1SFNA

Crystal structure of protein dr1152 from deinococcus radiodurans r1, pfam duf861
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
245
structure length
245
Chain Sequence
MKHLGQTRSALHGSHAVITPETFVRTALAEWPGSAIVLHIAPVVGLGARFVQFTAEMPAGAQATESVYQRFAFVLSGEVDVAVGGETRTLREYDYVYLPAGEKHMLTAKTDARVSVFEKPYQTVEGVQAPGVYWGNERENPGYPFEGDDHLIARKLLPDEPAFDFMVSTMSFAPGASLPYAEVHYMEHGLLMLEGEGLYKLEENYYPVTAGDIIWMGAHCPQWYGALGRNWSKYLLYKDMNRHPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of conserved hypothetical protein from Deinicoccus radiodurans
rcsb
source organism Deinococcus radiodurans
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
total genus 51
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05899 Cupin_3 Protein of unknown function (DUF861)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1sfnA00
3RYRA 4MH0E 4X6RB 1IPKA 1GQHA 2XLFA 5EFUA 1RUNA 3IIAA 3LAGA 3N4MA 1X8MA 2XLAA 4JVAA 5BY5A 1YHFA 5KHKA 3S7IA 2B8MA 3FE5A 4H7LA 3RNSA 1J3RA 5LRRA 4WBBA 4I3PA 3D0SA 4P9GA 4IEVA 4D7SA 3I54A 3NKTA 5FLIA 5BUVA 4XETA 3VHRA 1GQGA 3DL3A 3FWEA 1FI2A 1UCXA 4HBNA 5I0TA 1H1MA 4XFFA 3FZ3A 4I0BA 2KXLA 4HMZA 1I5ZA 2BYVE 4QGNA 4NVPA 5E16A 5E1RA 4UXAA 5K8SA 3LZZA 4AQ2A 3EO6A 3G7DA 2O1QA 5JSPA 4JV4A 4HLTA 4MGKE 4EWAA 2FQPA 2O8QA 4KU7A 5I0SA 4YYOA 2WFPA 4A2UA 1TQ5A 1DGWA 3KGZA 5HI0A 3FX3A 4EROA 4MUVA 1RC6A 1SQ4A 1X7NA 2I45A 4I2OA 3FHIB 3U10A 4I01A 3E6DA 1QXRA 1RUOA 1QY4A 1ZZ7A 4XF3A 2IXJA 2UY9A 5I91A 3D0JA 3R6SA 1QWRA 2PAKA 4JTOA 3MZHA 4I09A 3KSCA 4E2SA 5FLHA 1IPJA 3OCPA 1G6NA 2GAUA 4BH9A 2IC1A 4YSFA 4XFHA 4B29A 2BNOA 2GZWA 3BU7A 2CAVA 3PNAA 2H6CA 1O7FA 5JR7B 3B02A 4MX3A 2D5FA 2OA2A 4XFBA 1PMIA 1XE7A 3HT2A 1FT9A 4O9GA 2GC3A 3UKNA 1CAUB 4XFCA 1ZVFA 1SFNA 1ZREA 4MV2A 5I8YA 1NZCA 4LLOA 2N7GA 5J7MA 1YWKA 5LEJA 2EA7A 2ET7A 4KWKA 4LUMA 1CAUA 1UPIA 5I8TA 4I02A 3DN7A 2ETEA 3LA2A 3LA7A 2CAUA 3CO2A 3DKWA 2IXCA 5JAXA 4HSLA 3IWZA 3OF1A 4K8FA 5CADA 1NYWA 1ZRDA 4UBGA 2GU9A 2FMYA 1CAVA 3CEWA 3KCCA 4ORFA 2Q0AA 1ZZCA 4LEJA 2VQAA 5LEKA 1DZRA 2UYAA 4AVAA 2ATFA 3H7JA 2PAMA 2D93A 3QOPA 3BPZA 5I0UA 3MYXA 4ZU5A 4MZUA 1OD5A 3WW1A 3EQEA 4QX5A 4XFIA 2PFWA 2Q4SA 2OYZA 3NSTA 3IDBB 4EWDA 4MGYE 5JSRA 3WW2A 4OFGA 1ZZ8A 3ELNA 1EP0A 3EJKA 3H3UA 2IXLA 1YFYA 4KU8A 4TLFA 3OD0A 4QGMA 1NXMA 3IDCB 3EHKA 4XFGA 1CAVB 4JTNA 2ET1A 1WGPA 3HQXA 1NE6A 4HN1A 1O5UA 3QACA 1Y3TA 1CAWB 5FPXA 4FAGA 5AVPA 3LWCA 1ZZBA 1O3TA 3ZDSA 3C3VA 1L3JA 3H9AA 2VECA 4YRDA 3E5QA 1CX4A 1OMIA 4E2GA 4O9EA 2OZ6A 2H6BA 4KWJA 2GC2A 4L11A 2PHLA 3FJSA 3BALA 2Q30A 4KWLA 4F7ZA 2VPVA 4Q0SA 2BNMA 3SCFA 1UIKA 4EV0A 3E97A 3RDIA 1FXZA 1JUHA 3H1MA 3E6CC 3CF6E 4PIXA 3TNQA 1EYBA 3OGJA 4Q0VA 3RZZA 3E5XA 4ONUA 1ZRFA 3IBMA 2QJVA 4AVCA 5LRSA 5FLJA 4IETA 2PAEA 4LTAA 2MNGA 2ZCWA 3M3IA 4ZU4A 2PTMA 5FQ0B 2UYBA 1OI6A 3KMHA 1V70A 2XGXA 1HW5A 3H7YA 2GC1A 3ACLA 3CJXA 1CGPA 3CLPA 2C0ZA 1DGRA 4HVOA 1O5LA 2UY8A 2XKOA 3I59B 3H8UA 1LB2A 5I93A 2D40A 1SEFA 5FPZA 4IEWA 3E6BA 4HN0A 1U12A 1PM7A 3RYKA 5FDBA 3SHRA 4FBFA 4AVBA 2XLGA 3SXWA 1X8EA 4Q29A 2XHKA 4XF4A 2D5HA 4Q0PA 4F8AA 1EPZA 3LOIA 1X82A 1XRUA 2ZKLA 3NJZA 5JCTA 4XF9A 4N9IA 3MDPA 3PLQA 4LULA 1ZZ9A 1VR3A 4QMAA 3MPBA 4FT8A 2Y0OA 3M70A 4HSJA 3KGLA 4BIFA 4MGIE 4HZFA 3D82A 1VJ2A 1YFXA 4AQ6A 3OTFA 5KHIA 1Q5OA 2XKPA 2PYTA 2QDRA 4LA2A 4EWEA 4YARA 1LKNA 3JZVA 5BV6A 5J48A 5CU1A 1I6XA 3SMHA 4CYDA 3H50A 3PVBB 1RGSA 5I8SA 2BNNA 1RTVA 1J1LA 1Y9QA 3LA3A 4J1XA 1H1IA 2B9UA 2QCSB 2MPFA 2HKXA 4R52A 5KHJA 2OZJA 1QXJA 4QM9A 3H1YA 1YLLA 1J3PA 4XFAA 3GBFA 3SCGA 3WW3A 1Q43A 2B5HA 1O3QA 3I59A 5BXXA 4LUKA 5F1RA 3ES1A 3CL1A 4IEOA 1DZTA 1YUDA 1YFWA 3EBRA 3ETQA 4I0AA 3USSA 2IXKA 4X6QB 4META 3U0ZA 4QXKA 2WC2A 3HIFA 4PIYA 4QGLA 4IEPA 2BGCA 5I0RA 3WW4A 2OPKA 2K0GA 1ZNPA 5KBFA 3SCHA 4XF0A 3UKTA 2H0VA 1RL3A 1XE8A 4R8HA 5EZWA 3ES4A 1UD1A 1ZX5A 1EY2A 3O14A 3TNPB 4Q0UA 2GH2A 3BCWA 3E5UA 1O3RA 3H1WA 1YFUA 5FQ0A 4IESA 3ST7A 2IXIA 4BYYA 1J58A 4LA3A 1J59A 2QNKA 2Z2SB 4WZCA 3RYPA 2PHDA 5T3NA 2E9QA 3S7EA 4PIZA 5KHGA 4IEZA 2Z69A 4WVZA 2K9ZA 2XL7A 4IEYA 2CGPA 4J1WA 1NE4A 1VP6A 3RPQA 4IEQA 4FAHA 4QM8A 5C8WA 2F4PA 3NL1A 1LR5A 2XL9A 2MHFA 1ZZ6A 4HVRA 1OFNA 4XEZA 4HVQA 4PJYA 1WA4A 3ROUA 2PQQA 1CAXB 2V09A 3NW4A 5C6CA 5FCCA 4IEUA 2PA7A 4N9HA 5J3UA 4KL1A 2P17A 3I7DA 3GYDA 4Z07A 1LRHA 3NVCA 4IEXA 5D1IA 1ZRRA 1CAWA 3S0MA 2EAAA 4GULA 3FFQA 1WLTA 4Z82A 4AXOA 1ZRCA 3HT1A 3BB6A 3U11A 4BHPA 4IERA 3L2HA 5KHHA 3UKVA 4OLLA 2DCTA 1O3SA 1Q3EA 4E2QA 4UBHA 2CV6A 2GC0A 2EVXA 4ZU7A 5JSOA 2Q1ZB 4D7TA 5BPXA 4L2NA 4Q0QA 3H3ZA 2HJIA 1J3QA 4RD7A 4DINB 3DV8A 5CVRA 1UIJA 4XF1A 4MGZE 4YNIA 1O4TA 1CAXA 2QVSB 1UW8A 2BEOA 2IXHA
chains in the Genus database with same CATH superfamily
4E4ZA 4MH0E 1ST8A 5A7NA 2RS33 2WJSA 4YGCA 4QD2A 4GKXA 1J84A 5H9QA 1BMV1 3LQCA 1AZDA 4OZOA 3IIAA 3LAGA 2VG9A 1EV13 4JVAA 3WG1A 4AE2A 3TEWA 1JYIA 5BY5A 4CEYB 2PLV2 3S7IA 2R041 2ZJCA 3RNSA 2OT7A 3RZGA 3HPNA 4DRRA 3ILNA 5LRRA 2ENRA 1X9PA 1AR72 3OUHA 4WBBA 5FZLA 5LWBA 4I3PA 3PUQA 3D0SA 1RUH1 4P9GA 5A1AA 3T0DA 2KM2A 3BVCA 1QH6A 1Y7BA 5F32A 4D7SA 5CG8A 4YW4A 4D0QA 3X29B 3P1IA 3LE0A 2CL2A 4XETA 1QNWA 3DL3A 2RM21 3ZM8A 5I0TA 1Q8VA 5DPNA 5DZEA 4W6YA 2RG4A 5JI7A 4AFCA 4LPLA 4RL7A 4P9JA 3ACFA 3RMYA 4M0HA 4XBLA 3BIWE 1UPSA 3CIHA 1YYNA 2BYVE 5K0UB 5K8SA 5CFDA 4HOOA 1K3IA 1AR62 2Q5TA 1UQXA 1LODA 1QQP3 4AVVA 3WNNA 3LFIA 2ZPXA 3WVJA 1B09A 1SZBA 4A3XA 4M4PA 1NCQA 2XUEA 2VUCA 1QJU1 1SMVA 4HLTA 4MGKE 1GNHA 2FQPA 1JTZX 1GZWB 4HG6B 4AFAA 2ID4A 1YJLA 4QPIC 1FNZA 3ATGA 3FBMA 3KGZA 4M3CB 4NOTA 1WKYA 2SBAA 3UL2A 1RC6A 3BTYA 3VD4A 3HWJA 1WZXA 5BNPA 3MBWA 1QJY1 3K51A 4DY5A 4I2OA 2E31A 4TLGA 3TN93 3E6DA 3VKMA 3BTZA 1JZ4A 1RHI3 3HR9A 1HRV3 3QH7A 1KRIA 3DPRB 1TMF2 1ZZ7A 4S2GA 2WDBA 4JKMA 2BOJA 2RM22 4AYUA 3U37A 3VDAA 4LKFA 5C4WB 3AZZA 4TTGA 5FPBA 2UU8A 2FDJA 2HWC3 5CFCA 3R6SA 1QWRA 2X5IC 4RQPC 2WNUB 3VBOA 4CUAA 1AR93 2DU1A 3MZHA 5BNOB 3I3EA 3WEZA 4RR3B 1W28A 3ZFEA 1IPJA 1UY3A 3OCPA 1IGOA 3F95A 2PHTA 3M3CA 3T3YA 2GAUA 3I8TA 3HNMA 2VQUA 1W6OA 4DXSA 4BMBA 2YFZA 5ERLA 3OGRA 4DS0A 5F5QA 3KT1A 1FX5A 1N47A 2H6CA 3T1LA 4DZGA 4R9CA 4NRQA 2VCMA 4A42A 2D5FA 1A3KA 3MLLA 1PMIA 1XE7A 1DU3D 3UKNA 4B3NA 3RZLA 4AEDA 2XQRA 4TXWA 3ZXGA 5K7PA 3WDYA 4E4HA 1ZREA 4RA0A 2XJSA 4DO0A 1NZCA 3O1VA 5J7MA 3AB0A 1L7QA 1SG3A 4BQ1A 2YB7A 3GHNA 3N7LA 3FL7A 4CVUA 5C71A 5FXWA 5FOJB 2GALA 3DGTA 4JGYA 4DRVA 2FCTA 4LUMA 3ETPA 5FWEA 2ZGNA 3WD5A 3CBNA 3LA2A 3LA7A 3P5BA 3PUIA 1C5IA 4IV1C 5CZKA 3ZXJA 2Y64A 3O1MA 1VBE3 5JAXA 1LEDA 2K2SA 2HEWF 4PBPA 1GQPA 3ALQA 4GA9A 1ZRDA 2G19A 1WW5A 4PDWA 4UBGA 4IV1B 3N9PA 4XMIA 5GLVA 4AEKA 3FLRA 2HLEA 2VU9A 1UY1A 1W8OA 4ORFA 2CTVA 4LNVA 1ZZCA 2ZGRA 4YW2A 3T30A 4FFFA 5FMOL 3ZYPA 1DZRA 2YPJA 4AVAA 2JE9A 4AOCA 3QOPA 2D93A 4IL7A 3BPZA 2VBBA 5I0UA 1AR83 4MZUA 4OVEA 1UF2C 4RGGA 4I0WB 4K7JA 3THPA 3WW1A 1UKGA 5C8CA 1IKPA 2XUMA 3Q8CA 1JMUB 2Z5WA 3J8F1 1Q8PA 4LLFA 3BU0A 3IDBB 1UZYA 3I2DA 2NPIA 1RUI1 1OOPA 4FPFA 2Q8DA 3WW2A 4HFSA 2VZVA 4CE8A 1ZZ8A 2QBXA 1CZVA 4ZHNA 2C9AA 2YV8A 4YFZA 1W04A 4QAWA 4XDQA 1QJU2 1OOPB 1EP0A 3VDDC 1YI7A 4Q4X1 4PDWC 2RR12 3ZIWA 4CU8A 4PF1A 1W8ZA 1GP4A 1OQ1A 4D6QA 4TLFA 2VMHA 3POSA 4OQ9A 1ND2C 1NT0A 1Z78A 4IV1A 4XFGA 4JC1A 1VMFA 2Y6FA 3BYWA 3BKZA 3H0OA 5J36A 2BQPA 4W65A 1T6GC 4NMIA 1AYN1 1IS3A 4JGZA 1WGPA 5HV0A 1GP6A 4BQYA 4QHZA 1NE6A 2ZHKA 4JGYC 1CVNA 1O5UA 1Y3TA 3QACA 5FYUA 5DUUA 2Y6LA 1DLLA 3J7LA 4AF9A 1HB3A 1GWMA 1ENQA 3RRDA 2FDGA 2YC2A 4BQXA 3H8XA 4EN8B 3ASIA 5FKCA 1O3TA 1AJKA 1QDCA 4LBOA 4MLOA 1L3JA 1S2EA 1G9CA 1TZOA 2WNEA 3CNAA 1WMEA 2GMPA 4YM2A 5FXVA 4O9EA 4AW7A 3POWA 2R061 2H6BA 4KWJA 3O1SA 3OJBA 1JOPA 3ZFFC 4ASLA 1YQ8A 1GU3A 2Q1FA 2V5YA 3URFA 3ZR6A 2C4XA 1COV2 1TME2 1Q56A 2Y6GA 3PUAA 1H8TA 2VPVA 3ZXLA 4F7ZA 4OI4A 2P2KA 4IE5A 3KHBA 4ITCA 2D6KA 3L9JT 4DY3A 1JUHA 3DXTA 5DAVA 4LO4B 1H8TB 1JU4A 1ND2B 5JR2A 1EYBA 1MZ6A 4FTSA 4K40A 5LK5A 4RQPA 4AEJA 5LBCA 4ONUA 1ZRFA 5IT6A 3RVHA 4AVCA 5LRSA 5FLJA 2P3KA 4IETA 1VAKA 3O12A 5IHRA 2VXJA 4EN7B 2ZCWA 3AYAA 4ZU4A 2PHXA 1FOD1 3OYWA 2UYBA 2VZSA 4QB6A 2XOMA 1V70A 2XGXA 5FYMA 3ZYRA 3AK0A 1BBT3 2D3PA 4O65A 4AL9A 2RJKA 1AYN2 2LUWA 4RS5A 3AXDA 4TSVA 3WHTA 4KNCA 4UFHA 3AMMA 2W1UA 3KV5A 4D7YA 3RJRA 1FNYA 1DF0A 3PJQA 5FMBA 4O61A 2YYOA 5JXGA 2R49A 3RI9A 1R1A1 4BB3A 1ZBA1 2VZOA 1NY71 4XILA 2B45X 2G9ZA 5DDJ1 5FDBA 3HOBA 3ACHA 3VHOA 5L73A 2WT2A 3K3NA 3ZXAC 1UMHA 4CEWC 4HPKA 2VXRA 4MXWA 1PM4A 2VQ0A 4GMP0 4KG0A 4Q29A 4Q0PA 4F8AA 3IPVA 5FZ6A 1ZBE3 5FYVA 3ZKYA 4E27A 3TB0A 5FY5A 2O0OA 1IHMA 4E4SA 1AL22 2ZKLA 3LEIA 4C91A 1VBC1 3T4VA 4AG4A 3JD71 3V0AB 1YJKA 3UJQA 1ZBE2 3HEIA 1H4HA 3CHXA 4OUSA 1QNYA 3MPBA 4FT8A 2RDSA 2YC4A 4XUPA 5SV8A 4AGVA 1OVPA 5C8CB 3A21A 2ES3A 1NUKA 3M70A 4IQPA 3VKOA 3AP7A 1VE0A 5FP3A 3N9LA 1W8TA 5LBBA 1JHNA 1TNFA 4YZ3A 1WLWA 1O8PA 1M4WA 3RSJA 2PYTA 5BV6A 3JZVA 4CEYA 3MIDA 1AR82 4XVHA 4LO8A 4XAAA 1I6XA 2Z79A 2A71A 1HX6A 4XBNA 4AHZA 2NP0A 2O8OA 2I07B 2GP5A 1RTVA 4MO3M 1DFQA 3ZKUA 2PN5A 3IKWA 4KI5M 5FYHA 4J1XA 1C8M1 1H1IA 1LENA 1GNZA 2QFEA 2RS13 4NWWA 3WF4A 2B9UA 2V73A 4NAMA 1TEIA 4NUBA 2MPFA 2DURA 2HKXA 1TVGA 5FZ8A 1T6BX 3AL5A 4YM3A 1R093 1C4RA 2JIJA 3H1YA 2I74A 2VW0A 2RR13 1F4AA 3RMXA 1RYYA 4Y1YA 2IFWA 1Q43A 1SBFA 5ANQA 5T50A 3RZKA 5A6XA 2B5HA 1ULOA 1FPN3 1JOBA 4WM7B 5FY7A 1RUF1 5BXXA 4LUKA 1TG7A 3V0AA 4RYDA 5I0SA 5LCWL 2HWE1 1NCRB 2BV4A 4QQ2A 1OA2A 2ILMA 4CCCA 4LKDA 2BWCA 1OXCA 1SPPA 3HN3A 3O7OA 4RGAA 5KR7A 5DDJ3 4I0AA 4OZXA 1JODA 1BK0A 5F6LB 1F2NA 3VBFB 2EALA 3TOJA 3I2KA 4QXKA 1LOEA 3J7NA 3CJIC 5BNOA 3O0XA 1O4ZA 4LOSA 3WDUA 4CDWA 2VW2A 1ODNA 4G3YC 2BGCA 1OFSA 2XJTA 1SLBA 3JD72 1FPN1 5A3NA 2WQ4A 2GNMA 3VBSA 2ZEXA 5KBFA 2WNOA 2OS2A 2Y6JA 3NV3A 1RIRA 4JGYB 5KXBA 3M2MA 1D0HA 1UY2A 1RL3A 1OVSA 1QJX3 1XE8A 1RUF2 3OUJA 1WMXA 4Q4Y1 4R8HA 3TRSB 3D8CA 5EZWA 1LHVA 2QQNA 1EUUA 2ZTNA 4G9SB 3W5MA 3PVOA 1R091 2ZEZA 1K5MC 1KGYA 5JPNB 3ZSEA 2WO3A 3TNPB 3MLJA 4LIUA 4TZDA 2GH2A 3AL6A 3E5UA 3NMBA 3H1WA 4XZUG 4PI2A 4CSWA 2YBSA 1ULFA 5EXOA 1R083 2QNKA 1XBFA 4FQZA 5DAWA 1QOSA 2EIGA 5J98B 1C8M2 1XNAA 5FZIA 1MZ5A 1RUI3 2WO7A 3GJAA 3S7EA 2WLQA 1SLLA 4IV3A 2VUJA 2J1AA 4RN5A 2BVBA 5DG2A 3K46A 1OQEA 3AMHA 4LORA 3VZJA 1EV12 1APNA 1US3A 2YHJA 1NE4A 4X8NA 2DBNA 1SHWB 2WWSA 2R071 1NX9A 3AVSA 4Q8KA 1W0PA 2ZHNA 1MQTA 1RUC1 4XUNA 2A6VA 3T2TA 3WX5A 2BFUS 4HVRA 1OFNA 4XEZA 1C57A 2WO2A 4PJYA 4ASKA 2CGOA 4RS5C 3C7HA 2PQQA 5FCCA 2PA7A 5AVAA 4N9HA 4XIKA 2R1DA 1POV1 5J3UA 2P17A 2D6OX 3GYDA 3O5SA 5DXDA 4Z07A 1LRHA 1GZCA 2W2IA 3JB8A 4AQTA 4BZ4A 5JMCA 5CKNA 1ALYA 3OPZA 3ZFGA 3ZFFB 4IEXA 5D1IA 1S0EA 2D43A 3ZDVA 4Y1XA 4CPBD 4D3WA 4EZ4A 1V6NA 1STMA 2W39A 1UY0A 4QDRA 2WWJA 1X9TA 4Z82A 1VRH1 4AXOA 1ZRCA 1LESA 2YZ4A 3HT1A 4OI2A 4Y22B 3H8RA 3USUA 4XCBA 2BW8A 1OHFA 4IERA 3L2HA 2ZX4A 4OLLA 1H8TC 1O3SA 2WRAA 2JD4A 4QQOA 1Q3EA 2R043 5LBFA 2WZR1 5CFDB 4UBHA 3T09A 4UF0A 2WS93 3ZFFA 1VRH3 4KMQA 1URXA 3TN92 3SH4A 2VZUA 3LDBA 2JDPA 3GBGA 3Q9OA 1NA1B 3GXUA 4F83A 5HBAA 3NV1A 4AAPA 4QPGA 3H3ZA 4RD7A 2TNFA 4Y20A 3T4HB 4DINB 3KT4A 4FFIA 4WM7C 2OXBA 2WT1A 5FJKA 1VBA2 4YNIA 4YGDA 4YW1A 1JYWA 3VUOA 1NZIA 1W8UA 1QOTA 3I3MA 1CAXA 1UMIA 2ZGMA 1UW8A 3OY8A 4QPYA 5C9AA 3I2OA 4XURA 4BPZA 5K9YA 3RYRA 3K48A 4CUCA 4FTEA 4XPVA 1JN2P 2A6WA 3IIIA 2XLAA 4OQ8A 1H9PA 4WV8A 4OHXA 1CZTA 5LA1A 1ULGA 4L92A 2B8MA 2XONA 4EN9B 5FO7B 1AX1A 1J3RA 1WW4A 4Q27A 1QJFA 4XUOA 5EPAA 1MZFA 4JX0A 1QJY3 4KGQA 3NNJA 2X09A 4U36A 5FZ9A 2XJRA 2RS53 3QD6A 5L7OA 2VZTA 3HBKA 3MO4A 2VTXJ 2QQIA 3VDDA 3ORJA 4B4PA 4DB5A 3I54A 4YW6A 4ZZ5A 5CBLA 3NKTA 2QE3A 4QDSA 4YVSC 3MICA 1WA6X 1Y9GA 2HBUA 3NO8A 5FLIA 3VL9A 4PI0A 1GZ9A 3VHRA 3R4SA 1OOPC 1UCXA 3I2GA 5FZDA 2HYKA 3TWIA 4CEWB 1W6NB 2NZ9A 3ZYBA 3THCA 5FZHA 1W9SA 3KT7A 1MS8A 4I0BA 3B01A 1H9WA 1MACA 2A3YA 3C7GA 3GZTB 1D4M2 3KLSA 5FP9A 4HMZA 2XBO3 5BNQA 1RUG2 2I2SA 3O0VA 5E16A 1FAYA 4NO4A 4UXAA 5ACA2 2CY6A 4JQTA 2HWE2 1LECA 3HQUA 2ZX2A 4Y5TA 4AQ2A 2FCVA 1BHGA 4TWTA 1D4M3 1OBNA 4XDPA 5FAXA 4HKWA 4P9IA 1AL23 5BNNC 1DDLA 1R64A 4FTBA 1QJX2 3KCYA 2E26A 1AR91 1W9FA 2DYCA 2IFRA 1EUTA 1WCKA 5EYXA 5A33A 3N9QA 4MUVA 4BOWA 1V6KA 5TSWA 1SQ4A 5CKQA 1NAEA 4YG0A 1DG6A 4TYSA 4I01A 3U78A 2BTVC 2E33A 5B2GB 1LJ7A 1QEXA 5ABJC 1AYM1 1C3HA 2D6MA 3OD4A 4QXBA 1QDOA 4Q26A 3EYPA 1S0BA 1B35C 4I3GA 4XF3A 1N1YA 3LEKA 2UY9A 2CWSA 3R4DB 2D7FA 1N3QA 2MEV2 4E8CA 3SISA 1P8JA 4WZFA 3VBUC 2VUAA 5A3UA 3ZN6A 3CQOA 2JG9B 2YC0A 4E2SA 2WNVC 4XJWA 3T1MA 1XOYA 1POV3 5JZGA 1RUC2 2DTWA 4WVMA 1RJ7A 5DABA 4DQAA 4LO7A 4BH9A 3TYJA 4CCMA 5IVEA 1VB4A 4Y26A 2IZWA 1PK6B 1QIQA 1WUVA 3BU7A 4A6OA 1E5IA 2GSYA 4YPJA 5JR7B 1AR73 5A7WA 3VDCA 4BIOA 2Y6KA 4N7IA 1TMF1 1UYZA 3P3NA 3INAA 4IGQA 4O7XA 2YU2A 5K0UA 3HT2A 2XJQA 3SC7X 1KDMA 2GC3A 2WSUA 2JEMA 3LGRA 3VBOC 3A7QA 1JW6A 4K20A 3PMSA 2VM9A 3M3OA 4H14A 3WF0A 3JBG3 1OUXA 1XU2A 1G8WA 3OPTA 1V6LA 3LCPA 4GH4B 1E5HA 2N7GA 4QKNA 5AC93 2FCUA 2ZGTA 4UFKA 4CXWA 5LEJA 4A44A 1BEV2 2EA7A 5DDJ2 4CP9B 1R081 1XU1A 3WNMA 1ACCA 1MVEA 4K8RB 4GH4A 5ABJA 3DYMA 4M01A 4LBQB 3N36A 4KWKA 4CP1A 1Z7S3 2WZEA 1CAUA 2OVUA 5I8TA 3AKTA 2ETEA 4QX2A 1W90A 1BEV3 4HK9A 4IGOA 1K5MB 2AENA 3VKNA 3WZ1A 5D8AC 3TEZA 4CXYA 4XOGA 3PU8A 1JYTA 2R6QA 1OH4A 2AR6A 3IWZA 2ZACA 3OF1A 4K8FA 3POIA 1DQ0A 4COYA 3C2UA 1CAVA 3CEWA 1YXWA 3SITA 1MS3A 2X05A 1HXS3 4A7KA 1K45A 2W47A 3VD9A 3AZXA 4HXCA 3RJ2X 2RV9A 4RHV3 3H3LA 4B8EA 2ATFA 4QX7A 3VBHB 1YIPA 2PAMA 1LU2A 2VOVA 2WO1A 2WR9A 2W3JA 5FP7A 4P00B 2HWD3 4Z92B 1OD5A 5FZ1A 2YPDA 3J7MA 2W0XA 4CDUA 2JDHA 1JZ5A 2BBAA 2W91A 3WINE 4DEVA 2Q4SA 2OYZA 1J1TA 4AHYA 3WUCA 5C8CC 2XQXA 2WZPP 4MGYE 4V1PA 3K2OA 3PVEA 5J09A 1OUSA 5FYTA 1UMZA 1R1ZA 3DYOA 4Y3OA 2WWUA 1HLCA 3AMNA 3HD8B 1DGLA 3EJKA 2BZDA 1PZ9A 3UETA 2FDHA 1JI6A 1YFYA 4KU8A 1XQNA 1OF3A 3OD0A 4UW4A 1JZ7A 3IDCB 4OUMA 5FBJA 3U07A 4IE7A 1KXGA 3MEPA 4MSVA 1PMHX 3BTXA 1REEA 2VJXA 2HBTA 1D2QA 5T55A 1DHKB 3HQXA 3PUHA 4MGTA 5FUPA 2ARCA 1CONA 5FY1A 5FPXA 3MIGA 4FAGA 4LBKA 1S0CA 2JG9C 4CCKA 5AVPA 1HIXA 3ZYJB 3ZR5A 5C9AC 2YBPA 4GXLA 5LA2A 2HWB1 5FZOB 3C3VA 1S2BA 2ARAA 2OPWA 1RVF2 2RMU2 2VECA 1VBB1 2WABA 2WFF3 2Y33A 3E5QA 4K9SA 4AEDC 1EAH3 1OMIA 2JIGA 5FXZA 1KD7A 3D4KA 1FMD3 5FZ3A 3W9AA 3ZSMA 2OZ6A 2W1SA 3GZEA 1CJPA 4PF5A 4L11A 4LE4A 5FFOC 3RFRA 2G1MA 4B4QA 1RITA 1LGCA 5JIUA 4KWLA 1W3VA 5CG9A 1TE1B 2YBKA 4Q0SA 5A1LA 1VBC2 1HB4A 3VGIA 5FMCA 4XUQA 5F7UA 3E97A 3ZXEA 3RDIA 1FXZA 3VBSB 2B4KA 1IS6A 4KGGA 2VCAA 3E6CC 1WW6A 3TNQA 3OGJA 2W52A 2YUEA 2DFBA 1HJFA 3E5XA 4LO5B 4WM8A 3IBMA 2ZABA 2QJVA 1D7PM 4S2HA 4GAZA 4KG8A 1XPWA 1RUJ1 4ET7A 4Y20B 5A7OA 1HQWA 4NPRA 3ZFGC 2K46A 2PAEA 4AGRA 4Y4RA 3AZYA 2PTMA 5FQ0B 5JXHA 3VHNA 1VBA3 3ZYIB 1LOFA 2RVAA 2LROA 3H7YA 4N53C 2JG8A 1VBD2 2A3XA 5FTTC 2R073 1CGPA 4FSJA 1N3OA 2C0ZA 4LOTA 2DVGA 1DGRA 4HVOA 3POGA 2EXIA 3AMPA 1CX1A 5F37A 2UY8A 2XKOA 4JHZA 4QPIA 1ASJ2 3N9OA 3S5QA 2R072 2Y0IA 2D40A 1SEFA 4IEWA 4YZ1A 3E6BA 4QB2A 4UFIA 5A80A 4HN0A 4ASMB 5J1XA 3MUY1 1U12A 4KH9A 1PVC2 4CPBA 4OCTA 2E32A 5E6HA 3O1RA 4FI9A 2XH6A 3KWVA 2VZRA 4FBFA 5A3PA 2NN8A 1BZWA 1U5YA 4V2VA 3PURA 2A73B 4UI9L 4HKLA 2RDRA 4UW6A 2JECA 4LBLA 4FOYA 4QHBA 4DMIA 1C8NA 1EPZA 4COUA 3JB4C 1CD3G 1W99A 3PTRB 2ZGPA 4IW3A 4QQLA 1X82A 4PCRA 3NJZA 4PT6A 4LBQA 4UW3A 5JCTA 2DBIA 4N9IA 4NR1A 3MDPA 2VNVA 3PLQA 4AFDA 4AFBA 4EZHA 1VBE1 3W59A 1ZZ9A 3WQ0A 1K5MA 5EYYA 2YY1A 1SFPA 3ZX7A 2Q8EA 4FPGA 3KS7A 2D6NA 2OQ6A 1NLQA 2PMWB 2RJ2A 1PGL2 3U1XA 1UO9A 4K3UA 3WQBA 4LQRA 1HXS2 3CZUA 2EAKA 3N35A 4GWMA 1YFXA 1GUIA 4J25A 3ZSKA 5KHIA 1JZ6A 1L7RA 2XJVA 3NAPB 4RHV2 4P08A 2WA3A 3WCSA 1UZVA 2H0BA 2QDRA 3KQ4B 1UL9A 1H30A 1YCIA 2HWC2 3NJVA 3I2JA 4PLOA 4AZZA 2VTFA 4C1WA 4CCNA 1R1A3 3ZMNA 2PHWA 3SMHA 4CYDA 3PVBB 1RUE2 4M4RA 1RGSA 1PK6A 4UFJA 4LIVA 1Y9QA 2KD7A 1W9TA 3MW3A 4YZ5A 2VW1A 5AFBA 4IE0A 4WVMB 5JZGB 5A7WB 1QGLA 1ZA7A 2XDVA 2YMZA 4R52A 2OZJA 3MFCA 1LEMA 1JS9A 4HK8A 1HXS1 1QJZA 3NNLA 5I0DA 4MG2A 3R0RA 4U2AA 2P6HA 1PGL1 3SCGA 1GR3A 1AYN3 2AYHA 4IGPA 2BVVA 4NIAA 2ZBJA 1ZM1A 4LITA 2L9LA 5F39A 3ZN6B 1HB2A 1W6MA 2XHNA 4CDWB 4NN0A 1DZTA 1PNGA 4QQPA 3UT0A 1YUDA 5KC5A 2D6PA 2QQJA 1GZTA 2Q1MA 5JWPA 3H8OA 4AHWA 3THDA 3GF6A 4ZXEA 4A4AA 1E5SA 3EBRA 3LKJA 3AZWA 4NJ4A 3KQRA 1HRV1 3USSA 4DUVA 3VKLA 2IXKA 4B4RA 2C24A 4DFSA 4FO9A 1SLTA 2VBDA 2WFF1 4META 5K4LA 3K4DA 3THTA 2WC2A 4GWJA 4JRAA 2EXJA 1W9YA 1A8DA 4CZSA 4BXSV 4PIYA 1IKQA 1NCRA 3VBFA 2B46X 1UN1A 1JH5A 2K0GA 5GZCA 3RWNA 3BODA 1F5FA 1W05A 2BDRA 1UAIA 3WCRA 3AP6A 4LHLA 2ADDA 2R042 1SLIA 2VNOA 3MIBA 3UKTA 4URAA 2H0VA 1RJ8A 3OGSA 1VBC3 3SKVA 2GH8A 1BVP1 1T2XA 4FVVA 2ZGOA 4YVSB 4N7UA 5IFPA 4OHYA 1UD1A 5EWSA 4GD4A 4JKLA 3O14A 1PO21 1RMU2 4CDQC 2DFCA 4Q4V2 4W6WA 3PHMA 5GALA 5L7OB 2DF7A 2QQUA 2BP6A 1PIV1 4UT5A 2IXIA 1MVQA 3OEBA 3ST7A 2E53A 4DPNA 2QQWA 4LA3A 3WR0A 5J96B 2JB8A 2Z2SB 3ME2A 4WZCA 4JCKA 1H6XA 2IVJA 1W9WA 5D21A 3WSOA 3UGHA 4FPLA 1XYNA 1HDKA 5T3NA 4CEWA 3KV6A 3VDDB 4PIZA 1G9DA 1SCSA 1WMDA 2E51A 3EB7A 4CU9A 2XL7A 1OLQA 4BK5A 1WBLA 5E88A 1NLRA 1R092 2VMFA 1ZBA2 1GOFA 5FY8A 3RPQA 3ZYHA 4BCUA 4XE9A 5C8WA 2F4PA 1EV11 2CWMA 2SLIA 3OB8A 3BUCA 2PQSA 1F31A 2MHFA 2WAAA 2RS31 1GOGA 4C0BA 4BU2A 3O1UA 3ROUA 4P14A 5DG1A 3NW4A 1CAXB 3OY8B 5C9AB 3AKQA 2DVFA 2OX0A 5D8AB 4MYEA 5F3CA 4KL1A 2DVBA 5EJ3A 1FOD2 3DUIA 2RJLA 2J1SA 4NPMA 3NVCA 5DZGA 4AWDA 3WP6A 2GMMA 2P37A 1LULA 1C5HA 2X5IB 1HV0A 1MS4A 2XVLA 5ISLA 3OEAA 5CEHA 2A75A 1FV3A 1DIWA 1OF4A 2FHRA 3OOXA 4OHZA 1WLTA 3MF6A 4DEQA 4XDOA 3AYCA 2W92A 1G86A 2E7QA 4HT1T 3IDAA 4YVWB 2BBVA 3BB6A 3V64A 5F9TA 4CRQA 1GV9A 2JDNA 1GWLA 4DIQA 4YM1A 5GLWA 2ZHLA 1FMD2 4PHZA 1PX4A 3KB5A 5CNAA 2GC0A 2FD8A 1YI9A 4QPIB 2W87A 4UFLA 1W6QA 5F5IA 5FYSA 3WDWA 2DTYA 3O1TA 1MPXA 5IVYA 1XE0A 4Q2FA 1QKQA 5CISA 1V0AA 3FLPA 3K75B 1GNYA 4Q1PA 2JG8B 3OBZA 4YM0A 2HJIA 1RUE3 1OA3A 3DV8A 1KQRA 3B9IA 3S6PA 3N9MA 1GOHA 3CU7A 2MEV3 4XF1A 3ZN5A 4BMEA 5A6YA 4DXZA 4YW7A 3WNXA 5CYYA 2G9GA 2BEOA 2EIBA 1MS0A 1K12A 1XNCA 2WZR2 4XABA 1IPKA 4Y1UA 3OGGA 1DZQA 5FZCA 2XLFA 3MIHA 3GCWA 5EFUA 2DU0A 3OSDA 3UGFA 1WW7A 2XWBB 3N7MA 3WF2A 4RQPB 4XHXA 4HKOA 1I1EA 1YHFA 2WZ8A 3FE5A 4H7LA 1ND2A 4MADA 1OKQA 2D6LX 2Q8OA 5JXIA 3I2HA 4QXHA 4Y5SA 4CP2A 1AF9A 1U5XA 3O1PA 1IZ3A 1ND3B 3EMRA 4BQ2A 1AVBA 2W9XA 1Y9MA 1UKRA 1PIV2 1VBB3 5BUVA 1L7LA 3T2PA 3B5LB 2TEPA 1GQGA 2GNTA 3VBRC 1FI2A 1OT5A 3N3HA 1H1MA 2VMEA 5C3SA 2D44A 1YQCA 4FFGA 4K1YA 2VH9A 1GWKA 3LEGA 4N43C 3C8XA 2KXLA 4S2DA 3CKHA 2XJPA 1BCXA 1HB1A 4QGNA 5E1RA 4FOWA 1AXKA 4GMP1 1GMMA 1YQ6A 3MHZA 1DQ1A 2DDUA 4LJHA 4JGZB 3FUOA 2QUOA 3PDQA 3WXPA 4PLNA 2O1QA 2V5DA 3S57A 4JV4A 2XR4A 4GKYA 4EWAA 1ODMA 1V9U2 4GB32 4KU7A 3LFMA 4Q5OA 4AI2A 1QOOA 5BNPB 4A2UA 2WFPA 3SLIA 1I3HA 1TQ5A 1DGWA 4YW3A 3DF0A 3FX3A 4FPYA 5C70A 1N1SA 5KXDA 1HRV2 1ZYBA 2FDKA 1GZWA 1X7NA 1W2UA 2RM23 1KDKA 3ILFA 4H3WA 2IVIB 4YW5A 3O0WA 3U10A 4CDQB 5A3LA 1QXRA 1WCUA 4RSUA 1XNDA 5C3QA 1JXNA 1CZSA 4OUEA 1QY4A 1Z0HA 2IXJA 4R9BA 2VL4A 4R9DA 1A6CA 2HWD1 2B39A 4NIDA 3D0JA 4P9YA 2JDZA 2WA4A 1QMJA 4URTA 1R1A2 2PAKA 1NXD1 1PO12 4JTOA 1KJLA 1YEWA 3RZHA 3IZOA 5FIXA 4I09A 4CXXA 3KSCA 2ZX1A 3WG2A 3WNKA 5FLHA 1I5PA 2J1VA 3D5OA 1G6NA 1BBT2 3FHAA 2PHRA 4QKDA 4QU1A 1PO22 1RMU1 2IC1A 1AR92 1S55A 2JKXA 2JKBA 4XFHA 4ZY9A 4YSFA 4B29A 1H8VA 3KZ4C 5A7QA 1W3XA 1YQ2A 2UWCA 3PNAA 1LHNA 4FPEA 1KEXA 1O7FA 4DXRA 1RUE1 4MX3A 4LO6B 3UV9A 4FOVA 5DN2A 4D69A 2EICA 4RFT0 1LOAA 1ZA4A 5B4NA 3LEMA 2OA2A 4QX1A 4WM8C 4XFBA 5JMOA 1FT9A 4O9GA 3OBRA 1CAUB 2JDAA 1VMJA 3SNMA 2IWGB 2PHUA 4ZXKA 3TEXA 2ZEWA 1UZWA 1RB8G 4XMAA 5L9RA 2JJ6A 5F5CA 3ZYFA 5I8YA 3G6JB 4HONA 4GJZA 4PBOA 1OSGA 4BA6A 4D8MA 2ORZA 3AP4A 4IUGA 2VBPA 3HJRA 4YZ4A 4LBNA 1GICA 4XACA 1UX6A 2Y6HA 1UU5A 5H9RA 1UPIA 5LASA 1E5RA 2XPJA 2XG3A 1QHDA 1DQ2A 5LW9A 5IK7A 5CAZA 3QBQA 3WF1A 1UX7A 2E7TA 1UOJA 4HPKB 5IAVA 3ZOIA 3CO2A 1A34A 1U5IA 4ZS3A 4UW5A 2OW4A 1XYPA 2R32A 1QQP1 3M3QA 4Q4X2 4XCAA 3N9NA 3WUDA 4ISQA 3AP9A 3BPSA 2FMYA 3DPRC 5FZAA 4UYBA 3ZFEB 1W2NA 1G9BA 1NCQC 2DUQA 4GALA 4LEJA 1OLRA 1X33A 3I3QA 3KV9A 2WNUA 4MXWB 2F4LA 5FYZA 5HCFA 5FPUA 1PVC1 2ZMNA 4ZU5A 5B4XA 4YG6A 3EQEA 4QX5A 5GZDA 4MHUA 2NLRA 4XFIA 1H4GA 3PTYA 4B1LA 1CJDA 2PFWA 1MEC2 3WT3A 5F6KA 3K77A 4Q4V3 2GMEA 4QKBA 4EWDA 1H2KA 1AHSA 4BK4A 2WZR3 5JSRA 3NKGA 5GJ6A 4AI0A 5A32A 1U5ZA 1LNSA 1W8WA 1Q8OA 2WNUC 2P3IA 2ZAAA 4HETA 4AI3A 2ZX0A 3NNGA 2BGPA 1VBD1 1IQAA 3FN9A 4CCJA 4RFRB 1DCSA 1PHMA 3CDZB 4EYUA 4Q4W3 2JICA 3M3EA 5A32B 3KF5A 1BVVA 5GLTA 4L8QA 3DPRA 1WD4A 3IN9A 4AVTA 4UAPA 3PVNA 5FYCA 5LATA 4A3ZA 4NWVA 3T0BA 2BUKA 1NXMA 4AHXA 2WQ8A 1UXXX 3EHKA 4NPLA 4C8DA 2P34A 4Q4W2 4UWDA 2J22A 5DUXA 3VN4A 1F9KA 2BOIA 1AXYA 1PIV3 3ITQA 1BKZA 5JPMB 2ET1A 1MS5A 3UNPA 4M3CA 3JXSA 5J37A 1W8NA 4H7MA 5IVBA 5IK8A 1OKOA 2A6YA 1CAWB 1H2LA 3ACGA 2C26A 4H2AA 1NLSA 4NHLA 2BERA 4FPKA 4CDXB 1ZZBA 3ACIA 1IOAA 4YGBA 5C3RA 3JBG2 3ZDSA 2AC1A 5FZEA 2YDEA 2LRPA 2B42B 4JZRA 2ZEYA 4YRDA 1CPMA 4AR2A 3I4IA 3WP3A 4P9XA 2WQZC 5D8AA 4E2GA 3BI3A 1TME3 3HNYM 3VD5A 5FJHA 3AC0A 3IDEA 5IVJA 2PHLA 5FZ7A 1GKBA 2P4EA 4XQWA 2HWF1 4GH4C 3KV4A 5IVFA 2EIDA 3VBRB 3PUSA 4LBQD 4RGKA 3Q8FA 5FUNA 2BNMA 1W03A 4COZA 3HAGA 3SCFA 5ACA1 4EV0A 1I9RA 1W2OA 2AEYA 3HBZA 4YGEA 3NNMA 1COV3 5CA6A 4R9AA 2VCBA 1CIYA 2HWB3 3VD3A 2RDNA 4Q0VA 1ULPA 3RZZA 5IYYA 4D6SA 5K0UC 5FK8A 2X29A 2Y26A 4PLMA 2QTWB 5EP9A 3JUUA 3IM0A 2VUDA 1C8M3 2RS11 2ZGQA 4S2FA 2MNGA 5E8AA 5FO9B 1GBGA 1HKDA 3M3IA 3QCWA 4K6BA 4Q1RA 3UESA 1COV1 4P5HA 3RS6A 3KMHA 4BQWA 2VOKA 3NRUA 2WS91 5HCAA 1C1LA 1HW5A 1QJY2 5FZMA 2D3SA 1MZEA 2D3RA 2WKKA 2WUHA 3BTAA 3PU3A 3ACLA 5KXEA 2VGDA 5JZGC 2R062 3MFAA 1HN0A 2WNVA 4Z2AA 1O5LA 3Q8EA 3I59B 5CIRA 3ZPOA 5GZGA 3H8UA 1S0DA 5LY2A 3W5NA 1LB2A 3ZLIA 4BLIA 2DV9A 3KVBA 4XQ4A 5C33A 3GBWA 1CESA 4Z8BA 4JQRA 4QU2A 1VLNA 3K4AA 1LTEA 1AX0A 1QU0A 2R1BA 4NHMA 4PDWB 5T5LA 1DQ4A 4AVBA 2XBO2 4D6RA 4DUWA 1U0AA 4XYXA 4WM8B 3SXWA 1C28A 1KS4A 1Y4WA 2QZ3A 4BM8A 4NIHA 5A70A 2HWE3 1MS1A 3FFZA 4A7YA 4YFWA 1QXPA 1RVF1 1UYYA 2XHKA 4XF4A 2VQTA 3W58A 4QX8A 3FLTA 2XJUA 4UOJA 3T0AA 2GN7A 2JXAA 1XRUA 2J1UA 3VBRA 3AMQA 3AVRA 5FYIA 2VVDA 1CR7A 3ZSJA 3MUZ1 2A6XA 2ZOEB 3AKSA 4LULA 5FYBA 4JRLA 1UY4A 1VR3A 3I49A 1UZZA 4QMAA 2HEYF 2D98A 3WNLA 1O4YA 3M7AA 2Y0OA 4AFMA 1VBE2 1WMFA 3F2ZA 3KGLA 3LIHA 4HSJA 4LBMA 4MGIE 2JB4A 2CU5A 1KFUL 1XNTA 3D82A 1VJ2A 2EIEA 4HZFA 3U4SA 3WV6A 3MI8A 3ABZA 4N43A 5T5JA 5FWJA 3O1OA 1BMV2 3VZLA 2ZXQA 4BE3A 4FOQA 2DCZA 3VZOA 1Q5OA 2VZPA 4LA2A 4EWEA 2UWBA 4L99A 3SKJE 1A8MA 2NMNA 2VD7A 3NWKA 2RS12 2QQVA 4PQQA 4Q4V1 4AEDB 3H50A 2ZHMA 1GP5A 1LAJA 4JDMA 1WD3A 3M1HA 2BNNA 5A6ZA 2P3YA 3J9SA 4Y5Z0 3LA3A 1S0GA 3UJOA 3MV11 4BLJA 1RUH2 4JDNA 1CPNA 3V56A 1UOFA 2QCSB 3RGBA 1AR71 2P5BA 5KHJA 3ENRA 1QXJA 2ADEA 2ARBA 3JU9A 2Z42A 1J3PA 1Y43B 2BRTA 1LCLA 3K3OA 3NAPA 4GJYA 4LKEA 4MGQA 4XFAA 5GLUA 3ZXKA 5C4WC 1S0FA 4OYUA 4NROA 5EJZB 1S0JA 2B7YA 4P02B 5IVCA 3AP5A 5FPLA 4INDA 1Q8SA 4ATEA 4C1XA 3VBOB 2Y60A 2ZMLA 2RS52 4LBJA 3UYJA 4B7EA 5F2WA 3IAPA 5FP8A 5CFCB 3WDXA 5F1RA 5HV4A 4FP3A 4IEOA 4OULA 1ZRIA 2HH9A 3WF3A 1Q8QA 1UOBA 1PO11 1W6QB 2Y34A 4K1ZA 4CUGA 4YVWA 1V6OA 4SBVA 5H9PA 1RUD1 4QQHA 4CCLA 3OBAA 3ZYGA 3U0ZA 4FFHA 1XNKA 3HIFA 3NJYA 2V4AA 1NKGA 2VMGA 4OHVA 1N1VA 5DQ0A 4DUXA 2ZZJA 1XNBA 5IWFA 1OC1A 3R05A 1W8FA 3MW4A 3GHMA 4A41A 4QXCA 5JLVA 1RUF3 2OPKA 2WN2A 3KD4A 1K5JA 4CA9A 2VO5A 4YZ2A 5A1FA 1SFYA 2WYSA 1RUG1 1VB2A 4FXKB 5A7SA 2GNDA 1D4M1 3NQHA 4JHTA 4EN6B 4EE2A 2X5IA 4GB31 1US2A 1V9U1 4LE3A 4BWOA 5GLZA 1QJEA 4IE6A 2C9KA 1ZX5A 3VBUA 3W21A 5BYNA 4CP9A 3VDBA 1PNFA 1JZ8A 2XBO1 1OQDA 2W5FA 4ZKTB 2HWB2 3BCWA 1UU4A 5JOZA 2A5ZA 4DOUA 1YFUA 2QQMA 4OI1A 3WY6A 4ARYA 5FQ0A 4M3CF 3MF9A 4BYYA 1J58A 4W6XA 2LM3A 3RWKX 5FZGA 2PHDA 1OA4A 2XB6C 3RYPA 5AC91 2ZZQA 1O8SA 1V6JA 3ON7A 3IAQA 5APAA 5CB7A 2ERFA 3T2OA 1W6PA 3MPPG 3IMMA 4IEZA 3HN1A 3L2YA 2Z69A 2ZX3A 4GWNA 4WVZA 5LB6A 1OPMA 2K9ZA 1DP0A 4IEYA 1GYKA 5FMDA 5L19A 3T08A 4J1WA 2R063 2CGPA 4FAHA 4IEQA 1DQ5A 5C5TA 1IPSA 2CGNA 4ZPIA 5JOXA 4P9LA 3NL1A 3MLKA 3DKQA 1LOCA 4Y1VA 4FPHA 3V65A 4HVQA 4W50A 1JYXA 4BISA 1D4VB 1WA4A 2W95A 2OQ7A 3UK9A 3A4UA 5FYYA 3GNEA 1N1TA 4H55A 1IG0A 5LBEA 2HYXA 1RVF3 4V2WA 1JYCA 4YVSA 4BDVB 2VMCA 4CDQA 5FZ4A 3S5AA 2VR4A 3LB9A 1ZRRA 1CAWA 4QB1A 3CJIB 1REFA 3S0MA 4YVWC 1AR63 2J1TA 5DUVA 3FFQA 1B35B 2GN3A 4AGGA 1HQNA 3C7FA 4Y4YA 5T5PA 1KS5A 4M00A 3WNPA 4WVWA 2ORXA 3U11A 3GZUC 2FZ1A 1W8HA 2YXSA 2W08A 4A7ZA 3SEPA 1SLAA 4CDXC 1W0NA 3VBFC 1NCRC 4P5YA 1FMD1 2EXHA 3ILRA 4BQ5A 3AZVA 2GNBA 1BYHA 2ZMKA 3CJIA 3JBG1 3VZNA 3ZPYA 1YQ5A 4XJAA 2WT0A 2EVXA 1BBT1 3OUIA 2VOTA 3AX4A 3DYPA 5FREA 5C4WA 2CYFA 2VOWA 2VAUA 1AL21 4LHNA 4NRPA 5LA9A 5BNNB 5JSOA 2KR2A 3VKFC 5EHDA 2WSVA 1TMF3 1GLHA 3M8LA 1RMU3 4L2NA 2XVGA 4X8PA 4BXFA 1W6MB 2VZ1A 1J3QA 2WS92 2OUHA 5CVRA 2J1EA 4J6GA 1X36A 3I2IA 2HWD2 3OYWB 5HPOA 2JE8A 3FHQA 1O4TA 1ND3A 1ULCA 4XJZA 5DUWA 1PK6C 1RXFA 4N53B 2QVSB 5FP4A 2WINB 3RZJA 5FPAA 1FATA 3AYEA 5KHGA 2IXHA 3U75A 4L0PA 1LGBA 3ZN4A 4X6RB 5HCBA 1ENRA 1GQHA 2AZ5A 3LSEA 1E57A 1VIWB 3AKRA 4L9BA 1PGSA 4LK7A 2YU1A 1RUNA 1KITA 5FZOA 3N4MA 2VVFA 1X8MA 5LK7B 4DNYA 5KHKA 3DXUA 1POV0 3TN91 3VD7A 2B9VA 4XW3A 3GALA 2Y38A 2LTNA 2HEVF 2R16A 2NYYA 4IDZA 5A3MA 5G05L 1KFXL 2X8KA 4IEVA 3HMYA 4MHRA 3WNOA 1J83A 1K42A 4LK6A 4GQ7A 1LHUA 2EF6A 3FWEA 4HBNA 2VMIA 1DLCA 4XFFA 1X50A 2CSGA 4F3JA 1WLCA 3R4UA 3LPGA 3FZ3A 4DXTA 5CKMA 2J7MA 5FXXA 5C3PA 1HRI1 3P6BA 1OLME 1I5ZA 1HV1A 2VC9A 3JCIA 4E9KA 4NVPA 1GANA 3BOPA 2JENA 1MQTC 2ZAHA 1ONAA 3SQOA 1YC61 1UNBA 3LZZA 1PGW2 2F6BA 1EAH2 3EO6A 1V6IA 1QJX1 1XXNA 3G7DA 1VPHA 3N7KA 4W4ZA 5JSPA 1SDDB 3HNBM 5FZFA 3VV1A 2O8QA 2G4IA 4CDUB 3GM8A 3KVAA 4YYOA 2BFUL 4Q4X3 2GP3A 5L36A 4LKSA 4Q4W1 5HI0A 4XJ8A 4EROA 1POQA 5F3EA 5LA0A 5LZ6A 3V0BB 2AACA 1F35A 2I45A 2DCKA 2VZ3A 5A6QA 2VY0A 5FKBA 3FHIB 5DAQA 1LOFC 2VE1A 3Q8BA 1RUOA 4E8DA 1DGRN 3UGGA 3HVDA 3POFA 3OBTA 3B93A 4KBZA 5I91A 1W2AX 1UYPA 2V4VA 3N7JA 3E1F1 1WBFA 1SLCA 5FY9A 1XJAA 2FDFA 1QJU3 3TAYA 1O91A 4KQ7A 1F5JA 2W1WA 1W0OA 2JG8C 2TBVA 4GMP3 1H1AA 2BNOA 2GZWA 4CDWC 1O6UA 3AFKA 2CAVA 1H2MA 1UOGA 2R0HA 2C6SA 1DGWX 3B02A 2P3JA 3WOGA 5IW0A 3PIGA 4Q8LA 1PMJX 3BOWA 2J42A 1FPN2 3AFGA 1LHOA 3ZSLA 2VTXA 5AC92 5IK5A 3WDVA 1REDA 4QX0A 4XFCA 4CCEA 1IQDC 1ZVFA 3A0KA 5FMOS 4AQSA 1AYM3 1SFNA 4MV2A 4XC9A 3LOBA 1A78A 3I3BA 4LLOA 1WLDA 3ZIXA 3AXEA 4A45A 3C7OA 1Z7S2 3KCXA 4B7KA 1YWKA 2JG9A 3ZXDA 4ATFA 4HL0A 4MVTA 3WG4A 5T5OA 1G9FA 1YO8A 2QDNA 2ET7A 1W06A 1W39A 4ARXA 3P3PA 4I02A 4UFMA 3DN7A 5JOYA 2ZS6B 1HQLA 3IB3A 3KF3A 1EPWA 1DBNA 2DUPA 2PLV1 4XQDA 2CAUA 2AGSA 2JDUA 3VZKA 4GB33 1IG3A 3DKWA 2IXCA 2WLPA 3ECQA 4HSLA 1VRH2 3NV4A 3JD73 4EJRA 1NYWA 2V72A 3RQ0A 1XYOA 3VHPA 5CADA 2GU9A 2MEV1 2WYFA 4G4FA 1HRI3 4CCDA 1MS9A 3KCCA 2Q0AA 5EJ1B 1W6OB 2VQAA 3DECA 4QKFA 5LEKA 2UYAA 3OG2A 3H7JA 3IMNA 3MYXA 4QHOA 4JAAA 1RHI2 4CEYC 1HRI2 1CQ9A 2DUOA 1NQDA 1G7YA 2A1XA 4JGZC 1UYXA 3NSTA 4OHWA 3WLUA 1LOGA 1RHI1 3MW2A 3WDTA 4CDUC 1RUD3 1AUYA 2WNVB 3LSDA 2OUJA 2RS51 3VB9A 4OFGA 2LW8A 2QQLA 1MR5A 4AVSA 4MOAA 2CDOA 5FV3A 3ELNA 1CWPA 5FPVA 1NA1A 3ZXFA 5KXCA 4XTMA 1JUIA 4HANA 3OGVA 3W20A 2G9FA 1W6NA 4ZS2A 3H3UA 2IXLA 3MIFA 4NHXA 5JI9A 4E4DX 4QGMA 3B3QE 3POBA 1CAVB 2X53S 3AYDA 4NHYA 4Z2WA 2OKXA 4CUBA 5F2SA 4XUTA 4JTNA 4MXVA 2BGOA 2UWAA 5IK4A 4HN1A 4NIIA 5C7GA 1NCQB 3APBA 1ULEA 3SEEA 2ZA9A 2ZGSA 4IE4A 2VNGA 2P6CA 5SV5A 1G9AA 4NIGA 3LWCA 4Q4Y3 5DAPA 2XMLA 1O59A 1VAVA 2ZKNA 1RUG3 3VZMA 2VNRA 4COVA 1XSRA 2W94A 4LHKA 4FQ4A 1VAMA 3H9AA 2CDPA 3GCXA 4CCOA 1CX4A 2FMDA 3JQXA 1D0GA 3LDRA 4Q4Y2 5FBZA 3I2FA 5ABJB 2E7AA 3POJA 2GC2A 3FJSA 2UURA 4LHSA 4PQ9A 2W1QA 3M4FA 1S4CA 3K4ZA 3BALA 1LU1A 2Q30A 5L9VA 4JKKA 4XIOA 3U14A 5GZEA 4CDXA 1AR61 4OMDA 1UIKA 4YG3A 1VBA1 3WP4A 3RZMA 3U4XA 4YWAA 3H1MA 2PELA 3CF6E 4IV3B 4PIXA 5KWRA 1PX3A 4ES8A 2JDMA 1MEC1 4XJ9A 3WQ1A 4NHKA 1GSLA 3LD8A 5T52A 2AREA 2RS32 3USUB 1F15A 5FK7A 1QF3A 1C1FA 4LTAA 3WHUA 2TUNA 1OLMA 2RR11 5JVVA 1OI6A 3MGUA 1F4HA 4AEMA 2FZ2A 2LALA 3LIGA 1RUC3 4LMFA 1SCRA 2CNAA 3KM5A 2GC1A 2QKDA 5M0TA 2VULA 3JQWA 3CJXA 3CLPA 1RINA 4QT6A 3B7MA 2R7EB 3GZAA 4QPWA 5FY0A 3TBDA 1SACA 3NV2A 2AEZA 5H9SA 1ULDA 1VBD3 1CIWA 3J8F2 5I93A 5BNNA 5FPZA 1BLZA 1DYOA 2EXKA 1YRZA 2ZGKA 1PM7A 2X10A 4AI9A 3RYKA 1B35A 3LF7A 1ENXA 4QDQA 3SHRA 3A0NA 2XLGA 2QQOA 3AM2A 4IXLA 1TNRA 4XAEA 1AR81 5A3WA 1UWWA 4A6SA 1X8EA 3D6EA 3GJBA 3POEA 1BK1A 1D2SA 4FXGB 2D5HA 2O14A 2XXZA 3Q8AA 5DZFA 4AAXA 2PXJA 3ZO0B 5A3TA 2QQPA 4AI8A 2DCJA 2YGMA 3LOIA 4GWIA 1V9U3 3FUQA 1H2NA 5FZ0A 1HJGA 2DWRA 3NJXA 4XF9A 1WCQA 4FPCA 3BIEA 2A6ZA 2RHPA 1NOVA 4GZ9A 5JOWA 4MGSA 1NA1C 2HWF2 1JZ2A 5FR3A 1ASJ1 4TN7A 5ACA3 5L7OC 4JDOA 4ES9A 1JYNA 1ZBE1 4N43B 1M06G 4C90A 1LOBA 3AKPA 1GFF2 4BIFA 1DQ6A 5CFDC 2JWPA 1NG0A 5IJRA 2HWF3 3A23A 4WVVA 4AQ6A 3OTFA 1W2TA 1XC6A 4LXLA 3FC0A 1BXHA 1QH7A 1V6MA 1IS5A 2XKPA 4YARA 2GDFA 1LKNA 4NRMA 1H6YA 2JE7A 5GKAC 5JXJA 1DYKA 1W6PB 1R082 4CTEA 4C0HA 5CU1A 4XXAA 5J48A 5C5UA 3SH5A 5DMYA 1PO13 1RUJ2 2KA3A 3AJYA 5I8SA 1SBDA 1RUI2 3LDKA 1PVXA 1J1LA 1RUD2 5F3IA 4P9WA 3T2QA 1PO23 1RUJ3 2DCYA 2QQKA 5FZBA 4QM9A 2VZQA 3FMGA 4YLZA 5FZKA 1YLLA 4L97A 3VBUB 2W46A 3GBFA 4Z1VA 1OPOA 4QPGB 4BQ3A 5FY4A 4KWUA 1JU3A 2OIIA 1N3PA 5GZFA 3WW3A 2R0FA 4R4ZA 4CP0A 5EV7A 2PLV3 1BJQA 5C3OA 5JUVA 1O3QA 5FOBB 3I59A 5F8PA 2VMDA 1OURA 2VCCA 4XHBA 1VRBA 4Y33A 4AI1A 5FUIA 1HN1A 1Z7S1 3NAPC 1YNAA 1XB9A 3ES1A 3CL1A 2CHHA 4WM7A 5L9BA 2HWC1 1YFWA 2NM1A 3BN6A 3CMGA 1VBB2 1H0BA 2BJSA 2RMU1 3J7HA 3RI8A 4COWA 4QPGC 3VBHA 3DEMA 4K21A 4CU6A 1JZ3A 5A3OA 1AX2A 3ETQA 3PL0A 4NAOA 1KJRA 2QZ2A 4X6QB 4OMCA 2FDIA 4QWNA 2RMU3 2WFF2 4W8JA 1UU6A 2DVAA 5F5AA 1UZ0A 2ZGLA 3GGLA 1AYM2 4QGLA 3V0BA 1AJOA 1TME1 1UXZA 4IEPA 4Y22A 3ZVXA 1QQP2 4Y1ZA 3WW4A 1BQPA 5I0RA 3B00A 1ZNPA 1RXGA 1XSQA 2IUWA 4I30A 4Y24A 3RG0A 5IATA 3ZFEC 3SCHA 4GIQA 2Z4FA 1AL0G 3MV01 4EN0A 4LT5A 4XF0A 4ZZ8A 2WN3A 2R30A 2A70A 2XVKA 4OI0A 4XJUA 2W68A 3ZFGB 3ES4A 1CN1A 2WL1A 5IAXA 1PZ7A 3J4UH 5CFCC 1EY2A 2JD9A 3SH3A 3KHCA 1IS4A 5T54A 1JBCA 4FP2A 2XWJB 4Q0UA 1MEC3 2A3WA 5IUQA 4AK3A 1V00A 1SDWA 1FV2A 1O3RA 2LS6A 4IV3C 3AJZA 4IESA 4BQ4A 5A33B 2E63A 3HQRA 2AUYA 4CU7A 5JDBA 1J59A 2JDYA 1ENSA 4LR4A 2Q8CA 1VMHA 4M3CE 1MQTB 1JOJA 2ZGUA 5BNPC 1ZBA3 3DCQA 4RR3C 2E9QA 4N90A 1LHWA 4R4XA 1FYUA 1RUH3 2JX9A 1YIFA 4KBBA 2J1RA 1WWYA 3IPVB 5LY1A 4XBQA 2A7AA 2FBEA 3NNFA 1VP6A 3MIEA 4BJ0A 2Y8KA 2YGLA 3J26N 4QM8A 1EAH1 4RHV1 1PGW1 3D3AA 3H42B 3VLBB 1ASJ3 3VBSC 3J8F3 1LGNA 1LR5A 2XL9A 5HCHA 3A22A 1FOD3 1ZZ6A 2WBKA 3PJYA 1S0IA 4RR3A 5KC6A 1WCDJ 1S2KA 2NMOA 1PVC3 2NQYA 3GDBA 2BWAA 1WCSA 4FPOB 4FPJA 2V09A 2BU9A 2YFUA 3BGAA 4N53A 5C6CA 4IEUA 2ARXA 4D94A 1F8VA 4EQVA 4N8MA 1BEV1 2VOXA 3WP5A 2C1FA 3I7DA 2DVDA 5BNOC 2E6VA 1JHJA 3IT8A 1JYVA 5HXMA 3PIJA 4RS5B 5FRAA 5AFEA 4XTPA 1NY72 3B94A 2EAAA 5F3GA 3B69A 3QH6A 4GULA 5E89A 5G04L 3S30A 1S1AA 2JDKA 2RDQA 2AH2A 4BHPA 2YROA 3C7EA 4M0NA 3B9CA 2YG0A 5KHHA 3UKVA 5EIYB 2DCTA 5A7PA 2D97A 1SBEA 2VVEA 4E2QA 2F17A 3OPWA 3PMEA 3EXUA 3TEYA 4ISRA 1AXZA 2CV6A 3ZMOA 5FO8B 2C5DA 4SLIA 1PZ8A 1SPPB 1ND3C 2WAOA 2WIIB 3I97A 5ANNA 5DAXA 4ZU7A 3VL8A 3WG3A 3WQ7A 2Q1ZB 4D7TA 5IVVA 2BPA2 1DYPA 4UF0B 3LPFA 5BPXA 4Q0QA 3VBHC 3I3DA 4QX3A 2P1BA 1NQJA 5D2AA 2RE9A 1UIJA 1OH3A 4NE9A 4XZPA 4ZONA 1VALA 3FBYA 4MGZE 5GM0A 3POYA 3CZJA 5HXVA 4B1MA 3QLQA 5EQUA 4XXPA 1OD3A 2PHFA 4FCAA 5IFTA 5JIAA
chains in the Genus database with same CATH topology
4E4ZA 4MH0E 2RS33 2WJSA 4YGCA 4QD2A 4GKXA 5H9QA 1BMV1 1AZDA 3IIAA 3LAGA 2VG9A 1EV13 4JVAA 3WG1A 4AE2A 1JYIA 5BY5A 4CEYB 2PLV2 3S7IA 2R041 2ZJCA 3RNSA 4DRRA 3ILNA 5LRRA 2ENRA 1AR72 4WBBA 4I3PA 3D0SA 1RUH1 4P9GA 2KM2A 1QH6A 1Y7BA 4D7SA 5CG8A 4YW4A 3X29B 2CL2A 4XETA 1QNWA 3DL3A 2RM21 5I0TA 1Q8VA 5DZEA 4W6YA 5JI7A 4AFCA 4RL7A 4P9JA 3RMYA 4M0HA 4XBLA 3BIWE 1UPSA 1YYNA 2BYVE 5K0UB 5K8SA 5CFDA 1AR62 2Q5TA 1LODA 1QQP3 4AVVA 2ZPXA 3WVJA 1B09A 4A3XA 1NCQA 1QJU1 1SMVA 4HLTA 4MGKE 1GNHA 2FQPA 1JTZX 1GZWB 4AFAA 4QPIC 1YJLA 1FNZA 3ATGA 3FBMA 3KGZA 4M3CB 4NOTA 2SBAA 3UL2A 1RC6A 3HWJA 5BNPA 1QJY1 3K51A 4DY5A 4I2OA 3TN93 3E6DA 3VKMA 1RHI3 3HR9A 1HRV3 3QH7A 1KRIA 3DPRB 1TMF2 1ZZ7A 4S2GA 4AYUA 2RM22 5C4WB 3AZZA 2UU8A 5CFCA 2HWC3 3R6SA 1QWRA 2X5IC 4RQPC 2WNUB 3VBOA 1AR93 2DU1A 3MZHA 5BNOB 4RR3B 3ZFEA 1IPJA 3OCPA 1IGOA 2PHTA 3M3CA 2GAUA 3I8TA 1W6OA 4BMBA 4DS0A 5F5QA 3KT1A 1FX5A 1N47A 2H6CA 3T1LA 4DZGA 4R9CA 2D5FA 1A3KA 3MLLA 1PMIA 1XE7A 1DU3D 3UKNA 4B3NA 4AEDA 3ZXGA 5K7PA 3WDYA 1ZREA 4RA0A 2XJSA 1NZCA 5J7MA 3AB0A 4BQ1A 3N7LA 3GHNA 2GALA 3DGTA 4JGYA 4DRVA 4LUMA 2ZGNA 3WD5A 3LA2A 3LA7A 1C5IA 4IV1C 3ZXJA 1VBE3 5JAXA 1LEDA 2K2SA 2HEWF 4PBPA 3ALQA 1ZRDA 4GA9A 4UBGA 1WW5A 4PDWA 4XMIA 4IV1B 4AEKA 5GLVA 3FLRA 2VU9A 4ORFA 4LNVA 2CTVA 4YW2A 1ZZCA 2ZGRA 3ZYPA 4BOWA 5FMOL 1DZRA 2YPJA 4AVAA 2JE9A 3QOPA 2D93A 4IL7A 3BPZA 5I0UA 1AR83 4MZUA 4OVEA 1UF2C 4RGGA 4I0WB 4K7JA 3THPA 3WW1A 1UKGA 5C8CA 1IKPA 2XUMA 2Z5WA 3J8F1 1Q8PA 4LLFA 3IDBB 1UZYA 3I2DA 2NPIA 1RUI1 1OOPA 4FPFA 3WW2A 4HFSA 1ZZ8A 2C9AA 2YV8A 4YFZA 4XDQA 1QJU2 1OOPB 1EP0A 3VDDC 1YI7A 4Q4X1 4PDWC 2RR12 3ZIWA 1OQ1A 4TLFA 2VMHA 3POSA 1ND2C 4XFGA 1Z78A 4IV1A 4JC1A 3H0OA 5J36A 2BQPA 4W65A 1T6GC 1AYN1 1IS3A 4JGZA 1WGPA 1NE6A 2ZHKA 4JGYC 1CVNA 1O5UA 1Y3TA 3QACA 5DUUA 1DLLA 4AF9A 1ENQA 3RRDA 4EN8B 3ASIA 1O3TA 1AJKA 1QDCA 4LBOA 4MLOA 1L3JA 1G9CA 2WNEA 3CNAA 1WMEA 2GMPA 4YM2A 4O9EA 4AW7A 3POWA 2R061 2H6BA 4KWJA 3OJBA 3ZFFC 4ASLA 2V5YA 3URFA 1COV2 1TME2 1Q56A 4F7ZA 1H8TA 2VPVA 3ZXLA 4OI4A 2P2KA 4ITCA 2D6KA 3L9JT 4DY3A 1JUHA 4LO4B 1H8TB 1ND2B 1EYBA 1MZ6A 4FTSA 4K40A 5LK5A 4RQPA 4AEJA 4ONUA 1ZRFA 5IT6A 4AVCA 5LRSA 5FLJA 2P3KA 4IETA 1VAKA 3O12A 4EN7B 2ZCWA 3AYAA 4ZU4A 2PHXA 1FOD1 3OYWA 2UYBA 1V70A 2XGXA 3ZYRA 3AK0A 1BBT3 2D3PA 2RJKA 1AYN2 2LUWA 4RS5A 3AXDA 4TSVA 3WHTA 4KNCA 3AMMA 4D7YA 3RJRA 1FNYA 1DF0A 3PJQA 2YYOA 2R49A 3RI9A 1R1A1 1ZBA1 1NY71 4XILA 2B45X 5DDJ1 5FDBA 3VHOA 5L73A 2WT2A 3ZXAC 4CEWC 4HPKA 2VXRA 4MXWA 2VQ0A 4GMP0 4KG0A 4Q29A 4Q0PA 4F8AA 3IPVA 1ZBE3 4E27A 3TB0A 2O0OA 1IHMA 4E4SA 1AL22 2ZKLA 4C91A 1VBC1 4AG4A 3JD71 3V0AB 1YJKA 3UJQA 1ZBE2 1H4HA 4OUSA 1QNYA 3MPBA 4FT8A 5SV8A 4AGVA 5C8CB 2ES3A 3M70A 4IQPA 3VKOA 3AP7A 1JHNA 1TNFA 4YZ3A 1WLWA 1M4WA 2PYTA 5BV6A 3JZVA 4CEYA 3MIDA 1AR82 4LO8A 1I6XA 2Z79A 2A71A 1HX6A 4XBNA 4AHZA 2NP0A 2I07B 2O8OA 1RTVA 1DFQA 2PN5A 3IKWA 4J1XA 2RS13 1C8M1 1H1IA 1LENA 1GNZA 2QFEA 4NWWA 2BPA2 2B9UA 2V73A 1TEIA 2DURA 2HKXA 2MPFA 4YM3A 1R093 1C4RA 3H1YA 2I74A 2VW0A 2RR13 3RMXA 4Y1YA 2IFWA 1Q43A 1SBFA 5T50A 2B5HA 1FPN3 4WM7B 1RUF1 5BXXA 4LUKA 3V0AA 2HWE1 1NCRB 4QQ2A 1OA2A 2ILMA 2BWCA 3O7OA 4RGAA 5DDJ3 4I0AA 4OZXA 5F6LB 1F2NA 3VBFB 2EALA 3TOJA 4QXKA 1LOEA 3CJIC 5BNOA 3O0XA 1O4ZA 4CDWA 3WDUA 2VW2A 4G3YC 2BGCA 1OFSA 2XJTA 1SLBA 3JD72 1FPN1 2WQ4A 2GNMA 3VBSA 5KBFA 3NV3A 1RIRA 4JGYB 5KXBA 3M2MA 1D0HA 1RL3A 1QJX3 1XE8A 1RUF2 4Q4Y1 4R8HA 3TRSB 3D8CA 5EZWA 1LHVA 2ZTNA 4G9SB 3PVOA 1R091 1K5MC 5JPNB 3ZSEA 3TNPB 4TZDA 3MLJA 2GH2A 3E5UA 3H1WA 5EXOA 1ULFA 1R083 2QNKA 4FQZA 1QOSA 2EIGA 5J98B 1C8M2 1MZ5A 1RUI3 3S7EA 2WLQA 1SLLA 4IV3A 2VUJA 5DG2A 2BVBA 1OQEA 3AMHA 3VZJA 1EV12 1APNA 2YHJA 1NE4A 4X8NA 2WWSA 2R071 4Q8KA 1W0PA 2ZHNA 1MQTA 1RUC1 2A6VA 3T2TA 3WX5A 2BFUS 4HVRA 1OFNA 4XEZA 1C57A 4PJYA 2CGOA 4RS5C 2PQQA 5FCCA 2PA7A 5AVAA 4N9HA 4XIKA 2R1DA 1POV1 5J3UA 2P17A 2D6OX 3GYDA 3O5SA 5DXDA 4Z07A 1LRHA 1GZCA 3JB8A 4AQTA 4BZ4A 5JMCA 1ALYA 3OPZA 3ZFGA 3ZFFB 4IEXA 5D1IA 1S0EA 2D43A 4Y1XA 4D3WA 1V6NA 2W39A 4Z82A 1VRH1 4AXOA 1ZRCA 1LESA 2YZ4A 3HT1A 4OI2A 4Y22B 3USUA 2BW8A 1OHFA 4IERA 3L2HA 2ZX4A 4OLLA 1H8TC 1O3SA 2JD4A 4QQOA 1Q3EA 2R043 2WZR1 5CFDB 4UBHA 2WS93 3ZFFA 1VRH3 1URXA 3TN92 3SH4A 4F83A 3GBGA 3Q9OA 1NA1B 5HBAA 3NV1A 4QPGA 3H3ZA 4RD7A 2TNFA 4Y20A 4DINB 3KT4A 4WM7C 2WT1A 1VBA2 4YNIA 4YGDA 4YW1A 3VUOA 1QOTA 1CAXA 2ZGMA 3OY8A 1UW8A 4QPYA 5C9AA 4BPZA 5K9YA 3RYRA 3K48A 4FTEA 4XPVA 1JN2P 2A6WA 2XLAA 1H9PA 4WV8A 4OHXA 1ULGA 4L92A 2B8MA 4EN9B 5FO7B 1AX1A 1J3RA 1WW4A 4Q27A 1MZFA 1QJY3 4KGQA 4U36A 2XJRA 2RS53 3QD6A 5L7OA 3VDDA 4B4PA 4DB5A 3I54A 5CBLA 3NKTA 2QE3A 5FLIA 4YVSC 3MICA 3VL9A 3NO8A 3VHRA 1GZ9A 3R4SA 1OOPC 1UCXA 3TWIA 2HYKA 1W6NB 2NZ9A 3KT7A 1MS8A 4I0BA 3B01A 1H9WA 1MACA 2A3YA 3GZTB 1D4M2 3KLSA 4HMZA 2XBO3 5BNQA 1RUG2 2I2SA 3O0VA 5E16A 1FAYA 4NO4A 4UXAA 5ACA2 2CY6A 2HWE2 1LECA 2ZX2A 4AQ2A 4TWTA 1D4M3 5FAXA 4HKWA 4P9IA 1AL23 5BNNC 1DDLA 4FTBA 1QJX2 3KCYA 1AR91 2DYCA 2IFRA 5EYXA 1WCKA 5A33A 4MUVA 1V6KA 5TSWA 1SQ4A 4YG0A 1DG6A 4TYSA 4I01A 2BTVC 5B2GB 1LJ7A 5ABJC 1AYM1 1C3HA 2D6MA 3OD4A 1QDOA 4Q26A 1S0BA 1B35C 4I3GA 4XF3A 1N1YA 2UY9A 2CWSA 3R4DB 2D7FA 1N3QA 2MEV2 3SISA 3VBUC 4WZFA 2VUAA 3ZN6A 2JG9B 2YC0A 4E2SA 2WNVC 4XJWA 3T1MA 1POV3 5JZGA 1RUC2 2DTWA 4WVMA 1RJ7A 4DQAA 4LO7A 4BH9A 3TYJA 1VB4A 4Y26A 2IZWA 1PK6B 1WUVA 3BU7A 2GSYA 5JR7B 1AR73 4BIOA 4N7IA 1TMF1 3P3NA 3INAA 5K0UA 3HT2A 2XJQA 1KDMA 2GC3A 2WSUA 2JEMA 3LGRA 3VBOC 1JW6A 4K20A 3PMSA 3M3OA 4H14A 3JBG3 1XU2A 1G8WA 1V6LA 3LCPA 4GH4B 2N7GA 5AC93 2ZGTA 5LEJA 1BEV2 2EA7A 5DDJ2 1R081 1XU1A 1MVEA 4GH4A 5ABJA 4M01A 4LBQB 3N36A 4KWKA 4CP1A 1Z7S3 1CAUA 2OVUA 5I8TA 3AKTA 2ETEA 5FOJB 1BEV3 4HK9A 1K5MB 2AENA 3VKNA 3WZ1A 5D8AC 4XOGA 2R6QA 2AR6A 3IWZA 2ZACA 3OF1A 4K8FA 1DQ0A 4COYA 3C2UA 1CAVA 3CEWA 1YXWA 3SITA 1MS3A 1HXS3 4A7KA 3AZXA 3RJ2X 4RHV3 4B8EA 2ATFA 3VBHB 1YIPA 2PAMA 1LU2A 2VOVA 4Z92B 2HWD3 1OD5A 2W0XA 4CDUA 3WINE 2Q4SA 2OYZA 1J1TA 4AHYA 3WUCA 5C8CC 2WZPP 4MGYE 4V1PA 3PVEA 5J09A 1UMZA 1R1ZA 1HLCA 3AMNA 3HD8B 1DGLA 3EJKA 1PZ9A 1YFYA 4KU8A 1XQNA 3OD0A 4UW4A 3IDCB 4OUMA 3U07A 1KXGA 3MEPA 4MSVA 1REEA 1D2QA 5T55A 1DHKB 3HQXA 1CONA 5FPXA 3MIGA 4FAGA 4LBKA 1S0CA 2JG9C 5AVPA 1HIXA 3ZYJB 5C9AC 4GXLA 2HWB1 3C3VA 1S2BA 1RVF2 2RMU2 2VECA 1VBB1 2WFF3 4K9SA 4AEDC 3E5QA 1EAH3 1OMIA 1KD7A 3D4KA 1FMD3 3W9AA 3ZSMA 2OZ6A 1CJPA 4PF5A 4L11A 4LE4A 5FFOC 4B4QA 1RITA 1LGCA 5JIUA 4KWLA 5CG9A 1TE1B 4Q0SA 1VBC2 3VGIA 3E97A 3ZXEA 3RDIA 1FXZA 3VBSB 1IS6A 4KGGA 3E6CC 1WW6A 3TNQA 3OGJA 2W52A 2YUEA 2DFBA 3E5XA 4LO5B 4WM8A 3IBMA 2ZABA 2QJVA 4S2HA 4KG8A 1RUJ1 4Y20B 3ZFGC 1HQWA 4NPRA 2PAEA 4AGRA 3AZYA 2PTMA 5FQ0B 1VBA3 3ZYIB 1LOFA 3H7YA 4N53C 2JG8A 1VBD2 2A3XA 5FTTC 2R073 1CGPA 4FSJA 1N3OA 2C0ZA 2DVGA 1DGRA 4HVOA 2EXIA 3AMPA 2UY8A 2XKOA 4QPIA 1ASJ2 2R072 2Y0IA 2D40A 1SEFA 4IEWA 4YZ1A 3E6BA 4ASMB 4HN0A 1U12A 4KH9A 1PVC2 2XH6A 4FBFA 2NN8A 1BZWA 1U5YA 2A73B 4HKLA 4UW6A 2JECA 4LBLA 4FOYA 4QHBA 4DMIA 1C8NA 1EPZA 4COUA 3JB4C 1CD3G 4UW3A 2ZGPA 4QQLA 1X82A 4PCRA 3NJZA 4LBQA 5JCTA 4N9IA 4NR1A 3MDPA 3PLQA 4AFDA 4AFBA 1VBE1 3W59A 1ZZ9A 3WQ0A 1K5MA 5EYYA 2YY1A 3ZX7A 4FPGA 3KS7A 2D6NA 1PGL2 4K3UA 1HXS2 2EAKA 3N35A 4GWMA 1YFXA 5KHIA 3ZSKA 2XJVA 3NAPB 3WCSA 4RHV2 2WA3A 2QDRA 2H0BA 1UL9A 1H30A 1YCIA 2HWC2 4PLOA 4C1WA 1R1A3 3ZMNA 2PHWA 3SMHA 4CYDA 3PVBB 1RUE2 1RGSA 1PK6A 1Y9QA 3MW3A 4YZ5A 2VW1A 5AFBA 4WVMB 5JZGB 1QGLA 2YMZA 4R52A 2OZJA 3MFCA 1LEMA 4HK8A 1HXS1 1QJZA 3R0RA 4U2AA 1PGL1 3SCGA 1GR3A 1AYN3 2AYHA 2BVVA 2ZBJA 1ZM1A 3ZN6B 1W6MA 4CDWB 4NN0A 1DZTA 1PNGA 4QQPA 5KC5A 1YUDA 2D6PA 2Q1MA 5JWPA 4AHWA 3GF6A 3EBRA 3LKJA 3AZWA 3KQRA 1HRV1 3USSA 3VKLA 2IXKA 4B4RA 4DFSA 4FO9A 1SLTA 2WFF1 4META 3THTA 2WC2A 4JRAA 2EXJA 1A8DA 4CZSA 4PIYA 1IKQA 1NCRA 3VBFA 2B46X 1UN1A 1JH5A 2K0GA 5GZCA 3RWNA 3BODA 1F5FA 1UAIA 3WCRA 3AP6A 4LHLA 2R042 1SLIA 2VNOA 3MIBA 3UKTA 2H0VA 1RJ8A 1VBC3 2GH8A 1BVP1 4FVVA 2ZGOA 4YVSB 4N7UA 4OHYA 1UD1A 5EWSA 3O14A 1PO21 1RMU2 4CDQC 2DFCA 4Q4V2 4W6WA 3PHMA 5GALA 5L7OB 2DF7A 3ST7A 4DPNA 1PIV1 2IXIA 1MVQA 2E53A 4LA3A 3WR0A 5J96B 2Z2SB 3ME2A 4WZCA 4JCKA 4FPLA 1XYNA 1HDKA 5T3NA 4CEWA 3VDDB 4PIZA 1SCSA 1WMDA 2E51A 2XL7A 1OLQA 1WBLA 5E88A 1NLRA 1R092 1ZBA2 3RPQA 4XE9A 5C8WA 2F4PA 1EV11 2CWMA 2SLIA 1F31A 2MHFA 2RS31 4C0BA 3ROUA 4P14A 5DG1A 3NW4A 1CAXB 3OY8B 5C9AB 3AKQA 2DVFA 5D8AB 4MYEA 4KL1A 2DVBA 5EJ3A 1FOD2 3DUIA 2RJLA 5DZGA 3NVCA 4AWDA 3WP6A 2GMMA 2P37A 1LULA 1C5HA 2X5IB 1HV0A 1MS4A 2XVLA 2A75A 1FV3A 1DIWA 2FHRA 4OHZA 1WLTA 3MF6A 3AYCA 1G86A 2E7QA 4HT1T 4YVWB 2BBVA 3BB6A 3V64A 5F9TA 4CRQA 1GV9A 4YM1A 5GLWA 2ZHLA 1FMD2 3KB5A 5CNAA 2GC0A 1YI9A 4QPIB 1W6QA 3WDWA 2DTYA 4Q2FA 1QKQA 3FLPA 4Q1PA 2JG8B 4YM0A 2HJIA 1RUE3 1OA3A 3DV8A 1KQRA 3B9IA 3S6PA 4XF1A 3CU7A 3ZN5A 2MEV3 4BMEA 4DXZA 3WNXA 2G9GA 2BEOA 1MS0A 1XNCA 2WZR2 1IPKA 4Y1UA 3OGGA 1DZQA 2XLFA 3MIHA 5EFUA 2DU0A 1WW7A 2XWBB 3N7MA 4RQPB 4XHXA 4HKOA 1I1EA 1YHFA 3FE5A 4H7LA 1ND2A 1OKQA 2D6LX 2Q8OA 4CP2A 1AF9A 1U5XA 1IZ3A 1ND3B 1AVBA 1UKRA 1PIV2 1VBB3 5BUVA 3B5LB 2TEPA 1GQGA 2GNTA 3VBRC 1FI2A 3N3HA 1H1MA 2D44A 4K1YA 2VH9A 4N43C 2KXLA 4S2DA 2XJPA 1BCXA 4QGNA 5E1RA 4FOWA 1AXKA 4GMP1 1DQ1A 4JGZB 3FUOA 2QUOA 3WXPA 4PLNA 2O1QA 4JV4A 4GKYA 4EWAA 1V9U2 4KU7A 4GB32 5I0SA 1G9DA 4AI2A 5BNPB 1QOOA 4A2UA 2WFPA 3SLIA 1I3HA 1TQ5A 1DGWA 4YW3A 3DF0A 3FX3A 4FPYA 1N1SA 5KXDA 1HRV2 1ZYBA 1GZWA 1X7NA 1W2UA 2RM23 1KDKA 3ILFA 4H3WA 4YW5A 3O0WA 3U10A 4CDQB 5A3LA 1QXRA 4RSUA 1XNDA 1JXNA 1QY4A 1Z0HA 2IXJA 4R9BA 4R9DA 1A6CA 2HWD1 2B39A 3D0JA 4P9YA 2JDZA 2WA4A 1QMJA 4URTA 1R1A2 2PAKA 1NXD1 1PO12 4JTOA 1KJLA 4I09A 3KSCA 2ZX1A 3WG2A 5FLHA 3D5OA 1G6NA 1BBT2 2PHRA 1PO22 1RMU1 2IC1A 1AR92 1S55A 2JKBA 4XFHA 4YSFA 4B29A 1H8VA 3KZ4C 2UWCA 3PNAA 4FPEA 1LHNA 1O7FA 1RUE1 4MX3A 4LO6B 3UV9A 4FOVA 4D69A 4RFT0 1LOAA 1ZA4A 2OA2A 4WM8C 4XFBA 1FT9A 4O9GA 3OBRA 1CAUB 3SNMA 2IWGB 2PHUA 4ZXKA 1RB8G 4XMAA 2JJ6A 5I8YA 3G6JB 4PBOA 1OSGA 4BA6A 3AP4A 4YZ4A 4LBNA 1GICA 3ZYGA 1UX6A 1UU5A 5H9RA 1UPIA 2XPJA 2XG3A 1QHDA 1DQ2A 5IK7A 5CAZA 3QBQA 2E7TA 4HPKB 3CO2A 1U5IA 4UW5A 2OW4A 1XYPA 2R32A 1QQP1 3M3QA 4Q4X2 3WUDA 4BCUA 4ISQA 3AP9A 2FMYA 3DPRC 3ZFEB 1G9BA 1NCQC 2DUQA 4GALA 4LEJA 1OLRA 1X33A 4MXWB 2WNUA 5HCFA 1PVC1 2ZMNA 4ZU5A 4YG6A 3EQEA 4QX5A 5GZDA 2NLRA 4XFIA 1H4GA 3PTYA 1CJDA 1MEC2