3GALA

Crystal structure of human galectin-7 in complex with galactosamine
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
134
Chain Sequence
NVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords GALECTIN-7
publication title Structural basis for the recognition of carbohydrates by human galectin-7.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3galA00
5DUUA 5DG1A 1N1TA 2R16A 4Y1YA 1DZQA 3WLUA 1WBLA 1IS3A 3MW4A 3OBTA 4FPEA 2AREA 2D7FA 3USUB 3OBRA 1AVBA 3O12A 2WKKA 2ZGTA 5T55A 2ZHLA 3IPVA 5BYNA 4XMAA 2R0HA 3A0KA 3T2TA 1F31A 1ONAA 4BQ1A 1SFYA 2JKBA 1UPSA 1UX6A 1IKPA 1CPMA 1VAMA 5GLVA 2D43A 4YM2A 2A7AA 1DBNA 2E7TA 2DU0A 4XTPA 5JOZA 1KJLA 1S0DA 2GDFA 4FPOB 1FV2A 1YO8A 2ZGMA 1MS9A 1GKBA 1MR5A 2EALA 2WLQA 3UJOA 4BM8A 4YM0A 1Q56A 3M3EA 4U2AA 3USUA 1A3KA 1LECA 4YG0A 2D44A 5T54A 3GALA 4WVVA 1FX5A 4PQ9A 2E6VA 3M3OA 2C5DA 1OQ1A 1WUVA 1LGBA 3AZVA 3HN1A 2VW2A 2NMOA 5KXEA 3HMYA 3PJQA 1LHVA 1MS0A 4M3CB 4R9BA 1RITA 4FOWA 1SLBA 4YW5A 4DFSA 4FQZA 1LHNA 1N3PA 3RQ0A 5H9SA 3Q9OA 2WT0A 4XTMA 3WHTA 2D6OX 2ZHKA 3ZSLA 4BLJA 2DTWA 1JOJA 4SLIA 1W6PB 4XJWA 4YW2A 1A8DA 1ULCA 2YROA 3WV6A 5F9TA 1MZ6A 1LOEA 1VLNA 3HR9A 4XJZA 1KITA 2D3SA 2FMDA 2UWBA 3WZ1A 2SBAA 1MS5A 5DUXA 3TAYA 4ISRA 2CYFA 1MS4A 2V73A 4UW5A 3M3QA 1QNWA 4M3CA 2PHWA 4FPHA 3AP7A 2A3XA 3WDTA 1DFQA 1S0JA 1N1YA 3O5SA 2GN3A 2AGSA 3AJYA 1G7YA 3AZZA 4FP2A 1CJPA 2WJSA 1G8WA 3LSEA 5CBLA 5IT6A 4Y26A 4DPNA 1V6OA 4XJ9A 1W6PA 2A6YA 3FBYA 1VAVA 2ZA9A 1YYNA 3ILRA 1QOSA 4XOGA 3ZSMA 4FOVA 3AX4A 4K21A 3PVOA 4P9XA 4Y1ZA 4ZKTB 4WZFA 2DTYA 4MYEA 4XBNA 3MW2A 3W58A 1DIWA 4IQPA 4XHXA 5L73A 5JOXA 1N1SA 2D6KA 2UWCA 5CB7A 1FYUA 4TZDA 3AP5A 3ZVXA 3OY8B 3ZXJA 1W6MB 1EPWA 1NXD1 4FQ4A 5EWSA 5T5OA 5E88A 4GA9A 3D6EA 1ZA4A 1LGCA 1AXZA 3ZSJA 1CVNA 2EXJA 2R0FA 4H55A 5JLVA 2OUHA 2PHXA 5H9QA 5LK5A 4CTEA 3OPZA 3M1HA 2A6XA 2RHPA 1GLHA 2PHRA 3H0OA 3WDVA 5E89A 5IK5A 4Y1VA 1XQNA 1QKQA 1S0CA 1BKZA 2DUOA 3ATGA 5AVAA 4D69A 4XBLA 3V64A 5FRAA 2DYCA 2R1DA 2NYYA 1W6MA 3AP4A 3L2YA 1FV3A 3AZWA 1SBDA 3OY8A 1F5FA 1DQ2A 1I3HA 2DWRA 1UKGA 2W08A 1JXNA 4PCRA 2PHTA 2DV9A 2ZGQA 1IOAA 4OZXA 4R9AA 1AX1A 3FUOA 2I2SA 5T50A 3VKNA 2ZGSA 3UJQA 3DUIA 5H9PA 4AVSA 3W59A 1GANA 4XXAA 1WW4A 2D6LX 3BIWE 4F83A 3AXDA 3AYAA 4M01A 1S1AA 1Q8PA 1BXHA 1H9WA 1OKQA 3D5OA 1HQWA 4R9CA 2DU1A 4YZ4A 5HCAA 2ZACA 3AJZA 2ZHNA 2YY1A 1AX0A 4GWMA 5SV8A 2ZAAA 3AZXA 4FP3A 2GALA 4Q8LA 4BMBA 5JDBA 1WW7A 3N7KA 1MS3A 2W68A 1GNZA 1BJQA 3SH5A 1SLLA 1N3QA 2ZABA 2GN7A 3RS6A 2P3KA 3LSDA 2EIGA 2P2KA 1ENQA 1G86A 3UL2A 3WCRA 1ZM1A 1V6JA 1GZWB 1AZDA 1D0HA 1JYCA 2BQPA 5GZCA 1AXKA 3WG1A 1SLTA 4YG6A 4C1XA 4YLZA 1Q8SA 1WD3A 1H9PA 3FUQA 3V0AB 1H30A 4BOWA 1JW6A 2DVGA 2VU9A 1CN1A 2DVFA 3C2UA 4BLIA 2AH2A 1Q8VA 4Y1XA 3RSJA 3AXEA 3VKLA 1YIFA 1HQLA 1CIWA 1LU2A 5GLTA 2CNAA 4XBQA 4XJUA 3V0BB 2A6ZA 4YZ5A 1PZ7A 3POWA 1KDKA 3N36A 1DGLA 1DQ0A 4PBPA 5T52A 1DYPA 2JECA 1IS5A 4XE9A 4AVVA 2WNEA 1GZWA 1UL9A 2GNMA 4NO4A 1SBEA 5T5PA 4Z8BA 3WG4A 1IS4A 2DVAA 4LBQB 2HYKA 4NOTA 2OUJA 3V0AA 1A78A 1HKDA 4Y20B 3WG3A 1KRIA 3NV4A 4YM3A 1FAYA 2D6PA 1ULFA 1SLIA 1LTEA 5GM0A 1LESA 3R4UA 1UZZA 3B3QE 1G9AA 1WBFA 5GJ6A 1UAIA 1QOOA 1WCSA 4ZXKA 3WDWA 2A70A 4YG3A 2JD4A 2FHRA 3V0BA 2VY0A 4LBKA 4FVVA 1DHKB 2A71A 1N1VA 3A0NA 3N3HA 2PELA 3ASIA 2TEPA 3T1MA 1BZWA 1PZ8A 1U0AA 4FPKA 4Q26A 1DQ5A 1HLCA 1QDOA 3NV1A 4LBQA 4XJ8A 2P37A 1LULA 5GZFA 1F9KA 1LEMA 1JN2P 4Y20A 1QDCA 1QF3A 3IKWA 1YRZA 4XIKA 3B69A 1SACA 4YZ2A 4AVTA 1QU0A 2ZZJA 3NV2A 4LBNA 2ARXA 4CZSA 3OJBA 4ATFA 2H0BA 4YFWA 4FPGA 3VKOA 4GXLA 4L8QA 3APBA 1GBGA 3AZYA 4LBOA 1NLSA 1LHOA 1UMZA 3WDYA 5IK4A 4P9WA 3UK9A 2JJ6A 2DUQA 2ENRA 3B00A 3O0VA 5JVVA 1WLWA 1CR7A 4PF5A 3ZXKA 2EXHA 3AP9A 2CY6A 3AYCA 3AK0A 1GNHA 2A3YA 4Y1UA 2UURA 4FPYA 1CESA 1MVEA 3WNXA 4LBLA 3MPPG 2D3RA 5GALA 3FLPA 2GMEA 4DRRA 2VH9A 3O0XA 4TYSA 4CRQA 5IK7A 4YGBA 1LOCA 2KM2A 3WUDA 5CAZA 1SCSA 4FPLA 4GKXA 2LALA 3ZXEA 2DUPA 2AR6A 4XJAA 2AUYA 4XILA 3ZYPA 4XDQA 3WVJA 4W65A 1LOGA 1D2SA 4RL7A 2ARBA 1WW5A 3WDXA 2P34A 4AGVA 1WW6A 4K1ZA 1GSLA 3TB0A 3R05A 1O4YA 3N7MA 1FNYA 1KJRA 1G9BA 3ZXLA 1G9CA 1LOFC 5KXDA 3LCPA 5FREA 1W6QB 2R49A 3AYEA 1W6NB 1LGNA 3ILNA 4R9DA 1C4RA 1SCRA 1N47A 3POSA 1ENSA 2JDZA 4LBQD 2B7YA 4AYUA 3RMXA 1ULGA 2CTVA 4P9YA 3V65A 2SLIA 3JUUA 1LOBA 4FOQA 2AYHA 3M2MA 4XHBA 2A3WA 1QNYA 3VV1A 5JOYA 3CNAA 2XG3A 4XZPA 5T5JA 3A4UA 3PMEA 5GZEA 1VIWB 4XYXA 1WLDA 1GICA 1YXWA 2WSUA 1B09A 4GALA 3OGGA 4XXPA 1W6QA 2W52A 2VUAA 3FLRA 4YM1A 1W6NA 3SH4A 2JE9A 1MS1A 4YW1A 2OVUA 4Q1PA 3B9CA 4YFZA 1LOFA 1AF9A 1DQ4A 3SISA 2DURA 2YMZA 5F5QA 1FATA 1URXA 2P3IA 2YV8A 4YW3A 4XMIA 3ZPYA 2VW0A 1LENA 2V5YA 1JHNA 1DLLA 3MW3A 4GKYA 3PVEA 4K20A 2R1BA 2ZGOA 5DG2A 1MACA 2E53A 3INAA 2D6NA 5EYXA 3FFZA 1LU1A 1JYIA 4ASMB 1ULEA 4YW4A 1BQPA 1N3OA 4WVWA 5HCFA 1SLCA 1OFSA 2NN8A 5KXBA 1TEIA 1UN1A 3BODA 2AENA 3RRDA 3SNMA 1SLAA 4FPCA 3I8TA 5T5LA 3IMNA 3SLIA 2E7QA 2GMPA 4UW6A 3RMYA 4AGGA 1VALA 2A6VA 3N35A 4BPZA 3SITA 2ZGNA 4YGEA 4GWNA 4Q8KA 1IS6A 2OW4A 3IN9A 1BYHA 1V6NA 1FNZA 2EF6A 2NZ9A 1V6KA 1JBCA 4Q27A 1QGLA 1S0EA 3I4IA 2WT2A 1R1ZA 3BTAA 1V00A 2GNBA 2EAKA 2YXSA 3KM5A 3NWKA 3NV3A 1RIRA 2VW1A 4Q2FA 5DXDA 5H9RA 1IKQA 1S0GA 1Y7BA 5DUVA 3ZXFA 1DYKA 3DGTA 4U36A 4BMEA 1GZCA 2NMNA 3N7LA 1W0OA 3WDUA 4LBMA 5EYYA 5JMCA 3WCSA 4Q1RA 1CPNA 4ATEA 1CQ9A 4DS0A 5KXCA 1AJOA 2ZGPA 4ITCA 4M3CF 1QOTA 3IM0A 1KQRA 3GNEA 5HCBA 3O0WA 1QMJA 2D3PA 2W39A 2ZMKA 4M00A 2NP0A 2PHFA 2GNDA 1WD4A 2Q5TA 1O4ZA 1W0PA 2UWAA 2WSVA 4C1WA 5CA6A 3WUCA 1LHUA 2ZKNA 3T1LA 3U4XA 1W6OB 4FPFA 1V6LA 3VKFC 4JRAA 4HANA 1C1FA 2ERFA 3JU9A 4ISQA 2GNTA 2A75A 4DRVA 3ZYRA 2ES3A 1Z0HA 2XB6C 4AGRA 1GZ9A 2NM1A 1LHWA 1S0FA 3ENRA 3BOPA 2EXKA 2PHUA 4Y22B 3D4KA 4K1YA 2JE7A 5IUQA 3KQRA 2DVDA 1X50A 5DUWA 2VXRA 1LJ7A 2ZHMA 3PVNA 4UW4A 2EXIA 2C9AA 1ENRA 2ZBJA 5GLWA 3ZSKA 1MZ5A 1W6OA 1V6MA 1GYKA 4UW3A 1C57A 2ZGUA 4I30A 4DQAA 1WLCA 2E51A 4P14A 3N7JA 4FPJA 2GMMA 2Z42A 1AX2A 5EXOA 5GZDA 3WOGA 1Q8QA 3QLQA 1C1LA 2YZ4A 2D6MA 2ZGKA 2LTNA 3AFKA 3WG2A 2DVBA 3OYWB 1Z78A 4WV8A 1YI7A 1G9DA 4JCKA 2WQZC 4AWDA 4Y22A 5CNAA 3QCWA 4M3CE 2CL2A 4RA0A 1APNA 1MVQA 2ZMLA 4YZ3A 2A6WA 1S0BA 1HDKA 2UU8A 2WT1A 2A5ZA 5GLUA 4YGCA 1MS8A 2ZMNA 4YZ1A 5GZGA 4FOYA 3RG0A 5GLZA 1PZ9A 1J1TA 1CONA 1LOAA 2P3JA 5DZFA 3VKMA 3WHUA 4PBOA 5DZEA 1JUIA 3VUOA 4KBBA 4HL0A 1RINA 1ULDA 3AYDA 3POYA 4YGDA 1LODA 5JOWA 3OYWA 3M3CA 3MEPA 1DQ6A 3FLTA 1LEDA 1SBFA 4JC1A 3R4SA 1AXYA 1G9FA 2CWSA 2CWMA 3ILFA 4LBJA 2G4IA 1V6IA 3IPVB 4XIOA 2ZGLA 1KDMA 1Q8OA 1I1EA 5E8AA 5IK8A 1S0IA 5DZGA 3AP6A 3SH3A 1GV9A 1DQ1A 1AJKA 1UZYA 2ZGRA 1LCLA 4Y24A 3B01A
chains in the Genus database with same CATH superfamily
3H8RA 5KC5A 3U11A 1H1AA 4MGSA 2LS6A 1FPN1 5DUUA 5DG1A 4FFGA 2R16A 4Y1YA 1DZQA 2AEZA 5FCCA 5FYYA 2VC9A 2WS91 3MW4A 5SV5A 4X6RB 3AVSA 2AREA 3O12A 2WKKA 1BEV2 2ATFA 4ZHNA 3IPVA 4UFJA 4E4ZA 1X7NA 1UZWA 1ASJ3 4COVA 1HRV3 1O3QA 1JYTA 3M70A 4Q4X3 3T2TA 4BQ1A 1SFYA 3RYPA 1IKPA 2O14A 4LMFA 2GC2A 2D43A 5GLVA 2A7AA 2E7TA 4AFAA 1KJLA 4JHZA 3J7MA 4LOTA 3IAQA 2VZ3A 1H8TC 3KB5A 1GKBA 1RUG1 4CDQB 1PX3A 3VZMA 2YGLA 5LRRA 1UZ0A 5IFTA 1HIXA 2Z2SB 4UWDA 5M0TA 4L0PA 1L7LA 5FOJB 4Q4V1 2BEOA 3LPFA 3J8F3 2W1QA 2WAAA 4LA2A 4CU9A 1D2QA 5FP3A 3O1SA 4PQ9A 4Y5Z0 4MGTA 1RXFA 2W94A 3HN1A 2D98A 2VZSA 1OKOA 3HMYA 4PLMA 2QZ3A 1LHVA 1MS0A 4R9BA 3SKJE 3OPWA 5JZGB 2IXCA 1QEXA 1BBT3 4W50A 2VZUA 4LO6B 4XTMA 3DYOA 4AVAA 2ZHKA 3H50A 2CHHA 5FK7A 4SLIA 3B7MA 2Q8DA 1C28A 3SEPA 4XJWA 3GM8A 1ZZBA 3R4DB 2YROA 5F9TA 4Q0PA 2A73B 3HR9A 2FMDA 2OQ6A 3WZ1A 2RS51 2SBAA 5DUXA 5A6XA 3RYKA 3PL0A 4ASLA 3T30A 4A45A 1ZRDA 2W46A 3KV5A 3U78A 2V73A 3I3EA 1O3RA 4IV1C 2XBO1 4ZZ8A 1O3SA 3M3QA 4WM7B 2GP3A 2PHWA 1ZNPA 2E63A 2HBTA 4FPHA 3ES1A 3VL9A 1UOBA 1UOGA 2GN3A 4NOTA 4FP2A 5CBLA 3MIEA 3O14A 2LRPA 5CFCC 4I09A 2UY8A 1XNKA 3FJSA 3H7YA 1W6PA 4I0BA 4RD7A 2V5DA 4NRQA 1VBA2 3NJZA 4RS5C 3ILRA 2JXAA 2EIBA 4XOGA 4ARYA 4P5HA 4DZGA 3AX4A 4K21A 1YFXA 4JGZC 5I0RA 4MYEA 3MW2A 4HT1T 1DIWA 1OC1A 1UXXX 2HH9A 4W6XA 1OPMA 2D6KA 4BK5A 4TZDA 2RG4A 3OY8B 1W6MB 1EPWA 2IXIA 3VBFC 4BHPA 3W5MA 3KF5A 3WF3A 1KFXL 5T5OA 2YPJA 5E88A 3AL5A 3RZHA 1H2KA 2D93A 1W2OA 2CGPA 4CDUB 3C7OA 2PHXA 2R063 5E1RA 4LEJA 1ZRCA 1AYM3 3J7HA 3KVAA 3E97A 3BCWA 1FMD3 1GFF2 3ZN4A 5ABJA 2EIEA 1GR3A 1C5HA 1SDDB 2QQVA 1XQNA 3TEZA 3ZN6A 1BKZA 1NLRA 4LE3A 2WO2A 3HT2A 4OVEA 5FQ0B 5FRAA 2OZ6A 3L2YA 5F7UA 1SBDA 1POQA 1F5FA 1DQ2A 4UFKA 2DWRA 2G19A 4GH4C 5A7WA 4CUCA 5G05L 2PHTA 2VBBA 3K4ZA 1O6UA 4XCAA 4DXSA 1IOAA 1JZ4A 5BNNA 5C9AC 4R9AA 1RMU2 2HWC2 3A7QA 1AX1A 5FTTC 2I2SA 3QH6A 4MOAA 3X29B 4CU7A 4QU1A 2J1VA 3VBRA 1QJU2 4XXAA 3IDEA 2G1MA 3T4VA 4I01A 2WZR2 2RS13 4F83A 2WABA 3AYAA 4JDNA 1PGL1 1RUI2 1GP4A 1S1AA 1Q8PA 1OUSA 4Y5SA 2XR4A 4R9CA 5AC91 1S2EA 5LRSA 1SZBA 4GWMA 2YY1A 5FPZA 3K3NA 5CZKA 4FP3A 1NY71 2Y6JA 1XNBA 2L9LA 3N7KA 5IAVA 4XQ4A 3UGHA 3MV01 2Z69A 3BVCA 4WVZA 5IW0A 1RUD1 1RUF2 2IZWA 4MGYE 5FYTA 3ZR5A 2EIGA 3J7NA 4LKSA 2XKOA 5K4LA 1ENQA 2VULA 3S57A 5FZOA 3FL7A 1D0HA 4INDA 1AXKA 4IV3B 3WG1A 1SLTA 4YG6A 4IE6A 1W3XA 3VHRA 4DINB 1X9PA 1SPPA 1ZBA1 1EP0A 1CWPA 2VVFA 3T08A 4QD2A 4BIOA 2DVFA 1VBD1 5C3QA 5KC6A 4UFMA 1Q8VA 3GBFA 2JX9A 4DXTA 5FP8A 3QD6A 4IDZA 4XBQA 4XJUA 1T6GC 2A6ZA 3JZVA 1PZ7A 3LE0A 3S7EA 4YZ5A 1H2MA 5I0DA 3RPQA 4NIHA 3G7DA 2LUWA 1DYPA 2JECA 4NHLA 3UGFA 2GNMA 5DDJ1 5CKNA 5ERLA 4I0WB 4Z8BA 3HNMA 4AFDA 4P9GA 2DVAA 2WO1A 4E4SA 5ACA2 2OUJA 1DZTA 3WP4A 1HKDA 4Y20B 3TNPB 3WG3A 5G04L 4LOSA 4YM3A 1JZ3A 4LITA 1LESA 4N90A 1V9U2 1AR61 2BVVA 2WZPP 2BYVE 4CDWB 1QOOA 3VBHB 1OHFA 4UAPA 4EZHA 5E6HA 2A70A 3N9PA 5K8SA 3BTYA 3V56A 4LBKA 1NCRA 1BHGA 3D3AA 4FSJA 3LOBA 3L9JT 2R072 1GNYA 3OG2A 1N1VA 2OS2A 2PELA 1JYWA 2XQRA 1MEC1 2Q1ZB 3T1MA 2Y6LA 4CP9A 5TSWA 1BZWA 1CX4A 1U0AA 1UIJA 2XPJA 1HLCA 1QDOA 2RR13 4Q4W2 2P37A 1LULA 5IVVA 5F2SA 1RVF1 4GB31 1QF3A 2OPWA 1EUUA 2JG9C 3B9IA 4XABA 1SACA 1K3IA 4CP2A 1REEA 2VNVA 5ABJC 5DQ0A 4DUXA 3POFA 3QOPA 1ZRRA 2QQPA 2K46A 1TZOA 3OJBA 2H0BA 1QHDA 1XYPA 1NCQB 2HWF3 1J84A 2VBDA 2FMYA 4L8QA 3AZYA 1GBGA 2X53S 4LBOA 1W8UA 1UMZA 3OD0A 1C8M3 4HETA 1ND3A 4L97A 3CJIB 3IIAA 3NAPB 3B00A 1HRI1 1Z7S3 1WA4A 4GWIA 4PF5A 5EJ1B 2ZEXA 5FZFA 3ZMOA 3WNPA 4JKKA 1C5IA 4QGNA 1NA1A 3VBRC 1GP5A 3OBAA 5FMDA 4FPYA 1CESA 4Q5OA 4QDSA 2D3RA 3PUQA 5FXZA 4OUEA 3FLPA 2GMEA 5IYYA 1GOHA 2QKDA 1HB2A 1PVC3 4RR3A 2XJUA 1UNBA 3NJVA 4NIIA 2VMGA 5CYYA 2FCUA 5CAZA 1SCSA 4HFSA 4QKBA 2OIIA 1ZBE1 5KHHA 3VBUC 1X82A 2W0XA 4JGYB 4M0HA 2ILMA 5D8AA 5AVPA 5FXWA 4XJAA 2AUYA 2Y0OA 5I8YA 3DN7A 4BH9A 4H7MA 4Z2AA 1M06G 4K1ZA 2GAUA 1PNFA 1R1A1 3JBG2 4LIUA 3WF2A 3N7MA 3ZXLA 1DP0A 1LOFC 2JDUA 3ETQA 3KGLA 1J3RA 1W6QB 4FO9A 4P02B 5FZEA 4SBVA 1O5UA 4R9DA 1SCRA 4AEKA 1CIYA 1ENSA 1I5PA 1RHI2 4DNYA 1PO12 3SKVA 2DCKA 2SLIA 1LOBA 5FP4A 5JWPA 2AYHA 3VV1A 1QNYA 1MZFA 2ETEA 3PLQA 2XG3A 3NO8A 3ACIA 4A3ZA 2YUEA 4OULA 3GXUA 5DABA 4A3XA 5GZEA 5FK8A 4UFHA 5C4WB 4YVSB 4B4PA 2QQLA 3NNLA 3OGJA 1V0AA 4BQ3A 4MADA 5FIXA 5FYHA 5A6ZA 1VB2A 4GMP1 3JD73 2OX0A 4XF3A 1HV0A 1XYOA 4YW1A 4NHXA 5D2AA 4CP0A 4CDXC 2W91A 3B9CA 1F5JA 1AF9A 3U37A 4B3NA 2DURA 2YMZA 2R041 4R4XA 4P9JA 1O59A 2WYFA 4MGIE 4E2QA 3ZPYA 1AYN1 2V5YA 4MGKE 1JHNA 4XHBA 4EN6B 5FUNA 2EAAA 2R1BA 5DG2A 5FYIA 4Q4Y1 5FZ1A 5B4XA 3CQOA 2VMFA 3BOWA 3SXWA 3BALA 1LU1A 3CZUA 1STMA 2VOTA 4IEVA 3WNMA 2WFF1 4YW4A 1BQPA 3BTXA 4WVWA 1NYWA 1SLCA 1OFSA 2NN8A 4A44A 4IEZA 3RRDA 1QWRA 2C9KA 3E6BA 3ZFEC 3THDA 1PMHX 2QFEA 1SLAA 4FPCA 3PIJA 3IMNA 5FZ6A 2E7QA 4AR2A 2GMPA 1K5JA 3OGRA 1VALA 4OI4A 1XC6A 4AGGA 1EV13 4BJ0A 2Y26A 4BPZA 1ZYBA 4Z82A 5FYZA 1W2UA 3VBOA 1VRBA 2VPVA 2WRAA 4NR1A 4PIYA 4YGEA 1ND3C 2WUHA 1O8SA 4GWNA 5FKCA 2WNUC 4A4AA 4Q8KA 5C3RA 1LRHA 2OW4A 4EROA 5FP7A 4UT5A 1V6NA 2Q30A 4AFMA 4Q27A 1QGLA 4RHV1 1NZCA 1PO22 2MEV3 2GC0A 1H8TB 4ZPIA 2WT2A 2RS53 3BTAA 2GNBA 4M4PA 5IATA 3LIHA 2BU9A 2VW1A 3NWKA 3NV3A 3AKPA 4HMZA 1UYPA 3UYJA 3VLBB 1S0GA 5FKBA 3ZKYA 1DYKA 4JZRA 4LTAA 4QQOA 5BNOC 1TE1B 1X33A 3WDUA 5EYYA 5JMCA 3WCSA 3H8XA 4CSWA 3O1TA 4Q1RA 5FXVA 4I2OA 1CQ9A 4QPIB 5LCWL 1COV1 1X36A 2RS33 2ZGPA 1ASJ2 3BU7A 1HRV2 3LEIA 4ITCA 3UT0A 1IPKA 4QPGA 3IM0A 1UYZA 1KQRA 4Q4X2 1JYVA 2H6CA 5HCBA 1SQ4A 3A22A 2W39A 2D3PA 2ZMKA 3O0WA 1BVP1 2V09A 2ZEZA 3CEWA 1RUE3 1AR71 2Q8CA 4CU6A 4CPBA 2Q5TA 1TMF1 1W0PA 5JXHA 1UY0A 5IHRA 5CA6A 2VCAA 4V1PA 1NKGA 3U4XA 3WCRA 4CEYA 1W6OB 1V6LA 1VR3A 2VUJA 4JRAA 3TEYA 5F32A 4BZ4A 2FDGA 3K48A 1OOPA 2ID4A 4O65A 4UBHA 2YDEA 1ND2A 2RM23 2VZQA 2WR9A 1ZRIA 3P3PA 3WQ1A 4IV1B 4LHKA 3POBA 2VCCA 3EMRA 3KCXA 1BLZA 5C3SA 3J8F2 4RQPA 1YJKA 1S0FA 2XL7A 2BRTA 2P6HA 4LORA 2EXKA 1PNGA 2F4LA 2AZ5A 2PHUA 2VVDA 3ABZA 4K1YA 1VBB1 2JE7A 4M4RA 4NPRA 1CAVA 4CCMA 2WNVA 5CFCB 3PUAA 1X50A 2VECA 4OQ9A 1BBT2 2C9AA 3FN9A 2DBNA 2ZBJA 3ZSKA 4UW3A 5JSRA 1YC61 5FBZA 2E51A 3N7JA 1KS5A 2JB4A 1AX2A 5JPNB 1Q8QA 3QLQA 2YZ4A 2Y0IA 2IVJA 3CDZB 1I5ZA 2E31A 2Y34A 4HPKA 4URTA 1Z78A 4XC9A 3SCGA 3WG2A 5F1RA 1W9SA 1YI7A 4JCKA 5I91A 4LO5B 3VBFB 4MO3M 2P5BA 4OUSA 4PIXA 5F8PA 1MVQA 4E4DX 2IXLA 2PXJA 1HDKA 2UU8A 4WVMB 3MGUA 1NAEA 2P6CA 1MS8A 2ZMNA 5EQUA 4LUKA 1JOPA 3S5QA 3ZIWA 3BIEA 4LE4A 1LOAA 3BKZA 2E7AA 2P3JA 2ZTNA 5DZEA 1JUIA 4MXWA 3ZN6B 3VZOA 1R081 1FOD1 3BPZA 2HKXA 5AC93 5A3WA 4ZONA 3WNLA 3M3CA 1CGPA 3NRUA 1LEDA 1SBFA 1AXYA 1T2XA 2CWSA 2CWMA 2VG9A 2G4IA 3IPVB 1H1MA 3LFIA 3WNOA 4AHWA 1D4M3 1J3QA 3VBOC 1LKNA 3UGGA 5F3GA 1AJKA 3IDCB 1UZYA 2ZGRA 2ZCWA 3F95A 1U12A 3B01A 5FYBA 1OLRA 1XU1A 4XAEA 2XH6A 4XUOA 4QPYA 3P3NA 1Q5OA 3WLUA 1AL21 2R062 1IS3A 3KSCA 1AYM2 3VDDA 1VBD3 1AR81 3K75B 3OBRA 3UKVA 1FMD2 1WMEA 2ZGTA 4WM8A 5JR7B 3U10A 5T55A 4PI0A 4QX1A 2F17A 1RUJ1 3KV9A 2JWPA 1F31A 3W21A 1PIV1 1H0BA 4AI2A 5A7QA 1PM7A 4QQ2A 3BTZA 2VCBA 3RFRA 4GD4A 3MLKA 3H3LA 4FPOB 1YWKA 1FV2A 2ZGMA 4QPGC 1WCQA 4QQLA 3ALQA 4AQ6A 1RUNA 4J1XA 2W1UA 3AMHA 1A3KA 1AR63 2ZS6B 2D44A 5J3UA 4CEYC 1NX9A 3B94A 2E6VA 5EV7A 3U14A 1ND2C 1WUVA 2XHNA 2ZX2A 2VW2A 2NMOA 5KXEA 4FT8A 4MLOA 2W1SA 3PJQA 3MF9A 2WLPA 3GCXA 4FOWA 4DFSA 1SLBA 4RQPC 3MO4A 1N3PA 2BBVA 4QX8A 2EICA 3PNAA 1R64A 1H6XA 1FI2A 5FMBA 3I3DA 4D7TA 4GB33 4BLJA 4JRLA 1JOJA 1KFUL 1W6PB 4YW2A 1DGRN 1A8DA 4I02A 4PIZA 3WV6A 3UV9A 1VLNA 3TOJA 1S4CA 1W05A 4LLOA 1MS5A 4ISRA 4IGOA 4OCTA 2CYFA 2PFWA 3CU7A 3O1UA 1F4AA 4AQTA 2ET7A 3H1MA 3WDTA 1DFQA 3ZYGA 3M4FA 3AJYA 3AZZA 1G7YA 2J1RA 4OHWA 4E2GA 2XUEA 2ARCA 5T3NA 1XJAA 4CEWA 4COZA 1UMHA 1RJ7A 1DLCA 3VZKA 2A6YA 3ZPOA 5LW9A 5JAXA 1YYNA 3POGA 1W2NA 3WR0A 3T3YA 4FOVA 2HWB3 3POEA 4P5YA 5ABJB 1POV1 1H2NA 3CF6E 4CA9A 4BQYA 4ZKTB 3BUCA 4B4RA 2QQWA 3K4DA 1ZZ6A 1U5IA 2XOMA 4IE7A 2R32A 5DAVA 5JOXA 1N1SA 1GU3A 2NLRA 4W8JA 4JX0A 1UU6A 2D5FA 2ZX1A 4DEVA 1NXD1 1U5XA 3CBNA 1QXJA 5EWSA 5A7WB 4GA9A 1TME1 2OQ7A 1CVNA 1HB3A 4H55A 5BNNB 5JI7A 5H9QA 3SMHA 4CTEA 2BNNA 3OPZA 4MGQA 4ZS3A 3R0RA 1YFUA 1R1A3 2RHPA 1GLHA 5ANNA 4AFCA 2VTXJ 2K0GA 3DXTA 3VBRB 3WDVA 1OH4A 5E89A 1X9TA 4XACA 3ST7A 2LM3A 3MF6A 2RR12 2HLEA 4UYBA 4XUPA 2WAOA 1W9YA 1NT0A 2KD7A 4RS5A 5AVAA 3O1MA 3VDDC 5JXGA 5J09A 4JGZA 4HKLA 2R1DA 2NYYA 3ACGA 2XVGA 3PIGA 4WM8C 3AZWA 4XIKA 3JXSA 2W08A 1UKGA 2VE1A 2OYZA 3TNQA 1LAJA 2UYBA 1HN1A 2ZGQA 3I54A 4LLFA 4P08A 1M4WA 1L3JA 2X8KA 2HWF2 3ORJA 1UX7A 4DXZA 1BEV1 2XXZA 5L7OA 2ZGSA 1TNFA 1RL3A 1YHFA 5H9PA 3W59A 4AVCA 1UW8A 1DG6A 1GANA 3MIFA 3N9NA 2D6LX 1Z7S2 3MUZ1 3BIWE 4HK9A 4EYUA 4XAAA 5FZOB 5A32A 3H42B 1D7PM 2FD8A 3URFA 3HN3A 2V4AA 3S0MA 5FJHA 1OKQA 1SPPB 5D1IA 1HQWA 3VBSA 4XURA 3IAPA 4IETA 2ZACA 3SCHA 3ZO0B 5FZDA 3KMHA 2XVKA 2PAMA 5F3IA 5LEJA 4Q8LA 1QJX3 2R043 5JDBA 3MYXA 4RGAA 1WW7A 2IFRA 4XQDA 1MS3A 2W68A 1BJQA 3SH5A 1ZRFA 2DDUA 1PVC2 1AYN3 3MFAA 2VMDA 2VO5A 2GN7A 3H3UA 3RS6A 4GH4A 3LSDA 4K6BA 2BTVC 4Q4Y3 1O5LA 1G86A 5L9BA 3UL2A 5I8SA 5EJZB 5A1AA 2VMEA 5C9AA 5A1LA 4KWKA 4OI2A 2PHDA 4NIGA 3NVCA 1Q8SA 3BB6A 1BK0A 2K2SA 1B35A 1H30A 1JW6A 2DVGA 3EQEA 4UFIA 3RZJA 2FDFA 3IMMA 3C2UA 3WD5A 3LF7A 3I97A 4Y1XA 4NAMA 1CIWA 2CNAA 5IVBA 3WINE 3JCIA 1NCRB 4QB1A 3POWA 2CV6A 3LPGA 1NG0A 4XE9A 1RUH1 1GZWA 1PK6A 5FZGA 4CP9B 4CEWC 4OYUA 1HB1A 1YFWA 2OA2A 3VD9A 4LK7A 4KNCA 3WG4A 5FUPA 5C8WA 4A7KA 1SEFA 2HYKA 1OVSA 4B8EA 3V0AA 5KHKA 1W39A 4CXWA 3K4AA 3OPTA 1ST8A 1U5ZA 1ULFA 1SLIA 5GM0A 5KHIA 1UZZA 4C0HA 4HN1A 1LB2A 4HKWA 1MQTC 1WCSA 4D0QA 3WDWA 1ODNA 2BZDA 5FO9B 4KU7A 2HWE1 2FHRA 3V0BA 2VY0A 4EV0A 5A3TA 5FPUA 4FVVA 3JD72 5FBJA 2A71A 3A0NA 3N3HA 1UF2C 2WC2A 1BVVA 1BMV1 4H14A 4AHZA 1ND3B 4B1LA 4Q26A 1HX6A 1DQ5A 3LEGA 4ZU4A 4I3GA 4TTGA 5FAXA 1K5MA 4IEPA 5FMOL 4G9SB 3T0AA 4BQ2A 1LEMA 1QDCA 4EN0A 1YRZA 1NA1B 4XF0A 4YZ2A 5CISA 4AVTA 1OFNA 4XFIA 3O7OA 2RV9A 4FTEA 3PTYA 1L7QA 4LT5A 4A2UA 3S7IA 4FTSA 1ZZ7A 3QBQA 4Y33A 3QACA 5FV3A 4AI3A 4GXLA 1OA2A 3APBA 2BFUL 1NLSA 3PVBB 4HOOA 3VZNA 2VQ0A 4RR3B 1JZ2A 2Q8EA 2JJ6A 4LA3A 2DUQA 3O0VA 3PUSA 3I3BA 5A7SA 1NUKA 3WNKA 5JVVA 5HCHA 1CR7A 1EV12 4QX2A 5D8AB 3AP9A 1DGRA 5FMOS 3FHIB 4H7LA 5L7OC 5FWJA 1XE8A 3EXUA 3LFMA 4YVWA 2WNOA 4CCKA 2YC0A 1NQJA 1XE7A 3A21A 3WNXA 4HKOA 5FPVA 3MPPG 1RMU1 1TVGA 2HWC1 3LAGA 4JKLA 2VGDA 3I2DA 3PDQA 4L92A 5C3PA 3DF0A 2MEV2 3NJXA 3C7GA 2JG9A 2RS52 3VBSC 1QJU1 1Q43A 1YNAA 3OCPA 4IESA 4NIAA 4CVUA 2RMU3 2BFUS 3I3MA 4IERA 4KL1A 5IK7A 4YGBA 1LOCA 1QH7A 3KWVA 5IVCA 3PU8A 4IGPA 3VDBA 4IEUA 4QXCA 1RUI1 3WF1A 4LO7A 3NQHA 4LO4B 2P1BA 2DUPA 3ZYPA 4XDQA 3WVJA 2PYTA 4QB2A 3K3OA 2ARBA 5CG8A 1ULPA 2RS32 5C33A 4MH0E 4O7XA 3TB0A 5LK7B 4QMAA 1O4YA 1WWYA 1JI6A 1KJRA 2XJRA 1G9BA 1G9CA 1RUF1 3C7HA 4TWTA 2BJSA 2YU1A 4N7UA 1RUE2 1B35C 5FREA 4DEQA 2HWD3 1GQHA 4LBQD 4E8DA 1OF3A 4OHZA 4AYUA 2R30A 2RM22 2ZJCA 1ULGA 3RMXA 3JUUA 5JOYA 2QJVA 2OPKA 2BVBA 3CNAA 2RDQA 4XZPA 3PMEA 1PK6C 4FFHA 3VBUA 5IFPA 1P8JA 2VL4A 4JVAA 4CCCA 1AL23 4V2WA 4XYXA 1YXWA 2WSUA 4ZXEA 1A8MA 1VRH1 3I2KA 1ZX5A 2XJQA 3OGGA 3E1F1 4N7IA 4XF1A 4YM1A 1J59A 3RZKA 1XNTA 4UXAA 2OVUA 4CCLA 3PJYA 3KV4A 5J7MA 1NLQA 3TBDA 3KGZA 4Q1PA 1FT9A 5ACA1 4I0AA 1LOFA 2JG8C 3ZYHA 3SISA 5FMCA 1WCKA 4C0BA 1W90A 2G9GA 2B5HA 2YV8A 3VBOB 1DU3D 4IE4A 4YW3A 5ANQA 4RFRB 5DPNA 3EB7A 4EWEA 1MACA 3W9AA 3VDCA 3EJKA 1OD5A 2R071 1K5MC 2VZ1A 3EYPA 3LEMA 2VTXA 4JTOA 5HCFA 5KXBA 1HB4A 5FY5A 3KV6A 2YBSA 1UN1A 2AENA 2VR4A 1YQCA 3JQWA 4N9IA 1UQXA 5I8TA 2WWUA 4Q4W1 3LOIA 5T5LA 1PGL2 1REFA 5A3PA 4TXWA 4UW6A 4IEXA 4E2SA 5AC92 2Q4SA 4NN0A 3N35A 4PDWA 4JQRA 4PQQA 4OQ8A 1DZRA 1NY72 4CDXA 3HBKA 4COYA 1BCXA 3OEAA 1IS6A 3IN9A 2FDKA 1AR93 3MLJA 1YQ6A 3GJBA 4XFFA 2EF6A 3AB0A 4J25A 4QPGB 1K42A 2NZ9A 1D4M2 1V6KA 3FWEA 3MIBA 1OT5A 2FQPA 3T2QA 2RE9A 2C1FA 5FY1A 2CDOA 3CKHA 1V00A 1UO9A 4YVWC 2Q1FA 5A7NA 5H9RA 3VD3A 4CXYA 1K12A 3U75A 5DUVA 3ZXFA 4CEYB 3DGTA 1NXMA 2PLV3 3BYWA 4U36A 3N7LA 4AW7A 1OOPB 2RDNA 1W0OA 4LBMA 1ND2B 4LHLA 3HBZA 1VBD2 3ZFEA 2Z4FA 4JV4A 4NWWA 4FI9A 1POV0 4CCOA 1HN0A 1W8TA 2OT7A 3RI8A 3WW3A 1OLME 1VPHA 3D0JA 1VMHA 3DPRC 1CAVB 1R093 1QJY3 2WNVB 3OTFA 2LW8A 4PT6A 5KWRA 2PHFA 2GNDA 5F39A 2Y6GA 1RUC1 1O4ZA 2WNUA 4X8NA 4AG4A 2UWAA 3MUY1 2WSVA 3MIGA 4C1WA 2ZKNA 3T1LA 4FPFA 2QUOA 4OMCA 2IFWA 4HANA 1C1FA 2ERFA 3JU9A 4DY5A 3KT4A 1US2A 5LBCA 3CJXA 1Z0HA 2XB6C 5BNPC 1AR62 1CAWA 1GZ9A 2BW8A 3JBG1 4HPKB 2WA4A 3BOPA 5HV0A 1F15A 5LBEA 5BNOA 2ZZQA 3ITQA 5IUQA 3SEEA 2X10A 3DEMA 4AFBA 4TSVA 4B29A 2HBUA 4HVOA 2VXRA 2XHKA 2ZHMA 3ACLA 2EXIA 2CDPA 2VM9A 5A3UA 1RHI1 2HEYF 2JB8A 1YQ8A 4K7JA 5GLWA 1PO11 1GYKA 3P1IA 2ZGUA 2YFZA 4I30A 4GB32 4A42A 4MXWB 4P14A 2WWSA 4FPJA 1U5YA 5EXOA 5GZDA 3WOGA 1XNCA 2QDNA 1C1LA 2Y60A 3LD8A 2LTNA 3HD8B 2DVBA 4BYYA 5L9VA 2F4PA 1JS9A 3AKTA 1EAH3 3HPNA 4OUMA 3N9OA 5FP9A 1VBC1 4XF4A 4IEQA 4AWDA 2BOJA 5CNAA 4DMIA 2AC1A 4RA0A 1S0BA 2WT1A 4FAHA 1ZVFA 2A5ZA 1S2KA 2YYOA 4YGCA 3CLPA 4N53A 5GLUA 4OZOA 3T4HB 3ZXAC 3B5LB 4Q0SA 5GLZA 1PZ9A 1H6YA 2Y8KA 5JCTA 3VKMA 3CO2A 4PBOA 3WHUA 5J1XA 2JDYA 1GWLA 1RINA 1W06A 1ULDA 5JOWA 1LODA 3OYWA 3HQXA 3VDDB 1FPN3 2HWB2 4IW3A 3ILFA 2XDVA 2WS93 4WM8B 3N4MA 3Q8EA 4KQ7A 3NW4A 2IVIB 3IBMA 1Q8OA 1HJFA 4PDWC 1I1EA 5IK8A 3GHNA 3S5AA 1S0IA 5C8CA 2X05A 3EO6A 1W9TA 3SH3A 4O61A 1JZ8A 5BUVA 1UY2A 5IVYA 4Y24A 3ZX7A 2ARAA 3E6DA 5C71A 2VOXA 3ZKUA 4QAWA 4K8RB 4DY3A 2RDRA 2N7GA 4XFAA 1WBLA 2E9QA 4FFFA 4S2DA 4NHYA 5FZ4A 1R1A2 4LHNA 2D7FA 4NMIA 1RUG3 3RZMA 2ZHLA 2P4EA 3UETA 2KA3A 5FZIA 5LA9A 1PO21 2MHFA 4Q4V3 2R0HA 1YCIA 3A0KA 4PHZA 4KH9A 1ONAA 3N9LA 2ZOEB 4KU8A 4AVBA 1W8WA 1UPSA 1UX6A 4LXLA 3NMBA 1RUH3 2O0OA 4YM2A 1DBNA 2RVAA 3I2HA 1S0DA 2GDFA 2YPDA 1HXS1 1GZTA 5FUIA 1MS9A 1LR5A 4MGZE 3MDPA 3TN91 1MR5A 2WLQA 1W04A 2EALA 1I6XA 4BM8A 1S2BA 4CXXA 3PURA 4U2AA 4GJZA 3USUA 1QJEA 4D7SA 1HRV1 1HV1A 3GHMA 4AQSA 3GALA 4Q4X1 3VHNA 2HWE3 2DCYA 1PHMA 2C5DA 1OQ1A 4PF1A 3AZVA 1VP6A 3O1VA 2MNGA 2J1SA 1JMUB 4YW5A 2O1QA 1RITA 4Y5TA 1WMFA 1QXRA 3H8OA 2XBO3 5JIAA 4B4QA 4OMDA 5H9SA 4ASKA 1QXPA 3Q9OA 1QJX2 2R042 4IE0A 3KD4A 3WHTA 2D6OX 1UU4A 4CEWB 4LKDA 3LDBA 4NPLA 1OH3A 1AYN2 1SHWB 3GZTB 3IDAA 1ULCA 1VBE1 3GZUC 3J8F1 3OUHA 4WM7C 5FZ0A 1KGYA 4Q4Y2 4XJZA 1KITA 2D3SA 3I59A 2UWBA 4P00B 2HEWF 3RDIA 3TAYA 4NRMA 2FBEA 4ZS2A 2WA3A 5K0UA 3KQ4B 2YGMA 4G3YC 5A7OA 1MS4A 1OMIA 4UW5A 5A33A 5JUVA 3I2GA 1BBT1 1QQP1 1XSRA 2WN3A 4M3CA 1CZVA 4XFBA 1QJFA 4QX3A 4OHYA 1S0JA 1N1YA 3O5SA 2J42A 3OSDA 2VMCA 2WJSA 3K77A 3LSEA 4XVHA 5IT6A 3JB4C 4Y26A 4UI9L 1V6OA 3IB3A 4L2NA 3AL6A 4XJ9A 1NQDA 3BU0A 1YEWA 1VAVA 3AFGA 2ZA9A 4N53C 2XLGA 4TN7A 5FFOC 3M8LA 1QOSA 3Q8AA 3AMPA 4AI0A 2DFBA 5IAXA 3PVOA 4Y1ZA 4NE9A 3UKNA 3OOXA 2DTYA 4XBNA 3W58A 1IG0A 4RS5B 3OGVA 4IQPA 4X8PA 4XHXA 3C7FA 2UWCA 5FR3A 4CUAA 4MHRA 4JGZB 2EA7A 2B39A 3AP5A 4G4FA 3ZXJA 4AL9A 5FZ7A 2XLAA 4HK8A 4W6WA 5LWBA 1SFNA 3D6EA 4JDOA 4NRPA 1ZA4A 1LGCA 1YQ5A 2FDJA 3ZSJA 1SMVA 3ZR6A 2J1AA 2F6BA 2R0FA 2XWBB 5FY8A 3KT7A 1UD1A 3NJYA 3LDRA 2XWJB 2A6XA 5L7OB 2QCSB 2PHRA 3H0OA 4AF9A 3E6CC 4ZZ5A 1W2TA 5IK5A 4Y1VA 1DDLA 3GJAA 5A32B 1S0CA 2DUOA 2WWJA 3ME2A 3ATGA 1DYOA 2O8OA 4D6QA 4OI0A 4D69A 5DN2A 3DKQA 5BV6A 2C0ZA 4D7YA 3CHXA 1GQGA 2DYCA 2WQ8A 5CFDA 1DCSA 3V64A 3VBSB 3WEZA 5T52A 5IVFA 2PAEA 5JIUA 3HJRA 1YI9A 2VBPA 5KR7A 2R061 2Y38A 2VQTA 3ES4A 4Y3OA 4KWUA 4ES8A 1BK1A 1FMD1 4BCUA 5CIRA 4WBBA 5J48A 4H3WA 5T50A 3VKNA 1RGSA 3UJQA 3DUIA 3AVRA 2E26A 1MPXA 4GH4B 4D8MA 5B4NA 1RJ8A 1RUD3 2CAVA 1VRH3 5C9AB 3AXDA 3IIIA 4M01A 3VD7A 3WW1A 1BXHA 4BXFA 3D5OA 5A3MA 1B35B 4QQHA 3GDBA 5GKAC 2BGPA 2ZHNA 3Q8BA 5SV8A 4ET7A 1ZBA3 1UCXA 2ZAAA 5KBFA 3AZXA 5C8CC 2FDHA 1OA4A 1TQ5A 1W03A 2GALA 4J1WA 4QHBA 3TYJA 4F3JA 2JENA 2XONA 1XSQA 2WQ4A 4RSUA 2B46X 1GNZA 5FYUA 5EIYB 4IV3C 1N3QA 2BERA 2RMU2 4F8AA 3FC0A 3J7LA 3DYMA 3IWZA 2RS11 2P2KA 1HW5A 2VQAA 4MHUA 2VOVA 4XETA 3E5UA 1V6JA 1GZWB 1JYCA 1PK6B 2BQPA 4KWJA 1OLMA 2W47A 4QU2A 3PUHA 5FLHA 2WFPA 4C90A 2YC4A 4XFGA 1WLTA 1OD3A 5DDJ3 1UWWA 3V0AB 1J1LA 4BOWA 5HPOA 2B4KA 1WCDJ 5K0UC 4BLIA 1HJGA 2VTFA 2ZEWA 3OF1A 2PMWB 3AXEA 1YIFA 4GULA 4Q0QA 4OLLA 1LU2A 2X09A 3VKLA 4HONA 5HI0A 2VNRA 2ZX3A 3V0BB 2YG0A 3WNNA 3OUJA 3RWKX 1KDKA 3N36A 1DGLA 1DQ0A 2HWD2 2W95A 2X5IA 2ZXQA 2XUMA 3LA3A 4KWLA 4B7KA 1IS5A 2R7EB 1E5HA 2WNEA 5I0SA 1Y9GA 3FZ3A 1SBEA 1MEC3 1E5SA 3VBHC 3TWIA 1IS4A 4LUMA 1K5MB 4MG2A 3K2OA 1A78A 3ACFA 4K8FA 4XDPA 2XGXA 4X6QB 1FAYA 3ZYIB 4GQ7A 4OHXA 5EHDA 2B8MA 2WZ8A 1RVF3 4LKEA 4AI8A 5IVJA 3B3QE 1VAKA 4JTNA 5C3OA 1AL22 1UAIA 4AEDA 4ZXKA 3DXUA 3U0ZA 3MLLA 2JD4A 4EZ4A 2IUWA 3T0BA 3WXPA 1UY3A 3THTA 4D94A 1D0GA 1DHKB 4Z1VA 1EYBA 3ASIA 1W8NA 2TEPA 3PUIA 3ZOIA 2RDSA 2GC3A 1OUXA 5BPXA 1UY4A 4FPKA 2YB7A 5FY9A 2Q0AA 5FZHA 4LBQA 1NZIA 3FFQA 1RUC3 1F9KA 3LWCA 1JN2P 1HRI3 3NNGA 5BXXA 2BGCA 1KXGA 5C7GA 4LO8A 3B69A 4V2VA 4NPMA 4YVWB 2ZZJA 3ZFFA 1X8MA 3NV2A 3KHBA 4LBNA 4A7ZA 4N43A 1W8OA 4R52A 4CZSA 2J1EA 3CJIC 1CJDA 5FPBA 2FZ1A 2BWAA 1GQPA 4CCDA 2A1XA 1XE0A 4FPGA 4IL7A 3PU3A 2JG9B 5CFDC 1W8FA 3ZFGA 4AK3A 3GCWA 5F5IA 4COWA 3WF4A 5IK4A 4NJ4A 4P9WA 1MQTA 5FZCA 4PJYA 3M7AA 4CE8A 2BBAA 2VVEA 4R4ZA 1ALYA 3IT8A 1YIPA 4QGLA 3ZXKA 2EXHA 1IGOA 3B93A 1ZBE3 2CY6A 4GWJA 2E32A 4P9LA 1ZZ8A 1OF4A 3DV8A 3AK0A 4YYOA 1GNHA 2ZEYA 3H9AA 1AR92 2UURA 5APAA 4LBLA 4KGQA 3ACHA 5K9YA 1C8M1 4S2HA 4TLFA 4AOCA 4DRRA 2VZVA 3O0XA 3WQ0A 4CRQA 1VBC3 1Z7S1 1IZ3A 2KM2A 5JXIA 2C6SA 3WUDA 1RUOA 2PLV2 4FPLA 5FJKA 2LALA 4QM8A 2AR6A 3RI9A 2AACA 4L11A 4WZCA 1JOBA 5EFUA 1WCUA 4QKNA 3O1RA 2VCMA 3AC0A 4UF0A 1PGSA 1WW5A 1J83A 2P34A 4AGVA 4DXRA 3E5QA 1Y9QA 3R05A 3VBUB 4DB5A 2MPFA 1FNYA 4EWAA 1R092 1QJY2 3N9QA 1VMJA 2QQUA 4YSFA 1PGW2 1CAUA 1LNSA 3LCPA 4PLNA 2VD7A 3AYEA 4BIFA 2IXHA 1LGNA 2VQUA 2GC1A 1C4RA 3ILNA 1N47A 3POSA 4GMP3 4OFGA 4ZU5A 2JDZA 3U4SA 4A6SA 5JSOA 1YLLA 2ET1A 1VB4A 2CTVA 4IGQA 3V65A 3WF0A 4FOQA 1G6NA 1IQDC 2VXJA 2X5IC 3OBZA 2CU5A 4AEMA 3RZGA 5IJRA 5FZMA 5FZKA 3OB8A 1VIWB 2JDKA 4DOUA 4QXHA 3PMSA 3WP6A 3ZDSA 5JI9A 3CIHA 1CAXA 5CKMA 2W52A 2QE3A 3FLRA 1W6NA 1H4GA 3I2JA 2JE9A 1MS1A 3W20A 2WFF3 3MICA 4AEDC 4QPWA 2PHLA 4CUBA 1FATA 5J96B 4PDWB 1QY4A 2P3IA 4XMIA 1EAH2 2W92A 4E4HA 2IC1A 1HXS3 3ZDVA 1SFPA 1DLLA 4GKYA 2Y6KA 3PVEA 4K20A 1F35A 2ZGOA 4CDXB 3TN93 2E53A 3INAA 2D6NA 4BK4A 3JD71 4QT6A 3H3ZA 4BISA 1JYIA 2TBVA 4BMEA 3GGLA 2WO7A 4NAOA 1L7RA 2CAUA 5F3EA 5FLJA 4Z07A 1JZ5A 2H0VA 3BODA 4RHV3 4HN0A 3ZFFC 5C4WC 4N43C 3HVDA 4FCAA 5I0TA 3SLIA 2WINB 3RMYA 3VHOA 3LIGA 1XPWA 4YPJA 3ZXGA 2A6VA 3F2ZA 4YARA 3ECQA 3MBWA 3ZFGC 5LA2A 3AKQA 1FPN2 3D8CA 2ZGNA 1ENXA 3AMMA 3ZFEB 2PN5A 1VBA1 2WS92 3G6JB 5I0UA 2JG8A 1BYHA 3PHMA 3PTRB 1PVXA 1VBE3 1W2AX 1COV3 5DAWA 4GJYA 3VGIA 5I93A 4EWDA 2W2IA 4LKFA 2K9ZA 3TEWA 1R1ZA 2EAKA 3KM5A 2WNUB 1RIRA 1WGPA 4Q2FA 4QPIC 1IKQA 1AR73 1EV11 5B2GB 3HWJA 5JPMB 1TMF3 1QQP3 3I7DA 4BWOA 1GZCA 2NMNA 3VZLA 1GOGA 4NROA 1RB8G 3H7JA 3KZ4C 1RUG2 2VZOA 4K3UA 1CAWB 4ZY9A 5LB6A 3VB9A 4ATEA 1UOFA 1AJOA 1GMMA 2MEV1 4M3CF 4Q4V2 5BNOB 1QOTA 3GNEA 3FHAA 4HSLA 3GBWA 4QKDA 2NP0A 4QX7A 3WY6A 1VBB3 1RUH2 1WD4A 2X29A 1WMXA 3C7EA 4RFT0 3WUCA 4HG6B 2W9XA 3VKFC 4UFLA 4YNIA 3TEXA 1GWKA 2BWCA 4JQTA 2GNTA 2A75A 2ES3A 2RS31 2QQMA 4AGRA 1JTZX 4COUA 3I2OA 3WP5A 3FBMA 2V72A 3K51A 1IPJA 1XB9A 2HWE2 5EJ3A 2PAKA 3D4KA 1RUE1 4Q0VA 2XJTA 1JZ6A 3K46A 3KQRA 5F37A 2WBKA 4CYDA 4UBGA 5DUWA 2WZR1 1OI6A 3PVNA 1BMV2 2VOKA 3DKWA 2XBO2 4N53B 4RYDA 5J98B 2Q1MA 4QM9A 4ES9A 1W28A 2JEMA 3DPRA 2JIJA 1MZ5A 2W3JA 1Y3TA 1YFYA 2RM21 1ZREA 1AL0G 1C57A 5DAXA 2J7MA 5JSPA 3ROUA 3AKSA 2ZGKA 3ZM8A 3FE5A 2ORZA 3AFKA 1R083 3OYWB 1FOD3 1VE0A 3ZN5A 5FOBB 2DBIA 1G9DA 2QNKA 5A3OA 4KGGA 4Y22A 3QCWA 4M3CE 3OEBA 2CL2A 5D21A 4NVPA 4YZ3A 2A6WA 4RGGA 4AAXA 5BNPA 3MV11 1C8NA 3S6PA 4DUVA 5C8CB 4YZ1A 2EVXA 3NNMA 3RG0A 1EPZA 4LK6A 4LJHA 3U07A 1O3TA 2D40A 4FXKB 3A23A 3ZLIA 2PQQA 1OSGA 3NNFA 4ORFA 2HJIA 4KBBA 4HL0A 2ZKLA 1SG3A 4LHSA 3AYDA 4QDRA 3POYA 3UESA 3WX5A 3MEPA 4XFHA 3FLTA 3WW4A 3KCCA 3R4SA 2OXBA 2W5FA 4E8CA 1XRUA 3O1PA 1AR83 5KHGA 1V6IA 4L9BA 4XIOA 2WO3A 2PA7A 1RUJ3 3IDBB 1UYXA 5DZGA 4CCNA 4XW3A 3AP6A 5EP9A 2JKXA 1H4HA 4K40A 2Q8OA 3VUOA 1PIV3 4L99A 4BA6A 3B02A 3WQ7A 3RZZA 1VMFA 1N1TA 1V9U1 2B45X 3LKJA 3OUIA 3ELNA 3OBTA 4FPEA 3NKTA 4EN8B 4D3WA 1AHSA 5EPAA 3USUB 1AVBA 3HOBA 1D4M1 1EY2A 5BYNA 4XMAA 1Q3EA 2JICA 4Q29A 4FAGA 2QZ2A 5JR2A 2JKBA 4JAAA 5LEKA 1CPMA 3BI3A 1VAMA 2FCTA 4DO0A 1UPIA 1W8ZA 2DU0A 4XTPA 4XUQA 5JOZA 1JHJA 4N8MA 3ZYFA 4D6SA 2ADEA 1YO8A 4P9IA 3GYDA 2XJSA 3L2HA 3I3QA 1CD3G 3UJOA 3KLSA 4YM0A 3VN4A 5JMOA 1Q56A 2VMHA 3M3EA 2IWGB 5K7PA 2H6BA 1LECA 4YG0A 5T54A 3I59B 4WVVA 1RUD2 2ZAHA 4Q0UA 1FX5A 4E27A 1VRH2 3M3OA 5K0UB 3I2IA 1LGBA 1OVPA 5A33B 2DCJA 3W5NA 5FYSA 4M3CB 4QGMA 2WL1A 1LHNA 1S55A 4FQZA 1ZBA2 3RQ0A 3CZJA 2PTMA 2JDPA 2WT0A 4YRDA 5F6LB 3D0SA 1Y4WA 5FYVA 3JB8A 4C8DA 3ZSLA 2DTWA 4CDQA 1DF0A 3ON7A 3RVHA 4HXCA 4QXBA 4Y4YA 5E16A 1YJLA 5A80A 3CMGA 4HZFA 4RQPB 4XF9A 1MZ6A 1LOEA 2JE8A 3R6SA 2GH2A 1W9FA 1RTVA 3RNSA 2VZPA 3OGSA 3H8UA 1GOFA 1WKYA 4YW6A 3THCA 2QQIA 3DCQA 5FY7A 2BV4A 1T6BX 1POV3 1QNWA 2BDRA 5DDJ2 5JZGA 2ZPXA 1JZ7A 3AP7A 1JODA 1MZEA 2A3XA 4ONUA 5CU1A 1JU3A 4FTBA 1CZTA 1UYYA 2AGSA 3TRSB 1CJPA 3GZAA 1G8WA 3RYRA 1HQNA 4DPNA 4N9HA 3ZMNA 3MHZA 3FBYA 4B7EA 1OQEA 2RJLA 3AKRA 4QX0A 1TME3 3ZSMA 2DF7A 4F7ZA 5C6CA 3EHKA 4P9XA 2XVLA 4LIVA 4QQPA 4EN9B 1MEC2 5FY0A 3HNBM 4WZFA 1A34A 4WM7A 2DCZA 3BN6A 1PM4A 5F5AA 5L73A 5BNNC 5JLVA 3MZHA 5CB7A 3S30A 1FYUA 1RVF2 5CFDB 4S2GA 3ZVXA 4NWVA 4O9EA 2VAUA 3FHQA 1A6CA 5IVEA 4FQ4A 4AI1A 4QXKA 1AXZA 5DAQA 5HBAA 2EXJA 2HWB1 3MIDA 2OUHA 1XXNA 1XNAA 5LK5A 3ZYBA 3WT3A 3M1HA 3Q8CA 5FPLA 3KS7A 1BEV3 1QKQA 4LPLA 1RUC2 3POIA 5F2WA 4XBLA 1HRI2 2BNMA 5FWEA 5A3NA 2GP5A 3EBRA 5FYMA 4XFCA 4KG8A 3AP4A 3OY8A 1W6MA 4FBFA 1FV3A 1I3HA 2B42B 5FZ9A 2YFUA 1JXNA 3VHPA 4PCRA 2DV9A 4OZXA 4CDUA 3SHRA 1FXZA 2VZRA 3CL1A 2WIIB 3FUOA 2XLFA 5C70A 1QIQA 1NE4A 2QQKA 4A41A 4AVSA 3POJA 2NQYA 3GF6A 2QVSB 5BNQA 1WW4A 4ZU7A 5FO8B 4AHYA 1AUYA 1OQDA 1CX1A 4HBNA 2C24A 1DGWA 1ZBE2 2QBXA 5BY5A 2VMIA 2Y6HA 5FQ0A 1H9WA 3IZOA 4YZ4A 1OPOA 2DU1A 5A1FA 5HCAA 4IUGA 5FY4A 3AJZA 1AX0A 1IQAA 1ODMA 3VD4A 2QTWB 4AHXA 2D97A 4BMBA 2VUCA 4MVTA 2BPA2 4KBZA 1SLLA 1VBC2 2ZABA 3FMGA 4FFIA 4R8HA 2P3KA 4PLOA 3HQUA 2X5IB 5A7PA 4AZZA 1E5IA 3LZZA 3NL1A 1UXZA 1ZM1A 2VZTA 2XKPA 1AZDA 4XDOA 5FZBA 4CDQC 5GZCA 5LA1A 3WSOA 4NHKA 4LQRA 1ULOA 3P6BA 4C1XA 4YLZA 1WD3A 4NUBA 1H9PA 2YBPA 1NCRC 3FUQA 4YFWA 2V4VA 1QJX1 2VU9A 3HNYM 4DIQA 1CN1A 2AH2A 4XEZA 1UY1A 3RSJA 5J37A 5LY2A 1HQLA 4AEDB 1Y43B 5GLTA 1ASJ1 5JZGC 3KHCA 4LR4A 3AMQA 4IEWA 4OHVA 1VBA3 4M0NA 5C5TA 3C3VA 4PBPA 5DAPA 4KI5M 4UOJA 2UY9A 2JDAA 1REDA 5FPXA 4RGKA 2BOIA 2XJPA 4AVVA 1UL9A 2Y6FA 3OD4A 4NO4A 3J4UH 4IV3A 4I3PA 5T5PA 4HVRA 3RGBA 4LBQB 4MZUA 1KS4A 1UMIA 2XMLA 3NV4A 3QH7A 1KRIA 2D6PA 4AAPA 1LTEA 3R4UA 1G9AA 3ZFFB 1RYYA 1WBFA 5GJ6A 2G9FA 4N43B 4YG3A 3SCFA 2I07B 4A7YA 1E5RA 2FDIA 1OA3A 2QDRA 3GZEA 5LASA 3M3IA 4QWNA 3ZFGB 1NA1C 5J36A 2WFF2 2WZEA 5FO7B 4AXOA 1PX4A 1MQTB 2TUNA 3D82A 1PZ8A 4HLTA 1JYNA 3NV1A 2QQJA 1TNRA 3H1WA 1J3PA 4XJ8A 5GZFA 3USSA 4DUWA 4Y20A 4FXGB 3BGAA 3IKWA 2Z5WA 1HXS2 1W99A 1QU0A 4RR3C 4BQWA 4C91A 3TN92 2ARXA 5LBFA 4CDWA 1H2LA 3VBHA 4JKMA 3O1OA 3LEKA 4ATFA 5DMYA 5D8AC 3T09A 3VKOA 4HVQA 1RMU3 2HWC3 3AM2A 1IG3A 1LHOA 1OBNA 4RHV2 1IHMA 3WDYA 2JD9A 3LGRA 4MX3A 4QHZA 4Z92B 3P5BA 1OLQA 1QJU3 3UK9A 5LATA 2ENRA 4XQWA 5KHJA 5A6QA 1WLWA 4CDUC 3KVBA 2WZR3 1PMJX 2FZ2A 2VUDA 2XQXA 1RUI3 3I49A 5IWFA 3AYCA 5F6KA 4GAZA 2BNOA 2WDBA 2FCVA 4UF0B 1WMDA 2A3YA 1I9RA 4Y1UA 3ZYJB 1MVEA 2KXLA 3WW2A 1VBE2 1W0NA 4NIDA 5GALA 1COV2 2BP6A 1NCQA 2J1UA 3JQXA 2VH9A 4TYSA 2DFCA 3DECA 1CAUB 3HEIA 4HSJA 4YW7A 1H8VA 1RUF3 1XYNA 4IE5A 2BUKA 1AR72 3CJIA 3NAPA 4CCJA 1TMF2 5FZ3A 1QQP2 4B1MA 4CCEA 4CU8A 1XNDA 4YWAA 4GKXA 5LBBA 3ZXEA 1UU5A 2J1TA 2VNGA 4XILA 3I2FA 5HXMA 4W65A 5CADA 1LOGA 1D2SA 2EIDA 4RL7A 2AEYA 4RN5A 3LB9A 3WDXA 2P3YA 3U1XA 4E9KA 2NPIA 1WW6A 1AYM1 1GSLA 5F3CA 1ZA7A 3ZSEA 4MXVA 1JUHA 2C26A 3MPBA 5LA0A 3GBGA 3HIFA 2RMU1 3VZJA 5LZ6A 1V70A 3MIHA 4BE3A 4LULA 5KXDA 2RJ2A 1VBB2 1CAXB 2R49A 3HT1A 1O8PA 1W6NB 1OURA 3HAGA 4W4ZA 5EZWA 2I45A 2Y33A 3THPA 2ADDA 4JGYA 2B7YA 1DGWX 1NE6A 2HYXA 4P9YA 4GZ9A 3FX3A 1O91A 3M2MA 5ACA3 2A3WA 2Y64A 2YBKA 1GUIA 3LDKA 5FPAA 5T5JA 2OKXA 3A4UA 1WA6X 1V9U3 2YU2A 1JH5A 2PQSA 1WLDA 1GICA 5CVRA 1F4HA 2HWD1 5AFEA 1B09A 4GALA 2TNFA 4XXPA 1W6QA 5CG9A 2VUAA 5L36A 2JDMA 1SDWA 2R073 3BPSA 3SH4A 3VDAA 4AQ2A 5F5CA 2GZWA 1W9WA 4O9GA 1EUTA 4YFZA 1DQ4A 2R6QA 4Q4W3 5F5QA 3KF3A 4XZUG 1R082 1URXA 3AMNA 1FOD2 1YQ2A 4QKFA 2VW0A 1LENA 3Q8FA 4GIQA 3MW3A 1RXGA 4YVSA 4BU2A 3UNPA 2JG8B 2C4XA 4PI2A 5EYXA 3FFZA 3T2PA 3DYPA 1JYXA 4ASMB 1ULEA 5A6YA 4EQVA 1N3OA 4BQXA 2OZJA 4QX5A 1IPSA 3C8XA 1TEIA 4CDWC 3SNMA 2RJKA 3I8TA 1WZXA 5A3LA 4JDMA 4A6OA 2JDNA 4H2AA 4IXLA 4Z2WA 3MI8A 2B9VA 2VOWA 4TLGA 2DCTA 5FZ8A 1YUDA 3SITA 1C3HA 4S2FA 2CSGA 2ZX4A 4J6GA 1AR82 4QDQA 1FNZA 2IXKA 1K45A 2Z79A 5L19A 1RUJ2 3NNJA 1JBCA 3RZLA 4IEYA 1OOPC 2B9UA 1S0EA 2RS12 3I4IA 5FZAA 2P17A 1OXCA 2YXSA 3ETPA 1PIV2 2WYSA 4XCBA 1O7FA 5DXDA 2O8QA 3VD5A 4EJRA 1Y7BA 4MV2A 4CP1A 4QB6A 1NCQC 4XPVA 5FLIA 1W8HA 4BQ5A 2WNVC 1AR91 5C4WA 4QHOA 1CPNA 3NAPC 4DS0A 4AI9A 5KXCA 1PMIA 4Y4RA 3ZXDA 5ISLA 3JBG3 5AFBA 5HV4A 1QMJA 1H8TA 2ZX0A 4K9SA 2RR11 4M00A 2HEVF 1ZZ9A 4URAA 1QH6A 2E33A 2GSYA 2PLV1 1QJZA 4JHTA 1LHUA 1CZSA 2VJXA 3SQOA 3DPRB 1XBFA 1XU2A 2YC2A 4MSVA 5FXXA 1RHI3 4EE2A 1PO13 4IEOA 4ISQA 4DRVA 3ZYRA 4W6YA 1O4TA 4BQ4A 2HWF1 1KEXA 1NOVA 2NM1A 3LQCA 1LHWA 1TG7A 3HQRA 4META 1US3A 3ENRA 4QPIA 3DL3A 5FYCA 2LROA 1R091 1QJY1 2XL9A 4JGYC 1XOYA 3J26N 3UKTA 3ZIXA 3J9SA 4Y22B 1PGW1 2I74A 2J22A 3RWNA 1J58A 2DVDA 2W1WA 3RJRA 2QQOA 3NSTA 5BNPB 2D5HA 5HXVA 2XJVA 1LJ7A 1UIKA 4CUGA 4EN7B 4UW4A 3RJ2X 1F8VA 2UYAA 4LNVA 5CEHA 2W87A 4XUTA 3N9MA 1ENRA 1RC6A 5JXJA 1W6OA 2VNOA 1V6MA 3KT1A 2IXJA 4DQAA 4BXSV 1WLCA 2JIGA 2GMMA 2Z42A 4AEJA 1Y9MA 4IV1A 1ACCA 1ZZCA 2D6MA 5A70A 3MFCA 2QQNA 4OI1A 4NHMA 4WV8A 2WN2A 2BGOA 1PVC1 2WQZC 1X8EA 2KR2A 3NKGA 4ARXA 1APNA 5CFCA 1UZVA 5LY1A 2ZMLA 3H1YA 2G9ZA 2JDHA 1UOJA 3SC7X 5FDBA 5GZGA 4FOYA 5FZLA 1H1IA 3VL8A 4YVSC 5CKQA 3WP3A 1J1TA 1CONA 3WQBA 1JU4A 5DZFA 3KCYA 2GH8A 4KG0A 4BDVB 1VJ2A 1E57A 1GWMA 1D4VB 1EAH1 1UKRA 4XUNA 4YGDA 5C5UA 1F2NA 1TME2 3LA7A 4GMP0 1DQ6A 4MUVA 4JC1A 1G9FA 1C8M2 3VBFA 3T0DA 4LBJA 2ZGLA 1KDMA 1W3VA 4WVMA 2CGNA 2CGOA 4KMQA 5E8AA 4CPBD 2GU9A 5L9RA 2ORXA 1PO23 4D6RA 3E5XA 2YHJA 1GV9A 1DQ1A 1KD7A 1GP6A 3T2OA 1LCLA 4AE2A 4BB3A 3LA2A
chains in the Genus database with same CATH topology
5KC5A 3U11A 1H1AA 1FPN1 5DUUA 5DG1A 4Y1YA 2R16A 5FCCA 1DZQA 5SV5A 2WS91 3MW4A 4X6RB 2AREA 3O12A 2WKKA 1BEV2 2ATFA 3IPVA 4E4ZA 1X7NA 4COVA 1ASJ3 1HRV3 1O3QA 3M70A 4Q4X3 3T2TA 4BQ1A 1SFYA 3RYPA 1IKPA 2GC2A 2D43A 5GLVA 2A7AA 2E7TA 4AFAA 1KJLA 1H8TC 3KB5A 1GKBA 1RUG1 4CDQB 3VZMA 2YGLA 5LRRA 1HIXA 2Z2SB 5FOJB 4Q4V1 2BEOA 3J8F3 4LA2A 1D2QA 4PQ9A 4Y5Z0 3HN1A 2D98A 3HMYA 4PLMA 2QZ3A 1LHVA 1MS0A 4R9BA 5JZGB 2IXCA 1BBT3 4LO6B 4XTMA 4AVAA 2ZHKA 3H50A 4SLIA 3B7MA 1C28A 4XJWA 3R4DB 1ZZBA 2YROA 5F9TA 4Q0PA 2A73B 3HR9A 2FMDA 3WZ1A 2RS51 2SBAA 5DUXA 3RYKA 4ASLA 1ZRDA 2V73A 1O3RA 4IV1C 2XBO1 1O3SA 3M3QA 4WM7B 2PHWA 1ZNPA 2E63A 4FPHA 3ES1A 3VL9A 2GN3A 4NOTA 4FP2A 5CBLA 3MIEA 3O14A 5CFCC 4I09A 2UY8A 1XNKA 3FJSA 3H7YA 1W6PA 4I0BA 4RD7A 1VBA2 3NJZA 4RS5C 3ILRA 2JXAA 4XOGA 4P5HA 4DZGA 3AX4A 4K21A 1YFXA 4JGZC 5I0RA 4MYEA 3MW2A 4HT1T 1DIWA 4W6XA 1OPMA 2D6KA 4TZDA 3OY8B 1W6MB 1EPWA 2IXIA 3VBFC 4BHPA 1KFXL 5T5OA 2YPJA 5E88A 1H2KA 2D93A 2CGPA 4CDUB 2PHXA 2R063 5E1RA 4LEJA 1ZRCA 1AYM3 3E97A 3BCWA 1FMD3 1GFF2 3ZN4A 5ABJA 1GR3A 1C5HA 1XQNA 3ZN6A 1BKZA 1NLRA 4LE3A 3HT2A 4OVEA 5FQ0B 5FRAA 2OZ6A 3L2YA 1SBDA 1F5FA 1DQ2A 2DWRA 4GH4C 2PHTA 1IOAA 5BNNA 5C9AC 4R9AA 1RMU2 2HWC2 1AX1A 5FTTC 2I2SA 3QH6A 3X29B 3VBRA 1QJU2 4XXAA 3IDEA 4I01A 2WZR2 2RS13 4F83A 3AYAA 4JDNA 1PGL1 1RUI2 1S1AA 1Q8PA 4R9CA 5AC91 5LRSA 4GWMA 2YY1A 5FPZA 4FP3A 1NY71 1XNBA 3N7KA 4XQ4A 2Z69A 4WVZA 1RUD1 1RUF2 2IZWA 4MGYE 2EIGA 2XKOA 1ENQA 2VULA 1D0HA 4INDA 1AXKA 4IV3B 3WG1A 1SLTA 4YG6A 3VHRA 4DINB 1ZBA1 1EP0A 2VVFA 4QD2A 4BIOA 2DVFA 1VBD1 5KC6A 1Q8VA 3GBFA 2JX9A 3QD6A 4XBQA 4XJUA 1T6GC 2A6ZA 3JZVA 1PZ7A 3S7EA 4YZ5A 1H2MA 3RPQA 3G7DA 2LUWA 1DYPA 2JECA 4NHLA 2GNMA 5DDJ1 4I0WB 4Z8BA 4AFDA 4P9GA 2DVAA 4E4SA 5ACA2 2OUJA 1DZTA 3WP4A 1HKDA 4Y20B 3TNPB 3WG3A 4YM3A 1LESA 4N90A 1V9U2 1AR61 2BVVA 2WZPP 2BYVE 4CDWB 1QOOA 3VBHB 1OHFA 2A70A 5K8SA 3V56A 4LBKA 1NCRA 4FSJA 3LOBA 3L9JT 2R072 1N1VA 2PELA 1MEC1 2Q1ZB 3T1MA 5TSWA 1BZWA 1CX4A 1U0AA 1UIJA 2XPJA 1HLCA 1QDOA 2RR13 4Q4W2 2P37A 1LULA 1RVF1 4GB31 1QF3A 2JG9C 3B9IA 1SACA 5ABJC 4CP2A 1REEA 3QOPA 1ZRRA 2QQPA 3OJBA 2H0BA 1QHDA 1XYPA 1NCQB 2HWF3 4TSVA 4YFWA 2FMYA 4L8QA 3AZYA 1GBGA 2X53S 4LBOA 1UMZA 3OD0A 1C8M3 4HETA 1ND3A 4L97A 3CJIB 3IIAA 3NAPB 3B00A 1HRI1 1Z7S3 1WA4A 4PF5A 3ZMOA 1C5IA 4QGNA 1NA1A 3VBRC 4FPYA 1CESA 2D3RA 3FLPA 2GMEA 2QKDA 1PVC3 4RR3A 2XJUA 2VMGA 5CAZA 1SCSA 4HFSA 2OIIA 1ZBE1 5KHHA 3VBUC 1X82A 2W0XA 4JGYB 4M0HA 2ILMA 5D8AA 5AVPA 4XJAA 2AUYA 2Y0OA 5I8YA 3DN7A 4BH9A 4H7MA 1M06G 4K1ZA 2GAUA 1PNFA 1R1A1 3JBG2 3N7MA 3ZXLA 1LOFC 3ETQA 3KGLA 1J3RA 1W6QB 4FO9A 4SBVA 1O5UA 4R9DA 1SCRA 4AEKA 1ENSA 1RHI2 4DNYA 1PO12 2DCKA 2SLIA 1LOBA 5JWPA 2AYHA 3VV1A 1QNYA 1MZFA 2ETEA 3PLQA 2XG3A 3NO8A 2YUEA 4OULA 4A3XA 5GZEA 4YVSB 4B4PA 3OGJA 1VB2A 4GMP1 3JD73 4XF3A 1HV0A 1XYOA 4YW1A 4CP0A 4CDXC 3B9CA 1F5JA 1AF9A 4B3NA 2DURA 2YMZA 2R041 4R4XA 4P9JA 4MGIE 4E2QA 3ZPYA 1AYN1 2V5YA 4MGKE 1JHNA 4XHBA 4EN6B 2EAAA 2R1BA 5DG2A 4Q4Y1 3BOWA 3SXWA 3BALA 1LU1A 4IEVA 2WFF1 4YW4A 1BQPA 4WVWA 1NYWA 1SLCA 1OFSA 2NN8A 4IEZA 3RRDA 1QWRA 3E6BA 3ZFEC 2QFEA 1SLAA 4FPCA 3IMNA 2E7QA 2GMPA 4OI4A 1VALA 4AGGA 1EV13 2Y26A 4BPZA 1ZYBA 4Z82A 1W2UA 3VBOA 2VPVA 4NR1A 4YGEA 4PIYA 5C4WB 1ND3C 4GWNA 2WNUC 4Q8KA 1LRHA 2OW4A 4EROA 1V6NA 2Q30A 4AFMA 4Q27A 1QGLA 4RHV1 2MEV3 1NZCA 1PO22 2GC0A 1H8TB 2WT2A 2RS53 3BTAA 2GNBA 3NWKA 3NV3A 2VW1A 4HMZA 3AKPA 3VLBB 1S0GA 1DYKA 4LTAA 4QQOA 5BNOC 1TE1B 1X33A 3WDUA 5EYYA 5JMCA 3WCSA 4Q1RA 4I2OA 1CQ9A 4QPIB 1COV1 1X36A 2RS33 2ZGPA 1ASJ2 3BU7A 1HRV2 4ITCA 1IPKA 4QPGA 3IM0A 4Q4X2 1KQRA 2H6CA 5HCBA 1SQ4A 3O0WA 2W39A 2D3PA 2ZMKA 1BVP1 2V09A 3CEWA 1RUE3 1AR71 2Q5TA 1TMF1 1W0PA 5CA6A 4V1PA 3U4XA 4CEYA 1W6OB 1V6LA 1VR3A 2VUJA 4JRAA 4BZ4A 3K48A 1OOPA 4UBHA 2YDEA 1ND2A 2RM23 3WQ1A 3P3PA 4IV1B 4LHKA 3KCXA 3J8F2 4RQPA 1YJKA 1S0FA 2XL7A 2EXKA 1PNGA 2PHUA 2AZ5A 2VVDA 4K1YA 4NPRA 1VBB1 2JE7A 1CAVA 2WNVA 5CFCB 1X50A 2VECA 1BBT2 2C9AA 2ZBJA 3ZSKA 4UW3A 5JSRA 5FBZA 2E51A 3N7JA 1KS5A 1AX2A 5JPNB 1Q8QA 3QLQA 2YZ4A 2Y0IA 4Z1VA 3WG2A 1I5ZA 4URTA 5C8CC 4HPKA 1Z78A 3SCGA 5F1RA 1YI7A 4JCKA 5I91A 4LO5B 3VBFB 4OUSA 4PIXA 1MVQA 4E4DX 2IXLA 1HDKA 2UU8A 4WVMB 3MGUA 1MS8A 2ZMNA 4LUKA 3ZIWA 4LE4A 1LOAA 2E7AA 2P3JA 2ZTNA 5DZEA 1JUIA 4MXWA 3ZN6B 3VZOA 1R081 1FOD1 3BPZA 2HKXA 5AC93 3M3CA 1CGPA 1LEDA 1SBFA 1AXYA 2CWSA 2CWMA 2VG9A 2G4IA 3IPVB 1H1MA 4AHWA 1D4M3 1J3QA 3VBOC 1LKNA 1AJKA 3IDCB 1UZYA 2ZGRA 2ZCWA 1U12A 3B01A 1OLRA 1XU1A 2XH6A 4QPYA 3P3NA 1Q5OA 3WLUA 1AL21 2R062 1IS3A 3KSCA 1AYM2 3VDDA 1VBD3 1AR81 3OBRA 3UKVA 1FMD2 1WMEA 2ZGTA 4WM8A 5JR7B 3U10A 5T55A 1RUJ1 1F31A 1PIV1 1H0BA 4AI2A 1PM7A 4QQ2A 3MLKA 4FPOB 1YWKA 1FV2A 2ZGMA 4QPGC 4QQLA 3ALQA 4AQ6A 1RUNA 4J1XA 3AMHA 1A3KA 1AR63 2ZS6B 2D44A 5J3UA 4CEYC 3B94A 2E6VA 5EV7A 1ND2C 1WUVA 2ZX2A 2VW2A 2NMOA 5KXEA 4FT8A 4MLOA 3PJQA 3MF9A 2WLPA 4DFSA 4FOWA 1SLBA 4RQPC 2BBVA 1N3PA 3PNAA 1FI2A 4D7TA 4GB33 4BLJA 4JRLA 1JOJA 1KFUL 1W6PB 4YW2A 1DGRN 1A8DA 4I02A 4PIZA 3WV6A 3UV9A 1VLNA 3TOJA 4LLOA 1MS5A 4ISRA 2CYFA 2PFWA 3CU7A 4AQTA 2ET7A 3H1MA 3WDTA 1DFQA 3ZYGA 3M4FA 3AJYA 3AZZA 1G7YA 4OHWA 4E2GA 5T3NA 4CEWA 4COZA 1RJ7A 3VZKA 2A6YA 5JAXA 1YYNA 3WR0A 4FOVA 2HWB3 5ABJB 1POV1 1H2NA 3CF6E 4ZKTB 4B4RA 1ZZ6A 1U5IA 2R32A 5JOXA 1N1SA 2NLRA 1UU6A 2D5FA 2ZX1A 1NXD1 1U5XA 5EWSA 1QXJA 4GA9A 1TME1 1CVNA 4H55A 5BNNB 5JI7A 5H9QA 3SMHA 4CTEA 2BNNA 3OPZA 4AFCA 3MZHA 3R0RA 1YFUA 1R1A3 2RHPA 1GLHA 2K0GA 3VBRB 3WDVA 5E89A 3ST7A 2LM3A 3MF6A 2RR12 4RS5A 5AVAA 3VDDC 5J09A 4JGZA 4HKLA 2R1DA 2NYYA 4WM8C 2XVGA 4XIKA 3AZWA 2W08A 1UKGA 2OYZA 3TNQA 2UYBA 3I54A 2ZGQA 4LLFA 1M4WA 1L3JA 2X8KA 2HWF2 4DXZA 1BEV1 5L7OA 2ZGSA 1TNFA 1RL3A 1YHFA 5H9PA 3W59A 4AVCA 1UW8A 1DG6A 1GANA 3MIFA 2D6LX 1Z7S2 4HK9A 3BIWE 5A32A 3URFA 3S0MA 3VBSA 1OKQA 5D1IA 1HQWA 4IETA 2ZACA 3SCHA 3ZO0B 3KMHA 2XVKA 2PAMA 5LEJA 4Q8LA 1QJX3 2R043 5JDBA 3MYXA 4RGAA 1WW7A 2IFRA 4XQDA 1MS3A 2W68A 1BJQA 3SH5A 1ZRFA 1PVC2 1AYN3 3MFAA 2GN7A 3H3UA 3RS6A 4GH4A 3LSDA 4K6BA 2BTVC 4Q4Y3 1O5LA 1G86A 3UL2A 5I8SA 5C9AA 4KWKA 4OI2A 2PHDA 3NVCA 1Q8SA 3BB6A 2K2SA 1B35A 1H30A 1JW6A 2DVGA 3EQEA 3C2UA 3WD5A 4Y1XA 1CIWA 2CNAA 3WINE 3JCIA 1NCRB 3POWA 2CV6A 1NG0A 4XE9A 1RUH1 1GZWA 1PK6A 4CEWC 1YFWA 2OA2A 3WG4A 4KNCA 5C8WA 4A7KA 1SEFA 2HYKA 4B8EA 3V0AA 5KHKA 1W39A 1U5ZA 1ULFA 1SLIA 5GM0A 5KHIA 1UZZA 4C0HA 4HN1A 1LB2A 4HKWA 1MQTC 1WCSA 3WDWA 5FO9B 4KU7A 2HWE1 2FHRA 3V0BA 2VY0A 4EV0A 4FVVA 3JD72 2A71A 3A0NA 3N3HA 1UF2C 2WC2A 1BVVA 1BMV1 4H14A 4AHZA 1ND3B 4Q26A 1HX6A 1DQ5A 4ZU4A 4I3GA 5FAXA 1K5MA 4IEPA 5FMOL 4G9SB 1LEMA 1QDCA 4EN0A 1YRZA 1NA1B 4XF0A 4YZ2A 4AVTA 1OFNA 4XFIA 3O7OA 4FTEA 3PTYA 4LT5A 4A2UA 3S7IA 4FTSA 1ZZ7A 3QBQA 3QACA 4AI3A 4GXLA 1OA2A 3APBA 2BFUL 1NLSA 3PVBB 3VZNA 2VQ0A 4RR3B 2JJ6A 4LA3A 2DUQA 3O0VA 5JVVA 1CR7A 1EV12 5D8AB 3AP9A 1DGRA 5FMOS 3FHIB 4H7LA 5L7OC 1XE8A 3EXUA 4YVWA 2YC0A 1NQJA 1XE7A 3WNXA 4HKOA 3MPPG 1RMU1 2HWC1 3LAGA 2VGDA 3I2DA 4L92A 3DF0A 2MEV2 2JG9A 2RS52 3VBSC 1QJU1 1Q43A 1YNAA 3OCPA 4IESA 2RMU3 2BFUS 4IERA 4KL1A 5IK7A 4YGBA 1LOCA 1QH7A 4IEUA 1RUI1 4LO7A 4LO4B 2DUPA 3ZYPA 4XDQA 3WVJA 2PYTA 2ARBA 5CG8A 2RS32 5C33A 4MH0E 3TB0A 5LK7B 4QMAA 1O4YA 1KJRA 2XJRA 1G9BA 1G9CA 1RUF1 4TWTA 4N7UA 1RUE2 1B35C 5FREA 2HWD3 1GQHA 4LBQD 4OHZA 4AYUA 2R30A 2RM22 2ZJCA 1ULGA 3RMXA 3JUUA 5JOYA 2QJVA 2OPKA 2BVBA 3CNAA 4XZPA 3PMEA 1PK6C 3VBUA 4JVAA 1AL23 4XYXA 1YXWA 2WSUA 1A8MA 1VRH1 3OGGA 1ZX5A 2XJQA 4N7IA 4XF1A 4YM1A 1J59A 4UXAA 2OVUA 3PJYA 5J7MA 3TBDA 3KGZA 4Q1PA 1FT9A 5ACA1 4I0AA 1LOFA 2JG8C 3SISA 1WCKA 4C0BA 2G9GA 2B5HA 2YV8A 3VBOB 1DU3D 4YW3A 4EWEA 1MACA 3W9AA 3EJKA 1OD5A 2R071 1K5MC 4JTOA 5HCFA 5KXBA 1UN1A 2AENA 3JQWA 4N9IA 5I8TA 4Q4W1 3LOIA 5T5LA 1PGL2 1REFA 4UW6A 4IEXA 4E2SA 5AC92 2Q4SA <