4HLTA

Crystal structure of ferric e32v pirin
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
288
structure length
288
Chain Sequence
SSKKVTLSVLSREQSEGVGARVRRSIGRPVLKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Pirin
publication title Pirin is an iron-dependent redox regulator of NF-kappa B.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 288
sequence length 288
ec nomenclature ec 1.13.11.24: Quercetin 2,3-dioxygenase.
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02678 Pirin Pirin
A PF05726 Pirin_C Pirin C-terminal cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hltA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hltA01
3GYDA 1RUNA 2XLFA 5D1IA 5FLIA 1SQ4A 3H50A 5CADA 3RYPA 3NVCA 5BPXA 1IPKA 2IC1A 1J3QA 5C8WA 1Y3TA 4QM8A 1LKNA 4LA2A 4WVZA 3SMHA 1ZREA 5I8SA 2GAUA 1PM7A 4E2GA 2GH2A 4QM9A 1NYWA 2QVSB 3LOIA 1G6NA 5FPXA 5KHJA 2IXLA 4YNIA 3H1YA 4ONUA 1O3TA 1I6XA 1HW5A 4I2OA 2MHFA 3BB6A 4BYYA 4Z07A 2XKPA 4MH0E 5JR7B 1J3PA 4K8FA 4LUKA 1RGSA 5KBFA 4JTOA 1H1MA 3MYXA 4DINB 1YUDA 2Q4SA 3OGJA 4AXOA 3PVBB 1YFYA 3S7EA 2Z2SB 3KMHA 4EWEA 3FHIB 4F7ZA 1X7NA 1ZNPA 1CAVA 1L3JA 5LRSA 3LWCA 4WZCA 4IEUA 3WW3A 5FQ0A 4META 5F1RA 2IXKA 1CAUA 2IXCA 4L11A 2BEOA 4FT8A 1O4TA 3HT2A 3KSCA 2Q0AA 4IERA 1ZRRA 4Q0VA 4EWAA 2UYAA 3S0MA 2KXLA 3USSA 2OA2A 2OYZA 4NVPA 5I8YA 4Q0UA 3SCHA 3D0JA 3TNQA 3IDBB 4PIYA 3WW2A 4QGNA 4UBGA 3CEWA 4BH9A 2PAMA 2QDRA 1LR5A 1YWKA 3ETQA 4KU7A 2D40A 1IPJA 3DL3A 2BNMA 3DKWA 4E2QA 4RD7A 2XL7A 2F4PA 3LA7A 5E16A 3LZZA 4N9IA 2VPVA 5JAXA 2PAEA 4WBBA 2XHKA 5AVPA 3RDIA 4LTAA 1EY2A 2CGPA 3H7JA 3NL1A 4AVBA 2OZJA 3E5UA 5CVRA 1OFNA 5LEKA 4XFGA 4TLFA 3HT1A 4I0AA 4FAHA 3WW4A 2Z69A 3QOPA 3U11A 3WW1A 5I0RA 5LEJA 4MGYE 4YRDA 1EPZA 5HI0A 3I54A 3MDPA 3QACA 4LUMA 3H9AA 2D5HA 3BALA 4Z82A 4QMAA 1ZZCA 4F8AA 4I0BA 2K0GA 4IEWA 1UD1A 2O8QA 4E2SA 3BPZA 3U10A 5I0TA 1H1IA 4LULA 1CAWA 4HLTA 5FLHA 1FT9A 5E1RA 3H8UA 2N7GA 4XF0A 3CLPA 3D0SA 4KL1A 1ZX5A 2UYBA 1X8EA 1Q43A 3DN7A 4EWDA 5JSPA 4QX5A 3E5XA 3UKNA 4ZU7A 1X8MA 2HKXA 4QGLA 3NKTA 2UY9A 4QGMA 4XFBA 3RNSA 3CF6E 1UPIA 3SHRA 4FAGA 4IEZA 1VJ2A 2CAVA 2GZWA 5BY5A 4P9GA 3JZVA 3CJXA 3H1MA 3M3IA 2D5FA 3GBFA 3ES4A 2MPFA 4X6RB 4XF4A 2IXHA 1RTVA 3EBRA 1YFXA 4EROA 4R52A 4YSFA 3DV8A 1NE6A 2MNGA 2BNNA 1UIKA 4BIFA 3I59B 1DZTA 5C6CA 1NXMA 4IESA 2BNOA 4MZUA 3SCFA 3VHRA 1PMIA 2I45A 4JTNA 4MGKE 1JUHA 3L2HA 4YYOA 1EP0A 4UBHA 3RZZA 4D7TA 1CAVB 3EO6A 3IBMA 5FLJA 4PIZA 1DZRA 2VQAA 4O9EA 4QXKA 1YLLA 4IETA 1LB2A 2P17A 1ZVFA 3LA3A 2Q1ZB 3ZDSA 5I91A 1Y9QA 5KHIA 4CYDA 2WFPA 4IEYA 1XE7A 2B9UA 2HJIA 1O5UA 4GULA 1V70A 3IDCB 1O3SA 3CL1A 2Q30A 3NJZA 4X6QB 2DCTA 1SFNA 3SCGA 2EA7A 2V09A 2C0ZA 3U0ZA 1EYBA 2QCSB 2GC2A 1ZZBA 4XFCA 5I0SA 1GQGA 5JSOA 4KU8A 2PQQA 4IEQA 2XGXA 2WC2A 5KHHA 5K8SA 3EJKA 3KGZA 3IWZA 1WLTA 2H0VA 1CAXA 2QNKA 3LA2A 3EHKA 1I5ZA 5JSRA 2B5HA 1CX4A 4HVRA 1ZRCA 3NW4A 1J3RA 4EV0A 4KWKA 1QY4A 4XFIA 1RC6A 4UXAA 1CGPA 1O7FA 1XRUA 3I7DA 3FZ3A 5EZWA 4B29A 2BYVE 1J58A 2QJVA 3TNPB 1ZZ7A 1OI6A 4HN1A 1QXRA 4LLOA 3FFQA 4I3PA 2CV6A 3S7IA 2EVXA 4HSJA 3C3VA 2PA7A 4R8HA 2ET7A 1RL3A 3PLQA 3RPQA 5J7MA 4HSLA 2ETEA 2PFWA 1ZRDA 4H7LA 3CO2A 5BV6A 1TQ5A 1CAWB 2XKOA 3OD0A 4XETA 4ZU4A 2H6CA 1LRHA 4D7SA 4HVOA 4IEXA 2GC3A 4FBFA 1U12A 3O14A 3D82A 4J1WA 2PYTA 1ZRFA 5I8TA 2GC0A 2Y0OA 4HMZA 4IEOA 5J3UA 4IEPA 5BUVA 3UKTA 1VP6A 4L2NA 4ZU5A 4YARA 2EAAA 3MPBA 4LA3A 3OTFA 4Q0SA 4MGIE 4XF1A 3E6BA 4JV4A 3ELNA 2ZKLA 4O9GA 4BHPA 1OD5A 1YFUA 5FPZA 4PIXA 1SEFA 4AQ6A 4MV2A 3KCCA 3BU7A 5KHGA 2XLGA 2OPKA 1UIJA 3I59A 2XLAA 3FWEA 1YHFA 3NSTA 3M70A 5FQ0B 3H3UA 1RUOA 4MX3A 3EQEA 3OCPA 3HIFA 1J1LA 1CAUB 4JVAA 2PHLA 2IXIA 1NZCA 2ZCWA 1Q5OA 4Q0PA 5KHKA 1UCXA 3H3ZA 3BCWA 4PJYA 3E5QA 2IXJA 4HN0A 3LAGA 2D93A 1FXZA 2GU9A 4KWJA 4Q29A 1WA4A 4OLLA 1GQHA 4AQ2A 4LEJA 4XFAA 1DGWA 5T3NA 4A2UA 3ES1A 2VECA 5FCCA 1O3QA 4HVQA 3N4MA 3RYRA 1FI2A 2E9QA 3PNAA 4AVCA 2ET1A 2PTMA 3HQXA 3ACLA 5I93A 2K9ZA 3FX3A 4XF3A 4XFHA 5JCTA 2FMYA 3B02A 5CU1A 3E6DA 4I09A 2GC1A 1VR3A 3UKVA 2OZ6A 1UW8A 3H1WA 1ZZ6A 1QWRA 2CAUA 3ROUA 3FJSA 3OF1A 5FDBA 3MZHA 5BXXA 1YFWA 4ORFA 5J48A 4HBNA 1Q3EA 4XF9A 2BGCA 3E97A 3IIAA 1CAXB 4MGZE 1ZZ8A 4I01A 3R6SA 3FE5A 1NE4A 1XE8A 4AVAA 4MUVA 1O5LA 1DGRA 3RYKA 3E6CC 3KGLA 1QXJA 3ST7A 1J59A 1O3RA 2H6BA 4IEVA 4I02A 4XEZA 4N9HA 4KWLA 5I0UA 3H7YA 4HZFA 1ZZ9A 4XFFA 2PAKA 2UY8A 2B8MA 1OMIA 2FQPA 4Q0QA 2PHDA 2ATFA 4OFGA 5LRRA 3SXWA 1WGPA 4J1XA 5EFUA 3G7DA 2XL9A 1X82A 2O1QA
chains in the Genus database with same CATH superfamily
4Y5TA 4ZHNA 1RUNA 1VBB2 5D1IA 5CADA 1SQ4A 1W3XA 3IT8A 4NRQA 4IE4A 4A7ZA 3K3NA 4UW6A 4IV1B 3N36A 1HRI2 3HR9A 1JYTA 3T2TA 4XXPA 2W1WA 4E4DX 2FDKA 1KDMA 2QQVA 5FYUA 1VBA1 2XBO3 1BK1A 2I07B 5L73A 5EQUA 2DVDA 4BDVB 1FNZA 5IVVA 1PGSA 3RWKX 1O59A 2WQ4A 4JKLA 3O1TA 5FBZA 4CP2A 1AR61 4ES9A 2QFEA 1AYM2 1ND3B 3ALQA 1HQWA 3BB6A 4RQPB 4K8FA 1QJEA 1YJKA 1B35B 3AB0A 3AFKA 4LHKA 4LUKA 4Q4V3 4YGEA 1R1ZA 3WNPA 1I1EA 2E31A 5L36A 4W6YA 1ULDA 1AHSA 2VW0A 3IPVA 1TVGA 2Q4SA 4FPKA 2Y26A 1U0AA 3KT1A 4MLOA 2HWC2 1MEC2 4OQ8A 5FY7A 1EAH3 1NCQB 4PLMA 4Q1RA 5E8AA 5JI7A 1QJY2 2BFUS 5DDJ1 3CJIB 4EWEA 4ZS3A 2J1VA 1PNFA 3KZ4C 1CAVA 1L3JA 4Y22A 4DXRA 4XBQA 5LA2A 2J1AA 3MEPA 3LWCA 4EJRA 5M0TA 3UGHA 1RUD2 3M3OA 4WZCA 1H8TA 2EIBA 1MZ6A 5KWRA 4IEUA 1GP6A 2JG9A 1PVXA 3ENRA 1A34A 4META 4FPGA 4EN7B 2IXCA 5FR3A 3VDBA 4A6OA 2QQPA 2QE3A 2CGOA 1PZ7A 5A7SA 1W06A 1R091 2ZX4A 4MXWA 1JHJA 1RUG1 4EZ4A 1V6KA 2J42A 4WM8B 5DPNA 4A7YA 2V4VA 4DZGA 4RR3B 1E57A 1SG3A 1STMA 5CKMA 4AWDA 2XJRA 3VBUB 3ZX7A 4LO7A 4CDXB 2EXHA 4Q0UA 1W2AX 3KT4A 4YG0A 2ZAAA 4PT6A 3LCPA 1H8VA 1AXZA 1SACA 4PIYA 3KF3A 3CEWA 4UBGA 1AR72 1US2A 1CJDA 1TMF2 5CNAA 3B01A 3ZN4A 1ENXA 4QD2A 2JE8A 4QXHA 1VBA3 1X50A 3POJA 1ALYA 5K0UA 1UWWA 4Z2AA 1UX7A 3B5LB 2BOIA 2WNUB 2ZACA 3MFCA 4E27A 3TEWA 3ZYGA 2XB6C 3DL3A 4YLZA 2VCAA 2BNMA 1W6QA 3FLPA 2F4PA 4P9IA 1AR63 3AKSA 5JAXA 4P5HA 1CIYA 1D4M1 2PAEA 2NLRA 2ADDA 3BUCA 5FZKA 2XHKA 2WDBA 5AVPA 3MLJA 4NAOA 1EY2A 2JDHA 4PHZA 2YPDA 5F32A 5GLVA 3NNFA 5H9SA 4K6BA 2A1XA 2C6SA 5FJKA 3VBFA 4BQXA 5BNQA 4Z1VA 2OZJA 1S0IA 2HWD1 2R7EB 5F2SA 3APBA 4QWNA 4RQPC 4BQ2A 3NO8A 1B35C 1DU3D 2DCJA 3WW4A 3QOPA 2FCTA 1UOJA 3U11A 5CFCC 5I0RA 1W3VA 1GQPA 2JG8A 3NNMA 4XABA 4EZHA 1EPZA 2PLV3 1K12A 3I54A 4AVTA 4L9BA 1HB1A 4Y20A 1RUC2 5ABJC 1NCQC 2AGSA 4M4PA 5FMOL 5FZ7A 2HWF1 2JDZA 5E89A 1MS8A 1YQ5A 2G9FA 4YFZA 4JGYB 2F4LA 2Y0IA 3CJIC 3G6JB 1XPWA 5AC91 1FNYA 1SPPA 5IK7A 1DQ6A 2O8QA 2BPA2 4K21A 3BPZA 1VBE3 5FYBA 2X29A 2NN8A 3VBHC 2E53A 1JYWA 2YFUA 4Y1XA 3FL7A 3HEIA 5FYHA 1RUG3 4TTGA 5E1RA 2R071 1F4HA 4XF0A 3RRDA 1HRV1 1QQP1 4M3CA 4ARXA 4ET7A 3AL5A 2VUAA 5FV3A 4QB6A 5LB6A 4YVSC 5F6LB 1X8EA 1RUF3 1PGW1 2Q5TA 1AL21 1LHUA 1RUE2 2DU0A 1S1AA 1UY1A 2EALA 2XQRA 3WQ1A 4DS0A 2HKXA 4WM8C 2Y6HA 2WWJA 4QGLA 3LE0A 3OUIA 2UY9A 4QGMA 5AVAA 2WNVA 3I4IA 4BMBA 1BZWA 1WMXA 2VGDA 3CF6E 1JYCA 3SHRA 4CDXC 1GV9A 4LBQD 5EV7A 4TZDA 1BMV1 1UNBA 1WBFA 4XPVA 1N1YA 2DCYA 2D5FA 4TN7A 4KG8A 4C90A 4OHXA 5L19A 4Y4YA 2DWRA 1FPN1 3VB9A 2MEV3 4Y3OA 2P3JA 4CDUB 1CESA 2IXHA 1UY4A 3ILFA 1UMIA 2ARXA 5CAZA 1AYN2 2VZSA 2WFF1 5FAXA 2AACA 1S0DA 1GWMA 2B46X 2R041 4GWIA 4V1PA 3CZUA 1LULA 3VKOA 3NV3A 1OQEA 3U37A 1XNDA 5A3PA 2VU9A 4O61A 4BQ1A 1ZA4A 2E63A 1NXMA 4IESA 3ZYHA 2VMFA 3WHTA 3WF1A 4E4SA 2RR13 1NA1A 4Y24A 3VLBB 5LW9A 5CB7A 2HWD3 4WM7C 2QZ2A 4JHTA 4NRMA 4QPGC 1DZQA 1XJAA 1HV1A 3LD8A 1AVBA 1QKQA 4HFSA 5FZFA 4D7TA 4MGTA 2W91A 3KVBA 1UMHA 2RS11 3EO6A 4KG0A 4CU9A 4P9XA 3I2IA 2W94A 1PGL2 1Z0HA 1YLLA 5IAVA 1HV0A 2VMIA 4XYXA 1PO11 2CYFA 4NAMA 4F3JA 5J1XA 1N1TA 1Y9GA 2GP5A 4A4AA 1FX5A 2JENA 3POSA 1RJ7A 5HCAA 2VMDA 1XU1A 4FPYA 1COV3 1X9PA 1HDKA 2VMEA 4FVVA 1OD3A 4GD4A 4LO8A 4LE3A 4NIIA 3TBDA 5I91A 3QH6A 2XONA 1Y9QA 4XDPA 4QPIB 3UT0A 5KHIA 2KA3A 2XJPA 2R073 5T5LA 2ZAHA 2WS91 3IDAA 1C8M1 1R1A2 1XE7A 2VH9A 5FYTA 3RQ0A 4WVVA 2LTNA 1W0OA 4KGQA 1V70A 2A6XA 4XUQA 1O3SA 4ZY9A 4FSJA 1N3OA 3NKGA 3H8OA 3H0OA 3MGUA 1QDCA 1ZRIA 4W50A 2DCTA 1HLCA 1AJOA 5LBEA 5GJ6A 3PJYA 3VN4A 1I9RA 4AHYA 4R9DA 1VMJA 3SCGA 2V09A 4IV3A 4Q4Y2 3U0ZA 2NMOA 3I3DA 2WR9A 2GNMA 2UWAA 4UOJA 4D6RA 5FXWA 1JZ6A 5F3CA 2P34A 1N1VA 3PTRB 4NPLA 2FDIA 4IEQA 3VZOA 2AH2A 3USUA 2WC2A 4KNCA 1TME3 4L97A 5KHHA 4AI9A 1L7LA 3EJKA 2WFF3 2QQMA 2HEYF 2R043 1ENRA 3ZSEA 1CZSA 5FZBA 5JVVA 1OOPC 3W5MA 2B5HA 4QQOA 2C9KA 2JDMA 1CX4A 2HH9A 1M4WA 2W0XA 2HYKA 3DEMA 4IE7A 4JDNA 2ZS6B 4D6QA 4JZRA 4KWKA 3FFZA 1MQTB 1KDKA 2VMHA 2DUQA 4LQRA 2RM22 4CDQA 1CGPA 1Q8OA 1XRUA 3ZFEB 1YO8A 1C3HA 4CCLA 1Q8QA 3FZ3A 4A7KA 1JYIA 1JODA 4A3ZA 3DPRA 3M4FA 1OI6A 3VBOB 3RZJA 1QXRA 2RS52 1OLRA 4IGOA 1U5YA 4QQLA 4AFMA 4CUGA 2ZXQA 3FFQA 4NN0A 4I3PA 1ZBE1 3S7IA 1U5IA 4GJZA 5C33A 4AFDA 2ET7A 2C9AA 3PLQA 3RPQA 1PO13 3J9SA 4JX0A 2YBSA 1ND2A 5GZEA 2RDRA 2AEYA 1KGYA 4H7LA 5A3NA 2DTYA 3TN91 2JIGA 3R4SA 5K9YA 5F9TA 5FY0A 4PDWB 1HRI1 5A6YA 4UFJA 2W68A 2XVGA 3AK0A 3OD0A 5DZFA 5A3TA 1JTZX 1LGCA 2J22A 3IZOA 1OVSA 4CSWA 2FBEA 1JW6A 1BBT1 2C1FA 2JDUA 5C8CC 5JLVA 2WKKA 2WT2A 2QQKA 5DQ0A 5F5CA 1UY2A 1S2BA 5AFBA 1W2NA 1KEXA 2RS32 3D82A 3LDKA 5K4LA 2VNGA 2Z4FA 3KS7A 2JDKA 1AR81 3ILNA 5I8TA 3BODA 3DCQA 2PQSA 4XZUG 1YQ8A 2BTVC 2QQJA 4FPHA 4QPIC 4XURA 4URTA 3SEEA 3VDCA 2LW8A 3WNKA 2DFBA 2JDAA 2QQUA 2VW2A 2RJLA 4ZU5A 2WZEA 4FPOB 4XXAA 5JXHA 1OC1A 2O14A 4N43C 4QB1A 4F83A 4GH4A 2W92A 1IS4A 4PLOA 2HWC1 1VB2A 2JE7A 3DECA 1MEC1 4LKFA 4QX8A 2YDEA 5BNNB 5JR2A 5EPAA 2JB8A 4DQAA 3FUQA 5FO8B 4B1MA 4PCRA 2A5ZA 3EXUA 3ACHA 1OD5A 5DZEA 2ZKNA 2ZX3A 3WUCA 5DG2A 1VBC2 1H1AA 4GXLA 5FPZA 2PHWA 3J26N 3RI9A 2QBXA 1H2NA 5A7PA 2GALA 3VD7A 2WO1A 4MV2A 3ZFGA 4AQ6A 3BU7A 4YW6A 2XLGA 2WT1A 5KHGA 5JWPA 4HOOA 1RUD1 1GANA 2F17A 3W5NA 3ZFFB 5F5IA 2P5BA 3T09A 4R4XA 3H3UA 3PMEA 3EQEA 2GN3A 3ZDVA 3OCPA 4DB5A 5L7OC 1W0PA 2VZ1A 1BQPA 2BWCA 3ACFA 2PHRA 4OZOA 4BM8A 4CE8A 1JZ7A 4NR1A 2Y6FA 1V6NA 1NZCA 4XQWA 1QOSA 2VMGA 4HL0A 4CDWB 5F37A 4DXSA 3AL6A 3JB8A 4PJYA 4YZ2A 3S5QA 3VD5A 1S0EA 2ZHMA 4BQWA 3I2OA 1CD3G 1QJX3 3TN93 3LF7A 4FFFA 3ZXLA 1WA4A 1TG7A 4JGZB 2D3RA 4OLLA 2NZ9A 3I97A 2W08A 2DUPA 3FBMA 4QQPA 4LEJA 4WVMB 1CIWA 1JU4A 1D7PM 1DGWA 1TMF1 2HBTA 4ZZ5A 2WO2A 3AXEA 3QH7A 2KD7A 5FCCA 1W0NA 4LE4A 1BBT3 3JU9A 4ES8A 2BFUL 4YVWB 5DUXA 4OHVA 5IVFA 4AVCA 2VZOA 2PTMA 4C91A 1SHWB 1V6IA 3J8F2 4Y5SA 1AR83 4S2HA 2K9ZA 4DXZA 3FX3A 3URFA 2E7QA 2H0BA 4K3UA 3SKVA 4I09A 5J09A 3B93A 5GLTA 3KT7A 5HV4A 2OZ6A 5JI9A 2VZUA 4O65A 1W8OA 1ZZ6A 3ABZA 4ZXKA 4P08A 1Q8VA 2HWB1 4NPRA 4E8DA 1WCQA 1RUF2 3ZYRA 3MZHA 4ORFA 4XJZA 5J48A 1RMU2 4UFHA 2ZEWA 1YCIA 1JXNA 5HXVA 1W8HA 4BB3A 3E97A 3IIAA 1W90A 4HKOA 4OULA 5EJ1B 1POV1 4QPYA 5IUQA 3CHXA 5HBAA 4GWNA 2QUOA 4I01A 2ES3A 3R6SA 2VZQA 2QDNA 1RUH1 3OYWB 4GB32 4ZS2A 3UK9A 4IL7A 4ISRA 4AVAA 1OVPA 3IMNA 3AM2A 1CWPA 4QKDA 1AX1A 3WP5A 1G86A 5IK4A 1ENSA 3OY8B 4LO5B 5BNNC 5FOJB 2VZ3A 3AZZA 1VLNA 1NUKA 3PUAA 1R082 3ZSMA 2WO7A 1DQ4A 4IEVA 4XHBA 4FPCA 4YW4A 5FPUA 1S4CA 1W8ZA 1TNRA 4KWLA 4K7JA 5I0UA 1C1FA 1TE1B 3H7YA 3DYOA 1ZZ9A 1PZ8A 3MUZ1 1NLSA 2UY8A 1URXA 2XXZA 4GALA 5FMBA 3T3YA 4AEDB 2ZGMA 1OMIA 5KXBA 4Z92B 1JMUB 1OLMA 3C2UA 3PJQA 2WT0A 1V0AA 4DNYA 2A6VA 3VDDA 5JPNB 2RR12 4MYEA 3D6EA 3L2YA 5C3QA 1MPXA 4OFGA 3SXWA 1FOD1 4UW4A 1RUE1 3MIHA 3G7DA 4L11A 3WDVA 1X82A 2O1QA 4XDOA 4QX1A 1GBGA 1VAVA 3AFGA 4C1XA 3MF9A 3MO4A 5FLIA 5CZKA 4FCAA 1WMEA 2VMCA 4XVHA 5BPXA 3ZXJA 1IPKA 1GYKA 3OPTA 5IAXA 2K46A 3R0RA 1G9FA 2FCVA 1J3QA 3TEXA 4BIOA 4BLJA 1LKNA 1HXS3 4YWAA 1OF4A 4JGZC 2CHHA 2GAUA 4OZXA 1PM7A 2YXSA 4IGQA 4MADA 4KWUA 2GH2A 4E2GA 3VHPA 1K5MC 3POBA 5D8AA 3V0AA 1COV2 2R30A 5FPXA 3TEZA 5FK8A 1RINA 2X5IA 3FLTA 3K2OA 4W65A 4AK3A 1AYN1 5ERLA 1LNSA 1ZBA2 2BGOA 2BVVA 2XQXA 4TWTA 4AG4A 3O0VA 3FLRA 1T6GC 5J37A 2A73B 2YHJA 4QX3A 2V73A 2HWB3 2XR4A 2VR4A 3PUSA 4MH0E 4LNVA 1J3PA 5JR7B 2VTXJ 1RGSA 5JZGB 5KBFA 2HWE1 3UETA 1SBDA 2Y6LA 3MYXA 3VUOA 3ZSLA 1YUDA 2OKXA 5ACA1 4C0HA 1POV3 5A7WA 1XNAA 1REFA 1UY0A 1L7QA 4AXOA 3MIDA 5CKQA 3MLLA 3PVBB 2WUHA 3S7EA 4LR4A 2EXIA 3KMHA 3U07A 1LOCA 1PGL1 4D6SA 3FHIB 1HJGA 1US3A 4RHV3 3VD9A 1PMHX 1H30A 1AR91 1VB4A 5H9PA 1UN1A 3I2KA 3W20A 3FHAA 4CCDA 2DBNA 4N53B 3WW3A 1ULGA 2CU5A 2IFWA 3N35A 1APNA 1MVEA 1W9WA 1CAUA 1WW5A 2XUMA 2BEOA 1MS9A 1O4TA 1HKDA 3HT2A 3KSCA 5GALA 5KXEA 1BK0A 4CEWB 2VVEA 2Q0AA 4IERA 1ZRRA 1LEDA 1F15A 1V6JA 1PVC1 3I3BA 3N7JA 3USSA 4PI2A 2DV9A 2BW8A 1FOD3 2VUJA 1SBFA 5LK7B 4P02B 3BYWA 1DLLA 2KM2A 2P3KA 4OI2A 3WP4A 4FTEA 3LSDA 1XQNA 3S30A 2ZGNA 3AJZA 5DABA 5CKNA 2D6MA 3VV1A 4XAEA 4TYSA 1KQRA 3WF2A 4ZZ8A 1OA4A 1WCDJ 3TWIA 1SCRA 1QEXA 1VIWB 3OG2A 4CEYC 4RGGA 4Q4W1 3O1VA 1BHGA 5JPMB 3RZKA 2WZR3 4NHKA 3ZN6B 2ZX1A 4XIOA 1OPMA 3OB8A 2G9ZA 3DKWA 4Y5Z0 3OUHA 4RD7A 3NQHA 4WV8A 5FY8A 2XL7A 4CP9A 5FUPA 2IVJA 2VPVA 3WDUA 4DMIA 3CMGA 4XTMA 4QPWA 5FYZA 4EN9B 1UZVA 4URAA 1OUXA 3PDQA 4LORA 4LTAA 5A3OA 2CGPA 3H7JA 2BGPA 3JBG1 4BXFA 2HWE3 4B4QA 1DG6A 1A78A 5LWBA 3NL1A 2IWGB 3O5SA 1AF9A 3PVNA 5ACA3 3BTXA 4BQ3A 1CQ9A 2C24A 4RA0A 4TLFA 1OA3A 4I0AA 4Q4X2 4FAHA 2VG9A 2RS51 2W1UA 2Z69A 4L99A 1FV3A 3WW1A 1WLDA 5DAVA 4LT5A 5FPBA 4YRDA 3T08A 1EV13 4DUVA 1GZ9A 2YU1A 2XOMA 3MDPA 3OD4A 3QACA 1AR93 3OSDA 2DUOA 4CU8A 2D6OX 5FZGA 3BALA 1W8UA 4Z82A 5F2WA 2BERA 1H9PA 1B09A 4R9AA 1H6XA 4QMAA 4Z8BA 1W9TA 2DVBA 1ASJ3 1ZZCA 3THDA 1V9U2 1V00A 1RVF2 1Z7S3 2VL4A 1UU5A 3INAA 5EJ3A 2VOKA 1CAWA 1OFSA 5FLHA 3WF4A 4HT1T 4ATEA 2XVLA 1QIQA 2YZ4A 5FWJA 1L7RA 2JICA 2N7GA 2RS31 1JS9A 3ILRA 3W21A 3N3HA 4XCBA 4KL1A 3IAQA 1YEWA 1OKOA 3LEMA 3DN7A 5IT6A 1W6PA 4XJUA 1LOBA 1MZ5A 2VBDA 2LRPA 4FQZA 4CCKA 3E5XA 5JOYA 2RG4A 3ZMOA 4HXCA 1X8MA 4AAXA 1XE0A 3RNSA 1QHDA 2Q8EA 1LTEA 2LS6A 3GXUA 1CPNA 1M06G 4YZ5A 2X09A 4H2AA 4FAGA 1VJ2A 1F2NA 3QBQA 5DUVA 1VRH3 4P9GA 2GNBA 3H1MA 3JZVA 4NHXA 3WDTA 3M3IA 2JB4A 3VKLA 1GFF2 2MPFA 4XF4A 4RS5B 2CDPA 1VBC1 1WD3A 4HPKA 4V2VA 3GHNA 1GNZA 4NHYA 4GA9A 4W6XA 4UF0A 3DV8A 3BI3A 1NE6A 4LHNA 4GMP1 4RQPA 2JX9A 3NJXA 3I59B 1B35A 1DZTA 5CFCA 1E5IA 3K77A 1W9SA 4AGGA 4DEQA 1PO22 3O0XA 2BNOA 3LKJA 4MZUA 3VHOA 1KXGA 3U75A 4NHMA 1LHVA 4CXWA 1RHI2 1JUHA 3L2HA 4YYOA 2R1DA 1EP0A 2CY6A 4UBHA 1NCQA 2VXJA 3RZZA 3AX4A 4Y22B 3ZKYA 1CAVB 4OUSA 1EUTA 5DN2A 2F6BA 3WINE 4AL9A 5BNPB 3BGAA 4QHOA 1SMVA 3CJIA 1DZRA 2GMMA 1H8TB 2VQAA 2QQWA 5FP9A 1WCKA 1UZZA 3PIGA 3SKJE 4YW5A 2RMU2 4HK8A 3VBHA 1QXPA 1PZ9A 3A7QA 3WF0A 5C4WC 1JYNA 1BEV2 2ENRA 4M3CF 5A3WA 3WY6A 1LB2A 1RITA 3KF5A 3Q8AA 2ERFA 1ZVFA 2D98A 2P17A 4MXWB 4SLIA 5FY9A 4YVSA 4AQSA 4CXXA 3WVJA 1UYXA 3A23A 4FPJA 4MGSA 2VQTA 3OEBA 3BTYA 1W2TA 1T2XA 4CYDA 4XJWA 4IEYA 1IOAA 1WKYA 4UW5A 3VBRC 2P2KA 4D3WA 4WM8A 5H9QA 1NY71 2HJIA 2J1TA 5ABJA 1RIRA 3IDCB 5FXZA 2ZGLA 5LK5A 4CDXA 4CCJA 5JMOA 2BWAA 1ULFA 1N47A 4DY5A 1DYPA 1XU2A 2A6WA 4IV1C 4X6QB 1JUIA 1K5JA 2IFRA 4WZFA 5FY1A 3ZPYA 3SITA 4UFLA 1I5PA 4OHYA 1U5XA 2XVKA 1X33A 3SH4A 4WVWA 2DVAA 5FZOA 3WNOA 2EF6A 4RGKA 3WOGA 1OURA 4U36A 4YM3A 1EYBA 5IVEA 1RUJ2 5HCFA 1JH5A 4R9CA 1W6QB 1GZWB 3VHNA 4CCNA 4KU8A 1ST8A 3ZXAC 3MIEA 4LOTA 5A32A 1ODNA 5FYSA 2NQYA 3GZEA 2XGXA 5FZHA 1RJ8A 3RWNA 2FZ1A 1ND3C 1X36A 1ZM1A 2A3XA 2BP6A 3EYPA 3IWZA 3HNYM 3LB9A 1IG3A 5I0DA 1CZVA 1DIWA 1ENQA 4AHWA 3VBFB 4WM7A 4QT6A 4QPGA 3AP5A 4XE9A 1R081 5F5AA 4JQRA 4RS5C 4IE6A 5DDJ3 5EXOA 3NW4A 1ZRCA 1QJFA 3POEA 4N90A 1ODMA 4EV0A 1XOYA 1QY4A 3OGGA 1YIFA 4HANA 3JB4C 3NV2A 1NXD1 1E5SA 3LPFA 5CFDB 4KQ7A 1BCXA 2JG8B 5IWFA 4B29A 1LODA 2BYVE 2J7MA 5F6KA 4HN1A 2QQNA 5L9RA 4Y20B 2ZABA 5FZCA 2CV6A 4LITA 4HSJA 2PA7A 3FMGA 1H2KA 4OI1A 1R093 5T54A 3THTA 1LOAA 3O0WA 4HSLA 1SPPB 4CU7A 1LGBA 1FMD2 3AZWA 2XUEA 2VQUA 3PMSA 3GJAA 4M0HA 3CO2A 4PQQA 5BNPC 1ZRDA 1GZTA 1XNCA 3KV9A 1H8TC 2HEWF 5DUUA 4OHZA 3WXPA 1G9CA 1IS3A 1H4HA 2XKOA 3ECQA 4LLFA 4M3CB 4XETA 4ZU4A 2GNDA 5HXMA 2VUCA 3THCA 1LRHA 4RR3C 4I30A 2GC3A 1LENA 3VBUC 4FOWA 4BE3A 2A3YA 5K7PA 1SFYA 1K3IA 2OW4A 4J1WA 1LHOA 2RJKA 3WLUA 2A75A 4BA6A 5BNOB 1ZBA1 1DP0A 2ZGKA 3BOPA 1ZRFA 2WABA 2GC0A 5FZ1A 1VBD2 2WNVB 3LIGA 4IEOA 4OYUA 3AP4A 4ZKTB 1IZ3A 2W87A 1J1TA 4IEPA 5BUVA 1D4M3 1VP6A 2FDFA 2W47A 2K2SA 4YARA 1W03A 2EAAA 2Y6KA 5IJRA 3MPBA 2WNUC 3VKNA 2IVIB 2A70A 4XJAA 1WBLA 1S0CA 3BOWA 2DU1A 1NCRB 4GJYA 5FZ0A 1OOPA 4XF1A 5T50A 2KR2A 1O6UA 5DAXA 1SCSA 2ZA9A 2QQIA 3B9IA 4O9GA 1QOTA 2ZGUA 3V64A 3ORJA 4B8EA 1BVVA 4PIXA 1IHMA 2VVFA 2WZR2 3T0BA 2OPKA 1NA1B 2C4XA 2WL1A 1GLHA 2WZ8A 2E6VA 3ZFGC 3WG1A 3ZOIA 3AYEA 4KBZA 4CCEA 5FQ0B 1JZ4A 1W6NB 1RUOA 4NHLA 2HWF3 1GWKA 1J1LA 1QDOA 1YXWA 5F3GA 2O8OA 5B2GB 5LZ6A 2W95A 4W4ZA 2YROA 2EIEA 3GM8A 3MIGA 2PHLA 5AC93 1K45A 2RV9A 4R4ZA 1SLTA 2WA4A 3WZ1A 4CP0A 4UAPA 4LHLA 5FPLA 4LBLA 4AVSA 4IXLA 4XUPA 1CX1A 5CFDC 5KHKA 1UCXA 4B3NA 1WW6A 4A41A 2JG8C 1RUI1 2PXJA 2R062 2D93A 4JGYC 2SBAA 2CGNA 2XJSA 1FXZA 4C8DA 1HRV3 1QQP3 4BU2A 1RYYA 3N9PA 5C8CA 1GQHA 2WLPA 2DTWA 4G4FA 4H7MA 3AYAA 1BJQA 1D2SA 3J7LA 1EUUA 1AL23 2WLQA 2DCZA 1PIV1 3KQRA 2Z42A 3MW4A 4JQTA 5T3NA 4XOGA 4DOUA 2VECA 1O3QA 2J1RA 2P1BA 3VD3A 2VVDA 4HVQA 3RYRA 2YFZA 1BVP1 4QPIA 4AVVA 2G1MA 1IG0A 2V72A 2PHTA 2Y38A 3T2QA 2CSGA 1DFQA 3HQXA 4LBKA 2VD7A 4XCAA 3JD71 2XG3A 3ACLA 5I93A 3K4AA 4XF3A 2CNAA 2FCUA 2FMYA 4N43A 4ZONA 2GC1A 2Y33A 1PX4A 3UKVA 1XC6A 1FPN3 1F4AA 4B4PA 1NKGA 1LAJA 1QWRA 3FN9A 1EPWA 2CAUA 1MACA 3IMMA 1DHKB 4M3CE 5FMDA 3ZR6A 3FJSA 5BNOC 3WD5A 1LHWA 4HK9A 4BLIA 2XBO2 3AVRA 2D6PA 1QJU1 3USUB 5HPOA 4UI9L 1KFUL 2V5DA 2ZEYA 1VALA 4LBQA 4XF9A 4CDUC 5IK8A 4FTBA 4EN0A 5FKCA 4LPLA 5FZIA 3H8XA 4DEVA 1NE4A 1XE8A 3FC0A 3A22A 1POV0 2C26A 2VO5A 1NCRC 1VRH2 3RYKA 1N3PA 1WW4A 2RS13 5EYXA 2EXJA 5L7OA 4Q4V2 1UKGA 4ASKA 4YZ3A 4COYA 3WR0A 2RDNA 4CDQB 1J59A 2B4KA 3Q8BA 2E26A 4OUEA 4XEZA 2WIIB 4PI0A 3RMYA 1QNWA 3CBNA 3HPNA 2ADEA 1RVF1 1EAH2 4PF1A 3M7AA 2ORZA 1VBB1 5KXCA 4NMIA 2D97A 2BV4A 4P00B 2ID4A 1MZFA 3C7GA 1S2EA 1HQLA 2ZTNA 4QDRA 4COVA 2DVFA 1WLWA 1RUI3 3N7LA 4JRLA 5ISLA 2AZ5A 2WS93 1C8M3 4J1XA 2XL9A 3GALA 1SLBA 2XLFA 3LPGA 3T4HB 4EN6B 1A3KA 1XYOA 4COWA 2G9GA 3UL2A 1PIV3 2L9LA 3GHMA 2VAUA 4LK7A 1OH3A 3NVCA 3RYPA 4AI8A 4BISA 2DBIA 3PVEA 1AYM1 2IC1A 1NQDA 4QM8A 4INDA 1ZREA 4WVZA 1YNAA 2RDSA 3CZJA 4NOTA 5CYYA 3AZYA 1DQ5A 1JBCA 2OUHA 3LOIA 2IXLA 4JDMA 4YNIA 3FHQA 4YZ4A 2Z79A 1WA6X 4ONUA 1IS5A 1O3TA 1I6XA 5IHRA 1HW5A 5GM0A 4A3XA 5FZ8A 2MHFA 3K75B 4A6SA 4JAAA 4QQ2A 1QJY1 4GH4B 1VMFA 4BYYA 1HB4A 4RL7A 2XKPA 2YV8A 4Z07A 5FXXA 1VBA2 3GZTB 5C7GA 1PO21 1WCSA 4CA9A 4IQPA 3RMXA 1KS5A 4LKEA 4JTOA 1D2QA 1LHNA 2VZPA 4XUOA 2WAOA 2P6HA 3MFAA 3RFRA 4H14A 4AGRA 2G19A 4LKSA 1RHI1 4XZPA 4YW3A 3UJOA 5BNNA 3ZYFA 1AR62 2YPJA 3IN9A 5F7UA 1W8FA 3LEGA 2ZMNA 3WUDA 1YFYA 2YC0A 1CONA 1OSGA 4ISQA 2JECA 2ZX0A 4JKMA 3NJYA 3ZMNA 2WN2A 1MQTC 1OQ1A 2VTFA 1LOFC 1ZBE3 5E6HA 4UFMA 3KHCA 2R49A 3POIA 3ZFEC 1BEV1 3AKPA 3HQRA 2IXKA 1VBB3 3VBOC 1DGRN 1DYOA 2QKDA 4FT8A 1GNHA 4XDQA 3MBWA 3V65A 1R64A 2PLV2 5FZ9A 1HRI3 1AR71 3K3OA 5A7OA 4Q0VA 2P4EA 4LMFA 4X8NA 2I74A 2R32A 1C28A 2KXLA 4XUNA 1QMJA 2TNFA 3WNXA 3PVOA 5T5PA 1W39A 4NVPA 3R4DB 4SBVA 5I8SA 3RSJA 3WDXA 5I8YA 4M00A 4PDWC 3SCHA 4JGZA 3D0JA 3WQBA 2ZHKA 2BJSA 4WVMA 3KV6A 1VBE2 4QHBA 5ANNA 2RE9A 1K5MA 3WW2A 4QGNA 4BH9A 2PAMA 1AYM3 1W05A 4NWVA 5FXVA 3ZKUA 3BTZA 3PTYA 1UMZA 4P9LA 2LROA 4KGGA 1RUG2 1YWKA 2WNOA 4DY3A 3ETQA 4NIGA 1ZYBA 5DUWA 1MS1A 2WQ8A 5FZ4A 2D40A 2YB7A 3ZYPA 3BKZA 2XHNA 1UZWA 3P5BA 5A70A 4QX0A 1KITA 5L9VA 5A80A 5IVYA 1AXYA 4QX7A 4E2QA 5IVBA 1OLQA 5LCWL 2HWC3 3FUOA 4DUWA 1VAMA 5E16A 1MEC3 1UXZA 2WA3A 4XQ4A 4Y33A 4N9IA 1UU6A 2GN7A 3VBSB 4ARYA 2R0HA 1MS0A 2B45X 3VKMA 1QJY3 4BK5A 2X05A 1MZEA 3RDIA 3PU8A 3T1LA 1UAIA 1KS4A 1UX6A 4HG6B 1C1LA 3HNMA 1RUD3 1QGLA 1RUC1 1GICA 4PBOA 3E5UA 1OFNA 4FFGA 4XFGA 2MEV2 3HT1A 3O1OA 1D4M2 1SBEA 5FUIA 2ZJCA 3VZKA 2QQOA 3OYWA 2FMDA 4LBOA 5GZGA 5LEJA 2W1SA 2WN3A 4MGYE 1TEIA 5HI0A 1BXHA 3OY8A 4LUMA 2D7FA 3ZFFC 3H9AA 1S55A 3V0BB 3D5OA 1PK6B 3KB5A 3I3EA 1F9KA 1XNKA 3SNMA 2HWD2 4XW3A 3QD6A 4B1LA 3C7FA 4K40A 4F8AA 4I0BA 2K0GA 4IEWA 3PUIA 3LQCA 4MG2A 1SFPA 4E2SA 2CTVA 1Q8SA 3VDDB 3PHMA 4CPBD 3I49A 3U10A 5FZAA 5JUVA 1H1IA 3VD4A 1AR73 3N9MA 4CDWC 2TBVA 2JXAA 1TMF3 1S0JA 1REEA 1JOBA 3EMRA 1W2UA 4J6GA 5KC6A 2HWF2 3OGSA 2DYCA 3M8LA 1NAEA 3CLPA 4OHWA 5CIRA 1C4RA 3D0SA 1ZX5A 2DURA 3U4SA 1V6OA 1Q43A 1VBD1 3A4UA 1GUIA 3MV11 4Y1YA 4CEYA 2JEMA 3AMNA 3KLSA 4J25A 4QX5A 1W6OA 4Q8KA 3UKNA 3ZXGA 3WNMA 4ZU7A 3MW3A 3KWVA 2VULA 4Y1VA 5D8AB 3LDRA 5DAPA 4YVWC 3V0AB 4QKFA 1DDLA 2R072 1N3QA 2CAVA 2GZWA 2OT7A 5BY5A 1V6LA 2X5IB 3CJXA 4FI9A 4KI5M 1ACCA 1PGW2 1UZYA 3NAPB 2VJXA 1AL22 2WYFA 3ES4A 3LFMA 4X6RB 4QKNA 1OKQA 3IM0A 1XSQA 3RG0A 3EBRA 3CQOA 1QNYA 5JXIA 2YGMA 1PHMA 1RUH3 2YU2A 3VL8A 2MNGA 2Y8KA 2BNNA 3HWJA 1UIKA 5FZLA 3ASIA 1BMV2 4YW2A 3UYJA 2E51A 1WWYA 1RUC3 2OXBA 4GMP0 3VBSC 1DGLA 5C3RA 1K42A 4MHUA 5JXGA 3VHRA 2G4IA 2FDHA 4JTNA 1KFXL 1TME2 5FYMA 2WFF2 4N8MA 2D6LX 2ZEXA 1UOGA 1D0HA 2R042 3MICA 5G05L 3HVDA 5CBLA 4PIZA 3KD4A 2P3IA 4B7EA 4O9EA 3HN1A 1W6MA 4QXKA 4Q1PA 3O1RA 4L8QA 4IETA 1R1A1 4DUXA 1OPOA 3MI8A 2AENA 1UY3A 5F3EA 3BTAA 1F8VA 1BKZA 2WSUA 1RUE3 3GNEA 4IUGA 1JOPA 3OBAA 4AEDC 2VTXA 2W3JA 4JRAA 4XUTA 1PK6C 1FV2A 2D44A 2GMEA 4NIHA 2W39A 3AYCA 3RGBA 1H9WA 4BQYA 4Q4Y1 4CP1A 1W2OA 2ILMA 2P6CA 3K51A 2OUJA 2WFPA 3OBRA 2Q8DA 1PO12 3L9JT 4FP3A 2B9UA 4QKBA 2P37A 5A33A 3KVAA 3WDYA 3VZJA 1U5ZA 3WP3A 3CL1A 2Q30A 3NJZA 4JKKA 2Q8OA 2ZGTA 4COUA 5FJHA 3BU0A 2ZBJA 1JZ2A 2R16A 4Q26A 4YM2A 1IKPA 1AYN3 1WZXA 2V4AA 2C0ZA 2XBO1 2E7AA 1G8WA 5FY4A 1Z78A 2GC2A 3AVSA 4XFCA 3POFA 3B3QE 5I0SA 5B4XA 4CP9B 2JE9A 5LATA 5IW0A 2PQQA 2RM21 2JKBA 1FAYA 1CR7A 4HONA 1Q8PA 1YRZA 3WQ7A 1WLTA 2H0VA 1CAXA 2D43A 2YMZA 3K4ZA 4A45A 4GZ9A 4LBNA 3EHKA 4Q4V1 4E9KA 3NAPC 3O1MA 2V5YA 2DF7A 4DFSA 5JZGC 4HVRA 4NWWA 3ZLIA 1ULOA 3F95A 3THPA 1GOHA 2C5DA 5LA1A 4XFIA 1RC6A 4UXAA 5A1FA 2AR6A 3QLQA 1EAH1 1KRIA 4XMIA 4E4ZA 2BDRA 4K9SA 4UFKA 5EZWA 4IDZA 3PIJA 3TNPB 1ONAA 2VBBA 3DKQA 1YI7A 3WSOA 2TEPA 5FP3A 1NX9A 1H6YA 3MHZA 5C4WA 1JZ5A 5KXDA 1UF2C 3K48A 5JOZA 3V56A 4D0QA 4Y1ZA 4R8HA 1OBNA 1AUYA 3BVCA 2VC9A 1PVC3 1R1A3 4N53C 5J7MA 5JOXA 4FXGB 3DYPA 3DGTA 5L9BA 2VZTA 2PFWA 3B9CA 2XWBB 5C9AB 1UO9A 5JMCA 3O1SA 5FPVA 4AI0A 4DRRA 1S0GA 1QH6A 1TQ5A 3VBRA 5DMYA 1CAWB 1BLZA 4AW7A 3ATGA 3POYA 2NP0A 4CEWC 1NLRA 3DYMA 1C8NA 2VBPA 2FZ2A 2H6CA 4Q4Y3 2ARAA 2ZGQA 4YW7A 4IV1A 3IAPA 1W6PB 1XXNA 4HVOA 2D6NA 3AKRA 1WW7A 2BBAA 4Q4W3 1QJX2 3O14A 5EHDA 3TN92 4FBFA 3AP6A 4GWJA 3R4UA 1DLCA 1O4YA 2B9VA 5SV5A 3VZNA 3X29B 1G9AA 4MOAA 4HMZA 5FBJA 4RGAA 4QXBA 3OGRA 4B7KA 4EYUA 3I2DA 5T5OA 5FFOC 1I3HA 1S2KA 3EB7A 3UKTA 1BBT2 4L2NA 4KH9A 4CZSA 2YBKA 1ND3A 2NM1A 5JIAA 1DCSA 3WX5A 4LK6A 4LA3A 2QZ3A 3T0AA 2B39A 3IPVB 4Q0SA 2Y6JA 4JCKA 4HPKB 1AR82 3H3LA 3JBG3 3E6BA 4JV4A 2RM23 4MGIE 4QB2A 4RS5A 4UF0B 4AR2A 4AHZA 5LY1A 3U78A 4XTPA 3VGIA 3A0KA 4LBJA 3W58A 1W8TA 4FPLA 3LGRA 5CFCB 2RS53 1SEFA 5FYYA 5CG9A 2P3YA 2D3PA 3KCCA 3GZAA 4UW3A 4Z2WA 3KV4A 1UIJA 3I59A 4XACA 1LGNA 2RJ2A 1LCLA 1UOFA 2VNVA 2W46A 2ZZJA 1YHFA 4GQ7A 1UKRA 3LFIA 3NSTA 5A6XA 1GKBA 2JG9B 5ABJB 4MX3A 3P6BA 3RJ2X 3M3CA 5IVCA 2A7AA 4AYUA 4Q5OA 1HX6A 2ARBA 1OHFA 2WO3A 2TUNA 3NV4A 2PLV1 3ZPOA 5BNPA 2IXIA 1LOGA 2LM3A 2WSVA 4M01A 1WCUA 2WNEA 3VBHB 2RDQA 4Q0PA 3TEYA 4NJ4A 2IXJA 1W28A 3MIBA 2OS2A 1FATA 3ZO0B 1PM4A 3ETPA 2RS33 2GU9A 4JDOA 4COZA 1UU4A 4Q29A 2WZPP 4DRVA 4BZ4A 3AKTA 1VBE1 3J8F1 4YVSB 1LOEA 4E8CA 3N7KA 1RXFA 4RR3A 4CUCA 3VBUA 4A2UA 3ES1A 4LXLA 5C9AC 2ZGOA 3DXTA 2BUKA 2DCKA 3JQWA 3LIHA 1FI2A 5ANQA 5APAA 2PHXA 4CRQA 5K0UB 1GNYA 4HKLA 2VXRA 3J4UH 5FTTC 1RUF1 1SLCA 3AMHA 2E32A 1JU3A 4HETA 1RMU1 1SDDB 2XJVA 3WDWA 4UYBA 1AZDA 4OI4A 1DYKA 2WNUA 3B02A 1YQ2A 1GOFA 2ORXA 5FZOB 2HEVF 5LA0A 4KMQA 1ZA7A 5GKAC 3I8TA 1VBC3 2ZPXA 5T52A 2LUWA 3H1WA 4GB31 3ROUA 5C70A 1HXS2 3NRUA 4CCOA 4HKWA 3OF1A 2XH6A 4QDQA 5A32B 5BXXA 4YM1A 4GMP3 1XNTA 3LDBA 4W8JA 5FP7A 4HBNA 1DGWX 1GZWA 5FK7A 2MEV1 2BGCA 4V2WA 4AI1A 1WMFA 4MVTA 5CEHA 2VNRA 1WMDA 1ZZ8A 1PX3A 4MGZE 4CXYA 2LALA 4TSVA 3WT3A 3MLKA 3MV01 2DDUA 4WM7B 4QPGB 4L92A 5A3UA 2VCCA 1UYZA 3GDBA 3WG4A 2ZZQA 4OUMA 2OQ6A 2HWB2 1H0BA 3E6CC 3P3NA 1LEMA 3KGLA 1QXJA 3ST7A 3N9OA 5CA6A 3D3AA 4G3YC 4FXKB 2RR11 3I2GA 2FHRA 2FDJA 1UOBA 2H6BA 2CDOA 2VOWA 4I02A 3Q9OA 4N9HA 4P9WA 2XDVA 3ZR5A 5A7NA 5CFDA 5TSWA 4GIQA 5H9RA 4DIQA 1RUH2 4HZFA 3B00A 3Q8FA 1UL9A 2PAKA 5C3PA 5LBFA 4NIAA 4JGYA 2B8MA 1S0BA 4U2AA 4ZXEA 2JG9C 4RHV2 1AXKA 4I0WB 3MW2A 1J84A 1MS4A 4XQDA 5J36A 2ATFA 1S0FA 3N7MA 1V6MA 4FQ4A 4XILA 3CIHA 5B4NA 5IATA 1LJ7A 3I3MA 2YUEA 1WGPA 2XMLA 5EFUA 2VOTA 3TAYA 4RSUA 1COV1 4BQ4A 1XYNA 3GYDA 3J8F3 3IKWA 1CJPA 4XJ9A 1CPMA 4OMCA 1HQNA 4YGBA 3T1MA 3ZSKA 3H50A 4FOYA 4XMAA 2OPWA 5EJZB 4XBNA 4LHSA 5GZCA 4BMEA 3WG3A 3E1F1 5C8WA 1IGOA 1Y3TA 3O7OA 5F3IA 1GZCA 1NOVA 3B69A 4LA2A 3SMHA 3OUJA 4D69A 1FOD2 1XSRA 4C0BA 1GP5A 3M2MA 4BK4A 2Y6GA 4CVUA 4QM9A 1NYWA 2QVSB 1RMU3 2E33A 4LIUA 4AGVA 1G6NA 5KHJA 1W9YA 3H1YA 5BNOA 5A1AA 3HBZA 5BYNA 4DPNA 1C5HA 5K0UC 3Q8CA 4I2OA 2A71A 1JHNA 4GB33 5D2AA 1W8WA 4CDUA 2OVUA 4LO6B 5JXJA 2XJQA 3PUHA 1A8MA 1OOPB 3PUQA 1DQ2A 4ZPIA 1HN1A 1H1MA 1R083 1NT0A 5FOBB 2AC1A 3ACGA 5J96B 1NCRA 4DINB 1OQDA 3A0NA 1TME1 5F39A 2ZEZA 3POWA 3OGJA 1REDA 2PELA 2WRAA 3SEPA 5HCBA 3T2PA 3BN6A 4MHRA 5AFEA 3UNPA 2EIGA 4GKYA 1IQDC 4ASLA 2WINB 3VBFC 3CNAA 3JXSA 3BIWE 2Z2SB 3AZXA 3ZN5A 5KC5A 3N9LA 4XHXA 2JKXA 4CCMA 4F7ZA 1X7NA 1ZNPA 2B42B 2VZVA 4NPMA 3ME2A 4FPEA 1GR3A 5LRSA 2W1QA 1X9TA 2HWE2 2WWUA 3DXUA 1IKQA 3GJBA 4M4RA 5DZGA 1LESA 3ZSJA 4BQ5A 5FO9B 5ACA2 3OEAA 3MUY1 5FQ0A 5GZDA 1W6NA 2J1UA 3AMMA 4BCUA 5F1RA 4YG6A 4ATFA 5FMCA 1TZOA 3VZLA 1EV12 2YC4A 2JJ6A 2UYAA 4EWAA 4C1WA 2PN5A 3S0MA 1AR92 1XNBA 2OA2A 3I2FA 1VPHA 5HV0A 1JN2P 2WYSA 2OYZA 5C8CB 1VMHA 1AL0G 3MIFA 5LASA 3S6PA 3GZUC 5FO7B 1ASJ2 4X8PA 2WJSA 3VKFC 3WQ0A 1WUVA 5FZEA 3VL9A 1OH4A 3TNQA 3WCRA 4S2FA 3IDBB 5A6QA 5JOWA 1ZBA3 1Z7S2 4G9SB 5T5JA 2QDRA 1LR5A 2R1BA 3ZM8A 1PVC2 4IV3B 4UFIA 1NG0A 2X53S 4UWDA 3N9QA 1OUSA 3TOJA 2VCMA 4KU7A 3POGA 5C3SA 1O8PA 3KCXA 4S2DA 1IS6A 4BJ0A 2ARCA 5IK5A 4N43B 1IPJA 5C5UA 1OA2A 2WNVC 3M1HA 2WAAA 2FDGA 4AEKA 3LA7A 5A3MA 2BRTA 3LZZA 4Q4X1 1AX0A 5FP4A 3C8XA 2VOXA 3P1IA 3CKHA 4NE9A 5FYIA 4OVEA 4P5YA 4Q8LA 4WBBA 3J7NA 4Q4W2 2GDFA 1HB2A 3R05A 4LBQB 4IW3A 5HCHA 2VOVA 2E7TA 2ZGSA 4Y1UA 3UGGA 4AVBA 4XC9A 2VY0A 3CU7A 2OQ7A 2Q1FA 3AJYA 5CVRA 5FP8A 2Q1MA 4A44A 5LEKA 5CG8A 4MO3M 4AFCA 1MQTA 2QQLA 1LOFA 2VNOA 3DPRB 5L7OB 4RYDA 5FIXA 1V9U1 4GAZA 1YIPA 3ZFEA 2ZMLA 3C7OA 1NA1C 1Y4WA 1E5RA 3JBG2 3VBOA 2ZHNA 3LSEA 4FFHA 2VZRA 2D5HA 4YPJA 3GGLA 5A7QA 1ND2B 1RB8G 4JHZA 4AQTA 5GLWA 1E5HA 3OBZA 1LU1A 4MGQA 1UD1A 3N9NA 4CCCA 3WEZA 3HOBA 1O4ZA 3ZYBA 5I0TA 3PL0A 2X8KA 5FUNA 4LULA 2HBUA 2BZDA 4HLTA 4PDWA 5DAWA 1C57A 1CN1A 4ITCA 5IFTA 2OIIA 1FT9A 4FP2A 3H8UA 1QJX1 2GP3A 4IGPA 2UYBA 4EWDA 3B94A 1XB9A 3TB0A 3WHUA 5JSPA 5GZFA 3JD73 4NIDA 4LJHA 3JCIA 1Q56A 3NKTA 1W9FA 4XFBA 2ZHLA 3I2HA 3P3PA 4QHZA 3ZVXA 2VUDA 1UPIA 2W5FA 4K8RB 3IDEA 2OX0A 4AI2A 2AUYA 4IEZA 3ZYJB 3H42B 5KR7A 5FZ3A 4D7YA 3GBGA 3GBFA 4PLNA 5FKBA 1QJU3 4K20A 5CISA 4IV3C 3CDZB 3DF0A 4AOCA 4YGCA 1GP4A 1VE0A 4Q4X3 1RTVA 4CUAA 3HD8B 1YFXA 1A8DA 4Q2FA 3WNNA 4EROA 5C3OA 1J83A 4R52A 5DG1A 3ZFGB 1LECA 5EP9A 4K1ZA 4YSFA 3AMPA 4TLGA 1WLCA 4BIFA 1G9DA 1SLIA 3F2ZA 3GCXA 2UWBA 4OCTA 5C6CA 1QOOA 1OF3A 5LBBA 3SCFA 2RMU1 4Y4RA 1VRBA 2EXKA 1G9BA 1PMIA 2I45A 5E88A 1F5FA 3ZFFA 1XYPA 4MGKE 3GF6A 1UZ0A 1V9U3 2BQPA 3IBMA 3NV1A 1RVF3 2XJUA 4QXCA 5FLJA 1HN0A 4CDQC 4A42A 2BVBA 2CL2A 2VW1A 4FFIA 2Q8CA 5DDJ2 3J7MA 3OGVA 2CWMA 1H4GA 1C5IA 3OBTA 5FZDA 3DPRC 3KCYA 1Y7BA 4QX2A 2BBVA 4CDWA 1SLLA 3NJVA 1F35A 2FD8A 3OJBA 1POQA 3UJQA 3JUUA 4RFRB 4P14A 2DVGA 3LA3A 4LBMA 4QU2A 2HYXA 5F5QA 4YW1A 1AJKA 1ND2C 2Q1ZB 3ZDSA 4AI3A 1JI6A 4XIKA 1H2MA 2WWSA 2D6KA 1UYPA 3O12A 4AE2A 1GU3A 1R092 4PQ9A 1W04A 2XWJB 3WV6A 3WNLA 4JC1A 4KBBA 5FPAA 2Z5WA 4S2GA 1RUJ1 2J1SA 1O5UA 2R0FA 2W52A 4GULA 4YVWA 1K5MB 3OPZA 4AHXA 1D0GA 5FYCA 3GCWA 1NQJA 2CWSA 4AFAA 1HXS1 3RZGA 4FOQA 1SFNA 2EA7A 2AYHA 1GWLA 5FMOS 4BOWA 2QCSB 3M3QA 1NY72 1ZZBA 3AP7A 3D4KA 3HJRA 3H8RA 4YFWA 3A21A 1GQGA 3AKQA 1PO23 1RXGA 5LBCA 2PMWB 3JQXA 5JSOA 2EIDA 4NROA 3RVHA 1YQ6A 3ZXDA 5EIYB 1TNFA 2WBKA 5FREA 3RI8A 1FYUA 3KM5A 1RHI3 5K8SA 3KGZA 4AAPA 3VBSA 4FOVA 4GH4C 3U1XA 2QNKA 1QF3A 3LA2A 3QCWA 1SLAA 3SH3A 1I5ZA 4AF9A 5JSRA 4YGDA 2HLEA 1MS3A 1O8SA 2UWCA 5JDBA 4D94A 1DBNA 3RJRA 4YM0A 5GLZA 2GSYA 4AEMA 1J3RA 2VM9A 2JD4A 2IUWA 2RMU3 4D8MA 1DQ0A 4EE2A 2YYOA 1FMD1 1AX2A 1QJZA 1CZTA 1O7FA 3BPSA 4Q27A 3T2OA 1KJLA 2GNTA 2YG0A 3I7DA 4P9YA 4OI0A 1BEV3 4CUBA 5IVJA 2D3SA 5J98B 1HJFA 1J58A 2QJVA 3VZMA 1ZZ7A 2ZOEB 3AYDA 3RZMA 4LLOA 3S57A 4RHV1 5GLUA 2YY1A 2VQ0A 5T55A 2JIJA 2ZMKA 1IQAA 1OT5A 2EVXA 3C3VA 4LIVA 4UT5A 4W6WA 5EWSA 3TYJA 3W9AA 3ITQA 4AEDA 1RL3A 3ZIXA 3V0BA 2JD9A 1PK6A 3U4XA 3MPPG 2PHFA 2ETEA 3LEIA 3ZXEA 4M0NA 5LY2A 1Y9MA 3LEKA 5BV6A 1QH7A 2AEZA 4AZZA 2RVAA 5A6ZA 2VE1A 4MXVA 1JYVA 3NNLA 5AC92 1XBFA 5IYYA 3SH5A 3UESA 1CVNA 3NNGA 2BU9A 5FY5A 3HN3A 4CTEA 1ULCA 4BPZA 2EICA 3T0DA 4D7SA 4TXWA 3RZLA 3ZYIB 1RUJ3 1UYYA 4IEXA 4CEYB 3U14A 3LOBA 4AEJA 5C5TA 3AP9A 1U12A 1UPSA 1W6OB 1HRV2 1QQP2 2PYTA 3KHBA 3O1PA 2O0OA 3I3QA 2Y0OA 3IB3A 2VCBA 3TRSB 5J3UA 4EN8B 1YQCA 1BYHA 3C7HA 4XBLA 1VAKA 1Y43B 2B7YA 5IFPA 1IPSA 2WZR1 4CU6A 1MS5A 3DUIA 3J7HA 4QQHA 1ULPA 1JOJA 3OTFA 3PURA 4H3WA 1HB3A 3GBWA 3NAPA 5A7WB 5JZGA 5FWEA 1MVQA 3ELNA 2ZX2A 2ZKLA 2Y34A 3I2JA 4AFBA 4BHPA 5JIUA 2UURA 5FYVA 1FPN2 1YFUA 4N7IA 4PF5A 4PBPA 3WF3A 5EYYA 1DQ1A 3KV5A 4B4RA 3AC0A 4LO4B 3KQ4B 1H2LA 2XJTA 4BWOA 3MF6A 2XLAA 3FWEA 3ON7A 4LOSA 4NO4A 5A1LA 5LA9A 3ZXFA 3M70A 4Y26A 1FMD3 2R061 2NMNA 3AMQA 1HIXA 1W8NA 2RHPA 3HIFA 1CAUB 2A3WA 3WCSA 1YC61 4O7XA 4JVAA 4N53A 2YBPA 3B7MA 1W6MB 1EV11 1SDWA 2ZGRA 4R9BA 1A6CA 3RZHA 4XJ8A 2RS12 2ZCWA 1Q5OA 3RS6A 5DXDA 2W2IA 1QU0A 5C71A 1YJLA 1KD7A 3H3ZA 3BCWA 2JDYA 3E5QA 4CEWA 4HN0A 2JWPA 4RN5A 3SLIA 4ASMB 3LAGA 3ACIA 3ZIWA 1ASJ1 1WD4A 3OOXA 4FTSA 3O1UA 4KWJA 3K4DA 3UV9A 4RFT0 1Z7S1 2EAKA 5F8PA 3VDDC 3SC7X 1VBD3 4AQ2A 3D8CA 4XFAA 3Q8EA 3UGFA 2ZGPA 2XPJA 1OLME 3AZVA 2A6ZA 4CPBA 3C7EA 4L0PA 1JYXA 5A33B 4E4HA 3N4MA 2E9QA 3PNAA 1W99A 1RUI2 2Y64A 4DO0A 4QU1A 1JZ8A 2ET1A 1P8JA 4FPFA 2WS92 1C8M2 2R6QA 1UXXX 3BIEA 5D21A 4XFHA 1GOGA 5JCTA 5CU1A 1YI9A 3E6DA 3ZN6A 1PIV2 3AXDA 1VR3A 2IZWA 3M3EA 4MSVA 2PHUA 1KJRA 2JDPA 4YG3A 1UW8A 5D8AC 3NMBA 3OPWA 5FRAA 2UU8A 2SLIA 3IIIA 4GWMA 4OMDA 1VRH1 1NLQA 4H55A 2X5IC 5FDBA 4NRPA 1YFWA 3WP6A 3NWKA 1PNGA 2AREA 3NNJA 1Q3EA 3JD72 1O91A 4GKXA 3SISA 3HQUA 3W59A 1GMMA 1JZ3A 2J1EA 1CAXB 2BOJA 1ULEA 2QTWB 3HNBM 2NPIA 5FZ6A 1F31A 2I2SA 3FE5A 3ZXKA 1YYNA 1N1SA 2NYYA 3PU3A 1GSLA 1MR5A 4IE5A 4MUVA 1O5LA 1PMJX 1DGRA 5G04L 5FZMA 5A3LA 3HBKA 2W9XA 3SQOA 2A6YA 2DFCA 2JDNA 2YC2A 3VDAA 1G7YA 4K1YA 1QJU2 1UQXA 4NUBA 1O3RA 4DXTA 1NZIA 5DAQA 4EQVA 2R063 2GH8A 1OXCA 1LU2A 3HMYA 4IE0A 4I3GA 4QDSA 3WG2A 3S5AA 2Y60A 1F5JA 5C4WB 4BXSV 3FBYA 4XFFA 3T4VA 2WQZC 4N7UA 4P9JA 4FO9A 4QAWA 4XAAA 2FQPA 3K46A 4OQ9A 3HAGA 2GMPA 4Q0QA 1T6BX 2PHDA 1ZBE2 1DF0A 5SV8A 2YGLA 4YZ1A 4LKDA 5LRRA 1SZBA 3VBRB 1D4VB 5C9AA 3T30A 2X10A
chains in the Genus database with same CATH topology
1RUNA 1VBB2 5D1IA 5CADA 1SQ4A 3IT8A 4A7ZA 4UW6A 4IV1B 3N36A 1HRI2 3HR9A 3T2TA 4XXPA 4E4DX 1KDMA 1VBA1 2XBO3 1BK1A 2I07B 5L73A 2DVDA 1FNZA 1PGSA 2WQ4A 5FBZA 4CP2A 1AR61 4ES9A 2QFEA 1AYM2 1ND3B 3ALQA 1HQWA 3BB6A 4RQPB 4K8FA 4LUKA 1YJKA 1B35B 3AB0A 3AFKA 4LHKA 4Q4V3 4YGEA 1R1ZA 1I1EA 5L36A 4W6YA 1ULDA 1AHSA 2VW0A 3IPVA 2Q4SA 4FPKA 2Y26A 1U0AA 3KT1A 4MLOA 2HWC2 1MEC2 1EAH3 1NCQB 4PLMA 4Q1RA 5E8AA 5JI7A 1QJY2 2BFUS 5DDJ1 3CJIB 4EWEA 4Y22A 1PNFA 3KZ4C 1CAVA 1L3JA 4XBQA 4EJRA 3MEPA 3LWCA 1RUD2 3M3OA 4WZCA 1H8TA 5KWRA 1MZ6A 4IEUA 2JG9A 1PVXA 3ENRA 4META 4FPGA 4EN7B 2IXCA 2QQPA 2QE3A 2CGOA 1PZ7A 1R091 2ZX4A 4MXWA 1RUG1 1V6KA 4WM8B 4A7YA 4DZGA 4RR3B 1E57A 4AWDA 2XJRA 3VBUB 3ZX7A 4LO7A 4CDXB 2EXHA 4Q0UA 3KT4A 4YG0A 2ZAAA 3LCPA 1H8VA 1AXZA 1SACA 4PIYA 4UBGA 3CEWA 1AR72 1CJDA 1TMF2 5CNAA 3B01A 3ZN4A 1ENXA 4QD2A 1VBA3 1X50A 1ALYA 5K0UA 3B5LB 2WNUB 3MFCA 2ZACA 4E27A 3ZYGA 2XB6C 3DL3A 4YLZA 2BNMA 1W6QA 3FLPA 2F4PA 4P9IA 1AR63 3AKSA 5JAXA 4P5HA 1D4M1 2PAEA 2NLRA 2XHKA 5AVPA 3MLJA 1EY2A 5GLVA 5H9SA 4K6BA 5BNQA 3VBFA 4Z1VA 2OZJA 1S0IA 2HWD1 3APBA 4RQPC 3NO8A 1B35C 1DU3D 2DCJA 3WW4A 3QOPA 5CFCC 3U11A 5I0RA 2JG8A 1EPZA 2PLV3 3I54A 4AVTA 4L9BA 4Y20A 1RUC2 5ABJC 1NCQC 2AGSA 5FMOL 2HWF1 2JDZA 5E89A 1MS8A 2G9FA 4YFZA 4JGYB 2Y0IA 3CJIC 3G6JB 5AC91 1FNYA 5IK7A 1DQ6A 2O8QA 4K21A 3BPZA 1VBE3 2X29A 2NN8A 3VBHC 2E53A 4Y1XA 1RUG3 5E1RA 2R071 4XF0A 3RRDA 1HRV1 1QQP1 4M3CA 2VUAA 4YVSC 5F6LB 1X8EA 1RUF3 1PGW1 2Q5TA 1AL21 1LHUA 1RUE2 2DU0A 1S1AA 2EALA 3WQ1A 4DS0A 2HKXA 4WM8C 4QGLA 2UY9A 4QGMA 5AVAA 2WNVA 3I4IA 4BMBA 1BZWA 2VGDA 3CF6E 1JYCA 3SHRA 4CDXC 1GV9A 4LBQD 5EV7A 4TZDA 1BMV1 1WBFA 4XPVA 1N1YA 2DCYA 2D5FA 4KG8A 4C90A 4OHXA 5L19A 4Y4YA 2DWRA 1FPN1 4CDUB 2MEV3 2P3JA 1CESA 2IXHA 3ILFA 2ARXA 5CAZA 1AYN2 2WFF1 5FAXA 2B46X 1S0DA 4V1PA 2R041 1LULA 3VKOA 3NV3A 1OQEA 1XNDA 2VU9A 4BQ1A 1ZA4A 2E63A 1NXMA 4IESA 4E4SA 3WHTA 5JOZA 2RR13 1NA1A 4Y24A 3VLBB 5CB7A 2HWD3 4WM7C 2QZ2A 4QPGC 1DZQA 1HV1A 1AVBA 1QKQA 4HFSA 4D7TA 2RS11 3EO6A 4KG0A 4P9XA 1PGL2 1Z0HA 1YLLA 1HV0A 2VMIA 4XYXA 1PO11 2CYFA 4F3JA 1N1TA 1FX5A 2JENA 3POSA 1RJ7A 5HCAA 1XU1A 4FPYA 1COV3 1HDKA 4FVVA 4LO8A 4LE3A 3TBDA 5I91A 3QH6A 1Y9QA 4QPIB 5KHIA 2KA3A 2XJPA 2R073 5T5LA 2ZAHA 2WS91 3RQ0A 1C8M1 1R1A2 1XE7A 2VH9A 4WVVA 2LTNA 1W0OA 4KGQA 1V70A 2A6XA 1O3SA 4FSJA 1N3OA 3NKGA 3H0OA 3MGUA 1QDCA 2DCTA 1HLCA 1AJOA 5GJ6A 3PJYA 3VN4A 1I9RA 4AHYA 4R9DA 3SCGA 2V09A 4IV3A 4Q4Y2 3U0ZA 2NMOA 2GNMA 2UWAA 2P34A 1N1VA 4IEQA 3VZOA 2AH2A 3USUA 2WC2A 4KNCA 1TME3 4L97A 5KHHA 3EJKA 2WFF3 2HEYF 2R043 1ENRA 3ZSEA 5JVVA 1OOPC 2B5HA 4QQOA 4JDNA 4AHWA 1CX4A 2W0XA 1M4WA 2HYKA 2ZS6B 4KWKA 3FFZA 1MQTB 1KDKA 2VMHA 2DUQA 2RM22 4CDQA 1CGPA 1Q8OA 1XRUA 3ZFEB 1YO8A 1C3HA 1Q8QA 3FZ3A 4A7KA 1JYIA 3DPRA 3M4FA 1OI6A 3VBOB 1QXRA 2RS52 1OLRA 4AFMA 1U5YA 4QQLA 3FFQA 4NN0A 4I3PA 1ZBE1 3S7IA 1U5IA 5C33A 4AFDA 2ET7A 2C9AA 3PLQA 3RPQA 1PO13 3J9SA 1ND2A 5GZEA 4H7LA 2DTYA 3TN91 3R4SA 5K9YA 5F9TA 4PDWB 1HRI1 2W68A 2XVGA 3AK0A 3OD0A 5DZFA 1JTZX 1LGCA 2FBEA 1JW6A 1BBT1 2C1FA 5C8CC 5JLVA 2WKKA 2WT2A 1S2BA 5AFBA 2RS32 3D82A 2VNGA 3KS7A 1AR81 3ILNA 5I8TA 3BODA 4AI0A 2BTVC 4FPHA 4QPIC 4URTA 2DFBA 2VW2A 2RJLA 4ZU5A 4FPOB 4XXAA 4N43C 4F83A 4GH4A 1IS4A 4PLOA 2HWC1 1VB2A 2JE7A 1MEC1 5BNNB 2YDEA 4DQAA 3FUQA 5FO8B 4PCRA 2A5ZA 3EXUA 1OD5A 5DZEA 2ZKNA 2ZX3A 3WUCA 5DG2A 1VBC2 1H1AA 4GXLA 5FPZA 2PHWA 3J26N 3RI9A 1H2NA 3ZFGA 2GALA 4AQ6A 4MV2A 3BU7A 5KHGA 2XLGA 2WT1A 5JWPA 1RUD1 1GANA 3ZFFB 4R4XA 3H3UA 3PMEA 3EQEA 2GN3A 3OCPA 4DB5A 5L7OC 1W0PA 1BQPA 2BWCA 2PHRA 4BM8A 4NR1A 1V6NA 1NZCA 4XQWA 1QOSA 2VMGA 4HL0A 4CDWB 3JB8A 4PJYA 4YZ2A 1S0EA 2ZHMA 1CD3G 1QJX3 3TN93 3ZXLA 1WA4A 4JGZB 2D3RA 4OLLA 2NZ9A 4QQPA 2W08A 2DUPA 3FBMA 4WVMB 4LEJA 1CIWA 1DGWA 1TMF1 3AXEA 3QH7A 5FCCA 4LE4A 1BBT3 3JU9A 4ES8A 2BFUL 4YVWB 5DUXA 4OHVA 4AVCA 2PTMA 4C91A 1V6IA 3J8F2 1AR83 4S2HA 2K9ZA 4DXZA 3FX3A 3URFA 2E7QA 2H0BA 4K3UA 4I09A 5J09A 3B93A 5GLTA 3KT7A 2OZ6A 5JI9A 1ZZ6A 4ZXKA 1Q8VA 2HWB1 4NPRA 3MZHA 1RUF2 3ZYRA 4ORFA 4XJZA 5J48A 1RMU2 1YCIA 1JXNA 5HXVA 3E97A 3IIAA 4HKOA 4OULA 1POV1 4QPYA 5IUQA 5HBAA 4GWNA 2QUOA 4I01A 2ES3A 3R6SA 2QDNA 1RUH1 3OYWB 4GB32 3UK9A 4IL7A 4ISRA 4AVAA 3IMNA 3AM2A 1AX1A 3WP5A 1G86A 5IK4A 1ENSA 3OY8B 4LO5B 5BNNC 5FOJB 3AZZA 1VLNA 1R082 3ZSMA 1DQ4A 4IEVA 4XHBA 4FPCA 4YW4A 1TNRA 4KWLA 4K7JA 5I0UA 1C1FA 1TE1B 3H7YA 1ZZ9A 1PZ8A 1NLSA 2UY8A 1URXA 4GALA 4AEDB 2ZGMA 1OMIA 5KXBA 4Z92B 3PJQA 3C2UA 2WT0A 4DNYA 2A6VA 3VDDA 5JPNB 2RR12 4MYEA 3D6EA 3L2YA 4OFGA 3SXWA 1FOD1 4UW4A 1RUE1 3MIHA 3G7DA 4L11A 3WDVA 1X82A 2O1QA 1GBGA 1VAVA 3AFGA 4C1XA 3MF9A 5FLIA 4FCAA 1WMEA 5BPXA 3ZXJA 1IPKA 1GYKA 3R0RA 4BLJA 1G9FA 1J3QA 4BIOA 1LKNA 1HXS3 4JGZC 5I8SA 2GAUA 4OZXA 1PM7A 2YXSA 4E2GA 2GH2A 3VHPA 1K5MC 5D8AA 3V0AA 1COV2 2R30A 5FPXA 1RINA 2X5IA 3FLTA 4W65A 4AK3A 1AYN1 2BVVA 1ZBA2 4TWTA 4AG4A 3O0VA 3FLRA 1T6GC 5J37A 2A73B 2YHJA 2V73A 2HWB3 4MH0E 4LNVA 5JR7B 1J3PA 1RGSA 5JZGB 5KBFA 2HWE1 3VUOA 1SBDA 3MYXA 3ZSLA 1YUDA 5ACA1 4C0HA 1POV3 1REFA 4AXOA 3MIDA 3MLLA 3PVBB 3S7EA 4LR4A 2EXIA 3KMHA 3U07A 1LOCA 1PGL1 3FHIB 4RHV3 1H30A 1AR91 1VB4A 5H9PA 1UN1A 4N53B 3WW3A 1ULGA 2IFWA 3N35A 1APNA 1MVEA 1CAUA 1WW5A 2XUMA 2BEOA 1MS9A 1O4TA 1HKDA 3HT2A 3KSCA 5GALA 5KXEA 4CEWB 2VVEA 2Q0AA 4IERA 1ZRRA 1LEDA 1V6JA 1PVC1 3N7JA 3USSA 2DV9A 2BW8A 1FOD3 2VUJA 1SBFA 5LK7B 1DLLA 2KM2A 2P3KA 4OI2A 3WP4A 4FTEA 3LSDA 1XQNA 3S30A 2ZGNA 3AJZA 2D6MA 3VV1A 4TYSA 1KQRA 1OA4A 1WCDJ 3TWIA 1SCRA 1VIWB 4CEYC 4RGGA 4Q4W1 5JPMB 2WZR3 4NHKA 3ZN6B 2ZX1A 4XIOA 1OPMA 3DKWA 4Y5Z0 4RD7A 4WV8A 2XL7A 2VPVA 3WDUA 4DMIA 4XTMA 4EN9B 4LTAA 2CGPA 3H7JA 3JBG1 2HWE3 4B4QA 1DG6A 1A78A 3NL1A 2IWGB 3O5SA 1AF9A 3PVNA 5ACA3 1CQ9A 4RA0A 4TLFA 1OA3A 4I0AA 4Q4X2 4FAHA 2VG9A 2RS51 2Z69A 4L99A 1FV3A 3WW1A 1WLDA 4LT5A 4YRDA 1EV13 1GZ9A 3MDPA 3OD4A 3QACA 1AR93 2DUOA 2D6OX 3BALA 4Z82A 1H9PA 1B09A 4R9AA 4Z8BA 4QMAA 2DVBA 1ASJ3 1ZZCA 1V9U2 1V00A 1RVF2 1Z7S3 1UU5A 3INAA 5EJ3A 2VOKA 1CAWA 1OFSA 5FLHA 4HT1T 4ATEA 2XVLA 2YZ4A 2N7GA 2JICA 2RS31 3ILRA 3N3HA 4KL1A 5IT6A 3DN7A 1W6PA 4XJUA 1LOBA 1MZ5A 4FQZA 3E5XA 5JOYA 3ZMOA 1X8MA 3RNSA 1QHDA 1LTEA 1CPNA 1M06G 4YZ5A 4FAGA 1VJ2A 1F2NA 3QBQA 5DUVA 1VRH3 4P9GA 2GNBA 3H1MA 3JZVA 3WDTA 3M3IA 3VKLA 1GFF2 2MPFA 4XF4A 4RS5B 1VBC1 1WD3A 4HPKA 3GHNA 1GNZA 4GA9A 4W6XA 3DV8A 1NE6A 4LHNA 4GMP1 4RQPA 2JX9A 3I59B 1B35A 1DZTA 5CFCA 4AGGA 1PO22 3O0XA 2BNOA 3LKJA 4MZUA 3VHOA 1KXGA 4NHMA 1LHVA 1RHI2 1JUHA 3L2HA 4YYOA 2R1DA 1EP0A 2CY6A 4UBHA 1NCQA 3RZZA 5ABJA 3AX4A 4Y22B 5BNPB 1CAVB 4OUSA 2F6BA 3WINE 1SMVA 3CJIA 1DZRA 2GMMA 1H8TB 2VQAA 1WCKA 1UZZA 4YW5A 2RMU2 4HK8A 3VBHA 1QXPA 1PZ9A 5C4WC 1BEV2 2ENRA 4M3CF 3WY6A 1LB2A 1RITA 2ERFA 1ZVFA 2D98A 2P17A 4MXWB 4SLIA 4YVSA 4AQSA 3WVJA 4FPJA 4CYDA 4XJWA 4IEYA 1IOAA 4UW5A 3VBRC 4D3WA 2P2KA 4WM8A 5H9QA 1NY71 2HJIA 1RIRA 3IDCB 2ZGLA 5LK5A 4CDXA 2BWAA 1ULFA 1N47A 4DY5A 1DYPA 1XU2A 2A6WA 4IV1C 4X6QB 1JUIA 2IFRA 4WZFA 3ZPYA 3SITA 4OHYA 1U5XA 2XVKA 1X33A 3SH4A 4WVWA 2DVAA 2EF6A 3WOGA 4U36A 4YM3A 1EYBA 1RUJ2 5HCFA 1JH5A 4R9CA 1W6QB 1GZWB 3VHNA 4KU8A 3ZXAC 3MIEA 5A32A 2NQYA 2XGXA 1RJ8A 3RWNA 1ND3C 1ZM1A 1X36A 2A3XA 2FZ1A 3IWZA 3LB9A 1ENQA 1DIWA 3VBFB 4WM7A 4QT6A 4QPGA 3AP5A 4XE9A 1R081 4JQRA 4RS5C 5DDJ3 5EXOA 1ZRCA 3NW4A 4EV0A 4N90A 1QY4A 3OGGA 1YIFA 4HANA 3JB4C 3NV2A 1NXD1 5CFDB 4KQ7A 1BCXA 2JG8B 4B29A 1LODA 2BYVE 5F6KA 4HN1A 4Y20B 2ZABA 2CV6A 4HSJA 2PA7A 3FMGA 1H2KA 4OI1A 1R093 5T54A 3THTA 1LOAA 3O0WA 4HSLA 1LGBA 1FMD2 3AZWA 3PMSA 4M0HA 5BNPC 1ZRDA 3CO2A 4OHZA 1XNCA 3WXPA 1H8TC 2HEWF 5DUUA 1G9CA 1IS3A 1H4HA 2XKOA 3ECQA 4LLFA 4M3CB 4XETA 4ZU4A 2GNDA 1LRHA 4RR3C 4I30A 2GC3A 1LENA 3VBUC 4FOWA 4BE3A 2A3YA 5K7PA 1SFYA 2OW4A 4J1WA 1LHOA 2RJKA 3WLUA 2A75A 4BA6A 5BNOB 1ZBA1 2ZGKA 3BOPA 1ZRFA 2GC0A 1VBD2 2WNVB 4IEOA 3AP4A 4ZKTB 1IZ3A 1J1TA 4IEPA 5BUVA 1D4M3 1VP6A 2K2SA 4YARA 2EAAA 3MPBA 2WNUC 3VKNA 2A70A 4XJAA 1WBLA 1S0CA 3BOWA 2DU1A 1NCRB 1OOPA 4XF1A 5T50A 1SCSA 2ZA9A 3B9IA 4O9GA 1QOTA 2ZGUA 3V64A 4B8EA 1BVVA 4PIXA 1IHMA 2VVFA 2WZR2 2OPKA 1NA1B 2WL1A 1GLHA 2E6VA 3WG1A 3AYEA 5FQ0B 1W6NB 1RUOA 4NHLA 2HWF3 1J1LA 1QDOA 1YXWA 2O8OA 5B2GB 2YROA 3MIGA 2PHLA 5AC93 4R4ZA 1SLTA 2WA4A 3WZ1A 4CP0A 4LHLA 4LBLA 4AVSA 4IXLA 5CFDC 5KHKA 1UCXA 4B3NA 1WW6A 2JG8C 1RUI1 2R062 2D93A 4JGYC 2SBAA 2CGNA 2XJSA 1FXZA 1HRV3 1QQP3 5C8CA 1GQHA 2WLPA 2DTWA 4G4FA 4H7MA 3AYAA 1BJQA 1D2SA 1AL23 2WLQA 2DCZA 1PIV1 3KQRA 2Z42A 3MW4A 5T3NA 4DOUA 4XOGA 2VECA 1O3QA 2VVDA 4HVQA 3RYRA 1BVP1 4QPIA 4AVVA 2PHTA 2Y38A 1DFQA 3HQXA 4LBKA 3JD71 2XG3A 3ACLA 5I93A 4XF3A 2CNAA 2FMYA 4N43A 2GC1A 3UKVA 1FPN3 4B4PA 1QWRA 1EPWA 2CAUA 1MACA 4M3CE 1DHKB 3FJSA 5BNOC 3WD5A 1LHWA 4HK9A 4BLIA 2XBO2 2D6PA 1QJU1 3USUB 1KFUL 4XF9A 1VALA 4LBQA 4CDUC 5IK8A 4FTBA 4EN0A 1NE4A 1XE8A 3FC0A 1POV0 1NCRC 1VRH2 3RYKA 1N3PA 1WW4A 2RS13 5EYXA 2EXJA 5L7OA 4Q4V2 1UKGA 4YZ3A 4COYA 3WR0A 4CDQB 1J59A 4XEZA 2WIIB 3RMYA 1QNWA 1RVF1 1EAH2 3M7AA 1VBB1 5KXCA 2D97A 1MZFA 1HQLA 2ZTNA 4COVA 2DVFA 1WLWA 1RUI3 3N7LA 4JRLA 2AZ5A 2WS93 1C8M3 4J1XA 2XL9A 3GALA 1SLBA 2XLFA 4EN6B 1A3KA 1XYOA 4COWA 2G9GA 3UL2A 1PIV3 3GHMA 3RYPA 4AI8A 3NVCA 3PVEA 1AYM1 2IC1A 1NQDA 4QM8A 4INDA 1ZREA 4WVZA 1YNAA 4NOTA 3AZYA 1DQ5A 1JBCA 2OUHA 3LOIA 2IXLA 4JDMA 4YNIA 4YZ4A 2Z79A 4ONUA 1IS5A 1O3TA 1I6XA 1HW5A 5GM0A 4A3XA 2MHFA 4JAAA 4QQ2A 1QJY1 4GH4B 4BYYA 4RL7A 4Z07A 2XKPA 2YV8A 1VBA2 3GZTB 1PO21 1WCSA 4IQPA 3RMXA 1KS5A 4JTOA 1D2QA 1LHNA 3MFAA 4AGRA 4H14A 4YW3A 1RHI1 4XZPA 3UJOA 5BNNA 1AR62 2YPJA 3IN9A 2ZMNA 3WUDA 1YFYA 2YC0A 1CONA 1OSGA 4ISQA 2JECA 2ZX0A 3ZMNA 1MQTC 1OQ1A 1LOFC 1ZBE3 2R49A 3ZFEC 1BEV1 3AKPA 2IXKA 1VBB3 3VBOC 1DGRN 2QKDA 4FT8A 1GNHA 4XDQA 3V65A 2PLV2 1HRI3 1AR71 4Q0VA 4X8NA 2I74A 2R32A 1C28A 2KXLA 1QMJA 2TNFA 3WNXA 3PVOA 5T5PA 1W39A 4NVPA 3R4DB 4SBVA 3RSJA 3WDXA 5I8YA 4M00A 4PDWC 3SCHA 4JGZA 3D0JA 2ZHKA 4WVMA 1VBE2 4QHBA 2RE9A 1K5MA 3WW2A 4QGNA 4BH9A 2PAMA 1AYM3 4NWVA 3PTYA 1UMZA 4P9LA 4KGGA 1RUG2 1YWKA 4DY3A 3ETQA 1ZYBA 5DUWA 1MS1A 2D40A 3ZYPA 1KITA 1AXYA 4E2QA 1OLQA 2HWC3 3FUOA 1VAMA 5E16A 1MEC3 2WA3A 4XQ4A 4N9IA 1UU6A 2GN7A 3VBSB 2R0HA 1MS0A 2B45X 3VKMA 1QJY3 1MZEA 3RDIA 3T1L<