;  1W9W A;  3VDA A;  2Y34 A;  5FO9 B;  1JZ3 A;  1AYM 2;  2HWF 2;  2NMO A;  5FZI A;  2VZ1 A;  1Q8O A;  4N43 C;  1H2K A;  1POV 0;  2WFP A;  1VR3 A;  4Y24 A;  1IGO A;  5LK5 A;  2KXL A;  1A6C A;  4K1Y A;  4KU7 A;  4OMD A;  1AR6 3;  1R08 2;  1DFQ A;  1QJF A;  2ZGK A;  4LUL A;  4YWA A;  5CFD A;  4JKL A;  1PVX A;  2HWE 2;  2W9X A;  3RJR A;  4MX3 A;  1BZW A;  4DS0 A;  4B8E A;  1E57 A;  2XJP A;  4LHN A;  2DCJ A;  1W8Z A;  4M00 A;  1RUJ 2;  4FPF A;  2VMI A;  1VAL A;  3WNN A;  1SLB A;  3IAQ A;  1O59 A;  3ZPY A;  4FTE A;  5JZG A;  3SKV A;  1AR9 3;  2XB6 C;  1H8T A;  4NUB A;  2E51 A;  4DOU A;  4LLO A;  3I59 A;  2VO5 A;  1AYN 3;  4RQP A;  1KFX L;  5GZD A;  3BTY A;  3WX5 A;  2DCZ A;  4XAC A;  3WDW A;  5E1R A;  1PZ8 A;  3W9A A;  1W6N B;  4IV1 A;  3ZYB A;  4UW3 A;  4YSF A;  1GQG A;  1YWK A;  4PIZ A;  4Q0V A;  4R9A A;  1E5H A;  3PLQ A;  1OH4 A;  1KDK A;  2W68 A;  2ZX2 A;  2WSU A;  3JD7 3;  4QWN A;  4CP1 A;  4LHS A;  4JKK A;  3HQX A;  1JMU B;  3QH7 A;  1EP0 A;  2R04 1;  2YRO A;  1DQ2 A;  4BHP A;  1DHK B;  1QJU 1;  2NLR A;  1XND A;  3R4U A;  5ERL A;  1RMU 2;  2VOK A;  4E2Q A;  4Q8K A;  1YIF A;  2WO1 A;  2AUY A;  4LO7 A;  5JXH A;  2CGN A;  3W5N A;  1QQP 1;  4RL7 A;  2XVL A;  4DEQ A;  1HQL A;  2LM3 A;  1EY2 A;  2GAU A;  4KWJ A;  4PJY A;  2J42 A;  2YZ4 A;  1TE1 B;  3KV6 A;  3OGV A;  1QXR A;  1UO9 A;  3OPZ A;  4QU1 A;  3JCI A;  3UES A;  3WG2 A;  1JYV A;  1A8M A;  3HQR A;  1HB3 A;  5FYV A;  3VHP A;  5KXC A;  4BQY A;  4MSV A;  4OLL A;  1HRV 1;  4OQ9 A;  2GH2 A;  5FOB B;  1TME 1;  4NWV A;  1UZZ A;  3E5X A;  5FZ4 A;  2VZP A;  1G9F A;  5CFC B;  4H7L A;  5JDB A;  3IDC B;  2WO3 A;  1L3J A;  1DYP A;  3KWV A;  3O0X A;  2WS9 3;  4YFZ A;  4P9L A;  4GH4 A;  4BQW A;  3AM2 A;  3ZMO A;  4NHK A;  3A0K A;  4KH9 A;  3ETQ A;  3WDY A;  2XWB B;  3GHN A;  5LRR A;  3VGI A;  3I2K A;  2WT1 A;  2XXZ A;  3J26 N;  4AED B;  1PM4 A;  1RGS A;  4FXG B;  2XL7 A;  1LUL A;  2W3J A;  2ZHM A;  1MVE A;  1TEI A;  3KB5 A;  1FOD 2;  4BIS A;  4PDW A;  4NIA A;  5FXX A;  1CZV A;  1VBE 3;  2CAV A;  1MS0 A;  3RJ2 X;  4A2U A;  3N9P A;  5GKA C;  1JZ6 A;  3I2H A;  3O1T A;  1C28 A;  1XE0 A;  1R09 1;  3PU3 A;  5F5A A;  4CCE A;  5KXE A;  2R6Q A;  2RJL A;  4DZG A;  3HJR A;  1W2N A;  5FYU A;  2NMN A;  1HW5 A;  1NE4 A;  3LPF A;  3TAY A;  1LR5 A;  1QY4 A;  3LIG A;  2V09 A;  1OFS A;  3BTA A;  3NV1 A;  4R4X A;  4XFI A;  4CCL A;  1W90 A;  4XDQ A;  2A1X A;  5LA9 A;  5FZE A;  1C4R A;  1Q56 A;  1RIR A;  1W04 A;  4UFL A;  4QX3 A;  2A3W A;  2DVA A;  4GAZ A;  2ZZQ A;  3WDV A;  5CEH A;  3LDR A;  3VZN A;  2DYC A;  1E5R A;  4RN5 A;  2XR4 A;  4A44 A;  4AAX A;  2YDE A;  5KHJ A;  1RUN A;  3ES4 A;  1YIP A;  4FAG A;  1W8F A;  1IS3 A;  1IG3 A;  1QOS A;  2BOJ A;  5K0U A;  5APA A;  1SBF A;  1ZZ8 A;  3BAL A;  3CJI B;  3FWE A;  3GGL A;  1M4W A;  1PIV 2;  2W87 A;  3ME2 A;  4Y5Z 0;  4IV3 A;  2Y60 A;  4QPW A;  2OW4 A;  3A23 A;  4I02 A;  1OFN A;  2WYS A;  3MW3 A;  4BE3 A;  1HQN A;  3ROU A;  4PF1 A;  2OS2 A;  3ZYF A;  1LOE A;  5IVC A;  4P9G A;  3N35 A;  4N90 A;  4WM8 C;  1K42 A;  2XON A;  1BEV 2;  4OQ8 A;  1HJG A;  2K2S A;  4QXC A;  4RS5 A;  1GWM A;  3WQ1 A;  1L7Q A;  2W5F A; 
#chains in the Genus database with same CATH homology
 5F8P A;  3H8R A;  3H8X A;  4RFR B;  4NIH A;  3KHB A;  3I3M A;  3BTZ A;  4IE0 A;  3O1U A;  4OCT A;  3T4V A;  3BI3 A;  4NRM A;  3H8O A;  4QKB A;  4NIG A;  3RZK A;  5DAB A;  3O1S A;  4ZS3 A;  4NPM A;  4IDZ A;  3LFM A;  4CXY A;  3O1M A;  4IE7 A;  3BTX A;  3RZG A;  2FDK A;  3T4H B;  4CXX A;  4IE5 A;  2FDI A;  3O1O A;  3I49 A;  4QKF A;  3BIE A;  3I3Q A;  4ZHN A;  4MGT A;  4NII A;  4NRO A;  4QKN A;  4MG2 A;  3BUC A;  3KHC A;  4O7X A;  3BU0 A;  3O1T A;  4JHT A;  3S5A A;  3S57 A;  4O61 A;  4CXW A;  4NPL A;  2IUW A;  3BKZ A;  3O1R A;  4ZS2 A;  3RZM A;  3RZH A;  3O1P A;  4QHO A;  3RZL A;  4IE6 A;  4IE4 A;  4NJ4 A;  3O1V A;  3I2O A;  2FDH A;  3T3Y A;  4NID A;  2FDF A;  4QKD A;  4NRQ A;  2FD8 A;  4NRP A;  2FDJ A;  3BTY A;  3RZJ A;  2FDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...