1AYM1

Human rhinovirus 16 coat protein at high resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
285
structure length
285
Chain Sequence
NPVERYVDEVLNEVLVVPNINQSHPTTSNAAPVLDAAETGHTNKIQPEDTIETRYVQSSQTLDEMSVESFLGRSGCIHESVLDIVDNYNDQSFTKWNINLQEMAQIRRKFEMFTYARFDSEITMVPSVAAKDGHIGHIVMQYMYVPPGAPIPTTRDDYAWQSGTNASVFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDTYKSRYGTVVTNDMGTLCSRIVTSEQLHKVKVVTRIYHKAKHTKAWCPRPPRAVQYSHTHTTNYKLSSEVHNDVAIRPRTNLTTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title The refined structure of human rhinovirus 16 at 2.15 A resolution: implications for the viral life cycle.
pubmed doi rcsb
source organism Human rhinovirus sp.
molecule tags Virus
total genus 61
structure length 285
sequence length 285
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1aym100
5JZGA 1EAH3 3VBFA 1D4M1 3TN91 4Q4W1 1HRI1 1D4M2 4Q4X2 3TN92 4CEYB 4Q4W2 1HRI2 1VAKA 1Z7S1 2GSYA 2RS51 1Z7S2 1VB2A 2RS52 1PO21 5BNOC 2WZR1 1VBB1 4RS5B 2RR12 1A6CA 4AEDB 3JD73 1RMU3 1MEC3 1QJZA 1PIV1 1ND3C 3J8F1 1HRV3 5JZGC 1FOD2 3VBFC 4CDQA 1COV1 4CEWC 3DPRB 4YVSA 1NA1B 5CFCB 4YVWB 1QJU3 1AYN1 1F8VA 1AR72 3JB8A 4SBVA 5C4WB 1OHFA 2PLV2 2WLPA 4GH4B 2X5IA 1VRH3 1R082 4GMP1 5FOJB 4CDQC 2RS11 1MQTA 1VBB3 2WZR3 4RHV3 4YVSC 4FTEA 1PIV3 4BCUA 3VBSB 5ABJA 4CEYC 3DPRA 3VBUB 5ACA1 1NCRA 4CDWB 1COV3 1NY72 1IHMA 1FPN1 2R063 1RUH1 4YVWA 1FPN2 4AEDC 4RR3B 5L7OB 1NCQA 3VBHB 1MQTC 1AYN3 1EV11 5C4WA 1EV12 2HWF3 1BEV2 2RS31 1QJX2 3DPRC 1NA1C 1NCRC 4QPGB 2RS13 2TBVA 2WS93 4YVWC 5AC93 1NCQC 5C9AA 5C4WC 4GH4C 5ACA3 4Q4V1 4RR3A 5L7OA 5BNNA 1C8M3 1QJY2 4Q4Y1 3VBRB 2XBO2 1RUG3 3VBSC 4EJRA 4RQPA 5C9AC 2BBVA 4JGYA 3VBUC 1R091 2WWSA 4QPGA 1R092 3JBG3 2WFF2 3VDDB 4GB33 1RUE2 1VBA1 1K5MB 4RR3C 5L7OC 5BNNC 1HXS1 5FMOL 1R1A2 2R072 1HXS2 1AR91 1NOVA 2RMU1 5A32B 1POV1 2RMU2 1BMV1 1V9U3 4Q4V3 1BMV2 1ND2B 1AL21 4QPGC 1PO12 4Y4YA 3VBRA 1M06G 1QQP1 4IV3B 2BFUL 1K5MA 4WM8B 1RVF3 2RM21 1ZBA3 1RUI2 4Q4X1 2RM22 4CEWA 5A33B 4FTBA 4N53B 1RUC3 3VBRC 5A32A 4CDXA 1OOPB 2RR11 1TME1 2FZ1A 1TME2 3ZFEB 1RUF3 1AYM3 3VDDC 2HWB3 1AL23 4CDUA 1PVC2 1K5MC 1FOD1 1QJU2 4IV3A 1VBC2 1TMF1 4N43A 4CDXC 4WM8A 1TMF2 1AR71 1HX6A 1DDLA 1FMD2 1ND2C 2PLV1 4CEYA 1RUD2 1D4M3 4Q4X3 5A33A 3TN93 4RHV2 1R081 1HRI3 4Q4W3 4CDUC 2R042 2BUKA 1ASJ1 1Z7S3 4RS5A 2RS53 1AL0G 1ASJ2 4IV3C 4AEDA 3ZFEA 2RR13 1VBD2 5CFDB 1PO23 4N43C 4WM8C 3ZFGB 2IZWA 3J8F3 4FTSA 1FOD3 4JGZB 4QPIB 1NY71 1HQNA 1NA1A 4N53C 5CFCA 4RS5C 3CJIB 3ZFEC 1AR73 4GH4A 1CD3G 4NWWA 1BEV1 1R083 1W39A 5BNPB 1QJX1 5CFDA 3VBOB 4GMP3 5DDJ2 5AC92 2HWD2 5CFCC 1SMVA 1RHI1 1RHI2 3VBSA 1CJDA 4PDWB 4QPIA 3VBUA 1AUYA 5GKAC 4CDWA 1AR61 1E57A 2HWC1 1AR62 1FPN3 2HWC2 5CFDC 2QQPA 1RUH3 3VBHA 1QJY1 1EV13 1VBE2 2XBO1 3JB4C 3ZFGC 3JBG2 4GB32 1BEV3 4JGZC 1AR82 4QPIC 1ZBE2 1B35B 3S6PA 2WFF1 1QJX3 4CDWC 1RUE1 2RS33 3CJIC 1WCDJ 1R1A1 3LOBA 3VBHC 2R071 4NWVA 3ZFFB 1RUJ2 2XPJA 2HWE1 4Y5Z0 2HWE2 1BBT2 1PO11 2MEV2 5BNOB 4Q4Y3 2XBO3 1EAH1 1EAH2 1ND3B 1RVF2 3VDDA 2ZTNA 3VBFB 1R093 1F2NA 2WFF3 2GH8A 1RUE3 1RUI1 1OPOA 1VBA3 4IV1B 1R1A3 3JD71 2R073 1HXS3 1RMU1 1MEC1 1RUF2 3JD72 3ZFFA 1RMU2 1MEC2 1AR93 1HRV1 2RMU3 1POV3 1HRV2 1B35C 1ND2A 4WM7B 1PVC1 5D8AB 1QJU1 1PGL1 1QQP3 1VBC1 4GMP0 1PGL2 3ZFFC 1VRH1 5FMOS 1X33A 1FMD1 4FSJA 1VRH2 2X5IB 4IV1A 1RUD1 1H8TB 1RUI3 3NAPB 4RHV1 2RM23 1PO22 2R041 2WZR2 1VBB2 4N53A 1MQTB 1OOPA 1VBD1 4WM7A 1PIV2 1TME3 3J8F2 5D8AA 5ABJB 1PVC3 1COV2 2R061 1NCRB 5J98B 4IV1C 2R062 2DF7A 5C8CB 2BFUS 1VBC3 1AYN2 4RFT0 1NCQB 1OOPC 1TMF3 1GFF2 2HWF1 4WM7C 1H8TA 1FMD3 3NAPA 1X36A 2HWF2 2ZAHA 5D8AC 1RUD3 2PLV3 2WS91 2RS12 2R043 5J96B 2WS92 5DDJ1 5AC91 1ASJ3 2HWD1 4LLFA 1VBD3 5C9AB 1VB4A 2VQ0A 3ZFGA 2X5IC 5ACA2 3FBMA 1H8TC 3NAPC 5C8CA 4JGZA 3ZXAC 1C8M1 1RUH2 2Y26A 2BPA2 2FZ2A 1C8M2 5BNNB 3CJIA 1RUG1 1RUG2 1VBE1 5ABJC 4RQPB 3JBG1 4JGYB 4GB31 2RS32 5BNPA 1AR81 3VBOA 1ZBE1 1POV0 5C8CC 1RB8G 2ZZQA 5DDJ3 2HWD3 5K0UB 1RHI3 4PDWA 1V9U1 1PGW1 1V9U2 4Q4V2 1PGW2 1RUJ1 1AR63 5BNPC 3VBOC 4Q4Y2 1NG0A 2HWC3 1BBT1 2MEV1 1QJY3 1VBE3 1RVF1 4PDWC 1ZBA1 1B35A 1VBA2 5LK7B 1AR83 1ZBE3 5JZGB 1ZBA2 1RUC1 4CEWB 1RUC2 5K0UA 1AR92 3HAGA 4Z92B 4CDXB 1RUF1 1AYM1 3IDEA 4RQPC 4JGYC 2HWB1 1AYM2 2HWB2 1AL22 1RUJ3 4CDUB 1C8NA 1QQP2 5BNOA 2HWE3 1BBT3 2MEV3 4CDQB 3M8LA 1PO13 4YVSB 5K0UC 4N43B 1ND3A
chains in the Genus database with same CATH superfamily
1JU3A 2PHWA 2WWJA 3E5UA 1EAH3 3LEMA 1L7LA 2B9VA 3K48A 3TNPB 1DQ2A 4E2QA 3WCSA 1EUUA 2QQIA 4Y22B 3MLJA 2WNUB 4FVVA 1VB2A 3WEZA 2RS52 1Q3EA 3AM2A 5BNOC 2WZR1 1VBB1 2QBXA 2VOKA 2RR12 1HKDA 5I8TA 1ULGA 1KJRA 1WW6A 3JD73 5EXOA 4XJZA 4DO0A 4KL1A 4R9AA 1RMU3 1MEC3 1QJZA 1S2BA 5I93A 1UIKA 2WQ4A 1W9SA 2PHXA 2VO5A 4QQ2A 4UW4A 5DUUA 4AEKA 5FZDA 1FOD2 2G9FA 1UU4A 2XONA 4DB5A 2EVXA 4GA9A 5FDBA 1SCSA 1YWKA 3N35A 3SXWA 4QDSA 2G9GA 3A23A 5D21A 1H0BA 2ZGNA 4CCKA 4DUVA 4NAOA 2NM1A 2Z5WA 2EXKA 1T6GC 4SBVA 1CX4A 4MGQA 5FZHA 3SKJE 3I3EA 1OHFA 2PLV2 3POGA 4GH4B 4N9IA 2X5IA 2EXHA 4Y22A 4S2FA 4ZZ5A 4AW7A 1GZWB 1Y9GA 3HVDA 1HV1A 1KEXA 1R082 3NW4A 3PMEA 4P9IA 4EYUA 2DTYA 2IVIB 1QIQA 4XJAA 3RJRA 1HN0A 2WZR3 1VBB3 1OC1A 3RRDA 3OGJA 5E88A 3VN4A 4TYSA 5A7SA 3WD5A 3BIWE 3VBSB 1LJ7A 1W8ZA 2CDPA 2EIEA 4QGMA 5LBBA 3VBUB 5ACA1 5KR7A 1NCRA 2OW4A 4JRAA 3BGAA 4XIKA 1UZVA 1NY72 1IHMA 3A7QA 4K8FA 4LULA 4WV8A 5FYUA 4GWJA 1RUH1 3E97A 4OUMA 5JPNB 1CVNA 1SLTA 2YC0A 2YYOA 2Q8EA 4AEDC 4RR3B 1NCQA 3VBHB 4OQ9A 3ELNA 5CKNA 3N9MA 2LW8A 4JQRA 5IATA 2VMFA 2W9XA 4M0HA 1GZWA 4LBNA 1ST8A 3ZR5A 2WJSA 4PLMA 4WVVA 1BEV2 1DU3D 4MOAA 4MV2A 3J4UH 1AF9A 4L0PA 2OS2A 5T54A 1NA1C 3A0KA 1D4VB 5FZCA 2WS93 1UMZA 2WYSA 4YVWC 1W6MA 2CTVA 5CG8A 2J42A 1HQLA 2CL2A 4B7KA 2XLFA 3HNYM 2HYXA 3VKNA 1TE1B 5LB6A 5IK5A 3B69A 1YQ6A 1RITA 2XMLA 3PVOA 3VD5A 4BDVB 2HEVF 5ACA3 4Q1PA 1NXMA 4RR3A 1W99A 4AI0A 3GZTB 3WNOA 3OBTA 1C8M3 1CIYA 1QJY2 2VOWA 4Q4Y1 3WUCA 5FZGA 2P3KA 3C7OA 1KD7A 3PNAA 1G86A 3U11A 5A6QA 4KNCA 1W2UA 2VZOA 5LA9A 3ZXLA 1RUG3 1RIRA 3IZOA 1LHWA 4LQRA 5B4NA 5C9AC 5IT6A 3RMYA 2QQVA 3J7LA 2VMGA 3VDDB 4CVUA 1N1SA 4H14A 4LK6A 1VBA1 1W3VA 2JWPA 1JZ7A 3X29B 1K5MB 1W05A 1VIWB 4MGTA 4Y1ZA 5A3TA 4DXTA 1UO9A 1WMFA 2ZX3A 2VTFA 1HXS2 3KS7A 1I9RA 4XQWA 1Q8SA 4LIUA 2RHPA 5HI0A 4LORA 1IG0A 5K8SA 5A3UA 4NO4A 1HB2A 2RMU2 3JXSA 3HIFA 5C8WA 1V9U3 4C90A 3ZKUA 2BERA 1US3A 1VMHA 2DBIA 2K46A 3FMGA 4R9CA 5GLZA 1N3PA 2XG3A 3W21A 1YYNA 3OD0A 3ON7A 3UV9A 4QWNA 3MO4A 3D5OA 4EN9B 1S0FA 2QNKA 4BMBA 5KHJA 1PNFA 1W0OA 2KM2A 3VDBA 4AGVA 1JW6A 1L3JA 2IWGB 1EPZA 1W6QA 4IGQA 1K5MA 4ZU5A 3AYAA 4YFWA 5FP4A 5JOYA 3QH7A 1PK6C 2ES3A 4GULA 4H7MA 3I3BA 4CEWA 2IXIA 1V00A 4XFBA 2VZPA 4ORFA 1U0AA 2E32A 4LBMA 1OOPB 2MPFA 3CO2A 2RV9A 2WABA 1LHVA 1TME1 2FZ1A 3OPTA 2WC2A 1QF3A 4FXKB 2P17A 2NPIA 1RUF3 3HEIA 3CEWA 3VHOA 4U2AA 4BMEA 5A1FA 1XOYA 1X9TA 1PVC2 5IK4A 4G9SB 4Y24A 2GP3A 2X53S 3L2HA 1EUTA 3VHRA 2J7MA 3SISA 4RD7A 5IUQA 3LPGA 1NE4A 1CQ9A 3V56A 2NMOA 2JG8B 5EFUA 5H9PA 5KXCA 1EY2A 4Y20A 2HBTA 1O3QA 1HX6A 1DDLA 4ARXA 1FMD2 4ASLA 4KGGA 1VR3A 1ZA4A 4CEYA 5LBEA 4MADA 4QGNA 5JPMB 1D4M3 2P3YA 2VW2A 3POBA 4Q4W3 1HRI3 1LENA 4LO8A 5A6YA 3BTZA 2BUKA 3OSDA 5HCAA 4RS5A 4Q0SA 5JDBA 1W6PA 1AL0G 2VUCA 4IV3C 2W1QA 4LO5B 4OHWA 2YGMA 4QU1A 1K12A 3P3NA 3NV2A 1UYYA 2YDEA 4N43C 2JDNA 4N9HA 5IK7A 2ZOEB 1X82A 3LPFA 1RXGA 2IZWA 2YMZA 5G04L 4FTSA 5T5PA 4XFGA 3SH3A 2PYTA 2JG8A 2WNUC 3BUCA 3FBYA 3KV9A 5C3QA 3GDBA 5LY2A 1OMIA 3ZFEC 5DUWA 2RG4A 4QM8A 4AI9A 3I7DA 1DYKA 3EMRA 3RZLA 1WLCA 5F39A 1RUOA 2W5FA 3O1UA 3Q8CA 5HXVA 4UW6A 1W6OB 1ZNPA 1ENRA 4AQSA 2Q5TA 4E4ZA 4B1MA 4HANA 3W5MA 5JIUA 1GWLA 5EQUA 1UQXA 3B02A 1JXNA 2JB8A 2P2KA 3SCFA 1YQCA 5DMYA 2PELA 4D7TA 2JDZA 1MS0A 2W47A 3D4KA 2AUYA 3MICA 4LHLA 3OUIA 3SH5A 4CDWA 4E27A 4LK7A 4OUSA 4D94A 4M3CA 2IFWA 2HWC1 5F5AA 3RNSA 1N1VA 1LGCA 4LPLA 4XFFA 4HOOA 5CKMA 1XNAA 1OLMA 3PIJA 5F3IA 4AYUA 1VBE2 4HN1A 5LK5A 3ZFGC 3JBG2 3WF4A 3P5BA 3E1F1 1MZFA 1W6OA 3BN6A 4YLZA 3THDA 4QPIC 1O59A 2D6KA 3J7HA 3UK9A 1RUE1 1WA4A 3VUOA 4YM3A 1BXHA 1ZRFA 3BPSA 1DBNA 1WMEA 2I07B 1W0NA 5LRSA 1WCDJ 1R1A1 1Y9MA 4RL7A 3U1XA 4YZ4A 3VBHC 1JMUB 1S2EA 1F35A 1LCLA 5FMCA 4ZONA 3NJVA 3OPZA 3AZZA 1MACA 4RGAA 5JWPA 5M0TA 1WGPA 5F1RA 1H1IA 5A7OA 1G8WA 3SLIA 2UURA 1W2TA 1L7QA 3KCYA 3PUSA 2FCVA 2HWE1 1DGRN 3RZHA 2AACA 5GLUA 4DQAA 2MEV2 1SCRA 1W03A 5JIAA 3M70A 1W90A 5CB7A 2PHRA 4DNYA 1C57A 2HBUA 4I09A 5KXBA 1WCUA 5J36A 1EAH2 4CSWA 4XMAA 3KV4A 3GHNA 2NYYA 5FK8A 2J1AA 1WCKA 5FY5A 1R093 1CPMA 1F2NA 2I45A 4RGKA 2VPVA 1GMMA 1RUE3 2GH8A 2J1EA 3FLRA 4E8DA 1ZVFA 4XZPA 3MPBA 4AI1A 4FFHA 5EV7A 4GQ7A 5FO7B 4CCLA 5KC6A 4K40A 5E1RA 3VKLA 3NMBA 1R1A3 1AXKA 1OUXA 3JD72 3NSTA 1UU5A 3U37A 4NIIA 1ZRDA 1Y3TA 1FAYA 1MEC2 1RMU2 1B09A 1D7PM 4NJ4A 1HRV1 1LOCA 2VOVA 1W04A 1JYTA 5IW0A 1POV3 5H9RA 1JOBA 3I3DA 4OLLA 4WM7B 3VB9A 3ZXGA 5D8AB 2WNEA 2QQLA 1ZYBA 1G6NA 4HXCA 3UJQA 2QCSB 4R4XA 1UL9A 4FPOB 4GKYA 4UXAA 4JC1A 2FMYA 4LXLA 3ZYPA 3CNAA 1DLCA 5LK7B 2WNVC 2CGPA 2AZ5A 1VRH1 2YUEA 2ID4A 5DAVA 5EWSA 2KD7A 1ULCA 1TNFA 2C0ZA 4QU2A 3ETQA 4R9BA 5CYYA 3W5NA 5EPAA 4GD4A 4FO9A 1Z0HA 2ENRA 4BU2A 1DGRA 3QH6A 4RHV1 4CCDA 2RM23 4WVWA 5KHHA 2R041 1GSLA 1VBB2 2WZR2 3Q8FA 1NX9A 4FAHA 2R1BA 1VBD1 4F3JA 4WM7A 3H8RA 2DUQA 5I8YA 2DUPA 3OG2A 5D8AA 5ABJB 3WLUA 5I91A 3A4UA 4EQVA 4ASKA 4E9KA 3B7MA 3EO6A 3R0RA 2FCTA 1DHKB 5FO9B 5FZ3A 1O5UA 3POEA 4JKLA 3AMNA 4L9BA 1UYZA 5HCHA 1OOPC 1JZ2A 3R4UA 3T2OA 1TMF3 3S7EA 4JDNA 2WT2A 2QDNA 1X36A 4IW3A 3ZR6A 1MS8A 2G19A 3OPWA 1XYPA 2D40A 2PLV3 5FOBB 5JXIA 3O7OA 2R043 3NNMA 4QHZA 3T0BA 5J96B 1JODA 2WS92 5DDJ1 4J1XA 1QEXA 3T2QA 1ASJ3 5AC91 2HWD1 2A5ZA 1VBD3 2A71A 5HXMA 2J1RA 1J59A 2VOXA 5BUVA 2VQ0A 2QZ2A 2DCKA 5DAWA 2XR4A 2BBAA 2ZPXA 4XFIA 5ACA2 3O12A 2UU8A 3FBMA 3ZXAC 2XB6C 1RUH2 2Y26A 1G7YA 5FY8A 1C8M2 3IT8A 1WZXA 2PHDA 5BNNB 4P5YA 5IK8A 4FPFA 2KA3A 2X09A 1OF4A 3K3NA 3BALA 1IKPA 2WAOA 1QWRA 1XYOA 4QX8A 2F17A 1O91A 1OFNA 1GANA 3CJIA 3RYPA 1LGBA 5J09A 2WQZC 3VKOA 1GQPA 1RUG2 3E5XA 4FCAA 5DAXA 5FYSA 2YGLA 4MZUA 4P9YA 4XEZA 4COYA 5SV8A 1KS4A 3WV6A 3ZMOA 1NLQA 1GOFA 2QE3A 1POV0 2IXCA 2RJ2A 2XUMA 3B01A 3D6EA 3KF3A 4Q0QA 5L9RA 5C8CC 5DDJ3 3UL2A 3MI8A 2HWD3 3ROUA 3LA3A 2CDOA 2GMEA 1OH3A 1RHI3 1CAVA 2D3RA 5AVPA 1ZZ7A 3AC0A 2VZ1A 3AYDA 1BKZA 1V9U2 2YFUA 3NNLA 4XJUA 1BVVA 4IDZA 1BCXA 1AR63 4W8JA 4LKEA 3N3HA 4Q4Y2 3WX5A 5IFPA 2W87A 1QJY3 3ZN5A 3VHPA 2P34A 3ACIA 3H1YA 3B94A 3T0AA 4HK8A 1DFQA 4HVQA 3MFAA 3MHZA 3HQRA 4E2SA 4XBQA 1ZBA1 1B35A 1VBA2 3KVAA 1R1ZA 3LOIA 3OCPA 1CIWA 3PVEA 4U36A 2J1TA 5EZWA 5I0TA 1J84A 3POYA 5FXWA 1N1YA 5FXZA 2W39A 2DVAA 4D8MA 3HQUA 2XJSA 4XUPA 2Y6JA 1A3KA 3HAGA 3L9JT 4Z92B 4PJYA 1JZ6A 2PHFA 1AYM1 3PJQA 3IDEA 4XHXA 5FCCA 4YW3A 3WDWA 1JHNA 1ZREA 2HWB1 2QTWB 4ATFA 2D43A 5JCTA 5F32A 4HFSA 4YG3A 5A6XA 2LS6A 5IVEA 1LEDA 1JU4A 5D2AA 2WR9A 5BNOA 5F7UA 1CAUB 2PXJA 3RVHA 3MUZ1 4INDA 1J3PA 1OPMA 5IVBA 3ILNA 1GU3A 2CYFA 4YWAA 1E5RA 1AX2A 5JSPA 2BNNA 2QZ3A 1FXZA 2XWJB 1GKBA 3TN91 3OY8B 1IS3A 4QGLA 4K9SA 1D4M2 1WLTA 3H9AA 1GOHA 3LIHA 4Q4W2 1HRI2 1VAKA 1Z7S1 3POIA 4XJWA 1XE8A 2WFPA 1W9TA 4AEMA 1XSRA 4AR2A 4FP3A 1XYNA 1M4WA 1Q8OA 3ATGA 1PO21 3BPZA 3IBMA 2SLIA 4JRLA 3TB0A 1GUIA 4AEDB 1MS5A 3KT4A 5C5UA 1AJKA 4A7YA 1PIV1 3T4HB 2RE9A 3ZSKA 1WWYA 3HOBA 5FY0A 3TEZA 3J8F1 1UCXA 1CAUA 1RJ8A 3HN3A 3BTAA 3CHXA 3R4SA 3LF7A 1VRBA 4NIDA 3H8OA 1NA1B 1UY0A 1YIFA 2ILMA 1BHGA 4QB2A 4YVWB 5FZFA 1OKQA 4OMDA 3FFZA 1OQEA 3OY8A 4QXKA 4L11A 4A4AA 1H2NA 2YPDA 5DZFA 4BOWA 1LULA 4A7KA 2G1MA 4PLOA 2AR6A 4LBQD 2VTXJ 4YVSC 2JKBA 1BZWA 4FQ4A 1XRUA 4P02B 5C6CA 1W8FA 3RZGA 1Q8VA 1PIV3 3AKPA 4XFCA 3D82A 4AI3A 4CTEA 1HW5A 1OD3A 3MV01 2P37A 1YLLA 5FYZA 2V4VA 2Y6LA 1KDKA 4FPEA 2O8OA 4L2NA 1FPN1 1REFA 3KHCA 4YVWA 1O8PA 2V5YA 4XAAA 2QUOA 2XQRA 2CWMA 2R16A 5F2SA 4H7LA 1EV11 3OTFA 2NZ9A 2WA3A 5T5JA 2YXSA 1O3RA 3IMNA 1CWPA 4W4ZA 2CAUA 3AJYA 4IEQA 4IE0A 3N9PA 4QD2A 3VZJA 2H6CA 1W8HA 4KU8A 2RS31 5B4XA 2XHKA 4QB6A 3B9CA 4IERA 5A3MA 3ME2A 3K51A 4ES8A 4L97A 1NLRA 1V6MA 2XQXA 1OXCA 4GAZA 3BVCA 4GALA 4D69A 5C9AA 5C4WC 5T3NA 4UWDA 2R0HA 3JZVA 1H6XA 4LBOA 4OI4A 4XVHA 3AL6A 1K5JA 5E89A 3ZYJB 1VE0A 1PM7A 1H6YA 1NAEA 2Z4FA 4UF0B 2GC3A 3AZVA 4B4PA 1CN1A 3I4IA 1XQNA 2ZX4A 4NUBA 2XL7A 4RQPA 3AP5A 4JGYA 3MV11 2BBVA 1VMFA 2XJUA 3AP4A 1JS9A 2JIJA 3I2GA 1V6NA 4XFAA 3RZJA 1R092 1BVP1 1OURA 3JBG3 3RI8A 1Q56A 4Q1RA 1SACA 1RUE2 2ARBA 2C6SA 3AKTA 3D8CA 2FDIA 4QX1A 5ERLA 5GZFA 5L7OC 5JOWA 5BNNC 5FMOL 4TZDA 1R1A2 5FMOS 4A44A 2PHLA 5BY5A 3S57A 2WO3A 2B9UA 2VZRA 4Q26A 4XOGA 1NOVA 2VZSA 3KM5A 4XABA 2P6HA 1BMV1 5L9VA 1SG3A 1PK6A 4LA2A 2W1SA 4UF0A 3O1SA 4G3YC 1C28A 4K8RB 4DIQA 5LA0A 2FMDA 1PHMA 1KFXL 2VCBA 4YARA 1JYWA 3LIGA 5FLHA 4JKMA 4Y4YA 3LEIA 4FP2A 5DG2A 1QQP1 1DQ6A 2DFCA 3J9SA 1H2LA 2B45X 3ILFA 1LHNA 4IV3B 5AFBA 3ES1A 4HT1T 1F5JA 1UY1A 1MS3A 2JDAA 4I01A 1LOFC 3H42B 4XILA 3H7YA 2RM22 1VALA 1V6JA 1BYHA 1NT0A 2O8QA 3H1WA 5A33B 1J1LA 2JXAA 3MBWA 1RUC3 3VBRC 4CCMA 3O1TA 4FTBA 4BQ5A 2A3XA 2V4AA 3PUHA 3GJBA 3ZN6B 2DVFA 1S0GA 2BGCA 4YW1A 3ZFEB 3HT2A 2EA7A 4ZZ8A 4P9JA 5FYBA 2VZTA 1W8OA 2P4EA 2B39A 3VDCA 4AG4A 1TNRA 3UT0A 4LT5A 3PU8A 3KV6A 1QY4A 2Z2SB 3V0BB 3NQHA 1W2NA 4IV3A 4LITA 3O1PA 2QJVA 4QKNA 4TLGA 4XCBA 2Y38A 2IUWA 1XPWA 5J3UA 4AZZA 1UOJA 1E5HA 3G6JB 4N43A 4Z82A 4CE8A 4CCCA 4F7ZA 2VTXA 4BQ2A 1TMF2 1AR71 2C4XA 3MW4A 3S7IA 3ZXEA 3M3EA 2J1UA 4M0NA 1RUNA 2K9ZA 1ND2C 2JE9A 4EN6B 3ZYHA 3MYXA 1LECA 4BPZA 5K7PA 5A33A 3ETPA 4RHV2 2WNUA 1H2MA 2R042 2WYFA 1IQAA 4JX0A 4IQPA 1S1AA 4MGZE 2J1VA 1ASJ2 3VV1A 4BQ3A 1H30A 1XB9A 3ZFEA 1VBD2 5C5TA 4E4DX 1ULEA 3AXDA 1SLAA 2ADDA 3LDBA 4LHSA 4NHYA 1DGLA 2DCYA 3RI9A 3BU7A 1DG6A 1U5XA 1J1TA 2BYVE 2JG9C 3ZFGB 4NROA 5F9TA 5EJ1B 3V0BA 4MGYE 1GQGA 3KD4A 3RGBA 2A6YA 3I2JA 4LKSA 4QPIB 3EYPA 3ZIWA 4EROA 4N53C 5FYVA 5JR7B 4ZU7A 4ASMB 1IPKA 2QKDA 5C71A 3NVCA 5A80A 1JYVA 3T0DA 1ENQA 2OPWA 1WLWA 2YPJA 2AGSA 1X9PA 3GHMA 3T08A 2XHNA 1AR73 1LRHA 4UFIA 4BB3A 5KHIA 1RL3A 4GH4A 1ZZ9A 3D0SA 4TXWA 5CZKA 1I3HA 3THPA 4LEJA 3O1MA 3DN7A 4E8CA 1RJ7A 2AREA 2IC1A 1SEFA 3FHAA 4NAMA 1QJX1 1SBDA 3OD4A 2WZPP 1MZ6A 4OMCA 5DDJ2 5AC92 3PL0A 2HWD2 1SMVA 5B2GB 2QQUA 4QX2A 4Q2FA 3AKRA 3EQEA 3IMMA 1JYNA 4QAWA 4AL9A 1RHI2 3VBSA 4BISA 5FP7A 3C7HA 4PDWB 4QPIA 4GWMA 3VBUA 5GKAC 4URAA 5IAXA 3Q9OA 1ODMA 4UYBA 3GZUC 2W3JA 4O9EA 3S5AA 5I0DA 2X29A 1RC6A 1HN1A 1SPPB 2GNDA 1AR62 1QJEA 5CFDC 1ZZ8A 1RUH3 5FZ4A 3VBHA 2Q1MA 5FKCA 4AHYA 4OZOA 1V0AA 4Y33A 4YM0A 2C9AA 4XUNA 2V5DA 4IL7A 5CKQA 2XBO1 1POQA 3T2TA 4AHWA 2GH2A 2ZS6B 4BQ4A 3N7KA 4CZSA 4QXCA 5FPUA 2A70A 5A3WA 3I2FA 4IEVA 4JGZC 5FRAA 3T2PA 2VC9A 4QDRA 2VH9A 2IXHA 2WFF1 1QJX3 1PMHX 2Y60A 3MIBA 4MSVA 2WLQA 4CA9A 1WBFA 4CXXA 3VZNA 2WKKA 3BKZA 1VLNA 3ZSJA 1GP4A 5K4LA 5FUPA 3T4VA 4LJHA 2XKOA 1D0HA 4XJ8A 2R071 2R30A 3PDQA 2FHRA 5FPXA 3DEMA 1E5SA 4BJ0A 1UOFA 1QXJA 1GOGA 1FV3A 2W1WA 4QX7A 2Q1FA 2WNVB 1OQDA 3WQBA 3WNNA 4IETA 1ALYA 3NO8A 4XYXA 1JZ3A 3O5SA 1S0JA 1YQ5A 2BV4A 2W94A 2H6BA 4JQTA 4Y5Z0 1PO11 1UZYA 5FPZA 4K21A 1I5ZA 5FY1A 5DABA 5L9BA 4Q4Y3 3WNXA 3ZDSA 4B8EA 4BM8A 2XBO3 3O0XA 5FZIA 5I8SA 3MLLA 1PX3A 2N7GA 3T1LA 1ND3B 3ZO0B 4CPBA 5EIYB 5FO8B 2Y6FA 3VDDA 1FX5A 3HT1A 3RYKA 3VBFB 2WFF3 1GNHA 3WDTA 4CP1A 3O1VA 4AGRA 2K2SA 3WF1A 3AKSA 4IEOA 4JVAA 1OPOA 1VBA3 2GN3A 4N8MA 3GM8A 5FPVA 5LRRA 2A6WA 2UYBA 2R073 4UFKA 2WNVA 2OYZA 1GZ9A 4BH9A 2GU9A 2QQKA 4AVSA 3MZHA 4P00B 4F83A 1S0DA 3SCGA 4BQWA 1HLCA 2VQTA 1SLLA 2VQAA 4S2HA 4CUBA 4NPRA 4XTPA 1UW8A 1DZQA 2ZABA 2UYAA 2WL1A 3HJRA 2BOJA 3K46A 4P9WA 1QJU1 1PGL1 3MF6A 5SV5A 1N3QA 1XNDA 4Q29A 4KU7A 1S4CA 3ZFFC 2XJTA 3ZDVA 1GBGA 4DZGA 2WUHA 5APAA 4XF3A 5FK7A 1N47A 3TAYA 2VCMA 4QX3A 2ORZA 3INAA 1RUD1 3SNMA 3OBZA 3ZPYA 3WOGA 4CUGA 4XUTA 1PO22 4MLOA 1C3HA 3LEGA 1MQTB 4DY5A 1Q5OA 1OOPA 2RDSA 5TSWA 2VU9A 3AYCA 1C4RA 2O14A 3VZOA 4B29A 5CG9A 2ZEZA 1PIV2 4UAPA 4NIGA 3HWJA 1TME3 3J8F2 4QX0A 3I2OA 2V72A 4AQTA 2FDJA 4ONUA 3I8TA 4M3CF 2W08A 3S5QA 3S0MA 2P5BA 2ZAAA 4PI2A 2R061 4Q8KA 2ZEXA 5J98B 1QOTA 5GZCA 3T1MA 5KBFA 2DF7A 1DQ4A 5FWEA 5C8CB 4A6OA 3O1RA 4AI2A 1BQPA 4AVVA 1LNSA 3RQ0A 3GBWA 5IWFA 5FFOC 4XXAA 2HLEA 2HWF1 1ZZ6A 5FAXA 4CU7A 2A73B 1PVXA 2B8MA 4P5HA 1VJ2A 5BV6A 1CZTA 1RUD3 4KI5M 3CDZB 5JXGA 4NRQA 3F2ZA 3WQ1A 4QKFA 1TVGA 1OT5A 4IEZA 1W8UA 4QKBA 4R9DA 1GWKA 2DCZA 4LNVA 1LHOA 3LSEA 4GWNA 4QXHA 1K42A 1VPHA 5FZ8A 3N4MA 1ULPA 2CHHA 3LCPA 2X5IC 4LKDA 1IKQA 4NHMA 1W9WA 3LKJA 1NKGA 5IFTA 1H8TC 4LIVA 4CP9B 5C8CA 1WD4A 2CGOA 3V65A 1REDA 2G4IA 4IGPA 2ZX2A 2FZ2A 1H4GA 2DVBA 1OFSA 2RDNA 1QOSA 3WW1A 1OBNA 3I49A 5FZ1A 2Q8CA 4OZXA 1YC61 4O61A 5T5OA 3UGHA 4XBNA 3AYEA 4I2OA 3AFKA 4TTGA 1YNAA 4GB31 4JTOA 4YSFA 2RS32 2FQPA 1OA3A 3UETA 2F6BA 4JDOA 1AR81 1JYCA 1ZBE1 1RB8G 1SQ4A 2ZZQA 4I3GA 1QDOA 1A8MA 3H1MA 1Q8PA 4HSJA 4AK3A 3VKFC 4BLIA 4OFGA 5F5CA 5FYIA 2AENA 1F15A 3CLPA 1JYIA 4D6QA 4CP9A 4YYOA 1CGPA 5K9YA 1UMIA 2B5HA 3USUB 1PGW1 3OUJA 4K3UA 2CWSA 2P3IA 2ADEA 4NPMA 4BXFA 2NMNA 3RSJA 2A1XA 1RUJ1 4BIOA 5G05L 2VJXA 5EYXA 1TG7A 2WN3A 3E6CC 3OEBA 2NN8A 2HWC3 2B42B 2JX9A 4Z8BA 1BBT1 1GLHA 1LODA 5HV4A 1L7RA 2JEMA 4X8NA 2XJVA 5LW9A 4OHVA 3WP6A 3WHUA 2OUJA 3W58A 3VD3A 1RVF1 3POWA 4PDWC 3VZKA 3WR0A 1AR83 3OYWB 1ZBE3 1OLRA 1NLSA 5CVRA 4J6GA 3SEPA 4YW7A 1NZIA 4OCTA 1RUC2 1BK1A 4YW2A 4CXYA 4CDXB 1QH6A 2Q8DA 1Y43B 4MH0E 4O9GA 5FLIA 5BPXA 4XF9A 4BK5A 4PIYA 4G4FA 1DGWA 4NIHA 1FV2A 1RUJ3 3D0JA 4RGGA 1HJGA 4FFIA 4A41A 4CDUB 1JH5A 1C8NA 4BLJA 5C3PA 3BODA 1QQP2 1H9WA 2FD8A 2WZEA 4BHPA 1CESA 1BBT3 1ZX5A 2A3YA 2HWE3 3H7JA 1TZOA 2LUWA 2YBKA 4YPJA 3AP7A 4YVSB 2VUJA 1UKRA 5JI7A 5K0UC 1S2KA 4GIQA 2VECA 2ZGPA 1GZTA 2BRTA 3PUAA 2VL4A 5I0SA 3ACFA 3NNFA 1YHFA 4LBJA 3W20A 2VNOA 3M3QA 1OKOA 2GSYA 2XDVA 3WT3A 2BVVA 1W9FA 2RS51 2CY6A 2J22A 2RDRA 3IWZA 3GZEA 5DXDA 5L19A 2TUNA 1XC6A 3KGLA 3PTRB 1A6CA 4M4RA 4Q0UA 4W6XA 1HB4A 2ZXQA 1XNCA 4OI1A 5DUXA 3GGLA 4AQ6A 3SC7X 4UW5A 3BTXA 1F4HA 2WINB 4Y4RA 2J1SA 3KVBA 2C1FA 1X7NA 3GCWA 2Q8OA 3RMXA 1ND3C 4ZS3A 4QB1A 1HRV3 5JZGC 1SZBA 2AEZA 2D6LX 3AB0A 3LGRA 5FTTC 5L36A 3VBFC 3KT1A 4CEWC 3K3OA 4Y3OA 3IB3A 1D0GA 4YVSA 5GLTA 5FPAA 5CFCB 2Y0IA 2JJ6A 3U0ZA 2VGDA 1YFWA 1UD1A 1AYN1 1F8VA 2UWAA 1AR72 2PQSA 3JB8A 4XTMA 4CRQA 2D5FA 5IJRA 5C4WB 3QOPA 1VRH3 3MIHA 3BYWA 3BTYA 1C5IA 3FHQA 4GMP1 3WUDA 4AEJA 5FOJB 1Y9QA 3FFQA 4H3WA 4CDQC 2RS11 4HSLA 3AFGA 4RHV3 2C9KA 2E7TA 1IOAA 3HN1A 3KWVA 3WG1A 4XBLA 1EP0A 4HPKB 1LOBA 1UF2C 1SFPA 1AJOA 1W06A 5ABJA 4CEYC 5FZ0A 1DP0A 2ZMKA 4J25A 3WG2A 4CPBD 3R05A 4S2GA 1DF0A 4IEYA 1DZRA 3THTA 4Y26A 2VR4A 3ZKYA 4MGKE 3ZYGA 4Y1VA 5DZGA 4MHRA 5L7OB 4MXWB 3UKVA 3ACLA 1MQTC 1AYN3 1S55A 2PFWA 2WAAA 4KMQA 5C4WA 1FNYA 1URXA 2RJKA 2XXZA 2WRAA 5FBZA 3N9NA 3U4XA 1MZEA 3TEWA 3MW2A 3NV4A 4B1LA 2BQPA 4I0WB 4DXSA 1UYPA 4E2GA 1A34A 1GNZA 3M4FA 1QJX2 3DPRC 4A42A 2IXJA 2Y0OA 3R4DB 3ACGA 1UKGA 2RS13 2CU5A 4P14A 2TBVA 4C0BA 5LEJA 3GNEA 4LO4B 4FOYA 3RWNA 2OZ6A 4OUEA 3B3QE 5AC93 5A1AA 1D2SA 1YCIA 2VZQA 5FWJA 3ZYIB 1EPWA 3ACHA 3AL5A 5JR2A 2ARAA 5AVAA 2JDKA 1LU1A 4PF5A 1OF3A 2CAVA 4CU8A 2GNTA 3M3OA 3B5LB 1YQ8A 5L7OA 2OA2A 1KXGA 1PZ8A 1ZZCA 5BNNA 3IDBB 2E6VA 1APNA 4EN8B 1LOEA 2BOIA 3U07A 3LQCA 3CJXA 4PCRA 4META 1QXPA 1H4HA 2Q1ZB 5AFEA 3VBRB 1I6XA 2XBO2 2GP5A 2AH2A 4BYYA 2VCCA 3N7LA 4HKLA 4EE2A 3I54A 1HB3A 1IPSA 1H9PA 2HEYF 2WWSA 1KRIA 1GP6A 3M3CA 2WFF2 5FZ6A 1JOPA 1QDCA 4I3PA 3URFA 2ET7A 4GKXA 1O4ZA 3PURA 1HXS1 1UIJA 3CIHA 2Q0AA 4IEWA 2R072 2ZMNA 1AR91 2YV8A 4Z07A 5CIRA 4LE4A 3SITA 2RMU1 2DWRA 2EIGA 3DCQA 5HCFA 3RDIA 1RGSA 3OBAA 4A45A 1LOFA 5FZBA 3WW3A 3M3IA 4B4RA 1ND2B 4GXLA 4QPGC 3DXUA 2QQWA 2DBNA 2D7FA 2YROA 2ZGOA 1PO12 1SHWB 3VBRA 1PZ7A 3J7NA 2OUHA 4TSVA 1IS6A 3KQRA 2ZHMA 3GBFA 1F5FA 3M7AA 3IN9A 3ZPOA 2UY8A 1QH7A 3LEKA 2VW0A 2OZJA 2JD4A 1OI6A 2JG9B 4CYDA 1AZDA 3N9QA 1CJPA 1ZBA3 4Q4X1 2Q4SA 2ZGKA 1ZRIA 3NJYA 1ONAA 5F3GA 3ST7A 3B93A 2C5DA 4N53B 4A3XA 3VZMA 3WCRA 2WSUA 2BVBA 3OGRA 1ENSA 2A6ZA 4V2VA 4ET7A 3BOWA 2WO7A 1JYXA 4ZS2A 1TME2 4YW5A 5HV0A 1AYM3 3AMHA 3MUY1 1LB2A 1YEWA 1YJKA 2HWB3 5GM0A 1O4YA 4NMIA 3WQ7A 4HMZA 3ALQA 2AEYA 3NNGA 3WF3A 4PI0A 1AVBA 2H0BA 5FMBA 3WXPA 2VNGA 4UI9L 3IAPA 4YG0A 2L9LA 2LM3A 1QJU2 3DL3A 5ANNA 5HPOA 2E9QA 4XE9A 4HLTA 3POJA 1SDDB 5FPLA 1IS4A 1V6IA 1WUVA 2Y6HA 3J7MA 4CDXC 3IDCB 3GF6A 1HQWA 4C8DA 2DURA 5E6HA 1ENXA 5FXXA 1ULFA 3ZN4A 1RUD2 2OXBA 4Q4X3 1G9FA 3TN93 1A78A 3ZX7A 4TWTA 4CDUC 1YIPA 1MS4A 2B4KA 5FR3A 4PHZA 1Z7S3 2ARXA 5LASA 1UY4A 4R52A 3THCA 3QBQA 4AEDA 5CFDB 3N36A 1PO23 1QOOA 1WW7A 4FFFA 3VLBB 3UGFA 4Q8LA 4COWA 1QJFA 2BNMA 5FMDA 4KGQA 1W6NB 2A6XA 1LTEA 4P9GA 4WM8C 3VGIA 5LBCA 3AP6A 4KH9A 2VZUA 4PBPA 3FUOA 4AFAA 3J8F3 1NUKA 5A7WB 2BJSA 3RS6A 4JGZB 2YBPA 3FN9A 4MO3M 1I1EA 1HDKA 1NA1A 3C7EA 2VMDA 3I2IA 5FYMA 3MDPA 3CL1A 1WMXA 1YFXA 5IAVA 4E4HA 5BNQA 5DAQA 1OLQA 1YO8A 3KMHA 5LBFA 4CCNA 4IE4A 5J7MA 3WG4A 1CD3G 4NWWA 5A6ZA 3VD7A 4ZU4A 4DY3A 4HONA 3SHRA 1W39A 5BNPB 4AF9A 5CFDA 3VBOB 4WZFA 3ZXKA 3MLKA 1FT9A 3UNPA 2YHJA 3HR9A 3O14A 4RSUA 3VKMA 2GNBA 5CFCC 2W52A 1W6NA 2XL9A 3PTYA 4E4SA 4BXSV 4LLOA 2A3WA 5JAXA 1SBFA 1O7FA 2F4PA 1LU2A 2BWCA 5A7WA 4FPJA 4A2UA 1GNYA 4ATEA 4LHNA 4PQQA 5H9QA 5DAPA 4Y5SA 1OSGA 3HD8B 2D3PA 3I59B 2JDPA 4XF4A 2GN7A 5FJHA 2ZHLA 5CEHA 4N7IA 4M00A 1FPN3 1SLCA 5FP3A 2HWC2 3RG0A 2EAAA 4CUCA 5JXHA 3G7DA 2VY0A 4FPLA 4XQ4A 1W0PA 4C1WA 1N1TA 1IZ3A 1EV13 3TOJA 1LESA 2ZKNA 2ORXA 4FOVA 4GB32 4YW6A 3CMGA 3E6DA 1AR82 3S6PA 1ZBE2 1CAWB 4QPYA 2VE1A 2CGNA 2RS33 2RJLA 3FJSA 5J37A 5FZOB 3MIGA 3LFMA 2D93A 2FBEA 2DU1A 3NKGA 3FLTA 3LDRA 3CJIC 3LOBA 4YZ5A 4FBFA 5JMCA 2VD7A 3PLQA 4FOWA 4R4ZA 3I59A 1UY2A 3MFCA 4S2DA 3SQOA 3ZFFB 4DMIA 3Q8EA 1MVEA 1DLLA 2DCTA 5F3CA 1RUJ2 1KDMA 3P3PA 1UX6A 2UWBA 3PHMA 3ITQA 4JV4A 3Q8AA 1QMJA 2VULA 5BYNA 2BWAA 2HWE2 1BBT2 2PMWB 2Z42A 4PT6A 4DUWA 4I0BA 1XE0A 5GLWA 5LCWL 1XXNA 1KS5A 2XGXA 2ZGTA 3KQ4B 5FP9A 5LWBA 1J3RA 2QQOA 3O0VA 4HZFA 2QQNA 2GC1A 1EAH1 2EICA 1CAWA 1PNGA 1RVF2 5A3NA 3HBZA 1TQ5A 1W2OA 1LEMA 1BJQA 5FZOA 2XWBB 2ZA9A 1W9YA 1RINA 1RUI1 2Q30A 2GMPA 2VAUA 3JD71 1UZ0A 4NHKA 1RMU1 1MEC1 3ZFFA 1W3XA 5HCBA 5IVVA 2D5HA 2PTMA 3OEAA 2GDFA 3CZJA 2BZDA 1T2XA 3LA2A 5ISLA 1KQRA 1V6OA 2JICA 1HRV2 1B35C 4UOJA 5E8AA 1O5LA 2PAEA 3N7JA 1REEA 4HKWA 1NQJA 4EV0A 4XZUG 2FDHA 2ZHKA 5FZEA 3WNKA 5C3SA 2YBSA 1QQP3 1VBC1 2HKXA 3SCHA 2MNGA 4X6QB 1QGLA 4C91A 3OJBA 3HMYA 2ZGSA 2YU1A 4FSJA 1VRH2 2X5IB 3POFA 4DXZA 1H8TB 1RUI3 4LO7A 2K0GA 3MEPA 3UYJA 4DOUA 2VCAA 3BI3A 3UKNA 1U5YA 2Y6GA 1CPNA 3K2OA 1RYYA 3LB9A 2DFBA 3KCXA 4HVRA 4R8HA 5T50A 3ZN6A 3NRUA 4AWDA 4JAAA 5FZ7A 1YFUA 4H55A 1UOBA 2ZHNA 1LGNA 3WDUA 4XDQA 4AFBA 4M4PA 3UESA 1F4AA 1AXZA 2NP0A 1NCRB 3PIGA 1GP5A 2F4LA 4IV1C 3WW4A 4KWUA 4I30A 2BFUS 1VBC3 1XJAA 4QPWA 5F6LB 3ZLIA 1AYN2 1CR7A 2ZGLA 1NCQB 3I2KA 4RFT0 4ES9A 1CONA 5FP8A 3FL7A 5BXXA 3SEEA 1XU1A 1DGWX 1UPIA 1YQ2A 1GFF2 5I0RA 3WQ0A 1H8TA 1OVPA 4IESA 2ZAHA 4NOTA 1IQDC 2R1DA 2BP6A 2OIIA 3EBRA 3IAQA 3DYPA 3DGTA 2WS91 2RS12 4BZ4A 3KLSA 3NJZA 1ULDA 1W6MB 2VVFA 2LTNA 4LLFA 5KC5A 2X8KA 4LO6B 1K45A 1PX4A 3NJXA 4NVPA 5A7QA 2NLRA 3V64A 1O3SA 4HVOA 2HJIA 2MHFA 3ZFGA 1C5HA 4KG0A 2ERFA 2Y64A 1MZ5A 2VMHA 4FT8A 3NAPC 3ORJA 5A7PA 1C8M1 1NQDA 2E7QA 4URTA 4O7XA 3ZSMA 2W1UA 2BPA2 2JDUA 2XH6A 1S0BA 4JKKA 4YZ3A 3WVJA 1TEIA 1XSQA 3OF1A 2Y6KA 4WVZA 4ZPIA 1RUG1 1WD3A 4P9XA 3WDVA 1O6UA 4XACA 3DKQA 3I97A 4BIFA 3DECA 4QQHA 2WDBA 3E5QA 5JLVA 2DVDA 1F31A 4FPCA 4MVTA 3ZM8A 4AHXA 3CQOA 4QHOA 2ZMLA 4UT5A 4IGOA 2VXJA 4A7ZA 1MVQA 4W6YA 5JI9A 1H1AA 3WY6A 4DPNA 3ILRA 2GALA 5T52A 3ABZA 4COUA 1UZWA 1WKYA 2EAKA 4ZY9A 4BQXA 5K0UB 4QXBA 2LALA 4PDWA 1V9U1 1VAVA 5FXVA 4AAXA 1YRZA 2XJPA 2BNOA 2W92A 1FI2A 5IVJA 1DQ5A 3BIEA 1OA4A 2AYHA 1SPPA 3A0NA 2PAKA 5BNPC 3VD4A 3BOPA 3VBOC 4YGCA 2Z79A 1NG0A 5FZMA 5A7NA 1P8JA 5A70A 4FPGA 4NRPA 3AVRA 3VZLA 3RZMA 4V2WA 3RZZA 1DCSA 5JSRA 1ODNA 2RVAA 3C7GA 1QNYA 3NV1A 4L92A 1W6QB 5JZGB 1ZBA2 1CAXB 2EALA 5DUVA 4CUAA 4CEWB 4HG6B 3AZYA 5K0UA 1AR92 4NR1A 5JSOA 2KR2A 3B9IA 1Y4WA 3HNBM 4XHBA 1Z78A 2I2SA 1RUF1 4PF1A 5JVVA 3GJAA 4RQPC 4JGYC 3C7FA 2B46X 1AYM2 1LKNA 3LD8A 3I2HA 5H9SA 2X05A 2HWB2 5DPNA 5CAZA 4PBOA 3VL9A 2V09A 3T09A 4GZ9A 5KXEA 2DCJA 4AFDA 3LDKA 1MS9A 4CDQB 2ZGMA 2VMCA 3FC0A 1PO13 4HL0A 3USSA 3MIFA 1UN1A 2BDRA 1UNBA 4XURA 3QACA 1F9KA 3WDYA 4UBHA 2R7EB 3DYOA 4Y20B 1ND3A 4HK9A 5JZGA 4AGGA 1WA6X 2BEOA 3ENRA 3VBFA 1D4M1 1CAXA 1J83A 4PLNA 4GWIA 4ARYA 2VBBA 3K75B 4KBZA 1HRI1 3H3UA 4PIZA 4Q4X2 4Q4W1 3TN92 1SFYA 4CEYB 3O1OA 1VMJA 3WNPA 2D6OX 3NNJA 5F8PA 1JN2P 1Z7S2 1UXXX 3IDAA 5L73A 4RS5B 4K20A 1FYUA 1W6PB 3APBA 4MYEA 5FJKA 5FY4A 4UFHA 1JZ4A 2QQMA 2DV9A 4DINB 2R49A 3RWKX 5CU1A 2XKPA 2ZZJA 2ZKLA 4ISRA 4QQOA 4ITCA 4JHZA 4RN5A 4AI8A 2GNMA 3H3LA 4CDQA 1COV1 4XUOA 1V70A 5IHRA 2A75A 3DPRB 4OYUA 3PVNA 5FIXA 3WSOA 4AE2A 4IXLA 1UZZA 1V6LA 4XFHA 1QJU3 3F95A 4GJZA 1ZRCA 2KXLA 4IE6A 3JUUA 3FZ3A 2VMIA 3QD6A 1G9AA 2WLPA 4DXRA 4MG2A 1GQHA 2XUEA 4QHBA 2VMEA 4JTNA 4Q0PA 1KITA 1IGOA 2W46A 3I2DA 3PUIA 2JECA 3WP3A 3VDAA 3HQXA 4AVCA 4MX3A 3ASIA 1SBEA 2D3SA 1MQTA 1LAJA 1ZA7A 3IM0A 1STMA 2A7AA 1AHSA 1H1MA 3M1HA 3GALA 4I02A 2JDYA 2BW8A 4WVMB 3ZMNA 5A1LA 5CBLA 4UFMA 4BCUA 4JDMA 1JZ8A 2QFEA 3EHKA 2C26A 3LAGA 1QHDA 1FATA 2VM9A 3DPRA 2W2IA 3GXUA 3AJZA 4Q5OA 4AVTA 5KHKA 4FTEA 2ETEA 1COV3 4CDWB 2Y8KA 4XXPA 2IXKA 4QX5A 5FYTA 3KT7A 2R063 4M3CB 4BE3A 2IFRA 1FPN2 4YG6A 5A3LA 2JDHA 2JKXA 3N7MA 3QLQA 1D2QA 1J58A 4K6BA 4Y1YA 5CNAA 1EV12 5F5IA 4W65A 4C1XA 3V0AB 3TYJA 2D44A 3TEXA 2ZACA 4OHZA 4EWEA 1HV0A 2HWF3 4AFMA 1U12A 1NCRC 3MF9A 4P08A 4QPGB 1UYXA 4WVMA 4IEUA 4OHXA 2GC0A 5GJ6A 4QMAA 1SLIA 4XW3A 2VG9A 4XJ9A 1KFUL 2GAUA 1NCQC 4W6WA 4ZXKA 5LEKA 5GZDA 3K4ZA 4FI9A 4GH4C 4IE5A 4CP0A 3ES4A 3PU3A 2WIIB 1DQ0A 2HH9A 1JI6A 2OPKA 5T55A 2SBAA 4Q27A 4Q4V1 2ZJCA 1LOAA 1YI7A 1U5ZA 2UY9A 1IG3A 4LBQB 4AXOA 4L8QA 1SLBA 2PHTA 3MPPG 5IVYA 3V0AA 4DFSA 1GICA 5JOXA 4XDOA 3VBSC 3JQWA 4KWKA 4CP2A 4EJRA 4K7JA 5C33A 2VNVA 4D6SA 3VBUC 1R091 2PAMA 4QPGA 4ZHNA 2W95A 4J1WA 5FY9A 3WP5A 2A6VA 4GB33 4UFJA 5DN2A 4LBKA 2OQ6A 4CXWA 4FAGA 1OH4A 3FX3A 1W28A 1OVSA 4RR3C 3WINE 2G9ZA 3JU9A 3KGZA 5KHGA 3KB5A 4LUKA 4LTAA 1C1LA 2ET1A 3U14A 1O8SA 2QQJA 2VBPA 3MW3A 2E51A 3PJYA 2EXIA 2W68A 2ZCWA 5A32B 5FREA 1POV1 1LOGA 3TRSB 1RXFA 3MIEA 4RYDA 3USUA 1UWWA 3AKQA 4IUGA 2BGPA 4LBQA 3WF0A 1W8WA 4Q4V3 3P1IA 1BMV2 1AL21 2VUDA 1XU2A 1OD5A 2W91A 3AX4A 2E31A 2E26A 2YG0A 5T5LA 5J1XA 1K3IA 5FYYA 1M06G 2VUAA 1S0EA 2C24A 4RA0A 1HIXA 5ANQA 2HYKA 4MXVA 3WP4A 3NL1A 3CZUA 1JZ5A 3U78A 3OUHA 3NWKA 4HN0A 5EP9A 5F2WA 2BFUL 2CV6A 5FV3A 2E53A 3OYWA 1XNBA 4WM8B 3P6BA 1RVF3 2QDRA 3GBGA 3KV5A 5FQ0B 2RM21 1RUI2 4HBNA 4LR4A 3IIIA 4HKOA 4LE3A 2OT7A 5A32A 1OA2A 4KWJA 4CDXA 2ARCA 3T3YA 1E5IA 2CSGA 3AZWA 2RR11 3TNQA 4OQ8A 3WHTA 4XQDA 4A6SA 1QKQA 1W8NA 2R6QA 1BK0A 2XVKA 4JCKA 1OUSA 3VDDC 3LA7A 1AXYA 1AL23 1RTVA 3AXEA 4CDUA 3H8UA 1K5MC 1XBFA 3OGGA 1FOD1 4TLFA 3W59A 5KWRA 1PZ9A 3NKTA 3RPQA 3ZYFA 5A3PA 1VBC2 4XDPA 1GWMA 4YGBA 4JHTA 4DUXA 1TMF1 3LFIA 2PN5A 1IS5A 4I0AA 4WM8A 1T6BX 3FHIB 3U75A 2DYCA 3DKWA 3ZXJA 4EZ4A 4Z2AA 5FQ0A 5IYYA 2GZWA 3ZSLA 2PLV1 2WSVA 1JTZX 3OOXA 2LRPA 3JQXA 3PUQA 1UX7A 1R081 1NYWA 2B7YA 3CBNA 3I3QA 4OULA 4AQ2A 4COVA 1ASJ1 5DG1A 1PM4A 2JDMA 2RS53 5DZEA 3W9AA 3AMMA 2EXJA 2RR13 4ZXEA 2VNRA 4K1YA 2FDKA 1XNTA 5GZEA 4C0HA 4AHZA 3GCXA 3TBDA 4Q0VA 1X50A 4WZCA 5E16A 2XLAA 1FOD3 4OI2A 1YUDA 2RDQA 2OQ7A 3C2UA 3HPNA 1NY71 2BGOA 1HQNA 2WZ8A 3LZZA 4YGEA 5CFCA 4QKDA 4RS5C 4XETA 3U10A 3CJIB 1US2A 4OVEA 4D6RA 2LROA 3FWEA 3KZ4C 3RJ2X 3WNLA 4QDQA 4LA3A 2WO1A 4CCOA 4XF1A 5FYHA 4UW3A 1Q8QA 1KJLA 1BEV1 4F8AA 1JHJA 2AC1A 1R083 3AZXA 3SMHA 1DZTA 5FUIA 2HEWF 2ZEWA 4GMP3 4XC9A 4AVAA 1GYKA 3H0OA 1AX1A 4P9LA 2VW1A 3SKVA 2JG8C 5CISA 3R6SA 1V6KA 2YB7A 3EXUA 2GMMA 4BK4A 5HBAA 1RHI1 4HPKA 3BCWA 1O4TA 1JUHA 1QNWA 2P6CA 4OI0A 4ISQA 1QXRA 4EWAA 1CZSA 1CJDA 1CAVB 3H3ZA 4Z1VA 1AUYA 1GZCA 4BQ1A 1AR61 1E57A 2JIGA 3MGUA 4DEVA 2IVJA 4DRVA 5A3OA 3K4AA 4QQPA 5CADA 4MXWA 5GALA 2QQPA 4YM1A 3Q8BA 1QJY1 2EIDA 4Z2WA 5LZ6A 4MGIE 3N9LA 3JB4C 2E63A 2XVGA 4DEQA 5C7GA 3JCIA 2WT1A 2OX0A 2OKXA 3UKTA 4D7YA 1BEV3 1SDWA 1B35B 4D0QA 4CDWC 5CA6A 2YC2A 1AX0A 4KQ7A 5FZAA 2XJQA 1CX1A 3A21A 1WLDA 2P1BA 3AMPA 5D1IA 4LHKA 2WA4A 4NWVA 4JZRA 3RFRA 3S30A 5F3EA 3DV8A 4H2AA 2OVUA 2XPJA 5F6KA 3H50A 4O65A 2UWCA 5EJZB 1W8TA 4LUMA 2H0VA 5BNOB 3WW2A 4DRRA 4QT6A 4B3NA 3D3AA 4CCJA 3CU7A 4BQYA 2FDGA 1HB1A 1VP6A 1A8DA 5LATA 5JXJA 1U5IA 2ZX1A 2PQQA 1YXWA 2ZTNA 1G9DA 4FPKA 4XUQA 3VHNA 4FFGA 5FLJA 2DU0A 2V73A 1X8EA 2YC4A 1PMJX 4IV1B 4CCEA 4NRMA 5FZLA 1MPXA 4B4QA 4IEPA 2QVSB 1HXS3 4KWLA 1I5PA 1RUF2 5KXDA 1KGYA 4V1PA 4EZHA 1AR93 1MS1A 1ZZBA 3C8XA 4NHLA 2RMU3 5FZ9A 4D3WA 5C70A 4BWOA 2PA7A 1ND2A 3ZXFA 4YZ1A 2Y34A 3IKWA 4XIOA 1PVC1 3DUIA 3FLPA 1GR3A 3ECQA 1CZVA 4YNIA 5LY1A 2WBKA 4B7EA 1J3QA 4YZ2A 4GMP0 3BU0A 3EJKA 4NHXA 4XAEA 3BB6A 1PGL2 4X6RB 3AP9A 2D6PA 2DTWA 1Q43A 2ZBJA 2DDUA 2WWUA 1X33A 2FCUA 1FMD1 1NXD1 1LR5A 1WCQA 2EF6A 2JG9A 4FOQA 4FQZA 4IV1A 1WMDA 2ATFA 2XOMA 3CF6E 3DXTA 4AAPA 4EWDA 3CKHA 3NAPB 1S0CA 1EYBA 3PMSA 3WNMA 2BU9A 2TEPA 4N53A 2VVDA 3ZXDA 3UGGA 3RYRA 1H2KA 3KF5A 1XNKA 3GZAA 3HBKA 1G9CA 2VZ3A 3IPVB 1DYPA 3NV3A 4XCAA 4Y1XA 1ULOA 4FXGB 3AK0A 1N3OA 3ZIXA 2JB4A 2JE8A 2XVLA 4SLIA 4W50A 1YI9A 2WQ8A 5EJ3A 3ZVXA 1PVC3 1COV2 1IPJA 5IVCA 1O3TA 4OHYA 4COZA 4MUVA 2R062 2ZX0A 4K1ZA 4PIXA 2VBDA 3ZYRA 5FZKA 3RZKA 4NIAA 1DYOA 1UAIA 4HETA 5FUNA 3U4SA 2Z69A 2VQUA 4D7SA 4WM7C 1ZRRA 1FMD3 3NAPA 2HWF2 1FNZA 5D8AC 5J48A 3TWIA 5C3RA 4LBLA 4IEXA 5JOZA 4AVBA 2GC2A 2R0FA 4N90A 2E33A 4GJYA 4X8PA 1G9BA 1QU0A 3MIDA 2WNOA 1WW4A 1UOGA 1XE7A 3IPVA 3POSA 5GLVA 1YJLA 4KBBA 4YW4A 1WCSA 3OBRA 5DQ0A 2ZGRA 4Y1UA 1VB4A 4ZKTB 5C9AB 2CNAA 4LOTA 5EHDA 3GYDA 4BA6A 3H8XA 3OB8A 3A22A 4NPLA 2D6MA 4JGZA 3AVSA 4EN7B 3LSDA 3WDXA 2D6NA 1R64A 2ZEYA 4LMFA 3LE0A 5FY7A 4NE9A 1JBCA 3FE5A 2EIBA 4YRDA 4CU6A 3AMQA 5JUVA 2D97A 3PVBB 4XMIA 2ZGUA 3DF0A 4DS0A 1S0IA 2DUOA 2JENA 2YZ4A 3L2YA 5F37A 1VBE1 4AOCA 4XF0A 5ABJC 2XJRA 2VZVA 1ZM1A 3JBG1 2X10A 4RQPB 4JGYB 3VD9A 1UU6A 1OQ1A 3DYMA 4FPHA 1DQ1A 4WBBA 1NZCA 1UY3A 2I74A 3E6BA 2YU2A 5BNPA 2DVGA 3VBOA 3ZYBA 4NN0A 4YM2A 3WF2A 3K77A 3T30A 3M2MA 4Y5TA 4CU9A 1NE6A 4L99A 3B00A 3OGVA 4M3CE 4MHUA 1C1FA 3IIAA 1SFNA 3UJOA 1OLME 1WW5A 1PK6B 4Q4V2 4UBGA 4XPVA 1PGW2 5C3OA 2YY1A 5I0UA 1W2AX 3SH4A 1LHUA 4QQLA 1JOJA 3C3VA 2WO2A 4TN7A 2IXLA 1ACCA 2MEV1 2E7AA 3I3MA 3J26N 4EN0A 5GZGA 2JE7A 1JUIA 4LOSA 1VBE3 1UPSA 1DIWA 5FYCA 4A3ZA 3QCWA 4YFZA 3EB7A 4KG8A 1GV9A 4PQ9A 2O1QA 1H8VA 2Y33A 1MR5A 3KCCA 4IE7A 3O0WA 1WBLA 4MGSA 2NQYA 4FPYA 4YGDA 3FUQA 4LKFA 1RUC1 5LA2A 3K4DA 5IVFA 1PMIA 1PGSA 2FDFA 1YFYA 3N9OA 1VAMA 2VXRA 2VOTA 3LWCA 3OGSA 5FKBA 3ZOIA 1UMHA 5FPBA 3ZSEA 3KSCA 3WZ1A 2BTVC 4M01A 1UXZA 4N7UA 5LA1A 5F5QA 2P3JA 1AL22 2PHUA 1X8MA 2VVEA 4UFLA 3HNMA 1BLZA 2R32A 2W0XA 4AFCA 5EYYA 1Y7BA 5JMOA 2O0OA 2MEV3 2ZGQA 4QM9A 3VL8A 2JD9A 3WG3A 3M8LA 1HJFA 3TEYA 2D98A 3KHBA 4RFRB 2WT0A 2XLGA 5FBJA 2YFZA 2WN2A 4N43B 2TNFA
chains in the Genus database with same CATH topology
2PHWA 3E5UA 1EAH3 3K48A 3TNPB 1DQ2A 3WCSA 4Y22B 3MLJA 2WNUB 4FVVA 1VB2A 2RS52 1Q3EA 3AM2A 5BNOC 2WZR1 1VBB1 2VOKA 5I8TA 2RR12 1HKDA 1ULGA 1KJRA 1WW6A 3JD73 5EXOA 4XJZA 4KL1A 4R9AA 1RMU3 1MEC3 1QJZA 1S2BA 5I93A 1UIKA 2WQ4A 2PHXA 4QQ2A 4UW4A 5DUUA 4AEKA 1FOD2 2G9FA 1UU4A 4DB5A 2EVXA 4GA9A 5FDBA 1SCSA 1YWKA 3N35A 3SXWA 2G9GA 1H0BA 2ZGNA 2NM1A 2Z5WA 2EXKA 1T6GC 4SBVA 1CX4A 3SH4A 1OHFA 2PLV2 4GH4B 4N9IA 2X5IA 2EXHA 4Y22A 4S2FA 4AW7A 1GZWB 3PMEA 1HV1A 3NW4A 1R082 4P9IA 2DTYA 4XJAA 3RJRA 2WZR3 1VBB3 3RRDA 3OGJA 5E88A 3VN4A 4TYSA 3WD5A 3BIWE 3VBSB 1LJ7A 4QGMA 3VBUB 5ACA1 1NCRA 2OW4A 4JRAA 4XIKA 1NY72 1IHMA 4K8FA 4LULA 4WV8A 1RUH1 3E97A 4OUMA 5JPNB 1CVNA 1SLTA 2YC0A 2YYOA 4AEDC 4RR3B 1NCQA 3VBHB 3ELNA 4JQRA 4M0HA 1GZWA 4LBNA 2WJSA 4PLMA 4WVVA 1BEV2 1DU3D 4MV2A 3J4UH 1AF9A 5T54A 1NA1C 3A0KA 1D4VB 2WS93 1UMZA 5CG8A 4YVWC 1W6MA 2CTVA 1HQLA 2CL2A 4B7KA 2XLFA 3VKNA 1TE1B 5IK5A 3B69A 1RITA 3PVOA 5ACA3 2HEVF 4Q1PA 1NXMA 4RR3A 4AI0A 3GZTB 3OBTA 1C8M3 1QJY2 2VOWA 4Q4Y1 3WUCA 2P3KA 3PNAA 1KD7A 1G86A 3U11A 4KNCA 1W2UA 1LB2A 5IT6A 3ZXLA 1RUG3 1RIRA 1LHWA 5C9AC 3RMYA 2VMGA 3VDDB 1N1SA 4H14A 1VBA1 3X29B 1K5MB 1VIWB 4Y1ZA 1WMFA 2ZX3A 1HXS2 3KS7A 1I9RA 4XQWA 1Q8SA 2RHPA 5HI0A 5K8SA 4NO4A 2RMU2 3HIFA 5C8WA 1V9U3 4C90A 3FMGA 4R9CA 5GLZA 1N3PA 2XG3A 1YYNA 3OD0A 3UV9A 3D5OA 4EN9B 1S0FA 2QNKA 4BMBA 5KHJA 1PNFA 1W0OA 2KM2A 4AGVA 1JW6A 1L3JA 2IWGB 1EPZA 1W6QA 1K5MA 4ZU5A 3AYAA 4YFWA 5JOYA 3QH7A 1PK6C 2ES3A 4GULA 4H7MA 4CEWA 2IXIA 1V00A 4XFBA 4ORFA 1U0AA 4LBMA 1OOPB 2MPFA 3CO2A 1LHVA 1TME1 2FZ1A 2WC2A 1QF3A 4FXKB 2P17A 2NPIA 1RUF3 3VHOA 3CEWA 4U2AA 4BMEA 1PVC2 5IK4A 4G9SB 4Y24A 2X53S 3L2HA 3VHRA 3SISA 4RD7A 5IUQA 1NE4A 1CQ9A 3V56A 2NMOA 2JG8B 5EFUA 5H9PA 5KXCA 1EY2A 4Y20A 1O3QA 1HX6A 1DDLA 1FMD2 4ASLA 4KGGA 1VR3A 1ZA4A 4CEYA 4QGNA 5JPMB 1D4M3 2VW2A 4Q4W3 1HRI3 1LENA 4LO8A 2BUKA 5HCAA 4RS5A 4Q0SA 5JDBA 1W6PA 1AL0G 4IV3C 4LO5B 4OHWA 2YGMA 3P3NA 3NV2A 2YDEA 4N43C 5IK7A 4N9HA 2ZOEB 1X82A 2IZWA 2YMZA 4FTSA 5T5PA 4XFGA 3SH3A 2PYTA 2JG8A 2WNUC 3FBYA 1OMIA 3ZFEC 5DUWA 4QM8A 3I7DA 1DYKA 1WLCA 1RUOA 5HXVA 4UW6A 1W6OB 1ZNPA 1ENRA 4AQSA 2Q5TA 4E4ZA 4HANA 5JIUA 3B02A 1JXNA 2P2KA 3SCFA 2PELA 4D7TA 2JDZA 1MS0A 3D4KA 2AUYA 3MICA 4LHLA 3SH5A 4CDWA 4E27A 4OUSA 4D94A 4M3CA 2IFWA 2HWC1 3RNSA 1N1VA 1LGCA 4XFFA 4AYUA 1VBE2 4HN1A 5LK5A 3ZFGC 3JBG2 1MZFA 1W6OA 4YLZA 4QPIC 2D6KA 3UK9A 1RUE1 1WA4A 3VUOA 4YM3A 1BXHA 1ZRFA 1DBNA 1WMEA 2I07B 5LRSA 1WCDJ 1R1A1 4RL7A 4YZ4A 3VBHC 1LCLA 3OPZA 3AZZA 1MACA 4RGAA 5JWPA 1WGPA 5F1RA 1H1IA 3SLIA 1G8WA 2UURA 3KCYA 2HWE1 1DGRN 5GLUA 4DQAA 2MEV2 1SCRA 5JIAA 3M70A 5CB7A 2PHRA 4DNYA 1C57A 4I09A 5KXBA 5J36A 1EAH2 4XMAA 3GHNA 2NYYA 1WCKA 1R093 1CPMA 1F2NA 2I45A 2VPVA 2GH8A 1RUE3 3FLRA 1ZVFA 4XZPA 3MPBA 4AI1A 5EV7A 4GQ7A 5FO7B 5KC6A 4K40A 5E1RA 3VKLA 1R1A3 1AXKA 3JD72 3NSTA 1ZRDA 1UU5A 1Y3TA 1FAYA 1MEC2 1RMU2 1B09A 1HRV1 2VOVA 1LOCA 1POV3 5H9RA 4OLLA 4WM7B 3ZXGA 5D8AB 2WNEA 1ZYBA 1G6NA 3UJQA 2QCSB 4R4XA 1UL9A 4FPOB 4GKYA 4UXAA 4JC1A 2FMYA 3ZYPA 3CNAA 5LK7B 2WNVC 2CGPA 2AZ5A 1VRH1 2YUEA 5EWSA 5FMOS 4R9BA 1ULCA 1TNFA 2C0ZA 4QU2A 3ETQA 4FO9A 1Z0HA 2ENRA 1DGRA 3QH6A 4RHV1 2RM23 4WVWA 5KHHA 2R041 1GSLA 1VBB2 2WZR2 4FAHA 2R1BA 1VBD1 4F3JA 4WM7A 2DUQA 5I8YA 2DUPA 5D8AA 5ABJB 3WLUA 5I91A 3A4UA 4E9KA 3B7MA 3EO6A 3R0RA 1DHKB 5FO9B 1O5UA 3AMNA 4L9BA 1OOPC 3R4UA 1TMF3 3S7EA 4JDNA 2WT2A 2QDNA 1X36A 1MS8A 1XYPA 2D40A 2PLV3 5FOBB 3O7OA 2R043 5J96B 2WS92 5DDJ1 4J1XA 5AC91 1ASJ3 2HWD1 2A5ZA 1VBD3 2A71A 1J59A 2VOXA 5BUVA 2VQ0A 2QZ2A 2DCKA 4XFIA 2ZPXA 5ACA2 3O12A 2UU8A 3FBMA 3ZXAC 2XB6C 1RUH2 2Y26A 1G7YA 1C8M2 3IT8A 2PHDA 5BNNB 5IK8A 4FPFA 2KA3A 3BALA 1IKPA 1QWRA 1XYOA 3CJIA 1O91A 1OFNA 1GANA 3RYPA 1LGBA 5J09A 2WQZC 3VKOA 1RUG2 3E5XA 4FCAA 2YGLA 4MZUA 4P9YA 4XEZA 4COYA 5SV8A 1KS4A 3WV6A 3ZMOA 2XUMA 3B01A 2QE3A 1POV0 2IXCA 4Q0QA 5C8CC 3D6EA 5DDJ3 3UL2A 3MI8A 2HWD3 3ROUA 3LA3A 2GMEA 1RHI3 1CAVA 2D3RA 5AVPA 1ZZ7A 3AYDA 1BKZA 1V9U2 4XJUA 1BVVA 1BCXA 1AR63 4Q4Y2 3N3HA 3WX5A 1QJY3 3ZN5A 3VHPA 2P34A 3H1YA 3B94A 4HVQA 4HK8A 1DFQA 3MFAA 4E2SA 4XBQA 1ZBA1 1B35A 1VBA2 3LOIA 1R1ZA 3OCPA 5I0TA 1CIWA 3PVEA 4U36A 5EZWA 4FBFA 3POYA 1N1YA 2W39A 2DVAA 2XJSA 1A3KA 3HAGA 3L9JT 4Z92B 4PJYA 2PHFA 1AYM1 3PJQA 3IDEA 4XHXA 5FCCA 4YW3A 3WDWA 1JHNA 1ZREA 2HWB1 4ATFA 2D43A 5JCTA 4HFSA 4YG3A 1LEDA 5BNOA 1CAUB 4INDA 1J3PA 1OPMA 3ILNA 2CYFA 1AX2A 5JSPA 2BNNA 2QZ3A 1FXZA 2XWJB 1GKBA 3TN91 3OY8B 1IS3A 4QGLA 4K9SA 1D4M2 1WLTA 3H9AA 4Q4W2 1HRI2 1VAKA 1Z7S1 4XJWA 1XE8A 2WFPA 4AEMA 4FP3A 1XYNA 1M4WA 1Q8OA 3ATGA 1PO21 3BPZA 3IBMA 2SLIA 4JRLA 3TB0A 4AEDB 1MS5A 3KT4A 1AJKA 4A7YA 1PIV1 2RE9A 3ZSKA 3J8F1 1UCXA 1CAUA 1RJ8A 3BTAA 3R4SA 1NA1B 1YIFA 2ILMA 4YVWB 1OKQA 3FFZA 1OQEA 3OY8A 4QXKA 4L11A 1H2NA 5DZFA 4BOWA 1LULA 4A7KA 4PLOA 2AR6A 4LBQD 4YVSC 2JKBA 1BZWA 4FQ4A 1XRUA 5C6CA 1Q8VA 1PIV3 3AKPA 4XFCA 3D82A 4AI3A 4CTEA 1HW5A 2P37A 1YLLA 1KDKA 4FPEA 2O8OA 4L2NA 1FPN1 1REFA 4YVWA 2V5YA 2QUOA 2CWMA 2R16A 4H7LA 1EV11 3OTFA 2NZ9A 2WA3A 5T5JA 2YXSA 1O3RA 3IMNA 2CAUA 3AJYA 4IEQA 4QD2A 3VZJA 2H6CA 4KU8A 2RS31 2XHKA 3B9CA 4IERA 5A3MA 3ME2A 3K51A 4ES8A 4L97A 1NLRA 1V6MA 4D69A 4GALA 5C9AA 5C4WC 5T3NA 2R0HA 3JZVA 4LBOA 4OI4A 5E89A 3ZYJB 1PM7A 2GC3A 3AZVA 4B4PA 1CN1A 3I4IA 1XQNA 2ZX4A 4RQPA 2XL7A 2BBVA 3AP5A 4JGYA 2XJUA 3AP4A 4XFAA 1V6NA 1R092 1BVP1 3JBG3 3RI8A 1Q56A 4Q1RA 1SACA 1RUE2 2ARBA 3AKTA 3D8CA 5GZFA 5L7OC 5JOWA 5BNNC 5FMOL 4TZDA 1R1A2 2PHLA 5BY5A 2B9UA 4Q26A 4XOGA 1NOVA 3KM5A 1BMV1 1PK6A 4LA2A 4G3YC 1C28A 2FMDA 1PHMA 1KFXL 4YARA 5FLHA 4Y4YA 4FP2A 5DG2A 1QQP1 1DQ6A 2DFCA 3J9SA 1H2LA 2B45X 3ILFA 1LHNA 4IV3B 5AFBA 3ES1A 4HT1T 1F5JA 1MS3A 4I01A 1LOFC 4XILA 3H7YA 2RM22 1VALA 1V6JA 1BYHA 3H1WA 2O8QA 5A33B 1J1LA 2JXAA 4FTBA 1RUC3 3VBRC 2A3XA 3ZN6B 2DVFA 1S0GA 2BGCA 4YW1A 3ZFEB 3HT2A 2EA7A 4P9JA 2B39A 4AG4A 1TNRA 4LT5A 1QY4A 2Z2SB 3V0BB 4IV3A 2QJVA 2Y38A 5J3UA 4N43A 3G6JB 4Z82A 4F7ZA 1TMF2 1AR71 3ZXEA 3MW4A 3S7IA 3M3EA 4M0NA 1RUNA 2K9ZA 1ND2C 2JE9A 4EN6B 3MYXA 1LECA 4BPZA 5K7PA 5A33A 4RHV2 2WNUA 1H2MA 2R042 1IQAA 4IQPA 1S1AA 4MGZE 3VV1A 1ASJ2 1H30A 3ZFEA 1VBD2 4E4DX 1ULEA 3AXDA 1SLAA 1DGLA 2DCYA 3RI9A 3BU7A 1DG6A 1U5XA 1J1TA 2BYVE 2JG9C 3ZFGB 5F9TA 3V0BA 4MGYE 1GQGA 3KD4A 2A6YA 4QPIB 4EROA 3ZIWA 4N53C 5JR7B 4ZU7A 4ASMB 1IPKA 2QKDA 3NVCA 1ENQA 1WLWA 2YPJA 2AGSA 3GHMA 1AR73 1LRHA 5KHIA 1RL3A 4GH4A 1ZZ9A 3D0SA 1I3HA 3THPA 4LEJA 3DN7A 1RJ7A 2AREA 2IC1A 1SEFA 1QJX1 1SBDA 3OD4A 2WZPP 1MZ6A 5DDJ2 5AC92 2HWD2 1SMVA 5B2GB 4Q2FA 3AKRA 3EQEA 1RHI2 3VBSA 4PDWB 4QPIA 3VBUA 4GWMA 5GKAC 3Q9OA 3GZUC 4O9EA 2X29A 1RC6A 1AR62 2GNDA 5CFDC 1ZZ8A 1RUH3 3VBHA 2Q1MA 4AHYA 4YM0A 2C9AA 4IL7A 3T2TA 4AHWA 2XBO1 2GH2A 2ZS6B 3N7KA 4CZSA 2A70A 4IEVA 4JGZC 5FRAA 2VH9A 2IXHA 2WFF1 1QJX3 5CA6A 4MSVA 3MIBA 2WLQA 1WBFA 3VZNA 2WKKA 1VLNA 3ZSJA 2XKOA 1D0HA 4XJ8A 2R071 2R30A 5FPXA 2FHRA 1QXJA 1FV3A 2WNVB 1OQDA 4IETA 1ALYA 3NO8A 4XYXA 3O5SA 1S0JA 2H6BA 4Y5Z0 1PO11 1UZYA 5FPZA 4K21A 1I5ZA 3WNXA 4B8EA 4Q4Y3 3ZDSA 4BM8A 2XBO3 3O0XA 5I8SA 3MLLA 2N7GA 3T1LA 1ND3B 3ZO0B 5FO8B 3VDDA 1FX5A 3HT1A 3RYKA 3VBFB 2WFF3 1GNHA 3WDTA 4CP1A 4AGRA 2K2SA 3AKSA 4IEOA 4JVAA 1OPOA 1VBA3 2GN3A 5LRRA 2A6WA 2UYBA 2R073 2WNVA 2OYZA 1GZ9A 4BH9A 2GU9A 4AVSA 3MZHA 4F83A 1S0DA 3SCGA 1HLCA 1SLLA 2VQAA 4S2HA 4NPRA 4XTPA 1UW8A 1DZQA 2ZABA 2UYAA 2WL1A 4P9WA 1QJU1 1PGL1 3MF6A 5SV5A 1N3QA 1XNDA 4Q29A 4KU7A 3ZFFC 2XJTA 1GBGA 4DZGA 4XF3A 1N47A 3TAYA 3INAA 1RUD1 3SNMA 3ZPYA 3WOGA 1PO22 4MLOA 1C3HA 1MQTB 4DY5A 1Q5OA 1OOPA 5TSWA 2VU9A 3AYCA 1C4RA 3VZOA 4B29A 5CG9A 1PIV2 3HWJA 1TME3 3J8F2 4AQTA 4ONUA 3I8TA 4M3CF 2W08A 3S0MA 2ZAAA 4Q8KA 2R061 5J98B 1QOTA 5GZCA 3T1MA 5KBFA 2DF7A 1DQ4A 5C8CB 4AI2A 1BQPA 4AVVA 3RQ0A 3GBWA 5FFOC 4XXAA 2HWF1 1ZZ6A 5FAXA 2A73B 1PVXA 2B8MA 4P5HA 1VJ2A 5BV6A 1RUD3 3WQ1A 4IEZA 4R9DA 2DCZA 4LNVA 1LHOA 3LSEA 4GWNA 3N4MA 3LCPA 2X5IC 4NHMA 1IKQA 3LKJA 1H8TC 5C8CA 1WD4A 2CGOA 3V65A 1REDA 2G4IA 2FZ2A 2ZX2A 1H4GA 2DVBA 1OFSA 1QOSA 3WW1A 4OZXA 5T5OA 4XBNA 3AYEA 4I2OA 3AFKA 1YNAA 4GB31 4JTOA 4YSFA 2RS32 2FQPA 1OA3A 2F6BA 4JDOA 1AR81 1JYCA 1ZBE1 1RB8G 1SQ4A 2ZZQA 4I3GA 1QDOA 1A8MA 3H1MA 1Q8PA 4HSJA 4AK3A 3VKFC 4BLIA 4OFGA 2AENA 3CLPA 1JYIA 4YYOA 1CGPA 5K9YA 2B5HA 3USUB 1PGW1 4K3UA 2CWSA 2P3IA 2NMNA 3RSJA 1RUJ1 4BIOA 5EYXA 3E6CC 2NN8A 2HWC3 2B42B 2JX9A 4Z8BA 1BBT1 1GLHA 1LODA 2JEMA 4X8NA 2XJVA 4OHVA 3WP6A 3WHUA 2OUJA 3W58A 1RVF1 3POWA 4PDWC 3VZKA 3WR0A 1AR83 3OYWB 1ZBE3 1OLRA 1NLSA 5CVRA 4J6GA 1RUC2 1BK1A 4YW2A 4CDXB 1QH6A 1Y43B 4MH0E 4O9GA 5FLIA 5BPXA 4XF9A 4PIYA 4G4FA 1DGWA 1FV2A 1RUJ3 3D0JA 4RGGA 4CDUB 1JH5A 1C8NA 4BLJA 3BODA 1QQP2 1H9WA 4BHPA 1CESA 1BBT3 1ZX5A 2A3YA 2HWE3 3H7JA 2LUWA 3AP7A 4YVSB 2VUJA 1UKRA 5JI7A 5K0UC 1S2KA 4GIQA 2VECA 2ZGPA 5I0SA 4LBJA 1YHFA 2VNOA 3M3QA 3WT3A 2GSYA 2BVVA 2RS51 2CY6A 3IWZA 5DXDA 5L19A 2TUNA 3KGLA 1A6CA 4W6XA 4Q0UA 1XNCA 4OI1A 5DUXA 4AQ6A 4UW5A 2WINB 2Q8OA 3RMXA 2C1FA 1X7NA 1ND3C 1HRV3 5JZGC 2D6LX 3AB0A 3LGRA 5FTTC 5L36A 3VBFC 3KT1A 4CEWC 1D0GA 4YVSA 5GLTA 5CFCB 2Y0IA 2JJ6A 3U0ZA 2VGDA 1YFWA 1UD1A 1AYN1 1F8VA 2UWAA 1AR72 3JB8A 4CRQA 4XTMA 2D5FA 5C4WB 3QOPA 1VRH3 3MIHA 1C5IA 4GMP1 3WUDA 4AEJA 5FOJB 1Y9QA 3FFQA 4H3WA 4CDQC 2RS11 4HSLA 3AFGA 4RHV3 2E7TA 1IOAA 3HN1A 3WG1A 4XBLA 1EP0A 4HPKB 1LOBA 1UF2C 1AJOA 5ABJA 4CEYC 2ZMKA 3WG2A 3R05A 4S2GA 1DF0A 4IEYA 1DZRA 3THTA 4Y26A 3ZYGA 4MGKE 4Y1VA 5DZGA 5L7OB 4MXWB 3UKVA 3ACLA 1MQTC 1AYN3 1S55A 2PFWA 5C4WA 1FNYA 1URXA 2RJKA 5FBZA 3U4XA 1MZEA 3MW2A 3NV4A 2BQPA 4I0WB 4E2GA 1GNZA 3M4FA 1QJX2 3DPRC 2IXJA 2Y0OA 3R4DB 1UKGA 2RS13 4P14A 4C0BA 2TBVA 5LEJA 3GNEA 4LO4B 4FOYA 3RWNA 2OZ6A 3B3QE 5AC93 1D2SA 1YCIA 3ZYIB 1EPWA 5AVAA 1LU1A 4PF5A 2CAVA 2GNTA 3M3OA 3B5LB 5L7OA 2OA2A 1KXGA 1PZ8A 1ZZCA 5BNNA 3IDBB 2E6VA 1APNA 4EN8B 1LOEA 3U07A 3CJXA 4PCRA 4META 1QXPA 1H4HA 2Q1ZB 5AFEA 3VBRB 1I6XA 2XBO2 2AH2A 4BYYA 4HKLA 3N7LA 3I54A 2HEYF 1H9PA 1KRIA 2WWSA 3M3CA 2WFF2 1QDCA 4I3PA 3URFA 2ET7A 4GKXA 1O4ZA 1HXS1 1UIJA 2Q0AA 4IEWA 2R072 2ZMNA 1AR91 2YV8A 4Z07A 5CIRA 4LE4A 3SITA 2RMU1 2DWRA 2EIGA 5HCFA 3RDIA 1RGSA 1LOFA 3WW3A 3M3IA 4B4RA 1ND2B 4GXLA 4QPGC 2D7FA 2YROA 2ZGOA 1PO12 3VBRA 1PZ7A 2OUHA 4TSVA 1IS6A 3KQRA 2ZHMA 3GBFA 1F5FA 3M7AA 3IN9A 2UY8A 1QH7A 2VW0A 2OZJA 2JD4A 1OI6A 2JG9B 4CYDA 1AZDA 1CJPA 1ZBA3 4Q4X1 2Q4SA 2ZGKA 1ONAA 3ST7A 3B93A 2C5DA 4N53B 4A3XA 3VZMA 3WCRA 2WSUA 2BVBA 1ENSA 2A6ZA 3BOWA 4YW5A 1TME2 1AYM3 3AMHA 1YJKA 2HWB3 5GM0A 1O4YA 3WQ7A 4HMZA 3ALQA 1AVBA </