1FATA

Phytohemagglutinin-l
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
233
structure length
232
Chain Sequence
SNDIYFNFQRFNETNLILQRDASVSSSGQLRLTNLNNGEPRVGSLGRAFYSAPIQIWDNTTGTVASFATSFTFNIQVPNNAGPADGLAFALVPVGSQPKDKGGFLGLFDGSNSNFHTVAVEFDTLYNKDWDPTERHIGIDVNSIRSIKTTRWDFVNGENAEVLITYDSSTNLLVASLVYPSQKTSFIVSDTVDLKSVLPEWVSVGFSATTGINKGNVETNDVLSWSFASKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords PHYTOHEMAGGLUTININ-L
publication title The crystallographic structure of phytohemagglutinin-L.
pubmed doi rcsb
total genus 48
structure length 232
sequence length 233
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1996-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1fatA00
4AYUA 2ZABA 1LEDA 2A3XA 2GN7A 3LCPA 1O4YA 1MS5A 1V6KA 5AVAA 1ENQA 1MVEA 1GICA 2E51A 1N1YA 3B01A 3AZZA 2VW1A 2R16A 3R05A 1KJRA 4R9DA 1S0JA 1SBDA 1YI7A 1LHWA 4M3CB 3KQRA 3RMXA 1A78A 3V0BB 4XXAA 2ZGQA 1FV2A 3FLTA 4FQ4A 3I4IA 3LSDA 4XJWA 2ZHKA 5LK5A 3T1LA 3BODA 5T55A 3M3EA 1G8WA 1HQWA 3IPVB 1MR5A 1AXYA 3FUOA 1QU0A 3INAA 1AXZA 1LHVA 2I2SA 2D6PA 2DU1A 4DQAA 2W52A 2WQZC 3R4SA 5DG2A 1SLCA 1QOOA 2ES3A 1LOCA 2JJ6A 1UZYA 1S0CA 5JOWA 2VH9A 4YM0A 3ZSLA 2NZ9A 3N35A 1KRIA 1LOEA 2DU0A 2ENRA 5JDBA 3OY8B 3WG2A 1KDKA 4ISQA 2ZGMA 1W6MA 4XIOA 2VY0A 5DXDA 3ZYRA 2R1DA 2VW2A 4XIKA 5KXDA 1WLWA 1GZWB 1LULA 3HN1A 2FHRA 3USUB 1D0HA 4BOWA 4CTEA 3VKMA 1LGBA 3BOPA 3IN9A 1CVNA 1C4RA 4FP3A 4FPJA 5IT6A 5GLZA 4FPHA 3ZXLA 5JOZA 1CJPA 3AJYA 5FRAA 5GLVA 1DYPA 1LOGA 3C2UA 3D6EA 3WCSA 1G7YA 4GXLA 4Z8BA 1QOSA 4BLIA 3O5SA 3ZSJA 1LHUA 1CPMA 4U2AA 3DUIA 4LBOA 4Y24A 1S0IA 1W6QA 5HCBA 1O4ZA 4CRQA 5HCFA 1BKZA 2EXKA 1U0AA 3AK0A 5T5JA 4YGEA 4YG6A 4Q8KA 1W6NB 1HQLA 1GKBA 1N1TA 2NM1A 3M1HA 4KBBA 2DUOA 4YLZA 2Q5TA 2GNDA 2W39A 4D69A 4ITCA 1GLHA 4Y26A 5HCAA 3KM5A 2PHUA 1SFYA 4YG0A 3AX4A 2NP0A 3AZYA 1MZ6A 4L8QA 1ENSA 1V6LA 2D3RA 3U4XA 3A0KA 3BTAA 4FOWA 1Y7BA 2GDFA 4Q26A 3N7MA 2EXIA 3ILRA 1QDCA 1W0PA 3MW3A 4LBMA 1Q8QA 2D7FA 3JUUA 2CNAA 3ATGA 2WLQA 1SLBA 2A71A 5DZEA 2DV9A 4WV8A 4YW3A 1IS4A 2CWMA 2WJSA 3AJZA 3WUDA 5CAZA 4BLJA 2XG3A 4BPZA 2DVAA 1V6OA 4F83A 3N7KA 1S0DA 5E89A 4XBLA 2P3IA 1APNA 2OUHA 2ZMKA 1SCRA 5DUXA 3ZXKA 3SISA 1JW6A 1LECA 2CYFA 1WCSA 2VXRA 2JDZA 3FBYA 4YW4A 1ULFA 1UPSA 3B3QE 4AVVA 3AP7A 2CTVA 1WW6A 4DPNA 1G9BA 1BJQA 5CBLA 1Q8PA 3GALA 2JD4A 2LTNA 2G4IA 1DQ5A 1MZ5A 3AYAA 3AZXA 2ZGUA 3AP5A 5DG1A 3V0AB 1Q8OA 1MACA 2DTWA 2A5ZA 2JKBA 4XILA 3OYWA 1JUIA 2AUYA 1QKQA 2BQPA 5T52A 2FMDA 1KJLA 5H9PA 1RINA 3WDWA 4ISRA 2GALA 1EPWA 4RA0A 1KQRA 1AF9A 1GYKA 1F31A 4FVVA 4XHBA 3ZXEA 4TZDA 5T5OA 1G9CA 1J1TA 2CWSA 1JOJA 2PHXA 1DBNA 2ZGNA 4K1YA 1G9DA 3HR9A 4Q1PA 3SH4A 2EAKA 2A75A 1SLTA 5IK8A 3AXEA 4GKYA 4Y1VA 2ZHMA 1URXA 4LBQD 1CPNA 4Q1RA 4PQ9A 3WDVA 1IS3A 2AYHA 3N7LA 2ZGRA 1W6OA 2PELA 2WSUA 3WVJA 4AGGA 1AXKA 1JN2P 4LBQA 1D2SA 1ZM1A 1R1ZA 2D6LX 3POWA 3WG3A 1PZ9A 4BQ1A 5T54A 1QNYA 2DVDA 1LGNA 4HL0A 3FLPA 3LSEA 1S0BA 3OPZA 4FOYA 4FPKA 2LALA 4UW4A 1OFSA 2A6VA 1DQ6A 1GBGA 2P3JA 1CN1A 3PJQA 2W68A 3OBRA 1VALA 1WW7A 3SLIA 2A6WA 3UJQA 4XBNA 2D6KA 4AGVA 1LOAA 4UW3A 2NMOA 1LU2A 1DZQA 1Q8VA 1TEIA 2YROA 4FPLA 4GA9A 1OKQA 1CIWA 1SLIA 3POYA 2RHPA 1Q8SA 3M3CA 1W6MB 4PF5A 1ULEA 4UW5A 4XE9A 2E7QA 3M3OA 1LU1A 5SV8A 1QGLA 4XTPA 3ZYPA 1PZ7A 1N3OA 1H9WA 2WT2A 3WOGA 2GNTA 4C1XA 3NWKA 3POSA 1GNHA 1DFQA 4LBLA 4XBQA 4Q27A 3ZXJA 3B00A 4TYSA 1AJOA 3I8TA 2R1BA 4HANA 5T50A 1V6MA 4FPYA 3IKWA 4ASMB 1F5FA 1UX6A 3H0OA 2AH2A 4FOQA 4ATFA 5CB7A 5JLVA 2B7YA 1IS5A 2GN3A 1Z0HA 1W6QB 2VW0A 3ENRA 2DYCA 1LENA 2D3SA 2ZZJA 1MS9A 4M3CF 2YZ4A 2YMZA 1QOTA 2E53A 5F5QA 1FX5A 1QMJA 1WD3A 4Q8LA 3M3QA 1UZZA 2GNBA 1MS0A 3RMYA 2UWAA 3IMNA 2A70A 1UMZA 3N3HA 4GWNA 1AJKA 1AX0A 2P34A 5EXOA 3WG4A 3OJBA 4YM1A 2P3KA 5GZDA 2R49A 2ZACA 1WUVA 2UURA 1VIWB 2DUQA 1GZ9A 4XOGA 1DIWA 4FPEA 2GNMA 4YGCA 2SLIA 3NV4A 1S0FA 4FPFA 1WLDA 1VAVA 4PBOA 4PBPA 3UK9A 3WG1A 1W6PA 5T5LA 1WW5A 3WZ1A 2ZGTA 4YGBA 1MVQA 5CNAA 2A6YA 1FAYA 4Y20A 4FPCA 1AX1A 1YRZA 3NV3A 1FATA 3VKFC 2OW4A 2A6XA 1DLLA 1JYCA 2E6VA 4YFZA 2ZGSA 2ZMLA 2P37A 4OZXA 2WT1A 4Q2FA 2D6NA 3PVNA 4K21A 1C57A 1AVBA 1VLNA 5GZFA 2R0HA 4GWMA 4XZPA 1PZ8A 1DGLA 2ZGKA 4K1ZA 2H0BA 5GJ6A 2OVUA 3VKNA 5H9SA 3TAYA 3ZVXA 5EYXA 1N1SA 4YW2A 2JE7A 5T5PA 2NMNA 1G9AA 5GM0A 1SACA 1F9KA 1SBFA 2AR6A 2C5DA 3OGGA 4BMBA 2ZHLA 3WDXA 1LHNA 1SLLA 1LHOA 2ZGPA 2YV8A 4AGRA 1CQ9A 4AVSA 3WNXA 5GALA 3WDUA 5JMCA 1S0EA 3RRDA 3JU9A 4WVWA 5EYYA 4DRRA 3OYWB 4YZ5A 1HKDA 3MW2A 1DQ2A 1UN1A 4MYEA 2AENA 2WNEA 3ILNA 1BYHA 4FOVA 3WDTA 4Y1YA 4JC1A 4LBKA 4NOTA 4XJUA 1V00A 4GKXA 1N3PA 3O0VA 2DWRA 4IQPA 3ZSMA 1ULDA 3IM0A 3D4KA 3MW4A 3WCRA 2D3PA 3Q9OA 3WHUA 4BMEA 1CONA 3V65A 2WKKA 5GLUA 1YIFA 3FUQA 5DUUA 2D43A 1W6OB 4XJZA 3FFZA 1QNWA 2GMEA 2TEPA 4YZ2A 3GNEA 3N7JA 4Y22B 3WLUA 1IOAA 1ULGA 4LBQB 4YGDA 5DUVA 1V6NA 4Y22A 1GSLA 2ZHNA 4FP2A 1IKPA 2V5YA 4Y1ZA 1BQPA 5KXEA 4Y1UA 1A3KA 4FPOB 1AX2A 1DQ1A 2EXHA 2A3WA 2NN8A 2XB6C 2HYKA 4P9XA 5JVVA 1LCLA 1ENRA 4YG3A 3T1MA 2DVFA 5DUWA 1I1EA 3AYDA 3ZXFA 4YFWA 2SBAA 3VUOA 1MS3A 5DZGA 3A0NA 4GALA 1LEMA 2VUAA 5GZGA 1WBFA 3AFKA 1GV9A 2EF6A 5JOYA 1X50A 3D5OA 3FLRA 3O0WA 1JXNA 2JE9A 4YM3A 3N36A 1UKGA 4M3CA 4PCRA 4YZ1A 3V0BA 5L73A 4DS0A 1UL9A 2EIGA 2V73A 2DURA 4YW1A 4P9YA 5GZEA 3VKOA 3AZWA 3AP6A 2GMPA 4LBJA 1V6JA 2D44A 4M00A 4W65A 1WBLA 2CL2A 2PHFA 3IPVA 3AZVA 1I3HA 2ZMNA 4YZ3A 1LJ7A 5IUQA 5IK4A 1AZDA 1HDKA 3AYCA 4YW5A 1LTEA 4Y1XA 4CZSA 2UWBA 3WDYA 1BXHA 2YY1A 3L2YA 1GANA 2DVGA 1XQNA 3AXDA 1G86A 2UWCA 1DQ4A 4M3CE 1JYIA 3WV6A 4NO4A 1V6IA 3RQ0A 1LOFA 4XJ9A 3OY8A 1SCSA 4P9WA 1S0GA 4YZ4A 4R9BA 2ARXA 3UL2A 3USUA 1GZWA 4I30A 2CY6A 1N1VA 1JHNA 3VV1A 5EWSA 1NLSA 5E8AA 3ILFA 1RIRA 1NXD1 3WHTA 2P2KA 4XYXA 3A4UA 1SLAA 2ZKNA 5CA6A 1MS4A 2DUPA 3NV1A 1N3QA 4XMAA 1OQ1A 1W6PB 3OBTA 4ATEA 2AGSA 4C1WA 2E7TA 2JECA 3B69A 4XTMA 3AP9A 4XDQA 4Y20B 5H9QA 1CR7A 2OUJA 2PHRA 1VAMA 3AYEA 1WD4A 1C1LA 2EXJA 2D6OX 1CESA 2ZGLA 3APBA 1HLCA 2WT0A 3PVEA 1N47A 2EALA 1KITA 2ZGOA 1JBCA 4R9AA 1LODA 2VU9A 3QLQA 2ERFA 4XJ8A 4U36A 3T2TA 4K20A 3MPPG 2PHWA 3V64A 4ZKTB 2W08A 1FNYA 2A3YA 5GZCA 1W6NA 4M01A 1ULCA 3SNMA 3O12A 2ZAAA 1IS6A 1DQ0A 1ZA4A 3W59A 2KM2A 1QF3A 3M2MA 4R9CA 1MS8A 1SBEA 4WVVA 3RG0A 5BYNA 5F9TA 2DTYA 1WLCA 4P14A 4ZXKA 2WSVA 1UAIA 1WW4A 2ARBA 3NV2A 3QCWA 4H55A 1A8DA 4YM2A 3VKLA 1Z78A 4XXPA 4WZFA 1W0OA 3SH3A 3ZPYA 5IK5A 1ONAA 2A6ZA 3W58A 3R4UA 1BZWA 1KDMA 3BIWE 5KXCA 2AREA 1FYUA 1S1AA 2D6MA 1DYKA 1FNZA 1LESA 1H9PA 4RL7A 5JOXA 3CNAA 2UU8A 3TB0A 2DVBA 4SLIA 5DZFA 1G9FA 4BM8A 4XHXA 1GZCA 1YXWA 1C1FA 3RS6A 1LOBA 1YO8A 2ZBJA 3B9CA 2NYYA 2ZA9A 3AP4A 1RITA 5KXBA 2R0FA 3ASIA 1DHKB 1H30A 3UJOA 1GNZA 5H9RA 2GMMA 4JRAA 4XMIA 5FREA 4FPGA 3PMEA 3O0XA 1B09A 3SITA 1Q56A 1FV3A 1IKQA 2Z42A 4XJAA 1LOFC 2YXSA 3MEPA 1LGCA 5GLWA 3V0AA 4DFSA 4DRVA 3DGTA 1YYNA 2C9AA 5E88A 3WUCA 5GLTA 5IK7A 4FQZA 4UW6A 3SH5A 4JCKA 1QDOA 3RSJA 3HMYA 1MS1A 4AVTA 4AWDA 3PVOA 4LBNA 2A7AA 3ZSKA 2PHTA
chains in the Genus database with same CATH superfamily
1U5XA 2JICA 4JGYB 1WA4A 2QVSB 3KB5A 2GN7A 2JG9B 4N43A 3LCPA 1O4YA 1MS5A 2JDUA 1V6KA 5AVAA 2X05A 1ENQA 3W5NA 2E51A 4C90A 1QJY1 4XFAA 3AZZA 1H4GA 3FC0A 1UYZA 4AFDA 1BK0A 1KJRA 4XF4A 5EV7A 3FE5A 5LATA 1ZBE2 1A78A 3RMXA 1POV0 3WP4A 3GYDA 3THDA 1RUH2 2ZGQA 1O3SA 3POFA 4FQ4A 2BPA2 4MH0E 2ZHKA 4IEQA 3NKGA 5LK5A 1GQHA 1XYOA 3T1LA 1SDDB 1NQDA 3BODA 4QAWA 1G8WA 1W9TA 5C5UA 2ZJCA 4ASKA 1QU0A 3O1RA 2DCKA 4DY3A 4IGOA 4MO3M 2I2SA 4DQAA 3O14A 2WLPA 1OVPA 1XU2A 2VH9A 4N53A 2NZ9A 4MGIE 3OBAA 5JDBA 3OY8B 4ISQA 3POBA 1PMHX 2IXKA 3ZYRA 2VY0A 4GD4A 3ZR6A 1H6YA 3IAQA 4XIKA 5LY1A 3USUB 2XMLA 3S0MA 3WF2A 1D0HA 3VKMA 4NAMA 3IAPA 1OXCA 3EJKA 4Y4RA 4IESA 1CVNA 2VNOA 4FP3A 2PHDA 5JOZA 5F8PA 3AJYA 3OF1A 3D6EA 4NMIA 4GXLA 1QOSA 2DDUA 5L9BA 2VQAA 5SV5A 4ZY9A 4BLIA 4ZS2A 3TWIA 1UO9A 4U2AA 4H7LA 1JYWA 3AVRA 3DUIA 5C9AC 2WL1A 1WZXA 3WNNA 1NLQA 1VBE3 1FOD3 2FDIA 5FY9A 1O4ZA 2B45X 2PMWB 3RVHA 1UD1A 2EXKA 1U0AA 3BYWA 3B5LB 1NYWA 2WNUB 4A6OA 1L3JA 2J1SA 2MPFA 3EXUA 3GJAA 4YGEA 4YG6A 4CEWB 4B1MA 4Q8KA 1YFWA 1HQLA 3HIFA 3WQ1A 3I2FA 4NVPA 1H1MA 2NM1A 3OSDA 5L7OA 1RJ7A 2V4AA 1X33A 2D97A 1TMF2 1VRBA 1XBFA 3ZYHA 3WQ0A 3O1MA 4JGZB 2K46A 2EIDA 5BNQA 3RI9A 2VMIA 4XFCA 4YLZA 2R32A 2ZS6B 2Q5TA 4NWWA 3KWVA 4L0PA 2VZVA 1X8EA 3KM5A 1QXJA 4CEYA 4MGQA 5FMBA 4N43C 3A0KA 1PIV1 5EIYB 1ZX5A 1K12A 1KS4A 4FI9A 1Y7BA 4QM8A 2RS13 3WQBA 1NZIA 3N7MA 2EXIA 1W0PA 1DGRN 3MW3A 3PLQA 3JUUA 4A3ZA 4FFIA 2Y6JA 2QFEA 5LB6A 1R083 3MBWA 3MFAA 4FFHA 1W06A 5ABJB 3P5BA 4HK9A 4YW3A 2CWMA 3I97A 4N7UA 1DGWX 3KZ4C 3A23A 1CIYA 5E89A 4Q4W1 1AYM2 2LRPA 3NW4A 3OB8A 1O4TA 3ZXKA 1SCRA 5DUXA 2JB4A 1JYTA 1NE4A 3LE0A 5F37A 3ST7A 2ID4A 4CDWB 3TEZA 1LECA 1WCSA 1OH3A 2R30A 2VXRA 2VVFA 2WN2A 4YW4A 4COYA 3M70A 5C8CB 5CFCB 4AVVA 1NE6A 3ITQA 1MEC2 2HWC3 4HVRA 5CBLA 1YEWA 3CF6E 3GALA 1COV3 2HWD2 3MDPA 1SPPB 2LTNA 2G4IA 3HNYM 1QWRA 3NAPA 1AL21 5D21A 5DG1A 3V0AB 4NHMA 4JTOA 3FX3A 2JKBA 2ATFA 4IV1B 1BEV3 4KWUA 4ONUA 2BQPA 1QKQA 5FMDA 5T52A 3LEKA 3SEPA 2DCYA 5AVPA 5D1IA 1EPWA 4AFAA 4XFHA 3H8UA 3HAGA 2C26A 2WO7A 1KQRA 1AF9A 1F31A 3N9NA 1PGL1 1ZNPA 1WMFA 4HFSA 1J1TA 2EIBA 3HEIA 3I3DA 2Y60A 3KCYA 5HXVA 2PHXA 1DBNA 2ZGNA 3POIA 4IV3B 1VRH3 1AR61 4Q1PA 1WMXA 3SH4A 5FLIA 1R082 2GH2A 3DL3A 1PM4A 4EWAA 1W8HA 2VMEA 1YFXA 4LO6B 4ZONA 5FZHA 4UI9L 2QQVA 4HLTA 3UNPA 1URXA 4LBQD 3WDVA 3N7LA 1YQ5A 1RL3A 1DP0A 4X6QB 1RMU1 1DU3D 2WIIB 5ACA2 4DMIA 5J48A 3POWA 2CSGA 5L7OC 1LGNA 2XBO3 2GP3A 3F2ZA 4Q0VA 5FPBA 1H8TA 4COUA 2HWC2 5T54A 3OPZA 4UW4A 5FZGA 2LALA 3J9SA 2P3JA 3OGJA 3PJQA 1CN1A 2YHJA 2QQPA 4O65A 4XUNA 2DFCA 4N7IA 2NMOA 1LU2A 4GA9A 5IAXA 2YROA 3HT2A 4MSVA 5FYBA 5JXHA 3K48A 1A34A 1TVGA 4NIAA 1RC6A 1BEV2 2VNVA 2RHPA 2HWE3 1J1LA 1Q8SA 2YYOA 3M3CA 2QBXA 3OPWA 2E7QA 1PGSA 4Z2AA 1QGLA 3C7EA 4XTPA 2WT2A 1RUH1 2B9UA 4CDQB 3NWKA 4QX2A 5FY5A 1DFQA 5JR2A 2XWJB 5F3GA 3ZXJA 2QDNA 1OFNA 4NHLA 4MXWA 1VRH2 3NNGA 4HANA 2YU1A 1YJKA 1OD5A 1V6MA 4UFHA 2WNOA 3LGRA 3LF7A 4CCKA 1F5FA 4QB6A 3I3MA 1ULPA 4ATFA 5IATA 5JLVA 2JE8A 1RB8G 2VECA 2W5FA 2ZZJA 2D3SA 3ZFFB 3JCIA 4FT8A 1WA6X 4CPBA 5JPMB 4CCOA 3NKTA 2YMZA 1HV0A 2E53A 2HEVF 3JB4C 1QMJA 4Q8LA 5F5QA 2BBVA 3RMYA 2UWAA 3IMNA 2A70A 3MPBA 4GWNA 2P34A 4LLOA 2VZTA 3OJBA 2P3KA 4QPIB 2VQUA 3ZR5A 4BQ3A 3I49A 2ZACA 1XXNA 2HWB2 4XCBA 4B1LA 3AMQA 4JQTA 4FTSA 2JX9A 4FFGA 4XOGA 2Z4FA 1DIWA 1VE0A 4YGCA 2SLIA 2JXAA 2MNGA 1HXS3 2Y6GA 4FPFA 1K3IA 1WLDA 1FXZA 4PBOA 2LM3A 5DAQA 3HQXA 4QGNA 5T5LA 3WZ1A 2ZGTA 4QB1A 4RD7A 1MVQA 4BCUA 1LB2A 5CNAA 4P5HA 2B9VA 1YRZA 1SMVA 2OW4A 2A6XA 1DLLA 4YFZA 1GP5A 2P37A 4Q2FA 5A6YA 2D6NA 3M4FA 1ND3B 2QQJA 3CJXA 4E8CA 5A3TA 3DEMA 4LEJA 5BNNB 4DINB 1YNAA 1UU4A 1UY2A 2EAAA 2CDOA 2X10A 3AKPA 3ZDSA 4IEOA 4YW2A 2YC4A 5T5PA 3UGFA 3KHBA 2BNNA 4OI4A 5A7QA 3BCWA 2AR6A 2R072 1UKRA 3E5QA 4LOTA 4YYOA 1H8TC 4MHRA 3WDXA 2E31A 2QKDA 2BGPA 5FBZA 1S2EA 1REFA 4HETA 2ZGPA 1JZ6A 1W9YA 4QXBA 1QJX2 3WNXA 3LOBA 1W99A 2X5IB 2VOXA 5KC6A 4PJYA 5I0UA 5JMCA 1S0EA 2GC3A 1VMFA 3FFQA 4HK8A 4PIZA 4AI2A 5FOBB 4FTBA 3WP3A 4DRRA 3P3PA 4P02B 2QQUA 2Y64A 1HKDA 4GZ9A 2LUWA 4JQRA 4YZ5A 1HXS2 2XL9A 2TNFA 5I8TA 3LWCA 2RJKA 4GMP3 5A3LA 3S7IA 1VBE1 1FOD1 4LBKA 4R52A 5K0UA 4AHZA 1RUC3 2RM23 4KI5M 4EN7B 5FYTA 1N3PA 1QIQA 1PK6B 3D4KA 2XUMA 2OPKA 2W1SA 5GLUA 3FUQA 2D43A 5EZWA 4OHZA 5FY8A 1H4HA 4XJZA 1ZREA 1OT5A 2P5BA 1T2XA 3IDCB 1CAVA 3L9JT 3N7JA 4DXZA 5GKAC 4Y22A 2ZHNA 2BERA 2VR4A 5ERLA 4Y1ZA 1ZBA2 1BQPA 3BN6A 1RUI1 4IE5A 1AX2A 3VL9A 2EXHA 1XOYA 5J98B 2RS11 2P6CA 2BYVE 2XB6C 2HYKA 3ABZA 3BALA 2RS33 4IW3A 1GP6A 5DUWA 1I1EA 2NPIA 5BXXA 4AHXA 3ZXFA 3GCXA 3KQ4B 4OYUA 5FYSA 1R081 2QQLA 2SBAA 2VXJA 3OUIA 1WBFA 1O8SA 2FDJA 3I3EA 5JOYA 3D5OA 3K46A 1QJU1 1MQTA 2DF7A 2O0OA 2ZX2A 2XJUA 4QKDA 2CDPA 4EZHA 3ACFA 1AL0G 1SFPA 2QE3A 3MUY1 3U14A 4IEWA 2WNUC 5A3UA 1RUC2 2RM22 4DNYA 4CEWC 1OLMA 3JD73 1IHMA 4LBJA 3VDCA 1HRI2 4ZU5A 1HIXA 5F7UA 4D3WA 3VDDB 3DYMA 1EAH3 1F15A 2PHFA 2HWC1 4WBBA 1I3HA 2BVBA 4YZ3A 1LJ7A 5EJ3A 3K3OA 1COV1 4NUBA 1DF0A 4RFT0 3I2GA 1PVC2 5IUQA 3AYCA 5IK4A 4FTEA 1LTEA 4QGLA 4RQPA 5LCWL 2Q0AA 2JDHA 2E33A 1VP6A 5FWJA 4MVTA 1BEV1 1CD3G 2JDNA 3WV6A 3PIJA 1J83A 4NO4A 2XQRA 4A7KA 1SCSA 3FMGA 4P9WA 2Y8KA 3UL2A 3I2DA 3OOXA 5K8SA 5LRSA 2FDGA 1V9U2 3VBHA 2F6BA 5DPNA 1NXD1 5BNOA 3VBFB 5DQ0A 1PMJX 4JHTA 3A4UA 1VRH1 5CA6A 5LK7B 3GXUA 2RJ2A 3AM2A 4OUSA 1N3QA 4XMAA 3S5QA 2VZOA 5FUNA 4C1WA 3RFRA 4KH9A 4O7XA 4Z82A 4XTMA 1CR7A 3OCPA 4FAHA 1DGWA 1WD4A 2D6OX 1AUYA 2OXBA 2ZGLA 3H1WA 5FZ7A 2VAUA 3PVEA 3RWNA 3VDBA 4AZZA 2E26A 3JD72 4RS5B 2VMGA 3HQRA 5FZCA 4DOUA 4J25A 4MHUA 4R9AA 2XBO1 2YU2A 1EAH2 4XJ8A 5FQ0B 1LRHA 2VMCA 4ZKTB 3H7JA 3RYPA 2VZ3A 1BBT2 4IGQA 1CAWB 2PA7A 2XKPA 3HN3A 3O12A 4NRMA 4IV1C 3SNMA 5G05L 4L92A 3GCWA 4D7SA 1CZVA 2WA4A 2HWE1 2YG0A 3LAGA 1MS8A 1W8UA 3LA3A 1US2A 4WVVA 3U4SA 2I07B 4LUMA 4ZXKA 4AHYA 1C28A 1WW4A 1A8DA 4RSUA 3LD8A 3U78A 1W0OA 1GNYA 3PL0A 4DY5A 1ONAA 3OD4A 4I3GA 1LR5A 2LS6A 2OKXA 2ET1A 1CAXB 1FYUA 5AC93 2FBEA 1MQTC 4EQVA 3KS7A 3O1OA 1H9PA 3LDKA 4OULA 3H9AA 3TB0A 3U37A 4SLIA 1I6XA 2WN3A 4LO8A 4QXHA 3OUHA 4XZUG 5F5AA 1OOPB 4XHXA 4BM8A 5IVEA 5L36A 4L11A 4W6WA 1U12A 2PLV3 3RS6A 1LOBA 1YO8A 3PU3A 3B9CA 4BQWA 4DUVA 2X8KA 1BHGA 1DHKB 4LPLA 1FMD3 1O91A 3ZDVA 2CGNA 4WM8A 1OF4A 3PMEA 1PO23 1WLTA 3O0XA 3SITA 4EN6B 1FV3A 1IKQA 4QQOA 1WCDJ 1ASJ2 2RR13 2YGMA 4XJAA 1HXS1 3MEPA 5LA1A 4KG8A 4CDXB 4JAAA 1VAKA 2TUNA 3WP6A 3KV4A 4FXKB 3U1XA 5FTTC 3VBHC 4CDQC 4QHOA 4G9SB 1XYNA 4LHSA 3HMYA 1MS1A 3IZOA 1HQNA 5JXIA 4AK3A 1AR93 3KSCA 1CZTA 2PYTA 2WNVB 4UWDA 2PAMA 3WF0A 3B01A 2F4LA 2XKOA 2P17A 2ZEZA 3THPA 5AC92 4AEDA 4CE8A 2QZ2A 5FOJB 2BWCA 1RUNA 1S0JA 2XLFA 1CAUA 1W2TA 1YI7A 5FZ1A 2P1BA 2WR9A 3V0BB 1C3HA 2VCBA 1OLRA 4GB33 4AL9A 3K4ZA 3M3EA 2VG9A 3WNKA 4BQ2A 4WVMA 3FUOA 3HQUA 3INAA 5IHRA 3U0ZA 2ILMA 2BVVA 1W2OA 1YLLA 4QPWA 2WQZC 5DG2A 3R4SA 1W3XA 1QXRA 1NT0A 1PO22 1QOOA 2ES3A 2JJ6A 2GSYA 4LTAA 2RR12 5IFPA 3N35A 1X8MA 1LOEA 2BV4A 2E9QA 5A3MA 2DU0A 2ENRA 5F3CA 1OD3A 2ZGMA 1W6MA 3TOJA 1OQDA 4GMP1 4HZFA 4RGGA 3HN1A 1VBB3 1X82A 4YVSB 2Q8CA 3BOPA 2Q8EA 3O7OA 1IPJA 3Q8CA 1AR92 1C4RA 5IT6A 4FPHA 5LW9A 1Q43A 5GLVA 1YQ8A 1LOGA 4GJYA 1KEXA 4Q0UA 4QMAA 1G7YA 1QH6A 1QJEA 4WZCA 2HWF3 4C8DA 1ODNA 5FFOC 3ZOIA 1H2KA 3K2OA 3O5SA 4CXWA 3ZSJA 2VTXA 2W9XA 1LHUA 4QPYA 3C3VA 2ARCA 4BZ4A 1TG7A 4COVA 3LZZA 2VMHA 3DN7A 4KGQA 4O9GA 1S0IA 1HN1A 1W6QA 4LKFA 4Y24A 1E57A 3BTXA 3D8CA 1GUIA 4GB32 1QY4A 4N90A 1RUF2 4P00B 1W6NB 1MPXA 4E2GA 1W3VA 3CO2A 1N1TA 3TYJA 3M1HA 2RS31 2VMDA 3EYPA 1U5YA 2WYSA 4HBNA 4CDUA 5A3NA 2XUEA 3I2IA 2WC2A 1D7PM 2BW8A 3A7QA 2QZ3A 4LHNA 2IC1A 5IVYA 2GNDA 5LA2A 4ITCA 4A6SA 2HYXA 3LPFA 4Y26A 4ZU4A 5I0TA 3ZSEA 5HCAA 5FYZA 3W5MA 4CYDA 4XQDA 2XXZA 2WQ4A 1MZ6A 3D0SA 4L8QA 3S6PA 1GZTA 3U4XA 5ISLA 1VBB2 4CU9A 4FOWA 2VCCA 4QKBA 4WVZA 2XR4A 4Q26A 3JD71 4AXOA 3DKQA 4NHXA 4ZHNA 4QU2A 5IK5A 4AEDC 5BNPA 5L19A 4ZXEA 1EAH1 4CCEA 2HWF2 2PN5A 3ACGA 5DZEA 5IW0A 4EN0A 3EBRA 2OIIA 1IS4A 4HSJA 1O7FA 5CAZA 5CFDA 2BNOA 2XG3A 4B8EA 4BLJA 4BPZA 3OD0A 1UX7A 3VBOA 1PGW1 1GOFA 2P3IA 3R0RA 5FV3A 2ZMKA 3DKWA 4C0BA 5FPAA 1PO13 3X29B 3SISA 2JIGA 4YVWA 3GZAA 3FWEA 3ZYFA 1W9FA 2JDZA 3FBYA 3B3QE 3N9PA 4L9BA 3QOPA 2B46X 2VNRA 2WFPA 1BJQA 1Q8PA 2JD4A 4PLOA 3E5XA 2OZ6A 5A33B 2VOTA 5I0RA 4Y3OA 1CWPA 4RFRB 3CLPA 2A5ZA 3ZXDA 4AI1A 3KLSA 3OYWA 4DXTA 3S30A 1IG0A 2ZX4A 4B7EA 1A6CA 4XACA 3P3NA 1Y9MA 5I0SA 1H8VA 1RINA 5FZOA 5FPLA 4D6RA 3N9MA 4GH4A 1EUTA 1GYKA 2ZX0A 1E5IA 3WXPA 5G04L 3IWZA 5T5OA 5D8AB 1G9CA 4QX3A 2CWSA 3VBUB 2FDKA 2JDAA 4HKWA 4K1YA 4PI0A 1G9DA 5FZAA 4SBVA 2A75A 1SLTA 3N9LA 2R043 3AXEA 4QB2A 1SQ4A 5F2WA 4LULA 5FZ9A 4BISA 3SKJE 5JIUA 1CPNA 3AMHA 4RHV3 4AGGA 1HN0A 1PO12 1UU6A 1RGSA 4LBQA 1D2SA 4G4FA 2XJRA 3DPRB 3VHRA 4A4AA 2XHKA 1QNYA 2DVDA 4HL0A 3VHNA 4CDUC 1KXGA 5J96B 4FPKA 1UMIA 4NE9A 3VD4A 4JRLA 1DQ6A 1GBGA 3UJQA 2OPWA 2W68A 4AGVA 2A6WA 1TMF3 2Z69A 4I02A 1RUOA 1H0BA 5AC91 3KT1A 5FK7A 5KC5A 1GOGA 4QXKA 1JZ3A 2ZKLA 1NZCA 2J1UA 4PF5A 2JDPA 4UW5A 4PI2A 3WW3A 1J3PA 5FDBA 1LU1A 1XNDA 4R8HA 4XF1A 3ZYPA 1H2LA 3VZMA 4I09A 4F7ZA 5BNPC 2PLV1 3VB9A 4NPLA 5LBEA 2DBNA 1XE7A 4PDWA 5M0TA 4KBZA 3VBSB 4XUTA 1RUG2 3FHAA 1RUJ3 2R1BA 1FMD1 5IAVA 5CFDC 2WINB 1VPHA 5A32B 4ASMB 1UX6A 2R042 2R7EB 1YHFA 3VBOC 4K8RB 3ZMOA 1PO21 5CB7A 2H0VA 1Z0HA 2RR11 4QKFA 3ME2A 1F4HA 1LENA 1YQCA 1JU4A 4RHV2 4YVWC 3EHKA 1AYM3 2W95A 3ES4A 4M3CF 4IEVA 4UXAA 1QOTA 5C3SA 1WD3A 4ZS3A 2BNMA 1UOGA 3SCGA 1QEXA 3KCCA 3HWJA 2BJSA 3N3HA 3WG4A 5EXOA 1AX0A 3Q8EA 3MIGA 1J3QA 4XUOA 3O1UA 4YM1A 5GZDA 1MEC3 1AR91 3UKTA 4Q4X3 1ACCA 2HWD3 3LFMA 2IZWA 1VIWB 4I2OA 1GZ9A 1DZRA 5A6QA 2GP5A 4FPEA 1HB2A 1S0FA 2Y0IA 4PBPA 3T3YA 3D3AA 4HG6B 1W6PA 4GH4C 2Y33A 3LA2A 1PVXA 4XURA 4XFFA 1FAYA 5LEJA 4FPCA 4F8AA 3K77A 3VKOA 1K5MA 2YB7A 4M4RA 3T2QA 1J59A 1HRV1 4GB31 2ZGSA 3ZMNA 4OZXA 4LK7A 1G6NA 2BP6A 2OX0A 2WT1A 2WUHA 2Z5WA 5J36A 1RUJ2 4BIOA 3PVNA 1C57A 1NCRB 5JXJA 1GP4A 1IQDC 1B35B 1VLNA 5GZFA 3UGGA 1UIKA 1NAEA 4XABA 4GMP0 3M7AA 4XZPA 2ZGKA 5FAXA 2OVUA 3VKNA 5IVVA 3ACHA 4V2VA 4XFIA 4G3YC 4BJ0A 2NMNA 1G9AA 1SACA 3RGBA 3OGGA 3E97A 2G1MA 5ACA3 2ZHLA 1OA4A 1ZZ8A 5C3QA 1SLLA 1VBB1 4HONA 4YRDA 1CQ9A 1JI6A 1GQPA 3OBZA 4AGRA 4AVSA 1O6UA 2W2IA 3MIDA 3UESA 2VPVA 1UY3A 2WNVC 1BMV2 4Q4X2 3VHPA 2BFUS 4E4SA 4Q0SA 1EV13 5A7SA 3PUAA 3DXUA 5EYYA 2IXIA 4XETA 2Y38A 3GBWA 2HWF1 4QPGB 5K4LA 4HPKA 5LBCA 3RNSA 3TN93 3LB9A 1J84A 1UN1A 3GM8A 4E4HA 5JMOA 3A21A 4PHZA 2WNEA 1W8WA 2ZAHA 3MIHA 1JZ7A 4UF0B 3ILNA 1W9WA 2C1FA 1RVF2 4FOVA 4J6GA 4MX3A 1NY72 4Y1YA 3WDTA 4PDWC 4RR3B 3T0DA 3ZN4A 4NOTA 1V00A 1DG6A 2BBAA 3O0VA 2DWRA 4FBFA 3O1TA 5CEHA 2VL4A 3IM0A 3WT3A 3MW4A 4PLMA 2WO2A 4CP1A 2D3PA 3Q9OA 2B5HA 3WHUA 4BMEA 2JG8B 2V09A 1CONA 2DCTA 5I93A 3VL8A 3V65A 5DUUA 5F3EA 2W1UA 1W6OB 1AYN3 2WWUA 2GMEA 3GBGA 4I3PA 4Y22B 3WLUA 3PUHA 1NA1A 4B3NA 4UFMA 2VVDA 5E1RA 5JCTA 3UV9A 2VM9A 4I01A 5DAXA 1JHJA 1QQP3 5KXEA 3KT7A 4FPOB 3CJIA 3EB7A 5EPAA 4TXWA 1YI9A 4P9XA 1ENRA 4YG3A 3T1MA 4COWA 4JGYA 1EV12 5LY2A 2HWB3 2JG9A 4URTA 4LK6A 3VDAA 1S55A 3VZJA 4CUBA 1MS3A 3TN92 4CU6A 3K4DA 2XWBB 3CZJA 3VN4A 2EF6A 1JMUB 4JDOA 3RZHA 2QJVA 1K5MC 1ZBE1 1YC61 1UKGA 3PMSA 1OF3A 2Q1ZB 1X7NA 5FZ6A 2BZDA 5GZEA 3ZYBA 5CKNA 3AP6A 5F2SA 2GMPA 2Y6HA 3ZN6B 1V6JA 1JU3A 1QJFA 2D44A 4BYYA 3LPGA 4FAGA 4AFBA 4BH9A 3AZVA 3SCHA 3T0BA 2ZMNA 2P6HA 4E8DA 4ES9A 3HJRA 4DIQA 1HJGA 3D82A 3OTFA 2Q8DA 5C3OA 2BEOA 1BXHA 3ZIWA 1GANA 2NQYA 4M0NA 2DVGA 3VZLA 4A41A 5C4WB 2HBUA 2QTWB 1AYN2 3AXDA 1REEA 1G86A 2I74A 1DQ4A 1JYIA 4FSJA 3ON7A 5CU1A 3H1YA 5KHGA 2XL7A 4XJ9A 3OY8A 4Y4YA 2IXCA 2R073 1JOBA 1R093 3RZZA 4YZ4A 1S0GA 1QQP2 3EQEA 3USUA 4HVOA 3VZOA 4BQ5A 4LE3A 3KV9A 3I54A 1QJX3 4K3UA 5CYYA 2XQXA 3MO4A 1RUD3 1RIRA 1VBA3 5E8AA 3WW4A 3O1PA 3J7HA 3OGRA 3Q8BA 1RXGA 3ELNA 4LHKA 1SLAA 2R063 2DUPA 5C3RA 1JZ2A 1PMIA 4R4ZA 1LNSA 1M4WA 2R041 1H1AA 5FJHA 2E7TA 4QQHA 5FK8A 3GHNA 1UZWA 4XDQA 4Y20B 5H9QA 1ENXA 2OUJA 4Q4V3 1VAMA 3AYEA 4RHV1 1C1LA 3CHXA 4IEXA 2EXJA 4B29A 3BTZA 5JI9A 1ZRCA 3FJSA 3APBA 2YBKA 2WT0A 4YNIA 1F4AA 2Q8OA 1KITA 2BFUL 3AMPA 2ZGOA 4GQ7A 1JBCA 1TME2 2VU9A 2WNUA 3T2TA 2VULA 2VMFA 2WYFA 3BGAA 3EMRA 4S2FA 4LNVA 4CEWA 2VNGA 2A3YA 4XFBA 2OQ7A 4JTNA 5DMYA 1TMF1 3CDZB 4XF0A 3VD7A 1NA1C 1XNAA 1ZA4A 4D7TA 2KM2A 4N9IA 4IE0A 1QF3A 1OA2A 3M2MA 2P3YA 3IDBB 4R9CA 5FZFA 5LASA 4E2QA 1NCQB 3CJIC 1R092 1YFYA 4META 5BY5A 3LEIA 5FYUA 2ADDA 2QDRA 1ZBA3 5D8AC 2WSVA 3PHMA 1W2UA 1UAIA 2W94A 4JGYC 2JG9C 3VBUC 3CU7A 5EQUA 3VKLA 3IBMA 2CHHA 1RUD2 1VBA2 2GC0A 3MYXA 4OVEA 4CP9B 2XPJA 2YFUA 3BIWE 3AFGA 2R062 1W8ZA 4DEQA 4LO7A 5EP9A 2QQMA 1LESA 4J1XA 4RL7A 5ABJA 2KD7A 2XLGA 5JOXA 4PF1A 1C5HA 3PUSA 3TNQA 2PXJA 4CCNA 1G9FA 4Q4V2 4Q0PA 1AYM1 1GZCA 2OS2A 4NHKA 3U11A 2ZTNA 4QD2A 1C1FA 5EFUA 4D94A 5FCCA 5IFTA 4OI2A 3K4AA 4CDWA 3AP4A 1HRI3 1SFNA 3NJYA 4LORA 5AFBA 4LE4A 5C8CA 4FXGB 4YWAA 3PUQA 5CFCA 4BA6A 1VBC3 1BMV1 1MEC1 2K2SA 5H9RA 1KGYA 4Q4X1 4E9KA 2HWD1 3MUZ1 1PVC3 5FREA 4FPGA 1SPPA 2DFBA 4L97A 2J42A 2EICA 3V0AA 2YXSA 4EROA 1LGCA 3SQOA 4AF9A 3IDEA 4CXYA 1OSGA 1YYNA 1W2NA 4IV1A 3C8XA 3OGSA 5E88A 4H2AA 5GLTA 3WUCA 3AVSA 4FQZA 1XNCA 3SH5A 3J8F3 1QDOA 4JCKA 4AVTA 5DN2A 4QKNA 3PVOA 2OYZA 1V9U3 1X9PA 1R64A 1ND2B 3ZKYA 4S2HA 2FCTA 2VOKA 1D4VB 1JYXA 1GICA 4BK4A 4IV3A 1N1YA 2ZXQA 3K75B 5FMCA 2G9FA 5B4XA 3ZFGB 5LEKA 4QM9A 5CKQA 2VW1A 2R16A 3S57A 3QH7A 5FP7A 5C71A 2YGLA 4MG2A 1LHWA 3T2OA 3D0JA 4M3CB 2I45A 4QHZA 4RYDA 1L7RA 3B94A 1FV2A 4R4XA 1IZ3A 1OHFA 3LSDA 4XJWA 5ACA1 1GMMA 2F17A 5T55A 3ZIXA 2PHLA 1HQWA 3U07A 3H7YA 3IPVB 3MLLA 3ACLA 3J4UH 4OQ9A 1PNGA 4AQ2A 1E5HA 2WO1A 1VBC2 3KCXA 1AXZA 2C4XA 2WFF2 4BWOA 1LHVA 3VZKA 2DU1A 3G7DA 1O3QA 4JGZC 1EV11 1KD7A 2XOMA 4N9HA 4XEZA 1BBT3 4NR1A 5E16A 3SKVA 1LOCA 5KHIA 1WCKA 2YBSA 3H1MA 4LXLA 5KWRA 1KRIA 4LO4B 4LR4A 3TN91 3O1SA 1FT9A 2LW8A 3WG2A 4N8MA 4IEPA 3CEWA 1T6GC 2R1DA 2ZX1A 2GC1A 2VGDA 1OLME 1GZWB 1WLWA 3J8F2 2FHRA 4UOJA 3VBRB 4A45A 4C91A 2VJXA 2Y6LA 4TTGA 4FPJA 4CDQA 1UF2C 5GLZA 4S2GA 4AVCA 2W87A 5FRAA 3ROUA 3WCSA 4Z8BA 5ABJC 1EYBA 3NNFA 2CAVA 3I59B 4H7MA 1D0GA 2VZQA 1IPKA 2EA7A 1CPMA 1RHI3 1Q5OA 4LBOA 1AYN1 5IVFA 2ZX3A 4BE3A 4QT6A 5HCBA 4CDWC 4NAOA 4IDZA 4CRQA 1L7LA 3POGA 5HCFA 3ZFEB 5C8CC 5CFCC 1HV1A 2VE1A 4E4DX 5A3WA 2G19A 3AK0A 3KMHA 4K8FA 4FFFA 1QQP1 5T5JA 1W8TA 2C0ZA 2W92A 3BU0A 1V0AA 3MF9A 1GKBA 3M8LA 4IUGA 3H3ZA 4QPIA 4KBBA 2HWB1 1GOHA 5FZMA 5F6LB 3I2HA 4IE4A 1ASJ3 4WM7B 3LDBA 4ARXA 5FPXA 5FBJA 5A80A 1FPN3 4D69A 1GLHA 3SXWA 4QQ2A 4LA2A 4K6BA 2PHUA 4IXLA 3AX4A 4UFLA 3ZLIA 3ZN5A 3AZYA 1ZZCA 2QQWA 2D3RA 2C6SA 3BTAA 1T6BX 1SZBA 5B4NA 2VBBA 3NNJA 2ZEXA 2VBDA 4IV3C 4V2WA 3ILRA 3MIFA 1OPOA 1Q8QA 2CNAA 4S2DA 1ND3A 1SLBA 1UU5A 1K45A 3OGVA 1S4CA 2WJSA 3WUDA 1H2NA 2VOVA 5BNNA 5JPNB 1RHI2 4D6SA 3NSTA 1V6OA 3K51A 3N7KA 5FR3A 1S0DA 2VUJA 4CCDA 1APNA 5C9AB 2D5HA 3LFIA 4LIVA 2R071 1R091 2CYFA 4AG4A 2AC1A 3NJVA 3ZXGA 2O8QA 3QBQA 2CTVA 1WW6A 2JWPA 4DPNA 1QJX1 2XHNA 5HCHA 1RUD1 4TWTA 2X5IA 3KVBA 4OUEA 3RZLA 2BGCA 5FZ8A 3H42B 4XW3A 2ORXA 3AYAA 3AZXA 2R061 2WZEA 3AP5A 3B02A 4Y5SA 2V4VA 4AAXA 4KGGA 1MACA 5CG8A 3NO8A 3WD5A 4XILA 2FZ1A 5JZGB 1FPN2 3VZNA 1DCSA 5A7WB 1RJ8A 1DDLA 2FMDA 3EO6A 2CAUA 3WDWA 4ISRA 2GALA 4Q4V1 5DAPA 3B7MA 3IIIA 4GULA 1SEFA 4N43B 3ZXEA 5J09A 3K3NA 4K7JA 4COZA 5CG9A 1JOJA 2CU5A 4INDA 3PUIA 3JZVA 2IWGB 1PK6A 4JHZA 1QJY2 2EAKA 1OC1A 5FUIA 4B7KA 3TNPB 5C4WC 4GKYA 5JSOA 5LWBA 1ZZBA 3PIGA 2XJTA 3ZFFC 1IS3A 2J1TA 1Y9GA 2PELA 2L9LA 2JKXA 3WVJA 1AXKA 1NLRA 2RE9A 1ZM1A 2D6LX 4BU2A 1RUF3 3BU7A 1ZBA1 4QPIC 3TEYA 1L7QA 3ACIA 3FLPA 1S0BA 4FOYA 4TZDA 1OFSA 2A6VA 5GZGA 4KWKA 3SLIA 4F3JA 1VALA 3WF1A 4H3WA 2GH8A 3FHQA 1LOAA 4Z1VA 4N53B 1Q8VA 5EHDA 4FPLA 4EZ4A 1X36A 2VCMA 1CIWA 1GWKA 4CXXA 4Z92B 4CUGA 3MV01 2IFRA 2VQ0A 3LEMA 1ULEA 3M3OA 5FWEA 5JSPA 4CCCA 1H9WA 4A2UA 3RZJA 2WDBA 3I3QA 3OUJA 1O5LA 3CKHA 5FY1A 4LIUA 3WOGA 1XE0A 2GNTA 2JDYA 2P4EA 1RUC1 2UYAA 1V70A 1UYXA 2RM21 1C8NA 2VZSA 3C7FA 1ND3C 3KD4A 4XBQA 4AQSA 1HRI1 4AI3A 2YC0A 2O14A 4TYSA 1AJOA 5BPXA 3I8TA 5T50A 3VDDA 1VBC1 1EPZA 2VTFA 4LKEA 5BNNC 3IKWA 5D2AA 2AZ5A 1ZZ7A 1PVC1 3LIHA 3NJZA 4FOQA 5LA0A 5FY0A 4OHYA 4HSLA 3NQHA 2VW0A 3CBNA 4MOAA 3DV8A 5FP4A 3H8XA 5DAWA 3E6DA 3ZYIB 3M3QA 1MS0A 2W3JA 5TSWA 4JZRA 2X5IC 4GJZA 5FYMA 2K0GA 5L7OB 3AKRA 3HBKA 1V9U1 2CGOA 3PU8A 4TLFA 3WW1A 1EY2A 2BU9A 2UURA 2DUQA 5FYHA 3TEXA 5KR7A 4OUMA 3VBFA 2VOWA 1O3TA 3KVAA 2WWJA 5F1RA 1OVSA 1PHMA 3NV4A 1UIJA 2XJVA 3RI8A 3WG1A 3T4VA 4CEYB 1WW5A 4YGBA 1HW5A 3R6SA 2C24A 4QXCA 4QX5A 2A6YA 1NG0A 2MHFA 2RJLA 3WINE 2V5DA 4DUWA 1AX1A 3ETPA 1PIV2 4BDVB 3NV3A 2XLAA 1JYNA 5CZKA 2E6VA 1JYCA 2ZMLA 1NXMA 1OKOA 1PK6C 5FZLA 4BQ4A 4DZGA 1QHDA 4RS5A 3H3LA 3URFA 3E6BA 4HVQA 2RMU3 5FQ0A 2R0HA 1DGLA 4K1ZA 2H0BA 1BBT1 4ES8A 5A7NA 1CAWA 3UYJA 3IMMA 1ST8A 3GDBA 4OHWA 5EYXA 2LROA 4PQQA 3T09A 1U5IA 4H14A 5CIRA 1AR73 3HBZA 3PJYA 2ZOEB 3KF5A 5I91A 3SEEA 1XU1A 2C5DA 5IYYA 4AFCA 1LHNA 4Y5TA 3U75A 2YV8A 1A8MA 4XF3A 3MLJA 1MZEA 5GALA 4JVAA 5FP8A 2A1XA 2E63A 3NAPB 3SMHA 2B4KA 4MZUA 3CQOA 4WVWA 4I0WB 3E1F1 1BLZA 1ZYBA 3IDAA 3V56A 1F2NA 1DQ2A 2RG4A 4MYEA 5C33A 2Q30A 1UY1A 4W8JA 5CISA 1RHI1 4CUCA 5LRRA 1BYHA 1JZ8A 2UYBA 2J1VA 1OOPA 4CP2A 5FZKA 3P6BA 3VDDC 3VD9A 3AB0A 4GKXA 4IQPA 4A44A 5L9VA 5A1FA 1ULDA 4AVAA 3IT8A 4MLOA 2VVEA 1RUG3 4HN1A 1AR62 3WCRA 4LT5A 3ECQA 1OMIA 4BHPA 1ODMA 1VMHA 2RMU2 3UGHA 4Q29A 1UCXA 1YIFA 1UOBA 2MEV3 4MXVA 4XUQA 5FYIA 1ASJ1 3FFZA 4UFKA 1AR72 1RXFA 1GU3A 3JB8A 4CCJA 5E6HA 4AEJA 5BV6A 4KWJA 3WF4A 5DUVA 4CDXA 1V6NA 1GSLA 2V5YA 1W90A 1H8TB 4Y1UA 1A3KA 1GWLA 4GWIA 4KMQA 2A3WA 2H6BA 2NN8A 3NJXA 3VBFC 5K7PA 2CGPA 1PM7A 5JVVA 1UZVA 5HBAA 4PIYA 4QU1A 4Q0QA 3AYDA 3T0AA 4LUKA 2WNVA 1JH5A 3H8OA 4MGSA 2WS93 2EIEA 3J7MA 3BPSA 3A0NA 1RTVA 2J7MA 2XONA 1C8M3 4D8MA 1OBNA 3AL6A 3B9IA 3ZFEC 3O0WA 4YARA 2JE9A 3JQXA 3N36A 4PCRA 3V0BA 2YFZA 5L73A 3WF3A 5KBFA 4RS5C 4QQPA 3MHZA 3NNLA 4YW1A 2W0XA 4LMFA 3A22A 3BUCA 4MXWB 4KG0A 4GWJA 2HJIA 5J7MA 3RZGA 4HN0A 1OLQA 1RUE3 4LOSA 4CZSA 4WM7C 3WDYA 1O8PA 2MEV2 3ZYJB 2X53S 5JSRA 1OQEA 1SG3A 1VBD3 2UWCA 4ZZ5A 1OUXA 1W9SA 5FMOS 2YC2A 3RQ0A 1LOFA 3BVCA 2ZPXA 4QHBA 3PURA 4QDQA 2VCAA 3WNOA 2ARXA 3KF3A 4I0BA 5FZ3A 2CY6A 1N1VA 3P1IA 3WNPA 4YVSA 3VV1A 2WRAA 3ILFA 2P2KA 2ZKNA 1W8OA 1MS4A 3NV1A 2WS92 2H6CA 1UPIA 1KFUL 2XGXA 4Q4Y3 4AHWA 1NQJA 3B69A 3R4DB 1C8M2 3AP9A 5FO9B 1OOPC 2PHRA 5JIAA 2OT7A 1RVF3 5A1LA 1CESA 4RN5A 2XVGA 3PTYA 1HLCA 4LJHA 2QNKA 5FY4A 4NN0A 5FPUA 4AE2A 1RUF1 3GBFA 4TLGA 1LODA 2Y6FA 2ERFA 1XNKA 4K20A 3V64A 3Q8AA 1SHWB 2W08A 1JTZX 2BUKA 1W6NA 1RUE2 4M01A 1ULCA 2D40A 2ZAAA 5JZGC 1KFXL 2DCJA 1DQ0A 4W6YA 1DYOA 4DXRA 4CDXC 1VBD2 3VD5A 1E5SA 3E6CC 2YPDA 1SBEA 1TNFA 3L2HA 2VD7A 4AEKA 3RG0A 5FYVA 2DTYA 1WGPA 3POEA 1RUI3 1WLCA 2C9KA 4X8PA 4P14A 2PFWA 1W2AX 4H55A 2ARBA 3NV2A 3QCWA 1IPSA 4YM2A 5FKBA 2D5FA 5F5IA 4WZFA 3SH3A 4FO9A 3ZYGA 2A6ZA 4K40A 3I3BA 2YDEA 3W58A 1BZWA 1KDMA 4C1XA 5KXCA 4JKKA 3W21A 2RDNA 4HXCA 4QDRA 4Q4Y2 4CP0A 1DYKA 1FNZA 1ZZ6A 4Y5Z0 5F3IA 2UU8A 4HKOA 1QJU3 3CMGA 2WZR3 4XPVA 5DZFA 3N9QA 4OMCA 4ASLA 1VBE2 1FOD2 2PTMA 3B93A 3OPTA 5K0UB 3GJBA 3VLBB 2RV9A 2O1QA 4OZOA 3IB3A 2ZA9A 1P8JA 1RITA 2A73B 2WWSA 4UFJA 3T2PA 4B4QA 4UFIA 5FPVA 3ASIA 5DDJ3 1PNFA 5FXZA 1H30A 3UJOA 5FXXA 2GMMA 4K9SA 3J7LA 2KA3A 4N53C 1O5UA 4JRAA 4XMIA 1B09A 4OMDA 1Q56A 1Y3TA 2Z42A 1XJAA 5A33A 1CX1A 1PX4A 5FP9A 4AW7A 4NIIA 1LOFC 3RZMA 1CAVB 4W6XA 4NIHA 2RS53 4Q5OA 2BWAA 3WY6A 2C9AA 1GFF2 4HMZA 5JWPA 4PIXA 3PNAA 4UW6A 4YVSC 1RUI2 5I8SA 3RSJA 4AWDA 4LBNA 2A7AA 2RS12 3ZSKA 2IVIB 1TZOA 4PLNA 2ETEA 2ZABA 1LEDA 2A3XA 4AYUA 2WA3A 5HV0A 1SDWA 5D8AA 5A7OA 3VBUA 4JX0A 1MVEA 4BQYA 2FZ2A 1NUKA 1S2KA 1WKYA 2GAUA 4KU8A 2RMU1 4L2NA 1CGPA 3R05A 1UWWA 5FMOL 1DLCA 1MQTB 4R9DA 1QJU2 1SBDA 5LA9A 1X9TA 1TE1B 2WZR2 3C7OA 3KQRA 3SCFA 1ZRFA 4XXAA 2N7GA 1AR71 5A3OA 3FLTA 2JENA 3I4IA 1PO11 2Y26A 2ZCWA 4OQ8A 5JXGA 5I8YA 1C5IA 5L9RA 5B2GB 2HEYF 3DPRA 1MR5A 1AXYA 1TME3 5DDJ2 3HT1A 4M4PA 3T4HB 1COV2 3MF6A 2D6PA 4RQPB 4A3XA 2W52A 4MADA 1SLCA 4JV4A 1BCXA 4AI8A 2JEMA 4E27A 1IQAA 1UZYA 1S0CA 4NIDA 1F8VA 4CEYC 3ZSLA 4YM0A 5JOWA 2J1EA 2RS52 3E5UA 3T08A 4BXSV 3ZM8A 2WZPP 1KDKA 2IFWA 2FDHA 4XIOA 1STMA 4FCAA 1NOVA 5DXDA 1NKGA 4UBGA 2VW2A 3SHRA 2W46A 3FHIB 5KXDA 1JODA 1LULA 4NJ4A 4ET7A 4BOWA 5F5CA 4CTEA 2PQQA 1W04A 1YQ6A 1H1IA 3VBHB 3WSOA 1LGBA 5BNOB 3IN9A 1POV3 3GZUC 3J7NA 5LZ6A 3MIEA 3ZXLA 1CJPA 4QDSA 3DYPA 2JIJA 2W1QA 1DYPA 1RUG1 3C2UA 4Y33A 5FYYA 3RYKA 3VBSA 4E2SA 2BTVC 4LA3A 5BUVA 5FZ4A 1ALYA 3AKTA 5A32A 3JQWA 4CA9A 2MEV1 3HVDA 1Y43B 3ORJA 4LLFA 1XYPA 1YIPA 1XPWA 3MICA 2OA2A 4DUXA 1QH7A 4CU7A 4LQRA 1BKZA 1H2MA 1ULOA 2K9ZA 1OH4A 5FIXA 5EJZB 2RVAA 2VZ1A 2XBO2 2G9ZA 4MV2A 4O9EA 3AKQA 3NAPC 3N9OA 4MGTA 2UY9A 4MGZE 4IEUA 5IWFA 2ADEA 5A70A 3MIBA 4IETA 4NPMA 2DUOA 2PAKA 3NNMA 5F6KA 2WS91 4JKMA 4JDNA 2V72A 4L99A 4RGAA 4XVHA 4JGZA 4KU7A 2HWE2 2W39A 1XNTA 1C8M1 5IVCA 1ZA7A 1SFYA 3PDQA 1WMEA 3DCQA 4QX1A 4YG0A 4DXSA 2NP0A 1KS5A 1ENSA 1V6LA 5CVRA 4EE2A 3ES1A 2GDFA 1BK1A 2BGOA 4BB3A 1QDCA 2ET7A 4ARYA 2GC2A 4LBMA 3ZO0B 1HB1A 2D7FA 1RUJ1 3QD6A 4NWVA 3ATGA 2WLQA 1WMDA 5C3PA 4AOCA 2A71A 2BDRA 3MLKA 1NCRA 3UKVA 4CCLA 1B35A 1RUE1 2DV9A 4WV8A 1DGRA 3AJZA 2KR2A 5FPZA 3GZTB 2DVAA 3NMBA 4F83A 4O61A 1VBD1 2Q4SA 4XBLA 1JYVA 1VMJA 2OUHA 4KNCA 2IXLA 3BKZA 3DPRC 1JW6A 4KWLA 1K42A 2VUDA 1UY0A 1ULFA 1UPSA 3HD8B 5FZ0A 3AP7A 1G9BA 3JBG3 4RGKA 1W0NA 4WM8B 2WFF3 3ZX7A 1DQ5A 1R1A3 3HOBA 1MZ5A 3CZUA 2D98A 5FP3A 2ZGUA 1Q8OA 1I9RA 3OEBA 2Q1FA 5ANNA 2DTWA 4P9GA 4BQXA 4Q4Y1 4QPGA 1JUIA 1JUHA 3LOIA 3TBDA 2PQSA 2AUYA 3GZEA 2HKXA 5HXMA 3MZHA 1KJLA 4OCTA 5H9PA 3AMNA 1QJZA 4V1PA 4YW7A 1F35A 2J1RA 1IGOA 1RVF1 4UF0A 1NY71 4RA0A 4A7YA 1VJ2A 2ARAA 3WP5A 4XHBA 2B39A 4FVVA 4QWNA 4RR3A 3VBSC 1M06G 3WQ7A 3RWKX 1BVVA 3DECA 1D4M3 3NRUA 3HR9A 3ALQA 4AEDB 1LKNA 1XSRA 1GR3A 4CUAA 1NX9A 2WZ8A 4D7YA 5IK8A 1CAUB 1HJFA 2JG8A 3LEGA 2ZHMA 3KV5A 4Y1VA 4XCAA 4Q1RA 4ZZ8A 4PQ9A 5K9YA 2AYHA 2HEWF 3H50A 2ZGRA 1W6OA 2WSUA 2CV6A 1Z7S3 1JN2P 4E4ZA 2HH9A 5LBFA 1R1ZA 1REDA 4WVMB 3WG3A 5C70A 1PZ9A 4BQ1A 4PT6A 1Y4WA 3WW2A 3JBG2 3LSEA 1I5ZA 2WABA 1XRUA 5HI0A 3N4MA 3OBRA 1XSQA 1WW7A 4LHLA 4XQWA 1R1A2 2QQNA 3BOWA 2D6KA 4XBNA 2FCUA 4P9LA 4UW3A 1DZQA 5A3PA 1TEIA 5KHKA 1ZVFA 1OKQA 1SLIA 1U5ZA 3POYA 3ZKUA 3I7DA 1W6MB 1POQA 3TEWA 1DZTA 1GQGA 2UY8A 2WZR1 3KGZA 4XE9A 5SV8A 2ORZA 2ZEWA 5C5TA 1PZ7A 1N3OA 1CX4A 2B8MA 2YBPA 3RYRA 1FI2A 2HBTA 4OHVA 3POSA 1GNHA 1ZRIA 4LBLA 4XAAA 3J26N 4Q27A 1GWMA 5JUVA 4MGKE 3ZN6A 3H8RA 1D4M2 1NCRC 3B00A 4LKSA 5DDJ1 1B35C 5FLHA 3SC7X 3BI3A 3C7GA 4FPYA 2BOIA 3H0OA 4JDMA 3QACA 1YCIA 5FZEA 4CPBD 1YWKA 2AH2A 4YPJA 2VBPA 2B7YA 3RPQA 1IS5A 2GN3A 3OG2A 4D0QA 5HPOA 1W6QB 3ENRA 4KL1A 2DYCA 2XJPA 4XF9A 5C4WA 2RS51 1OURA 4MUVA 1MS9A 1XC6A 4J1WA 4EN9B 4YSFA 2YZ4A 1Z7S2 1AR83 3GF6A 3ZFFA 2JDKA 1FX5A 1UQXA 5FO8B 2DCZA 1UZZA 2GNBA 4QX7A 4NIGA 1OI6A 1UMZA 1ZRRA 1AJKA 2Z79A 4X6RB 2B42B 2RS32 3ETQA 1Y9QA 5FYCA 2R49A 4AAPA 4CDUB 1WUVA 3DF0A 5IVBA 2YUEA 3S5AA 4QPGC 3POJA 4QGMA 5KHHA 2GNMA 3LQCA 4Z07A 1VAVA 3CL1A 3UK9A 3AKSA 2O8OA 3I2KA 2J22A 5K0UC 4Y20A 4RR3C 1UMHA 4OFGA 1FATA 3VKFC 1S2BA 1VB2A 1E5RA 2ZZQA 4D6QA 2TBVA 2WO3A 3PTRB 3OEAA 5FY7A 5BNPB 4UYBA 2JDMA 4GAZA 3WNLA 1CJDA 4EWEA 3TRSB 4AQ6A 1TME1 2JG8C 1I5PA 2GU9A 4K21A 4NRQA 1AVBA 1F5JA 1QJY3 1RYYA 5APAA 3THTA 2Y0OA 5J3UA 4GWMA 5FXVA 1JZ4A 1PZ8A 5CFDB 5GJ6A 5H9SA 2BOJA 3VBOB 3TAYA 4GIQA 3ZVXA 4XAEA 2X09A 1PGW2 1N1SA 3BPZA 4IERA 4EJRA 2JE7A 5CKMA 4XFGA 3KV6A 3ZXAC 5GM0A 4YVWB 1AR82 1F9KA 1SBFA 2PAEA 2VTXJ 1W05A 3AL5A 4BMBA 1NCQA 3BTYA 1LHOA 3MV11 2Y6KA 4EYUA 3MFCA 1W03A 4NRPA 3VHOA 3WDUA 1POV1 2W47A 5FUPA 1UOJA 1HX6A 2RDRA 1VBA1 3RRDA 3T30A 3JU9A 1EP0A 4CP9A 1JOPA 3HNMA 3OYWB 4TN7A 4IE7A 2W1WA 3MGUA 4B4RA 3MW2A 2EVXA 5FXWA 3G6JB 4XC9A 5A1AA 2AENA 2JB8A 2XVLA 3FL7A 5FZOB 3WR0A 5A6XA 2X29A 1W39A 4GH4B 3WNMA 5T3NA 1MZFA 2NLRA 4JC1A 5J1XA 3FBMA 4NHYA 1UXXX 3VD3A 4XJUA 1D2QA 2QQKA 5A7PA 3ZSMA 5DAVA 4XDPA 3RZKA 3GGLA 4RQPC 4BK5A 1Q3EA 1IG3A 4XUPA 2OZJA 2IUWA 4AVBA 2WKKA 2FCVA 1OPMA 1YQ2A 1QNWA 1XNBA 2GZWA 2TEPA 4LKDA 4YZ2A 5KHJA 1O3RA 3GNEA 4LITA 1IOAA 1ULGA 2FMYA 4LBQB 4YGDA 5FLJA 4CU8A 1O59A 3NVCA 4FP2A 3BB6A 1TQ5A 1IKPA 3U10A 5BNOC 3AMMA 3W9AA 4NROA 1DQ1A 4P9JA 2F4PA 2VZRA 3MI8A 4M0HA 4AQTA 5IJRA 1LCLA 5FKCA 2OQ6A 2YPJA 1H6XA 2DVFA 1PX3A 2QCSB 2VZUA 1W8NA 1ND2A 3H3UA 4OHXA 4ORFA 5FJKA 5F32A 3WEZA 4YFWA 3VUOA 5DZGA 2IXJA 4GALA 1LEMA 2VUAA 5FZIA 3UETA 3ZFGA 3AFKA 3USSA 1GV9A 1WCQA 1X50A 2KXLA 4HOOA 1US3A 3FLRA 1UYPA 2BRTA 3GHMA 2RDQA 1JXNA 2WAOA 4KQ7A 2WAAA 1K5JA 4M3CA 4YM3A 4YZ1A 5J37A 2ZEYA 1PIV3 2PLV2 4HT1T 4DS0A 1UL9A 1HRV3 2EIGA 2DURA 2V73A 3F95A 4P5YA 4P9YA 3AZWA 4PDWB 4I0AA 5DABA 5JI7A 4ZU7A 2IXHA 4M00A 4W65A 1WBLA 2CL2A 1FMD2 3JBG1 3IPVA 3ZPOA 1AZDA 2WFF1 2XDVA 1HDKA 4YW5A 4BXFA 1R1A1 4Y1XA 2UWBA 3LDRA 2YY1A 4ZPIA 3L2YA 1AHSA 4A42A 3KHCA 1XQNA 3BIEA 4Q4W3 4W50A 4M3CE 1NCQC 3NL1A 3PVBB 4OI0A 2FQPA 1V6IA 5FZDA 1HB4A 2QUOA 4EV0A 2VC9A 3VGIA 3J8F1 3KGLA 4R9BA 5AFEA 1GZWA 4I30A 4XQ4A 3VBRA 4AR2A 4IEYA 1UYYA 1VB4A 4C0HA 3FZ3A 1JHNA 4CCMA 5EWSA 1NLSA 4AFMA 4A7ZA 4DO0A 3WHTA 1D4M1 4XYXA 1UW8A 4LO5B 1AL23 1WWYA 5JR7B 4AI0A 3DYOA 1W28A 3CIHA 3LIGA 4URAA 1OQ1A 2FD8A 1W6PB 3OBTA 4ATEA 2AGSA 2VQTA 2JECA 3HNBM 2VUCA 3I59A 5IVJA 5A6ZA 1UY4A 5I0DA 1EUUA 4JKLA 2D93A 4EN8B 4QX0A 1K5MB 4HKLA 4OLLA 1Z7S1 4IGPA 1HRV2 2VZPA 1YJLA 1LAJA 1N47A 3ZFEA 1TNRA 2EALA 5EJ1B 5ANQA 1JZ5A 4WM8C 4EWDA 5HV4A 4P9IA 3W20A 3QLQA 4U36A 1AR63 3UKNA 3MPPG 2PHWA 1FNYA 4DB5A 5GZCA 2QQOA 4AI9A 4CSWA 2AACA 3HPNA 1QXPA 3THCA 1IS6A 4CVUA 2XVKA 3W59A 4Q4W2 5CADA 1RMU3 4WM7A 2WQ8A 1YUDA 1UZ0A 1VR3A 1YFUA 2IVJA 2Q1MA 4AEMA 2FDFA 5BYNA 4XDOA 5F9TA 1OA3A 5FZBA 1W8FA 4Z2WA 2R6QA 2W91A 3AC0A 1ND2C 2AEZA 1OUSA 1Z78A 2DBIA 3KT4A 2XJSA 4XXPA 4QQLA 3RDIA 3ZPYA 3R4UA 3ZFGC 1AL22 4HPKB 1UOFA 2AREA 3S7EA 3WX5A 2E7AA 3IIAA 4MGYE 3Q8FA 1S1AA 1HB3A 2D6MA 2XH6A 3FN9A 5C8WA 1CAXA 4B4PA 3M3IA 3CNAA 2DVBA 2AEYA 1ZBE3 2J1AA 2Y34A 1WCUA 1UNBA 4UBHA 1J3RA 1RUH3 5JAXA 4X8NA 5C9AA 1YXWA 1AR81 3JXSA 4UAPA 2G9GA 4UT5A 2XJQA 3C7HA 5LBBA 2ZBJA 3QH6A 2NYYA 4IE6A 1PGL2 3RJRA 2JD9A 5KXBA 2R0FA 4IEZA 2QQIA 1UXZA 5C7GA 1XB9A 1GNZA 2RDSA 1XE8A 2VO5A 1ZRDA 4W4ZA 4DEVA 4NPRA 3LKJA 1CZSA 4OI1A 5GLWA 4IL7A 3UT0A 4DFSA 4DRVA 1NA1B 1RMU2 3DGTA 4BIFA 1ZZ9A 1FPN1 2WBKA 2Z2SB 4QX8A 5FO7B 5JZGA 5IK7A 3I2OA 1BVP1 3DXTA 5A7WA 3LA7A 3VBRC 1JS9A 3RJ2X 1J58A 2HLEA 5F39A 4TSVA 3CJIB 3O1VA 3I2JA 2E32A 5C6CA 4P08A 4YW6A 2PHTA
chains in the Genus database with same CATH topology
1U5XA 2JICA 4JGYB 1WA4A 2QVSB 3KB5A 2GN7A 2JG9B 4N43A 3LCPA 1O4YA 1MS5A 3ZXGA 1V6KA 5AVAA 1ENQA 2E51A 4C90A 1QJY1 4XFAA 3AZZA 1H4GA 3FC0A 1KJRA 4XF4A 5EV7A 3FE5A 1ZBE2 1A78A 3RMXA 1POV0 3WP4A 3GYDA 1RUH2 2ZGQA 1O3SA 4FQ4A 2BPA2 4MH0E 2ZHKA 4IEQA 3NKGA 5LK5A 1GQHA 1XYOA 3T1LA 1NQDA 3BODA 1G8WA 2ZJCA 1QU0A 2DCKA 4DY3A 2I2SA 4DQAA 3O14A 2WLPA 1XU2A 2VH9A 4N53A 2NZ9A 4MGIE 5JDBA 3OY8B 4ISQA 2IXKA 3ZYRA 2VY0A 4XIKA 3USUB 3S0MA 1D0HA 3VKMA 3EJKA 4IESA 1CVNA 2VNOA 4FP3A 2PHDA 5JOZA 3AJYA 3OF1A 3D6EA 4GXLA 1QOSA 2VQAA 5SV5A 4BLIA 3TWIA 4U2AA 4H7LA 5C9AC 3DUIA 2WL1A 1VBE3 1FOD3 1O4ZA 2B45X 1UD1A 2EXKA 1U0AA 3B5LB 1NYWA 2WNUB 1L3JA 2MPFA 3EXUA 4YGEA 4YG6A 4CEWB 4Q8KA 1YFWA 1HQLA 3HIFA 3WQ1A 4NVPA 1H1MA 2NM1A 5L7OA 1RJ7A 1X33A 2D97A 1TMF2 3WQ0A 4JGZB 5BNQA 3RI9A 2VMIA 4XFCA 4YLZA 2R32A 2ZS6B 2Q5TA 4NWWA 1X8EA 3KM5A 1QXJA 4CEYA 4N43C 3A0KA 1PIV1 1ZX5A 1KS4A 1Y7BA 4QM8A 2RS13 3N7MA 2EXIA 1W0PA 1DGRN 3MW3A 3PLQA 3JUUA 2QFEA 1R083 3MFAA 5ABJB 4HK9A 4YW3A 2CWMA 4N7UA 1DGWX 3KZ4C 5E89A 4Q4W1 1AYM2 3NW4A 1O4TA 3ZXKA 1SCRA 5DUXA 1NE4A 3ST7A 4CDWB 1LECA 1WCSA 2VXRA 2R30A 4YW4A 2VVFA 5C8CB 4COYA 5CFCB 3M70A 5J3UA 4AVVA 1NE6A 1MEC2 2HWC3 4HVRA 5CBLA 3CF6E 3GALA 1COV3 2HWD2 3MDPA 2LTNA 2G4IA 1QWRA 3NAPA 1AL21 5DG1A 3V0AB 4NHMA 4JTOA 3FX3A 2JKBA 2ATFA 4IV1B 1BEV3 4ONUA 2BQPA 1QKQA 5T52A 2DCYA 5AVPA 5D1IA 1EPWA 4AFAA 4XFHA 3H8UA 3HAGA 1KQRA 1AF9A 1F31A 1PGL1 1ZNPA 1WMFA 4HFSA 1J1TA 3KCYA 5HXVA 2PHXA 1DBNA 2ZGNA 4IV3B 1VRH3 1AR61 4Q1PA 3SH4A 5FLIA 1R082 2GH2A 3DL3A 4EWAA 4LO6B 1YFXA 4HLTA 1URXA 4LBQD 3WDVA 3N7LA 1RL3A 4X6QB 1RMU1 1DU3D 2WIIB 5ACA2 5J48A 3POWA 5L7OC 1LGNA 2XBO3 4Q0VA 4COUA 1H8TA 2HWC2 5T54A 3OPZA 4UW4A 2LALA 3J9SA 2P3JA 3OGJA 3PJQA 1CN1A 2YHJA 2QQPA 2DFCA 4N7IA 2NMOA 1LU2A 4GA9A 2YROA 3HT2A 4MSVA 3K48A 1RC6A 1BEV2 2RHPA 2HWE3 1J1LA 1Q8SA 2YYOA 3M3CA 2E7QA 1PGSA 1QGLA 4XTPA 2WT2A 1RUH1 2B9UA 4CDQB 3NWKA 1DFQA 2XWJB 3ZXJA 2QDNA 1OFNA 4NHLA 4MXWA 1VRH2 4HANA 1YJKA 1OD5A 1V6MA 3LGRA 1F5FA 4ATFA 5JLVA 1RB8G 2VECA 2ZZJA 2D3SA 3ZFFB 3JCIA 4FT8A 5JPMB 3NKTA 2YMZA 1HV0A 2E53A 2HEVF 3JB4C 1QMJA 4Q8LA 5F5QA 2BBVA 3RMYA 2UWAA 3IMNA 2A70A 3MPBA 4GWNA 2P34A 4LLOA 3OJBA 2P3KA 4QPIB 2ZACA 1XXNA 2HWB2 3AMQA 4FTSA 2JX9A 4XOGA 1DIWA 4YGCA 2SLIA 2JXAA 2MNGA 1HXS3 4FPFA 4PBOA 1WLDA 1FXZA 2LM3A 3HQXA 4QGNA 5T5LA 3WZ1A 2ZGTA 4BCUA 4RD7A 1MVQA 1LB2A 5CNAA 4P5HA 1YRZA 1SMVA 2OW4A 2A6XA 1DLLA 4YFZA 2P37A 4Q2FA 2D6NA 3M4FA 1ND3B 3CJXA 4LEJA 5BNNB 4DINB 1YNAA 1UU4A 2EAAA 3AKPA 3ZDSA 4IEOA 4YW2A 5T5PA 2BNNA 4OI4A 3BCWA 2AR6A 2R072 1UKRA 3E5QA 4YYOA 1H8TC 3WDXA 2QKDA 5FBZA 1REFA 4HETA 2ZGPA 1QJX2 3WNXA 3LOBA 2X5IB 2VOXA 5KC6A 4PJYA 5I0UA 5JMCA 1S0EA 2GC3A 3FFQA 4HK8A 4PIZA 4AI2A 5FOBB 4FTBA 3WP3A 4DRRA 3P3PA 4JQRA 1HKDA 4YZ5A 2LUWA 1HXS2 2XL9A 2TNFA 5I8TA 3LWCA 2RJKA 4GMP3 5A3LA 3S7IA 1VBE1 1FOD1 4LBKA 4R52A 5K0UA 4AHZA 1RUC3 2RM23 4EN7B 1N3PA 1PK6B 3D4KA 2XUMA 2OPKA 5GLUA 3FUQA 2D43A 5EZWA 4OHZA 1ZREA 1H4HA 4XJZA 3IDCB 1CAVA 3L9JT 3N7JA 4DXZA 5GKAC 4Y22A 2ZHNA 4Y1ZA 1ZBA2 1BQPA 1RUI1 3VL9A 1AX2A 2EXHA 5J98B 2RS11 2XB6C 2BYVE 2HYKA 3BALA 2RS33 5DUWA 1I1EA 2NPIA 5BXXA 4AHXA 3ZXFA 1R081 2SBAA 1WBFA 5JOYA 3D5OA 1QJU1 1MQTA 2DF7A 2O0OA 2ZX2A 2XJUA 1AL0G 2QE3A 4IEWA 2WNUC 1RUC2 2RM22 4DNYA 4CEWC 3JD73 1IHMA 4LBJA 1HRI2 4ZU5A 1HIXA 4D3WA 3VDDB 1EAH3 2PHFA 2HWC1 4WBBA 1I3HA 2BVBA 4YZ3A 1LJ7A 5EJ3A 5IUQA 1COV1 4RFT0 1DF0A 3R6SA 5IK4A 1PVC2 4FTEA 3AYCA 1LTEA 4QGLA 4RQPA 2Q0AA 1VP6A 4MVTA 1BEV1 1CD3G 3WV6A 4NO4A 4A7KA 1SCSA 3FMGA 4P9WA 3UL2A 3I2DA 5K8SA 5LRSA 1V9U2 3VBHA 2F6BA 5BNOA 1NXD1 3VBFB 3A4UA 1VRH1 5CA6A 5LK7B 3AM2A 4OUSA 1N3QA 4XMAA 4C1WA 4KH9A 4Z82A 4XTMA 1CR7A 3OCPA 4FAHA 1DGWA 1WD4A 2D6OX 1AUYA 2ZGLA 3H1WA 3PVEA 3RWNA 3JD72 4RS5B 2VMGA 4DOUA 4R9AA 2XBO1 1EAH2 4XJ8A 5FQ0B 1LRHA 4ZKTB 3H7JA 3RYPA 1BBT2 3SNMA 1CAWB 2PA7A 2XKPA 3O12A 4IV1C 4L92A 4D7SA 2WA4A 2HWE1 3LAGA 1MS8A 3LA3A 4WVVA 2I07B 4LUMA 4ZXKA 4AHYA 1C28A 1WW4A 1A8DA 4RSUA 4DY5A 1W0OA 1ONAA 3OD4A 4I3GA 1LR5A 2ET1A 1CAXB 1FYUA 5AC93 2FBEA 1MQTC 3KS7A 1H9PA 4OULA 3H9AA 3TB0A 4SLIA 1I6XA 4LO8A 4BM8A 1OOPB 4XHXA 5L36A 4L11A 4W6WA 1U12A 2PLV3 3RS6A 1LOBA 1YO8A 3B9CA 2X8KA 1DHKB 1FMD3 1O91A 2CGNA 4WM8A 3PMEA 1PO23 1WLTA 3O0XA 3SITA 4EN6B 1FV3A 1IKQA 4QQOA 1WCDJ 1ASJ2 2RR13 2YGMA 4XJAA 1HXS1 3MEPA 4KG8A 4CDXB 4JAAA 1VAKA 2TUNA 3WP6A 4FXKB 5FTTC 3VBHC 4CDQC 4G9SB 1XYNA 3HMYA 1MS1A 1HQNA 4AK3A 1AR93 3KSCA 2PYTA 2WNVB 2PAMA 3B01A 2XKOA 2P17A 3THPA 5AC92 4AEDA 2QZ2A 5FOJB 2BWCA 1RUNA 1S0JA 2XLFA 1CAUA 1YI7A 3V0BB 1C3HA 1OLRA 4GB33 3M3EA 2VG9A 4WVMA 3FUOA 3INAA 3U0ZA 2ILMA 2BVVA 1YLLA 2WQZC 5DG2A 3R4SA 1QXRA 1PO22 1QOOA 2ES3A 2JJ6A 2GSYA 4LTAA 2RR12 3N35A 1X8MA 1LOEA 2E9QA 5A3MA 2DU0A 2ENRA 2ZGMA 1W6MA 3TOJA 1OQDA 4GMP1 4HZFA 4RGGA 3HN1A 1VBB3 1X82A 4YVSB 3BOPA 3O7OA 1IPJA 1AR92 1C4RA 5IT6A 4FPHA 1Q43A 5GLVA 1LOGA 4Q0UA 4WZCA 4QMAA 1G7YA 1QH6A 2HWF3 5FFOC 1H2KA 3O5SA 3ZSJA 1LHUA 4QPYA 3C3VA 4BZ4A 4COVA 3LZZA 2VMHA 3DN7A 4KGQA 4O9GA 1S0IA 1W6QA 4Y24A 1E57A 3D8CA 4GB32 1QY4A 4N90A 1RUF2 1W6NB 4E2GA 3CO2A 1N1TA 3TYJA 3M1HA 2RS31 1U5YA 4HBNA 4CDUA 2WC2A 2BW8A 2QZ3A 4LHNA 2IC1A 2GNDA 4ITCA 4Y26A 5I0TA 5HCAA 4ZU4A 3ZSEA 4CYDA 4XQDA 2WQ4A 1MZ6A 3D0SA 4L8QA 3S6PA 3U4XA 1VBB2 4FOWA 4WVZA 4Q26A 3JD71 4AXOA 4QU2A 4AEDC 5BNPA 5L19A 1EAH1 2HWF2 2PN5A 5DZEA 4EN0A 3EBRA 2OIIA 1IS4A 4HSJA 1O7FA 5CAZA 5CFDA 2BNOA 2XG3A 4B8EA 4BLJA 4BPZA 3OD0A 3VBOA 1PGW1 3R0RA 2P3IA 2ZMKA 3DKWA 4C0BA 1PO13 3X29B 3SISA 4YVWA 3GZAA 3FWEA 2JDZA 3FBYA 3B3QE 4L9BA 3QOPA 2B46X 2VNRA 2WFPA 1BJQA 1Q8PA 2JD4A 4PLOA 3E5XA 2OZ6A 5A33B 5I0RA 3ZXDA 3CLPA 2A5ZA 4AI1A 3KLSA 3OYWA 3S30A 4B7EA 2ZX4A 1A6CA 3P3NA 5I0SA 1H8VA 1RINA 4GH4A 1GYKA 2ZX0A 3WXPA 3IWZA 5T5OA 5D8AB 1G9CA 2CWSA 3VBUB 4HKWA 4K1YA 1G9DA 4SBVA 2A75A 1SLTA 2R043 3AXEA 1SQ4A 4LULA 5JIUA 1CPNA 3AMHA 4RHV3 4AGGA 1PO12 1UU6A 1RGSA 4LBQA 1D2SA 4G4FA 2XJRA 3DPRB 3VHRA 2XHKA 1QNYA 2DVDA 4HL0A 4CDUC 1KXGA 5J96B 4FPKA 4JRLA 1DQ6A 1GBGA 3UJQA 2W68A 4AGVA 2A6WA 1TMF3 2Z69A 4I02A 1RUOA 1H0BA 5AC91 3KT1A 5KC5A 4QXKA 2ZKLA 1NZCA 4PF5A 4UW5A 3WW3A 1J3PA 5FDBA 1LU1A 1XNDA 4R8HA 4XF1A 3ZYPA 1H2LA 3VZMA 4I09A 4F7ZA 5BNPC 2PLV1 1XE7A 4PDWA 3VBSB 1RUG2 1RUJ3 2R1BA 1FMD1 5CFDC 2WINB 5A32B 4ASMB 1UX6A 2R042 3VBOC 1YHFA 3ZMOA 1PO21 5CB7A 2H0VA 1Z0HA 2RR11 3ME2A 1LENA 4RHV2 4YVWC 3EHKA 1AYM3 3ES4A 4M3CF 4IEVA 4UXAA 1QOTA 1WD3A 2BNMA 3SCGA 3KCCA 3HWJA 3N3HA 3WG4A 5EXOA 1AX0A 3MIGA 1J3QA 4YM1A 5GZDA 1MEC3 1AR91 3UKTA 4Q4X3 2HWD3 4I2OA 2IZWA 1VIWB 1GZ9A 1DZRA 4FPEA 1S0FA 2Y0IA 4PBPA 1W6PA 4GH4C 3LA2A 1PVXA 4XFFA 1FAYA 5LEJA 4FPCA 4F8AA 1K5MA 1J59A 1HRV1 4GB31 2ZGSA 3ZMNA 4OZXA 1G6NA 2Z5WA 5J36A 2WT1A 1RUJ2 4BIOA 3PVNA 1C57A 1NCRB 1B35B 1VLNA 3VHNA 5GZFA 1UIKA 5FAXA 4GMP0 3M7AA 4XZPA 2ZGKA 2OVUA 3VKNA 4XFIA 4G3YC 2NMNA 1G9AA 1SACA 3OGGA 3E97A 5ACA3 2ZHLA 1OA4A 1ZZ8A 1SLLA 1VBB1 4YRDA 4AGRA 1CQ9A 4AVSA 3MIDA 2VPVA 2WNVC 1BMV2 4Q4X2 3VHPA 2BFUS 4E4SA 4Q0SA 1EV13 5EYYA 2IXIA 4XETA 2Y38A 3GBWA 2HWF1 4QPGB 3RNSA 4HPKA 3TN93 3LB9A 1UN1A 2WNEA 3MIHA 2ZAHA 3ILNA 2C1FA 4FOVA 1RVF2 4J6GA 4MX3A 3WDTA 1NY72 4Y1YA 4PDWC 4RR3B 3ZN4A 4NOTA 1V00A 1DG6A 3O0VA 2DWRA 4FBFA 3IM0A 3WT3A 3MW4A 4PLMA 4CP1A 2D3PA 3Q9OA 2B5HA 3WHUA 4BMEA 2JG8B 2V09A 1CONA 2DCTA 5I93A 3VL8A 3V65A 5DUUA 1W6OB 1AYN3 2GMEA 3GBGA 4I3PA 4Y22B 3WLUA 1NA1A 4B3NA 2VVDA 5E1RA 5JCTA 3UV9A 4I01A 1QQP3 5KXEA 3KT7A 4FPOB 3CJIA 1YI9A 4P9XA 1ENRA 4YG3A 3T1MA 4COWA 4JGYA 1EV12 2HWB3 2JG9A 4URTA 1S55A 3VZJA 1MS3A 3TN92 2XWBB 3VN4A 2EF6A 4JDOA 2QJVA 1K5MC 1ZBE1 1UKGA 3PMSA 2Q1ZB 1X7NA 5GZEA 3AP6A 3ZN6B 2GMPA 1V6JA 2D44A 4BYYA 4FAGA 4AFBA 4BH9A 3AZVA 3SCHA 2ZMNA 4ES9A 3D82A 3OTFA 2BEOA 1BXHA 3ZIWA 1GANA 2NQYA 4M0NA 2DVGA 3VZLA 5C4WB 1AYN2 3AXDA