1AYM1

Human rhinovirus 16 coat protein at high resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
285
structure length
285
Chain Sequence
NPVERYVDEVLNEVLVVPNINQSHPTTSNAAPVLDAAETGHTNKIQPEDTIETRYVQSSQTLDEMSVESFLGRSGCIHESVLDIVDNYNDQSFTKWNINLQEMAQIRRKFEMFTYARFDSEITMVPSVAAKDGHIGHIVMQYMYVPPGAPIPTTRDDYAWQSGTNASVFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDTYKSRYGTVVTNDMGTLCSRIVTSEQLHKVKVVTRIYHKAKHTKAWCPRPPRAVQYSHTHTTNYKLSSEVHNDVAIRPRTNLTTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The refined structure of human rhinovirus 16 at 2.15 A resolution: implications for the viral life cycle.
pubmed doi rcsb
source organism Human rhinovirus sp.
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
total genus 61
structure length 285
sequence length 285
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1aym100
1ASJ3 4Q4X1 3VBUA 1NCRA 4RQPC 2GSYA 4N43B 5CFDA 4Q4X2 2RMU1 1D4M1 1AYN1 1NA1B 2WWSA 1X36A 1EAH3 5C9AC 3NAPB 1ND3B 5ABJB 4Z92B 1HRI3 1VAKA 1PIV3 2HWB2 5AC93 3DPRC 3JD72 1ND2A 2RS32 2BPA2 1AR72 1Z7S3 1MEC2 1MQTB 1VBD2 1PGL2 3VDDC 1RMU2 1AL21 1AL22 1AYN3 1RUI3 4CDQA 5C8CB 1K5MC 5JZGC 1HRI1 1PIV1 1VBE3 3NAPA 5ABJA 3S6PA 4IV1C 4QPIB 1NOVA 3ZFGC 5J96B 1D4M2 1EAH2 4RR3B 4QPGB 1X33A 1MQTA 2HWF3 1AR62 4CDUA 2TBVA 1TMF3 1COV3 4PDWA 1AYM3 4N53B 1EV12 4Y4YA 2R062 1RUD2 3ZFFC 1RUJ1 4RHV1 1VBD1 4WM8C 1VBA3 1V9U2 4FSJA 3VBFC 5J98B 3TN91 4GMP1 4WM7C 2GH8A 1CD3G 2RS13 4JGYA 1NCQA 4RR3A 1VBB1 2R061 4Q4V3 1FMD2 1VBC3 1VBE2 1AR83 1BEV1 1QJY3 1F2NA 5K0UA 1BEV3 1QJY1 1D4M3 5D8AA 5FMOL 1EAH1 2BUKA 4YVSB 2HWE2 5BNNB 1QJU2 4Y5Z0 2RM22 4IV3A 1ND3C 1HRV1 1C8NA 4YVWC 1RUF2 4GB32 4SBVA 2RMU2 2XBO3 1IHMA 3VDDB 4CEYC 1H8TB 1NA1A 1VBC2 1AR92 3VBHB 4FTSA 1RB8G 4N43A 2MEV1 1TME1 1PO21 1POV1 1OOPA 1B35B 4IV1B 4QPIC 5CFCA 1BBT3 1VB4A 4CEWA 1AUYA 1C8M2 2RS52 2HWF2 1AR63 1RUE3 5ACA1 1RUF3 1R093 4N53C 4CDQB 3FBMA 4LLFA 2BFUS 2RR11 1RUC3 5C4WC 2WLPA 4QPIA 1HXS3 2WFF1 4GH4B 3CJIA 1RUD1 1ZBA2 1AR93 1FMD3 1FOD1 1W39A 1QJZA 1PO12 1GFF2 1C8M3 4JGZB 1R081 1QJU3 1RUC1 1QJX1 3TN92 1ND2B 1HRV3 4YVWA 1PIV2 1VBC1 1R1A2 2HWB3 5A32B 1ND3A 2WZR3 1ZBE3 2WZR1 1CJDA 3ZXAC 2RMU3 2XBO2 1RMU3 1NCRB 1PVC2 5L7OC 4Q4Y2 5K0UB 1PO23 4RS5B 3DPRB 5LK7B 3VBHC 5BNPC 1NCQC 4JGYC 5BNPA 3VBHA 2PLV1 4NWVA 1VRH2 4EJRA 2R041 5L7OA 1R091 1COV2 1RUJ3 4CDUB 1MEC1 4PDWC 3VBSB 4IV3B 1V9U3 3VBRB 1VBA2 2R071 2FZ1A 5A32A 2R043 4Q4W1 2HWD3 1PVC3 1HXS2 3JBG2 2ZAHA 1FOD3 4RQPB 1TMF1 1ZBA3 2HWD1 2RS12 5D8AB 4IV1A 2HWC3 1BMV2 1RUG2 1AR82 3NAPC 5ABJC 1K5MA 1PGW1 5JZGA 1R083 4CEYB 1RVF2 5AC92 3CJIC 3TN93 1VB2A 2ZTNA 2VQ0A 5C4WA 5ACA2 1ZBE1 1ND2C 2X5IB 1HX6A 1AR73 1AL23 1RMU1 2DF7A 4GB33 4N53A 1NY71 1QJX3 3ZFGB 1ASJ2 5CFDC 1PO22 1TME3 1OPOA 1NCRC 3VBUC 3LOBA 2HWB1 2ZZQA 1ASJ1 4Q4X3 1POV3 4CEWC 1WCDJ 1FPN3 1RUG1 5CFCC 2HWC2 1OOPC 2PLV3 4CDWB 1RUG3 5C4WB 1BBT2 4GB31 4GH4C 4N43C 4Q4W2 3VBOC 1RUI1 1RHI3 4WM8B 5A33A 2Y26A 1H8TC 1NA1C 1RHI1 2WS91 4CEYA 4AEDB 4RHV3 1A6CA 4JGZC 2FZ2A 1RVF1 3J8F3 1PO11 1B35C 4IV3C 4Q4V2 1RUH1 3JBG3 1AYM1 2WS93 5A33B 4YVSC 1K5MB 5BNNC 5JZGB 5GKAC 1VBA1 1FPN2 2RR12 5D8AC 5DDJ1 3ZFEA 5DDJ2 5K0UC 1PO13 4Q4Y1 2HWE3 2XPJA 2R063 4RR3C 4Q4W3 4WM7A 4QPGC 1COV1 1TMF2 1RUH3 1RHI2 3ZFEB 5BNPB 1HXS1 2WFF3 1VBB3 3CJIB 4Q4V1 3VBFA 1ZBE2 1R1A1 4WM8A 1QQP3 3ZFFB 2BBVA 3ZFFA 5AC91 2X5IA 1SMVA 4CDUC 2WS92 1FPN1 1MQTC 1AR81 1BEV2 3VBUB 2XBO1 4GMP0 2PLV2 1BBT1 4RFT0 3ZFGA 5FOJB 1M06G 1OOPB 4NWWA 1HQNA 4FTBA 3JD71 4CDQC 3VBOB 4CDWA 3JD73 1MEC3 4RHV2 3VDDA 1R092 2BFUL 1AL0G 1NCQB 1PGW2 4YVWB 1QQP2 5BNOA 1RUI2 2RS51 3DPRA 1FOD2 5C9AB 2HWD2 1VBE1 1FMD1 4BCUA 5C9AA 2QQPA 1OHFA 1R082 3HAGA 4RQPA 2RR13 4CDXB 1RVF3 4PDWB 4GMP3 5BNOC 5CFDB 4WM7B 1POV0 2RS53 1EV13 4CEWB 3VBSA 3JBG1 1EV11 1RUD3 2WZR2 1DDLA 4CDWC 1RUF1 3M8LA 1R1A3 1QQP1 1AR71 1C8M1 5L7OB 3JB8A 1F8VA 1QJX2 4Q4Y3 1RUC2 1QJU1 4CDXA 2MEV2 1AR91 1QJY2 1BMV1 4RS5A 4AEDA 2X5IC 2IZWA 2R072 3VBFB 1HRV2 2RM23 5C8CA 3VBRC 1RUJ2 4QPGA 1Z7S1 3VBRA 5C8CC 1AYN2 1AR61 2HWF1 2R042 1VRH1 3J8F2 3ZFEC 1ZBA1 5BNNA 2RM21 4YVSA 2MEV3 2HWC1 3IDEA 4AEDC 4RS5C 5DDJ3 1V9U1 1B35A 1HRI2 4JGYB 3J8F1 1PVC1 1VRH3 1E57A 4CDXC 2RS11 1AYM2 5BNOB 4JGZA 1NY72 2R073 1RUE1 5ACA3 1RUH2 1VBB2 1RUE2 1Z7S2 2WFF2 2RS33 1PGL1 1H8TA 4FTEA 2RS31 1VBD3 3VBOA 4GH4A 5FMOS 1NG0A 3JB4C 3VBSC 5CFCB 2HWE1 1TME2
chains in the Genus database with same CATH superfamily
3IMNA 3DCQA 5LZ6A 3TEZA 1NCRA 3PUQA 4AFDA 2A75A 2D7FA 2JDAA 2P5BA 1LGBA 2GSYA 4JVAA 5FMBA 5CFDA 5FY7A 1GP6A 4QT6A 1D4M1 1NA1B 4XPVA 2VXJA 1OLME 3LDRA 5C9AC 1NQDA 3O1VA 2VULA 4Z92B 2BZDA 4GQ7A 3USUA 3O1PA 3WQBA 1ND2A 2RS32 2BPA2 1AR72 2P17A 4TWTA 5B4XA 1DGWA 2SLIA 4ZU4A 2JDKA 5FQ0B 1Q56A 1XC6A 4QQHA 3AM2A 5A7WA 1W90A 2ZGUA 3BOWA 2D3RA 2WWJA 1LESA 5C8CB 3JQWA 3WDXA 1HRI1 4YGDA 2JIGA 1VBE3 5ABJA 2XOMA 4AGGA 1CX1A 2BW8A 3PHMA 4I30A 4MXWB 2ATFA 1NOVA 2BWAA 3VHPA 5FYZA 3KT1A 3I4IA 4RA0A 4KU7A 3N7MA 1QU0A 1GNHA 3ZYPA 4OMCA 3V65A 3M3CA 1D4M2 4RR3B 5IATA 3VHRA 3V0BB 1Y9GA 4GD4A 2I2SA 2JG8A 5F6LB 1QMJA 3AKPA 1IS4A 1YYNA 2DTWA 1IKPA 4JC1A 3H7YA 4JX0A 2R062 1TNRA 2ZX0A 5C3PA 5D21A 4HK8A 2QNKA 3INAA 1UD1A 1WMEA 2PHLA 3OSDA 4WM8C 3IN9A 3KQRA 4XUQA 2XMLA 2R30A 2VECA 1V9U2 3BN6A 3VBFC 4FSJA 4AAPA 1S0DA 2WZ8A 2XHNA 4XFAA 4U36A 1PK6A 4AAXA 5EYYA 2RS13 3ILFA 4RR3A 5DZGA 3ZPOA 3HVDA 5CKMA 4FVVA 2X8KA 1F2NA 5DG2A 3J7NA 3HMYA 2PYTA 1ODMA 4FI9A 1GLHA 1O5LA 5LA9A 1S2EA 5FOBB 3PMSA 4QHBA 4LTAA 1O5UA 4BYYA 4CP1A 4DUWA 1RJ7A 2Q5TA 2VTXJ 3BPSA 1QJU2 2A3YA 2DV9A 3WHTA 5A6ZA 5KHHA 1JZ8A 2CY6A 1QH7A 4QDRA 2EA7A 4AI2A 5LASA 4YVWC 1TVGA 2B9VA 1C3HA 1GICA 2FHRA 2P3KA 3EHKA 3H7JA 4QPWA 2EIGA 5A1LA 1MACA 4K3UA 4GB32 3PUIA 3B9CA 1GWLA 4XTPA 2RMU2 4OFGA 5FY8A 1A3KA 1CX4A 5C33A 5CISA 1OQDA 5JSRA 1VJ2A 4JRAA 1NA1A 1LOAA 1W6OA 4W6XA 3ZN4A 1FX5A 1AR92 2HJIA 2J1UA 1RJ8A 3ITQA 2HYKA 4YG0A 1POV1 1W99A 2O1QA 4D7TA 3E97A 2Q8CA 5F5CA 1B35B 1DF0A 2VUCA 1DHKB 2JG8B 4LQRA 3MLKA 1NLRA 2VZTA 3WW2A 2VQTA 1W6NB 3GZEA 3MEPA 2HWF2 5GZCA 1AR63 3ZR6A 4COZA 3VZNA 1CAVA 1HKDA 1K3IA 1VP6A 5A3UA 2Y38A 3FWEA 5FBZA 1H9PA 2OX0A 4PCRA 2DVFA 1R093 2NN8A 2ZGMA 5L19A 1W9WA 4DINB 5FK8A 3FBMA 1OFSA 3I97A 1UZYA 3OG2A 3D6EA 4LLFA 2BFUS 1GZWB 2RR11 1RUC3 3ACGA 2XGXA 2J1SA 5IK8A 4MX3A 5JVVA 3LD8A 3CJIA 2YDEA 3ORJA 4GH4B 1D2SA 2VQUA 2BOJA 4Y1XA 4Q1PA 2A6XA 1SZBA 5IVYA 3TEYA 2OPWA 1QJZA 3FLPA 2L9LA 3RZGA 3VGIA 3POSA 3O1RA 4MO3M 4XYXA 2W46A 1C8M3 3UT0A 1PHMA 3BPZA 3NO8A 1NZIA 2VMEA 4XFCA 5EJ3A 5F32A 5HCFA 5KXEA 1IGOA 3O1TA 3VD9A 4YVWA 4GAZA 1PZ8A 2AC1A 2BGCA 4BOWA 3IM0A 5A32B 4Q5OA 2VMHA 2JDYA 3R05A 1REFA 3M3EA 3WG1A 3KMHA 4R9AA 5IAVA 4A44A 1CJDA 1YQ5A 3ZXAC 3WW3A 4MHRA 2GAUA 4OHYA 3RZLA 2YHJA 2W0XA 4A4AA 3FUQA 3HJRA 1OBNA 3VUOA 3ILNA 3Q8EA 4UT5A 1IZ3A 1NCRB 1DYKA 3GDBA 5L7OC 4HG6B 5KR7A 3PIGA 3POBA 4RS5B 3KCXA 4XC9A 5FPVA 5FXXA 4NIGA 2KD7A 1QOTA 4HLTA 2Q8EA 3BCWA 2VO5A 1W04A 1J1TA 5LK7B 2Y6LA 4N90A 5FKCA 5BNPC 4Q0UA 1BQPA 4NHYA 4MYEA 1IKQA 1DZRA 2B5HA 3GJAA 1G9CA 5DG1A 1O4ZA 1H1AA 1RGSA 3N7KA 5LBBA 1UMIA 2G4IA 5LRRA 3RYPA 4E4SA 4AHZA 4XBNA 1UY1A 4LNVA 5FZHA 1JYIA 4DO0A 4IQPA 1YNAA 2K0GA 4PJYA 1A8MA 4LJHA 1IS3A 3T3YA 2GC2A 2NPIA 2R7EB 1R091 4LA3A 3T4VA 5AVPA 1K45A 5DAXA 2ENRA 3ZKUA 4AWDA 4BWOA 4F3JA 1H6YA 2WSUA 4E9KA 2VGDA 4E27A 1JYTA 2W52A 3JU9A 4NPRA 3VBSB 2ES3A 4N7IA 1X9PA 1XXNA 2CSGA 2J1RA 3TRSB 5JMOA 1D7PM 2DFCA 4JDMA 4PLNA 1GOFA 1LEMA 2NMOA 2R043 5A32A 1ZRFA 3AL6A 2RS12 3BYWA 4CA9A 4QDSA 3LB9A 1LU1A 4YW5A 1WA6X 1KJRA 1LKNA 2QQKA 1K5MA 1PGW1 3NW4A 3WY6A 3EQEA 4XW3A 2J7MA 3TAYA 2VU9A 4KWJA 3NNJA 1QF3A 2CL2A 2DCJA 1W9SA 4UFKA 1V00A 4CCDA 2FMYA 2OVUA 1JMUB 3D0JA 4LK6A 2EIEA 3M3OA 4HSJA 3AP5A 3OF1A 5C4WA 1P8JA 3DF0A 4IGPA 1ZBE1 5H9SA 5JAXA 5I8YA 1YQ8A 4Y20A 4QB6A 4X8NA 3AZXA 3UGFA 4YARA 2V73A 2VOXA 2C24A 1X8EA 4XVHA 5FYUA 4CVUA 1RMU1 1YFXA 3IWZA 1NAEA 3OPTA 1GP4A 3H8RA 1QJX3 3WF3A 4QQPA 3E5UA 1ASJ2 5CFDC 3T30A 1DGRN 4GKYA 1PO22 2H6CA 4EYUA 3LOBA 3HT1A 4P9LA 3ZXEA 4LIUA 4CEWC 4GWIA 5CFCC 5F5AA 3LFIA 1F9KA 1ULCA 1ZRIA 2PLV3 2ZZJA 3FMGA 4E4DX 1YEWA 3C7OA 3RZKA 3POFA 1QOOA 5F3IA 5HCAA 3M1HA 5GZDA 1D0HA 3VBOC 4XBQA 3F95A 4WM8B 5A33A 2EAKA 3U11A 1DU3D 4IEQA 4TLFA 1AZDA 1SBDA 2BJSA 3PUAA 4Y22B 5F37A 5JI9A 4XE9A 2BU9A 4AEDB 4COVA 3U75A 1A6CA 2OXBA 3GZAA 2H0VA 1OUSA 1CPNA 2C1FA 4YPJA 3O1UA 4LT5A 1RVF1 4BLIA 2JDNA 2Y6GA 1PO11 1XU2A 3PTYA 4O61A 2UY9A 3MIHA 4CP2A 3AK0A 3JBG3 1YFWA 1YFYA 1JZ5A 5I0TA 1AYM1 2A6VA 1SLTA 1K5MB 3RYKA 1NYWA 2GC0A 5GKAC 2WN3A 2VNGA 3CF6E 3KT7A 1VBA1 1CAXB 1FPN2 5G05L 5A6YA 2BVVA 3ZFEA 2ZA9A 5FZMA 3GCXA 5FZ8A 3WDVA 4BQ2A 2DWRA 2VZ3A 4OVEA 2VNVA 3KGLA 3RZHA 4AXOA 1ULOA 3KB5A 4Q4W3 3IMMA 4QPGC 1B09A 2F17A 3FZ3A 1HXS1 1XE7A 4W6YA 1WMXA 3BIEA 3VBFA 1V0AA 1O3TA 1YQ2A 2JG9C 4INDA 3ZXKA 5FO7B 2W9XA 1ULGA 1ZRCA 1W6QB 3K3OA 3N9QA 3WP5A 3ZFFB 2A6WA 3ZSKA 4LKEA 4P9XA 2Y6HA 1UAIA 3NV2A 1K5JA 4WVZA 2ZX4A 4LO8A 2E53A 1GP5A 1YI9A 5AC91 1LECA 2K2SA 2IXLA 2PHDA 5FR3A 4CDUC 2WT0A 4D3WA 5J3UA 1OPMA 4B1LA 3AYEA 2N7GA 1O7FA 1W8WA 3JZVA 3ZMNA 3ZX7A 4BMBA 2AREA 5H9RA 4DQAA 4LBNA 3VBUB 3CL1A 5A80A 2NYYA 1GNZA 1V6MA 2EXIA 2O0OA 4RFT0 4P9JA 3ACLA 4C0BA 2YMZA 5DUXA 2DU0A 5FAXA 1F35A 2RJKA 3GYDA 2V4VA 3HQUA 4NWWA 4JV4A 4D6QA 4FTBA 3JD71 1LOBA 5A1AA 4CDQC 4CDWA 1DLLA 2PTMA 1C5HA 4FT8A 3AB0A 1NKGA 2W08A 1YQ6A 4GWNA 4DS0A 4GALA 3VDDA 4TZDA 1V6NA 4RN5A 5L73A 2BFUL 1AL0G 1NCQB 3RPQA 1OMIA 1CZTA 1PGW2 1RIRA 5L9BA 1QQP2 2A6YA 3N9MA 4DPNA 1RUI2 5TSWA 4F7ZA 2RS51 4Q1RA 2WA3A 3O1OA 3O7OA 1C1FA 3OTFA 5C9AB 1VBE1 2RDQA 3AMHA 4BCUA 2VZPA 5I0SA 5D2AA 1FNYA 2VAUA 3L2YA 3DEMA 5JOYA 5IUQA 1US3A 1AF9A 1IQDC 4FOQA 4RQPA 2RR13 4ZXKA 1CESA 1U5ZA 1UY3A 4AI9A 5K9YA 4GMP3 1ZX5A 1Q8VA 1S0IA 1LOCA 3OBRA 5IJRA 3MIFA 3CKHA 5GLZA 2RG4A 4XETA 1UIJA 4BQ1A 2QE3A 3U07A 3HNBM 1AXYA 1L7QA 1VMHA 2ORXA 4GXLA 4C90A 3PDQA 2WZR2 4CUAA 1O3QA 4EWDA 1AR71 3T4HB 4HPKA 2IXCA 4IL7A 4DRRA 3POJA 4I3PA 2YXSA 4DEQA 4QX3A 4CCOA 2W1WA 1CWPA 3HN1A 1V6KA 3R4SA 5FK7A 4TSVA 3PJYA 1JYWA 4OQ9A 1D0GA 3SITA 4L11A 5CEHA 3WG2A 2D3SA 1KJLA 3PURA 2VY0A 3JQXA 1QJY2 4YW4A 5F7UA 2Q30A 4AI8A 3GJBA 3PVBB 2KXLA 4JDNA 5IK5A 2X5IC 3M4FA 2ZMNA 1SEFA 2ADDA 2IZWA 3UL2A 2JJ6A 4XFGA 2R072 1UX6A 2CYFA 1F5JA 4FPCA 4B29A 4XBLA 1HRV2 1HW5A 3RZJA 2VOKA 4LBOA 2WRAA 2IFRA 5C8CA 3VBRC 1RUJ2 2ZX2A 4I0AA 4QPGA 2WBKA 1Z7S1 4GA9A 5C8CC 5FIXA 1AYN2 4A6OA 1IS6A 2C0ZA 1ZZBA 4IW3A 3N7JA 2V09A 4W65A 3FHAA 3LQCA 1XYPA 4PI2A 3WD5A 5BNQA 2YC4A 1OH3A 4XFIA 2VC9A 4ISQA 1AX2A 2RM21 4W8JA 4GWJA 5BNNA 3MICA 3GALA 5E16A 1Q43A 3PIJA 5HCBA 1W0OA 3UGHA 3GM8A 2PAKA 1OKOA 4V2WA 1UKGA 4XCAA 1ZA7A 1CAWB 5DAQA 4GKXA 4H2AA 5A3NA 4AK3A 4UBHA 1HRI2 3C7EA 3PU3A 1OF3A 2OQ7A 3J8F1 1CVNA 5E6HA 4I02A 5IT6A 1Q8OA 1NY72 3OUIA 2HLEA 3ZXJA 2WT1A 2DVAA 5ACA3 1RUH2 1VBB2 1RUE2 3M7AA 3RSJA 1G9AA 1UXZA 2W87A 4MUVA 1JBCA 2VVFA 4AE2A 1O8SA 2LALA 2RS33 2VR4A 3IB3A 1HIXA 2CGNA 3WF0A 1UIKA 4K1ZA 3WSOA 2QJVA 1Q8SA 3VZLA 1ULPA 3THCA 4S2FA 4HK9A 4XXPA 4GH4A 3WDUA 3W59A 2XVLA 4FPYA 3VD7A 5IVCA 4LBQD 5CFCB 4C8DA 3CZJA 4B4PA 2Q1FA 4Q4X1 4LBQB 3WXPA 3BTAA 4TN7A 4Q4X2 1PGSA 2Z2SB 3MW2A 2RMU1 3TYJA 3UJOA 1A8DA 1YLLA 3W20A 3ZYIB 4M4PA 4DZGA 1A34A 2A73B 1V70A 4IDZA 2XL9A 1N1TA 5ABJB 2WSVA 4LK7A 3WNOA 2Y0OA 2Y6JA 4G3YC 2Z79A 3OGVA 5LK5A 1S0FA 5FJHA 1JUIA 3JD72 3GZUC 3KVAA 4K21A 3MPPG 1CZVA 2XKOA 1MQTB 1VBD2 1AXZA 3P5BA 3UK9A 4H55A 2XUEA 2VMIA 4IETA 1PGL2 1HB2A 1TG7A 1AL21 5SV5A 3SEPA 4LITA 2ARCA 2R1DA 1OH4A 4KMQA 3USUB 2JDUA 5FPBA 5FZCA 1WW6A 3LA7A 4MGKE 1A78A 1N3PA 3ENRA 4KBZA 4ZU7A 2VMCA 1WZXA 5F5IA 4AFAA 3SEEA 3ZFGC 4Z2WA 3Q8BA 2VMGA 3L2HA 2RDRA 3WLUA 5J96B 3OD0A 3FL7A 2WO2A 3SKVA 3CU7A 1WGPA 1MVQA 3BUCA 5F2SA 1X33A 4NN0A 3WDTA 3ES1A 1WLTA 1ALYA 1TE1B 2TBVA 1TMF3 2XHKA 3AP9A 5FZDA 1AYM3 2C26A 1G86A 2HBUA 3B93A 4Y4YA 1CAWA 5FY1A 1RUD2 2Z42A 3I54A 5EYXA 1RUJ1 3VKLA 3QBQA 4AEKA 1ZA4A 2KM2A 4RHV1 1VBD1 2B7YA 3LDKA 2QQLA 4P02B 1JOPA 3WCRA 1CAUB 1YUDA 2FQPA 2J22A 5FYBA 4QU1A 1L7RA 1X9TA 3OEBA 4LUKA 4LIVA 3VKOA 4FBFA 1RUNA 3A0NA 4M00A 1RL3A 4B7KA 4D94A 4WM7C 1CD3G 2IXHA 3PJQA 1NCQA 4JGYA 5AVAA 2R061 3ACIA 1FV2A 4DEVA 4NIHA 2VBDA 1AR83 1BEV1 4ISRA 1UYZA 4BM8A 2VZQA 4YYOA 2K9ZA 4AVVA 1QJY1 2XLAA 2OKXA 3AJZA 4Y5TA 4ASKA 3LDBA 1UMZA 2TUNA 4YVSB 2HWE2 3RS6A 5A3LA 5EPAA 4QGMA 2C6SA 4ZPIA 4I3GA 3FHIB 1JU3A 2G9FA 4Y5Z0 5J09A 3UGGA 3O0XA 3K4DA 3VL9A 5BY5A 1ND3C 2JICA 2VJXA 4K20A 2ZGNA 1C8NA 3HPNA 5G04L 4DB5A 4GULA 1E5IA 2HEVF 5KHJA 2YU2A 5FMDA 2DDUA 4SBVA 1SG3A 1W9FA 4C1WA 3WHUA 4RGAA 5T5JA 4XF9A 5C3RA 2XJUA 1RB8G 5FQ0A 4OULA 1TME1 1O4TA 1PO21 4CU6A 4O7XA 3U1XA 4B4RA 5BXXA 1BVP1 2FCTA 4BLJA 2GMMA 2JENA 2CNAA 3EBRA 4IV1B 3QACA 2I45A 1JXNA 4L9BA 4CEWA 2VZ1A 5CBLA 3CNAA 5EFUA 1C8M2 4HN0A 2RS52 3GBWA 2JE9A 4J1WA 3PNAA 5F6KA 3ES4A 2B8MA 1K42A 4AQ6A 1UU6A 2O8QA 4YLZA 3OYWA 4X8PA 2FDJA 2UWCA 2XWJB 4L99A 1W0NA 2J1EA 3WF4A 3WNPA 4J25A 3CJXA 4YW7A 4DXSA 2F6BA 4WVWA 5IAXA 1IQAA 5L9VA 1XYOA 2DVGA 4JAAA 1H2MA 1G9FA 3IKWA 1REDA 3A7QA 2WQ4A 3T2PA 3S5QA 2WLPA 3J26N 4IXLA 1SFYA 1HXS3 3WP3A 1RUD1 1ZBA2 1FMD3 3OJBA 4QHOA 1FOD1 3I2DA 4HKOA 3QH7A 5T5OA 4D0QA 2JDPA 4UFIA 1MS9A 1U5XA 3E1F1 1EUTA 1ZREA 2O8OA 1GFF2 3E6BA 3K2OA 4EN0A 3KD4A 3RWKX 3NJZA 1O3RA 1SLAA 1R081 3THTA 2RHPA 1RUC1 4QX0A 1QJX1 4YFZA 3TN92 5K8SA 5LWBA 4W6WA 5T52A 3AMQA 5KHIA 4PIZA 2P6CA 2YFZA 1VBC1 1R1A2 4I0BA 3SCFA 4FPKA 2AYHA 2ZGOA 3WQ7A 2GC1A 2WZR1 3MF6A 4MXWA 3BTYA 3CZUA 2AEZA 3AXEA 1H0BA 4Y33A 1N1YA 2VBBA 3D5OA 2XVKA 1WWYA 2XBO2 1J3QA 2LROA 2XDVA 1VMJA 4Q4Y2 3RWNA 1CIWA 3OY8B 5LBCA 2W91A 1QJEA 2WR9A 2YFUA 3J4UH 4AOCA 5ISLA 1UN1A 2P2KA 4YNIA 3P1IA 2K46A 4JGYC 4ARYA 4IE0A 4FXGB 5FZAA 5BNPA 4K40A 4B1MA 4KH9A 2PLV1 4NWVA 4ASLA 2OA2A 4BXSV 3O1MA 2R041 3AVSA 5JLVA 2R6QA 4YM0A 4MVTA 1LODA 1JU4A 5K7PA 1GZWA 4EZ4A 2XR4A 3E5XA 2IC1A 5BV6A 2UWAA 3H42B 1DQ1A 2WYSA 5JXHA 2D6KA 2BDRA 1MEC1 1AX0A 1UU5A 4PDWC 4UFJA 2JD9A 1CAVB 4IGQA 5T50A 4QKFA 2ET1A 3ZM8A 3APBA 3ZXLA 4Y1VA 1HV0A 1PVC3 1FOD3 1LR5A 3D8CA 1AVBA 1TMF1 5A6XA 3WNNA 3NVCA 2VCCA 5LBFA 4BJ0A 2PELA 1FV3A 5EQUA 3AZWA 2AR6A 3K3NA 1AR82 2P1BA 2Q1MA 3OD4A 5CU1A 3ROUA 4BDVB 5ABJC 5JZGA 5LA0A 4J1XA 1R083 3H1YA 4CEYB 1CR7A 1WCUA 1OLMA 2NQYA 3DYOA 5CA6A 4A45A 4XUNA 1CJPA 1FXZA 3M70A 3OGJA 3B5LB 3EMRA 1R64A 5AC92 2GNDA 1YCIA 3C7HA 1VB2A 3WNXA 5BUVA 4YZ5A 2WAOA 1W8NA 1JOBA 2G9GA 4IEVA 3KS7A 4XURA 3AZYA 3A4UA 1H8VA 1ND2C 2HEWF 3CEWA 2LUWA 1LHWA 1W8UA 3USSA 5JXGA 5FP4A 1AR73 4NRQA 1AL23 5FY4A 3ZKYA 2YBSA 1XSRA 4RSUA 1GNYA 3H8XA 1U5YA 1OKQA 1E5HA 3H1WA 3CLPA 2E9QA 3WR0A 1WMFA 4LMFA 1TME3 4COWA 4WVMB 3VBUC 1V6JA 2HWB1 2ZZQA 3H3LA 3VV1A 1POV3 1UF2C 3C7GA 1UY4A 1WCDJ 2ZGKA 1RUG1 3AFGA 4YGBA 2HWC2 1ZYBA 1NXD1 4AFMA 5GZGA 1RUG3 1DYOA 1J3PA 5C4WB 4P9IA 4PQ9A 1Y9QA 1BBT2 1IS5A 4I09A 4GB31 4OLLA 4Q0SA 5GLUA 4IE6A 3SH5A 5CIRA 4HETA 4B8EA 1DP0A 1E5SA 4N43C 5F1RA 1VAVA 3ZSMA 4MV2A 5FYYA 2QQJA 1W6QA 4HVOA 5LY1A 4B3NA 5FUNA 4RHV3 2UYAA 4MG2A 4LOSA 4P5YA 2QFEA 1WLCA 2B39A 2J1VA 1YHFA 4YZ4A 5DDJ3 3D82A 5IVEA 1OC1A 1OVPA 5FFOC 4HSLA 1B35C 2PFWA 2VW2A 1IPKA 4IEPA 1NE4A 4Q4V2 2WQZC 4UWDA 2IVJA 5CAZA 1HV1A 2CGPA 2PXJA 1KGYA 4GWMA 2VVEA 5JZGB 4XDOA 2ZEZA 4BQ3A 4MADA 4PF1A 4R4XA 5M0TA 3ZYGA 5DDJ1 3V64A 4E8DA 4QXBA 2W1SA 1RXGA 4NMIA 5K0UC 3AFKA 4BH9A 4PF5A 1D4VB 2ZHNA 3AKRA 2YY1A 2WZPP 4BQ4A 1LEDA 4CCCA 1COV1 1RUH3 1RHI2 2C5DA 3KF3A 3VDCA 2ZX1A 5EXOA 5IFTA 4L92A 4AQTA 2H0BA 1ZBE2 2O14A 4IEXA 1QJFA 2E51A 1KS4A 2CWSA 2UURA 4K8RB 4KWLA 4WM8A 3LE0A 3DUIA 2QQVA 4K8FA 5HV0A 2BBVA 2DUPA 2VW0A 3ZFFA 3MV01 3RNSA 1AJOA 3UKVA 5EWSA 2QQIA 2YZ4A 1SMVA 3RVHA 2PAMA 1MS1A 2WS92 4FPGA 4OUEA 4AQSA 4FAHA 5EZWA 2JG8C 4URAA 5KC6A 2Q1ZB 2IXIA 1AR81 2YB7A 4MHUA 3VD5A 5AFEA 1W6PA 4IEWA 1GBGA 4SLIA 3W5NA 2EICA 4GMP0 3IZOA 1I9RA 3HQRA 4QU2A 1ONAA 4XAEA 3VDAA 2RJLA 1NLSA 4QX5A 1WW5A 4CP9B 1HQNA 2W1UA 2JX9A 4BZ4A 4EE2A 1DGRA 4L8QA 1H1IA 2PMWB 2DVDA 2RV9A 2Y33A 2V72A 2WKKA 4FOYA 4UI9L 1R092 2ETEA 5JUVA 3K75B 1JYVA 2DYCA 3ACHA 2WNOA 4OZXA 1G9DA 3DPRA 2E32A 3OOXA 4Q0PA 4Y3OA 3DXUA 2HYXA 1RTVA 4XQWA 5E8AA 5C9AA 3GHMA 1PX3A 3JXSA 1BCXA 4AGRA 1LNSA 1OHFA 2D6OX 2IFWA 3QD6A 1PMJX 4A42A 1F4HA 5K4LA 3BKZA 3LIHA 4DFSA 3ZYRA 3FLTA 5AFBA 4HKLA 2DBIA 2A6ZA 3KV6A 5HXMA 4MGYE 5F39A 5IVBA 1I5PA 1ZZCA 2XONA 4BIFA 5HBAA 1PX4A 3WEZA 3EXUA 3NV4A 4NHXA 5L9RA 4CDWC 4KL1A 1RUF1 1LJ7A 1LU2A 4P9GA 3R6SA 2RDSA 5F3EA 4EWAA 5FDBA 1C1LA 3POGA 1DYPA 1DG6A 5L7OB 3BB6A 3UYJA 3JB8A 5FP7A 1OD5A 4A6SA 1F8VA 1QJX2 2P6HA 4KI5M 2WDBA 1RUC2 3PUHA 3TBDA 1QJU1 1T6GC 2LS6A 2MEV2 1YI7A 1LHOA 3O0WA 1XPWA 2DFBA 3FX3A 4LUMA 1W8TA 1IPSA 5FY0A 2VZRA 1WW4A 4HANA 3CIHA 2QBXA 4XIKA 3CO2A 4ZKTB 4UFHA 2YG0A 3H1MA 4NRPA 3B7MA 5EP9A 3UNPA 3R4UA 3ETQA 3VBFB 3T2QA 2Y64A 4LHNA 4W4ZA 2C9AA 2RM23 3LEGA 3EYPA 2JXAA 3ZIXA 3SXWA 4EROA 3ZO0B 1JZ6A 3ST7A 4AFBA 1MZ5A 1YJKA 4KG8A 2GNBA 3DGTA 1BLZA 3ZSLA 4OYUA 2YBKA 3UESA 4BQWA 4YW2A 5FXVA 2VZSA 4B7EA 1UWWA 2BV4A 1GZTA 2WN2A 3ZLIA 1VRH1 3ELNA 1WD4A 3LWCA 3ZFEC 2UU8A 1U12A 4YFWA 1MS4A 1SBEA 3M3QA 4YVSA 2VNOA 2D6LX 3IDEA 1UX7A 3B69A 5FCCA 3LIGA 3WNKA 1UNBA 3DKQA 1F5FA 1OVSA 2PQQA 4ATEA 2BTVC 1B35A 4M3CB 3E6DA 5C3SA 1N3QA 5FO9B 1DGWX 5KHKA 4CCEA 3K46A 1S2KA 4M3CA 2RS11 4WBBA 1S0JA 4JGZA 4LBQA 1YC61 4LHSA 3HWJA 1US2A 1RUE1 3AKSA 1CPMA 2YC2A 3ABZA 1W6OB 1W03A 1H8TA 4FTEA 4FPFA 2RS31 3I3DA 1VBD3 1O91A 1MS8A 5HXVA 5T3NA 4OI2A 1NG0A 2DUOA 2E6VA 3JB4C 4NRMA 1KDKA 3B01A 3HIFA 4JHTA 2HWE1 3SNMA 5A3PA 1J59A 3U4XA 2IXKA 5FZOA 1ASJ3 4IEOA 4FPJA 1IG0A 5A6QA 4FQ4A 3PVOA 1POQA 1LRHA 2QKDA 1OD3A 1UOJA 1LOFA 3PMEA 4X6QB 1MZ6A 3TOJA 1AYN1 3E6CC 1F4AA 2XXZA 5FBJA 2WWSA 3AMPA 2I74A 1ND3B 2Z69A 4KGQA 4KQ7A 3KGZA 4Y20B 4ES9A 4IERA 2HWB2 2EF6A 1H6XA 3N3HA 4IEUA 4XUPA 2P3JA 3A23A 3DPRC 4LE4A 4QGLA 4BISA 4JQTA 4K1YA 1NX9A 3I59A 4ATFA 4QGNA 3FLRA 5CKNA 2DU1A 1Z7S3 5JSPA 4XF0A 3I3EA 4NR1A 1LOEA 3VDDC 3H0OA 1CZSA 2OZJA 3HBZA 3N9NA 4FFIA 1ZZ8A 3NWKA 1RUI3 1W05A 5IWFA 2BRTA 5I0RA 2W5FA 1K5MC 2VTFA 2WT2A 3DV8A 4AVTA 1W9YA 3NAPA 4RGKA 3OUJA 4BB3A 2ZAAA 4CSWA 2YROA 2A71A 1H1MA 4IV1C 4EQVA 2V5YA 2VBPA 4BIOA 1C4RA 1T6BX 2GMEA 1EAH2 1WW7A 4QPGB 3O5SA 1LHVA 4EN6B 1MQTA 2EXHA 1PM7A 2WO7A 2C9KA 2A3WA 2HWF3 3AC0A 5A7QA 5LY2A 2KR2A 1AR62 3J7MA 4CDUA 3WCSA 1COV3 3JUUA 4DNYA 5HI0A 4TTGA 2DCKA 5GJ6A 1W6MB 4JRLA 3BTXA 2BP6A 3ZFFC 1MZFA 1FT9A 1W6NA 2WWUA 1S4CA 2YPJA 1XSQA 5SV8A 5FREA 1UU4A 1M4WA 1X82A 2JB4A 4IESA 3SH3A 3IIIA 1DGLA 5FZ7A 3B94A 5HCHA 1PM4A 2PN5A 3U37A 1URXA 1MVEA 1VBE2 3O0VA 1QXJA 1QJY3 4IEYA 4QXHA 5K0UA 4DOUA 2BQPA 4EN8B 2P3IA 2X53S 5C5UA 1BEV3 1EY2A 2XWBB 4HBNA 2QTWB 3OCPA 5D8AA 3WW4A 3A0KA 4R9BA 5FMOL 2BERA 3RFRA 3SKJE 4WVMA 1APNA 2BUKA 2OYZA 3OYWB 5IVFA 2VL4A 5BNNB 4Z2AA 3WDWA 1YO8A 2VXRA 1OA3A 3LEMA 1JHNA 4H7LA 4IV3A 1WMDA 2E33A 2RDNA 3LEKA 1I3HA 3POWA 3ZSJA 1QNWA 3WUCA 5JCTA 2QDNA 2CV6A 2Q0AA 1DCSA 4QD2A 4AEMA 1IHMA 3VDDB 1H8TB 3ZVXA 2VZUA 2ZPXA 5LBEA 5FLHA 1VBC2 2LRPA 2LW8A 2ZEYA 4HFSA 3TNQA 1MS5A 4MXVA 1VIWB 2MEV1 3OGSA 3SISA 2ZEXA 2CDPA 2R0HA 1H9WA 2ZHKA 4XABA 3ZXDA 1Z0HA 4QQOA 1S0EA 2AGSA 1YXWA 1QKQA 2D98A 5CYYA 1GQHA 1OOPA 1DBNA 4QPIC 3P3PA 1BBT3 1ZZ9A 1JYCA 1KS5A 2W94A 3AKTA 3LSDA 2V5DA 5DXDA 1AX1A 1ZRRA 2RVAA 3AYCA 2WYFA 5D1IA 5FLIA 1RUE3 5IW0A 2VNRA 4AHXA 1RUF3 1GZ9A 3I2FA 2GH2A 2WL1A 1YRZA 1ULDA 1AHSA 2FBEA 4NJ4A 5LRSA 1GWMA 2OUJA 3E5QA 1HQWA 4JKKA 3KM5A 3KSCA 4AVSA 3KHCA 5LEJA 5C4WC 2LTNA 1UL9A 3EO6A 3VD3A 1SBFA 4D7SA 1LTEA 2WFF1 4QX2A 1WBFA 2D6NA 2H6BA 2IUWA 4R8HA 3WG3A 2GDFA 3ZXGA 2JG9B 1AR93 2PAEA 4PT6A 1CAUA 3OB8A 1J83A 3QLQA 1W39A 4N9IA 4DIQA 4L97A 3I49A 3SLIA 3J7LA 1SLIA 4WZCA 2Y6KA 3UV9A 5C6CA 5DAPA 1E5RA 5A3WA 3AMMA 1PO12 4NOTA 4OHZA 2VPVA 4AQ2A 2FDIA 4NHMA 3I2HA 4LOTA 4XDPA 1FAYA 3OY8A 1QJU3 2HKXA 4CXYA 2QDRA 4AF9A 4Y1YA 4WV8A 3URFA 1ND2B 1GR3A 4CPBA 2WLQA 2VTXA 5IHRA 2HWB3 3B3QE 2AZ5A 1DZQA 1X8MA 4OI4A 3OBTA 2FDFA 4S2DA 4AEJA 4Z8BA 1ND3A 2WZR3 5H9PA 1DQ4A 5FYMA 1ZBE3 4UF0A 5FZ9A 4UW5A 3DL3A 3GF6A 4EN7B 5A3TA 1GQPA 4YZ3A 3UKNA 2UWBA 2RMU3 4A7YA 2JKBA 1D2QA 1UW8A 4ASMB 1IOAA 4FOWA 5K0UB 4AG4A 1PO23 1ZM1A 3IPVB 4UW3A 1SQ4A 4XMAA 1LOGA 1QDOA 4YWAA 4DY5A 1TNFA 3VBHC 1NCQC 3MW4A 1G7YA 4AGVA 3Q9OA 4RD7A 5KXBA 1ST8A 3VBHA 4LA2A 4IE5A 4JKMA 5JR2A 1MS3A 1JI6A 1UZ0A 1VRH2 2NM1A 5IYYA 4XEZA 4XOGA 5DUUA 1KDMA 2ZJCA 5L7OA 3VZKA 4LLOA 1OQEA 5DUVA 2E63A 4M4RA 1COV2 2QCSB 3SC7X 4CDUB 2Q8DA 1WD3A 3W21A 3I7DA 2ZGQA 3MUY1 3KV9A 4JTNA 2LM3A 3I3MA 2UY8A 1SPPB 2VUJA 3FN9A 4XF3A 2YU1A 2P3YA 1BHGA 2R071 4BE3A 1UZZA 2ZGPA 3MFCA 4Q4W1 3WQ1A 5DMYA 3RJRA 2G9ZA 4XFBA 3JBG2 2ZAHA 2ARAA 1LGNA 2CAVA 2HWD1 2A70A 3HQXA 3NL1A 2YBPA 2RJ2A 2QVSB 4IV1A 3POIA 4XILA 3WP6A 3IT8A 2QZ3A 1JTZX 4NE9A 4HVRA 2W68A 2ILMA 4FO9A 1HJFA 4XIOA 1OI6A 1OQ1A 3FFQA 3N4MA 4O9EA 4AI1A 3CJIC 5FZGA 3MIDA 4LORA 4XQDA 5T5PA 1DQ5A 3ZSEA 1Q8QA 2CHHA 3T2TA 5ACA2 2WJSA 4K9SA 4UXAA 1QGLA 4HZFA 4YSFA 2YUEA 3VB9A 2FDKA 3KHBA 2X5IB 5C5TA 5FZ0A 1SACA 3WINE 3IAQA 4N53A 5EJZB 4M01A 3T2OA 1VALA 2EIBA 2NZ9A 3LCPA 3I2IA 3RJ2X 4CPBD 3ZFGB 5JI7A 4MSVA 1JOJA 4XHXA 2JDMA 3CMGA 1W3VA 1NE6A 3I2KA 4NAMA 1FPN3 4QX8A 2VUAA 5FV3A 4Q0VA 2ZOEB 1ULFA 3M2MA 3VZOA 4CDWB 1CONA 5FP9A 3T0BA 3ZN5A 1XQNA 3FE5A 4FOVA 4KWUA 3ZDSA 2KA3A 3BODA 4Q4W2 4ES8A 5KC5A 3KVBA 3VLBB 3NRUA 5GLWA 4CRQA 5A3OA 3B00A 1W28A 2BNMA 5DZFA 1NA1C 3G6JB 3MGUA 4P9WA 4Y5SA 4CEYA 5FP3A 2CU5A 5J37A 2BWCA 1I1EA 3H8OA 1HB3A 1YIFA 4XCBA 1DQ0A 5DABA 4Q8KA 5F3CA 4YW6A 4AFCA 3WF1A 4JGZC 3NJVA 3MIEA 2ZABA 3MIGA 3VZJA 3ZYHA 3I2GA 1GQGA 5J36A 2JEMA 2G19A 1YWKA 2PHXA 2WNVC 3HT2A 4FPHA 3WP4A 4CCNA 1L7LA 3LPGA 1QHDA 3IPVA 3WNLA 4C1XA 1RUH1 2PHRA 3H50A 3NNFA 4QM8A 3S7EA 4CCLA 2WS93 1W8HA 1XNAA 4YVSC 2B9UA 3DN7A 3IDBB 3AXDA 3BU0A 1TQ5A 3HEIA 4ZZ5A 2W92A 2RR12 3WVJA 5A1FA 4W50A 3HBKA 2XJQA 4IE4A 5DN2A 1OF4A 4XJZA 1PO13 4NPMA 4UOJA 2HWE3 3BU7A 2R063 1W3XA 1XYNA 2ZHLA 4RR3C 4WM7A 1NQJA 1TMF2 3ZFEB 5BNPB 3A22A 1KEXA 4AZZA 2D97A 4PBOA 2E31A 3IBMA 1JN2P 3CJIB 2BGPA 4EWEA 1SHWB 3HOBA 2VZOA 5ANQA 3AVRA 3KWVA 4JQRA 5JOZA 1QQP3 2DCTA 3FHQA 1RINA 3MO4A 4JCKA 4PBPA 4YM2A 2WUHA 5DAWA 4FCAA 2P34A 2WO1A 1XRUA 4COYA 4ZONA 4CCMA 3O1SA 3AYDA 3MZHA 3RZZA 3A21A 5FUIA 3VD4A 2JE7A 1QDCA 3GGLA 4QB2A 1DZTA 3KCYA 4Q2FA 4URTA 3TEXA 4BQYA 4EZHA 2WIIB 1Z78A 1UZWA 2JB8A 2XG3A 4CUBA 4OZOA 2XBO1 1BK1A 1MR5A 2PLV2 1LAJA 4TXWA 3LA3A 4QX7A 1NT0A 5FOJB 3AL5A 4JDOA 1ENXA 1OLRA 1OOPB 2EAAA 4CU8A 4FPOB 4QMAA 4WVVA 5FZ3A 4YZ1A 3VZMA 3S5AA 3K4AA 2DUQA 4UFLA 2JDHA 4AHWA 1VR3A 4C0HA 4Z1VA 2PHFA 3O14A 2MHFA 1OLQA 3ZMOA 2XB6C 4FPLA 4YVWB 4TLGA 4XAAA 4XJUA 4KG0A 2NLRA 2TEPA 3NV3A 5BNOA 1UOFA 3Q8AA 3RG0A 3WNMA 3CBNA 4R4ZA 4Z07A 5A7OA 5J7MA 3P3NA 2JIJA 1FOD2 3NSTA 4Q29A 4A2UA 1LHUA 2HWD2 4AI3A 4TYSA 4CYDA 5E88A 2OIIA 4CU7A 4BU2A 1H2KA 3NNGA 2QQPA 4WZFA 3H9AA 1XB9A 3T0DA 3C3VA 3D0SA 1R082 3NQHA 2WFPA 3IIAA 1RVF3 4NO4A 3CHXA 1WLWA 4PDWB 5FUPA 4AYUA 2GNMA 2YGMA 5CFDB 4WM7B 1Y9MA 2VZVA 4ORFA 4P14A 2RS53 5A70A 2ZCWA 3B02A 4QB1A 4L2NA 3RI8A 3T08A 1C5IA 4CEWB 3JBG1 4HKWA 2VOTA 1N47A 4HMZA 4JTOA 1TZOA 2VCAA 1G9BA 1PK6B 1R1A3 1QQP1 1C8M1 4ZS2A 3LOIA 2FDGA 2XLFA 1JS9A 2VE1A 1JZ2A 3KT4A 3U14A 4NHLA 5FKBA 5JR7B 2W47A 3ZN6A 1VAMA 4Q0QA 1SPPA 5CADA 3C8XA 3HR9A 4HOOA 2CAUA 4OMDA 2DCYA 1NXMA 2P4EA 4H3WA 1DQ6A 1BYHA 3GCWA 3KV5A 1VLNA 3F2ZA 2D43A 4AEDA 5CG8A 3EJKA 2ZMLA 3WG4A 1QOSA 1O3SA 2OT7A 2NP0A 3SH4A 1W2UA 3FUOA 3OBAA 4BQXA 3WW1A 5FZKA 2QQWA 3AZVA 4PQQA 1VE0A 4AVBA 2B45X 1DIWA 4CTEA 3MHZA 4LKDA 3V0BA 1Y4WA 4UYBA 3BI3A 5APAA 3VBRA 4KWKA 4O9GA 2ZBJA 2GU9A 3IDCB 5C70A 2R1BA 2HWF1 2R042 3DKWA 4GIQA 1QXRA 2VVDA 4Y24A 4FAGA 1QH6A 2X09A 2WNUC 2VQAA 1OUXA 1HJGA 2HWC1 4HT1T 2D5FA 4HL0A 3K77A 1W06A 4NROA 3KF5A 3WDYA 4AEDC 3GZTB 2V4AA 1LULA 1FATA 1HDKA 4QM9A 3NJXA 3NNLA 4YZ2A 4H14A 4UW6A 4XF1A 2Y0IA 5T5LA 4HXCA 1CGPA 4ZZ8A 3U0ZA 3C2UA 4CDXC 1AYM2 1JW6A 3HN3A 1V6IA 2R073 5FPAA 5ANNA 4Z82A 5BNOB 1SLLA 1GUIA 4JHZA 3SCGA 2WFF2 4LO7A 4NIIA 2J42A 1XE8A 2DVBA 2R0FA 2D44A 5JDBA 2A3XA 3BVCA 2ZHMA 4DXTA 4E2QA 3AYAA 4LPLA 4NVPA 1PMIA 1W6MA 2VM9A 4LHLA 5FMOS 4R52A 4FP2A 1TEIA 1WCKA 1XJAA 5FYTA 1WCQA 2VCMA 4ITCA 3VBSC 2J1AA 3U10A 1BVVA 4FFGA 5FZFA 1CAXA 1W2NA 5KBFA 3VBUA 4KBBA 3S57A 2ARXA 4RQPC 4N43B 4LXLA 4Y1ZA 5A3MA 1WBLA 2XH6A 1X36A 4QAWA 1EAH3 4CCJA 4E4ZA 3NAPB 1HRI3 1VAKA 1PIV3 3ECQA 5AC93 5A7WB 1O59A 2B4KA 1GOGA 2GN7A 2EALA 4FFHA 3V56A 5FZ6A 1R1ZA 2WABA 1ZRDA 1XU1A 3MBWA 4XDQA 1UXXX 3WF2A 1MEC2 5LA1A 2ZEWA 3O12A 1ENQA 2YGLA 5JIAA 1EPZA 1RMU2 1SCSA 5JMCA 1AL22 3I3QA 1AYN3 3ZN6B 3RZMA 4QWNA 2VG9A 3LSEA 4L0PA 5FZIA 4CDQA 5CKQA 2AUYA 3AX4A 4XHBA 2ERFA 3C7FA 2E7AA 5JZGC 3I3BA 1PIV1 4YG3A 1X50A 2IXJA 1OFNA 3S6PA 4CP0A 4QPIB 2VMFA 2FCVA 1XE0A 4QKDA 1Q5OA 2FCUA 4XJAA 3ZYBA 2XJPA 2BNNA 1EUUA 3MF9A 5FYSA 1FI2A 3EB7A 1LGCA 4PDWA 2PQSA 5A7NA 4N53B 1EV12 3PTRB 4U2AA 5LW9A 1N1VA 3ON7A 3MV11 1PNFA 3LAGA 4YRDA 1IPJA 1XNBA 3UKTA 5IK7A 3GHNA 1J1LA 1VBA3 2JG9A 2ZS6B 2VOWA 1UPIA 1WUVA 5J98B 1GOHA 4LBJA 5FY5A 3TN91 4GMP1 4AVAA 2D3PA 1BK0A 2XJVA 3BALA 4YM3A 2GH8A 1FNZA 1RC6A 2PHWA 1X7NA 1VBB1 2PHTA 2VCBA 3LF7A 4Q4V3 1FMD2 1VBC3 3TWIA 2JD4A 4XUTA 3TB0A 4D6RA 3S30A 1DLCA 5FZLA 4YW3A 1D4M3 3POYA 2DCZA 5GZFA 3ALQA 4XQ4A 1EAH1 1U0AA 3B9IA 1QNYA 3J9SA 3U78A 5LA2A 2E26A 4LKSA 1J58A 2WC2A 3L9JT 3ACFA 4XZUG 4CU9A 2EVXA 2X29A 5C71A 2RM22 3LGRA 2ID4A 4XJWA 3RYRA 4F8AA 1HRV1 2BBAA 2F4PA 4LBKA 2A5ZA 2WNVA 4PI0A 5FYIA 3NJYA 1W8ZA 1L3JA 1RUF2 2EXKA 3WQ0A 5FMCA 5IVJA 3RMYA 4LBMA 4XFFA 5FZBA 1N3OA 3D4KA 2MPFA 1KXGA 1QWRA 2XBO3 2SBAA 4ET7A 1N1SA 2IWGB 3WUDA 4MH0E 4CEYC 2VD7A 1GV9A 4Y1UA 3WZ1A 3BIWE 5BPXA 3VBHB 3K48A 4FTSA 1T2XA 1CIYA 1SFNA 1XNDA 3ETPA 4MLOA 1HQLA 4N43A 4QXCA 2XJTA 3OGGA 4BHPA 5C7GA 1H4HA 2XJRA 4N9HA 3V0AB 5BYNA 3MPBA 3M3IA 4LULA 4DRVA 5CFCA 1VB4A 1W9TA 5LB6A 1AUYA 1QIQA 2XL7A 3QH6A 4NIAA 3MIBA 4OCTA 3T1LA 4NHKA 4DMIA 5KWRA 4ZHNA 1QXPA 3KV4A 5CZKA 5ACA1 5F2WA 4K7JA 3QOPA 2AENA 4LKFA 3ME2A 1EP0A 5GZEA 4A7KA 2RE9A 4AR2A 2F4LA 1S2BA 4N53C 2D93A 4YG6A 4MGTA 3AP6A 5GLTA 4XZPA 3KZ4C 4CDQB 4E4HA 4IUGA 2OQ6A 3LFMA 5FO8B 3N36A 5DUWA 2GNTA 2DBNA 2Y6FA 4LE3A 1I5ZA 1HN0A 4KU8A 2XQXA 3SMHA 4QPIA 2GMPA 4BMEA 1RXFA 1UY0A 2OUHA 5EJ1B 2W2IA 5FPLA 5L36A 5LEKA 2ZACA 1WKYA 2G1MA 1OURA 4IE7A 1BXHA 2CDOA 2BGOA 2JE8A 1WLDA 3J7HA 1GYKA 1W8FA 1GANA 4PLMA 4JGZB 4HONA 1F15A 1VRBA 4XJ8A 4I2OA 1RYYA 3N9PA 5KXCA 2W3JA 5JOWA 4XF4A 3TEWA 4IEZA 5FP8A 1HRV3 5FPZA 2WNVB 3ZYJB 3ZOIA 2PHUA 3D3AA 4YW1A 1CN1A 1I6XA 1G8WA 1PIV2 1SCRA 1UYPA 1W2TA 4LO5B 4BQ5A 1HB4A 2PA7A 4C91A 5JIUA 5FZ4A 3VN4A 2OS2A 1LB2A 3WX5A 2YYOA 4QQ2A 5FPXA 3WT3A 1JYNA 4Y4RA 1YFUA 1KD7A 3FC0A 5CG9A 2ZKLA 1RMU3 4CP9A 2WNUB 1KFUL 2VW1A 3GNEA 1PVC2 3NMBA 5FY9A 2WAAA 4I01A 5GM0A 1HB1A 3KLSA 1JHJA 3FJSA 2B46X 2X10A 3DPRB 3ZYFA 2EIDA 4LEJA 4M0NA 1NLQA 4OHVA 3W58A 1MZEA 4MGIE 1W2OA 3GBGA 1KRIA 4OHWA 4P9YA 2Q8OA 4EJRA 1GSLA 1PVXA 3KQ4B 2WA4A 3SHRA 2OZ6A 1QEXA 4S2GA 2XLGA 4HPKB 5ERLA 1S0BA 2ADEA 3UETA 1RUJ3 4DUVA 1ENRA 2D40A 3AP4A 3PVNA 1W2AX 4P5HA 3IAPA 3ZDVA 1SFPA 4IV3B 2ZX3A 3POEA 1U5IA 3NKTA 4QPYA 4QXKA 1V9U3 4R9DA 3Q8FA 4UFMA 4YGEA 3VBRB 1W6PB 1VBA2 2FMDA 4XTMA 1J84A 2FZ1A 4A41A 3MW3A 1QY4A 2HWD3 3N7LA 1HXS2 4ONUA 4RQPB 5E1RA 1SLCA 4LO4B 1W0PA 1ZBA3 2P37A 4FQZA 2D6PA 1NUKA 4O65A 4QX1A 3N9LA 5D8AB 4V1PA 2HWC3 1BZWA 2X05A 4A7ZA 4CUGA 1BMV2 1RUG2 3NAPC 1BKZA 1EPWA 1UO9A 1UPSA 4JZRA 5FLJA 3N9OA 4Y22A 1RVF2 4OUSA 3PVEA 3VKFC 4DXZA 3MFAA 4E2GA 2ZKNA 1OSGA 2QUOA 2UYBA 1YIPA 5DAVA 3TN93 4EV0A 2Y8KA 2ZTNA 2VQ0A 2GN3A 2YPDA 3AMNA 4N7UA 4MGSA 4FPEA 4QKNA 1REEA 5FXWA 4CUCA 5FWJA 3PLQA 4BA6A 5IVVA 1HX6A 4GJZA 4A3ZA 5C8WA 2XJSA 4ZS3A 2DF7A 3OPZA 4GB33 4BXFA 1GMMA 1NY71 5DQ0A 4Q8LA 1UMHA 5FTTC 4CE8A 2Y34A 1ULEA 3DYPA 1C28A 4LO6B 4MZUA 1LOFC 4QQLA 4HVQA 1STMA 1SLBA 1PZ7A 1UKRA 1OPOA 1NCRC 5FZEA 2VMDA 4ZY9A 5FYHA 1ASJ1 1ZNPA 1GWKA 2QQUA 4KGGA 4Q4X3 5KXDA 2R49A 2D5HA 2GALA 3OBZA 3ZIWA 4E2SA 3BGAA 1OOPC 2A7AA 4M3CE 5FXZA 3THDA 4OUMA 1C57A 2OPKA 4XUOA 4GH4C 3DXTA 1RUI1 5JXIA 4MGZE 3V0AA 1UCXA 2QQOA 4M3CF 1RHI3 4D6SA 4ZXEA 2Y26A 1H8TC 1Q3EA 1RHI1 4QKBA 2WS91 3DYMA 4MGQA 4OI1A 4E8CA 2BNOA 3K4ZA 5A7SA 1PZ9A 3WOGA 3BTZA 3SQOA 3AZZA 1ZZ7A 3RDIA 3I59B 5EHDA 4D7YA 5JXJA 5I91A 1JZ3A 4CCKA 2FZ2A 1KITA 1WA4A 3J8F3 1SDWA 4ZU5A 1W8OA 3JCIA 3RGBA 3VKMA 2FD8A 1ACCA 2CTVA 5EV7A 4LBLA 5LATA 4IV3C 5JSOA 4XACA 1K12A 4V2VA 3ZXFA 2GP3A 4AVCA 5A33B 2WNUA 4KNCA 5BNNC 4B4QA 2Z5WA 5I8SA 1O6UA 1XNTA 5FZOB 2I07B 2ZGTA 5LCWL 5D8AC 3ASIA 1S0CA 5DDJ2 2W95A 4UAPA 4JKLA 3QCWA 3T1MA 4Q4Y1 2XPJA 1PNGA 5A7PA 1AXKA 1PK6C 3H3ZA 3LZZA 3X29B 2TNFA 2Y60A 5FYCA 2WFF3 1NZCA 1VBB3 4Q4V1 2D6MA 2XQRA 3UJQA 3N35A 1OXCA 4GJYA 1H30A 4GZ9A 1S55A 4A3XA 2BOIA 5I93A 3OUHA 1R1A1 1OA4A 2AEYA 1VMFA 4RYDA 1H2LA 4META 1WCSA 5IK4A 1YQCA 2X5IA 2DTYA 3BOPA 4Y26A 5F5QA 1UYXA 4RGGA 4CZSA 3HNYM 4RL7A 2XKPA 5C3OA 1FPN1 1MQTC 3OEAA 2ET7A 4Q27A 1XNCA 1ENSA 3PU8A 3MLJA 5F3GA 2VH9A 2NMNA 3VL8A 1BEV2 2XUMA 1BBT1 1O4YA 1LHNA 3I2OA 3R4DB 3ZFGA 1MPXA 4I0WB 1M06G 3IDAA 1JODA 4M0HA 4FXKB 3RQ0A 2XVGA 4D8MA 5HPOA 5J1XA 1LCLA 3MYXA 3RRDA 3W9AA 5JOXA 4NUBA 2QQMA 4PHZA 1JUHA 4IGOA 4NAOA 2JDZA 4CXXA 1J3RA 1XNKA 3VBOB 1MS0A 3AKQA 3JD73 1MEC3 2IVIB 4FP3A 4RHV2 4HN1A 4G9SB 1UY2A 4J6GA 2ZMKA 4YM1A 3H8UA 2WO3A 4P00B 2HEYF 4OHXA 2ZGRA 5IFPA 1Y3TA 5FJKA 1JZ7A 3SCHA 2EXJA 3RI9A 2AH2A 1AJKA 2ZGLA 1ODNA 1XBFA 1LENA 1FMD1 3T0AA 4N8MA 2QQNA 1HLCA 3NKGA 4EN9B 1SDDB 4XXAA 2ORZA 5CB7A 5H9QA 3HAGA 2GZWA 3H3UA 2R16A 1JZ4A 3U4SA 4R9CA 4CDXB 2C4XA 3PL0A 5BNOC 3MDPA 3THPA 2E7TA 1DFQA 1Y43B 2WZEA 3S7IA 1POV0 2W1QA 1EV13 3VKNA 3HD8B 3VBSA 3VHNA 2E7QA 5JPNB 2Q4SA 1UOBA 1EV11 5F9TA 1FYUA 1RUD3 1UOGA 4QDQA 1G6NA 1IG3A 4UBGA 2HH9A 5F8PA 1DDLA 3G7DA 3M8LA 2FDHA 2BVBA 5EIYB 3CQOA 1UZVA 2BYVE 2YC0A 5FRAA 1DQ2A 4Q26A 4OI0A 2Z4FA 4XJ9A 2B42B 4RFRB 1YJLA 4NPLA 3CDZB 4ARXA 2CGOA 3PUSA 4Q4Y3 3LEIA 1GKBA 5DZEA 4AW7A 2VUDA 5KHGA 1GZCA 3OGRA 1VPHA 3MLLA 4CDXA 5B2GB 2BEOA 4XFHA 3GBFA 1S0GA 1AR91 5JWPA 1V6OA 4UW4A 3LA2A 3OPWA 5DPNA 3ZPYA 1RITA 4S2HA 1BMV1 4CXWA 4H7MA 3MI8A 4G4FA 4RS5A 5FYVA 4OQ8A 3LPFA 1ZVFA 4LHKA 4PLOA 1CQ9A 1KQRA 1O8PA 3VHOA 4AI0A 5CVRA 3DECA 1OA2A 1ZZ6A 1EYBA 2JKXA 3LKJA 4F83A 2YV8A 2J1TA 5E89A 1JYXA 2MNGA 3KCCA 3I8TA 1RUOA 3AP7A 2GC3A 5I0UA 3ZR5A 4AL9A 2ZXQA 3VDBA 1F31A 3ILRA 3R0RA 1AR61 4DXRA 5C3QA 5J48A 1UYYA 3J8F2 3S0MA 1BJQA 4QHZA 5GALA 4COUA 2OW4A 1PMHX 3ATGA 3AJYA 3GXUA 5FZ1A 1S1AA 4BK5A 1ZBA1 2JWPA 5CNAA 4D69A 5JPMB 1H2NA 1Q8PA 2MEV3 2GP5A 1Y7BA 2WINB 4BK4A 1UQXA 4RS5C 3WV6A 1HN1A 2AACA 3TNPB 1V9U1 4NIDA 4PIXA 5B4NA 3NV1A 2R32A 5T54A 5GLVA 4JGYB 1PVC1 4AHYA 1VRH3 1E57A 3HNMA 4DUXA 1OT5A 2W39A 2JECA 5HV4A 3I2JA 3FBYA 2DURA 2QZ2A 4XMIA 1Z7S2 4P08A 1XOYA 2CWMA 4DY3A 5FPUA 4MOAA 3P6BA 5I0DA 2WQ8A 1PGL1 4PIYA 2A1XA 4X6RB 3T09A 1V6LA 3Q8CA 2WNEA 3FFZA 3W5MA 3VBOA 4LR4A 1JH5A 1H4GA 1GU3A 4BPZA 1KFXL 2HBTA 4UF0B 2ARBA 3K51A 2VOVA 3MUZ1 3NNMA 2ZGSA 4K6BA 4FFFA 5FWEA 1TME2 5T55A 4YGCA 3RMXA 5I8TA
chains in the Genus database with same CATH topology
3IMNA 1NCRA 4AFDA 2A75A 2D7FA 1LGBA 2GSYA 4JVAA 5CFDA 4QT6A 1D4M1 1NA1B 4XPVA 5C9AC 1NQDA 2VULA 4Z92B 4GQ7A 3USUA 1ND2A 2RS32 2BPA2 1AR72 2P17A 4TWTA 1DGWA 2SLIA 4ZU4A 5FQ0B 1Q56A 4QQHA 3AM2A 2ZGUA 3BOWA 2D3RA 1LESA 5C8CB 3JQWA 3WDXA 1HRI1 4YGDA 1VBE3 5ABJA 4AGGA 2BW8A 3PHMA 4I30A 4MXWB 2ATFA 1NOVA 2BWAA 3VHPA 3KT1A 3I4IA 4RA0A 4KU7A 3N7MA 1QU0A 1GNHA 3ZYPA 3V65A 3M3CA 1D4M2 4RR3B 3VHRA 3V0BB 2I2SA 2JG8A 5F6LB 1QMJA 3AKPA 1IS4A 1YYNA 2DTWA 1IKPA 4JC1A 3H7YA 2R062 1TNRA 2ZX0A 4HK8A 2QNKA 3INAA 1UD1A 1WMEA 2PHLA 4WM8C 3IN9A 3KQRA 2R30A 2VECA 1V9U2 4FSJA 3VBFC 1S0DA 4XFAA 4U36A 1PK6A 5EYYA 2RS13 3ILFA 4RR3A 5DZGA 4FVVA 2X8KA 1F2NA 5DG2A 3HMYA 2PYTA 1GLHA 1O5LA 5FOBB 3PMSA 4QHBA 4LTAA 1O5UA 4BYYA 4CP1A 1RJ7A 2Q5TA 1QJU2 2A3YA 2DV9A 3WHTA 5KHHA 2CY6A 1QH7A 4AI2A 2EA7A 4YVWC 1C3HA 1GICA 2FHRA 2P3KA 3EHKA 3H7JA 2EIGA 1MACA 4K3UA 4GB32 3B9CA 4XTPA 2RMU2 4OFGA 1A3KA 1CX4A 5C33A 5JSRA 1OQDA 1VJ2A 4JRAA 1NA1A 1LOAA 1W6OA 4W6XA 3ZN4A 1FX5A 1AR92 2HJIA 1RJ8A 2HYKA 4YG0A 1POV1 2O1QA 4D7TA 3E97A 1B35B 1DF0A 1DHKB 2JG8B 3MLKA 1NLRA 3WW2A 1W6NB 3MEPA 2HWF2 5GZCA 1AR63 4COZA 3VZNA 1CAVA 1HKDA 1VP6A 2Y38A 3FWEA 5FBZA 1H9PA 4PCRA 2DVFA 1R093 2NN8A 2ZGMA 5L19A 4DINB 3FBMA 1OFSA 1UZYA 3D6EA 4LLFA 2BFUS 1GZWB 2RR11 1RUC3 2XGXA 5IK8A 4MX3A 5JVVA 4GH4B 3CJIA 2YDEA 1D2SA 4Y1XA 4Q1PA 2A6XA 1QJZA 3FLPA 3VGIA 3POSA 4XYXA 1C8M3 1PHMA 3BPZA 3NO8A 4XFCA 5EJ3A 5HCFA 5KXEA 1IGOA 4YVWA 1PZ8A 2BGCA 4BOWA 3IM0A 5A32B 2VMHA 3R05A 1REFA 3M3EA 3WG1A 3KMHA 4R9AA 4OHYA 1CJDA 3ZXAC 3WW3A 2GAUA 2YHJA 2W0XA 3FUQA 3VUOA 3ILNA 1IZ3A 1NCRB 1DYKA 5L7OC 4RS5B 3KCXA 1QOTA 4HLTA 3BCWA 1J1TA 5LK7B 4N90A 5BNPC 4Q0UA 1BQPA 4MYEA 1IKQA 1DZRA 2B5HA 1G9CA 5DG1A 1O4ZA 1H1AA 1RGSA 3N7KA 5LRRA 3RYPA 2G4IA 4E4SA 4AHZA 4XBNA 4LNVA 1JYIA 4IQPA 1YNAA 2K0GA 4PJYA 1A8MA 1IS3A 2GC2A 2NPIA 1R091 4LA3A 5AVPA 4BWOA 3E6CC 2ENRA 4AWDA 4F3JA 2WSUA 4E9KA 2VGDA 4E27A 2W52A 3JU9A 4NPRA 3VBSB 2ES3A 4N7IA 3TRSB 1XXNA 2DFCA 4JDMA 4PLNA 1LEMA 2NMOA 2R043 5A32A 1ZRFA 2RS12 4YW5A 3LB9A 1LU1A 1KJRA 1LKNA 1K5MA 1PGW1 3NW4A 3WY6A 3EQEA 4XW3A 3TAYA 2VU9A 4KWJA 1QF3A 2CL2A 2DCJA 1V00A 2FMYA 2OVUA 3D0JA 3M3OA 4HSJA 3AP5A 3OF1A 5C4WA 3DF0A 1ZBE1 5H9SA 5JAXA 5I8YA 4Y20A 4X8NA 3AZXA 4YARA 2V73A 2VOXA 1X8EA 1RMU1 1YFXA 3IWZA 1QJX3 4QQPA 3E5UA 1ASJ2 5CFDC 1DGRN 4GKYA 1PO22 2H6CA 3LOBA 3HT1A 4P9LA 3ZXEA 4CEWC 5CFCC 1F9KA 1ULCA 2PLV3 3FMGA 2ZZJA 4E4DX 1QOOA 5HCAA 3M1HA 5GZDA 1D0HA 3VBOC 4XBQA 3U11A 4WM8B 5A33A 2EAKA 1DU3D 4IEQA 4TLFA 1AZDA 1SBDA 4Y22B 5JI9A 4XE9A 4AEDB 4COVA 1A6CA 3GZAA 2H0VA 1CPNA 2C1FA 4LT5A 1RVF1 4BLIA 1PO11 1XU2A 3PTYA 2UY9A 3MIHA 4CP2A 3AK0A 3JBG3 1YFWA 1YFYA 5I0TA 1AYM1 2A6VA 1SLTA 1K5MB 3RYKA 1NYWA 2GC0A 5GKAC 3CF6E 2VNGA 3KT7A 1VBA1 1CAXB 1FPN2 2BVVA 3ZFEA 2ZA9A 3WDVA 2DWRA 4OVEA 3KGLA 4AXOA 3KB5A 4Q4W3 4QPGC 1B09A 4W6YA 3FZ3A 1HXS1 1XE7A 3VBFA 1O3TA 2JG9C 4INDA 3ZXKA 5FO7B 1ULGA 1ZRCA 1W6QB 3WP5A 3ZSKA 3ZFFB 2A6WA 4P9XA 1UAIA 3NV2A 4WVZA 2ZX4A 4LO8A 2E53A 1YI9A 5AC91 1LECA 2K2SA 2IXLA 2PHDA 4CDUC 2WT0A 4D3WA 5J3UA 1OPMA 3AYEA 2N7GA 1O7FA 3JZVA 3ZMNA 3ZX7A 4BMBA 2AREA 5H9RA 4DQAA 4LBNA 3VBUB 3CL1A 2NYYA 1GNZA 1V6MA 2EXIA 2O0OA 4RFT0 4P9JA 3ACLA 4C0BA 2YMZA 5DUXA 2DU0A 5FAXA 2RJKA 3GYDA 4NWWA 4JV4A 4FTBA 3JD71 1LOBA 4CDQC 4CDWA 1DLLA 2PTMA 1C5HA 4FT8A 3AB0A 2W08A 4GWNA 4DS0A 4GALA 3VDDA 4TZDA 1V6NA 5L73A 2BFUL 1AL0G 1NCQB 3RPQA 1OMIA 1PGW2 1RIRA 1QQP2 2A6YA 4DPNA 1RUI2 5TSWA 4F7ZA 2RS51 4Q1RA 2WA3A 3O7OA 1C1FA 3OTFA 5C9AB 1VBE1 3AMHA 4BCUA 5I0SA 1FNYA 3L2YA 5JOYA 5IUQA 1AF9A 4FOQA 4RQPA 2RR13 4ZXKA 1CESA 1U5ZA 5K9YA 4GMP3 1ZX5A 1Q8VA 1S0IA 1LOCA 3OBRA 3MIFA 5GLZA 4XETA 1UIJA 4BQ1A 2QE3A 3U07A 1AXYA 4GXLA 4C90A 2WZR2 1O3QA 4EWDA 1AR71 4HPKA 2IXCA 4IL7A 4DRRA 4I3PA 2YXSA 3HN1A 1V6KA 3R4SA 4TSVA 3PJYA 1D0GA 3SITA 4L11A 3WG2A 2D3SA 1KJLA 2VY0A 3JQXA 1QJY2 4YW4A 2Q30A 4AI8A 3PVBB 2KXLA 4JDNA 5IK5A 2X5IC 3M4FA 2ZMNA 1SEFA 2IZWA 3UL2A 2JJ6A 4XFGA 2R072 1UX6A 2CYFA 1F5JA 4FPCA 4B29A 4XBLA 1HRV2 1HW5A 2VOKA 4LBOA 5C8CA 2IFRA 3VBRC 1RUJ2 2ZX2A 4I0AA 4QPGA 4GA9A 1Z7S1 5C8CC 1AYN2 1IS6A 2C0ZA 1ZZBA 3N7JA 2V09A 4W65A 1XYPA 3WD5A 5BNQA 4XFIA 4ISQA 5BNNA 1AX2A 2RM21 3MICA 3GALA 5E16A 1Q43A 5HCBA 1W0OA 5DDJ3 2PAKA 1UKGA 1CAWB 4GKXA 4AK3A 4UBHA 1HRI2 3J8F1 1CVNA 4I02A 5IT6A 1Q8OA 1NY72 3ZXJA 2WT1A 2DVAA 5ACA3 1RUH2 1VBB2 1RUE2 3M7AA 3RSJA 1G9AA 4MUVA 1JBCA 2VVFA 4AE2A 2LALA 2RS33 1HIXA 2CGNA 1UIKA 4K1ZA 2QJVA 1Q8SA 3VZLA 4S2FA 4HK9A 4XXPA 4GH4A 3WDUA 3W59A 2XVLA 4FPYA 4LBQD 5CFCB 4B4PA 4Q4X1 4LBQB 3WXPA 3BTAA 4Q4X2 1PGSA 2Z2SB 3MW2A 2RMU1 3TYJA 3UJOA 1A8DA 1YLLA 3ZYIB 4DZGA 2A73B 1V70A 2XL9A 1N1TA 5ABJB 2WSVA 2Y0OA 4G3YC 2Z79A 5LK5A 1S0FA 1JUIA 3JD72 3GZUC 4K21A 3MPPG 2XKOA 1MQTB 1VBD2 1AXZA 3UK9A 1RUNA 4H55A 4IETA 2VMIA 1PGL2 1AL21 5SV5A 2R1DA 3USUB 1WW6A 3LA7A 4MGKE 1A78A 1N3PA 3ENRA 4ZU7A 4AFAA 4Z2WA 3ZFGC 2VMGA 3L2HA 3WLUA 5J96B 3OD0A 3CU7A 1WGPA 1MVQA 1X33A 4NN0A 3WDTA 3ES1A 1WLTA 1ALYA 1TE1B 2XHKA 1TMF3 3AP9A 2TBVA 1AYM3 1G86A 3B93A 4Y4YA 1CAWA 1RUD2 2Z42A 3I54A 5EYXA 1RUJ1 3VKLA 3QBQA 4AEKA 1ZA4A 2KM2A 4RHV1 1VBD1 2B7YA 3WCRA 1CAUB 1YUDA 2FQPA 3VKOA 4FBFA 4LUKA 3A0NA 4M00A 1RL3A 4B7KA 4D94A 4WM7C 1CD3G 2IXHA 3PJQA 1NCQA 4JGYA 5AVAA 2R061 1FV2A 1AR83 1BEV1 4ISRA 4BM8A 4YYOA 2K9ZA 4AVVA 1QJY1 2XLAA 3AJZA 1UMZA 2TUNA 4YVSB 2HWE2 3RS6A 5A3LA 4QGMA 4I3GA 3FHIB 2G9FA 4Y5Z0 5J09A 3O0XA 3VL9A 5BY5A 1ND3C 2JICA 4K20A 2ZGNA 1C8NA 4DB5A 4GULA 2HEVF 5KHJA 4SBVA 4C1WA 3WHUA 4RGAA 5T5JA 4XF9A 2XJUA 1RB8G 5FQ0A 4OULA 1TME1 1O4TA 1PO21 4B4RA 5BXXA 1BVP1 4BLJA 2GMMA 2JENA 2CNAA 3EBRA 4IV1B 3QACA 2I45A 1JXNA 4L9BA 4CEWA 5CBLA 3CNAA 5EFUA 1C8M2 4HN0A 2RS52 3GBWA 2JE9A 4J1WA 3PNAA 5F6KA 3ES4A 2B8MA 4AQ6A 1UU6A 2O8QA 4YLZA 3OYWA 4X8PA 2UWCA 2XWJB 4L99A 3CJXA 2F6BA 4WVWA 1IQAA 1XYOA 2DVGA 4JAAA 1H2MA 1G9FA 3IKWA 1REDA 2WQ4A 2WLPA 3J26N 4IXLA 1SFYA 1HXS3 3WP3A 1RUD1 1ZBA2 1FMD3 3OJBA 1FOD1 3I2DA 4HKOA 3QH7A 5T5OA 1MS9A 1U5XA 1ZREA 2O8OA 1GFF2 3E6BA 4EN0A 3KD4A 3NJZA 1O3RA 1SLAA 1R081 3THTA 2RHPA 1RUC1 1QJX1 4YFZA 3TN92 5K8SA 4W6WA 5T52A 3AMQA 5KHIA 4PIZA 1VBC1 1R1A2 4I0BA 3SCFA 4FPKA 2AYHA 2ZGOA 3WQ7A 2GC1A 2WZR1 3MF6A 4MXWA 3AXEA 1H0BA 1N1YA 3D5OA 2XVKA 2XBO2 1J3QA 4Q4Y2 3RWNA 1CIWA 3OY8B 3J4UH 1UN1A 2P2KA 4YNIA 4JGYC 4FXGB 5BNPA 4K40A 4KH9A 2PLV1 4NWVA 4ASLA 2OA2A 2R041 5JLVA 2R6QA 4YM0A 4MVTA 1LODA 5K7PA 1GZWA 3E5XA 2IC1A 5BV6A 2UWAA 1DQ1A 2D6KA 1MEC1 1AX0A 1UU5A 4PDWC 1CAVB 5T50A 2ET1A 3APBA 3ZXLA 4Y1VA 1HV0A 1PVC3 1FOD3 1LR5A 3D8CA 1AVBA 1TMF1 3NVCA 2PELA 1FV3A 3AZWA 2AR6A 1AR82 3ROUA 2Q1MA 3OD4A 5CU1A 5ABJC 5JZGA 4J1XA 1R083 3H1YA 4CEYB 1CR7A 2NQYA 5CA6A 1CJPA 1FXZA 3M70A 3OGJA 3B5LB 5AC92 2GNDA 1YCIA 5BUVA 1VB2A 3WNXA 4YZ5A 4IEVA 2G9GA 3KS7A 3AZYA 3A4UA 1H8VA 1ND2C 2HEWF 3CEWA 2LUWA 1LHWA 3USSA 1AR73 1AL23 4RSUA 1U5YA 1OKQA 3H1WA 3CLPA 2E9QA 3WR0A 1WMFA 1TME3 4COWA 4WVMB 3VBUC 1V6JA 2HWB1 2ZZQA 3VV1A 1POV3 1UF2C 4YGBA 1WCDJ 2ZGKA 3AFGA 1RUG1 2HWC2 1ZYBA 1NXD1 4AFMA 5GZGA 1RUG3 1J3PA 5C4WB 4P9IA 4PQ9A 1Y9QA 1BBT2 1IS5A 4I09A 4GB31 4OLLA 4Q0SA 5GLUA 3SH5A 4B8EA 5CIRA 4HETA 5F1RA 4N43C 1VAVA 3ZSMA 4MV2A 1W6QA 4HVOA 4B3NA 4RHV3 2UYAA 2QFEA 1WLCA 2B39A 1YHFA 4YZ4A 3D82A 5FFOC 4HSLA 1B35C 2PFWA 2VW2A 1IPKA 4IEPA 1NE4A 4Q4V2 2WQZC 5CAZA 1HV1A 2CGPA 4GWMA 2VVEA 5JZGB 4R4XA 3ZYGA 5DDJ1 3V64A 5K0UC 3AFKA 4BH9A 4PF5A 1D4VB 2ZHNA 3AKRA 2YY1A 2WZPP 1LEDA 1COV1 1RUH3 1RHI2 2C5DA 2ZX1A 5EXOA 4L92A 4AQTA 2H0BA 1ZBE2 4IEXA 1KS4A 2CWSA 2E51A 2UURA 4KWLA 4WM8A 3DUIA 2BBVA 4K8FA 2DUPA 2VW0A 3ZFFA 3RNSA 1AJOA 3UKVA 5EWSA 2YZ4A 1SMVA 2PAMA 1MS1A 2WS92 4FPGA 4AQSA 4FAHA 5EZWA 2JG8C 5KC6A 2Q1ZB 2IXIA 1AR81 5AFEA 1W6PA 4IEWA 1GBGA 4SLIA 4GMP0 1I9RA 4QU2A 1ONAA 2RJLA 1NLSA 4QX5A 1WW5A 1HQNA 2JX9A 4BZ4A 1DGRA 4L8QA 1H1IA 2DVDA 2WKKA 4FOYA 1R092 2ETEA 1G9DA 2DYCA 4OZXA 3DPRA 4Q0PA 1RTVA 4XQWA 5E8AA 5C9AA 3GHMA 4AGRA 1BCXA 1OHFA 2D6OX 2IFWA 3QD6A 4DFSA 3ZYRA 3FLTA 5AFBA 4HKLA 2A6ZA 4MGYE 1ZZCA 4BIFA 5HBAA 3EXUA 3NV4A 4CDWC 4KL1A 1RUF1 1LJ7A 1LU2A 4P9GA 3R6SA 4EWAA 5FDBA 1C1LA 1DYPA 1DG6A 5L7OB 3BB6A 3JB8A 1OD5A 1F8VA 1QJX2 1RUC2 3TBDA 1QJU1 1T6GC 2MEV2 1YI7A 1LHOA 3O0WA 4LUMA 2DFBA 3FX3A 1WW4A 4HANA 4XIKA 3CO2A 4ZKTB 3H1MA 3B7MA 3R4UA 3ETQA 3VBFB 4LHNA 2C9AA 2RM23 2JXAA 3ZIXA 3SXWA 4EROA 3ZO0B 3ST7A 4AFBA 1MZ5A 1YJKA 4KG8A 2GNBA 3DGTA 3ZSLA 4YW2A 4B7EA 1VRH1 3ELNA 1WD4A 3LWCA 3ZFEC 2UU8A 1U12A 4YFWA 1MS4A 1SBEA 3M3QA 4YVSA 2VNOA 2D6LX 3IDEA 5FCCA 3B69A 1F5FA 2PQQA 4ATEA 2BTVC 1B35A 4M3CB 3E6DA 1N3QA 5FO9B 1DGWX 5KHKA 1S2KA 4M3CA 2RS11 4WBBA 1S0JA 4JGZA 4LBQA 3HWJA 1RUE1 3AKSA 1CPMA 1W6OB 1H8TA 4FTEA 4FPFA 2RS31 1VBD3 1O91A 1MS8A 5HXVA 5T3NA 4OI2A 1NG0A 2DUOA 2E6VA 3JB4C 1KDKA 3B01A 3HIFA 2HWE1 3SNMA 1J59A 3U4XA 2IXKA 1ASJ3 4IEOA 4FPJA 4FQ4A 3PVOA 1LRHA 2QKDA 1LOFA 3PMEA 4X6QB 1MZ6A 3TOJA 1AYN1 2WWSA 3AMPA 2I74A 1ND3B 2Z69A 4KGQA 4KQ7A 3KGZA 4Y20B 4ES9A 4IERA 2HWB2 2EF6A 3N3HA 4IEUA 2P3JA 3DPRC 4LE4A 4QGLA 4K1YA 3I59A 4ATFA 4QGNA 3FLRA 2DU1A 1Z7S3 5JSPA 4XF0A 4NR1A 1LOEA 3VDDC 3H0OA 2OZJA 3HBZA 1ZZ8A 3NWKA 1RUI3 5I0RA 1K5MC 2WT2A 3DV8A 4AVTA 3NAPA 2ZAAA 2YROA 2A71A 1H1MA 4IV1C 2V5YA 4BIOA 1C4RA 2GMEA 1EAH2 1WW7A 4QPGB 3O5SA 1LHVA 4EN6B 1MQTA 2EXHA 1PM7A 2HWF3 2A3WA 1AR62 4CDUA 3WCSA 1COV3 3JUUA 4DNYA 5HI0A 2DCKA 5GJ6A 1W6MB 4JRLA 3ZFFC 1MZFA 1FT9A 1W6NA 2YPJA 5SV8A 5FREA 1UU4A 1M4WA 1X82A 4IESA 3SH3A 1DGLA 3B94A 2PN5A 1URXA 1MVEA 1VBE2 3O0VA 1QXJA 1QJY3 4IEYA 5K0UA 4DOUA 2BQPA 4EN8B 2P3IA 2X53S 1BEV3 1EY2A 2XWBB 4HBNA 3OCPA 5D8AA 3WW4A 3A0KA 4R9BA 5FMOL 4WVMA 1APNA 2BUKA 2OYZA 3OYWB 5BNNB 3WDWA 1YO8A 2VXRA 1OA3A 1JHNA 4H7LA 4IV3A 1WMDA 1I3HA 3POWA 3ZSJA 1QNWA 3WUCA 5JCTA 2QDNA 2CV6A 2Q0AA 4QD2A 4AEMA 1IHMA 3VDDB 1H8TB 3ZVXA 2ZPXA 5FLHA 1VBC2 3TNQA 4HFSA 1MS5A 4MXVA 1VIWB 2MEV1 3SISA 2R0HA 1H9WA 2ZHKA 3ZXDA 1Z0HA 4QQOA 1S0EA 2AGSA 1YXWA 1QKQA 2D98A 1GQHA 1OOPA 1DBNA 4QPIC 3P3PA 1BBT3 1ZZ9A 1JYCA 1KS5A 3AKTA 3LSDA 5DXDA 1AX1A 1ZRRA 3AYCA 5D1IA 5FLIA 1RUE3 2VNRA 4AHXA 1RUF3 1GZ9A 2GH2A 2WL1A 1YRZA 1ULDA 1AHSA 2FBEA 5LRSA 2OUJA 3E5QA 1HQWA 3KM5A 3KSCA 4AVSA 5LEJA 5C4WC 2LTNA 1UL9A 3EO6A 1SBFA 4D7SA 1LTEA 2WFF1 1WBFA 2D6NA 2H6BA 4R8HA 3WG3A 2GDFA 3ZXGA 2JG9B 1AR93 2PAEA 1CAUA 3QLQA 1W39A 4N9IA 4L97A 3SLIA 1SLIA 4WZCA 3UV9A 5C6CA 3AMMA 1PO12 4NOTA 4OHZA 2VPVA 4AQ2A 4NHMA 1FAYA 3OY8A 1QJU3 2HKXA 2QDRA 4AF9A 4Y1YA 4WV8A 3URFA 1ND2B 1GR3A 2WLQA 2HWB3 3B3QE 2AZ5A 1DZQA 1X8MA 4OI4A 3OBTA 4S2DA