4HLTA

Crystal structure of ferric e32v pirin
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
288
structure length
288
Chain Sequence
SSKKVTLSVLSREQSEGVGARVRRSIGRPVLKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pirin
publication title Pirin is an iron-dependent redox regulator of NF-kappa B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 76
structure length 288
sequence length 288
ec nomenclature ec 1.13.11.24: Quercetin 2,3-dioxygenase.
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02678 Pirin Pirin
A PF05726 Pirin_C Pirin C-terminal cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hltA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hltA01
4Z82A 4AQ6A 2H6CA 3E97A 2XHKA 4KU8A 1CX4A 1ZZCA 4QXKA 2PFWA 4EWEA 1Y9QA 3PLQA 1LRHA 2OYZA 4EROA 4RD7A 4YNIA 3KSCA 3UKNA 2IXLA 2MPFA 5J7MA 1O7FA 1EP0A 3H3ZA 3ACLA 4PIXA 4P9GA 5FLIA 5K8SA 5F1RA 4FT8A 1YFWA 3CL1A 3ZDSA 4AVAA 1CAXB 4WZCA 1UIJA 3LOIA 5BPXA 5BY5A 3KGLA 4HSLA 1YWKA 2BNNA 2XKPA 3FWEA 3OD0A 4N9HA 1IPJA 5D1IA 5CADA 1ZVFA 1XE8A 2O1QA 2XLGA 3NSTA 3KCCA 3RZZA 2HJIA 4JTNA 4XFAA 2FQPA 5EFUA 4XF3A 1L3JA 4XF0A 2XKOA 5KBFA 2B9UA 4KWLA 2QJVA 4UXAA 4IEQA 1CAWA 2PA7A 4E2QA 1YFUA 4F7ZA 4YRDA 4Q0VA 3GYDA 3ST7A 4OLLA 4HN0A 5LRSA 3ES4A 2EA7A 3JZVA 4IEXA 4IEUA 1VR3A 3EJKA 3DN7A 1VJ2A 4I3PA 3B02A 3U11A 2BEOA 2D5HA 3SCGA 2CGPA 1YFXA 1QXJA 2UYBA 1GQGA 1DGRA 3EQEA 5KHGA 4ZU5A 3E6DA 4XFIA 3RYKA 1J3RA 3H8UA 4LA3A 4BIFA 1O5LA 2V09A 1ZREA 1X82A 1RL3A 1J3QA 4QMAA 4FAHA 4IERA 4XFBA 3IIAA 1EPZA 2HKXA 2ETEA 1J58A 1DZTA 2VPVA 1FXZA 3M70A 2GAUA 4KWJA 1XRUA 1VP6A 1ZZ9A 3FHIB 2IXKA 1NYWA 1X7NA 4HVOA 2QVSB 1DGWA 1EYBA 4PIYA 5FQ0A 3EHKA 1SEFA 3N4MA 3H1MA 4LEJA 4XFCA 4I0BA 1O4TA 5E1RA 3NJZA 1UD1A 3H3UA 2K9ZA 1Q5OA 3LA7A 3SCFA 3NW4A 2H6BA 1QXRA 3IBMA 5I0TA 4E2SA 3ETQA 2ATFA 2IXHA 1CAVB 2PYTA 4LULA 2Z2SB 4BH9A 1ZRCA 2F4PA 4PJYA 4UBHA 4PIZA 1YHFA 2KXLA 4HSJA 1XE7A 4HZFA 5JAXA 2DCTA 3BALA 3TNPB 4R52A 2E9QA 2EAAA 2UYAA 3H7JA 1O5UA 3E5QA 4HBNA 4AQ2A 3QOPA 2ET1A 4QGLA 4IEWA 3OF1A 4JTOA 4JV4A 4XETA 5FPZA 3CLPA 3L2HA 4LUMA 4MGZE 1OFNA 4X6QB 4ORFA 2D93A 2GZWA 2D40A 3PNAA 5J48A 3HIFA 2OPKA 3UKTA 3H9AA 3MYXA 2PHDA 1QY4A 5JSPA 1SQ4A 4OFGA 4FBFA 1HW5A 5BXXA 1OI6A 4YARA 3FZ3A 5KHJA 3DKWA 1RGSA 3NVCA 4I01A 2CAVA 4JVAA 5LEKA 3NKTA 4J1XA 3G7DA 4XF4A 5CU1A 1CGPA 5BUVA 3LWCA 4XFHA 5T3NA 4LTAA 4MUVA 2GC0A 1CAXA 2OZJA 3BPZA 1NE4A 3S7IA 1RC6A 4MGYE 1I5ZA 4EWDA 2QCSB 4LUKA 1CAUB 1ZZ7A 3IDCB 4CYDA 3I59B 3WW1A 3E6CC 1ZRFA 3ELNA 1X8MA 2XLFA 2CV6A 3LA2A 1YFYA 4I02A 2UY9A 4META 3D0JA 1ZX5A 1ZZ8A 4I0AA 3TNQA 1RTVA 5LEJA 4X6RB 4HLTA 2VECA 1ZRRA 5FPXA 2BGCA 2K0GA 3IWZA 4IESA 4F8AA 1G6NA 4ZU7A 3RYPA 2XL9A 4ZU4A 1O3QA 5JSOA 3C3VA 3FE5A 2ET7A 4HVRA 3EO6A 2QDRA 4A2UA 2MNGA 4XF1A 3OGJA 5KHHA 4BHPA 4MZUA 2OA2A 4L2NA 5I8TA 5FDBA 1Q3EA 4IEVA 3RYRA 5HI0A 4AXOA 3H1YA 1SFNA 4MX3A 4TLFA 1FI2A 2Z69A 4LLOA 2VQAA 4K8FA 5I8YA 3OCPA 3ROUA 3KGZA 2BNOA 4QGMA 1ZZBA 3CJXA 3E5UA 1UCXA 3H1WA 4AVBA 3OTFA 1O3SA 1O3RA 4WVZA 4WBBA 3E5XA 5EZWA 3UKVA 5FCCA 4HVQA 4KWKA 3USSA 1JUHA 3H50A 1H1MA 4QGNA 3RNSA 4HN1A 3KMHA 4B29A 1IPKA 5I8SA 2GC3A 1NE6A 4Q0QA 5J3UA 1U12A 5AVPA 1WLTA 1ZRDA 1EY2A 1NXMA 4H7LA 2ZKLA 2B8MA 3U10A 4O9EA 5KHKA 2QNKA 2Y0OA 4XEZA 1ZNPA 2PAKA 2D5FA 3FX3A 3PVBB 3R6SA 1TQ5A 4MH0E 3HQXA 3LA3A 5LRRA 1QWRA 2XLAA 5FLHA 1J59A 2IXJA 5I0UA 5I91A 3EBRA 3U0ZA 4Q0SA 1OMIA 1O3TA 3MZHA 2MHFA 1H1IA 4I09A 2Q1ZB 2I45A 2OZ6A 3BU7A 2BNMA 4IEYA 4BYYA 3ES1A 4EWAA 2IXIA 2IC1A 3RPQA 3RDIA 5C8WA 5JR7B 3I7DA 3BB6A 3CF6E 5FLJA 1UW8A 4N9IA 4Q0PA 3QACA 4UBGA 4XF9A 3DL3A 1CAWB 2H0VA 3D0SA 3VHRA 3H7YA 1UIKA 3CEWA 5E16A 1YUDA 2CAUA 3FFQA 2FMYA 3MPBA 1YLLA 2PAMA 4ONUA 3WW3A 1RUOA 4IEPA 4IEOA 3WW4A 2Q30A 1OD5A 5JCTA 4Q0UA 3S0MA 4I2OA 1CAUA 4QX5A 2P17A 3I59A 2B5HA 4D7SA 1Y3TA 2ZCWA 4L11A 4Z07A 1NZCA 3IDBB 3NL1A 4IEZA 4NVPA 2C0ZA 3CO2A 3E6BA 2Q0AA 4EV0A 1V70A 3FJSA 4XFGA 3HT2A 1Q43A 2UY8A 3D82A 4XFFA 5JSRA 4E2GA 1LB2A 5I0SA 1PMIA 3LAGA 3SHRA 4YYOA 2PAEA 2O8QA 1PM7A 4DINB 2EVXA 2GH2A 1LKNA 3WW2A 5FQ0B 2XL7A 4D7TA 1ZZ6A 3HT1A 4YSFA 1DZRA 4GULA 2PTMA 5C6CA 5I0RA 1J3PA 3BCWA 5BV6A 4MGKE 1GQHA 3SMHA 1I6XA 4QM9A 1WGPA 1WA4A 4O9GA 4Q29A 2XGXA 2GC2A 2PHLA 3DV8A 2WC2A 2GU9A 4LA2A 2N7GA 2Q4SA 4MV2A 5CVRA 2PQQA 5I93A 1FT9A 4QM8A 4KU7A 3M3IA 3SXWA 3MDPA 5KHIA 3SCHA 3O14A 3GBFA 1X8EA 4J1WA 4KL1A 2GC1A 1RUNA 1J1LA 1UPIA 3S7EA 1LR5A 1CAVA 4HMZA 4IETA 2WFPA 4MGIE 4AVCA 2BYVE 4R8HA 2IXCA 4FAGA 3LZZA 3I54A
chains in the Genus database with same CATH superfamily
2NMOA 3OBTA 3KV4A 2XHKA 4LK7A 3VL8A 4N90A 3DCQA 5FZBA 1Y9QA 5ANNA 3PLQA 1AL0G 5C9AA 1YJKA 4PCRA 5FP7A 4AYUA 1EPWA 3DPRB 3GZAA 5FZ0A 2R0FA 1H2MA 2IXLA 2VUJA 3BTZA 2YXSA 3NV2A 3IDEA 3OGGA 3VDDC 1IOAA 1W3XA 4CU8A 3T09A 5J7MA 1NCRB 1O7FA 1FV2A 4OHWA 1AR92 4PIXA 1XYNA 4R9CA 2IWGB 3B00A 1RUE2 1W05A 3WLUA 5AC91 3O0WA 4FPJA 1AJKA 4NAOA 5HCAA 1JTZX 5FMBA 1YFWA 5FY4A 3CL1A 3INAA 3VZLA 5FZHA 1WBLA 1CAXB 2AC1A 5IK4A 3NQHA 1C4RA 3E6CC 5BY5A 3QBQA 3VHNA 3KGLA 4HSLA 1AYN1 3KQ4B 1YWKA 2BNNA 1QJX2 4IE0A 2F6BA 4A3ZA 3LPGA 3VV1A 4GWIA 1GZWA 1PIV2 3NNMA 5FR3A 4XXAA 1H30A 5FPVA 5D1IA 4QDQA 1F8VA 4L8QA 4YG0A 1XE8A 4NIHA 1RUC1 4BXSV 4CEWC 2DVGA 4TLGA 4YW2A 2V4VA 1PMJX 2DVAA 4ASMB 3VDDB 2FDHA 1UO9A 4UW3A 1T2XA 2R0HA 3SLIA 4AEJA 1S55A 3MV11 4GKXA 2FQPA 4JTNA 4LK6A 4OMCA 4PF5A 1L3JA 4NWVA 4XF0A 2XKOA 3T0BA 2VCBA 2BZDA 1FAYA 2IVIB 3HAGA 2QJVA 3MIHA 5FXZA 3HR9A 4NHLA 3ZFGC 5C7GA 4XJUA 5DDJ3 1JYNA 1LHVA 1LOBA 3N9MA 5FZGA 2OT7A 4AF9A 3I8TA 4YRDA 1W2OA 1HQLA 5B4NA 2QZ2A 3PUQA 3OYWB 1DGRN 1NY72 3IIIA 4OLLA 3ST7A 3CHXA 4WVWA 2XVKA 5LRSA 4W8JA 2UWCA 4XIOA 1G86A 1LENA 1Z0HA 2XVGA 4R9AA 4CEWB 4CTEA 4LHSA 2P2KA 3JUUA 3B02A 4QX3A 3ZYIB 5IVYA 4QPYA 4XTMA 3OUHA 3U11A 1R1A2 2CGPA 3N9OA 5D21A 1UNBA 2VQ0A 5IT6A 1A8DA 3J9SA 5CFCC 3DF0A 5KHGA 2CDPA 2VNRA 3JQWA 3ZFGB 5JUVA 4ARYA 2W52A 2JD4A 1D2QA 1PX4A 3MIEA 2QQUA 3RMYA 5IHRA 4R9DA 1AVBA 1O5LA 1WCQA 3JU9A 4B3NA 3K3OA 1Z78A 4FPLA 1WMDA 2Y0IA 3AJYA 2C5DA 1OUXA 3VGIA 1OKQA 3V0AA 4G4FA 2A70A 2X10A 5F32A 5GZCA 2XB6C 2ETEA 3ZSJA 1J58A 4GB33 1K42A 5DN2A 1SCRA 2V72A 1VBA3 5AC92 4MOAA 4QPIA 4MGSA 4PLMA 1HRI2 5T5PA 3T2OA 4XJ8A 1VP6A 1GMMA 2ORZA 2WZ8A 3FUQA 4OI2A 5FZ4A 2IXKA 4JC1A 1X7NA 5FO8B 2WZR2 1OXCA 5CFCB 1RUJ3 1DGWA 1EYBA 1AYN2 2ENRA 4LO5B 4PIYA 3HJRA 3HBZA 1K45A 2NPIA 1AF9A 2JDMA 3VDBA 4DIQA 2E6VA 2AENA 1YYNA 1OF4A 2W39A 5DABA 1UD1A 3H3UA 2X05A 3SCFA 1SLIA 1RUC2 2UWAA 3LGRA 3O0VA 4M4PA 5FMOS 2ZGRA 3D8CA 4JDMA 1QXRA 3IBMA 4BDVB 1GZCA 2PYTA 3I49A 1E5HA 1W6QA 2VMFA 5IFPA 5A7OA 3GZEA 4S2HA 4RGKA 2XR4A 1REFA 4H7MA 4PIZA 5F6KA 3VBUA 3BTAA 2KXLA 4HSJA 1WCUA 3VKFC 4DB5A 2JDZA 3BALA 3KF3A 3OPWA 2YU2A 1DQ6A 2EAAA 3H7JA 4KBZA 2VULA 4XIKA 1JYVA 4MXWB 1BQPA 5FWJA 1Y43B 2AYHA 1S0JA 3WQ7A 1R64A 3QOPA 4P9JA 1HLCA 3H3LA 4HK9A 4IEWA 1GLHA 4EN6B 5JOWA 4JTOA 1W90A 4XETA 4FI9A 5FPZA 2FCUA 4ZXKA 5JI9A 1X36A 3QLQA 4YGEA 1O59A 4X6QB 3W20A 3PNAA 2GZWA 2G9GA 2P3JA 1X33A 1B35C 2YU1A 3FHQA 2XDVA 3MFCA 3FLRA 4Y4RA 4WM8C 5J48A 2P37A 4P9XA 3UKTA 3OUJA 4LBKA 1PZ7A 1MQTC 4RS5A 1FPN1 2WSUA 1Z7S1 4GD4A 2PQSA 3T4HB 4D6QA 1TNFA 2B9VA 1K3IA 1Q8PA 2HWC1 2VAUA 3PMSA 3K46A 5JMOA 3AZZA 1CESA 1T6GC 3FZ3A 2Y64A 4OUSA 2W95A 3DKWA 2JDPA 3NVCA 4I01A 5J98B 1XNAA 4F83A 4B7EA 4RQPA 2JDUA 1QOOA 2R041 1Z7S3 5CU1A 3O7OA 1JMUB 1HIXA 3CNAA 4NHKA 4S2DA 2WWUA 4AHXA 4WVMB 2VZ3A 5LA9A 3ZXKA 2VG9A 4AOCA 5C8CA 1C8NA 2GC0A 1AJOA 5KXBA 3BPZA 1BK1A 4QKNA 2OKXA 3VBOA 1B35B 1RC6A 2KR2A 1VBE2 2QQOA 4UF0B 3TEXA 4WM8B 3UJQA 3WP3A 2DDUA 2R043 4AFMA 4M4RA 4QDSA 5GZDA 1MQTB 4FCAA 1CAUB 2GSYA 3OG2A 5C71A 3THDA 5EYYA 4CYDA 1S2BA 3I59B 1FATA 1H9WA 2ZJCA 1QQP2 3BODA 1QOSA 1OLME 1N3OA 2V73A 2WWSA 3K48A 1WMEA 4RL7A 3N7LA 5FZ7A 1W6NB 4HFSA 4XBNA 3WW1A 1LTEA 4P9WA 4A41A 5KC5A 3RJRA 3PJQA 1W6MB 2YV8A 3AZYA 4PQQA 3ZIWA 2XVLA 1UZ0A 2UY9A 5FY1A 3T4VA 4F3JA 4CXXA 1OA2A 1ZX5A 4S2FA 5DUVA 1OQEA 2FDKA 5LEJA 2E63A 5DUUA 1GWLA 4X6RB 2ZZJA 4HLTA 1TZOA 1TMF1 4NIGA 1ZRRA 2VECA 4QWNA 5ERLA 5A32B 4W4ZA 2K0GA 1ZYBA 3AFKA 5GM0A 3ZLIA 4YPJA 4F8AA 2VW1A 2W0XA 1CN1A 1NXD1 1OKOA 1UMIA 1WD3A 4BPZA 4ZU4A 2RDQA 5JSOA 3WHTA 3PU8A 1KS4A 2ZMKA 3OD4A 2ET7A 3AYEA 4A2UA 2IFRA 2MNGA 3KWVA 2R072 1J1TA 1IQAA 2GNBA 1BVP1 2DVBA 1C1LA 2JB4A 2ZGSA 3AXDA 2CGNA 5IWFA 5I8TA 2ZOEB 3ZN6A 2G9ZA 2WFF1 4LE3A 4IEVA 3RYRA 2EXJA 1FPN2 2A73B 5CIRA 4CZSA 3VZJA 4CSWA 3C7OA 5GALA 4H14A 1GOHA 4AXOA 3H1YA 3WD5A 2HWC2 3VBSC 2QQVA 5H9RA 1PVC1 4YG6A 2LM3A 5FY8A 1Q8VA 2XWJB 3AVRA 2EIEA 4K1YA 4BK5A 4FXKB 3GHNA 2VTFA 2WFF3 2ZAAA 5I8YA 1RUI3 2AH2A 4QQHA 5FYVA 3WUCA 3FBMA 4P14A 2ZX2A 1UOJA 1SZBA 1Q56A 2VVDA 3ILFA 5LATA 1OVPA 3GBWA 1I5PA 3VL9A 3ECQA 3T1LA 1RINA 4XUQA 2F17A 3C8XA 3K2OA 4E4SA 4WBBA 4JGYA 5C4WA 2JJ6A 3TN91 1CD3G 1S0BA 2MEV3 3UKVA 4A7ZA 5FCCA 3L9JT 2DCZA 4QX2A 1DHKB 1ULFA 2QQKA 1QH6A 3H50A 2VXJA 5KXEA 1NCQA 3RNSA 2O14A 3BGAA 4CP9A 1YO8A 2GMEA 1IPKA 5I8SA 4OQ9A 1NZIA 3VBSB 4MG2A 1MEC2 1OLQA 1NE6A 1R1ZA 4UOJA 3VKLA 4C1XA 3J8F3 4CDWA 2VOTA 4H7LA 3FN9A 4JZRA 1G8WA 3U10A 1VB4A 4QXHA 3AKPA 4O9EA 4W50A 4KGGA 4AR2A 3TB0A 5A3NA 1WMFA 2VMEA 3TOJA 3KHCA 4MH0E 1DDLA 5A7QA 1HRV1 1TMF2 5F39A 5T50A 4P9LA 2JENA 1MVQA 5LRRA 2RM21 4XAAA 4EN9B 1ULEA 2DCYA 1S0EA 2VZOA 4D94A 3GJAA 4AVTA 1AUYA 1PO21 1HRV3 2E7AA 3WDTA 2ZZQA 1GZWB 1ONAA 2BVVA 2XBO2 2D6OX 4YM1A 3ZVXA 1SBEA 4IEYA 1WZXA 3NV4A 3U75A 3SH3A 4DXSA 2IXIA 1C5HA 3O1SA 3MBWA 3RDIA 3WG4A 1XNKA 4OYUA 5C8WA 1BJQA 1YCIA 1PHMA 2WFF2 2Y6FA 5FZIA 3RZJA 1MPXA 3NJVA 3CF6E 3AZVA 1YQCA 3B94A 5LBCA 1ULDA 2WAOA 4CUGA 3LFIA 1F35A 5F5CA 2AACA 1PVC2 2DVFA 2Y33A 3H7YA 1YQ2A 4UYBA 3SKJE 1OQDA 5E16A 3RFRA 4YG3A 1QDCA 1YUDA 2CAUA 1AR73 1AYM1 2QQIA 3MF6A 3WW3A 4AI1A 1KFUL 1RUOA 3K4DA 5FKBA 3WW4A 5HXVA 1UOGA 1XU1A 1W6OA 1UMHA 2XWBB 3HNYM 3LFMA 2P5BA 5F3EA 1HX6A 1KDKA 4D0QA 2EALA 4ZKTB 3TN92 2YUEA 4Q0UA 1OD3A 2IUWA 2D6LX 3AB0A 4Y5Z0 2WQZC 2B5HA 4QPIC 1M4WA 1KEXA 4E8DA 4CUCA 4GIQA 3KT1A 4XILA 1NLQA 3J7LA 4W65A 3OYWA 4LORA 3KF5A 3HEIA 4QAWA 4AWDA 3IDBB 2DV9A 5EV7A 1CIWA 2Y6JA 2ZGPA 4IEZA 5FWEA 3ALQA 4GMP0 2VMGA 3I3MA 2D97A 3VZNA 1VBC1 1QJY1 1VRH2 2WN2A 3MHZA 1W2TA 1UQXA 2ZABA 1V70A 4XFGA 2HWB2 3P6BA 4DNYA 2YDEA 5B4XA 5LY2A 3D82A 3LDKA 4N53C 3ACFA 3SISA 2WQ8A 4NHXA 1DLLA 5F5QA 5JSRA 4LBNA 3VUOA 3V0AB 3W5MA 5I0SA 1LJ7A 1PMIA 2CHHA 2XXZA 3EB7A 4LBQA 4Q4X3 5LWBA 5HCFA 2FZ1A 3GXUA 4FPHA 1VBC3 1LCLA 3VBUC 3OBZA 1W9WA 4AQSA 4PHZA 1YEWA 4QPIB 2RM22 2DUPA 1FV3A 2JECA 2X09A 3OEBA 5GLUA 3WZ1A 5FUIA 4Z92B 4XHBA 2GH2A 5HXMA 4HANA 1U5XA 2VZVA 5CNAA 4MSVA 2VZPA 4IV1A 1V6IA 5JZGA 4D7TA 1PO22 2BWAA 1V00A 2VCCA 4FPYA 3RZHA 4YSFA 3ZXAC 5F37A 4LNVA 4TXWA 3VKOA 3I2HA 4ARXA 1IS3A 3C2UA 1ULGA 4CDQA 5BV6A 4N53B 2R32A 3BOPA 4CU9A 1SDWA 3FMGA 5L9VA 2RS32 2BBAA 3R4SA 2RS12 5A7SA 1C8M2 1W6QB 1WGPA 3KT4A 4Q29A 2ZA9A 4RS5C 4CCJA 4RA0A 3DV8A 4C0HA 2D3PA 2GU9A 3VBUB 1HB2A 1OVSA 3H42B 4LLFA 2Q4SA 4Q4W2 4XDOA 3ZPYA 4NUBA 1X9PA 2WNUA 1XYOA 4LT5A 1JYTA 4XURA 3MDPA 2VTXA 4UWDA 1YNAA 5J96B 2NN8A 1X8EA 2ZGLA 4Q5OA 4JKLA 4J1WA 1MS9A 1AYM2 2ZX4A 4KL1A 4BQ5A 1H4GA 1QJU1 1UPIA 3S7EA 1LR5A 1PGL1 2WDBA 2WFPA 2Y60A 3ZYJB 1TME1 3POBA 4AVCA 5D8AA 1HQWA 2VL4A 2YC0A 5JLVA 1V6LA 4XVHA 4LKFA 1CZSA 5FZ3A 5JXHA 3RWNA 4LBOA 2IXCA 3MLLA 3B3QE 5HCHA 2H6CA 1QJU3 4OHYA 1CX4A 4GQ7A 1TME3 2B4KA 4RS5B 3ZKYA 4QKFA 3POGA 1QJY2 4NHYA 2NZ9A 2ZGKA 5JPMB 4ZY9A 2MPFA 3H3ZA 4Y24A 3KV9A 5H9QA 1UZYA 3GZUC 4RSUA 4TYSA 3MV01 1LHWA 3BIEA 3MUZ1 5C3SA 2RV9A 4DUXA 1ULOA 2BP6A 2A6ZA 1N1TA 4LO8A 5CKNA 4IE4A 4AVAA 1LOFA 2K2SA 2YC2A 3K3NA 3LIHA 4OHXA 4CEYA 5FPUA 1UZWA 4J6GA 1UIJA 5BPXA 2RVAA 1MR5A 1UYPA 1UXZA 3ME2A 2QUOA 2WNOA 2Y6GA 4D6RA 3MW2A 3FWEA 1NKGA 4N7IA 4Q26A 3OD0A 5KR7A 3WUDA 2HWE3 5CADA 5L9RA 1VPHA 2ZHKA 3ZXJA 1UF2C 3KCCA 1N3PA 3ON7A 3WXPA 1KD7A 4CCKA 4UW5A 1QGLA 1AR63 2BGOA 1PZ9A 2HJIA 2E26A 3DECA 4XFAA 4ZZ8A 5EFUA 5K9YA 3WP4A 1ULCA 3NJYA 5SV5A 4E2QA 1ZA4A 4HXCA 2PA7A 2ZMNA 5E88A 2RS51 2D98A 3KHBA 4YM0A 5FK8A 1UY4A 2YY1A 1IG3A 2XJQA 5GZFA 1LU1A 4TSVA 5CKQA 5KXDA 1Y9GA 2OS2A 2R063 2Q8EA 1X50A 4HL0A 3USUA 4Y33A 4HN0A 1VAMA 2P3IA 3VD7A 4W6WA 3A22A 1MS8A 4XE9A 2EA7A 2C9KA 1QJU2 1PGL2 1VBB1 4JRLA 2BERA 3DN7A 1AR91 4LHLA 5DAPA 4IW3A 1UWWA 5KWRA 1PK6A 3SCGA 3ZYHA 3O1OA 4NIAA 1BXHA 4JGYC 2LUWA 2X5IC 5C4WC 3N3HA 1XU2A 3EQEA 5JXJA 1S2KA 3ZN6B 1QIQA 2GNTA 2P1BA 4C0BA 1F4AA 1AR93 1GQPA 4QD2A 2Q8DA 1NCQC 1NLSA 1KS5A 1O8SA 2V09A 1JXNA 1WLDA 3N9QA 1RUE3 1TE1B 1VALA 2BPA2 1SBFA 1X82A 1RL3A 3I3QA 1RUF1 1JH5A 4Y1XA 3ZSEA 4K9SA 1JU4A 4E4ZA 1FOD2 4XFBA 4ZS2A 4CDWC 1LESA 2VBBA 3EXUA 3IIAA 4LJHA 3RZMA 3S30A 2GN3A 4FP2A 4CCMA 3LEMA 4AL9A 3HNBM 1QJX3 4Y5TA 4DRVA 1A78A 1XRUA 4DQAA 1AX1A 1GZTA 1ZZ9A 4JGYB 2X5IB 5C4WB 4C8DA 1W2AX 1NT0A 2JDKA 4U2AA 3K77A 1W9FA 1JZ5A 3KV5A 4BZ4A 1NCQB 3M3OA 3C7EA 4CP9B 1GOGA 2K9ZA 2JXAA 2DU1A 2SBAA 1Q8SA 4INDA 5LCWL 2H6BA 4QB2A 2ZTNA 5FRAA 4CDWB 3ETQA 2VXRA 2FMDA 2HH9A 2OXBA 2LALA 3N7JA 1ZRCA 1KJRA 4UBHA 1R1A1 4XMAA 3D5OA 3JD72 1OUSA 2V5YA 5JOZA 2A6YA 1D0HA 4YVWA 3WF0A 2RS52 3FLTA 4HKWA 4KH9A 5FREA 2PLV2 5LBFA 2UYAA 3VBSA 4EN0A 3R4UA 3MLJA 4Y3OA 2PHRA 3THPA 3V64A 5CYYA 4YWAA 5LA2A 4AQ2A 4P9IA 2ET1A 1R1A3 3J7MA 4E8CA 3U1XA 3V0BA 3THCA 3RWKX 4JV4A 3IMNA 2I07B 1AR81 3ZFFA 1VBB2 2Z4FA 4MGZE 5DZFA 1OFNA 2DFBA 4GWJA 1SLAA 2E32A 4ORFA 4XYXA 5T55A 5J1XA 4FSJA 1W0OA 3CZUA 4ISRA 1DLCA 3MPPG 2ZXQA 2WZEA 3N35A 2YBKA 1HRI1 5DAVA 2D6NA 2BVBA 1CJDA 4BISA 4BMEA 2FDGA 5JSPA 4A44A 1SQ4A 4OFGA 4OHZA 4FBFA 4EN7B 3ZPOA 4BXFA 2JICA 2WZR1 5BXXA 2DCJA 1JBCA 1GP4A 1YRZA 2BTVC 4YARA 1I9RA 3K4ZA 5AC93 4BQ2A 4XUPA 3QD6A 5KHJA 4EYUA 4WZFA 5GLZA 1RUF2 1HRI3 1J83A 2CAVA 3KT7A 4JVAA 4XC9A 4GWMA 1RJ8A 3NKTA 3G7DA 4J1XA 2OQ6A 4WM7A 2DWRA 1DQ0A 1W6PA 3D3AA 1UYYA 4GJZA 1OBNA 3HQRA 3M3QA 2WZR3 4YGCA 5DAWA 5FY5A 1VAKA 2J1RA 5T3NA 5A1AA 1AYN3 4AQTA 2B45X 3VHPA 2EXIA 1H8VA 1W6OB 1NE4A 1UU4A 3LSDA 3S7IA 4NPMA 1B09A 3SC7X 5HPOA 1AHSA 1I5ZA 2WKKA 3B9CA 4YM2A 4V1PA 4X8PA 3LEGA 2QCSB 4LUKA 1RUC3 1ZZ7A 2E51A 2JIGA 4LHKA 1A6CA 5F9TA 3IDCB 1G9AA 4LBLA 4ZXEA 4Z1VA 4JKMA 1GSLA 3CJIA 5C33A 5CAZA 1YC61 3ELNA 4CDXC 2DVDA 3DYOA 1W2NA 3LA2A 2PN5A 4IV1C 5FKCA 5JZGC 5IK8A 3H8OA 2QZ3A 3K51A 1W9TA 3WQBA 1MACA 3BTYA 3GGLA 2EXKA 4META 3LB9A 2Q1MA 3U78A 4CDQC 3HD8B 3WG2A 3GZTB 4PLOA 4B1LA 5L7OA 2GNDA 3WDYA 1OURA 4LBQB 2BGCA 4IESA 4KWUA 1WW5A 1G6NA 1UU5A 3IAPA 2CGOA 2XUMA 2DTWA 4P08A 5FBZA 5FZ6A 3RYPA 2XL9A 1OPOA 1W28A 1O3QA 3C3VA 4ASKA 2WO7A 2WNUC 1W8OA 1H8TA 4QQ2A 4GAZA 4UFKA 2AZ5A 2ZBJA 3MW3A 1AR82 1UYXA 4XF1A 3N9PA 2ZGNA 3V56A 2DUQA 4CDXB 5JZGB 3EMRA 4IV1B 4OULA 1H6XA 5A7NA 3ZN5A 4HKOA 3SH5A 1VIWB 2RR12 5IJRA 2HEWF 5D8AC 1GNYA 2CDOA 2ZX3A 1URXA 3P5BA 4CDQB 1VBE1 5F2SA 4MYEA 5IK7A 1S0GA 3GF6A 4M3CA 3IMMA 4NAMA 3OGRA 4IXLA 3T30A 3NWKA 4XDPA 1SFNA 4MX3A 1E5RA 2BJSA 1FI2A 2Z69A 2YMZA 4LLOA 3ENRA 3WVJA 1QQP1 4GA9A 3W58A 2VM9A 3AM2A 3OPZA 4K8FA 1LOAA 5FMOL 5FYUA 5EXOA 3WINE 3ROUA 3A0NA 1VBE3 4UAPA 4UFIA 1D4M2 2WNUB 2BNOA 3KGZA 4PI2A 4QGMA 1ZZBA 3CJXA 5C3QA 1UCXA 4IE7A 4N53A 3X29B 3ZIXA 4OI0A 1G9BA 1YQ8A 1VAVA 4AVBA 1C1FA 2IFWA 1LGNA 2PHUA 1QQP3 5C3OA 5EZWA 5D8AB 3MIFA 4HVQA 5L19A 2I74A 4EZ4A 3USSA 1D4VB 1LOFC 4CEYC 1FYUA 5F3IA 3RZLA 3M3CA 3WNOA 5BNQA 4MHUA 3O5SA 2BOJA 4FOYA 1AZDA 3AP6A 4NJ4A 5FY9A 4NROA 2JG8A 3VB9A 1LAJA 2D7FA 2YFUA 1WLTA 2ZACA 1ENRA 4XCBA 4ISQA 4YVSA 2WT0A 5AVPA 1EY2A 1REDA 4C91A 2R071 2KD7A 4Q4V1 1GFF2 3T0DA 1LOCA 1V6KA 4YZ4A 5GLWA 5KHKA 5HBAA 3OUIA 2QNKA 2Y0OA 3OPTA 1ZNPA 2ZGUA 2D5FA 3AVSA 3FX3A 3PVBB 4JX0A 4XEZA 5ISLA 3OEAA 1TQ5A 4LITA 4UI9L 4CCNA 5I0DA 3ACHA 3HQXA 1KFXL 3HVDA 3OJBA 3ZR6A 2R073 2Z42A 3KCXA 3B7MA 2WWJA 2QQLA 4GXLA 2PHXA 1UKRA 4HETA 4QHBA 2E31A 1LEMA 1U5IA 5FLHA 1LGCA 4CEYB 1J59A 1HV0A 5I0UA 4LO4B 4DRRA 4URAA 1CPMA 4E27A 4CCLA 4GZ9A 4LE4A 3AX4A 4DEVA 1PM4A 2B46X 2ADDA 5M0TA 1RXGA 1JZ8A 1FPN3 3RRDA 5LASA 2I45A 4BYYA 1EUUA 3ES1A 1A34A 2HWC3 3PMEA 1RMU1 2GNMA 3NAPC 1IG0A 3AL6A 5JR7B 4AFDA 1U5ZA 2W92A 3TAYA 5JMCA 1C5IA 1PK6C 2PHWA 2TEPA 5EHDA 3BB6A 4BOWA 2XQXA 4YW5A 5FLJA 1UW8A 5IW0A 4C90A 3HNMA 3TNQA 2GN7A 2Q5TA 4LIUA 4PT6A 3POYA 1RMU3 2HLEA 1UIKA 5A6YA 1H0BA 4QU2A 1JODA 5J37A 1MEC1 2ZHMA 5FZMA 3VBFA 3FFQA 4N43A 2XJVA 2JG9A 2PAMA 3VD9A 3USUB 1DF0A 2B39A 4ET7A 5GLTA 4JAAA 5DUXA 4Y20A 4IE5A 3ZYPA 4OI1A 1YIPA 3VN4A 4NRMA 5C5UA 2XHNA 4I2OA 1HKDA 3AFGA 5FO7B 1MEC3 3WP5A 4DMIA 3TRSB 2P17A 3UNPA 1HXS2 1Y9MA 3LEKA 3O1UA 3MO4A 1PK6B 2X8KA 1Y3TA 3DYMA 4UFJA 4BQXA 4MLOA 5FP4A 2K46A 3IDAA 1N47A 3RI9A 3NL1A 4QHZA 4XJWA 5DZEA 1MS3A 4CCOA 4QB6A 5FAXA 4G3YC 4PDWC 1XOYA 2XJPA 1NOVA 2DF7A 1TMF3 1US2A 4D3WA 3FJSA 2XBO1 4H55A 4K1ZA 3HT2A 4O65A 4Q4V2 3I97A 5J36A 1Q43A 1TNRA 1FMD2 1W8HA 2UY8A 3NRUA 4XFFA 3WDVA 1UMZA 5T54A 4Y26A 4E2GA 1K5JA 3TEWA 4BM8A 1ST8A 3DKQA 2DFCA 2HWF2 3AMMA 2AGSA 2WINB 1OQ1A 2PMWB 2R6QA 5IFTA 2XBO3 4YVWC 3A7QA 2DURA 3UESA 1XJAA 1SLBA 2G1MA 2LW8A 1NQDA 1LKNA 2OUHA 3BN6A 3ZXFA 2ZGOA 5ABJA 4QX1A 2D6KA 4B7KA 4Y1ZA 4GULA 4PDWB 5I0RA 1KGYA 1DQ5A 2DBNA 1RIRA 2R1DA 1O6UA 3LE0A 1CX1A 2YZ4A 2C1FA 1CZTA 3ZFFC 4XQWA 3MIGA 3BU0A 1RMU2 3VBHA 1PVC3 1I3HA 1GZ9A 1KQRA 2X5IA 3P3NA 3ACGA 3IT8A 3ZXGA 1RUH2 2ADEA 5EIYB 5DUWA 1WBFA 3AJZA 2C24A 2WYSA 1EUTA 1GYKA 4FPEA 3POSA 4XUNA 4CDUA 2JDHA 3A21A 4MV2A 4YVWB 1POV0 1XXNA 4FQ4A 4KU7A 3M3IA 1ZBA2 3T08A 3SXWA 3CU7A 1HDKA 4A7KA 3TN93 1ZM1A 3GBFA 1D7PM 3DUIA 3U4SA 1VRH1 2J1UA 1J1LA 4TTGA 4IETA 3SH4A 2HEYF 4YGBA 5JIAA 3KM5A 2HWB1 4MGIE 4WM7C 3V0BB 4QU1A 4Y4YA 1OT5A 2VZRA 3N7MA 3WF1A 3SEPA 2A6XA 3ZFFB 1IKPA 4FPOB 1UPSA 4LR4A 4R8HA 4N7UA 5CEHA 4A6SA 3AMNA 4FAGA 3LZZA 3I54A 1VRH3 5IVEA 3AYAA 4ASLA 4KU8A 3PUIA 2XQRA 2HWB3 4URTA 3M3EA 4K3UA 3IAQA 4PI0A 4AI0A 4EWEA 5A3UA 4OQ8A 1UY1A 4EROA 3VHOA 2WS92 1SPPA 3CJIC 3RG0A 5AFBA 4EJRA 4SBVA 4CE8A 2PXJA 4LBQD 5DAXA 1COV1 2RM23 1BVVA 1KITA 2NQYA 2WUHA 3VD3A 3KQRA 3UT0A 4P9GA 5FLIA 1BLZA 3JB8A 4WM7B 4XACA 2ZX0A 5F1RA 1W6PB 2RS31 1XB9A 1SFPA 2RS11 3OY8A 1HJFA 1PO23 1XPWA 1C8M1 2D44A 2ZEXA 4RN5A 1KRIA 1LU2A 4COYA 3LOIA 5L7OC 4LBMA 1EAH2 2VNVA 3PIJA 4EE2A 1IQDC 2X53S 1P8JA 4Q4W1 2P34A 1N1VA 1OSGA 4DUVA 2RS33 1ZVFA 2RS13 3CJIB 5E89A 3BPSA 1C8M3 1H8TC 2W68A 1ENXA 3DGTA 2XLGA 1GANA 4BQWA 2ZHNA 3WOGA 4E4HA 4IGQA 4K21A 4OUEA 4Q4W3 3BTXA 4AVSA 1ODMA 4XF3A 2QE3A 2XONA 2A6VA 1CJPA 5KBFA 2B9UA 4UXAA 1CAWA 1H9PA 3AP7A 1JW6A 1AYM3 2VOXA 4XPVA 5FYMA 4QKBA 1OLRA 3UGFA 1POV1 2FDFA 2OQ7A 5L7OB 1UXXX 5CB7A 4Q0VA 2WN3A 3MIDA 3GYDA 4QT6A 2VUCA 3V65A 3MGUA 4D8MA 2J22A 3LF7A 1LHOA 3NNLA 1ACCA 1HJGA 1OLMA 3DXTA 3ZYFA 3UJOA 2FBEA 4IEXA 4RHV1 5JXIA 3RVHA 2RMU1 2VCMA 2J1VA 1H8TB 1VR3A 4FTEA 4A6OA 4MGTA 1WCDJ 1PO11 4I3PA 2BFUS 5FZKA 1F5JA 3KB5A 2J7MA 4H2AA 4JQTA 2EIGA 3AL5A 4LO6B 1GQGA 1QJY3 2DU0A 5HV4A 2B42B 4AGGA 2ZGTA 3RYKA 4K20A 1J3RA 4A7YA 4ZS3A 2Y6HA 3IM0A 1GWMA 4LA3A 2VZ1A 5IAVA 5LZ6A 1W06A 4M3CB 3GHMA 3MLKA 2NLRA 4CDXA 4QXBA 1BZWA 1J3QA 4MVTA 4FAHA 4COVA 2JG8C 4XOGA 4YVSC 3SITA 2ILMA 1AXZA 2HKXA 1COV2 5LBEA 1RYYA 3BOWA 2R1BA 5EWSA 4Y1UA 4W6YA 5T5LA 2VZTA 2VPVA 4BQYA 1AR62 3VD4A 3ZFEA 2JD9A 1LOEA 2Q8CA 2GAUA 4KWJA 4NPRA 5F7UA 2QDNA 2J1EA 1TEIA 3AKTA 1UU6A 1VMFA 1LEDA 3Q8BA 3ZDVA 3I2JA 5FQ0A 5D2AA 4AI2A 1LULA 3EHKA 2YPDA 3OB8A 3WY6A 1W3VA 4KBBA 3H1MA 2JKBA 2WLQA 4XFCA 4LMFA 1L7QA 4MGQA 1A8MA 4EQVA 3C7HA 1DQ1A 1ZBE1 1Q5OA 3LA7A 4QHOA 4A45A 4ZONA 5FY7A 2JG8B 4PF1A 2JDNA 4YVSB 5I0TA 4Z2WA 5JOXA 2ATFA 3VBRA 2IXHA 3MUY1 5IAXA 4XW3A 2Z2SB 4RFT0 1WW7A 3KS7A 2RDNA 4BH9A 4PJYA 1GUIA 2EIDA 3H8RA 4FOVA 1YHFA 1XNBA 2RHPA 5IVFA 2F4LA 1XE7A 5JAXA 4TWTA 1G9CA 2DCTA 1JU3A 3TNPB 3O1VA 2AREA 1POQA 2A75A 3E5QA 5FOJB 2CWMA 2ZGMA 4GMP1 1S0FA 3O1TA 4AFBA 3U4XA 4QGLA 3OF1A 5GZGA 4K7JA 3VBFC 4B4PA 3UGHA 1PVXA 4N43C 3CLPA 1FOD1 4RHV2 2JG9C 5FMDA 2BU9A 2RMU2 3L2HA 4AEDA 4AI8A 3N36A 1PO12 2D93A 4XZUG 2D40A 2ZEZA 1XQNA 1NA1A 1IHMA 5FIXA 4GMP3 2FDIA 3FLPA 2XH6A 3SNMA 2FDJA 2OPKA 5JPNB 1RUG1 2OW4A 3RZGA 3MYXA 1JI6A 3N9LA 1J84A 2CL2A 2ZPXA 5A3WA 4WVVA 4AW7A 1FOD3 1H2KA 4YW3A 1REEA 4OVEA 5CISA 4Q4Y1 4YFZA 3T3YA 1QDOA 2L9LA 3HBKA 1RGSA 4IL7A 4XTPA 5F8PA 1CPNA 4YW1A 4JKKA 5LEKA 1BEV1 5FZAA 4XF4A 3RGBA 3RI8A 4MO3M 1WLCA 3ATGA 3LWCA 5K0UA 1CONA 3VBFB 1GOFA 4N43B 2JG9B 5GJ6A 5LA1A 3AP4A 1L7RA 3MW4A 1JZ4A 2VNGA 1YI9A 4Y20B 4Q2FA 4EWDA 5A3TA 3JD71 4DO0A 5BNPA 4Z2AA 4G9SB 3IZOA 4HONA 3QH7A 1G7YA 2PLV1 4BE3A 4FXGB 5DXDA 2WO3A 4J25A 3WX5A 3UV9A 4GALA 5F6LB 5AFEA 2QQPA 3Q8EA 1X8MA 3TEYA 2HYKA 2AEZA 3RSJA 4PLNA 5ABJC 2CV6A 1ZBE2 3JD73 2WAAA 2XJTA 1YFYA 2GMPA 5FYYA 2RS53 4I02A 3ZXEA 4E4DX 1LECA 3LIGA 2PLV3 5F2WA 5FBJA 2V5DA 1ZZ8A 3NAPA 2VUDA 2BOIA 3PHMA 2J1TA 1NLRA 2QKDA 4FFHA 4I0AA 1AL22 5ANQA 5FZCA 4XAEA 4ES8A 2TNFA 3VBHC 1RXFA 1SMVA 4XJ9A 1D0GA 3NNJA 5FPXA 2GP5A 4PQ9A 1DQ2A 1W03A 4XBLA 4O61A 1MZEA 5CBLA 3IWZA 4FTSA 5FMCA 2A3YA 1VBB3 3ZSMA 1N3QA 3LDRA 4LOTA 4CDUC 3ORJA 4JRAA 4KG0A 5F3CA 1JUIA 3OSDA 2WJSA 1HB4A 3FE5A 1BBT1 1ASJ1 1CQ9A 1QHDA 5LK5A 3ILRA 3KD4A 1UX7A 4RR3A 5JI7A 3PUSA 1AX0A 4FOQA 5FYZA 2HYXA 4AG4A 5ABJB 1KXGA 1XSQA 5IVJA 3WCSA 3E1F1 5KHHA 4AHYA 3AP9A 4P00B 3GNEA 4BHPA 3KV6A 4MZUA 2OA2A 1RVF1 2GALA 4FQZA 2V4AA 2W08A 4M3CE 5FDBA 4R9BA 5J09A 1Q3EA 1RUG2 3ZSKA 3LCPA 4A3XA 1RUF3 3VBHB 3MIBA 2VVFA 4XHXA 4FPGA 4Q8KA 5FZEA 2CY6A 1KJLA 2W94A 1QKQA 1WKYA 2BDRA 3RZKA 3T1MA 2JX9A 2YPJA 3HN3A 4Q4Y2 4CU7A 4CDUB 4ES9A 4N8MA 4PDWA 1PGSA 3OCPA 4AEMA 1BEV2 4QPGA 4AHZA 1GBGA 4CPBA 3M1HA 3E5UA 4FPCA 4SLIA 1ENSA 3H1WA 4LXLA 1IS6A 3B01A 3EYPA 1LODA 3H0OA 4CCDA 1F31A 3W5NA 4WVZA 2ZS6B 5FYTA 1LGBA 3E5XA 3AZXA 1R092 2ZHLA 3SQOA 2DTYA 1QNWA 2RG4A 4KWKA 1JUHA 1OC1A 2Q1FA 4QGNA 3B5LB 4XJAA 3BVCA 3KMHA 4JHZA 2ARXA 1F5FA 4B29A 4B4RA 1S1AA 4YZ5A 2GC3A 2D3RA 4AE2A 2OVUA 4Q0QA 2HWD2 3AKRA 1RJ7A 2QFEA 1Y4WA 1IZ3A 1CIYA 1HB3A 3I2FA 4OZOA 1SPPB 4QQOA 4PBOA 3WHUA 5IVBA 1TG7A 1R082 5BNOA 3I2IA 3WT3A 1V9U1 2PAKA 2RR11 3R6SA 4P5HA 3WNPA 4GKYA 2YFZA 5FPAA 1ND3A 4Y1VA 1DQ4A 1APNA 3PL0A 5FP8A 2W1UA 3AK0A 3M8LA 5IYYA 2VMDA 1AR83 4DZGA 4B8EA 3M4FA 5C3RA 2WR9A 3OY8B 1V9U3 4ATFA 3U0ZA 2RR13 3D6EA 4FPKA 2Y26A 4Q0SA 5EP9A 5A3MA 1SBDA 1OMIA 3B93A 2VW0A 1BBT2 1RUD2 3GCXA 1ASJ2 3LPFA 3MZHA 4Q1PA 2MHFA 2YROA 1H1IA 3IPVA 4I09A 2J42A 4RFRB 4AAXA 3R0RA 1D4M1 1F15A 2JE8A 5A33A 2E7QA 2A5ZA 2BNMA 3BU7A 3F2ZA 1SLTA 5LK7B 2LS6A 4BQ3A 3WNXA 4C1WA 2IC1A 1Q8QA 1RVF2 2WT1A 3PDQA 3RPQA 4A4AA 1IGOA 1ODNA 1N1YA 1JS9A 2WYFA 2ZGQA 4QX7A 2KA3A 2WO1A 5ACA2 3AXEA 4UFMA 1XYPA 2BQPA 1V6OA 4AFCA 5FOBB 4ZHNA 1OOPA 4X8NA 4N9IA 1D4M3 4Q0PA 3QACA 4V2WA 2DYCA 5LBBA 3DL3A 3KZ4C 1CAWB 1FX5A 4KQ7A 2H0VA 3D0SA 3POIA 5FYIA 5FUNA 3VHRA 2P4EA 3B69A 4CA9A 2WBKA 3P3PA 1DYKA 3JBG2 1HN1A 1OPMA 1W8WA 3LEIA 4NIIA 2FMYA 3J4UH 5DDJ1 1YLLA 4NOTA 2XJUA 4IEOA 1WA6X 3HPNA 5FPBA 2RDSA 5FTTC 1VBD2 3UL2A 2E33A 3CDZB 5A3LA 3VKMA 1E5IA 4FO9A 1HN0A 2Q30A 1SHWB 3PVEA 1OD5A 3AKSA 5FZOB 5JCTA 2Q8OA 1MS4A 4P5YA 3AMQA 4CXWA 4FFIA 4QX5A 1ENQA 3ZFEC 3URFA 2P6CA 5FYHA 3H8XA 2BGPA 5EJZB 5LB6A 1RHI2 2WQ4A 1QOTA 1F2NA 3ZMNA 3BKZA 2ZCWA 4L0PA 3JXSA 1SLLA 4L11A 1F9KA 1NZCA 2DBIA 2EIBA 1UX6A 3AMHA 3PTRB 3SEEA 1QH7A 1JHNA 2VUAA 2C0ZA 4W6XA 1CZVA 3J7HA 5DMYA 2YBSA 3E6BA 3I3BA 3NV1A 4I30A 3RQ0A 1G9DA 3DYPA 4EV0A 3S5AA 4R4ZA 3NNFA 1QU0A 2W2IA 1LOGA 1X9TA 2WT2A 4YW6A 5E6HA 3QH6A 4Q1RA 4XCAA 1W04A 3WSOA 3LOBA 5HV0A 2EF6A 1AXYA 4K8RB 5CG8A 2WA4A 3TEZA 2C4XA 1GNZA 1V9U2 3VBRC 5F5IA 3LSEA 2PAEA 3Q9OA 4B1MA 2HBUA 2WNVA 3ZFEB 2A6WA 2C26A 4GB31 2EICA 1VBA1 4D69A 2J1AA 4L97A 4AI9A 3W9AA 2WABA 5FO9B 4RGGA 5FQ0B 3QCWA 3JQXA 2IVJA 1BK0A 3WNKA 3O1RA 1GU3A 3PJYA 5C6CA 1DZRA 4BU2A 1GICA 1RUJ1 4UT5A 3ZYBA 1WD4A 4LQRA 1J3PA 3BCWA 4AEDC 2XPJA 3ETPA 4MHRA 5JR2A 3SMHA 1VE0A 4FPFA 4AFAA 1DP0A 1NA1C 1LNSA 1ND2A 4NRPA 3VBRB 2R49A 3G6JB 2QBXA 2ZMLA 4KI5M 4QM9A 5A6QA 1HXS1 1FNYA 4O9GA 2VTXJ 2GC2A 3WG3A 3OGVA 2WC2A 3LKJA 1CR7A 1IS4A 1O8PA 2WRAA 2Y8KA 5I93A 1FT9A 3J7NA 4QM8A 3UGGA 3NV3A 4DEQA 2OUJA 4D6SA 3RS6A 4XXPA 3JCIA 2TUNA 4BJ0A 1LHUA 4E9KA 5FZLA 1HXS3 5DDJ2 4KNCA 1PMHX 3CZJA 4Y22A 4NPLA 1DZQA 2YYOA 5G05L 2C9AA 1FMD1 2EAKA 5DG1A 5K0UC 1FNZA 3ASIA 4Y1YA 4AEDB 4GJYA 1JYXA 4COWA 5JWPA 3UETA 5FP9A 1A3KA 1NA1B 2HWF1 4P02B 4Z82A 4AQ6A 1YQ5A 3E97A 4JGZA 3ZKUA 4BLJA 1ZZCA 5BNPC 4P9YA 3ITQA 4QXKA 4JCKA 2PFWA 4Q4V3 4Y5SA 5F5AA 3VZMA 2TBVA 1FMD3 1O4ZA 1LRHA 2OYZA 3U37A 4ZZ5A 4RD7A 5A3PA 4YLZA 2P3YA 4YNIA 5GZEA 3KSCA 3UKNA 4RGAA 4DPNA 5T5OA 2DUOA 1WW6A 3WV6A 2HWF3 1STMA 2PHFA 2VQTA 5E8AA 3TWIA 1EP0A 3ACLA 4LOSA 3VKNA 5K8SA 3AMPA 1BHGA 2GDFA 2BRTA 5FZDA 1IPSA 5LY1A 5K0UB 2VMIA 3M7AA 2RDRA 1UY3A 3I3DA 4FT8A 5FJKA 3WF4A 4FFFA 4AVVA 4DXZA 4HPKA 3ZDSA 5FYBA 1RUH1 3HWJA 4XQDA 2NMNA 3OBRA 2D6PA 3JB4C 4WZCA 5CFDA 2NP0A 3MF9A 3ABZA 4GB32 1VBA2 2XKPA 3CBNA 5BNPB 1NQJA 3FFZA 1DYOA 4ITCA 1ZBA1 5G04L 4N9HA 1IPJA 3ZO0B 2YHJA 5FV3A 4COZA 1V6NA 1RUH3 5KC6A 2O1QA 3NSTA 1RUJ2 1Q8OA 4RR3C 1WCSA 3O1MA 2JE7A 5GLVA 3WEZA 1YJLA 3RZZA 3PUAA 2BV4A 5BNNA 5CZKA 5IUQA 2W1SA 4DY5A 1ZBA3 2UURA 1XNDA 1C28A 3R05A 2RE9A 3ZN4A 4KWLA 3NAPB 4IEQA 3HOBA 4IQPA 2YG0A 2BBVA 1YFUA 4HKLA 2VQUA 2YBPA 4F7ZA 2R7EB 3FBYA 4NE9A 1QJZA 4S2GA 2RJKA 4L92A 2WS91 4M3CF 1ALYA 3S6PA 1SCSA 2VD7A 1OA4A 4GWNA 3WNNA 1M06G 3ES4A 3JZVA 4CCCA 2SLIA 4IEUA 4QPGC 4QPWA 3EJKA 3L2YA 1VJ2A 4RR3B 3HN1A 4KG8A 4H3WA 1HQNA 3ACIA 2WS93 2BEOA 2D5HA 3TYJA 3WDXA 4D7YA 1YFXA 3GBGA 1QXJA 2UYBA 4OUMA 5FXVA 2ZEYA 3AC0A 1DGRA 4IV3A 5FXXA 4CP2A 4AHWA 4CUAA 1ZRFA 4ZU5A 3E6DA 4XFIA 1QMJA 2A3XA 2ARAA 5EPAA 2D6MA 1RITA 4KGQA 4LKDA 4NN0A 1EAH1 3H8UA 2WNEA 4BIFA 1BCXA 2CWSA 2ORXA 4FP3A 4YM3A 3VZOA 2C6SA 3W21A 1ZREA 3O1PA 1QJEA 3VDAA 5A70A 5F3GA 3Q8CA 4XQ4A 3OGSA 4QMAA 1PX3A 2VE1A 4IERA 3Q8AA 1EPZA 5HCBA 3WQ0A 3TBDA 1Y7BA 1EAH3 1OF3A 2VH9A 2HBTA 1NAEA 5A7WA 4QPGB 1DZTA 4IGPA 1FXZA 1SFYA 2BW8A 2VY0A 2XOMA 3M70A 5FJHA 3A23A 3ZXLA 5BNOC 1JYWA 1E57A 1RUI1 1Z7S2 2H0BA 1H2LA 1ND3C 4R4XA 4OHVA 3FHIB 4LIVA 4QXCA 3BI3A 4LKEA 1NYWA 4HVOA 3I4IA 1C57A 2QVSB 2W9XA 1SEFA 3N4MA 5C9AC 1W0PA 4LEJA 2MEV1 1JYIA 3NMBA 4I0BA 3M2MA 3PUHA 1JOBA 1O4TA 2R042 5E1RA 3NJZA 3MEPA 4JQRA 4CP0A 1UZVA 3NW4A 1JYCA 2G4IA 3APBA 3VDCA 1W8FA 4E2SA 1XNCA 2VZSA 3NNGA 2A1XA 1K5MA 1CAVB 2X29A 4I0WB 4V2VA 1MZ5A 4LULA 1CWPA 3WDUA 4LKSA 2F4PA 4XUOA 3J8F1 2FZ2A 2O0OA 4A42A 5BNOB 5DG2A 4CVUA 1S0IA 5FZ1A 3UYJA 4HZFA 5A1LA 4GH4A 3VD5A 3POFA 1N1SA 3P1IA 2JKXA 5FXWA 1NG0A 1XSRA 1ND3B 2E9QA 4R52A 5LA0A 1OOPC 2AEYA 1O5UA 5K4LA 2E7TA 2GH8A 3AYCA 4HOOA 4L9BA 4HBNA 4EZHA 1XE0A 4NIDA 1AXKA 5C9AB 5FY0A 2WZPP 1W99A 4I3GA 4LHNA 4WV8A 1BMV1 4BIOA 3PVOA 5A80A 4TN7A 4LUMA 3D4KA 3I2DA 1W39A 4XBQA 2G9FA 1JOJA 3C7GA 1D2SA 3IPVB 3LDBA 4M0NA 2G19A 4QB1A 5A33B 2FD8A 1GP6A 2DCKA 3HIFA 3THTA 1H2NA 2JIJA 3H9AA 5A7PA 1V6MA 2PHDA 4NRQA 1QY4A 5TSWA 3ZMOA 3GM8A 1MVEA 1DBNA 2QQNA 3DPRA 4YZ3A 4YW7A 1HW5A 3WG1A 1W8NA 1OI6A 1COV3 1OOPB 2FCTA 4UFHA 4LBJA 4B4QA 1BKZA 2D43A 2CTVA 1UYZA 4U36A 5IATA 1NCRA 3W59A 2W5FA 4BCUA 2QQWA 5JXGA 2WSVA 1WCKA 3DXUA 4AGVA 5FFOC 4CP1A 2J1SA 1PZ8A 3WCRA 5BUVA 1CGPA 1AX2A 4XFHA 4YW4A 2VOWA 1U0AA 1V6JA 4FOWA 4K6BA 4LTAA 1H1AA 2ES3A 1L7LA 3AYDA 4MUVA 4PBPA 4Q27A 5H9PA 1GKBA 2W91A 1CAXA 4OMDA 1VB2A 2OZJA 1IKQA 3PIGA 1AR71 1RUI2 4LPLA 1BYHA 4MGYE 3WDWA 1V0AA 4IE6A 4NR1A 4AEKA 1DCSA 3WF2A 1UOBA 2WNVC 2Z5WA 3MFAA 4FFGA 2XG3A 5C70A 2JB8A 3T2TA 2P6HA 2A3WA 2MEV2 1F4HA 2VC9A 3VDDA 4EN8B 3N9NA 2XLFA 3T0AA 5FK7A 2VZQA 3MICA 1JZ3A 2HEVF 4DS0A 1OA3A 3GALA 2BFUL 1POV3 1MS0A 3D0JA 4CXYA 3MI8A 3AZWA 5EJ3A 1RTVA 1VRBA 4NO4A 2QQMA 2VBDA 3J8F2 1I1EA 3R4DB 4M01A 2LRPA 2A7AA 1ND2C 1O4YA 3NJXA 2OIIA 5KXCA 4RHV3 5CG9A 3B9IA 5C3PA 2RMU3 1U5YA 4ZU7A 3K4AA 3WF3A 2WL1A 1PO13 2WNVB 4Q4X1 4XABA 1MZ6A 3WNMA 3GCWA 4AZZA 4HT1T 1GP5A 3EO6A 1DU3D 1XNTA 1WMXA 1XBFA 2I2SA 2QDRA 1GV9A 4HVRA 4RYDA 5FYSA 3ZOIA 4CEWA 5BYNA 1H4HA 1BMV2 2E53A 3OGJA 5DZGA 2Y6KA 1ULPA 4UFLA 3C7FA 4L2NA 2ZKNA 5EQUA 4QKDA 2FHRA 2NYYA 4XUTA 4BB3A 1HRV2 1UKGA 2ZAHA 3ZFGA 1G9FA 2RJ2A 4MADA 5K7PA 5A6XA 1SDDB 3WP6A 2UWBA 5HI0A 1ND2B 4M0HA 2IZWA 2VGDA 1KDMA 2YGLA 2ARBA 4JGZC 2PHTA 3GJBA 4L99A 4AAPA 4TLFA 3ZYGA 3CQOA 5A3OA 1MS1A 1UY0A 2VQAA 3CKHA 3POEA 3PU3A 5FP3A 1VLNA 5FPLA 3CMGA 4DXRA 1DGWX 2ZEWA 2LTNA 2BWCA 2Z79A 1SG3A 4AI3A 5DQ0A 2VOKA 2WIIB 3OTFA 1O3SA 3I2KA 4Z8BA 5DPNA 1O3RA 1S2EA 4Y22B 2LROA 3WR0A 2XJRA 1RB8G 1AL21 1AR72 3AP5A 5CFCA 5L36A 4LO7A 5APAA 1ZBE3 3T2PA 1H1MA 1WW4A 3UK9A 1O91A 1E5SA 2VMHA 5CFDC 4M00A 3SKVA 4BWOA 4FTBA 1PGW1 4HN1A 2OPWA 3O0XA 3OOXA 4JGZB 2VVEA 5DAQA 2VCAA 3RMXA 2GMMA 2ERFA 5JOYA 3AKQA 3IB3A 1GR3A 5J3UA 1AL23 1U12A 1ZRDA 3I2GA 4RQPC 3ZR5A 2ID4A 1NXMA 3PTYA 1W9SA 2ZKLA 1VMJA 2JDYA 2B8MA 4OZXA 1IS5A 1UOFA 3ILNA 5C8CC 4BLIA 4XMIA 4XZPA 5BNNC 1UL9A 4HG6B 1OH3A 3T2QA 1US3A 5SV8A 3VBOC 3LA3A 1CVNA 5FZ9A 3S5QA 4MXWA 1DG6A 1UZZA 4O7XA 1QWRA 3PVNA 4COUA 1YIFA 2CU5A 1HV1A 3Q8FA 2PELA 2XLAA 1YXWA 4HPKB 3NKGA 4OI4A 1W8TA 4JDNA 4QQLA 2IXJA 4QX0A 5AVAA 3RJ2X 5I91A 3EBRA 3VZKA 4DFSA 5CFDB 4Q4X2 5JIUA 4BMBA 1K12A 1UAIA 2Y38A 1VBC2 1EV11 2RJLA 3N7KA 1O3TA 1RUG3 3KVAA 2Q1ZB 4IDZA 2BUKA 5T52A 5CKMA 5JDBA 2OZ6A 4RQPB 1JZ6A 3WQ1A 1LHNA 1W0NA 4EWAA 1GWKA 3CIHA 2VW2A 2VR4A 3WNLA 4Q4Y3 5C8CB 3I7DA 4KMQA 3KVBA 2HWE1 3NO8A 1EV13 1R091 1WLWA 5GKAC 2VO5A 5H9SA 5BNNB 4CCEA 4YFWA 3VBOB 1BEV3 2W1WA 4IV3C 3HMYA 4UBGA 1AR61 4K40A 4XF9A 1QNYA 5EJ1B 3I2OA 3ZYRA 2VOVA 5IVCA 1OFSA 3KCYA 4CPBD 3CEWA 3ZX7A 2W47A 2P3KA 4WVMA 2JE9A 3ZXDA 4YZ1A 5C5TA 1R093 1OHFA 1H6YA 2HWD1 2VJXA 4DUWA 2R30A 3MPBA 2O8OA 3J26N 4CUBA 4ONUA 1XC6A 1SLCA 2YGMA 4IEPA 1OH4A 5LW9A 5JVVA 1JHJA 3BIWE 4BQ4A 1B35A 4OCTA 2CNAA 5FUPA 4UF0A 1C3HA 1QF3A 1R081 4WM8A 3PURA 2R061 1QJFA 4NMIA 1SACA 4QQPA 4CU6A 1MQTA 2XMLA 3S0MA 1YI7A 1CAUA 2Y34A 2CSGA 2HWD3 2UU8A 3I59A 4D7SA 3ZM8A 4BA6A 2B7YA 2Y6LA 3IN9A 3ZSLA 5FZOA 2YB7A 1HB1A 2VMCA 2XJSA 1W6NA 4BQ1A 4Z07A 1PGW2 4IV3B 1R083 2KM2A 5IVVA 2VNOA 1NX9A 1W6MA 4TZDA 4NVPA 3BYWA 3CO2A 2W87A 1WUVA 1TVGA 1RUD1 1W2UA 3A4UA 2Q0AA 3FL7A 1YQ6A 1JN2P 1MS5A 4YGDA 2W3JA 1TME2 2VZUA 1QEXA 4DOUA 3GDBA 2WLPA 2QQJA 3FHAA 1RUE1 2YC4A 3I3EA 1LB2A 1S0DA 5L9BA 1K5MC 3LAGA 3F95A 5A32A 3VLBB 3DEMA 5ACA1 4XJZA 5A7WB 3SHRA 1BBT3 1RUD3 2JDAA 1ASJ3 4YYOA 3O12A 2O8QA 2JEMA 1PM7A 4QDRA 2ZX1A 4DINB 2WO2A 3HQUA 2AR6A 3LD8A 4GH4C 4IGOA 1PNFA 1QXPA 2OX0A 2EVXA 1DGLA 1QJX1 3FC0A 1JZ2A 1DIWA 2VBPA 1PIV1 2ARCA 5EYXA 1RVF3 3WW2A 5B2GB 1ZA7A 2XL7A 1EV12 5ACA3 3FUOA 3JBG1 3OBAA 1ZZ6A 3HT1A 2PTMA 5FYCA 4HK8A 3K75B 1VBD1 1DYPA 2FCVA 4MGKE 1GQHA 4DXTA 3S57A 2EXHA 3POJA 4QX8A 1PIV3 4AK3A 4CRQA 1I6XA 1VMHA 4ZPIA 4BK4A 5A1FA 2HWE2 1S4CA 3U07A 1K5MB 1S0CA 3JBG3 1W8UA 2W46A 1PNGA 1JOPA 1WA4A 2R16A 4DY3A 2JWPA 2XGXA 3U14A 4FVVA 2PHLA 4LA2A 4NWWA 1NUKA 2CYFA 1UY2A 2N7GA 1DFQA 1RHI1 3LQCA 3DPRC 5CVRA 1VBD3 2PQQA 4GH4B 2A71A 5L73A 3A0KA 4JDOA 5KHIA 1MZFA 3POWA 1NY71 3O14A 3SCHA 5T5JA 5IK5A 3KLSA 2GP3A 2NM1A 1JZ7A 1RUNA 2GC1A 1W8ZA 1NCRC 1GNHA 5A6ZA 3BUCA 2D3SA 4HMZA 1CAVA 5FZFA 1ZRIA 1RHI3 4JHTA 4Q8LA 5FZ8A 4IUGA 4ATEA 2AUYA 2BYVE 3IKWA 2VU9A 5CA6A 4AGRA 1T6BX 2R062 4MXVA 1WWYA 4UW4A 2XUEA 2QTWB 4NHMA 4XDQA 1UN1A 4YZ2A 2W1QA 4UW6A 2WA3A 1W9YA
chains in the Genus database with same CATH topology
2NMOA 3OBTA 2XHKA 3VL8A 4N90A 1Y9QA 3PLQA 1AL0G 5C9AA 1YJKA 4PCRA 4AYUA 1EPWA 3DPRB 3GZAA 2R0FA 1H2MA 2IXLA 2VUJA 2YXSA 3NV2A 3IDEA 3OGGA 3VDDC 1IOAA 5J7MA 1NCRB 1O7FA 1FV2A 4OHWA 1AR92 4PIXA 1XYNA 4R9CA 2IWGB 3B00A 1RUE2 5AC91 3WLUA 3O0WA 4FPJA 1AJKA 5HCAA 1JTZX 1YFWA 3CL1A 3INAA 3VZLA 5IK4A 1WBLA 1CAXB 1C4RA 5BY5A 3QBQA 3VHNA 3KGLA 4HSLA 1AYN1 1YWKA 2BNNA 1QJX2 2F6BA 3VV1A 1GZWA 1PIV2 4XXAA 1H30A 5D1IA 1F8VA 4L8QA 4YG0A 1XE8A 1RUC1 4CEWC 2DVGA 4ASMB 4YW2A 2DVAA 3VDDB 4UW3A 2R0HA 3SLIA 4AEJA 1S55A 4JTNA 4GKXA 2FQPA 4PF5A 1L3JA 4NWVA 4XF0A 2XKOA 1FAYA 3HAGA 2QJVA 3MIHA 3HR9A 4NHLA 3ZFGC 4XJUA 5DDJ3 1LHVA 1LOBA 4AF9A 3I8TA 4YRDA 1HQLA 2QZ2A 3OYWB 1DGRN 1NY72 3ST7A 4OLLA 4WVWA 5LRSA 2XVKA 2UWCA 4XIOA 1G86A 1LENA 1Z0HA 2XVGA 4R9AA 4CEWB 4CTEA 2P2KA 3JUUA 3B02A 3ZYIB 4QPYA 4XTMA 3U11A 1R1A2 2CGPA 2VQ0A 5IT6A 1A8DA 3J9SA 5CFCC 3DF0A 5KHGA 2VNRA 3JQWA 3ZFGB 2W52A 2JD4A 1D2QA 3MIEA 3RMYA 4R9DA 1AVBA 1O5LA 3JU9A 4B3NA 1Z78A 4FPLA 1WMDA 2Y0IA 3AJYA 2C5DA 3VGIA 1OKQA 3V0AA 4G4FA 2A70A 5GZCA 2XB6C 2ETEA 3ZSJA 1J58A 4GB33 1SCRA 1VBA3 5AC92 4QPIA 4PLMA 5T5PA 1HRI2 4XJ8A 1VP6A 4OI2A 3FUQA 2IXKA 4JC1A 1X7NA 5FO8B 2WZR2 5CFCB 1RUJ3 1DGWA 1EYBA 1AYN2 2ENRA 4LO5B 4PIYA 3HBZA 2NPIA 1AF9A 2E6VA 2AENA 1YYNA 2W39A 1UD1A 3H3UA 3SCFA 1SLIA 1RUC2 2UWAA 3LGRA 3O0VA 5FMOS 2ZGRA 3D8CA 4JDMA 1QXRA 3IBMA 1GZCA 2PYTA 1W6QA 4S2HA 1REFA 4H7MA 4PIZA 5F6KA 3VBUA 3BTAA 2KXLA 4HSJA 3VKFC 4DB5A 2JDZA 3BALA 1DQ6A 2EAAA 3H7JA 2VULA 4XIKA 4MXWB 1BQPA 1Y43B 2AYHA 1S0JA 3WQ7A 3QOPA 4P9JA 1HLCA 4HK9A 4IEWA 1GLHA 4EN6B 5JOWA 4JTOA 4XETA 4ZXKA 5FPZA 5JI9A 1X36A 3QLQA 4YGEA 4X6QB 3PNAA 2P3JA 2G9GA 2GZWA 1X33A 1B35C 3MFCA 3FLRA 5J48A 4WM8C 2P37A 4P9XA 3UKTA 4LBKA 1PZ7A 1MQTC 4RS5A 1FPN1 2WSUA 1Z7S1 1TNFA 2HWC1 1Q8PA 3PMSA 3AZZA 1CESA 1T6GC 3FZ3A 4OUSA 3DKWA 4I01A 3NVCA 5J98B 4F83A 4B7EA 4RQPA 1QOOA 2R041 1Z7S3 5CU1A 3O7OA 3CNAA 1HIXA 4NHKA 4S2DA 4AHXA 4WVMB 3ZXKA 2VG9A 5C8CA 1C8NA 2GC0A 1AJOA 5KXBA 3BPZA 1BK1A 3VBOA 1B35B 1RC6A 3UJQA 1VBE2 4WM8B 3WP3A 2R043 4AFMA 5GZDA 1MQTB 4FCAA 1CAUB 2GSYA 5EYYA 4CYDA 1S2BA 3I59B 1FATA 1H9WA 2ZJCA 1QQP2 3BODA 1QOSA 2V73A 1N3OA 2WWSA 3K48A 1WMEA 4RL7A 3N7LA 3WW1A 1W6NB 4HFSA 4XBNA 5KC5A 1LTEA 4P9WA 3E6CC 3RJRA 3PJQA 1W6MB 2YV8A 3AZYA 3ZIWA 2XVLA 2UY9A 4F3JA 1OA2A 1ZX5A 4S2FA 5DUVA 1OQEA 5LEJA 2E63A 5DUUA 4X6RB 2ZZJA 4HLTA 1TMF1 1ZRRA 2VECA 5A32B 2K0GA 1ZYBA 3AFKA 5GM0A 4F8AA 2VW1A 2W0XA 1CN1A 1NXD1 1WD3A 4BPZA 4ZU4A 5JSOA 3WHTA 1KS4A 2ZMKA 3OD4A 2ET7A 3AYEA 4A2UA 2IFRA 2MNGA 2R072 1J1TA 1IQAA 2GNBA 1BVP1 2DVBA 1C1LA 2ZGSA 3AXDA 2CGNA 5I8TA 2ZOEB 3ZN6A 2WFF1 4LE3A 4IEVA 3RYRA 2EXJA 1FPN2 2A73B 5CIRA 4CZSA 3VZJA 5GALA 4H14A 4AXOA 3H1YA 3WD5A 2HWC2 3VBSC 5H9RA 1PVC1 4YG6A 2LM3A 1Q8VA 2XWJB 4K1YA 4FXKB 3GHNA 2WFF3 2ZAAA 5I8YA 1RUI3 2AH2A 4QQHA 3WUCA 3FBMA 4P14A 2ZX2A 1Q56A 2VVDA 3ILFA 3GBWA 3VL9A 3ECQA 3T1LA 1RINA 4E4SA 4WBBA 4JGYA 5C4WA 2JJ6A 3TN91 1CD3G 1S0BA 2MEV3 3UKVA 4A7ZA 5FCCA 3L9JT 2DCZA 1DHKB 1ULFA 1QH6A 3H50A 5KXEA 1NCQA 3RNSA 1YO8A 2GMEA 1IPKA 5I8SA 3VBSB 1MEC2 1OLQA 1NE6A 1R1ZA 3VKLA 4C1XA 3J8F3 4CDWA 4H7LA 1G8WA 3U10A 1VB4A 3AKPA 4O9EA 4KGGA 3TB0A 1WMFA 3TOJA 1DDLA 4MH0E 1HRV1 1TMF2 5T50A 4P9LA 2JENA 1MVQA 5LRRA 2RM21 4EN9B 1ULEA 2DCYA 1S0EA 4D94A 4AVTA 1AUYA 1PO21 1HRV3 2E7AA 3WDTA 2ZZQA 1GZWB 1ONAA 2BVVA 2XBO2 2D6OX 4YM1A 3ZVXA 1SBEA 4IEYA 3NV4A 3SH3A 2IXIA 1C5HA 3RDIA 3WG4A 1XNKA 5C8WA 1BJQA 1YCIA 2WFF2 1PHMA 3CF6E 3AZVA 3B94A 1ULDA 1PVC2 2DVFA 3H7YA 1OQDA 5E16A 4YG3A 1QDCA 1YUDA 2CAUA 1AR73 1AYM1 3MF6A 3WW3A 4AI1A 1KFUL 1RUOA 3WW4A 5HXVA 1XU1A 1W6OA 2XWBB 1HX6A 1KDKA 4ZKTB 2EALA 3TN92 2YUEA 4Q0UA 2D6LX 3AB0A 4Y5Z0 2WQZC 2B5HA 4QPIC 1M4WA 4GIQA 3KT1A 4XILA 4W65A 3OYWA 4AWDA 3IDBB 2DV9A 5EV7A 1CIWA 4IEZA 2ZGPA 3ALQA 4GMP0 2VMGA 2D97A 3VZNA 1VBC1 1QJY1 1VRH2 2ZABA 1V70A 4XFGA 2HWB2 4DNYA 2YDEA 3D82A 4N53C 3SISA 3VUOA 1DLLA 5F5QA 5JSRA 4LBNA 3V0AB 5I0SA 1LJ7A 1PMIA 4LBQA 4Q4X3 5HCFA 2FZ1A 4FPHA 1VBC3 1LCLA 3VBUC 4AQSA 4QPIB 2RM22 2DUPA 1FV3A 2JECA 5GLUA 3WZ1A 4Z92B 4XHBA 2GH2A 4HANA 1U5XA 5CNAA 4MSVA 5JZGA 4IV1A 1V6IA 4D7TA 1PO22 2BWAA 1V00A 4FPYA 4YSFA 3ZXAC 4LNVA 3VKOA 1IS3A 3C2UA 1ULGA 4CDQA 5BV6A 4N53B 2R32A 3BOPA 1SDWA 3FMGA 2RS32 3R4SA 2RS12 1C8M2 1W6QB 1WGPA 3KT4A 4Q29A 2ZA9A 4RS5C 4RA0A 3DV8A 4C0HA 2D3PA 2GU9A 3VBUB 4Q4W2 4LLFA 2Q4SA 3ZPYA 2WNUA 1XYOA 4LT5A 3MDPA 1YNAA 5J96B 2NN8A 1X8EA 2ZGLA 4J1WA 1MS9A 1AYM2 2ZX4A 4KL1A 1H4GA 1QJU1 1UPIA 3S7EA 1LR5A 1PGL1 2WFPA 3ZYJB 1TME1 4AVCA 5D8AA 1HQWA 5JLVA 1V6LA 3RWNA 4LBOA 2IXCA 3MLLA 3B3QE 2H6CA 1QJU3 4OHYA 1CX4A 4GQ7A 1TME3 4RS5B 1QJY2 2NZ9A 2ZGKA 5JPMB 2MPFA 3H3ZA 4Y24A 5H9QA 1UZYA 3GZUC 4RSUA 4TYSA 1LHWA 2A6ZA 1N1TA 4LO8A 4AVAA 1LOFA 2K2SA 4CEYA 4OHXA 4J6GA 1UIJA 5BPXA 1MR5A 3ME2A 2QUOA 3MW2A 3FWEA 4N7IA 4Q26A 3OD0A 3WUDA 2HWE3 5CADA 2ZHKA 3ZXJA 1UF2C 3KCCA 1N3PA 3WXPA 1KD7A 4UW5A 1QGLA 1AR63 1PZ9A 2HJIA 4XFAA 5EFUA 5K9YA 3WP4A 1ULCA 5SV5A 4E2QA 1ZA4A 2PA7A 2ZMNA 5E88A 2RS51 2D98A 4YM0A 2YY1A 2XJQA 5GZFA 1LU1A 4TSVA 5KXDA 3USUA 2R063 1X50A 4HL0A 4HN0A 1VAMA 2P3IA 4W6WA 1MS8A 4XE9A 2EA7A 1QJU2 1PGL2 1VBB1 4JRLA 3DN7A 1AR91 4LHLA 5KWRA 1PK6A 3SCGA 1BXHA 4JGYC 2LUWA 2X5IC 5C4WC 3N3HA 1XU2A 3EQEA 1S2KA 3ZN6B 2GNTA 4C0BA 4QD2A 1AR93 1NCQC 1NLSA 1KS5A 2V09A 1JXNA 1WLDA 2BPA2 1RUE3 1TE1B 1VALA 1SBFA 1X82A 1RL3A 1RUF1 1JH5A 4Y1XA 3ZSEA 4K9SA 4E4ZA 1FOD2 4XFBA 4CDWC 1LESA 3EXUA 3IIAA 3S30A 2GN3A 4FP2A 1QJX3 4DRVA 1A78A 1XRUA 4DQAA 1AX1A 1ZZ9A 4JGYB 2X5IB 5C4WB 4U2AA 4BZ4A 1NCQB 3M3OA 2K9ZA 2JXAA 2DU1A 2SBAA 1Q8SA 4INDA 2H6BA 5FRAA 2ZTNA 4CDWB 3ETQA 2VXRA 2FMDA 2LALA 3N7JA 1ZRCA 1KJRA 4UBHA 1R1A1 4XMAA 3D5OA 3JD72 2V5YA 5JOZA 2A6YA 1D0HA 4YVWA 2RS52 3FLTA 4HKWA 4KH9A 5FREA 2PLV2 2UYAA 3VBSA 4EN0A 3R4UA 3MLJA 2PHRA 3THPA 3V64A 4AQ2A 4P9IA 2ET1A 1R1A3 3V0BA 4JV4A 3IMNA 2I07B 1AR81 3ZFFA 1VBB2 4MGZE 5DZFA 1OFNA 2DFBA 4XYXA 1SLAA 5T55A 4ORFA 4FSJA 1W0OA 4ISRA 3MPPG 3N35A 1HRI1 2D6NA 2BVBA 1CJDA 4BMEA 5JSPA 1SQ4A 4OFGA 4OHZA 4FBFA 4EN7B 2JICA 2WZR1 5BXXA 2BTVC 1JBCA 1YRZA 2DCJA 4YARA 1I9RA 5AC93 5KHJA 3QD6A 4WZFA 5GLZA 1RUF2 1HRI3 2CAVA 3KT7A 4JVAA 4GWMA 1RJ8A 3NKTA 3G7DA 4J1XA 4WM7A 2DWRA 1DQ0A 1W6PA 4YGCA 3M3QA 2WZR3 1VAKA 5T3NA 1AYN3 4AQTA 2B45X 3VHPA 2EXIA 1H8VA 1W6OB 1NE4A 1UU4A 3LSDA 3S7IA 1B09A 1AHSA 1I5ZA 2WKKA 3B9CA 4YM2A 4V1PA 4X8PA 2QCSB 4LUKA 1RUC3 1ZZ7A 2E51A 4LHKA 5F9TA 1A6CA 3IDCB 1G9AA 4LBLA 4Z1VA 1GSLA 3CJIA 5C33A 5CAZA 3ELNA 4CDXC 2DVDA 5JZGC 4IV1C 3LA2A 2PN5A 5IK8A 2QZ3A 3K51A 1MACA 2EXKA 4META 3LB9A 2Q1MA 4CDQC 3HD8B 3WG2A 3GZTB 4PLOA 5L7OA 2GNDA 3WDYA 4LBQB 2BGCA 4IESA 1WW5A 1G6NA 1UU5A 2XUMA 2CGOA 2DTWA 5FBZA 3RYPA 2XL9A 1OPOA 1O3QA 3C3VA 2WNUC 1H8TA 4QQ2A 2AZ5A 2ZBJA 3MW3A 1AR82 4XF1A 4CDXB 3V56A 2ZGNA 2DUQA 5JZGB 4IV1B 4OULA 3ZN5A 4HKOA 3SH5A 1VIWB 2RR12 2HEWF 5D8AC 2ZX3A 1URXA 4CDQB 1VBE1 4MYEA 5IK7A 1S0GA 3GF6A 4M3CA 4IXLA 3NWKA 1SFNA 4MX3A 1FI2A 2Z69A 2YMZA 4LLOA 3ENRA 3WVJA 1QQP1 4GA9A 3W58A 3AM2A 3OPZA 4K8FA 1LOAA 5FMOL 3WINE 5EXOA 3ROUA 3A0NA 1VBE3 1D4M2 2WNUB 2BNOA 3KGZA 4QGMA 1ZZBA 3CJXA 1UCXA 4N53A 3X29B 3ZIXA 4OI0A 1G9BA 4AVBA 1VAVA 1C1FA 2IFWA 1LGNA 2PHUA 1QQP3 5EZWA 5D8AB 3MIFA 4HVQA 5L19A 2I74A 3USSA 1D4VB 1LOFC 4CEYC 1FYUA 3M3CA 5BNQA 3O5SA 4FOYA 1AZDA 3AP6A 2JG8A 2D7FA 2ZACA 1WLTA 4YVSA 1ENRA 5AVPA 4ISQA 2WT0A 1EY2A 1REDA 4C91A 2R071 4Q4V1 1GFF2 1LOCA 1V6KA 4YZ4A 5GLWA 5KHKA 5HBAA 2QNKA 2Y0OA 4XEZA 1ZNPA 2ZGUA 2D5FA 3FX3A 3PVBB 1TQ5A 3HQXA 1KFXL 3OJBA 2R073 2Z42A 3KCXA 3B7MA 4GXLA 4XJAA 4FTBA 2PHXA 1UKRA 4HETA 4QHBA 5FLHA 1LEMA 1U5IA 1LGCA 4CEYB 1J59A 1HV0A 5I0UA 4LO4B 4DRRA 1CPMA 4E27A 4LE4A 3AX4A 2B46X 1FPN3 3RRDA 2I45A 4BYYA 3ES1A 2HWC3 3PMEA 1RMU1 2GNMA 3NAPC 4AFDA 5JR7B 1U5ZA 3TAYA 5JMCA 1C5IA 1PK6C 2PHWA 2TEPA 3BB6A 4BOWA 4YW5A 5FLJA 1UW8A 4C90A 2GN7A 2Q5TA 3POYA 1RMU3 1UIKA 1H0BA 4QU2A 5J37A 1MEC1 2ZHMA 3VBFA 3FFQA 4N43A 2XJVA 2JG9A 2PAMA 3USUB 1DF0A 2B39A 5GLTA 4JAAA 5DUXA 4Y20A 3ZYPA 4OI1A 1YIPA 3VN4A 4I2OA 1HKDA 3AFGA 5FO7B 1MEC3 3WP5A 4DMIA 3TRSB 2P17A 1HXS2 1PK6B 2X8KA 1Y3TA 4MLOA 1N47A 3RI9A 3NL1A 4XJWA 5DZEA 1MS3A 5FAXA 4G3YC 4PDWC 2XJPA 1NOVA 2DF7A 1TMF3 4D3WA 3FJSA 2XBO1 4H55A 4K1ZA 3HT2A 4Q4V2 5J36A 1Q43A 1TNRA 1FMD2 2UY8A 4XFFA 3WDVA 1UMZA 5T54A 4Y26A 4E2GA 4BM8A 2DFCA 2HWF2 3AMMA 2AGSA 2WINB 1OQ1A 2R6QA 2XBO3 4YVWC 2DURA 1SLBA 1NQDA 1LKNA 2OUHA 3ZXFA 2ZGOA 5ABJA 2D6KA 4B7KA 4Y1ZA 4GULA 4PDWB 5I0RA 1DQ5A 1RIRA 2R1DA 2YZ4A 2C1FA 3ZFFC 4XQWA 3MIGA 1RMU2 3VBHA 1PVC3 1I3HA 1GZ9A 1KQRA 2X5IA 3P3NA 3IT8A 3ZXGA 1RUH2 5DUWA 1WBFA 3AJZA 4FPEA 1GYKA 3POSA 4CDUA 4MV2A 4YVWB 1POV0 1XXNA 4FQ4A 4KU7A 3M3IA 1ZBA2 3SXWA 3CU7A 1HDKA 4A7KA 3TN93 1ZM1A 3GBFA 3DUIA 1VRH1 1J1LA 4IETA 3SH4A 2HEYF 4YGBA 5JIAA 3KM5A 2HWB1 4MGIE 4WM7C 3V0BB 4Y4YA 3N7MA 2A6XA 3ZFFB 1IKPA 4FPOB 1UPSA 4LR4A 4R8HA 4N7UA 3AMNA 4FAGA 3LZZA 3I54A 1VRH3 3AYAA 4ASLA 4KU8A 2HWB3 4URTA 3M3EA 4K3UA 4AI0A 4EWEA 4EROA 3VHOA 2WS92 3CJIC 3RG0A 5AFBA 4EJRA 4SBVA 4LBQD 1COV1 2RM23 1BVVA 1KITA 2NQYA 3KQRA 4P9GA 5FLIA 3JB8A 4WM7B 2ZX0A 5F1RA 1W6PB 2RS31 2RS11 3OY8A 1PO23 2D44A 1C8M1 1KRIA 1LU2A 4COYA 3LOIA 5L7OC 4LBMA 1EAH2 2X53S 4Q4W1 2P34A 1N1VA 1OSGA 2RS33 1ZVFA 2RS13 3CJIB 5E89A 2W68A 1C8M3 1H8TC 1ENXA 3DGTA 2XLGA 1GANA 2ZHNA 3WOGA 4K21A 4Q4W3 4AVSA 4XF3A 2QE3A 2A6VA 1CJPA 5KBFA 2B9UA 4UXAA 1CAWA 1H9PA 3AP7A 1JW6A 1AYM3 2VOXA 4XPVA 1OLRA 1POV1 5L7OB 5CB7A 4Q0VA 3MIDA 3GYDA 4QT6A 3V65A 3MGUA 1LHOA 3UJOA 2FBEA 4IEXA 4RHV1 2RMU1 1H8TB 1VR3A 4FTEA 1WCDJ 1PO11 4I3PA 2BFUS 1F5JA 3KB5A 2EIGA 4LO6B 1GQGA 1QJY3 2DU0A 2B42B 4AGGA 2ZGTA 3RYKA 4K20A 1J3RA 4A7YA 3IM0A 4LA3A 4M3CB 3GHMA 3MLKA 2NLRA 4CDXA 1BZWA 1J3QA 4MVTA 4FAHA 4COVA 2JG8C 4XOGA 4YVSC 3SITA 2ILMA 1AXZA 2HKXA 1COV2 3BOWA 2R1BA 5EWSA 4Y1UA 4W6YA 5T5LA 2VPVA 3ZFEA 1LOEA 2GAUA 4KWJA 4NPRA 2QDNA 1TEIA 3AKTA 1UU6A 1LEDA 5FQ0A 4AI2A 1LULA 3EHKA 3WY6A 4KBBA 3H1MA 2JKBA 2WLQA 4XFCA 1A8MA 1DQ1A 1ZBE1 1Q5OA 3LA7A 2JG8B 4YVSB 5I0TA 4Z2WA 5JOXA 2ATFA 3VBRA 2IXHA 4XW3A 2Z2SB 4RFT0 1WW7A 3KS7A 4BH9A 4PJYA 4FOVA 1YHFA 1XNBA 2RHPA 1XE7A 5JAXA 4TWTA 1G9CA 2DCTA 3TNPB 2AREA 2A75A 3E5QA 5FOJB 2CWMA 2ZGMA