5CG8A

Ngtet1 in complex with 5hmc dna
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
266
structure length
266
Chain Sequence
MINKKSLLQNLLSKCKTTFQQSFTNANITLKDEKWLKNVRTAYFVCDHDGSVELAYLPNVLPKELVEEFTEKFESIQTGRKKDTGYSGILDNSMPFNYVTADLSQELGQYLSEIVNPQINYYISKLLTCVSSRTINYLVSLNDSYYALNNCLYPSTAFNSLKPSNDGHRIRKPHKDNLDITPSSLFYFGNFQNTEGYLELTDKNCKVFVQPGDVLFFKGNEYKHVVANITSGWRIGLVYFAHKGSKTKPYYEDTQKNSLKIHKETK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/dna
molecule keywords Tet-like dioxygenase
publication title Structure of Naegleria Tet-like dioxygenase (NgTet1) in complexes with a reaction intermediate 5-hydroxymethylcytosine DNA.
pubmed doi rcsb
source organism Naegleria gruberi
total genus 89
structure length 266
sequence length 266
ec nomenclature ec 1.14.11.n2: Methylcytosine dioxygenase.
pdb deposition date 2015-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1640 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cg8A00
5CG9A 5CG8A 4LT5A
chains in the Genus database with same CATH superfamily
1AX0A 3H1WA 4L2NA 2FDGA 3LEGA 4GZ9A 3BCWA 2VO5A 1FNYA 3TYJA 4NO4A 1G9CA 1YJLA 2DV9A 3CF6E 5CAZA 2WLPA 2J1EA 2RMU1 4AEDB 2D98A 3R4DB 1QQP1 3WQ0A 4LJHA 2ENRA 2JKXA 4CDWB 5FZ7A 2GP3A 2EA7A 2YG0A 3O1MA 1KJRA 2JDAA 3CQOA 1U0AA 2W08A 1QDOA 1QJEA 1UZWA 4LMFA 2EIBA 3NL1A 2XWJB 4AEDC 4D94A 2OT7A 1UY1A 1MVEA 5IJRA 5IW0A 2BNMA 4CDWC 4IE0A 2AZ5A 3GZAA 1AX2A 5A1AA 5LY2A 1HXS1 5CU1A 4IE5A 1JBCA 1HQLA 3USUA 1EYBA 5F3IA 2XBO1 2ZX1A 2ZACA 3NSTA 1RUH3 3ST7A 4D7TA 4M01A 5E1RA 1WLCA 2ZJCA 5CB7A 1NAEA 5K0UA 3HMYA 4PI2A 1AZDA 4AW7A 4FFHA 1QNWA 1OUSA 1Y4WA 3AKRA 3E1F1 3MW3A 3U1XA 2JB8A 5JMOA 1ND3B 3B01A 3RYPA 2TEPA 1Q56A 2B39A 4D6SA 4YLZA 3G6JB 4I09A 2EXHA 2FMYA 2ZGUA 2VVEA 3J8F2 4F83A 5C3QA 3B93A 5EJ1B 4NIAA 4B4QA 4OQ8A 4IV3B 2DU0A 3I3MA 1GV9A 2Y8KA 3OUIA 3VBOA 4TLGA 4FOWA 1LECA 2G1MA 3PDQA 4IEVA 1RTVA 1ND3C 1VAVA 4LBQA 3LA2A 1O7FA 1E57A 4E2QA 3AYEA 4KU7A 5G04L 2XPJA 2RDSA 4IV3C 2DYCA 2OQ6A 3FUQA 5T5LA 4CVUA 2WBKA 3VBRA 1E5IA 1E5HA 1V6IA 2C1FA 5A7QA 3MUY1 4I3PA 1QJY3 4ZS3A 1BEV1 5GLVA 4OQ9A 2MEV2 3THTA 5FP8A 1GANA 1Z7S3 2IFWA 5DG2A 1CAWB 4QB1A 2YPDA 4PBOA 3LDRA 5CISA 2DCYA 1ULFA 4MO3M 5J48A 2JB4A 1BBT2 4AL9A 2WFF1 4LOTA 2XDVA 3SCFA 4L11A 1AJOA 2YC2A 3RS6A 3ZKYA 3KLSA 2Y6KA 1A78A 2O1QA 1HW5A 2DCTA 4LITA 4UW6A 5FIXA 2WLQA 2OZJA 2J42A 3BPSA 3E6DA 4RFRB 4EN7B 3R6SA 4QXKA 5KHJA 1LGNA 2IXLA 2VBPA 1ZRCA 2GDFA 1U5ZA 2H0VA 1G6NA 3NWKA 1VMFA 3ZFFB 1MS8A 3EO6A 5FYZA 3O7OA 5E6HA 3CZJA 2MHFA 3AFGA 4N7UA 4V1PA 5FUPA 2MNGA 1R1A1 4DFSA 3ZYIB 1W9YA 4AEJA 4HFSA 4PLNA 3BKZA 1VAMA 1UZ0A 4IGOA 2ZOEB 5IVJA 4OZOA 1CAUA 2HWC1 2ZGMA 1QQP3 2W1UA 4A42A 5FZ8A 5H9SA 1GBGA 3PJQA 4G9SB 1F4AA 2HYKA 1BK0A 2DUPA 2ID4A 5FYMA 4NMIA 2QQUA 1JMUB 1OFSA 1SFYA 4E8DA 1YQCA 4B7KA 3RWKX 3DCQA 2HWD2 1PGL2 1KDMA 3AP5A 1HXS3 1OXCA 4OZXA 3ILRA 4XF4A 2D5FA 2JENA 4J1WA 5DZFA 2XBO3 1C8M2 4HN1A 1Q5OA 4OUSA 1Z78A 4S2FA 3S6PA 5DPNA 2KM2A 2QQNA 1F4HA 4NHYA 5I0DA 4NWWA 2X8KA 4HT1T 2BVBA 1W6QB 2ARAA 2VCCA 3JBG1 1MEC2 2ZS6B 3VHRA 2JD9A 4A3ZA 4DMIA 2B45X 5FZMA 5LCWL 4LOSA 3TRSB 4AHWA 2VUAA 5A33B 4JKMA 1SLCA 3KCYA 2OXBA 2D44A 2XH6A 5K7PA 3QH7A 1V6MA 1GZCA 3H8RA 2JIGA 1ULGA 5FYHA 3W9AA 4XMIA 4AEDA 4JVAA 3C8XA 2XMLA 3C2UA 3H3ZA 4FOQA 4FPYA 5T55A 3ZLIA 4CDWA 4EZ4A 4LNVA 3MLLA 3VKMA 1MS1A 5DAPA 1YFYA 2PQQA 4I01A 2J1AA 3QBQA 3OPZA 2FDIA 4WVWA 4FPOB 2XL7A 2Z5WA 4XQWA 3T09A 1LOGA 3ACGA 2BJSA 3LFMA 5BPXA 1XPWA 2VNGA 1NA1B 1HN1A 4XFCA 3JB8A 1GWKA 1BEV3 2RG4A 1RUNA 2YFUA 4YW5A 1AR82 1UMZA 4QX5A 5JZGB 4Q26A 2CV6A 1W6OA 3NV3A 4RQPB 1LCLA 3UGHA 4AWDA 4MGYE 1PM7A 1NX9A 4AI2A 4BE3A 3DF0A 4L8QA 1NA1C 4KQ7A 1DF0A 2HBTA 4N7IA 4UW4A 4DXSA 5I8TA 1H8VA 1H9WA 1H2MA 4A7KA 5JZGC 4LULA 1JYVA 4RQPC 1ND3A 4TXWA 5KWRA 2JECA 3J9SA 5FP7A 1S1AA 1UPSA 5C3SA 1W9WA 2DCZA 1XU1A 1A3KA 1NZCA 2BERA 4OHWA 2NMOA 1DYOA 1O3QA 2HEVF 2HBUA 1R092 1AL22 1OH3A 3URFA 4A7YA 2RS31 1DGRN 1OFNA 1FXZA 5FZFA 3JUUA 5FYIA 2EICA 5F5AA 3VDDB 1R1A3 4FOVA 4BIFA 4AFBA 2VQTA 4Y24A 3KB5A 2AH2A 2GZWA 3QH6A 3LDBA 4JDNA 1Y9QA 2ZX0A 1UWWA 4UF0B 5EQUA 1RHI1 2QE3A 3RPQA 3DPRB 4K7JA 2QJVA 2HWC3 3RFRA 3TN92 4ZU7A 3VDDC 4XAEA 3K4ZA 1AYN1 1OF3A 5IK8A 1S2EA 3WF1A 2Y6FA 3Q9OA 4OULA 4F7ZA 2ET7A 4FTEA 1UKRA 1W8UA 4DB5A 1RUF1 1LKNA 2A73B 5DAXA 3VBUC 4C90A 3DPRC 1V70A 1PIV2 4ZXEA 4CU9A 3JB4C 4UBHA 3S5QA 2XLGA 1C1LA 3CIHA 4XJUA 1H8TB 2XWBB 4OCTA 3Q8AA 1OPOA 4LE3A 5FREA 2QKDA 5A32B 1ZBA2 1RUC1 4WVVA 5LBBA 3T2TA 1WW5A 4AYUA 4R9CA 3VLBB 4B29A 1S0IA 4BLIA 2I2SA 3I2GA 4XTMA 2BWAA 3ZXDA 4KI5M 2LTNA 4Q4Y3 4B1LA 1RVF1 1BYHA 1A8MA 1AR71 3JBG3 1H8TC 5FJKA 1YJKA 2DTYA 2UU8A 3AMPA 3KD4A 4EE2A 4JRAA 5FQ0B 5CKNA 3VBSB 4FPFA 1VMJA 5A3TA 1YQ2A 4EZHA 1Q3EA 3B00A 2PTMA 4PIXA 2VTXJ 1WW4A 1GZWA 1VBA2 2P3IA 1NXD1 3I49A 5CG9A 1O4YA 3VBSC 5C5TA 1FT9A 5A7PA 2ADDA 2D43A 4YARA 4Q1RA 4ZS2A 4V2VA 5CZKA 1VP6A 2WN3A 3ZYRA 2IXJA 3A21A 1HB2A 4COZA 3RZJA 4LKDA 1XSQA 4KGQA 5HCAA 5HCBA 1JZ2A 3DECA 1E5RA 1KEXA 1SPPA 3RDIA 1N1YA 5I91A 2GAUA 1HJFA 1V00A 1US2A 4QKBA 2ZA9A 1UX6A 1F5JA 1OLMA 4JTOA 4K9SA 2LALA 1I3HA 4O9GA 1RJ8A 5LB6A 4EQVA 1O8SA 3SCGA 5ACA2 1JZ4A 3S7EA 1RUOA 4AFAA 1OT5A 1XNDA 5D1IA 5IVEA 2O8OA 3ATGA 4K1ZA 3G7DA 3POGA 1S2BA 3GJBA 5T5PA 3DYMA 4KU8A 1D2QA 1TEIA 3CJXA 2BBAA 4B4RA 5A33A 2QFEA 2WFPA 1WMXA 2GNTA 3VZOA 3T30A 3BIWE 3MBWA 4CZSA 1NUKA 3SQOA 3RGBA 4LK6A 3JD71 2RS33 1RUE2 4M4PA 1GQGA 3ZR5A 2FDFA 2IUWA 3IB3A 1GP5A 4BYYA 1KQRA 2WQ4A 4P9IA 1X36A 1J3PA 3M3EA 3OBTA 4OHXA 2P37A 4A45A 5ANQA 3RJ2X 1JZ8A 2D6PA 1NQDA 5A6ZA 3PU8A 4BQ1A 2RE9A 1Q8PA 4CP1A 4JTNA 1ULCA 4XDOA 1DBNA 5KHKA 2Z2SB 5ANNA 1O6UA 1RHI3 1NA1A 2ZABA 5LATA 5FZ3A 4Q4X2 4XE9A 5LZ6A 3WF0A 1IG3A 2VECA 1AYN3 5JZGA 1UY2A 1YRZA 1F8VA 2W47A 4RQPA 4S2HA 5DZEA 5I0SA 5FV3A 2P6CA 2NP0A 3LOBA 3MUZ1 1LESA 4Q29A 2JEMA 3HD8B 4QMAA 1RUF3 5FZ1A 1LOCA 1UCXA 3KV6A 5DUWA 1A6CA 1VBD2 1D4VB 1UPIA 2VBDA 5C3OA 2V4VA 3AZYA 3QD6A 2VU9A 4CEYB 2LM3A 1RUC3 1SLBA 2A6ZA 1IPSA 4HKOA 1NT0A 4AF9A 3F2ZA 5ABJB 1QOTA 1QJX2 4HONA 3T0BA 3I2HA 3VZJA 2B9UA 1VJ2A 1XNBA 3NVCA 1UQXA 1TQ5A 2RS52 3E6CC 1DCSA 3VBHA 4DUXA 4Z2AA 1RVF3 4RR3B 1AR73 2WDBA 4CEYC 1AVBA 5FR3A 3HNBM 3VDDA 5ABJC 3IIIA 4XXPA 5GLUA 4PQ9A 3IDBB 3I2FA 4QX1A 3VDBA 2D6NA 2P3JA 2ZAHA 2HH9A 4RR3C 4FXGB 4Q1PA 4ISRA 4WVMB 4UF0A 3WG2A 3VBUA 5BV6A 2BFUL 3DPRA 4K8RB 4RHV2 4GMP0 4ATEA 4P9JA 3RI9A 5HCHA 1ZZ9A 2WO3A 1UMHA 1OLQA 1W0OA 2ZGOA 2IZWA 3N7KA 4Q27A 1XJAA 4YG3A 4Z07A 2OA2A 4WV8A 2NLRA 5FOBB 2YGMA 1MQTA 3UKVA 5A1LA 2YBSA 5SV8A 3FWEA 3OBZA 3U11A 3WOGA 3U4SA 4J6GA 1QDCA 2R062 2WWSA 4XDPA 4CSWA 1IG0A 4YZ1A 2C5DA 4NIGA 1ASJ2 1S0BA 2RJLA 2XUEA 2H6CA 2VMCA 2A1XA 3T4HB 4N90A 5A70A 2ARXA 3B94A 3N9MA 1CVNA 2D6OX 4I3GA 1PO22 3H1YA 3LDKA 5FMDA 4R8HA 4CEWB 4CP9A 2RJ2A 3HJRA 2DUQA 1NG0A 4A7ZA 3PVOA 2AC1A 1BK1A 1W3VA 2Q1MA 3MGUA 2D7FA 5FQ0A 1UX7A 2QQVA 1XNKA 3VBSA 4Y5TA 1S55A 2ZPXA 2GNMA 1PMJX 5DDJ1 4CEWC 2RDNA 1QJU2 2ZGPA 1CIWA 1YEWA 1SCRA 4Q8KA 3JD73 2V73A 2Z42A 2QZ3A 4KBBA 2DBIA 1SBFA 3SHRA 1OKQA 3KHCA 2C6SA 2P17A 3N3HA 5FZDA 1TME1 2W39A 3MLKA 3N4MA 5FZOB 4N43B 3KMHA 5F9TA 1ZBE2 1W6NB 2VZ1A 4J25A 4RD7A 4CDUB 1DGWA 2R0HA 3DV8A 3GZEA 2OS2A 4CP0A 4BQXA 1OLRA 1PVC2 4E4ZA 1SLLA 2H6BA 5GLZA 1OQEA 4C1WA 1T6BX 5H9PA 4AGVA 4P9GA 1UY3A 1LHWA 2FZ1A 1IS3A 2AUYA 3N9OA 1JTZX 4N43C 1EV11 4YZ4A 4DEQA 3WP3A 4CE8A 4CDUC 1HRI2 1YUDA 4UW5A 3WEZA 3FHIB 4JCKA 2HKXA 4RGKA 3MI8A 5EWSA 2TBVA 3OPTA 4I0BA 1O3SA 1UOFA 4QB6A 4IE7A 1CAXB 5L19A 3PUIA 2VCBA 4BWOA 1XB9A 3P1IA 3ORJA 4BQ4A 3WP4A 2EAKA 1CN1A 1XXNA 3V0AA 4AI1A 3EXUA 4JKKA 1G9DA 3OG2A 3TEXA 4RGGA 1N1TA 4AHYA 4YGBA 1JOBA 2F17A 3D3AA 1O91A 1UYPA 2PHFA 2DDUA 3IDAA 3MIHA 5JVVA 3GJAA 2D3PA 1X8MA 2PFWA 5FYBA 3W58A 2YDEA 4A2UA 3GCWA 3I8TA 4QQLA 4UBGA 4EYUA 1WCUA 4QX8A 1KFUL 2Q30A 4XJWA 2ES3A 3JU9A 4RFT0 1W06A 2ET1A 3MV01 4XJ9A 4E4HA 3AL6A 3POSA 4QU1A 1NCQA 5L73A 4Y1ZA 4QU2A 2Y60A 2VTXA 1C5IA 1PNFA 3M3OA 4KWJA 1EP0A 2D93A 3A4UA 3D0JA 4URTA 3WF3A 4XF1A 2WINB 2IVIB 1GOFA 4COWA 1J1LA 2BWCA 3OEAA 1DQ1A 5JXJA 1DQ4A 1RUJ3 4IEXA 2OQ7A 2RR11 4MHUA 3U10A 4Q4V2 5DUXA 3GBWA 4I02A 1OA3A 5A3WA 3H3LA 3HNYM 2A75A 5EJ3A 4C0BA 3ZO0B 1AXKA 2WS93 1HB1A 1WZXA 4FQ4A 4E2SA 3T2QA 4HSLA 1CONA 1VBB2 3KT1A 4LBQD 4QPWA 4XUTA 3O1TA 3IZOA 1U5YA 2VCMA 4R9DA 1VBC1 2RM22 2OZ6A 4F8AA 1UY4A 4R4ZA 2OVUA 5DDJ3 1LOFC 3DUIA 1QIQA 4DUWA 4QDRA 4WVMA 4M3CB 5L9RA 2FCVA 5KXEA 3O1PA 4D69A 4GALA 4BM8A 2BZDA 4QX0A 3DYOA 1W2NA 2VNRA 4IQPA 1DHKB 1OPMA 4YW6A 5HV4A 2EAAA 5LBEA 1TME3 5GM0A 3VD5A 1RXFA 3ACFA 3RZGA 3B7MA 4SBVA 2R071 2R0FA 4LKSA 3M3QA 3POYA 3MIGA 4KWUA 2QNKA 4YW7A 4P9LA 1CAVA 4IEUA 4LUKA 5FXVA 1ZZBA 3AJZA 1CX1A 1V6OA 1W03A 2W3JA 2VZPA 2JD4A 5CKMA 2B4KA 5DZGA 4XVHA 5IT6A 1EV13 3UL2A 2YUEA 1AF9A 3WDTA 2VR4A 2FMDA 3IAQA 3LPGA 1JI6A 2R041 2SBAA 4GWNA 4AHZA 3POEA 1PM4A 4CEWA 3HN1A 5C3PA 5FMBA 1LOAA 2XJSA 1YFUA 5JR7B 3AP4A 4ZU4A 5AFBA 1RINA 1VIWB 3LEMA 1FMD1 2VMDA 1HB4A 4CDQB 2FDKA 3W59A 1OMIA 5E89A 1UO9A 4PHZA 3M7AA 3UNPA 3FN9A 4Q2FA 1AJKA 2WNEA 2LW8A 5FMCA 4B3NA 5FPLA 1HN0A 4COUA 4OHYA 2QZ2A 1DLLA 1W2AX 3I2JA 3ZFEA 3F95A 3ZMOA 1NCRB 2HEWF 4CDQC 2F6BA 2UY8A 1TNFA 2GMMA 5FZOA 3DL3A 4LKFA 4CYDA 2JDHA 1W6NA 2IXKA 4DO0A 2V72A 4CDUA 1IS6A 3HQUA 1DQ5A 1KS4A 1S4CA 5JOXA 1ULEA 1BLZA 4P14A 4DRVA 1XE8A 5GLWA 1H1IA 2VJXA 1NCRC 3FHQA 1GP4A 4BQ3A 4DZGA 1L7QA 2ZMLA 3PL0A 1EAH1 4GH4B 5FKCA 4OI2A 2Y6GA 3U07A 3NV1A 1QJY2 4LO6B 1LGCA 2GU9A 5GJ6A 3RMYA 1PGSA 1Z7S2 1WCQA 1DQ0A 4Y20B 1KRIA 2VMGA 1UYXA 2WYSA 2G4IA 3K51A 1I1EA 1CAXA 4IESA 4GH4C 1FI2A 1BMV2 5FMOL 4HSJA 2ADEA 2YXSA 2RR13 2J1UA 1G86A 4HXCA 1RMU1 1FV3A 4Y26A 3WF4A 4FPLA 4YM2A 1B35A 1LJ7A 5DN2A 2PHDA 1EPWA 2FHRA 3LFIA 2PQSA 2WKKA 3ZM8A 4Z82A 1PO11 4QKFA 4XQ4A 3ZXKA 3ITQA 2C24A 1C28A 3ZXLA 3NV2A 2YGLA 2QUOA 1LOEA 5DABA 5F5IA 1CESA 2YPJA 2YB7A 1QH6A 2WAOA 5A6YA 1JU3A 3NQHA 5C9AA 3TB0A 3VHOA 5JAXA 1LHOA 3NMBA 3GGLA 2ZHKA 5EYYA 1RUG3 2R073 3GZTB 2ZX2A 3NNLA 4I2OA 4NROA 1D4M1 4H55A 4PLMA 2LROA 4EJRA 2EIEA 4OYUA 3UETA 1CR7A 3KM5A 2W91A 4JGZA 4AAPA 3OY8A 1GFF2 3WP6A 2W92A 1ENXA 4M00A 5JOZA 3CO2A 3H3UA 2VXRA 1XNAA 2W1SA 4XFAA 1J1TA 3VZMA 4BA6A 2JE8A 4WVZA 5F1RA 4A6SA 2R043 1V6KA 4JQTA 4XCAA 1GUIA 1PMIA 1LOFA 1HXS2 2YBPA 4PT6A 4CCKA 3AP6A 2JKBA 4QB2A 1OLME 2P3YA 2BGPA 4HMZA 3SCHA 3HT1A 4DEVA 4FAHA 2E63A 4GULA 3NV4A 4HK8A 5I93A 1FMD3 5DUUA 1WUVA 1X33A 2GH2A 1J83A 2XKPA 3HQRA 3WNXA 1FX5A 4P9YA 2AACA 4IEWA 4LBJA 3OB8A 1DQ2A 1GQHA 1SDWA 4BH9A 3MFAA 4LBLA 3AC0A 1GICA 1HKDA 4RA0A 1SBEA 4LA2A 1C4RA 2BUKA 2ZHLA 3PVNA 4XFGA 5FYUA 4URAA 4Q0SA 2C0ZA 3M70A 5FO8B 1UZYA 3I4IA 3UJQA 5BY5A 3I2KA 1SLTA 4MGQA 2JX9A 3AKPA 4XZPA 1QOOA 4UXAA 4XQDA 4YW4A 3IDCB 3H7YA 4FBFA 3ZN4A 2BGCA 4GQ7A 4PLOA 1TMF1 4QPGB 2Q8CA 5HI0A 4LT5A 4OUMA 2BNOA 3QCWA 1JS9A 4QPIA 4WZFA 1OBNA 2JDNA 4BK4A 1JUHA 2WO1A 1EAH3 1ZNPA 2KD7A 2PLV1 3ZYHA 2ZX3A 1R081 4QPGC 1AR61 1BEV2 1YNAA 3MIEA 4C1XA 5K4LA 5JOWA 2MEV1 4HLTA 3T2OA 1ZRFA 2H0BA 2VOTA 4LHLA 3QACA 1A8DA 4LHSA 1WW6A 4NE9A 1IZ3A 3THCA 3LA7A 1S0FA 5C4WB 1XRUA 4QGLA 1YFXA 4KG0A 1QXRA 1UU6A 4JAAA 1WD3A 4CDQA 4XBLA 2D5HA 1RMU3 1W6MA 3KZ4C 4EWDA 1IPKA 2AEYA 1NYWA 3LD8A 4DUVA 2E6VA 3OUHA 4BJ0A 4R4XA 2XHKA 1WA6X 2CNAA 2GC1A 3DKWA 5C4WC 5A7SA 3HOBA 4XURA 5BNPB 1PO13 3AYCA 3T1MA 3KV5A 1XBFA 3VHNA 3WG3A 4QHZA 4KH9A 3AVSA 3ZFFC 1W8TA 4ZPIA 2WO2A 1IOAA 1JW6A 3S57A 2DU1A 1PNGA 3WNOA 2RMU3 5CFCA 3WV6A 4MH0E 1R1A2 5LEKA 5BNPC 5J98B 5IATA 1H9PA 5A3OA 1COV2 2NMNA 2ZXQA 3H8XA 4L97A 4F3JA 4EN9B 4IE6A 1APNA 4TN7A 4NIIA 4NHXA 2X09A 1ZZ6A 2JDPA 2VOVA 1LRHA 1D4M3 2HWC2 2WZPP 1RUI1 4Y20A 1QNYA 5IFPA 3EHKA 4QXBA 4YVWB 2DVFA 1UL9A 4WM8B 1Y3TA 1XQNA 3HNMA 4GJYA 4ARYA 3O1SA 2W94A 3KT7A 2J22A 4K1YA 4MZUA 2FCTA 5EJZB 2A6VA 2WQ8A 5D2AA 1MR5A 1PMHX 2C9KA 1SFPA 2D3SA 3FMGA 3AJYA 2C4XA 4ZKTB 5F7UA 2R32A 4M4RA 4YVWC 2HWB2 1JYNA 4WM8C 3HT2A 2XQRA 3ES4A 4O7XA 1MACA 2WABA 4QAWA 2Y26A 1H1MA 3GNEA 5T54A 2ZKLA 1WCDJ 2FCUA 2JICA 5IVCA 1UOBA 4TSVA 4Y22B 4AHXA 2ZEZA 3AL5A 4Q4Y2 3ZXGA 3H8OA 3JBG2 1KJLA 4G3YC 2YHJA 4W8JA 3KVBA 2V4AA 4GA9A 3OCPA 3N7JA 3U14A 3AB0A 3T0DA 4Q0UA 2YMZA 3POIA 5GKAC 3WUDA 5BNOB 5IK7A 4A41A 1W3XA 4HANA 2VL4A 4PF5A 5B4XA 5FZIA 3WDUA 3LSEA 2CDPA 2VVDA 2B46X 4BCUA 2YU2A 2QTWB 1TMF3 3IT8A 4H3WA 3ZFGB 1GOHA 4PIZA 3THDA 3I59B 4AI9A 3K3OA 5BNOC 4X6QB 3ILFA 5KR7A 3AZZA 3H7JA 1TVGA 2XJPA 4OFGA 5AVAA 3RI8A 1J59A 5D21A 2GSYA 1NOVA 2PLV3 3B02A 2WFF3 3ZFGC 1R083 2Q1FA 1AR63 2BW8A 3NJXA 4LBNA 3R0RA 4LUMA 3AMMA 4N53B 2FZ2A 4GKYA 4AVSA 2ZGRA 4UW3A 4BQWA 2MEV3 4ZONA 5FP9A 2XG3A 1SLAA 4TZDA 1K42A 2QQJA 3U75A 4P00B 1GNYA 4NHMA 5FZ9A 3WY6A 4CA9A 4IEQA 1VAKA 3GALA 2D40A 3MF6A 2FQPA 2ZAAA 3ZSEA 2FDHA 4N53C 4FP2A 4IV3A 4ZHNA 1AX1A 3JCIA 1IKQA 4IEYA 1OUXA 1UW8A 3INAA 4PQQA 3NRUA 4Q4W1 4LBKA 5FZBA 4JDMA 4JZRA 3HWJA 3WX5A 3VL9A 2DVGA 4R9AA 5APAA 4QM9A 3FLRA 3J7LA 2ZZJA 3LWCA 4PIYA 4ZZ8A 3SH4A 2RS32 1J3QA 2UYAA 1W39A 2DFBA 2VULA 3RYKA 1W2UA 1R091 1AL21 2A6XA 2DVDA 3V64A 1FPN1 4AQ6A 3RYRA 2R6QA 2ZGNA 2CU5A 1PZ9A 3ZPYA 4E9KA 5AVPA 1V6NA 1RUD1 1CAWA 1BQPA 5IFTA 3GZUC 2G9FA 3I3EA 4MGSA 4AG4A 3AMQA 3NKTA 4A44A 1RHI2 1M4WA 3I2IA 1NY71 1UMIA 5IVFA 1MZEA 1RUI3 1AYN2 5JXGA 3KVAA 2F4PA 2R16A 1S0GA 3J26N 4RL7A 5AFEA 2XGXA 2YROA 3H42B 4EV0A 1DYPA 1QKQA 1RUF2 3WW2A 5FDBA 3ZYGA 2ZZQA 1VPHA 3WD5A 1OH4A 5H9RA 2AREA 4P02B 4XDQA 4LO7A 4YG0A 3ZFFA 4MV2A 4XF9A 5IK4A 3T0AA 1UAIA 5D8AB 2OIIA 2BDRA 5LA2A 4JHZA 2JXAA 4K6BA 2W68A 5LK7B 3AK0A 3ON7A 3POBA 5BNPA 1D7PM 1ZBA1 3VD7A 5FZ4A 1BZWA 5JUVA 3LQCA 2VAUA 1SQ4A 3BTYA 1RVF2 5FZCA 3BU7A 1AR72 3CHXA 5EFUA 3TNPB 4LR4A 1DGRA 2CTVA 2XR4A 2Z4FA 3FZ3A 4QXCA 5D8AC 3SLIA 3B3QE 1DGWX 1TZOA 4UFLA 3VDAA 2ZHNA 5FO9B 2Q1ZB 3E5XA 3A0KA 4H2AA 4M0HA 3Q8BA 4FPGA 4EN6B 1QJZA 2QQWA 2WT1A 4QKNA 4XUPA 4D8MA 4LBOA 4W50A 1OC1A 1NXMA 4E4DX 2WZ8A 1K45A 5A7WB 3ZIXA 4KBZA 3CU7A 5FLJA 1X8EA 3THPA 2W5FA 1YC61 4BXSV 3VKLA 4Z92B 1VBA1 3D5OA 2Y0IA 4YVWA 3WR0A 4WM8A 3N35A 3KGLA 3PUHA 1O3RA 2ZGKA 3K75B 1TE1B 3O14A 5J3UA 3TEWA 3B9IA 3WW4A 1F31A 3OGVA 2BOJA 3SEPA 1LEMA 1IPJA 3PUQA 4XF0A 3DKQA 1CWPA 1W6QA 2IVJA 1WMFA 1IQDC 3M4FA 5GALA 3CMGA 1GNZA 5M0TA 3RRDA 1MVQA 1W0NA 4BLJA 5BNNB 1MS9A 2QQKA 4Y22A 3RQ0A 1NE4A 1C5HA 5SV5A 3PU3A 2Q8EA 3MFCA 3CKHA 4Q4W3 2R1BA 5KHGA 1W90A 4MX3A 3VKOA 3AFKA 5BNNC 3ECQA 3RMXA 1X9TA 4XHXA 5J09A 4W6WA 2NQYA 1STMA 4AI0A 3FBYA 4G4FA 3BTXA 2WT2A 3AKSA 3JD72 5CADA 4HOOA 1R093 2FDJA 1PK6B 1FPN3 1H30A 3N9LA 3TWIA 3I59A 4CCDA 3JQXA 1MPXA 4ORFA 5FY0A 4CP2A 2VH9A 3U37A 1RUD3 2A5ZA 2DFCA 3IMNA 3WCRA 5FZHA 1CPMA 3UYJA 3R4UA 1AR92 3ZXAC 1PK6C 3N7LA 1UU5A 2HWE1 3H8UA 4N53A 3A22A 4CUBA 1HX6A 3MO4A 4SLIA 4YVSB 4Q4X1 5H9QA 3LPFA 1DZRA 4BMBA 4AFDA 4QDSA 1K5JA 2GH8A 1HV1A 4R52A 4LA3A 5JI7A 3VZKA 2UY9A 4BDVB 2YZ4A 4D6RA 4LK7A 3ASIA 5CIRA 3AXEA 5JSPA 4I0WB 4YVSC 4LEJA 4DPNA 2X10A 1VBD1 1QXJA 3W5NA 2G19A 2Z79A 2PAMA 4I0AA 3C7EA 1ZBA3 3PMSA 4XHBA 1OOPB 4AVCA 2WNVB 4HK9A 4Y1UA 1UY0A 4UFIA 3MW2A 4Y4RA 5FZ6A 1HDKA 2Y33A 1YXWA 5DAWA 5FYTA 3E5UA 1CGPA 4D0QA 3LE0A 1IS5A 2F4LA 4CXYA 1YWKA 4W4ZA 4GKXA 2IXCA 1H6XA 1OOPC 4PJYA 2WNVC 4X8NA 3BTZA 3HBZA 4H14A 1ZYBA 1QOSA 2O14A 4E4SA 2GN3A 1QH7A 1JZ6A 1W2OA 4K40A 5GZGA 3OOXA 1F2NA 4E8CA 2WR9A 1FOD1 1W0PA 1UYZA 4X8PA 2AGSA 2RS11 1EUUA 1CD3G 1VBA3 4GWIA 4PCRA 4NPRA 1VRH2 3FX3A 1S2KA 3DN7A 1ENRA 1H8TA 2CHHA 4LPLA 1E5SA 5A32A 2QQLA 2AEZA 4XPVA 5AC91 2C26A 2TUNA 1XSRA 3RNSA 3M3CA 3WDVA 1YLLA 4FPCA 1JZ5A 4OLLA 2VMEA 2BBVA 3CL1A 3BI3A 4AVBA 1ASJ1 3SISA 1JXNA 1KXGA 2XVKA 4D7YA 5JXHA 2KR2A 3ZYJB 5EZWA 1ZA4A 1RUJ2 2XJUA 3BB6A 3IBMA 4GIQA 1POV0 1ZZ7A 3GF6A 5FRAA 1JYWA 2P2KA 4AK3A 2JG8B 1DP0A 2WN2A 2JDYA 1V6JA 2CDOA 4AEMA 2WS92 1VBE1 3AVRA 3EB7A 4O61A 5E16A 3HBKA 5F5QA 1O5UA 4DXRA 5CFDB 3KV4A 3IN9A 4Y3OA 1DZQA 4HN0A 4META 3V0BB 1CX4A 2EXJA 2JG8C 4YYOA 2R49A 3VD4A 5DDJ2 3SMHA 2VZTA 3USSA 4QHBA 2OKXA 2VW2A 3SITA 2E53A 5A7WA 4C91A 5CFDC 1QJU1 2EXIA 5IYYA 3DXUA 5FOJB 3SXWA 3AM2A 5FPZA 4C0HA 2RDRA 4XF3A 4WM7B 1TME2 5A3LA 1OA2A 1U5IA 2WZR1 4GJZA 1S0EA 4A6OA 1LAJA 1YQ8A 4KWKA 3LEIA 4HG6B 3OF1A 1SG3A 5FWJA 5F32A 5FZAA 4XFHA 1HV0A 2W9XA 3FLTA 3WDWA 2HWE3 4XJAA 4WM7C 5F3EA 3BGAA 2YC0A 2A3XA 2VNOA 3EJKA 3FJSA 2DCKA 5C8CB 1EV12 1H2LA 2J1VA 2ZCWA 3AYAA 4UT5A 5EPAA 5FUNA 3E97A 4CPBA 2JG9B 1JH5A 2GC0A 2GP5A 1W2TA 1N1SA 3AP9A 3ZN6B 4XEZA 3ZYBA 1YHFA 4K21A 5T5OA 1AUYA 2ORZA 2ZEYA 1BXHA 5C8CC 3RZZA 1BVVA 5CVRA 4ATFA 3RVHA 4AVVA 1L7RA 4FQZA 2B42B 2JG9C 3WW3A 3ZYFA 1QMJA 1V9U1 2Q5TA 4L92A 5E8AA 4TLFA 1GSLA 4NPMA 5FY7A 2WNUB 3UV9A 4LIVA 4NHLA 3ZN5A 3ZSLA 1ZZ8A 5A7NA 5L9VA 1PK6A 4QQ2A 3KWVA 2VE1A 4NUBA 4CCOA 4QX3A 3MICA 1MZFA 2YY1A 3FHAA 2JE9A 3AMNA 3R4SA 3WZ1A 4XBQA 2GC2A 3WVJA 2WNUC 1XU2A 4I30A 4NR1A 5FUIA 2EIGA 4Q0VA 4UAPA 1Y9MA 1FOD3 1CIYA 4YGDA 4S2GA 2PXJA 2RS13 3T08A 4AVTA 4UFHA 2V5YA 3DGTA 3JZVA 1J84A 3K4DA 1L7LA 4YVSA 1SCSA 2HWF1 4CEYA 2D6LX 2LUWA 5AC93 2VPVA 4LO4B 1CPNA 1GWMA 2VUJA 5ABJA 1VRBA 3Q8CA 4HVRA 5FP4A 2Q8OA 2V09A 4EN0A 3ELNA 1PGW1 3SH3A 2A71A 1LNSA 1G8WA 1HRV1 3WINE 4RR3A 1AYM1 3MIDA 2RR12 3UJOA 5FY4A 1ST8A 5JMCA 1HIXA 1LU1A 5EV7A 1OOPA 2UURA 1OF4A 4BISA 2VZOA 4AGRA 4BQ2A 2E31A 3NJYA 1QWRA 5FXZA 1HLCA 3VD3A 3RWNA 1VBE3 3O1VA 4FPJA 2JJ6A 5FLHA 3OTFA 3USUB 1POQA 2VUDA 3I3DA 1FAYA 2HEYF 3C7HA 4ZU5A 3P3PA 3OGGA 4IEZA 3POWA 5EXOA 3IKWA 3WHTA 4DY5A 5K0UB 3PURA 4IERA 2GALA 4J1XA 1K5MB 2W46A 3IAPA 5A7OA 3NJVA 1REDA 3POFA 2VQ0A 1YQ6A 3W20A 2EXKA 4CCJA 2W2IA 1RUG2 2AYHA 2R072 2WZR3 1ENQA 2BGOA 3AX4A 5IAXA 5K0UC 1WKYA 4NIDA 1K5MC 3TBDA 2BFUS 4GB31 4BMEA 3Q8FA 5LA1A 1UN1A 3P3NA 4LBQB 4YW1A 1Z0HA 5A6QA 1I9RA 3CDZB 1XNTA 5JOYA 3O1UA 4WBBA 2BYVE 4OI4A 4P9XA 2CWMA 4Y4YA 2JDMA 1RUH2 1HB3A 4AVAA 2P1BA 2SLIA 2PN5A 3QOPA 1NKGA 2JE7A 1ZM1A 2J1SA 1G7YA 5CFDA 3OD4A 2A6WA 1FMD2 1U12A 2XVLA 3ZPOA 4R9BA 3V0BA 3WG1A 2D97A 1NLSA 2XLAA 5F6KA 1V9U3 4CCMA 3KQRA 5FFOC 4RSUA 2QCSB 1JOPA 1VLNA 4N43A 1QHDA 5F2SA 4ASLA 3KQ4B 3HR9A 3GDBA 1LHUA 1QEXA 3WHUA 1Y43B 2W87A 1DGLA 2WUHA 3FFZA 1BHGA 2V5DA 1SEFA 2GMEA 1O4TA 2E9QA 5JXIA 3AZWA 2Q0AA 4A4AA 4O65A 1G9FA 2Y34A 1YQ5A 1JYXA 4UOJA 3LOIA 1P8JA 3H0OA 4OMCA 1ALYA 1MZ5A 3NO8A 1S0DA 2P3KA 4KWLA 2A3WA 1YCIA 5I8SA 3SC7X 2I07B 2QBXA 3BODA 3VDCA 1GOGA 1EAH2 2HWF3 2K0GA 1ND2B 1K12A 2JG9A 2WWJA 2P5BA 2BPA2 2BTVC 5K8SA 5JIUA 3ZN6A 2VY0A 1QJY1 3BU0A 4AGGA 3KCXA 3MZHA 2VUCA 2X05A 1Q8SA 4FSJA 1HRV3 5KXBA 1ND2C 1AYM3 1S0CA 4RGAA 3WCSA 2VGDA 1C57A 2ARCA 5T5JA 1RMU2 3X29B 1MS5A 1GP6A 1V6LA 4A3XA 1SLIA 3ACHA 2YYOA 1ZZCA 5T3NA 1VBC3 4EN8B 1OVSA 1TNRA 1JHJA 3IWZA 2E32A 3MLJA 2PHLA 4X6RB 1PO12 4XETA 4IE4A 1O4ZA 3VD9A 3O1OA 2NM1A 2BP6A 4NOTA 2MPFA 3D8CA 3GCXA 2WNOA 1W8WA 4YNIA 1KFXL 1F9KA 2Y6JA 2YU1A 3BVCA 2W1WA 3GHNA 4PDWB 4ZY9A 4YM3A 4YZ5A 1PX4A 2BNNA 4QD2A 3UK9A 5LA0A 1G9AA 2RMU2 1R1ZA 2X53S 2XQXA 4UWDA 4NWVA 1HQWA 4XUNA 3W21A 1QQP2 3PUSA 2ZGQA 3DXTA 2EALA 1Q8OA 2VMIA 3C7GA 3CBNA 4PDWC 5CYYA 2PELA 1D4M2 3HPNA 3D0SA 4AQTA 4L0PA 4UFKA 3S30A 5F3GA 1MZ6A 1LOBA 1C1FA 4GB33 2NPIA 3WQ1A 5BUVA 3L9JT 2IFRA 3MIBA 4ASMB 3FE5A 3PJYA 3AZXA 3WNKA 2IC1A 2ETEA 2XBO2 3CZUA 3RZMA 3FLPA 3C3VA 5C70A 1LU2A 1LR5A 2AR6A 2XJQA 3W5MA 3RZKA 3EMRA 3O0XA 3AXDA 4LHKA 3N7MA 5FPUA 4BZ4A 1SZBA 2ZHMA 5FK8A 2ATFA 1W28A 4FO9A 4M3CA 2WJSA 4QX2A 1F5FA 2XJRA 4M3CF 4MSVA 2JDUA 4XACA 5LBFA 3V56A 1W6OB 3TNQA 1CZSA 3O12A 4W65A 2BOIA 5EIYB 5FYCA 2WSUA 4QDQA 4IDZA 5GZEA 4MADA 4CRQA 5C71A 5HBAA 2Q4SA 3SEEA 3J8F1 3WUCA 1K5MA 1SHWB 2BVVA 4Z8BA 4BOWA 1W6PB 2B5HA 2AENA 3HVDA 3ACLA 4FPEA 3OGRA 1RB8G 2DURA 4Q8LA 2O0OA 3KV9A 3K46A 2E51A 1PX3A 4MUVA 5FBJA 3IMMA 3POJA 4Q0QA 1ODNA 1TMF2 1VMHA 3WNMA 3ZVXA 2EF6A 4N9IA 4AQ2A 3UGFA 3MW4A 1DYKA 4Q0PA 5KC6A 1GWLA 3PIGA 4QT6A 2IXHA 4KMQA 5A6XA 3T3YA 2WA3A 4FI9A 4MXWB 5F3CA 3IM0A 5A80A 2XONA 5I0RA 4YFWA 3WT3A 4DINB 3AMHA 2PLV2 2WFF2 3D4KA 4XTPA 5FBZA 1R082 1J3RA 1AR62 1BBT1 5K9YA 2C9AA 5IHRA 3NW4A 5FXWA 3ZDSA 4N9HA 1ULPA 1GR3A 3N9PA 5LBCA 3LF7A 1W05A 4Y1XA 1GLHA 2VZRA 3ABZA 4O9EA 1Q8VA 1QU0A 3O0WA 5FYVA 1UIKA 2XJTA 1ZA7A 2E7TA 1NCRA 3LGRA 3BUCA 5FZGA 1JOJA 4YW3A 4CUGA 4HBNA 3PTRB 5GZDA 1NLRA 1N3PA 4QM8A 4QXHA 5C33A 4FPHA 5CA6A 3S0MA 2KXLA 4DQAA 3BPZA 1VB2A 1A34A 4MHRA 4RYDA 4BPZA 1UXZA 4MXVA 5F6LB 5F2WA 4GH4A 3BYWA 1LEDA 4MOAA 1W8HA 1T6GC 5FCCA 4AXOA 5BNQA 1JZ3A 4IEOA 3OJBA 5FZ0A 4LLFA 5F8PA 5L36A 4YGEA 3I54A 3N9NA 3WNNA 1COV1 4FVVA 1ND2A 1W8FA 3SNMA 4L99A 4Z1VA 5LWBA 3KGZA 3RJRA 5KHIA 1WBLA 3EYPA 1N3OA 1GZWB 1RUI2 1T2XA 1OURA 4D7SA 4GWMA 4UYBA 4NN0A 1ULOA 1H0BA 1DZTA 2E33A 4LTAA 1RC6A 5IVYA 4KL1A 1W8ZA 5DG1A 4YM0A 1ZRRA 4W6XA 1PZ8A 2HWD1 1PGL1 3OSDA 5IK5A 3J7MA 5KC5A 1YI7A 5DMYA 1LHVA 5DQ0A 1N3QA 1C8M1 5FPBA 2WQZC 2CL2A 1CQ9A 2EIDA 1SPPB 5FPVA 1JU4A 1UXXX 2HWB1 4NVPA 3K77A 4CCNA 1MEC1 4IUGA 4MLOA 5BXXA 3NNFA 5FMOS 1SACA 5FP3A 2WZEA 2WC2A 4XW3A 1WLDA 2JDZA 1PVXA 4OHVA 4PDWA 2Y38A 1FATA 2W1QA 3OBRA 4Q4Y1 3WNPA 3B9CA 2VZQA 3J8F3 4LO8A 2WRAA 1OHFA 4AAXA 4QKDA 2VC9A 3U0ZA 4XZUG 3WQBA 3NNMA 3UESA 1MS3A 1JZ7A 1D0HA 3S7IA 2VOWA 5L9BA 3KT4A 1AHSA 2ZTNA 4XUOA 1M06G 3OGJA 4YZ2A 2Y6HA 3MYXA 4BU2A 3D6EA 1YIFA 3HN3A 4KG8A 2VM9A 4RS5B 2WAAA 5FLIA 3CJIB 3WDYA 1DQ6A 3PUAA 4K8FA 4XC9A 1AR81 3ZSJA 2PYTA 4ES9A 1UD1A 4Y33A 4OVEA 2VQUA 4P5YA 5IAVA 5J1XA 1NZIA 1BBT3 2VCAA 1ULDA 3MDPA 1ACCA 4HKLA 4RS5C 5FTTC 2JIJA 2ZMNA 3CJIC 3J7NA 3PTYA 4TTGA 2QQPA 1ZRDA 4QQHA 4WZCA 2ZEWA 2L9LA 4IW3A 2ZMKA 1IS4A 4OHZA 2VTFA 2VQAA 1XOYA 4JDOA 4ET7A 5FPXA 4BK5A 1Y9GA 1O5LA 4NRMA 5I0UA 3ZSMA 1NQJA 3A7QA 4M0NA 4AI8A 1RIRA 4XFIA 3S5AA 1S0JA 1MS0A 4Q4W2 1UF2C 5FZKA 1W6PA 4JHTA 5LK5A 3GM8A 3WSOA 4QPGA 3O5SA 3FFQA 4AQSA 1W8OA 4L9BA 1RJ7A 4LE4A 5FY5A 5A3UA 4NPLA 4COYA 4ZZ5A 4XBNA 2J1TA 2WA4A 3VKFC 4MGZE 2WIIB 4C8DA 2TNFA 2XOMA 3FBMA 1FPN2 1VR3A 3VBHB 1DIWA 1O8PA 2NN8A 3WP5A 4K20A 1UU4A 4XYXA 4PI0A 5LRRA 5LRSA 4FP3A 4CU7A 1RUD2 2GMPA 2QDRA 4ISQA 1REFA 1OA4A 2I74A 2VZ3A 4MXWA 4Y1VA 3TN91 3FC0A 3V65A 2GNDA 1W04A 3HEIA 5GZCA 1COV3 2PHTA 5C4WA 2QDNA 3VBHC 5FPAA 2VG9A 1NY72 1SFNA 4U2AA 3T1LA 4QPYA 5LW9A 3VBUB 1ZRIA 1YIPA 1LODA 2D3RA 2GN7A 1D2SA 3Q8EA 2CGPA 3N9QA 2HLEA 3PVEA 1PIV1 4QGMA 5LASA 2ZX4A 3WQ7A 3M3IA 3VUOA 1RUC2 2DCJA 2HWD3 1MQTB 1YYNA 1VB4A 4B8EA 4DY3A 4HZFA 2DVBA 2W52A 4K3UA 5FXXA 4DIQA 1C8M3 2VNVA 3M8LA 4XCBA 4BQYA 1CJPA 4DS0A 3ETPA 3JXSA 1FV2A 3DYPA 3LEKA 1OD3A 2J1RA 4EWAA 1JYIA 5JLVA 2VOXA 2HWB3 5A3MA 1MEC3 5B4NA 3WG4A 3P6BA 2W95A 1MQTC 4MGIE 5JWPA 1ZREA 3H50A 3WF2A 2G9GA 2GC3A 1K3IA 3AKTA 1RXGA 2E26A 5JPNB 4BHPA 4CP9B 4JX0A 4Q5OA 5FKBA 4IGPA 4CCEA 4FFGA 1I5PA 1WMEA 3LIGA 4GMP1 4KNCA 3VBFB 5LA9A 1FNZA 1W9SA 4QGNA 2XB6C 2O8QA 4BQ5A 4U36A 1J58A 3J7HA 4XMAA 4CPBD 1WCSA 2HYXA 4MYEA 2R1DA 4DXZA 1GKBA 4OI1A 3PVBB 3I2OA 1U5XA 4YZ3A 3VBFC 2VXJA 1HJGA 5TSWA 2D6KA 2E7QA 2W0XA 3KCCA 1AR83 3MHZA 3QLQA 4UFMA 5ACA1 2IXIA 3BOWA 5JSOA 2K9ZA 3EBRA 3WDXA 1DFQA 3ME2A 4AZZA 2A6YA 1GQPA 2LS6A 3UGGA 3KSCA 4XILA 5FWEA 5JDBA 2Y0OA 5JPMB 4BXFA 2ZGTA 4ONUA 1POV1 2VBBA 4IEPA 2JWPA 2VVFA 5BNOA 2YV8A 3ES1A 4PBPA 4LBMA 4XFBA 1JN2P 3R05A 2ERFA 4W6YA 5IVBA 3ZXFA 3UT0A 4IGQA 2JDKA 1AL23 4TWTA 4AFMA 1ENSA 4NHKA 3ZFGA 1RUE1 1I5ZA 3A23A 1SDDB 4JV4A 5FYSA 1JYTA 1WD4A 1LB2A 5IWFA 4JC1A 3V0AB 3JQWA 5ERLA 2XUMA 4V2WA 5BYNA 4HL0A 4YG6A 1C3HA 2J7MA 4HPKB 3LA3A 4XAAA 5C8WA 3KF3A 2VOKA 1GZ9A 2G9ZA 4NAMA 4H7MA 4UFJA 4RS5A 4IETA 3CJIA 4DRRA 3ZOIA 3TN93 1OQDA 3N36A 4JRLA 2XJVA 5HXVA 1QXPA 1XYPA 2QVSB 3RG0A 1YI9A 2HWE2 4KGGA 2ZGLA 1AR91 3OBAA 1UYYA 1QJFA 3FL7A 5KBFA 2VW0A 1PIV3 5IUQA 1FYUA 1NCQB 1US3A 4JGYB 2PHUA 1WW7A 1EY2A 4DXTA 2YBKA 5L7OB 1YO8A 2VMHA 3BN6A 2BQPA 1ONAA 1HQNA 1RITA 4NRPA 3H1MA 4GXLA 1QJX1 3C7FA 1KD7A 1X82A 2CGOA 2RS51 1NCQC 3MPBA 4FFIA 4JQRA 1EPZA 1RL3A 4JGYC 1N47A 5GZFA 2UYBA 3WW1A 4CCLA 4Y5Z0 3ZDVA 5L7OC 1CZVA 2PA7A 1DG6A 4H7LA 2NYYA 4LLOA 4CU8A 1REEA 5FO7B 2OX0A 4P9WA 1H6YA 3I7DA 2XXZA 1G9BA 3ALQA 3LCPA 4FXKB 1Y7BA 2CGNA 3K4AA 4ARXA 2OPKA 4GMP3 3A0NA 4RHV1 4COVA 5JCTA 2ZKNA 4QX7A 5FY8A 3K3NA 1FOD2 4LQRA 2RS12 3FUOA 5EHDA 3ZKUA 4NJ4A 3BALA 2KA3A 2R061 2BRTA 1DDLA 3NAPB 1VRH1 3ACIA 5D8AA 5AC92 1R64A 1GZTA 2D6MA 5EYXA 4HETA 3UKTA 5I0TA 5ACA3 1SBDA 1CAVB 3I3BA 3ZSKA 3ZXJA 4AR2A 3IPVB 1KITA 2VD7A 3NAPC 4UI9L 3ETQA 1PO21 3B5LB 3TEYA 3KF5A 2OUJA 1W9FA 2WT0A 2RDQA 4FCAA 5FY1A 4LKEA 2XLFA 1POV3 1RUJ1 4ES8A 3TAYA 5KXCA 4QQPA 5J7MA 1LGBA 5FYYA 4CUAA 3LZZA 4GWJA 3OGSA 2RVAA 3ROUA 2UWBA 1VBE2 1UOGA 4EROA 1D0GA 3ZYPA 5JR2A 1TG7A 2WS91 4M3CE 3PMEA 3IIAA 2WWUA 5CKQA 1LULA 3AZVA 4HVOA 1RUE3 1UOJA 5DAVA 4AE2A 3VBFA 1BJQA 2FBEA 1F35A 2DBNA 2GNBA 3LIHA 3VKNA 3WNLA 1PZ7A 1ZBE1 1N1VA 2XVGA 3M1HA 1PVC1 2WZR2 2X29A 1V0AA 3ZFEB 3HQXA 4YFZA 4Q4X3 3I3QA 1CZTA 5FK7A 1L3JA 3WLUA 5BNNA 3VB9A 4YW2A 1BCXA 1HRI1 1OVPA 1AR93 2PMWB 3LSDA 4HKWA 1NLQA 1X50A 3NNJA 4CDXB 2XL9A 2UWCA 5FZLA 5F37A 3ZFEC 5HXMA 1XYNA 3OYWB 4LHNA 5DUVA 1VBD3 4XIOA 4AI3A 2BU9A 4YWAA 1NE6A 4S2DA 3OD0A 4CTEA 1GNHA 4CDXC 4IV1B 1QJX3 1WA4A 5LEJA 5J37A 1OQ1A 4B4PA 4E27A 3BTAA 1LHNA 2A7AA 2P6HA 2PHRA 2RS53 2XHNA 4B1MA 1XYOA 3CLPA 5C5UA 1V9U2 3GHMA 4QHOA 5DXDA 3VGIA 3E6BA 4GAZA 4PF1A 4LIUA 4XUQA 1X7NA 2ORXA 1ZX5A 2X5IB 2CAVA 3OUJA 4XFFA 2ILMA 2QQOA 4IV1C 3T2PA 4CXXA 2WO7A 1B35B 4RN5A 4HPKA 2CAUA 5CNAA 1KDKA 5DAQA 2N7GA 1H2KA 2DVAA 2YC4A 2OPWA 4Z2WA 2PHWA 3RZHA 2E7AA 3CNAA 3CEWA 2FD8A 5C3RA 2X5IC 1UNBA 2P34A 3L2HA 4RHV3 1I6XA 1Q8QA 2A3YA 2CSGA 2OUHA 2RHPA 4YM1A 3VZLA 3VZNA 3ZR6A 4MGKE 1B35C 2OYZA 1QGLA 4ASKA 5I8YA 2DTWA 3PNAA 3APBA 2CY6A 1H4HA 1IHMA 2VMFA 3GYDA 3U4XA 2R063 3I97A 4AFCA 2HWF2 3U78A 5C9AB 1ASJ3 3O0VA 4HVQA 1VRH3 2Z69A 4GD4A 4NRQA 5J96B 4JGYA 2PHXA 3MPPG 1DLCA 3SKJE 2Q8DA 3WXPA 4YRDA 1KGYA 3BOPA 5L7OA 4FTSA 3P5BA 3I2DA 2NZ9A 1XE7A 3GBGA 1XNCA 4LXLA 5FY9A 2WNVA 4E2GA 1PGW2 2YFZA 4Q4V1 3KS7A 4LO5B 1HRV2 4EWEA 1DU3D 5A3PA 4JGZB 5C9AC 4FAGA 3OY8B 1AYM2 1PO23 3O1RA 1UZZA 3ZIWA 5J36A 3T4VA 3LAGA 1VBB1 1CJDA 1VBC2 3H9AA 3OEBA 4YGCA 5JI9A 3SKVA 4FFFA 5HCFA 5C6CA 2QQMA 1B09A 2RM21 1C8NA 1AXYA 1AL0G 4JGZC 4LORA 3TEZA 2PAEA 5A1FA 1QJU3 2WL1A 4YPJA 2HJIA 5JIAA 3K48A 5FZEA 1IQAA 4FOYA 1F15A 1O59A 1UIJA 1JYCA 4XJZA 3AP7A 4CUCA 4CCCA 1W8NA 4Y1YA 4YSFA 5T52A 3UKNA 3VBOB 1WGPA 4OI0A 3GXUA 1ZBE3 4DNYA 3HIFA 2DWRA 5GLTA 3C7OA 2RJKA 1PVC3 1JODA 3NAPA 3SH5A 5CEHA 3MF9A 1QF3A 4MVTA 4IL7A 1JUIA 1RUG1 2Y64A 5HPOA 3ZXEA 1X9PA 4GB32 2JG8A 3VBOC 3MV11 3VBRB 4NIHA 2VZVA 2R042 4ITCA 5CBLA 5FAXA 2CWSA 1UKGA 2ZBJA 1HRI3 4TYSA 4XXAA 3IPVA 4FT8A 1AXZA 1LTEA 1WMDA 5ISLA 4FTBA 3RZLA 4QPIB 3DEMA 3PLQA 3AKQA 4P5HA 1QY4A 4CU6A 3K2OA 5A3NA 5EP9A 3ENRA 5F5CA 3VBRC 3D82A 4JKLA 1RUH1 5HV0A 1W99A 1ZVFA 2BV4A 4NAOA 4Y5SA 2ZGSA 3B69A 1WLTA 3MEPA 3VL8A 4P08A 5B2GB 2VW1A 1H2NA 3KHBA 1EUTA 4OMDA 4QPIC 1H4GA 4INDA 1OI6A 5CG8A 2VZSA 2EVXA 2Y6LA 4XIKA 4WM7A 2VZUA 3LB9A 4B7EA 4MGTA 1XC6A 1VALA 1W6MB 1LENA 3GBFA 3NJZA 3PIJA 5E88A 2DUOA 1WBFA 2K46A 1WWYA 2B8MA 4N8MA 5T50A 1RGSA 2BEOA 3OPWA 3L2YA 4ZXKA 5LY1A 5C7GA 2IWGB 1O3TA 5C8CA 4BB3A 1PHMA 3EQEA 2XKOA 4BIOA 3VHPA 1XE0A 1RYYA 1VE0A 1KS5A 3ZX7A 5CFCB 1BKZA 4CDXA 4FPKA 1CAUB 1SMVA 3IDEA 4IXLA 2ARBA 4DOUA 2DF7A 1MS4A 1Z7S1 2UWAA 4XABA 4CXWA 1UZVA 3OYWA 3ILNA 2PAKA 2K2SA 1YFWA 4AOCA 5KXDA 1JHNA 2R30A 1IGOA 2R7EB 5F39A 4AEKA 3NKGA 1GYKA 1BVP1 4QWNA 3ZMNA 1BMV1 4D3WA 1WCKA 2WSVA 5CFCC 2RV9A 3BIEA 1GMMA 4Q4V3 2LRPA 4IV1A 4XOGA 1OSGA 2WNUA 5G05L 4D6QA 3E5QA 2OW4A 1H1AA 4MG2A 1URXA 2P4EA 1W9TA 1WLWA 3HAGA 2CYFA 1GU3A 3RSJA 2I45A 3VV1A 3AYDA 5JSRA 2B7YA 3MIFA 1ODMA 4QQOA 5IVVA 3LKJA 2X5IA 1VBB3 3VN4A 1OKOA 1IKPA 5FJHA 1Q43A 5KHHA 3M2MA 3PHMA 3J4UH 2B9VA 1OD5A 2WYFA 2RM23 4XJ8A 2QQIA 3TOJA 2ZEXA 4OUEA 2A70A 3NNGA
chains in the Genus database with same CATH topology
1AX0A 3H1WA 4L2NA 3BCWA 1FNYA 3TYJA 4NO4A 1G9CA 1YJLA 2DV9A 3CF6E 5CAZA 2WLPA 2RMU1 4AEDB 2D98A 3R4DB 1QQP1 3WQ0A 4CDWB 2ENRA 2EA7A 1KJRA 1U0AA 2W08A 1QDOA 3NL1A 4D94A 2XWJB 4AEDC 1MVEA 2BNMA 4CDWC 2AZ5A 3GZAA 1AX2A 1HXS1 5CU1A 1JBCA 1HQLA 3USUA 1EYBA 2XBO1 2ZX1A 2ZACA 3NSTA 1RUH3 3ST7A 4D7TA 4M01A 5E1RA 1WLCA 2ZJCA 5CB7A 5K0UA 3HMYA 1AZDA 4AW7A 1QNWA 3AKRA 3MW3A 1ND3B 3B01A 3RYPA 2TEPA 1Q56A 2B39A 4YLZA 3G6JB 4I09A 2EXHA 2FMYA 2ZGUA 2VVEA 3J8F2 4F83A 3B93A 4B4QA 4IV3B 2DU0A 1GV9A 3VBOA 4FOWA 1LECA 4IEVA 1RTVA 1ND3C 1VAVA 4LBQA 3LA2A 1O7FA 1E57A 4E2QA 3AYEA 4KU7A 2XPJA 4IV3C 2DYCA 3FUQA 5T5LA 3VBRA 1V6IA 2C1FA 4I3PA 5GLVA 1QJY3 1BEV1 2MEV2 3THTA 1GANA 1Z7S3 2IFWA 5DG2A 1CAWB 4PBOA 2DCYA 1ULFA 5J48A 1BBT2 2WFF1 3SCFA 4L11A 1AJOA 3RS6A 3KLSA 1A78A 2O1QA 1HW5A 2DCTA 4UW6A 2WLQA 2OZJA 4EN7B 5KHJA 3E6DA 3R6SA 4QXKA 1LGNA 2IXLA 1ZRCA 2GDFA 1U5ZA 2H0VA 1G6NA 3NWKA 3ZFFB 1MS8A 3EO6A 3O7OA 2MHFA 3AFGA 4N7UA 4V1PA 2MNGA 1R1A1 4DFSA 3ZYIB 4AEJA 4HFSA 4PLNA 1VAMA 2ZOEB 1CAUA 2HWC1 2ZGMA 1QQP3 5H9SA 1GBGA 3PJQA 4G9SB 2HYKA 2DUPA 1OFSA 1SFYA 4B7KA 2HWD2 1PGL2 1KDMA 3AP5A 1HXS3 4OZXA 3ILRA 4XF4A 2D5FA 2JENA 4J1WA 5DZFA 2XBO3 1C8M2 4HN1A 1Q5OA 4OUSA 1Z78A 4S2FA 3S6PA 2KM2A 4NWWA 2X8KA 4HT1T 2BVBA 1W6QB 3JBG1 3VHRA 1MEC2 2ZS6B 4DMIA 2B45X 3TRSB 4AHWA 2VUAA 5A33B 1SLCA 3KCYA 2D44A 2XH6A 5K7PA 3QH7A 1V6MA 1GZCA 1ULGA 3W9AA 4XMIA 4AEDA 4JVAA 4FPYA 4FOQA 3C2UA 3H3ZA 5T55A 4CDWA 4LNVA 3MLLA 3VKMA 1MS1A 1YFYA 2PQQA 4I01A 3QBQA 3OPZA 4WVWA 4FPOB 2XL7A 2Z5WA 4XQWA 1LOGA 5BPXA 2VNGA 1NA1B 4XFCA 3JB8A 1BEV3 1RUNA 4YW5A 1AR82 1UMZA 4QX5A 5JZGB 4Q26A 2CV6A 1W6OA 3NV3A 4RQPB 1LCLA 4AWDA 4MGYE 1PM7A 4AI2A 4BE3A 3DF0A 4L8QA 1NA1C 4KQ7A 1DF0A 4N7IA 4UW4A 5I8TA 1H8VA 1H9WA 1H2MA 4A7KA 5JZGC 4LULA 4RQPC 1ND3A 5KWRA 2JECA 3J9SA 1S1AA 1UPSA 2DCZA 1XU1A 1A3KA 1NZCA 4OHWA 1O3QA 2NMOA 2HEVF 1R092 1AL22 3URFA 4A7YA 2RS31 1DGRN 1OFNA 1FXZA 3JUUA 3VDDB 1R1A3 4FOVA 4BIFA 4AFBA 4Y24A 3KB5A 2AH2A 2GZWA 3QH6A 4JDNA 1Y9QA 2ZX0A 1RHI1 2QE3A 3RPQA 3DPRB 4K7JA 2QJVA 2HWC3 3TN92 4ZU7A 3VDDC 1AYN1 5IK8A 4OULA 3Q9OA 4F7ZA 2ET7A 4FTEA 1UKRA 4DB5A 1RUF1 1LKNA 2A73B 3VBUC 4C90A 3DPRC 1V70A 1PIV2 3JB4C 4UBHA 2XLGA 1C1LA 4XJUA 1H8TB 2XWBB 1OPOA 4LE3A 5FREA 2QKDA 5A32B 1ZBA2 1RUC1 4WVVA 4AYUA 3T2TA 1WW5A 4B29A 4R9CA 3VLBB 4BLIA 1S0IA 2I2SA 4XTMA 2BWAA 3ZXDA 2LTNA 4Q4Y3 1RVF1 1BYHA 1A8MA 1AR71 3JBG3 1H8TC 1YJKA 2DTYA 2UU8A 3AMPA 3KD4A 4JRAA 5FQ0B 3VBSB 4FPFA 1Q3EA 3B00A 2PTMA 4PIXA 1WW4A 1GZWA 1VBA2 2P3IA 1NXD1 5CG9A 1O4YA 3VBSC 1FT9A 2D43A 4YARA 4Q1RA 1VP6A 3ZYRA 2IXJA 4COZA 4KGQA 5HCAA 5HCBA 3RDIA 5I91A 1N1YA 1V00A 2GAUA 4YM0A 4DPNA 2ZA9A 1UX6A 1F5JA 4JTOA 4K9SA 2LALA 1I3HA 4O9GA 1RJ8A 5ACA2 3SCGA 3S7EA 1RUOA 4AFAA 1XNDA 5D1IA 2O8OA 3ATGA 4K1ZA 3G7DA 1S2BA 5T5PA 4KU8A 1D2QA 1TEIA 3CJXA 4B4RA 5A33A 2QFEA 2WFPA 3VZOA 2GNTA 3BIWE 4CZSA 3JD71 2RS33 1RUE2 1GQGA 4BYYA 1KQRA 2WQ4A 4P9IA 1X36A 1J3PA 3M3EA 3OBTA 4OHXA 2P37A 3RJ2X 2D6PA 1NQDA 4BQ1A 2RE9A 1Q8PA 4CP1A 4JTNA 1ULCA 5KHKA 1DBNA 2Z2SB 1RHI3 1NA1A 2ZABA 4Q4X2 4XE9A 2VECA 1AYN3 5JZGA 1YRZA 1F8VA 4RQPA 4S2HA 5DZEA 5I0SA 2NP0A 3LOBA 4Q29A 1LESA 2JEMA 3HD8B 4QMAA 1RUF3 1LOCA 1UCXA 5DUWA 1A6CA 1VBD2 1D4VB 1UPIA 3AZYA 3QD6A 2VU9A 4CEYB 2LM3A 1RUC3 1SLBA 2A6ZA 4AF9A 4HKOA 5ABJB 1QOTA 1QJX2 3VZJA 2B9UA 1VJ2A 1XNBA 3NVCA 1TQ5A 2RS52 3E6CC 3VBHA 1RVF3 4RR3B 1AR73 4CEYC 1AVBA 3VDDA 5ABJC 4XXPA 5GLUA 4PQ9A 3IDBB 2D6NA 2P3JA 2ZAHA 4RR3C 4FXGB 4Q1PA 4ISRA 4WVMB 3WG2A 3VBUA 5BV6A 2BFUL 3DPRA 4RHV2 4GMP0 4ATEA 4P9JA 3RI9A 1ZZ9A 2ZGOA 1W0OA 1OLQA 4Q27A 4Z07A 2IZWA 3N7KA 4YG3A 4AGVA 4AVVA 2OA2A 4WV8A 2NLRA 5FOBB 2YGMA 1MQTA 3UKVA 5SV8A 3FWEA 3U11A 3WOGA 4J6GA 1QDCA 2R062 2WWSA 4YZ1A 2C5DA 1ASJ2 1S0BA 2RJLA 2H6CA 4N90A 2ARXA 3B94A 1CVNA 2D6OX 4I3GA 1PO22 3H1YA 4CEWB 4R8HA 4A7ZA 2DUQA 1NG0A 3PVOA 1BK1A 2Q1MA 5FQ0A 3MGUA 2D7FA 1XNKA 3VBSA 1S55A 2ZPXA 2GNMA 5DDJ1 4CEWC 1QJU2 2ZGPA 1CIWA 1SCRA 4Q8KA 3JD73 2V73A 2Z42A 2QZ3A 4KBBA 1SBFA 3SHRA 1OKQA 2P17A 3N3HA 1TME1 2W39A 3MLKA 3N4MA 4N43B 3KMHA 5F9TA 1ZBE2 1W6NB 4RD7A 4CDUB 1DGWA 2R0HA 3DV8A 4CP0A 1OLRA 1PVC2 4E4ZA 1SLLA 2H6BA 5GLZA 1OQEA 4C1WA 5H9PA 4P9GA 1LHWA 1IS3A 2FZ1A 2AUYA 4N43C 1JTZX 4YZ4A 1EV11 3WP3A 4CDUC 1HRI2 1YUDA 4UW5A 3FHIB 4JCKA 2HKXA 3MI8A 5EWSA 2TBVA 4I0BA 1O3SA 1CAXB 5L19A 4BWOA 3WP4A 2EAKA 1CN1A 1XXNA 3V0AA 4AI1A 3EXUA 1G9DA 4RGGA 1N1TA 4AHYA 4YGBA 1O91A 2PHFA 5JVVA 3MIHA 2D3PA 1X8MA 2PFWA 3W58A 2YDEA 4A2UA 3I8TA 4QQLA 4UBGA 1KFUL 2Q30A 4XJWA 2ES3A 3JU9A 4RFT0 2ET1A 4XJ9A 3POSA 1NCQA 5L73A 4Y1ZA 4QU2A 1C5IA 1PNFA 3M3OA 4KWJA 1EP0A 2D93A 3A4UA 3D0JA 4URTA 4XF1A 2WINB 4COWA 1J1LA 2BWCA 1DQ1A 1DQ4A 1RUJ3 4IEXA 2RR11 3U10A 4Q4V2 5DUXA 3GBWA 4I02A 1OA3A 2A75A 5EJ3A 4C0BA 3ZO0B 1AXKA 2WS93 4FQ4A 4E2SA 4HSLA 1CONA 1VBB2 3KT1A 4LBQD 1U5YA 4R9DA 1VBC1 2RM22 2OZ6A 4F8AA 4R4ZA 2OVUA 5DDJ3 1LOFC 3DUIA 4WVMA 4M3CB 5KXEA 4D69A 4GALA 4BM8A 2VNRA 4IQPA 1DHKB 1OPMA 2EAAA 1TME3 5GM0A 3B7MA 4SBVA 2R071 2R0FA 3M3QA 3POYA 3MIGA 2QNKA 4P9LA 1CAVA 4IEUA 4LUKA 1ZZBA 3AJZA 1V6OA 2JD4A 5DZGA 5IT6A 1EV13 3UL2A 2YUEA 1AF9A 3WDTA 2FMDA 4GWNA 4AHZA 2SBAA 2R041 4CEWA 3HN1A 1LOAA 2XJSA 1YFUA 5JR7B 3AP4A 4ZU4A 5AFBA 1RINA 1VIWB 1FMD1 4CDQB 3W59A 1OMIA 5E89A 3M7AA 4Q2FA 1AJKA 2WNEA 4B3NA 4OHYA 4COUA 2QZ2A 1DLLA 3ZFEA 3ZMOA 1NCRB 2HEWF 4CDQC 2F6BA 2UY8A 1TNFA 2GMMA 3DL3A 4CYDA 1W6NA 2IXKA 4CDUA 1IS6A 5JOXA 1DQ5A 1KS4A 1ULEA 4P14A 4DRVA 1XE8A 5GLWA 1H1IA 1NCRC 4DZGA 2ZMLA 1EAH1 4GH4B 4OI2A 3U07A 3NV1A 1QJY2 4LO6B 1LGCA 2GU9A 5GJ6A 3RMYA 1PGSA 1Z7S2 1DQ0A 4Y20B 1KRIA 2VMGA 2G4IA 3K51A 1I1EA 1CAXA 4IESA 4GH4C 1FI2A 1BMV2 5FMOL 4HSJA 2YXSA 2RR13 1G86A 1RMU1 1FV3A 4Y26A 4FPLA 4YM2A 1B35A 1LJ7A 2PHDA 1EPWA 2FHRA 2WKKA 4Z82A 1PO11 4XQ4A 3ZXKA 1C28A 3ZXLA 3NV2A 2YGLA 2QUOA 1LOEA 1CESA 2YPJA 1QH6A 5C9AA 3TB0A 3VHOA 5JAXA 1LHOA 2ZHKA 5EYYA 1RUG3 2R073 3GZTB 2ZX2A 4I2OA 4EJRA 1D4M1 4H55A 4PLMA 1CR7A 3KM5A 4JGZA 3OY8A 1GFF2 3WP6A 1ENXA 4M00A 5JOZA 3CO2A 3H3UA 2VXRA 4XFAA 1J1TA 3VZMA 4BA6A 4WVZA 5F1RA 2R043 1V6KA 1PMIA 1LOFA 1HXS2 3AP6A 2JKBA 4HMZA 3SCHA 4FAHA 3HT1A 2E63A 4GULA 3NV4A 4HK8A 5I93A 1FMD3 5DUUA 1WUVA 1X33A 2GH2A 2XKPA 3WNXA 1FX5A 4P9YA 4IEWA 4LBJA 1DQ2A 1GQHA 1SDWA 4BH9A 3MFAA 4LBLA 1GICA 1HKDA 4RA0A 1SBEA 4LA2A 1C4RA 2BUKA 2ZHLA 3PVNA 4XFGA 4Q0SA 2C0ZA 3M70A 5FO8B 1UZYA 3I4IA 3UJQA 5BY5A 1SLTA 4XZPA 2JX9A 3AKPA 1QOOA 4UXAA 4XQDA 4YW4A 3IDCB 3H7YA 4FBFA 3ZN4A 2BGCA 4GQ7A 4PLOA 1TMF1 4QPGB 5HI0A 4LT5A 4OUMA 2BNOA 3QCWA 4QPIA 4WZFA 1JUHA 1EAH3 1ZNPA 2PLV1 2ZX3A 1R081 4QPGC 1AR61 1BEV2 1YNAA 3MIEA 4C1XA 5JOWA 2MEV1 4HLTA 1ZRFA 2H0BA 4LHLA 3QACA 1A8DA 1WW6A 1IZ3A 3LA7A 1S0FA 5C4WB 1XRUA 4QGLA 1YFXA 4KG0A 1QXRA 1UU6A 4JAAA 1WD3A 4CDQA 4XBLA 2D5HA 1RMU3 1W6MA 3KZ4C 4EWDA 1IPKA 1NYWA 2E6VA 4R4XA 2XHKA 2CNAA 2GC1A 3DKWA 5C4WC 5BNPB 1PO13 3AYCA 3T1MA 3VHNA 3WG3A 4KH9A 3ZFFC 1IOAA 1JW6A 2DU1A 1PNGA 2RMU3 5CFCA 3WV6A 4MH0E 1R1A2 5LEKA 5BNPC 5J98B 1H9PA 1COV2 2NMNA 4L97A 4F3JA 4EN9B 1APNA 1ZZ6A 2VOVA 1LRHA 1D4M3 2HWC2 2WZPP 1RUI1 4Y20A 1QNYA 3EHKA 4YVWB 2DVFA 1UL9A 4WM8B 1Y3TA 1XQNA 3KT7A 4K1YA 4MZUA 2A6VA 1MR5A 2D3SA 3FMGA 3AJYA 4ZKTB 2R32A 4YVWC 2HWB2 4WM8C 3HT2A 3ES4A 1MACA 2Y26A 1H1MA 3GNEA 5T54A 2ZKLA 1WCDJ 2JICA 4TSVA 4Y22B 4AHXA 4Q4Y2 3ZXGA 3JBG2 1KJLA 4G3YC 2YHJA 4GA9A 3OCPA 3N7JA 3AB0A 4Q0UA 2YMZA 5GKAC 3WUDA 5BNOB 5IK7A 4HANA 4PF5A 3WDUA 3LSEA 2VVDA 2B46X 4BCUA 1TMF3 3IT8A 4H3WA 3ZFGB 4PIZA 3I59B 5BNOC 4X6QB 3ILFA 3AZZA 3H7JA 2XJPA 4OFGA 5AVAA 3RI8A 1J59A 2GSYA 1NOVA 2PLV3 3B02A 2WFF3 3ZFGC 1R083 4LBNA 1AR63 2BW8A 2FZ2A 4LUMA 3R0RA 3AMMA 4N53B 4GKYA 4AVSA 2ZGRA 4UW3A 2MEV3 2XG3A 1SLAA 4TZDA 4NHMA 3WY6A 4IEQA 1VAKA 3GALA 2D40A 3MF6A 2FQPA 2ZAAA 3ZSEA 4N53C 4FP2A 4IV3A 1AX1A 3JCIA 1IKQA 4IEYA 1UW8A 3INAA 4Q4W1 4LBKA 4JDMA 3HWJA 3WX5A 3VL9A 2DVGA 4R9AA 4QM9A 3FLRA 2ZZJA 3LWCA 4PIYA 3SH4A 2RS32 1J3QA 2UYAA 1W39A 2DFBA 2VULA 3RYKA 1W2UA 1R091 1AL21 2A6XA 2DVDA 3V64A 1FPN1 4AQ6A 3RYRA 2R6QA 2ZGNA 1PZ9A 3ZPYA 4E9KA 5AVPA 1V6NA 1RUD1 1CAWA 1BQPA 3GZUC 2G9FA 4AG4A 3AMQA 3NKTA 1RHI2 1M4WA 1NY71 1MZEA 1RUI3 1AYN2 2F4PA 2R16A 1S0GA 3J26N 4RL7A 5AFEA 2XGXA 2YROA 4EV0A 1DYPA 1QKQA 1RUF2 3WW2A 5FDBA 3ZYGA 2ZZQA 3WD5A 5H9RA 2AREA 4XDQA 3ZFFA 4LO7A 4YG0A 4MV2A 4XF9A 5IK4A 1UAIA 5D8AB 2OIIA 4K6BA 2JXAA 5LK7B 2W68A 3AK0A 5BNPA 1ZBA1 1BZWA 1SQ4A 1RVF2 3TNPB 3BU7A 1AR72 5EFUA 4LR4A 1DGRA 2CTVA 3FZ3A 3SLIA 5D8AC 3B3QE 1DGWX 2ZHNA 5FO9B 2Q1ZB 3E5XA 3A0KA 4M0HA 4EN6B 4FPGA 1QJZA 2WT1A 4LBOA 1NXMA 4E4DX 3ZIXA 3CU7A 5FLJA 1X8EA 3THPA 4Z92B 3VKLA 1VBA1 3D5OA 2Y0IA 4YVWA 3WR0A 4WM8A 3N35A 3KGLA 1O3RA 2ZGKA 3O14A 1TE1B 5J3UA 3B9IA 3WW4A 1F31A 1LEMA 1IPJA 4XF0A 1W6QA 1WMFA 3M4FA 5GALA 1GNZA 3RRDA 1MVQA 4BLJA 5BNNB 1MS9A 4Y22A 3RQ0A 1NE4A 1C5HA 5SV5A 3MFCA 4Q4W3 2R1BA 5KHGA 4MX3A 3VKOA 3AFKA 5BNNC 3ECQA 3RMXA 4XHXA 5J09A 4W6WA 2NQYA 4AI0A 3FBYA 4G4FA 2WT2A 3AKSA 3JD72 5CADA 1R093 1PK6B 1FPN3 1H30A 3TWIA 3I59A 3JQXA 4ORFA 4CP2A 2VH9A 1RUD3 2A5ZA 2DFCA 3IMNA 3WCRA 1CPMA 3R4UA 1AR92 3ZXAC 1PK6C 3N7LA 1UU5A 2HWE1 3H8UA 4N53A 1HX6A 4SLIA 5H9QA 4YVSB 4Q4X1 1DZRA 4BMBA 4AFDA 4R52A 2GH8A 1HV1A 4LA3A 5JI7A 3VZKA 2UY9A 2YZ4A 3ASIA 5CIRA 3AXEA 5JSPA 4I0WB 4YVSC 4LEJA 1VBD1 1QXJA 2Z79A 2PAMA 4I0AA 3PMSA 1ZBA3 4XHBA 1OOPB 4AVCA 2WNVB 4HK9A 4Y1UA 3MW2A 1HDKA 1YXWA 1CGPA 3E5UA 1IS5A 1YWKA 4GKXA 2IXCA 1OOPC 4PJYA 2WNVC 4X8NA 3HBZA 4H14A 1ZYBA 1QOSA 4E4SA 2GN3A 1QH7A 4K40A 5GZGA 1F2NA 1FOD1 1W0PA 4X8PA 2AGSA 2RS11 1CD3G 1VBA3 4PCRA 4NPRA 1VRH2 3FX3A 1S2KA 3DN7A 1ENRA 1H8TA 5A32A 5AC91 4XPVA 2TUNA 3RNSA 3WDVA 3M3CA 1YLLA 4FPCA 4OLLA 2BBVA 3CL1A 4AVBA 1ASJ1 3SISA 1JXNA 1KXGA 2XVKA 4D7YA 3ZYJB 5EZWA 1ZA4A 1RUJ2 2XJUA 3BB6A 3IBMA 4GIQA 1POV0 1ZZ7A 3GF6A 5FRAA 2P2KA 4AK3A 2JG8B 1V6JA 4AEMA 2WS92 1VBE1 5E16A 5F5QA 5CFDB 1O5UA 3IN9A 1DZQA 4HN0A 4META 3V0BB 1CX4A 2EXJA 2JG8C 4YYOA 2R49A 5DDJ2 3SMHA 3USSA 4QHBA 2VW2A 3SITA 2E53A 4C91A 5CFDC 1QJU1 2EXIA 5FOJB 3SXWA 3AM2A 5FPZA 4C0HA 4XF3A 4WM7B 1TME2 5A3LA 1OA2A 1U5IA 2WZR1 1S0EA 4KWKA 3OF1A 4XFHA 1HV0A 3FLTA 3WDWA 2HWE3 4XJAA 4WM7C 2YC0A 2A3XA 2VNOA 3EJKA 3FJSA 2DCKA 5C8CB 1EV12 1H2LA 2ZCWA 3AYAA 3E97A 2JG9B 1JH5A 2GC0A 3AP9A 3ZN6B 1N1SA 4XEZA 1YHFA 4K21A 5T5OA 1AUYA 1BXHA 5C8CC 3RZZA 1BVVA 5CVRA 4ATFA 4FQZA 2B42B 2JG9C 3WW3A 1QMJA 1V9U1 2Q5TA 4L92A 5E8AA 4TLFA 1GSLA 2WNUB 3UV9A 4NHLA 3ZSLA 3ZN5A 1ZZ8A 1PK6A 4QQ2A 3MICA 1MZFA 2YY1A 2JE9A 3AMNA 3R4SA 3WZ1A 4XBQA 2GC2A 3WVJA 2WNUC 1XU2A 4I30A 4NR1A 2EIGA 4Q0VA 1FOD3 4YGDA 4S2GA 2RS13 4AVTA 2V5YA 3DGTA 3JZVA 4YVSA 1SCSA 2HWF1 4CEYA 2D6LX 2LUWA 5AC93 2VPVA 4LO4B 1CPNA 2VUJA 5ABJA 4HVRA 2Q8OA 2V09A 4EN0A 3ELNA 1PGW1 3SH3A 2A71A 1G8WA 1HRV1 3WINE 4RR3A 1AYM1 3MIDA 2RR12 3UJOA 5JMCA 1HIXA 1LU1A 5EV7A 1OOPA 2UURA 4AGRA 1QWRA 1HLCA 3RWNA 1VBE3 4FPJA 2JJ6A 5FLHA 3OTFA 3USUB 1FAYA 2HEYF 4ZU5A 3P3PA 3OGGA 4IEZA 3POWA 5EXOA 3IKWA 3WHTA 4DY5A 5K0UB 4IERA 2GALA 4J1XA 1K5MB 1REDA 2VQ0A 2EXKA 1RUG2 2AYHA 2R072 2WZR3 1ENQA 3AX4A 5K0UC 1K5MC 3TBDA 2BFUS 4GB31 4BMEA 1UN1A 3P3NA 4LBQB 4YW1A 1Z0HA 1I9RA 5JOYA 4WBBA 2BYVE 4OI4A 4P9XA 2CWMA 4Y4YA 1RUH2 4AVAA 2SLIA 2PN5A 3QOPA 2JE7A 1ZM1A 1G7YA 5CFDA 3OD4A 2A6WA 1FMD2 1U12A 2XVLA 4R9BA 3V0BA 3WG1A 2D97A 2XLAA 1NLSA 5F6KA 1V9U3 3KQRA 5FFOC 4RSUA 2QCSB 1VLNA 4N43A 1QHDA 4ASLA 3HR9A 1LHUA 3WHUA 1Y43B 1DGLA 3FFZA 1SEFA 2GMEA 1O4TA 2E9QA 3AZWA 2Q0AA 1G9FA 3LOIA 3H0OA 1ALYA 1MZ5A 3NO8A 1S0DA 2P3KA 4KWLA 2A3WA 1YCIA 5I8SA 2I07B 3BODA 1EAH2 2HWF3 2K0GA 1ND2B 2JG9A 2BPA2 2BTVC 5K8SA 5JIUA 3ZN6A 2VY0A 1QJY1 4AGGA 3KCXA 3MZHA 1Q8SA 4FSJA 1HRV3 5KXBA 1ND2C 1AYM3 1S0CA 4RGAA 3WCSA 2VGDA 1C57A 5T5JA 3X29B 1RMU2 1MS5A 4A3XA 1V6LA 1SLIA 2YYOA 1ZZCA 5T3NA 1VBC3 4EN8B 1TNRA 3IWZA 3MLJA 2PHLA 4X6RB 1PO12 4XETA 1O4ZA 2NM1A 4NOTA 2MPFA 3D8CA 4YNIA 1KFXL 1F9KA 4YM3A 3GHNA 4PDWB 4YZ5A 2BNNA 4QD2A 3UK9A 1G9AA 2RMU2 1R1ZA 2X53S 4NWVA 1HQWA 1QQP2 2ZGQA 2EALA 1Q8OA 2VMIA 4PDWC 2PELA 1D4M2 3D0SA 4AQTA 3S30A 1MZ6A 1LOBA 1C1FA 4GB33 2NPIA 5BUVA 3L9JT 2IFRA 3MIBA 4ASMB 3FE5A 3PJYA 3AZXA 2IC1A 2ETEA 2XBO2 3FLPA 3C3VA 1LU2A 1LR5A 2AR6A 2XJQA 3O0XA 3AXDA 4LHKA 3N7MA 4BZ4A 2ZHMA 2ATFA 4FO9A 4M3CA 2WJSA 1F5FA 2XJRA 4M3CF 4MSVA 3V56A 1W6OB 3TNQA 3O12A 4W65A 2WSUA 5GZEA 4CRQA 5HBAA 2Q4SA 3J8F1 3WUCA 1K5MA 4Z8BA 2BVVA 4BOWA 1W6PB 2B5HA 2AENA 3ACLA 4FPEA 1RB8G 2DURA 4Q8LA 2O0OA 2E51A 4MUVA 4Q0QA 3ZVXA 1TMF2 2EF6A 4N9IA 4AQ2A 3MW4A 1DYKA 4Q0PA 5KC6A 4QT6A 2IXHA 2WA3A 4MXWB 3IM0A 5I0RA 4YFWA 3WT3A 4DINB 3AMHA 2PLV2 2WFF2 3D4KA 4XTPA 5FBZA 1R082 1J3RA 1AR62 1BBT1 5K9YA 2C9AA 3NW4A 3ZDSA 4N9HA 1GR3A 4Y1XA 1GLHA 4O9EA 1Q8VA 1QU0A 3O0WA 1UIKA 2XJTA 2E7TA 1NCRA 3LGRA 1JOJA 4YW3A 4HBNA 5GZDA 1NLRA 1N3PA 4QM8A 5C33A 5CA6A 4FPHA 3S0MA 2KXLA 4DQAA 3BPZA 1VB2A 4BPZA 4MXVA 5F6LB 4GH4A 1LEDA 5BNQA 5FCCA 1T6GC 4AXOA 4IEOA 3OJBA 4LLFA 5L36A 4YGEA 3I54A 1COV1 4FVVA 1ND2A 3SNMA 4L99A 4Z1VA 3KGZA 3RJRA 5KHIA 1WBLA 1N3OA 1GZWB 1RUI2 4D7SA 4GWMA 4NN0A 1H0BA 1DZTA 4LTAA 1RC6A 4KL1A 5DG1A 1ZRRA 4W6XA 1PZ8A 2HWD1 1PGL1 5IK5A 5KC5A 1YI7A 1LHVA 1N3QA 1C8M1 2WQZC 2CL2A 1CQ9A 2HWB1 4NVPA 1MEC1 4MLOA 5BXXA 5FMOS 1SACA 2WC2A 4XW3A 1WLDA 2JDZA 1PVXA 4OHVA 4PDWA 2Y38A 1FATA 3OBRA 4Q4Y1 3B9CA 3J8F3 4LO8A 1OHFA 3U0ZA 1MS3A 1D0HA 3S7IA 2VOWA 3KT4A 1AHSA 2ZTNA 1M06G 3OGJA 4YZ2A 3MYXA 3D6EA 1YIFA 4KG8A 4RS5B 5FLIA 3WDYA 3CJIB 1DQ6A 4K8FA 1AR81 3ZSJA 2PYTA 4ES9A 1UD1A 4OVEA 1BBT3 1ULDA 3MDPA 4HKLA 4RS5C 5FTTC 3PTYA 2ZMNA 3CJIC 1ZRDA 2QQPA 4QQHA 4WZCA 2ZMKA 1IS4A 4OHZA 2VQAA 4JDOA 5FPXA 1O5LA 5I0UA 3ZSMA 1NQJA 4M0NA 4AI8A 1RIRA 4XFIA 1S0JA 1MS0A 4Q4W2 1UF2C 1W6PA 5LK5A 4QPGA 3O5SA 3FFQA 4AQSA 4L9BA 1RJ7A 4LE4A 4COYA 4XBNA 3VKFC 2WA4A 4MGZE 2WIIB 2TNFA 3FBMA 3VBHB 1FPN2 1VR3A 3WP5A 1DIWA 2NN8A 3WQ1A 4K20A 1UU4A 4XYXA 5LRRA 5LRSA 4FP3A 1RUD2 2GMPA 2QDRA 4ISQA 1REFA 1OA4A 2I74A 4MXWA 4Y1VA 3TN91 3V65A 3FC0A 4Z2WA 2GNDA 5GZCA 1COV3 2PHTA 5C4WA 2QDNA 3VBHC 2VG9A 1NY72 1SFNA 4U2AA 3T1LA 4QPYA 3VBUB