5CG8A

Ngtet1 in complex with 5hmc dna
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
266
structure length
266
Chain Sequence
MINKKSLLQNLLSKCKTTFQQSFTNANITLKDEKWLKNVRTAYFVCDHDGSVELAYLPNVLPKELVEEFTEKFESIQTGRKKDTGYSGILDNSMPFNYVTADLSQELGQYLSEIVNPQINYYISKLLTCVSSRTINYLVSLNDSYYALNNCLYPSTAFNSLKPSNDGHRIRKPHKDNLDITPSSLFYFGNFQNTEGYLELTDKNCKVFVQPGDVLFFKGNEYKHVVANITSGWRIGLVYFAHKGSKTKPYYEDTQKNSLKIHKETK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tet-like dioxygenase
publication title Structure of Naegleria Tet-like dioxygenase (NgTet1) in complexes with a reaction intermediate 5-hydroxymethylcytosine DNA.
pubmed doi rcsb
source organism Naegleria gruberi
molecule tags Oxidoreductase/dna
total genus 89
structure length 266
sequence length 266
ec nomenclature ec 1.14.11.n2: Methylcytosine dioxygenase.
pdb deposition date 2015-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1640 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cg8A00
5CG9A 5CG8A 4LT5A
chains in the Genus database with same CATH superfamily
2WZ8A 5IWFA 3MF6A 4JCKA 2B9VA 5T54A 5BNPA 1TVGA 4ZXKA 2B45X 5E8AA 5FZCA 4CE8A 1DU3D 2RS51 4DRRA 5J98B 5CFDA 3A21A 1W8OA 4HANA 5FZEA 5A3MA 1CESA 1RXFA 1YWKA 4IV1A 3WF3A 2ZMNA 1F5FA 2YC0A 5LRSA 3EO6A 5L9RA 3TYJA 4CU8A 1JZ2A 2P6HA 2VOXA 2AENA 2HEYF 1UZ0A 5LA0A 4EN9B 1QJX2 4TSVA 1W6NB 3VBSA 2F6BA 2ZHLA 3RMYA 1Q8QA 1ULEA 3RZLA 1S2EA 4WM8A 4D8MA 1QJU3 1E57A 3KQ4B 1JN2P 1SLLA 5A7WA 3ZFGB 2QJVA 1AR61 1G9FA 2JKBA 3NJZA 1OKOA 2BERA 3G6JB 2LS6A 3BI3A 2WNOA 4BIFA 1Z7S3 2ATFA 5LB6A 4E9KA 2D44A 5APAA 2EIBA 1CIWA 2XKPA 4CCNA 4R9DA 2HBUA 3AJZA 1O8PA 4EV0A 3IDBB 1VBA3 1AXYA 1OPMA 2WO1A 3LKJA 1M4WA 4NR1A 1A6CA 3GZEA 4Q27A 3ZFFC 1ZBA1 3RS6A 2YBPA 1E5RA 1EAH2 3MIDA 4XW3A 4BMBA 1VBB3 4BIOA 3ACHA 4O61A 4P9JA 2GH8A 2QQOA 3POBA 1MZFA 1WLWA 1XNKA 2P4EA 2ZMLA 5CU1A 5T5JA 1YFYA 2ARBA 3J26N 4OI2A 1X82A 5A1LA 5F37A 1BKZA 1ZZCA 2YXSA 3P1IA 3EJKA 4WVMA 2HBTA 4D0QA 1GLHA 2XBO3 1CIYA 5T5PA 2JICA 3WINE 3I2OA 1PX3A 3IAQA 1HB4A 1V6NA 4IERA 3B93A 3B5LB 2WL1A 1X8EA 4ARXA 1COV1 2DVBA 1O3QA 2WINB 2WT1A 5F3GA 3E97A 2HWB1 2O8OA 3AMMA 4IV3C 3WQ0A 1YRZA 3T2OA 3MO4A 2J1RA 2JG9B 1N3QA 4NAMA 3HN1A 2OUJA 2VTXA 3OB8A 1RUF1 2Z5WA 3ZLIA 2CHHA 4DPNA 2FZ1A 5GJ6A 3I2FA 2TEPA 3THPA 1OOPB 5FZOB 5FPAA 4CDXA 2D43A 2D7FA 5H9PA 2B39A 4PJYA 2Y64A 3W20A 1HRI3 2RDRA 5BPXA 5LA9A 2GNTA 1UY4A 2DWRA 1QJFA 2EIGA 2TUNA 4H7LA 1OC1A 1S55A 1YUDA 4FQ4A 3S6PA 4AGGA 4AVTA 1Y9MA 2VG9A 2JD9A 2K2SA 4XIKA 4JKLA 3ZXEA 2AGSA 2FMDA 1LHOA 1HQNA 2W52A 3ATGA 1PGL1 1LAJA 3I3EA 3N9OA 1JOJA 2AACA 4AFMA 1GOHA 3P5BA 4FPKA 3UGGA 3ES4A 1AUYA 2VUDA 2VVFA 2WNEA 4JKKA 5GZEA 3USUB 1AX0A 2Y6JA 2ZJCA 4XQWA 5D8AA 1NCRB 1QMJA 2WFF3 5K9YA 2I07B 4ZU7A 3QBQA 2BNNA 1KITA 4JX0A 3WDWA 4R4ZA 2QVSB 4AQ6A 3O1VA 4LBLA 3PU8A 1AYM2 1G9CA 1Q56A 2NP0A 2ETEA 2ZMKA 4XF0A 1EV11 4ZONA 1LOBA 2PHRA 2R1DA 1UMIA 1WLCA 2ZGLA 1REFA 5HPOA 2W0XA 1RMU3 4GH4B 2OYZA 2PLV1 4LBKA 4OVEA 1R083 1WLTA 2JJ6A 4YARA 1XNBA 4A3ZA 1F8VA 3SH5A 4CPBA 2DYCA 3VBFB 5FZ7A 3VDCA 1Y4WA 3PUQA 4QX0A 3GZAA 2VCMA 5DG1A 1DZTA 1PK6C 4AAXA 1DF0A 3E6DA 3CF6E 3VDBA 4XJ8A 4MUVA 4PLNA 4Z07A 4HL0A 5FY9A 1BVP1 1GNYA 5GZCA 4B29A 3APBA 1NA1A 5F5AA 4B7EA 1NLQA 4CCOA 4N43A 3DUIA 3IPVA 3JBG2 3ZR6A 5L9BA 4OUSA 1DGRA 1LHWA 4QX2A 3UGFA 2WNUC 3HQUA 3I2JA 4NUBA 1X50A 3TN93 4RYDA 4CP2A 5L7OB 3PJQA 1HIXA 5A6YA 4I01A 5JVVA 3OD0A 2DVDA 5K0UC 1XE0A 1RB8G 1KFXL 5CYYA 4EN7B 1J3PA 4IEOA 5E88A 5HBAA 1WCKA 4AI1A 1AL21 3ZPOA 1XYOA 4Q29A 5LK5A 4DS0A 2GNMA 4LLOA 5FPUA 5LY1A 1PM7A 4HN1A 1PIV2 3BTAA 2WQZC 3WW3A 3VZKA 2JDNA 3SXWA 4K1YA 1V70A 4AQ2A 2VJXA 1NCQB 3CJIB 5FZ1A 1Q8OA 2BTVC 2AZ5A 4LULA 4N90A 4QHZA 1ZVFA 1OLRA 2EAKA 5LRRA 1RTVA 4A2UA 2JG8C 5CBLA 4QXHA 4AI9A 1YIPA 3MHZA 4Q4W1 2YC2A 1NXMA 3MLJA 4CDUC 1RVF3 3A0NA 4EWAA 3BUCA 4UOJA 5C4WC 2R30A 2HWC3 1JI6A 3C7FA 3PIJA 1JMUB 3EBRA 3UV9A 2JD4A 1O3RA 3FLPA 1DP0A 3WP4A 2R063 3O1MA 5EPAA 2XHNA 2WKKA 2H0VA 1AYN2 2XVLA 4NN0A 5FK8A 5F3CA 4E2GA 5IVEA 1VMHA 2RMU3 3B9IA 5FO9B 3I2KA 3L9JT 1SFNA 2DV9A 2JECA 1EPZA 1QXJA 3CEWA 4IV1C 4QB2A 1PO12 4X8PA 4XFFA 2CNAA 2XJQA 4MADA 4HMZA 2RJLA 3O0WA 3CJXA 3RFRA 3T1MA 1JZ3A 1QJEA 3U1XA 1PGSA 3JU9A 5EFUA 5A7PA 2W08A 1Q8VA 2OUHA 5C9AA 2Q30A 4L2NA 3D0JA 4C0HA 2DVGA 2P3IA 2ZGKA 2IWGB 3LIHA 2BWCA 3ASIA 1AX1A 4Q8LA 4J1XA 4WM8C 4AL9A 1OLMA 4UI9L 4BE3A 1LRHA 2NLRA 1RUG1 2HKXA 3TBDA 2FDIA 4ZXEA 2GN7A 1CPNA 3A22A 1CVNA 1QJY3 1YC61 4F83A 1BBT1 2D5FA 2BWAA 3TNPB 1F2NA 4PIXA 4NHMA 2LRPA 4UW3A 2J1TA 5EXOA 3MW3A 3CHXA 3LPFA 3ZFEA 1B35B 1HRV2 5EZWA 2GMEA 5AC93 2YFZA 4LLFA 1RHI3 4AFCA 3K48A 4CCEA 1JOPA 5FJHA 4PF1A 1FX5A 1GZWB 4QU1A 3I59A 4NHLA 4D6RA 1CX4A 1Q3EA 2A75A 4QT6A 3VKOA 4YVWA 3BTZA 2Q1ZB 1W6OA 1W8FA 4NPLA 5JSPA 4K1ZA 1QXRA 3K4ZA 1JZ6A 2GNBA 2WLQA 5FY4A 3Q8AA 1RUNA 1PVC2 2UURA 2J1SA 2ZXQA 3I97A 3RZHA 1HV0A 3IMNA 5FZ9A 1N1SA 1OSGA 1SDWA 1RUD3 1UF2C 2VNGA 5FP3A 2XQXA 1WCUA 3ZYFA 4Q4X2 4LBOA 3K3NA 4NRMA 2CY6A 2VW1A 4UW5A 3WR0A 2C6SA 4UF0B 1W3XA 4LHLA 5B4NA 5FZAA 3KS7A 3AX4A 1AF9A 3VKFC 3CO2A 1W0PA 2Y38A 4QX5A 2P37A 4P02B 5ABJB 2DFBA 1OFSA 4CDXC 3P3PA 1QJU2 4I0WB 1J1TA 1GANA 2NN8A 2MPFA 3FN9A 5EJ3A 3VDDA 5KXEA 4OI0A 3QH7A 1TG7A 4MGSA 2WYSA 3TEZA 3OOXA 1YIFA 3AP6A 3KD4A 3LA2A 2IZWA 3HQXA 1XU2A 3RRDA 2QQLA 4FOVA 1UZWA 2VZUA 1Z7S2 1POV3 4CXYA 1VRH1 1XC6A 1I9RA 2XUMA 4XUNA 4CDWA 5FMOL 1KDKA 3VL8A 3LSDA 3ILNA 2VNVA 5CFCB 4XFIA 2OS2A 4N7UA 1TMF3 3PUSA 1AR73 4YGBA 4FAHA 2VR4A 4WM7B 1QNYA 5GLWA 4R9AA 2WR9A 1XRUA 3AL6A 4A4AA 1CONA 5D8AC 1V9U3 2BEOA 4AF9A 4CP0A 1DQ1A 2AR6A 5FZBA 5JSOA 4BA6A 2KD7A 5JZGB 1W6PB 4N9HA 3VLBB 1QY4A 5CISA 1J59A 2RM23 4COWA 4NVPA 1TEIA 3ZN4A 1K5JA 1FNZA 4FP3A 2ORZA 1XOYA 5GM0A 1ULOA 4FPFA 2Y6FA 4O65A 5HCAA 4KWJA 2J1AA 2XLAA 3LDBA 5FKCA 1GUIA 4Y4YA 5CADA 4IDZA 1G9AA 4QXBA 2XKOA 2HWF3 3LZZA 3MBWA 3O7OA 1LR5A 1RIRA 1RUE1 1JXNA 2KA3A 4J6GA 4FBFA 1FXZA 3VB9A 4EROA 4WBBA 2DDUA 2Q5TA 4I30A 1JYIA 5DXDA 1MS5A 4XBNA 4CCDA 1SLTA 2RVAA 1NE6A 4HVOA 1H8VA 4WZCA 2ZHNA 1LEDA 1NA1C 1WLDA 3GZUC 4COVA 1LOCA 1VAVA 2JG9A 2QFEA 1GOFA 1OF3A 4C1XA 2JDUA 2ES3A 2FDJA 3AFKA 2HWC1 3HNYM 5C6CA 1HW5A 1P8JA 4RQPC 3H1WA 1OOPA 4CUAA 1BMV2 3VBHA 2DVFA 3D3AA 4Q4V1 1HXS1 4BH9A 3D82A 3T2PA 5L9VA 2EIEA 3KV9A 1UMZA 1VMJA 4N53B 2Y0OA 4COUA 4JZRA 2K9ZA 3WY6A 4CU6A 4AI3A 3LWCA 5FUNA 4J25A 3NAPA 2R0HA 4GJYA 1DQ2A 3AYDA 4DUWA 4UBGA 1NY71 5C5TA 3AYCA 2A7AA 4ONUA 3HNMA 5KR7A 4FPHA 1UN1A 2D6OX 1CJPA 3GBWA 5LEKA 1DGRN 4LKFA 5ACA3 1MS1A 1J1LA 4BZ4A 1WD3A 2RJ2A 1RMU2 4P9LA 1VBE1 1JTZX 2XOMA 1XNTA 3HVDA 3IDAA 5DG2A 3WNXA 1JZ7A 1YFUA 3O14A 5FOBB 5DAXA 3PLQA 4P00B 1QQP3 2G1MA 5FY7A 2ZX4A 3ZIXA 1OVSA 5BY5A 3JUUA 3NJVA 2HWD1 4YW4A 2C0ZA 2DFCA 3BU7A 4AEDB 3AKQA 1QOOA 1S1AA 2ZEYA 2ZHKA 4GH4A 1BVVA 2ZEZA 4LHKA 5BYNA 2X5IB 1JHJA 3OBAA 1OD5A 4M00A 3IN9A 4QKFA 4XJAA 1US2A 4XABA 3N4MA 3NKTA 4XBQA 4LO5B 3OEBA 2FD8A 4XIOA 4KMQA 1FMD1 2BFUS 4KG8A 1GP5A 1HX6A 3OGVA 4XUPA 3AYEA 4GB33 1VB2A 4IQPA 5C9AC 4Z92B 2ZACA 3A0KA 3KV6A 3ILRA 1DYKA 1V6MA 1AR91 3BALA 4FFGA 5DAPA 2XJUA 1OQ1A 1M06G 1TME3 1NLSA 3SH4A 1RITA 2WA3A 3OGGA 5L7OA 4AEJA 5JSRA 1IKPA 1DGWX 1XU1A 1WA6X 1W04A 2BOIA 2XQRA 3N9NA 1UNBA 4IETA 2DUQA 4CUCA 1KFUL 4NIAA 3KVBA 1OVPA 1JZ8A 4FVVA 3C7OA 4FXKB 3DL3A 2WC2A 3CZUA 4A7KA 1VALA 3JD72 5KHHA 4LPLA 2HWE1 4XJ9A 5A3WA 3FHAA 2GMPA 3H50A 1H2MA 4MSVA 1XB9A 3USSA 1ASJ3 2ZGSA 4YVWC 1QDOA 5JR7B 4LBJA 2RS53 4LHSA 1QHDA 1WMDA 4V1PA 1H8TB 2RS12 1S0JA 4GALA 2D93A 2R062 2A71A 2JDMA 3I3MA 3HJRA 3MW4A 5FMDA 2PHLA 2UWCA 3BOPA 2RMU2 1IGOA 3PDQA 2ZEXA 1D7PM 3K75B 4IE0A 5DZFA 1KJRA 1XNDA 4KGGA 5GZFA 3TNQA 5C3OA 1XJAA 1FOD3 4FO9A 1GZ9A 1ULDA 2J42A 1V9U1 3BOWA 2RHPA 3LA3A 2PQQA 4KBBA 1POV0 2G4IA 3M3CA 4KGQA 3ZXJA 2WIIB 4BQ2A 3U78A 2A6XA 4GWNA 2PHXA 4XF9A 5F5CA 1AR63 5IK5A 1PHMA 3SKVA 1MZ5A 2VY0A 1JH5A 3IIIA 1QJZA 3THTA 5C7GA 4H14A 4I0BA 4IV3A 4CYDA 2XMLA 3I4IA 4BJ0A 5FUIA 3LE0A 4GAZA 4PLMA 1QNWA 4L99A 5JI9A 3TEYA 1Q43A 1HKDA 1RUJ1 2GDFA 2JDYA 4YZ3A 3GCWA 1ZBA3 5CVRA 3RJ2X 4D7SA 2L9LA 2PHTA 4DOUA 3C8XA 1CZTA 4CDWC 4CUBA 2GH2A 4YFWA 3ZFGC 3BPZA 1DHKB 3I54A 1RHI2 4KBZA 2RE9A 3AMQA 2BFUL 4UAPA 3CZJA 2BU9A 4DQAA 2YB7A 3KV4A 5DQ0A 5AVPA 2MEV1 2JE8A 3URFA 2HYKA 4LIUA 3UT0A 4A41A 2VD7A 1UZYA 3AL5A 3C7GA 5FO8B 1SBEA 1SFPA 3CLPA 3MIHA 1LOAA 3C3VA 3IB3A 2XWJB 1COV3 1H2NA 1W3VA 3J7NA 5BUVA 2QNKA 1ZRDA 5B4XA 4FAGA 1RUD2 1I1EA 2HWB3 1RXGA 4XMIA 5FXWA 3VZLA 2Z42A 3I2GA 5E16A 4CP9B 4XFGA 1SPPA 4IEWA 4IEUA 3T0AA 2WZR1 3AYAA 3LIGA 4QGNA 2D40A 2V4AA 5JIUA 1UU6A 3RWNA 1I3HA 2ID4A 4M3CE 3LFIA 4FSJA 2D3SA 2R0FA 3VHRA 5EP9A 5CB7A 1J84A 5ACA1 1CN1A 4M3CB 5JOXA 4UF0A 4H2AA 3AM2A 5EJZB 1XSQA 3ON7A 4NIGA 4YLZA 4DY3A 5T55A 2JG9C 1O6UA 4BLJA 2VZRA 1QGLA 1PK6A 1PNGA 2JWPA 3OGJA 1RJ7A 3L2YA 2JKXA 5KC6A 4BB3A 4M3CF 1MQTA 2B9UA 5FLIA 1OOPC 2VULA 1HJFA 1QJX1 2VM9A 1UKGA 2V72A 3D8CA 4CCCA 4QQLA 2P17A 4FQZA 1LODA 1TMF2 1AR72 1W90A 3HNBM 5FZKA 4RFRB 1LOFA 2WNUA 2O8QA 1WD4A 4XF1A 3ZXLA 2BBVA 4Y1UA 1LGBA 1RUI2 1S0DA 1EV13 3GBFA 5FXXA 3PVEA 3N9QA 4AG4A 2EF6A 2WS92 4V2VA 1IS4A 2Q8OA 2R32A 5DAVA 1IG0A 2Y34A 4V2WA 3V56A 2QDRA 3NNMA 3O0XA 1VR3A 3WUCA 1I5ZA 4CU7A 2MNGA 4ES8A 2BVVA 5JXGA 4BQ3A 4LE3A 1IG3A 3B94A 3PVNA 1EPWA 4META 1MS3A 3PL0A 4IGPA 1FPN1 1NCRC 2B7YA 4SBVA 1UU5A 2P1BA 2GC1A 3OF1A 5J36A 1L3JA 5FY0A 5JZGA 3BIWE 4XC9A 2YHJA 3WD5A 2YG0A 5FBZA 3NMBA 2QQPA 3ELNA 2ZKNA 3WG2A 1K42A 2JDHA 2HWF2 5FYMA 2JG8A 4GH4C 3ZIWA 1RUC2 4ZU4A 2ZX3A 4QPYA 1HB3A 1XYPA 4L97A 2VOVA 5K7PA 4CDUA 2J1VA 3QCWA 2Z79A 5C4WA 5A3LA 4GULA 5FV3A 3WHTA 1ULPA 5F5IA 3VBFC 3LEKA 3POSA 2RG4A 5FP7A 3SC7X 1ASJ1 3DECA 4PT6A 5IVJA 1F35A 2QQUA 1CWPA 1EUUA 4NHKA 5BNOB 4K20A 1ACCA 1LU1A 2FDFA 3VZOA 2OVUA 4HOOA 1CPMA 4GJZA 3T2QA 4NIDA 3K4AA 1H6XA 1AL23 1UX7A 2CGOA 3NV2A 4Y1XA 5LW9A 3B02A 4L8QA 5IFPA 3BTXA 4QPGB 3MICA 3OBZA 2CDPA 2DCKA 3EHKA 1QH7A 1LHNA 3AZYA 3FMGA 4COYA 1PNFA 5L7OC 4EN0A 2R042 1MZ6A 3DGTA 1CAXB 4LTAA 1ZZ6A 1ULCA 3FUQA 1FOD1 2UY9A 4F3JA 1KS4A 5FRAA 2ZOEB 3VBUB 1S0IA 3ALQA 4FPJA 4Q4W3 2FDGA 2GP5A 1UXZA 4N53A 2NYYA 4IE7A 4C90A 2EALA 3IZOA 2BBAA 2HJIA 2LW8A 1LHUA 4BISA 3CJIC 1UOGA 2WNVB 3C7HA 2YU1A 2J22A 4RGGA 1U12A 1U5YA 2K0GA 4G4FA 2X29A 5F9TA 1NZCA 3CIHA 3FHQA 1LGCA 4NHXA 5LATA 1AYM1 2DBIA 3AMHA 5BXXA 3VN4A 1ZZ7A 2DUOA 3GM8A 1CAWB 2R7EB 5FO7B 3CQOA 5FTTC 3E6BA 2BV4A 1VBC2 1XPWA 1GKBA 2VQ0A 3ZDSA 3UKTA 4EWEA 3O1OA 1JODA 4AEDA 2XLGA 3WF4A 4P5HA 2QQNA 3OY8A 3AZZA 3CU7A 1WW6A 1CZSA 5M0TA 1ZBE2 2Y26A 2CWMA 3LD8A 2W5FA 2JDPA 5F2SA 3S0MA 1RUG3 1UZZA 1G9BA 5FZGA 3AVRA 2W9XA 2YZ4A 5FZDA 5FK7A 5DAWA 2IXKA 1BBT3 4DEQA 3I3BA 1I5PA 1PZ8A 5FPBA 3ZMNA 1TME2 4ES9A 5A33B 1VBD2 2QCSB 3UK9A 5F7UA 1R1A2 1NKGA 3WW4A 1RUH2 2TBVA 2VW0A 5C70A 1R091 2Y6GA 3KVAA 4WZFA 4D7YA 1DCSA 3D0SA 2V5YA 4RSUA 4QQOA 3PJYA 1YQ5A 1JYNA 1G8WA 2C5DA 2YGMA 2VGDA 2OT7A 2VMCA 2P6CA 3IDCB 1UWWA 3JB8A 1JUIA 3ACFA 4IEXA 3BKZA 4RA0A 4CUGA 3AXDA 2C26A 2VZSA 2WWJA 1A3KA 5LBBA 4RHV2 3M7AA 5DDJ1 3UJOA 1C8M2 1HB1A 1B35C 3JXSA 3ZYPA 4XJWA 4ZU5A 2UYBA 2JB4A 1PIV1 4RS5B 4R9BA 5EV7A 1Q8SA 3FLTA 1F4AA 1ZM1A 4QQPA 4W65A 1Y9GA 3OPZA 2R1BA 2A70A 1K5MB 5F6KA 3V65A 3V0BB 5J7MA 2D5HA 4AHXA 4E8CA 5C3QA 1O4ZA 3T4VA 3ZSJA 2VVDA 4IEQA 5J37A 1H8TA 1VAKA 2R072 1JOBA 2QBXA 5A32B 2GZWA 4QKBA 5FY5A 2I2SA 1VIWB 5FXVA 2H6BA 2BUKA 2DTWA 2PMWB 3KB5A 4S2FA 3V64A 3WDTA 4LOTA 2ADDA 1AYN1 4IEVA 5FZFA 1MZEA 3MFAA 5SV5A 2BNMA 4D7TA 1AR82 5LK7B 4XFBA 4XHXA 4LBQD 4YVSA 1UOBA 3ZVXA 4HG6B 5G05L 2XJTA 1VRH3 3RJRA 3VHOA 4MLOA 4URAA 4RGKA 2H0BA 4TZDA 4A42A 3ZSLA 5ABJC 1MQTC 3KHCA 3OPWA 4XFHA 3U14A 3VBOB 4GWIA 5EQUA 1HDKA 4DMIA 3RNSA 3KWVA 2RS31 4DXTA 1UYZA 3MPBA 4LMFA 4QKDA 5AFEA 3LOBA 1SEFA 1PO23 5JXIA 2CSGA 1WCDJ 2FCUA 4Y1VA 5KHIA 2AREA 4QHOA 1ZZ8A 1YHFA 1LOFC 2O1QA 5LASA 1CAVB 1HJGA 4RQPA 5IHRA 1MEC2 2VZTA 2XJRA 2IXCA 1G86A 3F95A 4CSWA 5CFCC 4D3WA 5I8SA 3SKJE 3GJBA 2VPVA 3WP3A 3K2OA 1YYNA 1DYPA 2WO2A 3KM5A 4AFDA 1OUSA 4AE2A 1RUE3 1D4M2 3FBYA 4UFLA 3T30A 5JZGC 4ORFA 5LY2A 3RZKA 1RUF2 1W2NA 2YGLA 3H3ZA 5F2WA 4BM8A 3FX3A 5GLUA 3CMGA 1JYWA 3QOPA 4FT8A 2QTWB 4NO4A 1GSLA 3OUHA 3O1RA 4LHNA 2EXIA 5DUXA 5JUVA 2D3RA 4KG0A 1PVC1 1UU4A 1H1MA 2O0OA 2OPWA 2WUHA 3A4UA 4LBQB 3VKLA 2W1QA 4XQDA 3BU0A 3GHMA 4Z2AA 4MV2A 2WA4A 1IQAA 3WNNA 4AI2A 5JDBA 5FQ0A 3LGRA 2WBKA 4Q4X1 4YSFA 3OYWA 2JEMA 4GMP1 4Q4V3 3KQRA 1HXS3 3T3YA 3O1SA 2CV6A 5IVVA 1OH4A 4CEWB 2JX9A 4M3CA 4MXWB 1YEWA 4IEZA 4LXLA 5C71A 2QQMA 2VXJA 4L9BA 5JWPA 3AP9A 1DQ6A 2RDNA 1SMVA 1ENSA 4QAWA 3R6SA 4O9EA 2E32A 2NMOA 2FMYA 3BODA 4GMP0 4XJZA 4Y4RA 2WWUA 3UYJA 2XL7A 1SLAA 4FPLA 1V6KA 4Q4Y2 4Y20B 2VZ1A 2QZ3A 4HSJA 1VBE3 4N53C 2PLV2 2VZQA 3J8F2 3FBMA 2BDRA 4IEYA 2P2KA 3AKSA 2DCZA 4QD2A 2XJVA 3OBTA 1RINA 3AP5A 3UKVA 1OLQA 2WAAA 4XE9A 2HWD3 4FTSA 2CAUA 3K46A 4MGTA 4ET7A 2Y6LA 4KWLA 1US3A 4NRQA 4YNIA 2ERFA 4XF3A 4FTBA 5FYYA 3U07A 2CDOA 1DLCA 4K21A 1BLZA 4XURA 3BYWA 2PHWA 1GQGA 1GMMA 5EJ1B 4LK7A 4Y22A 3E1F1 1XE8A 4P5YA 1LESA 1PVXA 2W68A 3POJA 4LO7A 3HR9A 4IL7A 1FMD3 3DV8A 3ACGA 5FPVA 2SBAA 4AK3A 1LENA 1OPOA 2ADEA 3L2HA 3QH6A 4H3WA 4CDQB 4EZ4A 5JOWA 5FPZA 1PM4A 3JCIA 5E89A 4AEDC 2PN5A 4QGMA 3BPSA 3SH3A 5FYUA 2FHRA 1AR93 2GAUA 4MH0E 1KGYA 2GC3A 2NMNA 3CKHA 2FZ2A 1OD3A 2X5IC 1WUVA 4IXLA 3WDYA 3MUY1 1QU0A 1W9WA 1WKYA 4URTA 3HT2A 3WOGA 1BQPA 1AL22 5DAQA 1ODMA 1YQCA 3FFZA 1V6JA 5J48A 2ARXA 3OGRA 5KXCA 1KXGA 2YMZA 5BNOA 2WT0A 2GP3A 2XONA 4ISQA 1DGWA 1KEXA 3RDIA 4BDVB 5GALA 3C2UA 4E4DX 4DO0A 3UKNA 1OQDA 2HWE3 2AC1A 4XTMA 1VMFA 3WDUA 4E2QA 1CD3G 1V00A 1HB2A 1CAXA 1U5ZA 3OCPA 1W6NA 3HBZA 1ZZBA 1HV1A 1MVQA 2N7GA 3S7EA 3T09A 5FYVA 2PQSA 2VCCA 1Y3TA 2VBPA 5IATA 2XL9A 1NYWA 4BMEA 4JGYB 1TNRA 1JW6A 2XG3A 1FYUA 1VBA2 3Q8FA 1S2KA 3ACIA 3N9LA 3ZFGA 4AQSA 5T50A 1J58A 4A3XA 2JXAA 3H9AA 4O7XA 1UIJA 3BN6A 1VBB2 3B3QE 2DCYA 2UU8A 3LDKA 2GMMA 1NOVA 1PO21 5T5LA 4AXOA 4B4PA 1H8TC 4IW3A 1NZIA 1QIQA 1U5XA 5DN2A 4MZUA 5D1IA 4HKWA 2XBO2 3CBNA 2PHDA 3VBRB 3W9AA 1O8SA 4WVWA 2P5BA 2JE7A 1FT9A 1IS6A 3GALA 2JIJA 1RUG2 4HK9A 5CKQA 3N7JA 3WQBA 1UW8A 1HQWA 3H7JA 3C7EA 1RL3A 3EB7A 3GGLA 1RUJ3 2XHKA 3GZTB 1E5IA 4L92A 1AJKA 1N1TA 2C24A 3WF1A 4YVSC 1TZOA 3SQOA 2Z2SB 3W5MA 4BYYA 5HCHA 2QZ2A 4JTNA 5LBEA 1EUTA 2CWSA 4MHRA 3MLKA 4S2HA 1MVEA 5A7SA 5JCTA 1XXNA 1SLBA 5A3UA 2VOWA 1UD1A 1LJ7A 4KH9A 2V4VA 4R9CA 3HQRA 5J3UA 3NNLA 1IPSA 1J3RA 3EQEA 3PUAA 1GFF2 1L7RA 1B09A 3ZN6B 2J1UA 2MEV3 4ISRA 3HIFA 1DZRA 4DXRA 1X7NA 2ZA9A 3JQWA 1HRI2 1S0EA 5JPNB 3RG0A 1H9PA 4LORA 5FZOA 1C28A 5BNNB 4MOAA 3U0ZA 2BGOA 2GC2A 2EIDA 4UFMA 1MS0A 2A6ZA 2CGNA 3N9MA 1LECA 3AMPA 5BNPB 2VMDA 4LK6A 5D21A 3FZ3A 1GICA 1W2AX 2B46X 1H0BA 2WAOA 4ZY9A 2E6VA 4UWDA 5FYZA 3TAYA 4D69A 3N36A 5IUQA 2E51A 2WZR3 3VKNA 3JD71 5CFDB 5JMOA 2ORXA 4RS5A 5A6ZA 1YI9A 3FUOA 2BW8A 3FHIB 4J1WA 1LU2A 4E4HA 5JR2A 5IFTA 2WFF2 5FZ6A 5FWEA 3LEMA 4PBPA 4AOCA 2A3XA 2F4PA 4AGVA 5IVYA 4QKNA 2RS11 1WZXA 4ZPIA 4QWNA 3USUA 3AJYA 4K8RB 4MVTA 3VBSB 1YCIA 2WWSA 3FC0A 3FE5A 1NCRA 3GCXA 4IESA 1C3HA 1MPXA 3U37A 4XCBA 2E63A 3ZKUA 1R082 2IUWA 1W8HA 3VZMA 3AXEA 3NW4A 4PIYA 4BQ4A 4BCUA 3KHBA 3S5AA 2JDKA 2FCVA 4P9XA 1NUKA 5A7WB 4YZ2A 1QJX3 4QX8A 2HEVF 4MYEA 4IE6A 2IC1A 4NOTA 3UJQA 3HMYA 2YDEA 3ZSKA 2PYTA 3VBFA 1GZTA 3INAA 2XJPA 2YPJA 4YW6A 4EYUA 1K3IA 2C1FA 4C0BA 3VUOA 3WZ1A 3ST7A 1QOTA 1XNAA 2D6MA 2ET7A 2YYOA 2IVIB 3W5NA 4K3UA 1XQNA 3FLRA 2GNDA 3TN92 2VNRA 4QDQA 5AFBA 3KZ4C 2A3YA 3OPTA 2PXJA 1UX6A 3PUIA 4JRLA 1UY1A 4LKSA 4R52A 3KCCA 1XYNA 4X6RB 2YBSA 3I2HA 1FPN3 1EAH3 4WVMB 4CEYB 3Q8BA 4S2DA 1OKQA 2K46A 5IJRA 4Y5SA 4ATFA 3SCFA 4QPWA 1GWKA 1UOFA 3H1YA 3ZOIA 4PDWB 5FDBA 4DUXA 4OUEA 5A80A 3MW2A 1GR3A 4K6BA 3WX5A 5HCFA 1RUE2 4I2OA 4KI5M 1WA4A 4AHWA 5HCBA 3POGA 3O1UA 3Q8EA 4OI1A 1ZRCA 3NSTA 1K12A 4W6WA 2G9ZA 4CPBD 4FP2A 1KDMA 1ENQA 3HT1A 3PUHA 1LCLA 2ZX2A 4JGZB 1WMXA 3VKMA 4Y24A 1RVF2 1NCQA 3CJIA 4N9IA 4P9YA 3WT3A 3RYPA 2OA2A 2NM1A 2RR11 1WCQA 4JVAA 3K77A 2HWC2 4CDXB 3MGUA 1O3SA 2VQAA 4AHYA 3T0BA 3RZMA 3D4KA 3NO8A 5T52A 1H9WA 1Y9QA 2OZ6A 2CGPA 2QDNA 2VL4A 4TLFA 4TXWA 5JPMB 2ZX0A 2V09A 4I09A 3P3NA 4AVVA 3M2MA 4P9IA 1ND2B 5HXVA 5G04L 4AEKA 5AVAA 3POFA 2WO3A 4CRQA 2Y60A 1H2KA 5BNQA 2NQYA 5T5OA 5BNOC 2BPA2 2Q4SA 2WZEA 2R6QA 4MXWA 4I3GA 4BU2A 4XAEA 2ZZQA 3ZXAC 4Q1RA 4KWKA 3ES1A 4QPGC 5FYTA 4AW7A 4Q26A 2W95A 1Z0HA 1NT0A 1N1VA 1BEV1 4OI4A 4X8NA 3KSCA 1UZVA 1UL9A 4WVZA 4OLLA 2B8MA 1QJY2 1X8MA 3T1LA 1OXCA 3R4DB 4Y20A 4GWJA 4DB5A 2YBKA 1X9TA 3VBUC 1AYM3 3UETA 4YM1A 5FJKA 3WQ7A 3ZXGA 2Q1FA 1NXD1 1RUI1 2VZOA 3NJYA 4FPYA 1J83A 3SMHA 5AC92 3W58A 1N3PA 4NPRA 1XBFA 4QX7A 3PTYA 5FOJB 1Z78A 5DUVA 3J4UH 3WLUA 1MACA 4BQXA 2BGCA 4LA2A 2ARCA 4YZ4A 5DMYA 3P6BA 3GF6A 5FREA 4YW1A 2WNVC 4ZS2A 1F5JA 1B35A 4CCLA 4A6SA 2BOJA 3QLQA 4XUQA 4QDRA 1GNHA 3FJSA 3CL1A 4W4ZA 3NVCA 4DEVA 4N43B 3EXUA 3GHNA 1U0AA 3IPVB 5FYCA 3R4SA 1ALYA 2E7QA 5IAXA 3RVHA 5A7QA 1GZWA 1REDA 1W9SA 2IFWA 4AQTA 2BRTA 1RUC1 4TWTA 1W99A 4LO6B 4YRDA 3ACLA 3LB9A 1R093 4FPOB 1UQXA 1UY2A 4EN8B 4QQHA 5L73A 2WSVA 2ZKLA 2X53S 5DUUA 4AVSA 1OF4A 1XNCA 4A7YA 4RL7A 2WS91 5I0TA 3WUDA 4S2GA 4OQ9A 3VD4A 1R1ZA 1Y43B 3LEGA 2VTXJ 3RYKA 4PF5A 1BCXA 4DINB 5FZ8A 1LB2A 2P34A 2YFUA 1GP4A 2ENRA 2D6LX 4ZS3A 4LBNA 4BK4A 4D94A 2OIIA 3AZVA 5DDJ3 3HEIA 3RPQA 3O1TA 3DPRB 1CJDA 1ZNPA 3IDEA 1PIV3 2WO7A 1H4GA 4XYXA 4E4ZA 3R0RA 5JXHA 2XDVA 1RGSA 5ABJA 1O5UA 4UXAA 3WP5A 2D6KA 5FPXA 1OFNA 2W87A 2DCJA 4DXZA 3TOJA 4PCRA 2VZ3A 2IXIA 1DZQA 1V0AA 4AFAA 1SLCA 2B42B 3POIA 3H1MA 3H8OA 1ENXA 1ODNA 2PAKA 1ST8A 4NPMA 3POEA 5FCCA 3PTRB 4OUMA 1MS4A 4RS5C 1BYHA 1DGLA 1LOEA 3SCGA 3WNPA 1V9U2 4DFSA 4L11A 4GZ9A 1JU4A 4OFGA 5CFCA 1K5MC 4TTGA 1BK0A 2F17A 3OJBA 1AYN3 1W8WA 2RM22 2O14A 4UW6A 4WM7A 5C3SA 4XXAA 2Y6HA 2VXRA 1D0HA 5LBCA 5IYYA 1PO13 4LUMA 1EAH1 1GQHA 1H1IA 3PURA 5IK4A 3LF7A 3U4SA 1HN0A 4Q2FA 1W6PA 2PAMA 3I7DA 1H30A 1UPSA 4LBMA 5FBJA 1PMHX 1VBC1 3M3OA 5T3NA 5C8CB 2EXJA 4LO8A 4Y5Z0 3VBRA 4D6QA 3HWJA 4B3NA 3RSJA 2EXHA 2X09A 2RS33 2ZGPA 3PIGA 4QB6A 4U36A 5LWBA 2RDSA 4AZZA 4NIHA 1QDCA 3GBGA 1ULFA 4NJ4A 1ZBE1 2VQUA 3WCRA 1JYVA 3ZFEB 5IK8A 5I8TA 4B8EA 5DUWA 4XQ4A 5A3NA 4PQQA 1JUHA 3HOBA 3ME2A 2ZAAA 4YGCA 3PHMA 5EWSA 2DBNA 3N7KA 2IFRA 5J09A 2VZVA 4RFT0 2MEV2 4XAAA 4AR2A 4FPCA 1VBD1 3I59B 3X29B 3K3OA 1R1A1 4W8JA 4ATEA 1RUH1 4Q1PA 4YVWB 3VBOC 2VMEA 2XH6A 1ZZ9A 2WDBA 4Q0UA 4YW7A 4DNYA 5DZGA 1W6OB 1O3TA 3GYDA 5LBFA 5I8YA 2QQIA 4HN0A 4M01A 2G9GA 2VE1A 4IE5A 3UESA 1GWLA 4B7KA 1UO9A 3M70A 4QGLA 3LFMA 3MIGA 5ERLA 4I02A 1STMA 2ZBJA 3VD5A 4BQ1A 4CA9A 5BNNA 1S4CA 1JU3A 4RHV1 3AP7A 1C8M1 1W9FA 4C91A 4XHBA 1PVC3 2VECA 4UBHA 2WFPA 3LEIA 3WF2A 4D6SA 5ACA2 4FXGB 5L19A 1JYXA 5FLJA 3DXUA 5GLTA 3ITQA 5F32A 1O5LA 4JTOA 4ZZ8A 4Q4X3 2VTFA 1NCQC 4HSLA 4NWVA 4AHZA 4GMP3 1PZ9A 4MG2A 5FZ3A 1QQP2 1URXA 4H55A 2E26A 2E31A 5J1XA 3VDDB 4K9SA 3AMNA 4LQRA 5FPLA 2PFWA 2YROA 4KNCA 2R071 4X6QB 1D2QA 3PNAA 2E7AA 5A7NA 1RUOA 4MGIE 2WYFA 5HXMA 1DQ0A 3MV11 4HKOA 4YGDA 5KBFA 1YNAA 3ZYHA 4CDWB 4BQ5A 2BQPA 5LZ6A 1PMIA 4HLTA 3K4DA 5JOYA 5FZIA 1AZDA 1AR81 5JOZA 3MLLA 3CNAA 4OYUA 5LA1A 4K8FA 4I3PA 2E53A 1SCRA 3T2TA 1OI6A 5SV8A 1MR5A 2X5IA 3PVBB 4GB32 1YLLA 2DVAA 2VAUA 4P14A 4ARYA 5CA6A 2VU9A 3VHPA 2P3KA 2ZX1A 4XMAA 1X9PA 1ZRFA 2EVXA 3EMRA 1FPN2 5F39A 3IIAA 3ZSMA 4LNVA 3WNLA 3K51A 3V0AB 4Y5TA 1PGW2 4QXCA 4CVUA 2DURA 4JDOA 5ANQA 4GXLA 3MZHA 5F5QA 1RJ8A 2ZABA 3JBG1 3SITA 1OA2A 3LPGA 3WW2A 4XCAA 1QKQA 3NV4A 2BYVE 2R16A 3MIEA 1Q8PA 2WLPA 4XUTA 1AHSA 1MEC1 4CEYA 2BJSA 3MDPA 1K45A 4NRPA 1GBGA 4OQ8A 3ZMOA 2LM3A 1WW5A 4PDWA 5CG9A 1UYPA 2ZS6B 4YW3A 4XPVA 4EJRA 2GN3A 3AKPA 4XFAA 1UPIA 2VOTA 4YYOA 4BOWA 1GWMA 1ASJ2 2W1UA 2XWBB 3BVCA 1AX2A 4GIQA 3WEZA 2UY8A 2Y6KA 5I0UA 5GKAC 3KCXA 4YGEA 3VD3A 2RS52 4OHVA 1JBCA 1V6LA 2PELA 1D4M1 2WZPP 4P08A 5GLVA 2W39A 4AFBA 2DCTA 4FPEA 3WV6A 2CAVA 3AZXA 4JGZA 2QQJA 5EHDA 3TWIA 1YXWA 3RZGA 1UKRA 2VQTA 3N3HA 4RR3B 1YQ8A 2HH9A 3BB6A 3VBHB 4CDQC 2QQVA 3U4XA 4KU7A 4QPIB 1SHWB 4MX3A 5I0DA 2B5HA 3G7DA 1QXPA 2VMFA 3NWKA 4HPKB 4YM2A 1S0GA 4LOSA 4CCJA 2X10A 1FOD2 1RC6A 4UFKA 1YO8A 3CDZB 1J3QA 3ZN5A 5EYYA 1NQJA 1VP6A 4LO4B 1W0OA 2PHUA 2NPIA 4JAAA 4E2SA 1ND2A 3TRSB 3NAPB 4QX3A 2I45A 4QQ2A 4XZPA 1AR62 4M4RA 4F7ZA 1UIKA 3WW1A 5C33A 3PMEA 4QX1A 1JS9A 2E9QA 2X05A 2ZGTA 2VH9A 4YPJA 1N3OA 3WP6A 1PO11 3H8UA 4JRAA 1AVBA 1T6GC 3O5SA 4XDQA 4DZGA 3R4UA 1DYOA 2GU9A 1Q5OA 4HKLA 5FYBA 3WG3A 4GA9A 4PIZA 3ZPYA 1ZBA2 4XBLA 3Q9OA 2ZGNA 4LITA 4M0HA 4E8DA 3NL1A 3T0DA 2RJKA 4EE2A 3VDAA 1C1LA 3M3IA 2EAAA 3ETQA 4Q4Y1 4QXKA 2OQ7A 2YUEA 1UYYA 1ZA7A 1IOAA 3SEEA 1G7YA 3J8F1 3NV3A 4HFSA 4NWWA 4AEMA 1ZRRA 4E27A 4JDMA 1ND3B 1H2LA 1UY0A 4JGYC 5F1RA 1IPKA 3U10A 1N47A 1SBDA 4L0PA 4MGYE 3ZR5A 4PI2A 2ZTNA 1OQEA 3D6EA 3OUIA 1BHGA 3GJAA 1CZVA 1HRV1 1H1AA 3D5OA 3ILFA 4QHBA 5FY8A 4WM7C 5HV0A 1YI7A 3I2IA 3DYOA 4HK8A 1COV2 4M0NA 4QMAA 4XETA 1ZYBA 1BXHA 5DABA 4IUGA 2HWB2 2JDZA 3HBKA 3TEWA 2ARAA 3DN7A 1X33A 1R092 4A7ZA 3FFQA 4QDSA 4KWUA 4N7IA 4BLIA 3WCSA 2GC0A 4COZA 3H8XA 1GV9A 4QU2A 4WV8A 3GXUA 3VBRC 1S0BA 2FDHA 4KU8A 4Q0SA 3H7YA 2OW4A 1XSRA 3MI8A 3VZJA 3MEPA 4CP9A 4AVCA 5HI0A 1MS9A 5KXDA 3ZKYA 2D98A 2IXJA 3IKWA 3PU3A 4DIQA 2W1WA 1ONAA 5DDJ2 3S7IA 5C3RA 3H3LA 1VB4A 3NJXA 1FAYA 4TYSA 2J1EA 4G9SB 1DLLA 4UFIA 4LEJA 3U11A 2XXZA 3OBRA 4TLGA 4W6YA 3S30A 3J7HA 2JDAA 1UY3A 3FWEA 1QF3A 1PGL2 1W8UA 1UCXA 2GSYA 4AYUA 3RI9A 1W8TA 1W6MB 1DFQA 4JHTA 3DPRA 5FXZA 3WNMA 4LT5A 2A6WA 3JD73 4FOYA 4AVBA 4OMDA 2AEYA 2JIGA 3ZFFB 4LKEA 1PMJX 3LAGA 5TSWA 3OD4A 1QJU1 5L36A 2ZGQA 1YFXA 5DPNA 2P3YA 5KC5A 3R05A 3JZVA 2VOKA 4JDNA 5BNNC 3I49A 1EV12 2F4LA 2RS13 5F6LB 1CR7A 2V73A 5JIAA 1H6YA 2WQ4A 2WQ8A 1Z7S1 2KXLA 1JZ5A 5BNPC 2VMIA 1GZCA 3LA7A 4AGRA 4EZHA 2KR2A 1YQ2A 4JQRA 4P9WA 4W6XA 4BPZA 1JYCA 1VBA1 3BGAA 1ZREA 4CCKA 2MHFA 5CFDC 1W6QB 1HLCA 1ZA4A 4G3YC 5FMOS 1CAUB 4GWMA 2BZDA 5A70A 1OA3A 1VBB1 2UWBA 3E5QA 1C57A 3LCPA 3VZNA 4HBNA 1WBLA 4IV3B 1T6BX 1NE4A 2FQPA 4Y1YA 4HVQA 3SNMA 5IK7A 1D4VB 5FY1A 1YJLA 4GQ7A 3VBSC 1IHMA 2RS32 3WXPA 3TEXA 3UNPA 2VUAA 1IQDC 2XBO1 4MGZE 5FMCA 4ASKA 2LTNA 2QE3A 3VGIA 1KD7A 3AP4A 5C8CA 5FIXA 1GU3A 3MUZ1 1GYKA 1NX9A 3DYMA 5FP8A 5FZHA 3RWKX 5I91A 2XJSA 3AKRA 4DUVA 1UOJA 4Z2WA 1DIWA 1VJ2A 5GZGA 2JENA 2YC4A 3LQCA 4JHZA 4E4SA 2BVBA 1O7FA 1FATA 3T4HB 1L7LA 2OKXA 2PHFA 4A45A 1C1FA 2Y0IA 1A8DA 1C8NA 1LNSA 3RMXA 1MS8A 2OXBA 3M3EA 2LROA 4YFZA 2E33A 1OURA 3IWZA 4Y33A 3RYRA 4ASMB 5KXBA 1HRI1 4LKDA 2WN3A 2XVKA 3KGLA 3KGZA 4XACA 2W1SA 3KCYA 5FYSA 3ENRA 4QPGA 3UL2A 1SPPB 4CEYC 2UWAA 3EYPA 3HPNA 4Q4W2 5CAZA 5DZEA 4HONA 1BMV1 4YZ1A 1F9KA 1S0CA 2RR13 1NG0A 1FNYA 2OPKA 4PDWC 2PA7A 4EN6B 3POYA 1AL0G 5IVBA 4GKXA 5F3EA 5C5UA 1OBNA 4PLOA 3GNEA 4BQYA 4WVVA 5CKMA 2HYXA 2P3JA 4EQVA 4JQTA 3VBUA 1C4RA 4NAOA 3WF0A 4YG3A 4Y1ZA 2VCAA 2ZGOA 3HAGA 2XLFA 2IXLA 2VMHA 4CTEA 3WG4A 2WFF1 4QM8A 4XDOA 3NQHA 3OEAA 1APNA 1PK6B 2W2IA 3B7MA 4JGZC 2ET1A 2H6CA 4KQ7A 4YW2A 1MQTB 2WNVA 2Q0AA 4YG6A 3ZYGA 4BQWA 4BHPA 3U75A 1A78A 1RMU1 1QOSA 1TE1B 3WNOA 3ZXDA 4CEWC 3DCQA 1IKQA 2C9AA 4K7JA 1R081 3J7LA 2W3JA 5A1AA 4BXFA 4YM0A 4XFCA 3N7LA 4LE4A 4LUKA 2OQ6A 4IGOA 2WNUB 1CAWA 4LIVA 5H9QA 2DF7A 5JAXA 1JZ4A 5A6XA 1ND2C 1BEV3 1VAMA 2A5ZA 3B00A 1C5IA 5K0UB 2X8KA 2CTVA 3ZSEA 1SBFA 5JXJA 3NV1A 4N8MA 3AKTA 1BBT2 3ZXKA 4LR4A 4PBOA 3LOIA 3H3UA 2VBBA 3IAPA 3B9CA 3RI8A 2W91A 1RUI3 2QUOA 4ASLA 3THDA 4OHWA 3ZYJB 1UAIA 2ZGUA 4OHZA 3TN91 3UGHA 4UYBA 4CXWA 3V0AA 1W9YA 2R49A 1SZBA 5A33A 3KV5A 4CXXA 4Q0PA 2TNFA 1WW7A 3O0VA 2JG8B 5A3OA 3SEPA 1EYBA 2EXKA 1T2XA 3J7MA 1LKNA 4HZFA 5FYHA 4CDUB 1VPHA 1U5IA 5C4WB 1LGNA 2BNOA 3DEMA 3DF0A 1D0GA 4XF4A 4RGAA 3LDRA 1RUC3 3VHNA 1Y7BA 4YZ5A 4ZZ5A 1O4TA 5KHJA 3MPPG 4BXSV 3RQ0A 3THCA 5EIYB 2ILMA 1KRIA 5EYXA 3M8LA 4FFIA 4LA3A 4MO3M 5FP9A 5FZ4A 4OHXA 5IW0A 4XZUG 2Q8CA 4A44A 3OTFA 2WS93 1NAEA 4IV1B 4N43C 1RVF1 2QQWA 1V6IA 3E6CC 1K5MA 1WBFA 3V0BA 5LEJA 2FCTA 2QKDA 2C9KA 4UT5A 5FAXA 1W03A 2SLIA 4RR3A 1W8ZA 3F2ZA 3I8TA 1F4HA 2VZPA 2R061 4QPIA 5ISLA 4ZKTB 1UYXA 1H4HA 4YW5A 1A34A 3WVJA 4HPKA 3B01A 1IS5A 3ZX7A 4WM8B 2RMU1 5A32A 1V6OA 1OUXA 2CL2A 2VUJA 4FCAA 2R043 3AFGA 1OA4A 4Q0VA 1VRH2 3RZZA 5I0SA 2KM2A 1S2BA 1GP6A 1NLRA 3I3QA 1A8MA 2Y33A 5FFOC 1W9TA 1BJQA 1F31A 3DPRC 3J9SA 1W2OA 1ULGA 2W47A 5JI7A 1JYTA 5K8SA 3ZYBA 4P9GA 1PO22 2HEWF 5I0RA 5K4LA 1POQA 3OSDA 5KHKA 1O4YA 3BTYA 3VBOA 1QJY1 4YWAA 2D6NA 2J7MA 1OT5A 2W46A 4Q5OA 4Q8KA 3DKQA 3VL9A 1QWRA 3I2DA 5FUPA 5A6QA 4DXSA 3NRUA 3OY8B 2VBDA 1WMFA 5AC91 1E5SA 5H9RA 2A3WA 1CAVA 1ND3A 2A6VA 2UYAA 3H42B 3FL7A 1VBC3 1O91A 4GKYA 1RHI1 4I0AA 4M4PA 1W39A 4QM9A 1AXZA 3MFCA 4OZOA 1YQ6A 4XDPA 2WN2A 3ZDVA 3H8RA 1CQ9A 3IM0A 3W59A 2BGPA 1KJLA 1ZBE3 2G19A 2WRAA 5H9SA 3KLSA 1GQPA 1VE0A 3MIBA 4PI0A 2AEZA 3AC0A 2Q8EA 1DG6A 3AVSA 3S57A 4FTEA 1OHFA 2EA7A 1S0FA 1GOGA 1RUD1 1BZWA 1VBD3 3PVOA 5C8CC 1VRBA 1R1A3 2YU2A 1W06A 1RUH3 1YJKA 2B4KA 2Q1MA 2IVJA 2Y8KA 4XEZA 3OGSA 2LUWA 5FZ0A 4CU9A 4F8AA 1REEA 3MYXA 1ENRA 1W2UA 2GALA 4UFJA 4Q4V2 3T08A 4PQ9A 1HXS2 1ZX5A 4LBQA 4MGKE 3DKWA 3ZFEC 5KHGA 5A7OA 3WDVA 1CX1A 2PTMA 1TQ5A 2AH2A 5CKNA 4BWOA 3BIEA 3SCHA 1L7QA 4CCMA 1SDDB 2YV8A 1WMEA 1OH3A 2ZEWA 1EY2A 1XE7A 1E5HA 4CP1A 2FBEA 4FPGA 4RHV3 1WGPA 1C8M3 5FR3A 1NQDA 1NY72 2A1XA 1GNZA 1W0NA 1X36A 4CEWA 3O1PA 1ZRIA 2ZGRA 3PMSA 1W6MA 5D8AB 1HQLA 1W05A 3ZFFA 4Y26A 4Z82A 1POV1 1O59A 1VBE2 3B69A 1BK1A 1DBNA 1QH6A 2VNOA 4IE4A 4Z8BA 3ZYIB 5HV4A 1CGPA 4B1LA 3A23A 2YY1A 2RV9A 2HLEA 4AWDA 4JV4A 2HWD2 1TMF1 1N1YA 2EICA 1AR71 2R073 3JB4C 4XVHA 2WT2A 1FI2A 5FP4A 4KL1A 5LA2A 1LTEA 2DU1A 4YVSB 2XR4A 4HETA 4IGQA 4AVAA 3O12A 1W6QA 1QEXA 5FMBA 3H0OA 2A73B 2NZ9A 4OULA 2ZAHA 1CAUA 3M1HA 4OCTA 2QQKA 4Q0QA 3TB0A 2RM21 3SLIA 4LJHA 1AR83 4UFHA 1PX4A 2D3PA 1FMD2 2PAEA 2ZPXA 4FFFA 5FYIA 3M4FA 2VCBA 2YPDA 3SISA 3VDDC 1I6XA 2VO5A 1NA1B 3M3QA 2ZHMA 4Z1VA 1G9DA 4OZXA 4NHYA 3MIFA 3ZO0B 1AR92 5F8PA 3HN3A 3IT8A 1SG3A 4RQPB 4NIIA 4B1MA 3A7QA 1IPJA 2HWF1 4CDQA 1SACA 3NNGA 1AXKA 2XB6C 3E5XA 3IMMA 3WSOA 3KF3A 3JBG3 4R8HA 5ANNA 2ZCWA 4XILA 1R64A 4MGQA 2D6PA 3GDBA 3NNJA 3ZYRA 2DTYA 2D97A 4JKMA 1MEC3 3NNFA 3MV01 2V5DA 2CU5A 3ZM8A 4EWDA 5A3TA 3QD6A 4AI0A 2WJSA 2E7TA 3WHUA 2JB8A 5CEHA 4JC1A 4DRVA 1SCSA 4MXVA 2FDKA 2HWE2 4NROA 3E5UA 5I93A 2XVGA 3ABZA 4PHZA 5IVFA 2VVEA 3IBMA 2DUPA 2RR12 4HXCA 1TNFA 1W2TA 2OX0A 3ORJA 5FZLA 4FI9A 1LULA 3Q8CA 5B2GB 1D4M3 2OZJA 1SLIA 4GD4A 2XUEA 4INDA 3WNKA 1RUF3 2R041 3POWA 2VW2A 3OUJA 4QB1A 5CNAA 3ETPA 1FV2A 3JQXA 1VLNA 3SHRA 3MF9A 4MHUA 1EP0A 1RYYA 1WWYA 1PZ7A 2DU0A 4UW4A 4C1WA 4DY5A 5FQ0B 3DXTA 4XJUA 4XXPA 3OYWB 1G6NA 5JLVA 3VV1A 3VD9A 1DQ4A 4CZSA 3WDXA 2AUYA 2VMGA 2VUCA 3KMHA 4YG0A 1W8NA 2WSUA 3W21A 5A1FA 1LOGA 1UXXX 1DQ5A 4JGYA 2CYFA 4NE9A 1JHNA 4ITCA 5LCWL 1SQ4A 2WABA 4R4XA 4FOQA 5D2AA 3ZXFA 1QQP1 1SFYA 2VC9A 2Z69A 3OG2A 4FOWA 5GLZA 5CIRA 4C8DA 5C3PA 4RR3C 5E1RA 4H7MA 5C9AB 1OLME 3VBHC 3AK0A 1BEV2 1D2SA 2LALA 1OMIA 3KT1A 4QPIC 3AZWA 2I74A 4AI8A 3BCWA 3QACA 1WCSA 5FKBA 3KT4A 2AYHA 4U2AA 2W92A 5F3IA 5IVCA 1RUJ2 4OMCA 4HT1T 5GZDA 4W50A 4XTPA 2ZZJA 4K40A 1IZ3A 3N7MA 3ECQA 2IXHA 2XPJA 4Q4Y3 3NAPC 5JMCA 1LHVA 5KWRA 5A3PA 1FV3A 5K0UA 2JE9A 1F15A 1AJOA 4GB31 5CZKA 2PLV3 2RDQA 1KS5A 2W94A 3J8F3 3I3DA 4FFHA 3WG1A 3AB0A 4B4QA 4O9GA 3N9PA 5CG8A 2XGXA 4TN7A 3KF5A 4XUOA 4Y22B 2G9FA 2A6YA 3WQ1A 5J96B 3S5QA 4IEPA 1PGW1 1TME1 4HVRA 1W28A 4YM3A 4AAPA 1LEMA 1KQRA 5E6HA 5FWJA 1HRV3 4B4RA 3DYPA 5C8WA 5IAVA 4OHYA 1WW4A 2Q8DA 5IT6A 4Y3OA 4BK5A 3KT7A 3N35A 5FLHA 3RGBA 3RZJA 1UMHA 3LSEA 3NKGA 3ZN6A 2BP6A 5FZMA 4ZHNA 4A6OA 1IS3A 2C4XA 1C5HA 3ROUA 4NMIA 4RD7A 4XOGA 2Z4FA 1DDLA 1ND3C 2ZGMA 3VD7A 5BV6A 1HN1A 2WZR2 4RN5A 4SLIA 1YFWA 3HD8B
chains in the Genus database with same CATH topology
3MF6A 4JCKA 5T54A 5BNPA 4ZXKA 2B45X 5E8AA 1DU3D 2RS51 4DRRA 5J98B 5CFDA 4HANA 5A3MA 1CESA 4IV1A 1YWKA 2ZMNA 1F5FA 2YC0A 5LRSA 3EO6A 3TYJA 2VOXA 2AENA 2HEYF 4EN9B 1QJX2 4TSVA 1W6NB 3VBSA 2F6BA 2ZHLA 3RMYA 1Q8QA 1ULEA 4WM8A 1QJU3 1E57A 1JN2P 1SLLA 3ZFGB 2QJVA 1AR61 1G9FA 2JKBA 3NJZA 3G6JB 4BIFA 1Z7S3 2ATFA 4CEWC 4E9KA 2D44A 2XKPA 1CIWA 4R9DA 3AJZA 4EV0A 3IDBB 1VBA3 1AXYA 1OPMA 3LKJA 4NR1A 1M4WA 4Q27A 1A6CA 3ZFFC 1ZBA1 3RS6A 1EAH2 3MIDA 4XW3A 4BMBA 1VBB3 4BIOA 4P9JA 2GH8A 1MZFA 1WLWA 1XNKA 2ZMLA 5CU1A 5T5JA 1YFYA 2ARBA 3J26N 4OI2A 1X82A 1BKZA 1ZZCA 2YXSA 3EJKA 4WVMA 1GLHA 2XBO3 5T5PA 2JICA 3WINE 1V6NA 4IERA 3B93A 3B5LB 2WL1A 1X8EA 1COV1 2DVBA 1O3QA 2WINB 2WT1A 3E97A 2HWB1 2O8OA 3AMMA 4IV3C 3WQ0A 1YRZA 2JG9B 1N3QA 3HN1A 2OUJA 1RUF1 2Z5WA 4DPNA 2FZ1A 5GJ6A 3THPA 2TEPA 1OOPB 4CDXA 2D43A 2D7FA 5H9PA 2B39A 4PJYA 1HRI3 5BPXA 2GNTA 2DWRA 2TUNA 2EIGA 4H7LA 4AGGA 3S6PA 1S55A 1YUDA 4FQ4A 4AVTA 2VG9A 2K2SA 4XIKA 3ZXEA 2AGSA 2FMDA 1LHOA 1HQNA 2W52A 3ATGA 1PGL1 4AFMA 1JOJA 4FPKA 3ES4A 1AUYA 2WNEA 2VVFA 5GZEA 3USUB 1AX0A 2ZJCA 4XQWA 5D8AA 1NCRB 1QMJA 2WFF3 5K9YA 2I07B 4ZU7A 3QBQA 2BNNA 1KITA 3WDWA 4AQ6A 4R4ZA 2QVSB 4LBLA 1G9CA 1AYM2 1Q56A 2NP0A 2ETEA 2ZMKA 4XF0A 1EV11 1LOBA 2PHRA 2R1DA 1WLCA 2ZGLA 1REFA 2W0XA 1RMU3 4GH4B 2OYZA 2PLV1 4LBKA 4OVEA 1R083 1WLTA 2JJ6A 4YARA 1XNBA 1F8VA 3SH5A 2DYCA 3VBFB 3GZAA 5DG1A 1DZTA 1PK6C 1DF0A 3E6DA 3CF6E 4XJ8A 4MUVA 4PLNA 4Z07A 4HL0A 1BVP1 5GZCA 4B29A 3APBA 1NA1A 4B7EA 4N43A 3DUIA 3IPVA 3JBG2 4OUSA 1DGRA 1LHWA 2WNUC 3TN93 1X50A 5L7OB 4CP2A 3PJQA 1HIXA 4I01A 5JVVA 3OD0A 2DVDA 5K0UC 1RB8G 1KFXL 4EN7B 1J3PA 4IEOA 5E88A 5HBAA 1WCKA 4AI1A 1AL21 1XYOA 4Q29A 5LK5A 4DS0A 2GNMA 4LLOA 1PM7A 4HN1A 1PIV2 3BTAA 2WQZC 3WW3A 3VZKA 3SXWA 4K1YA 1V70A 4AQ2A 3CJIB 1NCQB 1Q8OA 2BTVC 2AZ5A 4LULA 4N90A 1ZVFA 1OLRA 2EAKA 5LRRA 1RTVA 4A2UA 2JG8C 5CBLA 1YIPA 4Q4W1 1NXMA 3MLJA 4CDUC 1RVF3 3A0NA 4EWAA 5C4WC 2R30A 2HWC3 3EBRA 3UV9A 2JD4A 1O3RA 3FLPA 3WP4A 2R063 2WKKA 2H0VA 1AYN2 2XVLA 4NN0A 4E2GA 2RMU3 3B9IA 5FO9B 3L9JT 1SFNA 2DV9A 2JECA 1EPZA 1QXJA 3CEWA 4IV1C 4X8PA 1PO12 4XFFA 2CNAA 2XJQA 4HMZA 2RJLA 3O0WA 3CJXA 3T1MA 1PGSA 3JU9A 5EFUA 2W08A 1Q8VA 2OUHA 5C9AA 2Q30A 4L2NA 3D0JA 4C0HA 2DVGA 2P3IA 2ZGKA 2IWGB 2BWCA 3ASIA 1AX1A 4Q8LA 4J1XA 4WM8C 4BE3A 1LRHA 2NLRA 1RUG1 2HKXA 3TBDA 2GN7A 1CPNA 1CVNA 1QJY3 4F83A 1BBT1 2D5FA 2BWAA 3TNPB 1F2NA 4PIXA 4NHMA 4UW3A 5EXOA 3MW3A 3ZFEA 1B35B 1HRV2 5EZWA 2GMEA 5AC93 4LLFA 1RHI3 4AFCA 3K48A 1FX5A 1GZWB 3I59A 4NHLA 1CX4A 1Q3EA 2A75A 4QT6A 3VKOA 4YVWA 2Q1ZB 1W6OA 5JSPA 4K1ZA 1QXRA 2GNBA 2WLQA 1RUNA 1PVC2 2UURA 1HV0A 3IMNA 1N1SA 1OSGA 1SDWA 1RUD3 1UF2C 2VNGA 4Q4X2 4LBOA 2CY6A 2VW1A 4UW5A 3WR0A 4LHLA 3KS7A 3AX4A 1AF9A 3VKFC 3CO2A 1W0PA 2Y38A 4QX5A 2P37A 5ABJB 2DFBA 1OFSA 4CDXC 3P3PA 1QJU2 4I0WB 1J1TA 1GANA 2NN8A 2MPFA 3VDDA 5EJ3A 5KXEA 4OI0A 3QH7A 1YIFA 3AP6A 3KD4A 3LA2A 2IZWA 3HQXA 1XU2A 3RRDA 4FOVA 1Z7S2 1POV3 1VRH1 2XUMA 1I9RA 4CDWA 5FMOL 1KDKA 3VL8A 3LSDA 3ILNA 5CFCB 4XFIA 4N7UA 1TMF3 1AR73 4YGBA 4FAHA 4WM7B 1QNYA 5GLWA 4R9AA 1XRUA 1CONA 5D8AC 1V9U3 2BEOA 4AF9A 4CP0A 1DQ1A 2AR6A 5JSOA 4BA6A 5JZGB 1W6PB 4N9HA 3VLBB 1QY4A 1J59A 2RM23 4COWA 4NVPA 1TEIA 3ZN4A 1FNZA 4FP3A 5GM0A 4FPFA 5HCAA 4KWJA 2XLAA 5CADA 4Y4YA 1G9AA 2XKOA 2HWF3 3LZZA 3O7OA 1LR5A 1RIRA 1RUE1 1JXNA 2KA3A 4J6GA 4FBFA 1FXZA 4EROA 4WBBA 2Q5TA 1JYIA 4I30A 5DXDA 1MS5A 4XBNA 1SLTA 1NE6A 4HVOA 1H8VA 4WZCA 2ZHNA 1LEDA 1NA1C 1WLDA 3GZUC 4COVA 1LOCA 1VAVA 2JG9A 2QFEA 4C1XA 2ES3A 3AFKA 2HWC1 5C6CA 1HW5A 4RQPC 3H1WA 1OOPA 1BMV2 3VBHA 2DVFA 4Q4V1 1HXS1 4BH9A 3D82A 1UMZA 4N53B 2Y0OA 4COUA 2K9ZA 3WY6A 4AI3A 3LWCA 3NAPA 2R0HA 1DQ2A 3AYDA 4UBGA 1NY71 3AYCA 2A7AA 4ONUA 4FPHA 1UN1A 2D6OX 1CJPA 3GBWA 5LEKA 1DGRN 5ACA3 1MS1A 1J1LA 4BZ4A 1WD3A 1RMU2 4P9LA 1VBE1 1JTZX 5DG2A 3WNXA 1YFUA 3O14A 5FOBB 3PLQA 1QQP3 2ZX4A 3ZIXA 5BY5A 3JUUA 2HWD1 4YW4A 2C0ZA 2DFCA 3BU7A 4AEDB 3AKQA 1QOOA 1S1AA 4GH4A 2ZHKA 1YFWA 1BVVA 4LHKA 5BYNA 2X5IB 1OD5A 4M00A 3IN9A 4XJAA 3NKTA 4XBQA 4LO5B 4XIOA 1FMD1 2BFUS 4KG8A 1HX6A 3AYEA 4GB33 1VB2A 4IQPA 5C9AC 4Z92B 2ZACA 3A0KA 3ILRA 1DYKA 1V6MA 1AR91 3BALA 2XJUA 1OQ1A 1M06G 1TME3 1NLSA 3SH4A 1RITA 2WA3A 3OGGA 5L7OA 4AEJA 5JSRA 1IKPA 1DGWX 1XU1A 4IETA 2DUQA 1KFUL 4FVVA 4FXKB 3DL3A 2WC2A 4A7KA 1VALA 3JD72 5KHHA 2HWE1 4XJ9A 3USSA 2GMPA 3H50A 1H2MA 4MSVA 1ASJ3 2ZGSA 4YVWC 1QDOA 5JR7B 4LBJA 2RS53 1QHDA 1WMDA 4V1PA 1H8TB 2RS12 1S0JA 4GALA 2D93A 2R062 2A71A 3MW4A 2PHLA 2UWCA 3BOPA 2RMU2 1IGOA 5DZFA 1KJRA 1XNDA 4KGGA 5GZFA 3TNQA 1FOD3 4FO9A 1GZ9A 1ULDA 1V9U1 3BOWA 2RHPA 3LA3A 2PQQA 4KBBA 1POV0 2G4IA 3M3CA 4KGQA 3ZXJA 2WIIB 2A6XA 4GWNA 2PHXA 4XF9A 1AR63 5IK5A 1PHMA 1MZ5A 2VY0A 1JH5A 1QJZA 3THTA 4H14A 4I0BA 4IV3A 4CYDA 3I4IA 4PLMA 1QNWA 4L99A 5JI9A 1Q43A 1HKDA 1RUJ1 2GDFA 4YZ3A 1ZBA3 5CVRA 3RJ2X 4D7SA 2PHTA 4DOUA 4CDWC 2GH2A 4YFWA 3ZFGC 3BPZA 1DHKB 3I54A 1RHI2 2RE9A 3AMQA 2BFUL 4DQAA 5AVPA 2MEV1 3URFA 2HYKA 1UZYA 5FO8B 1SBEA 3CLPA 3MIHA 1LOAA 3C3VA 2XWJB 1COV3 1H2NA 5BUVA 2QNKA 1ZRDA 4FAGA 1RUD2 1I1EA 2HWB3 4XMIA 3VZLA 2Z42A 5E16A 4XFGA 4IEWA 4IEUA 2WZR1 3AYAA 4QGNA 2D40A 5JIUA 1UU6A 3RWNA 1I3HA 4M3CE 4FSJA 2D3SA 2R0FA 3VHRA 5CB7A 5ACA1 1CN1A 4M3CB 5JOXA 3AM2A 4YLZA 4DY3A 5T55A 2JG9C 4BLJA 1QGLA 1PK6A 1PNGA 3OGJA 1RJ7A 3L2YA 5KC6A 4M3CF 1MQTA 2B9UA 5FLIA 1OOPC 2VULA 1QJX1 1UKGA 3D8CA 4QQLA 2P17A 4FQZA 1LODA 1TMF2 1AR72 1LOFA 2WNUA 2O8QA 1WD4A 4XF1A 3ZXLA 2BBVA 4Y1UA 1LGBA 1RUI2 1S0DA 1EV13 3GBFA 3PVEA 4AG4A 2EF6A 1IS4A 2Q8OA 2R32A 3V56A 3N4MA 2QDRA 3O0XA 4ES8A 1VR3A 3WUCA 1I5ZA 2MNGA 2BVVA 4LE3A 3B94A 3PVNA 1EPWA 4META 1MS3A 1FPN1 1NCRC 2B7YA 4SBVA 1UU5A 3OF1A 2GC1A 5J36A 1L3JA 5JZGA 3BIWE 2YHJA 3WD5A 5FBZA 2QQPA 3ELNA 2ZKNA 3WG2A 2HWF2 2JG8A 4GH4C 3ZIWA 1RUC2 4ZU4A 2ZX3A 4QPYA 1XYPA 4L97A 2VOVA 5K7PA 4CDUA 3QCWA 2Z79A 5C4WA 5A3LA 4GULA 3WHTA 3VBFC 3POSA 1ASJ1 4NHKA 5BNOB 4K20A 1LU1A 3VZOA 2OVUA 1CPMA 1AL23 2CGOA 3NV2A 4Y1XA 3B02A 4L8QA 4QPGB 3MICA 2DCKA 3EHKA 1QH7A 1LHNA 3AZYA 3FMGA 4COYA 1PNFA 5L7OC 4EN0A 2R042 1MZ6A 3DGTA 1CAXB 4LTAA 1ZZ6A 1ULCA 3FUQA 1FOD1 2UY9A 4F3JA 1KS4A 5FRAA 2ZOEB 3VBUB 1S0IA 3ALQA 4FPJA 4Q4W3 4N53A 2NYYA 4C90A 2EALA 2HJIA 1LHUA 3CJIC 2WNVB 4RGGA 1U12A 1U5YA 2K0GA 4G4FA 2X29A 5F9TA 1NZCA 1LGCA 1AYM1 3AMHA 5BXXA 3VN4A 1ZZ7A 2DUOA 5FO7B 1CAWB 5FTTC 3E6BA 2VQ0A 1VBC2 4EWEA 1GKBA 3ZDSA 3UKTA 4AEDA 2XLGA 4P5HA 3OY8A 3AZZA 3CU7A 1WW6A 1ZBE2 2Y26A 2CWMA 3S0MA 1RUG3 1UZZA 1G9BA 2YZ4A 2IXKA 1BBT3 1PZ8A 3ZMNA 4ES9A 5A33B 1TME2 1VBD2 2QCSB 3UK9A 1R1A2 3WW4A 1RUH2 2TBVA 2VW0A 1R091 4D7YA 4WZFA 3D0SA 2V5YA 4RSUA 4QQOA 3PJYA 1G8WA 2C5DA 2YGMA 2VGDA 3IDCB 3JB8A 1JUIA 4IEXA 4RA0A 3AXDA 1A3KA 4RHV2 3M7AA 5DDJ1 3UJOA 1C8M2 1B35C 4XJWA 4ZU5A 2UYBA 4RS5B 1PIV1 4R9BA 5EV7A 1Q8SA 3FLTA 1ZM1A 4QQPA 4W65A 3OPZA 2R1BA 2A70A 1K5MB 5F6KA 3V65A 3V0BB 5J7MA 2D5HA 4AHXA 1O4ZA 3ZSJA 2VVDA 4IEQA 5J37A 1H8TA 1VAKA 2R072 5A32B 2GZWA 2I2SA 1VIWB 2H6BA 2BUKA 2DTWA 4S2FA 3KB5A 3V64A 3WDTA 1AYN1 4IEVA 1MZEA 3MFAA 5SV5A 2BNMA 4D7TA 1AR82 5LK7B 4XFBA 4XHXA 4LBQD 4YVSA 3ZVXA 2XJTA 1VRH3 3RJRA 3VHOA 4MLOA 2H0BA 4TZDA 3ZSLA 5ABJC 1MQTC 4XFHA 3VBOB 4DMIA 1HDKA 3RNSA 2RS31 3MPBA 5AFEA 3LOBA 1SEFA 1PO23 1WCDJ 4Y1VA 5KHIA 2AREA 1ZZ8A 1YHFA 1LOFC 2O1QA 1CAVB 4RQPA 1MEC2 2XJRA 2IXCA 1G86A 5CFCC 4D3WA 5I8SA 2VPVA 3WP3A 1YYNA 1DYPA 3KM5A 4AFDA 4AE2A 1RUE3 1D4M2 3FBYA 5JZGC 4ORFA 1RUF2 2YGLA 3H3ZA 4BM8A 3FX3A 5GLUA 3QOPA 4FT8A 4NO4A 1GSLA 4LHNA 2EXIA 5DUXA 2D3RA 4KG0A 1PVC1 1UU4A 1H1MA 2O0OA 4LBQB 3A4UA 3VKLA 4XQDA 3GHMA 4MV2A 2WA4A 1IQAA 5JDBA 4AI2A 5FQ0A 3LGRA 4Q4X1 4YSFA 3OYWA 2JEMA 4GMP1 4Q4V3 3KQRA 1HXS3 2CV6A 4CEWB 2JX9A 4M3CA 4MXWB 4IEZA 4L9BA 5JWPA 3AP9A 1DQ6A 1SMVA 1ENSA 3R6SA 4O9EA 2NMOA 2FMYA 3BODA 4GMP0 4XJZA 2XL7A 1SLAA 4FPLA 1V6KA 4Q4Y2 4Y20B 2QZ3A 4HSJA 1VBE3 4N53C 2PLV2 3J8F2 3FBMA 4IEYA 2P2KA 3AKSA 2DCZA 4QD2A 2XJVA 3OBTA 1RINA 3AP5A 3UKVA 1OLQA 4XE9A 2HWD3 4FTSA 2CAUA 4KWLA 4YNIA 2ERFA 4XF3A 4FTBA 3U07A 4K21A 2PHWA 1GQGA 4Y22A 1XE8A 1LESA 1PVXA 2W68A 4LO7A 3HR9A 4IL7A 1FMD3 3DV8A 2SBAA 4AK3A 1LENA 1OPOA 3L2HA 3QH6A 4H3WA 4CDQB 5JOWA 5FPZA 3JCIA 5E89A 4AEDC 2PN5A 4QGMA 3SH3A 2FHRA 1AR93 2GAUA 4MH0E 2GC3A 2NMNA 2FZ2A 2X5IC 1WUVA 4IXLA 3WDYA 1QU0A 4URTA 3HT2A 3WOGA 1BQPA 1AL22 3FFZA 1V6JA 5J48A 2ARXA 5KXCA 1KXGA 2YMZA 5BNOA 2WT0A 4ISQA 3RDIA 1DGWA 5GALA 3C2UA 4E4DX 3UKNA 1OQDA 2HWE3 4XTMA 3WDUA 4E2QA 1CD3G 1V00A 1CAXA 1U5ZA 3OCPA 1W6NA 3HBZA 1ZZBA 1HV1A 1MVQA 2N7GA 3S7EA 1Y3TA 2XL9A 1NYWA 4BMEA 4JGYB 1TNRA 1JW6A 2XG3A 1FYUA 1VBA2 3ZFGA 1S2KA 4AQSA 5T50A 1J58A 4A3XA 2JXAA 3H9AA 1UIJA 1VBB2 3B3QE 2DCYA 2UU8A 2GMMA 1NOVA 1PO21 5T5LA 4AXOA 4B4PA 1H8TC 1U5XA 4MZUA 5D1IA 4HKWA 2XBO2 2PHDA 3VBRB 3W9AA 4WVWA 3GALA 2JE7A 1FT9A 1IS6A 4HK9A 1RUG2 3N7JA 1UW8A 1HQWA 3H7JA 1RL3A 1RUJ3 2XHKA 3GZTB 4L92A 1AJKA 1N1TA 4YVSC 2Z2SB 4BYYA 2QZ2A 4JTNA 2CWSA 3MLKA 4S2HA 1MVEA 5JCTA 1XXNA 1SLBA 2VOWA 1UD1A 1LJ7A 4KH9A 4R9CA 5J3UA 3EQEA 1J3RA 1GFF2 1B09A 3ZN6B 2MEV3 4ISRA 3HIFA 1DZRA 1X7NA 2ZA9A 3JQWA 1HRI2 1S0EA 5JPNB 3RG0A 1H9PA 1C28A 5BNNB 3U0ZA 2GC2A 1MS0A 2A6ZA 2CGNA 1LECA 3AMPA 5BNPB 3FZ3A 1GICA 2B46X 1H0BA 2E6VA 3TAYA 4D69A 3N36A 5IUQA 2E51A 2WZR3 3VKNA 3JD71 5CFDB 4RS5A 1YI9A 3FUOA 2BW8A 3FHIB 4J1WA 1LU2A 2WFF2 4PBPA 2A3XA 2F4PA 4AGVA 2RS11 3USUA 3AJYA 4MVTA 3VBSB 1YCIA 2WWSA 3FC0A 3FE5A 1NCRA 4IESA 1C3HA 2E63A 1R082 3VZMA 3AXEA 3NW4A 4PIYA 4BCUA 4P9XA 4YZ2A 1QJX3 2HEVF 4MYEA 2IC1A 4NOTA 3UJQA 3HMYA 2YDEA 3ZSKA 2PYTA 3VBFA 3INAA 2XJPA 2YPJA 2C1FA 4C0BA 3VUOA 3WZ1A 3ST7A 1QOTA 2D6MA 2ET7A 2YYOA 4K3UA 1XQNA 3FLRA 2GNDA 3TN92 2VNRA 5AFBA 3KZ4C 2A3YA 1UX6A 4JRLA 4R52A 3KCCA 1XYNA 4X6RB 1FPN3 1EAH3 4WVMB 4CEYB 4S2DA 1OKQA 4ATFA 3SCFA 3H1YA 4PDWB 5FDBA 3MW2A 1GR3A 4K6BA 3WX5A 5HCFA 1RUE2 4I2OA 1WA4A 4AHWA 5HCBA 4OI1A 1ZRCA 3NSTA 4W6WA 4FP2A 1KDMA 1ENQA 3HT1A 1LCLA 2ZX2A 4JGZB 3VKMA 4Y24A 1RVF2 1NCQA 3CJIA 4N9IA 4P9YA 3WT3A 3RYPA 2OA2A 2NM1A 2RR11 4JVAA 4CDXB 2HWC2 3MGUA 1O3SA 2VQAA 4AHYA 3D4KA 3NO8A 5T52A 1H9WA 1Y9QA 2OZ6A 2CGPA 2QDNA 4TLFA 5JPMB 2ZX0A 2V09A 4I09A 3P3NA 4AVVA 3M2MA 4P9IA 1ND2B 5HXVA 4AEKA 5AVAA 4CRQA 5BNQA 1H2KA 2NQYA 5T5OA 5BNOC 2BPA2 2Q4SA 2R6QA 4MXWA 4I3GA 2ZZQA 3ZXAC 4Q1RA 4KWKA 3ES1A 4QPGC 4AW7A 4Q26A 1Z0HA 1N1VA 1BEV1 4OI4A 4X8NA 3KSCA 1UL9A 4WVZA 4OLLA 2B8MA 1QJY2 1X8MA 3T1LA 3R4DB 4Y20A 4DB5A 3VBUC 1AYM3 4YM1A 3WQ7A 3ZXGA 1NXD1 1RUI1 4FPYA 3SMHA 5AC92 3W58A 1N3PA 4NPRA 3PTYA 5FOJB 1Z78A 5DUVA 3J4UH 3WLUA 1MACA 2BGCA 4LA2A 4YZ4A 3GF6A 5FREA 4YW1A 2WNVC 1F5JA 1B35A 3QLQA 1GNHA 3FJSA 3CL1A 3NVCA 4N43B 3EXUA 3GHNA 1U0AA 3IPVB 3R4SA 1ALYA 2E7QA 1GZWA 1REDA 2IFWA 4AQTA 1RUC1 4TWTA 4LO6B 4YRDA 3ACLA 3LB9A 1R093 4FPOB 4EN8B 4QQHA 5L73A 2WSVA 2ZKLA 2X53S 5DUUA 4AVSA 1XNCA 4A7YA 4RL7A 2WS91 5I0TA 3WUDA 4S2GA 1R1ZA 1Y43B 1LB2A 3RYKA 4PF5A 1BCXA 4DINB 2P34A 2ENRA 2D6LX 4D94A 4LBNA 2OIIA 3AZVA 5DDJ3 3RPQA 3DPRB 1CJDA 1ZNPA 3IDEA 1PIV3 1H4GA 4XYXA 4E4ZA 3R0RA 1RGSA 5ABJA 1O5UA 4UXAA 3WP5A 2D6KA 5FPXA 1OFNA 2DCJA 4DXZA 3TOJA 4PCRA 2IXIA 1DZQA 4AFAA 1SLCA 2B42B 3H1MA 1ENXA 2PAKA 5FCCA 4OUMA 1MS4A 4RS5C 1BYHA 1DGLA 1LOEA 3SCGA 1V9U2 4DFSA 4L11A 4OFGA 5CFCA 1K5MC 3OJBA 1AYN3 2RM22 4UW6A 4WM7A 4XXAA 2VXRA 1D0HA 1PO13 4LUMA 1EAH1 1GQHA 1H1IA 5IK4A 4Q2FA 1W6PA 2PAMA 3I7DA 1H30A 1UPSA 4LBMA 5T3NA 1VBC1 3M3OA 5C8CB 2EXJA 4LO8A 4Y5Z0 3VBRA 3HWJA 4B3NA 3RSJA 2EXHA 4U36A 2RS33 2ZGPA 1QDCA 3GBGA 1ULFA 3WCRA 1ZBE1 3ZFEB 5IK8A 5I8TA 4B8EA 5DUWA 4XQ4A 1JUHA 3ME2A 2ZAAA 4YGCA 3PHMA 5EWSA 3N7KA 2IFRA 5J09A 4RFT0 2MEV2 4FPCA 1VBD1 3I59B 3X29B 1R1A1 4ATEA 1RUH1 4Q1PA 4YVWB 3VBOC 2XH6A 1ZZ9A 4Q0UA 4DNYA 5DZGA 1W6OB 1O3TA 3GYDA 5I8YA 4HN0A 4M01A 2G9GA 4B7KA 4QGLA 3M70A 3MIGA 4I02A 2ZBJA 4BQ1A 5BNNA 4RHV1 3AP7A 1C8M1 4C91A 4XHBA 1PVC3 2VECA 4UBHA 2WFPA 5ACA2 4FXGB 5L19A 5FLJA 5GLTA 1O5LA 4JTOA 4Q4X3 1NCQC 4HSLA 4NWVA 4AHZA 4GMP3 1PZ9A 1QQP2 1URXA 4H55A 3VDDB 4K9SA 3AMNA 2PFWA 2YROA 4KNCA 2R071 4X6QB 1D2QA 3PNAA 2E7AA 1RUOA 4MGIE 1DQ0A 4HKOA 4YGDA 5KBFA 1YNAA 4CDWB 2BQPA 1PMIA 4HLTA 5JOYA 1AZDA 1AR81 5JOZA 3MLLA 3CNAA 4K8FA 4I3PA 2E53A 1SCRA 3T2TA 1OI6A 5SV8A 1MR5A 2X5IA 3PVBB 4GB32 1YLLA 2DVAA 4P14A 5CA6A 2VU9A 3VHPA 2P3KA 2ZX1A 4XMAA 1ZRFA 2EVXA 3ZSMA 1FPN2 3V0AB 3IIAA 4LNVA 3K51A 1PGW2 2DURA 4JDOA 4GXLA 3MZHA 5F5QA 1RJ8A 2ZABA 3JBG1 3SITA 1OA2A 3WW2A 1QKQA 3NV4A 2BYVE 2R16A 3MIEA 1Q8PA 2WLPA 1AHSA 1MEC1 4CEYA 3MDPA 1GBGA 3ZMOA 2LM3A 1WW5A 4PDWA 5CG9A 2ZS6B 4YW3A 4XPVA 4EJRA 2GN3A 3AKPA 4XFAA 1UPIA 4BOWA 4YYOA 1ASJ2 2XWBB 1AX2A 4GIQA 2UY8A 5JLVA 5I0UA 5GKAC 3KCXA 4YGEA 2RS52 4OHVA 1JBCA 1V6LA 2PELA 1D4M1 2WZPP 5GLVA 2W39A 4AFBA 2DCTA 4FPEA 3WV6A 2CAVA 3AZXA 4JGZA 3TWIA 1YXWA 1UKRA 3N3HA 4RR3B 4CDQC 3U4XA 3BB6A 3VBHB 4KU7A 4QPIB 4MX3A 2B5HA 3G7DA 1QXPA 3NWKA 4HPKB 4YM2A 1S0GA 1FOD2 1RC6A 3ZN5A 1YO8A 1J3QA 5EYYA 1NQJA 1VP6A 4LO4B 1W0OA 2PHUA 2NPIA 4JAAA 4E2SA 1ND2A 3TRSB 3NAPB 2I45A 4QQ2A 4XZPA 1AR62 4F7ZA 1UIKA 3WW1A 5C33A 3PMEA 2E9QA 2ZGTA 2VH9A 1N3OA 3WP6A 1PO11 3H8UA 4JRAA 1AVBA 1T6GC 3O5SA 4XDQA 4DZGA 3R4UA 2GU9A 1Q5OA 4HKLA 3WG3A 4GA9A 4PIZA 3ZPYA 1ZBA2 4XBLA 3Q9OA 2ZGNA 4M0HA 3NL1A 2RJKA 1C1LA 3M3IA 2EAAA 3ETQA 4Q4Y1 4QXKA 2YUEA 1IOAA 1G7YA 3J8F1 3NV3A 4HFSA 4NWWA 4AEMA 1ZRRA 4E27A 4JDMA 1ND3B 1H2LA 4JGYC 5F1RA 1IPKA 3U10A 1N47A 1SBDA 4MGYE 2ZTNA 1OQEA 3D6EA 3ILFA 1HRV1 3D5OA 1H1AA 4QHBA 4WM7C 1YI7A 4HK8A 1COV2 4M0NA 4QMAA 4XETA 1ZYBA 1BXHA 2HWB2 2JDZA 3DN7A 1X33A 1R092 4A7ZA 3FFQA 4BLIA 4N7IA 3WCSA 2GC0A 4COZA 1GV9A 4QU2A 4WV8A 3VBRC 1S0BA 4KU8A 4Q0SA 3H7YA 2OW4A 3MI8A 3VZJA 3MEPA 4AVCA 5HI0A 1MS9A 5KXDA 2D98A 2IXJA 3IKWA 5DDJ2 1ONAA 3S7IA 1VB4A 1FAYA 4TYSA 4G9SB 1DLLA 4LEJA 3U11A 3OBRA 4W6YA 3S30A 3FWEA 1QF3A 1PGL2 2GSYA 1UCXA 4AYUA 3RI9A 1W6MB 1DFQA 3DPRA 4LT5A 2A6WA 3JD73 4FOYA 4AVBA 3ZFFB 3LAGA 5TSWA 3OD4A 1QJU1 5L36A 2ZGQA 1YFXA 5KC5A 3R05A 3JZVA 2VOKA 4JDNA 5BNNC 1EV12 2RS13 5F6LB 1CR7A 2V73A 5JIAA 2WQ4A 1Z7S1 2KXLA 5BNPC 2VMIA 1GZCA 3LA7A 4AGRA 4JQR