5IK7A

Laminin a2lg45 i-form, apo.
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
381
structure length
381
Chain Sequence
APLAMVHGPCVAESEPALLTGSKQFGLSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRNGFPYFSYDLGSGDTSTMIPTKINDGQWHKIKIVRVKQEGILYVDDASSQTISPKKADILDVVGILYVGGLPINYTTRRIGPVTYSLDGCVRNLHMEQAPVDLDQPTSSFHVGTCFANAESGTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTRPTGVLLGVSSQKMDGMGIEMIDEKLMFHVDNGAGRFTAIYDAEIPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQSPNSASTSADTNDPVFVGGFPGGLNQFGLTTNIRFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laminin subunit alpha-2
publication title Structural basis of laminin binding to the LARGE glycans on dystroglycan.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 80
structure length 381
sequence length 381
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ik7A01
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ik7A02
1ONAA 1YXWA 4FQ4A 5JOWA 5T5OA 5CBLA 3N7LA 3ASIA 2DVAA 3ZXKA 1CJPA 2YXSA 4Y20B 5H9RA 3AZYA 1O4ZA 5GLTA 3AJYA 3RSJA 5DUVA 1SLTA 3TAYA 3L2YA 1H30A 3D4KA 3NV2A 4XBLA 4LBOA 5SV8A 2DVDA 3T1MA 1SBEA 1F9KA 3OGGA 3AXDA 2UWAA 4ISQA 2P3JA 2VW0A 4YM2A 2WSVA 5T54A 1G8WA 2CNAA 3CNAA 3USUB 4Y1ZA 2ZMNA 1G9FA 1G9BA 2EXJA 5HCBA 1C57A 2CY6A 5IT6A 3WDYA 1V6KA 2SBAA 2DVBA 1WW5A 1FNZA 3QLQA 1HQWA 2DU1A 1UMZA 2A6VA 2ZA9A 3AYDA 3AZVA 3N7KA 4R9BA 1BQPA 2ZKNA 5DZEA 2CWSA 4GALA 1SLIA 2ZACA 2D3RA 5GZEA 1GANA 2UWCA 4R9CA 3WDWA 3VKOA 3N35A 5DXDA 3WDTA 2ZMLA 4LBNA 4D69A 1NXD1 1RITA 4PBPA 3N7JA 1CR7A 3N3HA 4BMBA 5EYXA 3A0NA 3UJOA 3V64A 2DVGA 2ZBJA 2DURA 1F5FA 1G9DA 1W6NB 2W52A 1N3OA 2A5ZA 2YZ4A 4FPEA 3AYCA 3RRDA 5KXDA 2NM1A 3V0AA 2R1BA 1LULA 3VKNA 3PJQA 2NP0A 1FAYA 1QU0A 4OZXA 4PCRA 4JC1A 1GZWA 2JE9A 3ENRA 1C1FA 3OBRA 1IOAA 3ATGA 3VKFC 2W68A 1MS1A 4Q27A 2AUYA 5DUWA 5AVAA 2D44A 2CWMA 2EIGA 4XMIA 2Q5TA 1GNHA 5GM0A 1KRIA 1S0CA 3WZ1A 2WT2A 3AZXA 4YW5A 2D3SA 5GLVA 5DG2A 2JE7A 3MW3A 4XJWA 1J1TA 1Q8PA 2EAKA 3FLPA 2EXKA 2GMEA 4P9XA 4DFSA 3B3QE 1LOFC 4ZKTB 2A6ZA 1Q8VA 4YLZA 4YW2A 2GNTA 1D2SA 1ENRA 1HKDA 1AJOA 1H9PA 3HMYA 3PVOA 2CL2A 3PVEA 4XZPA 1G9AA 2ZGQA 3O5SA 1G9CA 1KDKA 1UPSA 4YZ5A 1AZDA 5T5PA 3FUQA 5E89A 3M3QA 1H9WA 3B9CA 3OY8A 1DLLA 5GZCA 5DZGA 1LEMA 3LSDA 3ZSJA 2NMOA 3WOGA 1JUIA 1KJLA 1WW6A 1APNA 1I1EA 1VAVA 4WVVA 2JJ6A 3AFKA 3IKWA 2W08A 3R4UA 3FUOA 1W6OA 4HANA 2OVUA 4TZDA 4PF5A 3ILRA 4XJAA 4C1XA 1CQ9A 1Q8OA 2A71A 4YGDA 5T5LA 2AGSA 5CA6A 1MACA 2XB6C 4XBQA 2A75A 1JN2P 2ZZJA 3M2MA 3PVNA 2GNMA 1AVBA 4M3CF 2EF6A 4Q26A 3AX4A 3BODA 3N7MA 4XHBA 5H9SA 5JDBA 1Z0HA 3WV6A 2VW1A 3AP7A 2ZHKA 3AP5A 2XG3A 1MVQA 1N1TA 4YZ1A 1U0AA 1G86A 4FVVA 4ATFA 4YFZA 1LODA 4U36A 1GICA 3B00A 1FYUA 1LOBA 4K21A 1QMJA 4Q1PA 2PELA 2AR6A 4YG3A 4YG0A 1MS8A 5GLUA 2OUHA 4DPNA 2D7FA 1ULFA 2E7QA 2D3PA 3DUIA 1FV2A 4AVSA 1BJQA 2ZHNA 4XE9A 5E8AA 3B01A 3NWKA 2FHRA 3ILFA 5T50A 2B7YA 1SACA 1MZ5A 1JYIA 4Y24A 1WLWA 3H0OA 4XJ9A 2DUPA 4FPJA 1RIRA 1SBFA 2ENRA 4Y1YA 2A6YA 4KBBA 4Q1RA 5GALA 1HDKA 4R9AA 4M3CE 4L8QA 4W65A 3WNXA 3ZVXA 1JHNA 1A8DA 4Y22A 4CZSA 4P9YA 1PZ7A 1W6QA 1S0EA 2CYFA 3WCRA 4C1WA 4XXPA 5IK5A 5EYYA 3A0KA 3PMEA 4WV8A 1W6PA 1HQLA 4CTEA 3M1HA 3T2TA 1Q56A 4Q8KA 1LOGA 3W58A 5T5JA 3O12A 1DYPA 4FOQA 1YI7A 1I3HA 1IS3A 3AYAA 4UW3A 3WLUA 1W6NA 2ZGPA 4XDQA 1VIWB 1LOFA 3AYEA 1LHWA 4AGGA 5T52A 1GSLA 4LBQA 1WW4A 1QKQA 4YZ3A 1IS6A 1JW6A 3JUUA 2P2KA 4XOGA 3WG1A 1W6MA 3C2UA 1YRZA 2D6MA 1HLCA 4LBKA 2LTNA 3FBYA 2EXHA 3T1LA 1N3PA 3DGTA 4LBLA 3UL2A 2P34A 2V73A 1Z78A 2JD4A 2C9AA 2G4IA 1MS9A 1TEIA 3POSA 4FOWA 4FPYA 4GWMA 4XJ8A 2VUAA 1IKQA 1CPMA 2GALA 5KXBA 2PHRA 2WJSA 1WLCA 4UW6A 3D6EA 4RA0A 5GJ6A 1GLHA 2KM2A 4K1ZA 3RMYA 1LU1A 1WUVA 4FQZA 4LBMA 1ULGA 3WHUA 1DZQA 2ARBA 3ZPYA 3OPZA 1S0BA 4ISRA 2UURA 3ZSMA 3IPVA 3OYWB 3WG4A 5FREA 1GBGA 1DQ0A 4Q8LA 3BTAA 3M3EA 1LJ7A 5HCFA 2A6XA 1BZWA 3ILNA 4FPFA 3M3OA 1UZYA 1AF9A 2WT0A 1AX1A 1IKPA 1DQ2A 2GMMA 1UKGA 5L73A 5GZDA 3WVJA 3GNEA 1A78A 1GNZA 1WW7A 1V6OA 2RHPA 3AJZA 1ENQA 2GDFA 3QCWA 2ZGSA 1DQ1A 3VUOA 1SLCA 3MW4A 4M01A 1WD3A 4LBJA 4FOVA 1PZ8A 2E53A 4XMAA 1SLBA 2E51A 1AX0A 1SCRA 1AXYA 2ZGNA 4PQ9A 2D6OX 4U2AA 3VKMA 1DFQA 4Y1UA 1Q8SA 1N1YA 2Z42A 3BIWE 3BOPA 3SH3A 2GNBA 3SLIA 2VH9A 1ZM1A 4YZ2A 1N1VA 2P3KA 1UN1A 4MYEA 4WZFA 1V6IA 3NV4A 1S0GA 3RG0A 1N3QA 1GV9A 3U4XA 1BKZA 2ZGRA 3LSEA 3ZYPA 2DVFA 3AP6A 1O4YA 2A3YA 1UZZA 1WBFA 4ITCA 4ASMB 4BOWA 4GKXA 3WDXA 3ZSKA 1FX5A 3W59A 4AWDA 5JMCA 4BMEA 2R0HA 2AYHA 4DQAA 3R4SA 5JVVA 2BQPA 2D6NA 4Y26A 4YW1A 5GLZA 3A4UA 4BQ1A 4YM3A 1GZCA 4XTMA 2D43A 3OJBA 4M3CA 4UW5A 1MS3A 4BM8A 2NMNA 2A7AA 1DQ4A 1N47A 3OY8B 3APBA 2JECA 1DIWA 1UAIA 5GLWA 4NO4A 3UK9A 5IK7A 5DUUA 3SH5A 5JLVA 2ARXA 1MR5A 4WVWA 2OW4A 2ERFA 2EXIA 1LOAA 2V5YA 2E6VA 1JXNA 1MZ6A 4FPLA 2A70A 2D6PA 3NV1A 1AJKA 1LESA 2YMZA 4I30A 4Y20A 4YM1A 1CPNA 3V0BB 5CB7A 1FV3A 4DS0A 5CAZA 4AVVA 4Q2FA 4FP3A 2PHWA 1MS5A 1Y7BA 1ENSA 4K20A 1CVNA 3USUA 4YGCA 3FLRA 1JYCA 4FPCA 1GYKA 1LECA 3IM0A 1KJRA 2YROA 1DQ6A 1OKQA 1WBLA 4AVTA 4H55A 4YW3A 1CN1A 2ES3A 2H0BA 1LTEA 5IUQA 2NZ9A 2E7TA 2UU8A 1QOSA 5LK5A 5GZGA 1AX2A 1XQNA 3WG2A 2NYYA 4TYSA 2ZGOA 1JOJA 1IS5A 1DGLA 4F83A 3RQ0A 2AENA 1LCLA 4XIOA 5H9QA 2A3WA 2DTYA 1OFSA 3FLTA 4GXLA 4YFWA 1YIFA 2ZMKA 1C1LA 4DRVA 1QOTA 4P9WA 1VALA 1LHUA 2OUJA 1QDCA 1X50A 1LGBA 4K1YA 3ZXJA 3WHTA 2I2SA 4RL7A 1MS4A 1LHOA 2WQZC 1LHNA 1V6MA 3WUDA 4YM0A 4BPZA 5BYNA 1LGNA 2EALA 2ZGMA 2PHXA 4XHXA 4XILA 2D6LX 5JOYA 4GKYA 4Y22B 3AXEA 1JBCA 1W6QB 3KM5A 2VW2A 1SLAA 4IQPA 1VAMA 1MVEA 1PZ9A 2WNEA 3I8TA 3POYA 1S0IA 2ZGTA 1D0HA 1QGLA 1QOOA 2NN8A 1ZA4A 4CRQA 1QF3A 2ZHMA 5KXCA 1W6PB 4YGEA 2JKBA 2DYCA 2W39A 4JCKA 4R9DA 4XTPA 2A6WA 4FP2A 4SLIA 2JDZA 3O0VA 4FPOB 3HN1A 1S0FA 1SCSA 3OYWA 2DU0A 2R49A 4XXAA 3WDVA 4XJUA 1CIWA 1QDOA 2A3XA 3D5OA 1AXKA 3IN9A 4BLIA 1C4RA 5IK4A 3IMNA 1LU2A 2DUQA 4XBNA 1G7YA 3AP9A 5GZFA 5IK8A 3SISA 5T55A 4LBQB 4JRAA 1SLLA 3MPPG 1UX6A 2HYKA 3SH4A 4AGRA 1VLNA 3ZXEA 1A3KA 5F9TA 1W6MB 4Z8BA 1LEDA 5KXEA 1WLDA 4XJZA 1BXHA 3V0AB 1MS0A 1Q8QA 5FRAA 3WUCA 3POWA 3AK0A 3SITA 3O0WA 3AP4A 1KDMA 4HL0A 1S0DA 2VU9A 5DG1A 4FPHA 1GZWB 4DRRA 1KITA 1GKBA 1QNYA 5JOZA 1F31A 1V00A 2WKKA 1ULEA 1YYNA 5EXOA 1B09A 1S0JA 3I4IA 4YW4A 3Q9OA 2DUOA 4BLJA 1UL9A 3WCSA 3NV3A 4P14A 4AGVA 2VY0A 1URXA 2D6KA 5F5QA 3N36A 2ZHLA 4XYXA 2SLIA 3ZSLA 1BYHA 3GALA 3MW2A 3IPVB 3OBTA 4PBOA 5EWSA 1WCSA 2CTVA 5H9PA 2ZABA 1EPWA 1S1AA 4UW4A 1YO8A 3M3CA 1V6JA 2R16A 1NLSA 5E88A 2GNDA 4GA9A 2ZGKA 1SBDA 2WT1A 1DQ5A 3ZYRA 3V65A 3ZXFA 1DHKB 1W0PA 2R0FA 3JU9A 2YV8A 4YGBA 3ZXLA 3O0XA 4YG6A 3AZWA 1DYKA 2DV9A 2C5DA 1N1SA 1AXZA 1FNYA 1LENA 1FATA 2DWRA 4GWNA 5JOXA 1DBNA 1QNWA 4Y1XA 1W0OA 1SFYA 3VV1A 4XIKA 3FFZA 2ZAAA 4Y1VA 1OQ1A 2YY1A 3SNMA 2P37A 3RS6A 2VXRA 1ULDA 3V0BA 4YZ4A 5DZFA 1LOEA 2WSUA 1IS4A 3INAA 3UJQA 1WD4A 4AYUA 2GMPA 2UWBA 1V6NA 1LOCA 3MEPA 4FPKA 1LHVA 1W6OB 2AH2A 3B69A 1LGCA 4M00A 1V6LA 1GZ9A 2GN7A 2P3IA 3AZZA 2LALA 3KQRA 3LCPA 4NOTA 3TB0A 3WG3A 2PHFA 5DUXA 2FMDA 3WDUA 2PHTA 4LBQD 4ZXKA 2R1DA 2PHUA 5HCAA 1ULCA 2TEPA 4FPGA 2WLQA 5CNAA 2GN3A 2DTWA 1KQRA 2ZGUA 1CONA 4M3CB 1RINA 1CESA 2AREA 3VKLA 2ZGLA 3HR9A 1R1ZA 4ATEA 4FOYA 3R05A 3RMXA
chains in the Genus database with same CATH superfamily
1ND3A 2QQVA 1YXWA 3K4DA 4FQ4A 5JOWA 1NUKA 3U11A 2B39A 1CAXA 4RYDA 4Z2AA 5C4WC 1AR61 1ZBA3 1CJPA 3TNPB 3CMGA 5FXZA 5H9RA 2D98A 3H3ZA 4Q4W3 3AJYA 2BPA2 2JICA 2HWB3 1XRUA 5BNQA 1GWMA 4BB3A 3D4KA 3NV2A 4O7XA 2XDVA 3PU3A 4NIHA 3E5UA 1JS9A 5IVYA 3AXDA 4L0PA 4ISQA 2W1QA 2P3JA 2Z5WA 2VMDA 5FZ4A 3VBOB 4QX2A 2WZR2 1CX4A 3CNAA 4JV4A 2Y34A 2ZMNA 3KMHA 4Y1ZA 5F2WA 3CDZB 2XHNA 5HCBA 2WS91 3ZSEA 2XJUA 1NCQA 2RS13 1IQAA 3D0SA 3QLQA 1HQWA 2DU1A 4HKLA 4HVRA 3AYDA 2W2IA 2XL7A 2DCYA 4GWJA 1OLMA 4LE4A 3VZOA 2ZACA 2YPJA 5GZEA 4OCTA 4BHPA 2JDYA 2JG8C 4X6QB 4OMDA 4LBNA 4LKSA 3ZFGC 4PBPA 1PIV1 2R6QA 4DXZA 1CJDA 4BMBA 1AR92 2VOWA 3OOXA 3VBUC 2PLV3 4CEWB 4LO6B 3ZR6A 2W52A 3RWNA 4EE2A 5LA0A 1UPIA 1XSRA 2GC0A 3RRDA 2O0OA 5KXDA 4F8AA 1FMD3 4XABA 2ET7A 3VBRC 1Z7S3 2R30A 3PJQA 3IDEA 3H3LA 2NP0A 4P9JA 1H2LA 3RFRA 4CDWB 3AMNA 1GZWA 2JE9A 4JGYC 1QJX3 3VKFC 5IJRA 4MXWB 2JEMA 1QH7A 3UKVA 4ARYA 1CZTA 1GNHA 3VGIA 3GBWA 1I5ZA 2XLGA 4YVSB 5D8AB 4EN6B 4FSJA 2RS51 2FBEA 2Y60A 4RHV2 4IESA 4CCJA 1TMF1 5LRRA 2D3SA 1W05A 2LM3A 5JPMB 2VCCA 5DG2A 1US3A 2JE7A 3I3BA 4R8HA 3WNPA 1Q8PA 4IV1A 2GMEA 5A7WB 2JWPA 1LOFC 1XU1A 1Q8VA 1RUC2 2WFF1 4YLZA 4YW2A 1OHFA 1D2SA 4LPLA 1RGSA 4XF9A 2HWD1 2RS31 1AJOA 1H9PA 2RE9A 3GZTB 2FDFA 1G9AA 4L92A 1XNAA 5JZGB 5I0TA 3NNMA 4S2GA 3PUAA 1UPSA 3RI9A 4W50A 2WWJA 1T6GC 4CDQA 2VM9A 3C7HA 1Y4WA 1EV12 2E33A 1ND2B 5DZGA 1MZFA 1LEMA 2KA3A 5J7MA 5FO9B 4PIYA 1XNCA 3LIGA 3WOGA 4KNCA 1RUF3 4QPIB 3ZSJA 1WCQA 5F3CA 4QPGB 4I2OA 1RUG3 4IGQA 1D4M2 4XVHA 2B9VA 4WVVA 3JBG3 2BRTA 1MZEA 2DCKA 3AFKA 5A3WA 3R4UA 2B46X 3FUOA 5LRSA 4QX8A 4MGSA 3ST7A 5JSRA 4PF5A 1QXPA 4HVOA 4Q0UA 4JX0A 4QKBA 2YC2A 1CAUA 1NLQA 1YFXA 4LLFA 4LO4B 2XB6C 1HV1A 1R092 2ZXQA 5F39A 4EZHA 5CA6A 2ZZJA 1U12A 3PVNA 2GNMA 3CBNA 4N7IA 2EF6A 2RM23 5HV4A 3DF0A 1Z0HA 2JG9A 5FYUA 3W9AA 1RUE3 1ZX5A 1UU5A 4S2HA 5FQ0A 2XG3A 1MVQA 1N1TA 1IPSA 2WFPA 1R1A1 1U0AA 4YZ1A 1X9TA 2V5DA 5FYSA 4EWEA 4KWJA 4LKFA 1JZ3A 4QXKA 1F35A 5ACA1 5HCHA 2X05A 1LOBA 2QDNA 4D6SA 3ZDSA 2XJTA 4YG0A 5GLUA 4MSVA 1G6NA 4DPNA 4QX3A 4N90A 1ULFA 2V4VA 2P6HA 4TLGA 1NCRC 5FBJA 4ZY9A 4WVZA 1JMUB 3ZPOA 2BYVE 5D21A 4WM7B 3NMBA 1AUYA 1KS4A 4YVWA 2OA2A 5T50A 5FO7B 3K46A 3N4MA 5DAXA 1MZ5A 1JYIA 1UZ0A 4WM8C 4FTSA 1OVPA 2CDPA 4QQPA 4AVBA 2R32A 5BNNA 5F1RA 3T4VA 1SBFA 4MG2A 2A6YA 1W8WA 3SKVA 4M3CE 4EZ4A 3MO4A 1IPKA 5JAXA 1BK1A 3ZVXA 1JHNA 2ZEXA 4IUGA 1BMV1 3C7EA 3LEKA 2XKPA 1DYOA 2DFCA 2VZQA 2ARAA 1D4VB 3WT3A 1DZTA 2QZ3A 3VDDB 3WCRA 1ALYA 4XXPA 4HZFA 3I2DA 4LUMA 4Y5TA 4Q4V1 4CP0A 1CAXB 3TEZA 1HQLA 5FCCA 1XU2A 5D2AA 1DLCA 5K9YA 1GOGA 3LA7A 4FI9A 1O4TA 5T5JA 3HD8B 4QU1A 1QJFA 3GBGA 5A1AA 4FOQA 1YI7A 4E4ZA 5FP7A 2P5BA 1RTVA 1VIWB 1TQ5A 1AR73 1LHWA 1QJZA 4AGGA 1BEV3 3ZDVA 1K45A 4IEUA 4YZ3A 2W92A 3VBOC 1IS6A 1JW6A 4XOGA 2P2KA 2WL1A 4NPMA 1HLCA 2HWC1 4DUWA 3T1LA 5DMYA 2VJXA 3K3NA 1NCQB 2V73A 1Z78A 2JD4A 4I3GA 4Q4Y2 5IFPA 3LGRA 4LEJA 5KHIA 4D3WA 4E2QA 2WLPA 4LKEA 2VL4A 2WUHA 3C7GA 5AC92 1K5JA 4IEVA 4NIAA 5JIUA 5FMDA 5KXBA 3D6EA 1JODA 2HBUA 1GLHA 2QE3A 2RR12 4RA0A 4BJ0A 4K1ZA 4NWWA 4CCCA 1LU1A 1WUVA 1QJY3 4FQZA 1ULGA 2HWF3 3Q8CA 2HH9A 5FKCA 3NNFA 4MGQA 2Q8OA 3ZPYA 1S0BA 1J1LA 1UKRA 1AYM2 1F2NA 1MEC2 1WCDJ 1GBGA 3OB8A 1DQ0A 5FY9A 3NVCA 4CEWC 3VD4A 5LBBA 2RDNA 5J3UA 3LEIA 3M3OA 3RZMA 4Z92B 3J7NA 4K40A 1AX1A 2Q8DA 5FMOL 4JRLA 3WVJA 2F6BA 1HN0A 1JYXA 1FT9A 3GHMA 2ZGSA 1DQ1A 1OF4A 1SLCA 3M70A 4CDWC 3USSA 4XQWA 3C3VA 3R4DB 4FOVA 2E53A 4XMAA 2E51A 1AX0A 5KWRA 3VBFA 4D7TA 1ZZ7A 3ACHA 3BIWE 3SH3A 2GNBA 4YNIA 3BUCA 3RZHA 1ZM1A 4YVSC 4MX3A 5D8AC 2XLFA 1RUJ1 2P3KA 4MYEA 1NA1A 4WBBA 3OD0A 3LSEA 2DVFA 3AP6A 1O4YA 1E5SA 1WBFA 4ITCA 4ASMB 2CAVA 2WNUA 3OUIA 4Y33A 5A3TA 3KCXA 3RZLA 3WDXA 3O14A 3J4UH 3NO8A 5FWEA 3WF4A 3P3PA 3T30A 5JMCA 2NLRA 3BVCA 2R0HA 2AYHA 4IETA 1JZ4A 4PI0A 2D6NA 5FUPA 3KCCA 3ORJA 4YW1A 5CFCA 1E5RA 1GZCA 2GC1A 4XTMA 2AC1A 3LFMA 4M3CA 1ACCA 5ERLA 3QD6A 1DQ4A 4XFFA 3ROUA 2X53S 3KGZA 5GLWA 4A41A 3VD9A 4LA2A 1ND2C 2BZDA 4DINB 4WVWA 2OW4A 2OIIA 4QPIC 1JXNA 1MZ6A 5FZ0A 2D6PA 2ZKLA 4Y4YA 1AJKA 1JH5A 3ZKYA 3AVRA 2VGDA 3AL5A 3LWCA 1OA4A 3GCWA 5DDJ3 5FYVA 3WF0A 4DS0A 4QX5A 4XFIA 5CAZA 2J7MA 4KG8A 4AVVA 2Y26A 2JIGA 5FZ7A 1JYVA 2UY8A 1PGSA 4Q2FA 3BTZA 4FP3A 1CAUB 2XR4A 4YWAA 3MIEA 3THPA 1UOJA 4K20A 4UFHA 2ZZQA 4E9KA 1QIQA 1CVNA 5JSPA 3USUA 4AI3A 2JG9B 3K2OA 3IM0A 2IVJA 4MADA 4DIQA 1RUD2 1DQ6A 5BV6A 3H1WA 2Q8EA 1PMHX 2GP3A 1VRH2 4H55A 5FZMA 5A33B 1JU4A 2B45X 1HRV1 5LK5A 3KF3A 1AX2A 5LWBA 1CIYA 2CDOA 3WG2A 3ZYJB 5A6YA 1ZRRA 1COV3 5J96B 1OUSA 4AFDA 1IS5A 2QUOA 4CUGA 1TNFA 1PO12 1SZBA 1PGW2 2Z79A 3JXSA 5H9QA 4FO9A 1VE0A 2XONA 4AQ6A 3AKTA 3PUIA 4D94A 3ZFFA 3NSTA 4WM7C 4DRVA 4MGZE 3LZZA 1TME2 1VALA 3ZFEB 4CSWA 2OUJA 3IWZA 3WNKA 4AQTA 1QDCA 3ZXJA 2I2SA 1UXZA 1MS4A 2WQZC 1LHNA 1I6XA 1V6MA 4MOAA 4JTOA 1ULOA 5BYNA 3KT4A 3BI3A 1SHWB 2PHXA 4XHXA 4XILA 2D6LX 5JOYA 4H3WA 1DZRA 2I45A 3S5AA 1KXGA 3KCYA 2WZPP 4UAPA 1H1MA 2VW2A 5L9BA 1HV0A 3PUHA 4G9SB 1SLAA 3UKNA 1MVEA 2WNEA 2YPDA 2JB4A 5K0UA 3VDDC 2NN8A 5J09A 2R061 2ZHMA 5KXCA 3W5MA 4YGEA 5D1IA 2JKBA 1HRI1 2W39A 4R9DA 4FT8A 2VBPA 2QQLA 4LHSA 4SLIA 3HN1A 4BQ4A 1SCSA 3K48A 1K5MA 3OYWA 4BXSV 1W3VA 5A32A 2A3XA 1AXKA 3DXTA 3KVBA 1C4RA 2WO2A 5I8YA 4CUAA 4PDWA 1YIPA 2YFZA 2XKOA 3OF1A 1RUH2 2OZJA 4IEQA 1G7YA 3KT1A 5GZFA 4B7EA 5A6ZA 3HPNA 3SISA 5T55A 1AR62 5L9RA 3CEWA 1SLLA 3MPPG 3SH4A 3D8CA 3HN3A 4AGRA 4PLMA 4PF1A 4A6OA 4B1LA 4XJZA 4EV0A 5FRAA 2QQMA 4UBHA 1KDMA 3WQ7A 1NCQC 1AR93 1C8M1 2ZX2A 5JI9A 5FZ9A 3I2KA 1ZZ6A 1F31A 1VBE2 4FFHA 2PAEA 2Z4FA 3KQ4B 4L97A 4C0HA 2IFWA 1B09A 1S0JA 4YW4A 2QNKA 3Q9OA 4QB1A 1CD3G 4I0WB 1ZRIA 1EAH1 4Q0QA 2WS92 1URXA 2D6KA 1XNTA 1GQHA 2ZHLA 4CDUC 2SLIA 1L7LA 1BYHA 1KGYA 2WINB 5FZCA 3OBTA 4PBOA 3TBDA 3BOWA 3NRUA 4R4ZA 3E6CC 2CTVA 2PFWA 4AVCA 4AHXA 3M3CA 3S30A 1T6BX 1V6JA 1XNBA 3Q8BA 5E88A 2YUEA 3BCWA 3ZYHA 2WT1A 4CP1A 4RHV3 4JAAA 1W8FA 4BK5A 1S55A 4I02A 4RR3B 5FXWA 4KGGA 3D82A 2MEV1 3O0XA 4AAXA 2AACA 1W8ZA 4AQSA 1IG0A 2FD8A 1PIV2 2DV9A 2BTVC 1XBFA 3ZN6A 4TLFA 1ENXA 2N7GA 3DL3A 1NE4A 2BWCA 4PJYA 3RJRA 4GWNA 5JOXA 3OBAA 2VVEA 2W94A 2ZAAA 4Y1VA 1YFUA 4DUVA 2Q1ZB 3GYDA 3WF1A 4GMP1 4DXRA 1VP6A 1SG3A 2BNMA 4YZ4A 1GOFA 4RSUA 3ES4A 5AVPA 1IS4A 3I3QA 1NA1B 2WQ8A 3INAA 2GMPA 1H2NA 2UWBA 1LHVA 2E7AA 1XSQA 4LIVA 2VOVA 2WNUB 1LGCA 1C8NA 2P3IA 1GZ9A 4ZU5A 4NOTA 4DXTA 1IG3A 5CU1A 5CKQA 2RS52 1D4M3 3VBSA 5EP9A 5JXJA 5BPXA 2PHUA 1TMF2 4YARA 4FFGA 1UIKA 4NAMA 4CCLA 1S2BA 5LA9A 1CONA 1UMIA 3GZAA 2JDHA 3MFCA 3MYXA 4M3CB 5LY2A 2AREA 2OPWA 4IDZA 3U78A 3JB8A 3ELNA 5BNOA 4OVEA 3SMHA 1R093 3RNSA 4XC9A 2WFF2 3VHPA 1OKOA 2ZAHA 1O3TA 4Q0PA 5CBLA 2DVAA 2Q30A 2HWD2 2RS32 4Q4X2 2JKXA 4DNYA 2QQWA 1O4ZA 1SEFA 4CCOA 3I59B 1RJ8A 4NE9A 3TAYA 3L2YA 1UYXA 1H30A 2XUEA 4XBLA 4LBOA 1JZ7A 1LRHA 1W8OA 5IVJA 4A42A 1QJEA 1C28A 1F9KA 3IZOA 5IFTA 2UWAA 4XFAA 2CNAA 2IXJA 3USUB 3VZMA 2IFRA 1U5XA 1VBC1 2JDKA 2X29A 2EXJA 3I2FA 1HB3A 4KH9A 5CFDB 1G9BA 2CSGA 4XACA 5FK8A 3GGLA 5IT6A 2CY6A 1V6KA 1QJU3 4BH9A 1W2UA 4LOSA 1UMZA 5FUNA 4R9BA 1WA6X 4GALA 3OSDA 3U37A 5BNPA 2VOTA 1A34A 1XE0A 5LA1A 4CE8A 1DGRA 3UNPA 2W5FA 2W1SA 1GANA 1V70A 4N43A 3M4FA 1YNAA 1O91A 3K75B 3SCFA 1UO9A 3N35A 5DXDA 4COVA 1ZRDA 1FXZA 2WA3A 3SEPA 4D69A 3J8F1 3PURA 4B29A 4D7SA 2P3YA 3N7JA 4GJZA 3CZJA 5ACA2 2VMIA 4BQXA 3V64A 1F15A 4LT5A 4HN0A 2ZBJA 1GMMA 5FO8B 3ZFEC 1W6NB 3KWVA 2YGMA 3OTFA 2JDUA 4QQHA 2QVSB 3AYCA 2X5IA 4V1PA 3V0AA 2XMLA 4Q0SA 3MF9A 4R4XA 4TWTA 1UMHA 4D7YA 2VCMA 5JUVA 3EQEA 1FAYA 2O8QA 4RS5A 1PX3A 2H6BA 3ATGA 4Q27A 2PHDA 2WWSA 5K0UB 2CWMA 2EIGA 2Q5TA 5A3LA 1O3QA 2RMU3 1ZBA1 1AYN2 3MV01 2BEOA 3PL0A 1KRIA 4CEYA 2C4XA 2PN5A 2C1FA 1UCXA 1K5MB 3SHRA 4Q4W1 4Q4Y3 1BMV2 1OVSA 3AL6A 2HWB1 4XJWA 4HKWA 4PDWB 2MNGA 5AC93 2EAKA 2EXKA 4M0NA 3GBFA 3S57A 3B3QE 4HFSA 2A6ZA 4KI5M 2JXAA 5FLIA 5L36A 4MGYE 3Q8EA 2YYOA 1JUHA 3SQOA 3FHQA 2IZWA 5LY1A 3PVOA 2LW8A 1AYM3 1MEC3 4CUCA 1G9CA 1HB2A 1KDKA 1RHI3 2X8KA 2RS11 5FFOC 5T5PA 4OQ8A 2VZTA 2OYZA 3E5XA 5FY4A 5B4XA 2EVXA 3B9CA 1UY4A 4QB2A 4MZUA 1DLLA 1YC61 4QAWA 4QD2A 5I93A 3U75A 1R083 2XBO3 1IZ3A 4O9EA 1JUIA 2VTFA 4IEYA 5A7NA 3KF5A 2DBIA 4DEQA 4OHZA 3D3AA 3I3EA 1XYOA 2W08A 4BCUA 5LCWL 3B02A 1W9FA 2OVUA 3C7FA 5SV5A 4C1XA 5A80A 3IMMA 2BVVA 1HN1A 2PLV1 1GOHA 1NAEA 5LEKA 4E2SA 2WABA 4OUEA 2C24A 2A75A 3CKHA 1JN2P 5GM0A 3T0AA 5I0DA 3WW3A 1FMD1 3BODA 3K3OA 3N7MA 4OULA 2W3JA 4XFBA 5H9SA 1Z7S1 3SCHA 4AQ2A 4NIGA 3CJXA 1HXS3 3UV9A 3AP7A 4RR3C 4CP2A 1ZZCA 3AP5A 3HBZA 1EPZA 3OD4A 1G86A 2JENA 3HVDA 4QQOA 3ZN6B 3VN4A 3CO2A 4ATFA 4YFZA 3I3MA 1QJX1 2JDPA 3VBHA 1LODA 1QH6A 4QKFA 4RFT0 1M4WA 4XFCA 1DF0A 2XHKA 4Q1PA 3OUHA 5FZ8A 1MS8A 3URFA 2FDHA 2OUHA 4QPWA 4HVQA 3CJIA 3WD5A 3PUQA 4HMZA 4URTA 4CUBA 1X82A 3DUIA 4NHMA 1FV2A 4JVAA 4S2FA 3WINE 3H9AA 5FYYA 1H6XA 4YYOA 3S7EA 1NA1C 4ZHNA 3RZGA 3RZKA 3ILFA 1VMHA 2B7YA 3MICA 2R072 4C0BA 4OYUA 1OC1A 5A6QA 1OF3A 4BA6A 1RIRA 2WNVB 2ENRA 2VZRA 4H7MA 3VBSB 3ZYIB 2Z2SB 1XJAA 4NN0A 5FBZA 1HDKA 3VHNA 4AI2A 4R9AA 1OA2A 4IEPA 1Q43A 5EV7A 5FYZA 4XFHA 2IXLA 5IWFA 4IE7A 4ZZ5A 2E63A 5IK5A 1BVVA 4W4ZA 3MHZA 3T0BA 4FAHA 3MGUA 3ZR5A 1RUF1 3FFQA 5C70A 1CGPA 1RUG1 3JBG1 1Q56A 2EIBA 3W58A 3MLJA 4GZ9A 1EY2A 3WLUA 1IS3A 5APAA 2ZGPA 4XDQA 2Y6JA 3J7LA 5CYYA 4LHNA 3AYEA 1NKGA 5T52A 1GSLA 5EZWA 3I2OA 3CF6E 3ZYGA 2RM21 1QKQA 4AFBA 1PO13 2J1TA 3PUSA 2JDMA 1RUE1 5CFDC 2BJSA 3C2UA 1JYTA 4LBKA 3FBYA 1W8UA 2F4LA 3S7IA 1N3PA 1ZBE2 2P34A 1BHGA 4FPYA 3ZXGA 2IWGB 5FZLA 1TME3 1E57A 1IKQA 1PK6A 4DY5A 3AB0A 2GALA 4M4PA 3WQ0A 4E8DA 2PHRA 1W2TA 1WLCA 3D0JA 3TN93 1VBD2 3JZVA 2KM2A 4N43B 2WO1A 5M0TA 1W0NA 4LBMA 3E5QA 2VZVA 2ARBA 2Y0IA 3OPZA 5FYHA 1WMDA 4L2NA 2XVLA 4HLTA 3M3EA 2YBSA 1HRV2 5FMCA 1QXRA 2UY9A 4FPFA 3MZHA 1FOD2 4COZA 4LK7A 4NRPA 5L7OA 3O1PA 3TWIA 3I2JA 1DQ2A 5L73A 2VUDA 4LMFA 2VTXA 5GZDA 4BQ2A 3GNEA 1GNZA 1WW7A 3OGVA 2RHPA 4HSLA 3KVAA 2BOIA 3M7AA 2RG4A 1BBT3 1PVC2 1RUI2 4G4FA 5C3QA 5FZFA 4QM8A 1DGRN 1JOPA 1H4HA 1W8TA 1WD3A 1L3JA 3HNMA 2ZGNA 4LHKA 5ANQA 4ZXEA 3ZIXA 3VKMA 1ZVFA 3CU7A 2G9FA 2Z42A 4Y1UA 5KHGA 1AL22 4CEYB 2A73B 4YZ2A 1N1VA 1OOPB 2WN3A 5C3PA 3ZM8A 4D8MA 3SXWA 1K5MC 4INDA 3RG0A 1GV9A 2C0ZA 1RVF3 4GQ7A 3ZYPA 2GSYA 1TE1B 2A3YA 1VBE3 4BISA 3ZO0B 1AR71 5KR7A 3ZSKA 4GAZA 3NNLA 1BEV1 2ZX4A 3VHRA 3LE0A 4DQAA 2BQPA 2VZUA 4B7KA 5K8SA 3T2PA 3MI8A 4QXBA 5BXXA 3VHOA 2D43A 3T09A 1MS3A 4KWUA 4BM8A 1H8TA 2NMNA 2A7AA 4MO3M 3KB5A 2JECA 3KLSA 1UAIA 2J1SA 1O5UA 2J42A 2VVFA 4GULA 4N9HA 4NO4A 3UK9A 5JLVA 5JR7B 3O1MA 1MR5A 2BERA 2ERFA 3OPWA 3P6BA 4CXXA 1GP4A 3N9OA 1QJY1 1YCIA 2A70A 3ACGA 3FHIB 3S5QA 2HWF1 4Y20A 4KU8A 4AI8A 1CPNA 4OHXA 2QCSB 4X8NA 3V0BB 1FV3A 2HEVF 3NW4A 3OBZA 3LPGA 1UWWA 3PLQA 2Q1MA 4LNVA 2IXKA 1Y7BA 2OS2A 3AMMA 5L9VA 1ZA7A 4AF9A 2BFUS 4BIOA 1OD5A 5FZ6A 1ZREA 1JYCA 4QU2A 1LECA 4OMCA 4A7YA 4LK6A 1W8NA 1L7RA 2WYSA 1J83A 4LUKA 1PO23 2Y0OA 2Y6HA 4CDXB 1WGPA 3C7OA 4NR1A 2E7TA 2UU8A 3KT7A 3VL9A 2QQUA 5JXIA 1O3RA 1GQPA 3WSOA 1JHJA 1ND3B 2XL9A 2IXCA 3IT8A 5FIXA 4CCMA 2F17A 5HV0A 3LDRA 4F83A 2MEV2 3ECQA 4MGTA 4JTNA 4GMP0 5FY8A 3FN9A 2A3WA 4NHKA 1PMJX 3DPRA 4YFWA 4XURA 3QH6A 1C1LA 1OUXA 3M8LA 1QOTA 1AR83 4P9WA 4QGLA 5FLJA 1LHUA 2RDSA 1J58A 1FPN3 1F4AA 2W46A 1X50A 1LGBA 4UFJA 4ZU7A 4HK9A 3WHTA 1LNSA 3TNQA 2CV6A 1U5IA 3MPBA 2WNVC 4Q4X3 5JIAA 3VBSC 4FAGA 4HOOA 4YM0A 5L19A 2EALA 4LIUA 1J3RA 4R52A 4LQRA 3N9QA 5JXHA 2VOKA 3LOBA 5FZOA 3RYPA 1CZVA 2XJRA 3W20A 4QMAA 1VAMA 1PZ9A 1VBA2 4L99A 2ZGTA 1D0HA 1JOBA 1ZA4A 2K0GA 2LUWA 4OI0A 1LR5A 3JD73 4JCKA 4UOJA 1TZOA 2YGLA 2R7EB 4NVPA 5FPVA 3HBKA 2VPVA 5KC5A 3GM8A 4XJUA 2XXZA 3QBQA 5E6HA 4KWLA 5DDJ1 5A7QA 1RL3A 3MUZ1 3FE5A 4NIIA 1LU2A 3EO6A 3EYPA 3NNGA 3POGA 5A6XA 4QHBA 3E1F1 5FPXA 5FY5A 3VD5A 2QQPA 3DEMA 2BWAA 2MHFA 2VD7A 2YDEA 3H7YA 3ZX7A 4COWA 4LKDA 3FC0A 3GXUA 2HYKA 4BK4A 1O3SA 1MQTA 1A3KA 1NG0A 3NKTA 4QKNA 3MLLA 1W99A 5LW9A 1BXHA 3WUCA 2XJPA 2WN2A 1K42A 3AK0A 3H1YA 3SITA 3VDCA 1POV3 2VU9A 5DG1A 1KFUL 5A3OA 3BPSA 1HIXA 4FPHA 1GZWB 1S4CA 1GKBA 3NJVA 4TSVA 3TOJA 1UY1A 3ZXDA 2WKKA 1COV1 3E6DA 4PHZA 1YYNA 1WA4A 3I4IA 1VBC2 3AKRA 4GD4A 2DUOA 5IVBA 4C90A 4N43C 3H1MA 2R042 3NV3A 3WCSA 4AEJA 1ZZBA 5F6LB 5F5QA 4XQ4A 4GH4A 4XYXA 4DUXA 5DQ0A 4JKKA 4JDNA 1RXFA 4P00B 3B7MA 4NHYA 5EWSA 1WCSA 5FMBA 2BGCA 2XJVA 4HSJA 3RZJA 5IW0A 3K4ZA 1Q3EA 2R16A 3LEMA 2P4EA 4IV1B 4OI4A 1AYN3 2GNDA 2ZGKA 2ZX3A 2JE8A 1I9RA 2WAAA 1CAWA 2Y38A 1PM7A 4RQPA 3O1OA 1D7PM 1W0PA 4IEOA 3LDKA 4QQLA 4YGBA 5C3OA 3J8F2 3AZWA 1DYKA 2QDRA 3F2ZA 1N1SA 4QX7A 4YW7A 1A6CA 1AXZA 1UY3A 1FNYA 2YB7A 2HWE3 5JZGC 1FATA 3VZLA 1DBNA 4Y1XA 4XW3A 5C4WA 2JB8A 4XF0A 2VUCA 4E2GA 4CDQB 3MV11 4CDUB 1X8EA 3HIFA 3SNMA 5JPNB 4MXVA 3IIAA 1OOPC 2BW8A 1EUUA 4ES9A 1H1IA 2PAMA 2XUMA 4QPGC 1UYPA 1WD4A 2Y6GA 4AYUA 2QQKA 4WVMA 5C8CA 4FPKA 1ZRCA 3B69A 1PGL1 3H8UA 4EJRA 1V6LA 4PLOA 3TB0A 2OT7A 3T4HB 4GB33 2VQAA 2FMDA 4OHWA 1ASJ2 2VQTA 1JZ8A 5FUIA 1QY4A 5HCAA 4JZRA 3A23A 2GZWA 3ON7A 3WW4A 1UF2C 2X09A 1GR3A 4CCDA 4DEVA 1UX7A 2VAUA 4B4RA 2GN3A 5FP8A 2V72A 3ZXAC 1QQP2 1RINA 1AR91 3AFGA 3KV6A 5FQ0B 5FZEA 3NL1A 2ZGLA 4UI9L 1K3IA 1R1ZA 5A3NA 4ATEA 4FOYA 4OZOA 1C5HA 2MPFA 5F8PA 3WNOA 1XOYA 1E5IA 2WZ8A 5EIYB 5I0SA 2JG8A 2Q1FA 5T5OA 3O1TA 3N7LA 3ASIA 4H14A 4HONA 4XUTA 3ZFGA 1VBB2 2FDGA 3H8RA 4Y20B 2RS12 3ALQA 1SLTA 2VMGA 1ZRFA 4OLLA 4AI0A 3NKGA 2ORXA 5SV8A 2DVDA 5JI7A 1SBEA 4YVWB 1V9U2 4A3XA 2AZ5A 4DOUA 3HNBM 3OGGA 4F3JA 5C8WA 1T2XA 2VW0A 4YM2A 4EN0A 3IB3A 2WSVA 2DF7A 2LROA 3BU7A 1G8WA 4NWVA 4RHV1 5T54A 5J36A 4O61A 3B5LB 4JGYA 5BNNB 1W3XA 5IVEA 4FFFA 3I2GA 3POBA 5C3RA 2DVBA 1FNZA 4QM9A 4YPJA 2ZA9A 3LIHA 2HEWF 3AZVA 2G19A 2PLV2 4CDXC 1J3QA 2R073 1BQPA 3AMQA 3WF2A 2CWSA 3M3IA 5BUVA 1NQDA 3LAGA 1FMD2 4MHUA 2PXJA 1PM4A 3I97A 1Z7S2 1ND3C 5CKMA 4ZONA 1UXXX 1UZWA 2WZR3 2VBBA 2UWCA 2W0XA 4R9CA 1UOGA 3LDBA 5GKAC 3BIEA 3DN7A 2ZMLA 3WX5A 3DPRB 1RITA 1RMU2 1CR7A 1NZIA 1HQNA 3A0NA 1OQEA 5FYMA 2WWUA 2DURA 1F5FA 1J3PA 1S2KA 2DBNA 5AFBA 1O8PA 1N3OA 2A5ZA 2D5HA 2K2SA 2YZ4A 3Q8FA 4FPEA 4AI1A 1RB8G 4NRMA 1D4M1 3KGLA 1H1AA 2R1BA 4BE3A 3OUJA 3UETA 1C5IA 4IERA 4PIXA 3VZKA 1QU0A 4PCRA 4I09A 1Y3TA 3ENRA 1CX1A 3NAPA 3PVBB 1IOAA 1DP0A 4ZS2A 2W68A 1MS1A 1R091 1W2NA 3DV8A 3PHMA 3QH7A 5DUWA 4NPLA 2J1UA 2D44A 4XMIA 4MV2A 1VB4A 1OA3A 1SFPA 1S0CA 1EYBA 1GNYA 2WT2A 4FFIA 4UFKA 4XF4A 2DDUA 1ZYBA 3PU8A 3WP4A 1GWKA 1VRBA 1ZBE3 2X10A 2GH2A 3UGFA 2VC9A 3N9LA 3RYKA 4E4DX 3MW3A 1ODNA 4N9IA 1J1TA 1I1EA 4P9LA 3KS7A 4BYYA 3N9NA 5A1FA 1CAVA 3F95A 3J7HA 3FLPA 4B3NA 3B94A 2ZCWA 1B35A 4MLOA 4P9XA 2D93A 4W6YA 4ZKTB 2E31A 1RUF2 1VBD3 2WO7A 2GNTA 5DABA 1CWPA 2BV4A 1D2QA 5IAXA 3LQCA 1RUG2 1NY71 2GH8A 1ST8A 3JBG2 4XEZA 5EHDA 1BLZA 3PVEA 3KZ4C 2ZGQA 3O5SA 3U07A 4NRQA 1JU3A 1QJU1 2VUJA 5CIRA 3WNNA 4AFMA 4D0QA 4YZ5A 3FUQA 3TYJA 5E89A 3VLBB 3M3QA 4AHYA 2GC3A 4COYA 4CXWA 2WAOA 3OY8A 4I0AA 4CA9A 5GZCA 1FOD3 4YSFA 2WO3A 5CADA 4HN1A 2QJVA 3LSDA 1RUC3 1OH4A 1NCRA 1LKNA 1KJLA 3VBFB 1WCUA 3U0ZA 1RUE2 3POIA 1APNA 2WNOA 1ZZ9A 2VNOA 3UYJA 1VAVA 4GIQA 4CU9A 5C33A 3WW2A 3J9SA 5CEHA 3IKWA 3PDQA 1PVC3 3LD8A 1RUI3 1W6OA 4HANA 4IXLA 4WM8A 4IGPA 5CZKA 1SPPA 3U10A 4XJAA 1JZ6A 3JB4C 1CQ9A 4YGDA 1HB4A 4ZZ8A 2DCZA 2AGSA 1EV13 1MACA 3ZN4A 5JSOA 4XUNA 4IV1C 1AL23 4IE4A 4M3CF 4XHBA 1WWYA 1YJLA 3GZEA 5JDBA 2E9QA 1CAWB 4RQPB 3WV6A 2V4AA 3UGGA 4OHVA 1PHMA 5CFCB 3W21A 3T2QA 4LR4A 2GAUA 3VDBA 1YEWA 2WRAA 3NNJA 2FDIA 1GICA 2CGNA 3B00A 4XZUG 1W90A 2YU1A 4K21A 5FLHA 5C4WB 2YFUA 1QMJA 5FPUA 5F5CA 4QDSA 4YG3A 4CDQC 2RMU1 3HAGA 4AZZA 4DMIA 3IIIA 1GU3A 2D7FA 3POEA 1O5LA 1XE7A 2VVDA 2XJSA 2Y6FA 4Q4Y1 4B4QA 2ZHNA 4J6GA 4Q29A 4XE9A 5CISA 2VCBA 2XVKA 2FHRA 5C8CB 2RJKA 5AC91 4XPVA 3ZMOA 3CLPA 3VBOA 5FY1A 3ACFA 2DUPA 4FPJA 4BXFA 1GWLA 4Q1RA 1ODMA 4JKLA 4S2DA 4Z2WA 4N7UA 4MH0E 2B8MA 2ZX1A 4QQ2A 1AYM1 1MEC1 3WNXA 4YW6A 4I01A 5CG9A 1RHI1 1Y9QA 1A8DA 2JG9C 5A7SA 4CZSA 2WC2A 1OLQA 4P9YA 1AR72 3LA2A 3G7DA 4KU7A 2CYFA 4XQDA 2KXLA 2W91A 4LA3A 5FR3A 5EYYA 3PMEA 2Y6KA 1R081 2XBO1 2GP5A 4WV8A 1W6PA 2G9GA 1D0GA 4CCNA 5CG8A 2JX9A 2PA7A 3T2TA 4Q8KA 1LOGA 3B93A 2V09A 4RGKA 3PIJA 5FK7A 1R1A2 4UW3A 3AYAA 3FBMA 4HPKA 5DAPA 5EJZB 3GF6A 4K7JA 2KD7A 3ZYBA 4GJYA 3ZFFB 4YVWC 3U1XA 5FYTA 1EUTA 4NROA 1QJY2 3JUUA 2VOXA 1HXS1 1W6MA 1GZTA 3WG1A 1BK0A 1XXNA 5BNNC 2BBVA 3BGAA 4LO5B 3GDBA 4AHWA 4LBLA 3UL2A 4FOWA 2YG0A 1MS9A 1OSGA 1TEIA 1VPHA 3POSA 4XJ8A 2J1AA 5LASA 2VUAA 3DCQA 4N8MA 1H2KA 2VO5A 4YVSA 4N53A 5D8AA 3R6SA 4CXYA 1WMEA 2WJSA 4UW6A 5GJ6A 2CHHA 3OGRA 3RMYA 1JTZX 4Y3OA 3WHUA 2OXBA 4LORA 4MVTA 4META 3OYWB 3BB6A 3EBRA 3ZSMA 4BQ3A 5A32B 4Q8LA 3BTAA 1VBA3 4JKMA 1LJ7A 5HCFA 4XUQA 2A6XA 1BZWA 1ZNPA 4X6RB 2VNRA 4AAPA 5JWPA 1UZYA 1AF9A 1DU3D 2L9LA 4XCBA 1OPMA 2RR13 4HBNA 4Q4V2 2JDNA 3BKZA 5FYBA 2RVAA 1A78A 4P5YA 2UYAA 3AJZA 3QCWA 2PQSA 2D40A 5FKBA 5C7GA 3MBWA 1BCXA 1ND2A 4Z07A 3NAPB 1S2EA 4LBJA 5BY5A 2FDKA 1JI6A 3JQWA 1SLBA 5DPNA 1SCRA 1AXYA 4D6QA 2D6OX 4U2AA 4ONUA 1Q8SA 3BOPA 1YHFA 1DDLA 1STMA 3E6BA 4WZFA 1V6IA 3GZUC 2HWC2 1N3QA 1SFNA 2E26A 1BKZA 2VE1A 1M06G 1CAVB 4UWDA 4GKXA 1B35B 4UFLA 5FZGA 2EAAA 1FX5A 1CZSA 3EMRA 3T2OA 4ET7A 4JGZA 5JMOA 2R043 3LOIA 4AWDA 1PO11 4BMEA 1PGW1 2XVGA 5IVVA 4Y26A 4IGOA 4BQ1A 3KHCA 4YM3A 4PQQA 4W6WA 1UOFA 1O8SA 4WZCA 3U4SA 5F37A 2RJLA 3OCPA 1TME1 5I91A 3OY8B 2BDRA 3APBA 2VZ1A 4IEWA 4PI2A 2BVBA 5DUUA 1U5ZA 3P5BA 3SH5A 2ARXA 3ACIA 3TN91 5F6KA 4LHLA 1YI9A 1LOAA 2BBAA 2V5YA 3LB9A 2ADDA 4LULA 3VBFC 1L7QA 3CZUA 1LESA 2XGXA 4I30A 4NHLA 5F3IA 5FZKA 2ET1A 4AI9A 1RUOA 1PX4A 4IEXA 3KHBA 5HXVA 1SPPB 1F5JA 2QQNA 3MUY1 2VCAA 2OX0A 4P9GA 1OBNA 2PHWA 1MS5A 1POQA 3WP3A 1COV2 2D97A 4GWIA 1F8VA 3CIHA 2WNUC 5KC6A 1PNGA 2TUNA 3FLRA 4BWOA 4RQPC 4FPCA 4NMIA 5FMOS 2O14A 1KJRA 2W95A 5FPLA 2YROA 3VL8A 2BP6A 1RUJ2 2PMWB 1OKQA 1QHDA 5EQUA 1WBLA 1X9PA 1BBT1 3DKQA 3HEIA 3LEGA 3VDDA 3VDAA 4AVTA 4AW7A 1RC6A 5CFCC 2ES3A 2H0BA 3N9MA 5FZDA 2NZ9A 5BNOB 2ORZA 4FTEA 5K7PA 1H2MA 1ASJ3 2NYYA 3HQRA 4AK3A 1JOJA 2VULA 4FCAA 2XWJB 2XLAA 3R0RA 3ACLA 2B4KA 2AENA 1LCLA 1OXCA 3K4AA 1NQJA 1QQP3 4XIOA 4CYDA 1UY2A 1OFSA 4K6BA 4GXLA 4KBZA 1RVF1 3P3NA 1RUD3 2JDAA 4AHZA 4V2VA 3MF6A 2IUWA 1VRH3 2VG9A 5C8CC 1VBE1 2ZEZA 1W39A 3EHKA 1KS5A 4B4PA 5IVCA 3H50A 2W1WA 1H4GA 1VBB3 4RL7A 5EPAA 3O1UA 1VB2A 3BALA 3WF3A 4JQTA 3THTA 2XH6A 4Q5OA 4XETA 4BPZA 3NJYA 4GKYA 4BDVB 3AXEA 4QGNA 1JBCA 2UYBA 1X33A 3KM5A 1PGL2 1V9U3 3RGBA 3I8TA 4AFCA 3POYA 4CPBA 2W87A 2W47A 1QGLA 4XCAA 4CRQA 2VMFA 1W6PB 3AC0A 5BNPB 4CDUA 4HXCA 4XTPA 4FP2A 2JDZA 3POJA 4XXAA 3WQBA 1OI6A 5FP4A 2DU0A 2R49A 4BIFA 2TBVA 3D5OA 4K8FA 1U5YA 4BLIA 4AR2A 3POFA 4HPKB 3PJYA 4P08A 2BNOA 4CCKA 1US2A 3IDCB 3AP9A 1W04A 3PTRB 5IK8A 3ZFFC 2BOJA 4LJHA 4IV3A 5FYCA 3LFIA 4JRAA 3I54A 3CQOA 1WMFA 5A7PA 2QFEA 4X8PA 5F9TA 2X5IB 1NOVA 1W6MB 3WY6A 1LEDA 5KXEA 2XPJA 1WLDA 3V0AB 1RMU3 1MS0A 1Q8QA 3POWA 3L2HA 3O0WA 4HL0A 1PO21 4MHRA 5CVRA 4QPYA 1ULPA 4RS5B 4A2UA 1NT0A 1KEXA 4G3YC 4DRRA 1RUH3 2VNGA 1QNYA 2ZTNA 3H3UA 3WXPA 4N53B 5B2GB 5JOZA 2IXHA 1W28A 4DB5A 3ES1A 5EXOA 1W9SA 3WW1A 1AR63 1LAJA 4Y4RA 5K0UC 3FZ3A 3SKJE 1W03A 3N36A 4BQYA 3ZSLA 3GALA 3MW2A 2GU9A 3FWEA 1IQDC 4CCEA 5LEJA 5I0UA 1QWRA 3WP5A 1AR81 5H9PA 3RI8A 1S1AA 4UW4A 2VZ3A 1YO8A 1FPN1 1NE6A 4PDWC 3OGSA 4NPRA 3GCXA 1DQ5A 3HWJA 5DAVA 2FZ1A 5I0RA 2R062 4Q4X1 3ZYRA 5F5IA 3V65A 3ZXFA 1K12A 1DHKB 3JU9A 1HRI2 2YV8A 4ZS3A 4NHXA 2WS93 4YG6A 3BU0A 2P17A 1GFF2 3MIHA 1UY0A 1X36A 2DWRA 2FZ2A 3NAPC 4XFGA 1HW5A 1SFYA 3VV1A 4E4HA 3H42B 3GJBA 2YY1A 2J1VA 1OFNA 2YC0A 3PTYA 1REEA 3JD71 5I8TA 2FCTA 3BPZA 1LOEA 2I74A 5LZ6A 4QWNA 4V2WA 5KHKA 4E27A 3UJQA 1PIV3 1V6NA 3J7MA 3H8OA 5FJHA 3IBMA 1C8M2 2QKDA 2Z69A 4LTAA 4M00A 4A4AA 2GN7A 1O59A 1OMIA 1B35C 2LALA 5G04L 3S6PA 4RFRB 2HBTA 2PHFA 4JGZB 5DUXA 1J59A 3T0DA 2PHTA 2HJIA 5E16A 2R1DA 4FXGB 4ZXKA 3PMSA 2WLQA 2HLEA 1EAH2 1GUIA 5FP3A 1KQRA 5A33A 2VZSA 2QBXA 1POV1 2Q4SA 1CESA 4HETA 5C3SA 1UYZA 2CGPA 3R05A 2CAUA 4BQWA 1ONAA 3VBHB 1VR3A 4CVUA 3DYOA 3DYMA 1NY72 1O7FA 2EICA 3ZXKA 2RS53 2WBKA 2YXSA 5JCTA 2NPIA 1TMF3 3AZYA 3CJIB 1QJU2 5GLTA 3RSJA 1DGWX 5DUVA 2Y64A 3ZFEA 4K3UA 3T1MA 4QKDA 2J22A 1C3HA 5FOBB 4A6SA 3TRSB 1AYN1 2WFF3 1H6YA 2YU2A 4K9SA 2B9UA 2RDRA 3ABZA 1G9FA 4EROA 4NIDA 2HWD3 2RS33 4URAA 2C9KA 4LE3A 1QXJA 1C57A 1HB1A 3WDYA 2SBAA 4FTBA 3G6JB 1WW5A 4AOCA 2PQQA 2A6VA 2HWE1 3N7KA 2ZKNA 5FP9A 4LO7A 2O8OA 5DZEA 1NX9A 1SLIA 2WYFA 5HXMA 2D3RA 5BNOC 4UYBA 5C9AA 3EXUA 5EFUA 4AE2A 4LITA 1PMIA 2A1XA 5F32A 3WDWA 3WDTA 1REFA 3VKOA 4IEZA 1HX6A 5F3EA 2BNNA 2G9ZA 1WKYA 1NXD1 4MGIE 4J25A 3N3HA 5EYXA 4IE5A 5IVFA 3UJOA 2D5FA 4I0BA 2DVGA 4LLOA 1REDA 3THDA 5LA2A 1G9DA 1IGOA 2RMU2 4QHOA 3BN6A 4GB31 1X8MA 2RV9A 2NM1A 1LULA 5FYIA 1W9TA 5FV3A 3VKNA 2K9ZA 4IW3A 5FDBA 3HJRA 2XWBB 4OZXA 4AL9A 1R1A3 1YQ6A 1XE8A 4JC1A 4AEDA 3OBRA 1C1FA 5FY7A 5ACA3 5IHRA 2IVIB 4J1XA 2AUYA 4C91A 5C5TA 1SDDB 5AVAA 5ISLA 5FXVA 4P9IA 4ASKA 1PK6B 5FXXA 1SDWA 1XB9A 4YRDA 3WZ1A 3AZXA 4YW5A 5BNPC 3OGJA 4TTGA 4EN8B 5GLVA 1RHI2 5J48A 5C6CA 3MDPA 4QT6A 2AEZA 1NYWA 1AL0G 2XQRA 5HI0A 2NQYA 2ILMA 1W8HA 5J98B 4DFSA 1R082 2XBO2 5ABJA 4IV3B 4RR3A 3ITQA 4Q0VA 1UOBA 5E1RA 1ENRA 4L9BA 1HKDA 4UF0A 5DAWA 5DAQA 4XZPA 3HMYA 2CL2A 2X5IC 5L7OB 3HOBA 2JD9A 1AZDA 1TG7A 1SMVA 3BTYA 1H9WA 3S0MA 1VJ2A 4J1WA 2ARCA 2R071 2B5HA 4RGAA 4RS5C 5FY0A 4KQ7A 3RPQA 4A45A 2QQIA 4M4RA 2PTMA 5FTTC 2RDQA 5KBFA 4N53C 4Q4V3 2FCVA 2NMOA 3T08A 3J26N 2P6CA 1YJKA 1WW6A 3CL1A 2WA4A 4QX0A 1HXS2 4HKOA 1EP0A 2WZR1 4COUA 3OG2A 2JJ6A 1JZ2A 4CEYC 1X7NA 1VAKA 4TZDA 4BU2A 3ILRA 1UU6A 1Y43B 3LPFA 1J84A 1Q8OA 1SQ4A 2A71A 2QQJA 4ZPIA 3FL7A 5T5LA 1W9YA 4XBQA 2DCJA 4EYUA 1OPOA 3M2MA 1AVBA 3ME2A 4Q26A 3AX4A 5IYYA 5HPOA 3PNAA 5FZ3A 1ZBA2 2VW1A 1TNRA 2W9XA 2VTXJ 2ZHKA 3T3YA 2HWC3 1I5PA 3MLKA 1UD1A 3FHAA 4FVVA 4Q4W2 4UFIA 2HWB2 4KL1A 4E8CA 1YUDA 5A3MA 4AEMA 4U36A 1H8TB 1FYUA 2BU9A 2PELA 4XDPA 2AR6A 3DYPA 3I2IA 4CPBD 5K4LA 1JYNA 4P02B 3NJZA 3I59A 2E7QA 1OH3A 2D3PA 1ZBE1 4MUVA 5T3NA 4AVSA 1BJQA 3AVSA 2VECA 5E8AA 3B01A 3NWKA 3ZN5A 5LBCA 3I3DA 2ETEA 4LO8A 5KHHA 3VBUA 1LB2A 1SACA 5FZIA 3WNMA 4EWDA 4Y24A 1W2OA 4XAEA 1UYYA 4O9GA 1UW8A 1VBD1 5CFDA 1WLWA 2WQ4A 3H0OA 4XJ9A 2HEYF 3LA3A 4JGZC 3VBRA 4A44A 4Y1YA 2QZ2A 4KBBA 5GALA 3ETPA 4QX1A 1W2AX 3PIGA 4L8QA 4W65A 5F3GA 2I07B 2VR4A 2VZOA 4ES8A 4Y22A 3GHNA 5A3UA 2J1RA 2B42B 1PZ7A 1OLRA 1W6QA 1YFYA 1QEXA 3IAPA 4OI1A 4Y5SA 3Q8AA 1S0EA 3ZMNA 4XF1A 1FOD1 4AVAA 4C1WA 3A0KA 3VZNA 3VBHC 1RUC1 3WP6A 3GJAA 2DCTA 3K51A 4CTEA 1VMFA 3M1HA 1RUJ3 3VD3A 5LATA 1R64A 3SC7X 1PVC1 3CJIC 3O12A 1RUI1 1DYPA 1I3HA 1NLRA 5FPZA 4DY3A 1W6NA 1UIJA 4UFMA 4XUPA 1QJX2 1LOFA 1RXGA 1EV11 4DZGA 3TN92 1AL21 4LBQA 3BTXA 1WW4A 1P8JA 4FBFA 5C71A 1YRZA 2D6MA 2VMEA 3KD4A 2LTNA 4P5HA 2EXHA 2ZS6B 3O1VA 3DGTA 1YQCA 4IE0A 3SEEA 4JDOA 2C9AA 2G4IA 4GWMA 2ADEA 4E4SA 5FZBA 5FZOB 5J1XA 4OI2A 4TXWA 1CPMA 2XQXA 2JIJA 5C9AB 2G1MA 4BZ4A 5IATA 1KD7A 1GP5A 2FDJA 2QQOA 2WZEA 2BUKA 4QGMA 4CU7A 2OKXA 1DZQA 1YLLA 2OPKA 1BBT2 3IDBB 4ISRA 2KR2A 1XNKA 2UURA 3EJKA 4UBGA 3IPVA 3WG4A 4CP9A 4LXLA 4SBVA 4XAAA 5FREA 3B9IA 4IE6A 2C6SA 2VZPA 3A21A 4I3PA 2GC2A 3ILNA 5B4NA 3UESA 1UU4A 2BFUL 3H7JA 3HT1A 1XC6A 5FOJB 2WT0A 1IKPA 2F4PA 1HJFA 2LRPA 2GMMA 1UKGA 2ZEYA 3AKPA 3RVHA 1WZXA 1V6OA 3KV9A 1MQTB 1RVF2 1ENQA 2GDFA 4AEDB 5FWJA 3UT0A 3VUOA 2OQ7A 3MW4A 4M01A 3DKWA 1PZ8A 4EN7B 1HRV3 4B8EA 4PQ9A 3RWKX 1DFQA 1N1YA 2Q0AA 2VXJA 4UXAA 1PK6C 3SLIA 2VH9A 4RN5A 2RM22 3TEWA 1UN1A 3KV4A 5FAXA 4B1MA 4Z1VA 5FPAA 3NV4A 1S0GA 3U4XA 2ZGRA 4GH4B 1RJ7A 2PAKA 1WCKA 5F2SA 1UZZA 3QACA 2YBKA 4KGQA 3WQ1A 4BOWA 1YFWA 3X29B 4ARXA 3IDAA 3O7OA 5ABJB 3IAQA 5LBFA 3W59A 4HK8A 4IV3C 2WR9A 4AXOA 4QHZA 3HQUA 2WIIB 1YQ2A 1W06A 3R4SA 4UF0B 1KFXL 4QDQA 5JVVA 3BYWA 4JDMA 4QDRA 3A4UA 5GLZA 5L7OC 4BQ5A 3OJBA 1FI2A 4UW5A 4A7KA 2TNFA 4QXCA 4XF3A 4A3ZA 2YBPA 1WLTA 4NJ4A 1OURA 4EQVA 2VMHA 1N47A 2XOMA 5DN2A 1BVP1 1DIWA 2FMYA 2VBDA 5IK7A 4C8DA 5LBEA 1DGWA 2R063 2H0VA 2EXIA 1HRI3 2E6VA 1MPXA 1YQ5A 4FPLA 3W5NA 3NV1A 2YMZA 2LS6A 4YM1A 1PNFA 3HNYM 4FXKB 5CB7A 2Q8CA 1PO22 3MFAA 1UQXA 4W8JA 5EJ1B 4OUMA 1JZ5A 2YC4A 1VBA1 4H7LA 3RZZA 2BGOA 4WVMB 2WNVA 1ENSA 1YWKA 5A70A 4XDOA 5G05L 4K8RB 2RR11 4YGCA 1GYKA 3SCGA 2EIEA 2ZEWA 3EB7A 3RJ2X 3MIBA 5F7UA 2PYTA 4KMQA 1WMXA 3VZJA 1AR82 2W1UA 1C8M3 3LKJA 4YW3A 1CN1A 5IUQA 1LTEA 4W6XA 2RJ2A 1FPN2 2Y8KA 4HT1T 1QOSA 1H8TC 5C5UA 2K46A 5GZGA 4F7ZA 3AM2A 3VB9A 1XQNA 2OQ6A 3ZIWA 4TYSA 2EIDA 2ZGOA 4LOTA 1BEV2 1DGLA 2ID4A 4ORFA 2O1QA 4AFAA 2FQPA 2JG8B 1EAH3 1GP6A 3RQ0A 3ZOIA 3HQXA 3ZFGB 2DTYA 3FLTA 1YIFA 5A7OA 2ZMKA 4IL7A 2Y33A 1V0AA 4L11A 3VBUB 2ZOEB 4CEWA 5A3PA 4HG6B 2ZX0A 4DO0A 1W9WA 2FCUA 2C26A 2DFBA 4K1YA 1XYPA 3JD72 3VBRB 2R041 3AKSA 3TEXA 3H8XA 4NAOA 1LHOA 3CHXA 3WUDA 3LF7A 1A8MA 3DECA 2MEV3 4NUBA 1LGNA 3I49A 2ZGMA 4EWAA 2HWF2 4OUSA 4CDWA 4JGYB 4Y22B 3V56A 1JYWA 4AG4A 1W6QB 5LK7B 4UT5A 4Y5Z0 3E97A 4IQPA 4MXWA 1POV0 4A7ZA 2VQ0A 2IXIA 4EN9B 1S0IA 1Y9MA 3AMPA 1QOOA 1QF3A 3OEBA 1UZVA 2VMCA 3P1IA 4KWKA 1XNDA 3FMGA 2DYCA 4GMP3 2A6WA 3JQXA 4CU8A 3O0VA 4FPOB 1VMJA 1S0FA 3WDVA 4QXHA 1CIWA 3FX3A 1QDOA 3AKQA 3IN9A 3WR0A 5IAVA 5IK4A 3IMNA 2DUQA 4XBNA 2E32A 3DPRC 4M0HA 4OFGA 1RYYA 2H6CA 5A7WA 1HJGA 4LBQB 1TVGA 4PLNA 1H0BA 3ZKUA 5J37A 1OQDA 1UX6A 1VLNA 3KSCA 2CGOA 3ZXEA 1F4HA 2XJQA 4Z8BA 2HYXA 4AEKA 5JZGA 1Y9GA 4D6RA 5JR2A 4O65A 3AP4A 1OLME 1NZCA 1S0DA 2ZPXA 3NQHA 5JXGA 1YQ8A 3THCA 1IPJA 1KITA 1O6UA 2EA7A 3TEYA 1V00A 1ASJ1 1DG6A 1OOPA 1Q5OA 1ULEA 4ASLA 4ZU4A 1PVXA 4QPIA 4KG0A 4Z82A 2QTWB 4H2AA 5F5AA 5C9AC 4QPGA 4BLJA 1UL9A 3HT2A 4P14A 3UGHA 4AGVA 2VY0A 1QQP1 3OPTA 3O1RA 1ZZ8A 2VQUA 1RUD1 2Y6LA 4CP9B 2IC1A 3IPVB 2HWE2 4CU6A 4RD7A 1UNBA 1VRH1 3RDIA 2ZABA 1EPWA 5KHJA 2BGPA 2ATFA 4MGKE 1NLSA 2HKXA 2P1BA 1IHMA 4GA9A 4JHZA 1SBDA 4TN7A 1VBB1 3NJXA 5ANNA 1OD3A 5I8SA 3I7DA 1VBC3 2AEYA 1AHSA 2R0FA 3MIDA 3DXUA 3U14A 3ZXLA 1OT5A 3UKTA 3A22A 1GQGA 2C5DA 2VNVA 1MQTC 3MIGA 4QB6A 5DDJ2 1XPWA 3AMHA 4AEDC 3N9PA 1LENA 4OHYA 1V9U1 3RYRA 1RUNA 5TSWA 1QNWA 3ETQA 1W0OA 5HBAA 4XIKA 3FFZA 1DCSA 4GB32 3MIFA 3VD7A 1OQ1A 1NXMA 2P37A 3FJSA 4XUOA 5FPBA 2VXRA 3RS6A 1ULDA 3V0BA 5DZFA 5AFEA 4JHTA 1NCRB 2ZJCA 2WSUA 4OQ9A 4PIZA 4JQRA 3J8F3 3ZLIA 4WM7A 1LOCA 3MEPA 4GH4C 3ZYFA 1W6OB 2AH2A 5FZ1A 4WM8B 5CKNA 3AZZA 3KV5A 1E5HA 1H8VA 3KQRA 3LCPA 3A7QA 3L9JT 4PT6A 3WG3A 2PHLA 3WDUA 5ABJC 3JCIA 1XYNA 5FZHA 3O1SA 4LBQD 3QOPA 1ULCA 2TEPA 3OEAA 4FPGA 4DXSA 5A1LA 5CNAA 2OZ6A 1RMU1 2YHJA 3I2HA 4CDXA 2DTWA 3C8XA 3K77A 2ZGUA 4RGGA 5EJ3A 2J1EA 5FJKA 3WEZA 3VKLA 5LB6A 3HR9A 5FZAA 2WDBA 3WNLA 2CU5A 1RUH1 3RMXA
chains in the Genus database with same CATH topology
1ND3A 1YXWA 4FQ4A 5JOWA 3U11A 2B39A 1CAXA 5C4WC 1AR61 1ZBA3 1CJPA 3TNPB 5H9RA 2D98A 3H3ZA 4Q4W3 3AJYA 2BPA2 2JICA 2HWB3 1XRUA 5BNQA 3D4KA 3NV2A 3E5UA 3AXDA 4ISQA 2Z5WA 2P3JA 3VBOB 2WZR2 1CX4A 3CNAA 4JV4A 4Y1ZA 2ZMNA 3KMHA 5HCBA 2WS91 3ZSEA 2XJUA 1NCQA 2RS13 1IQAA 3D0SA 3QLQA 1HQWA 2DU1A 4HKLA 4HVRA 3AYDA 2XL7A 2DCYA 4LE4A 3VZOA 2ZACA 2YPJA 5GZEA 4BHPA 2JG8C 4X6QB 4LBNA 3ZFGC 4PBPA 1PIV1 2R6QA 4DXZA 1CJDA 4BMBA 1AR92 2VOWA 3VBUC 2PLV3 4CEWB 4LO6B 2W52A 3RWNA 1UPIA 2GC0A 3RRDA 2O0OA 5KXDA 4F8AA 1FMD3 2ET7A 3VBRC 1Z7S3 2R30A 3PJQA 3IDEA 2NP0A 4P9JA 1H2LA 4CDWB 3AMNA 1GZWA 2JE9A 4JGYC 1QJX3 3VKFC 4MXWB 2JEMA 1QH7A 3UKVA 1GNHA 3VGIA 3GBWA 1I5ZA 2XLGA 4YVSB 5D8AB 4EN6B 4FSJA 2RS51 2FBEA 4RHV2 4IESA 1TMF1 5LRRA 2D3SA 2LM3A 5JPMB 5DG2A 2JE7A 4R8HA 1Q8PA 4IV1A 2GMEA 1LOFC 1XU1A 1Q8VA 1RUC2 2WFF1 4YLZA 4YW2A 1OHFA 1D2SA 1RGSA 4XF9A 2HWD1 2RS31 1AJOA 1H9PA 2RE9A 3GZTB 1G9AA 4L92A 5JZGB 5I0TA 4S2GA 1UPSA 3RI9A 1T6GC 4CDQA 1EV12 1ND2B 5DZGA 1MZFA 1LEMA 2KA3A 5J7MA 5FO9B 4PIYA 1XNCA 3ZSJA 3WOGA 4KNCA 1RUF3 4QPIB 4QPGB 4I2OA 1RUG3 1D4M2 4WVVA 3JBG3 1MZEA 2DCKA 3AFKA 3R4UA 2B46X 3FUOA 5LRSA 3ST7A 5JSRA 4PF5A 1QXPA 4HVOA 4Q0UA 1CAUA 1YFXA 4LLFA 4LO4B 5CA6A 2XB6C 1HV1A 1R092 2ZZJA 1U12A 3PVNA 2GNMA 4N7IA 2EF6A 2RM23 3DF0A 1Z0HA 2JG9A 3W9AA 1RUE3 1ZX5A 1UU5A 4S2HA 5FQ0A 2XG3A 1MVQA 1N1TA 2WFPA 4YZ1A 1R1A1 1U0AA 4EWEA 4KWJA 4QXKA 5ACA1 1LOBA 2QDNA 3ZDSA 2XJTA 4YG0A 5GLUA 4MSVA 1G6NA 4DPNA 4N90A 1ULFA 1NCRC 4WVZA 2BYVE 4WM7B 1AUYA 1KS4A 4YVWA 2OA2A 5T50A 5FO7B 3N4MA 1MZ5A 1JYIA 4WM8C 4FTSA 4QQPA 4AVBA 2R32A 5BNNA 5F1RA 1SBFA 2A6YA 4M3CE 1IPKA 5JAXA 1BK1A 3ZVXA 1JHNA 1BMV1 2XKPA 2DFCA 1D4VB 3WT3A 1DZTA 2QZ3A 3VDDB 3WCRA 1ALYA 4XXPA 4HZFA 3I2DA 4LUMA 4Q4V1 4CP0A 1CAXB 1HQLA 5FCCA 1XU2A 5K9YA 3LA7A 1O4TA 5T5JA 3HD8B 3GBGA 4FOQA 1YI7A 4E4ZA 1RTVA 1VIWB 1TQ5A 1AR73 1LHWA 1QJZA 4AGGA 1BEV3 4IEUA 4YZ3A 3VBOC 1IS6A 1JW6A 4XOGA 2P2KA 2WL1A 1HLCA 2HWC1 3T1LA 2V73A 1NCQB 1Z78A 2JD4A 4I3GA 4Q4Y2 3LGRA 4LEJA 5KHIA 4D3WA 4E2QA 2WLPA 5AC92 5KXBA 4IEVA 5JIUA 3D6EA 2RR12 2QE3A 1GLHA 4RA0A 4K1ZA 4NWWA 1LU1A 1WUVA 1QJY3 4FQZA 1ULGA 2HWF3 4CDUB 2Q8OA 3ZPYA 1S0BA 1J1LA 1UKRA 1AYM2 1F2NA 1MEC2 1WCDJ 1GBGA 1DQ0A 3NVCA 4CEWC 5J3UA 3M3OA 4Z92B 4K40A 1AX1A 5FMOL 4JRLA 3WVJA 2F6BA 1FT9A 3GHMA 2ZGSA 1DQ1A 1SLCA 3M70A 4CDWC 3USSA 4XQWA 3C3VA 3R4DB 4FOVA 2E53A 4XMAA 2E51A 1AX0A 5KWRA 3VBFA 4D7TA 1ZZ7A 3SH3A 3BIWE 2GNBA 4YNIA 1ZM1A 4YVSC 4MX3A 5D8AC 2XLFA 1RUJ1 2P3KA 4MYEA 1NA1A 4WBBA 3OD0A 3LSEA 2DVFA 3AP6A 1O4YA 1WBFA 4ITCA 4ASMB 2CAVA 2WNUA 3KCXA 3WDXA 3O14A 3J4UH 3NO8A 3P3PA 5JMCA 2NLRA 2R0HA 2AYHA 4IETA 2D6NA 3KCCA 4YW1A 5CFCA 1GZCA 2GC1A 4XTMA 4M3CA 3QD6A 1DQ4A 4XFFA 3ROUA 2X53S 3KGZA 5GLWA 4LA2A 1ND2C 4DINB 4WVWA 2OW4A 2OIIA 4QPIC 1JXNA 1MZ6A 2D6PA 2ZKLA 4Y4YA 1AJKA 1JH5A 2VGDA 4D94A 3LWCA 1OA4A 5DDJ3 4DS0A 4QX5A 4XFIA 5CAZA 4KG8A 4AVVA 2Y26A 2UY8A 1PGSA 4Q2FA 4FP3A 1CAUB 3MIEA 3THPA 4E9KA 4K20A 2ZZQA 1CVNA 5JSPA 3USUA 4AI3A 2JG9B 3IM0A 5BV6A 1RUD2 1DQ6A 3H1WA 1VRH2 4H55A 5A33B 2B45X 1HRV1 5LK5A 1AX2A 3ZYJB 3WG2A 1ZRRA 1COV3 5J96B 4AFDA 1IS5A 2QUOA 1TNFA 1PO12 1PGW2 2Z79A 5H9QA 4FO9A 4AQ6A 3AKTA 3ZFFA 3NSTA 4WM7C 4DRVA 4MGZE 3LZZA 1TME2 1VALA 3ZFEB 2OUJA 3IWZA 4AQTA 1QDCA 3ZXJA 2I2SA 1MS4A 2WQZC 1LHNA 1I6XA 1V6MA 4JTOA 5BYNA 3KT4A 2PHXA 4XHXA 4XILA 2D6LX 5JOYA 4H3WA 1DZRA 2I45A 1KXGA 3KCYA 2WZPP 1H1MA 2VW2A 1HV0A 4G9SB 1SLAA 3UKNA 1MVEA 2WNEA 5K0UA 3VDDC 2NN8A 5J09A 2R061 2ZHMA 5KXCA 4YGEA 5D1IA 2JKBA 1HRI1 2W39A 4R9DA 4FT8A 4SLIA 3HN1A 1SCSA 3K48A 1K5MA 3OYWA 5A32A 2A3XA 1AXKA 1C4RA 5I8YA 4PDWA 1YIPA 3OF1A 2XKOA 1RUH2 2OZJA 4IEQA 1G7YA 3KT1A 5GZFA 4B7EA 3SISA 5T55A 1AR62 3CEWA 1SLLA 3MPPG 3SH4A 3D8CA 4AGRA 4PLMA 4XJZA 4EV0A 5FRAA 4UBHA 1KDMA 3WQ7A 1NCQC 1AR93 1C8M1 2ZX2A 5JI9A 1ZZ6A 1F31A 1VBE2 2PAEA 4L97A 4C0HA 2IFWA 1B09A 1S0JA 4YW4A 2QNKA 3Q9OA 1CD3G 4I0WB 4Q0QA 1EAH1 2WS92 1URXA 2D6KA 1GQHA 2ZHLA 4CDUC 2SLIA 1BYHA 2WINB 3OBTA 4PBOA 3TBDA 3BOWA 4R4ZA 3E6CC 2CTVA 2PFWA 4AVCA 4AHXA 3M3CA 3S30A 1V6JA 1XNBA 5E88A 2YUEA 3BCWA 4CP1A 2WT1A 4RHV3 4JAAA 1S55A 4I02A 4RR3B 4KGGA 3D82A 2MEV1 3O0XA 4AQSA 1PIV2 2DV9A 2BTVC 3ZN6A 4TLFA 1ENXA 2N7GA 3DL3A 1NE4A 2BWCA 4PJYA 3RJRA 4GWNA 5JOXA 2VVEA 2ZAAA 4Y1VA 1YFUA 2Q1ZB 3GYDA 4GMP1 1VP6A 2BNMA 4YZ4A 4RSUA 3ES4A 5AVPA 1IS4A 3INAA 1NA1B 2GMPA 1H2NA 2UWBA 1LHVA 2E7AA 2VOVA 2WNUB 1LGCA 1C8NA 2P3IA 1GZ9A 4ZU5A 4NOTA 5CU1A 2RS52 1D4M3 3VBSA 5BPXA 2PHUA 1TMF2 4YARA 1UIKA 1S2BA 1CONA 3MFCA 3GZAA 3MYXA 4M3CB 2AREA 5BNOA 3JB8A 3ELNA 4OVEA 3SMHA 1R093 3RNSA 2WFF2 3VHPA 2ZAHA 1O3TA 4Q0PA 5CBLA 2DVAA 2Q30A 2HWD2 2RS32 4Q4X2 4DNYA 1O4ZA 1SEFA 3I59B 1RJ8A 3TAYA 3L2YA 1H30A 4XBLA 4LBOA 1LRHA 1C28A 1F9KA 2UWAA 4XFAA 2CNAA 2IXJA 3USUB 3VZMA 2IFRA 1U5XA 1VBC1 2X29A 5CFDB 2EXJA 4KH9A 1G9BA 5IT6A 2CY6A 1V6KA 1QJU3 4BH9A 1W2UA 1UMZA 4R9BA 4GALA 5BNPA 1DGRA 4N43A 1GANA 1V70A 3M4FA 1YNAA 1O91A 3SCFA 3N35A 5DXDA 4COVA 1ZRDA 1FXZA 2WA3A 4D69A 3J8F1 4B29A 4D7SA 3N7JA 5ACA2 2VMIA 3V64A 4LT5A 4HN0A 2ZBJA 5FO8B 3ZFEC 1W6NB 2YGMA 3OTFA 4QQHA 2QVSB 3AYCA 2X5IA 4V1PA 3V0AA 4Q0SA 3MF9A 4R4XA 4TWTA 4D7YA 3EQEA 1FAYA 2O8QA 4RS5A 2H6BA 3ATGA 4Q27A 2PHDA 2WWSA 5K0UB 2CWMA 2EIGA 2Q5TA 5A3LA 1O3QA 2RMU3 1ZBA1 1AYN2 1KRIA 2BEOA 4CEYA 2PN5A 2C1FA 1UCXA 1K5MB 3SHRA 4Q4W1 4Q4Y3 1BMV2 2HWB1 4XJWA 4HKWA 4PDWB 2MNGA 5AC93 2EAKA 2EXKA 4M0NA 3GBFA 3B3QE 4HFSA 2A6ZA 2JXAA 5FLIA 5L36A 4MGYE 2YYOA 1JUHA 2IZWA 3PVOA 1AYM3 1MEC3 1G9CA 1KDKA 1RHI3 2X8KA 2RS11 5FFOC 5T5PA 2OYZA 3E5XA 2EVXA 3B9CA 4MZUA 1DLLA 4QD2A 5I93A 1R083 2XBO3 1IZ3A 4O9EA 1JUIA 4IEYA 4OHZA 1XYOA 2W08A 4BCUA 3B02A 2OVUA 5SV5A 4C1XA 2BVVA 2PLV1 5LEKA 4E2SA 2A75A 1JN2P 5GM0A 3WW3A 1FMD1 3BODA 3N7MA 4AQ2A 4OULA 4XFBA 5H9SA 3SCHA 1Z7S1 3CJXA 1HXS3 3UV9A 3AP7A 4RR3C 4CP2A 1ZZCA 3AP5A 3HBZA 1EPZA 3OD4A 1G86A 2JENA 4QQOA 3ZN6B 3VN4A 3CO2A 4ATFA 4YFZA 1QJX1 3VBHA 1LODA 1QH6A 4RFT0 1M4WA 4XFCA 1DF0A 2XHKA 4Q1PA 1MS8A 3URFA 2OUHA 4HVQA 3CJIA 3WD5A 4HMZA 4URTA 1X82A 3DUIA 4NHMA 1FV2A 4JVAA 4S2FA 3WINE 3H9AA 4YYOA 3S7EA 1NA1C 3ILFA 2B7YA 3MICA 2R072 4C0BA 4BA6A 1RIRA 2WNVB 2ENRA 3VBSB 4H7MA 4AI2A 3ZYIB 2Z2SB 3VHNA 4NN0A 5FBZA 1HDKA 4R9AA 1OA2A 4IEPA 1Q43A 5EV7A 4XFHA 2IXLA 5IK5A 2E63A 1BVVA 4FAHA 3MGUA 1RUF1 3FFQA 1CGPA 1RUG1 3JBG1 1Q56A 3W58A 3MLJA 1EY2A 3WLUA 1IS3A 2ZGPA 4XDQA 4LHNA 3AYEA 5T52A 1GSLA 5EZWA 3CF6E 3ZYGA 2RM21 1QKQA 4AFBA 1PO13 1RUE1 5CFDC 3C2UA 4LBKA 3FBYA 3S7IA 1N3PA 1ZBE2 2P34A 4FPYA 3ZXGA 2IWGB 1TME3 1E57A 1IKQA 1PK6A 4DY5A 3AB0A 2GALA 3WQ0A 2PHRA 1WLCA 3D0JA 3TN93 1VBD2 3JZVA 2KM2A 4N43B 4LBMA 3E5QA 2ARBA 2Y0IA 3OPZA 1WMDA 4L2NA 2XVLA 4HLTA 3M3EA 1HRV2 1QXRA 2UY9A 4FPFA 3MZHA 1FOD2 4COZA 5L7OA 3TWIA 1DQ2A 5L73A 5GZDA 3GNEA 1GNZA 1WW7A 2RHPA 4HSLA 3M7AA 1BBT3 1PVC2 1RUI2 4G4FA 4QM8A 1DGRN 1WD3A 1H4HA 1L3JA 2ZGNA 4LHKA 3ZIXA 3VKMA 1ZVFA 3CU7A 2G9FA 2Z42A 4Y1UA 5KHGA 1AL22 4CEYB 2A73B 4YZ2A 1N1VA 1OOPB 3SXWA 1K5MC 4INDA 3RG0A 1GV9A 2C0ZA 1RVF3 4GQ7A 3ZYPA 2GSYA 1TE1B 2A3YA 1VBE3 3ZO0B 1AR71 3ZSKA 1BEV1 2ZX4A 3VHRA 4DQAA 2BQPA 4B7KA 5K8SA 3MI8A 5BXXA 3VHOA 2D43A 1MS3A 4BM8A 1H8TA 2NMNA 2A7AA 3KB5A 2JECA 3KLSA 1UAIA 1O5UA 2VVFA 4GULA 4N9HA 4NO4A 3UK9A 5JLVA 5JR7B 1MR5A 2ERFA 1QJY1 1YCIA 2A70A 3FHIB 2HWF1 4Y20A 4KU8A 4AI8A 1CPNA 4OHXA 2QCSB 4X8NA 3V0BB 1FV3A 2HEVF 3NW4A 3PLQA 2Q1MA 4LNVA 2IXKA 1Y7BA 3AMMA 4AF9A 2BFUS 4BIOA 1OD5A 1ZREA 1JYCA 4QU2A 1LECA 4A7YA 4LUKA 1PO23 2Y0OA 4CDXB 1WGPA 4NR1A 2E7TA 2UU8A 3KT7A 3VL9A 1O3RA 4E2GA 1ND3B 2XL9A 2IXCA 3IT8A 4F83A 2MEV2 3ECQA 4JTNA 4GMP0 2A3WA 4NHKA 3DPRA 4YFWA 3QH6A 1C1LA 3M8LA 1QOTA 1AR83 4P9WA 4QGLA 5FLJA 1LHUA 1J58A 1FPN3 1X50A 1LGBA 4ZU7A 4HK9A 3WHTA 3TNQA 2CV6A 1U5IA 3MPBA 2WNVC 4Q4X3 5JIAA 3VBSC 4FAGA 4YM0A 5L19A 2EALA 4R52A 1J3RA 2VOKA 3LOBA