5IK7A

Laminin a2lg45 i-form, apo.
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
381
structure length
381
Chain Sequence
APLAMVHGPCVAESEPALLTGSKQFGLSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRNGFPYFSYDLGSGDTSTMIPTKINDGQWHKIKIVRVKQEGILYVDDASSQTISPKKADILDVVGILYVGGLPINYTTRRIGPVTYSLDGCVRNLHMEQAPVDLDQPTSSFHVGTCFANAESGTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTRPTGVLLGVSSQKMDGMGIEMIDEKLMFHVDNGAGRFTAIYDAEIPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQSPNSASTSADTNDPVFVGGFPGGLNQFGLTTNIRFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laminin subunit alpha-2
publication title Structural basis of laminin binding to the LARGE glycans on dystroglycan.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 80
structure length 381
sequence length 381
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ik7A01
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ik7A02
1O4YA 4YM0A 4PF5A 4BLJA 3WDYA 3WG1A 3WDVA 1JN2P 2ZGLA 1WLDA 1FNYA 1LOCA 1UL9A 2R1DA 3USUB 4YZ5A 3D4KA 1G8WA 1QOSA 4YM3A 4Y1UA 3RRDA 1WW7A 3IMNA 3LSEA 2D3RA 4XBLA 4FPYA 1AJKA 4YGEA 1SLAA 3AP4A 1PZ8A 1AJOA 2JD4A 2BQPA 2JDZA 1Q56A 2VY0A 1WBLA 2DVBA 3WG3A 2D6KA 2E7QA 2ZZJA 5CA6A 1BQPA 3BIWE 4CTEA 2CWMA 5GM0A 4LBKA 5GLZA 2UWCA 3ENRA 4LBQD 4NO4A 1HDKA 1S0FA 2D6NA 1CJPA 2ZA9A 4Q8KA 1G9AA 5LK5A 2EIGA 2EXHA 3H0OA 1F5FA 1QDCA 4LBQB 2DURA 5T5JA 4P9XA 2GNDA 1LESA 3GALA 4XHBA 3WDWA 1XQNA 3VKMA 1W6QB 4BPZA 2GALA 3AZWA 4BLIA 4U36A 5IUQA 1SACA 3KM5A 5DZGA 3T2TA 2WSVA 2DYCA 1SLIA 2ZGTA 4FPJA 1F9KA 3FLRA 4AVSA 2NYYA 1G9BA 1MS5A 1MS9A 1JYCA 3AZZA 1N3QA 3V0BB 2ZGNA 1W6PA 2ERFA 4FPGA 1D2SA 5HCAA 4GXLA 1DQ5A 1GV9A 2WJSA 2ZKNA 4Q8LA 5T50A 2C9AA 2C5DA 2DUPA 4XBQA 2ZABA 1WD4A 1AX0A 2EALA 3OBRA 4XIOA 5IK8A 2D6PA 4GALA 4K1ZA 1SCSA 2WT1A 5FREA 3SITA 1GYKA 3NWKA 1FV2A 1S0IA 3WCSA 3V0AA 1LHWA 1WW5A 1LHOA 4FPHA 2A6ZA 4H55A 2DVGA 4ZKTB 4YZ3A 1ENSA 1UZZA 1J1TA 3ZSMA 4FQZA 4PBOA 3AXDA 4F83A 4XJ9A 2V73A 5EYXA 2CTVA 3UJQA 2WKKA 3WHTA 2JECA 1DHKB 3ZXJA 3ZVXA 1BKZA 2OVUA 1CONA 1V6KA 3B69A 2VW1A 1A78A 5KXDA 3O0VA 3OY8B 3POSA 1SCRA 3POYA 1JBCA 2NZ9A 1V00A 3N7MA 4YFWA 3A4UA 4FOQA 4Y22A 2EXJA 5E88A 4ZXKA 4XTPA 3SNMA 2W68A 1W6OA 1N1SA 2LTNA 3VKNA 1KDMA 4FPEA 4XYXA 3OPZA 2VXRA 1APNA 1YO8A 5GLWA 1C4RA 1AX2A 2D3SA 1GZWB 5JMCA 1H9WA 3RG0A 2GMMA 3JUUA 1IOAA 5IT6A 1V6OA 2ZHLA 1YRZA 1KJRA 1ZA4A 3HN1A 2JE7A 2DVAA 1ULGA 2NN8A 3PMEA 2PHUA 2VU9A 5EWSA 3WNXA 1LEDA 3AYCA 4YGBA 5H9SA 1JOJA 5T5PA 1Q8VA 5GZGA 1GSLA 5BYNA 2D6OX 2PHFA 1MS8A 3B9CA 2P3KA 1DYKA 1EPWA 1W6MA 1LULA 5JOZA 2JKBA 2PHRA 1N1TA 5JOYA 5T55A 4YW4A 3ZXFA 1LU1A 5HCFA 3M2MA 1GZ9A 4M00A 4Z8BA 4W65A 2UWAA 1SBEA 2DV9A 5KXCA 2B7YA 2PHXA 3AYDA 1AXYA 4FP3A 1URXA 3AZYA 4DPNA 3WOGA 1S0JA 3VKFC 4WV8A 5HCBA 2SBAA 5DG1A 4YZ1A 4BOWA 1WUVA 5GZDA 2VW2A 4AVTA 4YZ4A 1V6NA 2EAKA 3ILFA 4M01A 2OUJA 3D5OA 5DZFA 3VKLA 4YZ2A 3RMXA 2PHTA 2EXKA 1IS4A 2CL2A 1DBNA 1G7YA 1WD3A 2EF6A 1W6NA 4NOTA 3BODA 1LGBA 2AENA 4XJAA 3WG2A 2JE9A 3B3QE 2FHRA 3WCRA 3ZXLA 4U2AA 1AXKA 3OBTA 4BQ1A 4M3CE 2FMDA 3AYAA 2VW0A 5SV8A 2R0FA 3KQRA 3V65A 1W0OA 3UL2A 3Q9OA 1UPSA 1S0CA 3FBYA 2NMOA 1SLBA 5GZFA 3WDTA 2NMNA 1RINA 1X50A 4P14A 3SLIA 3V64A 4YW5A 3IN9A 2A6YA 1Z78A 4D69A 2D44A 3ZPYA 1IS5A 1MS0A 2VH9A 1N3PA 4Y1XA 1S0BA 3WG4A 1HKDA 2WLQA 3NV1A 5JLVA 4AYUA 4XDQA 2V5YA 3OJBA 1UX6A 1JUIA 1ULDA 2XB6C 4Y1VA 1UKGA 3PVEA 1SFYA 2CWSA 1UN1A 2RHPA 4HL0A 4XXAA 4Y26A 3IM0A 1GANA 4Q1RA 3O0XA 1VAMA 1CESA 4HANA 4XJ8A 4C1WA 5DUVA 5CNAA 4I30A 3WZ1A 1H30A 1GICA 1W6PB 4BMBA 1YI7A 1I1EA 3QCWA 1MZ6A 1QKQA 3WV6A 2D43A 1N1YA 2E51A 2P3JA 2ZMNA 3OYWA 2A3XA 1CPMA 1S0DA 2OUHA 5E8AA 2E53A 5H9QA 1HQLA 1CVNA 1FAYA 3FLPA 3WVJA 1Q8QA 4FOVA 4JCKA 2Z42A 1GLHA 5CB7A 1LU2A 2WT0A 1FV3A 4XHXA 5T52A 3ZXEA 3V0AB 2ZMLA 1QNYA 5GJ6A 1AXZA 2PHWA 1LHUA 3WLUA 1DZQA 4RL7A 1HLCA 1LHVA 1V6LA 4PCRA 2Q5TA 2YZ4A 3NV2A 3TB0A 3M3QA 3R4UA 2GMPA 2ZGQA 3T1LA 1WLWA 5DUWA 1VIWB 1WW6A 2GDFA 5GALA 2YXSA 1S0EA 1W0PA 2W52A 2P37A 1S0GA 4MYEA 5JDBA 1PZ9A 2KM2A 3N7LA 4JC1A 4ITCA 1JW6A 5JVVA 1KQRA 4Y22B 4OZXA 4GWMA 3VV1A 1LTEA 1LOBA 1S1AA 1W6OB 2GMEA 3HMYA 4M3CF 3FUOA 1QOOA 5GLTA 4Q27A 2AH2A 1WW4A 1Q8OA 2R0HA 1RITA 1DQ1A 1ULEA 2GN7A 2ZGOA 2CYFA 1FATA 4C1XA 2EXIA 2ZHMA 3BOPA 3RS6A 1FYUA 1QDOA 2AGSA 1GNZA 3AK0A 4AGGA 2XG3A 1V6JA 3NV3A 2R16A 1DQ0A 1LEMA 4R9CA 3W58A 2ZHNA 4XZPA 4AGVA 1B09A 1MZ5A 1BZWA 4YG0A 5F9TA 1NXD1 3SH4A 1NLSA 4L8QA 2DVFA 4WZFA 4Q1PA 1JXNA 4R9DA 4UW5A 4Y1YA 1W6MB 2YMZA 3INAA 1SLLA 2ARBA 3B01A 4SLIA 4XJWA 3ZSKA 2WQZC 1MR5A 5IK7A 3IPVA 3O12A 1LECA 2TEPA 4LBNA 3ZSLA 4CZSA 4ATEA 2UWBA 2DVDA 1YYNA 3ZSJA 5H9PA 2DUQA 1YIFA 3N36A 4ISRA 2P34A 1I3HA 1G9FA 1KJLA 4P9WA 4AVVA 1MACA 5KXBA 1BYHA 4ISQA 3D6EA 1DQ2A 1DGLA 1MS3A 4DQAA 1VAVA 3APBA 1DFQA 4M3CA 1LOGA 4YW3A 4DS0A 1IS6A 1C57A 3O5SA 2VUAA 3LCPA 2W39A 1W6NB 1ZM1A 1CQ9A 1V6MA 2A7AA 2YY1A 3MW3A 3PVNA 4YFZA 1LJ7A 1GZCA 1ENQA 4YW1A 1UMZA 2UURA 1QU0A 3N3HA 1WCSA 3N7JA 2P3IA 1LHNA 1SBDA 2JJ6A 1A3KA 1AZDA 2R49A 3O0WA 5T5OA 2UU8A 1MVEA 3I4IA 4YG6A 1IS3A 1ONAA 4Y20A 4XTMA 1U0AA 5KXEA 4TYSA 2AREA 1JHNA 1LOEA 1UZYA 4GWNA 3M3EA 1SLCA 3W59A 4DRVA 3T1MA 3AJZA 1MVQA 2ZACA 3PVOA 1LODA 3UJOA 1KDKA 3QLQA 2W08A 1CPNA 2A3YA 4PQ9A 1KITA 3AXEA 3USUA 2ZBJA 1V6IA 1CIWA 3MEPA 3WUCA 4YLZA 1DQ4A 3AFKA 2P2KA 1KRIA 1C1LA 1LOAA 4WVVA 1GKBA 5DZEA 1FX5A 2GN3A 4FPCA 4Y24A 3M1HA 3ZYPA 5JOXA 5DXDA 1A8DA 4FPFA 3JU9A 4FVVA 2YROA 1SLTA 2NM1A 1Q8SA 1AX1A 1R1ZA 2ES3A 3ILNA 2WSUA 1N1VA 3ZYRA 4FPOB 1Y7BA 2ZGRA 1OFSA 3AJYA 1ENRA 4K20A 3TAYA 4XOGA 2ARXA 4GKXA 4DRRA 1DLLA 3HR9A 3OYWB 4BMEA 1ULFA 5JOWA 1N3OA 3AP6A 4WVWA 4BM8A 2ZGMA 4AWDA 4PBPA 3C2UA 4LBQA 4AGRA 4ATFA 2D6LX 4GA9A 2SLIA 3PJQA 3FFZA 4RA0A 3N35A 4K1YA 4XJUA 1LOFA 2ZMKA 4YW2A 2NP0A 2DWRA 1W6QA 2DU0A 2DUOA 1Z0HA 1QNWA 2OW4A 1IKQA 1LGCA 4CRQA 1LGNA 3RSJA 4IQPA 1DQ6A 1VALA 2PELA 2I2SA 4R9AA 4DFSA 1H9PA 1F31A 5EXOA 1QGLA 2DTYA 4FP2A 1CR7A 3ASIA 2YV8A 3V0BA 2AUYA 1WLCA 2A6WA 3AX4A 3FUQA 4UW6A 2ENRA 2LALA 5DG2A 1TEIA 2E7TA 5EYYA 5H9RA 2CNAA 5L73A 3M3CA 4LBLA 5GLVA 1N47A 4TZDA 5F5QA 1QF3A 3B00A 3VUOA 2G4IA 1AVBA 1G9DA 2A71A 3WUDA 1BXHA 4FPLA 2A70A 3LSDA 3SH3A 1JYIA 1WBFA 1LCLA 2D3PA 2AR6A 2A3WA 2ZAAA 3AYEA 4FQ4A 4XMAA 3DGTA 2A75A 5T5LA 3WHUA 1UAIA 4ASMB 3AP5A 4XIKA 3POWA 1QOTA 1PZ7A 4XILA 5IK4A 4FOYA 1LOFC 2DTWA 1GNHA 4XJZA 2E6VA 4FOWA 3AZXA 4KBBA 3ATGA 4FPKA 3ZXKA 1OKQA 3U4XA 2GNTA 4LBMA 1GBGA 5DUXA 5GLUA 3FLTA 3NV4A 5GZCA 3ILRA 3UK9A 3OY8A 5AVAA 1DIWA 1HQWA 1IKPA 4XE9A 2WT2A 2R1BA 5GZEA 3MW4A 3L2YA 1LENA 2A6XA 4YGCA 4UW4A 3R4SA 1Q8PA 3IPVB 4P9YA 3M3OA 5CAZA 1MS1A 4GKYA 4UW3A 5T54A 3VKOA 4XMIA 1GZWA 2GNMA 4Y1ZA 5DUUA 5CBLA 2ZGPA 4XXPA 1D0HA 5FRAA 3WDXA 2DU1A 4JRAA 4LBJA 3RQ0A 3DUIA 1RIRA 3R05A 4M3CB 1SBFA 1OQ1A 4LBOA 3CNAA 3AP9A 2AYHA 4Q26A 3OGGA 2D6MA 1G86A 4Q2FA 4YM1A 3IKWA 3MW2A 3MPPG 3N7KA 2A6VA 4R9BA 5E89A 4K21A 1C1FA 2WNEA 3RMYA 3AP7A 3I8TA 2H0BA 1O4ZA 3BTAA 1FNZA 1AF9A 2A5ZA 2ZGSA 4YG3A 2GNBA 2ZGUA 3WDUA 5IK5A 3SH5A 4Y20B 1VLNA 2D7FA 4YGDA 1MS4A 2CY6A 1CN1A 3AZVA 4YM2A 3A0NA 1G9CA 1YXWA 3SISA 2ZGKA 1BJQA 2HYKA 3A0KA 4XBNA 1QMJA 1ULCA 1DYPA 3GNEA 2ZHKA
chains in the Genus database with same CATH superfamily
1O4YA 3RZGA 4BLJA 3WDYA 4LMFA 1RMU2 1X36A 4HVQA 2BBAA 3WQ1A 5F3EA 4QU1A 1FNYA 1UL9A 2VTXA 4HK9A 1RTVA 4IEXA 4KWUA 4YZ5A 5L7OA 4QHZA 1CIYA 4Y1UA 2VQ0A 2D40A 3VBRA 4UBHA 3T4HB 2G1MA 1AJKA 3UYJA 3NRUA 3AP4A 3LFIA 4NIIA 1NG0A 4CUGA 1IQAA 1ND3A 5CFDB 4AQTA 3OB8A 5LBEA 5J3UA 4CP1A 5CFCC 2E7QA 2ZZJA 4UF0A 4GWIA 4KWJA 1VR3A 1XYOA 1VBB3 3AMHA 4PQQA 5CA6A 1BQPA 4CTEA 3WNMA 5FPZA 4PI2A 4LBKA 3PL0A 2UWCA 5GLZA 4F3JA 2OIIA 5F39A 5T3NA 1S0FA 1CJPA 3K4AA 3WSOA 2EAAA 3B02A 3ZXGA 1FT9A 1H2MA 1L3JA 1H8TC 3SEPA 1PK6A 2DURA 2XHNA 2GNDA 2C24A 2BGCA 4XHBA 3USSA 3RZHA 4CVUA 1O5LA 1W6QB 4BPZA 2HWB1 2RS53 4BYYA 4U36A 1WMEA 3T3YA 5IUQA 1TME2 1W8OA 4UFIA 2ZGTA 2DYCA 4A41A 5L36A 2VZRA 1G9BA 4CXWA 1MS9A 4LR4A 2HJIA 1WCUA 4NPLA 3J7NA 3OUJA 2O8OA 2VGDA 5FO7B 1W8HA 2JEMA 5LA9A 1MEC2 2ERFA 5BNPA 1J84A 1DQ5A 2HKXA 4WM7C 5FLIA 5T50A 4CCDA 3E6DA 4RR3B 4EE2A 2Y6HA 3G7DA 3A22A 5FMCA 1AYN3 1HRI1 2P4EA 2EALA 3OBRA 4KNCA 1PGW2 3RWKX 4AAXA 1SCSA 4IV3C 4H7LA 5L9RA 3U75A 3VBFB 3V0AA 1RXFA 2ZX4A 1WW5A 4ZKTB 2VZPA 1UZZA 2Y6LA 2J1VA 2D93A 1BBT1 2W46A 1RUJ2 4L0PA 4QPGA 2JECA 3ZXJA 3AM2A 5CU1A 2ZKLA 1ZA7A 1PVC3 1RJ8A 1XPWA 3H1MA 1ODMA 2RV9A 2HWB3 3POSA 4NRPA 2ZEWA 1GP6A 1SCRA 2WAAA 4QM8A 4H7MA 4XABA 1W8WA 2GP3A 2EXJA 4ZXKA 4OVEA 2N7GA 4MOAA 2BOJA 1XNTA 3VD5A 1W6OA 1OLQA 2XXZA 2YC4A 2H6BA 2YB7A 4XYXA 5CKMA 3U10A 1PMHX 3I3EA 4I3GA 1ALYA 1I5PA 2R32A 3MHZA 3MDPA 1CAWB 1PGSA 2W1WA 2B8MA 3CBNA 3CU7A 1VBA2 4XQDA 5IFTA 4LEJA 2ZPXA 2BRTA 3UV9A 3WW1A 2Y6JA 1ZA4A 2DVAA 1ULGA 2R30A 3U37A 5LBBA 1DGRA 3KD4A 3WNXA 5H9SA 1RUI2 1SQ4A 2MEV2 5T5PA 4AI0A 4XPVA 1HXS2 1ZRRA 1PHMA 5HXVA 2R071 3NVCA 3MIBA 5A70A 2P3KA 2TUNA 1EPWA 4GMP1 3GZTB 5F1RA 1BBT3 3WNLA 3VDBA 1D4M1 5T55A 3MIEA 3HPNA 1LU1A 4IL7A 5F2SA 5FZCA 3LDRA 1RUH2 1RUF3 1ZBE2 4ARXA 1R081 5KWRA 2B7YA 1Z7S1 3KQ4B 1UYPA 1AXYA 1LRHA 4WVZA 3AZYA 3SHRA 3HAGA 1S0JA 3VKFC 3AL5A 3WOGA 4CEYB 5ACA2 2SBAA 4QKBA 1VMJA 4LHLA 5FY5A 5ABJB 5LW9A 5GZDA 1ZREA 3TEYA 2VECA 1NUKA 1KEXA 1QH6A 1IHMA 3PNAA 4K7JA 2EAKA 4O7XA 2AEZA 3ILFA 3ITQA 4HVRA 1UQXA 2EXKA 5JZGC 2WNVA 3B94A 5K0UC 3ZFGB 2YBPA 2VOVA 4MGZE 3DXUA 4AI1A 2VCBA 4DXZA 2IZWA 2H0VA 5KC6A 4HPKB 1XC6A 2RS31 3I7DA 3B3QE 3WCRA 2FHRA 3WXPA 1NA1A 2QQUA 2FMDA 2R0FA 3I59B 4QDQA 5C5UA 3Q8AA 3I54A 4JRLA 4AAPA 4YVWC 2LM3A 2R073 1H1MA 4P14A 1X50A 3LB9A 5IVBA 4YW5A 2IXKA 1PIV2 3GCXA 4BZ4A 4GMP3 4RN5A 3P3NA 4AL9A 3QBQA 1D4M3 3SCGA 5KC5A 3K3OA 3ZPYA 2HWC1 5I0TA 3CO2A 3LDBA 5D8AC 4Y1XA 2HWF1 1UYZA 2ID4A 3LKJA 3WG4A 4XUQA 5A33B 3T0DA 1R083 3ZO0B 4P00B 1SG3A 4AYUA 2OPWA 5LEKA 3OJBA 3NW4A 1ULDA 1Z7S3 1OLME 2ORZA 2PYTA 3FBMA 1U5IA 1UN1A 3M4FA 3THPA 1OF3A 3WQ0A 2Z79A 4LTAA 2Y0IA 4HETA 1GANA 3KCXA 3CHXA 1Y9MA 4Q4Y2 4HANA 1OA2A 1O8PA 3NQHA 3DPRC 4XFGA 2VMHA 3DYOA 3T2QA 2RVAA 3EHKA 3H3ZA 1C8M2 4HXCA 2DFCA 1W6PB 4C0HA 1R1A1 3Q8EA 5LRRA 1DGRN 3QCWA 1I1EA 3I2OA 3BU0A 2Y33A 4QX5A 3WV6A 4FCAA 2CGOA 1N1YA 1NLRA 3GJAA 1K5JA 3OYWA 2OUHA 5E8AA 5H9QA 3QACA 2KXLA 4BISA 3I49A 1A8MA 1WCDJ 3WVJA 3MFAA 4JCKA 3UT0A 2Z5WA 1HRV1 2UY8A 4ES8A 1QJU1 3ZXEA 2JDMA 4WZCA 1JTZX 1QNYA 2WFF2 2PAEA 3GBWA 4BQYA 1RUC3 2K9ZA 3R0RA 4RL7A 1W06A 4Z07A 1CAVA 3NV2A 5F6KA 5BNOB 1O3QA 1FOD2 1RVF2 2GMPA 1NCQA 2X5IA 4RHV3 2JIJA 1AR73 3CDZB 4KH9A 1VIWB 2HWF3 5DUWA 3ZYIB 2UY9A 1VBD2 1W0PA 1O3RA 3MIHA 4CDQA 2P37A 1S0GA 3U1XA 1JZ7A 5FO9B 5B4NA 1I6XA 1F35A 1YI9A 2BNNA 2KM2A 1AR62 2WQ8A 4NRMA 3FC0A 3IBMA 1PMJX 2VUCA 3OUIA 1S1AA 1LOBA 5CEHA 1ASJ1 2BGOA 4MX3A 2AH2A 1WW4A 2QQIA 1RITA 3BOWA 4NMIA 1R1A3 2QTWB 1D4VB 2E31A 2DCZA 4FXGB 3HNBM 1QDOA 3AK0A 3FHIB 3ZKUA 4AGGA 3S5AA 3WINE 3VBSB 2IXIA 2R16A 2V5DA 3GGLA 2QQVA 5D21A 3NAPC 2ZHNA 5FYYA 3QD6A 3W58A 1OUSA 1MZ5A 5F9TA 3JQXA 5BY5A 2HH9A 3BIEA 1NXD1 4CDXC 1CZVA 1QQP3 3N9MA 3IIAA 1ND2C 4Q1PA 1NCRB 4Y1YA 4UW5A 1J3RA 3KT4A 1W6MB 3INAA 5FMOS 2Q8CA 2VBBA 5CISA 3ZFEC 4IV1C 2HWD1 1UXZA 3KCYA 3RZZA 3ZYBA 3I3QA 3O12A 4QHOA 4B4PA 1YUDA 5FIXA 5H9PA 5FQ0B 3ZFFB 1IQDC 4D7TA 1KJLA 4JQTA 5KXBA 1MACA 2VZOA 1REEA 3VBOB 1DQ2A 1DGLA 5A3UA 1J59A 2MHFA 1VAVA 1ASJ3 4M3CA 4W50A 2XVKA 4LPLA 1IS6A 2VCCA 3K75B 1C57A 2XL9A 3ZN6B 4NPRA 2VUAA 4RYDA 1UIJA 1NKGA 3FHQA 1IGOA 1Q43A 1W6NB 1ZM1A 1CQ9A 1V6MA 1JHJA 1LJ7A 4A3XA 1ENQA 4JGYA 1UMZA 5EZWA 3N7JA 3N3HA 3E97A 1UPIA 1A3KA 2ZOEB 5T5OA 2CAUA 3E1F1 2UU8A 5DAQA 4OMCA 3ZMOA 1MVEA 3GHNA 4QX0A 1SZBA 1JHNA 2HLEA 5CVRA 5FO8B 5C9AA 3ZIWA 1UZYA 2WBKA 2ZX1A 4P9JA 4W8JA 5FXZA 3W59A 4CDUB 3H3UA 3AJZA 2JWPA 1NY72 4Z1VA 3IDEA 4ZPIA 2Y8KA 2Q8EA 3RYPA 3S7IA 4MGSA 2HWD3 3UJOA 1KDKA 5FP7A 2OZJA 3NJXA 2PAKA 3QLQA 5IAVA 3H1WA 1KITA 3PU8A 1QEXA 3PVBB 1UZVA 4UFMA 4YLZA 5EV7A 3JXSA 2P2KA 4F8AA 1KRIA 2PAMA 5JR7B 1EV12 1FX5A 1XNDA 4UXAA 3OUHA 5IW0A 3ZYPA 3CJIC 4D8MA 1S2KA 5DXDA 5CFDA 5JXHA 1YQ2A 4JKMA 2E26A 5FXWA 3FX3A 2TNFA 5J96B 4AF9A 1Q8SA 1W28A 1AX1A 2XQXA 1RXGA 1NE6A 1VBE1 4I0WB 2VAUA 4V1PA 2ARXA 4BXFA 4GKXA 1DLLA 3HR9A 4BMEA 2XQRA 5JOWA 1N3OA 4WVWA 4BM8A 2ZGMA 2VCMA 5G04L 4AGRA 3ZR5A 1GUIA 2NP0A 3N35A 4K1YA 4LOSA 4ZONA 1W6QA 2DUOA 1Z0HA 4DIQA 1C5IA 4GB32 2E7AA 3BPZA 4CRQA 2WYFA 3RSJA 4D7SA 3AMPA 5JI9A 3VDAA 1OUXA 4QQPA 2WS92 2VUJA 1H9PA 4UOJA 4AQ2A 1D2QA 1XOYA 3M3IA 4J6GA 4N53C 5FYSA 1UZWA 1KGYA 1O4TA 1RUE1 1WLCA 3AX4A 3ECQA 4LHSA 4LITA 5DG2A 1TEIA 5FY0A 5FY7A 5KHHA 3JQWA 5L73A 4HKWA 1R091 5GLVA 1W2TA 5F5QA 4RR3A 3CKHA 4NWWA 3VUOA 2XLFA 5DMYA 1BXHA 4LO4B 2PN5A 3NO8A 2A70A 2DCKA 3D82A 1HB3A 5I8SA 1JYIA 1WBFA 2XBO2 1ZZCA 4DXTA 1LCLA 1X7NA 2D3PA 5C8CC 1TZOA 3VBFA 1TVGA 4J1WA 3CQOA 3POWA 4A3ZA 5BV6A 4LHKA 4AHWA 1PZ7A 5IK4A 4XDOA 4O9GA 1GNHA 4I0BA 4XJZA 1VAKA 4KBBA 4XFAA 3RZLA 1B35C 3OBAA 3DN7A 3U4XA 2GNTA 4LBMA 1GBGA 2LS6A 4Q4W2 3FWEA 3LIGA 2GZWA 2RMU1 3PUIA 4IEOA 3TN93 5GZCA 3TOJA 3UK9A 5E1RA 1BEV1 2ADEA 4WM8B 5AVAA 3VHNA 4A45A 3QOPA 2WT2A 4QXHA 2VQAA 1RHI2 2G9ZA 4XE9A 3N9PA 2FD8A 3L2YA 1LENA 2A6XA 4YGCA 1BK0A 2XJQA 4UW4A 3H7JA 1Q8PA 2DDUA 3NJYA 2Y60A 4JGZC 5JSPA 3LAGA 4JHTA 4MADA 4OI1A 4COVA 4XCBA 2JDHA 2PLV3 2GNMA 1VRH2 4XMIA 1UO9A 1CAWA 4NIHA 2BV4A 3I2KA 4QX2A 2BDRA 5FLHA 4H3WA 1HN1A 1MQTB 2JIGA 3R05A 4LBJA 3X29B 4BQ2A 5KHGA 4L92A 4RS5B 2VNOA 3FHAA 1PO13 4LKEA 4Q26A 4ZS2A 5KHKA 2ZEYA 4Q2FA 2ZX0A 3LDKA 4GQ7A 5BNNC 3N7KA 1PGL2 4LUMA 4R9BA 1CD3G 1ZZ6A 2WA4A 1L7QA 3AP7A 2Z69A 1O4ZA 2JB8A 2X53S 5FUIA 2VMCA 2ZGUA 4B4QA 4UFJA 4Q4V2 4MO3M 1RMU3 3F2ZA 4EWDA 3EB7A 5A1FA 2WZR1 4YM2A 1G9CA 1ACCA 2RMU3 4Z92B 1BJQA 2VULA 5AC91 3NMBA 3A0KA 4XBNA 3SCHA 5A3PA 1ULCA 1DYPA 3MYXA 1OLMA 3LIHA 3GNEA 4CEYA 3LE0A 4CCNA 2V72A 5ABJA 3WDVA 3POGA 4S2HA 2R1DA 3DEMA 3USUB 3VDDB 3AVSA 5FZHA 3D4KA 5FPXA 5FFOC 3W5NA 5J48A 5FJHA 3I3BA 5A1AA 4V2VA 2VOXA 3RRDA 3ZFGA 3DKQA 4QAWA 3WY6A 4B1MA 2QQKA 3FMGA 1RUD2 4HPKA 2MPFA 4BE3A 1PZ8A 2DFBA 3AKPA 2BQPA 4M4PA 1Q56A 1PNFA 2VY0A 1WBLA 3WG3A 4YWAA 1JI6A 3I59A 3VN4A 2V4AA 3KHCA 3J8F1 4DO0A 2WQ4A 4GJZA 5GM0A 2OYZA 3ENRA 4NO4A 3ZMNA 4MUVA 1HDKA 5BNQA 2D6NA 2ZA9A 1GR3A 2ZZQA 2O0OA 3I2IA 3K48A 1YCIA 4XACA 2EIGA 5EQUA 5LK5A 3VDCA 5CKNA 2PQQA 3I97A 4LBQB 3ACIA 4K3UA 5T5JA 5A1LA 4G3YC 3H8RA 1LESA 3GDBA 3GALA 5DAXA 1O3TA 4CDWB 3MO4A 4HKOA 3WDWA 1CZSA 1XQNA 1SFPA 5A33A 4E4DX 2A73B 1PO21 2XH6A 3GBFA 5AC93 1UU6A 3KLSA 3AZWA 1UU4A 4BLIA 1F15A 1SACA 2K46A 4UI9L 5J98B 3A21A 5A32B 4CEWB 4ZY9A 2WSVA 5L7OC 1SLIA 2LUWA 4GH4B 5FOJB 1F9KA 3FLRA 4AVSA 1MS5A 3ROUA 1JYCA 4Y5TA 3WT3A 3VBRC 3ACLA 4XQWA 1QWRA 5FMDA 2MEV1 5FZEA 2ZGNA 1DGWX 4XF0A 1W6PA 2ILMA 4XC9A 5HCAA 1ND3C 1VRBA 4RQPC 4GXLA 2ZKNA 4Q8LA 5JMOA 2C9AA 4AI8A 2C5DA 4MG2A 4X6RB 2DUPA 5JSOA 1RUJ3 2IXCA 4ORFA 1AR81 5FXVA 3K2OA 5IK8A 5JWPA 2PTMA 1XBFA 4K1ZA 3T0AA 3J8F3 4QT6A 2WT1A 4XW3A 3KF5A 1JOPA 2W0XA 1LHOA 1VB4A 1GQPA 2A6ZA 2AEYA 2DVGA 1PK6C 5J1XA 3VZLA 4PIXA 2VE1A 4XURA 5I0UA 3TNPB 1KFXL 1XNKA 4XJ9A 5BNOA 2V73A 3BTYA 5FZ3A 4PF1A 2D5HA 3WHTA 4I01A 1DHKB 1S2EA 2X8KA 1BKZA 1WA4A 1CONA 2EVXA 4QKFA 1V6KA 3B69A 3PUHA 4XQ4A 2VW1A 3ZLIA 5KBFA 5HV4A 4GJYA 1PO23 1JYXA 3HQUA 4AK3A 3O0VA 5FZOB 5JIAA 2XJSA 3N7MA 4OHZA 1GZTA 1ZBA2 3A4UA 4KBZA 5I0DA 3JBG2 4XTPA 3SNMA 4QHBA 2JDKA 2G9FA 1N1SA 2LTNA 5FP4A 5A3MA 3L9JT 2Y6KA 4JTOA 4XAEA 5BNPC 3GZEA 1RUI3 2MEV3 3WW4A 3WF4A 4XF3A 2ARAA 1LKNA 1APNA 2VXRA 3HOBA 1GZWB 1UIKA 1JOBA 2WDBA 4UFLA 3UGFA 2W2IA 4XFBA 5C3PA 1H9WA 5JMCA 3RG0A 2YC0A 2GMMA 1SDWA 4GAZA 3IZOA 1V6OA 3E5QA 1YRZA 4IGPA 4AOCA 2JE7A 2PMWB 1JYNA 1NLQA 3KB5A 3VBSA 4FO9A 1AR83 1H8VA 2VZVA 1OURA 2EIBA 2RG4A 3VBHB 3VBUB 4YGBA 1Q8VA 1D0GA 4R8HA 2QQPA 4HN1A 4OULA 4ET7A 2PHFA 5C70A 1MS8A 3LPGA 4BIFA 3J9SA 1NCRA 2Q8OA 2VD7A 3U78A 1DYKA 1W6MA 4QPGC 4E4HA 2XPJA 3ELNA 1LULA 1CJDA 1XSRA 2PHRA 4IUGA 5A3LA 3N9NA 3AB0A 1US3A 3ZXFA 3B7MA 5FPBA 4HONA 2UWAA 2DV9A 3GZAA 3ZFFA 5FQ0A 1REFA 4QQOA 3ZN4A 5KXCA 1SMVA 3S6PA 3WX5A 4FP3A 1URXA 4H14A 4DPNA 3I2GA 3VBOA 2BWAA 5DG1A 1W05A 2PFWA 3P6BA 4JKKA 4BOWA 2GC1A 3OPWA 4AVTA 1DDLA 1V6NA 1XNAA 3BPSA 5DZFA 2BFUS 2OUJA 3ZN6A 2PHTA 1G7YA 1WD3A 1W6NA 3K46A 3M70A 4NOTA 2AENA 4KL1A 4NAOA 4BQXA 1QJZA 4IETA 2JE9A 4QB2A 5C4WB 4W6WA 2YGLA 3OBTA 4BQ1A 3NJVA 4M3CE 4RQPA 3A7QA 5HI0A 2P3YA 2VW0A 2YFZA 1AYN1 2E33A 2QDRA 3KQRA 1W0OA 4AVCA 2JE8A 3I3DA 1SLBA 2WC2A 4UFKA 3WNKA 3IDCB 3MBWA 3ME2A 5LCWL 4CDUA 3IN9A 2C0ZA 3O1UA 4D69A 2PHLA 1QJY2 3EQEA 4TN7A 3OBZA 4JDMA 1IS5A 4Q4Y3 5D2AA 1JUHA 2ARCA 1N3PA 3CL1A 5IATA 1S0BA 1JZ2A 3E6CC 1HKDA 3SKJE 1J3PA 1DLCA 4BQWA 1TMF2 4JVAA 4NROA 3MV11 1PVC1 4XDQA 1UX6A 3E6BA 2XB6C 3KV6A 4RGKA 4Y1VA 2FCVA 3WR0A 5FDBA 4N9HA 1SFYA 3B93A 1WCKA 3ETPA 4X8NA 4FAGA 3N9LA 5JAXA 2WNUB 1GWMA 4Q1RA 4XXAA 1NE4A 4Y26A 4AR2A 1VAMA 2WN3A 1CESA 2WNVC 3JD72 1JODA 1IG3A 2Z4FA 5CNAA 3VZKA 3MIDA 4FFIA 3KF3A 1YI7A 2X29A 2RM22 1YQ5A 4NRQA 1ZZ9A 4PDWB 5ISLA 1QKQA 1J58A 4QQ2A 1NA1C 2E51A 1XJAA 1F4HA 1AR91 2QKDA 4OHWA 1FOD3 1HQLA 3OG2A 1RJ7A 4FT8A 4LKSA 1FAYA 4E8CA 1Q8QA 3IDBB 3O7OA 1X82A 4EV0A 4XHXA 5T52A 3FL7A 4UT5A 2BW8A 5GJ6A 3WF2A 1LHUA 3K3NA 3PMSA 1AR63 1DZRA 1LHVA 4PCRA 4Y3OA 3TB0A 3C8XA 2BYVE 3R4UA 2B4KA 2ZGQA 3MI8A 3T1LA 4IE6A 4BCUA 1WLWA 3OPTA 2JG9B 1XU1A 1OOPB 2NLRA 4JKLA 4QGMA 5BPXA 3MUZ1 5FBZA 3DL3A 4PIZA 3ZKYA 4E2SA 4W4ZA 1V9U1 3LOIA 1RUF1 4J1XA 4MYEA 4OMDA 3HT2A 3ZDSA 3RI8A 5DAVA 4ZZ5A 4IEUA 2P6CA 1POQA 2XWJB 1OA4A 5FCCA 1Y9GA 2GMEA 3HMYA 3FUOA 1QJX1 2PA7A 2YBKA 4A6OA 2X05A 1QOOA 1R64A 2OS2A 5IVVA 1AL22 1QXRA 1FMD2 2R0HA 4LK6A 4CP0A 1IPSA 1ULOA 1DQ1A 2P6HA 2WWJA 2GN7A 4CCKA 2ZTNA 2EXIA 2ZHMA 3OGJA 4EZ4A 4PI0A 4UFHA 1UZ0A 2AGSA 1AR93 1WCQA 4PLMA 5FPLA 2XG3A 4TLGA 1K5MB 4DUVA 4JQRA 5JPNB 1GP4A 3ZPOA 4QQLA 1W04A 4OI0A 1RUG2 1B09A 1BZWA 1HV1A 1NLSA 1Y4WA 5BXXA 2XLGA 4A42A 2CSGA 3H7YA 1A34A 1PVXA 1X9TA 1NCQC 2X5IC 3BGAA 3D0SA 4WM8A 2QZ2A 2FDJA 4HN0A 5JSRA 4CDQC 1ZRFA 5C71A 2WWUA 4AFMA 1KFUL 2VMGA 1ZRCA 1UY1A 1X33A 1LECA 2TEPA 2B9VA 2UWBA 1V9U3 2VZTA 4ISRA 2BERA 1I3HA 1G9FA 2P34A 4XF9A 1XU2A 3T4VA 3VHRA 4CCCA 4KGQA 4NHLA 1YFYA 4JTNA 2XJUA 4GZ9A 2Q0AA 3T0BA 3WF0A 5IYYA 1DFQA 1MQTA 1OSGA 1QJX3 4CU7A 4NAMA 3NL1A 1YFXA 1DP0A 2KA3A 3D3AA 4RS5A 3LCPA 4I3PA 4N7UA 2RDNA 2W39A 2XJPA 2AC1A 4YFZA 4N90A 5KHIA 3NNGA 1XNBA 5A6ZA 2HWE1 3OOXA 2HBUA 2KD7A 5LASA 1JZ5A 4AVAA 2QJVA 4DMIA 3TNQA 4LA2A 5A7NA 1IS3A 4BWOA 5DDJ1 5F8PA 5JUVA 3KS7A 4KG0A 4AG4A 1K45A 1W8FA 1ZVFA 2J1TA 5I0SA 1OD5A 1BVVA 5ANQA 1HJFA 1SLCA 1EAH2 5CYYA 5DAPA 2W92A 5FUNA 1RUC1 3O1SA 1W8ZA 4DINB 1L7RA 5C3QA 1ULPA 1W8UA 1LODA 4PJYA 2W91A 4H2AA 1F2NA 2A3YA 1AUYA 4PQ9A 4RHV1 2HEVF 3USUA 1AR71 3VDDA 2ZBJA 5LA0A 2JKXA 4FFHA 2Y64A 4AHYA 1JZ6A 4Q4X1 1LOAA 2LRPA 3WQ7A 2GN3A 2ZAHA 2WWSA 2YPJA 3L2HA 1O3SA 1U5XA 4FPFA 4HFSA 2ETEA 5IVFA 4FVVA 5FYVA 1MZEA 2F17A 4K8FA 4JGYC 3AKRA 4LE3A 1R1ZA 2ES3A 1HV0A 3WP3A 2WSUA 3ZYRA 3LEMA 1Y7BA 2TBVA 1OFSA 1AYM2 1ENRA 1MZFA 2HWE3 2VTFA 3C7GA 3KV5A 4GB33 4K20A 4L11A 3SKVA 3WW3A 3TEZA 5L9BA 4RFT0 4BJ0A 2WZ8A 4AWDA 4PBPA 2C4XA 4LBQA 3SMHA 4FTSA 1VBB2 2D6LX 5C9AC 5DDJ3 2FMYA 5FLJA 3GYDA 4NHKA 2K0GA 4CDWA 3I2DA 3AMQA 1LOFA 2XJRA 2WZEA 2R042 4P08A 4XEZA 1UOJA 3MF6A 2ET7A 4CUAA 2VTXJ 4EN0A 1QNWA 1JS9A 2Q30A 2GC2A 1QQP1 2WAOA 3GJBA 1HW5A 3ABZA 4IQPA 4CEWA 5A32A 2WR9A 4HSJA 2LROA 2BBVA 4P9LA 3BCWA 4GH4A 3ZDVA 4NIGA 5HCHA 5EXOA 3MIFA 1QGLA 2DTYA 3BVCA 2L9LA 2WL1A 3ASIA 2RS52 2WYSA 3FUQA 3I2FA 5FYZA 2ENRA 2LALA 3LPFA 4P02B 4Q4X3 5H9RA 5CFDC 3M3CA 3B00A 1G9DA 2XGXA 4OFGA 2W5FA 1U5ZA 3TRSB 3ZM8A 3H8XA 1LB2A 1XRUA 4XVHA 4Q4W3 2AR6A 4MV2A 4AZZA 1VE0A 2ZAAA 3AYEA 1SPPB 2EIDA 3THCA 3DGTA 4CCLA 2J1SA 2BU9A 4J25A 1X8MA 2W9XA 4GWJA 2CHHA 2OZ6A 3WW2A 1J1LA 1XE8A 3SC7X 2RS12 2UYBA 1OKQA 4XCAA 3FZ3A 4N43B 2GH2A 3RJ2X 5C7GA 2RR11 4OQ9A 3PUAA 3KGZA 3J4UH 2P17A 4N7IA 3CLPA 5FZOA 2WA3A 3HEIA 3LFMA 2JDNA 3HJRA 4G4FA 5G05L 1HQWA 4IGOA 5LATA 3MW4A 1BK1A 1ENXA 2QUOA 4P9YA 1UYXA 1H0BA 2HWB2 2QE3A 3KV9A 4LOTA 5FY9A 3W20A 3P5BA 3SQOA 5FY8A 3VKOA 4RR3C 1ST8A 1GZWA 5A6QA 2ZGPA 1QJEA 1H6XA 2W94A 3WDXA 1GQGA 4JRAA 3DUIA 5LEJA 3B5LB 4MGIE 1SBFA 4A7ZA 4CCJA 5I8YA 4LBOA 4BH9A 5L9VA 3OGGA 2DF7A 1G86A 3VBFC 3VBHA 4CYDA 3VBUA 3MFCA 3LEKA 4QPIB 3F95A 2VR4A 3MF9A 4MXWB 4CCOA 3I8TA 3C7EA 3BTAA 2FDKA 4XUTA 4BU2A 1HRI2 4P9IA 1QXPA 4LLFA 2OPKA 4YG3A 4ES9A 2GNBA 1E5HA 5IK5A 4DZGA 2Y6FA 2YU2A 4XETA 3SH5A 2QQMA 4ASLA 2D7FA 4YGDA 2VVDA 1FPN1 1G6NA 1GFF2 1GOHA 4OI2A 2RR13 2ZGKA 4IDZA 2WLPA 5LY2A 4IE4A 1VBC1 1BBT2 1QMJA 1KD7A 3C7HA 5FBJA 3BTZA 3FJSA 1YHFA 1UU5A 4QXBA 4D0QA 2ZX2A 3VD9A 1JN2P 4Y5Z0 5JR2A 1LOCA 2ZS6B 5FPUA 2V4VA 3JB4C 1UOBA 1G8WA 1QOSA 4YM3A 4TTGA 1AL0G 4ONUA 4B7EA 1WW7A 4BQ4A 4BQ5A 5FZKA 3IMNA 2RJ2A 3KSCA 4FPYA 1SLAA 3B9IA 4DUWA 3NJZA 3BUCA 4XFCA 4XF4A 4AEJA 1AJOA 5C4WA 1YQCA 3RNSA 3C7FA 2DVBA 1OVPA 2D6KA 3ZR6A 1EUUA 4IE5A 2VM9A 3DYPA 1OMIA 2CWMA 5FTTC 4AI2A 5FPAA 5HBAA 4LBQD 4YVSB 4URAA 2GC0A 4P5YA 1X8EA 2E63A 1WKYA 1LAJA 1W2NA 1HB4A 4DY3A 2BWCA 1QDCA 4QX7A 4TSVA 1HQNA 2OQ6A 3LA2A 1FPN3 2JG8B 2R072 3VKMA 3POFA 1CZTA 4Y4YA 4CEYC 2GALA 1UW8A 4NR1A 3TN91 5ABJC 1VBC3 1D4M2 3KM5A 4FPJA 2WNOA 2CDPA 3NNMA 3ZXAC 1S2BA 4E2QA 4KWLA 1SHWB 2WNUA 4NIAA 5LB6A 1CWPA 3H42B 4COYA 1R082 3AZZA 3ZFGC 4AEDB 1W2AX 1T6BX 2RE9A 2GU9A 4DY5A 3V0BB 1Z7S2 4K6BA 1D2SA 4PDWA 1GV9A 4MSVA 2Y34A 2PLV1 1E5SA 5FZIA 1S55A 4AFBA 3GHMA 1C3HA 4NVPA 3LA7A 3ZX7A 1WGPA 2D6PA 3JB8A 4GALA 1PO11 2NPIA 5ERLA 1JH5A 3SITA 4M0HA 3NWKA 4RFRB 1FV2A 4H55A 2RS32 5J09A 3U14A 1C8NA 4P9GA 4YZ3A 1J1TA 1GNYA 1ZBA3 3ZSMA 3JBG3 3UJQA 1ZRDA 2WKKA 4OUMA 1RMU1 2JG9A 1OOPA 2OVUA 2DBIA 2YG0A 5LK7B 5A80A 1JYWA 3MUY1 1DG6A 2O1QA 4B4RA 4EWEA 5KXDA 3OY8B 3DXTA 1BCXA 1JBCA 1V00A 2NZ9A 4HBNA 4LHNA 4YFWA 4OZOA 1V0AA 5ANNA 2F4PA 3HN3A 3AKSA 2HWC2 2W68A 4OLLA 1I9RA 5EP9A 2HWF2 1YFWA 5FZ9A 2WINB 1ZRIA 5FOBB 1YO8A 5GLWA 1AX2A 4UWDA 3HQRA 5A7PA 5FKCA 4CSWA 2P5BA 4NHYA 1H4HA 3JUUA 1IOAA 5IT6A 4DXSA 4EROA 2ZHLA 1PGL1 1KJRA 3OCPA 5HXMA 5F3CA 1K5MA 3PMEA 4QGLA 3MPBA 5F3GA 1PX4A 2IVIB 5EWSA 1XYPA 4AE2A 1JOJA 1R1A2 3THTA 5FWJA 5GZGA 3RI9A 1GSLA 3WP5A 1IZ3A 4ASKA 4B8EA 5CFCB 2K2SA 4YPJA 1WMDA 3PURA 3B9CA 5BNOC 1DZTA 4I0AA 4LKFA 5FYUA 4QX3A 5A7QA 4SBVA 3VZMA 5JOZA 3WP6A 1TME1 1U5YA 2X09A 3H8UA 1W0NA 3U4SA 4YW4A 1HRV2 1H8TB 5EPAA 2B5HA 1QJU2 1BHGA 3M2MA 2IFWA 4A6SA 1GZ9A 4Z8BA 5FMBA 1PX3A 3DECA 1SBEA 3GCWA 1YQ6A 2BOIA 3RDIA 1QJFA 4XUNA 3AYDA 4AHZA 1MEC1 3GBGA 1XE7A 3DV8A 3AVRA 1OD3A 3CZJA 5HCBA 3LZZA 1OC1A 1W39A 1WUVA 3J7MA 3UNPA 2VBPA 2VZSA 1BVP1 4YZ4A 4M01A 3D5OA 3RMXA 3UGGA 5FMOL 3MLJA 2CL2A 1PGW1 4Q0PA 3O1MA 1K42A 4QPWA 4OCTA 3BODA 1LGBA 4O61A 1OKOA 4KGGA 4XJAA 3VBSC 3S57A 1ASJ2 2JDAA 2QQNA 2VNGA 4Y5SA 3POJA 4WM7B 5EFUA 5J36A 4U2AA 1AXKA 1RUJ1 3LQCA 1D7PM 1NYWA 1OQDA 5LA2A 1NCRC 2DCYA 3FBYA 4BB3A 2NMOA 5GZFA 2G19A 4L9BA 2Q1ZB 1MPXA 4WVMB 3OTFA 3PTYA 5EHDA 2PQSA 4IV3B 3V64A 4AQSA 3PLQA 1US2A 5FZ0A 1OHFA 2WUHA 2A6YA 1Z78A 5FZGA 1TME3 4XUOA 2JICA 3CZUA 1MS0A 1E57A 2J1AA 2VH9A 3ZFFC 3WEZA 5HV0A 3BU7A 2WLQA 5JLVA 5CADA 2QNKA 3VBOC 2BVVA 1JUIA 4FI9A 1W3XA 5JXGA 1MEC3 1UKGA 3K4ZA 2CWSA 1W03A 2HWD2 4A7KA 2FCTA 1VBA1 4R4XA 3O0XA 4WBBA 2VQTA 2FZ1A 2I45A 4XJ8A 4C1WA 2J22A 1K12A 4LUKA 3WZ1A 1H30A 4QXKA 2CDOA 3OD4A 4BMBA 1RUI1 4EZHA 2A1XA 2VBDA 1HXS1 2ZJCA 4QX1A 4DEVA 5LA1A 3D8CA 1DU3D 5FZBA 1XNCA 2P3JA 2ZMNA 4B29A 4DEQA 5FZ1A 1CPMA 1IG0A 1DF0A 2IFRA 2E53A 5F6LB 5F37A 4K9SA 1QY4A 4M4RA 3UESA 1UMHA 3AKQA 5E6HA 4FOVA 4LLOA 4C90A 4EN6B 1GMMA 1JZ3A 5B4XA 2WT0A 1RUOA 2H6CA 2IC1A 4CDUC 1RUH1 2ZMLA 1ZBE1 3AMMA 3MLKA 2DCJA 1Y9QA 3WLUA 1YNAA 1DZQA 1XB9A 5F5AA 3S0MA 4QQHA 2I74A 1HLCA 1V6LA 3KHBA 3BYWA 2Q5TA 4QB1A 1JMUB 4TWTA 2YZ4A 5FYHA 5FY1A 4EN7B 3M3QA 3RJRA 4NPMA 5ACA1 2QFEA 3FE5A 1WW6A 5GALA 2GDFA 1C28A 1S0EA 5LWBA 1W9WA 4FFFA 3N4MA 5JDBA 3QH7A 1PZ9A 4JC1A 1KQRA 4Y22B 4CP9B 2XMLA 1VBA3 1JYVA 2B39A 4M3CF 5FWEA 4CP2A 5C33A 4DUXA 4YYOA 1RUG3 4QDRA 1Q8OA 3A23A 4KU8A 4LULA 3T2PA 5K8SA 4PT6A 1GQHA 5F32A 1ULEA 4R52A 5I91A 1SPPA 1HXS3 1FATA 2ZGOA 5JZGB 3ALQA 5K0UB 3POEA 3BOPA 1FYUA 2QZ3A 3P1IA 2I07B 1GNZA 4M0NA 1PIV1 4ZU7A 3POIA 1LEMA 4NHMA 4R9CA 3ACGA 4QD2A 4YG0A 1VBE2 4BK4A 4N43A 2QQOA 1RUH3 1HIXA 1ZBE3 3WP4A 1YIPA 4WZFA 4HMZA 4JV4A 4R9DA 4YVWB 2YMZA 3PU3A 4O9EA 5FZ6A 2ZX3A 3LOBA 1Q5OA 2ARBA 3B01A 3ZSKA 5ACA3 2WQZC 3UGHA 1MR5A 5IK7A 2UYAA 2JXAA 1F5JA 4Q4Y1 3OGRA 4LBNA 2GP5A 1HB2A 4CZSA 3ZSJA 4IEQA 1O8SA 5D8AB 2DUQA 4GULA 3E5UA 1C8M1 4AVVA 3EMRA 2PHDA 1BYHA 4ISQA 3D6EA 3RGBA 5DAWA 2YYOA 4ZXEA 3BTXA 1MS3A 5LBCA 4DQAA 5CG9A 2VVEA 5F7UA 1YFUA 1LOGA 3NNLA 4E9KA 3Q8CA 4GMP0 1RYYA 1W99A 4D6RA 5IVCA 1RUE2 3DPRB 4QU2A 3PVNA 3ORJA 4IEZA 1R092 4COUA 1LNSA 2UURA 4MXWA 1QU0A 1WCSA 2WFF1 5DN2A 4IW3A 4UYBA 3VHPA 2P3IA 4K8RB 3WD5A 1LHNA 1PIV3 2R49A 1AZDA 5FP3A 1OXCA 2Z2SB 4YG6A 3I4IA 1FOD1 1ONAA 3LGRA 1RVF1 4QWNA 3ZXDA 1WWYA 1CAUB 1PM7A 1U0AA 5KXEA 4TYSA 2AREA 1VB2A 2W3JA 4WM8C 1VBD1 4QKDA 1LOEA 4HOOA 1W3VA 4GWNA 4LA3A 4YARA 3M3EA 4DRVA 4EN9B 4FFGA 5LBFA 3T1MA 2OKXA 4R4ZA 4A44A 4MLOA 1Y3TA 3W5MA 1MVQA 3EXUA 1AR61 4YRDA 3PVOA 4EJRA 2W47A 4NN0A 4DB5A 2F4LA 3ZOIA 2JD9A 3PTRB 2W08A 2RMU2 1J83A 3AXEA 5FZMA 5FYIA 2YPDA 1W8NA 1YQ8A 4HVOA 1SDDB 3C7OA 1BEV2 1C8M3 3AL6A 3AFKA 1AYM3 4B1LA 2BVBA 1MQTC 4I2OA 5DZEA 1ODNA 1CX4A 1F4AA 3I2HA 4RS5C 4Y24A 5JOXA 2D97A 4D7YA 1GWKA 1UCXA 1A8DA 2BNMA 4JDNA 4XFHA 1GU3A 1YJLA 2GAUA 1SLTA 5CIRA 1XE0A 2RS11 3Q8FA 5CKQA 1OQEA 2C1FA 3KWVA 5C5TA 1VJ2A 2R043 5IFPA 1N1VA 1W9FA 2ZGRA 3AJYA 3OGVA 4NUBA 3TAYA 2VJXA 2WFF3 4YVSA 4CCEA 2XKPA 3GXUA 5KHJA 1UMIA 5C3OA 1ULFA 1W2OA 4AHXA 3AP6A 4AI9A 2CGNA 2BP6A 3C2UA 4V2WA 4D6QA 1RVF3 5FXXA 1UY2A 2SLIA 3FFZA 4RA0A 2QQLA 4XJUA 2JG8A 2ZMKA 3NAPB 1VBD3 2DWRA 2DU0A 1RB8G 2OW4A 1HX6A 2FDGA 1NT0A 1IKQA 1LGCA 4CDXB 5LY1A 1LGNA 1DQ6A 1ND2B 1VALA 2I2SA 2PELA 4MH0E 3VDDC 1WLTA 1VMHA 4KU7A 4DFSA 2WZR2 4LK7A 3ZFEB 4IV1B 2AACA 4FP2A 1CR7A 1W9TA 3LD8A 4AEDA 5AC92 2YV8A 3N9QA 1WA6X 2QDNA 1OBNA 4NE9A 2AUYA 2IXLA 3V0BA 2R062 1U12A 3MV01 4UAPA 5LRSA 1ZYBA 2E7TA 2CNAA 2ZCWA 1UWWA 2Y6GA 2XDVA 1AVBA 3KVBA 2VZ1A 3WUDA 4FPLA 3PUQA 3BI3A 2RS13 1REDA 2XVGA 1OH3A 3ZN5A 1O7FA 3T30A 5C8WA 4OI4A 4YW6A 1UY3A 4IE0A 3WHUA 1EP0A 1UAIA 4YNIA 5FK7A 2XONA 4AW7A 3EYPA 1NY71 3J7LA 4XUPA 4CDWC 1LOFC 5FYBA 3RYKA 3J8F2 1WZXA 4FOWA 3ATGA 4FPKA 4QMAA 3ZXKA 2R7EB 4XAAA 3VHOA 4AXOA 1E5RA 3RWNA 5A3WA 2XR4A 3NV4A 4B3NA 2OA2A 4QDSA 4CEWC 3OY8A 4GH4C 2YU1A 4BDVB 1PM4A 2ET1A 2VZQA 4AEKA 5GZEA 3NNJA 5A7WB 2YDEA 1EV11 3MICA 4ZHNA 1OA3A 4AFAA 1H2LA 3KGLA 1VP6A 1Y43B 3WQBA 1UX7A 3IPVB 1EY2A 5A3OA 1JZ8A 4EN8B 1PO22 1MS1A 4GKYA 2GH8A 1FXZA 4MVTA 4X6QB 4JZRA 1COV2 3VZJA 3RVHA 2XHKA 1JYTA 1HB1A 1HRI3 3C3VA 1OVSA 3D0JA 4BHPA 3TEWA 1OQ1A 3ES1A 3CJIB 1ZX5A 3AP9A 4I02A 1W8TA 5JI7A 3MPPG 2A6VA 2RJLA 5LZ6A 4K21A 1C1FA 2WNEA 5CFCA 4AFDA 2EA7A 2HYXA 1RL3A 5IVEA 4GB31 1FNZA 5A7OA 1AR82 2ZGSA 2BNOA 3ZYHA 4Y20B 4CPBA 4LQRA 5IVYA 2G9GA 1MS4A 1H8TA 2CY6A 2WS91 3VL9A 2VG9A 5CG8A 3A0NA 4LJHA 3SISA 3THDA 2WRAA 2HYKA 2WO7A 3ZYGA 5IWFA 2ORXA 1BMV2 3SEEA 1EV13 1NAEA 2FBEA 4PF5A 1T6GC 4YM0A 3WG1A 1GOFA 1UY4A 2ZGLA 1WLDA 4W6YA 2HEYF 3UKTA 3O1RA 2W95A 4A4AA 1POV0 2XBO1 4IE7A 4N53B 3UKNA 1YLLA 2V09A 2WIIB 2D3RA 3LSEA 4XBLA 3GM8A 3LA3A 1F8VA 3AFGA 4YGEA 2YFUA 1W90A 4E2GA 3VBHC 2JD4A 4WM7A 3VBUC 2JDZA 5D1IA 2IWGB 1OLRA 3FFQA 4GD4A 4QM9A 1K3IA 5K4LA 3KV4A 2WABA 3BIWE 3CIHA 4Q4W1 4HG6B 4WVMA 4ZS3A 3J7HA 1C5HA 2VXJA 3MLLA 4IV3A 2IVJA 2J1EA 4Q8KA 5C8CB 1G9AA 2BFUL 2EXHA 4LO6B 5FAXA 1VMFA 3H0OA 1F5FA 1RHI1 5HPOA 2VMDA 4P9XA 4IEYA 2WS93 4LNVA 1LR5A 1O6UA 1S4CA 5A6XA 1A6CA 2ATFA 2PXJA 4EYUA 4A7YA 4FTBA 1B35B 2XUMA 3GZUC 3TEXA 3KZ4C 4AEMA 2EICA 3IWZA 3S7EA 5DZGA 1VRH1 3T2TA 4LO7A 3T09A 1RUNA 4KMQA 2NYYA 1JU3A 5A6YA 2YBSA 5I93A 2X10A 1N3QA 3MGUA 4LORA 4PHZA 2BTVC 2XBO3 3IDAA 4JGZB 5DABA 4FPGA 1KS5A 1ZZBA 1SFNA 2RS33 2WJSA 2YGMA 3URFA 1NZCA 3T2OA 4MZUA 5C4WC 5A3TA 1EYBA 5FR3A 4S2GA 1YEWA 4Q5OA 3IIIA 3O1VA 4XBQA 4FSJA 2ZABA 4PLOA 1WD4A 1AX0A 2C26A 4XIOA 4Q4V1 4LE4A 4QXCA 4PLNA 5FUPA 4DOUA 3O1PA 5FREA 1GYKA 2HBTA 5FYTA 1S0IA 2IXHA 3WCSA 1LHWA 4FPHA 4QKNA 2JX9A 3FN9A 4META 5BNNB 2FZ2A 1ENSA 1VPHA 4FQZA 4PBOA 3O14A 1WMXA 3AXDA 4MGQA 2HWC3 4LO5B 4F83A 4NIDA 3CF6E 1RHI3 1AYN2 2CTVA 5EYXA 1PMIA 1GOGA 3W9AA 1YJKA 3RZMA 1TG7A 3ZVXA 1A78A 5JIUA 4MGTA 5KR7A 2JB4A 4RGAA 3POYA 2O14A 2Y26A 2LW8A 5AVPA 3LEIA 4BXSV 2OXBA 2WNUC 4CU6A 1VRH3 4FOQA 4Y22A 5E88A 4CP9A 2W1SA 5K9YA 1EPZA 1RUD1 5K7PA 4JHZA 2GSYA 1EUTA 3CJXA 4LIUA 3VKNA 5J37A 1KDMA 4FPEA 3UETA 2J1RA 3OPZA 1PVC2 3KMHA 4PDWC 4CUBA 2QQJA 4ZZ8A 1C4RA 4HK8A 2D3SA 4OHXA 5F5CA 2RDRA 1L7LA 5J7MA 3EJKA 5JZGA 2WFPA 5K0UA 5FYCA 1CAXB 2O8QA 1IPKA 1RC6A 3HN1A 1KS4A 2YC2A 4MGYE 3IB3A 2NN8A 2E9QA 1HRV3 2PHUA 2B46X 2CAVA 2VU9A 1QJU3 3HT1A 1LEDA 3AYCA 3KT1A 4Q4V3 1TNRA 4E4SA 3ES4A 4F7ZA 5BYNA 5DQ0A 2D6OX 4UBGA 3HNMA 4KI5M 3IT8A 5L19A 4CPBD 1AR92 4YVWA 5F5IA 5FZFA 2XJTA 4RSUA 5DPNA 3VLBB 2JG9C 2JKBA 1OOPC 1N1TA 2VO5A 4OHVA 4RD7A 5JOYA 1UF2C 3P3PA 3EBRA 5HCFA 1O59A 2YUEA 4N9IA 4M00A 3K4DA 4E4ZA 4HKLA 4W65A 5M0TA 3H1YA 1M06G 5D8AA 4Z2AA 3VZOA 2PHXA 1TQ5A 5BUVA 4FBFA 2W87A 4WV8A 2XOMA 4YZ1A 1RUD3 3PJYA 5FV3A 3HD8B 3PDQA 2QBXA 2VW2A 2FDHA 5L7OB 1YWKA 5A7SA 4FXKB 3VKLA 1V9U2 4YZ2A 1RUF2 1IS4A 1UKRA 2BGPA 3RPQA 1DBNA 2EF6A 2WN2A 2XWBB 4LXLA 4C8DA 3DPRA 3VBRB 4CCMA 3RZKA 4JX0A 1K5MC 1QH7A 5FZ4A 4AFCA 3HVDA 1ND3B 1QJX2 1POV1 2ZXQA 4RQPB 3WG2A 3ZXLA 3DF0A 3RYRA 5C3SA 2CV6A 2JDPA 1KXGA 2GC3A 4IGQA 3AYAA 2QQWA 5SV8A 4UF0B 1O5UA 3V65A 2ZEZA 3UL2A 1CAUA 3Q9OA 1UPSA 1S0CA 2JDYA 2C9KA 4L97A 5B2GB 1AHSA 4HT1T 4JAAA 3WDTA 2NQYA 2NMNA 1RINA 5GKAC 2Q8DA 2P1BA 3SLIA 3E5XA 5FZLA 4Z2WA 3GF6A 3VD3A 3M7AA 1ZBA1 1PK6B 2D44A 3DCQA 3JBG1 4RGGA 1UNBA 3H3LA 4BK5A 3NV1A 4NWVA 1JU4A 2V5YA 3ACFA 4AVBA 3R4DB 4MHRA 4XF1A 3NKGA 3PVEA 1H1IA 5F3IA 5APAA 5FZDA 5EJ3A 2RHPA 2RDSA 5JPMB 4HL0A 4A2UA 3U11A 3NNFA 3IM0A 3TBDA 2WO1A 5AFEA 4X8PA 4XDPA 5EIYB 5DUVA 4I30A 2VZUA 1GICA 3AKTA 3HBKA 5BNPB 1I5ZA 1T2XA 1MZ6A 4NHXA 2D43A 5FY4A 3ON7A 1W2UA 4LIVA 1OH4A 1POV3 2A3XA 1S0DA 4E27A 4Q0VA 1CVNA 3NSTA 3FLPA 3JZVA 5CB7A 2Z42A 1GLHA 1LU2A 3M8LA 5AFBA 2FDFA 1FV3A 4CUCA 2HWE2 3NAPA 1OFNA 4YSFA 5C3RA 1AXZA 3V0AB 2PHWA 2VMIA 1UD1A 3WNNA 4CDXA 1ND2A 5F2WA 2XLAA 4QB6A 4QPGB 2MNGA 4S2DA 5DDJ2 4COZA 1NZIA 4KWKA 3ZFEA 2YXSA 4IV1A 2W52A 5EJZB 1H6YA 1RUC2 1H1AA 3N7LA 4ITCA 1JW6A 5JVVA 5FZ7A 2C6SA 3BKZA 4OZXA 2VOTA 4GWMA 3TYJA 2VL4A 3VV1A 1LTEA 1W6OB 4E8DA 2VC9A 4RHV2 5IAXA 4O65A 1GWLA 1OPMA 3MIGA 1AR72 5GLTA 4Q27A 3NKTA 2Q4SA 2FCUA 4XFFA 1VBE3 4YW7A 4Q4X2 2Q1FA 4COWA 2CYFA 4C1XA 3K77A 5IVJA 3RS6A 3AMNA 5TSWA 3NV3A 1V6JA 4B7KA 3LEGA 1TE1B 4PIYA 1DQ0A 3Q8BA 3H50A 5CZKA 4D94A 1QJY1 4XZPA 4AGVA 4TLFA 3PUSA 1OT5A 3SH4A 4DNYA 3HBZA 4L8QA 4Z82A 1ZNPA 2DVFA 1TMF1 1JXNA 3PIGA 1OPOA 1SLLA 3N9OA 2DBNA 2F6BA 3IMMA 5A7WA 4XJWA 2ADDA 4SLIA 4L99A 3HQXA 3PIJA 1FI2A 1P8JA 3IPVA 3VL8A 3JD71 3ZSLA 2ZEXA 4HZFA 1RUE3 2DVDA 1YYNA 4ATEA 5IHRA 2XVLA 1YIFA 3N36A 4XZUG 4CU9A 2E32A 1QQP2 4JDOA 4P9WA 1R093 5E16A 4BQ3A 2BUKA 3HNYM 4OYUA 3ST7A 2RM21 2J42A 1STMA 2VCAA 3CMGA 4KG8A 3APBA 4G9SB 4YW3A 4DS0A 1ZZ8A 3CJIA 3O5SA 1H2KA 2WO2A 1V70A 1DYOA 2VVFA 2WNVB 3R6SA 3VD7A 3DYMA 2YY1A 2A7AA 1CX1A 3MW3A 2BJSA 2IXJA 1GZCA 4YW1A 1NQDA 4IXLA 4S2FA 2XJVA 3ACHA 4OQ8A 1SBDA 4FAHA 2JJ6A 1UXXX 2J7MA 3O0WA 4Q0UA 1NA1B 3KVAA 4ZU5A 1NOVA 2FDIA 5I8TA 3ETQA 4LT5A 4N43C 5FK8A 4Y20A 1QJY3 3T08A 4C91A 4W6XA 5A3NA 4XTMA 2OT7A 5FKBA 1BEV3 4Y33A 4D3WA 1TMF3 2R061 1J3QA 3U07A 2QVSB 3PHMA 3H9AA 2ZACA 3ZYFA 1QXJA 4Q0QA 5I0RA 4EQVA 4CU8A 4Q29A 2B9UA 3O1TA 5IJRA 3IAPA 1CPNA 3JCIA 1UY0A 3JD73 2RR12 3OF1A 3POBA 3S30A 3U0ZA 2BPA2 3G6JB 5FZ8A 1V6IA 1AL21 1CIWA 1FMD1 3MEPA 3WUCA 1DQ4A 3BALA 1C1LA 4N53A 4WVVA 1GKBA 2RM23 3I2JA 3QH6A 4FPCA 4QX8A 3M1HA 3BN6A 2RJKA 3JU9A 3WNOA 2YHJA 2YROA 2NM1A 3OGSA 2XKOA 4CE8A 1W9YA 4QPIC 1O91A 1RUG1 2W1UA 3ILNA 4N8MA 4CXYA 4K40A 4FPOB 4AI3A 3MZHA 3VZNA 4XOGA 3WF1A 4DRRA 2RDQA 2VNVA 3OYWB 4IESA 5C8CA 4Q0SA 3DKWA 2VOKA 2VZ3A 3KT7A 2VOWA 2WZR3 1H4GA 2JDUA 4ATFA 4GA9A 3ZSEA 3PJQA 4YW2A 4BA6A 4CA9A 4L2NA 4MGKE 4QGNA 4HSLA 1B35A 1H2NA 2R063 1NXMA 5FJKA 1UYYA 1COV1 1CAVB 5FP9A 4IEPA 4R9AA 3ZYJB 1M4WA 1NCQB 2OX0A 1GP5A 2X5IB 3AC0A 2WZPP 4AQ6A 1FPN2 1F31A 4OUEA 2OQ7A 4IEVA 4CDQB 1WMFA 1XYNA 4NJ4A 1AL23 1FMD3 1VBC2 2A6WA 1RGSA 4JGZA 4KQ7A 4QPYA 4UW6A 1XXNA 4URTA 5FPVA 3VD4A 3UKVA 5EYYA 1YC61 2VNRA 4LBLA 5FP8A 1N47A 5FYMA 4D6SA 4DXRA 4TZDA 4LO8A 1QF3A 4INDA 2B42B 5JXJA 2B45X 2G4IA 2R6QA 4IERA 1UOGA 4OUSA 2A71A 2JENA 4P5HA 3LSDA 2VMFA 3SCFA 3SH3A 2CGPA 3TWIA 3BB6A 2WO3A 4YVSC 2BEOA 2A3WA 4FQ4A 5JCTA 2Y38A 4XMAA 3VB9A 2A75A 5T5LA 1BLZA 3OEBA 5SV5A 2AZ5A 4ASMB 4IEWA 5BNNA 2D5FA 3AP5A 5EJ1B 4XIKA 3V56A 4C0BA 1BMV1 1EAH1 3H8OA 1QOTA 4XILA 3K51A 4FOYA 2JG8C 2DTWA 1W9SA 2E6VA 3AZXA 2J1UA 2VPVA 1E5IA 3OD0A 3HWJA 5DUXA 5GLUA 4ARYA 3FLTA 4ZU4A 3S5QA 3ILRA 1NX9A 3I3MA 1COV3 1DIWA 5C6CA 1IKPA 4MHUA 2HEWF 2R1BA 3LWCA 4AEDC 3J26N 2XUEA 2Y0OA 1HJGA 3R4SA 2CU5A 4LKDA 1X9PA 4EWAA 4XFIA 3M3OA 5CAZA 2VUDA 2BZDA 2XL7A 2D98A 4I09A 1CGPA 1QHDA 4UW3A 4GIQA 5T54A 3TN92 4CXXA 2KR2A 3OEAA 3RZJA 5CBLA 3RFRA 3LF7A 4Y1ZA 3KCCA 1SEFA 5DUUA 1DCSA 3SXWA 4XXPA 2W1QA 3ZIXA 1AYM1 1D0HA 5FRAA 1CAXA 2DU1A 3IAQA 3RQ0A 1RIRA 1OF4A 2EIEA 4M3CB 1IPJA 3W21A 1Q3EA 3CNAA 2AYHA 1ZZ7A 2D6MA 4Y4RA 3IKWA 2QCSB 1VBB1 3MW2A 4YM1A 3WF3A 4HLTA 5E89A 3CEWA 4JGYB 2PLV2 3RMYA 2R041 3HIFA 2H0BA 4QPIA 5JXIA 1TNFA 3O1OA 1AF9A 1EAH3 2A5ZA 3VGIA 3WDUA 3WNPA 2FQPA 1PO12 1VLNA 4TXWA 3EO6A 2VMEA 1CN1A 1XSQA 3AZVA 4OHYA 1QIQA 1YXWA 1DGWA 5C9AB 2DCTA 3OSDA 5FZAA 2RS51 1JZ4A 1HN0A 4FTEA 2IUWA 2VQUA 4BIOA 1NQJA 2Q1MA 1PNGA 2ZHKA 1OI6A 1UOFA 4MXVA
chains in the Genus database with same CATH topology
1O4YA 4BLJA 3WDYA 1RMU2 1X36A 4HVQA 3WQ1A 1FNYA 1UL9A 4IEXA 4HK9A 1RTVA 4YZ5A 5L7OA 4Y1UA 2VQ0A 2D40A 3VBRA 4UBHA 1AJKA 3AP4A 1NG0A 1IQAA 1ND3A 5CFDB 4AQTA 5J3UA 4CP1A 5CFCC 2E7QA 2ZZJA 5CA6A 4KWJA 1VR3A 1XYOA 1VBB3 3AMHA 1BQPA 4CTEA 5FPZA 5JPMB 4LBKA 5GLZA 2UWCA 4F3JA 2OIIA 5T3NA 1S0FA 1CJPA 2EAAA 3B02A 3ZXGA 1FT9A 1H2MA 1L3JA 1H8TC 1PK6A 2DURA 2GNDA 2BGCA 4XHBA 3USSA 1O5LA 1W6QB 4BPZA 2HWB1 2RS53 4BYYA 4U36A 1WMEA 5IUQA 1TME2 2ZGTA 2DYCA 5L36A 1G9BA 1MS9A 4LR4A 2HJIA 2O8OA 2VGDA 5FO7B 2JEMA 1MEC2 2ERFA 5BNPA 1DQ5A 5FLIA 2HKXA 4WM7C 5T50A 3E6DA 4RR3B 3G7DA 1AYN3 1HRI1 2EALA 3OBRA 4KNCA 1PGW2 1SCSA 4IV3C 4H7LA 3VBFB 3V0AA 2ZX4A 1WW5A 4ZKTB 1UZZA 2D93A 1BBT1 1RUJ2 4QPGA 2JECA 3ZXJA 3AM2A 5CU1A 2ZKLA 1PVC3 1RJ8A 3H1MA 2HWB3 3POSA 1SCRA 4QM8A 4H7MA 2EXJA 4ZXKA 4OVEA 2N7GA 1W6OA 1OLQA 2H6BA 4XYXA 3U10A 4I3GA 1ALYA 2R32A 3MDPA 1CAWB 1PGSA 3CU7A 2B8MA 4XQDA 1VBA2 4LEJA 2ZPXA 3UV9A 3WW1A 1ZA4A 2DVAA 1ULGA 2R30A 1DGRA 3KD4A 3WNXA 5H9SA 1RUI2 1SQ4A 2MEV2 5T5PA 4AI0A 4XPVA 1HXS2 1ZRRA 1PHMA 5HXVA 2R071 3NVCA 3MIBA 2P3KA 2TUNA 1EPWA 4GMP1 3GZTB 5F1RA 1BBT3 1D4M1 5T55A 3MIEA 1LU1A 4IL7A 1RUH2 1RUF3 1ZBE2 1R081 5KWRA 2B7YA 1Z7S1 1AXYA 1LRHA 4WVZA 3AZYA 3SHRA 3HAGA 1S0JA 3VKFC 3WOGA 4CEYB 5ACA2 5ABJB 2SBAA 4LHLA 5GZDA 1ZREA 2VECA 1QH6A 4K7JA 1IHMA 3PNAA 2EAKA 3ILFA 4HVRA 2EXKA 5JZGC 2WNVA 3B94A 5K0UC 3ZFGB 2VOVA 4MGZE 4AI1A 4DXZA 2IZWA 2H0VA 5KC6A 4HPKB 2RS31 3I7DA 3B3QE 3WCRA 2FHRA 3WXPA 1NA1A 2FMDA 2R0FA 3I59B 3I54A 4JRLA 4YVWC 2LM3A 2R073 1H1MA 4P14A 1X50A 3LB9A 4YW5A 2IXKA 1PIV2 4BZ4A 4GMP3 3P3NA 3QBQA 1D4M3 3SCGA 5KC5A 3ZPYA 2HWC1 5I0TA 3CO2A 5D8AC 4Y1XA 2HWF1 3WG4A 3LKJA 5A33B 1R083 3ZO0B 4AYUA 5LEKA 3OJBA 3NW4A 1ULDA 1Z7S3 3THPA 2PYTA 3FBMA 1U5IA 1UN1A 3M4FA 3WQ0A 2Z79A 4LTAA 2Y0IA 4HETA 1GANA 3KCXA 4Q4Y2 4XFGA 4HANA 1OA2A 3DPRC 2VMHA 3EHKA 3H3ZA 1C8M2 2DFCA 1W6PB 4C0HA 1R1A1 5LRRA 1I1EA 1DGRN 3QCWA 4QX5A 3WV6A 4FCAA 2CGOA 1N1YA 1NLRA 3OYWA 2OUHA 5E8AA 5H9QA 3QACA 2KXLA 1A8MA 1WCDJ 3WVJA 3MFAA 4JCKA 2Z5WA 1HRV1 2UY8A 4ES8A 1QJU1 3ZXEA 4WZCA 1JTZX 2WFF2 1QNYA 2PAEA 3GBWA 1RUC3 2K9ZA 3R0RA 4RL7A 4Z07A 1CAVA 3NV2A 5F6KA 5BNOB 1O3QA 1FOD2 1RVF2 2GMPA 1NCQA 2X5IA 4RHV3 1AR73 4KH9A 5DUWA 1VIWB 2HWF3 3ZYIB 2UY9A 1VBD2 1W0PA 1O3RA 3MIHA 4CDQA 2P37A 1S0GA 5FO9B 1I6XA 1YI9A 2BNNA 2KM2A 1AR62 3FC0A 3IBMA 1S1AA 1LOBA 1ASJ1 4MX3A 2AH2A 1WW4A 1RITA 3BOWA 1R1A3 1D4VB 2DCZA 4FXGB 1QDOA 3AK0A 3FHIB 4AGGA 3WINE 3VBSB 2IXIA 2R16A 3NAPC 2ZHNA 3W58A 3QD6A 1MZ5A 5F9TA 3JQXA 5BY5A 1NXD1 4CDXC 1QQP3 3IIAA 1ND2C 4Q1PA 1NCRB 4Y1YA 4UW5A 1J3RA 3KT4A 1W6MB 3INAA 5FMOS 3ZFEC 4IV1C 2HWD1 3KCYA 3RZZA 3O12A 4B4PA 1YUDA 5H9PA 3ZFFB 5FQ0B 4D7TA 1KJLA 5KXBA 1MACA 1REEA 3VBOB 1DQ2A 1DGLA 1J59A 2MHFA 1VAVA 1ASJ3 4M3CA 2XVKA 1IS6A 3ZN6B 1C57A 2XL9A 4NPRA 2VUAA 1UIJA 1IGOA 1Q43A 1W6NB 1ZM1A 1CQ9A 1V6MA 1LJ7A 4A3XA 1ENQA 4JGYA 1UMZA 5EZWA 3N7JA 3N3HA 3E97A 1UPIA 1A3KA 2ZOEB 5T5OA 2CAUA 2UU8A 3ZMOA 1MVEA 3GHNA 1JHNA 5CVRA 5FO8B 5C9AA 3ZIWA 1UZYA 2ZX1A 4P9JA 3W59A 4CDUB 3H3UA 3AJZA 1NY72 4Z1VA 3IDEA 3RYPA 3S7IA 2HWD3 3UJOA 1KDKA 2OZJA 2PAKA 3QLQA 3H1WA 1KITA 3PVBB 4YLZA 5EV7A 2P2KA 4F8AA 1KRIA 2PAMA 5JR7B 1EV12 1FX5A 1XNDA 4UXAA 3ZYPA 3CJIC 1S2KA 5DXDA 5CFDA 3FX3A 2TNFA 5J96B 4AF9A 1Q8SA 1AX1A 1NE6A 1VBE1 4I0WB 4V1PA 2ARXA 4GKXA 1DLLA 3HR9A 4BMEA 5JOWA 1N3OA 4WVWA 4BM8A 2ZGMA 4AGRA 2NP0A 3N35A 4K1YA 1W6QA 2DUOA 1Z0HA 1C5IA 4GB32 2E7AA 3BPZA 4CRQA 5JI9A 3RSJA 4D7SA 3AMPA 4QQPA 2WS92 2VUJA 1H9PA 4AQ2A 1D2QA 3M3IA 4J6GA 4N53C 1WLCA 3AX4A 1O4TA 1RUE1 3ECQA 5KHHA 5DG2A 1TEIA 5L73A 3JQWA 4HKWA 1R091 5GLVA 5F5QA 4RR3A 4NWWA 3VUOA 2XLFA 1BXHA 4LO4B 2PN5A 3NO8A 2A70A 2DCKA 3D82A 5I8SA 1JYIA 1WBFA 2XBO2 1ZZCA 1LCLA 1X7NA 2D3PA 5C8CC 3VBFA 4J1WA 3POWA 5BV6A 4LHKA 4AHWA 1PZ7A 5IK4A 4O9GA 1GNHA 4I0BA 4XJZA 1VAKA 4KBBA 4XFAA 1B35C 3U4XA 3DN7A 2GNTA 4LBMA 1GBGA 4Q4W2 3FWEA 2GZWA 2RMU1 4IEOA 3TN93 5GZCA 3TOJA 3UK9A 5E1RA 1BEV1 4WM8B 5AVAA 3VHNA 3QOPA 2WT2A 4XE9A 2VQAA 1RHI2 3L2YA 1LENA 2A6XA 4YGCA 4UW4A 2XJQA 3H7JA 1Q8PA 4JGZC 5JSPA 3LAGA 4OI1A 4COVA 2PLV3 2GNMA 1VRH2 4XMIA 1CAWA 5FLHA 4H3WA 4LBJA 1MQTB 3R05A 3X29B 5KHGA 4L92A 4RS5B 2VNOA 1PO13 4Q26A 5KHKA 4Q2FA 2ZX0A 4GQ7A 5BNNC 3N7KA 1PGL2 4LUMA 4R9BA 1CD3G 1ZZ6A 2WA4A 3AP7A 2Z69A 1O4ZA 2X53S 2ZGUA 4B4QA 4Q4V2 4EWDA 1RMU3 2WZR1 4YM2A 1G9CA 2RMU3 4Z92B 1BJQA 2VULA 5AC91 3A0KA 4XBNA 3SCHA 1ULCA 1DYPA 3MYXA 3GNEA 4CEYA 5ABJA 3WDVA 4S2HA 2R1DA 3USUB 3VDDB 5FPXA 3D4KA 5FFOC 5J48A 2VOXA 3RRDA 3ZFGA 3WY6A 3FMGA 1RUD2 4HPKA 2MPFA 4BE3A 1PZ8A 2DFBA 3AKPA 2BQPA 1Q56A 1PNFA 2VY0A 1WBLA 3WG3A 3I59A 3VN4A 3J8F1 2WQ4A 5GM0A 2OYZA 3ENRA 4NO4A 3ZMNA 4MUVA 1HDKA 5BNQA 2D6NA 2ZA9A 1GR3A 2ZZQA 2O0OA 3K48A 1YCIA 5LK5A 2EIGA 2PQQA 4LBQB 4K3UA 5T5JA 4G3YC 1O3TA 1LESA 3GALA 4CDWB 4HKOA 3WDWA 1XQNA 5A33A 4E4DX 2A73B 1PO21 2XH6A 3GBFA 5AC93 1UU6A 3KLSA 3AZWA 1UU4A 4BLIA 1SACA 5J98B 5A32B 4CEWB 2WSVA 5L7OC 1SLIA 2LUWA 4GH4B 5FOJB 1F9KA 3FLRA 4AVSA 1MS5A 3ROUA 1JYCA 3WT3A 3VBRC 3ACLA 4XQWA 1QWRA 2MEV1 2ZGNA 1DGWX 4XF0A 1W6PA 2ILMA 5HCAA 1ND3C 4RQPC 4GXLA 2ZKNA 4Q8LA 2C9AA 4AI8A 2C5DA 4X6RB 2DUPA 5JSOA 1RUJ3 2IXCA 4ORFA 1AR81 5IK8A 5JWPA 2PTMA 4K1ZA 3J8F3 4QT6A 2WT1A 4XW3A 2W0XA 1LHOA 1VB4A 2A6ZA 2DVGA 1PK6C 3VZLA 4PIXA 3TNPB 5I0UA 1KFXL 1XNKA 4XJ9A 5BNOA 2V73A 2D5HA 3WHTA 4I01A 1DHKB 2X8KA 1BKZA 1WA4A 1CONA 2EVXA 5KBFA 1V6KA 3B69A 4XQ4A 2VW1A 1PO23 4AK3A 3O0VA 5JIAA 2XJSA 3N7MA 4OHZA 3A4UA 1ZBA2 3JBG2 4XTPA 3SNMA 4QHBA 2G9FA 1N1SA 2LTNA 5A3MA 3L9JT 4JTOA 5BNPC 1RUI3 2MEV3 3WW4A 4XF3A 2VXRA 1LKNA 1APNA 1GZWB 1UIKA 5JMCA 4XFBA 1H9WA 3RG0A 2YC0A 2GMMA 1SDWA 1V6OA 3E5QA 1YRZA 2JE7A 3KB5A 3VBSA 4FO9A 1AR83 1H8VA 3VBHB 3VBUB 4YGBA 1Q8VA 1D0GA 4R8HA 2QQPA 4HN1A 4OULA 2PHFA 1MS8A 4BIFA 3J9SA 1NCRA 2Q8OA 2XPJA 1DYKA 1W6MA 4QPGC 3ELNA 1LULA 1CJDA 2PHRA 5A3LA 3AB0A 3ZXFA 3B7MA 2UWAA 2DV9A 3GZAA 3ZFFA 5FQ0A 1REFA 4QQOA 3ZN4A 5KXCA 1SMVA 3S6PA 3WX5A 4FP3A 1URXA 4H14A 4DPNA 3VBOA 2BWAA 5DG1A 2PFWA 4BOWA 2GC1A 4AVTA 1DDLA 1V6NA 5DZFA 2BFUS 2OUJA 3ZN6A 2PHTA 1G7YA 1WD3A 1W6NA 3M70A 4NOTA 2AENA 4KL1A 1QJZA 4IETA 2JE9A 5C4WB 4W6WA 2YGLA 3OBTA 4BQ1A 4M3CE 4RQPA 5HI0A 2VW0A 1AYN1 2QDRA 3KQRA 1W0OA 4AVCA 1SLBA 2WC2A 3IDCB 3ME2A 4CDUA 3IN9A 2C0ZA 4D69A 2PHLA 1QJY2 3EQEA 4JDMA 1IS5A 4Q4Y3 1JUHA 1N3PA 3CL1A 1S0BA 3E6CC 1HKDA 1J3PA 1TMF2 4JVAA 1PVC1 4XDQA 1UX6A 3E6BA 2XB6C 3WR0A 4Y1VA 5FDBA 4N9HA 1SFYA 3B93A 1WCKA 4X8NA 4FAGA 5JAXA 2WNUB 4XXAA 4Q1RA 4Y26A 1NE4A 1VAMA 1CESA 2WNVC 3JD72 5CNAA 3VZKA 3MIDA 1YI7A 2X29A 2RM22 4PDWB 1ZZ9A 1QKQA 1J58A 4QQ2A 1NA1C 2E51A 2QKDA 1AR91 4OHWA 1FOD3 1HQLA 4FT8A 1RJ7A 1FAYA 1Q8QA 3IDBB 3O7OA 1X82A 4EV0A 4XHXA 5T52A 2BW8A 5GJ6A 1LHUA 3PMSA 1AR63 1DZRA 1LHVA 4PCRA 3TB0A 2BYVE 3R4UA 3MI8A 2ZGQA 3T1LA 4BCUA 1WLWA 2JG9B 1XU1A 1OOPB 2NLRA 4QGMA 5BPXA 5FBZA 3DL3A 4PIZA 4E2SA 1V9U1 3LOIA 1RUF1 4J1XA 4MYEA 3HT2A 3ZDSA 3RI8A 4IEUA 2XWJB 1OA4A 5FCCA 2GMEA 3HMYA 3FUOA 1QJX1 2PA7A 1QOOA 1AL22 1QXRA 1FMD2 2R0HA 4CP0A 1DQ1A 2GN7A 2ZTNA 2EXIA 2ZHMA 3OGJA 2AGSA 1AR93 4PLMA 2XG3A 1K5MB 5JPNB 4JQRA 4QQLA 4OI0A 1RUG2 1B09A 1BZWA 1HV1A 1NLSA 5BXXA 2XLGA 3H7YA 1PVXA 1NCQC 2X5IC 4WM8A 3D0SA 2QZ2A 4HN0A 5JSRA 4CDQC 1ZRFA 1KFUL 2VMGA 1ZRCA 1X33A 1LECA 2TEPA 2UWBA 1V9U3 4ISRA 2P34A 1I3HA 1G9FA 4XF9A 1XU2A 3VHRA 4KGQA 4NHLA 1YFYA 4JTNA 2XJUA 2Q0AA 1DFQA 1MQTA 1OSGA 1QJX3 3NL1A 1YFXA 4RS5A 2KA3A 3LCPA 4I3PA 4N7UA 2W39A 2XJPA 4YFZA 4N90A 5KHIA 1XNBA 2HWE1 4AVAA 2QJVA 4DMIA 3TNQA 4LA2A 1IS3A 4BWOA 5DDJ1 3KS7A 4KG0A 4AG4A 1ZVFA 5I0SA 1OD5A 1BVVA 1SLCA 1EAH2 1RUC1 4DINB 1LODA 4PJYA 1F2NA 2A3YA 1AUYA 4PQ9A 4RHV1 2HEVF 3USUA 1AR71 3VDDA 2ZBJA 4AHYA 4Q4X1 1LOAA 3WQ7A 2GN3A 2ZAHA 2WWSA 2YPJA 3L2HA 1O3SA 1U5XA 4FPFA 4HFSA 2ETEA 4FVVA 1MZEA 4K8FA 4JGYC 3AKRA 4LE3A 1R1ZA