5IK7A

Laminin a2lg45 i-form, apo.
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
381
structure length
381
Chain Sequence
b'APLAMVHGPCVAESEPALLTGSKQFGLSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRNGFPYFSYDLGSGDTSTMIPTKINDGQWHKIKIVRVKQEGILYVDDASSQTISPKKADILDVVGILYVGGLPINYTTRRIGPVTYSLDGCVRNLHMEQAPVDLDQPTSSFHVGTCFANAESGTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTRPTGVLLGVSSQKMDGMGIEMIDEKLMFHVDNGAGRFTAIYDAEIPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQSPNSASTSADTNDPVFVGGFPGGLNQFGLTTNIRFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laminin subunit alpha-2
molecule tags Structural protein
source organism Mus musculus
publication title Structural basis of laminin binding to the LARGE glycans on dystroglycan.
pubmed doi rcsb
total genus 80
structure length 381
sequence length 381
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ik7A01
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ik7A02
3AZXA 4XILA 4UW6A 3ZSLA 1KJLA 4LBQA 1FNYA 3FLRA 4NOTA 1BYHA 1I3HA 1PZ8A 1LHUA 5DXDA 3VKFC 4BMBA 2HYKA 3RMYA 5DG1A 1CIWA 4FPGA 2OVUA 1AX2A 4GALA 3AP5A 3NV4A 1S1AA 5EXOA 1GZCA 1VALA 2A75A 2NZ9A 3B3QE 2PHFA 1Y7BA 1AZDA 1YO8A 1AVBA 2C5DA 1KITA 1C1FA 2A70A 4WVVA 2ZGOA 1GNZA 1N3PA 2ZHMA 3AP7A 1U0AA 1QNYA 3LCPA 2WLQA 1UZYA 2YY1A 2CWSA 3V64A 1D0HA 1J1TA 1V6NA 1W6NA 3N35A 4F83A 2YXSA 5DZFA 2GNDA 2P34A 3N36A 4FOVA 3ZXFA 2WNEA 2D6PA 5JMCA 3SH3A 3ZXEA 1MVQA 1OFSA 1SLAA 4WV8A 2PHXA 2D6KA 4Y20A 4AVSA 4M01A 3M3OA 3RS6A 3WLUA 1Q8OA 4AVTA 3UK9A 4PQ9A 1R1ZA 4ISRA 2WT2A 1OKQA 1EPWA 1N3OA 2DTYA 2CY6A 4YFWA 1ENRA 1N1YA 2D6LX 4GA9A 1V6JA 4R9DA 1LOEA 4XHBA 4YFZA 4H55A 4K1YA 1V6IA 3ZXJA 4FQ4A 3AXEA 3ENRA 2ZHKA 3WG4A 4GWNA 2FMDA 1H30A 1F31A 3ILNA 1SBDA 1S0FA 3AP6A 3OYWA 2UWCA 3WHTA 3B00A 4ZKTB 3ZSMA 1LHNA 4D69A 2UU8A 2JKBA 3IMNA 2VH9A 1DHKB 4GKYA 2CL2A 1MZ6A 2ZMKA 3RG0A 3H0OA 1WUVA 4K1ZA 4AWDA 1MS0A 2D6NA 5JOXA 1IOAA 2ZHNA 2YV8A 4YM2A 3NV1A 1JYCA 3USUB 3NV3A 3PVEA 1G9DA 4XJUA 3WNXA 1GICA 1VAMA 5HCFA 1MACA 3ASIA 4XJ8A 3V65A 2G4IA 5EYXA 2UWBA 1AF9A 4YW1A 1S0IA 3B69A 1LESA 5GLTA 2NN8A 5AVAA 1N1VA 3FUQA 4BLIA 4PBPA 2UWAA 1VAVA 1BZWA 1H9WA 2DUOA 4DPNA 3APBA 2ZAAA 1SLCA 2GN7A 3IPVB 3V0BB 5FREA 1O4ZA 1DFQA 4PF5A 4NO4A 4FP3A 3UL2A 1W6PB 2WKKA 4YZ3A 1N1SA 3CNAA 4SLIA 3UJOA 1RIRA 4XE9A 3C2UA 5H9PA 1MVEA 3SITA 3VKLA 3V0AB 4ZXKA 2AR6A 1WBLA 1A3KA 2P3JA 2DU1A 1WLCA 3MEPA 1SLIA 2DWRA 3OBTA 3O12A 5GZDA 5IK4A 3OGGA 4ATEA 2NMOA 4RA0A 5L73A 5KXEA 3M1HA 1G9FA 4M3CB 3POWA 3T1LA 1QU0A 1WLWA 1RITA 3WZ1A 1WD4A 3OY8B 1YI7A 2JJ6A 1ULCA 4Y24A 5JVVA 1MS5A 4Q2FA 2DUPA 3MW2A 5EYYA 1A8DA 1QGLA 3SISA 4DRRA 2CTVA 2H0BA 4PCRA 1DYPA 4FPOB 4DQAA 3Q9OA 1BQPA 1W6OA 4C1WA 2PHTA 3AZWA 1ULGA 1CR7A 2XB6C 4UW5A 1N3QA 5JLVA 4P9YA 4YGBA 3ZSKA 1MZ5A 1UX6A 3AJZA 5T54A 3T2TA 1G8WA 3FLPA 1LCLA 1UN1A 2P2KA 2D3SA 3GNEA 3ILRA 5GLZA 3ZSJA 1LOBA 5E8AA 2DV9A 4Y1ZA 4LBOA 5T5PA 3L2YA 1CQ9A 1D2SA 1GZWB 4YG0A 2D6OX 2WT1A 2DVAA 5IUQA 1CJPA 1I1EA 1WW6A 3D4KA 3WV6A 4PBOA 3FBYA 2PHRA 3AYDA 1C1LA 5DZGA 2W39A 5DUVA 1W6QA 3D5OA 3N3HA 5DUXA 4LBJA 4Z8BA 1ULFA 2NM1A 3WUDA 3R4SA 4YG3A 1LGBA 1AXYA 1VLNA 2DU0A 3D6EA 2ZGLA 2A3XA 4LBQD 3O0XA 1Q8PA 4JRAA 3QCWA 4M3CF 5JOYA 4LBLA 1LU2A 2P3IA 4Q8LA 4Q27A 5IK8A 1IKPA 2SLIA 1IS6A 5F9TA 4AGGA 4YLZA 4BOWA 3AK0A 4GKXA 1LTEA 3M2MA 1WBFA 2WQZC 4FOQA 2I2SA 3IM0A 1DQ1A 2LALA 5IK7A 4DS0A 2A6VA 4YM1A 3M3QA 1CESA 1W6QB 4I30A 4HL0A 3WDWA 1DQ0A 2GMEA 3TB0A 4LBKA 5GLUA 1WD3A 2DVDA 4P9WA 2ARXA 3LSDA 3R4UA 2D6MA 4FPCA 5DZEA 5GZFA 5GZEA 1Q8SA 3MW4A 5T55A 3WVJA 2R16A 5H9QA 2ZGPA 3BODA 3PVOA 5GM0A 1LOFC 4CTEA 1UAIA 3ILFA 4TYSA 1MS8A 1SCSA 1LULA 2A3YA 2D44A 3HN1A 1O4YA 3JUUA 3M3CA 4FPEA 4W65A 1HKDA 2R1DA 3VKMA 1YYNA 3AJYA 3BIWE 1AXZA 1QNWA 2CWMA 5E89A 3A0KA 4BQ1A 3FLTA 1W6MA 3ZPYA 1TEIA 1WW4A 3VKNA 1HQWA 1GNHA 3MPPG 2ZGMA 1PZ7A 2EIGA 3AZVA 3DGTA 5FRAA 3HR9A 1S0GA 1FYUA 2AUYA 4Y20B 1WW7A 1JOJA 2RHPA 1ZM1A 4K20A 1IS5A 1DYKA 3WCSA 1CPMA 1HQLA 2E53A 1JN2P 3VUOA 5JDBA 2JECA 3AYEA 3AP9A 4XJWA 4ISQA 2AREA 1GZ9A 1LECA 4XIOA 1S0EA 1ULDA 4KBBA 2NYYA 4M3CA 5IK5A 1QMJA 1SBFA 1AJKA 4Y22B 4BMEA 3NV2A 4P14A 4DFSA 4Q1RA 4R9AA 1QF3A 1GBGA 1MS9A 1NXD1 1Q8QA 1S0JA 2VW0A 1QOOA 3FFZA 2ZBJA 2D3RA 1FNZA 2ZZJA 4LBMA 3AYAA 4XDQA 1SFYA 2W68A 2CNAA 2VU9A 3A0NA 4R9BA 3LSEA 3ZVXA 4YW5A 1KQRA 5DG2A 3FUOA 1F5FA 1UL9A 3KM5A 4WZFA 3WG1A 1A78A 3WOGA 2R49A 1Z0HA 4JC1A 2ERFA 2DYCA 5T52A 4XOGA 3U4XA 2D43A 2ZGTA 3OPZA 1LODA 1JHNA 2B7YA 2PELA 4FPFA 1FAYA 1ONAA 4FPJA 4XBQA 1Z78A 2P3KA 2V5YA 3B01A 3INAA 4FVVA 4XJ9A 4XMAA 5IT6A 2GMPA 1JUIA 4HANA 5F5QA 4AVVA 1GV9A 2E7QA 4YZ1A 1DGLA 2ZACA 1CN1A 1MS4A 1WLDA 4XXPA 2EAKA 3AFKA 1BKZA 3ZYPA 3OY8A 2GDFA 1C4RA 4XJZA 5JOZA 1W6MB 1G7YA 1YIFA 1FV3A 1JW6A 2OUHA 2WJSA 3ATGA 3N7LA 2GNMA 3O0VA 5GJ6A 2PHUA 2A71A 3BOPA 1IKQA 2P37A 3OYWB 4XBLA 3ZYRA 3AZZA 3B9CA 1F9KA 1G9CA 1MS1A 2AENA 1QKQA 3QLQA 2ENRA 1KDMA 2OUJA 1B09A 2SBAA 3IKWA 2JE7A 5EWSA 1YRZA 4BM8A 4XIKA 1ENSA 3NWKA 2FHRA 4C1XA 2LTNA 1SLBA 1LJ7A 2EXIA 3SH5A 4UW3A 1UKGA 5CNAA 4U2AA 3PMEA 4TZDA 1V6KA 2AH2A 1DLLA 2C9AA 3GALA 4FPLA 2EXHA 4Y26A 1DQ5A 2EXJA 3PVNA 2DVFA 3WCRA 3AX4A 4XJAA 1WCSA 2W52A 4DRVA 1W6NB 2R0FA 4JCKA 1N1TA 4XXAA 1LEDA 3WHUA 4XTPA 4YW2A 2Q5TA 4XHXA 2A3WA 3N7KA 5H9SA 4Y1VA 1QDOA 1QDCA 2WSUA 1LOFA 3AZYA 3BTAA 4YW4A 2VW2A 1VIWB 4XZPA 2WSVA 1LGNA 2EF6A 2W08A 2Z42A 4UW4A 3UJQA 1SACA 4CRQA 4ITCA 5HCBA 5T50A 5GZCA 1DQ2A 1W0PA 2ZMNA 1KDKA 5H9RA 3WDXA 3WG3A 4BLJA 3N7MA 4Q1PA 4Q26A 1JYIA 1AX1A 1W6OB 3JU9A 4XMIA 2ZGNA 2ZA9A 4K21A 5BYNA 1LGCA 1MR5A 2YMZA 1Q8VA 1MS3A 4AGRA 4LBQB 2VUAA 3RSJA 2E7TA 2CYFA 1WW5A 1CONA 2GMMA 2ZGQA 2ZGSA 3A4UA 3WDUA 5E88A 1AX0A 5GLVA 4AYUA 3PJQA 3AP4A 2GALA 5JOWA 2XG3A 1LHOA 4L8QA 1IS3A 1GANA 4Y22A 2A6YA 3VV1A 5T5LA 3USUA 5KXDA 4ATFA 1KJRA 1LHWA 1DBNA 5CBLA 1CPNA 1DIWA 1Q56A 3N7JA 1FATA 4MYEA 4R9CA 1YXWA 2R1BA 1S0DA 1GYKA 1HDKA 3KQRA 4YG6A 1QOSA 2VW1A 2A6ZA 3I4IA 1H9PA 1KRIA 2ZMLA 5CA6A 1LEMA 2E6VA 1FX5A 4U36A 2D7FA 1JXNA 1PZ9A 1SCRA 3ZXLA 5CAZA 1ULEA 2DTWA 2ARBA 1RINA 1V00A 2ZABA 2AYHA 3DUIA 1N47A 1LOAA 4Y1YA 3SLIA 1LU1A 1SBEA 2VY0A 3AXDA 5DUWA 4Y1UA 2DVGA 3WDYA 2D3PA 3AYCA 2NP0A 5LK5A 1GZWA 4FPKA 1DQ6A 4FP2A 1LOGA 3SH4A 1BJQA 5CB7A 5T5JA 3T1MA 2A7AA 4FOWA 4CZSA 4YW3A 3V0AA 2WT0A 2E51A 4ASMB 5GALA 4AGVA 4XYXA 2PHWA 5SV8A 1SLTA 2BQPA 3RMXA 5KXCA 4FOYA 1UMZA 1W0OA 3R05A 2NMNA 1LOCA 1BXHA 2A6XA 4BPZA 4RL7A 1ZA4A 3I8TA 2A5ZA 1V6OA 1GLHA 4Q8KA 2DVBA 1QOTA 4IQPA 4M3CE 1DQ4A 4P9XA 2YROA 3POYA 1C57A 1AXKA 4YGDA 1GKBA 2AGSA 3VKOA 3WDVA 2EALA 2ZGUA 4FPYA 4XBNA 3TAYA 3HMYA 1GSLA 2ZKNA 1X50A 3OJBA 3POSA 3WG2A 3ZXKA 4YM0A 4Y1XA 3O0WA 3WDTA 1NLSA 2GNTA 1UZZA 2R0HA 4YGEA 3W59A 2ZHLA 2V73A 4FQZA 1CVNA 5GZGA 1V6LA 3RQ0A 5KXBA 2TEPA 4GWMA 1OQ1A 1S0BA 4YZ2A 3O5SA 4OZXA 2YZ4A 2OW4A 4YZ5A 1ENQA 2DURA 2ZGKA 3M3EA 2EXKA 5T5OA 1W6PA 2KM2A 5GLWA 2ZGRA 1FV2A 4YZ4A 2JDZA 1URXA 4YM3A 4M00A 3IPVA 3V0BA 1HLCA 1UPSA 1LHVA 1APNA 1JBCA 1S0CA 1IS4A 2JD4A 4LBNA 4WVWA 1LENA 2ES3A 3W58A 2JE9A 2A6WA 1DZQA 3SNMA 3MW3A 5DUUA 1V6MA 4XTMA 5HCAA 2GN3A 4GXLA 3WUCA 3RRDA 2DUQA 2VXRA 1G9AA 1SLLA 1G86A 1XQNA 3IN9A 4YGCA 3OBRA 2UURA 1AJOA 4FPHA 2GNBA 1G9BA
chains in the Genus database with same CATH superfamily
1GNYA 1GR3A 4IXLA 1UXXX 1CZTA 4LITA 3VN4A 3M7AA 2ZEZA 1BYHA 5I93A 3RZKA 3VKFC 1AR63 4BMBA 1PHMA 3UGGA 4BWOA 1CIWA 2WNUA 2XVLA 3QH7A 1ULOA 2OVUA 1HRI1 5SV5A 4P9LA 4DY3A 3NV4A 2E32A 1IG3A 2A75A 2BNOA 3I2JA 2DBIA 4AE2A 4CCDA 4DXRA 1JZ6A 3U4SA 3RZGA 4DMIA 2C5DA 3GM8A 1IG0A 3JQXA 4Y4YA 4WVVA 3AL5A 3ACIA 3EO6A 4HVOA 1U0AA 1QNYA 3LCPA 4Q0SA 2XL7A 1V6NA 4F83A 5ANNA 4YW7A 5FJKA 3ES1A 3OPTA 4AW7A 4FOVA 1RUF1 2D6PA 3ON7A 5JMCA 3CJIC 1B35B 2PHXA 2BBAA 3FX3A 2D6KA 4A7YA 2GZWA 4Y20A 4AVSA 4B4QA 3M3OA 2JG8B 1YFYA 1Q8OA 4AVTA 5F2SA 5GKAC 5JPMB 4IDZA 5JIUA 4PQ9A 1R1ZA 2ORZA 3NNFA 1AR73 2ZX4A 2TNFA 3LZZA 1W8TA 1N3OA 4MH0E 3RI9A 5KHGA 2D6LX 4GA9A 1D2QA 4R9DA 4YFZA 4FBFA 1UMIA 1WMEA 4I0WB 1IPKA 1CAXA 1V6IA 4E2QA 4WM8C 3T0DA 2FZ2A 4D3WA 1TZOA 4FTBA 4AHXA 4AI0A 4GWNA 4O9EA 3MPBA 4CDUB 1F31A 3ILNA 4LKFA 3WHTA 1IPJA 2R30A 2RR13 1BK1A 4Q0VA 2VCBA 3OF1A 2PMWB 4MXWB 4PDWB 5FY4A 2QBXA 4QB2A 3F2ZA 2BFUL 3LA3A 3GBWA 3ZO0B 4CP2A 1NXMA 3IWZA 3RG0A 4IV3B 3KSCA 2BERA 5FXWA 4DUVA 2RS52 2XGXA 3AM2A 2QQIA 2AEZA 3USUB 3VBHB 5A6YA 1YC61 4XJUA 3N9LA 1VBD2 3KMHA 5HCFA 3OOXA 4XJ8A 2BGCA 2C26A 4Q4Y1 2VUCA 3OBZA 5C4WA 5EYXA 3E6CC 1AF9A 2NN8A 3U75A 1N1VA 2PLV2 3ZFEA 4D6SA 2RV9A 2YG0A 1QJX3 4PBPA 2RG4A 4CDUA 3K48A 5FZ3A 4CEWC 2ZX2A 2UYBA 2H0VA 1H9WA 3ZFFA 1IHMA 4HPKA 2EIDA 1OOPB 2Y8KA 1AYM2 3DEMA 4QX0A 3AMPA 4XUQA 1EAH1 1O4ZA 2MEV1 5KHJA 2P17A 4KGGA 5FZMA 5BNPC 1DCSA 1P8JA 5FY1A 3FWEA 1QJZA 1HX6A 2WKKA 1R081 2Q0AA 1YQ8A 3CNAA 1UYPA 4SLIA 1RIRA 4XE9A 1A34A 4CP1A 4CDXC 1JU3A 3VKLA 1RUJ1 5C3SA 2VNVA 3AMHA 5A3PA 3VHOA 1CX4A 1PX4A 2XBO1 3G6JB 1HN1A 3OBTA 4QHBA 3I7DA 3O12A 1GWMA 1OMIA 2VE1A 3BI3A 1RUH3 1PO13 1O3SA 1VMHA 1Y3TA 2CDPA 4DXZA 5KXEA 2HWE3 3M1HA 4TXWA 2GP5A 1QU0A 2KD7A 1WLWA 4DINB 1QQP2 4IV1A 3CJXA 4OHZA 1KS5A 4PIYA 5HXVA 1EAH2 5FZ6A 4NJ4A 1ZA7A 1W05A 5DDJ2 1DF0A 5LA2A 5A7WB 1TQ5A 5FV3A 2Q1MA 2VM9A 1X33A 4LMFA 2CTVA 1UIKA 3U1XA 4CP9B 1VRH2 1XE7A 1ZRFA 1BQPA 1H8TC 5LWBA 2PHTA 2V5DA 1C5IA 2QQLA 3H1YA 1CR7A 2BUKA 5HXMA 1N3QA 4JGYA 4Q4Y2 4S2HA 5CU1A 3WW2A 1HB4A 4YGBA 1YJKA 5IW0A 2VNRA 4IE5A 3AJZA 5CKQA 2QE3A 4GIQA 3VHRA 3T2TA 3WQ1A 4LHLA 4PT6A 1LCLA 1T6GC 3PHMA 1UN1A 2OPWA 3PUAA 5GLZA 3ZSJA 1GQPA 1OF4A 3LB9A 3GHNA 4FT8A 5BNPB 3UKNA 1J3RA 1DGRA 3C3VA 5KHIA 1GP4A 1GZWB 3OD4A 4YVSA 4DNYA 4HSJA 4QB6A 3WV6A 4PBOA 1ND3A 5CFDA 5L7OA 5C71A 2WQ4A 4ZONA 5DZGA 3B7MA 2OS2A 3Q8CA 5DUVA 1W6QA 3WF4A 1GOHA 2LW8A 3D5OA 4OFGA 2VZ3A 5DUXA 4LBJA 4Z8BA 2VCMA 1H4GA 4A42A 1LGBA 4CDWB 2DU0A 3POBA 4KMQA 1HRV2 3AMMA 4LBQD 4QKDA 2JIGA 1LU2A 4J1XA 1NA1C 2W0XA 4HK9A 4AGGA 4BOWA 1XE8A 4DIQA 1WBFA 4ONUA 3CMGA 1UYXA 4PLOA 5FZ8A 1PMHX 1VMFA 5BNNA 4CCJA 1DQ1A 2LALA 3CU7A 3WF2A 1I5ZA 1H8TB 1POQA 5FUIA 2J1SA 4N7UA 4I30A 1MZFA 1O3RA 4HL0A 3WW1A 5A3LA 5A3TA 2VGDA 1COV2 3KS7A 2XL9A 1UW8A 3H7JA 3LSDA 3ZN4A 5GZEA 2VG9A 2JEMA 4BE3A 3E6DA 1M06G 2IFRA 2W47A 5F3GA 3PVOA 4JHZA 4TYSA 2VJXA 2D44A 4W65A 1RL3A 1JYWA 2R1DA 5DAXA 5CFCC 4N90A 2QVSB 4A45A 1UZVA 1W8ZA 3BIWE 4FXKB 4UF0A 3IBMA 2W9XA 5IAXA 2L9LA 4CA9A 3ECQA 2W5FA 4AI1A 1AL22 2EIGA 2ZCWA 1IPSA 3DGTA 3KVBA 2N7GA 3HR9A 5FRAA 5C7GA 1PNFA 1S0GA 3HBKA 4XVHA 2Y38A 4R4XA 4Y20B 3S7EA 3WSOA 1U5YA 1QJY2 4CDWC 1JOJA 5FZOA 5C8CC 1DYOA 4AI2A 1ZM1A 2JB8A 4COWA 3HOBA 2HWD2 3UETA 2W46A 4PLNA 1O3TA 4XJWA 1PVXA 4ZU4A 3K77A 2EICA 5CISA 2DCYA 4XIOA 2XQXA 1W3VA 3WQ7A 2P5BA 3BUCA 3VBHA 5FXZA 4AEKA 2VBBA 4RHV1 3WNMA 2BU9A 3Q8BA 3NNGA 4BMEA 4GZ9A 1I6XA 3RZMA 4XFCA 1GBGA 1C28A 1J3PA 1RHI2 1NXD1 1Q8QA 5CNAA 1SFNA 3FFZA 1W8OA 2D3RA 1FNZA 1JYVA 1RUE1 3HVDA 1UOGA 1RGSA 4LBMA 2MHFA 3TN92 4A6SA 1ZX5A 4XDQA 5LBCA 4Q0PA 2YGLA 3LGRA 1UMHA 2BFUS 1F5FA 3WOGA 5FOBB 1K5MC 2D97A 3DL3A 4MG2A 4JC1A 4BZ4A 2PQQA 2ERFA 1W2NA 2D43A 2ADEA 2ZGTA 1UQXA 1LODA 1JHNA 4XBQA 4CCEA 1ONAA 3VUOA 4FPJA 4XMAA 1Z78A 2P3KA 1S4CA 2V5YA 4FFIA 4Q4X1 2RDQA 4QPIC 5F8PA 2HWE1 3FHQA 3L9JT 5F5QA 4CDXA 3UESA 3BKZA 1PGSA 4YZ1A 2CAUA 3CJIB 5F3IA 1H8VA 1CN1A 1MS4A 1E5RA 3KV9A 3WNPA 1UZWA 1REEA 4A3XA 2XKPA 3AFKA 3MBWA 2OT7A 3D8CA 1U12A 3ZYPA 3K4DA 4CUAA 5IHRA 4R52A 2VQTA 2GDFA 1W6MB 1G7YA 2OUHA 1JW6A 2CGNA 2V72A 1R083 3N7LA 2GNMA 4OHWA 4NIIA 2A1XA 2QQUA 3TEZA 5DQ0A 1PO12 3AZZA 1F9KA 4HK8A 1ZNPA 4IV1B 3ZM8A 1MS1A 4RQPC 2AENA 1QKQA 3I2OA 2ENRA 5FFOC 2WNUB 2OUJA 1J84A 3IKWA 4OHXA 5EWSA 4BM8A 2OIIA 2BV4A 3BTZA 1VR3A 2FHRA 4C1XA 4AL9A 3RZHA 2JG9B 3POFA 4Y3OA 5EFUA 1SHWB 1UKGA 4MGIE 4M4PA 2YU2A 3S6PA 5JWPA 3H7YA 4MGZE 2Y0IA 1OLMA 3GALA 2Y6KA 1VB4A 2PFWA 5FPVA 2DVFA 5EJ1B 2WYFA 4GJZA 3AX4A 1MQTB 1RUJ2 2XJPA 1CGPA 4AZZA 1Y9GA 1ZBE3 4JCKA 2Q8EA 1KEXA 1R082 3HAGA 4XC9A 4MVTA 3WHUA 2X5IB 5FP3A 5A3WA 1OLQA 2B46X 2WSUA 3BTAA 4YW4A 2Y34A 5FYTA 4XFHA 1VIWB 4UFJA 1AYM1 1O6UA 2JG9A 2JDMA 2WSVA 4UW4A 1VBE1 3UJQA 5ISLA 4CRQA 4MHUA 4LNVA 2W1UA 3IDCB 1DQ2A 5CKNA 1H2NA 4ZPIA 4BLJA 2PLV1 1AL0G 3S57A 1NLRA 3GZTB 1JZ7A 1QJX1 3RNSA 2VMGA 2WBKA 2XHKA 2JDKA 3QOPA 5FMBA 3NVCA 4XMIA 5T3NA 5C9AB 5K0UC 4LO5B 4D0QA 1MS3A 4EE2A 2VUAA 4EWAA 1DGRN 1KFXL 3RSJA 2E7TA 3KT7A 2CYFA 4L92A 1WW5A 4P9JA 4XUNA 5CVRA 3A4UA 3VD9A 2R073 5GLVA 3PJQA 5F3EA 2X05A 4DUXA 2XG3A 4RS5C 3WNKA 4COZA 3J7NA 4OHVA 2IXJA 1W9WA 4AFMA 3B5LB 1UX7A 2CGPA 1RJ7A 3MHZA 1GANA 5G05L 2E33A 3J8F3 1SDWA 2O14A 1UU5A 3MF9A 4WBBA 1KJRA 2Q4SA 3VV1A 3OEBA 3MLJA 1DIWA 3U07A 3N7JA 5CG8A 1FATA 4DXTA 1J3QA 1CAWB 2KXLA 4OUEA 2E26A 4YG6A 1HDKA 3OCPA 5J3UA 2XLAA 4I0AA 4CXWA 5EV7A 4P5HA 2PYTA 3JBG1 5FZFA 4XQDA 1YFUA 4LO7A 1FX5A 3HBZA 2D7FA 1JHJA 2G9ZA 5CFCA 4GQ7A 1PZ9A 3ZXLA 1RUF2 1YQ6A 2ZABA 3DUIA 5FQ0B 1RINA 1V00A 3W21A 4C0HA 4S2GA 4PI2A 1LOAA 4QM9A 2OYZA 3FHAA 2VZRA 4Y1YA 4OCTA 2JG8C 4Y1UA 2DVGA 3O14A 3EB7A 2XBO3 2XVGA 1YHFA 3LQCA 1C5HA 3SH4A 4DB5A 5JZGA 1BJQA 5CB7A 1TNRA 2VZQA 2JD9A 3FE5A 3HNMA 3T1MA 3N9QA 2ZZQA 1HV1A 1ND2C 2E51A 4ASMB 5KHKA 3B93A 3USSA 2PAMA 1SLTA 2RM21 3I54A 4Q0QA 5SV8A 4FOYA 1XSRA 3BTYA 1HW5A 3R05A 4N53A 1LOCA 1QH7A 1ULPA 2A6XA 2LUWA 2BVVA 4M0NA 1STMA 2VTXJ 3DXTA 3ZR5A 4N53B 4I0BA 4CDQA 1EUTA 4XPVA 2DVBA 4Q8KA 4BQXA 4P9XA 1S55A 5A1LA 3KHBA 2HWB2 1DZRA 1RTVA 3BOWA 5FPZA 4EROA 1GKBA 3FZ3A 4RR3A 3VKOA 3UGHA 1PO21 1F35A 5L36A 1D4M2 2ZGUA 4QPGA 3TYJA 2HWC1 3UKTA 3PIGA 3VBUB 1L7LA 4KU8A 5J36A 3AC0A 1GSLA 3SCGA 2Y6JA 4NIDA 4G4FA 1HRV1 3IZOA 2ZX0A 3ZDVA 3S0MA 5I0UA 2GNTA 1E5IA 4LT5A 5A7OA 1F8VA 4YGEA 1PVC1 3OGVA 2VNGA 4COVA 2I45A 2G9GA 4NUBA 4RHV3 5KXBA 4GWMA 4ZS2A 2AACA 1OQDA 1OQ1A 1S0BA 4YARA 4YZ2A 1W04A 3W5NA 4OZXA 2YZ4A 3NW4A 4CU6A 5B4NA 1LNSA 5A6QA 2DURA 3ME2A 4JGYB 4AOCA 2FD8A 1W90A 1X8MA 4I2OA 1ZRIA 5I0DA 4NE9A 2KM2A 1R093 5GLWA 1FV2A 2CV6A 4EZHA 4JKLA 1VRH3 1RXFA 4YM3A 1NCRA 1HLCA 1OA2A 2WFF2 3KLSA 2VXJA 4IEXA 5LY1A 2ET1A 1S0CA 2JD4A 4K6BA 5I8YA 4AEMA 2ETEA 3VBRC 4CUBA 3W58A 4L9BA 4CCCA 5FZBA 4XTMA 2R063 3THDA 3T08A 2WS93 2R6QA 2XXZA 2BOJA 2V09A 4YGCA 2VMCA 5FY9A 5BPXA 3DPRC 4F8AA 5FZEA 2PA7A 1UYZA 2ZKLA 5JZGC 4BQ5A 5LEJA 1ND3B 1PO22 2VMEA 5DDJ1 5CFDB 4BHPA 2WR9A 4PHZA 1NA1A 4FAGA 1H8TA 2MNGA 4IGQA 4H2AA 3WF1A 1XNKA 3RZZA 3VZLA 1OQEA 3JXSA 2FDJA 4LO6B 1U5XA 4FPGA 4HETA 1PO23 3KCYA 2ARAA 4GALA 3ZDSA 5JMOA 4H7LA 1S1AA 2XVKA 2XMLA 1WCKA 5EXOA 3VDAA 4C0BA 3O1UA 2PHFA 1Y7BA 1AZDA 1YO8A 3JB4C 2WO2A 4LE4A 5AC92 1QXPA 4AVCA 2WS92 3PURA 4RD7A 2ID4A 4ZU5A 5JI7A 1VBA3 3KVAA 3MDPA 4KWUA 2WLQA 2VOXA 2VD7A 2YY1A 5EP9A 1UYYA 1D0HA 1J1TA 4MHRA 1GWLA 5KC6A 3HNYM 4HFSA 2ZEYA 1REFA 3H8UA 4XFGA 3N36A 3E97A 2A73B 3ZXEA 2Z2SB 5F7UA 1MVQA 1QJU1 3I2IA 5FIXA 3JBG2 1R091 4M01A 4SBVA 1OPOA 2IFWA 4A7KA 3TNPB 4CP0A 2WT2A 3AKRA 1VBE3 1EPWA 2BEOA 3LPFA 2DTYA 2RR12 4MGKE 1ENRA 1V6JA 2P3YA 3AKTA 2VQUA 3ZN5A 1AR61 1CAWA 2RS32 4RR3B 2PN5A 3ENRA 5FXXA 5BNOA 1NAEA 2ZHKA 1OURA 1Q5OA 4P08A 4R4ZA 1SBDA 3WP3A 1BVP1 3OYWA 1ZBE2 1JI6A 3ZSMA 1ZBE1 3IAQA 3OEAA 4QDRA 2Z79A 1JYNA 1WGPA 2YBKA 2BDRA 1WCQA 2FZ1A 3H0OA 4P5YA 4K1ZA 5JOXA 3AVSA 3W9AA 1JYCA 3PU3A 3NKGA 3NV3A 5LY2A 4E2SA 3PNAA 4BIFA 4N9HA 3WP6A 2WZ8A 3ASIA 3ACLA 3ZFEB 4JTNA 3B69A 5IVYA 4BQ3A 3B02A 4Y4RA 5IYYA 3I49A 1PGL1 1ZZCA 1QJU2 4JHTA 4E9KA 5JSOA 5J37A 4CCMA 3VHNA 1ZRCA 2UWAA 2YB7A 3L2HA 1BZWA 5EZWA 1QWRA 3PUSA 3APBA 3IPVB 2XJQA 3I2DA 5F32A 1NUKA 1DFQA 3DCQA 2X53S 2IWGB 1AR91 1O91A 4NHYA 5FDBA 4NO4A 4FP3A 1W9YA 1W6PB 4KWLA 3UL2A 4AFDA 3TEYA 2R042 2B45X 3UJOA 5F5IA 4IEVA 4N53C 2RE9A 3SITA 3H8XA 2PTMA 4JQRA 4ZXKA 3JQWA 1JS9A 1GOGA 2DU1A 3LOIA 1SLIA 4A3ZA 3H1WA 4WM7B 1H0BA 1UY3A 1DLCA 3DYPA 4ATEA 1RXGA 4W6WA 2AC1A 4NPRA 2NMOA 2R072 4QDSA 4TLGA 4UFHA 5FMOL 5L73A 3RJ2X 3SKVA 1G9FA 4M3CB 1JZ4A 3T1LA 5I0SA 1RUI1 5LCWL 3N9NA 3WZ1A 4FFGA 2RS33 4IE7A 4JQTA 5K8SA 4EN6B 1BBT3 1GZTA 1B35A 2DUPA 3C7EA 1OVSA 2JXAA 2X29A 3O1OA 4N43A 1RUG2 3JD71 4I3PA 5B4XA 5IVCA 3VBHC 5FP9A 2H0BA 3NSTA 4PCRA 4LHKA 4A44A 4IE4A 4DQAA 1SZBA 2XONA 2YDEA 3H1MA 4C1WA 1OH3A 2YC2A 5FTTC 4QMAA 2CSGA 3OGSA 3IDBB 4PJYA 3I3EA 1JOPA 1MZ5A 1OPMA 2XWJB 3I3MA 2JKXA 4G9SB 4O7XA 3LFIA 3MFCA 1OA3A 2P2KA 2WFF1 4META 4NR1A 4CUCA 2HKXA 1LRHA 3GBGA 2DV9A 4KGQA 3MGUA 4UFLA 3KV4A 2XR4A 2QQMA 5JAXA 1D2SA 4XABA 5IVEA 2WT1A 2DVAA 4JKKA 2K9ZA 5IUQA 5JI9A 3BGAA 1I1EA 1VE0A 4S2FA 3D4KA 5FP8A 2Y26A 3ACFA 5BUVA 2BZDA 4QPIA 2PHRA 3AYDA 2VCCA 5FYMA 4XFFA 3LIHA 1W8WA 3I2FA 3HWJA 3HQUA 5KHHA 1C8M3 2ZTNA 4AI8A 5FUNA 5FZDA 3WUDA 1RUE2 5BNOB 3MLLA 1SQ4A 1TME3 3UYJA 3WQBA 3H3UA 4C8DA 3AMQA 3O0XA 4KWJA 4M3CF 1VBC1 5FLHA 4E4DX 3KZ4C 4LBLA 4IEOA 1RUC2 2VNOA 1PVC3 4JZRA 4QX8A 5F9TA 3C7FA 3NAPC 5FPLA 3AK0A 3BPZA 4GKXA 4K9SA 1YWKA 3LA7A 3OUHA 4KI5M 3IM0A 2Z5WA 1BMV1 1JOBA 4I3GA 1BK0A 2QQKA 2A6VA 4YM1A 5FLIA 2RJLA 4EWDA 4PQQA 2GC1A 1D4VB 1W2OA 4IEZA 4HPKB 1AUYA 4J1WA 1H1AA 4FAHA 4P9WA 4YPJA 4FPCA 2RM22 1Q8SA 4XF1A 3HT2A 3WVJA 2R16A 2WFPA 1HV0A 4QHZA 4XF9A 2Y6GA 5C70A 3ACGA 1NY72 4OUMA 5F5AA 3DN7A 1SCSA 1W03A 2H6CA 4W6YA 3KV5A 4EQVA 4EN7B 3MIBA 2XHNA 4F7ZA 5FPXA 2WZEA 5JSPA 2FMYA 1VBB3 2WWJA 1BCXA 2XOMA 3H3ZA 2QQVA 1OXCA 4QHOA 1Q3EA 1Z7S3 4FSJA 1AXZA 4OYUA 2CWMA 4JDMA 3VZMA 1QIQA 1RMU3 1YQCA 1TME1 1PX3A 3ZPYA 1WW4A 2QUOA 4HXCA 1HQWA 1GNHA 3MPPG 1DDLA 1UO9A 1PZ7A 5FUPA 2FDKA 3ZFGC 1J58A 1FYUA 2HJIA 1WW7A 2RHPA 1D4M3 4NMIA 1RMU2 3A21A 4K20A 1IS5A 3CKHA 3KCXA 2E53A 1JN2P 3GXUA 3KD4A 5CYYA 4NRMA 3AYEA 3AP9A 4AQ6A 2BPA2 3J9SA 4ISQA 3H50A 1GZ9A 4LEJA 3KHCA 3WX5A 1YNAA 4NHXA 5AC93 4LHNA 4Y22B 2RS53 3LF7A 4V2VA 1MQTA 4P14A 2XUEA 4Q1RA 3U11A 1DGWX 4R9AA 4DFSA 2IXLA 1REDA 4N7IA 1S0JA 3GZUC 2I07B 1O7FA 3MI8A 4QKBA 3NL1A 1Y9QA 1Y43B 2RMU1 3V56A 2RMU2 1CX1A 1WZXA 2CNAA 2VU9A 3KT1A 3PU8A 4KQ7A 1MEC1 3NAPA 3PUQA 4YW5A 4JGZC 2HWC3 4M4RA 1EAH3 2HWD3 1NYWA 1W2TA 4D7YA 4WZFA 3KM5A 4IGOA 2R49A 4BQ2A 5FPUA 4HZFA 3PJYA 2DYCA 2WNVC 4UFIA 5LRRA 1W0NA 2XUMA 5L9RA 2B7YA 1OF3A 2PELA 1VRBA 1FAYA 2VMIA 3MIGA 4QX2A 4XJ9A 3INAA 2R043 1U5IA 1OLRA 4OHYA 1JUIA 3K51A 3S5QA 1OI6A 4MADA 4AVVA 1GV9A 1J59A 3N4MA 1BKZA 1XE0A 1CJDA 4JKMA 1RMU1 1ZZBA 2OZJA 1C4RA 2C4XA 5FR3A 5JOZA 1YIFA 1ND2A 2WJSA 3ATGA 4YVSB 1NCQC 2MEV3 5A33B 1PK6A 3MUY1 3BVCA 1UY2A 5LBFA 4QD2A 3BOPA 2DF7A 2P37A 1NQDA 1XU2A 3ABZA 3SEPA 5ACA3 3QLQA 2ZAHA 4F3JA 4QPYA 2SBAA 5J48A 1YRZA 4XIKA 1EUUA 1DP0A 2VQAA 5BNQA 4R8HA 4YW6A 1LJ7A 1EV11 1QQP1 2EXIA 2X5IC 2EVXA 4UW3A 4Z1VA 1BBT1 1HIXA 3BPSA 4LUKA 3T30A 4BIOA 4OMCA 4AQTA 2WWUA 3SC7X 1V6KA 3K3OA 4OMDA 1RC6A 2YBPA 3LDRA 2GC0A 2EXJA 3NMBA 4DOUA 4QAWA 3E5XA 4XJAA 5A1AA 5DAWA 2W52A 2R0FA 1HXS1 4XTPA 5H9SA 2TUNA 5E16A 2JDHA 3N7KA 4E8DA 4Y1VA 1QDCA 1V9U1 1RUD1 2J1AA 3J4UH 5ANQA 1BMV2 1OBNA 1ZBA1 2RDRA 3R0RA 4XETA 1C8M1 2Z42A 2QZ2A 3ELNA 5C3QA 2VMHA 1SACA 5D8AA 1POV0 3I3BA 4ITCA 5HCBA 4QQHA 3C7GA 3FBMA 3I59B 3WDXA 4PF1A 4Q1PA 2E31A 1PGW2 2CU5A 5A6ZA 1RYYA 5JSRA 3I59A 2GH8A 3ZXDA 3P6BA 1OFNA 2YU1A 2ZGNA 3FFQA 4P9IA 3TN91 5JZGB 3SXWA 5BYNA 1W9SA 1LGCA 1MR5A 3ZMNA 2VVDA 5APAA 3O1VA 3U37A 1CONA 2ZEXA 3WDUA 4OI0A 3IDEA 3N9MA 4QQOA 2W94A 1AX0A 3S30A 2GALA 1W8NA 3FHIB 3CIHA 3SCHA 4L8QA 1W2UA 5F2WA 1VBC3 4IEWA 5C4WB 2VPVA 1TMF3 4JTOA 2BNNA 1COV3 3LD8A 1MZEA 1ODNA 2A6YA 4Q5OA 5T5LA 1QY4A 3HPNA 4XQWA 1OSGA 2P6HA 3EHKA 1CPNA 4MYEA 2IUWA 2WA3A 1OKOA 4QXHA 4NVPA 4R9CA 1S0DA 1QQP3 3WXPA 3VBRB 5L19A 3I4IA 1OA4A 4CDXB 2PAKA 2ZMLA 1NLQA 1SPPA 3MYXA 1LEMA 2E6VA 4JVAA 4YVWC 1AL21 5D2AA 4CCLA 3FMGA 1SCRA 2JE8A 1O5LA 4JAAA 5CIRA 2DTWA 5JPNB 4NWWA 5FYBA 1N47A 1RUG1 1BEV1 3VB9A 4ASKA 3NO8A 1POV3 4M0HA 3AYCA 3GYDA 4LORA 2NP0A 3DKQA 4FPKA 3LEKA 4FP2A 1LOGA 4YSFA 4MSVA 2J1VA 4XUPA 2A7AA 4FOWA 1W9TA 4UWDA 4YW3A 4AAPA 4JRLA 5HPOA 5K0UB 4AGVA 4XF3A 4EN9B 2IXHA 2EA7A 3H3LA 1W0OA 1FOD1 1UPIA 1ZA4A 3E6BA 1NA1B 4Z82A 2G9FA 4IE0A 4ARXA 4L0PA 2QDNA 1Y4WA 3GF6A 5EJZB 4UXAA 1DQ4A 1GQHA 2WZR3 4QWNA 1R64A 3LWCA 3RYPA 4D6RA 4Z2WA 5FBJA 5G04L 3WDVA 1MEC3 4X6QB 4FPYA 1UY0A 5J1XA 4JV4A 1XNTA 4OZOA 3HMYA 2ZKNA 3OJBA 1X50A 1ENXA 4YM0A 5K0UA 1ZRDA 1J83A 1H4HA 4LLFA 3O0WA 3WDTA 1NLSA 2FBEA 1UZZA 2R0HA 1D0GA 3OSDA 4XFBA 3HN3A 3W59A 4FQZA 4AR2A 1CVNA 4YWAA 3P1IA 4QQ2A 2OKXA 3O5SA 4IL7A 2C1FA 5FP4A 1QXRA 2QQOA 2VC9A 1ENQA 5DPNA 4KWKA 2PHDA 4ZZ8A 2ZGKA 2K2SA 3O1SA 1EYBA 1H2MA 1PIV1 3SKJE 1AL23 4DEVA 3RYKA 2WYSA 2WN3A 3R4DB 3HQRA 4NROA 1URXA 5C8WA 4ORFA 3V0BA 3MLKA 2FDFA 1UPSA 4GD4A 4IESA 3URFA 1FMD3 4B4RA 4WVWA 1IS4A 1WCUA 3MICA 2JE9A 3BB6A 2A6WA 1DZQA 1YFWA 2MPFA 3MW3A 4UYBA 4WM8A 5DUUA 2GN3A 3RRDA 3J8F1 2VXRA 2IXKA 4BH9A 1XQNA 1Z7S1 2B9VA 3CLPA 2WINB 3WW4A 4Q4W2 3SEEA 1F4HA 4B7KA 1TME2 2RMU3 4BQWA 4FPHA 4D6QA 2GNBA 3VDDC 1GP6A 1W39A 3AZXA 2QQJA 4UW6A 3T09A 2VUDA 3FL7A 2LS6A 3UKVA 1GU3A 4QPIB 3ZSLA 2YC0A 4AQSA 3FLRA 4B7EA 3D82A 1I3HA 3NKTA 1GOFA 1LHUA 1Y9MA 4PIXA 4Q4V3 5DXDA 4B4PA 2HYKA 3TN93 4H3WA 2KA3A 2WN2A 1CIYA 4GH4B 1RJ8A 4XCAA 3MFAA 3VD5A 4XURA 2HWF1 4XUTA 3AP5A 5KR7A 5FPAA 2NZ9A 2J42A 3B3QE 4IV3A 4CPBD 5FYZA 1D7PM 4UF0B 3K3NA 3K46A 1KITA 4Z07A 5A7NA 1C1FA 2A70A 2D98A 2ZGOA 4S2DA 4D94A 2ZHMA 1X9TA 4HT1T 4YVWB 2ZX1A 1UOJA 4Q4W3 1UZYA 3WW3A 2XWBB 5D8AC 2YYOA 5LA0A 3N35A 1W6NA 1A8MA 4LKSA 4CE8A 2IXIA 2P34A 5K4LA 4V1PA 3NRUA 3VDBA 3ZXFA 2WNEA 3ETPA 3IMMA 3SH3A 3OB8A 1OFSA 1SLAA 2YBSA 1Z7S2 4WVZA 4YYOA 1FMD2 1HQNA 3RS6A 4I01A 1E5HA 3WLUA 4BU2A 2X09A 3EMRA 1IZ3A 4MGYE 1ACCA 4ISRA 4CU8A 1UWWA 1OKQA 3ST7A 2B42B 1HB3A 1N1YA 3H8RA 1K45A 1LOEA 3LOBA 4FQ4A 4XAAA 3AXEA 5A7QA 3WG4A 4DY5A 1ZRRA 1H30A 1RUF3 2FMDA 2RVAA 3KB5A 4Q4Y3 1NCRC 4URAA 2UWCA 1PIV2 4QT6A 4ZKTB 1LHNA 3T0BA 4D69A 4Y33A 2UU8A 4COYA 2JKBA 2B9UA 5FKCA 3ZMOA 2VH9A 3VBRA 1DHKB 4GH4C 4GKYA 2PAEA 2CL2A 5IJRA 3WNNA 5C3RA 2PQSA 4QX3A 1WUVA 4ARYA 1MS0A 3DYMA 1HJFA 4IERA 1IOAA 3ETQA 1KFUL 2YV8A 4YM2A 2QJVA 3NV1A 5A80A 1MQTC 2K46A 4W6XA 5KWRA 1G9DA 4FFFA 1MACA 1PMJX 2UWBA 4YW1A 1S0IA 3M3IA 3BIEA 2XQRA 3PIJA 4E4SA 2IC1A 3PUHA 3FUQA 2Z69A 2XJRA 4L11A 1CAVB 5HV0A 4IEQA 3O1PA 1VAVA 3C7OA 2DUOA 2HWC2 5DAPA 1Q43A 2X5IA 4N9IA 4Z92B 2HYXA 2GN7A 4CEYC 5FREA 2EIBA 3NAPB 4O9GA 4CDQC 2HWB1 4LA2A 4IV1C 3POIA 1T2XA 4ZXEA 1MPXA 3O1RA 4MV2A 1OD5A 4LJHA 4YZ3A 1JODA 4QDQA 5KBFA 5JXHA 4XZUG 5BXXA 1SEFA 1UXZA 2W3JA 1U5ZA 2AR6A 1FOD2 1WBLA 2YPJA 3MEPA 1WLCA 1UZ0A 1BEV3 4DO0A 4MOAA 1JZ3A 4CXYA 1HRI2 4CDWA 4RA0A 4I09A 3J7LA 4MXWA 4PDWA 3POWA 1ZZ6A 1WD4A 3B9IA 4INDA 1AR92 1YI7A 3OY8B 3OG2A 4MX3A 1JZ5A 1ULCA 1XU1A 1XYPA 1MS5A 2Y64A 4Q2FA 2CHHA 4RSUA 4EJRA 3J26N 4EV0A 1QGLA 3MIEA 3MV01 4O61A 2CAVA 4DRRA 3TNQA 1NE6A 4FPOB 3ES4A 2W91A 2JDYA 4Y5TA 4NAMA 5LZ6A 4UW5A 4L99A 2XPJA 1TMF2 4P9YA 5J7MA 2OPKA 3ZSKA 2B5HA 2XJVA 1UX6A 5T54A 2W92A 2FDGA 1G8WA 3FLPA 5CZKA 4RS5A 3ILRA 1AR72 1GP5A 1LOBA 1RUJ3 4LOSA 4QU2A 5E8AA 3VBSC 3TEWA 1DU3D 4JGZA 2VZSA 5T5PA 3L2YA 1QEXA 1CQ9A 3GJBA 3LKJA 4YG0A 4OI2A 3DPRA 5FAXA 1CJPA 2VZTA 2QFEA 3KT4A 3CZJA 4LIVA 2K0GA 3DPRB 3RYRA 1ODMA 3P5BA 1C1LA 2C9KA 2W39A 1XNBA 1ZZ8A 4E4HA 4OI1A 4E8CA 5ABJC 1X36A 3N3HA 1PK6C 3BU7A 1US3A 1LB2A 1ULFA 2ARCA 3HJRA 4YG3A 5FZ1A 1JUHA 1R092 1AXYA 3D6EA 2XDVA 1LAJA 4QU1A 2ZGLA 2A3XA 4QGMA 3VBFA 2Y33A 1Q8PA 4IGPA 5JOYA 2BVBA 1LKNA 3N9OA 4JGZB 1H6XA 2P3IA 4NN0A 4Q8LA 2R7EB 4LLOA 1IKPA 5IK8A 1IS6A 1C8M2 4K40A 1FI2A 2ZJCA 4YLZA 5LBBA 4D8MA 3VZNA 1LTEA 3M2MA 4XEZA 4HN1A 2I2SA 1OOPC 1WMXA 1RUD2 2R061 4DS0A 2XJSA 4ASLA 3M3QA 5JIAA 1KXGA 2QZ3A 4WM7A 5A32B 3ZSEA 1ZREA 5AC91 2Y6FA 4LUMA 3WDWA 2VMDA 3TB0A 3BCWA 3JZVA 4LBKA 2RS13 3JD73 5GLUA 3FC0A 5FQ0A 4BJ0A 3A7QA 5DZEA 2D6MA 5T55A 5JXGA 3O1TA 4IEYA 3VBOC 2ZGPA 4JGYC 5GM0A 1EPZA 4CTEA 1XYOA 1MS8A 2A3YA 1DG6A 3D0JA 1O4YA 4FPEA 1EV12 4QPGC 4UBHA 4OI4A 5F6LB 4AFCA 1HKDA 5AFEA 3E5UA 5FWEA 4B1LA 3B94A 5F37A 1NKGA 3I2KA 3AJYA 2VTXA 3ZKUA 5FZ7A 1QNWA 2WUHA 3A0KA 3BALA 3VD4A 1W6MA 2VUJA 1XBFA 3M4FA 3NJVA 4Q4W1 3SMHA 3VKNA 1TE1B 3AZVA 3U0ZA 1RUG3 4RFRB 5FXVA 2VULA 2QKDA 2VVEA 2AUYA 3CQOA 1RVF3 1NG0A 5I8SA 4Q4V2 3ZYIB 4EN8B 5FZIA 1ALYA 4HSLA 3LEMA 3WR0A 4CCOA 1DYKA 3RWNA 2BOIA 5F1RA 1CPMA 1HB2A 1FPN2 1HQLA 5BNNB 5JDBA 4RQPA 2WC2A 2JECA 4O65A 4BK4A 4B29A 3LE0A 1PMIA 5C4WC 1LECA 2F4LA 3P3NA 1S0EA 5I91A 4Q4X2 4M3CA 1VPHA 3ZFEC 2GC3A 2AEYA 4TN7A 1JTZX 1TNFA 3TWIA 3GDBA 4LIUA 2ZX3A 3D3AA 3ZFFC 5CG9A 3WP5A 4CU9A 1F5JA 4UFMA 2GU9A 1MS9A 4XCBA 3WNOA 2E63A 1ST8A 2VW0A 4AI9A 1QOOA 2ZZJA 4NWVA 5BNPA 2VZOA 1PVC2 2RJKA 1SFYA 2W68A 1BLZA 3GCXA 4R9BA 3ZVXA 5EPAA 4RR3C 5DG2A 1GUIA 3FUOA 3X29B 3AKPA 2GSYA 3IIIA 3WG1A 1A78A 1A6CA 1IQDC 3WF0A 1Z0HA 4Q0UA 2E7AA 5T52A 2WRAA 1D4M1 1OUSA 3MUZ1 4RS5B 3K75B 4QQPA 2BBVA 2QQWA 5FYSA 2F17A 3B01A 4G3YC 4FVVA 1NZIA 2VOKA 4AI3A 2GMPA 3IIAA 4LULA 4BA6A 4HANA 2VZUA 3RJRA 4B3NA 2E7QA 4QM8A 1DGLA 2JG8A 2ZACA 4XXPA 3LFMA 2W95A 5IVVA 1UY1A 2W1WA 2HWD1 4KNCA 3OY8A 2BWAA 4XDPA 2QDRA 2WNOA 4XJZA 2OXBA 1QJY1 1AR93 3CO2A 3CZUA 4XW3A 4W8JA 5GJ6A 3ZKYA 5LW9A 2HBTA 5AFBA 3ZYFA 5LRSA 4MGTA 3AFGA 1C3HA 1HRI3 1UOFA 3D0SA 1BVVA 2WZPP 3SQOA 3WP4A 1KDMA 1QXJA 2JE7A 5CFCB 5EQUA 1X7NA 3JBG3 1BEV2 3NWKA 4CDUC 3RWKX 4DEQA 2LTNA 1WLTA 1SLBA 5EJ3A 1E5SA 3SH5A 4MUVA 4QXKA 4BDVB 4MO3M 1SFPA 1OH4A 4U2AA 3WNLA 5I8TA 2AH2A 5A32A 1DZTA 1IQAA 2EXHA 2IVJA 1DQ5A 3PVNA 4FPLA 4JX0A 4Y26A 4FO9A 3VDCA 5HCHA 1COV1 3PL0A 3NJXA 1VBA2 4IEPA 4KG8A 1WCSA 3WCRA 3WT3A 5FJHA 5CKMA 4DRVA 3THTA 2W1SA 4MLOA 4XXAA 2VOVA 4YW2A 2JDAA 3MO4A 2A3WA 1E57A 2VR4A 1GQGA 4BYYA 2NLRA 4NIHA 5FMDA 4AFBA 4LK7A 5T50A 5GZCA 5FYHA 4FFHA 2OX0A 1QH6A 2XJTA 3KQ4B 4TWTA 1KDKA 5H9RA 3T2OA 3WG3A 3ZXGA 3N7MA 3EBRA 4Q26A 3VHPA 1AX1A 4E4ZA 1W6OB 4UOJA 4Q4X3 5A3MA 2KR2A 4NAOA 3SCFA 2ZA9A 1W06A 3PTRB 1OHFA 1Q8VA 4EYUA 1AYM3 3RFRA 3BU0A 4AGRA 2Q1FA 3HD8B 4LBQB 4AEDB 1AR82 4AG4A 3DF0A 1JZ2A 1RUH2 2GMMA 2ZGSA 3CBNA 5E88A 1JU4A 3GJAA 4AYUA 3AP4A 4LHSA 3AL6A 4HG6B 4B8EA 4CP9A 1V9U2 3Q8EA 4HMZA 1RVF2 3WEZA 4BXSV 2JENA 2UY8A 1HXS2 1IS3A 2ZXQA 4Y22A 3I3DA 5J09A 1WKYA 5KXDA 4ATFA 2YUEA 1FPN1 5CBLA 2RDNA 2HEVF 2QTWB 2ZS6B 3U78A 3KQRA 5C3OA 2VW1A 2P1BA 4NPMA 1EV13 1H9PA 2D5FA 5CA6A 3NNLA 4NIAA 3WINE 1AYN1 3QD6A 4U36A 1BBT2 4AEJA 4KH9A 4N43C 4HN0A 1XOYA 3IB3A 4CCKA 2ARBA 4ZHNA 2AYHA 5E1RA 2IVIB 4NHMA 1JH5A 2WAOA 4GWIA 5BY5A 1SBEA 2VY0A 5DUWA 1QHDA 3W20A 3WDYA 4UBGA 4LO4B 2JDUA 1PO11 1XRUA 4LO8A 1GZWA 2EIEA 1WCDJ 1DQ6A 2J22A 3A23A 3C7HA 4ZS3A 4CEYA 1O8SA 1RUD3 4J6GA 4NHKA 5BNNC 2R071 1HXS3 2WT0A 2VAUA 4OLLA 4GWJA 2PHWA 5KXCA 2BQPA 1CAXB 2HWB3 2XBO2 3ROUA 2NMNA 1NCRB 1BXHA 5A7PA 3UV9A 4Y5SA 2O8QA 4RL7A 2FQPA 3I8TA 4Q29A 1S2EA 2A5ZA 3C8XA 4UI9L 1GLHA 2RDSA 2R041 2D40A 4M3CE 1QOTA 1SMVA 2W2IA 3E1F1 3GBFA 5F39A 4QX5A 2YROA 4AHZA 4W50A 1W3XA 1C57A 4EZ4A 1AXKA 1QJU3 2DCJA 1HJGA 1WMDA 2C0ZA 1ND2B 2IXCA 4WZCA 3EQEA 4XBNA 4NPLA 2GAUA 1V9U3 2DDUA 3TAYA 3ZYBA 2Q8DA 3OUIA 5A3NA 1VB2A 1OUXA 4RYDA 5DDJ3 1PGL2 3J8F2 5TSWA 3VBFC 4BQ4A 3KWVA 1J1LA 4QQLA 2ZHLA 1OD3A 2VECA 1VBD1 4P02B 2BGPA 1VMJA 5D21A 5IVJA 4COUA 2HLEA 1ASJ2 2OW4A 5A3OA 4E27A 2NQYA 1I5PA 2WIIB 2EXKA 3H9AA 1AYN3 2WO1A 4YZ4A 2JIJA 5DABA 1H1IA 5J98B 1AR71 4OVEA 3ZXAC 1X82A 2VZPA 4FTSA 1LHVA 4QXBA 5FZOB 3POGA 1F2NA 4Z2AA 4LBNA 5I0TA 1V0AA 3ZYHA 2ES3A 5F6KA 2W87A 3HEIA 1ZVFA 2BJSA 2WAAA 4KBZA 2Y6HA 4GXLA 5HCAA 3WUCA 3UGFA 2DUQA 3NNJA 1GMMA 2YFUA 3OUJA 5FLJA 1SLLA 1G86A 1G9AA 5FZHA 3DECA 3IN9A 4B1MA 3T0AA 4CSWA 3WD5A 2UURA 1AJOA 1G9BA 1PNGA 4XILA 1S2BA 4MZUA 4GJYA 1CZSA 1KJLA 4LBQA 4MGSA 1FNYA 4NOTA 5FKBA 1HB1A 2WL1A 1K5MA 5HI0A 2JB4A 1PZ8A 2OQ6A 1VAKA 3EYPA 3RMYA 5DG1A 4QGLA 5EIYB 5ACA1 2DCZA 2CDOA 2LM3A 1AX2A 3GZEA 1UY4A 4UAPA 4WM7C 1GZCA 1VALA 1CAUB 4LA3A 5FMCA 2XKOA 3VBUA 1AVBA 3ZFGB 4XACA 3AVRA 5FO8B 2WA4A 1GNZA 1UCXA 3S7IA 1N3PA 4RGAA 3AP7A 3VBOA 4EN0A 5F3CA 5JCTA 5IAVA 1QJY3 5IFTA 2CWSA 3OPWA 4HKLA 3V64A 1UD1A 4P9GA 4CEYB 4AEDA 3VBSA 1ZZ9A 5JXIA 2YXSA 2J1UA 3VL8A 5DZFA 2GNDA 5LATA 1UKRA 1YLLA 1VBC2 1SG3A 1VBB1 4AQ2A 4LOTA 4WV8A 1JZ8A 3VGIA 4HKWA 4CU7A 1H1MA 1US2A 4YNIA 1H2KA 5FCCA 5LASA 4QB1A 2YPDA 4TSVA 3UK9A 5KC5A 5L7OB 3UNPA 2B8MA 1PIV3 2CY6A 2JWPA 3MF6A 4GMP3 4HKOA 4XHBA 4YFWA 4H55A 3I2GA 4K1YA 3PTYA 5FY7A 3ZXJA 2ADDA 1H6YA 1RVF1 3CHXA 4AXOA 4TTGA 4K3UA 5A70A 1S0FA 1FPN3 3AP6A 3B00A 1RUE3 5LK7B 3TEXA 1XNAA 4P00B 3O7OA 5FZLA 4RQPB 3IMNA 2BP6A 4D7SA 1RUH1 5C3PA 2ZMKA 1MZ6A 5HV4A 1AR81 2NPIA 4AWDA 4CVUA 2D6NA 3ZPOA 2ZHNA 2ATFA 4XFIA 4BISA 3PVEA 3WNXA 4TLFA 1GICA 3KF5A 5BNOC 1VAMA 3BTXA 3V65A 4I02A 2G4IA 2E9QA 1PK6B 4JDOA 1KGYA 1LESA 5GLTA 1FMD1 5AVAA 5C9AA 3FN9A 1XJAA 4IV3C 4BLIA 4LPLA 1TG7A 2FCVA 2DFBA 5A6XA 2P6CA 1XNDA 4DPNA 2UY9A 4DUWA 1XXNA 1SLCA 1ZBA2 2ZAAA 3V0BB 1YEWA 2VZVA 4AF9A 3UT0A 3DXUA 3AB0A 2HH9A 4PF5A 1RUI2 4A6OA 1N1SA 1RHI3 1LR5A 3ACHA 3C2UA 5H9PA 1L7QA 1MVEA 3V0AB 2QCSB 1VBA1 2FCTA 4GAZA 1A3KA 2P3JA 2DWRA 5GZDA 4CEWA 2X10A 5IK4A 3M70A 3OGGA 3DV8A 5JR2A 2V4AA 3ZYGA 5ACA2 1F15A 5B2GB 4AEDC 2GC2A 4WM8B 2O8OA 1RITA 4HBNA 4FTEA 1WWYA 2YGMA 1IGOA 2JJ6A 5IVFA 2DCTA 2MEV2 1CD3G 4Y24A 5EYYA 5JVVA 1OVPA 3MW2A 1ZYBA 2J1TA 3LIGA 1A8DA 5D8AB 5F5CA 3VBFB 3MIHA 2QNKA 3SISA 4AVBA 2HBUA 4QGNA 3QBQA 2VQ0A 2TBVA 5FZ0A 1DYPA 3Q9OA 1W6OA 3CDZB 3AZWA 1ULGA 2PXJA 1EP0A 2XB6C 5JLVA 1NT0A 4GB32 4LR4A 3I97A 2WNUC 1WMFA 3Q8FA 3THPA 1AR83 1NQJA 3VZOA 3LEIA 1OT5A 2GH2A 2X8KA 1UU4A 3NNMA 4HVQA 3GNEA 2D3SA 2RS51 1HN0A 1NE4A 5DAVA 2JDPA 3JB8A 1FT9A 4L97A 1OLME 1QJEA 2OQ7A 2DCKA 4AHWA 4Y1ZA 4LBOA 3NJZA 2WWSA 2O1QA 3IDAA 5CEHA 3DKWA 4IE6A 2D6OX 3H8OA 4J25A 1WA6X 2Z4FA 2J1RA 3PMSA 4X6RB 2FDHA 3OGRA 1WW6A 3HIFA 2G1MA 2Y6LA 3RPQA 1ASJ1 1R1A3 2RS31 3FBYA 4CCNA 1AR62 4ZZ5A 5C6CA 3ZFFB 3RZLA 1MEC2 1QJFA 2P4EA 3HNBM 3BN6A 3CJIA 5DAQA 2Q1ZB 3KF3A 3IT8A 3KV6A 2NM1A 1SPPB 3R4SA 3PUIA 1VLNA 2OA2A 3MZHA 1K5MB 1PM4A 5A7WA 4JRAA 3QCWA 3EJKA 3POJA 5IVBA 4Q27A 3HT1A 2SLIA 1WA4A 3VLBB 2WQZC 4RFT0 3JCIA 1S2KA 3PVBB 4FOQA 3DYOA 1YI9A 3LEGA 5IK7A 3H42B 4H14A 4UFKA 5FO7B 5DMYA 4QPGB 5FY8A 1CESA 4QXCA 1W6QB 5JR7B 3ZOIA 3FJSA 3OBAA 1DQ0A 2GMEA 2OZ6A 2PHLA 4C90A 4AFAA 1WD3A 2DVDA 3KCCA 2ARXA 1UNBA 3T2QA 2WZR2 3R4UA 5GZFA 4D7TA 4Q4V1 3MW4A 1ZZ7A 5H9QA 3VBSB 3BODA 3ZFGA 1LOFC 1UAIA 2VOTA 3ILFA 3HN1A 3JUUA 1LULA 5FY5A 3M3CA 1X9PA 3ZYJB 1AHSA 3NJYA 5LEKA 2RM23 2Y0OA 1YYNA 3T4HB 1X8EA 3VKMA 5LA1A 1CAVA 2LROA 1O3QA 5E89A 4BQ1A 4HLTA 3FLTA 3VD3A 2D5HA 4DZGA 1TEIA 4A7ZA 1NY71 2ZGMA 1AYN2 3LPGA 1YQ2A 3IAPA 2VMFA 3A22A 3K4AA 4QX1A 5ERLA 3RVHA 3TRSB 3WCSA 1ASJ3 1CZVA 1R1A1 4Y5Z0 5L9BA 1XYNA 3MIFA 3P3PA 2GP3A 5FK7A 2WO7A 2R062 2AREA 5FBZA 2RS11 3J7HA 1XNCA 3RGBA 5A7SA 4BXFA 1ULDA 1M4WA 2LRPA 2NYYA 4KBBA 5IK5A 1OC1A 1QMJA 1SBFA 1AJKA 3VD7A 1O8PA 3ZLIA 2XH6A 1G6NA 1YFXA 2WNVB 1RUC1 3NV2A 4CUGA 2D93A 1VBD3 1F4AA 1OOPA 1KS4A 1QF3A 2O0OA 4XDOA 5FO9B 2VCAA 2JG9C 2J7MA 2ZBJA 2VO5A 5FK8A 5C9AC 3AYAA 3A0NA 3MIDA 4PLMA 3LSEA 1PGW1 2BNMA 1RHI1 2QQPA 1KQRA 1YUDA 4UT5A 1UL9A 3R6SA 5IFPA 1TVGA 3GHMA 2JICA 3VL9A 4YVSC 2BGOA 1NCQB 4XOGA 2PLV3 3U4XA 3OPZA 1YCIA 4C91A 5FZ4A 4FPFA 2VZ1A 1ND3C 4WVMB 5CFDC 3GZAA 5IT6A 3ZN6B 3QH6A 3AMNA 4LE3A 3VDDB 5BV6A 3POEA 2BW8A 1C8NA 1W9FA 3ORJA 3CL1A 1W2AX 3U10A 1B35C 1WLDA 2AZ5A 3GGLA 2EAKA 4AAXA 2Q8CA 3S5AA 5IATA 4RN5A 5M0TA 3O1MA 4LKDA 5C8CB 2RJ2A 3N9PA 2VOWA 4FCAA 4CPBA 2VTFA 1FV3A 2I74A 3O0VA 1XC6A 2ET7A 4GMP0 4XFAA 2PHUA 3WF3A 4AHYA 1POV1 4LTAA 2BWCA 2G19A 4MXVA 4OUSA 3ZIWA 2A71A 3OGJA 1IKQA 2HEYF 3OYWB 2JDNA 3J7MA 4XBLA 3B9CA 3ZYRA 1G9CA 4CXXA 3LDBA 1UIJA 4CDQB 1B09A 5LBEA 1W99A 1ENSA 1I9RA 4HOOA 1CAUA 5AVPA 4GB33 3VZKA 1XB9A 1UF2C 3E5QA 2V4VA 3RDIA 5J96B 3PMEA 4TZDA 1DLLA 2C9AA 2WO3A 3G7DA 4KU7A 4LQRA 4EWEA 1PM7A 2WZR1 4LK6A 4BK5A 2XJUA 1RUNA 3T3YA 4RGKA 1W6NB 4JDNA 5I0RA 3K2OA 1N1TA 2ORXA 1LEDA 4HONA 1GWKA 4IW3A 4LXLA 4ET7A 3RZJA 5K9YA 2Q5TA 4XHXA 5IWFA 3ZX7A 1QDOA 1LOFA 3AZYA 4IUGA 3TBDA 5HBAA 1H2LA 1K12A 2C24A 2VW2A 4V2WA 2Q30A 2DFCA 3F95A 4XZPA 3ZIXA 1LGNA 2EF6A 2W08A 4URTA 5CADA 1W0PA 2ZMNA 4XUOA 4GMP1 3PDQA 4K8RB 3WY6A 1JYIA 2C6SA 3JU9A 2XLFA 2UYAA 5FZGA 4H7MA 4OQ9A 5JUVA 4K21A 1QJX2 5FYVA 1KD7A 4QX7A 2WABA 3K4ZA 2YMZA 1V70A 1ZBA3 4KL1A 2ZPXA 5FZAA 1K3IA 3QACA 4BB3A 5LB6A 2ZGQA 1VBE2 3CEWA 1HRV3 2YHJA 4OULA 3SHRA 1JMUB 5JOWA 2YC4A 2WQ8A 2F6BA 1LHOA 3MV11 1L3JA 1BHGA 5FYCA 1NX9A 4N43B 1VP6A 4FI9A 2Q8OA 1NOVA 2DBNA 3USUA 3VBUC 3VZJA 1LHWA 1DBNA 5C5TA 5FYUA 1RB8G 2RR11 1Q56A 4PDWC 1CWPA 4NRQA 1YXWA 2R1BA 5E6HA 3Q8AA 1GYKA 1GFF2 4GB31 4W4ZA 1QOSA 3HQXA 5L9VA 1FXZA 2A6ZA 4BCUA 2HEWF 4DXSA 4XF0A 1KRIA 2VBDA 1T6BX 2QQNA 4HVRA 4XAEA 1VRH1 4MGQA 1JXNA 5CAZA 1ULEA 1W8UA 1XPWA 1FOD3 3M8LA 4NRPA 3I2HA 4PI0A 3RI8A 1K42A 1JYXA 5K7PA 5C5UA 3SLIA 1LU1A 3ZR6A 2VVFA 3AXDA 5DN2A 4OQ8A 2D3PA 5A33A 3I3QA 1JYTA 5ABJB 4CEWB 5LK5A 4ES8A 1XSQA 5EHDA 5LA9A 3U14A 5FMOS 4WVMA 2WS91 5T5JA 5C8CA 2YFZA 5FZKA 4AK3A 4CZSA 3V0AA 4NIGA 4YVWA 3AKSA 2CGOA 4N8MA 5FZCA 1NCQA 5GALA 4XYXA 5FZ9A 3RMXA 3THCA 1UMZA 2BYVE 4LKEA 5FPBA 4BPZA 1RUC3 2HWF2 4FXGB 2W1QA 3VDDA 3T4VA 2ZOEB 1V6OA 1W8FA 1EY2A 2B39A 4IQPA 2WDBA 1O59A 2FCUA 5FYYA 4X8PA 2HWE2 3NQHA 3POYA 4NHLA 4E2GA 3LA2A 4ZY9A 3LAGA 3WQ0A 4YGDA 1W28A 1O4TA 2HWF3 2AGSA 4XF4A 5FOJB 3EXUA 1RUOA 5ABJA 2EALA 3KGZA 4QKFA 1K5JA 1W8HA 2BTVC 2WFF3 2WNVA 3WG2A 2VBPA 3ZXKA 4A41A 3POSA 4IETA 4A2UA 4GH4A 5A3UA 3GCWA 4Y1XA 3VBOB 3W5MA 2IZWA 2ZEWA 1L7RA 1DGWA 5FWJA 4K7JA 1NZCA 2V73A 4GULA 5GZGA 1V6LA 3RQ0A 4A4AA 2TEPA 2Y60A 1SDDB 4QPWA 4L2NA 2J1EA 4YZ5A 4AVAA 2BRTA 1YQ5A 5A1FA 3M3EA 2F4PA 1O5UA 4RHV2 5T5OA 1W6PA 3OTFA 1UU6A 2ZGRA 1YIPA 5FY0A 1RUI3 3ITQA 3ZN6A 2RS12 2JDZA 3LDKA 2B4KA 4PIZA 4X8NA 3TOJA 4M00A 3IPVA 3KGLA 4RGGA 4XQ4A 4KG0A 1APNA 1JBCA 4ZU7A 3AKQA 2WLPA 5FYIA 3BYWA 5D1IA 2R32A 1LENA 4BQYA 1R1A2 5JXJA 4K8FA 5L7OC 2EAAA 3ALQA 1TMF1 3SNMA 1V6MA 4QKNA 3T2PA 4CYDA 3CF6E 5FP7A 4IEUA 5C33A 1UOBA 4YRDA 2JX9A 3PLQA 1YJLA 4ES9A 1VBB2 1VJ2A 3OBRA 3OD0A 2FDIA 2VL4A 2XLGA 2H6BA 2ILMA 3JD72
chains in the Genus database with same CATH topology
1GR3A 4IXLA 3VN4A 3M7AA 1BYHA 5I93A 3VKFC 1AR63 4BMBA 1PHMA 4BWOA 1CIWA 2WNUA 2XVLA 3QH7A 2OVUA 1HRI1 5SV5A 4P9LA 4DY3A 3NV4A 2A75A 2BNOA 4AE2A 4DMIA 2C5DA 3JQXA 4Y4YA 4WVVA 3EO6A 4HVOA 1U0AA 1QNYA 3LCPA 4Q0SA 2XL7A 1V6NA 4F83A 3ES1A 4AW7A 4FOVA 1RUF1 2D6PA 5JMCA 3CJIC 1B35B 2PHXA 3FX3A 2D6KA 4A7YA 2GZWA 4Y20A 4AVSA 4B4QA 3M3OA 2JG8B 1YFYA 1Q8OA 4AVTA 5JPMB 5GKAC 5JIUA 4PQ9A 1R1ZA 1AR73 2ZX4A 2TNFA 3LZZA 4MH0E 1N3OA 3RI9A 5KHGA 2D6LX 4GA9A 1D2QA 4R9DA 4YFZA 4FBFA 1WMEA 4I0WB 4E2QA 1IPKA 1CAXA 1V6IA 4WM8C 4D3WA 4FTBA 4AHXA 4AI0A 4GWNA 4O9EA 3MPBA 4CDUB 1F31A 3ILNA 3WHTA 1IPJA 2R30A 2RR13 1BK1A 4Q0VA 3OF1A 4MXWB 4PDWB 4CP2A 3LA3A 2BFUL 3ZO0B 3GBWA 1NXMA 3IWZA 3RG0A 4IV3B 3KSCA 2RS52 2XGXA 3AM2A 3USUB 3VBHB 4XJUA 1VBD2 3KMHA 5HCFA 3E6CC 4XJ8A 2BGCA 5C4WA 4Q4Y1 5EYXA 1AF9A 2NN8A 1N1VA 2PLV2 3ZFEA 1QJX3 4PBPA 4CDUA 3K48A 4CEWC 2ZX2A 2UYBA 2H0VA 1H9WA 3ZFFA 1IHMA 4HPKA 1OOPB 1AYM2 3AMPA 1EAH1 1O4ZA 2MEV1 5KHJA 2P17A 4KGGA 5BNPC 3FWEA 1QJZA 1HX6A 2WKKA 1R081 2Q0AA 3CNAA 4SLIA 1RIRA 4XE9A 4CP1A 4CDXC 3VKLA 1RUJ1 3AMHA 3VHOA 1CX4A 4QHBA 2XBO1 3G6JB 3OBTA 3I7DA 3O12A 1OMIA 1RUH3 1PO13 1O3SA 1Y3TA 4DXZA 5KXEA 2HWE3 3M1HA 1QU0A 1WLWA 4DINB 1QQP2 4IV1A 3CJXA 4OHZA 1KS5A 4PIYA 5HXVA 1EAH2 5DDJ2 1DF0A 1TQ5A 2Q1MA 1X33A 2CTVA 1UIKA 1VRH2 1XE7A 1ZRFA 1BQPA 1H8TC 2PHTA 1C5IA 3H1YA 1CR7A 2BUKA 1N3QA 4JGYA 4Q4Y2 4S2HA 5CU1A 3WW2A 3ZX7A 4YGBA 1YJKA 2VNRA 3AJZA 2QE3A 4GIQA 3VHRA 3T2TA 3WQ1A 4LHLA 1LCLA 1T6GC 3PHMA 1UN1A 5GLZA 3ZSJA 3LB9A 3GHNA 4FT8A 5BNPB 3UKNA 1J3RA 1DGRA 3C3VA 5KHIA 1GZWB 3OD4A 4YVSA 4DNYA 4HSJA 3WV6A 4PBOA 1ND3A 5CFDA 5L7OA 2WQ4A 5DZGA 3B7MA 5DUVA 1W6QA 3D5OA 4OFGA 5DUXA 4LBJA 4Z8BA 1H4GA 4CDWB 1LGBA 2DU0A 1HRV2 3AMMA 4LBQD 1LU2A 4J1XA 1NA1C 2W0XA 4HK9A 4AGGA 4BOWA 1XE8A 1WBFA 4ONUA 5BNNA 4PLOA 1DQ1A 2LALA 3CU7A 1I5ZA 1H8TB 4N7UA 4I30A 1MZFA 1O3RA 4HL0A 3WW1A 5A3LA 2VGDA 1COV2 3KS7A 2XL9A 1UW8A 3H7JA 3LSDA 3ZN4A 5GZEA 2VG9A 2JEMA 4BE3A 3E6DA 1M06G 2IFRA 3PVOA 4TYSA 2D44A 4W65A 1RL3A 2R1DA 5CFCC 4N90A 2QVSB 3BIWE 4FXKB 3IBMA 3ECQA 4AI1A 1AL22 2EIGA 2ZCWA 3DGTA 5FRAA 2N7GA 3HR9A 1PNFA 1S0GA 3S7EA 2Y38A 4R4XA 4Y20B 4CDWC 1U5YA 1QJY2 1JOJA 5C8CC 4AI2A 1ZM1A 4COWA 2HWD2 4PLNA 1O3TA 4XJWA 1PVXA 4ZU4A 2DCYA 4XIOA 3WQ7A 3VBHA 4AEKA 4RHV1 4BMEA 1I6XA 4XFCA 1GBGA 1C28A 1J3PA 1RHI2 1NXD1 1Q8QA 5CNAA 1SFNA 3FFZA 2D3RA 1FNZA 1RUE1 1RGSA 4LBMA 2MHFA 3TN92 1ZX5A 4XDQA 4Q0PA 2YGLA 3LGRA 2BFUS 1F5FA 3WOGA 5FOBB 1K5MC 2D97A 3DL3A 4JC1A 4BZ4A 2PQQA 2ERFA 2D43A 2ZGTA 1LODA 1JHNA 4XBQA 3VUOA 1ONAA 5LRSA 4FPJA 4XMAA 1Z78A 2P3KA 2V5YA 4QPIC 4Q4X1 2HWE1 4CDXA 3L9JT 5F5QA 1PGSA 4YZ1A 2CAUA 3CJIB 1H8VA 1CN1A 1MS4A 1REEA 4A3XA 2XKPA 3AFKA 3D8CA 1U12A 3ZYPA 4R52A 2GDFA 1W6MB 1G7YA 2OUHA 1JW6A 2CGNA 3N7LA 1R083 4OHWA 2GNMA 1PO12 3AZZA 1F9KA 4HK8A 1ZNPA 4IV1B 1MS1A 4RQPC 2AENA 1QKQA 2ENRA 5FFOC 2WNUB 2OUJA 3IKWA 4OHXA 5EWSA 4BM8A 2OIIA 1VR3A 2FHRA 4C1XA 2JG9B 5EFUA 1UKGA 4MGIE 3S6PA 5JWPA 3H7YA 4MGZE 2Y0IA 3GALA 1VB4A 2PFWA 2DVFA 3AX4A 1MQTB 1RUJ2 2XJPA 1CGPA 4JCKA 1ZBE3 1R082 3HAGA 4MVTA 3WHUA 2X5IB 1OLQA 2B46X 2WSUA 3BTAA 4YW4A 4XFHA 1VIWB 1AYM1 2JG9A 2WSVA 4UW4A 1VBE1 3UJQA 4CRQA 4LNVA 3IDCB 1DQ2A 1H2NA 4BLJA 2PLV1 1AL0G 1NLRA 3GZTB 1QJX1 3RNSA 2VMGA 2XHKA 3QOPA 3NVCA 4XMIA 5T3NA 5C9AB 5K0UC 4LO5B 1MS3A 2VUAA 4EWAA 1DGRN 1KFXL 3RSJA 2E7TA 3KT7A 2CYFA 4L92A 1WW5A 4P9JA 5CVRA 3A4UA 2R073 5GLVA 3PJQA 2XG3A 4RS5C 4COZA 4OHVA 2IXJA 4AFMA 3B5LB 2CGPA 1RJ7A 1GANA 3J8F3 3MF9A 1SDWA 3VV1A 1UU5A 4WBBA 1KJRA 2Q4SA 3MLJA 1DIWA 3U07A 3N7JA 5CG8A 1FATA 1J3QA 1CAWB 2KXLA 4YG6A 1HDKA 3OCPA 5J3UA 2XLAA 4I0AA 5EV7A 4P5HA 2PYTA 3JBG1 4XQDA 1YFUA 4LO7A 1FX5A 3HBZA 2D7FA 5CFCA 4GQ7A 1PZ9A 3ZXLA 1RUF2 2ZABA 3DUIA 5FQ0B 1RINA 1V00A 4C0HA 4S2GA 1LOAA 4QM9A 2OYZA 4Y1YA 2JG8C 4Y1UA 2DVGA 3O14A 2XBO3 2XVGA 1YHFA 1C5HA 3SH4A 4DB5A 5JZGA 1BJQA 5CB7A 1TNRA 3T1MA 3FE5A 2ZZQA 1HV1A 1ND2C 2E51A 4ASMB 5KHKA 3B93A 3USSA 2PAMA 1SLTA 2RM21 3I54A 4Q0QA 5SV8A 4FOYA 1HW5A 3R05A 4N53A 1LOCA 1QH7A 2A6XA 2BVVA 2LUWA 4M0NA 4N53B 4I0BA 4CDQA 4XPVA 4Q8KA 2DVBA 4P9XA 1S55A 2HWB2 1DZRA 1RTVA 3BOWA 5FPZA 4EROA 1GKBA 3FZ3A 4RR3A 1PO21 5L36A 1D4M2 2ZGUA 4QPGA 3TYJA 2HWC1 3UKTA 3VBUB 4KU8A 5J36A 1GSLA 3SCGA 4G4FA 1HRV1 2ZX0A 3S0MA 5I0UA 2GNTA 1F8VA 4LT5A 4YGEA 1PVC1 2VNGA 4COVA 2I45A 2G9GA 4RHV3 5KXBA 4GWMA 1OQDA 1OQ1A 1S0BA 4YARA 4YZ2A 4OZXA 2YZ4A 3NW4A 2DURA 3ME2A 4JGYB 4I2OA 1X8MA 2KM2A 1R093 5GLWA 1FV2A 2CV6A 1VRH3 4YM3A 1NCRA 1HLCA 1OA2A 2WFF2 3KLSA 4IEXA 2ET1A 1S0CA 2JD4A 4K6BA 5I8YA 4AEMA 2ETEA 3VBRC 3W58A 4L9BA 4XTMA 2R063 2WS93 2R6QA 2V09A 4YGCA 4F8AA 5BPXA 3DPRC 2PA7A 2ZKLA 5JZGC 5LEJA 1ND3B 1PO22 5DDJ1 5CFDB 4BHPA 1NA1A 4FAGA 1H8TA 2MNGA 1XNKA 3RZZA 3VZLA 1OQEA 4LO6B 1U5XA 4FPGA 4HETA 1PO23 3KCYA 4GALA 3ZDSA 4H7LA 1S1AA 2XVKA 5EXOA 1WCKA 4C0BA 2PHFA 1Y7BA 1AZDA 1YO8A 3JB4C 4LE4A 5AC92 1QXPA 4AVCA 2WS92 4RD7A 4ZU5A 5JI7A 1VBA3 3MDPA 2WLQA 2VOXA 2YY1A 1D0HA 1J1TA 5KC6A 4HFSA 4XFGA 1REFA 3H8UA 3N36A 3E97A 2A73B 3ZXEA 2Z2SB 1MVQA 1QJU1 3JBG2 1R091 4M01A 4SBVA 1OPOA 2IFWA 4A7KA 3TNPB 4CP0A 2WT2A 3AKRA 1VBE3 1EPWA 2BEOA 4MGKE 2DTYA 2RR12 1ENRA 1V6JA 3AKTA 3ZN5A 1AR61 1CAWA 2RS32 4RR3B 2PN5A 3ENRA 5BNOA 2ZHKA 1Q5OA 4R4ZA 1SBDA 3WP3A 1BVP1 3OYWA 1ZBE2 3ZSMA 1ZBE1 2Z79A 1WGPA 2FZ1A 3H0OA 4K1ZA 5JOXA 3W9AA 1JYCA 3NKGA 3NV3A 4E2SA 3PNAA 4BIFA 4N9HA 3WP6A 3ASIA 3ACLA 3ZFEB 4JTNA 3B69A 3B02A 1PGL1 1ZZCA 1QJU2 5JSOA 4E9KA 5J37A 3VHNA 1ZRCA 2UWAA 3L2HA 1BZWA 5EZWA 1QWRA 3APBA 3IPVB 2XJQA 3I2DA 1DFQA 2X53S 2IWGB 1AR91 1O91A 5FDBA 4NO4A 4FP3A 4KWLA 1W6PB 3UL2A 4AFDA 2R042 2B45X 3UJOA 4IEVA 4N53C 2RE9A 3SITA 2PTMA 4JQRA 4ZXKA 3JQWA 2DU1A 3LOIA 1SLIA 3H1WA 4WM7B 1H0BA 4ATEA 4W6WA 4NPRA 2NMOA 2R072 5FMOL 5L73A 3RJ2X 3ZXGA 1G9FA 4M3CB 3T1LA 5I0SA 1RUI1 3WZ1A 2RS33 5K8SA 4EN6B 1BBT3 1B35A 2DUPA 2JXAA 2X29A 4N43A 1RUG2 3JD71 4I3PA 3VBHC 2H0BA 3NSTA 4PCRA 4LHKA 4DQAA 2YDEA 3H1MA 4C1WA 5FTTC 4QMAA 3IDBB 4PJYA 1MZ5A 1OPMA 2XWJB 4G9SB 3MFCA 1OA3A 2P2KA 2WFF1 4META 4NR1A 2HKXA 1LRHA 3GBGA 2DV9A 4KGQA 3MGUA 5JAXA 1D2SA 5JI9A 2WT1A 2DVAA 5IUQA 2K9ZA 1I1EA 4S2FA 3D4KA 2Y26A 5BUVA 4QPIA 2PHRA 3AYDA 4XFFA 3HWJA 5KHHA 1C8M3 2ZTNA 4AI8A 5BNOB 3WUDA 1RUE2 3MLLA 1SQ4A 1TME3 3H3UA 3AMQA 3O0XA 4KWJA 4M3CF 1VBC1 5FLHA 4E4DX 3KZ4C 4LBLA 4IEOA 1RUC2 2VNOA 1PVC3 5F9TA 3NAPC 3AK0A 3BPZA 4GKXA 4K9SA 1YWKA 3LA7A 1BMV1 3IM0A 2Z5WA 4I3GA 2A6VA 4YM1A 5FLIA 2RJLA 4EWDA 2GC1A 1D4VB 4IEZA 4HPKB 1AUYA 4J1WA 1H1AA 4FAHA 4P9WA 4FPCA 2RM22 1Q8SA 4XF1A 3HT2A 3WVJA 2R16A 2WFPA 1HV0A 4XF9A 4OUMA 1NY72 3DN7A 1SCSA 4W6YA 2H6CA 4EN7B 3MIBA 4F7ZA 5FPXA 5JSPA 2FMYA 1VBB3 3H3ZA 1BCXA 1Q3EA 1Z7S3 4FSJA 1AXZA 2CWMA 4JDMA 3VZMA 1RMU3 1TME1 3ZPYA 1WW4A 2QUOA 1HQWA 1GNHA 3MPPG 1DDLA 1PZ7A 3ZFGC 1J58A 1FYUA 2HJIA 1WW7A 2RHPA 1D4M3 1RMU2 4K20A 1IS5A 3KCXA 2E53A 1JN2P 3KD4A 3AYEA 3AP9A 4AQ6A 2BPA2 3J9SA 4ISQA 3H50A 1GZ9A 4LEJA 3WX5A 1YNAA 5AC93 4LHNA 4Y22B 2RS53 1MQTA 4P14A 4DFSA 4Q1RA 3U11A 1DGWX 4R9AA 2IXLA 1REDA 4N7IA 1S0JA 3GZUC 2I07B 1O7FA 3MI8A 3NL1A 1Y9QA 1Y43B 2RMU1 3V56A 2RMU2 2CNAA 2VU9A 3KT1A 4KQ7A 1MEC1 3NAPA 4YW5A 4JGZC 2HWC3 1EAH3 2HWD3 1NYWA 4D7YA 4WZFA 3KM5A 2R49A 4HZFA 3PJYA 2DYCA 2WNVC 5LRRA 2XUMA 3VKOA 2B7YA 2PELA 2VMIA 1FAYA 3MIGA 4XJ9A 3INAA 2R043 1U5IA 1OLRA 4OHYA 1JUIA 3K51A 1OI6A 4AVVA 1GV9A 1J59A 3N4MA 1BKZA 1CJDA 1RMU1 1ZZBA 2OZJA 1C4RA 5JOZA 1YIFA 2WJSA 1ND2A 3ATGA 4YVSB 1NCQC 2MEV3 5A33B 1PK6A 4QD2A 3BOPA 2DF7A 2P37A 1NQDA 1XU2A 5ACA3 3QLQA 2ZAHA 4F3JA 4QPYA 2SBAA 5J48A 1YRZA 4XIKA 2VQAA 5BNQA 4R8HA 1LJ7A 1EV11 1QQP1 2EXIA 2X5IC 2EVXA 4UW3A 4Z1VA 1BBT1 1HIXA 4LUKA 4BIOA 4AQTA 1V6KA 1RC6A 2GC0A 2EXJA 4DOUA 3E5XA 4XJAA 2W52A 2R0FA 1HXS1 4XTPA 5H9SA 2TUNA 5E16A 3N7KA 4Y1VA 1QDCA 1V9U1 1RUD1 3J4UH 1BMV2 1ZBA1 3R0RA 4XETA