1SFNA

Crystal structure of protein dr1152 from deinococcus radiodurans r1, pfam duf861
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
245
structure length
245
Chain Sequence
MKHLGQTRSALHGSHAVITPETFVRTALAEWPGSAIVLHIAPVVGLGARFVQFTAEMPAGAQATESVYQRFAFVLSGEVDVAVGGETRTLREYDYVYLPAGEKHMLTAKTDARVSVFEKPYQTVEGVQAPGVYWGNERENPGYPFEGDDHLIARKLLPDEPAFDFMVSTMSFAPGASLPYAEVHYMEHGLLMLEGEGLYKLEENYYPVTAGDIIWMGAHCPQWYGALGRNWSKYLLYKDMNRHPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
publication title Crystal structure of conserved hypothetical protein from Deinicoccus radiodurans
rcsb
source organism Deinococcus radiodurans
total genus 51
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05899 Cupin_3 Protein of unknown function (DUF861)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1sfnA00
4I3PA 1ZRFA 1O7FA 2OZJA 4ONUA 4QGMA 5BUVA 3ELNA 3EBRA 4YRDA 3RYKA 3IIAA 2VPVA 4HN0A 4OLLA 2O8QA 4R8HA 5C8WA 3RDIA 3E5QA 1UCXA 4KU8A 4JTOA 3SCFA 4A2UA 3KSCA 4L11A 3LA3A 4MX3A 4IERA 3E5UA 4QGNA 4LUMA 4HLTA 1GQHA 2IXKA 4MV2A 1O4TA 3CLPA 2OYZA 3ES4A 4X6QB 1QXJA 3MDPA 4KWJA 4I09A 1TQ5A 4PIXA 1FI2A 2H0VA 4X6RB 4ZU4A 1GQGA 1OMIA 4BIFA 2IC1A 2UYBA 3NJZA 2FQPA 4I01A 4MGKE 5KHKA 4LLOA 5I8YA 4IEWA 3D0SA 4IEVA 3FFQA 1CAXB 5J48A 4AVAA 1DGRA 4B29A 4GULA 3I59A 2HKXA 1Q5OA 4MH0E 2UYAA 4KU7A 1DZTA 1NE6A 4MGIE 3H1WA 4HVOA 4Q0PA 2XKPA 3FHIB 5FQ0A 1YWKA 5JSOA 2WC2A 1ZX5A 4R52A 3BB6A 1H1MA 3NVCA 3MZHA 3NSTA 1X7NA 2FMYA 1ZZ7A 2GC3A 4RD7A 3O14A 2OA2A 1RTVA 1O5UA 1YLLA 4F7ZA 1I5ZA 4J1XA 2Q1ZB 4HZFA 5KHGA 3ETQA 3FE5A 1UIJA 1PMIA 2B5HA 5LEJA 3H3UA 1QXRA 1VJ2A 4P9GA 1CGPA 5BV6A 4E2QA 5I91A 1RUOA 5AVPA 4N9HA 3M70A 4YYOA 4K8FA 5I93A 3HT2A 2D5FA 3MYXA 5I8SA 4Q0UA 4Q0VA 5I8TA 3I7DA 5C6CA 3OCPA 4EV0A 3E6CC 2IXHA 1RL3A 2OPKA 1EY2A 4WZCA 3H8UA 1ZVFA 1IPKA 4XFCA 1YFWA 5JCTA 5FCCA 3WW4A 3E6DA 2MHFA 5KHJA 1J3RA 2Q0AA 2XLFA 1CAUB 4FAGA 2XL9A 2F4PA 1CAVA 4ZU5A 1EYBA 2ZCWA 1NXMA 4QMAA 3WW1A 4XFGA 4FAHA 3CF6E 5KHIA 1Y9QA 4JVAA 3L2HA 2XLAA 2O1QA 5D1IA 4H7LA 3IWZA 4HN1A 3HT1A 3ROUA 1Q43A 2IXLA 2E9QA 3CEWA 5K8SA 3D82A 2PAEA 4KWKA 3OTFA 1J59A 4IEXA 4E2GA 1DGWA 1LKNA 2WFPA 4IEYA 5I0TA 4PIZA 3ST7A 3CL1A 1SQ4A 1QY4A 3FJSA 4FT8A 4TLFA 2GH2A 2EVXA 3UKVA 2K0GA 3H50A 3LZZA 4Q0SA 1G6NA 2ET1A 3IBMA 4JV4A 4YNIA 5KBFA 4JTNA 4PIYA 2XL7A 4MGZE 1J3QA 4PJYA 4I02A 1WLTA 3NW4A 5J7MA 1CAWA 3H1YA 4IEZA 3BALA 4HSJA 4IEQA 1OFNA 1H1IA 3C3VA 3E5XA 1Q3EA 3IDCB 1EP0A 4XEZA 4XF9A 4HVQA 1X8MA 2H6BA 5F1RA 1CAXA 4N9IA 1ZRCA 3USSA 4EWDA 4LA2A 3DV8A 4XFBA 5I0SA 3NL1A 4CYDA 1U12A 3ACLA 5BY5A 1O5LA 2B9UA 3RYRA 1O3TA 5FLIA 2PHDA 1XRUA 3S0MA 3U0ZA 1V70A 5CVRA 4KWLA 3BCWA 2QDRA 4HVRA 3KGLA 1VP6A 2C0ZA 1OD5A 1SEFA 1ZNPA 4LUKA 3N4MA 4QX5A 3CO2A 2Q30A 4LULA 1RUNA 1YHFA 3GBFA 1NYWA 4YSFA 3VHRA 2P17A 5T3NA 3H9AA 5FQ0B 3D0JA 1SFNA 2V09A 2QNKA 2Z69A 4O9EA 3BU7A 3U10A 3RNSA 3WW2A 3RPQA 2PAKA 4MZUA 4J1WA 3NKTA 1UIKA 4XFAA 1NE4A 3MPBA 1O3RA 4F8AA 4ZU7A 2I45A 1J3PA 4LA3A 4I0BA 1WGPA 5HI0A 1HW5A 4Z82A 5JAXA 4AXOA 4E2SA 4EWAA 3HIFA 5CADA 3E6BA 4UXAA 3SCGA 4XFIA 1YFYA 2D5HA 1ZREA 1CAUA 2GZWA 1QWRA 4HBNA 3H7YA 3KGZA 1YUDA 1FXZA 3SCHA 1LB2A 1ZRDA 3TNPB 2BGCA 1UW8A 1YFXA 1ZRRA 3KMHA 4O9GA 3OGJA 3G7DA 1J58A 4BH9A 2UY8A 5LEKA 2BEOA 3SXWA 4AQ6A 2CAUA 2VQAA 4XF1A 2PAMA 2H6CA 2QJVA 1XE8A 4I0AA 2GC2A 4L2NA 3EJKA 3FX3A 4Z07A 3DL3A 2ATFA 2PFWA 4QGLA 3LA7A 2PQQA 3HQXA 3JZVA 4META 4I2OA 2ET7A 1IPJA 1EPZA 2DCTA 1J1LA 3LWCA 4XFHA 5E1RA 2EAAA 4BYYA 4D7TA 1O3QA 3RZZA 3TNQA 1WA4A 3ZDSA 2BNOA 2PTMA 4OFGA 2K9ZA 3PNAA 3LAGA 3WW3A 3B02A 2IXJA 2XHKA 1UPIA 2OZ6A 3FZ3A 2IXIA 2PHLA 4FBFA 2CAVA 4QXKA 1ZZ6A 4ORFA 1O3SA 1ZZ8A 4XF4A 1ZZBA 5CU1A 2KXLA 1CAWB 1I6XA 2UY9A 2Z2SB 4YARA 5FPZA 5KHHA 1NZCA 1UD1A 5J3UA 1YFUA 1VR3A 1OI6A 1XE7A 2GAUA 4LEJA 3IDBB 2EA7A 4HMZA 2IXCA 4KL1A 5FLHA 5EFUA 2HJIA 2BNMA 3ES1A 2BYVE 2GC0A 4EROA 4MUVA 4UBHA 1ZZ9A 4IEUA 3I59B 1L3JA 5EZWA 1FT9A 2XGXA 4XF3A 3LA2A 1RC6A 3I54A 1RGSA 5LRRA 3U11A 3DN7A 4WBBA 2ZKLA 4NVPA 4UBGA 3S7IA 3H1MA 3UKTA 2PA7A 2MPFA 3KCCA 4IESA 4IEPA 4XFFA 2PYTA 2GC1A 2B8MA 4Q29A 2GU9A 4QM8A 3OF1A 2Y0OA 1CX4A 4HSLA 4XETA 3RYPA 4AQ2A 4EWEA 3R6SA 1PM7A 4DINB 2CGPA 3EHKA 4D7SA 3SMHA 2ETEA 1LR5A 1Y3TA 3CJXA 5BXXA 4QM9A 2MNGA 3UKNA 3EQEA 5I0RA 1DZRA 3PLQA 3GYDA 4Q0QA 5LRSA 3H7JA 4XF0A 1ZZCA 4IEOA 3QACA 2VECA 5FLJA 3S7EA 2D40A 2CV6A 3BPZA 2D93A 3H3ZA 3SHRA 2QVSB 2XLGA 5JR7B 4BHPA 3M3IA 1JUHA 4LTAA 4AVBA 3E97A 2QCSB 2BNNA 4WVZA 1X82A 5E16A 3EO6A 4AVCA 5I0UA 5FDBA 4IETA 1X8EA 1CAVB 5JSRA 5BPXA 3QOPA 3FWEA 3DKWA 4MGYE 5FPXA 3PVBB 3LOIA 1LRHA 2Q4SA 3OD0A 2N7GA 5JSPA 2XKOA
chains in the Genus database with same CATH superfamily
5EJ1B 3NAPC 1ZRFA 1O7FA 2P3YA 4QGMA 1IQAA 2G9FA 3IM0A 3VD3A 3EBRA 4EN8B 5FTTC 4P02B 1OKQA 4DXRA 2JJ6A 3VB9A 4NWVA 4Y22A 5L36A 4HN0A 1C8M1 4OLLA 1V00A 2ZGRA 4BQ4A 1UXXX 4R8HA 3TRSB 4TLGA 1W0NA 1UCXA 1RUI2 3AKRA 4XPVA 1O59A 2WR9A 3A22A 3VLBB 4PI0A 1YQ5A 4JTOA 3N3HA 1WZXA 1AXZA 1JZ4A 3GHNA 1V9U1 4L11A 5JZGC 1C8M3 1PO13 3OEAA 3E5UA 3ZFEB 4RHV1 3WDUA 1GQHA 2F4LA 5K4LA 2DWRA 2LALA 5FWJA 3CLPA 2VOTA 2OYZA 4QX8A 4YM1A 4BQ1A 1I3HA 4X6QB 3I2DA 5FMCA 4P9YA 3MDPA 1V9U3 3PHMA 1KEXA 1JZ5A 3NNLA 4I09A 2VQTA 4QU1A 4RHV3 1F4HA 2Y6KA 1TQ5A 4PIXA 5FBZA 1FI2A 1YIFA 3ALQA 4X8PA 3IMNA 4AI0A 4C91A 4WM8A 4MHUA 4XAEA 2VMIA 2ADEA 1NCRC 1PVXA 4WM7B 3O1RA 1QJY1 1OMIA 4LITA 1Q8QA 4LBMA 5SV8A 4BIFA 1W8FA 2IC1A 3AMPA 2WS92 1S0CA 3SH4A 5JSPA 3NJZA 2FQPA 2E33A 4W6YA 1W8NA 2JDAA 4MGKE 1XYNA 1Z7S3 2VVDA 4QDSA 4IEVA 1VBC1 3FFQA 1PHMA 3PVEA 5FXVA 4EN9B 5L7OB 4GZ9A 4B1LA 2Y8KA 1QJY3 3OEBA 4CEYB 1CAXB 5J48A 1AYN2 5A3MA 4XJZA 3VKMA 1ASJ1 3LIGA 1M06G 2VNRA 2G4IA 1NCQA 2C5DA 2HKXA 4K7JA 4PBOA 1UZZA 2FCTA 2X5IA 1VBC3 1OVPA 3LKJA 3D8CA 4IL7A 4COUA 3POJA 4MLOA 5AC92 4CEWC 5E88A 1DZTA 4XDQA 4HVOA 3FN9A 4LXLA 4P14A 4Q0PA 4A42A 4XMIA 2VZQA 1QJFA 4DRRA 1YWKA 4AL9A 1I9RA 4YVSA 5JXIA 1YQ8A 5IK4A 2ZX4A 2WAOA 5A7WB 3BB6A 5C5UA 3HD8B 3VKLA 3MZHA 3C2UA 2JG9C 2PHUA 1Q8OA 1BXHA 5LW9A 2LROA 2GC3A 4Q8LA 4LBQB 1VAMA 1BEV1 2W94A 4UFMA 1WCKA 2R6QA 3FBMA 3ZM8A 4CU9A 3AYEA 4M3CA 2RS52 5LK5A 1O5UA 4KG8A 5HXMA 4F7ZA 2HWE1 4J1XA 2Q1ZB 4HZFA 2R061 2RR12 5HPOA 3AMHA 3M7AA 1UIJA 2ZTNA 2B5HA 3MI8A 4GH4C 3OUJA 1QXRA 3KV4A 1BEV3 4NHYA 3W5MA 1UY2A 3VBRC 2ZA9A 1XNBA 4AAXA 1BMV2 5KXEA 1FOD3 2J1SA 4A4AA 1BLZA 3M3QA 1YC61 2R1DA 2HWE3 4K8FA 2A5ZA 5FYTA 5FOBB 1AX2A 3WF2A 2D5FA 4EN0A 1S4CA 2DUQA 4ZXEA 5I0DA 4JKMA 2RJKA 1RUG2 2VU9A 5I8TA 4YVWA 1JH5A 3OCPA 4EV0A 2LTNA 1MZFA 2IXHA 2XG3A 1QH7A 4PI2A 4W50A 1EY2A 3AXDA 5DAPA 4NAOA 3DPRA 3VZKA 1DQ0A 1RUJ2 1YFWA 3UGFA 3ZMOA 5FCCA 2Y6HA 4LLFA 1TZOA 5IW0A 2F4PA 2QKDA 4ZU5A 2X53S 4P9XA 1KFUL 1H6YA 2WLQA 1MZEA 2WZEA 3MEPA 4Z92B 4QPYA 1D4M3 5FBJA 3WW1A 1DU3D 2ZPXA 4RGKA 1S1AA 3THTA 1NKGA 1UX6A 1C3HA 1Y9QA 3Q8BA 4AHZA 1CN1A 3L2HA 2ZHLA 2O1QA 1OLME 4H7LA 4SLIA 5C4WC 1ZBA1 5IFPA 3KCXA 1Q43A 1WLWA 4QKDA 4JGZA 1MS3A 5FYSA 2A3XA 2E9QA 1JOBA 5F3CA 2Z5WA 1AR72 2DBIA 2WN3A 4N43A 3OTFA 4JGYB 4CXWA 1PZ9A 1KDKA 5I0TA 1G8WA 4OHZA 1CPMA 4V2WA 2O14A 3KF5A 2ZEWA 4GMP1 5F6LB 2JG8C 4FT8A 4YW3A 1SBFA 3VDCA 1OA3A 3NWKA 1YXWA 4TLFA 2GH2A 3PMSA 2ARXA 4GALA 1JBCA 4YW7A 5T5JA 1LHOA 2AGSA 2EVXA 2Y26A 2K0GA 4XIOA 4YW6A 4ZONA 5EJZB 5JXJA 2PLV2 1G6NA 2JIJA 4YNIA 2D6KA 3DXUA 4PIYA 1HRV1 2C9KA 4MGZE 1J3QA 2IVJA 1KD7A 3K3OA 3AZZA 4IV3C 5BNPB 4PLMA 1O8SA 1QKQA 5T52A 4QX0A 3JXSA 4COVA 1OT5A 3ABZA 1W6NA 4BIOA 3HNMA 3WLUA 1LOBA 1HRV3 1HB4A 1C5HA 4M3CF 3N36A 4YW5A 1NLRA 3CZUA 5A6ZA 1CJPA 5GZEA 1UMIA 1W2TA 5EHDA 1EP0A 2D44A 4XF9A 5C8CB 2MEV1 2H6BA 3PDQA 3OUIA 4HPKB 3WHUA 5A80A 5EQUA 3FC0A 1SLLA 3K3NA 4Y24A 5F1RA 4XZUG 4NE9A 3I2GA 4LA2A 3WDXA 2YFUA 5FFOC 4B1MA 4XFBA 1FPN3 4QT6A 3ZFGA 4CYDA 1U12A 1B35B 3ACLA 1RUF1 3ZN4A 1L7QA 2P3JA 2VOXA 2YC0A 5FXXA 3RYRA 2FDFA 4NIIA 1MEC1 3ZXJA 3S0MA 1GYKA 1N1VA 1C8M2 3U0ZA 1PO12 3PTRB 3IB3A 5CVRA 3W20A 1MQTA 3BCWA 4K9SA 1OD5A 3VBOA 1OC1A 1RUF3 1KGYA 4Q4Y3 4QQOA 5CA6A 4FTEA 1UY1A 3CO2A 5G05L 3ZDVA 1RUNA 1YHFA 2BGPA 1V9U2 1XBFA 2DYCA 4YSFA 3D4KA 4LO8A 5A6YA 1NY71 1JW6A 1ONAA 2P17A 4RHV2 1QJEA 3ZX7A 4CDQA 4MXWB 5CFCB 3H9AA 3T1LA 1PGW2 3OY8B 1EUUA 2P3IA 4NHLA 2BU9A 5DDJ1 3SISA 4P00B 1GOHA 4XUOA 1SFNA 2V09A 4CU8A 1MS1A 3KT7A 2G1MA 2JENA 3ZLIA 5C5TA 4CP9B 5F3IA 1UU4A 4UW6A 3BU7A 5LA9A 2GMEA 3LSDA 1Z7S2 2ZHNA 1C5IA 1MACA 2D3RA 4J1WA 3WDVA 4XFAA 1W06A 4XBQA 2W5FA 1NE4A 1W6OB 2DCYA 2EALA 3ITQA 1F5JA 1QJY2 3WG3A 5FWEA 1RB8G 1O4YA 3I2JA 5H9SA 3USUB 4ATEA 4CVUA 5FZHA 1ND3A 1AR91 1KXGA 1CR7A 2E32A 5DZGA 2F17A 4PDWC 3HBZA 2W1WA 1HW5A 2B45X 1AZDA 4Z82A 5HI0A 2EIGA 1VBC2 2XWJB 4A3ZA 1RUH1 2DVAA 1QU0A 1W9FA 1GWLA 3TWIA 3E6BA 4CE8A 2AUYA 1AR93 2EXIA 4HANA 3SCGA 1ASJ2 1UWWA 2VZRA 3TBDA 1SG3A 1AL0G 2WNVA 3R4DB 3B94A 2GP5A 3OYWB 3PVOA 1QWRA 3LEGA 4HBNA 4AFMA 5A7NA 4CCCA 1CZVA 1A6CA 5J36A 1RUH3 3I3DA 3PUSA 2JB8A 4CPBA 2I2SA 3IPVA 2BGCA 2IUWA 2TBVA 2J1RA 3HPNA 5KWRA 5KXDA 1PK6B 1S2EA 2C9AA 4R4XA 3SH3A 3AVSA 3POIA 3UK9A 4XUPA 3RZGA 3KMHA 4O9GA 3WNXA 4UFLA 5A1FA 4BH9A 5L7OC 1QEXA 1BEV2 2A6ZA 3AYAA 1MPXA 3MLLA 1VB4A 5F3EA 2QJVA 4CXXA 5IVVA 1FOD2 2OVUA 3OGSA 4C1XA 5FZFA 1K5MB 3EJKA 1W99A 3ORJA 2HWE2 2ZMKA 3U75A 3T08A 1FNYA 1C1LA 2WYFA 2QDNA 3N9MA 1LNSA 2DCJA 2WFF3 2PQQA 4LBJA 4P5HA 4QX7A 4B7KA 4XUTA 3ZXEA 2W1SA 5AFEA 5IHRA 5A3TA 3LIHA 4META 4I2OA 1F8VA 2WQZC 1IPJA 1EPZA 3RJRA 1J1LA 1HRI3 1RUD1 1Q8SA 1AUYA 1GP5A 1YQ2A 1PMJX 3J26N 3QLQA 4IQPA 1XNDA 4WM8B 4YW4A 3ZFFC 1JYTA 2CY6A 4KQ7A 5A32A 1UYZA 2P1BA 1EUTA 5JIAA 2BNOA 1GWKA 3CJIA 2PTMA 3ZDSA 3POSA 2VQ0A 3IKWA 1AR81 4WVMB 3VBHB 3I2HA 5KC5A 3LDKA 2EICA 3Q8AA 2D43A 2DUPA 2CL2A 5GLUA 1C57A 3DUIA 4M00A 4FP3A 1C28A 4IW3A 2D98A 1U5XA 2BWCA 2DUOA 1UPIA 3AK0A 4NIAA 3FZ3A 1DGLA 4FFFA 5F6KA 5FZ9A 1AF9A 2GP3A 5FZ1A 4ORFA 4BB3A 3POWA 3O1PA 1N1SA 3PIJA 4LO7A 3ILRA 4E9KA 1G9BA 1UZVA 2UY9A 2Q1FA 2R1BA 4QX2A 4WZFA 4AQTA 1UL9A 1NZCA 4OCTA 4GQ7A 5J3UA 1RJ8A 1YFUA 4BMEA 4ZPIA 3DF0A 5HV4A 3VBUC 2OUJA 2YPJA 2ZGPA 4DOUA 4YGBA 1PVC3 1WD4A 2XMLA 5EJ3A 5FK8A 3NAPA 1ZBA2 4CDUA 3I3MA 4WV8A 5FLHA 2RDSA 1MVQA 1E5SA 1ZM1A 3ES1A 3PUHA 5FMOL 4FPFA 4AAPA 2GC0A 3AZXA 4EROA 5DMYA 2H0BA 1ZA7A 4FPLA 3MF6A 2Y38A 3VV1A 3I59B 3VBSC 1UXZA 5EZWA 4XF3A 4RQPA 4LQRA 2BW8A 2E31A 3LA2A 1S0GA 5JZGB 3NV4A 3U11A 3GBWA 4UFKA 2IWGB 5KXCA 4RR3C 4D0QA 3H1MA 5IVFA 1KITA 1HRV2 2PA7A 5JWPA 3KCCA 2AACA 1FMD1 4YM0A 2GC1A 1BBT1 4UW3A 3RWNA 5IVJA 3MHZA 4NIDA 2ZKNA 1RUE1 2CWSA 2EIEA 3OF1A 4V1PA 2LRPA 3T30A 5DUWA 3GCWA 4JGYC 5FUIA 4AQ2A 4TTGA 3UGHA 2WAAA 3OPTA 1NCRB 4DINB 1X9PA 3KLSA 4RGAA 1FMD3 2PHTA 3OBAA 4CDXB 1R1A1 1Y3TA 2RS31 2ZXQA 1ULFA 4AVTA 3A0NA 5BXXA 3KHBA 1FPN2 1RUE3 3UKNA 1W8WA 4E4HA 4XHXA 1DZRA 1XNCA 1DG6A 2VNVA 4AI8A 5B2GB 4NN0A 1EAH3 3Q8EA 2HLEA 3UNPA 1PZ7A 3ASIA 3D5OA 1ZZCA 1R1A3 3KB5A 2RS33 1WMEA 5H9PA 4BLJA 1DYKA 2JE7A 3PVNA 3WG1A 1RUF2 1H9PA 2RHPA 4Q4Y2 1CESA 1W8ZA 3A0KA 4A3XA 3AKSA 5EIYB 3WQ1A 4BHPA 3BKZA 2WNEA 1VE0A 3N7LA 3RS6A 4AVBA 3N9NA 3ZKUA 2QCSB 3OD4A 1W0PA 2XB6C 2Q8OA 3VKOA 1X82A 1H0BA 4D6SA 4FSJA 3SKJE 5FDBA 3VBFB 1LGCA 4QPGA 1S0FA 1I1EA 5BPXA 4L97A 2JG9B 2Z79A 3QOPA 5JLVA 1DQ2A 2ZHMA 3NV1A 4N8MA 1VMJA 2ZX2A 1NY72 1V6NA 4MGYE 4S2HA 5DZEA 1IKQA 5BNQA 3WOGA 3GZEA 3I3BA 2ZGSA 3KV6A 5IVCA 5DDJ2 4AEJA 1H2LA 4I3PA 4GD4A 4BCUA 5FP9A 1LHWA 4AVSA 4YZ1A 4ONUA 1Y43B 4E8DA 3RQ0A 2DV9A 4J25A 4YRDA 3GZAA 3ME2A 4XAAA 3RYKA 2JDHA 3IIAA 4GH4A 4Q27A 5CEHA 2VPVA 3VBRA 2CDPA 2XVLA 2Q8CA 2GNBA 3KS7A 2O8QA 3OJBA 1H8TA 3OPWA 4CDWB 2KM2A 2ILMA 3VZOA 5C3RA 1AR92 4KU8A 1YO8A 5DABA 3AKTA 3SQOA 4A2UA 1SLTA 5J09A 1MS0A 1W2AX 3KSCA 3TEXA 4QDRA 1WW5A 1NA1B 2VM9A 3LA3A 3MGUA 4KNCA 5FZ8A 3WP3A 5LBFA 4AEDA 4BQ5A 2RM21 1SZBA 1RUH2 2W0XA 1JU3A 4LKEA 2ZEZA 3AP7A 2VNOA 1YYNA 2V5DA 4YFWA 1XNKA 1QNYA 2C4XA 4BPZA 4NIGA 1QXJA 1VAKA 3ZIXA 5LBCA 5A3PA 1MS4A 1PMHX 4FOYA 1N1TA 2RM23 4XQDA 3CMGA 1RVF3 1WMFA 3AP9A 1AX1A 1S55A 4XCAA 5ABJB 4X6RB 3X29B 1TNFA 4LE4A 4AVVA 2HEWF 1IZ3A 2VUAA 5EV7A 4FTBA 3OSDA 3WCRA 1RYYA 4ARYA 4PHZA 1JHJA 3JD71 2UYBA 4MGQA 4K1YA 2C26A 4QXBA 5FZGA 4EN7B 5C4WB 4I01A 3VHNA 4LLOA 3O1UA 2WFF2 5J96B 2OX0A 4FTSA 1ACCA 1N1YA 2P37A 1QGLA 4U36A 1GV9A 2KR2A 2J42A 1SBDA 1VRH1 4RGGA 1JYCA 4OI1A 4AVAA 2YB7A 3JD73 2YXSA 1Z78A 1OQEA 2FDKA 1HRI2 1GZWB 2BV4A 4YG0A 4B29A 3GZUC 4GULA 2IVIB 5LBEA 3S57A 4JKLA 1ST8A 4PF5A 2JG8B 2WZR1 3CNAA 1VBB1 1VMFA 4QQPA 5HCFA 5GZGA 4KH9A 3O0XA 3KHCA 4MGIE 1VRH3 3V0BB 2BGOA 4Y1YA 3FHIB 4BQYA 4QKBA 4PLOA 1PK6C 1RUD2 4OHVA 2JDPA 5FQ0A 5FO9B 3BTAA 2ZZQA 1LENA 3T1MA 5FOJB 3MBWA 2WZR3 1UYYA 3B9CA 4FOWA 1VBB3 4R52A 4AI3A 3TAYA 3HN1A 3NVCA 1HLCA 4IV3B 4NJ4A 1J84A 1APNA 1VIWB 4IV1C 1X7NA 2FMYA 1W2UA 4TSVA 4LT5A 1JI6A 1HXS1 5C33A 4QXCA 1HIXA 4RD7A 1K5MC 2IFWA 3ILFA 5FRAA 3O14A 1ND2C 2OA2A 1YLLA 3FHAA 5IK8A 3WY6A 5FP4A 5FO7B 5A3WA 3MLKA 5KHGA 4Y20B 3VKFC 3VGIA 2VCAA 2VMCA 3B01A 5CB7A 1BVP1 4EJRA 2AZ5A 4CUAA 5LEJA 3H3UA 1AXYA 1HXS3 4QQ2A 2XDVA 4J6GA 5HV0A 1C8NA 5BV6A 2XONA 4W6XA 3GZTB 3WD5A 2PLV1 5LCWL 5J37A 4M0HA 5AVPA 3M70A 3FUOA 5I93A 3UJOA 2ZABA 2WA4A 1RIRA 1NXD1 2ENRA 4M0NA 3SITA 2A75A 2ZGMA 4Q0UA 1HN1A 2VZSA 3JCIA 3J4UH 4B8EA 3WQ7A 3PUAA 3VBHC 1DYPA 1W6PB 3I7DA 1S0EA 5C6CA 5E89A 2WWSA 1U5IA 2WABA 1RL3A 3ZN5A 5LATA 1DLLA 2QTWB 1IPKA 1FATA 2AYHA 2VUCA 2Z42A 3I3EA 4OUMA 4XFCA 1V6KA 5JCTA 5IK7A 1PIV1 3DYPA 3WW4A 4FAGA 1CAUB 1JU4A 3MUY1 5BNNA 2XL9A 4YGCA 2AH2A 1CAVA 1EYBA 3V65A 2ZCWA 1U5ZA 2Y33A 4DUWA 1NXMA 5A1AA 1OH4A 1POQA 1F9KA 3FFZA 1ALYA 4IE4A 4UFIA 2E51A 3LE0A 1PIV3 1IHMA 4CCLA 1L7RA 4CSWA 1JZ3A 2VCCA 1HJGA 1ULPA 4MXVA 1FMD2 4AGRA 2XHNA 2XLAA 1BBT2 5D1IA 4XUQA 1YRZA 4C0HA 4HN1A 1YIPA 4PT6A 3BYWA 1RUE2 3HOBA 1SLBA 3ZKYA 4DXZA 5B4NA 2IXLA 2A3WA 1PO11 3W5NA 4CCKA 1FAYA 1RHI1 2PAEA 5CIRA 4FO9A 2WO3A 1EAH2 1BK0A 1DGWA 4PIZA 1R1A2 5BNOB 3ST7A 3WNLA 2RS32 2WN2A 4OULA 1GZ9A 2WUHA 5L73A 4ZZ8A 3BU0A 3FJSA 4MOAA 4PDWB 5A3UA 5DXDA 5CYYA 1C1FA 3WG2A 1RHI3 1WWYA 4INDA 4XJ9A 5F32A 1VBA1 1OFSA 1REFA 3ZFEA 2Y34A 1KFXL 3DEMA 1PGW1 3LZZA 4Y22B 1GNZA 3FHQA 3IBMA 4JV4A 1QOTA 5FUPA 2DURA 4YG3A 1WLDA 5B4XA 3H3LA 4I02A 4DY5A 1GICA 1UU5A 3GF6A 1WLTA 1DGWX 5FY9A 1VBA3 1Z7S1 3NW4A 5J7MA 1QJX1 1UZWA 4IEZA 3V64A 4MO3M 3BALA 1C4RA 4IEQA 3VD5A 1MS9A 4CDXC 4WM7A 2Y6LA 2AR6A 4LK6A 1SPPB 3E5XA 4G4FA 2WZ8A 4XMAA 4HT1T 2VMDA 1G9CA 4P08A 4XEZA 3LEKA 4DS0A 4D94A 2GH8A 3KF3A 1AR63 1QJX3 1T6BX 5EPAA 1US3A 4DEQA 1I5PA 4XIKA 5L7OA 5IJRA 1LGBA 1LHNA 5IVEA 1MZ6A 2BVBA 4CEYA 1CAXA 3FUQA 5FZBA 2BJSA 2Y0IA 4EWDA 3WQ0A 3C7EA 4PQ9A 3ZPYA 2XUMA 3VD4A 3ZOIA 1UAIA 2E7QA 5BY5A 1SFPA 2WQ4A 3PU3A 4QX1A 3M3EA 3S5QA 2B9UA 5JPMB 4JX0A 2ZACA 4H3WA 4HG6B 1IG0A 3B7MA 3J8F1 1WLCA 4OI2A 4QPIB 1V70A 4KWLA 5HCAA 4WVWA 3ZFFB 3VBFC 1H30A 3AP5A 5LA2A 1AXKA 2YBKA 1ZNPA 4LUKA 4MHRA 5A70A 3RVHA 1W3VA 1NCQB 2RV9A 2Q30A 1V6IA 4MGSA 3BODA 5A3NA 1H1AA 3AZWA 3J8F3 4Y26A 3J9SA 5D8AC 3WR0A 3ZN6B 3WP6A 1FOD1 2RM22 1G9FA 1GWMA 3QBQA 4LBQA 4CU6A 3UV9A 3ZSJA 1RVF2 4E4DX 3P1IA 4MG2A 1CZTA 5A7SA 1JZ8A 3POBA 5IT6A 4CUBA 4UFHA 3OG2A 4CCDA 1LOCA 4L8QA 4YVSB 3OB8A 2UWBA 4LIUA 2GDFA 2J22A 3LGRA 4K3UA 4XQ4A 4FOVA 3WW2A 4RS5A 2A6YA 4FPHA 1UIKA 2XJUA 4YW2A 5FZOB 3MPBA 1XPWA 5FYZA 4FOQA 4CDWC 1WKYA 1XSQA 5FZ7A 3RZJA 4F83A 2K46A 3VBUB 3JD72 1WBLA 2I45A 4CUGA 4LOSA 4ZU7A 4LKSA 5CFDB 3PUIA 1UKRA 1U0AA 4HK8A 1NA1C 3WHTA 4CTEA 1TMF3 2V4AA 3PURA 4RSUA 2VBPA 1D4M1 4MYEA 5FPUA 1VRH2 1LOFA 2E53A 3ZXLA 4RFT0 3HIFA 5C9AB 1SBEA 3C7OA 3WF1A 3J7NA 4NHMA 4NPLA 4UXAA 5FPAA 4ES9A 4Q4W1 5FZCA 1OF4A 3VBSB 2D5HA 3TOJA 3HNBM 4AYUA 4C8DA 1ZREA 5J98B 2WZR2 3J7HA 1VBB2 4FI9A 4N7IA 2CGNA 3VZJA 4YVWB 5ABJC 4AHYA 1FXZA 2OUHA 3SCHA 5FZKA 4GWNA 1LB2A 2BDRA 3TNPB 3NV2A 4EN6B 3DPRB 3NO8A 4Q4W3 1AYM1 4RR3B 2VZTA 2VTXA 5A7PA 4EYUA 2JDYA 4U2AA 4QHOA 1JN2P 1CIYA 2YDEA 3WDWA 5GLZA 2HYKA 3T0DA 2WSUA 4E27A 4AQ6A 3JU9A 3O1TA 2CAUA 3ATGA 4XJWA 1HXS2 5FIXA 2ZGOA 4A44A 2PAMA 2G9GA 1XE8A 2WNUC 1AYM3 1FV2A 1H4GA 2Z4FA 4TWTA 4JGYA 2ZX0A 3OBTA 4HL0A 4EZ4A 4AZZA 3KCYA 3TB0A 3DL3A 2VR4A 1WD3A 1WW6A 2ATFA 4OI0A 4QGLA 2WO7A 4XILA 5FP3A 3VHOA 1SCSA 3RWKX 2BFUL 2XOMA 1YEWA 1OA2A 1SCRA 3M3OA 2ZGLA 4CUCA 4CCJA 2ET7A 4Q1RA 4N43B 5E1RA 2UWAA 2EAAA 4BYYA 2NM1A 2NLRA 2BOIA 1HQWA 4Q4V3 5CNAA 4D7TA 4EE2A 2X05A 5CAZA 3BGAA 1W8TA 1O3QA 1BVVA 2WA3A 3PMEA 3BIEA 3G6JB 3TNQA 1WA4A 3OBRA 4LR4A 4OFGA 4B4PA 5BNPA 4W8JA 1OLRA 3L9JT 4FPJA 1TE1B 5FKBA 3THPA 1H2MA 3AFGA 1US2A 3VN4A 4XABA 5FZ6A 2WIIB 1PIV2 2V72A 3OPZA 2P6CA 2ZS6B 4FBFA 1FPN1 2CAVA 4QXKA 3WQBA 4NWWA 1ZZ6A 4I30A 5C8CA 1O3SA 4XF4A 1L7LA 1EV13 4N53C 1E5IA 3N7JA 2ZMLA 4HPKA 1I6XA 2E6VA 5FZ0A 3ZSEA 4G9SB 5FPZA 5KHHA 3ILNA 2Y60A 4OI4A 1VMHA 2A6WA 3CKHA 4R9CA 2CTVA 5FREA 3H0OA 3KT4A 1TG7A 4Q4Y1 1O8PA 2EA7A 1B35A 4XURA 4YFZA 3H8XA 1PGSA 3OBZA 1A78A 2W2IA 5G04L 2WDBA 1GFF2 5DAVA 5FXWA 2W9XA 5FZ3A 3PL0A 1RHI2 4FP2A 2J1UA 1IS4A 2GNDA 3AB0A 3HVDA 4BQWA 3GBGA 5FUNA 3SEPA 2ORXA 4A41A 2FDHA 2JDMA 2XVGA 3AJZA 5E6HA 1L3JA 4W4ZA 3ZFGB 4RYDA 4PCRA 2JB4A 4K8RB 5IUQA 1RC6A 2ARCA 2X29A 1VBA2 2R16A 3LDRA 3WNKA 1S0BA 3LOBA 3CZJA 5CFCA 3DN7A 4MXWA 2ZKLA 3QD6A 4LHSA 4NVPA 3OY8A 3AFKA 1RMU1 2QQKA 4XDPA 2WT2A 4NRMA 4IESA 4IEPA 5FK7A 2PYTA 3VBOB 3NNFA 4IUGA 5FY1A 1YI9A 2B8MA 4AG4A 2W46A 2A70A 3NJYA 2QQNA 5T50A 2DF7A 1V6MA 4FPKA 4Q1PA 1BHGA 1QJX2 1W3XA 4XHBA 1AR62 2HWF1 4YM3A 2VY0A 5A3LA 1UZYA 1RMU3 4CDQB 1W6OA 2CGPA 5BNOC 5ANNA 3RZMA 5FKCA 4AHWA 3USUA 3NNGA 3WNPA 3KZ4C 1XU1A 3KVBA 3S30A 2JWPA 4NOTA 3EQEA 2HWF3 3WEZA 5FZLA 3WX5A 5FPVA 5I0RA 4KWUA 3PLQA 2ADDA 3VDDA 3WSOA 4ZY9A 5JXHA 4FFIA 4E8CA 1BZWA 3AX4A 3ZR5A 1E5HA 1UOBA 4BLIA 3S7EA 4BXSV 4XE9A 1UF2C 4LO4B 5F3GA 2D6OX 1ND3B 2VUDA 3AXEA 1H6XA 2G9ZA 3BIWE 3H3ZA 3VL8A 4CP0A 1XU2A 2QVSB 2XLGA 5JR7B 2HWD3 3J8F2 4XCBA 3JUUA 1IPSA 1H2KA 2NQYA 1R083 4FXKB 2A3YA 2NYYA 1XXNA 3D6EA 4H14A 4WVZA 2RDQA 2WL1A 4DPNA 4GA9A 4FQZA 1PK6A 5I0UA 3I8TA 4A6OA 2VBDA 1X8EA 2WNVB 4UW4A 2WFF1 4M01A 4CCNA 4AEKA 5JSRA 3UESA 2R071 4IV1B 4Z1VA 2EIBA 1NZIA 3DKWA 3VL9A 5JR2A 3LOIA 4DQAA 5C3PA 3N9QA 1ND2B 2A6VA 5DAXA 1HRI1 5FYMA 4D69A 4Q4X1 1HJFA 2VOWA 3N9OA 4R4ZA 5BUVA 2R073 4PF1A 5LY2A 3ELNA 1LHVA 2JX9A 2FCUA 3K46A 4QPIC 2Y64A 1DLCA 5EXOA 3ON7A 2BZDA 3U14A 2OT7A 2Q1MA 4Q4X3 5C8WA 4YGEA 3U78A 3C7HA 5JVVA 3T2QA 1NCQC 4JQRA 2P4EA 3VDAA 3ZVXA 2X5IC 3SCFA 1V0AA 1W05A 1FNZA 2ARAA 2DVFA 3H42B 2NMOA 2FD8A 4WVMA 4MX3A 1Y9GA 1D4M2 3PJQA 1D7PM 1UYXA 4LUMA 1XNAA 5GLTA 1GKBA 1IKPA 2IXKA 5DUVA 1U5YA 4MV2A 1TEIA 4YVSC 4OQ8A 3ES4A 4Q4W2 4D7YA 2UWCA 2JD9A 1GOFA 3ZR6A 3JQXA 3EXUA 4KWJA 1PVC1 5A32B 4Y5SA 2VZ3A 4AHXA 3CJIB 4P9JA 4BK4A 3RGBA 4OMCA 5FZAA 1TNRA 4UI9L 2H0VA 4FQ4A 5CKNA 1RINA 4BXFA 4DFSA 2FCVA 1AYM2 1Q8VA 2AENA 2Q8DA 4CCEA 1ULDA 2EAKA 3PJYA 5CFDC 1RITA 3IAQA 2WWUA 3Q8FA 5KHKA 2KA3A 4KBBA 2L9LA 1A8MA 3ACFA 4GJYA 4IE0A 4QKNA 4KMQA 5C9AC 3T3YA 1GP6A 1DP0A 1CZSA 2EXHA 2OXBA 3SNMA 1ZA4A 3S6PA 3ZXFA 3UGGA 2DU1A 4JAAA 3LDBA 4PBPA 1DGRA 3RZLA 4Q4V2 3I59A 5KR7A 1Q5OA 1W8UA 4MH0E 1LULA 4YVWC 3IMMA 1KQRA 4KU7A 2JKBA 3O0VA 4CDUB 3I2FA 4LO6B 5JZGA 3H1WA 5GZFA 5T54A 3RMXA 2XKPA 3DPRC 2V5YA 4AOCA 1QNWA 5H9QA 1A3KA 2A7AA 1W04A 2VD7A 1ZX5A 2QZ3A 1PGL1 3JBG1 2GNTA 3A23A 3JB4C 3K75B 2HEVF 2R0FA 4LMFA 1BK1A 5FY4A 3ZYGA 2LUWA 3NSTA 1GUIA 3TYJA 3PIGA 3U37A 4I3GA 1QOOA 1W03A 1EV12 2JDUA 3O1VA 2X09A 1EAH1 1UZ0A 5LWBA 2EXKA 3J7LA 3UL2A 1DDLA 1NCRA 3DYMA 2JD4A 3JBG3 4CDXA 3E1F1 1POV0 5FMOS 5F39A 2W87A 4HXCA 3I3QA 2DBNA 2YPDA 1PMIA 4JQTA 5HBAA 5FJKA 1F2NA 4O65A 1VJ2A 4UT5A 3WXPA 4JGZC 4P9GA 1W9YA 4R9DA 1XNTA 3TN93 2D6PA 2RMU1 4BK5A 3BTYA 5I91A 1Y4WA 4JHTA 5A6QA 4N43C 3FBYA 4N9HA 4MVTA 4YYOA 3HT2A 2XWBB 3WINE 5C7GA 3MYXA 4BM8A 4DXSA 4Z2WA 4IE6A 3WF0A 4JHZA 4E4ZA 5A1LA 4OZOA 3I49A 1GZCA 2LW8A 3U4SA 1XSRA 2RMU3 1QQP1 1O4ZA 1SMVA 3K51A 4NPRA 5FZDA 3V0AB 4CEWA 4ES8A 1NQDA 2FDGA 2VMFA 4S2FA 4WZCA 4L9BA 5DUXA 3AZYA 4FPYA 1ZVFA 1VBE3 1CIWA 1K45A 2E63A 3BVCA 3BOPA 2YGMA 3E6DA 2QE3A 3MF9A 2XLFA 5KHJA 3VBFA 1QQP3 2RG4A 2JG9A 3BN6A 5D8AB 1AJOA 1Y9MA 2E7TA 1AX0A 1POV1 4TXWA 5F2WA 4XFGA 1W8HA 1XYPA 4UOJA 4FAHA 1B09A 1LHUA 3R05A 2ERFA 5KHIA 1N3PA 2TEPA 1RMU2 5F5AA 3D3AA 2AC1A 4JVAA 3WT3A 4F3JA 4UF0B 2NN8A 4OQ9A 1K12A 3BPSA 4URAA 5J1XA 1JYWA 5A7OA 1S0JA 3IWZA 1ZBE1 1OPOA 4COZA 1POV3 2YC4A 2HWF2 5K8SA 4XJ8A 4AR2A 4CA9A 1REDA 1CONA 1ODMA 3D82A 3ZXKA 2XJVA 2ZGKA 1J59A 3UETA 1LKNA 2WFPA 4IEYA 2HWB1 2YUEA 4AF9A 2ZMNA 3CL1A 5FYVA 5IWFA 3ZFGC 4QAWA 4AE2A 2DVDA 1ZBE3 1YJKA 2CHHA 1IG3A 2PMWB 3RFRA 4YZ3A 2ZHKA 3EYPA 4GJZA 1UPSA 2C24A 1NA1A 5JMCA 1RVF1 5LZ6A 5F5CA 1WCSA 2HWD2 1MQTC 4Q0SA 3SLIA 2HWB3 5A33A 2VE1A 3AC0A 1O6UA 2YYOA 2ZZJA 4D8MA 1W6MB 1OOPB 5KBFA 2XL7A 1H8TB 3VBOC 3POEA 5FR3A 4XTPA 3LEMA 1ENSA 1OF3A 4Y33A 2WT0A 4IDZA 1CAWA 4AEDB 2J1VA 4BE3A 2X10A 4CDQC 1OFNA 1QDCA 3AVRA 2JIGA 1NLSA 5DUUA 3T4HB 3K77A 1HB2A 2A71A 3C3VA 3ZSKA 3AP4A 1Q3EA 1DIWA 1NUKA 4QB2A 5A7QA 4HVQA 2J1TA 1YNAA 4GXLA 5FP8A 3APBA 2R072 5C4WA 2W08A 3T0AA 1LU1A 1SDWA 3OUHA 1JS9A 4BDVB 5FMDA 5C3QA 2QQUA 3HMYA 4Y1VA 5LA0A 2WNUB 1CD3G 1PX4A 2BVVA 4XYXA 4N9IA 5FZEA 1W9WA 3DV8A 5JUVA 3C8XA 1ND3C 4Q4X2 1GZWA 5I0SA 2XPJA 2JG8A 2RVAA 4P5YA 2HEYF 4ZZ5A 4YG6A 2PHDA 2UURA 1XRUA 4FCAA 4H55A 4H2AA 4ATFA 5KC6A 2JDKA 5F8PA 3V0BA 4FPEA 1PO21 4M4RA 5T5PA 4EQVA 2DVGA 4H7MA 1VP6A 3VZMA 3KM5A 4LHLA 1W6QA 1K5JA 2WNVC 2WYSA 4XZPA 1SEFA 2PXJA 3N4MA 3HQUA 3B3QE 4QX5A 4YPJA 5LBBA 2B42B 4L99A 3ACIA 5EYYA 2BRTA 4IV3A 5F5IA 2W3JA 3GBFA 4DO0A 4DMIA 1PO23 2PHFA 4HKWA 4JDMA 3VHRA 1VRBA 3MW3A 5K0UB 1YQ6A 4X8NA 1IGOA 5FY5A 2Y6JA 3RMYA 4B4QA 5FQ0B 3MV01 1JHNA 3OGRA 4OUEA 3D0JA 3FL7A 2QNKA 3GDBA 1PVC2 2TUNA 5LB6A 1ULGA 3AKQA 3NNMA 2Z69A 3O5SA 1SFYA 2WT1A 4N53B 2PAKA 2YGLA 4MZUA 4UFJA 3RPQA 4COWA 5IFTA 1QJU1 4M4PA 1HB1A 1HB3A 4I0WB 1LESA 2HWC1 1E57A 3GXUA 2PHXA 4QWNA 3A21A 2JICA 2WWJA 2P5BA 2XQRA 1WW4A 1KS5A 2VW1A 3CIHA 2FBEA 2CU5A 5FYYA 5HXVA 2J1AA 2BUKA 5GZCA 1A34A 2ZGTA 5K7PA 1QJU3 2Y6FA 2ZAHA 3N7MA 2HWC3 3A4UA 3QH6A 2W68A 5GALA 4CP1A 1AR73 4E2SA 2VUJA 1PM4A 4SBVA 1H9WA 3RRDA 2NMNA 4P9WA 1V6JA 1YFYA 4OMDA 1CAUA 2GZWA 3CJIC 1H2NA 4C90A 1UQXA 2OPWA 4ASMB 1H8VA 3H7YA 3KGZA 3M8LA 4QXHA 1YUDA 3U1XA 5C71A 2W52A 5LY1A 5DPNA 1ENRA 2QQJA 3FLTA 3HEIA 1PNFA 1JXNA 2SLIA 2QQMA 1PX3A 1UW8A 2ZGNA 2ZAAA 3ZSLA 3GJAA 1LTEA 4LBNA 1PGL2 1ZRRA 3JBG2 1S2KA 3G7DA 5H9RA 2UY8A 5LEKA 1OURA 2XJTA 2VZVA 1F4AA 1KS4A 4TYSA 4P9IA 4XF1A 2VG9A 2H6CA 2VTFA 3TN92 4IXLA 4NUBA 1AJKA 3O0WA 1STMA 2K2SA 1GANA 5T55A 3FX3A 1JZ6A 4Z07A 4NIHA 1CVNA 2QQIA 4P9LA 1WBFA 2FZ1A 4XBLA 4Y1ZA 1NG0A 1HX6A 4IGOA 3LA7A 5GZDA 3I2OA 3T4VA 4CDUC 5L19A 1SDDB 4OHXA 4PDWA 1WW7A 3WZ1A 3Q8CA 3ZYRA 3WG4A 2RMU2 3POFA 1F31A 3C7GA 3ZO0B 5L9BA 5FJHA 2DCTA 3KV9A 1KJLA 4GWIA 3LWCA 4QDQA 1HQLA 4XFHA 1VBE2 5FPLA 4JDNA 4M3CE 4QHBA 3PUQA 3W21A 3RZZA 5KXBA 1JMUB 2IZWA 3C7FA 4RQPC 4BZ4A 2W1QA 2JDZA 2XQXA 1AR61 3FLPA 1CQ9A 1QQP2 1SLIA 1JYIA 2VW0A 2JE9A 4K40A 4A6SA 1VAVA 2R7EB 4ZXKA 5FYIA 4YLZA 1VB2A 3AM2A 4OHYA 1WA6X 3EMRA 1J83A 2OZ6A 4O61A 2PHLA 4S2DA 1SPPA 4OZXA 4BMBA 1ULOA 2W91A 3HQRA 4G3YC 4C1WA 1NLQA 2ZOEB 4NAMA 2HBTA 5HCBA 2JECA 2VVFA 3P3NA 1LJ7A 3AMQA 3CQOA 3FLRA 3J7MA 2XBO1 2Y6GA 1QH6A 3NNJA 2YHJA 1D0GA 2VCMA 1UD1A 4YARA 5FAXA 4NR1A 2E7AA 4S2GA 1OD3A 1OI6A 1XE7A 3WF4A 2GAUA 2B4KA 3GM8A 3WUCA 1UNBA 2WNOA 4HMZA 2IXCA 1ZBE2 4NHKA 1UN1A 3HR9A 3UJQA 2W95A 2XBO3 1N3OA 5FYBA 5JIUA 3MPPG 5GKAC 4NPMA 2BNMA 2ZEXA 3HN3A 2HYXA 2ID4A 4QPIA 2BYVE 5FY7A 1RXGA 3VHPA 3ZYJB 1MZ5A 3LD8A 4MUVA 2HWB2 3M4FA 2VW2A 3ZFFA 4PQQA 4IEUA 2DCZA 4C0BA 5A7WA 2X5IB 1LOAA 1XE0A 2R0HA 4LKDA 4AK3A 2WSVA 2YG0A 4KGQA 3ZN6A 4CCMA 5LRRA 4OUSA 4OHWA 4ZS3A 4WBBA 3I97A 4GKXA 1GSLA 1WUVA 1F15A 2X8KA 4GKYA 3UKTA 1ASJ3 4QPGC 1QIQA 2NPIA 4AFBA 1VLNA 5L9RA 1TMF1 4QM8A 4Y4YA 2Y0OA 1CX4A 2JDNA 4HSLA 4NHXA 3RYPA 1JZ7A 1F5FA 1X9TA 3R0RA 4M3CB 3UYJA 4EWEA 5FZOA 3EHKA 1A8DA 1GBGA 3SMHA 4MADA 3V56A 4D7SA 2QQPA 2ETEA 3VBUA 2D97A 3THDA 1X50A 3M2MA 3CJXA 5JI9A 5CFDA 4QM9A 4AI2A 2MNGA 2PHWA 3U07A 4QQHA 2OQ6A 3IDEA 2VXRA 3NJVA 4Q0QA 4RS5B 2BBAA 4MSVA 5LRSA 4ISRA 1GLHA 3ZYIB 4XF0A 1OOPC 1H8TC 5C9AA 3QCWA 1DFQA 3WNMA 2R063 2D40A 5AFBA 1QOSA 2YBSA 1H4HA 3BPZA 1DZQA 2D93A 3VBSA 4NO4A 1D2QA 2FHRA 4DUXA 1LEMA 1UOJA 4AEDC 2DU0A 3KV5A 2A1XA 2BP6A 1COV1 3M3IA 2R041 1PO22 5F7UA 2DTWA 3QH7A 4Q5OA 5DAQA 3B93A 1OSGA 1XC6A 2GALA 4GMP0 5F5QA 2BNNA 1ULCA 5JOZA 2VTXJ 2ARBA 1HN0A 3EO6A 4RR3A 5E16A 5IAVA 2NP0A 2XJRA 2J1EA 2QUOA 3AL6A 2KD7A 4IETA 4ITCA 3URFA 1S0DA 2XUEA 3INAA 4W65A 1COV3 4R9AA 5FMBA 1T2XA 2R043 3GJBA 2XJPA 3K4DA 2QQWA 4LK7A 4LPLA 2ZX1A 4Y5Z0 4JRAA 3KT1A 3PVBB 4AFAA 2YBPA 4O7XA 3WP4A 4DIQA 5CG9A 2WO2A 3ZXAC 4K6BA 1I5ZA 2XKOA 1AHSA 2ZEYA 2D6MA 2R30A 4Q4V1 2NZ9A 4CRQA 1DF0A 3O7OA 2OZJA 3ZXGA 1CX1A 4ZHNA 4LHKA 3AL5A 2B46X 3M1HA 4CZSA 4CPBD 3HWJA 1DGRN 4JGZB 4AFCA 1HDKA 2SBAA 4FXGB 1X36A 4K1ZA 1QJU2 2GN3A 1UY0A 2HWC2 1MR5A 1NOVA 1KDMA 3RDIA 2R49A 5CZKA 2WO1A 3E5QA 1GOGA 1OLQA 4JKKA 1J1TA 3VDBA 2XJSA 3SH5A 4A7KA 4QX3A 2VULA 3NMBA 1ZBA3 1T6GC 3OGVA 3WCSA 5K0UC 1EV11 5FZ4A 4IERA 1ENQA 2D3SA 4QGNA 4HLTA 1MS8A 4A7ZA 1O4TA 3P6BA 4B3NA 1GQPA 2AREA 5FY8A 4IGPA 1GNHA 4ZKTB 2FMDA 1JYVA 4JDOA 3WDYA 4IGQA 3GGLA 4ARXA 4GMP3 4TZDA 1OPMA 4AEMA 3AP6A 1DQ5A 2OW4A 3LF7A 1G7YA 4Y4RA 2XR4A 3O1MA 1VPHA 2R32A 3RI9A 1W6NB 5D2AA 2DDUA 2VCBA 5C3OA 2BFUS 4ZU4A 1JYXA 3SEEA 1GQGA 5AVAA 3W58A 5LA1A 2P34A 3O12A 4DY3A 1OUXA 4QU2A 4LNVA 3B9IA 3ENRA 1XJAA 2G19A 1REEA 4GWJA 4AGGA 5I8YA 4IEWA 3D0SA 2BQPA 2VMEA 3TEWA 1QMJA 3HJRA 5ACA1 4QB6A 1W9TA 5ANQA 2LM3A 3AKPA 4YZ5A 3S5AA 5JI7A 1R1ZA 2PHRA 4L0PA 1OLMA 4B4RA 4DUVA 5BYNA 3LPFA 5IVYA 5FP7A 1Q8PA 1UMZA 4IE5A 4BJ0A 1DQ6A 2ZBJA 2MEV3 1OKOA 2UYAA 2RJ2A 3R4SA 5ACA3 5APAA 4CXYA 5GJ6A 1TME1 2O8OA 4DB5A 1NE6A 3ZIWA 2YU2A 1OBNA 4GB31 3DECA 1MQTB 1R64A 3IT8A 3MIDA 4DXTA 1LOEA 3OOXA 5DG2A 5JSOA 2WC2A 5BNNC 4CP9A 4FPCA 1H1MA 1TME3 3I2IA 1WMDA 1O91A 5IVBA 3AYDA 1MEC3 1ZZ7A 4GB33 3CDZB 1X33A 4K20A 1W9SA 4HKLA 1HV1A 1D0HA 5K9YA 1RTVA 1UYPA 1IS6A 2VGDA 1OQDA 3ETQA 3ACGA 4Y1XA 3FE5A 3THCA 3T09A 1KRIA 4JRLA 2D6LX 1CGPA 2CGOA 4E2QA 1HQNA 2HWD1 1M4WA 1XOYA 4HOOA 2QQVA 2VBBA 2XBO2 3DGTA 4KBZA 4UYBA 1XB9A 3AYCA 4CU7A 1R081 4RFRB 5DDJ3 4ISQA 4RN5A 5I8SA 5LK7B 3OYWA 1OH3A 2WBKA 4Q0VA 1LGNA 5CKMA 4LBKA 4XXAA 4BISA 1FX5A 3CU7A 2AEZA 3HAGA 3E6CC 1P8JA 4LKFA 5L9VA 3ZFEC 2OPKA 3WF3A 4N90A 3W59A 3RZKA 3VDDB 3H8UA 4ZS2A 4NRQA 3K2OA 1SLAA 3NQHA 3N35A 5JDBA 4TN7A 4XACA 2MHFA 3LFMA 1J3RA 2Q0AA 3MFAA 3O1SA 1YI7A 3NV3A 2VQUA 4HETA 4BWOA 2WINB 4XVHA 3VZNA 1FV3A 2D7FA 5FYCA 3NJXA 4IV1A 4WM8C 1FYUA 4QMAA 3IPVB 2JE8A 2CSGA 3MIHA 1K5MA 3CF6E 4WM7C 2CNAA 5ISLA 2WLPA 2D3PA 1ND2A 4BU2A 1HV0A 3I4IA 1MS5A 4XTMA 2CWMA 2B9VA 3DKQA 1IS5A 3ROUA 3HT1A 1TMF2 2VZPA 5CBLA 1Q56A 3CEWA 2HBUA 4KWKA 4CEYC 2VH9A 4IEXA 3B69A 3PTYA 1VBD1 5DQ0A 4E2GA 2WQ8A 3HNYM 5T5LA 2TNFA 1UO9A 4LHNA 5E8AA 4BQ2A 3LEIA 1NAEA 1SQ4A 5M0TA 3K48A 2R062 3WDTA 1DYOA 1QY4A 1QJZA 4OYUA 2Q8EA 3MFCA 4FFGA 4BA6A 2W1UA 1NQJA 3VBHA 3VKNA 3LFIA 2WZPP 1LCLA 3UKVA 1VBD3 2PN5A 3H50A 2CDOA 1SHWB 4FVVA 5LASA 3RSJA 3ZSMA 1GZTA 2ET1A 2GN7A 4YM2A 2VNGA 3HBKA 5FY0A 1BKZA 4AI9A 4JTNA 3H8OA 3ZPOA 1YQCA 2WJSA 4PJYA 5DG1A 3ZYFA 3RZHA 1WCDJ 1AL21 5JXGA 3DXTA 3T2OA 2VZOA 4BOWA 2XXZA 5IAXA 5JOYA 1COV2 3DCQA 3H1YA 3JQWA 2R042 2A6XA 2VXJA 1UMHA 5JPNB 1GP4A 3LPGA 4HSJA 1RUOA 1ULEA 1RUD3 1W39A 5FV3A 1H1IA 2EF6A 4HFSA 4AGVA 1OXCA 2I74A 4QQLA 3VD7A 1AL23 1UOFA 3UT0A 1W2OA 2V73A 3IDCB 4AWDA 1RJ7A 4URTA 4DZGA 1QXPA 1X8MA 2OQ7A 2QFEA 3M3CA 2OKXA 1AR83 2P6HA 1UKGA 1Z0HA 2RS11 2VC9A 4RS5C 2RE9A 2BBVA 5JOWA 2JXAA 1LECA 4A7YA 3BOWA 3EB7A 2ORZA 1BJQA 4ASKA 2BTVC 1ZRCA 1GNYA 4NRPA 3SC7X 3USSA 1PZ8A 3MUZ1 3BI3A 2I07B 3FMGA 5FZMA 5FXZA 3NL1A 1Y7BA 2B7YA 2C6SA 2QQLA 3NAPB 1OHFA 3AMMA 3MIGA 2RS13 1OUSA 2YU1A 1O5LA 4XC9A 1PNGA 1O3TA 5FLIA 5CG8A 1G9AA 2W92A 1LOFC 1R091 4GAZA 4YWAA 2UU8A 1ZYBA 2EIDA 1SLCA 1OVSA 3ZYPA 1SACA 1EPWA 2QDRA 4HVRA 4B7EA 1CPNA 3IZOA 3KGLA 1HKDA 2C0ZA 3AZVA 2B39A 1UY4A 1LAJA 5IYYA 4RQPB 4LULA 1WCUA 1NYWA 1R093 1N47A 3TN91 4XJAA 1YCIA 1WCQA 3MIFA 5T3NA 4LORA 2XH6A 2C1FA 1XQNA 4XDOA 4JC1A 2VAUA 4YGDA 1RUC1 1UU6A 2EXJA 3MO4A 4L92A 2GNMA 3MLJA 1W8OA 5JMOA 3RG0A 2VO5A 1G9DA 4AFDA 3LSEA 4O9EA 4XOGA 3KWVA 2GSYA 1WMXA 4A45A 2A73B 4KGGA 3U10A 3RNSA 1JZ2A 4MGTA 3POYA 5A3OA 3NKTA 3TEYA 1RUC3 1VBE1 1V6LA 1OA4A 1O3RA 3KVAA 4F8AA 2YY1A 2OS2A 2DCKA 1J3PA 1RUI1 4LA3A 5F2SA 4K21A 4I0BA 1WGPA 1BBT3 1F35A 4HONA 4E4SA 4DRVA 4LIVA 3WNOA 2MEV2 5JAXA 5ACA2 2YZ4A 3LCPA 3V0AA 5FYUA 4AXOA 5F37A 1TVGA 4QD2A 1K42A 4EWAA 3IN9A 2J7MA 5CKQA 5TSWA 5CADA 2ES3A 1RUI3 4Z8BA 4XQWA 2LS6A 2YROA 1CJDA 4XFIA 2FZ2A 1BYHA 3JB8A 4XW3A 4XUNA 3T0BA 4HKOA 5BNPC 4GWMA 3I2KA 1KJRA 1TME2 2VMGA 2E26A 5DZFA 5D8AA 2O0OA 3ECQA 5DAWA 2XJQA 3T2TA 1MEC2 4GB32 4CEWB 5JOXA 3VZLA 4D6RA 4UAPA 3RJ2X 1ZRDA 3W9AA 5FO8B 4YZ2A 1W0OA 1YFXA 2PELA 3O1OA 3WNNA 4N7UA 5EWSA 2BWAA 4QPGB 2WS91 1LU2A 2DTYA 3GCXA 3OGJA 4UF0A 2YV8A 1J58A 4LBLA 5C8CC 2BPA2 2BEOA 3ACHA 3SXWA 3L2YA 2BOJA 5FZIA 2VQAA 4CP2A 1BQPA 4D3WA 3TEZA 1D2SA 2WRAA 1S0IA 5D21A 4I0AA 2GC2A 4L2NA 4QB1A 1AVBA 2DFCA 1AYN1 2WS93 4NMIA 4CDWA 3KQRA 5GM0A 4Q26A 2PFWA 2FDJA 1B35C 3DYOA 3ZMNA 3HQXA 2DVBA 4GH4B 4FPOB 4XBNA 4ET7A 5AC91 3B5LB 4NROA 1DHKB 3VBRB 2VOKA 3JZVA 3K4AA 1AYN3 2XVKA 3A7QA 5FYHA 1R082 4OVEA 5GLVA 3F95A 4Y3OA 4YZ4A 2AEYA 1G86A 1RXFA 1W6MA 1OOPA 2HH9A 1K3IA 3LB9A 2WKKA 2GMMA 4WVVA 1N3QA 5AC93 3ZYBA 4UWDA 2K9ZA 2V4VA 5ABJA 2VMHA 3U4XA 4ASLA 2QQOA 3PNAA 1URXA 3LAGA 3WW3A 2Q5TA 5CFCC 4JZRA 2W39A 4YW1A 1NX9A 1DCSA 1ENXA 2RS51 3B02A 2IXJA 2XHKA 1NT0A 3NKGA 5FPBA 4RA0A 5T5OA 2ZGUA 3RI8A 1UOGA 5A33B 1OQ1A 2IXIA 5C70A 1V6OA 2PQSA 3ZXDA 2RR11 2VVEA 3GHMA 1ZZ8A 1DBNA 1ZZBA 3ETPA 5CU1A 1E5RA 1GR3A 1BMV1 2KXLA 4KI5M 1CAWB 2RS53 1LEDA 4LE3A 2Z2SB 2WNUA 4QKFA 3N9LA 1VALA 3ZYHA 1BCXA 1DQ4A 1VR3A 2RR13 3B00A 4QHZA 4AI1A 3NRUA 4LEJA 3IDBB 3N9PA 1RUG1 1ZRIA 4KL1A 2YC2A 2YMZA 1DQ1A 2ZX3A 5EFUA 1CWPA 3MICA 2HJIA 3VDDC 2FDIA 5DN2A 2QZ2A 4DEVA 5ERLA 3WP5A 1VBD2 5EP9A 1S2BA 1RUJ1 2QBXA 4UBHA 4FFHA 4XJUA 1GU3A 1ZZ9A 1MVEA 2VZUA 5SV5A 1QHDA 3PU8A 1RUG3 2D6NA 5EYXA 3BTXA 4COYA 1JODA 4PLNA 4HK9A 4GIQA 1IOAA 1FT9A 2XGXA 3BUCA 3CHXA 3P3PA 3I54A 4EZHA 3VD9A 1RGSA 5IATA 2RDRA 4UW5A 4KG0A 3K4ZA 1ODNA 1RUJ3 2IFRA 3MIBA 5K0UA 4DNYA 1YJLA 4UBGA 3S7IA 4Y20A 2JEMA 2MPFA 2CYFA 3F2ZA 1GMMA 4XFFA 1W6QB 1UY3A 3IDAA 2DFBA 5IK5A 3H8RA 1AL22 2YFZA 2F6BA 4BQ3A 1QF3A 4Q29A 1W90A 2GU9A 1W2NA 1AR82 3GALA 4N53A 4XETA 4CCOA 4R9BA 4BQXA 1AR71 3MW2A 3MW4A 3WUDA 1IS3A 3R6SA 4Q2FA 1PM7A 2RJLA 4JCKA 2RDNA 3AJYA 4LO5B 3R4UA 4IE7A 2VOVA 5F9TA 1LR5A 3GNEA 4W6WA 4D6QA 2GMPA 4XXPA 2OIIA 1W6PA 4LBQD 3IAPA 4Y5TA 1D4VB 2RS12 5GLWA 2VL4A 1JUIA 3OGGA 3GYDA 5C3SA 3CBNA 4AW7A 3H7JA 1UX7A 5HCHA 4IEOA 3QACA 2W47A 2VECA 3T2PA 5FLJA 4Q8KA 1JOJA 1JYNA 1LODA 3MV11 2P3KA 2CV6A 4LJHA 3P5BA 3KD4A 3SHRA 3KQ4B 4FPGA 2VZ1A 2PLV3 3SKVA 1JUHA 1QDOA 2ZJCA 4LTAA 1R092 4QPWA 4AQSA 2BERA 1JOPA 3E97A 3IIIA 3VUOA 1LOGA 4V2VA 2VJXA 3Q9OA 4AVCA 4Z2AA 1IQDC 3N7KA 3WVJA 5BNNB 4RL7A 2P2KA 1XYOA 1CAVB 2ZGQA 3MIEA 3POGA 3BTZA 3AMNA 1W28A 3FWEA 5FPXA 5CISA 5A6XA 4LOTA 1JTZX 2JKXA 1LRHA 2Q4SA 3OD0A 3WV6A 2N7GA 3LQCA 4Y1UA 1RUC2 4LBOA 5BNOA
chains in the Genus database with same CATH topology
3NAPC 1ZRFA 1O7FA 4QGMA 1IQAA 2G9FA 3IM0A 3EBRA 4EN8B 5FTTC 1OKQA 2JJ6A 4NWVA 4Y22A 5L36A 4HN0A 1C8M1 4OLLA 1V00A 2ZGRA 4R8HA 3TRSB 1UCXA 1RUI2 3AKRA 4XPVA 3VLBB 4JTOA 3N3HA 1AXZA 3GHNA 1V9U1 4L11A 5JZGC 1C8M3 1PO13 3E5UA 3ZFEB 4RHV1 3WDUA 1GQHA 2DWRA 2LALA 3CLPA 4BQ1A 2OYZA 4YM1A 1I3HA 4X6QB 3I2DA 4P9YA 3MDPA 1V9U3 3PHMA 4I09A 4RHV3 1TQ5A 4PIXA 5FBZA 1FI2A 1YIFA 3ALQA 4X8PA 3IMNA 4AI0A 4C91A 4WM8A 2VMIA 4WM7B 1NCRC 1PVXA 1QJY1 1OMIA 1Q8QA 4LBMA 5SV8A 4BIFA 2IC1A 3AMPA 2WS92 1S0CA 3SH4A 5JSPA 3NJZA 2FQPA 4W6YA 4MGKE 1XYNA 1Z7S3 2VVDA 4IEVA 1VBC1 3FFQA 1PHMA 3PVEA 4EN9B 5L7OB 1QJY3 4CEYB 1CAXB 5J48A 1AYN2 5A3MA 4XJZA 3VKMA 1ASJ1 1M06G 2VNRA 2G4IA 1NCQA 2C5DA 2HKXA 4K7JA 4PBOA 1UZZA 2X5IA 1VBC3 3LKJA 3D8CA 4IL7A 4COUA 5AC92 4MLOA 4CEWC 5E88A 1DZTA 4XDQA 4HVOA 4P14A 4Q0PA 4XMIA 4DRRA 1YWKA 1I9RA 4YVSA 5IK4A 2ZX4A 3BB6A 3HD8B 3VKLA 3MZHA 3C2UA 2JG9C 2PHUA 1Q8OA 1BXHA 2GC3A 4Q8LA 4LBQB 1VAMA 1BEV1 1WCKA 2R6QA 3FBMA 3AYEA 4M3CA 2RS52 5LK5A 1O5UA 4KG8A 4F7ZA 2HWE1 4J1XA 2Q1ZB 4HZFA 2R061 2RR12 3AMHA 3M7AA 1UIJA 2ZTNA 2B5HA 3MI8A 4GH4C 1QXRA 1BEV3 3VBRC 2ZA9A 1XNBA 1BMV2 5KXEA 1FOD3 3M3QA 2R1DA 2HWE3 4K8FA 2A5ZA 5FOBB 1AX2A 2D5FA 4EN0A 2DUQA 2RJKA 1RUG2 2VU9A 5I8TA 4YVWA 1JH5A 3OCPA 4EV0A 2LTNA 1MZFA 2IXHA 2XG3A 1QH7A 1EY2A 3AXDA 3DPRA 3VZKA 1DQ0A 1RUJ2 1YFWA 3ZMOA 5FCCA 4LLFA 2F4PA 2QKDA 4ZU5A 2X53S 4P9XA 1KFUL 2WLQA 1MZEA 3MEPA 4Z92B 4QPYA 1D4M3 3WW1A 1DU3D 2ZPXA 1S1AA 3THTA 1UX6A 1C3HA 1Y9QA 4AHZA 1CN1A 3L2HA 2ZHLA 2O1QA 4H7LA 4SLIA 5C4WC 1ZBA1 3KCXA 1Q43A 1WLWA 4JGZA 1MS3A 2A3XA 2E9QA 2Z5WA 1AR72 4N43A 3OTFA 4JGYB 1PZ9A 1KDKA 5I0TA 1G8WA 4OHZA 1CPMA 4GMP1 5F6LB 2JG8C 4FT8A 4YW3A 1SBFA 1OA3A 3NWKA 1YXWA 4TLFA 2GH2A 3PMSA 2ARXA 4GALA 1JBCA 5T5JA 1LHOA 2AGSA 2Y26A 2EVXA 2K0GA 4XIOA 2PLV2 1G6NA 4YNIA 2D6KA 4PIYA 1HRV1 4MGZE 1J3QA 1KD7A 3AZZA 4IV3C 5BNPB 4PLMA 1QKQA 5T52A 4COVA 1W6NA 4BIOA 3WLUA 1LOBA 1HRV3 1C5HA 4M3CF 3N36A 4YW5A 1NLRA 1CJPA 5GZEA 1EP0A 2D44A 4XF9A 5C8CB 2MEV1 2H6BA 4HPKB 3WHUA 3FC0A 1SLLA 4Y24A 5F1RA 4LA2A 3WDXA 5FFOC 4XFBA 1FPN3 4QT6A 3ZFGA 4CYDA 1U12A 1B35B 3ACLA 1RUF1 3ZN4A 2P3JA 2VOXA 2YC0A 3RYRA 1MEC1 3ZXJA 3S0MA 1GYKA 1N1VA 1C8M2 3U0ZA 1PO12 5CVRA 1MQTA 3BCWA 4K9SA 1OD5A 3VBOA 1RUF3 4Q4Y3 4QQOA 5CA6A 4FTEA 3CO2A 1RUNA 1YHFA 1V9U2 2DYCA 4YSFA 3D4KA 4LO8A 1NY71 1JW6A 1ONAA 2P17A 4RHV2 3ZX7A 4CDQA 4MXWB 5CFCB 3H9AA 3T1LA 1PGW2 3OY8B 2P3IA 4NHLA 5DDJ1 3SISA 1SFNA 2V09A 1MS1A 3KT7A 2JENA 1UU4A 4UW6A 3BU7A 2GMEA 3LSDA 1Z7S2 2ZHNA 1C5IA 1MACA 2D3RA 4J1WA 3WDVA 4XFAA 4XBQA 1NE4A 1W6OB 2DCYA 2EALA 1F5JA 1QJY2 3WG3A 1RB8G 1O4YA 5H9SA 3USUB 4ATEA 1ND3A 1AR91 1KXGA 1CR7A 5DZGA 4PDWC 3HBZA 5HI0A 1HW5A 2B45X 1AZDA 4Z82A 2EIGA 1VBC2 2XWJB 1RUH1 2DVAA 1QU0A 3TWIA 3E6BA 2AUYA 1AR93 2EXIA 4HANA 3SCGA 1ASJ2 3TBDA 1AL0G 2WNVA 3R4DB 3B94A 3OYWB 3PVOA 1QWRA 4HBNA 4AFMA 1A6CA 5J36A 1RUH3 2I2SA 3IPVA 2BGCA 2TBVA 5KWRA 5KXDA 1PK6B 2C9AA 4R4XA 3SH3A 3UK9A 3KMHA 4O9GA 3WNXA 4BH9A 5L7OC 1BEV2 2A6ZA 3AYAA 3MLLA 1VB4A 2QJVA 2OVUA 1FOD2 4C1XA 1K5MB 3EJKA 2HWE2 2ZMKA 1FNYA 1C1LA 2QDNA 2DCJA 2WFF3 2PQQA 4LBJA 4P5HA 4B7KA 3ZXEA 5AFEA 4META 4I2OA 1F8VA 2WQZC 1IPJA 1EPZA 3RJRA 1J1LA 1HRI3 1RUD1 1Q8SA 1AUYA 4IQPA 4YW4A 3J26N 3QLQA 3ZFFC 1XNDA 2CY6A 4KQ7A 5A32A 3ZDSA 5JIAA 2BNOA 3CJIA 2PTMA 3POSA 2VQ0A 3IKWA 1AR81 4WVMB 3VBHB 5KC5A 2D43A 2DUPA 2CL2A 5GLUA 1C57A 3DUIA 4M00A 4FP3A 1C28A 2D98A 1U5XA 2BWCA 2DUOA 1UPIA 3AK0A 3FZ3A 1DGLA 5F6KA 1AF9A 4ORFA 3POWA 1N1SA 4LO7A 3ILRA 4E9KA 1G9BA 2UY9A 2R1BA 4WZFA 4AQTA 1UL9A 1NZCA 4GQ7A 5J3UA 1RJ8A 1YFUA 4BMEA 3DF0A 3VBUC 2OUJA 2YPJA 2ZGPA 4DOUA 4YGBA 1PVC3 1WD4A 5EJ3A 3NAPA 1ZBA2 4CDUA 4WV8A 5FLHA 1MVQA 1ZM1A 3ES1A 5FMOL 4FPFA 2GC0A 3AZXA 4EROA 2H0BA 4FPLA 3MF6A 2Y38A 3VV1A 3I59B 3VBSC 5EZWA 4XF3A 4RQPA 2BW8A 3LA2A 1S0GA 5JZGB 3NV4A 3U11A 3GBWA 2IWGB 5KXCA 4RR3C 5JWPA 3H1MA 1KITA 1HRV2 2PA7A 3KCCA 1FMD1 4YM0A 2GC1A 1BBT1 4UW3A 3RWNA 2ZKNA 1RUE1 2CWSA 3OF1A 4V1PA 5DUWA 4JGYC 4AQ2A 1NCRB 4DINB 3KLSA 4RGAA 1FMD3 2PHTA 4CDXB 1R1A1 1Y3TA 2RS31 4AVTA 1ULFA 3A0NA 5BXXA 1FPN2 1RUE3 3UKNA 4XHXA 1DZRA 1XNCA 1DG6A 4AI8A 5B2GB 4NN0A 1EAH3 1PZ7A 3ASIA 3D5OA 1ZZCA 1R1A3 3KB5A 2RS33 1WMEA 5H9PA 4BLJA 1DYKA 2JE7A 3PVNA 3WG1A 1RUF2 1H9PA 2RHPA 4Q4Y2 1CESA 3A0KA 4A3XA 3AKSA 3WQ1A 4BHPA 2WNEA 3N7LA 3RS6A 4AVBA 2QCSB 3OD4A 2XB6C 1W0PA 2Q8OA 3VKOA 1X82A 1H0BA 4FSJA 5FDBA 3VBFB 1LGCA 4QPGA 1S0FA 1I1EA 5BPXA 4L97A 2JG9B 2Z79A 3QOPA 5JLVA 1DQ2A 2ZHMA 3NV1A 2ZX2A 1NY72 1V6NA 4MGYE 4S2HA 5DZEA 1IKQA 5BNQA 3WOGA 2ZGSA 5DDJ2 4AEJA 1H2LA 4I3PA 4YZ1A 4AVSA 1LHWA 4ONUA 1Y43B 3RQ0A 2DV9A 4YRDA 3GZAA 3ME2A 3RYKA 3IIAA 4GH4A 4Q27A 2VPVA 3VBRA 2XVLA 2GNBA 3KS7A 2O8QA 3OJBA 1H8TA 4CDWB 2KM2A 2ILMA 3VZOA 1AR92 4KU8A 1YO8A 3AKTA 4A2UA 1SLTA 5J09A 1MS0A 3KSCA 1WW5A 1NA1B 4KNCA 3LA3A 3MGUA 4AEDA 3WP3A 2RM21 1RUH2 2W0XA 3AP7A 2VNOA 1YYNA 4YFWA 1XNKA 1QNYA 4BPZA 1QXJA 1VAKA 3ZIXA 1MS4A 4FOYA 1N1TA 2RM23 4XQDA 1RVF3 1WMFA 3AP9A 1AX1A 1S55A 5ABJB 4X6RB 3X29B 1TNFA 4LE4A 4AVVA 2HEWF 1IZ3A 2VUAA 5EV7A 4FTBA 3WCRA 3JD71 2UYBA 4K1YA 4EN7B 5C4WB 4I01A 3VHNA 4LLOA 2WFF2 5J96B 4FTSA 1N1YA 2P37A 1QGLA 4U36A 1GV9A 1SBDA 1VRH1 4RGGA 1JYCA 4OI1A 4AVAA 3JD73 2YXSA 1Z78A 1OQEA 1HRI2 1GZWB 4B29A 4YG0A 3GZUC 4GULA 4PF5A 2JG8B 2WZR1 3CNAA 1VBB1 4QQPA 5HCFA 5GZGA 4KH9A 3O0XA 4MGIE 1VRH3 3V0BB 4Y1YA 3FHIB 4PLOA 1PK6C 1RUD2 4OHVA 5FQ0A 5FO9B 3BTAA 2ZZQA 1LENA 3T1MA 5FOJB 2WZR3 3B9CA 4FOWA 1VBB3 4R52A 4AI3A 3TAYA 3HN1A 3NVCA 1HLCA 4IV3B 1APNA 1VIWB 4IV1C 1X7NA 2FMYA 1W2UA 4TSVA 4LT5A 1HXS1 5C33A 1HIXA 4RD7A 1K5MC 2IFWA 3ILFA 5FRAA 3O14A 1ND2C 2OA2A 1YLLA 5IK8A 3WY6A 5FO7B 3MLKA 5KHGA 4Y20B 3VKFC 3VGIA 3B01A 5CB7A 1BVP1 4EJRA 2AZ5A 5LEJA 3H3UA 1AXYA 1HXS3 4QQ2A 4J6GA 1C8NA 5BV6A 4W6XA 3GZTB 3WD5A 2PLV1 5J37A 4M0HA 5AVPA 3M70A 3FUOA 5I93A 3UJOA 2ZABA 2WA4A 1RIRA 1NXD1 2ENRA 4M0NA 3SITA 2A75A 2ZGMA 4Q0UA 3JCIA 3J4UH 4B8EA 3WQ7A 3VBHC 1DYPA 1W6PB 3I7DA 1S0EA 5C6CA 5E89A 2WWSA 1U5IA 1RL3A 3ZN5A 1DLLA 1IPKA 1FATA 2AYHA 2Z42A 4OUMA 4XFCA 5JCTA 5IK7A 1V6KA 1PIV1 3WW4A 4FAGA 1CAUB 5BNNA 2XL9A 4YGCA 2AH2A 1CAVA 1EYBA 3V65A 2ZCWA 1U5ZA 1NXMA 1F9KA 3FFZA 1ALYA 2E51A 1PIV3 1IHMA 4MXVA 1FMD2 4AGRA 2XLAA 1BBT2 5D1IA 1YRZA 4C0HA 4HN1A 1YIPA 4DXZA 1RUE2 1SLBA 2IXLA 2A3WA 1PO11 1FAYA 1RHI1 2PAEA 5CIRA 4FO9A 1EAH2 1DGWA 4PIZA 1R1A2 5BNOB 3ST7A 2RS32 4OULA 1GZ9A 5L73A 3FJSA 4PDWB 5DXDA 1C1FA 3WG2A 1RHI3 4XJ9A 4INDA 1VBA1 1OFSA 1REFA 3ZFEA 1KFXL 3LZZA 1PGW1 4Y22B 1GNZA 3IBMA 4JV4A 1QOTA 2DURA 4YG3A 1WLDA 4DY5A 4I02A 1GICA 1UU5A 3GF6A 1WLTA 1DGWX 1VBA3 1Z7S1 3NW4A 5J7MA 1QJX1 4IEZA 3V64A 3BALA 1C4RA 4IEQA 1MS9A 4CDXC 4WM7A 2AR6A 3E5XA 4G4FA 4XMAA 4HT1T 1G9CA 4XEZA 4DS0A 4D94A 2GH8A 1AR63 1QJX3 4XIKA 5L7OA 1LGBA 1LHNA 1MZ6A 2BVBA 4CEYA 1CAXA 3FUQA 2Y0IA 4EWDA 3WQ0A 4PQ9A 3ZPYA 2XUMA 1UAIA 2E7QA 5BY5A 2WQ4A 3M3EA 2B9UA 5JPMB 2ZACA 4H3WA 3B7MA 3J8F1 1WLCA 4OI2A 4QPIB 1V70A 4KWLA 5HCAA 4WVWA 3ZFFB 3VBFC 1H30A 3AP5A 1AXKA 1ZNPA 4LUKA 1NCQB 2Q30A 1V6IA 3BODA 1H1AA 3AZWA 3J8F3 4Y26A 3J9SA 5D8AC 3WR0A 3ZN6B 3WP6A 1FOD1 2RM22 1G9FA 3QBQA 4LBQA 3UV9A 3ZSJA 1RVF2 4E4DX 5IT6A 1LOCA 4L8QA 4YVSB 2UWBA 2GDFA 3LGRA 4K3UA 4XQ4A 4FOVA 3WW2A 4RS5A 2A6YA 4FPHA 1UIKA 2XJUA 4YW2A 3MPBA 4FOQA 4CDWC 4F83A 3VBUB 3JD72 1WBLA 2I45A 4ZU7A 5CFDB 1UKRA 1U0AA 4HK8A 1NA1C 3WHTA 4CTEA 1TMF3 4RSUA 1D4M1 4MYEA 1VRH2 1LOFA 2E53A 3ZXLA 4RFT0 3HIFA 5C9AB 1SBEA 4NHMA 4UXAA 4ES9A 4Q4W1 3VBSB 2D5HA 3TOJA 4AYUA 1ZREA 5J98B 2WZR2 1VBB2 4N7IA 2CGNA 3VZJA 4YVWB 5ABJC 4AHYA 1FXZA 2OUHA 3SCHA 4GWNA 1LB2A 3TNPB 3NV2A 4EN6B 3DPRB 3NO8A 4Q4W3 1AYM1 4RR3B 4U2AA 1JN2P 2YDEA 3WDWA 5GLZA 2HYKA 2WSUA 4E27A 4AQ6A 3JU9A 2CAUA 3ATGA 4XJWA 1HXS2 2ZGOA 2PAMA 2G9GA 1XE8A 2WNUC 1AYM3 1FV2A 1H4GA 4TWTA 4JGYA 2ZX0A 3OBTA 4HL0A 3KCYA 3TB0A 3DL3A 1WD3A 1WW6A 2ATFA 4OI0A 4QGLA 4XILA 3VHOA 1SCSA 2BFUL 1OA2A 1SCRA 3M3OA 2ZGLA 2ET7A 4Q1RA 4N43B 5E1RA 2UWAA 2EAAA 4BYYA 2NM1A 2NLRA 4D7TA 1HQWA 4Q4V3 5CNAA 1O3QA 5CAZA 1BVVA 2WA3A 3PMEA 3G6JB 3TNQA 1WA4A 3OBRA 4LR4A 4OFGA 4B4PA 5BNPA 1OLRA 3L9JT 4FPJA 1TE1B 3THPA 1H2MA 3AFGA 3VN4A 2WIIB 1PIV2 3OPZA 2ZS6B 4FBFA 1FPN1 2CAVA 4QXKA 4NWWA 1ZZ6A 4I30A 5C8CA 1O3SA 4XF4A 1EV13 4N53C 3N7JA 2ZMLA 4HPKA 1I6XA 2E6VA 3ZSEA 4G9SB 5FPZA 5KHHA 3ILNA 4OI4A 2A6WA 4R9CA 5FREA 2CTVA 3H0OA 3KT4A 4Q4Y1 2EA7A 1B35A 4YFZA 1PGSA 1A78A 1GFF2 1RHI2 4FP2A 1IS4A 2GNDA 3AB0A 3GBGA 2XVGA 3AJZA 1L3JA 3ZFGB 4PCRA 5IUQA 1RC6A 2X29A 1VBA2 2R16A 1S0BA 3LOBA 5CFCA 3DN7A 4MXWA 2ZKLA 3QD6A 4NVPA 3OY8A 3AFKA 1RMU1 2WT2A 4IESA 4IEPA 2PYTA 3VBOB 1YI9A 2B8MA 4AG4A 2A70A 5T50A 2DF7A 1V6MA 4FPKA 4Q1PA 1AR62 1QJX2 4XHBA 2HWF1 4YM3A 2VY0A 5A3LA 1UZYA 1RMU3 4CDQB 1W6OA 2CGPA 5BNOC 4AHWA 3USUA 3KZ4C 1XU1A 3S30A 4NOTA 3EQEA 2HWF3 3WX5A 5I0RA 3PLQA 3VDDA 1BZWA 3AX4A 4BLIA 3S7EA 4XE9A 1UF2C 4LO4B 2D6OX 1ND3B 3AXEA 3BIWE 3H3ZA 3VL8A 4CP0A 1XU2A 2QVSB 2XLGA 5JR7B 2HWD3 3J8F2 3JUUA 1H2KA 2NQYA 1R083 4FXKB 2A3YA 2NYYA 1XXNA 3D6EA 4H14A 4WVZA 2WL1A 4DPNA 4FQZA 1PK6A 5I0UA 3I8TA 1X8EA 2WNVB 4UW4A 2WFF1 4M01A 4AEKA 5JSRA 2R071 4IV1B 4Z1VA 3DKWA 3VL9A 3LOIA 4DQAA 1ND2B 2A6VA 1HRI1 4D69A 4Q4X1 2VOWA 4R4ZA 5BUVA 2R073 3ELNA 1LHVA 2JX9A 4QPIC 5EXOA 2Q1MA 4Q4X3 5C8WA 4YGEA 5JVVA 1NCQC 4JQRA 3ZVXA 2X5IC 3SCFA 2DVFA 1FNZA 2NMOA 4WVMA 4MX3A 1D4M2 3PJQA 4LUMA 5GLTA 1GKBA 1IKPA 2IXKA 5DUVA 1U5YA 4MV2A 1TEIA 4YVSC 3ES4A 4Q4W2 4D7YA 2UWCA 3JQXA 3EXUA 4KWJA 1PVC1 5A32B 4AHXA 3CJIB 4P9JA 1TNRA 2H0VA 4FQ4A 1RINA 4DFSA 1AYM2 1Q8VA 2AENA 1ULDA 2EAKA 3PJYA 5CFDC 1RITA 5KHKA 2KA3A 4KBBA 1A8MA 5C9AC 2EXHA 3SNMA 3ZXFA 1ZA4A 3S6PA 2DU1A 4JAAA 4PBPA 1DGRA 4Q4V2 3I59A 1Q5OA 4MH0E 4YVWC 1LULA 1KQRA 4KU7A 2JKBA 3O0VA 4CDUB 4LO6B 5JZGA 3H1WA 5GZFA 5T54A 3RMXA 2XKPA 3DPRC 2V5YA 1QNWA 5H9QA 1A3KA 2A7AA 1ZX5A 2QZ3A 1PGL1 3JBG1 2GNTA 3JB4C 2HEVF 2R0FA 1BK1A 3ZYGA 2LUWA 3NSTA 3TYJA 4I3GA 1QOOA 1EV12 1EAH1 2EXKA 3UL2A 1DDLA 1NCRA 2JD4A 3JBG3 4CDXA 1POV0 5FMOS 1PMIA 5HBAA 1F2NA 1VJ2A 3WXPA 4JGZC 4P9GA 4R9DA 3TN93 2D6PA 2RMU1 5I91A 4N43C 3FBYA 4N9HA 4MVTA 4YYOA 3HT2A 2XWBB 3WINE 3MYXA 4BM8A 4Z2WA 4E4ZA 1GZCA 2RMU3 1QQP1 1O4ZA 1SMVA 3K51A 4NPRA 3V0AB 4CEWA 4ES8A 1NQDA 4S2FA 4WZCA 4L9BA 5DUXA 3AZYA 4FPYA 1ZVFA 1VBE3 1CIWA 2E63A 3BOPA 2YGMA 3E6DA 2QE3A 3MF9A 2XLFA 5KHJA 3VB