1AYM1

Human rhinovirus 16 coat protein at high resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
285
structure length
285
Chain Sequence
NPVERYVDEVLNEVLVVPNINQSHPTTSNAAPVLDAAETGHTNKIQPEDTIETRYVQSSQTLDEMSVESFLGRSGCIHESVLDIVDNYNDQSFTKWNINLQEMAQIRRKFEMFTYARFDSEITMVPSVAAKDGHIGHIVMQYMYVPPGAPIPTTRDDYAWQSGTNASVFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDTYKSRYGTVVTNDMGTLCSRIVTSEQLHKVKVVTRIYHKAKHTKAWCPRPPRAVQYSHTHTTNYKLSSEVHNDVAIRPRTNLTTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title The refined structure of human rhinovirus 16 at 2.15 A resolution: implications for the viral life cycle.
pubmed doi rcsb
source organism Human rhinovirus sp.
molecule tags Virus
total genus 61
structure length 285
sequence length 285
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1aym100
2PLV2 1QJX3 1VBB1 5D8AB 4QPIA 4JGYC 1AR81 1NA1A 2X5IC 1H8TA 2R072 5AC91 1D4M3 1IHMA 1R081 4Q4X3 1VAKA 3VBUC 4YVSA 1PIV1 1POV3 4WM8A 1AUYA 4JGZC 4RS5B 4GMP3 2RS52 1QJY1 1RUF1 1RUJ1 4JGYA 2MEV2 2RR11 2X5IA 2DF7A 5J98B 1RUC2 4CEWB 4JGZA 4IV3C 1M06G 1K5MB 1VBA2 3VBUB 1AR63 1RUH1 2RM21 2RS31 5ACA3 1HRV3 2TBVA 4RR3B 1QJU1 1BBT2 4YVWC 3ZFEB 4IV3A 1E57A 1VB4A 1QJY2 1RUF2 5CFDB 1ND2B 1PGL2 1FMD3 1ZBA1 5LK7B 4GMP1 4YVWA 1RUE1 1BEV1 1BMV2 1PO12 2PLV3 1X36A 1RUH2 1Z7S2 4RHV2 1OOPB 5FMOL 4WM7C 4Y5Z0 1AYM3 1QJX2 1R091 1RVF3 1AR61 1HRV1 2RMU3 1D4M2 4CEYC 4Q4X2 2WZR3 3S6PA 2RS11 1V9U2 1PO21 4WM7A 5C9AB 5A33B 1FOD2 1RUD2 3DPRB 1VBC1 1MEC3 4WM7B 2WFF3 3ZFGC 4FSJA 1FPN3 4CEYA 1VBA3 1AL23 2R043 2WLPA 4N43C 1NCQB 1ND3C 5BNPC 3JB8A 2ZTNA 5K0UC 1WCDJ 2PLV1 1AR62 1EAH3 5ACA2 1C8M3 3ZFGA 1HRV2 1MQTC 1QQP3 3VBOC 1OHFA 3ZFFB 1AYM1 1AYN3 4N43A 2GH8A 5BNPA 5BNOB 1POV0 5K0UA 2RS51 4Q4Y3 4RQPB 1ND3B 1FMD2 2WZR1 1MQTA 5CFCB 2MEV1 3VBOA 1CJDA 1C8NA 1RUC1 2WS93 5L7OC 3VDDA 3VBOB 1NOVA 2WFF1 3NAPC 1FPN1 1VBA1 1PVC3 1AYM2 3JD73 1HRI3 2HWB3 4GH4C 1RVF2 4QPIB 5L7OA 1BBT1 1V9U3 1NA1B 1H8TB 1EAH1 3J8F3 3NAPA 1FOD3 2RMU2 1A6CA 1RUD3 4CDXC 4LLFA 2WZR2 2HWE2 4YVSB 1PGL1 5L7OB 4WM8B 3JB4C 4FTSA 3NAPB 4Y4YA 4QPGC 4GH4A 4JGYB 1MEC2 5FMOS 2X5IB 2WFF2 3ZXAC 4EJRA 1FPN2 1BMV1 5FOJB 1PO11 1AL22 2R042 4CDXA 4RFT0 1TME3 4JGZB 1Z7S1 2BFUL 3CJIC 4RHV1 4QPGA 1QJX1 2FZ2A 1RUI3 1EAH2 2HWD3 1C8M2 2Y26A 1QQP2 5A32A 2BPA2 1AYN2 5BNNC 1D4M1 2BBVA 4Q4X1 4IV3B 2HWB1 3VBFC 4NWVA 4CDWC 3CJIA 1POV1 1ZBE3 1V9U1 5C4WC 1DDLA 4Q4Y2 3J8F1 1FOD1 1RUD1 4N53C 4YVWB 5BNNA 3FBMA 2WS92 3VBFA 4PDWC 1HXS3 1NY72 4CDWA 1F8VA 1AR92 5C4WA 1VRH3 1PVC2 4CDWB 5ACA1 3JD72 4N53A 1HRI2 2HWE3 3VBSC 2HWB2 1TMF3 4PDWA 2QQPA 2GSYA 1AL0G 3JBG3 4GB33 3J8F2 1RHI3 4SBVA 2XBO3 4PDWB 2HWC2 1FMD1 1VBE3 1SMVA 1ZBE1 3VBSA 1EV13 3VBRC 4FTBA 4CEYB 3VBHC 4CDQC 1NCRC 3LOBA 1TME2 2R063 4AEDC 1F2NA 1R1A3 1RUI2 3VBRA 1RVF1 2HWD2 3VDDC 2HWF3 3ZFGB 1VBB3 5GKAC 3VBHA 4CDQA 5J96B 4N43B 2RMU1 1NCRA 4IV1C 5BNPB 2HWE1 1RUG3 1R083 4AEDA 5K0UB 1TMF1 1ZBE2 2ZZQA 2XPJA 3JBG1 1PIV3 1OPOA 1NCRB 1RHI1 1W39A 2XBO1 1MQTB 1MEC1 1RMU2 1COV3 1AR93 1RUJ3 2RR13 1AL21 2R041 4IV1A 3VDDB 1HXS2 1EV11 1ASJ3 4CDUC 5DDJ2 1VBD2 1VRH2 4RS5C 2BUKA 1C8M1 2RM23 1QQP1 1R1A1 1AYN1 1TMF2 2VQ0A 3IDEA 2HWC3 3TN93 1QJU3 3JBG2 4GB32 2HWF1 4CEWC 1RHI2 4CDUA 1PGW1 2XBO2 3HAGA 4Q4Y1 1AR72 4RS5A 1K5MC 1VBE2 1RUG1 1HX6A 4CDUB 1ZBA3 4GH4B 3M8LA 1EV12 4Q4W3 2ZAHA 2WS91 4RR3C 1NY71 1RUE3 4CEWA 4CDXB 1BEV3 3ZFEC 1COV1 1AR91 1K5MA 5C8CC 2R062 1PVC1 5CFDC 1ND2C 3VBUA 1R1A2 4NWWA 4QPGB 2IZWA 1ASJ1 3JD71 1HRI1 1R093 2HWF2 1VBB2 4RR3A 1CD3G 1PGW2 5A32B 3ZFEA 1AR82 4Q4V3 1B35C 5C8CA 5AC92 1RUG2 3CJIB 1R082 5CFDA 1ND2A 2HWC1 1RMU3 3TN91 1PIV2 2RS13 1PO23 1OOPC 5C8CB 1X33A 1VBC3 1COV2 1RUJ2 5BNNB 2RR12 5JZGC 5DDJ3 1VBD3 2FZ1A 1B35A 3VBFB 1TME1 4Q4W1 5C4WB 1RB8G 1ASJ2 1B35B 1OOPA 1RUI1 5C9AC 2HWD1 5ABJC 2RM22 3DPRC 4N53B 2RS32 1NG0A 5JZGA 1AR73 2R073 1QJU2 3TN92 5JZGB 1NCQC 4Q4V1 2RS53 5C9AA 1HQNA 5A33A 5ABJA 3DPRA 1ZBA2 1RMU1 3VBSB 2MEV3 4Q4W2 4FTEA 5ABJB 1RUC3 1HXS1 1RUE2 3ZFFC 1BEV2 1NCQA 5BNOC 5DDJ1 1VBD1 1VRH1 1GFF2 2WWSA 4RQPC 1AR83 3VBRB 5AC93 5CFCC 1R092 4BCUA 3ZFFA 3VBHB 1BBT3 4CDQB 4GB31 4Q4V2 5BNOA 4AEDB 1QJY3 1RUF3 2BFUS 1AR71 2R071 1VBE1 4RQPA 2RS12 1PO22 1ND3A 5D8AC 4Z92B 5CFCA 4GMP0 1QJZA 1VBC2 4IV1B 4QPIC 1NA1C 1PO13 1H8TC 2R061 1RUH3 2RS33 4YVSC 1Z7S3 5D8AA 1VB2A 4RHV3 4WM8C
chains in the Genus database with same CATH superfamily
1XSRA 2Y6JA 1PNGA 3HQUA 4IDZA 1VBB1 4YG6A 1WMXA 1AHSA 5FXXA 4QX5A 4DPNA 2JDUA 4XILA 5T5LA 1JODA 1F4AA 2CGNA 2RJLA 1LGBA 5AC91 3MHZA 1A34A 4LKSA 2GP5A 1H9WA 1PIV1 3O1SA 3WT3A 1AUYA 4QX1A 3L2HA 3LSEA 4B4QA 3A0KA 2RHPA 3POBA 2NP0A 1ULEA 4QM8A 5LA2A 1QJY1 2BDRA 3WF3A 3KD4A 3M1HA 1LESA 5C3RA 2XVLA 2JG8B 3O1VA 1OMIA 1JHNA 1W0PA 3O1TA 2YBPA 1RUC2 1WLCA 5FY8A 2K9ZA 4HFSA 3PTRB 1UKGA 3NJZA 4ISQA 4IV3C 4JQTA 3THDA 4DRRA 1V70A 1TNRA 4FPJA 5CU1A 5H9RA 3WNNA 4C0BA 2ZOEB 3BUCA 1W06A 2IXIA 4IEPA 1AR63 5FZGA 1RUH1 2RM21 1OFSA 3EQEA 4MZUA 1J1TA 4JRLA 4FXKB 1YUDA 1WMEA 4RR3B 3AVSA 3K51A 1QJU1 2F6BA 3K77A 1BBT2 3RJRA 4BLJA 3DCQA 1E57A 4LK6A 3POWA 1GBGA 2ZX0A 1ND2B 1U5XA 3T2OA 2WA4A 4EN6B 1OH4A 1W2OA 1MACA 1ZZBA 1W8HA 1FMD3 2ZS6B 3B9CA 3NVCA 1EYBA 2Q1FA 3HD8B 5CKMA 5L73A 2FMYA 4DMIA 5C70A 4TZDA 5I0DA 3KGZA 4IXLA 1SBEA 1RIRA 1HB3A 4AQSA 2E7QA 3FBYA 4X8PA 5FIXA 1RUE1 5IW0A 1WCKA 1AX1A 1FV3A 4ZONA 2ZBJA 4YG3A 5FZ8A 4QWNA 5H9QA 1LODA 1PO12 3U14A 4K1ZA 4AW7A 3ENRA 5ERLA 5DG2A 5FBZA 5FK7A 4AOCA 4CYDA 1G9CA 1OOPB 1J83A 2GC3A 5JXJA 4WM7C 4MGKE 1AYM3 2ERFA 4XFHA 2X29A 4NROA 4V2WA 2JDHA 2UWCA 4LBNA 5FZHA 4BK4A 3JQXA 1C28A 5I8YA 4OQ9A 1UQXA 2IVIB 4P5YA 2KA3A 1BYHA 4CEYC 1D4M2 2AH2A 1GZ9A 3MPPG 3I97A 4QDSA 4C0HA 5CADA 1N1TA 4Y33A 4YM0A 2I74A 4LIVA 2UYAA 3OGJA 5C9AB 5A33B 2E51A 5FLHA 4Q0UA 1RUD2 3DPRB 3KS7A 4DINB 1GOHA 5C3QA 2AACA 1VBC1 1Q3EA 2G9FA 2VUJA 3FC0A 3BVCA 4JZRA 1KDMA 3AP4A 1MEC3 3JZVA 3UESA 2OA2A 3OBAA 4AAPA 4CE8A 5JIUA 4YFWA 1AL23 1ULCA 3DXUA 2R49A 4N43C 5F2SA 2WYSA 1LENA 1H2NA 3AZVA 3ILFA 3K4ZA 4RL7A 5KXDA 1WCDJ 2WR9A 3AL5A 4LBQA 4NPMA 1AX2A 4QT6A 4XEZA 1A8DA 4YW3A 1DLLA 1LULA 1EAH3 4H14A 5EJ3A 1LOBA 1QQP3 5FP3A 1OHFA 5T55A 3WNXA 2BGPA 1MZFA 2P4EA 3VKLA 3VZOA 2VJXA 1XB9A 5FWEA 3QOPA 2QDNA 3OY8A 4DXTA 3K48A 5KBFA 2FDIA 2VO5A 1EPWA 1ND3B 3E5XA 4OHVA 2GNBA 3RNSA 4YZ4A 4HETA 5FUNA 2JIGA 1NLQA 4C1WA 3VBOA 1DYKA 3EMRA 4NUBA 5FAXA 3H8RA 1CJDA 5FUIA 4M01A 4K8RB 2WWJA 2D43A 3RS6A 3VDDA 1SCSA 2FCTA 3ETQA 4ES9A 4MLOA 2E32A 1NOVA 2LALA 2ID4A 3H9AA 3KF5A 1Y9MA 1HJFA 5FP8A 2LTNA 4UXAA 3T09A 1AZDA 3LEKA 3DKWA 5FYIA 4C1XA 4CCLA 4LJHA 1BQPA 3PHMA 5FQ0B 3IKWA 4BE3A 2XJVA 5FZCA 2BZDA 4KBBA 2AREA 1WCUA 5FZMA 2PHXA 1UL9A 2W5FA 2ZMKA 4CVUA 2JDPA 1H8TB 2Y6LA 3J8F3 1PZ7A 2WNUB 1WCSA 1PNFA 1RUD3 2ZGTA 4WZCA 2WZR2 4GQ7A 5L7OB 4WM8B 4D0QA 1C3HA 2WYFA 1Y3TA 2OIIA 2BYVE 1H8VA 4JTNA 1UMHA 4JCKA 1MVQA 1FYUA 2XB6C 1PX4A 1YIPA 4XAEA 4D69A 1IG0A 4MXVA 3WHUA 3RFRA 1SEFA 1CJPA 4ARYA 1JYVA 3ZDSA 2XVKA 4CDXA 2R042 4RGKA 4NIHA 1KEXA 4I3GA 5FZAA 3LIHA 3M3CA 1CN1A 3K3NA 1W2TA 4W6YA 3S7EA 1TME3 4AHWA 2VC9A 5FWJA 4ZPIA 5K9YA 1IGOA 4LUKA 3CJIC 2YYOA 1N47A 2VULA 2OT7A 3MGUA 3PMEA 1V6JA 4RHV1 3U0ZA 1DLCA 4GIQA 3MPBA 4QPGA 2FZ2A 1RUI3 3ON7A 2QUOA 3FLTA 3SISA 1OQEA 2WT0A 5C3OA 3H1YA 4A44A 4ES8A 1CGPA 5F39A 4LORA 2XWBB 4CUGA 4EN9B 1LB2A 1WZXA 2PHTA 1CVNA 2VBBA 2XUMA 3NNJA 5BNNC 2BPA2 4E8DA 3HN1A 5D1IA 1NZCA 2DU1A 2NPIA 2BOIA 4IV3B 4JHZA 4LMFA 3VBFC 2H0VA 4NWVA 2V4AA 1JZ8A 3WCRA 1GLHA 1ZBE3 1V9U1 2VPVA 2YU2A 4W50A 1JYTA 4FCAA 4XCBA 3WP6A 4QXKA 1L7RA 4Q4Y2 4HVQA 1ZRFA 1N1SA 5D21A 4I02A 4OHXA 1Q8SA 5GZDA 4JDOA 5FZOA 5JPMB 4PLMA 5IYYA 1DGRN 1YI7A 3N9NA 5IUQA 1B09A 2ARCA 4QQ2A 5FLIA 1OKQA 2TUNA 4Y5SA 3AKRA 2B9UA 3ORJA 5FZ7A 4XFBA 3MDPA 4IL7A 4LE4A 1AR92 2FCVA 2GALA 1GWKA 1W3XA 1XXNA 5IVFA 1FXZA 4FQZA 1VRH3 3T30A 2QQJA 4MUVA 3USSA 5I91A 5JSRA 3RZGA 1D7PM 5A6YA 2OUHA 2WO2A 5ACA1 4MHRA 2I45A 3NMBA 2K46A 4LO8A 4COWA 2FMDA 2A6YA 2A73B 1HRI2 3VBSC 4MYEA 2HWB2 2AZ5A 4CCDA 2FD8A 2HEYF 5C6CA 4YZ2A 3H1WA 4A42A 2Y33A 4AEMA 3ZN6A 3IB3A 1RHI3 5IK4A 1LHNA 2PXJA 2WBKA 4CTEA 3D5OA 4PLOA 3WY6A 3CU7A 4Q0VA 2ZAAA 2D3RA 1C4RA 3HMYA 2HWC2 4I0BA 3LDBA 4PHZA 5FZEA 3IPVB 3WF1A 4AGRA 5H9PA 2CU5A 3KGLA 2R1DA 3WUDA 1K5JA 2YXSA 3VBRC 3SKVA 5F37A 5DAXA 4B7EA 5F9TA 4CEYB 2IXJA 3K4AA 1JN2P 3VBHC 4ZS2A 3WVJA 2EIGA 1UYPA 2YGMA 4DXZA 3UETA 4MSVA 1JS9A 2R063 3ZYGA 4AEDC 4Y1XA 3S30A 1F2NA 3QBQA 3O12A 3VKMA 3WR0A 4L0PA 3AP9A 4CCNA 4KBZA 3OPTA 2DVAA 3VDDC 2VVEA 2J22A 1VBB3 3BIWE 5A7WB 1C1FA 1UW8A 1N1YA 4P9XA 4QDQA 4TLGA 3BIEA 1O3SA 3LPFA 4N43B 3EB7A 3KHCA 5K7PA 1CAXB 5HI0A 2XDVA 2YC2A 1TMF1 3TYJA 3WF4A 3OPWA 2XH6A 2ZZQA 4LO5B 5DABA 1F35A 3ZO0B 1PIV3 3VKOA 5CBLA 1ZZ7A 1Z0HA 4CP2A 1NCRB 2ADDA 3E5QA 1W39A 4NO4A 4AHXA 4W4ZA 5E1RA 1D2QA 1UAIA 4NPRA 3K2OA 1COV3 1AR93 2GC0A 4YLZA 2VVDA 2D44A 5L9BA 4BQ1A 4ET7A 1U0AA 4PQQA 2P3IA 4NHXA 4ATFA 3WDVA 1LOCA 4E4SA 5FYBA 1EV11 3DYPA 3MFCA 4OYUA 3H7JA 1NQJA 4XJWA 5LEKA 1W6PB 5JOYA 4HXCA 3ZLIA 4Z8BA 2YGLA 1EY2A 3GBWA 4OCTA 1JMUB 4YYOA 3ZPOA 3GBGA 5FRAA 2PHLA 3PUHA 5JXHA 4JKMA 3V56A 4AQTA 1SFYA 1W9SA 1C8M1 2RM23 2VZQA 3W20A 4BK5A 5C3PA 1C5HA 2MHFA 3OF1A 3U37A 1AYN1 1GP5A 3FL7A 1SLCA 2HWC3 1QJU3 4RD7A 4NPLA 2HWF1 5GZGA 2A7AA 1LOAA 4O7XA 2D7FA 2XBO2 1WW4A 5DMYA 4Q1RA 2YPDA 5T3NA 2H6BA 1HX6A 2WLQA 4XC9A 3R4SA 4ZXKA 4QB6A 5A7PA 4CDUB 3QH6A 3I8TA 4XHBA 3I59B 5BYNA 4PLNA 3WXPA 1MS5A 2NYYA 4NRQA 1IS5A 2XR4A 2ZMLA 1KFXL 2JG8A 1QMJA 3I3BA 1UO9A 2WS91 3O1RA 4MGTA 1RUE3 1SQ4A 2GNDA 1W0OA 1X7NA 4GJZA 1JZ4A 3ZFEC 1JHJA 1I3HA 1OUSA 1RXFA 4JKKA 4LITA 3UJQA 4LOSA 5LA9A 1PVC1 2YU1A 5GJ6A 3RWNA 5CFDC 4Q0QA 4XMAA 4EZ4A 1OURA 1UN1A 1R1A2 3OCPA 4XJ8A 3UJOA 2RJKA 4QQHA 1HB4A 1YHFA 2MNGA 1F5JA 5FO7B 4RR3A 4J1WA 4OUEA 4D7TA 3B01A 2P3JA 1AR82 4RN5A 2DWRA 3VZMA 4HK9A 2ZEWA 2Z69A 4XF9A 1RUG2 3CJIB 5CISA 1JUIA 1ENSA 1ND2A 1W99A 3POYA 4O65A 4P9JA 2J7MA 4D7YA 3KF3A 1TG7A 2I2SA 3MLLA 4BWOA 4AI8A 5C8CB 2DCZA 1UYZA 5LEJA 1REDA 4XOGA 4XQ4A 3ZR5A 1VBC3 4AAXA 1RUJ2 4QKBA 3WP5A 4XUOA 5BNNB 2RR12 1B35A 2RV9A 3VBFB 4CXYA 3C7FA 1D4VB 5FY9A 4AVAA 4META 5EHDA 1ASJ2 3KVBA 1DQ4A 2EAAA 1OOPA 1WD3A 3P3PA 5FZKA 5BY5A 4IEZA 4U36A 5LB6A 2Q8EA 2RS32 3NNMA 5HV0A 5JLVA 5C7GA 2QKDA 4XJ9A 4CCEA 2R073 3TN92 3UL2A 3M4FA 4ASKA 4DUVA 3RPQA 4EQVA 4FOVA 4M0NA 1JUHA 3LWCA 5JZGB 2D6LX 4LKFA 4GXLA 5FZ9A 5C9AA 5A33A 2CDPA 2W91A 2WWUA 1W3VA 1H2MA 3DPRA 1ZBA2 2JECA 1XNTA 3J9SA 3POIA 5FK8A 3VBSB 4DUWA 1OFNA 2VD7A 1RXGA 3JU9A 1H1IA 1DGRA 1PZ9A 1HXS1 1QH7A 2GMPA 1SCRA 5FLJA 2R32A 3SCGA 3ZFFC 2P1BA 1BEV2 4MGSA 1H6YA 3WZ1A 1Q8PA 2DUOA 2CAUA 5BNOC 4DRVA 5IVVA 3WP4A 1VBD1 3ZXJA 1GFF2 2J1EA 2QE3A 2WWSA 2VZPA 2XGXA 2ZX3A 1AR83 5CKQA 2X10A 4BDVB 1S0IA 1W04A 3VBRB 3O1MA 3V64A 4N9HA 4BCUA 3T1MA 2JICA 4UFMA 2C26A 3ITQA 3VBHB 2VVFA 1OLME 4GB31 1J3RA 4Q4V2 5FZBA 2OYZA 3WF2A 3FUQA 4C91A 3I2IA 3Q8AA 3ZXKA 3A21A 3DEMA 4OMDA 2WSUA 4AEDB 5IVEA 1RUF3 1UZYA 1OVPA 2BFUS 1ZREA 4J6GA 1OLQA 2O0OA 3POFA 1W6NB 1GNYA 2DCKA 4FT8A 4LIUA 3L2YA 4HVOA 1ND3A 1PZ8A 5APAA 3QACA 4YFZA 3IMMA 4BQXA 3CZJA 1O4ZA 3EO6A 5F32A 4FPOB 4E2SA 3OB8A 5FPUA 1KS5A 1H2LA 1QJZA 1VMHA 3PUQA 3WQ0A 2LUWA 1EUTA 2P34A 4TTGA 2JJ6A 5A6ZA 5LRSA 4CP0A 4QPIC 3ELNA 1DYPA 2ZHMA 1UZ0A 5JIAA 3VL8A 3AXEA 2QNKA 2HYXA 4DUXA 1DQ1A 2BBAA 3VHOA 1BMV2 4D8MA 4QB2A 2W0XA 4TWTA 4V2VA 2RS33 3NO8A 4XZPA 4HK8A 4RHV3 4KG8A 2CAVA 1ACCA 1OD5A 3ILRA 3FUOA 2PLV2 2VMEA 3U75A 5KWRA 3U07A 4OVEA 3B00A 1LU1A 4KU8A 5F1RA 4A6SA 5D8AB 3MFAA 2JE7A 4W6WA 5JWPA 3H50A 4JGYC 2EXHA 1DZTA 1O3TA 2X5IC 1H8TA 3AYCA 4NHKA 2D40A 5FFOC 5FYZA 3USUA 4BZ4A 2VY0A 2WNUA 1IHMA 1PK6C 1R081 1VJ2A 2XOMA 1VAKA 3OSDA 1GP6A 4WM8A 4JGZC 4GMP3 4RYDA 4FVVA 1WWYA 2BW8A 1PVXA 3M3OA 2DUQA 2UWBA 3AFGA 4LQRA 5GLUA 5FDBA 1G9AA 2DTYA 2WNOA 3LCPA 3SEPA 2YY1A 2MEV2 4XF0A 2R7EB 3LA7A 2CV6A 1W6OB 2R0FA 4FPFA 4BQ2A 4DS0A 5J98B 4QD2A 3BCWA 4BU2A 1S0FA 4YM3A 5JSOA 5DAQA 3D6EA 1XU1A 1N3PA 5EIYB 4QHZA 2OVUA 1C5IA 4KI5M 3ZYFA 1UY3A 1TVGA 2B7YA 2A70A 4HN1A 4EWDA 5JSPA 4HN0A 4LKDA 2QQVA 3MV01 1UY1A 4N8MA 5ACA3 3FFZA 5LY2A 1HRV3 1JYIA 3R0RA 2VUCA 5FYVA 3TAYA 2XLFA 3ZFEB 4EROA 4YW1A 2VE1A 3M7AA 3KV9A 2LW8A 3FE5A 4IV3A 1KRIA 3A4UA 5CFDB 1Q5OA 4CP9A 2Y60A 3HBKA 4XETA 1JYXA 2PHDA 1KD7A 3RI9A 4QX3A 4Y3OA 1ZRCA 3RQ0A 3N9MA 4GWMA 3SMHA 5DUVA 1W2NA 4YW4A 1IPKA 4D6SA 2E7AA 5LK7B 5FPXA 2K0GA 4YPJA 5B4NA 2IXCA 1SFNA 4UT5A 4IEQA 3ZYJB 3PUSA 3ZXDA 4FI9A 1GV9A 2DU0A 3BPSA 2X53S 2PLV3 5FYUA 3H0OA 3SHRA 1AJOA 1VMFA 2YBSA 4QX2A 5ANQA 5F6KA 2WA3A 3PNAA 2EXIA 2X05A 3W5MA 3ASIA 2D6OX 2AEZA 5FREA 1W03A 4LO6B 1DGLA 2CGOA 4Y5Z0 2A71A 3O0VA 2XONA 3ACFA 4Z2AA 2B9VA 1R091 3AC0A 3AKSA 3HQRA 3SC7X 1FT9A 3WNMA 2IXKA 5A1LA 1SFPA 5E6HA 4K1YA 1CPMA 4FFFA 4D3WA 1TZOA 2DV9A 5JOXA 4XUPA 4CXXA 1ZRDA 4MGIE 4HLTA 1OQ1A 4L11A 3S6PA 3DL3A 2A3XA 2RS11 1PO21 4WM7A 1F9KA 3I3QA 4UYBA 1TEIA 2V5DA 3MO4A 4XURA 5EZWA 1FOD2 3ZVXA 2GH2A 3SXWA 1O91A 1RITA 2ZGNA 4Y1ZA 1RTVA 4YZ5A 1XC6A 4K40A 1ENQA 2B5HA 2DVGA 2GC2A 1OLRA 2WFF3 4R4XA 2P2KA 4HANA 3NW4A 1FPN3 4CEYA 2WLPA 3UKTA 3RYPA 1JZ7A 1ND3C 5BNPC 1RC6A 1EUUA 1LECA 3F2ZA 4FFIA 2C0ZA 1NZIA 2ZTNA 3CZUA 5E16A 5FP4A 4BA6A 2BOJA 5LY1A 2RG4A 4YW7A 2P37A 5GLTA 4CCKA 1AR62 1X9TA 5GLVA 3UT0A 4FPHA 1C8M3 1RYYA 2R6QA 5IVCA 2HYKA 3V0BB 1UZWA 5GLZA 3ZFFB 1AYN3 5H9SA 4N43A 5CG9A 2BU9A 4H3WA 5HCHA 3I3DA 5BNOB 2PFWA 4XF4A 5JR2A 4IEUA 1K45A 3AB0A 2RS51 2JEMA 4IGQA 1CR7A 1GYKA 1WD4A 2PQQA 3FZ3A 1FMD2 2WZR1 4AGVA 1GR3A 3ACLA 2BVVA 4BXFA 1OPMA 1OKOA 5FZLA 1APNA 4YZ1A 4QKNA 3WQ1A 1X9PA 3KT1A 2ZGLA 3NRUA 3VD3A 2GNTA 1FI2A 3VUOA 2WS93 5F2WA 4PIZA 5L7OC 2ORXA 1YFUA 2ORZA 3GZEA 3U10A 2WRAA 3T3YA 1W6PA 1H30A 3OJBA 4XXAA 3DXTA 2WC2A 3T2PA 3RZHA 1VBA1 4L2NA 4C8DA 1WKYA 3D0SA 1PVC3 2BQPA 4XIOA 2PHRA 3PVNA 4M4RA 5GALA 1AYM2 4AFDA 1MPXA 4OHYA 4QGLA 2XQXA 3K4DA 3D4KA 1RGSA 1YNAA 4H55A 4Q0PA 2UYBA 3P6BA 4GH4C 4QPIB 3HNMA 3IM0A 5KHHA 3D82A 3B5LB 4HKLA 1FOD3 2A3WA 5JI7A 4EN7B 2DBIA 4JX0A 1LKNA 2HWE2 2TNFA 4FFHA 3KV4A 3VZJA 1YXWA 1JTZX 1G86A 1PGL1 3RDIA 2F17A 3JB4C 4XZUG 4JAAA 1WA4A 3OBTA 3NAPB 4Y4YA 2FCUA 3I59A 3BB6A 4JGYB 3PIGA 1MEC2 1MR5A 2X5IB 3ZXAC 5C33A 3MIHA 1MS8A 1PK6B 2CHHA 1AL22 2B39A 2VZUA 3B9IA 3HNBM 3N35A 2VTXA 3D0JA 4AVSA 2LRPA 4JGZB 1Z7S1 3GALA 2VBPA 4D94A 5A3PA 2AYHA 3MICA 4FXGB 4QKFA 4ZXEA 3AYDA 3BOWA 5I8TA 4Q29A 1QJX1 3AMNA 2J1SA 4B4PA 1S0CA 3EBRA 2D97A 4JQRA 1EAH2 3L9JT 2VQUA 1QQP2 4COVA 1RUOA 3G7DA 3G6JB 2VUDA 5FZ1A 1HQLA 1K3IA 1O7FA 5HCFA 3UYJA 1JZ6A 4Q4X1 4L8QA 5F5IA 1FATA 2HWB1 4IETA 4LO4B 3CJIA 4QQOA 4YZ3A 5AVPA 1JBCA 2Y6FA 4FAHA 3GNEA 2HBTA 3I2HA 1BLZA 3ZSJA 4XDOA 3FX3A 1SLIA 2EXJA 1G8WA 3IWZA 2OQ6A 4Z1VA 4AK3A 1CZTA 1KJLA 3ZX7A 3UGGA 2VCCA 4D6QA 1OF3A 3C7EA 2IUWA 5BNNA 2VMIA 1W8OA 5LBFA 3VBFA 3ZYRA 1HXS3 5IFPA 1M4WA 1WUVA 4BOWA 1F8VA 4OZOA 4PBOA 1NE6A 1F4HA 5J1XA 3FHIB 5A3LA 5A3TA 3ZIWA 5HXVA 4CDWB 1XU2A 4DEVA 3WEZA 3W59A 3ZMNA 2KD7A 4BMEA 4CRQA 3GHNA 3PDQA 4A6OA 1YQ8A 2DCTA 3UNPA 4Z2WA 2HWE3 2ZMNA 3CEWA 2W95A 1Y4WA 4GD4A 4HL0A 2QQPA 2UY8A 3AP7A 3JBG3 3U11A 4JRAA 4GB33 3J8F2 1BKZA 1CIYA 1PM7A 4SBVA 2W1UA 4XFCA 5A7NA 4CA9A 2VZVA 4XHXA 1CPNA 5DAWA 2PAKA 2VW2A 1W8WA 4PDWB 2EVXA 3MEPA 3ZIXA 4N9IA 2D3PA 3A23A 2Y6KA 2XJPA 3ZYIB 1PX3A 4FPEA 4ZU7A 1SMVA 3KB5A 4KMQA 4GALA 5SV8A 3VBSA 1S2BA 4ZS3A 2PTMA 5FYMA 1YFWA 3B94A 5FXZA 3CIHA 4F8AA 1OVSA 2Y34A 3PUIA 2VL4A 2L9LA 5AVAA 1NCRC 4FPKA 1TME2 3GZTB 4KWKA 1NLRA 1ALYA 2KM2A 1RL3A 5FBJA 3ZYHA 5HPOA 1LEDA 4AWDA 2YBKA 1H9PA 3E1F1 3WNPA 1AJKA 1DIWA 1RUI2 3VBRA 2Q30A 5F8PA 1RVF1 3MF6A 4DXSA 2DVFA 1PGSA 5FZ0A 3VD9A 3VBHA 1LHOA 2AGSA 4HMZA 2RMU1 5DUWA 5BNPB 3RZKA 1LJ7A 2H6CA 4FOYA 1R083 5FZIA 2HKXA 1L3JA 1ZBE2 2BJSA 2VZTA 4ZU4A 4AEDA 2ET1A 4LKEA 5JDBA 3O1PA 3M70A 4QU2A 5F3CA 4UFHA 2W92A 1L7QA 2XBO1 3APBA 5DAPA 5J09A 3JQWA 4OMCA 4BM8A 1GQPA 2ZEXA 4DO0A 2VNGA 2CL2A 3DYOA 1YFYA 1FNYA 1RMU2 2BVBA 1DGWA 4V1PA 1ZRRA 4KL1A 3OYWB 5BNQA 4KWJA 3AP6A 1KITA 2BGCA 4YGBA 1WA6X 5FKCA 4COUA 1IQDC 2ZHKA 3VB9A 3KT7A 4FFGA 4CDUC 5DDJ2 1N3OA 1VRH2 1WLWA 1X8MA 3OBZA 4RS5C 3N7MA 1ZZ9A 2ENRA 3LQCA 3OUIA 4IE0A 1MS9A 1R1A1 2DCJA 3CF6E 2VQ0A 5FY4A 1BHGA 1KGYA 1V6OA 1S0GA 4HBNA 1OXCA 2FBEA 5CG8A 2FDKA 3N9QA 4Y20B 4KU7A 1RHI2 3Q9OA 2J1TA 3TB0A 4A2UA 3BU7A 2QFEA 2BP6A 4COYA 2QZ2A 3AK0A 4RGGA 3B3QE 4CCCA 4AI9A 2WN3A 5JI9A 4YARA 2W39A 4UOJA 1RUG1 4BB3A 1YLLA 1UMZA 2FDFA 4GH4B 1ST8A 4FO9A 2YFZA 3M8LA 4XJUA 4DY5A 1W6OA 4Q4W3 3I2KA 1NY71 5DG1A 5FPBA 3B93A 1UU5A 2E31A 2LROA 2J1AA 3PVOA 2XUEA 2Z4FA 1XNDA 5IATA 1URXA 3PIJA 5C8CC 2QCSB 2R062 3FN9A 4S2FA 5FY5A 4MGQA 3LFMA 4IERA 2UY9A 3WINE 4CPBA 4FPLA 3MBWA 2WN2A 4H7MA 2IZWA 1ASJ1 3JD71 3SITA 4GWJA 1HV0A 4XQWA 3LPGA 1K12A 1R093 1V6MA 2LM3A 1VBB2 3FJSA 3HOBA 2V72A 3N9PA 1CD3G 1PGW2 5LZ6A 3TEZA 5E8AA 3W5NA 4JKLA 3ZFEA 1OF4A 3WG4A 2XXZA 4XVHA 2DVBA 4FAGA 2EIBA 4N7IA 5AC92 4MHUA 1GZWB 1QY4A 4TSVA 2EICA 5CFDA 1E5HA 1EPZA 1RMU3 1SHWB 3TN91 5GM0A 1PIV2 2RS13 4QQPA 1PO23 1I5PA 2AUYA 3OBRA 2W94A 2W1QA 5DUXA 4ZU5A 4E4ZA 1ONAA 2EF6A 1GQHA 1X33A 1VIWB 4R9CA 5CYYA 1COV2 2VW1A 5FXVA 3HT2A 2W46A 3SKJE 2VUAA 5DDJ3 4QQLA 5JZGC 4UWDA 1W6QB 5F5CA 4E9KA 1IS3A 1J3PA 2GP3A 1LOGA 4QB1A 1UPIA 3IDBB 1CIWA 1W2UA 4OQ8A 1I5ZA 1US3A 2HWD1 1NQDA 1O4TA 1L7LA 1QOTA 2RDSA 2RM22 4GAZA 1YJLA 4UW3A 3H8UA 5LASA 3AMPA 3I4IA 4P08A 1Z78A 3LFIA 1GOGA 3ST7A 1QIQA 5LRRA 1DGWX 2XJQA 1QJU2 1SLBA 2C4XA 5A3MA 1S0JA 4NIDA 3K75B 2JG9C 1UY0A 1NCQC 3WD5A 3M3QA 4Q4V1 4MO3M 2RS53 1FV2A 3W58A 3O1OA 1UNBA 4DQAA 2PELA 2BNOA 2VCAA 4M3CB 3HN3A 1S0EA 3H8XA 4FTEA 4LE3A 4PJYA 4QKDA 2QDRA 1OH3A 5ABJB 3RZZA 2OW4A 1RUE2 2YZ4A 3R4UA 1JYWA 1WBLA 1VE0A 3NKTA 5A7OA 4HONA 2ATFA 4OFGA 1ODNA 2ZGMA 4A3ZA 1UU4A 1BXHA 4J25A 5FJHA 3I2FA 4L99A 4RQPC 5AFBA 3LEMA 3DF0A 3GF6A 1QXRA 4IE6A 2VOKA 4OI2A 3SQOA 5KXEA 5AC93 3RG0A 5CFCC 3ALQA 4Y4RA 3V0BA 3FLPA 1HB2A 3ZFFA 2JKBA 3C7GA 1O3QA 1QEXA 2RDRA 2VXRA 1DP0A 1CAUA 1LGNA 1SLTA 4GWNA 5FMDA 5BNOA 5C3SA 5LCWL 1QJY3 1W8UA 1AR71 3U78A 1C57A 4YWAA 1IQAA 1VBE1 3ZXFA 5D8AC 4IUGA 2BRTA 1E5IA 4ORFA 5DN2A 2NLRA 1YQ6A 4P9IA 5FUPA 5I8SA 1XRUA 2QQNA 5LWBA 5CZKA 1VBC2 2ARXA 2C1FA 1GP4A 3C3VA 1XE7A 3AP5A 1GU3A 5A7QA 1NA1C 3VD4A 2IFRA 1YYNA 1XOYA 4QPWA 5K4LA 4U2AA 4AXOA 1RUH3 5HV4A 4YVSC 1Z7S3 2AEYA 2NMNA 1CWPA 1N1VA 4ISRA 4P14A 2VZRA 4QAWA 2WDBA 4YGEA 3U4XA 2BNNA 5IK8A 1QJX3 2D93A 4QPIA 4OUMA 3POGA 2XKPA 2PAEA 3UV9A 2YG0A 5A6QA 2QQKA 5A3UA 2R072 4NIIA 2D98A 4KNCA 4MV2A 4Q4X3 4BPZA 4Q2FA 2RVAA 3Q8FA 1OSGA 2WQZC 4RS5B 1WBFA 2XJSA 2YMZA 5FYHA 1S0BA 3URFA 1A78A 3INAA 3MIEA 5F3IA 4JGYA 5FP7A 3RWKX 2GN7A 2ZX4A 3BTYA 4R9BA 2X5IA 1Y9GA 2RDNA 1PK6A 2Y8KA 1F31A 3BPZA 3PLQA 1GNZA 2ZEZA 5FPAA 5FPZA 4AVBA 4JGZA 1M06G 3SCFA 3ETPA 3J4UH 2Q8DA 2PHFA 1W2AX 1IKPA 2C6SA 3CDZB 1LTEA 3NJVA 1KQRA 5EPAA 3VBUB 1LHVA 1LHWA 4Z07A 4D7SA 3RSJA 5FY1A 2TBVA 2D6MA 2JD4A 3S5AA 3ZSKA 4ASLA 4OHWA 1ULGA 4IEVA 4K8FA 4LULA 4YVWC 1QJEA 2PN5A 1VB4A 3GZAA 4LHKA 1RUF2 3ZKYA 4HPKB 2CWSA 1V6LA 4NMIA 4UW5A 3E97A 4BISA 5FR3A 2VR4A 3BODA 4WVMB 2E33A 5GZCA 3HPNA 4HG6B 4YSFA 2IFWA 1V6IA 4LEJA 4XFGA 1UX6A 5EJZB 1N3QA 1Y9QA 1W8ZA 5LBEA 2XJUA 4HKOA 5FOJB 2VW0A 3KVAA 3THTA 3KQRA 4R4ZA 2D6NA 3R6SA 2JB8A 4AL9A 1D0HA 4E4HA 3ZN5A 4ZZ5A 4LBMA 2QQMA 1SZBA 1S2KA 1DQ5A 2Q8OA 5IT6A 2D5HA 3ZSLA 3DGTA 4RHV2 2WQ8A 3T4HB 5FMOL 5DZEA 1BZWA 2A6WA 1VAVA 1STMA 1HW5A 2EIEA 1MS3A 3RYRA 5F7UA 4IEOA 3IMNA 1RVF3 5HCAA 4BQ4A 1AR61 3H3UA 4UFKA 5FTTC 4CUAA 2FDJA 2RMU3 5JOZA 2J42A 2WO3A 2VZOA 4TXWA 1V9U2 3WW3A 1CZVA 5FCCA 5BXXA 5CB7A 1JYNA 1QOOA 1YWKA 3E6BA 3Q8CA 4M3CE 2CNAA 3ZR6A 1WMDA 3AMMA 5E89A 3IT8A 3ZFGC 4FSJA 1F15A 4LA2A 3HWJA 4BIFA 2C5DA 2JG9B 1NCQB 1WCQA 3IDAA 4Q26A 1JOPA 3JB8A 4P00B 2ZGKA 4X6QB 2W87A 2CGPA 2E7TA 4SLIA 5K0UC 4B3NA 3RGBA 2G19A 4OI0A 2DTWA 2YDEA 5LA1A 3KWVA 4LNVA 4NRPA 3ZYBA 2EAKA 2FDHA 5ACA2 3TEWA 4P5HA 1HRV2 1MQTC 4R9AA 1S4CA 4CU7A 1W05A 3KV6A 3E5UA 1YFXA 1AYM1 1LCLA 2YB7A 2A6XA 2GH8A 1ZZ6A 4S2HA 5BNPA 2RE9A 3I3EA 3IAQA 4HVRA 5IAVA 3T4VA 3TBDA 1POV0 4BH9A 1OA3A 2YV8A 5IAXA 2EIDA 2R0HA 4RQPB 5J36A 3LGRA 4ZZ8A 4ZY9A 1JOBA 2VOWA 4Y1YA 5FYYA 3KZ4C 1LOFC 1V6NA 1OT5A 3OEAA 5CFCB 3OY8B 4EV0A 4DOUA 2BWAA 2NQYA 4A41A 4N90A 2OKXA 1RUC1 1AXZA 1DF0A 1ULOA 4HOOA 4Y22B 1J84A 2D6PA 2HBUA 4DB5A 3X29B 4M00A 3H7YA 5FQ0A 3VBOB 4XTPA 3MI8A 3NAPC 1DFQA 1Y7BA 4XAAA 5LBBA 4AQ6A 5J48A 5JVVA 5KR7A 1XNCA 4LK7A 2XG3A 3H42B 2WL1A 3I7DA 4QHOA 1W9TA 3MIBA 1H1AA 3VV1A 1ZNPA 4AFCA 3JD73 1VRBA 4WV8A 4M3CF 1XYPA 4A7KA 3GDBA 5L7OA 1BBT1 4XPVA 1V9U3 1XNKA 3BOPA 1NA1B 1YC61 1UYYA 1EAH1 2TEPA 2R16A 1ZX5A 2G9GA 4Y20A 4LLFA 1SLAA 5T5JA 2UU8A 4XJAA 4YVSB 5FXWA 1BK1A 5IVBA 4NN0A 3AZZA 2A75A 4EWAA 1O59A 2V09A 4OI1A 2XJRA 2AC1A 1ZA7A 3ZM8A 1R64A 4GH4A 2DURA 3PU3A 5FMOS 5CKNA 2WFF2 4G4FA 4H7LA 1FPN2 2GU9A 1BMV1 1PO11 2VXJA 3OD4A 4E2GA 1JZ3A 4NVPA 4YRDA 4DZGA 5FJKA 1UPSA 1UX7A 3AJZA 3SNMA 3P3NA 3NL1A 2ZKNA 4YNIA 3B69A 1AXKA 4YW2A 1NYWA 2WNVC 4A3XA 4EN8B 1JZ5A 3GCXA 1Q43A 2HWD3 4PF5A 1C8M2 2UURA 3W21A 4A7YA 4I09A 1V0AA 2VM9A 4LOTA 4A45A 3WNKA 1LEMA 4MGYE 1AYN2 3AKPA 4RSUA 2ZGQA 1D4M1 1SBDA 2VH9A 4XUQA 2BBVA 2GAUA 3U1XA 3T0AA 4CDWC 1POV1 1GZWA 1MZ5A 4AHZA 3ES4A 4FP2A 3KM5A 4CU6A 3J8F1 5C4WC 1GKBA 2OPWA 2W68A 4FPGA 1RUD1 1G7YA 1I6XA 4IE7A 5FZ3A 3CMGA 1PHMA 3BALA 1IPJA 3CHXA 3MUY1 4LUMA 5EXOA 1YQ5A 1T6BX 3NV4A 4N53C 4YVWB 1OA2A 3N36A 4LBJA 1QKQA 3FBMA 5FO9B 5DAVA 2WS92 2P6HA 1W6QA 3FLRA 1KFUL 1WGPA 4PDWC 2WZEA 1C1LA 3RMYA 2HJIA 5EP9A 2A3YA 1UOFA 2BV4A 2Q8CA 3VKNA 1PVC2 1YEWA 3MYXA 5BUVA 4GZ9A 3B7MA 5FMBA 2W9XA 4IEWA 5L36A 1BJQA 4XBLA 3RMXA 3VD7A 3H3ZA 4RGAA 3W9AA 4AVVA 3D8CA 1AXYA 1TMF3 1HJGA 3PMSA 4BQWA 1AL0G 3IPVA 1NLSA 2VZSA 1CQ9A 4F7ZA 4Q0SA 3J7LA 3WLUA 1W8NA 5B4XA 1MS1A 2WABA 5F3EA 3V65A 4NRMA 1VBE3 2OZ6A 2P6CA 2R30A 3VHPA 1ZBE1 1Q8QA 4JTOA 4B29A 4Y1UA 3I2OA 1EV13 4NJ4A 3KV5A 2VCBA 3DUIA 4FTBA 1UXXX 3GGLA 3WV6A 4FOQA 3EJKA 4ITCA 4UF0B 4CP1A 4CDQC 1GSLA 4YW6A 3ACIA 3VKFC 3LOBA 1YI9A 5T52A 1GOFA 3A0NA 2ET7A 4NHMA 3WX5A 5A7WA 2E53A 3WHTA 3I49A 4H2AA 5I0SA 2QBXA 2W08A 2K2SA 1KXGA 1OLMA 4BQYA 2JDAA 4R8HA 2WO7A 1OA4A 3PVBB 4L92A 5FKBA 1GZTA 1CAXA 2HWF3 1HB1A 3ZFGB 1GICA 2XHKA 3IDCB 4LBQD 2A5ZA 2QQLA 3AZXA 5GKAC 2Z79A 4BQ5A 4CCJA 5J96B 2DFBA 3IAPA 3N7LA 3GJAA 4PF1A 1NCRA 4IV1C 4NR1A 1G9DA 5IJRA 4I0WB 1ZZ8A 3H1MA 5K0UB 1E5RA 2XPJA 4YM1A 5LK5A 1ZYBA 2D3SA 2WZ8A 2IXHA 1RHI1 3M3IA 4NAOA 4O9EA 1UYXA 2X09A 1ZVFA 4CZSA 3POEA 1MQTB 3N7KA 3P5BA 3AYEA 4P9YA 1D2SA 2W2IA 2FHRA 4JC1A 3KMHA 3WQBA 1DU3D 4NHLA 1QU0A 3S0MA 2R041 3MZHA 1YQCA 4TYSA 1HXS2 4LHSA 1H1MA 5CVRA 2WAAA 3M2MA 4WVZA 1TQ5A 5DXDA 3UKVA 2H0BA 4GJYA 5ANNA 4QXHA 1YIFA 1VBD2 5JMCA 2OZJA 4EN0A 3CNAA 2BUKA 3DECA 3MUZ1 1HQWA 2OX0A 2XQRA 3ECQA 4B7KA 3WDXA 5C71A 1S0DA 4CCMA 1UMIA 3IDEA 4IE5A 4DNYA 3Q8BA 3JBG2 4NIGA 3WDYA 2JX9A 1JXNA 1PM4A 2C9KA 3J7HA 4GB32 2DUPA 4JHTA 4UFJA 4CDUA 1U5IA 4F83A 1PGW1 3HAGA 2DCYA 1REEA 4P9LA 1S55A 2CDOA 4Q4Y1 3MF9A 4RS5A 3ZMOA 1K5MC 4AE2A 4F3JA 4D6RA 5IFTA 1UOGA 4OZXA 2BEOA 4AQ2A 1IS4A 1AF9A 1GANA 4OI4A 4EZHA 4C90A 3J7MA 5SV5A 2VMFA 4S2GA 2WJSA 1CZSA 4ARXA 2QQUA 4KGQA 2GMEA 1I9RA 3VDBA 3BI3A 1UWWA 2WUHA 3LKJA 1COV1 1AR91 2VZ3A 4N7UA 3K46A 4QGNA 4Q8LA 3LDRA 1OUXA 4M0HA 5HBAA 4UW4A 3VBUA 2ZCWA 4JDNA 2JE9A 2RDQA 1DG6A 1S1AA 1HRI1 1HN0A 3TOJA 1PMHX 2OPKA 3PUAA 2VGDA 1IKQA 3AKTA 3KCYA 4IW3A 2D5FA 5A32B 4IEYA 4GA9A 2SLIA 4K3UA 2QVSB 4BYYA 5GZEA 2DDUA 3RRDA 5C5UA 5C8CA 1R082 2JD9A 1T6GC 3GM8A 4HPKA 2ZEYA 2HWC1 3GYDA 5DPNA 4PIYA 3MW2A 4CPBD 3SEEA 4XXPA 2AR6A 2O14A 2XL9A 4K7JA 4WVMA 3VZKA 2WNVB 2QJVA 5FYSA 2KXLA 1LGCA 4KH9A 3ZDVA 2Q1ZB 4COZA 5C8WA 2Y0OA 1GZCA 1VBD3 1IPSA 2MPFA 2VOXA 2PMWB 1Y43B 3FMGA 5E88A 1NE4A 4FQ4A 4L9BA 5FPLA 5LATA 4PT6A 3WG2A 3NWKA 5C4WB 2PA7A 1RB8G 2XVGA 3SH4A 5B2GB 1B35B 2N7GA 2P3YA 5JCTA 2ARAA 3NNGA 4XFAA 3LSDA 2D6KA 3CBNA 4A4AA 1WLTA 5ABJC 1H6XA 4I01A 4N53B 4OULA 3O0XA 2ZA9A 3BKZA 1NG0A 2GDFA 5JZGA 2SBAA 1SBFA 2WT1A 1IS6A 1NXD1 1HKDA 2YC4A 4G3YC 3MW4A 3ME2A 4MG2A 4KGGA 4DEQA 4GKYA 5JPNB 1A3KA 1O5UA 4ONUA 1CAVB 1SDDB 4QM9A 1ODMA 1HQNA 2ADEA 1XE0A 3ACGA 4ASMB 1UU6A 4BLIA 5ISLA 3IIIA 5IWFA 4MXWB 1DCSA 2P17A 5GZFA 5CEHA 3OPZA 4URAA 4AFAA 1V00A 2A6ZA 2WT2A 4Q4W2 3VZNA 1DQ6A 4UBHA 1RUC3 3HIFA 5T50A 3UKNA 3VN4A 2DVDA 1VMJA 4AFMA 2JG9A 2J1RA 1NCQA 3HNYM 3NSTA 4XBQA 5AFEA 2NM1A 5DUUA 4BMBA 3IBMA 5L9RA 2VTXJ 3A22A 3KHBA 5A7SA 1T2XA 2W52A 3HEIA 2B4KA 2FQPA 5EWSA 5EQUA 2JWPA 1DZRA 4AF9A 4QXCA 1R092 1W9YA 5DZGA 2JE8A 2Y0IA 1W6NA 1BBT3 4CDQB 4QMAA 4GWIA 1O5LA 1XBFA 4PBPA 3WSOA 3CL1A 4EYUA 1LOEA 2ZHNA 3R05A 5KXBA 1DYOA 2Z42A 3EYPA 3FHQA 2YHJA 4AZZA 5JAXA 4UBGA 2R071 2EXKA 1O6UA 2B8MA 2JDKA 2RS12 4RQPA 1PO22 1KDKA 3AYAA 1NT0A 4UFIA 3UK9A 4Z92B 5CFCA 3ZN4A 1UZZA 4IGPA 4GMP0 2P3KA 5FZFA 3LA3A 4IV1B 4Y22A 2HH9A 5I0TA 1BCXA 4XUNA 2JIJA 1PO13 3THCA 3T2QA 1ZM1A 4LO7A 3H3LA 1GUIA 4HKWA 3VDCA 3I2GA 4AI0A 4LHNA 1LNSA 5D8AA 1WW6A 4Q8KA 1VB2A 1W6MB 5T54A 1DBNA 3O5SA 3POJA 3NQHA 1KJRA 4I30A 4XJZA 4AVCA 5F3GA 4LBLA 1CX1A 4XFFA 1AR81 3VHNA 1NA1A 3VLBB 1JI6A 2XL7A 5FPVA 1D4M3 2C9AA 2V73A 3VBUC 4YVSA 2B46X 2Y6GA 3WW4A 1POV3 1IOAA 3LEGA 2NN8A 1HV1A 2RS52 3USUB 4L97A 1XYNA 3MIGA 1RUF1 3QH7A 3Q8EA 3N7JA 1RUJ1 1E5SA 2RR11 2DF7A 4INDA 2RJ2A 1CAWB 2A1XA 2VG9A 3RVHA 4FPYA 2X8KA 4CEWB 1O8PA 2VBDA 2G4IA 2I07B 2VMGA 4MH0E 1U5ZA 1FNZA 1K5MB 1GNHA 4XQDA 2HEVF 5KC5A 1VBA2 2VCMA 2ZGPA 3C8XA 1BK0A 2BTVC 3OUHA 1UF2C 3M3EA 5EV7A 4R9DA 4RFRB 1NKGA 4HSJA 2O8QA 2RS31 1UOJA 4QHBA 4LR4A 4NOTA 1REFA 3T0BA 3V0AB 4E2QA 1W9FA 2WO1A 4QU1A 3RZMA 3I54A 1WW7A 4AG4A 1RINA 3LEIA 4W65A 2E26A 2G9ZA 4OUSA 5M0TA 1O3RA 4AEKA 4BIOA 1QJY2 4FPCA 3OD0A 1PGL2 4P9WA 4YGCA 5L19A 3WDUA 2OXBA 3VD5A 1ZBA1 1XYOA 3C7HA 1RUNA 1HLCA 3AZYA 4CP9B 4GMP1 3EHKA 2PHWA 3LD8A 1XQNA 1HN1A 4YVWA 3NV1A 2O1QA 4BHPA 3AJYA 3DKQA 3PVEA 1BEV1 3RZLA 4K6BA 3N3HA 4UAPA 1X36A 3GHMA 1RUH2 2C24A 2OUJA 1W8FA 1W9WA 4Z82A 3T1LA 1Z7S2 3T2TA 2WSVA 1PMJX 1QH6A 1UOBA 3EXUA 2JDMA 3E6CC 3AMHA 4KG0A 1QJX2 1QWRA 2JDNA 3AX4A 2V5YA 3BGAA 3OGVA 1YO8A 4MADA 1NAEA 1GQGA 2QZ3A 3TWIA 3LIGA 3CO2A 4AVTA 3ZXLA 2J1UA 3C2UA 3DV8A 1YJKA 5G05L 1HRV1 2VQAA 1CX4A 2W1SA 1US2A 1OQDA 1JOJA 3HT1A 4Q4X2 2WZR3 5FP9A 3TNQA 4X8NA 4XFIA 2VOVA 2O8OA 4XDQA 2JKXA 5JXGA 1G9FA 4QDRA 2VTFA 3K3OA 2Q5TA 3NNFA 4IE4A 2GNMA 3F95A 5BPXA 3WUCA 3NKGA 1I1EA 2DBNA 3RI8A 4WM7B 4XACA 1TNFA 1VBA3 3S5QA 2R043 3PURA 4UF0A 1NXMA 4XW3A 1F5FA 2NMOA 3KSCA 1U12A 3VGIA 2B42B 1QXPA 2GZWA 1SDWA 2LS6A 1QXJA 4DFSA 2PLV1 1HIXA 2CWMA 2GC1A 3PJYA 3FWEA 3SCHA 2E6VA 4OLLA 1XJAA 2Y64A 3ZFGA 1TE1B 3VBOC 4HZFA 4XF1A 2ES3A 3KQ4B 4NIAA 4Q1PA 1QGLA 2WQ4A 5LA0A 1UZVA 2ZX1A 4XE9A 1H4GA 5K0UA 4AI2A 2VMCA 3LA2A 3KCCA 2ARBA 4Q4Y3 5EFUA 2XJTA 4E4DX 3ATGA 5I0RA 1X50A 1QDOA 3LAGA 3OGSA 1SPPB 3NV3A 1QF3A 1MQTA 2MEV1 4QGMA 1GWMA 3GZUC 2VNVA 2Z5WA 1LU2A 1C8NA 3GBFA 4JDMA 2XLGA 4FOWA 4E8CA 3T08A 3J7NA 5IK7A 3O0WA 1W28A 1DHKB 1MZEA 4LBKA 4YM2A 2ZHLA 2WNEA 2WFF1 3IN9A 1SG3A 1KS4A 1FPN1 4B1LA 2VMHA 5FOBB 5A3OA 4KWLA 3DN7A 1LOFA 3AMQA 4NHYA 2IWGB 4QX8A 3MLKA 4CU9A 4WVVA 3I2DA 4LPLA 1BVVA 1HRI3 4Q5OA 2HWB3 1RVF2 4PQ9A 5FZDA 3TEXA 3N9OA 3OG2A 2W1WA 2WKKA 3NAPA 3WW1A 2RMU2 1A6CA 5EYYA 5FZ4A 4CDXC 2VAUA 3LZZA 2VNOA 1OBNA 1QNYA 1UKRA 3E6DA 1GWLA 3VDAA 4ZHNA 5DQ0A 3BTXA 4FTSA 1YRZA 2F4PA 2ZPXA 1VAMA 4YG0A 4W6XA 1SLLA 4QPGC 3FFQA 3SH5A 4S2DA 2PYTA 1UY4A 2ZX2A 4M4PA 1YQ2A 3AFKA 4EJRA 3AKQA 1CONA 1LRHA 1JZ2A 3T0DA 3N4MA 1UY2A 4O9GA 1QOSA 3NV2A 4MGZE 4RFT0 4CCOA 3NJXA 2AENA 2BWCA 2BFUL 5HXMA 3LOIA 3CLPA 5F5QA 2QQIA 1Q8VA 1ZRIA 5FMCA 5T5OA 3ILNA 3AM2A 2Y26A 5F5AA 5A32A 1XSQA 3OGGA 5KHIA 3ES1A 4Y5TA 1QNWA 3KLSA 2CY6A 4XUTA 1WW5A 4IGOA 5C5TA 4JV4A 3HQXA 1DDLA 1FOD1 2WNVA 3BYWA 5EYXA 2P5BA 2DFCA 3TNPB 2VECA 1OD3A 1Q56A 4QPYA 4CXWA 3KT4A 4UFLA 2W47A 2XMLA 4TLFA 3LF7A 5TSWA 4B8EA 1O8SA 3TEYA 5IVJA 1UD1A 2OS2A 1DZQA 3QLQA 1FX5A 3S57A 1VLNA 4LHLA 4AFBA 4CDWA 1NY72 4NE9A 1R1ZA 2QTWB 4FBFA 5C4WA 1QJFA 1EP0A 3AZWA 4QX7A 4A7ZA 3ZKUA 1WLDA 5KXCA 2A6VA 3KCXA 4B4RA 5FO8B 3JD72 4AHYA 3PTYA 4N53A 1A8MA 1H2KA 4K21A 5FYCA 1H4HA 2Q4SA 5GLWA 3VZLA 3ZSMA 4LLOA 4NAMA 4PDWA 4XTMA 3PL0A 4UW6A 2GSYA 3QD6A 3WW2A 2XWJB 5DZFA 4AI1A 2XBO3 3MIDA 3HJRA 4TN7A 4PIXA 3ZXEA 4DY3A 2E63A 1CAVA 3LB9A 1FMD1 5KC6A 4HSLA 2BNMA 3WQ7A 2B45X 4MXWA 1H0BA 5T5PA 2Y38A 2IC1A 2XLAA 1SACA 5LBCA 4XYXA 4ATEA 3RYKA 2PQSA 1XE8A 2VQTA 4Y26A 5KHKA 3O14A 5FY7A 5IVYA 1W90A 1AVBA 3MIFA 5CNAA 4LTAA 2WZPP 4LBQB 1R1A3 2PHUA 1XNAA 1O4YA 1ULDA 1POQA 2JB4A 5IK5A 5EJ1B 4MOAA 3B02A 2R1BA 2HWD2 1ZZCA 1J3QA 4HT1T 4P02B 1VP6A 3AXDA 3ZYPA 2JENA 4K9SA 4CDQA 4J1XA 4AEJA 5KHJA 5FYTA 1MS0A 2HWE1 5F6LB 2IXLA 3VL9A 1Q8OA 1RUG3 1ULPA 3GCWA 3JBG1 5JOWA 1OPOA 2WIIB 2ZGSA 3OYWA 1NX9A 1DQ2A 3WG1A 2UWAA 3BTZA 3CKHA 4P9GA 2ETEA 1MEC1 3ZXGA 4W8JA 1RUJ3 3R4DB 2JDZA 2RR13 4XIKA 1XPWA 1AL21 2BGOA 2V4VA 3I2JA 1WMFA 4IV1A 4LXLA 2ZGOA 3WNLA 4AGGA 3VDDB 5LW9A 4BXSV 4AI3A 3CQOA 1DQ0A 4WBBA 1XNBA 4XCAA 1ASJ3 5A3NA 1NUKA 2VZ1A 3ZOIA 4XDPA 1VPHA 1W6MA 2Z2SB 1U5YA 1QQP1 2GMMA 3IIAA 2Q0AA 3TRSB 4KQ7A 1OC1A 1TMF2 3OTFA 5JUVA 1UIKA 4I3PA 5A80A 2JG8C 3BTAA 3TN93 2YC0A 3FHAA 1QHDA 2WFPA 3LDKA 4PI0A 1ULFA 1VALA 3WCSA 3LE0A 2OQ7A 4I0AA 5A1AA 1MVEA 3ACHA 3RZJA 1AR72 1JW6A 5JMOA 4YW5A 2YFUA 1VBE2 4AR2A 1UIJA 1ZBA3 2HEWF 1K42A 3H8OA 1EV12 3UGHA 3D3AA 2ZAHA 2E9QA 3O7OA 2VU9A 1CAWA 4RR3C 1FAYA 3UGFA 4CEWA 4CDXB 4WVWA 1BEV3 5I0UA 3OOXA 4G9SB 3MV11 1K5MA 1LHUA 1S2EA 2ZGRA 4LBOA 4FP3A 3GJBA 1GMMA 2KR2A 1ND2C 1PMIA 1J58A 1RJ8A 2ILMA 2IVJA 3P1IA 4PI2A 4NWWA 3S7IA 4QPGB 4EWEA 4CUCA 1MZ6A 5FV3A 2EALA 4CU8A 3ABZA 3V0AA 2VNRA 4X6RB 2HWF2 3WDTA 1W0NA 1ENXA 2Y6HA 4Q4V3 5CIRA 1G9BA 3SH3A 1B35C 3WDWA 3JUUA 1OI6A 2JDYA 4JVAA 2YUEA 4B1MA 2QQOA 4EE2A 4CEWC 4MX3A 1LR5A 3J26N 2YROA 4XF3A 3NJYA 1OOPC 2QQWA 2J1VA 1J59A 5FZOB 5K8SA 2FZ1A 2HLEA 4O61A 1TME1 5D2AA 1IG3A 2G1MA 2ZACA 4Q4W1 3WG3A 3ZSEA 3NNLA 3WOGA 1G6NA 4IQPA 4MVTA 5J37A 1HDKA 5A3WA 4BQ3A 2ZKLA 1V6KA 3OEBA 1ENRA 3HBZA 1RUI1 2CYFA 2VMDA 3PU8A 4KWUA 5C9AC 4BJ0A 3DPRC 4RA0A 2CSGA 4R52A 5I93A 3OGRA 3C7OA 1AR73 3JXSA 1X82A 2ZJCA 2YPJA 4LA3A 2XHNA 3SLIA 3N9LA 1CESA 1JU4A 2BERA 1BVP1 3ZN6B 3I3MA 5FY0A 1ZA4A 4M3CA 3IZOA 2CTVA 3THPA 3ZPYA 3AVRA 4IESA 3VHRA 2ZABA 1W8TA 1MS4A 5ABJA 4QXBA 4Y1VA 4CSWA 2FDGA 2Q1MA 1RMU1 5FZ6A 2MEV3 3WF0A 1IZ3A 1YCIA 4LT5A 4K20A 5A1FA 5G04L 4URTA 2VOTA 1JH5A 2W3JA 4OHZA 2XKOA 1JU3A 4ZKTB 3PJQA 5JR7B 5BV6A 5HCBA 2ZZJA 5DDJ1 1VRH1 1UCXA 3OUJA 3MW3A 3JCIA 3WNOA 3GXUA 3HR9A 4PCRA 4DXRA 4I2OA 4XBNA 5KHGA 3DYMA 1UXZA 4QX0A 4YGDA 2JXAA 1AX0A 3A7QA 2NZ9A 4WZFA 2DYCA 4CUBA 1QDCA 3BU0A 4Q27A 4IEXA 1P8JA 3AL6A 2ZXQA 3RJ2X 4AYUA 5A6XA 4XMIA 4UI9L 1J1LA 3U4SA 2F4LA 1CAUB 2EA7A 3BN6A 5J7MA 1SPPA 1JYCA 3POSA 1LAJA 3QCWA 5CAZA 5A70A 4GULA 2WAOA 5IHRA 3MLJA 4Y24A 4E27A 3CJXA 1D0GA 2WINB 1RJ7A 1H8TC 3ROUA 3WP3A 5L9VA 3O1UA 2GN3A 2WNUC 2R061 2PAMA 2ZGUA 5JXIA 4DIQA 4GKXA 4WM8C 1X8EA 3HVDA 1VR3A 5CA6A 5J3UA 4XABA
chains in the Genus database with same CATH topology
1PNGA 1VBB1 4YG6A 1AHSA 4QX5A 4DPNA 4XILA 5T5LA 2CGNA 2RJLA 1LGBA 5AC91 1H9WA 1PIV1 3WT3A 1AUYA 3L2HA 3LSEA 4B4QA 3A0KA 2RHPA 2NP0A 1ULEA 4QM8A 1QJY1 3KD4A 3M1HA 1LESA 2XVLA 2JG8B 1OMIA 1JHNA 1W0PA 1RUC2 1WLCA 2K9ZA 4HFSA 1UKGA 3NJZA 4ISQA 4IV3C 4DRRA 1V70A 1TNRA 4FPJA 5CU1A 5H9RA 4C0BA 2ZOEB 2IXIA 4IEPA 1AR63 1RUH1 2RM21 1OFSA 3EQEA 4MZUA 1J1TA 4JRLA 4FXKB 1YUDA 1WMEA 4RR3B 3K51A 1QJU1 2F6BA 3RJRA 1BBT2 4BLJA 1E57A 3POWA 1GBGA 2ZX0A 1ND2B 1U5XA 4EN6B 2WA4A 1MACA 1ZZBA 2ZS6B 1FMD3 3B9CA 3NVCA 5L73A 1EYBA 3HD8B 4DMIA 2FMYA 4TZDA 3KGZA 4IXLA 1SBEA 1RIRA 4AQSA 2E7QA 3FBYA 4X8PA 1RUE1 1WCKA 1AX1A 1FV3A 5H9QA 2ZBJA 4YG3A 1BMV2 4AW7A 1LODA 1PO12 4K1ZA 3ENRA 5DG2A 5FBZA 4CYDA 1G9CA 1OOPB 2GC3A 4WM7C 4MGKE 1AYM3 2ERFA 4XFHA 2X29A 2UWCA 4LBNA 3JQXA 1C28A 5I8YA 2KA3A 1BYHA 4CEYC 1D4M2 2AH2A 1GZ9A 3MPPG 4C0HA 5CADA 1N1TA 4YM0A 2I74A 2UYAA 3OGJA 5C9AB 5A33B 2E51A 5FLHA 4Q0UA 1RUD2 3DPRB 3KS7A 4DINB 1VBC1 1Q3EA 2G9FA 2VUJA 3FC0A 3S30A 1KDMA 3AP4A 1MEC3 3JZVA 2OA2A 5JIUA 4YFWA 1AL23 1ULCA 2R49A 4N43C 1LENA 1H2NA 3AZVA 3ILFA 4RL7A 5KXDA 1WCDJ 4LBQA 1AX2A 4QT6A 4XEZA 1A8DA 4YW3A 1DLLA 1LULA 1EAH3 4H14A 5EJ3A 1LOBA 1QQP3 1OHFA 5T55A 3WNXA 1MZFA 3VKLA 3VZOA 3QOPA 2QDNA 3OY8A 3K48A 5KBFA 1EPWA 1ND3B 3E5XA 4OHVA 2GNBA 3RNSA 4YZ4A 4HETA 4C1WA 3VBOA 1DYKA 5FAXA 1CJDA 4M01A 2D43A 3RS6A 3VDDA 1SCSA 3ETQA 4ES9A 4MLOA 1NOVA 2LALA 3H9AA 2LTNA 4UXAA 1AZDA 3DKWA 4C1XA 1BQPA 3PHMA 5FQ0B 3IKWA 4BE3A 2XJVA 4KBBA 2AREA 2PHXA 1UL9A 2ZMKA 1H8TB 3J8F3 1PZ7A 2WNUB 1WCSA 1PNFA 1RUD3 2ZGTA 4WZCA 2WZR2 4GQ7A 5L7OB 4WM8B 1C3HA 1Y3TA 2OIIA 2BYVE 1H8VA 4JTNA 4JCKA 1MVQA 1FYUA 2XB6C 1YIPA 4D69A 4MXVA 3WHUA 1SEFA 1CJPA 3ZDSA 2XVKA 4CDXA 2R042 4I3GA 3S7EA 3M3CA 1CN1A 4W6YA 1TME3 4AHWA 5K9YA 1IGOA 4LUKA 3CJIC 2YYOA 1N47A 2VULA 3MGUA 3PMEA 4RHV1 1V6JA 3U0ZA 4GIQA 3MPBA 4QPGA 2FZ2A 1RUI3 2QUOA 3FLTA 3SISA 1OQEA 2WT0A 1CGPA 3H1YA 4ES8A 4EN9B 2XWBB 1LB2A 2BPA2 2PHTA 1CVNA 2XUMA 5BNNC 3HN1A 5D1IA 1NZCA 2DU1A 2NPIA 4IV3B 3VBFC 2H0VA 4NWVA 3WCRA 1GLHA 1ZBE3 1V9U1 2VPVA 4FCAA 3WP6A 4QXKA 1ZRFA 4Q4Y2 4HVQA 1N1SA 4I02A 4OHXA 1Q8SA 5GZDA 4JDOA 5JPMB 4PLMA 1DGRN 1YI7A 5IUQA 1B09A 5FLIA 4QQ2A 1OKQA 2TUNA 3AKRA 2B9UA 4XFBA 3MDPA 4IL7A 4LE4A 1AR92 1XXNA 2GALA 1FXZA 4FQZA 1VRH3 3USSA 4MUVA 5JSRA 5I91A 2OUHA 5ACA1 2I45A 4LO8A 4COWA 2A6YA 2FMDA 2A73B 1HRI2 3VBSC 4MYEA 2HWB2 2AZ5A 2HEYF 5C6CA 4YZ2A 3H1WA 4AEMA 3ZN6A 1RHI3 5IK4A 1LHNA 4CTEA 3D5OA 4PLOA 3WY6A 3CU7A 4Q0VA 2ZAAA 2D3RA 1C4RA 3HMYA 2HWC2 4I0BA 3IPVB 4AGRA 5H9PA 3KGLA 2R1DA 3WUDA 2YXSA 3VBRC 5F9TA 4B7EA 4CEYB 2IXJA 1JN2P 3VBHC 3WVJA 2EIGA 2YGMA 4DXZA 4MSVA 2R063 3ZYGA 4AEDC 4Y1XA 1F2NA 3QBQA 3O12A 3VKMA 3WR0A 3AP9A 2DVAA 3VDDC 2VVEA 3BIWE 1VBB3 1C1FA 1UW8A 1N1YA 4P9XA 1O3SA 4N43B 1CAXB 5HI0A 1TMF1 3TYJA 4AEJA 3ZO0B 2XH6A 2ZZQA 4LO5B 5CBLA 1PIV3 3VKOA 1ZZ7A 1Z0HA 4CP2A 1NCRB 4NO4A 3E5QA 1W39A 4AHXA 5E1RA 1D2QA 1UAIA 4NPRA 1COV3 1AR93 2GC0A 4YLZA 2VVDA 2D44A 4BQ1A 1U0AA 2P3IA 4ATFA 3WDVA 1LOCA 4E4SA 1EV11 3MFCA 3H7JA 1NQJA 4XJWA 5LEKA 1W6PB 5JOYA 4Z8BA 2YGLA 1EY2A 3GBWA 4YYOA 3GBGA 5FRAA 2PHLA 3V56A 4AQTA 1SFYA 1C8M1 2RM23 1C5HA 2MHFA 3OF1A 1AYN1 1SLCA 2HWC3 1QJU3 4RD7A 2HWF1 5GZGA 2A7AA 1LOAA 2D7FA 2XBO2 1WW4A 4Q1RA 5T3NA 2H6BA 1HX6A 2WLQA 3R4SA 4ZXKA 4CDUB 3QH6A 3I8TA 4XHBA 3I59B 5BYNA 4PLNA 3WXPA 1MS5A 2NYYA 1IS5A 2ZMLA 1KFXL 2JG8A 1QMJA 2WS91 1RUE3 1SQ4A 2GNDA 1W0OA 1X7NA 3ZFEC 1I3HA 3UJQA 1PVC1 5GJ6A 3RWNA 5CFDC 4Q0QA 4XMAA 1UN1A 4XJ8A 1R1A2 3OCPA 3UJOA 2RJKA 4QQHA 1YHFA 2MNGA 1F5JA 5FO7B 4RR3A 4J1WA 4D7TA 3B01A 2P3JA 1AR82 2DWRA 3VZMA 4HK9A 2Z69A 4XF9A 1RUG2 3CJIB 1JUIA 1ENSA 1ND2A 3POYA 4P9JA 4D7YA 3MLLA 2I2SA 4BWOA 4AI8A 5C8CB 2DCZA 5LEJA 1REDA 4XOGA 4XQ4A 1VBC3 1RUJ2 3WP5A 5BNNB 2RR12 1B35A 3VBFB 1D4VB 4AVAA 4META 1ASJ2 1DQ4A 2EAAA 1OOPA 1WD3A 3P3PA 5BY5A 4IEZA 4U36A 2RS32 5JLVA 2QKDA 4XJ9A 2R073 3TN92 3UL2A 3M4FA 3RPQA 4FOVA 4M0NA 1JUHA 3LWCA 5JZGB 2D6LX 4GXLA 5C9AA 5A33A 3DPRA 1H2MA 3J9SA 1ZBA2 2JECA 3VBSB 1OFNA 3JU9A 1H1IA 1DGRA 1PZ9A 1HXS1 1QH7A 1SCRA 2GMPA 5FLJA 2R32A 3SCGA 3ZFFC 1BEV2 3WZ1A 1Q8PA 2DUOA 2CAUA 5BNOC 4DRVA 3WP4A 1VBD1 3ZXJA 1GFF2 2QE3A 2WWSA 2XGXA 2ZX3A 1AR83 1S0IA 3VBRB 3V64A 4N9HA 4BCUA 3T1MA 2JICA 3VBHB 2VVFA 4GB31 1J3RA 4Q4V2 2OYZA 3FUQA 4C91A 3ZXKA 2WSUA 4AEDB 1ZREA 1RUF3 1UZYA 2BFUS 4J6GA 1OLQA 2O0OA 1W6NB 4FT8A 2DCKA 3L2YA 4HVOA 1ND3A 1PZ8A 3QACA 4YFZA 1O4ZA 3EO6A 4E2SA 4FPOB 1KS5A 1H2LA 1QJZA 3WQ0A 2LUWA 2P34A 2JJ6A 5LRSA 4CP0A 4QPIC 3ELNA 1DYPA 2ZHMA 5JIAA 3VL8A 3AXEA 2QNKA 1DQ1A 3VHOA 2W0XA 4TWTA 4XZPA 2RS33 3NO8A 4HK8A 4RHV3 4KG8A 2CAVA 1OD5A 3ILRA 3FUOA 2PLV2 5KWRA 3U07A 4OVEA 3B00A 1LU1A 4KU8A 5F1RA 5D8AB 3MFAA 2JE7A 4W6WA 5JWPA 3H50A 4JGYC 2EXHA 1DZTA 1O3TA 2X5IC 1H8TA 3AYCA 4NHKA 2D40A 5FFOC 3USUA 4BZ4A 2VY0A 2WNUA 1IHMA 1PK6C 1R081 1VJ2A 1VAKA 4WM8A 4JGZC 4GMP3 4FVVA 2BW8A 1PVXA 3M3OA 2DUQA 2UWBA 3AFGA 5FDBA 5GLUA 1G9AA 2DTYA 3LCPA 2YY1A 2MEV2 4XF0A 4DS0A 3LA7A 2CV6A 1W6OB 2R0FA 4FPFA 5J98B 4QD2A 3BCWA 5JSOA 1S0FA 4YM3A 3D6EA 1XU1A 1N3PA 2OVUA 1C5IA 2B7YA 2A70A 4HN1A 4EWDA 5JSPA 4HN0A 5ACA3 3FFZA 1HRV3 1JYIA 3R0RA 3TAYA 2XLFA 3ZFEB 4EROA 4YW1A 3M7AA 4IV3A 3FE5A 1KRIA 3A4UA 5CFDB 1Q5OA 4XETA 2PHDA 1KD7A 3RI9A 1ZRCA 3RQ0A 4GWMA 3SMHA 5DUVA 4YW4A 1IPKA 5LK7B 2E7AA 5FPXA 2K0GA 2IXCA 1SFNA 4IEQA 3ZYJB 3ZXDA 1GV9A 2DU0A 2X53S 2PLV3 3H0OA 3SHRA 1AJOA 5F6KA 2WA3A 3PNAA 2EXIA 3ASIA 2D6OX 5FREA 4LO6B 1DGLA 2CGOA 4Y5Z0 2A71A 3O0VA 1R091 3AKSA 1FT9A 2IXKA 4K1YA 1CPMA 4D3WA 2DV9A 5JOXA 1ZRDA 4MGIE 4HLTA 1OQ1A 4L11A 3S6PA 3DL3A 2A3XA 2RS11 1PO21 4WM7A 1F9KA 1TEIA 5EZWA 1FOD2 3ZVXA 2GH2A 3SXWA 1O91A 1RITA 2ZGNA 4Y1ZA 1RTVA 4YZ5A 4K40A 1ENQA 2B5HA 2DVGA 2GC2A 1OLRA 2WFF3 4R4XA 2P2KA 4HANA 3NW4A 1FPN3 4CEYA 2WLPA 3UKTA 3RYPA 1ND3C 5BNPC 1RC6A 1LECA 2C0ZA 5E16A 2ZTNA 4BA6A 2P37A 5GLTA 1AR62 5GLVA 4FPHA 1C8M3 2R6QA 2HYKA 3V0BB 5GLZA 3ZFFB 1AYN3 5H9SA 4N43A 5CG9A 4H3WA 5BNOB 2PFWA 4XF4A 4IEUA 3AB0A 2RS51 2JEMA 1CR7A 1GYKA 1WD4A 2PQQA 3FZ3A 1FMD2 2WZR1 4AGVA 1GR3A 3ACLA 2BVVA 1OPMA 1APNA 4YZ1A 3WQ1A 3KT1A 2ZGLA 2GNTA 1FI2A 3VUOA 2WS93 5L7OC 4PIZA 1YFUA 3U10A 1W6PA 1H30A 3OJBA 4XXAA 2WC2A 1VBA1 4L2NA 3D0SA 1PVC3 2BQPA 4XIOA 2PHRA 3PVNA 5GALA 1AYM2 4AFDA 4OHYA 4QGLA 4H55A 3D4KA 1RGSA 1YNAA 4Q0PA 2UYBA 4GH4C 4QPIB 3IM0A 5KHHA 3D82A 3B5LB 4HKLA 1FOD3 2A3WA 5JI7A 4EN7B 1LKNA 2HWE2 2TNFA 3VZJA 1PGL1 1YXWA 1JTZX 1G86A 3RDIA 3JB4C 4JAAA 1WA4A 3OBTA 3NAPB 4Y4YA 3I59A 3BB6A 4JGYB 1MEC2 1MR5A 2X5IB 3ZXAC 5C33A 3MIHA 1MS8A 1PK6B 3N35A 1AL22 2B39A 3B9IA 4AVSA 5FOJB 1RUNA 3D0JA 4JGZB 1Z7S1 3GALA 4D94A 2AYHA 3MICA 4FXGB 3AYDA 3BOWA 5I8TA 4Q29A 1QJX1 3AMNA 4B4PA 1S0CA 3EBRA 2D97A 4JQRA 1EAH2 3L9JT 1QQP2 4COVA 1RUOA 3G7DA 3G6JB 1HQLA 1O7FA 5HCFA 4Q4X1 4L8QA 1FATA 2HWB1 4IETA 4LO4B 3CJIA 4QQOA 4YZ3A 5AVPA 1JBCA 4FAHA 3GNEA 3ZSJA 3FX3A 1SLIA 2EXJA 1G8WA 3IWZA 4Z1VA 4AK3A 1KJLA 3ZX7A 5BNNA 2VMIA 3ZYRA 3VBFA 1HXS3 1M4WA 1WUVA 4BOWA 1F8VA 4PBOA 1NE6A 3FHIB 5A3LA 3ZIWA 5HXVA 4CDWB 1XU2A 3W59A 3ZMNA 4BMEA 4CRQA 3GHNA 2DCTA 4Z2WA 2HWE3 2ZMNA 3CEWA 4HL0A 2QQPA 2UY8A 3AP7A 3JBG3 3U11A 4JRAA 4GB33 3J8F2 1BKZA 1PM7A 4XFCA 4SBVA 4XHXA 1CPNA 2PAKA 2VW2A 4PDWB 2EVXA 3MEPA 3ZIXA 4N9IA 2D3PA 3ZYIB 4ZU7A 2XJPA 4FPEA 1SMVA 3KB5A 4GALA 5SV8A 3VBSA 1S2BA 2PTMA 4F8AA 1YFWA 3B94A 5AVAA 1NCRC 4FPKA 1TME2 3GZTB 4KWKA 1NLRA 1ALYA 2KM2A 1RL3A 1LEDA 4AWDA 1H9PA 1AJKA 1DIWA 1RUI2 3VBRA 2Q30A 1RVF1 3MF6A 2DVFA 1PGSA 3VBHA 1LHOA 2AGSA 4HMZA 2RMU1 5DUWA 5BNPB 1LJ7A 2H6CA 4FOYA 1R083 4AEDA 2HKXA 1L3JA 1ZBE2 5K7PA 4ZU4A 2ET1A 5JDBA 3M70A 4QU2A 2XBO1 3APBA 5J09A 3JQWA 4BM8A 2VNGA 2CL2A 1YFYA 1FNYA 1RMU2 2BVBA 1DGWA 4V1PA 1ZRRA 4KL1A 3OYWB 5BNQA 4KWJA 3AP6A 1KITA 2BGCA 4YGBA 4COUA 2ZHKA 3KT7A 4CDUC 5DDJ2 1N3OA 1VRH2 1WLWA 1X8MA 4RS5C 3N7MA 1ZZ9A 2ENRA 1MS9A 1R1A1 2DCJA 3CF6E 2VQ0A 1V6OA 1S0GA 4HBNA 2FBEA 5CG8A 3TB0A 4Y20B 4KU7A 1RHI2 3Q9OA 4A2UA 3BU7A 2QFEA 4COYA 2QZ2A 3AK0A 4RGGA 3B3QE 5JI9A 4YARA 2W39A 1RUG1 1YLLA 1UMZA 4GH4B 4FO9A 3M8LA 4XJUA 4DY5A 1W6OA 4Q4W3 1NY71 5DG1A 3B93A 1UU5A 3PVOA 1XNDA 1URXA 5C8CC 2QCSB 2R062 4S2FA 4IERA 2UY9A 3WINE 4FPLA 4H7MA 2IZWA 1ASJ1 3JD71 3SITA 1HV0A 4XQWA 1R093 1V6MA 2LM3A 1VBB2 3FJSA 1CD3G 1PGW2 5E8AA 3ZFEA 3WG4A 2DVBA 4FAGA 4N7IA 5AC92 1GZWB 1QY4A 4TSVA 5CFDA 1EPZA 1RMU3 3TN91 5GM0A 1PIV2 2RS13 4QQPA 1PO23 2AUYA 3OBRA 5DUXA 4E4ZA 4ZU5A 1ONAA 2EF6A 1GQHA 1X33A 1VIWB 4R9CA 1COV2 2VW1A 3HT2A 2VUAA 5DDJ3 4QQLA 5JZGC 1W6QB 4E9KA 1IS3A 1J3PA 1LOGA 1UPIA 3IDBB 1CIWA 1W2UA 1I5ZA 2HWD1 1NQDA 1O4TA 1QOTA 2RM22 4UW3A 1YJLA 3H8UA 3ST7A 3AMPA 3I4IA 1Z78A 5LRRA 1DGWX 2XJQA 1QJU2 1SLBA 5A3MA 1S0JA 2JG9C 1NCQC 3WD5A 3M3QA 4Q4V1 2RS53 1FV2A 3W58A 4DQAA 2PELA 2BNOA 4M3CB 1S0EA 4FTEA 4LE3A 4PJYA 2QDRA 5ABJB 3RZZA 2OW4A 1RUE2 2YZ4A 3R4UA 1WBLA 3NKTA 2ATFA 4OFGA 2ZGMA 1UU4A 1BXHA 4L99A 4RQPC 5AFBA 3DF0A 3GF6A 1QXRA 4OI2A 2VOKA 5KXEA 5AC93 3RG0A 5CFCC 3ALQA 3V0BA 3FLPA 3ZFFA 2JKBA 1O3QA 2VXRA 1LGNA 1CAUA 4GWNA 1SLTA 5BNOA 1QJY3 1AR71 1C57A 1IQAA 1VBE1 3ZXFA 5D8AC 4ORFA 2NLRA 4P9IA 5I8SA 1XRUA 1VBC2 2ARXA 2C1FA 3C3VA 1XE7A 3AP5A 1NA1C 2IFRA 1YYNA 4AXOA 4U2AA 1RUH3 4YVSC 1Z7S3 2NMNA 1N1VA 4ISRA 4P14A 4YGEA 3U4XA 2BNNA 5IK8A 1QJX3 2D93A 4QPIA 4OUMA 2XKPA 2PAEA 3UV9A 2R072 2D98A 4KNCA 4MV2A 4Q4X3 4BPZA 4Q2FA 1OSGA 2WQZC 4RS5B 1WBFA 2XJSA 2YMZA 1S0BA 3URFA 1A78A 3INAA 3MIEA 4JGYA 2GN7A 2ZX4A 4R9BA 2X5IA 1PK6A 1F31A 3BPZA 3PLQA 1GNZA 5FPZA 4AVBA 4JGZA 1M06G 3SCFA 3J4UH 2PHFA 1IKPA 1LTEA 3VBUB 1KQRA 1LHVA 1LHWA 4Z07A 4D7SA 3RSJA 2TBVA 2D6MA 2JD4A 3ZSKA 4ASLA 4OHWA 1ULGA 4IEVA 4K8FA 4LULA 4YVWC 2PN5A 1VB4A 3GZAA 4LHKA 1RUF2 4HPKB 2CWSA 1V6LA 4UW5A 3E97A 3BODA 4WVMB 5GZCA 4YSFA 2IFWA 1V6IA 4LEJA 4XFGA 1UX6A 1N3QA 1Y9QA 2XJUA 4HKOA 2VW0A 3THTA 3KQRA 4R4ZA 2D6NA 3R6SA 1D0HA 3ZN5A 4LBMA 1S2KA 1DQ5A 2Q8OA 5IT6A 2D5HA 3ZSLA 3DGTA 4RHV2 5FMOL 5DZEA 1BZWA 2A6WA 1VAVA 1HW5A 1MS3A 3RYRA 4IEOA 3IMNA 1RVF3 5HCAA 1AR61 3H3UA 5FTTC 2RMU3 5JOZA 1V9U2 3WW3A 5FCCA 5BXXA 5CB7A 1QOOA 1YWKA 3E6BA 4M3CE 2CNAA 1WMDA 3AMMA 5E89A 3IT8A 3ZFGC 4FSJA 4LA2A 3HWJA 4BIFA 2C5DA 2JG9B 1NCQB 4Q26A 3JB8A 2CGPA 2ZGKA 4X6QB 2E7TA 4SLIA 5K0UC 4B3NA 4OI0A 2DTWA 2YDEA 4LNVA 2EAKA 5ACA2 4P5HA 1HRV2 1MQTC 4R9AA 3E5UA 1YFXA 1AYM1 1LCLA 2A6XA 2GH8A 1ZZ6A 4S2HA 5BNPA 2RE9A 4HVRA 3TBDA 1POV0 1OA3A 2YV8A 2R0HA 4RQPB 5J36A 3LGRA 2VOWA 4Y1YA 3KZ4C 1LOFC 1V6NA 5CFCB 3OY8B 4EV0A 4DOUA 2BWAA 2NQYA 4N90A 1RUC1 1AXZA 1DF0A 4Y22B </