1AYM1

Human rhinovirus 16 coat protein at high resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
285
structure length
285
Chain Sequence
b'NPVERYVDEVLNEVLVVPNINQSHPTTSNAAPVLDAAETGHTNKIQPEDTIETRYVQSSQTLDEMSVESFLGRSGCIHESVLDIVDNYNDQSFTKWNINLQEMAQIRRKFEMFTYARFDSEITMVPSVAAKDGHIGHIVMQYMYVPPGAPIPTTRDDYAWQSGTNASVFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDTYKSRYGTVVTNDMGTLCSRIVTSEQLHKVKVVTRIYHKAKHTKAWCPRPPRAVQYSHTHTTNYKLSSEVHNDVAIRPRTNLTTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title The refined structure of human rhinovirus 16 at 2.15 A resolution: implications for the viral life cycle.
pubmed doi rcsb
source organism Human rhinovirus sp.
molecule tags Virus
total genus 61
structure length 285
sequence length 285
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1aym100
1CD3G 4Q4Y1 1EV13 1VBC3 5BNOB 4AEDC 1RUJ2 3VBHB 3VBRB 3ZFEB 1VBE3 3CJIA 4Q4W1 1RUG3 3ZFEC 5FOJB 1FMD3 4Q4Y2 4CDUC 2HWD3 2RM23 4PDWB 1B35B 1OOPA 1B35C 4Q4W2 1PGW1 1PVC1 1AR93 5L7OB 2BBVA 4CEWB 1RVF2 5CFCA 4Q4V1 1PGW2 1PVC2 4CDQB 4IV1B 2XPJA 1R083 3ZFGB 1V9U3 4Q4X1 5ACA1 4CDQC 2HWF2 1PO12 5JZGA 2RR11 2WFF3 2XBO1 3NAPA 1TMF2 2VQ0A 4YVSA 4WM7C 1R092 5C9AB 4Q4V2 1IHMA 3TN91 1BBT3 1PIV3 1ZBA3 4Q4X2 5ACA2 3VBFB 2RR12 2XBO2 5CFDB 3J8F1 4WM8A 3VDDA 1TME1 3VBFC 5A33A 5AC93 1RUE3 1RHI1 1M06G 1NCRB 1FOD3 2MEV1 1ZBE1 2TBVA 4YVWA 4RS5A 1AL21 1H8TA 1EAH3 3J8F2 2RS13 4JGZB 2WZR3 4LLFA 1RUI2 1QJZA 5K0UB 1QJX2 3VBUB 4CDWB 2RS51 4CEYB 1ASJ1 5C4WC 5K0UC 1NCQB 1MQTB 5BNPA 2MEV2 1ZBE2 4JGYC 2GSYA 3DPRC 1HRI3 1VBB2 1AL22 1HXS2 5J98B 3JBG2 2PLV3 4IV3C 2RS31 2QQPA 1RUH3 2BFUS 2RS52 1ASJ2 4RR3A 1NA1A 5ABJA 4GMP1 1MEC3 2RS32 2WS91 5D8AB 1POV3 2RMU3 4RHV1 1POV0 1PO23 1EV11 2R043 1ND3B 5C8CA 4N43B 1NOVA 2WLPA 1VBC1 1VRH3 3CJIC 4EJRA 1RUF3 1D4M3 1QQP3 2HWE3 1BEV3 2WS92 1VBE1 1A6CA 4FSJA 1VB2A 1RUG1 4GB33 1R1A3 1COV3 4AEDB 1FMD1 1RUD3 3VBOA 2X5IA 3ZFFA 2HWD1 2RM21 1HRV3 1BMV1 5BNNA 4CDUB 1VBE2 1X36A 4FTEA 2GH8A 2HWB3 1RUG2 1OPOA 1FMD2 1AR91 2HWD2 2RM22 3JB4C 5CFCC 1RB8G 2R073 4N53A 1AR73 1RUC3 4QPGA 3VBSA 1R081 2R063 5JZGC 4QPIA 1V9U1 1AR92 3NAPC 4FTBA 2WFF1 3JD73 2BUKA 1BBT1 1PIV1 1R082 5BNOA 4WM7B 1VAKA 1ZBA1 3VBHA 3LOBA 1OHFA 4WM8C 3VDDC 3VBRA 3ZFEA 2WFF2 4FTSA 1RVF3 1H8TB 5AC91 1BBT2 1QJY3 1RUE1 4PDWA 2ZZQA 1B35A 4YVWC 4RS5C 1H8TC 1FOD1 5A32B 2HWF3 1PO13 1AR83 1EAH1 1AYM3 2RS11 1VB4A 1TMF3 2WZR1 4Y4YA 3TN92 1R093 2ZAHA 5BNPC 1RUE2 1RMU3 5L7OA 4CEWA 1VBD3 1HRI1 4GH4A 1TME2 5C4WB 1EAH2 4RFT0 2RS12 4CDQA 2PLV1 4IV1A 4JGYB 3ZFGA 1C8M3 1RUH1 3DPRB 1RHI2 1NA1C 3IDEA 5GKAC 4IV3B 5ABJC 2BFUL 5J96B 5C9AA 1ND2B 1K5MB 1MEC1 3S6PA 1RUI3 1Z7S3 1ND2C 1RUH2 1K5MC 1QJX3 1FPN3 1AR63 3VBFA 3ZXAC 1POV1 2RMU1 5CFDA 1PO21 1HQNA 2R041 1CJDA 4RR3B 1VBB3 1VRH1 1HXS3 1RUF1 1D4M1 1MEC2 3JBG3 5DDJ3 1QQP1 2HWE1 4RR3C 1BEV1 1AL0G 1NCRA 3ZFFC 3CJIB 4GB31 1R1A1 1COV1 1RUD1 2RMU2 5FMOL 4JGZA 5BNNC 5K0UA 1HRV1 1VRH2 2FZ2A 1D4M2 3VBUA 4CDWA 4CEYA 2HWE2 1OOPB 1NCQA 1MQTA 4Z92B 4CDXA 2HWB1 4GB32 4RHV2 1COV2 1OOPC 1EV12 1VBA3 2FZ1A 1RUD2 3FBMA 1F2NA 1QJU3 1VBC2 4Y5Z0 3VBSB 1AUYA 2R071 2HWC3 3VBSC 1AR71 1RUC1 4QPIC 2BPA2 1AYN3 5CFCB 2R061 2IZWA 1BMV2 2Y26A 1RUJ3 3JD71 1DDLA 2R072 5JZGB 3NAPB 5D8AA 1AR72 1RUC2 4YVSB 5BNOC 1ND3A 4RQPA 4N43A 3VBHC 3VBRC 2R062 4Q4Y3 4YVSC 1SMVA 1HX6A 3JD72 4Q4W3 4AEDA 2WWSA 4PDWC 1RVF1 4WM8B 3VDDB 1V9U2 5A33B 1QJY1 4SBVA 2HWF1 4CDUA 1PO11 1AR81 4YVWB 4RS5B 1AYM1 1TMF1 1PVC3 1R091 1PIV2 4GH4B 5L7OC 1QJY2 1ZBA2 4CEWC 4GH4C 1RMU1 1VBD1 5BNPB 4IV1C 3ZFGC 1AR82 1AYM2 4Q4V3 5AC92 1C8M1 5LK7B 1FOD2 4Q4X3 5ACA3 5C9AC 1RMU2 1VBD2 2RR13 2XBO3 3JB8A 2WZR2 1PGL1 1NA1B 5ABJB 3TN93 1RUI1 1C8M2 1Z7S1 4WM7A 5CFDC 1QJX1 1FPN1 1AR61 1HRI2 4NWWA 1WCDJ 2PLV2 3J8F3 1VBB1 5C8CB 1TME3 1HXS1 1NCRC 1PGL2 1F8VA 5DDJ1 3JBG1 1C8NA 1Z7S2 5C8CC 1RHI3 3M8LA 1FPN2 4JGZC 5A32A 1AR62 2MEV3 1ZBE3 4BCUA 3VBUC 4CDWC 4CDXB 4CEYC 1AL23 3VBOB 2X5IB 3ZFFB 1NCQC 1MQTC 5DDJ2 4CDXC 3VBOC 2X5IC 1X33A 2RS53 5BNNB 1ASJ3 1PO22 1VBA1 2R042 5C4WA 1QJU1 1RUF2 4JGYA 1QQP2 1BEV2 3DPRA 2RS33 3HAGA 1NG0A 1R1A2 2HWC1 4IV3A 4N53B 4NWVA 1NY71 1W39A 1AYN1 1E57A 1VBA2 4N53C 1ND2A 4QPGB 1HRV2 1QJU2 1K5MA 4QPIB 4GMP3 2DF7A 4RQPB 1RUJ1 2ZTNA 4GMP0 4QPGC 5D8AC 2WS93 2HWB2 1ND3C 4RQPC 4N43C 1GFF2 2HWC2 5FMOS 1NY72 1AYN2 4RHV3
chains in the Genus database with same CATH superfamily
3WW4A 3J26N 2OT7A 2A71A 3RRDA 2VJXA 2VO5A 3P3PA 2XR4A 4IE7A 4AEDC 1RUJ2 1RIRA 5K9YA 3HIFA 5G04L 2FDIA 1SFNA 4Q0SA 3VBRB 4CCCA 1WGPA 4AHZA 1HN0A 4CU8A 4BJ0A 1RUG3 3LOIA 4GJYA 4XFHA 4QHOA 1YQ8A 4PJYA 1X8EA 4Q4Y2 2BWCA 1KXGA 3AP6A 2RM23 2W94A 4JKMA 4ZONA 4WVMB 5GLUA 4XCBA 1OOPA 4XMAA 5F37A 5DUWA 2RV9A 2E51A 1RTVA 2KD7A 5A80A 2VBPA 2VNVA 2D5FA 5KBFA 1LHUA 4YW7A 4YW3A 1W8OA 1KRIA 3CBNA 4JVAA 2GALA 4MLOA 3C8XA 4GZ9A 5A6QA 3ZM8A 4TLFA 5FPXA 1GNYA 3MBWA 5FXVA 5I0SA 4IE5A 3PVEA 3R4DB 3P5BA 4RGKA 2AEYA 4F8AA 1S0GA 2JE9A 1PVC2 1GNHA 4CDQB 5IAXA 2ZS6B 2XPJA 2UWBA 4MXWB 5FYCA 3ZYIB 5J37A 1XBFA 2WSVA 3W59A 2NM1A 2CTVA 3JXSA 4KGQA 1PO12 4QQPA 4BQ5A 5JZGA 2QQLA 2RR11 2WFF3 3NAPA 5FUIA 4KG0A 1TMF2 1X9TA 2VQ0A 4YVSA 2VMEA 3N7JA 5C9AB 3WP4A 5JWPA 4Q4V2 3LKJA 1IHMA 3TN91 5FREA 2LRPA 1VMJA 1BJQA 5ACA2 1ULGA 2DCTA 1PZ8A 1Q43A 4XDQA 1VLNA 2WR9A 2QNKA 5CA6A 3I2OA 2XBO2 3B02A 1A8DA 1LODA 2VQAA 3NKGA 1CZVA 3T2TA 3UESA 3BI3A 2QDNA 3PUIA 3VDDA 3AM2A 3TWIA 4K8RB 2ID4A 4QB1A 3LCPA 1MR5A 3A21A 3RJRA 1GUIA 2NQYA 1H2KA 3SXWA 1GZWB 3WW2A 5BYNA 3G7DA 3T0DA 2KA3A 1D2QA 2CDPA 2XB6C 3S7IA 3AKQA 4B1MA 3LIHA 2D3SA 3IWZA 2MEV1 5IAVA 1ZBE1 2JDPA 3I59B 3DF0A 4YZ3A 4BQYA 2TBVA 2QQMA 4DINB 4H7LA 4RS5A 2Z5WA 1H8TA 2AUYA 3TEZA 2RS13 5HXVA 3PDQA 4DPNA 2JG9A 1XYOA 1MS4A 4W6WA 1OA3A 1TVGA 2J1EA 4CP2A 4HFSA 1UZYA 1W06A 4LJHA 5HCFA 5K0UC 3W20A 1O3SA 1LOAA 1NLRA 4JGYC 2QQUA 1O8SA 3IB3A 1A8MA 5FPZA 1HXS2 4UFIA 4XOGA 5DAWA 4IUGA 4CP9A 5LEJA 2PLV3 4YGEA 5F32A 1GBGA 2RS31 4GXLA 2BVBA 4QM9A 1RUH3 4OCTA 2QQPA 3JQWA 3ZN6B 1HJFA 1WBLA 4I2OA 1JS9A 1Q8VA 5ABJA 1JOPA 3O1TA 1MEC3 2EIDA 1O8PA 2W47A 2AENA 2WS91 3OY8B 1UOGA 2XHNA 5GM0A 3L2HA 3U1XA 3W58A 4NUBA 3AP4A 4JRAA 4K6BA 4R9CA 1POV3 5D8AB 5IVJA 3WEZA 4RHV1 3MFAA 3BB6A 4UFMA 4QXBA 4FFHA 3AMHA 4XF4A 5C8CA 3HVDA 4LBNA 1VBC1 1VRH3 4EJRA 1NLQA 1V6KA 5FR3A 5A7WA 2ZMKA 1QQP3 1MS9A 1VBE1 2AACA 4AEMA 1A6CA 1JZ3A 4DXTA 2BYVE 1SG3A 1UN1A 1COV3 1ZRRA 2ZX3A 4QHBA 3RWKX 3MF9A 2QQIA 5FZGA 4TXWA 3O1PA 2X5IA 1GQGA 3POIA 3UNPA 1UXZA 1KFXL 1W3VA 3IDCB 2W91A 4QDQA 5F2WA 2J42A 3OYWB 1REFA 1ZRFA 1H30A 3LPGA 4YW4A 1GLHA 2KM2A 2ZGMA 2GH8A 2HWB3 1OPOA 1ZZ8A 1CAXB 4XUNA 2A3XA 2JXAA 4XHXA 1CPMA 1APNA 1GOFA 3KCXA 3INAA 3ALQA 2Y6GA 1MS3A 5FKCA 5BPXA 3IKWA 4IETA 5GZDA 5FZLA 5IK8A 3MIFA 1H8VA 2GU9A 2GNTA 4JCKA 3GF6A 1J59A 1VALA 3QCWA 1BVVA 3VBSA 1K42A 1R081 3VKOA 5JIUA 5JZGC 1V9U1 1AR92 3NAPC 4CUAA 3I2FA 2WZPP 3MIGA 4IEXA 3T1MA 1GP5A 2Y64A 2GMMA 5DG1A 4KBZA 3VKNA 1WZXA 4DO0A 2GC3A 2EXKA 1T6BX 5CU1A 4FP2A 4BQ2A 1Y9GA 1GWMA 1YI9A 4XFAA 2D3RA 3U37A 3N35A 2UU8A 4QT6A 2I07B 2ZGTA 1PIV1 2G9GA 1BVP1 2D98A 1VAKA 4XE9A 3EYPA 4FPLA 1O91A 3VDDC 3VBRA 2EF6A 4CP0A 4FTSA 3FE5A 3APBA 3EHKA 4ZS2A 3UGHA 1H6YA 2RG4A 3WDTA 1LGNA 2FMYA 1NZIA 1GKBA 3QACA 1QH6A 4AVTA 5EQUA 3VL8A 3PUSA 3RZMA 1RVF3 2ZEWA 5FZ3A 1SBFA 4YZ1A 1P8JA 3D4KA 5AC91 1BBT2 4WVMA 1RUE1 3PVNA 2ZZQA 3ZDSA 4RS5C 5F6LB 5FPAA 4YFZA 1H8TC 3GBGA 2OKXA 2Y34A 1HV0A 1UL9A 5KHGA 2VR4A 2HWF3 3CO2A 4A7KA 2BTVC 5A7QA 5JMCA 1JYXA 2JG9C 3K4DA 2P5BA 4HN0A 1EAH1 1XXNA 5FY8A 3KLSA 1KJLA 1QJEA 3U78A 4MGSA 4DXRA 4JKLA 1W9FA 2H0VA 1UZZA 4W4ZA 3MUZ1 1R093 5FYYA 5KXEA 2DWRA 4MXVA 3MV11 2DVFA 2FQPA 3K2OA 1WD4A 3ECQA 3PTYA 5LBEA 3ZSEA 2KXLA 5FY1A 4DY5A 4C90A 1RMU3 4PF1A 2RHPA 3MW3A 1NUKA 4Y20B 5F5IA 4FQZA 1TME2 3OPWA 5C4WB 3O1RA 1UKGA 4CDQA 1MACA 2DCJA 1S0BA 3CZJA 3FHAA 2R6QA 5FCCA 4OI1A 4MXWA 5JOZA 1LOEA 2GNMA 3DN7A 5C5TA 3DPRB 1PX4A 3ZKUA 4QX0A 1RHI2 2Q5TA 5F1RA 3NNMA 1NAEA 3AC0A 1OF4A 5GKAC 5ABJC 3NJZA 1Y4WA 4ZXEA 2BFUL 2JICA 1JODA 1OQEA 3MLLA 3BTAA 3ZYRA 5C9AA 4OI0A 2RDRA 1W8NA 2C24A 3UL2A 4NJ4A 1RUI3 1HB2A 2W95A 1QOTA 1XE7A 4IEUA 2JD9A 1SFPA 2ENRA 4XJ8A 3ZXAC 1KGYA 1UY1A 5JSPA 2HBTA 5JXGA 1ZZCA 1C1FA 1GZWA 2WNUC 1RUF1 1TZOA 2VCAA 3POEA 5KXCA 4DOUA 1ULFA 2LTNA 3K75B 4XXAA 5E8AA 1BK1A 1BHGA 5EJZB 2PFWA 3I59A 5DUXA 3VZNA 1FAYA 1HKDA 1R1A1 2B45X 3CJIB 4GB31 1ZZBA 4UYBA 4XFCA 3VD9A 5A1LA 1RUD1 2H6BA 3OUIA 4FFFA 4AHWA 4Z8BA 4ZU7A 2VZ3A 1E5HA 1OA2A 2B8MA 2OIIA 5M0TA 3KV6A 1D4M2 1UO9A 3PU3A 5FWEA 3LF7A 4OLLA 3T09A 2JDKA 2XGXA 2XMLA 2ZGUA 4Z92B 1UYXA 5A3UA 1JU3A 5A7SA 3BIEA 1N1TA 2W2IA 1O3RA 4IEYA 5I8SA 2B9VA 3PUAA 3VHRA 3O0XA 1RXFA 3NV4A 3ZN6A 2LUWA 2R071 2D6LX 1ULDA 2A7AA 4OMCA 1LHNA 3VBSC 4YG3A 5ANNA 1O4YA 1VPHA 3T0BA 3V65A 3LEKA 1XNKA 4K40A 4E2QA 1US2A 3EXUA 3VHOA 1LGCA 4YNIA 1BMV2 4ZPIA 3WOGA 3ZMOA 2Y26A 1RUJ3 2VQTA 4Y22B 2ZOEB 3OY8A 5C7GA 2BP6A 1LCLA 2IVJA 2WO7A 3HT1A 5D8AA 4COWA 2W3JA 4AHXA 2ARAA 5F3CA 4PQ9A 3T0AA 1JYTA 4CPBD 1H6XA 1OLME 5L73A 2HEVF 1H1AA 1LENA 2R062 2PQQA 2OZ6A 2VXRA 1OFSA 2WRAA 3FMGA 4Q4Y3 3T2QA 1Q8PA 2Y38A 5FJHA 5FZBA 2FDJA 4AVVA 2DVDA 1QEXA 5FP8A 4BMBA 1MS5A 1OXCA 1FV3A 2Y60A 1AXKA 3ZPOA 3AB0A 2ZHLA 3PVBB 2QCSB 1W3XA 1AJKA 4C91A 1V0AA 2VU9A 1QJY1 2VOTA 3MW4A 4O9GA 4FPCA 3OYWA 5FLJA 1U5YA 3I8TA 3H0OA 3MLKA 3WCRA 1N3QA 1JU4A 4JTOA 3WZ1A 1AR81 1FXZA 3ENRA 4B7EA 1UZWA 3MO4A 1HW5A 2YC4A 4MGQA 4IGQA 1CAXA 1PVC3 3HPNA 3TRSB 1UZVA 4I0BA 2VZUA 2WN2A 4LBQB 4K1YA 1A3KA 2C5DA 5AFEA 4MV2A 2DVAA 4EYUA 4AI1A 1VBD1 2OW4A 4XQWA 3RGBA 2ARBA 5BNPB 5FO9B 2QZ2A 2Y6KA 3A4UA 1WA6X 5EXOA 4ZU4A 3GZEA 3KGZA 2BGOA 5HPOA 3K51A 4OHXA 3AKSA 4Q4V3 3LSEA 3HQUA 1C8M1 5LA9A 4YGDA 1S0JA 2OS2A 5ACA3 1XSQA 1MS1A 5C9AC 5A7OA 1J3QA 4LMFA 4L97A 4AE2A 2JECA 3RZJA 5GALA 2B4KA 2XBO3 2DVGA 5FZ0A 4YSFA 3IM0A 1J58A 4MOAA 1AXYA 2QUOA 1NA1B 3THPA 3AZZA 2KR2A 2ORXA 3K3OA 3B9CA 1F5JA 5FY9A 3C3VA 3VDCA 3O1UA 1QJX1 2ZABA 3NJVA 5C3PA 3M1HA 5BY5A 3MZHA 1Q56A 4Q1RA 4MH0E 2TEPA 3A0NA 3SHRA 2MNGA 2PLV2 1VIWB 2DVBA 1A78A 3K3NA 3BVCA 1PGL2 2W92A 3BKZA 3JBG1 4QGLA 3ZYHA 3JCIA 4DQAA 3BTYA 1DGWX 1Z7S2 2VZSA 2IVIB 4BMEA 5I0UA 3M8LA 1FPN2 5DAPA 2A6ZA 1TG7A 5A3OA 4LEJA 4EE2A 1AR62 1ENSA 2E26A 1DFQA 1GWKA 4QU2A 1F4HA 1S1AA 2E31A 3GJAA 4I3PA 5IW0A 2RVAA 1YHFA 4NPRA 4XZUG 1AHSA 4HANA 4ISQA 1JN2P 3KHCA 3EB7A 5DDJ2 3T1LA 2WYSA 2RDSA 2A6WA 4BXSV 2HH9A 3J7MA 1QMJA 2YPJA 1DLCA 1QXRA 1VAVA 2JDYA 4Y20A 4AVCA 1KS5A 2B42B 4YG6A 1SBEA 1JZ8A 2G1MA 2CAUA 2E63A 5C4WA 3WY6A 2FD8A 3J7NA 1UYYA 2P6CA 5FXWA 3KV9A 3FLPA 5I0TA 1QQP2 3DPRA 4E27A 2P34A 3ZO0B 1C5HA 1IQAA 1SLTA 3H8UA 5FZOB 4LNVA 3U14A 3S0MA 1ZRIA 5FIXA 1NY71 3R4UA 3AYCA 4OQ8A 3B3QE 1YQ6A 5JR7B 2WT0A 1UX6A 1VBA2 4N53C 1CJPA 3BU7A 3OGSA 2JIGA 5DAQA 2WIIB 1SPPB 4QPIB 2DF7A 4P08A 4RQPB 3AMMA 5D8AC 2YBPA 2ZTNA 4GMP0 4QPGC 4CPBA 1JUIA 3ES1A 1FNZA 3H3ZA 5KHHA 5JXJA 4NHMA 5GZEA 2HWB2 3HN3A 3MIDA 3GBWA 2HWC2 2D6OX 4H2AA 5F5CA 2FDGA 1NXMA 2P1BA 3BCWA 2K46A 4QQHA 4L0PA 4D3WA 5AFBA 1G9DA 2I74A 3B01A 5GZCA 1A34A 1DYOA 2WN3A 4XAAA 5D1IA 5DG2A 4XUTA 2DUOA 5JSOA 3OBTA 2GDFA 5FQ0B 4Y24A 1HB1A 1SFYA 4LOSA 2OXBA 4RGGA 1F4AA 1S55A 3ACLA 2VMGA 3MPBA 3P1IA 4K9SA 4ZU5A 2E7QA 3VBHB 3CJIA 4Q4W1 2SLIA 2VCMA 2J7MA 3OF1A 1SZBA 1DQ2A 1CIWA 3M3QA 3RI9A 3ZFEC 3I2KA 3HEIA 4GWNA 3RZGA 3H3LA 3C7GA 3M70A 1YQ2A 4LBMA 1PVXA 1SBDA 3RQ0A 4QX5A 2BEOA 1O5LA 4LIVA 2D7FA 2XG3A 4QPYA 2VOKA 5FPBA 1B35C 2BNNA 1CAUB 4XUPA 1M4WA 2J22A 2Q8OA 2WL1A 3NSTA 3K77A 1AR93 5K7PA 4LKDA 1W28A 4EN9B 2YU1A 2D93A 2YUEA 4LKFA 5H9PA 4DZGA 1RJ7A 5H9RA 2XXZA 4LQRA 3FHIB 1AX0A 4NHXA 1FI2A 5C3QA 1RL3A 1WW6A 1RC6A 1RJ8A 2VXJA 1RVF2 4P9IA 3FN9A 4MHRA 1BK0A 1H2LA 4GWIA 5FXXA 3UJOA 1NLSA 5CG8A 3D5OA 4I01A 3ZFGB 4UF0B 3SH5A 4FOVA 3WDYA 1G9AA 4KWKA 2HWF2 4Y22A 5E88A 5J36A 2PHUA 4W8JA 4B4RA 5FYZA 5FV3A 2ZX4A 3WNOA 3TB0A 1JH5A 5LA0A 4J6GA 1R092 1DF0A 2DUPA 1OLMA 1O7FA 1LEDA 2R16A 1DGRA 1BBT3 1UW8A 2HKXA 4UI9L 1H9WA 5JSRA 4GKYA 1UKRA 4OYUA 4LE4A 3RMYA 3BUCA 1C5IA 3SCGA 2IXHA 4ASLA 4I0AA 2RR12 4UFHA 3WQ7A 3ZXKA 5CFDB 4MADA 2JEMA 5IYYA 1UX7A 2IFRA 2ZGQA 4W6XA 3BN6A 4FPJA 3VBFC 1TE1B 2NMNA 2X8KA 4H3WA 4CCDA 3T4VA 2ZKNA 3M2MA 2GAUA 5CKNA 4FXGB 1CZTA 2QVSB 4UW3A 5FLIA 4URTA 1GP6A 1XNDA 3GCWA 1QHDA 1ZZ7A 3KQ4B 1FOD3 1PM7A 5FYBA 1IOAA 4JKKA 4ISRA 4NO4A 2ZGRA 2WT2A 1QNYA 4AHYA 5F39A 1NYWA 3B93A 2DFCA 5I0DA 4LR4A 4JGZB 2WUHA 4LLFA 1RUI2 4LBQA 3RFRA 4COUA 1XPWA 2Q1MA 5D2AA 1W6QB 4CEYB 5IATA 4R8HA 1ASJ1 5C4WC 4LK6A 1NCQB 5T3NA 1MQTB 4QAWA 2XLFA 3IT8A 2MEV2 3VZKA 1ZBE2 5BNPA 5I8YA 1LESA 1Y43B 2W46A 1IS3A 5EJ1B 2GSYA 3DPRC 1HRI3 1C3HA 5FZ8A 5B4NA 2VH9A 1ACCA 5J98B 2VZ1A 2RE9A 1CPNA 2WJSA 4JQRA 5IVBA 4S2GA 3WG4A 2GP3A 2BFUS 1Z0HA 4YGBA 5DZFA 2K2SA 2TNFA 3SKVA 5IVCA 2EVXA 2NPIA 3WNXA 1JOBA 4M3CF 4NRQA 1HQLA 1NA1A 4GWJA 4A6SA 4BXFA 4W65A 3PLQA 4Q26A 2ILMA 5C71A 2CL2A 2RS32 1W6NB 4E2SA 4KNCA 2CAVA 1TQ5A 4P14A 4P9YA 5B4XA 2Q1FA 3ZXLA 4CE8A 4EWAA 5JUVA 1D4VB 1EPWA 4RGAA 1ULEA 2L9LA 3H1YA 1W8TA 2PELA 2YXSA 2ZJCA 2FCUA 1FNYA 1POV0 4N9HA 2E53A 4LO4B 5FP7A 1EV11 2HYKA 1ND3B 5FYVA 2JDMA 5GZFA 1LTEA 4QB2A 5H9QA 1ZYBA 5IK7A 3CJIC 2JB4A 4XEZA 1D4M3 4XVHA 3WSOA 2B46X 2WNVB 2ZZJA 3M3CA 4GA9A 4BLJA 2WS92 3AVRA 4OULA 5DABA 1I6XA 3KHBA 4QWNA 4YWAA 1VB2A 3MI8A 4Z1VA 1T2XA 4E8DA 2DDUA 1BKZA 1FMD1 3AKTA 4M4PA 1WCQA 3SQOA 2YMZA 4I09A 5LY2A 2HWD1 3H3UA 5IWFA 2YHJA 4EV0A 1OLRA 2QBXA 1HRV3 2JDNA 4LO5B 3VL9A 5FZ4A 4GIQA 2VVDA 4D7YA 1UF2C 1RXGA 2VG9A 4L9BA 3HNBM 1NT0A 1VJ2A 1JHJA 1VBE2 1X36A 3GNEA 4OUSA 1H4HA 5JI7A 3UKNA 3WW1A 3ZOIA 5HBAA 5FYSA 4FTEA 2XQRA 5DZGA 1J3PA 1GOHA 2YBSA 3Q8BA 1YCIA 3WDXA 4AFDA 3CIHA 1W2AX 2V4VA 3WDWA 2X29A 3WX5A 2JDHA 2IWGB 1UNBA 3JB4C 1BLZA 4XIKA 4PLMA 1PHMA 3ZSLA 2JENA 3SNMA 5CBLA 4TWTA 4NROA 1RB8G 1XJAA 2WQ8A 5H9SA 4CXYA 2XVLA 5CKMA 2GN3A 3IMNA 1PMIA 4RN5A 5A3TA 2EIGA 3N7LA 5KWRA 5KHKA 4XFGA 2ZGNA 3BALA 1SPPA 2R063 4QPIA 1JBCA 2VZVA 3RS6A 3AZVA 3E5XA 3OSDA 5JPNB 2EXIA 4R9AA 2YGMA 1PX3A 1HDKA 3B9IA 1G6NA 2AYHA 1OBNA 4NAOA 5LA2A 3RYKA 3VHNA 4CVUA 5CIRA 4YPJA 1I9RA 1ZX5A 2BUKA 2LW8A 4N7UA 3FC0A 3I3QA 3FJSA 4B1LA 2G4IA 1R082 1ZZ9A 4K8FA 3LQCA 3N9NA 5FQ0A 5F3GA 1XC6A 1ZBA1 4DB5A 4WVZA 1IPKA 3VBHA 4BQ3A 2VUAA 5ERLA 4AFCA 2VMHA 4FOQA 1OKQA 1YFUA 4LKEA 4P9JA 5LK5A 2Y33A 3KB5A 2NP0A 2UWCA 3H1WA 1W04A 1QDOA 4AZZA 3UK9A 3HT2A 1D7PM 3UKTA 1S0IA 2NYYA 2K0GA 3LFMA 3UGGA 3O5SA 4MZUA 4Q5OA 3LDBA 5A32B 5CAZA 4GD4A 2LROA 5C3SA 1CAUA 2PAMA 3MV01 2VE1A 2HYXA 4XUOA 2BU9A 1W05A 2VOWA 3E1F1 1VB4A 2WZR1 4P9LA 4Y4YA 1L7RA 4OHVA 3THDA 1UU6A 2IXKA 2VVFA 5BNPC 1LHOA 4K21A 1RUE2 1DZRA 4I0WB 4AQ2A 4GQ7A 3OGVA 1FATA 5HV0A 4C0BA 2EAAA 2VUDA 4R9DA 4W50A 4YM3A 1L3JA 4H7MA 4AI0A 4KH9A 4NAMA 1GP4A 3RMXA 4D69A 4ES8A 1EAH2 4Y5TA 5CB7A 2I45A 5JXIA 2JIJA 1GQPA 2JX9A 3IIIA 2CY6A 5A1FA 3ZFGA 5A6ZA 1XNTA 4UF0A 1JYWA 4FBFA 4L11A 3W5MA 1G86A 4KBBA 4FP3A 1NA1C 3IDEA 3MEPA 3AXDA 3FX3A 3NNLA 4Y26A 4AEKA 3LA2A 5JLVA 1NQDA 3MHZA 2XUMA 1ND2B 4OFGA 2XWJB 3I2IA 5FBZA 2Q0AA 3WXPA 1K5MB 1H9PA 4XJWA 5IK4A 1QNWA 2P6HA 3NVCA 2ZEZA 1Z7S3 3AXEA 4OVEA 4QQOA 3O1SA 3QLQA 1DYKA 2VBDA 1FPN3 1K3IA 1AR63 1ULPA 2RMU1 5CFDA 3UV9A 5LY1A 1PO21 1HQNA 3RZLA 2R041 3OD0A 2R0FA 5IUQA 3B5LB 1VBB3 4ZKTB 1NXD1 5CG9A 3DYMA 5DDJ3 2JE7A 3VV1A 4LORA 2HWE1 4G9SB 1BEV1 1GQHA 4RR3C 4D6SA 2A5ZA 2CHHA 5A7PA 5HV4A 2OUHA 4NVPA 5FK8A 2F6BA 1GSLA 4XQDA 2WZ8A 3MIHA 5LEKA 2HJIA 4WZFA 3RNSA 1PM4A 3AKRA 3FBYA 1E5IA 1SLCA 4JGZA 4LUMA 1H0BA 4ZXKA 4Q8KA 4QMAA 1LU2A 3L9JT 2UY9A 1W6QA 1AXZA 2R49A 4CEYA 4WVWA 1NCQA 1MQTA 4XTMA 3J9SA 5FK7A 1NX9A 3TBDA 1VRBA 2BQPA 3AP7A 3DKWA 4GB32 1OOPC 1I5ZA 4INDA 3I54A 1VBA3 2FZ1A 3FBMA 1RUD2 1XNCA 4ONUA 4UBGA 1URXA 1VR3A 1T6GC 1G9CA 4GULA 4XF1A 1BZWA 4S2FA 1OD5A 4ZS3A 5KC6A 3CLPA 1OFNA 1AUYA 2W1UA 3B69A 3S7EA 3FWEA 2SBAA 4A44A 2HWC3 1AR71 1RUC1 5LRRA 2OPKA 4QPIC 5G05L 2BPA2 3BTZA 4XDPA 3PJYA 1GZCA 3ZIXA 2K9ZA 3GBFA 2D6KA 1ZVFA 1W6NA 3SCFA 4PI2A 3OGGA 3LDRA 4EN7B 3JD71 1WMDA 4M00A 2R072 5J09A 1STMA 3OG2A 4LO7A 2O1QA 1CX4A 2BVVA 3P6BA 4IEVA 1N1SA 2R7EB 4N8MA 4FAHA 1ND3A 3GZUC 1OUSA 3MW2A 4PLOA 2G9ZA 3AJZA 3VBHC 4AFMA 4P9XA 4YVSC 1H2NA 3WF2A 4Q2FA 3C7EA 4D7TA 1G9FA 2BW8A 4LITA 2NZ9A 3I3DA 2WNVA 4UXAA 5FUNA 4RFRB 2CV6A 3ABZA 4BK4A 3KWVA 1W8WA 1YO8A 2O0OA 2CU5A 4UT5A 2VOVA 2XL7A 1LEMA 5F2SA 3FLTA 3OEBA 4EN8B 4E8CA 3POFA 5T54A 2H6CA 4MG2A 2F4LA 5A33B 3IAPA 2J1VA 2XVGA 1GMMA 2C1FA 3I3BA 3FFZA 4C8DA 3CMGA 4XZPA 5IHRA 3ETPA 2D44A 3E6BA 3UYJA 3DXTA 4OI2A 1PO11 3Q8AA 3SKJE 1GR3A 1C4RA 4YVWB 5FZDA 1AYM1 3KF3A 1TMF1 4L2NA 5L19A 4XUQA 3EO6A 1YXWA 1YC61 4GH4B 3IDAA 1QJFA 2D97A 3BPZA 3M3EA 1QJY2 3A7QA 3NL1A 2ETEA 2ZXQA 2GN7A 4CP1A 4CU6A 2PHDA 3B7MA 2ZEYA 2VW0A 4PHZA 2D6MA 3ZFGC 1AR82 1UWWA 3H9AA 3MGUA 2IFWA 4KQ7A 4AYUA 3HQRA 4FFIA 4XFFA 4NIAA 4D0QA 2B39A 4OQ9A 1OURA 3RSJA 4E9KA 4QKDA 3IIAA 5FDBA 3PMEA 4XF9A 1UMIA 5LBCA 1FOD2 1ODNA 1XOYA 3MYXA 1UZ0A 4S2DA 3OBAA 1VBD2 2RR13 3HN1A 4Y1XA 2DV9A 5FP4A 1R64A 4AGGA 3GGLA 4LULA 1SLAA 1OVPA 3TN93 5A6XA 5LZ6A 1C8M2 1CN1A 4O9EA 1SDWA 3ZXEA 4MGZE 4XETA 5EHDA 5CFDC 3U75A 4XFBA 1QF3A 1HRI2 4PLNA 5T55A 1WCDJ 3C2UA 3HQXA 5C70A 2YGLA 2W52A 5A3NA 1HXS1 3J4UH 3WUDA 4COZA 2E33A 1EYBA 2VZPA 2WFPA 1C8NA 3MF6A 3I97A 5C8CC 3M3IA 4CXWA 3S30A 1GOGA 5APAA 2WO3A 1Y9MA 2C9AA 4JGZC 4LBKA 4UBHA 2MEV3 4AAXA 1ZBE3 5A32A 3CZUA 3UETA 3ROUA 2YPDA 3H7JA 1S2BA 2HEYF 1DIWA 4CDXB 3AFGA 4CEYC 3GZAA 2VCCA 3Q8CA 3VD5A 3IDBB 3VBOB 1K5JA 3ZFFB 1NCQC 4PCRA 1MQTC 2A70A 3O0VA 3WF3A 1WMXA 2WLQA 1WLCA 3QH6A 4X6RB 1XU2A 3V0AB 1ULOA 2AZ5A 2WWUA 2X5IC 4WVVA 4UWDA 5BNNB 2GC1A 3B94A 4CCJA 1ENXA 1YFXA 3N9LA 4UW4A 5ANQA 4B3NA 3LE0A 1Y3TA 3DKQA 1I5PA 4QKFA 1LGBA 3B00A 3VD4A 1QJU1 3KT7A 1JYNA 1VE0A 1UCXA 2V09A 3CF6E 2RS33 2QQOA 4BWOA 4HK8A 2J1AA 1Q8OA 1W8HA 4NWVA 1W39A 1QU0A 1AYN1 5L9BA 1E57A 3HBZA 1XE0A 2DU1A 3K4AA 4KWJA 1ND2A 5JOYA 5KHJA 1C28A 1HRV2 1MPXA 5EYYA 1K5MA 4YW1A 3WF1A 2GZWA 3RDIA 5FFOC 1JOJA 1ULCA 4CCLA 5A1AA 1WMFA 5E1RA 4ITCA 4KI5M 2WS93 3EBRA 3K48A 1ND3C 1IKPA 5FMOS 1NY72 2Z69A 3AVSA 2XUEA 4MYEA 3E6CC 4LK7A 2WNVC 3H7YA 1W8ZA 4RHV3 1CD3G 5IT6A 1V6NA 3NMBA 4A6OA 1ENRA 3OEAA 1ENQA 2QZ3A 3RYRA 1VBC3 5BNOB 5BV6A 3GCXA 4BOWA 3ZR5A 3IZOA 3GYDA 1VBE3 1SCSA 1YFYA 4M3CE 4IEPA 5JIAA 4M3CB 3WD5A 2Q8CA 2XWBB 3ILRA 3I3EA 5L9RA 2JE8A 2WA3A 5FY4A 4CCNA 4N7IA 3GXUA 4PDWB 4XDOA 4FOWA 4PBOA 2QKDA 4L99A 4QD2A 4Y5SA 1JZ7A 1VP6A 2VVEA 3ZKYA 5LRSA 4Q4W2 2FDKA 2XHKA 1PGW1 3NRUA 2FMDA 4QGMA 3SLIA 1W99A 3HMYA 5JOWA 2CGPA 2GNDA 4AVSA 1G9BA 1IZ3A 1S4CA 4X8PA 2A1XA 1WUVA 3R4SA 3DUIA 1W9SA 5FZ6A 1PNGA 4Y1YA 4YARA 5L7OB 2BBVA 2JDAA 4A3ZA 1QIQA 2EXJA 2UWAA 3SEPA 1UY2A 3CU7A 1PZ9A 3HOBA 3I49A 4PIXA 1R083 2YC0A 3DYOA 1F15A 1V9U3 4AF9A 2EIBA 2V4AA 4KWUA 4Q4X1 2EALA 4CDQC 2OA2A 1MS8A 3JQXA 5F8PA 2EICA 4M01A 4KMQA 1GANA 4CCMA 1FX5A 4EWDA 3KM5A 4LE3A 1XE8A 2GMEA 3VZJA 1ZA4A 1PIV3 3KT1A 1LECA 3H8RA 2ORZA 1W6OB 3KVAA 4BE3A 4FFGA 3NWKA 2VNGA 4LHNA 2Y6LA 4P5HA 4DRRA 1JTZX 1YIFA 4AFBA 3J8F1 1TME1 2ZACA 2XOMA 5DMYA 4AQTA 5A33A 2JD4A 1LOGA 5AC93 3T08A 1RUE3 1RGSA 2ZHKA 3K4ZA 3NW4A 1RHI1 3BU0A 1M06G 1NCRB 4KGGA 4TSVA 1WW7A 3S5QA 5IVFA 3RWNA 4WV8A 5SV8A 4YZ2A 2Z2SB 4YVWA 2VAUA 2R1DA 1AL21 1C57A 4OUEA 2OQ7A 1EAH3 2ZEXA 1ZRCA 4AFAA 5K0UB 3CDZB 1JHNA 4FT8A 1IGOA 4CDWB 1H1MA 2RS51 1HN1A 4NMIA 5JCTA 2WAOA 3AJYA 3ASIA 4JDNA 1ODMA 5K4LA 1VBB2 1REDA 4BZ4A 1KITA 2WKKA 2F4PA 3ON7A 3C7OA 4OMDA 2QDRA 3WNLA 4NR1A 2OZJA 2PAEA 5C3RA 4DRVA 1GYKA 3J7LA 1ASJ2 2DTWA 4LBQD 4TYSA 4AXOA 3A22A 2MPFA 1JMUB 4OHZA 3CQOA 1BCXA 3FZ3A 4FI9A 4YG0A 4GMP1 2W1SA 1TNFA 2XDVA 3OB8A 2BV4A 4LBLA 4P9GA 2RDNA 3ZXFA 2VM9A 4PQQA 4U2AA 2A6YA 4ARXA 4DXZA 3BPSA 2BBAA 5FO7B 1W2TA 3N7KA 5CISA 3W9AA 1N47A 1AVBA 4N43B 1NOVA 4YZ4A 3RI8A 1RUF3 1US3A 1FT9A 4TN7A 1W6MB 5IK5A 2X53S 4XXPA 1W9YA 1V70A 1IS5A 3AP9A 5FMDA 3QD6A 4AAPA 1RUG1 4FSJA 4GB33 1R1A3 1QGLA 2ZBJA 1YQCA 1RUD3 4HOOA 2BDRA 3VBOA 4NE9A 3ZFFA 4CU7A 2RM21 1K12A 1U0AA 4GAZA 2FDFA 2O14A 3V0AA 2ZGOA 1BMV1 2W0XA 5BNNA 1IS6A 4CDUB 3NKTA 4JHTA 3R05A 4DS0A 2YB7A 5JDBA 1Q8SA 1TNRA 3POYA 2PHRA 3LDKA 3VD7A 3WNKA 1FMD2 2EXHA 3I2DA 4MGYE 1YQ5A 1L7LA 2HWD2 3FL7A 2D40A 4XJZA 1IG3A 2YY1A 3E6DA 3WLUA 3LEGA 4A45A 2C9KA 3U10A 2R073 3KZ4C 3OJBA 3W5NA 4V2VA 4E4HA 4G3YC 5FBJA 3IPVB 3WNMA 4CUCA 2J1RA 5AVPA 2RJ2A 3ILFA 4N90A 2BZDA 2VUCA 4BIFA 2BRTA 4CTEA 1KDMA 4FTBA 5FY5A 1LAJA 4FXKB 4LPLA 4CA9A 2XKOA 3ACGA 2WFF1 3OCPA 3N4MA 1EPZA 2W1WA 4BISA 4ATFA 2NN8A 3FHQA 3ZSKA 2DBNA 2WQZC 1CZSA 1V6IA 5FXZA 3ORJA 4ORFA 3VHPA 2WSUA 4EN6B 5BNOA 4WM7B 4NN0A 1CAWB 1E5RA 2AH2A 5EWSA 3LOBA 5FTTC 4EROA 4FVVA 3TOJA 1F35A 2W87A 4K7JA 4CYDA 5FPUA 1KS4A 4YW5A 4M3CA 4S2HA 2ERFA 3PJQA 3LSDA 4YRDA 1X8MA 3E5UA 3N9OA 5EP9A 2MHFA 4B4QA 4Z2AA 1Q8QA 1H8TB 2ZGSA 1DYPA 4IESA 1AJOA 1QJY3 4PDWA 4YVWC 1IS4A 4Q8LA 1AZDA 1SDDB 4C1WA 5A6YA 3TNPB 2JJ6A 1V6LA 2PN5A 3KGLA 3SH4A 1UMZA 2DTYA 4BYYA 1AR83 2HEWF 2PHFA 2RS11 1NE4A 3TN92 1CX1A 4K20A 1W0PA 2ZAHA 1XB9A 3AP5A 4O61A 2YDEA 1BYHA 5LB6A 1CQ9A 4QX7A 3ZXDA 3H8XA 4A2UA 4JDMA 2R32A 4FPKA 1RITA 1PMJX 2DURA 5L7OA 2AR6A 1VBD3 4IE0A 4HKWA 2VZTA 1W2UA 3JU9A 3M3OA 3U0ZA 2J1SA 4RFT0 2PHTA 2PLV1 2PHLA 4Y1ZA 5JR2A 2QQVA 1C8M3 4JDOA 1RUH1 2RJLA 4NOTA 5FZKA 4BQ1A 4WBBA 3AK0A 1S0CA 4HBNA 4IV3B 3KV5A 3TEYA 5J96B 4HN1A 2YYOA 3WUCA 1XSRA 5I91A 2E7AA 1MEC1 3NNJA 3S6PA 1UOJA 4ET7A 4IEWA 4HG6B 5E6HA 1W6OA 2W39A 4BHPA 1QJX3 3H1MA 3X29B 3SMHA 1OPMA 4F7ZA 3OUJA 3V0BB 1POV1 1AX1A 1KJRA 5FZAA 2JB8A 2WNUB 3AZXA 5DAVA 3JUUA 3VGIA 3KVBA 1WLDA 2ZHNA 3RYPA 1DQ6A 5FWJA 1VRH1 4BH9A 3POGA 5DQ0A 3UJQA 3G6JB 3JBG3 2JKBA 1DCSA 4OZOA 1QQP1 3D0JA 3USUB 3DV8A 1AL0G 1NCRA 1XYNA 3SC7X 2ZX1A 3ZMNA 1GICA 2XL9A 4FPHA 3ZFFC 1V6OA 1GWLA 1COV1 5DXDA 4D7SA 1HV1A 3VZOA 1RUOA 4DNYA 1AX2A 2RMU2 5FMOL 4AL9A 3T4HB 1YFWA 4JZRA 5BNNC 2VQUA 5K0UA 4P00B 2VOXA 3ZYJB 2FZ2A 4QDRA 4D6RA 1OC1A 4CDWA 2VECA 2JG8B 3WCSA 4Q0UA 2HWE2 1AF9A 4V1PA 4XCAA 5FMCA 5JAXA 2HWB1 3KCCA 2YROA 4RHV2 2ZX2A 1PK6B 2VCBA 3KV4A 4JTNA 1VBC2 3O7OA 2VTXA 5LBFA 2B7YA 4Y5Z0 1VMHA 1PZ7A 3POBA 3SITA 1JYVA 1D2SA 4QQLA 3VBSB 1XRUA 1W8FA 3OTFA 1LU1A 2PYTA 1POQA 3LPFA 3T30A 2Q8EA 4Z07A 1GU3A 2V72A 4ES9A 3WP3A 5CFCB 4LO6B 3VD3A 1H4GA 2Y8KA 3WF4A 4KU7A 1WCKA 5KC5A 3PL0A 3LA7A 3IMMA 4B7KA 5ISLA 5FZOA 3FFQA 1UY0A 2V5DA 5EV7A 2OYZA 3I2GA 4C0HA 2D43A 3O1MA 1HB3A 3JZVA 1DU3D 1QH7A 1AR72 1RUC2 3C7HA 3OPTA 3WR0A 4IL7A 4JQTA 2A75A 5GLTA 3K46A 4XW3A 4EQVA 5BNOC 2OUJA 3I2HA 1G7YA 4HPKB 4N43A 4RQPA 3DL3A 2WWJA 3Q9OA 3ZYBA 4E4SA 3AKPA 3OPZA 1SMVA 1WMEA 1J84A 1W6MA 5SV5A 3TYJA 5HCBA 1O4ZA 5CYYA 4QKBA 4PI0A 4K1ZA 1HX6A 3JD72 1S2EA 3WDVA 3ZR6A 4Q4W3 5KR7A 4HSJA 5FP3A 3HNMA 2LALA 4PDWC 1CAVB 1RVF1 4QU1A 4WM8B 4Y33A 5F3IA 4CCKA 2AGSA 2D6PA 4LA2A 1V9U2 2XONA 2UY8A 1MZFA 1LNSA 3O12A 1XYPA 4QXKA 4HKLA 4QDSA 4LT5A 2XJSA 1QXJA 2WO2A 4HL0A 1UYZA 2IUWA 1CR7A 2D6NA 3F95A 2HWF1 4CDUA 5C3OA 3N3HA 2JKXA 1HLCA 3M7AA 4NHLA 1UQXA 1YEWA 4MUVA 1U5ZA 4J25A 4HZFA 4HONA 1OKOA 1R091 1PIV2 1YLLA 2Q8DA 2XJTA 5L7OC 1XNBA 3AFKA 4XILA 2YG0A 4NPLA 2D3PA 4DMIA 3A0KA 1RMU1 2EIEA 2VTFA 2A3YA 2RJKA 1WCSA 3GHNA 1DQ0A 2QTWB 3IPVA 3KS7A 1DBNA 1DGWA 3AL5A 4QX8A 1AYM2 4MO3M 3LB9A 4XC9A 2W1QA 4Z82A 5L9VA 2P3IA 5AC92 4IEOA 2DCYA 4Y1VA 4UOJA 1OUXA 2WBKA 4K3UA 1OSGA 1WA4A 2W08A 1MZ6A 2BNMA 2G9FA 1X50A 2WZEA 2ZMLA 4H55A 2VW1A 4OHYA 4XPVA 2BERA 3LEMA 1UAIA 3EQEA 1MVQA 1RUI1 3ELNA 4WM7A 2VMDA 1OQDA 4XF0A 1CAWA 5IFTA 3RZKA 3NV1A 5FY0A 4FO9A 1LKNA 3CJXA 4META 4QQ2A 5EFUA 5FZFA 3VKMA 2ZAAA 3MDPA 4D6QA 3OUHA 3ST7A 4PT6A 4AG4A 3RJ2X 1EUUA 5I0RA 1S0EA 4KU8A 1NCRC 1F8VA 1W8UA 3AL6A 5HI0A 5CNAA 1QOSA 3BOPA 4Y4RA 2CDOA 4CU9A 2VZRA 2YC2A 3GHMA 4KWLA 3AX4A 1WLWA 1J3RA 2A3WA 4AQ6A 5I93A 4CDWC 5FRAA 1JZ4A 5FUPA 1DGLA 2C4XA 3WDUA 1I1EA 2DUQA 1YRZA 4XAEA 2VD7A 2XJUA 1UU5A 4XURA 1QY4A 1W2OA 2R0HA 1X33A 2PA7A 1ASJ3 2W68A 5A7NA 4XBQA 1SEFA 1W9WA 4YLZA 3THTA 4COYA 4TTGA 3BIWE 4LO8A 4OI4A 4P5YA 1OD3A 1QDCA 3PTRB 1Q5OA 1RUF2 2P3JA 3RZZA 3I3MA 1OT5A 4AW7A 4AR2A 4COVA 3BOWA 5FPLA 4V2WA 1FV2A 3PUHA 1WD3A 1OI6A 3EMRA 3HAGA 5BUVA 1NG0A 1R1A2 1Y9QA 4IV3A 4N53B 4ZY9A 3BODA 2NMOA 1JZ2A 4HMZA 4QB6A 4Q0VA 3WNNA 1RUNA 3FLRA 3TEWA 1EY2A 4QPGB 5IFPA 1QJU2 2H0BA 2IXLA 3C7FA 3ZPYA 1DZQA 1RUJ1 4Z2WA 4HKOA 5FYHA 1LULA 2PXJA 4RQPC 4N43C 3V0BA 3O1OA 4QX3A 4BM8A 2VC9A 2WNUA 4NIIA 1AYN2 1ST8A 1JYCA 1O5UA 1W03A 4UW6A 4DUVA 5FO8B 4Q4Y1 5A3LA 1EV13 4M4RA 1N1YA 1J1LA 3WT3A 3AMPA 1W9TA 4N9IA 3HR9A 3USUA 3WF0A 4L8QA 5AVAA 5FZIA 1TEIA 1IPSA 2VTXJ 2WNOA 3ZFEB 3U4XA 1NKGA 3UKVA 5EJ3A 3GALA 1XU1A 3GM8A 2XJQA 4IEZA 4YM2A 5FOJB 1FMD3 1SHWB 2DBIA 3UT0A 2P37A 2P17A 3PHMA 4CDUC 5J48A 2HWD3 3H42B 4Q27A 1MVEA 1R1ZA 4IGPA 3D82A 2JG8A 2WO1A 1B35B 2E32A 4BQ4A 2Y6HA 2N7GA 3VZMA 3AZYA 4BQXA 1ZA7A 1JW6A 1LRHA 3LGRA 2XLGA 1QWRA 3ACHA 5FZHA 4LHLA 4LHSA 1LJ7A 1V6JA 1JZ6A 3CEWA 2ZKLA 2WC2A 1GV9A 1OH3A 1PK6A 1PVC1 2I2SA 2FCTA 2ZX0A 3KQRA 1YJLA 2IC1A 4P9WA 1MS0A 5IVEA 4IE6A 4IXLA 4ZZ8A 1UU4A 1OA4A 4CEWB 2A6VA 2F17A 1S0DA 1IKQA 2VY0A 3ITQA 4Q4V1 1PGW2 5CFCA 1VMFA 4BPZA 5F7UA 2Z4FA 4D8MA 4IV1B 3CHXA 3PVOA 4IE4A 3Q8FA 3FUQA 1Q3EA 5FZMA 5ACA1 5FZEA 4HXCA 1DG6A 3IN9A 2XBO1 1F5FA 2DYCA 2ZMNA 1U5IA 2DFBA 5KHIA 4WM7C 3S5AA 5F5QA 5FP9A 4MHUA 5CADA 2EAKA 4HPKA 4QX2A 3T3YA 3ZYFA 4YZ5A 4ZHNA 3N9MA 1UOBA 1W6PB 5GLVA 2W9XA 3POSA 4LBJA 1UPIA 5E16A 3ZX7A 4H14A 1ZBA3 4Q4X2 1U12A 4OUMA 4XMIA 1CONA 2DCZA 3VBFB 1PNFA 1CAVA 3ATGA 4WM8A 4HVQA 2GMPA 1YUDA 5DPNA 5E89A 5K8SA 2OX0A 4OZXA 5IVYA 2VMCA 1D0GA 4A41A 2C0ZA 3N7MA 1XQNA 5GLZA 4QX1A 4MGTA 2CGNA 4YW6A 2PTMA 2ZPXA 3AYEA 2J1UA 2IXCA 2ES3A 3J8F2 2WZR3 4R4XA 4AI3A 1N3OA 5HCAA 1QJZA 3PIJA 4PIYA 1QJX2 3WVJA 2VBBA 3VBUB 2YU2A 3VBRC 1SLIA 2JDUA 2ADEA 3HJRA 3ZXJA 4AK3A 5C33A 4CXXA 2P2KA 1H1IA 1KDKA 1O6UA 1AL22 1YI7A 3ZN5A 3JBG2 1QKQA 4IV3C 4IGOA 1B09A 3KF5A 5T52A 3SH3A 4LOTA 5C6CA 3DGTA 3T2OA 2RS52 4ASKA 1MZ5A 3MUY1 4I30A 4EWEA 4DUWA 2FDHA 3O14A 5F3EA 3D0SA 2Q1ZB 2V5YA 5FJKA 3WG3A 2Y0OA 1G8WA 1DHKB 3VUOA 3I2JA 2JDZA 5FLHA 3URFA 4QPWA 2DU0A 3WQ0A 2B9UA 5CEHA 5LA1A 4RL7A 1KEXA 4O65A 3U4SA 5FY7A 3LAGA 2RMU3 4PIZA 4XF3A 1S2KA 1LOBA 4G4FA 1PO23 5LASA 4DUXA 3HD8B 1LOFA 2R043 3HWJA 2VNOA 3WV6A 2WLPA 1X82A 4XFIA 5DUVA 1KQRA 1JI6A 2C6SA 1BEV3 2HWE3 1MZEA 4XYXA 3OGJA 3AYDA 4FPOB 3MIBA 2GH2A 5CZKA 4DEQA 4F3JA 1KD7A 4ZZ5A 2X10A 3TEXA 3ZDVA 3OD4A 2CNAA 3F2ZA 4AEDB 3LA3A 4FPGA 2JG8C 4LTAA 3WHTA 1PGSA 1Y7BA 2VL4A 1GZTA 4Y3OA 1OF3A 4OHWA 4KL1A 4RSUA 3I7DA 1C1LA 2ZGPA 1U5XA 2XVKA 1PK6C 5LBBA 5A70A 2B5HA 3ZYPA 2YBKA 4B4PA 3ZYGA 2HLEA 1RUG2 4RD7A 1WW4A 1LOCA 4XACA 1AR91 2RM22 1WLTA 2ET1A 3USSA 2HBUA 2VNRA 1UIJA 5CFCC 3O0WA 4N53A 4DY3A 2DCKA 2PMWB 2ZCWA 2Y6JA 3E5QA 3MPPG 4AGVA 4AI8A 1L7QA 1AR73 1KFUL 1RUC3 4GKXA 3VDAA 4AVAA 4QHZA 4QPGA 4A42A 1LR5A 3POWA 5LCWL 2OPWA 2VMIA 3ETQA 4UFLA 5FOBB 1YWKA 4NRPA 3RVHA 4E4DX 4GWMA 1DGRN 5EZWA 4XIOA 2P3YA 2AEZA 1VAMA 3JD73 5FYUA 4LHKA 4BU2A 1SCRA 3WG2A 1UIKA 5J1XA 1XNAA 3W21A 4HETA 1BBT1 2PHWA 4UAPA 2BGPA 1ZM1A 3VN4A 4YYOA 3PMSA 3VKFC 2QFEA 3U07A 5FZCA 1YJKA 1OHFA 1WCUA 4WM8C 4NRMA 4AWDA 4LUKA 3THCA 4M0HA 3ZFEA 3ES4A 4EN0A 2WFF2 4JHZA 5IVVA 3QH7A 4F83A 1CWPA 4UFJA 3WQBA 1GNZA 4L92A 4IQPA 2Y6FA 2GC2A 3TAYA 3ZIWA 1E5SA 3P3NA 3VLBB 1DQ5A 3NV2A 2X09A 4C1XA 2O8QA 2AC1A 5FAXA 4XHBA 1B35A 1N3PA 1V6MA 1FOD1 3LEIA 4U36A 4A3XA 4LIUA 1PO13 4SLIA 2BOIA 1S0FA 5D21A 5T5JA 1AYM3 4I02A 1TMF3 1W0NA 4QXHA 4ASMB 1W90A 2AREA 4X8NA 1I3HA 5IJRA 1BXHA 3KSCA 2CSGA 3V64A 3D3AA 1YNAA 4B29A 4DIQA 1UD1A 3IAQA 3BYWA 3QOPA 5EPAA 4CEWA 5HXMA 4YFWA 5EIYB 2ARCA 2CWMA 1HRI1 2D5HA 2OVUA 1H2MA 4GH4A 3VB9A 5FYTA 3PNAA 4I3GA 4GALA 1QOOA 2RS12 5JPMB 2WINB 2G19A 4IV1A 4M0NA 4JGYB 1JZ5A 4Y1UA 3SEEA 3MICA 4CCEA 3ACIA 2ATFA 2ADDA 3O1VA 2BOJA 5JOXA 1Z78A 4NIGA 3M4FA 3LZZA 2QQKA 1ALYA 1DQ4A 3ILNA 4CUBA 5LW9A 1RINA 5BNQA 1FYUA 3KD4A 4RYDA 4J1XA 1X9PA 5L36A 1UYPA 3EJKA 2ZHMA 1W6PA 5F5AA 4PBPA 4FOYA 3ZSMA 1ND2C 1RUH2 2UYBA 4B8EA 3D8CA 1K5MC 4XJ9A 3ZXGA 4BQWA 1LOFC 3VBFA 2TUNA 5FZ1A 4EZ4A 2QQNA 4IERA 4A7ZA 2Q4SA 3OOXA 3R0RA 2XQXA 1CJDA 2ET7A 1PMHX 3ME2A 4HVRA 4Q29A 1SLLA 1UY4A 3KCYA 4RR3B 5DUUA 4PF5A 1HIXA 1HXS3 3AMQA 1D4M1 1X7NA 1MEC2 3N9QA 3PIGA 4MGKE 5GJ6A 3U11A 3E97A 3UGFA 4A7YA 5FPVA 3MFCA 2R1BA 5T5OA 4WZCA 2QQWA 2VW2A 4D94A 2BGCA 2VUJA 4CRQA 5CKQA 1O4TA 2WABA 2VGDA 2CWSA 1F31A 3MLJA 1REEA 5TSWA 3GZTB 2JWPA 3WINE 3R6SA 1HRV1 2GC0A 4YGCA 1VRH2 1N1VA 1O3TA 3VBUA 4AQSA 1ZNPA 1OOPB 3KMHA 4TLGA 4JC1A 2ZA9A 2WDBA 1YIPA 3GJBA 4CDXA 5FZ7A 1EUTA 3CNAA 3NV3A 4HVOA 4BDVB 1COV2 1EV12 5DZEA 5JVVA 1F2NA 4AEJA 4GJZA 1QJU3 2WAAA 3VKLA 2XH6A 1IG0A 4HK9A 4MX3A 1K45A 4O7XA 2R30A 4XJAA 1ZREA 1J1TA 2O8OA 3VZLA 2P4EA 2PQSA 3WW3A 2W5FA 4CSWA 2FBEA 5B2GB 5LWBA 4FPFA 5JI9A 1CESA 1NZCA 1AYN3 3MIEA 4Q0PA 3NNFA 3WP6A 3CL1A 3KT4A 2R061 4YM0A 3NNGA 4AGRA 3HBKA 3AYAA 2LS6A 2GP5A 2WA4A 1WWYA 2IZWA 4BB3A 3I4IA 4KG8A 2FCVA 4E2GA 3D6EA 1V00A 2VZOA 2CGOA 1DQ1A 1DDLA 2LM3A 1CGPA 5JZGB 3SCHA 3NAPB 4XJUA 3ACFA 3PU8A 4Q1PA 1W0OA 2GNBA 2ZGLA 4YVSB 3AZWA 3OBZA 2PAKA 1QXPA 2A73B 1UY3A 3NJXA 2UURA 5T5PA 4AVBA 3NO8A 2VMFA 1LB2A 1JYIA 4XBNA 4ARYA 4DFSA 4AEDA 2WWSA 3ZVXA 3GDBA 3VDDB 2XKPA 4HLTA 5KXDA 3DXUA 3LD8A 4URAA 5T50A 4W6YA 2WNEA 2VPVA 4SBVA 5FZ9A 4LLOA 4R4ZA 1W2NA 4JX0A 2C26A 2CYFA 2V73A 1IQDC 1ZZ6A 5I8TA 4FQ4A 1NE6A 3AMNA 4XBLA 1F9KA 4RS5B 1HQWA 5FKBA 4RA0A 1YYNA 2Q30A 1OVSA 3T2PA 2JG9B 3V56A 1ZBA2 4NHYA 3LFIA 4CEWC 2E7TA 1DLLA 1UXXX 2XLAA 2WT1A 4GH4C 5F9TA 4LXLA 4XQ4A 2QQJA 2XJVA 2UYAA 1JXNA 1WBFA 5J3UA 5F6KA 4IV1C 2QE3A 3ZLIA 2YFZA 1ONAA 5FYMA 1D0HA 3DECA 1LHWA 1SACA 1SLBA 2ARXA 1JUHA 3L2YA 4CP9B 4HT1T 2E9QA 2Z42A 4BA6A 4IW3A 4Q0QA 5A3PA 4QKNA 2FHRA 1SQ4A 5LK7B 3N9PA 4QXCA 3N36A 4Q4X3 5C5UA 1RMU2 3CKHA 1HB4A 1WW5A 4LKSA 5JXHA 3POJA 3HNYM 3JB8A 2WZR2 2RDQA 5KXBA 4BIOA 4X6QB 4CUGA 1PGL1 2IXIA 3LWCA 5ABJB 2OQ6A 1NQJA 2XJRA 2Y0IA 5DN2A 1Z7S1 1HJGA 1ZRDA 2YFUA 4JV4A 4UFKA 3BGAA 4NPMA 1FPN1 2BJSA 4FPYA 1AR61 3IBMA 3OBRA 1GZ9A 1UMHA 4NWWA 5C8WA 2BWAA 4TZDA 3S57A 1WKYA 1J83A 4XTPA 5JMOA 3DEMA 2YV8A 1OMIA 1VBB1 2NLRA 3J8F3 3LIGA 3PURA 1TME3 4FPEA 3QBQA 4YW2A 4MGIE 5DDJ1 3RPQA 5C8CB 3RG0A 2P3KA 3H50A 4HSLA 4JRLA 4R52A 2WYFA 5BXXA 5A7WB 4EZHA 1RHI3 2WQ4A 3NJYA 3VDBA 4LBOA 3WG1A 4BCUA 5J7MA 4IDZA 5LATA 3WHUA 1RYYA 3VBUC 3H8OA 4MSVA 5HCHA 1AL23 4AOCA 5A3MA 2X5IB 1DZTA 1EP0A 5GLWA 1OLQA 1O59A 4CDXC 2A6XA 3BTXA 5FMBA 5T5LA 4NIDA 2ZGKA 3VBOC 2X05A 3ZN4A 2RS53 4DXSA 1UOFA 1IPJA 2IXJA 4R9BA 3ZSJA 4FAGA 1PO22 5EYXA 1CIYA 1O3QA 1VBA1 2R042 3FUOA 2VZQA 5A3WA 1CVNA 4YM1A 5CVRA 4JGYA 3OGRA 4JAAA 1BEV2 3Q8EA 3DYPA 1UPSA 3NQHA 4LA3A 3WNPA 4E4ZA 3RZHA 2QJVA 1OH4A 4IEQA 2E6VA 2XJPA 4CCOA 2HWC1 2VULA 1OQ1A 4BK5A 4XABA 4NHKA 3SISA 4CZSA 3DCQA 4FCAA 4MVTA 4P02B 2EA7A 4NIHA 2PHXA 4GMP3 5DAXA 2J1TA 4ATEA 4QGNA 5GZGA 2BNOA 3J7HA 5FYIA 4A4AA 1DP0A 2YZ4A 4QM8A 1GFF2 1LHVA 3WP5A 3WQ1A 4AI9A 1BQPA 3TNQA 4AI2A 4BLIA 4DEVA 4UW5A 3A23A 2Z79A 4RR3A 4J1WA 3PUQA
chains in the Genus database with same CATH topology
3WW4A 3J26N 3RRDA 2A71A 3P3PA 4AEDC 5K9YA 1RUJ2 1RIRA 3HIFA 1SFNA 4Q0SA 3VBRB 1WGPA 4AHZA 1RUG3 3LOIA 4XFHA 4PJYA 1X8EA 4Q4Y2 2BWCA 1KXGA 3AP6A 2RM23 5GLUA 4WVMB 1OOPA 4XMAA 5DUWA 2E51A 1RTVA 2D5FA 5KBFA 1LHUA 4YW3A 1KRIA 4JVAA 2GALA 4MLOA 5FPXA 4TLFA 5I0SA 3PVEA 3R4DB 4F8AA 1S0GA 2JE9A 1PVC2 1GNHA 4CDQB 2ZS6B 2XPJA 2UWBA 4MXWB 3ZYIB 5J37A 2WSVA 3W59A 2NM1A 2CTVA 4KGQA 1PO12 4QQPA 5JZGA 2RR11 2WFF3 3NAPA 4KG0A 1TMF2 2VQ0A 4YVSA 3N7JA 5C9AB 3WP4A 5JWPA 4Q4V2 3LKJA 1IHMA 3TN91 5FREA 1BJQA 5ACA2 1ULGA 2DCTA 1PZ8A 1Q43A 4XDQA 1VLNA 5CA6A 2QNKA 2XBO2 3B02A 1A8DA 1LODA 2VQAA 3NKGA 3T2TA 2QDNA 3VDDA 3AM2A 3TWIA 3LCPA 1MR5A 3RJRA 2NQYA 1H2KA 3SXWA 1GZWB 3WW2A 5BYNA 3G7DA 2KA3A 1D2QA 2XB6C 3S7IA 3AKQA 2D3SA 3IWZA 2MEV1 1ZBE1 4YZ3A 3I59B 3DF0A 4DINB 2TBVA 4H7LA 4RS5A 2Z5WA 1H8TA 2AUYA 2RS13 5HXVA 4DPNA 2JG9A 1XYOA 1MS4A 4W6WA 1OA3A 4CP2A 4HFSA 1UZYA 5HCFA 5K0UC 1O3SA 1LOAA 1NLRA 4JGYC 1A8MA 5FPZA 1HXS2 4XOGA 5LEJA 2PLV3 4YGEA 1GBGA 2RS31 4GXLA 2BVBA 4QM9A 1RUH3 2QQPA 3JQWA 3ZN6B 1WBLA 4I2OA 1Q8VA 5ABJA 1MEC3 2AENA 2WS91 3OY8B 5GM0A 3L2HA 3W58A 3AP4A 4JRAA 4K6BA 4R9CA 1POV3 5D8AB 4RHV1 3MFAA 3BB6A 3AMHA 4XF4A 5C8CA 4LBNA 1VBC1 1VRH3 4EJRA 1V6KA 2ZMKA 1QQP3 1MS9A 1VBE1 4AEMA 1A6CA 2BYVE 1UN1A 1COV3 1ZRRA 2ZX3A 4QHBA 3MF9A 2X5IA 1GQGA 1KFXL 3IDCB 3OYWB 1REFA 1ZRFA 1H30A 4YW4A 1GLHA 2KM2A 2ZGMA 2GH8A 2HWB3 1OPOA 1ZZ8A 1CAXB 2A3XA 2JXAA 4XHXA 1CPMA 1APNA 3KCXA 3INAA 3ALQA 1MS3A 5BPXA 3IKWA 4IETA 5GZDA 5IK8A 3MIFA 1H8VA 2GU9A 2GNTA 4JCKA 3GF6A 1J59A 1VALA 3QCWA 1BVVA 3VBSA 1R081 3VKOA 5JIUA 5JZGC 1V9U1 1AR92 3NAPC 2WZPP 3MIGA 4IEXA 3T1MA 2GMMA 5DG1A 3VKNA 2GC3A 2EXKA 5CU1A 4FP2A 1YI9A 4XFAA 2D3RA 3N35A 2UU8A 4QT6A 2I07B 2ZGTA 1PIV1 2G9GA 1BVP1 2D98A 1VAKA 4XE9A 4FPLA 1O91A 3VDDC 3VBRA 2EF6A 4CP0A 4FTSA 3FE5A 3APBA 3EHKA 3WDTA 1LGNA 2FMYA 3QACA 1GKBA 4AVTA 1QH6A 3VL8A 1RVF3 1SBFA 4YZ1A 3D4KA 5AC91 1BBT2 4WVMA 1RUE1 3PVNA 2ZZQA 3ZDSA 4RS5C 5F6LB 4YFZA 1H8TC 3GBGA 1HV0A 1UL9A 5KHGA 3CO2A 2HWF3 4A7KA 5JMCA 2BTVC 2JG9C 4HN0A 1EAH1 1XXNA 3KLSA 1KJLA 2H0VA 1UZZA 5KXEA 1R093 2DWRA 4MXVA 2DVFA 2FQPA 3PTYA 1WD4A 3ECQA 3ZSEA 2KXLA 4DY5A 4C90A 1RMU3 2RHPA 3MW3A 4Y20B 4FQZA 1TME2 5C4WB 1UKGA 4CDQA 1MACA 2DCJA 1S0BA 5FCCA 4OI1A 2R6QA 5LEKA 4MXWA 5JOZA 1LOEA 2GNMA 3DN7A 3DPRB 1RHI2 2Q5TA 5F1RA 5GKAC 5ABJC 3NJZA 2BFUL 2JICA 1OQEA 3MLLA 3BTAA 3ZYRA 5C9AA 4OI0A 3UL2A 1RUI3 1QOTA 1XE7A 4IEUA 2ENRA 4XJ8A 3ZXAC 5JSPA 1ZZCA 1C1FA 1GZWA 2WNUC 1RUF1 5KXCA 4DOUA 1ULFA 2LTNA 4XXAA 5E8AA 1BK1A 3VZNA 2PFWA 3I59A 5DUXA 1FAYA 1HKDA 1R1A1 2B45X 3CJIB 4GB31 1ZZBA 4XFCA 1RUD1 2H6BA 4Z8BA 4AHWA 4ZU7A 1OA2A 2B8MA 2OIIA 1D4M2 4OLLA 2XGXA 2ZGUA 4Z92B 1N1TA 1O3RA 4IEYA 5I8SA 3VHRA 3O0XA 3NV4A 3ZN6A 2LUWA 2R071 2D6LX 1ULDA 2A7AA 1LHNA 3VBSC 4YG3A 1O4YA 3V65A 1XNKA 4K40A 4E2QA 3EXUA 3VHOA 1LGCA 4YNIA 1BMV2 3WOGA 3ZMOA 2Y26A 1RUJ3 4Y22B 2ZOEB 3OY8A 1LCLA 3HT1A 5D8AA 4COWA 4AHXA 4PQ9A 5L73A 2HEVF 1H1AA 1LENA 2R062 2PQQA 2OZ6A 2VXRA 1OFSA 4Q4Y3 3FMGA 1Q8PA 2Y38A 4AVVA 2DVDA 4BMBA 1MS5A 1FV3A 1AXKA 3AB0A 2ZHLA 3PVBB 2QCSB 1AJKA 4C91A 2VU9A 1QJY1 3MW4A 4O9GA 4FPCA 3OYWA 5FLJA 1U5YA 3I8TA 3H0OA 3MLKA 3WCRA 1N3QA 4JTOA 3WZ1A 1AR81 1FXZA 3ENRA 4B7EA 1HW5A 1CAXA 1PVC3 3TRSB 4I0BA 4LBQB 4K1YA 1A3KA 2C5DA 5AFEA 4MV2A 2DVAA 4AI1A 1VBD1 2OW4A 4XQWA 5BNPB 2ARBA 5FO9B 2QZ2A 3A4UA 5EXOA 4ZU4A 3KGZA 3K51A 4OHXA 3AKSA 4Q4V3 3LSEA 1C8M1 4YGDA 1S0JA 5ACA3 1MS1A 5C9AC 4AE2A 1J3QA 4L97A 2JECA 5GALA 2XBO3 2DVGA 4YSFA 3IM0A 1J58A 1AXYA 2QUOA 1NA1B 3THPA 3AZZA 3B9CA 1F5JA 3C3VA 1QJX1 2ZABA 3M1HA 5BY5A 3MZHA 1Q56A 4Q1RA 4MH0E 2TEPA 3A0NA 3SHRA 2MNGA 2PLV2 1VIWB 2DVBA 1A78A 1PGL2 3JBG1 4QGLA 3JCIA 4DQAA 1DGWX 1Z7S2 4BMEA 3M8LA 1FPN2 2A6ZA 1AR62 4LEJA 1ENSA 1DFQA 4QU2A 4I3PA 1S1AA 1YHFA 4NPRA 1AHSA 4HANA 4ISQA 1JN2P 5DDJ2 3T1LA 2A6WA 1QMJA 2YPJA 1QXRA 1VAVA 4Y20A 4AVCA 1KS5A 2B42B 4YG6A 1SBEA 2CAUA 2E63A 5C4WA 3WY6A 5I0TA 3FLPA 1QQP2 3DPRA 4E27A 2P34A 3ZO0B 1C5HA 1IQAA 1SLTA 3H8UA 4LNVA 3S0MA 1NY71 3R4UA 3AYCA 3B3QE 5JR7B 2WT0A 1UX6A 1VBA2 4N53C 1CJPA 3BU7A 2WIIB 4QPIB 2DF7A 4RQPB 3AMMA 5D8AC 2ZTNA 4GMP0 4QPGC 1JUIA 3ES1A 1FNZA 3H3ZA 5KHHA 4NHMA 5GZEA 2HWB2 3MIDA 3GBWA 2HWC2 2D6OX 1NXMA 1G9DA 3BCWA 4QQHA 5AFBA 2I74A 3B01A 5GZCA 5D1IA 5DG2A 2DUOA 5JSOA 3OBTA 2GDFA 5FQ0B 4Y24A 1SFYA 4RGGA 5JDBA 1S55A 3ACLA 4ZU5A 2VMGA 3MPBA 3VBHB 4K9SA 2E7QA 3CJIA 4Q4W1 2SLIA 3OF1A 3M3QA 1DQ2A 1CIWA 3RI9A 3ZFEC 4GWNA 3M70A 4LBMA 1PVXA 1SBDA 3RQ0A 4QX5A 2BEOA 1O5LA 2D7FA 2XG3A 4QPYA 2VOKA 1B35C 2BNNA 1CAUB 1M4WA 2Q8OA 2WL1A 3NSTA 5K7PA 1AR93 4EN9B 2D93A 2YUEA 5H9PA 4DZGA 1RJ7A 5H9RA 3FHIB 1AX0A 1FI2A 1RL3A 1WW6A 1RC6A 1RJ8A 1RVF2 4P9IA 3UJOA 1H2LA 5CG8A 1NLSA 3D5OA 4I01A 3ZFGB 3SH5A 3WDYA 4FOVA 1G9AA 4KWKA 2HWF2 4Y22A 5E88A 5J36A 2PHUA 4B4RA 2ZX4A 3TB0A 1JH5A 4J6GA 1R092 1DF0A 2DUPA 1O7FA 1LEDA 2R16A 1DGRA 1BBT3 1UW8A 2HKXA 1H9WA 5JSRA 4GKYA 1UKRA 4LE4A 3RMYA 1C5IA 3SCGA 2IXHA 4ASLA 4I0AA 2RR12 3WQ7A 3ZXKA 5CFDB 2JEMA 2IFRA 4W6XA 2ZGQA 3VBFC 4FPJA 1TE1B 2NMNA 2X8KA 4H3WA 2ZKNA 3M2MA 2GAUA 4FXGB 2QVSB 4UW3A 5FLIA 4URTA 1XNDA 1QHDA 1ZZ7A 1FOD3 1PM7A 1IOAA 4ISRA 4NO4A 2ZGRA 2WT2A 1QNYA 4AHYA 1NYWA 3B93A 2DFCA 4LR4A 4JGZB 4LLFA 1RUI2 4LBQA 4COUA 2Q1MA 1W6QB 4CEYB 4R8HA 1ASJ1 5C4WC 1NCQB 5T3NA 1MQTB 3VZKA 2XLFA 3IT8A 2MEV2 5BNPA 1ZBE2 5I8YA 1LESA 1Y43B 1IS3A 2GSYA 3DPRC 1HRI3 1C3HA 2VH9A 5J98B 2RE9A 1CPNA 2WJSA 4JQRA 4S2GA 3WG4A 2BFUS 1Z0HA 4YGBA 5DZFA 2K2SA 2TNFA 2EVXA 2NPIA 3WNXA 4M3CF 1HQLA 1NA1A 4W65A 3PLQA 4Q26A 2ILMA 2CL2A 2RS32 1W6NB 4E2SA 4KNCA 2CAVA 1TQ5A 4P14A 4P9YA 3ZXLA 4EWAA 1D4VB 1EPWA 4RGAA 1ULEA 3H1YA 2PELA 2YXSA 2ZJCA 4N9HA 1FNYA 1POV0 2E53A 4LO4B 1EV11 2HYKA 1ND3B 5GZFA 1LTEA 5H9QA 5IK7A 1ZYBA 3CJIC 4XEZA 1D4M3 2B46X 2WNVB 2ZZJA 3M3CA 4GA9A 4BLJA 2WS92 4OULA 1I6XA 4Z1VA 1VB2A 3MI8A 3AKTA 1BKZA 1FMD1 2YMZA 4I09A 2HWD1 3H3UA 4EV0A 2YHJA 1OLRA 1HRV3 4LO5B 3VL9A 4GIQA 2VVDA 4D7YA 1UF2C 2VG9A 4L9BA 1VJ2A 4D3WA 3GNEA 1VBE2 1X36A 4OUSA 5JI7A 1H4HA 3UKNA 3WW1A 4FTEA 5HBAA 5DZGA 1J3PA 1YCIA 3WDXA 4AFDA 3WDWA 3WX5A 2X29A 3JB4C 2IWGB 3ZSLA 4XIKA 4PLMA 1PHMA 5CBLA 2JENA 3SNMA 4TWTA 1RB8G 5H9SA 2XVLA 2GN3A 3IMNA 1PMIA 2EIGA 3N7LA 5KWRA 5KHKA 4XFGA 2ZGNA 3BALA 2R063 4QPIA 1JBCA 3RS6A 5JPNB 3AZVA 3E5XA 2EXIA 4R9AA 2YGMA 3B9IA 1HDKA 1G6NA 2AYHA 3RYKA 3VHNA 5CIRA 1I9RA 1ZX5A 2BUKA 4N7UA 3FC0A 3FJSA 2G4IA 1R082 1ZZ9A 4K8FA 5FQ0A 1ZBA1 4DB5A 4WVZA 1IPKA 3VBHA 2VUAA 4AFCA 2VMHA 4FOQA 1OKQA 1YFUA 4P9JA 5LK5A 2NP0A 3KB5A 2UWCA 3H1WA 1QDOA 3UK9A 3HT2A 3UKTA 1S0IA 2NYYA 2K0GA 3O5SA 4MZUA 5A32B 5CAZA 1CAUA 2PAMA 2VOWA 4P9LA 1VB4A 2WZR1 4Y4YA 4OHVA 1UU6A 2IXKA 2VVFA 5BNPC 1LHOA 4K21A 1RUE2 1DZRA 4I0WB 4AQ2A 4GQ7A 1FATA 4C0BA 2EAAA 4R9DA 4YM3A 1L3JA 4H7MA 4AI0A 4KH9A 3RMXA 4D69A 4ES8A 1EAH2 5CB7A 2I45A 2JX9A 2CY6A 3ZFGA 4FBFA 4L11A 1G86A 4KBBA 4FP3A 1NA1C 3IDEA 3MEPA 3AXDA 3FX3A 4Y26A 4AEKA 3LA2A 5JLVA 1NQDA 2XUMA 1ND2B 4OFGA 2XWJB 5FBZA 2Q0AA 3WXPA 1K5MB 1H9PA 4XJWA 5IK4A 1QNWA 3NVCA 3AXEA 1Z7S3 4OVEA 4QQOA 3QLQA 1DYKA 1FPN3 1AR63 2RMU1 5CFDA 3UV9A 1PO21 1HQNA 2R041 3OD0A 2R0FA 5IUQA 3B5LB 1VBB3 4ZKTB 1NXD1 5CG9A 5DDJ3 2JE7A 3VV1A 2HWE1 4G9SB 1BEV1 1GQHA 4RR3C 2A5ZA 2OUHA 4NVPA 2F6BA 1GSLA 4XQDA 3MIHA 2HJIA 4WZFA 3RNSA 3AKRA 3FBYA 1SLCA 4JGZA 4LUMA 1H0BA 4ZXKA 4Q8KA 4QMAA 1LU2A 3L9JT 2UY9A 1W6QA 1AXZA 2R49A 4CEYA 4WVWA 1NCQA 1MQTA 4XTMA 3J9SA 3TBDA 2BQPA 3DKWA 3AP7A 4GB32 4INDA 1OOPC 1I5ZA 3I54A 1VBA3 2FZ1A 3FBMA 1RUD2 1XNCA 4ONUA 4UBGA 1URXA 1VR3A 1T6GC 1G9CA 4GULA 4XF1A 1BZWA 4S2FA 1OD5A 5KC6A 3CLPA 1OFNA 1AUYA 3B69A 3S7EA 3FWEA 2SBAA 2HWC3 1AR71 1RUC1 5LRRA 2OPKA 4QPIC 2BPA2 3PJYA 1GZCA 3ZIXA 2K9ZA 3GBFA 2D6KA 1ZVFA 1W6NA 3SCFA 3OGGA 4EN7B 5J09A 3JD71 1WMDA 4M00A 2R072 4LO7A 2O1QA 1CX4A 2BVVA 4IEVA 1N1SA 4FAHA 1ND3A 3GZUC 3MW2A 4PLOA 3VBHC 4AFMA 3AJZA 4P9XA 4YVSC 1H2NA 4Q2FA 4D7TA 1G9FA 2BW8A 2NZ9A 2WNVA 4UXAA 2CV6A 1YO8A 2O0OA 2VOVA 2XL7A 1LEMA 3FLTA 4EN8B 5T54A 2H6CA 5A33B 2XVGA 2C1FA 3FFZA 4XZPA 2D44A 3E6BA 4OI2A 1PO11 1GR3A 1C4RA 4YVWB 1AYM1 1TMF1 4L2NA 5L19A 3EO6A 1YXWA 4GH4B 2D97A 3BPZA 3M3EA 1QJY2 3NL1A 2ETEA 2GN7A 4CP1A 2PHDA 3B7MA 2VW0A 2D6MA 3ZFGC 1AR82 3H9AA 3MGUA 4KQ7A 2IFWA 4AYUA 4XFFA 2B39A 3RSJA 4E9KA 5FDBA 3IIAA 3PMEA 4XF9A 1FOD2 3MYXA 4S2DA 1VBD2 2RR13 3HN1A 4Y1XA 2DV9A 4AGGA 4LULA 1SLAA 3TN93 1C8M2 1CN1A 4O9EA 1SDWA 3ZXEA 4MGZE 4XETA 5CFDC 4XFBA 1QF3A 1HRI2 4PLNA 5T55A 1WCDJ 3C2UA 3HQXA 2YGLA 2W52A 1HXS1 3J4UH 3WUDA 4COZA 1EYBA 2WFPA 1C8NA 3MF6A 5C8CC 3M3IA 3S30A 4LBKA 2C9AA 4JGZC 4UBHA 5A32A 2MEV3 1ZBE3 3ROUA 3H7JA 1S2BA 2HEYF 1DIWA 4CDXB 3AFGA 4CEYC 3GZAA 3IDBB 3VBOB 3ZFFB 1NCQC 4PCRA 1MQTC 2A70A 3O0VA 2WLQA 1WLCA 3QH6A 4X6RB 1XU2A 3V0AB 2AZ5A 4WVVA 2X5IC 5BNNB 2GC1A 3B94A 1ENXA 1YFXA 4UW4A 4B3NA 1Y3TA 1LGBA 3B00A 1QJU1 3KT7A 1UCXA 2V09A 3CF6E 2RS33 4BWOA 4HK8A 1Q8OA 4NWVA 1W39A 1QU0A 1AYN1 1E57A 3HBZA 2DU1A 4KWJA 1ND2A 5JOYA 5KHJA 1C28A 1HRV2 4YW1A 5EYYA 1K5MA 2GZWA 3RDIA 5FFOC 1JOJA 1ULCA 1WMFA 5E1RA 4ITCA 2WS93 3EBRA 3K48A 1ND3C 1IKPA 5FMOS 1NY72 2Z69A 3E6CC 4MYEA 4RHV3 2WNVC 3H7YA 1CD3G 5IT6A 1V6NA 1ENRA 1ENQA 2QZ3A 3RYRA 1VBC3 5BNOB 5BV6A 4BOWA 3GYDA 1VBE3 1SCSA 1YFYA 4M3CE 4IEPA 5JIAA 4M3CB 3WD5A 2XWBB 3ILRA 2WA3A 4N7IA 4PDWB 4FOWA 4PBOA 2QKDA 4L99A 4QD2A 1VP6A 2VVEA 5LRSA 4Q4W2 2XHKA 1PGW1 4QGMA 2FMDA 3SLIA 3HMYA 5JOWA 2CGPA 2GNDA 4AVSA 1G9BA 1IZ3A 4X8PA 1WUVA 3R4SA 3DUIA 1PNGA 4Y1YA 4YARA 5L7OB 2BBVA 2EXJA 2UWAA 3CU7A 1PZ9A 4PIXA 1R083 2YC0A 1V9U3 4AF9A 4Q4X1 4CDQC 2EALA 2OA2A 1MS8A 3JQXA 4M01A 1GANA 1FX5A 4EWDA 3KM5A 4LE3A 1XE8A 2GMEA 3VZJA 1ZA4A 1PIV3 3KT1A 1LECA 1W6OB 4BE3A 3NWKA 2VNGA 4LHNA 4P5HA 4DRRA 1JTZX 1YIFA 4AFBA 3J8F1 1TME1 2ZACA 4AQTA 5A33A 2JD4A 1LOGA 5AC93 1RUE3 1RGSA 2ZHKA 3NW4A 1RHI1 1M06G 1NCRB 4KGGA 4TSVA 1WW7A 3RWNA 4WV8A 5SV8A 4YZ2A 2Z2SB 4YVWA 2R1DA 1AL21 1C57A 1EAH3 1ZRCA 4AFAA 5K0UB 1JHNA 4FT8A 1IGOA 4CDWB 1H1MA 2RS51 5JCTA 3AJYA 3ASIA 4JDNA 1VBB2 1REDA 4BZ4A 1KITA 2WKKA 2F4PA 2QDRA 4NR1A 2OZJA 2PAEA 4DRVA 1GYKA 1ASJ2 2DTWA 4LBQD 4TYSA 4AXOA 2MPFA 4OHZA 1BCXA 3FZ3A 4YG0A 4GMP1 1TNFA 4LBLA 4P9GA 3ZXFA 4U2AA 2A6YA 4DXZA 5FO7B 3N7KA 3W9AA 1N47A 1AVBA 4N43B 1NOVA 4YZ4A 3RI8A 1RUF3 1FT9A 5IK5A 1W6MB 2X53S 4XXPA 1V70A 1IS5A 3AP9A 4FSJA 3QD6A 1RUG1 4GB33 1R1A3 1QGLA 2ZBJA 1RUD3 3VBOA 3ZFFA 2RM21 1U0AA 3V0AA 2ZGOA 1BMV1 2W0XA 5BNNA 1IS6A 4CDUB 3NKTA 3R05A 4DS0A 1Q8SA 1TNRA 3POYA 2PHRA 1FMD2 2EXHA 3I2DA 4MGYE 2HWD2 2D40A