1AYM1

Human rhinovirus 16 coat protein at high resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
285
structure length
285
Chain Sequence
NPVERYVDEVLNEVLVVPNINQSHPTTSNAAPVLDAAETGHTNKIQPEDTIETRYVQSSQTLDEMSVESFLGRSGCIHESVLDIVDNYNDQSFTKWNINLQEMAQIRRKFEMFTYARFDSEITMVPSVAAKDGHIGHIVMQYMYVPPGAPIPTTRDDYAWQSGTNASVFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDTYKSRYGTVVTNDMGTLCSRIVTSEQLHKVKVVTRIYHKAKHTKAWCPRPPRAVQYSHTHTTNYKLSSEVHNDVAIRPRTNLTTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title The refined structure of human rhinovirus 16 at 2.15 A resolution: implications for the viral life cycle.
pubmed doi rcsb
source organism Human rhinovirus sp.
total genus 61
structure length 285
sequence length 285
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1aym100
4RFT0 5CFDC 1FOD2 4GH4A 1HXS2 4IV3A 2HWD3 1ASJ1 3S6PA 2WLPA 1QQP2 4GB31 2R073 5AC93 2X5IB 4QPIC 2FZ2A 3CJIC 3TN92 5K0UA 5A33A 2WZR2 5FMOL 1TMF1 1PGW1 2RM23 4AEDB 1EV13 2DF7A 5D8AA 1K5MB 2HWF3 1VB4A 1FPN3 3JD73 1POV0 1V9U1 1VRH1 4RR3A 2RS31 1PO21 2RR12 4RHV2 2MEV3 1RUJ3 3HAGA 2PLV3 3ZFGC 1BMV2 5BNPB 1AR61 2WS92 2X5IC 1Z7S1 4QPIA 1QJZA 5L7OA 1POV1 1RUH3 1ZBE3 3CJIA 3VBRB 4Y5Z0 4RQPB 4EJRA 4JGYB 1HRI3 5FOJB 1EAH3 2WFF3 2RS12 2HWD1 1HRV3 5ABJB 5AC91 5DDJ3 1R093 1TME2 1AR93 1PIV3 1PO13 2RMU3 4CEYB 1EV11 1MEC2 3VBHB 4Q4X2 1GFF2 2HWB2 4Q4W2 5C4WB 1VBB2 2HWF1 1VBA3 1QJY2 2X5IA 1FPN1 1NOVA 4PDWB 3VBRC 2R063 5J98B 1VBE1 1RHI3 4IV1B 4RQPC 1FMD2 2RS52 1WCDJ 4JGYC 1AR73 1PVC2 2MEV1 1RUJ1 1RUD1 4AEDA 1HXS3 2PLV1 4Q4Y3 5ABJC 1C8M3 1QQP3 1B35C 3DPRB 1K5MA 4CDQB 1RUI2 1BEV3 5CFDB 4CDUB 2HWC2 1ZBE1 1OHFA 4YVSB 3TN93 1MQTB 1PGL1 1EAH1 1D4M1 3VBSB 1RB8G 1ZBA3 2WFF1 2BPA2 1AR82 3VBHC 3LOBA 2R042 1HRV1 5BNPA 5BNNB 1M06G 1RUG2 5C4WC 5DDJ1 1R091 5C9AB 1AL22 1AR91 1R1A3 4PDWC 3VBRA 5BNOB 5CFCC 4RQPA 5C8CB 1AYM2 1PO11 4JGYA 2RMU1 2RR13 1QJX2 1RUC2 4N53B 4WM8B 1AL0G 5ABJA 2XBO2 1AUYA 2WS93 1VBA1 1VBD3 1VBC2 3DPRC 4CDQC 1NY72 4CDUC 1AYN2 4BCUA 2R061 4NWVA 1C8NA 1RHI1 1COV2 4YVSC 4WM7B 1MQTC 3ZFGB 1NCQB 1AR71 3VBSC 4CEYA 1BBT2 4Q4Y1 3IDEA 1RUE2 4QPGB 1C8M1 3ZXAC 5BNNC 5C9AC 1BEV1 2QQPA 4PDWA 5BNOC 4IV1A 5C8CC 1ASJ2 1RMU3 5ACA3 1VB2A 1ZBA1 3JB4C 4GB32 4Q4V1 2HWE3 3VBOC 4N53C 4Q4X3 3JB8A 4WM8C 2BFUL 2HWB3 4Q4W3 3DPRA 4FTEA 4CDQA 1VBB3 1QJY3 1TMF2 5CFDA 4CDUA 1PGW2 1R1A1 3JBG1 4YVSA 4WM7C 1MQTA 1NCQC 1FMD3 3VBSA 2VQ0A 4Y4YA 3M8LA 1ND2B 4NWWA 4QPGC 5BNNA 1V9U2 1VBD1 4FSJA 1VRH2 5C9AA 2RS32 1PO22 1DDLA 2HWC3 2ZAHA 5BNOA 1IHMA 3ZFFB 5C8CA 1R083 3NAPC 1AR62 1RVF3 2R071 1B35B 1Z7S2 4N53A 4WM8A 4CEWB 1QJU3 1RUG3 2RM21 4WM7A 2HWD2 4LLFA 3J8F3 3ZFGA 1NCQA 1RMU1 5ACA1 1W39A 2HWE1 1QJX3 5AC92 1ND2C 1RUF3 4Q4X1 4QPGA 3JD71 2XBO3 5CFCB 1QJY1 1F2NA 4GH4B 1FOD3 1EV12 3ZFFC 1OPOA 1BBT3 1FPN2 5GKAC 1RUE3 5FMOS 4CEWC 5LK7B 1RUH1 1VBE2 5JZGB 2WZR3 1HRI1 2MEV2 1RUJ2 3VDDC 4CDXB 1OOPB 1RUD2 2PLV2 1R081 2ZTNA 1H8TC 1RVF1 4GMP3 4JGZC 1ND2A 1NCRB 1PIV1 1ZBE2 1QJU1 5J96B 1EAH2 1D4M2 4GH4C 2WFF2 4RHV3 3VBOB 3ZFFA 3J8F1 3VBUB 2TBVA 1HRV2 1A6CA 1E57A 1B35A 4FTSA 1RUF1 5DDJ2 1AR92 2WWSA 4CEWA 4YVWB 5JZGC 1PO12 1VRH3 4N43B 1FOD1 4CDXC 1OOPC 1HXS1 3VBHA 2RS13 1AR63 1QQP1 2GH8A 5D8AC 1VBA2 1NCRC 5C4WA 2ZZQA 1SMVA 1TME3 3FBMA 2R062 1POV3 1RHI2 1ND3B 1NG0A 5CFCA 3TN91 3NAPB 2WZR1 4RR3C 1AR72 1X36A 3ZFEB 4SBVA 1NA1B 4Q4Y2 2BUKA 1MEC3 3VBUC 1C8M2 4GMP1 1BEV2 5L7OC 4YVWC 5JZGA 4CDWB 4Z92B 4N43C 3VBFB 1HX6A 2RR11 1ZBA2 2RS53 4Q4V2 4RHV1 4CDXA 1PVC3 1OOPA 1BMV1 2XPJA 1NCRA 2WS91 4FTBA 1F8VA 1R1A2 1RUI3 3JBG2 1ND3C 1CJDA 1VBE3 4RS5B 2GSYA 3ZFEC 1NA1C 3VBOA 1RUD3 1AR83 2RS11 3VBUA 5A32B 2R043 1VBD2 1TME1 1AL23 4YVWA 3VDDB 4CDWC 4N43A 3VBFC 1AYM3 1H8TB 1D4M3 4JGZB 2R072 4AEDC 1RUC3 1MEC1 1HQNA 2HWB1 4Q4W1 1K5MC 1VBB1 1X33A 1CD3G 1VBC3 1VAKA 2RM22 1AYN3 1ND3A 4IV3B 1COV3 3NAPA 1RMU2 5ACA2 3ZFEA 4RS5C 1FMD1 2RS51 1NA1A 1PVC1 2HWE2 2HWF2 3JD72 5BNPC 5K0UB 5A33B 1RUI1 2HWC1 4CDWA 3VBFA 2IZWA 1ASJ3 5D8AB 2BFUS 4GB33 1AR81 2BBVA 2R041 1RUH2 1RUG1 1PGL2 4RR3B 1HRI2 1AL21 1TMF3 2Y26A 1R082 4IV3C 4RS5A 1AYM1 1RVF2 4CEYC 1QJX1 4Q4V3 1RUC1 1R092 4QPIB 5A32A 1PIV2 1QJU2 5L7OB 1V9U3 2XBO1 3CJIB 5K0UC 1VBC1 2RS33 1NY71 1PO23 2RMU2 1AYN1 3VDDA 3JBG3 3J8F2 4IV1C 1COV1 2FZ1A 1H8TA 4GMP0 4JGZA 1BBT1 1RUF2 1Z7S3 1RUE1
chains in the Genus database with same CATH superfamily
5FP9A 2OVUA 4RFT0 4MGQA 2NN8A 3BKZA 3P3PA 4FP3A 4CCKA 4GH4A 5FO8B 2PQQA 1WCSA 1HXS2 4I30A 4CVUA 4LHKA 1ODMA 1ASJ1 1AJOA 1S55A 1SACA 2VUAA 3WDUA 4W6XA 3HQXA 2R073 5LA1A 2EIBA 1LGCA 1ZZ8A 2X5IB 3O5SA 1LJ7A 4XEZA 3GHNA 1VAMA 2B42B 2A3XA 3GDBA 2RDRA 3TN92 3WSOA 1LOFA 4DPNA 4FPEA 2IXKA 2WZR2 4IL7A 1TMF1 3VHNA 1PGW1 3AB0A 2V72A 3U78A 4COWA 2WDBA 2XJSA 3MFCA 4JKKA 4O9EA 3IPVB 4WVZA 5GALA 5C3QA 1ENXA 4JV4A 1MZFA 3MF9A 2IWGB 2DF7A 4A2UA 2VMFA 5KXDA 3WHTA 3U0ZA 5D8AA 3URFA 4MX3A 3IT8A 4JKLA 1GWLA 3B02A 5FREA 5CEHA 4YGEA 3GM8A 3K4DA 3J4UH 3S7IA 5A6YA 3PVNA 1WKYA 2BTVC 3I54A 3SHRA 4P9JA 1VRH1 1OURA 3BI3A 1PO21 5LBCA 4RHV2 2ZGOA 3H1MA 4HKLA 5JI7A 2DCTA 3UYJA 3FLTA 3H9AA 5CKMA 5BXXA 3ZFGC 3D6EA 4LK7A 3BTYA 4I0AA 4GAZA 4Q0PA 1D2SA 5KWRA 4QPIA 2K0GA 4Y22B 2Q1MA 5CADA 3LSDA 1UOGA 4PLOA 4BMBA 4BIOA 4ZZ5A 4L9BA 4JCKA 5FO9B 1FT9A 3PJYA 1FX5A 1ZVFA 2XG3A 1UU4A 4JGYB 4QDQA 2VR4A 1EAH3 4XCAA 3U4XA 2J1AA 2WFF3 3ZYHA 4FPOB 3JCIA 4ARYA 1TEIA 1ULFA 4M3CE 3POFA 5ABJB 4Q0SA 1UU5A 2LM3A 2GMEA 2V4VA 5DDJ3 1TME2 3K4AA 5F3EA 1PIV3 5FJKA 3X29B 2PQSA 1W8TA 4Q0UA 3VDBA 2ZZJA 4KWUA 4GALA 2PAEA 5DZEA 3WNXA 1GP5A 4EYUA 4BB3A 3ZYRA 1IPSA 1O6UA 2EIDA 2JICA 4YW5A 1MEC2 3ZXFA 4B3NA 2BGOA 1GFF2 2HH9A 4Q4W2 5FXVA 1HDKA 1JZ4A 2XL7A 2X5IA 3WG1A 1O8PA 1QJY2 1OFNA 1UKRA 1NOVA 1LEMA 3P3NA 1GNHA 2HLEA 3OGJA 5IVFA 1ZZBA 1UZVA 2XGXA 4KH9A 4KU7A 5L36A 3S30A 4KWKA 4XJUA 2QJVA 3IDBB 1RUD1 1HXS3 5DAVA 4AYUA 2P6HA 4HVQA 3I2KA 5I0DA 1G9DA 5IK4A 1PZ9A 4JQTA 2ADDA 3KT4A 3GBFA 1WW7A 2A5ZA 3J26N 4LHNA 4N90A 4CDQB 1GOFA 1BEV3 5F5QA 4AR2A 2NQYA 2QNKA 2EF6A 3C7FA 4LBKA 1WW6A 4Z2WA 4XUQA 5KC5A 4P08A 1OVPA 3TN93 1WZXA 5FPBA 1PGL1 3KQ4B 1UOJA 3HMYA 4XFHA 1EAH1 5CU1A 5KHHA 5A3PA 5IVBA 5KHIA 2WFF1 1GV9A 2Y8KA 2HEYF 2X05A 3SQOA 5CVRA 3AC0A 3RYPA 3N9PA 3QBQA 2Y6FA 2B39A 3EO6A 5C4WC 3NNMA 5DDJ1 1TNRA 3LFMA 5LEJA 2GN3A 4LT5A 5FY7A 4HK9A 5CIRA 3RSJA 3SH4A 4QAWA 2W0XA 5FZBA 5CFCC 3AYEA 5C8CB 1U5IA 4JGYA 5JSPA 3R05A 4XF3A 2RG4A 4JHZA 1Q8OA 2YY1A 2K46A 1AXYA 2ZGRA 2D43A 3RJ2X 1SFYA 4WM8B 4M0HA 4LKFA 5ABJA 3V0BB 3UKVA 1QXJA 5HCFA 2AACA 1W8WA 1VBC2 3RFRA 3Q8AA 4AFBA 1AYN2 1W2OA 2QZ3A 1LESA 4XABA 2WAAA 2D3SA 2WNVB 4XURA 4YPJA 1PNGA 2VMEA 4YVSC 4COUA 4COZA 4W4ZA 1MQTC 4MOAA 3ZFGB 2JECA 4S2HA 3U11A 4ZPIA 3VBSC 1ONAA 4G9SB 1XU2A 4ZU4A 3CEWA 3I2HA 4HETA 2VECA 1XE0A 3HNMA 3LGRA 1PVXA 3NO8A 2VBBA 2ZOEB 4PBOA 5FZKA 2A75A 4OHYA 1N3OA 4LHSA 5JWPA 3QOPA 4Q8LA 4AGRA 2E9QA 5CYYA 3UT0A 4OFGA 5GLWA 1W2UA 4N7UA 4BQ4A 4BQ3A 5C9AC 1BEV1 3R4UA 5FLJA 5FZDA 4A4AA 2QQPA 2VZQA 4K8RB 1C1LA 4LK6A 4CCOA 5BNOC 1X8MA 1ULOA 4BZ4A 5DXDA 4YM2A 4GB32 5IVJA 2HWE3 2WBKA 4QQ2A 3PUHA 1JYIA 2D93A 5KHGA 4XHBA 5JUVA 1J3PA 2BVBA 1UZWA 2BFUL 1ENQA 5IAVA 1MS1A 5F5CA 4XC9A 4Q4W3 3NKGA 4R9DA 3ZLIA 5FMBA 1WLCA 4AVSA 4CDQA 1CX4A 1QJY3 1XOYA 2VMGA 2VOTA 1UMIA 3WY6A 3LF7A 3W9AA 1YLLA 2BU9A 2GP3A 4HANA 5GZFA 1NCQC 5T55A 1VMFA 1UYXA 1UU6A 2GC1A 2QBXA 1J59A 1Y9QA 1XQNA 1YWKA 2K2SA 4QPGC 4BYYA 5FY8A 2N7GA 4KMQA 1V9U2 2VCAA 2G4IA 2PA7A 3FN9A 2RS32 2ZEWA 5EHDA 2WLQA 4UF0B 1JXNA 2YGLA 2VJXA 2ZAHA 3HJRA 5F6KA 3IZOA 1KFXL 4FFHA 5C8CA 1R083 2B9UA 4XFAA 5C3PA 4XETA 4A41A 1Z7S2 4WM8A 2GC2A 3V0BA 2WNUC 3U4SA 1VE0A 1QJU3 3AX4A 5LZ6A 4S2FA 4WVVA 2L9LA 3MLKA 2E33A 1W8NA 4YLZA 3EJKA 2WNVA 1S0JA 3I2FA 3OGVA 2BEOA 2HWD2 3RZGA 3ZFGA 4A45A 3POBA 3O0XA 3OBZA 4LBJA 4IEOA 2C1FA 4AFDA 2HWE1 2RHPA 1V00A 3WVJA 3T1MA 3K3NA 2A6ZA 3FX3A 2ET1A 4BQ1A 5C3RA 1YFXA 5C70A 3BTZA 3ZIWA 5CFCB 1QJY1 2C24A 1DGWX 1N1YA 3P1IA 2FMDA 4XXAA 3MO4A 4XBLA 1HN0A 2HYXA 3ZM8A 1OPOA 2XQXA 5JLVA 2VULA 1S2EA 1T6GC 2D6LX 5EV7A 2XLGA 2JE7A 1YNAA 1KDMA 5GKAC 5L9BA 5SV5A 4AVTA 1SG3A 1UAIA 5FMOS 5LK7B 3FHIB 4Y5SA 3PTRB 1O59A 3ACLA 5FZAA 2BP6A 1W2TA 3WP3A 2MEV2 5FZOB 1RUJ2 2XJPA 4HK8A 4CDXB 3WP4A 2PLV2 3VL9A 1R081 1EY2A 2ZTNA 1GQHA 1ALYA 3HN1A 3EXUA 1QJEA 2WRAA 2WO1A 1LHUA 4HSJA 1NCRB 3QLQA 4P14A 4AVVA 1C5HA 2CTVA 2Z2SB 2D44A 3VKLA 3GNEA 3LDBA 2OS2A 1QJU1 4QQLA 3K75B 4OLLA 4MO3M 2BNMA 3TOJA 4UF0A 2DTWA 4MH0E 4QKDA 4D7TA 3R0RA 4BK5A 5J48A 4AAPA 4AF9A 3VZJA 3FL7A 1A6CA 2EXJA 4IUGA 4LO8A 5FUNA 1B09A 1V6OA 1E57A 2P3YA 3E6DA 4K6BA 2PHWA 2QQJA 5T5OA 3WLUA 1G9CA 4YVWB 1LNSA 5IVEA 2RDSA 1N1TA 3BB6A 3KD4A 1FATA 3B5LB 3KV5A 5IJRA 2YC4A 1QH7A 3WQ1A 1CQ9A 5F7UA 5I8SA 4MGKE 4YZ5A 2RS13 1JU3A 3FWEA 2PYTA 4Q29A 5A7PA 1QQP1 1NXD1 2QDRA 2YU2A 5B4XA 5LBEA 1Y3TA 5C4WA 3M1HA 1KITA 1LOCA 1DLCA 2R062 5LA2A 3K48A 5CFCA 1SEFA 1W9FA 2W46A 4DMIA 2Y6LA 3H3UA 4INDA 5JCTA 3AYDA 1QNWA 1XE7A 2VE1A 2BERA 4UT5A 3PUQA 4QKFA 3VBUC 5FZ6A 5C5TA 2JDZA 4Q0QA 1A78A 2V4AA 4D6RA 2WNUB 1V0AA 5FY1A 5C5UA 1H1MA 4Z07A 2JG9B 4BXSV 5FTTC 4XMIA 1V6NA 5FK8A 4Z92B 5AVPA 4N43C 3ZXDA 1UXXX 3VBFB 4AEJA 2BV4A 4UWDA 5FZOA 5G04L 4CDXA 3LB9A 2WJSA 4LQRA 1DYOA 5E6HA 4NPRA 2ZPXA 3ZXKA 5A80A 4DS0A 5JOYA 5LEKA 1BMV1 5IWFA 1H2KA 4AGGA 3OYWB 2D5FA 2WO2A 1GANA 3C8XA 4E4ZA 3DCQA 1NCRA 1W9YA 2JE8A 2FCVA 2WS91 3K51A 3ZN5A 1O3QA 1F8VA 4TLFA 5FYMA 1ZZ6A 2NM1A 4A42A 3JBG2 1FI2A 4GWIA 4NR1A 2O8OA 1CJDA 1JZ5A 3H8RA 2JDMA 4CP9B 3GF6A 4LHLA 3ZFEC 1XC6A 5CKQA 4OVEA 5E1RA 4XW3A 4PT6A 4FXGB 3MW2A 2RS11 4GQ7A 5FKBA 1WW4A 1X8EA 2VQUA 3ZYBA 1GP6A 2R043 2Z5WA 3N9OA 4IE7A 4LUMA 3OG2A 4Y26A 1E5SA 3WINE 1N1VA 1RJ8A 5KBFA 5F5IA 1U0AA 3AP4A 5K4LA 2CDPA 2PHRA 3ACIA 4YVWA 5FPLA 4GKXA 1VRBA 1EPZA 1I6XA 1UW8A 4JVAA 4YG6A 1OPMA 3KCYA 4B7EA 4XAAA 4D3WA 3BCWA 2DBNA 2GH2A 4AEDC 1RUC3 1DQ1A 1R64A 1JOJA 4GZ9A 4NMIA 2VO5A 3DKQA 3QH7A 4FPYA 4L92A 4A7YA 5FY5A 4DY3A 4EE2A 1K5MC 2Q30A 4NE9A 5JSOA 1DGRA 4DRVA 3ROUA 4U36A 1YQ5A 3LPGA 3POSA 2AUYA 1OF4A 5FZ1A 1Q8QA 1HV1A 1OLQA 2ZHMA 4JKMA 5C71A 3ZXLA 1RMU2 1FMD1 2J22A 4NHLA 4P9YA 3WUCA 4XJZA 3OBAA 4COVA 4QX3A 3EQEA 2G9FA 3GYDA 4KGGA 3JD72 5HXVA 5BNPC 1MACA 2J1VA 2WNUA 1WCUA 4ASMB 4CP1A 2VW0A 2A1XA 1WLDA 4MLOA 2ZGPA 5A33B 1XYPA 2R30A 1F9KA 4NPMA 4R8HA 2JG9A 2OPWA 2HWC1 2QQIA 4MZUA 3B01A 4HMZA 5FKCA 2WNEA 1GICA 2DVGA 4XE9A 3VBFA 2IZWA 3DYPA 5A7NA 4AI8A 4C1WA 4HSLA 3S5AA 4XDQA 2XOMA 2XUMA 1LENA 1ZRRA 1QMJA 5DG1A 2R041 3OYWA 3WD5A 3LKJA 3ZMNA 2RJLA 5JPNB 1YI9A 3EHKA 3GALA 5H9PA 2ATFA 1YJKA 2VMCA 4J1XA 2D7FA 1CESA 1CN1A 4CP9A 4ZXEA 1XYNA 3I3MA 4R9BA 2VOXA 2Y34A 3I3DA 4CEYC 1RUOA 5LK5A 1RUC1 2VNGA 4FPFA 4QU2A 1WCKA 2DCJA 2R0HA 2X29A 4LMFA 5EP9A 3TYJA 1QKQA 4QKNA 2HBTA 4CA9A 4LBQB 2XH6A 1LOFC 1JHNA 2E31A 3VLBB 1H2MA 2PHLA 3RNSA 1NY71 3MPPG 4QU1A 1XXNA 3JBG3 2LROA 3J8F2 4IV1C 2VTXA 3H8OA 2QQMA 5F32A 1JZ6A 5IVCA 5B2GB 1QNYA 4FPLA 5FZLA 1BBT1 1H1IA 2RE9A 4M01A 1W0NA 4AZZA 4D6QA 2E7QA 2HBUA 1RUE1 1GZ9A 2VBPA 3HNBM 5C3OA 4YFZA 1GZWA 2EIGA 3O1UA 2DFCA 5CB7A 1W03A 4XHXA 4CU9A 3DGTA 4E27A 2IXCA 4MGYE 1XNTA 1FOD2 1LKNA 3VB9A 3JXSA 4WV8A 1JMUB 5HV4A 1BVP1 3N7KA 1WCQA 1O5UA 3BGAA 2FDFA 4IETA 4AL9A 1QH6A 4LO7A 4QPIC 1OLRA 4XFGA 4LBOA 2VH9A 4FAGA 1DU3D 3VZLA 1F5FA 3ZIXA 1GR3A 4DNYA 1I9RA 5HBAA 2FZ2A 5A33A 3OUHA 1JBCA 4AHZA 3VL8A 5BUVA 4QXHA 3O7OA 4OHVA 3AZXA 1FXZA 2EAAA 3O1PA 2ES3A 4AEDB 1EV13 1UNBA 2ZGSA 4CU6A 2OPKA 2ZX2A 1YCIA 2TEPA 2ZMLA 4S2DA 4BIFA 3IAPA 4BJ0A 1K5MB 4K1YA 4BH9A 1D2QA 3JD73 5EYXA 3RI9A 1KS5A 4FQ4A 4K3UA 1W05A 1W6QB 4O61A 4F3JA 1VJ2A 1OH3A 1JYCA 2VZ3A 4G3YC 2Q1ZB 3K4ZA 5F3IA 2XLFA 1QOSA 1AR61 2IXLA 5BNPB 1O5LA 3GJAA 5DN2A 4HKOA 3KMHA 2X5IC 4XJ8A 2XQRA 2WN2A 3GCWA 1YQ6A 3D82A 3B9IA 5GM0A 4LBQA 1ZBE3 2WA3A 3ZYIB 2JX9A 4RQPB 3MFAA 4YW1A 4B8EA 4CP2A 4HVRA 4CUAA 5ISLA 2E53A 2B7YA 2VNRA 2JEMA 1W2AX 1W9SA 2OQ6A 3ETQA 2Q8EA 3BPZA 2DDUA 4MYEA 1HRV3 1UY2A 5E8AA 4META 3SITA 1QDCA 2W1SA 3ORJA 1J58A 1QY4A 2DUQA 1C57A 2WUHA 2KA3A 3LSEA 2ZABA 3OGSA 3LCPA 4TWTA 4FQZA 4CU8A 3BVCA 4V2WA 5G05L 1PO13 4CEYB 3AVSA 2DCKA 1EV11 3BU7A 3F95A 4BQWA 3VBHB 4S2GA 2KM2A 4OI0A 4R4ZA 5HPOA 4NIAA 1YQCA 2VNVA 4FFIA 3USSA 2HWB2 1HKDA 1VBA3 4KG0A 3PU3A 1HJGA 4QX1A 1I5PA 4PDWB 3NNFA 4NPLA 5J98B 1UYPA 1VBE1 4OUEA 4IV1B 1H0BA 2BZDA 2D98A 2RS52 4JGYC 3A23A 2W52A 3H1YA 4AEDA 4IERA 4YWAA 4E2QA 4CRQA 5FBJA 5ABJC 1S0BA 2ERFA 5EYYA 3USUB 5FY0A 3E6CC 2QTWB 3DPRB 1CAWB 1K5MA 2OZJA 1RUI2 3MYXA 3HBKA 3O14A 4CDUB 4EN6B 4KU8A 1ZBE1 1OHFA 1AVBA 1KS4A 4LIVA 1ULDA 2YHJA 1W6QA 4H3WA 2VUCA 1D4M1 1JW6A 3CQOA 1RB8G 2ZGLA 3WNLA 2AR6A 1AR82 3M3IA 3AZWA 3LOBA 1OLMA 2AC1A 2RJKA 5D21A 1HRV1 5BNPA 2WIIB 3ZXEA 4PF1A 1I1EA 1M06G 2VZTA 1EUTA 4LE4A 3AFGA 3VKOA 3ACFA 4ZHNA 1JOPA 2P3KA 2B46X 3L2YA 1OQ1A 2R16A 2JDUA 1NX9A 5BPXA 1W6PB 4RQPA 1NUKA 5FQ0B 1AYM2 1PO11 3JQWA 2Y6GA 4N9HA 3KT7A 4XFIA 4K1ZA 5C3SA 3LD8A 2OA2A 3E6BA 5CA6A 1AL0G 2VG9A 2XBO2 4Y1ZA 4OQ9A 1QGLA 1KFUL 1VBA1 1VBD3 2ZHNA 3JQXA 2Y6JA 2ZHKA 1XRUA 3CF6E 4CDQC 5KXBA 1ZRDA 3M7AA 5A7WB 4NRMA 4NWVA 4XFBA 4LBLA 1COV2 2ET7A 3OBTA 4Q26A 4MGTA 1OC1A 5FUIA 1O4TA 3EYPA 4CEYA 1SLAA 3N9QA 1OMIA 2R32A 4UAPA 2XWBB 3M3QA 1W06A 1P8JA 4IXLA 5JXHA 4KBZA 2FBEA 1HW5A 2ZX1A 3CBNA 4QQHA 1WLTA 5A3NA 3BUCA 4WVWA 5LA0A 5FYCA 2DV9A 3LE0A 2VOVA 4QB1A 5FYZA 3MLLA 4PDWA 5I8TA 5FMDA 4IV1A 5C8CC 3VZNA 2PHFA 4YGBA 1X82A 5LWBA 4WZCA 3T09A 1W6OB 5A1AA 4CCNA 1DP0A 3JB4C 3OUIA 2E7AA 2VM9A 1YXWA 2GC3A 3BODA 3B9CA 2GP5A 3JZVA 4WM8C 1XJAA 3USUA 3AL6A 3MF6A 4FXKB 2HWB3 1JI6A 4EWDA 3DL3A 3DPRA 1CAWA 4ISQA 2JD9A 4IE5A 5JR2A 4FTEA 4CDUA 1O91A 2J7MA 1G86A 2R1DA 2A70A 2WNVC 4RL7A 1IPKA 1YFUA 3GXUA 2J1UA 3D0JA 1M4WA 1AHSA 1S0CA 4Y4YA 3AKSA 2Y64A 2WA4A 1ND2B 1UWWA 4ES9A 3AYCA 4IE0A 4NWWA 1JU4A 5A7QA 3T08A 2VAUA 3WNPA 3V65A 4L99A 4IEVA 1LOBA 4UOJA 3SCFA 3ZSMA 1VBD1 2NMNA 3T4VA 4ES8A 4FSJA 4AHYA 1MS0A 4AI2A 1JYWA 1FAYA 5I8YA 2E51A 1HB2A 1YI7A 1QWRA 1W6PA 3ALQA 4XFCA 2NYYA 3ZFFB 5FQ0A 3ZR5A 4ASLA 4OZXA 5FOBB 4BE3A 5FZEA 4EWEA 4XILA 3UK9A 2R071 2YFZA 2ZS6B 5JI9A 4BOWA 3NMBA 4R9CA 2EXHA 1QXRA 2WWJA 4CEWB 4PIXA 5GZEA 1X9TA 2IXIA 5CG9A 2JJ6A 4M4PA 3KVAA 2GMPA 1BK1A 5A7WA 4AWDA 1G7YA 4URAA 5DABA 1IS5A 3E5QA 4LLFA 1W28A 4XUNA 2WT2A 1Y9GA 1W39A 4BLIA 3KCXA 2XDVA 5AC92 3RGBA 4XUTA 1RUF3 2ZCWA 3ME2A 3ZX7A 3EB7A 2OX0A 2XBO3 3M3OA 4W6YA 3N4MA 4N8MA 4P02B 3AMHA 4RFRB 5IW0A 1G6NA 1W9TA 4DB5A 3TEWA 2XKOA 3TB0A 1ZREA 1DIWA 1CX1A 1KQRA 4UFLA 4AFMA 3ON7A 3IPVA 5FZHA 2DBIA 5D1IA 3FJSA 2UU8A 2CGOA 4AE2A 1W6OA 3AP7A 1W99A 5GLVA 4LULA 3D8CA 4GWMA 4QGNA 3FMGA 4IEPA 1FPN2 4J1WA 1ST8A 1RXGA 4B4PA 5JZGB 1HB3A 1K3IA 4ASKA 3L2HA 2WZR3 1JUHA 2VU9A 1J3QA 2QQUA 1W8OA 3C7OA 4RGGA 1CVNA 1BYHA 4JX0A 3AP6A 1CJPA 1H8TC 2PN5A 5GZDA 3OY8B 1ND2A 4YZ3A 4UXAA 1VIWB 3I2DA 4Y22A 5A3OA 1OXCA 1PIV1 5J3UA 1W3VA 4HPKB 4ZY9A 3NV1A 3PVOA 1DGLA 4EROA 2WZEA 3J7HA 3MPBA 2MNGA 3MW3A 4PQQA 3RS6A 2AH2A 4HONA 5JXJA 2BVVA 4RHV3 5JXGA 4EN8B 4LOTA 4LA2A 1DZQA 2JKXA 3ZFFA 1QF3A 1SBFA 4CCMA 5JDBA 5FYHA 4FOVA 4L97A 4UW4A 1LR5A 2O8QA 4PLMA 1RUF1 4QGLA 4LITA 1AR92 4GD4A 3RZZA 1XNAA 1ZA4A 2EAKA 4IQPA 4CEWA 4M0NA 5CBLA 3CL1A 4FOYA 1IG0A 5KXEA 4CZSA 1PMIA 3HEIA 1S0DA 3V56A 1YQ8A 1DHKB 4CDXC 1RC6A 5B4NA 5A3MA 4JAAA 1HXS1 4UFKA 2YPJA 5C33A 2WZ8A 1RIRA 2JIJA 2IFWA 3ZMOA 2XJTA 4QB2A 2A73B 1W8ZA 5FZGA 4W65A 2WO3A 4DY5A 1NCRC 2ZZQA 3HVDA 1SMVA 2ADEA 2CL2A 1TME3 2TNFA 3FBMA 4PI2A 2CU5A 3NV3A 3POGA 1POV3 1RHI2 2QQWA 1NG0A 3PIGA 3TN91 1F31A 3MICA 2O0OA 2WZR1 4RR3C 4IEXA 1AR72 4B29A 4LR4A 1NA1B 2OUHA 5FPZA 4Q4Y2 2BUKA 1MEC3 1CPNA 2BOIA 2VOWA 4XJWA 1KRIA 1IQDC 1C8M2 4MADA 3W20A 4NUBA 2GU9A 4JDMA 3C7HA 1WD4A 3DYMA 5I0SA 2ZXQA 3Q8FA 2TUNA 1LTEA 4LEJA 4YVWC 3CNAA 1NE4A 4CDWB 5JZGA 3KGZA 5LW9A 2DVFA 1OD3A 4XTMA 1RYYA 1HX6A 1ZBA2 4RHV1 4Q4V2 3LQCA 2FDIA 2Q8CA 3I4IA 4JQRA 3WG4A 2C4XA 5DAXA 1UL9A 2C5DA 5FAXA 2DYCA 1AJKA 5FBZA 3TEYA 2YV8A 3OY8A 4UYBA 4CCJA 3JU9A 1SLCA 4XTPA 2A6VA 1R1A2 1YYNA 2HEVF 2ZX3A 4HPKA 2ZX4A 5C8WA 5IYYA 3Q8BA 4KWLA 4ZS3A 4ZS2A 4DO0A 1OA3A 4I3GA 2J1SA 4YW2A 2RV9A 1C28A 2EVXA 2H0BA 1RITA 3HN3A 2GSYA 2D6MA 1GWKA 3UGGA 3BALA 1QJFA 5F8PA 4QX5A 4JTNA 3CO2A 1RTVA 4BM8A 1L3JA 4LLOA 1PK6B 3SEPA 3FUOA 1AXKA 2Y0OA 1GUIA 2AGSA 1ZX5A 1GNYA 1TME1 3HOBA 1PM7A 3IM0A 3INAA 2JG9C 1WMXA 5DMYA 2YU1A 1S0GA 2CV6A 3WZ1A 3WR0A 5JIUA 2JDKA 1ACCA 5FWJA 1W8UA 3LWCA 3VBFC 1BCXA 4UFIA 3WDWA 2WQ8A 1RJ7A 4GULA 1H8TB 2BBAA 3FFQA 4HG6B 3UGFA 3DEMA 2A71A 1SHWB 4AEKA 1MEC1 3AVRA 3LA2A 1CZSA 1HQNA 4OULA 3RWNA 1GOHA 4FVVA 5FLHA 1UY4A 2WNOA 4Q4W1 3SNMA 2XWJB 2YMZA 1H9PA 1VBC3 3THPA 4GWNA 4F7ZA 2X8KA 2CNAA 2RM22 4Y1UA 1AYN3 3THTA 4UW6A 2WT0A 1HLCA 1QXPA 2VBDA 3G6JB 4IV3B 1UZZA 5ACA2 1E5RA 4Y1YA 2EALA 4QD2A 5JOZA 1NA1A 3C7EA 5I0TA 2K9ZA 3K3OA 3ZSKA 5FY4A 2VC9A 3T4HB 4LBMA 3VHPA 3RZLA 4BPZA 4DEVA 5KHKA 4XPVA 1CIYA 3W59A 3C2UA 3A22A 3ES1A 3WQBA 3LAGA 3N9LA 3LOIA 2DVAA 4M4RA 5FUPA 1XBFA 4IGQA 4NROA 4CDWA 2W68A 4NIIA 2R6QA 4YW6A 2W87A 1XSRA 4LO5B 2I07B 5EJ1B 4B4RA 4ZU5A 2BFUS 1WA4A 4GB33 2D97A 1IS3A 4CU7A 2KR2A 4E8CA 2CY6A 3NV4A 3Q8EA 1RUH2 2OW4A 3VV1A 5E16A 4AQ6A 1K5JA 4RR3B 1HRI2 4A3XA 4DIQA 2BYVE 4MHRA 4AW7A 1JODA 4DINB 1O4YA 2JIGA 1DQ6A 3MGUA 3OJBA 2DUPA 3CHXA 4QXBA 4LJHA 1RVF2 4L2NA 4Q4V3 1PZ7A 2FDJA 4O7XA 1KD7A 5IAXA 3BTAA 1VAVA 1VALA 1KXGA 5FYTA 3THCA 3KF5A 3WG2A 3RJRA 1PK6A 1V9U3 3CJIB 4O65A 1VBC1 2PHUA 2VMHA 4LIUA 2RS33 3RYRA 2RMU2 5I0RA 1AYN1 2JG8B 2YGMA 1F35A 2GNBA 4NOTA 3SC7X 5BNQA 5F1RA 3ATGA 2Z4FA 3SLIA 1MS3A 2ZEXA 2FZ1A 1H8TA 3N9NA 5DZGA 4KGQA 2IVJA 4KG8A 4IDZA 1CZTA 4DOUA 4GXLA 4N7IA 1RXFA 1Z7S3 3FFZA 5DAWA 1D7PM 4NO4A 3I2JA 3IBMA 4RGAA 3T1LA 2NZ9A 3IWZA 4EWAA 3HIFA 4XZUG 3W58A 5F9TA 1IKQA 2VGDA 2W39A 2VW2A 3ZKYA 2J1EA 4YG0A 5FZ3A 5CFDC 3O1RA 3OD0A 3NW4A 4QMAA 4IV3A 2HWD3 1O7FA 2JENA 3OB8A 5FY9A 1LGNA 2E6VA 2XMLA 3IDCB 1H8VA 4GB31 4GKYA 4IE6A 4YGDA 4YG3A 3EMRA 5A6QA 5M0TA 3AXDA 4IEQA 1DF0A 4Y5TA 2BW8A 2X10A 4P9IA 5LBBA 3PURA 4K21A 5AFEA 4NN0A 4YGCA 5FPUA 1ZM1A 3S0MA 2RM23 2ZGKA 2FHRA 3NJXA 1YHFA 3MLJA 2HEWF 1S0EA 4K8FA 1CAVB 2VMIA 4RD7A 1WLWA 1J83A 5FCCA 4RN5A 1OKOA 2QE3A 4XFFA 3M3EA 4KWJA 5EWSA 4P00B 3FLPA 3N7MA 3O12A 2Q8OA 1VB4A 3IB3A 5ANQA 5CKNA 1POV0 1V9U1 2ZMNA 1Q8SA 2VZUA 1UQXA 1ZNPA 2VXJA 1QOTA 2XKPA 5K9YA 3NRUA 3OCPA 4RR3A 2RS31 5FZ0A 2RR12 5FP7A 2A6WA 5F6LB 3DV8A 2MEV3 1RUJ3 4ZU7A 3HAGA 4E2GA 5TSWA 2PLV3 4L0PA 3ZSLA 4AQTA 3AFKA 1TE1B 1GOGA 1EP0A 3GHMA 3PMSA 4QQPA 2R1BA 3RQ0A 1Z7S1 4D94A 5LRSA 1UZ0A 1VMJA 1QJZA 4Q2FA 1V70A 3KWVA 1RUH3 3VBRB 1LU2A 3CJIA 3WW4A 1OLME 2UY8A 3TBDA 3ZO0B 4E4SA 1W6NB 4ATFA 1HRI3 4SLIA 2JG8A 2CAVA 3FHAA 4PHZA 2HWD1 1S2BA 3I3EA 1SLIA 4RGKA 4CP0A 1WA6X 5IT6A 1Z78A 1Q56A 2PELA 3AP5A 1LOGA 4ZONA 5HCHA 2OYZA 3IMNA 3W5MA 2BDRA 2GNTA 1Y4WA 1K45A 3GZEA 4D6SA 1BJQA 2ZJCA 3KV6A 3LIHA 2P2KA 2RMU3 2KXLA 1DFQA 2XR4A 3U37A 1JZ3A 4Q4X2 3RZMA 1GP4A 2Q8DA 4R52A 3UKTA 4A6OA 1D4VB 4MGZE 4XF1A 3ACGA 4P5YA 5JMCA 1SPPB 3HQUA 1VBB2 2G1MA 2ORXA 4LBNA 4EN9B 5APAA 2R063 3TAYA 1UF2C 3AZZA 4RQPC 1UIKA 4XDOA 2BWAA 4FI9A 1WCDJ 2JB4A 4YFWA 1PVC2 1UX6A 2CHHA 2MEV1 1RUJ1 4I09A 4OMCA 4E9KA 3DKWA 1POQA 1CAVA 2PLV1 4QM8A 4DUVA 3TEZA 5J7MA 1US3A 2P37A 2V73A 4Y1XA 2VPVA 2VUJA 2EIEA 4CXXA 1B35C 1BQPA 4PBPA 3BOWA 5FLIA 3S7EA 1G8WA 2XJVA 3SEEA 5CFDB 4NVPA 5KC6A 4OI4A 2VCCA 5FZCA 4CE8A 1GZCA 2OXBA 4BDVB 4DZGA 4OUSA 1D0HA 4GJYA 2Y60A 1UIJA 1CPMA 1BK0A 2ZBJA 2A3WA 2W92A 2BPA2 1C4RA 3IKWA 3KCCA 5IUQA 3T2OA 3VBHC 3GBWA 4B1LA 1W0PA 1NLRA 5BNNB 1VMHA 1RUG2 2FCUA 4J6GA 1AL22 3FZ3A 4FFGA 4M00A 1NKGA 3AMMA 4AG4A 4PDWC 3VBRA 2VL4A 2WYSA 3VD7A 1K42A 1W6NA 2BQPA 4FOWA 5F5AA 4CYDA 3UJOA 2RMU1 2CSGA 1H2NA 1QJX2 2RR13 4UI9L 2FDKA 1CWPA 5FWEA 3NJYA 4N53B 3H3ZA 2VCMA 3VKNA 5FXZA 1PM4A 4ATEA 4TXWA 5HV0A 4OI2A 2WABA 4HVOA 3DPRC 3NNLA 4XZPA 2XLAA 1MZ6A 5C6CA 1UY1A 4CDUC 4NAMA 4BCUA 2R061 3KHCA 4QT6A 4WM7B 1E5IA 4YSFA 4MV2A 5FYYA 5EJ3A 1O4ZA 1UD1A 1TVGA 2ORZA 2UURA 1FV2A 4KNCA 3IDEA 2RVAA 1NZIA 4BK4A 3SISA 3ZXAC 4LORA 4ITCA 1SPPA 2WSVA 1BLZA 4KQ7A 1OH4A 1CZVA 3K2OA 5F3GA 3QH6A 2ZGTA 4I0BA 2LS6A 5FFOC 4XVHA 1ASJ2 3DUIA 2VNOA 4RA0A 3A21A 1RMU3 4JDOA 1X9PA 1MZ5A 1VB2A 1IOAA 1QOOA 3VBOC 1S2KA 4NHKA 3SKVA 3VZKA 4HFSA 1H30A 1NE6A 3N3HA 4LE3A 4NHYA 4Q4X3 1OA4A 2PHDA 3JB8A 1GLHA 4LBQD 4XJ9A 1YJLA 4YM3A 1KJLA 2VVFA 4NRPA 1VBB3 1GU3A 1TMF2 2VZSA 4LNVA 1PGW2 5CFDA 3T30A 4BA6A 2W2IA 3CLPA 1TNFA 3JBG1 5LA9A 4XACA 4V1PA 3RRDA 1OUXA 2A7AA 1NAEA 3D5OA 2VQ0A 1J84A 1KEXA 3M8LA 3P6BA 3OOXA 4UFHA 5FMCA 2DU1A 4I2OA 2AEYA 1JZ2A 5BYNA 1CAUB 5LB6A 5BNNA 2FDHA 2B9VA 4UBHA 1VRH2 3MHZA 1REDA 1PO22 1DDLA 1L7QA 4I3PA 2AYHA 4Y1VA 4BQ2A 2JXAA 2Y6KA 3SH5A 2FD8A 3WQ0A 1SFPA 3RMXA 3ZYGA 4Z1VA 3PVEA 5IATA 2WQZC 2ZKNA 2R49A 3KZ4C 1B35B 5T50A 4N53A 3UNPA 4E2SA 5FYVA 1UXZA 1MR5A 1Q8VA 3V64A 3WG3A 1ULCA 3WDXA 4AVBA 1RUG3 2YFUA 2FMYA 2GZWA 4URTA 4IGPA 3WF3A 3DF0A 3SCHA 4CXYA 2XXZA 1E5HA 1YQ2A 4WM7A 4Y4RA 3J8F3 4DXSA 2VZPA 1RMU1 2W9XA 1LRHA 1QJX3 1C1FA 2EICA 3GZAA 1ND2C 1LECA 1ULPA 2D6OX 3ILFA 3OUJA 4FPJA 4HN1A 4Q4X1 5EFUA 5FK7A 2GDFA 1J3RA 3JD71 4YRDA 1O3RA 1FNYA 1F4HA 2ZGUA 4XQWA 2P3IA 4H55A 2DCYA 3PNAA 1GBGA 1OQDA 3WP5A 3HT1A 1F2NA 2D40A 3F2ZA 1D0GA 4Q1RA 4GH4B 1GQPA 3T0DA 1FOD3 3ZFFC 1DZTA 1SDWA 4E4DX 4MHUA 4K7JA 3ZPOA 1ZRIA 1NQJA 5DUUA 2YPDA 5A6XA 1DGWA 1WD3A 2JE9A 1QHDA 5FP3A 2QVSB 4CEWC 1DBNA 4LKSA 1XYOA 2ZAAA 3MIEA 3LDRA 1JTZX 2YROA 4LA3A 2F17A 3ZDVA 3OF1A 1H2LA 4ORFA 4OHXA 3OSDA 2W91A 3VDDC 1PNFA 1OOPB 1RUD2 2RDNA 4XF0A 5JR7B 5J09A 1HIXA 4UBGA 2X53S 3TWIA 3OPWA 4JGZC 1XSQA 3AP9A 3HD8B 4QX0A 1CAUA 3WF4A 2I45A 3NNGA 1UY3A 2QQOA 5J96B 2CAUA 1EAH2 1XPWA 3I3QA 2JKBA 5I93A 2GALA 2WFF2 3I59B 3VBOB 2V5DA 4OHWA 3J8F1 4MG2A 5FDBA 1MS5A 3CZUA 1ODNA 2WL1A 4TYSA 1X50A 1XNCA 5KR7A 1HV0A 1B35A 1PGSA 1DGRN 5DDJ2 4FTSA 3AZYA 5J1XA 3BIWE 2W1WA 3N7LA 3THDA 3BN6A 3ST7A 3ZSJA 5JZGC 1DQ2A 1UPIA 2ZA9A 1VRH3 3I2OA 2QQKA 1OBNA 1GSLA 4NHMA 1FOD1 5I0UA 1ENSA 3VHOA 1OF3A 3VBHA 2E7TA 4BU2A 3MUZ1 1IQAA 1JH5A 2GH8A 5F2SA 2UWCA 2JDHA 1KDKA 3WNOA 1DYKA 2JD4A 3HBZA 2VXRA 4XJAA 1W04A 1FNZA 3FHQA 3KLSA 1ND3B 3T2TA 1SLTA 4C0HA 1X36A 4Y33A 4SBVA 4MXVA 4NIDA 3J7LA 2ZEYA 3FE5A 2Q1FA 3AZVA 1LU1A 4XYXA 4CCLA 5GZCA 4Z82A 3ZSEA 3AL5A 4XMAA 2BRTA 4LKEA 1BEV2 2ZMKA 1HQLA 1XE8A 2CGPA 3I8TA 3HNYM 5L19A 3WF1A 5L7OC 3R6SA 5L73A 1H6XA 3E5XA 2Z69A 1VLNA 4MVTA 4IEYA 4PF5A 3SKJE 2RS53 2A3YA 3B93A 3LA7A 3I49A 1OOPA 1OI6A 3AKQA 4AI0A 3U75A 3BPSA 1IS6A 2WZPP 4QDSA 3U14A 3UGHA 2XPJA 4FTBA 2P4EA 2QDNA 1DLLA 1OKQA 2DVDA 2C0ZA 2VZ1A 1RUI3 3PUAA 5FZ8A 4E8DA 1XB9A 5DUVA 1RUNA 4YM1A 2WC2A 1FV3A 2DUOA 4JZRA 4RS5B 2F6BA 3IMMA 1NA1C 2XJRA 3MIBA 3I59A 3VBOA 1BVVA 3H8UA 5GLTA 1RUD3 3PTYA 5A6ZA 1AR83 1Y9MA 4LO4B 2YYOA 3H0OA 3OTFA 2WO7A 2LW8A 3VZMA 2O1QA 2PFWA 3H1WA 3WNMA 5AVAA 1DQ0A 2BGPA 3ZN4A 2ZEZA 3GJBA 4QHOA 2VZOA 5T3NA 3VDDB 1ENRA 2E26A 4CDWC 4Q0VA 1WBFA 5T5LA 3POWA 2YC2A 1Q43A 5DAQA 1AYM3 3RDIA 4JGZB 3WW3A 4IEZA 4BMEA 4KI5M 3J7NA 3OGGA 2UWAA 4FT8A 5IFTA 4P9XA 1RGSA 1PHMA 2W47A 2ZKLA 1UCXA 1DYPA 2HWB1 3ZR6A 1UZYA 5A3LA 4Q27A 2BJSA 5IK5A 4NJ4A 1X33A 1CD3G 1ZZ9A 2CWSA 1OVSA 3T2PA 1ND3A 2NP0A 1RINA 1COV3 1W8FA 2JDAA 2R7EB 1AZDA 1UOBA 3M2MA 5JOWA 1AXZA 2RS51 4BQYA 3RZJA 4PQ9A 1LOEA 2HWE2 3PJQA 3POYA 1A3KA 4HBNA 2HWF2 1UMHA 2DFBA 1JS9A 2PAKA 1UX7A 2RDQA 1PX3A 2Z79A 3LPFA 3N35A 4PIZA 3LZZA 1QU0A 4B4QA 4E4HA 1PK6C 2UYBA 4HKWA 3WOGA 4Q8KA 4YM0A 1STMA 4I02A 4ZZ8A 5K0UB 5T5JA 1RUI1 2CDOA 1OSGA 1CR7A 2W08A 3E1F1 3LEMA 1O3SA 2ZGQA 3ACHA 2PMWB 3AXEA 2YB7A 2CGNA 4XCBA 5FP8A 3UKNA 3RZHA 2XVKA 1V6MA 4AI1A 1T2XA 4FPKA 3WX5A 1AR81 2UYAA 3RZKA 2DCZA 3WP6A 3WUDA 1LHOA 1NLQA 5GLZA 5ERLA 4FAHA 1Q8PA 4U2AA 5LY2A 4HLTA 3P5BA 1R1ZA 4IEUA 4KBBA 1EYBA 3ZXGA 1O3TA 5KXCA 1R082 3LIGA 4IV3C 4FPCA 4RS5A 1AYM1 3MEPA 2Y0IA 5CNAA 4D7YA 2G9GA 2D3RA 4QWNA 1R092 1NXMA 1DQ4A 3ZXJA 1WGPA 3CZJA 1QJU2 2WQ4A 5L7OB 2XBO1 4HL0A 3NKTA 2HYKA 2XB6C 2ZX0A 3VDDA 4QXKA 5IVVA 2GAUA 3DYOA 5FZMA 4C0BA 2EXKA 1COV1 2Y6HA 5HXMA 3NJVA 2C9KA 1OQEA 2H0VA 3IDAA 3ILRA 2KD7A 4JGZA 4AOCA 1H4GA 5H9QA 3AMPA 1CIWA 1REEA 4IGOA 1LB2A 2ZGMA 4ZKTB 3V0AB 1W3XA 4C91A 1BHGA 3MIFA 4XUPA 1WUVA 2ID4A 1I5ZA 2JDNA 3PDQA 2V09A 4Y20B 1DCSA 2XVGA 5T5PA 1YRZA 1S4CA 2I2SA 3SMHA 1UYYA 3LEGA 3S6PA 4FBFA 1SLBA 3OD4A 5CG8A 1N1SA 2WLPA 1LOAA 1QQP2 2WT1A 2YG0A 4UW5A 4XBNA 3SH3A 5AC93 5F39A 3VGIA 2P34A 4D8MA 3HPNA 4DXTA 4JHTA 2YZ4A 2GNMA 2B5HA 2PTMA 3CJIC 3VD9A 1UYZA 5K0UA 2XL9A 1A8DA 3MW4A 3MUY1 1JOBA 4TSVA 5FMOL 4AI9A 4K40A 2H6CA 1JYTA 1LHVA 2JG8C 3MZHA 4QPYA 2XJQA 3AYAA 4FCAA 4XQ4A 1G9FA 1LCLA 4XDPA 5FZ9A 3H8XA 1OT5A 1YIPA 5DZFA 4C1XA 4AGVA 2HWF3 3LFIA 5HCAA 3VD5A 2Q4SA 1FPN3 2NPIA 3DN7A 3DXUA 1YUDA 3PU8A 3U1XA 4Z8BA 3KGLA 1SFNA 1JYNA 1XNBA 3B7MA 5FV3A 3VDAA 4F83A 3OBRA 2UWBA 1C5IA 2YUEA 2AENA 2YXSA 4WBBA 4TTGA 3POJA 3CJXA 1BMV2 2AREA 3S5QA 5IFPA 4YZ1A 3RWKX 3NJZA 3E5UA 2IUWA 2WS92 3H7YA 1V6KA 2CYFA 2H6BA 2HKXA 3B00A 3OPTA 4MSVA 2O14A 4GWJA 4M3CB 3RVHA 5L7OA 1POV1 4EN7B 4Y5Z0 4OUMA 1W8HA 4UFJA 3NV2A 4EJRA 4JRLA 3WEZA 5FOJB 4GJZA 3H50A 4OMDA 3W21A 4A7ZA 5CAZA 3HQRA 3M4FA 2RS12 3ENRA 4A3ZA 3WF0A 3ZYFA 4H2AA 3UL2A 1IG3A 3ETPA 1JZ8A 1ZZCA 1LHNA 5AC91 3FUQA 3ITQA 1UY0A 1R093 2WINB 3I7DA 2FQPA 1AR93 2D6KA 2DTYA 3KV9A 1GMMA 2C6SA 3V0AA 2SBAA 4A7KA 1MVQA 5JAXA 1GQGA 4P9GA 5A1FA 1PMJX 4XBQA 3VZOA 4Y20A 5FYSA 2BWCA 4AHXA 1MVEA 1LHWA 2IXJA 4XQDA 3OEBA 4QHBA 4AAXA 3WT3A 2NMOA 5C4WB 2HWF1 2ETEA 1FPN1 3T0AA 2ARCA 1ULGA 2WKKA 4LTAA 3VBRC 1NZCA 5C7GA 2GMMA 4YZ4A 3T3YA 1RHI3 2EXIA 4X6RB 5LBFA 1GYKA 4B7KA 1FMD2 5CISA 1AR73 2QQNA 5JOXA 3C3VA 4AFCA 1QEXA 4K9SA 4BXFA 4IESA 4DFSA 3WW1A 5GJ6A 4Q4Y3 1DQ5A 2XJUA 2W5FA 1F4AA 2W1QA 3K77A 1SCSA 1C8M3 3WCSA 1QQP3 5IK8A 5D2AA 4XAEA 1EUUA 3BU0A 3KV4A 3VDCA 4HOOA 2HWC2 4BISA 4UFMA 4DXRA 3MDPA 2IXHA 2YBKA 2B4KA 2IC1A 5FR3A 4YVSB 1AF9A 1IPJA 4KL1A 1MQTB 1TZOA 4TLGA 3WQ7A 1YFYA 5EXOA 3VBSB 1ZBA3 5IVYA 1V6LA 3MI8A 2JB8A 3POEA 2R042 5LRRA 4CUBA 1J1LA 5FYIA 3NNJA 2A6YA 1H6YA 3HWJA 3MV01 2ENRA 1R091 3E97A 5C9AB 1AR91 4J25A 4A6SA 4M3CA 1R1A3 4OZOA 4OI1A 5AFBA 2VQAA 3HT2A 4F8AA 5BNOB 1SQ4A 1AX0A 2F4LA 5FP4A 5DQ0A 1Y43B 3KVBA 1C3HA 1G9BA 1G9AA 1XU1A 3DECA 1RUC2 3BOPA 3PHMA 3KF3A 4AI3A 1NYWA 2D5HA 1YO8A 2GN7A 3VUOA 1SZBA 1AUYA 5FPAA 1VP6A 1MS4A 2WS93 5FXXA 4EQVA 5F37A 3WXPA 2ZACA 1JUIA 1I3HA 1NY72 2LUWA 5FO7B 2LALA 1PZ8A 2OQ7A 1XNKA 2W3JA 3ELNA 1C8NA 1RHI1 2MPFA 4X8NA 3GBGA 3B69A 1NCQB 5ANNA 1NLSA 4JTOA 1AR71 2VVEA 2XUEA 3NL1A 4FO9A 4IEWA 5JVVA 4PLNA 4UW3A 4EZHA 1BBT2 4WVMB 2VCBA 4Q4Y1 1AX1A 4XUOA 1EPWA 1UN1A 1Q5OA 1RUE2 3LEIA 3GZUC 2G19A 4QPGB 1C8M1 1GKBA 3Q8CA 4QX7A 1HJFA 1DG6A 2ARXA 5BNNC 1CAXB 5FZ7A 4I0WB 3VD4A 5LASA 4B1MA 3BTXA 1PX4A 5H9RA 3A0NA 5ACA3 5JPMB 1ZBA1 4Q4V1 2W1UA 4JC1A 2J1RA 4LO6B 4O9GA 4P5HA 4N53C 4TN7A 2C9AA 4NRQA 1OA2A 3VKMA 4Q5OA 3WNKA 2OZ6A 4HN0A 3OPZA 1R1A1 2BGCA 2P6CA 3ILNA 3KT1A 1UMZA 5LCWL 2PXJA 2WSUA 3AM2A 4YVSA 4WM7C 1T6BX 1MQTA 3LEKA 4IE4A 3BIEA 1FMD3 4LPLA 3OEAA 2VZVA 3VBSA 3ZVXA 1PMHX 1NQDA 5IK7A 1SCRA 3BYWA 3MIHA 4X8PA 5I91A 1U12A 2A6XA 2SLIA 4L8QA 4LUKA 5A7SA 3UV9A 2VW1A 5SV8A 4BQXA 5BY5A 1NT0A 5EQUA 1N3QA 2UY9A 4QM9A 4QPWA 5FIXA 3UETA 4XIKA 3ZPYA 1UOFA 1Z0HA 4CUCA 5C9AA 1LEDA 3GCXA 1UKGA 1S0FA 1S0IA 1VPHA 2HWC3 3H7JA 5BNOA 1VR3A 1KGYA 3CDZB 1IHMA 5GLUA 1S1AA 3O1SA 3VHRA 3NAPC 3OGRA 2E32A 2P5BA 3T0BA 1AR62 3VKFC 1F15A 2B45X 2DVBA 3CU7A 1RVF3 3SCGA 4CXWA 3I2IA 3KQRA 2G9ZA 2XHNA 2J42A 3ASIA 1MPXA 3H42B 3APBA 4YARA 5T52A 4CTEA 1GWMA 1L7LA 1OFSA 3QACA 5FZIA 2B8MA 2RM21 3KSCA 1JN2P 3PUIA 4OCTA 5DUWA 1NCQA 3ZYPA 5ACA1 1CONA 4YW3A 1SLLA 2PHTA 4CUGA 3J7MA 4WVMA 1H9WA 5HI0A 4W8JA 1WWYA 1RL3A 3MBWA 1O8SA 3IIAA 1H1AA 3U07A 4QPGA 1QIQA 3M3CA 4PI0A 1GZWB 4RYDA 1CAXA 4OYUA 5H9SA 3TNPB 4YW4A 3U10A 3ZN6B 3CMGA 3WCRA 1US2A 3ZYJB 4FOQA 4LKDA 3R4SA 1EV12 4IW3A 3AKRA 4K20A 3POIA 4YZ2A 1HB4A 4QQOA 2X09A 4XXPA 2WFPA 3TEXA 1ULEA 3WF2A 3NQHA 1W90A 3KM5A 1BBT3 3N9MA 4WZFA 1W9WA 3N7JA 1SDDB 4QDRA 1IZ3A 5GZGA 3R4DB 4XF4A 1RUE3 4CSWA 1SBDA 3LA3A 3VN4A 1RUH1 4YYOA 1TQ5A 1VBE2 5EPAA 3AMNA 4AQ2A 4D7SA 3A4UA 5DUXA 4W50A 1HRI1 2WWUA 4HXCA 3WHUA 2QKDA 2BNNA 2XVLA 4M3CF 3TNQA 2WR9A 1V6JA 3EBRA 4CCEA 1RVF1 4GMP3 4EV0A 4XOGA 5DG2A 4QX2A 2I74A 5CZKA 1ZBE2 2PHXA 2P17A 2ZGNA 4FFFA 3MIGA 2VOKA 3UJQA 4P9WA 1YFWA 4N9IA 5A1LA 1MZEA 4PIYA 4QGMA 5FZFA 5FXWA 1D4M2 1OUSA 4GH4C 5LY1A 5IHRA 1L7RA 2DU0A 3VBUB 2TBVA 3IIIA 2VTFA 1HRV2 3RMYA 3WDYA 5JSRA 2Q0AA 1GNZA 1JHJA 2VQTA 4HT1T 1OD5A 5HCBA 1AX2A 4D0QA 1XNDA 2CWMA 3MIDA 3HR9A 4I01A 2WWSA 4QHZA 3GGLA 4V2VA 5K7PA 1N47A 2VUDA 1F5JA 1PO12 1BXHA 2F4PA 4MGSA 4N43B 5LATA 4HZFA 4AEMA 3I2GA 3L9JT 2V5YA 4DUWA 4YW7A 4Z2AA 1OOPC 2D6PA 4D69A 4R4XA 3PL0A 4AVAA 4CCDA 2DURA 1IGOA 1WW5A 2WYFA 4XF9A 2BNOA 3FLRA 1BZWA 1AR63 3KS7A 2DWRA 1YC61 1WMDA 5D8AC 3NWKA 1VBA2 1CGPA 1ZRFA 4QB6A 3A0KA 3PUSA 4YNIA 5KHJA 4JDNA 2QQLA 1W6MB 3VD3A 3CIHA 5JXIA 3ZN6A 1LAJA 1BKZA 1ZRCA 1DZRA 1LODA 2ZHLA 3NAPB 5BV6A 5K8SA 3ZFEB 3AJYA 3H3LA 2QQVA 1Q3EA 2JDYA 4ONUA 1K12A 2VD7A 1A8MA 3SXWA 4BLJA 4GMP1 1W0OA 3ECQA 3DXTA 2FDGA 2IFRA 5A70A 5J36A 1URXA 1HB1A 2D3PA 4GIQA 3O1VA 4LOSA 3I97A 4CPBD 2FCTA 4FPGA 4AHWA 3IAQA 3N36A 4AK3A 2Z42A 1IS4A 4W6WA 4C8DA 2RR11 1KJRA 2BOJA 1PVC3 4C90A 1U5YA 2EA7A 3D0SA 1UPSA 4BHPA 3PLQA 3O1OA 2GC0A 2YBPA 4XIOA 5A3WA 4NAOA 4CCCA 5E88A 2XHKA 5EJZB 5L9RA 3S57A 1WMFA 2QFEA 3AKPA 4G4FA 4A44A 1LGBA 1JYVA 1JZ7A 2GNDA 3QD6A 4PJYA 5JIAA 5DAPA 2D6NA 2R0FA 3IN9A 1ND3C 4CPBA 1QDOA 1VBE3 2YBSA 2LTNA 4FPHA 5J37A 3C7GA 3O0WA 1J1TA 4AQSA 2VMDA 1ZA7A 5A3TA 3VBUA 5EIYB 5A32B 2QUOA 4COYA 1APNA 1VBD2 4AXOA 1ZYBA 1GZTA 2IVIB 2QCSB 4MXWB 5T54A 4MGIE 3RI8A 4DQAA 1AL23 3O1MA 3NSTA 2JDPA 4OHZA 3JUUA 3GZTB 5E89A 2W95A 3ZOIA 3MV11 2NLRA 4N43A 4QX8A 4DEQA 4DRRA 2VZRA 1D4M3 1X7NA 2R072 4Y3OA 1MS8A 2Y33A 3A7QA 3KHBA 3FBYA 4PCRA 2RJ2A 4BQ5A 4ARXA 3O0VA 1VBB1 1REFA 2WAOA 1VAKA 4RSUA 1W6MA 3CKHA 1H4HA 3B94A 3RPQA 4BWOA 4OQ8A 1IKPA 2AEZA 3PMEA 4NIGA 3WV6A 4P9LA 1SBEA 3NAPA 5FPXA 3ZFEA 4RS5C 2Q5TA 3AKTA 1PVC1 1YIFA 3PIJA 4AFAA 3RYKA 4DXZA 3AMQA 3O1TA 3QCWA 1JYXA 1U5XA 5F3CA 5F2WA 3M70A 3WNNA 2ILMA 1WBLA 3B3QE 5FYBA 1UO9A 4LXLA 2ARBA 4EN0A 2W94A 4QKBA 3WDVA 2JWPA 1N3PA 4Y24A 1YEWA 5DPNA 2J1TA 1ASJ3 2MHFA 2VTXJ 3K46A 3T2QA 5D8AB 2OUJA 5FYUA 3UESA 3D3AA 4AVCA 2BBVA 2VY0A 2LRPA 2HJIA 3G7DA 4Q1PA 4ISRA 4ZXKA 1MS9A 4L11A 4H7MA 4H7LA 1RUG1 1WMEA 5FZ4A 2OT7A 2C26A 1PGL2 2XONA 3AK0A 3NVCA 1AL21 2OIIA 1TMF3 3RG0A 4NHXA 4R9AA 2Y26A 4FP2A 5FPVA 1FYUA 1A34A 4JRAA 4H14A 2OKXA 5JMOA 4GA9A 4EZ4A 1V6IA 1HQWA 1QJX1 5FRAA 3I3BA 2P3JA 1LULA 1U5ZA 2VVDA 2AZ5A 4QPIB 4ET7A 5A32A 1PIV2 2Y38A 3D4KA 3ES4A 2QZ2A 3AJZA 3J9SA 5A3UA 3W5NA 1HN1A 5EZWA 1Y7BA 3TRSB 4MXWA 5K0UC 1ZZ7A 2WN3A 3ABZA 2E63A 4X6QB 4NIHA 1PO23 3ZKUA 1W2NA 3ZDSA 5L9VA 3PVBB 4QXCA 3WW2A 2YC0A 2YDEA 3WDTA 2PAMA 4MUVA 4GMP0 5A7OA 1TG7A 4TZDA 3Q9OA 1RUF2 3FC0A 2ARAA 3LDKA 4DUXA 2P1BA 5FJHA 3KB5A
chains in the Genus database with same CATH topology
2OVUA 4RFT0 2NN8A 3P3PA 4FP3A 4GH4A 5FO8B 2PQQA 1WCSA 1HXS2 4I30A 4LHKA 1ASJ1 1AJOA 1S55A 1SACA 2VUAA 3WDUA 4W6XA 3HQXA 2R073 1LGCA 1ZZ8A 2X5IB 3O5SA 1LJ7A 4XEZA 3GHNA 1VAMA 2B42B 2A3XA 3TN92 4DPNA 1LOFA 4FPEA 2IXKA 2WZR2 4IL7A 1TMF1 3VHNA 1PGW1 3AB0A 4COWA 4O9EA 2XJSA 3MFCA 4WVZA 3IPVB 5GALA 1ENXA 4JV4A 1MZFA 3MF9A 2IWGB 2DF7A 4A2UA 5KXDA 3WHTA 3U0ZA 5D8AA 3URFA 4MX3A 3IT8A 3B02A 5FREA 4YGEA 3J4UH 3S7IA 3PVNA 3I54A 2BTVC 3SHRA 4P9JA 1VRH1 1PO21 4RHV2 2ZGOA 3H1MA 4HKLA 5JI7A 2DCTA 3FLTA 3H9AA 3ZFGC 5BXXA 3D6EA 4I0AA 4Q0PA 1D2SA 4QPIA 2K0GA 4Y22B 2Q1MA 5CADA 3LSDA 4PLOA 4BMBA 4BIOA 4L9BA 4JCKA 5FO9B 1FT9A 3PJYA 1FX5A 1ZVFA 2XG3A 1UU4A 4JGYB 3U4XA 1EAH3 2WFF3 4FPOB 3JCIA 1TEIA 1ULFA 4M3CE 5ABJB 4Q0SA 1UU5A 2LM3A 2GMEA 5DDJ3 1TME2 1PIV3 3X29B 4Q0UA 2ZZJA 4GALA 2PAEA 5DZEA 3WNXA 3ZYRA 2JICA 4YW5A 1MEC2 3ZXFA 4B3NA 1GFF2 4Q4W2 1HDKA 2XL7A 2X5IA 3WG1A 1QJY2 1OFNA 1UKRA 1NOVA 1LEMA 3P3NA 1GNHA 3OGJA 1ZZBA 2XGXA 4KH9A 4KU7A 5L36A 3S30A 4KWKA 4XJUA 2QJVA 3IDBB 1RUD1 1HXS3 4AYUA 4HVQA 1G9DA 5IK4A 1PZ9A 3KT4A 3GBFA 1WW7A 2A5ZA 3J26N 4LHNA 4N90A 4CDQB 5F5QA 1BEV3 2NQYA 2QNKA 2EF6A 4LBKA 4Z2WA 1WW6A 3TN93 1PGL1 3HMYA 4XFHA 5CU1A 1EAH1 5KHHA 5KHIA 2WFF1 1GV9A 2HEYF 5CVRA 3RYPA 3QBQA 2B39A 3EO6A 5C4WC 5DDJ1 1TNRA 5LEJA 2GN3A 4LT5A 4HK9A 5CIRA 3RSJA 3SH4A 2W0XA 5CFCC 3AYEA 5C8CB 1U5IA 4JGYA 5JSPA 3R05A 4XF3A 1Q8OA 2YY1A 2ZGRA 1AXYA 3RJ2X 2D43A 1SFYA 4WM8B 4M0HA 5ABJA 3V0BB 3UKVA 1QXJA 5HCFA 1VBC2 4AFBA 1AYN2 2QZ3A 1LESA 4COUA 2D3SA 2WNVB 4COZA 1PNGA 4YVSC 1MQTC 3ZFGB 2JECA 4S2HA 3U11A 3VBSC 1ONAA 4G9SB 1XU2A 4ZU4A 3CEWA 4HETA 2VECA 3LGRA 4PBOA 1PVXA 3NO8A 2ZOEB 2A75A 4OHYA 1N3OA 5JWPA 3QOPA 4Q8LA 4AGRA 2E9QA 4OFGA 5GLWA 1W2UA 4N7UA 5C9AC 1BEV1 3R4UA 5FLJA 2QQPA 1C1LA 5BNOC 1X8MA 4BZ4A 5DXDA 4YM2A 4GB32 2HWE3 4QQ2A 1JYIA 2D93A 5KHGA 4XHBA 1J3PA 2BVBA 2BFUL 1ENQA 1MS1A 4Q4W3 3NKGA 4R9DA 4AVSA 1WLCA 4CDQA 1CX4A 1QJY3 2VMGA 3WY6A 3W9AA 1YLLA 4HANA 5GZFA 1NCQC 5T55A 1UU6A 2GC1A 1J59A 1Y9QA 1XQNA 1YWKA 2K2SA 4QPGC 4BYYA 2N7GA 1V9U2 2G4IA 2PA7A 2RS32 2WLQA 1JXNA 2YGLA 2ZAHA 5F6KA 1KFXL 5C8CA 1R083 2B9UA 4XFAA 4XETA 1Z7S2 4WM8A 2GC2A 3V0BA 2WNUC 1QJU3 3AX4A 4S2FA 4WVVA 3MLKA 4YLZA 3EJKA 2WNVA 1S0JA 2BEOA 2HWD2 3ZFGA 4LBJA 3O0XA 4IEOA 2C1FA 4AFDA 2HWE1 2RHPA 1V00A 3WVJA 3T1MA 2A6ZA 3FX3A 2ET1A 4BQ1A 1YFXA 3ZIWA 5CFCB 1QJY1 1DGWX 1N1YA 2FMDA 4XXAA 4XBLA 1OPOA 5JLVA 2VULA 1T6GC 2D6LX 5EV7A 2XLGA 2JE7A 1YNAA 1KDMA 5GKAC 4AVTA 5SV5A 1UAIA 5FMOS 5LK7B 3FHIB 3ACLA 3WP3A 2MEV2 1RUJ2 2XJPA 4HK8A 4CDXB 3WP4A 2PLV2 3VL9A 1R081 1EY2A 2ZTNA 1GQHA 1ALYA 3HN1A 3EXUA 1LHUA 4HSJA 1NCRB 3QLQA 4P14A 4AVVA 1C5HA 2CTVA 2Z2SB 2D44A 3VKLA 3GNEA 1QJU1 4QQLA 4OLLA 2BNMA 3TOJA 2DTWA 4MH0E 4D7TA 3R0RA 5J48A 4AF9A 3VZJA 1A6CA 2EXJA 4LO8A 1B09A 1V6OA 1E57A 3E6DA 4K6BA 2PHWA 5T5OA 3WLUA 1G9CA 4YVWB 1N1TA 3BB6A 3KD4A 1FATA 3B5LB 1QH7A 3WQ1A 1CQ9A 5I8SA 4MGKE 4YZ5A 2RS13 3FWEA 2PYTA 4Q29A 1QQP1 1NXD1 2QDRA 1Y3TA 5C4WA 3M1HA 1KITA 1LOCA 2R062 3K48A 5CFCA 1SEFA 4DMIA 3H3UA 4INDA 5JCTA 3AYDA 1QNWA 1XE7A 3VBUC 2JDZA 4Q0QA 1A78A 2WNUB 1H1MA 4Z07A 2JG9B 5FTTC 4XMIA 1V6NA 4Z92B 5AVPA 4N43C 3ZXDA 3VBFB 4AEJA 4CDXA 3LB9A 2WJSA 4NPRA 2ZPXA 3ZXKA 4DS0A 5JOYA 5LEKA 1BMV1 1H2KA 4AGGA 3OYWB 2D5FA 1GANA 4E4ZA 1NCRA 2WS91 3K51A 1O3QA 1F8VA 3ZN5A 4TLFA 1ZZ6A 2NM1A 3JBG2 1FI2A 4NR1A 2O8OA 1CJDA 3GF6A 4LHLA 3ZFEC 4OVEA 5E1RA 4XW3A 4FXGB 3MW2A 2RS11 4GQ7A 1WW4A 1X8EA 2R043 4LUMA 2Z5WA 4Y26A 3WINE 1N1VA 1RJ8A 5KBFA 1U0AA 3AP4A 4YVWA 2PHRA 4GKXA 1EPZA 1I6XA 1UW8A 4JVAA 4YG6A 1OPMA 3KCYA 4B7EA 4D3WA 3BCWA 2GH2A 4AEDC 1RUC3 1DQ1A 1JOJA 3QH7A 4FPYA 4A7YA 4L92A 4DY3A 1K5MC 2Q30A 5JSOA 1DGRA 4DRVA 3ROUA 4U36A 3POSA 2AUYA 1Q8QA 1HV1A 1OLQA 2ZHMA 3ZXLA 1RMU2 1FMD1 4NHLA 4P9YA 3WUCA 4XJZA 4COVA 3EQEA 2G9FA 3GYDA 4KGGA 3JD72 5HXVA 5BNPC 1MACA 2WNUA 4ASMB 4CP1A 2VW0A 1WLDA 4MLOA 2ZGPA 5A33B 1XYPA 2R30A 1F9KA 4R8HA 2JG9A 2HWC1 4MZUA 3B01A 4HMZA 2WNEA 1GICA 2DVGA 4XE9A 3VBFA 2IZWA 4AI8A 4C1WA 4HSLA 4XDQA 2XUMA 1LENA 1ZRRA 1QMJA 5DG1A 2R041 3OYWA 3WD5A 3LKJA 3ZMNA 2RJLA 5JPNB 1YI9A 3EHKA 3GALA 5H9PA 2ATFA 1YJKA 4J1XA 2D7FA 1CESA 1CN1A 1XYNA 4R9BA 2VOXA 4CEYC 1RUOA 5LK5A 1RUC1 2VNGA 4FPFA 4QU2A 1WCKA 2DCJA 2R0HA 2X29A 3TYJA 1QKQA 4LBQB 2XH6A 1LOFC 1JHNA 3VLBB 1H2MA 2PHLA 3RNSA 1NY71 3MPPG 1XXNA 3JBG3 3J8F2 4IV1C 5B2GB 1QNYA 4FPLA 1BBT1 1H1IA 2RE9A 4M01A 2E7QA 1RUE1 1GZ9A 4YFZA 1GZWA 2EIGA 2DFCA 5CB7A 4XHXA 3DGTA 4E27A 2IXCA 4MGYE 1FOD2 1LKNA 4WV8A 1BVP1 3N7KA 1O5UA 4IETA 1QH6A 4LO7A 4QPIC 1OLRA 4XFGA 4LBOA 2VH9A 4FAGA 1DU3D 3VZLA 1F5FA 3ZIXA 1GR3A 4DNYA 1I9RA 5HBAA 2FZ2A 5A33A 1JBCA 4AHZA 3VL8A 5BUVA 3O7OA 4OHVA 3AZXA 1FXZA 2EAAA 2ES3A 4AEDB 1EV13 2ZGSA 2OPKA 2ZX2A 1YCIA 2TEPA 2ZMLA 4S2DA 4BIFA 1K5MB 4K1YA 4BH9A 1D2QA 3JD73 5EYXA 3RI9A 1KS5A 4FQ4A 4K3UA 1W6QB 4F3JA 1VJ2A 1JYCA 4G3YC 2Q1ZB 2XLFA 1QOSA 1AR61 2IXLA 5BNPB 1O5LA 4HKOA 3KMHA 2X5IC 4XJ8A 3D82A 3B9IA 5GM0A 4LBQA 1ZBE3 2WA3A 3ZYIB 2JX9A 4RQPB 3MFAA 4YW1A 4B8EA 4CP2A 4HVRA 2E53A 2B7YA 2VNRA 2JEMA 3ETQA 3BPZA 4MYEA 1HRV3 5E8AA 4META 3SITA 1QDCA 1J58A 1QY4A 2DUQA 1C57A 2KA3A 3LSEA 2ZABA 3LCPA 4TWTA 4FQZA 1PO13 4CEYB 2DCKA 1EV11 3BU7A 3VBHB 4S2GA 2KM2A 4OI0A 4R4ZA 3USSA 2HWB2 1HKDA 1VBA3 4KG0A 4PDWB 5J98B 1VBE1 4IV1B 1H0BA 2D98A 2RS52 4JGYC 2W52A 3H1YA 4AEDA 4IERA 4E2QA 4CRQA 5ABJC 1S0BA 2ERFA 5EYYA 3USUB 3E6CC 3DPRB 1CAWB 1K5MA 2OZJA 1RUI2 3MYXA 3O14A 4CDUB 4EN6B 4KU8A 1ZBE1 1OHFA 1KS4A 1AVBA 1ULDA 2YHJA 1W6QA 4H3WA 1D4M1 1JW6A 1RB8G 2ZGLA 2AR6A 1AR82 3M3IA 3AZWA 3LOBA 2RJKA 1HRV1 5BNPA 2WIIB 3ZXEA 1I1EA 1M06G 4LE4A 3AFGA 3VKOA 2P3KA 2B46X 3L2YA 1OQ1A 2R16A 5BPXA 1W6PB 4RQPA 5FQ0B 1AYM2 1PO11 3JQWA 4N9HA 3KT7A 4XFIA 4K1ZA 2OA2A 3E6BA 5CA6A 1AL0G 2VG9A 2XBO2 4Y1ZA 1QGLA 1KFUL 1VBA1 1VBD3 2ZHNA 3JQXA 2ZHKA 4CDQC 1XRUA 3CF6E 5KXBA 1ZRDA 3M7AA 4NWVA 4XFBA 4LBLA 1COV2 2ET7A 3OBTA 4Q26A 1O4TA 4CEYA 1SLAA 1OMIA 2R32A 2XWBB 3M3QA 4IXLA 2FBEA 1HW5A 2ZX1A 4QQHA 1WLTA 4WVWA 2DV9A 2VOVA 3MLLA 4PDWA 5I8TA 4IV1A 5C8CC 3VZNA 2PHFA 4YGBA 1X82A 4WZCA 1W6OB 3JB4C 2E7AA 1YXWA 2GC3A 3BODA 3B9CA 3JZVA 4WM8C 3USUA 3MF6A 4FXKB 2HWB3 4EWDA 3DL3A 3DPRA 1CAWA 4ISQA 4FTEA 4CDUA 1O91A 1G86A 2R1DA 2A70A 2WNVC 4RL7A 1IPKA 1YFUA 3D0JA 1M4WA 1AHSA 1S0CA 4Y4YA 3AKSA 2WA4A 1ND2B 4ES9A 3AYCA 4NWWA 3V65A 4L99A 4IEVA 1LOBA 3ZSMA 3SCFA 1VBD1 2NMNA 4ES8A 4FSJA 4AHYA 1MS0A 4AI2A 1FAYA 5I8YA 2E51A 1YI7A 1QWRA 1W6PA 3ALQA 4XFCA 2NYYA 3ZFFB 5FQ0A 4ASLA 4OZXA 5FOBB 4BE3A 4EWEA 5JI9A 4XILA 3UK9A 2R071 2ZS6B 4BOWA 4R9CA 2EXHA 1QXRA 4CEWB 4PIXA 5GZEA 2IXIA 5CG9A 2JJ6A 2GMPA 1BK1A 4AWDA 1G7YA 1IS5A 3E5QA 4LLFA 2WT2A 1W39A 4BLIA 3KCXA 5AC92 1RUF3 2ZCWA 3ME2A 3M3OA 2XBO3 4W6YA 3N4MA 4DB5A 3AMHA 1G6NA 2XKOA 3TB0A 1ZREA 1DIWA 1KQRA 4AFMA 3IPVA 5D1IA 3FJSA 2UU8A 2CGOA 4AE2A 1W6OA 3AP7A 5GLVA 4LULA 3D8CA 4GWMA 4QGNA 3FMGA 4IEPA 1FPN2 4J1WA 4B4PA 5JZGB 3L2HA 2WZR3 1JUHA 2VU9A 1J3QA 4RGGA 1CVNA 1BYHA 3AP6A 1CJPA 1H8TC 2PN5A 5GZDA 3OY8B 1ND2A 4YZ3A 4UXAA 1VIWB 3I2DA 4Y22A 1PIV1 5J3UA 4HPKB 3NV1A 3PVOA 1DGLA 4EROA 3MPBA 2MNGA 3MW3A 3RS6A 2AH2A 2BVVA 4RHV3 4EN8B 4LA2A 1DZQA 3ZFFA 1QF3A 1SBFA 5JDBA 4FOVA 4L97A 4UW4A 1LR5A 2O8QA 4PLMA 1RUF1 4QGLA 1AR92 3RZZA 1ZA4A 2EAKA 4IQPA 4CEWA 4M0NA 5CBLA 3CL1A 4FOYA 5KXEA 4CZSA 1PMIA 1S0DA 3V56A 1DHKB 4CDXC 1RC6A 5C33A 5A3MA 4JAAA 1HXS1 2YPJA 1RIRA 2IFWA 3ZMOA 2XJTA 2A73B 4W65A 4DY5A 1NCRC 2ZZQA 1SMVA 2CL2A 1TME3 2TNFA 3FBMA 3NV3A 1POV3 1RHI2 1NG0A 3TN91 1F31A 3MICA 2O0OA 2WZR1 4RR3C 4IEXA 1AR72 4B29A 4LR4A 1NA1B 2OUHA 5FPZA 4Q4Y2 2BUKA 1MEC3 1CPNA 2VOWA 4XJWA 1KRIA 1C8M2 2GU9A 4JDMA 1WD4A 5I0SA 2TUNA 1LTEA 4LEJA 4YVWC 3CNAA 1NE4A 4CDWB 5JZGA 3KGZA 2DVFA 4XTMA 1HX6A 1ZBA2 4RHV1 4Q4V2 3I4IA 4JQRA 3WG4A 1UL9A 2C5DA 5FAXA 2DYCA 1AJKA 5FBZA 2YV8A 3OY8A 3JU9A 1SLCA 4XTPA 2A6VA 1R1A2 1YYNA 2HEVF 2ZX3A 4HPKA 2ZX4A 5C8WA 4KWLA 1OA3A 4I3GA 4YW2A 1C28A 2EVXA 2H0BA 1RITA 2GSYA 2D6MA 3BALA 4QX5A 4JTNA 3CO2A 1RTVA 4BM8A 1L3JA 4LLOA 1PK6B 3FUOA 1AXKA 2Y0OA 2AGSA 3INAA 1ZX5A 3IM0A 1TME1 1PM7A 2JG9C 1S0GA 2CV6A 3WZ1A 3WR0A 5JIUA 3LWCA 3VBFC 1BCXA 3WDWA 3ZX7A 1RJ7A 4GULA 1H8TB 3FFQA 2A71A 4AEKA 1MEC1 3LA2A 1HQNA 4OULA 3RWNA 4FVVA 5FLHA 4Q4W1 3SNMA 2XWJB 2YMZA 1H9PA 1VBC3 3THPA 4GWNA 4F7ZA 2X8KA 2CNAA 2RM22 4Y1UA 1AYN3 3THTA 4UW6A 2WT0A 1HLCA 1QXPA 3G6JB 4IV3B 1UZZA 5ACA2 4Y1YA 2EALA 4QD2A 5JOZA 1NA1A 5I0TA 2K9ZA 3ZSKA 4LBMA 3VHPA 4BPZA 5KHKA 4XPVA 3W59A 3C2UA 3ES1A 3LAGA 3LOIA 2DVAA 4CDWA 2W68A 2R6QA 4LO5B 2I07B 4B4RA 4ZU5A 2BFUS 1WA4A 4GB33 2D97A 1IS3A 2CY6A 3NV4A 1RUH2 2OW4A 3VV1A 5E16A 4AQ6A 4RR3B 1HRI2 4A3XA 2BYVE 4AW7A 4DINB 1O4YA 3MGUA 1DQ6A 3OJBA 2DUPA 1RVF2 4L2NA 4Q4V3 1PZ7A 1KD7A 3BTAA 1VAVA 1VALA 1KXGA 3WG2A 3RJRA 1PK6A 1V9U3 3CJIB 1VBC1 2PHUA 2VMHA 2RS33 3RYRA 2RMU2 5I0RA 1AYN1 2JG8B 2YGMA 4NOTA 2GNBA 5BNQA 5F1RA 3ATGA 3SLIA 1MS3A 2FZ1A 1H8TA 5DZGA 4KGQA 4KG8A 4DOUA 4GXLA 4N7IA 1Z7S3 3FFZA 4NO4A 4RGAA 3IBMA 3T1LA 5F9TA 2NZ9A 3IWZA 4EWAA 3HIFA 3W58A 1IKQA 2VGDA 2W39A 2VW2A 4YG0A 5CFDC 3OD0A 3NW4A 4QMAA 4IV3A 2HWD3 1O7FA 2JENA 1LGNA 2E6VA 3IDCB 1H8VA 4GB31 4GKYA 4YGDA 4YG3A 3AXDA 4IEQA 1DF0A 2BW8A 4P9IA 4K21A 5AFEA 4NN0A 4YGCA 1ZM1A 3S0MA 2RM23 2ZGKA 2FHRA 1YHFA 3MLJA 2HEWF 1S0EA 4K8FA 1CAVB 2VMIA 4RD7A 1WLWA 5FCCA 2QE3A 4XFFA 3M3EA 4KWJA 5EWSA 3FLPA 3N7MA 3O12A 2Q8OA 1VB4A 1POV0 1V9U1 2ZMNA 1Q8SA 1ZNPA 2XKPA 1QOTA 5K9YA 4RR3A 3OCPA 2RS31 2RR12 2A6WA 5F6LB 3DV8A 2MEV3 1RUJ3 4ZU7A 3HAGA 4E2GA 5TSWA 2PLV3 3ZSLA 4AQTA 3AFKA 1TE1B 1EP0A 3GHMA 3PMSA 4QQPA 2R1BA 3RQ0A 1Z7S1 4D94A 5LRSA 1QJZA 4Q2FA 1V70A 1RUH3 3VBRB 1LU2A 3CJIA 3WW4A 3ZO0B 2UY8A 3TBDA 4E4SA 1W6NB 4ATFA 1HRI3 4SLIA 2JG8A 2CAVA 2HWD1 1S2BA 1SLIA 4CP0A 5IT6A 1Z78A 1Q56A 2PELA 3AP5A 1LOGA 2OYZA 3IMNA 2GNTA 1BJQA 2ZJCA 2P2KA 2RMU3 2KXLA 1DFQA 4Q4X2 4R52A 3UKTA 1D4VB 4MGZE 4XF1A 5JMCA 1VBB2 4LBNA 4EN9B 2R063 3TAYA 1UF2C 3AZZA 4RQPC 1UIKA 2BWAA 4YFWA 1WCDJ 1PVC2 1UX6A 2MEV1 1RUJ1 4I09A 4E9KA 3DKWA 4QM8A 1CAVA 2PLV1 5J7MA 2P37A 2V73A 4Y1XA 2VPVA 2VUJA 1B35C 1BQPA 4PBPA 3BOWA 5FLIA 3S7EA 1G8WA 2XJVA 5CFDB 4NVPA 5KC6A 4OI4A 1GZCA 4DZGA 4OUSA 1D0HA 1UIJA 1CPMA 2ZBJA 2A3WA 2BPA2 1C4RA 3IKWA 3KCCA 5IUQA 3VBHC 3GBWA 1W0PA 1NLRA 5BNNB 1RUG2 4J6GA 1AL22 3FZ3A 4M00A 3AMMA 4AG4A 4PDWC 3VBRA 1W6NA 2BQPA 4FOWA 4CYDA 3UJOA 2RMU1 2RR13 1H2NA 1QJX2 4N53B 3H3ZA 3VKNA 4ATEA 4OI2A 4HVOA 3DPRC 4XZPA 2XLAA 1MZ6A 5C6CA 4CDUC 4BCUA 2R061 4QT6A 4WM7B 4YSFA 4MV2A 5EJ3A 1O4ZA 1UD1A 2UURA