4KG8A

Crystal structure of light mutant
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
149
structure length
129
Chain Sequence
VNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGTITHGLYKRTPRYPEELELLVSQQSPSNWFDSSFLGGVVHLEAGEEVVVRVLDERLGTRSYFGAFMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords Tumor necrosis factor ligand superfamily member 14
publication title Mechanistic basis for functional promiscuity in the TNF and TNF receptor superfamilies: structure of the LIGHT:DcR3 assembly.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 129
sequence length 149
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4kg8A00
1C28A 2JG9A 2R30A 4N90A 2WNUC 4KG8A 1A8MA 1PK6C 2JG8C 2RE9A 4EN0A 2R6QA 2WNVA 2HEWF 2ZJCA 2Z5WA 3MI8A 4QQPA 5HBAA 1GR3A 4QPYA 4OUSA 3AB0A 5BNQA 1D0GA 3K48A 1I9RA 3B94A 1JTZX 3L9JT 3V56A 2E7AA 3IT8A 4RSUA 1U5ZA 2Q8OA 4QQLA 1C3HA 3QBQA 1S55A 2QDNA 2TUNA 4NN0A 4GIQA 2WNUB 3TYJA 1KXGA 1PK6B 1RJ8A 2AZ5A 1JH5A 2JG8B 4QQHA 2JG9C 4DOUA 4MXWB 1U5XA 3B93A 3K51A 3LKJA 1XU2A 1OQDA 1OQEA 2WNVC 3TWIA 4G4FA 5KC5A 3FC0A 1O91A 3WD5A 1ALYA 2RJKA 4MXVA 2ZPXA 5CIRA 1U5YA 1RJ7A 4E4SA 2RJLA 1TNFA 2Q1MA 5L19A 2KA3A 4E4DX 3URFA 2JG9B 1D2QA 4TSVA 1DG6A 4D7YA 4KGGA 4F3JA 3ALQA 2WNVB 1WCKA 2HEVF 5TSWA 4J6GA 4QQ2A 5KWRA 2WNUA 4G3YC 2HEYF 2QE3A 1PK6A 2JG8A 1DU3D 5KC6A 2R32A 4MXWA 4DB5A 4TWTA 1OSGA 2OIIA 4OULA 4HT1T 4MSVA 1KD7A 1TNRA 1XU1A 3B9IA 1D4VB 2TNFA 3QD6A 5L36A 1IQAA 4QQOA 3ME2A 2X29A 2O0OA 4OUMA 4KGQA
chains in the Genus database with same CATH superfamily
4FP3A 5CFCA 2DVAA 3QCWA 2R16A 4BMBA 1OMIA 2BDRA 4CP9A 3VHRA 3AMMA 4TLGA 1ND2A 3ZN5A 3K46A 5BPXA 1CX4A 1Q56A 1OUXA 4M3CF 2JICA 5CU1A 3MFCA 4ZXKA 3PMEA 1PZ8A 4GJZA 4A41A 4CDQB 2OXBA 1YFWA 4R9DA 1OHFA 4IV1A 1ZVFA 3ASIA 3T2OA 2RR13 4HK8A 1O4TA 4YFZA 4WM7B 5GLWA 4BB3A 3ETPA 4QKNA 2VG9A 5LRRA 2WZ8A 3K48A 3IBMA 3AZWA 4X8PA 3DPRA 3P6BA 3V56A 1F8VA 1NCRA 1W6OA 1QJU1 2UY9A 3KV6A 4RQPA 4KI5M 1GP4A 2VOXA 2VULA 1RITA 1ZBE2 2BU9A 3NQHA 4YFWA 1GZCA 4WM8B 4XAAA 2JX9A 2E7TA 3H1MA 3U10A 1W2TA 5DQ0A 1U5XA 3CEWA 1B35B 4YG3A 5C8CC 5HV0A 4LORA 4B4QA 2LM3A 5FYTA 4LHKA 2P3IA 4CXYA 2FCUA 1JU3A 5FRAA 4MGQA 2HYXA 1H2MA 3G7DA 5FXZA 4G4FA 1TG7A 3D5OA 3J7HA 5JXGA 2P3YA 4YW7A 3PUQA 4FPCA 4GZ9A 5BV6A 2WN2A 1F15A 1ND3B 1RC6A 4MGZE 4ET7A 4JGYC 5BNPB 2EIBA 1UY0A 1YFUA 4BIFA 1NY72 2HWE2 2Y0IA 3LEKA 5IVJA 1MZ5A 2QQVA 2MEV3 4MH0E 4DY3A 5LWBA 1KEXA 4UYBA 3AX4A 3AYCA 1GQGA 2ZX0A 5EP9A 2DWRA 2XJUA 5FFOC 2O8OA 2V4VA 1I6XA 4HXCA 2YG0A 2OW4A 2GH8A 1YHFA 4SBVA 2ZEWA 3ZFFA 4ONUA 4ES8A 4E4DX 2WS93 1AYN3 3O0XA 3RYPA 1CAVA 4A44A 2FDKA 1W3XA 2CTVA 2UY8A 3MICA 1ULOA 1CJDA 2ZEXA 3OPZA 3IN9A 4UBHA 4XJUA 1W6QA 3MV01 4W4ZA 1O6UA 1UAIA 2JJ6A 5A7WA 5ISLA 5CB7A 3O1OA 4XZUG 1DGLA 4DNYA 3E6CC 3D6EA 4OMDA 1OOPB 3PDQA 1Y43B 4ZXEA 3S5QA 3DYMA 1OA4A 3M1HA 3TN92 1JZ4A 5IK4A 3N7LA 1DDLA 4DO0A 2OKXA 1C8M1 1OVPA 3OGSA 3AFKA 4CDWA 5KHKA 1K3IA 4JHTA 4BQXA 3P5BA 2DCZA 2I2SA 2AREA 2F4PA 3MLJA 2R043 2KM2A 2RM23 3SNMA 1IZ3A 2NM1A 1ULPA 2KD7A 2VUCA 2Z79A 3B9IA 2Z69A 3MUY1 4GB32 2VCMA 4YZ5A 1H9WA 1HRV3 5A3TA 3QACA 3KVBA 3LDRA 4QX7A 5FY1A 4XQWA 5C4WC 1Q43A 5FOJB 3GZAA 3U4XA 1RUE2 5F5CA 1LAJA 3POEA 1DQ6A 3I3EA 5FKCA 3N9PA 3A23A 2ZGSA 2QZ3A 2WSVA 4R52A 1MEC1 3I3BA 2G4IA 2MNGA 1O8PA 3VBHB 1S0IA 4AVSA 4N90A 4K8RB 5DUUA 5K4LA 5C9AB 2PHDA 4NJ4A 4XPVA 3MFAA 5FMOS 2ARAA 1WW6A 1LOFA 1NUKA 2WNVA 1W6PB 1JODA 1KFUL 1QJY2 3UGHA 2BBAA 4LOTA 1W2AX 1YIFA 1LHVA 1L7LA 1TMF3 1HXS2 4PDWA 3WEZA 2GP3A 1TEIA 3ILNA 5FZ8A 4NIDA 1LULA 1QXJA 4JQTA 2A71A 4YVSC 1YYNA 3DECA 1NE6A 4WVZA 3KCYA 1YO8A 3THTA 2J1SA 5A7QA 4YYOA 3HMYA 3H0OA 1LKNA 3MF9A 5FR3A 3M3CA 3WUCA 3N3HA 3N7JA 1JTZX 2SBAA 3ZXDA 3CBNA 1RHI1 3GJBA 3GYDA 1QIQA 4URTA 5AC91 5A80A 2WZR2 3K77A 1YEWA 3ST7A 3BALA 2IUWA 2Y60A 1RYYA 2XQXA 3BTAA 4I01A 3ROUA 4QQHA 5LY2A 4UW5A 3BPZA 3ENRA 4A42A 4CDUC 5T5PA 1XU2A 5JZGB 1STMA 1SG3A 2YUEA 4PBOA 3ZFEA 3AXDA 4RHV2 2K0GA 1ASJ2 3KT1A 2FCVA 4LO4B 4AZZA 5JSPA 1NA1B 5IJRA 5KHGA 2ENRA 4QU2A 4RS5C 4CA9A 1IG0A 2Y26A 3UYJA 3J8F2 3T2PA 4LKSA 5IW0A 1OFSA 3LA7A 2DDUA 3VD4A 4HVOA 1XE0A 3AC0A 4YLZA 4N43C 3EHKA 1RUC2 1TNFA 2HLEA 3H1YA 5FK8A 1DLLA 2JIJA 3LFIA 3CU7A 4QDRA 1KDKA 2W95A 1SDDB 2CYFA 1YC61 4RQPB 5ANNA 1HV0A 1QJZA 1UL9A 2VH9A 4IV3B 5D8AB 2VTXJ 3POBA 3HN1A 4Y5TA 3VBSC 5A6XA 2PYTA 4FPFA 3ZR5A 4DXSA 1AJOA 1PO13 2BYVE 2RS12 3DXUA 1CD3G 3POYA 2ATFA 3Q8BA 5A3NA 1W8FA 3PTRB 5APAA 2WNUA 1UMHA 2VW2A 4CYDA 5IK7A 3IAQA 4QPIB 2MHFA 3C7GA 2Y8KA 5IT6A 1QQP2 4HL0A 1W8UA 4AFAA 3ES4A 1XSRA 2P34A 3POJA 1OSGA 1B09A 2BTVC 4Y1UA 1SDWA 4LUKA 2KR2A 3PURA 5J96B 1YCIA 4J25A 4IE4A 4BCUA 3JQXA 2OZ6A 4DEQA 1RVF2 3JBG3 4Z1VA 1D4VB 2DCYA 3I2KA 1W8NA 1OUSA 4WZCA 4AR2A 3NJYA 3GNEA 1X9PA 4QQOA 2XBO3 3VD3A 3KV9A 5FYZA 3PMSA 2X29A 1LOGA 2XG3A 4YG0A 3U0ZA 1Z7S1 2R0HA 5IVYA 1SLCA 1JUIA 2VZ3A 4KBZA 4KMQA 2QQUA 5C3SA 2D93A 4W50A 4EQVA 4UWDA 2XLGA 3VDCA 2SLIA 3GBWA 3ZYGA 5C3OA 2HJIA 3B00A 1L7QA 4NVPA 4EN0A 5FDBA 1XYNA 2VQTA 4LKFA 5B4NA 4MLOA 2PHXA 1MS0A 1NYWA 5D2AA 2XHKA 3TNQA 3BN6A 1NLSA 4IE0A 5H9QA 1EAH2 3P1IA 4XC9A 2ZXQA 1NQDA 1R081 3J26N 4LIUA 3GXUA 3E1F1 1LECA 1EV12 5IVEA 5FPBA 2JEMA 1D4M1 3WG4A 2OUHA 2RDRA 3LAGA 4Q0PA 4YWAA 5FPZA 5FBZA 5FOBB 5CG8A 2J22A 4BZ4A 1TE1B 5F8PA 2GC3A 3VBOC 3TNPB 1ENXA 4RSUA 1U5ZA 1MPXA 1H8TB 1ENRA 3ZDSA 2D6PA 5FZBA 1NLQA 2NMOA 3MPPG 4XMIA 2AZ5A 2ZX3A 4IUGA 4I09A 2EAKA 2RR11 1HQNA 5ABJB 3N4MA 3FL7A 1WCDJ 4LLFA 1T6GC 3BYWA 1I5ZA 4BQYA 1MS4A 2VMHA 3BODA 1V6LA 2WNOA 4H14A 4XJWA 2D5FA 1CAWB 5FZCA 1FAYA 4AEKA 1G9CA 2ZGKA 2RJKA 1VALA 5CIRA 3LA3A 1VBB3 1M4WA 2ZA9A 2P2KA 1X50A 2X8KA 4FPYA 2BOIA 2WIIB 3UL2A 3SH4A 2B8MA 2D43A 3CMGA 4OQ9A 5KR7A 4B7EA 4QWNA 3LD8A 5GALA 4CRQA 5GLUA 1LHWA 1OPOA 1LU1A 3FN9A 2VGDA 4XXAA 1SBDA 1VBE2 3CJXA 3W21A 1CESA 2JG9B 1D2QA 3LEIA 3NKGA 2X5IB 1YQ2A 1S2KA 3AP5A 1WLCA 2VU9A 2PHFA 2WINB 1R092 3RFRA 2H0VA 1WW7A 4Q29A 2MEV1 1H2KA 1Y9GA 1YJKA 4CUAA 5HCHA 5FY8A 5FUPA 5DDJ2 3C7OA 2JG8A 4IEXA 2EVXA 1AR72 1BBT3 1PGW2 2E32A 1ACCA 4IEVA 4MXWA 5DPNA 5I0TA 4EN7B 1ZREA 1R1A1 2ORZA 4LLOA 4DPNA 1AR63 4XQ4A 4DUXA 2E26A 1XNCA 2VQAA 2WS91 2C5DA 1CIYA 1AYN1 1VRH2 1MZEA 1W9WA 3OB8A 4I30A 5DN2A 4HT1T 4HPKA 1V9U1 5BXXA 1D0HA 1CIWA 1KD7A 1PVC2 1QJX3 1VBC2 2XGXA 2XKPA 2BGOA 2YBPA 4UFKA 2NN8A 3WG3A 5T50A 5GZDA 1QWRA 3WDTA 3ZM8A 4QXCA 3WW1A 5L36A 5FWEA 4RGKA 3VZLA 4XAEA 1QDCA 3AMNA 3M4FA 4LITA 2WYSA 4FPEA 1QNWA 1LNSA 2BFUL 3I59B 3ZPOA 3H3LA 3SKVA 2GZWA 1JOBA 4JKKA 3C7HA 4Q0SA 4RFRB 4KG8A 3AP4A 2R041 1XXNA 5C7GA 3THDA 5IUQA 4COUA 1HRV1 2A75A 4UF0B 3W5MA 2YFUA 4LEJA 4FTEA 2HWB2 3IAPA 3OUHA 1W8ZA 1W6MB 3PUIA 4Y5SA 3WDXA 1H2NA 3E6DA 3PL0A 1HIXA 4IQPA 1MVQA 1LOEA 4S2HA 1F2NA 1AJKA 1HKDA 4YGDA 1GR3A 4Q0QA 4QPYA 5FV3A 2ZMNA 2F6BA 2GU9A 5LA1A 1H4HA 1ENSA 3VKMA 3ZN4A 1H4GA 3CLPA 4JHZA 3AL5A 2OPKA 2QQLA 3L2HA 1D2SA 3ZFGB 5A6ZA 1AZDA 2E7AA 4AEJA 3KCCA 3RMXA 4EZHA 4E8CA 3RZMA 1WA4A 4JAAA 1ONAA 5CZKA 1TMF1 1UWWA 4JCKA 3NJZA 4P00B 1W9FA 2Z42A 4JX0A 4L0PA 4QB2A 3U37A 2WYFA 5F3CA 3I8TA 1LHNA 1CR7A 2CAUA 5JXHA 3K3OA 4MYEA 4QD2A 1YLLA 1QJU3 3VDDA 4AW7A 1NZCA 3RDIA 2VNOA 3JD73 2R073 5F32A 5EFUA 2K9ZA 2B9UA 4BXSV 3AKTA 2FDJA 2PLV3 3NNLA 4LTAA 3IDBB 1X36A 4XFFA 4ZU4A 4FI9A 2PQSA 1IS3A 1YQCA 4IE6A 4M0NA 3MEPA 5FYCA 5A1FA 1COV3 4XFHA 3Q9OA 4XABA 5L7OB 4LO5B 4ES9A 1IOAA 3BGAA 4MVTA 4JTOA 4X6RB 2QQJA 4MUVA 2I45A 1W28A 1ZX5A 5FY4A 2P17A 5C5UA 1LEDA 3H8XA 2JB8A 2RS53 4E2GA 1QGLA 3DYPA 2DTWA 2HYKA 3CJIB 3S7EA 3NV3A 5IAVA 3PVOA 5FZHA 1QOSA 2AGSA 4ZZ8A 2E9QA 5CBLA 5CKMA 4HVRA 4FSJA 3O1TA 1CAUA 3E97A 4IEWA 5E89A 1OC1A 5JIUA 3BTZA 2VM9A 4DY5A 1HW5A 1WCKA 1XQNA 3N9QA 4XURA 5FY0A 4B4PA 5BNNA 1G9FA 3KVAA 4UW4A 4W65A 1M06G 1PK6A 5K8SA 1AR82 3MF6A 1JI6A 1REEA 2D98A 2R32A 4S2GA 4ASMB 1V6KA 1SCRA 1YI9A 2EF6A 1RUJ2 2Q4SA 3OEAA 5FZ0A 5K0UA 2JE8A 2VQUA 3PJYA 4QX8A 1PGL1 2PHRA 3EJKA 1KJRA 3BOWA 4Q8KA 3BIEA 1PHMA 5JPNB 2YY1A 5LBEA 1FV3A 1MS3A 1QH6A 2ZGMA 1S0JA 2XJQA 2Q1FA 3R4DB 3ZYRA 1PO11 4IXLA 1V00A 1F31A 2CNAA 2PAEA 1DQ1A 3QD6A 4K8FA 4EYUA 4WM7C 2IVJA 3AP6A 4QX0A 5IFPA 3ME2A 5A7NA 1SHWB 2JD4A 2JE7A 3LEMA 3W58A 3LE0A 1EY2A 4YVWB 4V2VA 2WSUA 1Y9QA 1J3RA 1AF9A 4GQ7A 2VVEA 4EV0A 1BVVA 3VBFB 4O7XA 1DHKB 1Q8VA 5CG9A 1UZWA 2CWSA 4WM8C 4XFGA 4OHVA 1WD4A 3WX5A 3JBG1 2OS2A 4ZS2A 1VJ2A 4RR3A 1B35C 4JDMA 4CDXA 3FLPA 1RHI2 2XUEA 2OVUA 2XBO1 2ZJCA 1OD5A 2ZABA 4BDVB 1GZWA 5AC92 2WO7A 4EE2A 4CCDA 4CCNA 3D0SA 4XHBA 1S0EA 3MIEA 2XUMA 1ND3C 4Q4V2 1HQWA 5BNPC 5FPLA 2EICA 4Q8LA 3AB0A 4XEZA 4XETA 5EZWA 4HANA 4JC1A 2CSGA 3VDBA 3HNMA 3S30A 4RA0A 1QJFA 3DCQA 4KNCA 1FPN3 1LOAA 5IK5A 2LRPA 2BUKA 3O12A 4Q2FA 3WP6A 4EZ4A 3VBUB 2VMDA 4NN0A 4RFT0 2O8QA 1X33A 4R9AA 3ATGA 1JH5A 1HLCA 1ZBA3 2RDQA 2ZACA 4W8JA 5A6QA 5FZ4A 3NSTA 2W1SA 2YGLA 2W46A 4L97A 2RMU2 4Q4X1 3T4VA 4OHYA 1I3HA 5CNAA 3HPNA 2DTYA 3T0AA 1RUF3 3UNPA 1RUH2 3D4KA 1NOVA 2D40A 2BPA2 3VZOA 1CX1A 1PO22 3ZXKA 2W3JA 3VDAA 5FLJA 4DRVA 1OOPC 5EJ3A 4NHYA 3SEPA 4NHMA 5LK5A 3JXSA 2E53A 3KV4A 2ZOEB 1RUG3 3MO4A 3KHCA 3IMMA 1IKPA 2GMPA 3IDEA 3SISA 3NJXA 3ZIXA 3IWZA 2DCTA 2PELA 4BQWA 4XMAA 5J48A 4XF9A 4FT8A 2VBBA 3AK0A 4LO7A 4COVA 1GWMA 4K1YA 2A6XA 4C90A 1GV9A 4LBQB 3LCPA 4OZOA 5FZGA 3M3EA 4DIQA 5BYNA 1Q3EA 3H42B 3OUIA 1AXKA 3UT0A 1CZSA 1OKOA 2Z2SB 3SLIA 3HN3A 2B4KA 4BXFA 4AVCA 1PZ7A 2BW8A 2P6CA 5C5TA 3I54A 4QGLA 3J9SA 5FZKA 4AEDA 4MGIE 3RQ0A 5G04L 2QBXA 3VL9A 2YU1A 1O3TA 1NXD1 5T5OA 1KDMA 2HWF3 3ZXFA 2B39A 3OOXA 3WF2A 2W91A 1ULDA 3VBHC 3K4ZA 4DZGA 5I0DA 5KXBA 1TME2 2FMYA 4DB5A 5C9AC 4TWTA 4RGAA 4JGZA 4YSFA 3VBRA 1UU5A 2PA7A 2RDSA 2Y6KA 2BWAA 3A0KA 4Q4W2 4CSWA 3ZKYA 3I2IA 4PF5A 3KT7A 5LASA 4GA9A 3SITA 4PCRA 4UXAA 3GHNA 3CNAA 4FXGB 3BKZA 1T6BX 3DF0A 1HN0A 3LGRA 4QPGB 4HLTA 5CFDA 3W20A 1SPPB 4DFSA 5JSOA 1REFA 3MIGA 1SQ4A 5T52A 3WINE 4K1ZA 1UXXX 3LIGA 1BBT1 1N1SA 2C6SA 2WDBA 1J83A 1VBA3 5EHDA 1PIV2 4EN8B 2IFWA 4OUMA 1F4HA 2W92A 2QQNA 3O1UA 2FDIA 5C8WA 4IETA 1UIJA 4ORFA 5FXXA 1CJPA 5FZOA 1QJX1 4UFMA 4W6YA 3WG1A 1Z7S3 3AYAA 4AI1A 1VB4A 3DKQA 3KD4A 3NAPA 3KS7A 5E6HA 3ZXLA 3D8CA 3PHMA 5I93A 4DQAA 5JZGC 4XDOA 5JUVA 1Z0HA 1CPNA 2VZ1A 4FVVA 2EXHA 2QQKA 4C8DA 1NA1C 4XUNA 4XFCA 1H30A 4A7KA 1V6NA 1UZZA 3HT2A 4K3UA 4E4HA 2O1QA 4LXLA 1G9AA 2BVVA 3MBWA 1I9RA 1ZA7A 3RZKA 3B94A 2VTFA 3V0BA 3BVCA 4J1XA 3WNOA 3IT8A 3K3NA 3OGGA 3M3IA 1C3HA 1KITA 2ZGQA 1D4M3 4XZPA 2VMEA 2DVDA 3FX3A 3D3AA 1RINA 2GNTA 4B3NA 1BEV3 4GXLA 2NQYA 3Q8AA 1ZYBA 3WQ1A 3HAGA 4AQTA 1CAXA 5J3UA 1AYM3 3JU9A 4GD4A 4K20A 4DXTA 4HG6B 4QXKA 4DOUA 2RHPA 3CO2A 4N53C 2PQQA 3V64A 1KRIA 3ZSKA 3ZYBA 1DGWA 4IV3C 5D8AC 4NAOA 4QDSA 2LW8A 1XPWA 5BNOB 1JW6A 1ENQA 5KHHA 1Q8QA 3WG2A 4WBBA 2JDKA 2VZQA 3KV5A 4HFSA 4QU1A 2GP5A 1RMU2 2D44A 4IERA 4XBLA 1CZVA 4CDXB 2W87A 3N7MA 3WD5A 4CEWB 4CEYB 4QPIC 4AE2A 5F1RA 2D3PA 4LHLA 4UOJA 1DQ0A 1RJ7A 1IG3A 3EB7A 1SZBA 3FBYA 2VY0A 5D1IA 1FNYA 4JV4A 4ITCA 3KQ4B 4HOOA 4XIOA 2IVIB 2VZOA 3JD71 2R071 3FLRA 1Y7BA 1UZVA 2PLV1 3V0AB 1FOD1 1O59A 5GJ6A 1RUI2 4C0HA 2VW1A 1Q8SA 2H6CA 1MVEA 3O7OA 3T1MA 2WA4A 2IC1A 1DF0A 3AVSA 3M3OA 3MV11 2WS92 4AVAA 1COV1 4Q4Y2 3USUA 1US2A 3WNKA 3ALQA 1REDA 3USSA 4BLJA 2A73B 1PGSA 2WWUA 2ILMA 4I02A 4LJHA 3SCFA 4ZKTB 1O4YA 3NNMA 3VN4A 3KCXA 1JOPA 3IDCB 4XIKA 2RS51 4BIOA 4PT6A 3QLQA 4PIZA 3PJQA 4K6BA 1S0GA 5JXJA 4ZS3A 2WWJA 2YBSA 1A6CA 5FYBA 3TRSB 1G9DA 1G7YA 4XJ8A 4XF0A 4AI2A 2GNDA 4M00A 1K5MB 3ZN6B 3RZHA 1R1A3 5BY5A 1GSLA 2VMGA 3WR0A 3A7QA 4KU7A 1XU1A 1O5UA 1ULEA 2VMFA 1NCQB 1N1YA 2RM22 2W08A 3MIBA 1EP0A 5GM0A 4AK3A 4L11A 5FWJA 4UT5A 5JLVA 4CU8A 3KMHA 4JRAA 4YNIA 1V9U3 4ZU5A 1TVGA 1YQ5A 2HKXA 4PQQA 1VBD2 3GBFA 4XE9A 3U11A 4Z92B 2YYOA 3KWVA 2QDRA 1WBFA 4YW1A 1RXGA 4MV2A 2Y33A 1H8TC 2AYHA 1R64A 2ID4A 3UKVA 1I5PA 1DP0A 2J7MA 4AEDB 4A7ZA 2ZKNA 5F5QA 1RUD1 2XMLA 5C8CA 4YW3A 3ACFA 3APBA 5ABJC 2QVSB 2DVBA 1QOOA 3WLUA 4W6XA 1BKZA 2YPDA 3VBRB 4CPBD 1WCSA 1SACA 3SC7X 4Q1RA 2Y38A 4Q0VA 4QM8A 1AHSA 1QJEA 4CTEA 4PQ9A 1W8OA 5FYHA 4JGYA 2XQRA 1VPHA 1RIRA 2W0XA 4FO9A 5FZ1A 2WABA 2HWE3 2UU8A 4A4AA 3VLBB 3KF5A 3L9JT 2Q8OA 4KBBA 4PLMA 4GWNA 2XR4A 4P9IA 2D5HA 1OLQA 2XLFA 2ZHMA 5EQUA 1A78A 1C5IA 5AFBA 2GN7A 4HMZA 4LPLA 2JG9C 5LK7B 2X5IC 3DV8A 1J58A 3FE5A 4Y4RA 1A8DA 3THCA 5F6KA 4XHXA 3K2OA 1HB3A 2P1BA 4N9IA 1MQTB 5CA6A 2VVFA 1YFYA 2CV6A 5JMOA 5FO9B 1FPN1 1JMUB 3SQOA 1UKRA 1HQLA 1W3VA 2TBVA 3LA2A 1F5FA 2IFRA 4QXBA 4QXHA 4NIIA 3TN93 3VKNA 1QXPA 1UYPA 4NPRA 4CPBA 4HN1A 2G9FA 3FWEA 1SLIA 1TZOA 1ZBA1 4NOTA 2ARCA 2NPIA 2GNBA 4CCMA 2HWC2 3PTYA 1RL3A 3V0BB 1RUF1 3H1WA 4IEQA 4GB33 5I8YA 2JKBA 4IGOA 4GH4B 1BVP1 5C4WA 5CFCB 1NT0A 1C1LA 4LUMA 3IPVA 4B4RA 1VLNA 5I0UA 1BK0A 1RUG1 1WZXA 2C1FA 4LBKA 1RUE3 4CP9B 3PUAA 3C3VA 3T09A 3WQ7A 1JZ8A 4KQ7A 4BYYA 3R6SA 1ND2B 2HEVF 1AR91 1ZRCA 2ZGPA 4R8HA 5DZGA 2HEYF 4OHZA 4JDOA 2WZEA 4YRDA 2VC9A 1ZA4A 4IV1B 2D7FA 3AZXA 4KWUA 3T08A 2ZGLA 2W52A 2XL9A 3DXTA 4OUEA 3ZOIA 1QJY3 3HBZA 1UY2A 2EAAA 4YVSA 2A7AA 3DPRB 3PLQA 3ZMNA 4INDA 4ZONA 3GCWA 4BLIA 1BQPA 3N9OA 2JIGA 4MGYE 1NCRB 2B42B 3MGUA 2DF7A 3FUOA 1W6OB 2B46X 2XL7A 3WW2A 3WZ1A 5BUVA 1ULFA 2HWF1 1K5JA 1DZTA 2TNFA 3M70A 3JBG2 3TBDA 3H8RA 1GNYA 1W9TA 3FHAA 5FP9A 1W04A 5FP8A 3OY8A 3UJOA 3AJZA 5I0SA 5JCTA 5KHIA 5E16A 3RWKX 4AHXA 3ELNA 2XLAA 4XUTA 2AENA 3HOBA 4XBNA 4K40A 3ZFGC 3WHUA 1F4AA 1G6NA 5A3WA 2FHRA 1FT9A 3I2FA 4QHBA 1C28A 3SKJE 4C0BA 1KFXL 1GOFA 3KZ4C 3MW4A 1H2LA 4H3WA 4P9GA 4BPZA 1C5HA 2BJSA 4CDUA 3IZOA 2DCJA 4K9SA 4AI8A 1AL21 4E27A 1X9TA 4AFBA 1AX2A 2NLRA 5CYYA 2WFF3 1VBA1 3NNJA 2ZZQA 4OYUA 4RHV3 5T5JA 5FPXA 3LZZA 3X29B 4RS5A 1SFYA 4RYDA 2QFEA 4BWOA 3I2OA 5HBAA 4GMP3 3ZFFB 1DGRA 1LEMA 3WDUA 3JUUA 1ZM1A 4I0AA 5L7OC 3I2HA 1QEXA 4SLIA 3M2MA 4N43A 5F5AA 1CAVB 2ZX1A 1MS5A 1AXZA 5LATA 1W03A 5J09A 4Q5OA 2J1TA 1RUC3 1W6QB 1XYOA 2RG4A 4YZ1A 1ZZ7A 4QDQA 5A7WB 3I2GA 2TUNA 4OHWA 1OURA 4YM0A 4CU6A 2VMCA 5CEHA 3JCIA 3JB4C 3CJIC 4JQRA 2N7GA 1KXGA 4NR1A 5ACA1 3T4HB 5I0RA 2OUJA 3VBSA 2C24A 3VL8A 3EXUA 2FMDA 4R4XA 2OPWA 2DYCA 4XACA 2RS13 5JMCA 1NXMA 4JZRA 2W1WA 2ZMKA 4KU8A 4L99A 4MX3A 1H9PA 1URXA 2DU0A 3O0WA 1FMD1 4CDWB 3FMGA 3VHNA 3FC0A 2DURA 3A0NA 3NV2A 1JU4A 4PIXA 1O91A 4Q4X3 3SEEA 1UYZA 5FQ0A 4BK4A 4Z07A 1C8NA 2YC4A 1BEV1 5DG2A 5F39A 4D6RA 3UKNA 1AYM1 4O65A 4MO3M 2UYAA 1VBB2 1OLME 4QX2A 2VUAA 2A6ZA 5GZEA 1E5SA 2VE1A 5FIXA 4BQ2A 3C7EA 2QCSB 1BMV2 2OX0A 4FBFA 3HT1A 1QHDA 1YFXA 3KB5A 2CAVA 5I91A 1RVF3 1JYXA 1GNZA 1WCUA 2HWD2 2Q0AA 2C4XA 2ZCWA 3VB9A 4AVTA 4Y22A 2X10A 2CGNA 2BWCA 4ASLA 4OI1A 2Y6FA 5FYIA 2R49A 5JVVA 1W6NA 3G6JB 4E2SA 3S6PA 3HVDA 2PTMA 2DU1A 1EPZA 2WNVB 1MS8A 4YVWC 4J6GA 3EYPA 1R1ZA 5FYUA 5IAXA 5T3NA 3WQ0A 3AP7A 4PDWB 2AEZA 2QE3A 5FKBA 4ZHNA 3AMPA 4ZZ5A 5KC6A 4MADA 2P4EA 3VBFC 3CQOA 3SCGA 4H7LA 3ZSJA 1PMIA 1W39A 5J7MA 2CY6A 4S2DA 3LIHA 3ABZA 3ZIWA 3IM0A 1GP6A 4DMIA 1AR62 4N7IA 3VGIA 1CZTA 4ASKA 2WFPA 5JI9A 4MSVA 3NV1A 5DUXA 3QH6A 1D7PM 1EV13 1HB1A 2ETEA 5FZFA 3VKLA 1EUUA 3CZUA 4Q0UA 3ZVXA 1HRI2 3VBOA 1IQAA 5AFEA 1S4CA 2QQMA 1MS9A 4R4ZA 1U12A 2O0OA 2D3SA 3POFA 4TYSA 3OPTA 4QKDA 1QNYA 4XUOA 3ZFEB 4PI0A 1OH4A 3VBUC 3ITQA 5KHJA 5FZEA 4ZY9A 5A33A 2R062 1W90A 4XTPA 3QH7A 1ST8A 4LBLA 3ILFA 1GBGA 1IPJA 4XF1A 2VZUA 1ZRRA 5CVRA 2ZHNA 2GALA 2EXIA 3J7NA 1WMDA 2QQIA 3BIWE 1IHMA 4LBNA 1Y9MA 4Q27A 1GLHA 1L3JA 3BTXA 4XCAA 1N1TA 1PZ9A 1WCQA 4BQ3A 4FPHA 5DAVA 3LPFA 4PIYA 2IZWA 1SLLA 2Q8CA 3T3YA 1ZBE1 3UETA 2VVDA 3KHBA 3N36A 4P5HA 3WF0A 4HVQA 5J36A 1O5LA 2UWBA 1BHGA 3VD7A 1ODMA 4AHWA 4WZFA 3VZMA 1XB9A 3RYKA 2FDGA 2FBEA 1OVSA 4AFCA 3QBQA 5K9YA 2J1RA 2VZSA 1W8TA 3B9CA 2XKOA 1ZZ9A 4LHNA 2JWPA 2VOKA 1VBE3 2XVLA 1PMHX 2WNUB 3L2YA 4XVHA 1UYXA 4CP0A 4LBQA 3WF4A 1WLDA 1N3PA 2Y6GA 5FYMA 4CDUB 1NY71 1R093 1UOJA 2HWE1 3MW3A 1HV1A 1QJU2 3P3NA 1EUTA 3SH5A 3H8OA 2E31A 1S2BA 2EXKA 1W05A 2XXZA 4LK7A 3TWIA 2JDZA 3JZVA 4C91A 5FZ7A 5KC5A 2PLV2 4FFIA 4NPMA 1W0OA 1SLAA 1AR73 4URAA 5LY1A 3DN7A 2ARXA 4D94A 1HB2A 3AKPA 1VRH3 3MYXA 1X8MA 2L9LA 4AOCA 5FBJA 2G19A 3A22A 3E5QA 1ZRIA 4CUGA 3KM5A 1PVC3 3OUJA 3AYEA 4I3PA 4EWAA 2BNOA 4QPGC 2QQOA 2TEPA 3C8XA 1AL0G 4C1WA 3ACHA 1V6MA 4A45A 3AFGA 1W9SA 4NRMA 4K7JA 4Y3OA 3RZZA 4BHPA 4M3CA 3TN91 3V65A 5LZ6A 4FOQA 1FOD3 1WMXA 5FP7A 4A6OA 4LT5A 1IPSA 2BNMA 5HV4A 1XNKA 1DU3D 2VTXA 2AC1A 4NROA 2NP0A 3H3ZA 3PVNA 2F17A 4AYUA 4GB31 2BGPA 3WXPA 1LOBA 4HSJA 1OPMA 4RL7A 1L7RA 5A32A 3WP3A 2XJRA 4AQSA 2KXLA 2MPFA 4D6SA 2HWB3 3WQBA 4Q1PA 4F7ZA 4ATEA 1RUE1 3RJ2X 2D6LX 3A4UA 1QDOA 5EPAA 1AX1A 2IXHA 2CDPA 2WO1A 2Y6HA 3K4DA 2WC2A 1BXHA 1C8M2 1W06A 2BFUS 2YB7A 5FP3A 1W0PA 3AMQA 4XFAA 2VR4A 4CXWA 3BTYA 1UD1A 2VOTA 3AXEA 3N9MA 1DGRN 5GLZA 3VD9A 4AI0A 1QJY1 4FPLA 1SBFA 1LENA 1HXS1 1PVXA 3HQUA 4KWLA 4EN9B 1W2NA 2ADEA 2I74A 4FQZA 1ZRFA 3HIFA 1KS5A 3PUSA 2RE9A 2AACA 4FFHA 3NL1A 5DG1A 4AGVA 1LJ7A 3LWCA 1CN1A 2BRTA 3MPBA 4YARA 3GGLA 2D6KA 4LO6B 1MEC2 5BNOC 1MZ6A 1DLCA 1RUD3 4CDQC 4E8DA 5A3MA 1W99A 3RSJA 5IVCA 1X82A 1IS4A 3ZYIB 5C33A 2Q1ZB 3AZZA 4AHYA 4CEWC 4CEYC 4MOAA 1OQ1A 2WZR1 5DMYA 2QNKA 4DUVA 1RGSA 3IIIA 4N8MA 3P3PA 2RS33 2ES3A 4S2FA 1W2OA 5GZCA 1DYOA 3PUHA 3WDYA 4QQLA 2XONA 3HBKA 4IEOA 1UOBA 5FY7A 3T1LA 1JZ3A 3UV9A 2WFF1 1XSQA 1FPN2 1XC6A 4RHV1 3WOGA 4GALA 3UJQA 4FPOB 2FD8A 5IATA 2PN5A 3NJVA 4QGMA 2JG8B 2PHLA 1C57A 4Y20A 5LRSA 4MXWB 5M0TA 1ZBA2 4GMP1 1LODA 1UPSA 5JDBA 1Y3TA 3E6BA 1UPIA 4CE8A 5LBFA 4LQRA 4V1PA 1UMIA 1LCLA 4Y1YA 4UFJA 4EWDA 2QZ2A 3HD8B 4HPKB 1AR83 1RUC1 1SLBA 1FI2A 1OD3A 5FUNA 4F8AA 1RUJ3 2J1UA 2VCBA 1LGNA 1NE4A 1RUG2 4HONA 3NNGA 3OTFA 4YPJA 3C7FA 5FZ9A 2BQPA 4KG0A 1WLTA 4KH9A 3NV4A 5E1RA 3I3DA 1FYUA 1K5MC 1WA6X 3FHIB 2R7EB 2RS11 3R4SA 1UZ0A 4Y5Z0 1SFPA 2YXSA 1NLRA 4WM7A 1ZRDA 1Z78A 3URFA 1POV1 1O3RA 1NCQC 3IDAA 5CKQA 3WW3A 1OKQA 4D7YA 1QQP1 1VMJA 1ODNA 2BVBA 4EWEA 4IGPA 4EN6B 2GMEA 2WN3A 2BP6A 3F95A 5HXMA 1QOTA 2VW0A 3AYDA 4WM8A 1GUIA 4I2OA 2DFBA 4OCTA 4MHUA 1OT5A 4P9WA 1B35A 5HCBA 1RVF1 5FP4A 5FMDA 3F2ZA 1AR93 2A3WA 3H9AA 3OEBA 4B8EA 3B7MA 1XNDA 3GHMA 4LR4A 3HEIA 3OSDA 2GH2A 1RXFA 1ZZCA 4UBGA 4UFHA 3UESA 4COZA 5JXIA 2IXJA 1ND3A 3O14A 4NMIA 2YFZA 4DEVA 1VAMA 5BNPA 4IGQA 3AZVA 5FYYA 5SV5A 5C70A 4L8QA 1FNZA 4I3GA 4AAXA 2D97A 2WQ4A 2VQ0A 5LB6A 5FLIA 4BQ4A 2XJPA 3ZYPA 3VDDB 2VBPA 4M4RA 2WLQA 4FTSA 4P9YA 5I8SA 3ZXJA 1Q8OA 2ZZJA 1EAH1 1QF3A 4JVAA 3BCWA 2R30A 1ZZ8A 1I1EA 1CVNA 1PM7A 3AVRA 1F9KA 4GAZA 1EV11 4GMP0 1Z7S2 1OXCA 2W68A 1BYHA 2RMU3 2ZMLA 3OF1A 4W6WA 3J7MA 1IGOA 5A1AA 2WLPA 1HDKA 1RTVA 1RUH3 5DAQA 2XVKA 2Z5WA 5FY9A 1OOPA 1LB2A 3LPGA 4NHLA 3C2UA 3VD5A 1MQTC 3K4AA 1AL23 1J3QA 1UU4A 4HKOA 2XB6C 2WO3A 1HJFA 4DS0A 4YZ4A 4FFFA 3Q8FA 4NIHA 4XJAA 1XE7A 3E5UA 4CUBA 3POSA 5A1LA 1KS4A 5FK7A 1SCSA 3E5XA 2YC0A 5JWPA 2ZX4A 1EYBA 2QKDA 3MIHA 1R082 1CAUB 2JENA 3HNYM 3OCPA 1QY4A 4LBMA 2IWGB 2VO5A 1D4M2 2Y34A 1GWKA 4YZ3A 3GZTB 3CIHA 4GH4C 2YROA 3DKWA 3W59A 4A3XA 1PK6B 5CFCC 5F3EA 4M4PA 3K51A 2LS6A 5K0UB 5JOWA 2W5FA 3FHQA 3KGZA 1WKYA 5ANQA 2ZTNA 3MIDA 5FMBA 1OQDA 2UWCA 3VKOA 1ND2C 2E6VA 2CGPA 5ACA3 3VBHA 5C9AA 4XFBA 2RR12 4XQDA 1FATA 1TME3 3QOPA 4IV1C 3RVHA 1E57A 4XFIA 1VBE1 4GWMA 1W6PA 4Q4W3 4Z2AA 3VZNA 1FMD3 4JKLA 4U2AA 4CVUA 4OZXA 1IS5A 4FPJA 3AM2A 4QX3A 3WF1A 1XE8A 3DPRC 1R091 2WA3A 3NO8A 3WNXA 4GKYA 3KGLA 4A2UA 4D0QA 5L19A 1NCRC 2YBKA 2VUDA 3NMBA 3NW4A 4I0WB 3OGRA 2NMNA 1LR5A 4RQPC 5DDJ1 3NRUA 2WNEA 4O9EA 1IQDC 3H3UA 1AR71 4MGKE 1PGW1 2DFCA 4IL7A 4M3CE 5FUIA 5FMCA 5FZDA 5JOZA 4KGGA 4QM9A 4RR3B 2VNVA 1OI6A 3MDPA 1BK1A 1JZ2A 5IK8A 4JRLA 5JOXA 4PLNA 5FZIA 3LB9A 1VRH1 4GULA 4NRQA 4LBJA 1GZWB 2JDNA 1OA2A 1YWKA 1OF4A 1PVC1 4UFIA 1VBC1 1DBNA 3CL1A 4AGRA 3S7IA 5JZGA 2MEV2 3M7AA 4NHKA 1OLMA 1NZIA 3ZXGA 2P6HA 1YJLA 3RWNA 4BM8A 1UY4A 1JN2P 1NA1A 4FQ4A 5A6YA 3KT4A 1Q8PA 3IIAA 1R1A2 2K46A 2R1DA 3DEMA 3OJBA 4M0HA 2A70A 5HCAA 3ZFFC 1C1FA 1AYN2 1W8WA 4TN7A 5F2WA 5JOYA 2RV9A 1A34A 4TLFA 3AKRA 4YZ2A 5J98B 1V9U2 2GC1A 5A7SA 5A3LA 1WLWA 3RI8A 2YHJA 2XOMA 2HWB1 3ECQA 1WWYA 4NUBA 5T5LA 4ATFA 4E9KA 3W5NA 1GICA 4YM1A 4YW5A 4N53A 2K2SA 3WNNA 2DUOA 3ACLA 1A8MA 3CKHA 3DYOA 4L92A 4Z8BA 3MW2A 4IV3A 5D8AA 4ZU7A 4OI0A 5DXDA 3JQWA 4OHXA 5LEKA 1GOGA 2D6NA 1ULGA 1OLRA 2ZGRA 4DRRA 1NQJA 2PAMA 2G9ZA 5FMOL 2V5YA 1H1MA 3RZLA 4IE5A 1VMFA 3WP5A 1W0NA 2ZGOA 4CDWC 1RMU3 1Q5OA 2R042 1UY1A 4QPIA 1DQ4A 4WV8A 1JHNA 1OF3A 2QUOA 4XILA 5DAPA 3ZXEA 1HRV2 3J7LA 4COWA 4CCJA 5BNQA 3SMHA 4HETA 2BV4A 2WAAA 2YDEA 3AP9A 4QGNA 3ZO0B 3ACGA 4BOWA 1YXWA 3I97A 4AXOA 5T54A 2EXJA 2XDVA 4BH9A 1AUYA 4CCOA 2Y0OA 2OT7A 2VNRA 3M8LA 3BOPA 5CISA 5F7UA 2EIEA 1ZBE3 3U78A 1VB2A 4KWKA 1RUI3 2YMZA 2Q8EA 3ZSMA 2EA7A 4N7UA 4YM2A 1HN1A 2C9AA 3OG2A 4JGZB 4Q4Y3 2YV8A 1JOJA 2ZX2A 4KL1A 1LOFC 1NG0A 1VAKA 2WNVC 5DABA 5C6CA 1TMF2 1WMEA 2OA2A 2RS31 4TZDA 5F2SA 1S0CA 4XTMA 1JYVA 4PDWC 1LU2A 3PVEA 1ALYA 2FQPA 2RDNA 3GZUC 5CFDB 2ZPXA 3D82A 2DUPA 4LE3A 2QTWB 3GZEA 3ON7A 2BOJA 3CF6E 3H7YA 2ZBJA 5EXOA 5FYSA 3POWA 1SFNA 5FPUA 2R1BA 3WDVA 3HQRA 2Q1MA 1POQA 2X53S 5FCCA 5EYXA 5L9RA 4AWDA 4P9XA 2GNMA 3OBZA 1K45A 4Z82A 1AR81 5FZOB 3ZYHA 2VXRA 5J1XA 3OYWA 4LULA 2IXLA 1RUJ1 1W9YA 1ZNPA 2J1AA 1GWLA 3NAPB 1VBD3 3OGJA 1WMFA 1H8TA 3MUZ1 2IXKA 3ZSLA 3R05A 2E7QA 5TSWA 1GOHA 3PU8A 5JIAA 2VUJA 1J84A 2DUQA 4YGCA 4G3YC 3ZFEC 4A3ZA 5KWRA 4ISRA 1XBFA 2X09A 3ES1A 5ABJA 1VRBA 3WSOA 1XNBA 4OLLA 1UO9A 1ULCA 4UI9L 4Y26A 4UW6A 2DV9A 2V4AA 4QHOA 4O61A 1UNBA 3T0DA 4I0BA 1CAWA 3T0BA 3WF3A 4B1MA 2A1XA 1W8HA 2EIGA 5A3PA 3S5AA 3FLTA 1PGL2 4LOSA 5I8TA 1CAXB 3RNSA 4LHSA 4O9GA 1O7FA 3BPSA 3H7JA 2ERFA 4Z2WA 5L73A 4NO4A 2WQZC 1GYKA 4GWJA 5FLHA 1PO12 4KGQA 3FFZA 1G86A 3UK9A 4QHZA 3O5SA 1PX3A 1HB4A 2V5DA 2JG9A 3FZ3A 1GFF2 5KXCA 1GANA 4QKFA 2WNUC 1GU3A 2X5IA 4QX5A 4AQ6A 1TQ5A 2B7YA 4IE7A 5E88A 5FXWA 2JDHA 4FAHA 2LUWA 3O1SA 4Q4V1 1AXYA 4QAWA 1MR5A 1HXS3 2JE9A 2ZEYA 4YW2A 4XOGA 3OBTA 5GLTA 2E63A 3MI8A 2WFF2 2A6VA 4PLOA 4RN5A 2X05A 1K42A 2QQWA 2VBDA 2VOWA 2V09A 4P14A 3SH3A 3ZMOA 2C0ZA 4C1XA 3H50A 2Y6LA 5HI0A 2XBO2 4AFMA 2C9KA 3Q8CA 1FX5A 2CDOA 1BCXA 2W9XA 3USUB 2HWC3 2RMU1 3GCXA 1P8JA 2WZR3 2P3JA 3GBGA 1UIKA 3I2DA 3HWJA 1RUH1 5F37A 4XBQA 3PIJA 2JDPA 1PO21 3TYJA 1WW5A 3UGFA 4AFDA 3FFQA 3PU3A 3LKJA 4N53B 4AGGA 4LNVA 3OBAA 4ARYA 2JD9A 3HR9A 3I59A 2Y6JA 2V72A 1ASJ3 3LOIA 1OQEA 4L9BA 3OGVA 3EO6A 4D69A 2VZTA 4HSLA 4CU9A 4YM3A 5JPMB 2PFWA 3WNMA 3PIGA 1DQ5A 3BB6A 4Y1XA 1QKQA 5FO8B 3Q8EA 4XJ9A 2HBTA 5JR2A 2PMWB 3J8F3 4MXVA 4G9SB 4Q4X2 5C71A 4UF0A 4AG4A 3MHZA 1JYCA 2F4LA 4H55A 1N1VA 4E4SA 2PHUA 4RD7A 1JHJA 1W6MA 2XJTA 4MG2A 4IESA 3R4UA 1GMMA 3I3MA 4AHZA 3H8UA 3MIFA 5F9TA 4LKDA 1GNHA 1J1TA 4FXKB 2AUYA 2KA3A 4BISA 4XUQA 1DFQA 1N3QA 5KXEA 2XVGA 4NE9A 1TME1 1Y4WA 4Y1ZA 1DG6A 3IKWA 3ZFGA 5C8CB 4P5YA 3RMYA 2H0BA 5H9RA 4F3JA 3AKSA 4Q4W1 1POV3 3RRDA 1US3A 1V6IA 3VKFC 1SMVA 1XJAA 2Q5TA 4B1LA 2UYBA 2Y64A 4HKWA 2DCKA 4YG6A 2WKKA 5D21A 5FPAA 1QQP3 2VL4A 4JGYB 2B9VA 4BJ0A 1DIWA 4CUCA 2AH2A 4XW3A 2YGMA 2OIIA 4H7MA 3THPA 4D3WA 1PIV1 1KJLA 2P5BA 2C26A 2CWMA 5FJHA 3RS6A 3A21A 1H6XA 2VD7A 4XXPA 3LDKA 5BNNB 4AQ2A 2G1MA 5FY5A 5L7OA 1S0DA 3ZDVA 5DAWA 3VUOA 1H8VA 1UX6A 2FZ2A 3MLKA 2WJSA 3S0MA 3TB0A 4JDNA 1O8SA 3ZPYA 3I49A 4F83A 3OYWB 2QQPA 2WBKA 3CJIA 4OI4A 4A6SA 4JKMA 3AKQA 3RI9A 3B01A 1QXRA 5A3OA 1BBT2 2J42A 4IEZA 2JDMA 2JG8C 4YGEA 1V6JA 2Q30A 2W2IA 1JXNA 2R6QA 3AJYA 3ZXAC 2HEWF 5FJKA 1EAH3 3LOBA 4P9JA 4D8MA 2A6YA 4P9LA 3I7DA 4PHZA 4X8NA 4XDPA 4NWVA 1QJX2 4WVWA 1H1AA 3FBMA 2FZ1A 1RUNA 1JYNA 1ZZ6A 3RJRA 5FO7B 3SHRA 5C4WB 4P08A 3ZLIA 1H0BA 2E33A 3IPVB 1GZ9A 3T2QA 2ADDA 5DZFA 2BBVA 1QMJA 2PAKA 1WD3A 1JYTA 2NYYA 1SLTA 2EALA 5KBFA 1PMJX 5IHRA 2YU2A 5F5IA 5GKAC 4AVVA 1NKGA 2HWD3 3N35A 4GIQA 4AL9A 4ARXA 1RMU1 1GP5A 2VZVA 2W1QA 5EV7A 3I2JA 1RB8G 3I3QA 2LROA 1GQHA 1PX4A 3CHXA 1JUHA 1GZTA 2VZPA 3B93A 4AEMA 5C3QA 5IFTA 4YVWA 3BUCA 2XJVA 3HQXA 4DXZA 3CZJA 2WL1A 2VXJA 4AI9A 3TEYA 5FYVA 4KWJA 3TEZA 1XNTA 2I07B 4YVSB 3VBFA 2IXCA 1ZZBA 1BLZA 1KQRA 2G9GA 5B2GB 2R0FA 1JYWA 4FFGA 1U5YA 5DZEA 2D6OX 2WUHA 1RUI1 4CCCA 1K12A 1LHOA 1EPWA 4JTNA 1UMZA 2ZAAA 2RJLA 3OY8B 3B69A 4AF9A 1OFNA 2RJ2A 4QB1A 4Q4Y1 4PF1A 4WVMA 3SXWA 4QT6A 3VHOA 2H6BA 1V6OA 4FP2A 5LA9A 4Y4YA 1LHUA 4LBQD 4FOVA 4MGSA 4UW3A 3MZHA 5HXVA 2ARBA 4U36A 3VHPA 1HRI3 1QH7A 4FCAA 1KGYA 3I4IA 4AVBA 3JD72 4CP2A 2R072 4IEUA 3VDDC 3WHTA 3VBUA 5DDJ3 1FOD2 4QQ2A 5F3GA 3WT3A 1VR3A 2FCTA 2DVFA 1FV2A 3LEGA 3KQRA 4RS5B 4M01A 2R063 1E5RA 4Q26A 1RUOA 1COV2 2AEYA 4V2WA 4XCBA 1S0FA 4HZFA 2VAUA 4MGTA 5AVAA 2RM21 2BEOA 1J3PA 3WY6A 3S57A 3J4UH 1WBLA 1OBNA 2CGOA 1WUVA 2WT1A 3RZJA 4N43B 5T55A 2VCAA 4LA3A 1VBC3 4GJYA 3WP4A 1VBD1 2RS52 3WNPA 3VZKA 1LGCA 3WVJA 4QB6A 5IVVA 1H1IA 1DZQA 1IS6A 3LDBA 5EJ1B 3GF6A 3T30A 3O1RA 1HX6A 3VBSB 2BERA 4LA2A 1SEFA 3ORJA 1MS1A 4HBNA 3ZSEA 3B3QE 3KLSA 3OBRA 3FJSA 1GKBA 2CU5A 2JECA 2VNGA 3N9NA 2PHTA 3HNBM 4IW3A 2HBUA 3IB3A 5H9SA 2GAUA 4YW6A 2Z4FA 4BK5A 1PM4A 3O1MA 3B02A 5FZAA 4NIGA 1LESA 5BNNC 3ZKUA 5F6LB 4NHXA 2XWJB 1PK6C 3LSDA 1SBEA 5FQ0B 3W9AA 4ISQA 4IEYA 4CP1A 1N3OA 5CADA 5K0UC 4P02B 2W94A 5FZ6A 2D6MA 3TAYA 5KXDA 1RUD2 4DINB 4TTGA 5LBCA 2VCCA 4OUSA 3RYRA 5GZFA 3BI3A 2D3RA 4Y22B 1UX7A 4AAPA 4E2QA 4TXWA 5L9BA 2ZGNA 1W6NB 1YQ8A 1JS9A 2RS32 4R9BA 2A3XA 4QPGA 5FAXA 2OYZA 4EROA 3LF7A 1SPPA 4QX1A 4FTBA 2QDNA 5FTTC 5H9PA 5IYYA 2BGCA 1YRZA 1JZ6A 1U0AA 2BNNA 3LFMA 4UAPA 3NVCA 1UYYA 1S0BA 3ZX7A 4A7YA 3ZYJB 2WQ8A 3N9LA 5A7OA 2WO2A 1CONA 1DYPA 3RZGA 1XNAA 3GJAA 3DGTA 2JKXA 1E5HA 1LOCA 3GDBA 3MLLA 3WNLA 4RR3C 3POGA 3KSCA 4PJYA 4CDXC 2XH6A 3ZYFA 2OQ7A 2DVGA 2HH9A 2XJSA 2HWC1 2W47A 4XJZA 3WCSA 4DUWA 3VV1A 5FPVA 2YPJA 3U1XA 2V73A 2WZPP 1CWPA 3ACIA 1GQPA 2ZEZA 1S2EA 2VJXA 4XF3A 4BE3A 2WT2A 2ORXA 3VBOB 1BJQA 5G05L 3UKTA 4BQ5A 4COYA 3POIA 4OVEA 2JDAA 1LTEA 3BU7A 1W2UA 5B4XA 1ASJ1 2ET1A 5FZLA 2B5HA 1JYIA 1NAEA 2CL2A 3ZR6A 4RGGA 1UY3A 1E5IA 3EBRA 5F3IA 4XUPA 4B7KA 4BU2A 2WT0A 1C8M3 5A33B 3J8F1 2ZHKA 1XYPA 1JZ7A 5C3RA 2E51A 1X7NA 5IVBA 1RUF2 1H6YA 1UKGA 4K21A 4NIAA 1AVBA 5J37A 1JBCA 2AR6A 4BQ1A 5GZGA 3O0VA 3AMHA 1DQ2A 3RG0A 1O3SA 3ETQA 4FOYA 4N9HA 3INAA 3DUIA 3VZJA 2DBNA 2LTNA 2VZRA 2IXIA 4CDQA 1AR92 3LSEA 5BNOA 3FUQA 2J1VA 5A70A 1MEC3 1F35A 2CHHA 1N47A 1QU0A 1XRUA 4FAGA 4LBOA 4E4ZA 5JSRA 3HJRA 3OD4A 4CEWA 1TNRA 2EIDA 2ZS6B 3T2TA 3UGGA 4CEYA 3DL3A 4NWWA 3GM8A 5FXVA 2WWSA 1CQ9A 4WVMB 4IEPA 2GC0A 5JI7A 1C4RA 2ZGTA 5EWSA 3RGBA 3PVBB 4OI2A 4CCEA 1FXZA 2WAOA 1O4ZA 3EMRA 4B29A 3R0RA 4HN0A 5JR7B 5IWFA 2A6WA 1VAVA 2OZJA 1BZWA 2Q8DA 3V0AA 3OD0A 2HWF2 4AEDC 3B5LB 1A3KA 1YQ6A 4WVVA 4Y24A 5LCWL 4D7TA 3O1PA 3IMNA 2XPJA 1YIPA 3M3QA 3NNFA 1UW8A 4OFGA 1RHI3 4FPKA 4JGZC 4PBPA 3VBRC 1UXZA 2QJVA 1AX0A 5CAZA 2FDFA 1VMHA 4FOWA 1LGBA 5AC93 2VOVA 2GC2A 3GALA 1VIWB 1OA3A 3U14A 4EJRA 4QQPA 4CXXA 2ET7A 4Q4V3 1AL22 3OPWA 3CDZB 5CFDC 4H2AA 2P37A 4NAMA 4HK9A 2NZ9A 4ZPIA 1D0GA 1VBA2 3PNAA 5AVPA 4BMEA 1IKQA 2XWBB 2UWAA 2ZAHA 1K5MA 3ZN6A 2VPVA 4M3CB 3KF3A 1DGWX 1CGPA 4LIVA 2YZ4A 1UZYA 2ZGUA 1S55A 2GMMA 4R9CA 1NCQA 2JDUA 4CCLA 3D0JA 3ILRA 3U75A 5JAXA 5EYYA 3EQEA 1HJGA 2J1EA 2W39A 4XYXA 4CZSA 4D7SA 2JXAA 4META 2GDFA 1RJ8A 1APNA 4OMCA 4YGBA 5IVFA 2GSYA 2OQ6A 4MZUA 1DZRA 4GKXA 1DCSA 4FPGA 1XOYA 4MHRA 3NAPC 5A32B 3N7KA 3SCHA 5A3UA 5LA2A 1J59A 1IPKA 1PO23 1VBB1 2ZHLA 3NWKA 1YNAA 5FREA 2O14A 1VE0A 4L2NA 3WV6A 2PXJA 4QPWA 3BU0A 5DAXA 5ACA2 5HCFA 1BMV1 2P3KA 1J1LA 5LBBA 4D6QA 5E8AA 2W1UA 3JB8A 2DBIA 2HWD1 4J1WA 5EJZB 4XDQA 5K7PA 2XHNA 3O1VA 5L9VA 5A7PA 1FMD2 2YC2A 5EIYB 1VP6A 1V0AA 1LRHA 1PNGA 1POV0 3K75B 1WW4A 1BEV2 1O3QA 1MACA 4IDZA 2UURA 5DUWA 1UCXA 1AYM2 1F5JA 1S1AA 1UN1A 2RVAA 2GN3A 3NKTA 4Y1VA 4TSVA 4Y33A 3U4SA 3WDWA 4GWIA 4LKEA 4BA6A 1NX9A 5C3PA 4NRPA 1UQXA 4QMAA 1YI7A 1U5IA 4LE4A 1OH3A 2B45X 5ERLA 1AR61 1YUDA 4PI2A 4DXRA 2FDHA 2ZKLA 3TEXA 5FZMA 4LMFA 4AI3A 3TOJA 5HPOA 5SV8A 5LEJA 3TEWA 3AL6A 1UOGA 5FZ3A 1JZ5A 4HKLA 4YW4A 1HRI1 5DUVA 1WGPA 1X8EA 1UU6A 3AZYA 1MQTA 1MZFA 2A3YA 2VECA 4OULA 3WUDA 2JB4A 5GLVA 2WR9A 3WCRA 2BZDA 1UF2C 1DYKA 1G8WA 2JDYA 3RPQA 1G9BA 4OQ8A 4CCKA 5LA0A 2PHWA 3U07A 2A5ZA 4NPLA 4X6QB 2WRAA 1PIV3 3LQCA 4CU7A 1UOFA 1V70A 2R061 4UFLA 3WW4A 1T2XA 1CPMA 2VMIA 4Y20B 5CKNA 4LO8A 5LW9A 1R083 4XF4A 2LALA 4LK6A 4QKBA 1PNFA 4GH4A
chains in the Genus database with same CATH topology
4FP3A 5CFCA 2DVAA 3QCWA 2R16A 4BMBA 1OMIA 3VHRA 3AMMA 1ND2A 3ZN5A 5BPXA 1CX4A 1Q56A 4M3CF 2JICA 5CU1A 3MFCA 4ZXKA 3PMEA 1PZ8A 4CDQB 1YFWA 4R9DA 1OHFA 4IV1A 1ZVFA 3ASIA 2RR13 4HK8A 1O4TA 4YFZA 4WM7B 5GLWA 2VG9A 5LRRA 3K48A 3IBMA 3AZWA 4X8PA 3DPRA 3V56A 1F8VA 1NCRA 1W6OA 1QJU1 2UY9A 4RQPA 2VULA 2VOXA 1RITA 1ZBE2 4YFWA 1GZCA 4WM8B 2JX9A 2E7TA 3H1MA 3U10A 1U5XA 3CEWA 1B35B 4YG3A 5C8CC 4B4QA 2LM3A 4LHKA 2P3IA 5FRAA 1H2MA 3G7DA 4G4FA 3D5OA 5BV6A 4FPCA 1ND3B 1RC6A 4MGZE 4JGYC 5BNPB 1YFUA 4BIFA 1NY72 2HWE2 2Y0IA 1MZ5A 2MEV3 4MH0E 4DY3A 3AX4A 3AYCA 1GQGA 2ZX0A 2DWRA 2XJUA 5FFOC 2O8OA 1I6XA 2OW4A 2GH8A 1YHFA 4SBVA 3ZFFA 4ONUA 4ES8A 4E4DX 2WS93 1AYN3 3O0XA 3RYPA 1CAVA 2CTVA 2UY8A 3MICA 4UBHA 1CJDA 3OPZA 3IN9A 4XJUA 1W6QA 1UAIA 2JJ6A 5CB7A 1DGLA 4DNYA 3E6CC 3D6EA 1OOPB 1Y43B 1OA4A 3M1HA 3TN92 5IK4A 3N7LA 1DDLA 1C8M1 3AFKA 4CDWA 5KHKA 2DCZA 2I2SA 2AREA 2F4PA 3MLJA 2R043 2KM2A 2RM23 3SNMA 1IZ3A 2NM1A 2Z79A 4GB32 3B9IA 4YZ5A 2Z69A 1H9WA 1HRV3 3QACA 5C4WC 5FOJB 4XQWA 1Q43A 3GZAA 3U4XA 1RUE2 1DQ6A 2ZGSA 2QZ3A 2WSVA 4R52A 1MEC1 2G4IA 2MNGA 3VBHB 1S0IA 4AVSA 4N90A 5DUUA 5C9AB 2PHDA 4XPVA 5FMOS 3MFAA 1WW6A 1LOFA 2WNVA 1W6PB 1QJY2 1KFUL 1YIFA 1LHVA 1TMF3 4PDWA 1HXS2 1TEIA 3ILNA 1LULA 1QXJA 4YVSC 2A71A 1YYNA 1NE6A 4WVZA 3KCYA 1YO8A 3THTA 4YYOA 3HMYA 3H0OA 1LKNA 3MF9A 3M3CA 3WUCA 3N3HA 3N7JA 1JTZX 2SBAA 3ZXDA 1RHI1 3GYDA 4URTA 5AC91 2WZR2 3ST7A 3BALA 4I01A 3BTAA 3ROUA 4QQHA 4UW5A 3BPZA 3ENRA 4CDUC 5T5PA 1XU2A 5JZGB 2YUEA 4PBOA 3ZFEA 3AXDA 4RHV2 2K0GA 1ASJ2 3KT1A 4LO4B 5JSPA 1NA1B 5KHGA 2ENRA 4QU2A 4RS5C 2Y26A 3J8F2 1OFSA 3LA7A 4HVOA 4YLZA 4N43C 3EHKA 1RUC2 1TNFA 3H1YA 1DLLA 3CU7A 1KDKA 2CYFA 4RQPB 1HV0A 1QJZA 1UL9A 2VH9A 4IV3B 5D8AB 3HN1A 3VBSC 2PYTA 4FPFA 1AJOA 1PO13 2BYVE 2RS12 3POYA 1CD3G 2ATFA 2WNUA 2VW2A 4CYDA 5IK7A 4QPIB 2MHFA 5IT6A 1QQP2 4HL0A 4AFAA 3ES4A 2P34A 1OSGA 1B09A 2BTVC 4Y1UA 1SDWA 4LUKA 5J96B 1YCIA 4BCUA 3JQXA 2OZ6A 1RVF2 3JBG3 4Z1VA 1D4VB 2DCYA 4WZCA 3GNEA 4QQOA 2XBO3 3PMSA 2X29A 1LOGA 2XG3A 4YG0A 3U0ZA 1Z7S1 2R0HA 1SLCA 1JUIA 2D93A 2XLGA 2SLIA 3GBWA 3ZYGA 2HJIA 3B00A 4NVPA 4EN0A 5FDBA 1XYNA 4MLOA 2PHXA 1MS0A 1NYWA 2XHKA 3TNQA 1NLSA 5H9QA 1EAH2 1NQDA 1R081 3J26N 1LECA 1EV12 2JEMA 1D4M1 3WG4A 2OUHA 4Q0PA 3LAGA 5FPZA 5FOBB 5CG8A 5FBZA 4BZ4A 1TE1B 2GC3A 3VBOC 3TNPB 1ENXA 4RSUA 1U5ZA 1H8TB 1ENRA 3ZDSA 2D6PA 2NMOA 3MPPG 4XMIA 2AZ5A 2ZX3A 4I09A 2EAKA 2RR11 1HQNA 5ABJB 3N4MA 1WCDJ 4LLFA 1T6GC 1I5ZA 1MS4A 2VMHA 3BODA 1V6LA 4H14A 4XJWA 2D5FA 1CAWB 1FAYA 4AEKA 1G9CA 2ZGKA 2RJKA 1VALA 5CIRA 3LA3A 1VBB3 1M4WA 2ZA9A 2P2KA 1X50A 2X8KA 4FPYA 2WIIB 3UL2A 3SH4A 2B8MA 2D43A 4B7EA 5GALA 4CRQA 5GLUA 1LHWA 1OPOA 1LU1A 4XXAA 2VGDA 1SBDA 1VBE2 3CJXA 1CESA 2JG9B 1D2QA 3NKGA 2X5IB 1S2KA 3AP5A 1WLCA 2VU9A 2PHFA 2WINB 1R092 2H0VA 1WW7A 4Q29A 2MEV1 1H2KA 1YJKA 5DDJ2 2JG8A 4IEXA 2EVXA 1AR72 1BBT3 1PGW2 4IEVA 4EN7B 4MXWA 5I0TA 1ZREA 1R1A1 4DPNA 4LLOA 1AR63 4XQ4A 1XNCA 2VQAA 2WS91 2C5DA 1AYN1 1VRH2 1MZEA 4I30A 4HT1T 4HPKA 1V9U1 5BXXA 2XGXA 1CIWA 1D0HA 1KD7A 1PVC2 2XKPA 1QJX3 1VBC2 1RB8G 2NN8A 3WG3A 5T50A 5GZDA 1QWRA 3WDTA 3WW1A 5L36A 3VZLA 1QDCA 3AMNA 3M4FA 4FPEA 1QNWA 2BFUL 3I59B 2GZWA 4Q0SA 4KG8A 3AP4A 2R041 1XXNA 5IUQA 4COUA 1HRV1 2A75A 4LEJA 4FTEA 2HWB2 1W6MB 3WDXA 1H2NA 3E6DA 4IQPA 1HIXA 4S2HA 1MVQA 1LOEA 1F2NA 1AJKA 1HKDA 4YGDA 1GR3A 4Q0QA 4QPYA 2ZMNA 2F6BA 2GU9A 1H4HA 1ENSA 3VKMA 3ZN4A 1H4GA 3CLPA 2OPKA 3L2HA 1D2SA 3ZFGB 1AZDA 2E7AA 4AEJA 3KCCA 3RMXA 1WA4A 4JAAA 1ONAA 1TMF1 4JCKA 4CTEA 3NJZA 5JOZA 2Z42A 3I8TA 1LHNA 1CR7A 2CAUA 4MYEA 4QD2A 1YLLA 1QJU3 3VDDA 4AW7A 1NZCA 3RDIA 2VNOA 3JD73 2R073 5EFUA 2K9ZA 2B9UA 3AKTA 2PLV3 4LTAA 4ZU4A 3IDBB 1X36A 4XFFA 1IS3A 4M0NA 3MEPA 1COV3 4XFHA 3Q9OA 5L7OB 4LO5B 4ES9A 1IOAA 4MVTA 4JTOA 4X6RB 4MUVA 2I45A 1ZX5A 2P17A 1LEDA 2RS53 4E2GA 1QGLA 2DTWA 2HYKA 3CJIB 3S7EA 3NV3A 3PVOA 1QOSA 2AGSA 2E9QA 5CBLA 4HVRA 4FSJA 1CAUA 3E97A 4IEWA 5E89A 5JIUA 4DY5A 1HW5A 1WCKA 1XQNA 4B4PA 5BNNA 1G9FA 4UW4A 4W65A 1M06G 1PK6A 5K8SA 1AR82 3MF6A 1REEA 2D98A 2R32A 4S2GA 4ASMB 1V6KA 1SCRA 1YI9A 2EF6A 1RUJ2 2Q4SA 5K0UA 3PJYA 1PGL1 2PHRA 3EJKA 1KJRA 3BOWA 4Q8KA 1PHMA 5JPNB 2YY1A 1FV3A 1MS3A 1QH6A 2ZGMA 1S0JA 2XJQA 3R4DB 3ZYRA 1PO11 4IXLA 1V00A 1F31A 2CNAA 2PAEA 1DQ1A 3QD6A 4K8FA 4WM7C 3AP6A 3ME2A 2JD4A 2JE7A 3W58A 1EY2A 4YVWB 2WSUA 1Y9QA 1J3RA 1AF9A 4GQ7A 2VVEA 4EV0A 1BVVA 3VBFB 1DHKB 1Q8VA 5CG9A 2CWSA 4WM8C 4XFGA 4OHVA 1WD4A 3WX5A 3JBG1 1VJ2A 4RR3A 1B35C 4JDMA 4CDXA 3FLPA 1RHI2 2OVUA 2XBO1 2ZJCA 1OD5A 2ZABA 1GZWA 5AC92 3D0SA 4XHBA 1S0EA 3MIEA 2XUMA 1ND3C 4Q4V2 1HQWA 5BNPC 4Q8LA 3AB0A 4XEZA 4XETA 5EZWA 4HANA 4JC1A 3S30A 4RA0A 4KNCA 1FPN3 1LOAA 5IK5A 4Q2FA 2BUKA 3O12A 3WP6A 3VBUB 4NN0A 4RFT0 2O8QA 1X33A 4R9AA 3ATGA 1JH5A 1HLCA 1ZBA3 2ZACA 3NSTA 4L97A 2YGLA 4Q4X1 2RMU2 4OHYA 1I3HA 5CNAA 2DTYA 1RUF3 1RUH2 3D4KA 1NOVA 2D40A 2BPA2 3VZOA 1PO22 3ZXKA 4DRVA 5FLJA 1OOPC 5EJ3A 4NHMA 5LK5A 2E53A 2ZOEB 1RUG3 1IKPA 2GMPA 3IDEA 3SISA 3ZIXA 3IWZA 2DCTA 2PELA 4XMAA 5J48A 4XF9A 4FT8A 3AK0A 4LO7A 4COVA 4K1YA 2A6XA 4C90A 1GV9A 4LBQB 3LCPA 3M3EA 5BYNA 1Q3EA 1AXKA 2Z2SB 3SLIA 4AVCA 1PZ7A 2BW8A 3I54A 4QGLA 3J9SA 4AEDA 4MGIE 3RQ0A 3VL9A 1O3TA 1NXD1 5T5OA 1KDMA 2HWF3 3ZXFA 2B39A 5KXBA 1ULDA 3VBHC 4DZGA 1TME2 2FMYA 4DB5A 5C9AC 4TWTA 4RGAA 4JGZA 4YSFA 3VBRA 1UU5A 2PA7A 3A0KA 2BWAA 4Q4W2 4PF5A 3KT7A 3SITA 4GA9A 4PCRA 4UXAA 3GHNA 3CNAA 4FXGB 3DF0A 3LGRA 4QPGB 4HLTA 5CFDA 4DFSA 5JSOA 1REFA 3MIGA 1SQ4A 5T52A 3WINE 4K1ZA 1BBT1 1N1SA 4EN8B 1VBA3 1PIV2 2IFWA 4OUMA 5C8WA 4IETA 1UIJA 4ORFA 1CJPA 1QJX1 4W6YA 3WG1A 1Z7S3 3AYAA 4AI1A 1VB4A 3KD4A 3NAPA 3ZXLA 3KS7A 3D8CA 3PHMA 5I93A 4DQAA 5JZGC 1Z0HA 1CPNA 4FVVA 2EXHA 1NA1C 4XFCA 1H30A 4A7KA 1V6NA 1UZZA 3HT2A 4K3UA 2O1QA 1G9AA 2BVVA 1I9RA 3B94A 3V0BA 4J1XA 3IT8A 3OGGA 3M3IA 1C3HA 1KITA 2ZGQA 1D4M3 4XZPA 3FX3A 2DVDA 4B3NA 1RINA 2GNTA 1BEV3 4GXLA 2NQYA 1ZYBA 3WQ1A 3HAGA 4AQTA 1CAXA 5J3UA 1AYM3 3JU9A 4K20A 4QXKA 4DOUA 2RHPA 3CO2A 4N53C 2PQQA 3V64A 1KRIA 3ZSKA 1DGWA 4IV3C 5D8AC 5BNOB 1JW6A 1ENQA 5KHHA 1Q8QA 3WG2A 4WBBA 4HFSA 4CDXB 1RMU2 2D44A 4IERA 4XBLA 3N7MA 3WD5A 4CEWB 4CEYB 4QPIC 4AE2A 5F1RA 2D3PA 4LHLA 1DQ0A 1RJ7A 3FBYA 2VY0A 5D1IA 1FNYA 4JV4A 4ITCA 4XIOA 3JD71 2R071 3FLRA 1Y7BA 2PLV1 3V0AB 1FOD1 5GJ6A 1RUI2 4C0HA 2VW1A 1Q8SA 2H6CA 1MVEA 3O7OA 3T1MA 2WA4A 2IC1A 1DF0A 3M3OA 2WS92 4AVAA 1COV1 4Q4Y2 3USUA 3ALQA 1REDA 3USSA 4BLJA 2A73B 1PGSA 2ILMA 4I02A 3SCFA 4ZKTB 1O4YA 3VN4A 3KCXA 3IDCB 4XIKA 2RS51 4BIOA 3QLQA 4PIZA 3PJQA 4K6BA 1S0GA 1A6CA 3TRSB 1G9DA 1G7YA 4XJ8A 4XF0A 4AI2A 2GNDA 4M00A 1K5MB 3ZN6B 1R1A3 5BY5A 1GSLA 2VMGA 3WR0A 4KU7A 1XU1A 1O5UA 1ULEA 3MIBA 1NCQB 1N1YA 2RM22 2W08A 4AK3A 1EP0A 5GM0A 4L11A 5JLVA 3KMHA 4JRAA 4YNIA 1V9U3 4ZU5A 2HKXA 1VBD2 3GBFA 4XE9A 3U11A 4Z92B 2YYOA 2QDRA 1WBFA 4YW1A 4MV2A 1H8TC 2AYHA 3UKVA 4A7ZA 4AEDB 2ZKNA 5F5QA 1RUD1 5C8CA 4YW3A 3APBA 5ABJC 2QVSB 2DVBA 1QOOA 3WLUA 4W6XA 1BKZA 3VBRB 1WCSA 1SACA 4Q1RA 2Y38A 4Q0VA 4QM8A 1AHSA 4PQ9A 4JGYA 1RIRA 2W0XA 4FO9A 2HWE3 2UU8A 3VLBB 3L9JT 2Q8OA 4KBBA 4PLMA 4GWNA 4P9IA 2D5HA 1OLQA 2XLFA 2ZHMA 1A78A 1C5IA 5AFBA 2GN7A 4HMZA 2JG9C 5LK7B 2X5IC 3DV8A 1J58A 3FE5A 1A8DA 5F6KA 4XHXA 4N9IA 1MQTB 5CA6A 2VVFA 1YFYA 2CV6A 5FO9B 1FPN1 1UKRA 1HQLA 2TBVA 3LA2A 2IFRA 1F5FA 3TN93 3VKNA 1QXPA 4NPRA 4HN1A 2G9FA 3FWEA 1SLIA 1ZBA1 4NOTA 2NPIA 2GNBA 2HWC2 3PTYA 1RL3A 3V0BB 1RUF1 3H1WA 4IEQA 4GB33 5I8YA 2JKBA 4GH4B 1BVP1 5C4WA 5CFCB 1C1LA 4LUMA 3IPVA 4B4RA 1VLNA 5I0UA 1RUG1 2C1FA 4LBKA 1RUE3 3C3VA 3WQ7A 4KQ7A 4BYYA 3R6SA 1ND2B 2HEVF 1AR91 1ZRCA 2ZGPA 4R8HA 5DZGA 2HEYF 4OHZA 4JDOA 4YRDA 1ZA4A 4IV1B 2D7FA 3AZXA 2ZGLA 2W52A 2XL9A 1QJY3 3HBZA 2EAAA 4YVSA 2A7AA 3DPRB 3PLQA 3ZMNA 4INDA 4BLIA 1BQPA 4MGYE 1NCRB 2B42B 3MGUA 2DF7A 3FUOA 1W6OB 2B46X 2XL7A 3WW2A 3WZ1A 5BUVA 1ULFA 2HWF1 2TNFA 1DZTA 3M70A 3TBDA 3JBG2 3UJOA 5JCTA 5KHIA 3OY8A 5LRSA 3AJZA 5I0SA 5E16A 4AHXA 3ELNA 2XLAA 2AENA 4XBNA 4K40A 3ZFGC 3WHUA 1G6NA 2FHRA 1FT9A 4QHBA 1C28A 4C0BA 1KFXL 3KZ4C 3MW4A 1H2LA 4H3WA 4P9GA 4BPZA 1C5HA 4CDUA 2DCJA 4K9SA 4AI8A 1AL21 4E27A 4AFBA 1AX2A 2NLRA 2WFF3 1VBA1 5T5JA 2ZZQA 4RHV3 5FPXA 3LZZA 3X29B 4RS5A 1SFYA 2QFEA 4BWOA 5HBAA 4GMP3 3ZFFB 1DGRA 1LEMA 3WDUA 3JUUA 1ZM1A 4I0AA 5L7OC 4SLIA 3M2MA 4N43A 1CAVB 2ZX1A 1MS5A 1AXZA 5J09A 1RUC3 1W6QB 1XYOA 4YZ1A 1ZZ7A 4OHWA 2TUNA 4YM0A 3JCIA 3JB4C 3CJIC 4JQRA 2N7GA 1KXGA 4NR1A 5ACA1 5I0RA 2OUJA 3VBSA 3VL8A 3EXUA 2FMDA 4R4XA 2DYCA 2RS13 5JMCA 1NXMA 4L99A 2ZMKA 4KU8A 4MX3A 1H9PA 1URXA 2DU0A 3O0WA 1FMD1 4CDWB 3FMGA 3VHNA 3FC0A 2DURA 3A0NA 3NV2A 4PIXA 1O91A 4Q4X3 5FQ0A 4Z07A 1C8NA 5DG2A 1BEV1 3UKNA 1AYM1 2UYAA 1VBB2 2VUAA 2A6ZA 5GZEA 2QCSB 1BMV2 4FBFA 3HT1A 1QHDA 1YFXA 3KB5A 2CAVA 5I91A 1RVF3 1GNZA 2HWD2 2Q0AA 2ZCWA 4AVTA 4Y22A 2CGNA 2BWCA 4ASLA 4OI1A 2R49A 5JVVA 1W6NA 3G6JB 4E2SA 3S6PA 2PTMA 2DU1A 1EPZA 2WNVB 1MS8A 4YVWC 4J6GA 1R1ZA 5T3NA 3WQ0A 3AP7A 4PDWB 2QE3A 3AMPA 5KC6A 3VBFC 3SCGA 4H7LA 3ZSJA 1PMIA 1W39A 5J7MA 2CY6A 4S2DA 3ZIWA 4DMIA 3IM0A 1AR62 4N7IA 3VGIA 2WFPA 5JI9A 4MSVA 3NV1A 5DUXA 3QH6A 1EV13 2ETEA 3VKLA 4Q0UA 3ZVXA 1HRI2 3VBOA 1IQAA 5AFEA 1MS9A 4R4ZA 1U12A 2O0OA 2D3SA 4TYSA 1QNYA 3ZFEB 3VBUC 5KHJA 5A33A 2R062 4XTPA 3QH7A 4LBLA 3ILFA 1GBGA 1IPJA 4XF1A 1ZRRA 5CVRA 2ZHNA 2GALA 2EXIA 4LBNA 1WMDA 3BIWE 1IHMA 4Q27A 1GLHA 1L3JA 1N1TA 1PZ9A 4FPHA 4PIYA 2IZWA 1SLLA 4HVQA 1ZBE1 2VVDA 4P5HA 3N36A 5J36A 1O5LA 2UWBA 4AHWA 4WZFA 3VZMA 3RYKA 2FBEA 4AFCA 3QBQA 5K9YA 3B9CA 2XKOA 1ZZ9A 4LHNA 2VOKA 1VBE3 2XVLA 2WNUB 3L2YA 4CP0A 1WLDA 1N3PA 4CDUB 1NY71 1R093 2HWE1 3MW3A 3P3NA 1HV1A 1QJU2 3SH5A 1S2BA 2EXKA 3TWIA 2JDZA 3JZVA 4C91A 5KC5A 2PLV2 1W0OA 1SLAA 1AR73 3DN7A 2ARXA 4D94A 3MYXA 3AKPA 1VRH3 1X8MA 3E5QA 3KM5A 1PVC3 3AYEA 4I3PA 4EWAA 2BNOA 4QPGC 2TEPA 1AL0G 4C1WA 1V6MA 3AFGA 4BHPA 4K7JA 3RZZA 4M3CA 3TN91 3V65A 4FOQA 1FOD3 4LT5A 2BNMA 1XNKA 1DU3D 2NP0A 3H3ZA 3PVNA 4AYUA 4GB31 3WXPA 1LOBA 4HSJA 1OPMA 4RL7A 5A32A 3WP3A 2XJRA 4AQSA 2KXLA 2MPFA 2HWB3 4Q1PA 4F7ZA 4ATEA 1RUE1 2D6LX 3A4UA 1QDOA 1AX1A 2IXHA 2WC2A 1BXHA 1C8M2 2BFUS 1W0PA 3AMQA 4XFAA 1UD1A 3AXEA 1DGRN 5GLZA 4AI0A 1QJY1 4FPLA 1SBFA 1LENA 1HXS1 1PVXA 4KWLA 4EN9B 2I74A 4FQZA 1ZRFA 3HIFA 1KS5A 2RE9A 3NL1A 5DG1A 4AGVA 1LJ7A 3LWCA 1CN1A 3MPBA 4YARA 2D6KA 4LO6B 1MEC2 5BNOC 1MZ6A 4CDQC 1RUD3 5A3MA 3RSJA 1X82A 1IS4A 3ZYIB 5C33A 2Q1ZB 3AZZA 4AHYA 4CEWC 4CEYC 1OQ1A 2WZR1 2QNKA 1RGSA 3P3PA 2RS33 2ES3A 4S2FA 5GZCA 3WDYA 4QQLA 3T1LA 4IEOA 3UV9A 2WFF1 1FPN2 4RHV1 3WOGA 4GALA 3UJQA 4FPOB 2PN5A 4QGMA 2JG8B 2PHLA 1C57A 4Y20A 4MXWB 1ZBA2 4GMP1 1LODA 1UPSA 5JDBA 1Y3TA 3E6BA 1UPIA 4V1PA 4Y1YA 1LCLA 4EWDA 2QZ2A 3HD8B 4HPKB 1AR83 1RUC1 1SLBA 1FI2A 4F8AA 1RUJ3 1LGNA 1NE4A 1RUG2 3OTFA 2BQPA 4KG0A 1WLTA 4KH9A 3NV4A 5E1RA 1FYUA 1K5MC 3FHIB 2RS11 4Y5Z0 3R4SA 1ZRDA 2YXSA 1NLRA 4WM7A 1Z78A 3URFA 1POV1 1O3RA 1NCQC 3WW3A 1OKQA 4D7YA 1QQP1 2BVBA 4EWEA 4EN6B 2GMEA 1QOTA 2VW0A 3AYDA 4WM8A 4I2OA 2DFBA 4P9WA 1B35A 5HCBA 1RVF1 1AR93 2A3WA 3H9AA 4B8EA 3B7MA 1XNDA 3GHMA 4LR4A 2GH2A 1ZZCA 4UBGA 4COZA 2IXJA 1ND3A 3O14A 1VAMA 5BNPA 3AZVA 5SV5A 4L8QA 1FNZA 4I3GA 2D97A 2WQ4A 2VQ0A 5FLIA 2XJPA 3ZYPA 3VDDB 2WLQA 4FTSA 4P9YA 5I8SA 3ZXJA 1Q8OA 2ZZJA 1EAH1 1QF3A 4JVAA 3BCWA 2R30A 1ZZ8A 1I1EA 1CVNA 1PM7A 1F9KA 1EV11 4GMP0 1Z7S2 2W68A 1BYHA 2RMU3 2ZMLA 3OF1A 4W6WA 1IGOA 2WLPA 1HDKA 1RTVA 1RUH3 2XVKA 2Z5WA 1LB2A 1OOPA 4NHLA 3C2UA 1MQTC 1AL23 1J3QA 1UU4A 4HKOA 2XB6C 4DS0A 4YZ4A 4XJAA 1XE7A 3E5UA 3POSA 1KS4A 1SCSA 3E5XA 2YC0A 5JWPA 2ZX4A 1EYBA 2QKDA 3MIHA 1R082 1CAUB 2JENA 3OCPA 1QY4A 4LBMA 2IWGB 1D4M2 4YZ3A 3W59A 5BNNB 3GZTB 4GH4C 4A3XA 2YROA 3DKWA 1PK6B 5CFCC 3K51A 5K0UB 5JOWA 3KGZA 2ZTNA 3MIDA 1OQDA 2UWCA 3VKOA 1ND2C 2E6VA 2CGPA 5ACA3 3VBHA 5C9AA 4XFBA 2RR12 4XQDA 1FATA 1TME3 3QOPA 4IV1C 1E57A 4XFIA 1VBE1 4GWMA 1W6PA 4Q4W3 3VZNA 1FMD3 4U2AA 4OZXA 1IS5A 4FPJA 3AM2A 1XE8A 3DPRC 1R091 2WA3A 3NO8A 3WNXA 4GKYA 3KGLA 4A2UA 5L19A 1NCRC 3NW4A 4I0WB 2NMNA 1LR5A 4RQPC 5DDJ1 4O9EA 2WNEA 3H3UA 1AR71 4MGKE 1PGW1 2DFCA 4IL7A 4M3CE 4KGGA 4QM9A 4RR3B 1OI6A 3MDPA 1BK1A 5IK8A 4JRLA 5JOXA 4PLNA 3LB9A 1VRH1 4GULA 4LBJA 1GZWB 1OA2A 1YWKA 1PVC1 1VBC1 1DBNA 3CL1A 4AGRA 3S7IA 5JZGA 2MEV2 3M7AA 4NHKA 3ZXGA 1YJLA 3RWNA 4BM8A 1JN2P 1NA1A 4FQ4A 3KT4A 1Q8PA 3IIAA 1R1A2 2R1DA 3OJBA 4M0HA 2A70A 5HCAA 3ZFFC 1C1FA 1AYN2 5JOYA 4TLFA 3AKRA 4YZ2A 5J98B 1V9U2 2GC1A 5A3LA 1WLWA 3RI8A 2YHJA 2HWB1 3ECQA 5T5LA 4ATFA 4E9KA 1GICA 4YM1A 4YW5A 4N53A 2K2SA 2DUOA 3ACLA 1A8MA 4Z8BA 4L92A 4OI0A 3MW2A 4IV3A 5D8AA 4ZU7A 5DXDA 3JQWA 4OHXA 5LEKA 2D6NA 1ULGA 1OLRA 2ZGRA 4DRRA 1NQJA 2PAMA 5FMOL 2V5YA 1H1MA 3WP5A 2ZGOA 4CDWC 1RMU3 1Q5OA 2R042 4QPIA 1DQ4A 4WV8A 1JHNA 2QUOA 4XILA 4COWA 3ZXEA 1HRV2 5BNQA 3SMHA 4HETA 3AP9A 3ZO0B 2YDEA 4QGNA 4BOWA 1YXWA 4AXOA 5T54A 2EXJA 4BH9A 1AUYA 2Y0OA 2VNRA 3M8LA 3BOPA 1ZBE3 1VB2A 4KWKA 1RUI3 2YMZA 3ZSMA 2EA7A 4N7UA 4YM2A 2C9AA 4JGZB 4Q4Y3 2YV8A 1JOJA 2ZX2A 4KL1A 1LOFC 1NG0A 1VAKA 2WNVC 5C6CA 2OA2A 1TMF2 1WMEA 2RS31 4TZDA 1S0CA 4XTMA 4PDWC 1LU2A 3PVEA 1ALYA 2FQPA 3GZUC 5CFDB 2ZPXA 3D82A 2DUPA 4LE3A 3CF6E 3H7YA 2ZBJA 5EXOA 3POWA 1SFNA 2R1BA 3WDVA 2Q1MA 2X53S 5FCCA 5EYXA