5F3IA

Crystal structure of human kdm4a in complex with compound 54j
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
350
structure length
342
Chain Sequence
b'ETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 4A
publication title 8-Substituted Pyrido[3,4-d]pyrimidin-4(3H)-one Derivatives As Potent, Cell Permeable, KDM4 (JMJD2) and KDM5 (JARID1) Histone Lysine Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 106
structure length 342
sequence length 350
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5f3iA01
5FWJA 5FZOB 3PTRB 5A3PA 5LY1A 5F39A 5A1LA 3AL5A 5FY9A 4V2VA 4UF0A 5FZDA 3K3OA 4ASKA 5A7WA 4HONA 4D6QA 5A7SA 3KV5A 4IGPA 5IVBA 5FJKA 5FYSA 2PXJA 5FYUA 2W2IA 3ZPOA 2XXZA 5IVCA 4AAPA 5FYBA 5K4LA 3U4SA 3KVBA 5A80A 3OPTA 3K2OA 4QXHA 5FZEA 5F2SA 5FUPA 4BISA 5FZ9A 4GD4A 2WWUA 4UF0B 5A7WB 4D6RA 2WWJA 2Q8EA 5FZ8A 5LW9A 5FWEA 4QX7A 4Y33A 3PDQA 5F5IA 5F3GA 5A7OA 3N9OA 2VD7A 3NJYA 5F5CA 3KV9A 5FYYA 5FZ3A 4EZHA 3PUQA 5FY1A 3KV4A 5CEHA 5FY4A 4CCNA 5IVYA 5FY7A 5FYMA 5A7NA 5FZMA 5F5AA 5FPUA 2YBKA 3N9MA 4XDPA 5FPVA 5FYVA 4AI9A 4BU2A 4GAZA 4CCKA 2YBSA 4EZ4A 5FP7A 5FZ7A 5ISLA 4CSWA 5A3WA 5FY5A 5FYIA 3DXTA 5FYHA 3PUSA 3N9QA 4GJYA 5F2WA 5FY8A 5FZFA 5FYCA 4DIQA 5E6HA 3N9NA 3KV6A 2YU2A 5FXXA 2XMLA 3K3NA 5FXWA 5IWFA 5FP9A 5FZ4A 5KR7A 4DO0A 5IVJA 5A7QA 5F3CA 2OQ6A 4EYUA 4LIVA 2OS2A 4TN7A 3AL6A 5FZ6A 5IW0A 5A1FA 4V2WA 3KVAA 5F3IA 2XDVA 5FZBA 4LITA 4Y4RA 4Y3OA 3LD8A 5FYZA 4QX8A 4URAA 4QU1A 3ZLIA 5FZIA 4CCJA 4LIUA 3RVHA 5FZLA 5FZKA 5IVVA 3U78A 4CCLA 5FPAA 5FXVA 4HOOA 5FBJA 5FPBA 4BXFA 5FZCA 3AVRA 2Q8DA 5IVEA 4QXBA 4NUBA 2YPDA 2YU1A 5FUNA 2OX0A 3PU3A 1VRBA 5ANQA 5FZHA 2YBPA 3LDBA 5F3EA 5FP3A 3PU8A 5FJHA 4E4HA 5FZGA 2OT7A 5A3NA 3OPWA 5A7PA 4D6SA 2GP3A 5LY2A 4CCMA 3N9LA 3UYJA 4CCOA 5FZOA 4C8DA 5FV3A 3DXUA 5FPLA 5LWBA 4QWNA 4GJZA 2OQ7A 5FYTA 2Q8CA 4QXCA 4LXLA 4CUGA 3PUAA 5FXZA 3AVSA 5FZ0A 5FZAA 4IGOA 2P5BA 5A3TA 5F37A 5FY0A 4IGQA 3N9PA 2XUEA 3PURA 5FP8A 4XDOA 5FP4A 5IVFA 5FZ1A 2GP5A 5F32A
chains in the Genus database with same CATH superfamily
4XZPA 4RR3B 2X53S 5H9RA 2X8KA 2XLGA 3GNEA 2W1WA 4LO7A 1RUJ1 1SLBA 1ND2B 1VBB2 5EQUA 3BTAA 2UYBA 4KG8A 1JUHA 3NNLA 1LOCA 2RV9A 3JBG3 3VUOA 1W6MA 1BVVA 4GB32 3U4SA 1V6KA 3M3IA 3V64A 1Y3TA 2ZGLA 5A80A 1ZRDA 2VZSA 4DEQA 4Q4V3 1XJAA 3DECA 3LSEA 3ZYGA 4CA9A 2WABA 4XVHA 3OTFA 1G9CA 1F5FA 1I9RA 3PJYA 2QCSB 4HPKB 4QHBA 4E4SA 5FZ8A 1U5IA 2A5ZA 3D6EA 4GH4B 1QJX3 2F17A 2JDPA 3VBOA 5K7PA 4M3CE 3PTYA 3HNMA 2Q5TA 5DG1A 4CVUA 4JRAA 5JZGA 2YUEA 2GC3A 4UFLA 5FY1A 3FL7A 1RUF3 1D0GA 2A3XA 5IVYA 5FYMA 1TME1 3N7KA 2WFF3 2V4VA 2RG4A 2ZGQA 5EFUA 2EXHA 3ZYFA 2G9FA 4BK5A 4HXCA 5FP7A 5ISLA 1CWPA 2RS52 5FUIA 1CZSA 1AR91 3N36A 1UIJA 5FYHA 2FZ2A 1K12A 5HI0A 1VBE1 1DQ2A 3VZNA 3BTYA 2RM23 1O5LA 1SDDB 4MGQA 3JD71 1AR61 3F95A 3O7OA 4CEYC 4DZGA 2CWSA 3SQOA 4LUKA 2AUYA 2CWMA 2QKDA 3U11A 3SEPA 2IFRA 5KBFA 4L9BA 3CJIC 1HRV2 1R64A 2RDQA 1Y9QA 4PDWA 1WCDJ 4NIHA 4YZ2A 2C0ZA 2FCVA 1OUSA 1SZBA 4XHBA 4LEJA 4A42A 1Q8OA 4DXTA 4CDUC 4HANA 1LOFC 5KHHA 1WGPA 4Y5TA 4AE2A 5DABA 2D3PA 2WRAA 2DCKA 4MXWB 5FREA 4QGNA 3RFRA 3UKVA 4NHKA 1RTVA 1ENSA 3ZXGA 3ZXDA 3E5XA 3PHMA 3BUCA 5FZCA 2BPA2 4G9SB 1A8MA 4W6XA 2JXAA 2YPDA 1LU1A 3NNGA 4FPOB 3JBG1 1CAXA 4BQ3A 1QH7A 3THTA 1I1EA 4U2AA 1A78A 3NNJA 3PMEA 5H9QA 4RR3C 5FLJA 2VNOA 4IW3A 4Q4V1 1CD3G 2UU8A 3AKPA 1W05A 2HKXA 1ND2C 2WO3A 2VNVA 5LRSA 1ZZ6A 1HB3A 1CZVA 2G9ZA 1QJX1 4YW3A 3NKTA 1BBT3 1GKBA 2HWF3 3JUUA 3R4SA 4B7KA 4COYA 2D7FA 3AVSA 3HMYA 2XJPA 2HWE3 3AP9A 4YVWB 3MO4A 1PIV3 3WP6A 3RZGA 4Y22A 1TEIA 4XFGA 5C70A 3R4DB 4WVVA 1P8JA 2ZZQA 3U37A 1DQ0A 1UW8A 1RUF1 4ZHNA 5FDBA 1X9TA 1XYOA 1GNHA 1GNYA 2I2SA 2WQ4A 4HG6B 4ZZ8A 1QDOA 3JB4C 4LHNA 4OHZA 3S5AA 3IAPA 2WFF1 1KJRA 2D6KA 5BPXA 4ARYA 1ENQA 4V2VA 2BVVA 1NLQA 4TYSA 1H2NA 1RUE3 4NHYA 3FWEA 2YXSA 2J1AA 5FJKA 5B4NA 2W2IA 2DVAA 2W0XA 4NIIA 2RM21 2XJSA 2YDEA 2IXHA 3FZ3A 1GNZA 4LJHA 3RJRA 2WNVA 3OPTA 1GBGA 4ZXKA 5KWRA 2JIJA 3DYMA 3LFMA 2R072 5K0UB 1ZREA 1SDWA 3WV6A 1OPMA 1NCRB 3VBRA 1W2TA 5IUQA 4EN7B 4AG4A 2OUHA 1GANA 1UY3A 1ULCA 4XUTA 3ZDSA 3AMHA 2Y0OA 2WNUA 5IVEA 5BNNA 1AX2A 1UZWA 3MBWA 5CFCA 2YGMA 5LCWL 1W6PA 3V0AB 3USUA 4YFZA 1AR83 1ZZCA 3ZN4A 4ASLA 4XDPA 3KMHA 4GAZA 1WUVA 1S0IA 3ST7A 2I07B 4AGVA 4CP1A 1KRIA 3B9IA 1T2XA 1UZ0A 4ZU5A 4GXLA 1FPN2 1VMHA 2VR4A 2Y6LA 1LCLA 1RYYA 4XBLA 2AH2A 1DGWX 5FYCA 4A3ZA 5I8YA 1VAMA 3FN9A 5E6HA 5G05L 3N9NA 2R0FA 4ZXEA 3TYJA 1ULFA 1H1AA 2QQOA 2VOXA 3A0NA 3H0OA 3SITA 5A7QA 1N1VA 1W2NA 4OMDA 5F3CA 1H1IA 5JXHA 4LIVA 1RUNA 3J7MA 2YFZA 3NO8A 4Z92B 3BTZA 1ND3C 1OA3A 2GMPA 1BBT1 5DUWA 2HWF1 2DVDA 4XF1A 1W8WA 2ZX4A 3SMHA 3POYA 4LITA 2XR4A 1ZRIA 2GC1A 2B7YA 4Y4RA 1PIV1 4CXWA 4N9IA 3WDYA 4B4QA 4AQSA 2ET7A 4Y1UA 4KGQA 4AHZA 1AL0G 3H3UA 3HBKA 5FZIA 1QDCA 5E16A 2WL1A 4AHYA 4CDXA 1KFXL 3LGRA 2KD7A 2JIGA 4K3UA 2JECA 3A22A 2PLV3 4H55A 4CCLA 1RVF2 5I0UA 2Q8OA 4Y20A 1LGBA 2WT1A 2RR13 4FOYA 1BQPA 2EA7A 5IFPA 3ILFA 4YVWC 4EJRA 4QXBA 3DYOA 4P9IA 2JDNA 5IK4A 1RUE1 5JXGA 3MV11 2OIIA 4Z2AA 3OEAA 2BP6A 1Y9GA 5ANQA 2BWCA 2VNRA 4NHXA 4LKEA 1DIWA 2ZEWA 4OYUA 4E4HA 1WLCA 4XZUG 2XL7A 1JU3A 2NQYA 2OT7A 4QPIA 4OQ8A 3RZKA 4P08A 4AVBA 4JQRA 1LHNA 4LPLA 4N43B 4RS5A 1W2OA 2EXIA 5FPLA 2KR2A 4YG3A 3HT2A 1BMV1 2ADDA 2W1UA 4K20A 5E89A 3W5NA 1WW6A 2DCTA 1IQAA 3IAQA 5FQ0A 3LF7A 5EWSA 3ZMNA 3H8OA 1RUI3 5LBBA 2GC2A 4OLLA 4A3XA 3POGA 4N43A 4AI1A 5BNOA 5KHJA 3M7AA 5LY1A 1UMHA 2D6NA 1GOFA 3MUZ1 4C0HA 2UURA 3HT1A 4ASKA 4D6QA 2ES3A 3BGAA 4ZU7A 5HV4A 5A7SA 5IVBA 2WAOA 3P3PA 1J3RA 3BYWA 5IT6A 4YZ4A 4QX0A 2VOWA 4UW5A 1GP4A 5EZWA 3VZMA 5A33B 4ZY9A 4YWAA 2YC2A 1F4HA 4D3WA 1SHWB 1OLRA 3M1HA 1XU1A 4JV4A 4BISA 4QB1A 2CYFA 4AQ6A 1VIWB 3LDRA 4M01A 2W39A 2XBO2 5DAXA 1EAH2 2I45A 3NJYA 4UWDA 5JIUA 1YEWA 3VBFC 3VV1A 1QQP3 1W0NA 3H9AA 2VZ1A 4M00A 4B4PA 1ZVFA 4HN1A 3TEWA 2J1RA 2V72A 3MPPG 2BGCA 3ZXFA 1NCQB 2PLV1 2WN3A 4IEUA 2IFWA 5HCFA 1JOJA 3NRUA 3Q8FA 2JDHA 1L7RA 2EIEA 2RR11 1UOGA 4KI5M 2Y6GA 3T0DA 3O12A 4HZFA 3AMPA 3D3AA 5DQ0A 1KDKA 4PLOA 3A4UA 2VVDA 1H2LA 3H3LA 2IUWA 1V6MA 3RDIA 1YIFA 3SH4A 3I3BA 2P3YA 4XYXA 4BYYA 3V65A 1PVC2 2QVSB 5D8AB 1H4HA 4D94A 4BMBA 5A3LA 2BOJA 4MV2A 1QXPA 4UFIA 5A1FA 2DWRA 1SLIA 3M4FA 2A6ZA 1YLLA 3ZXLA 5KHGA 4JDOA 2QQJA 4DUVA 3HNYM 3G6JB 3NNMA 4ARXA 1GZWB 5ABJC 1F15A 2BW8A 4CPBA 2XJVA 2XONA 2WIIB 4META 2DVGA 5AFBA 1QEXA 3AKTA 2DBNA 1DBNA 1LU2A 5FZKA 3RZMA 5T52A 5FPAA 3VZJA 2BQPA 2XLFA 4M3CA 5FPBA 2W87A 2ZHMA 2K2SA 2GH8A 3AVRA 3B02A 3VL8A 4Q1RA 3LKJA 4LR4A 4XQDA 2JB8A 4BH9A 1YHFA 1NUKA 1S2BA 1V9U2 3K48A 3VBUB 2XL9A 1PVXA 1K5MC 4CDWA 5JOXA 4JHZA 2VCBA 4XFFA 2WO1A 1YRZA 2BOIA 1RHI2 4AFMA 2NMOA 2WZR2 3GM8A 2ZGUA 3P1IA 4QX2A 5FZGA 3TEXA 1W39A 1S0GA 1H9PA 4JQTA 3CBNA 1XSQA 2Z42A 3WW4A 4BK4A 2FCTA 3D4KA 1UMZA 3VGIA 4BXSV 4GJZA 1Y9MA 1C8M3 1UQXA 1RUC2 5FXZA 2VOKA 1QQP1 3HIFA 4CCCA 5FLIA 1UYYA 2NPIA 2JG9C 4XDOA 3VDBA 2Y38A 1J3QA 1M06G 3R6SA 3AB0A 4MYEA 2C5DA 4AFBA 5HXVA 3WDUA 4DNYA 3MIEA 5F39A 2GALA 4ZKTB 5BUVA 3E5UA 1ZZ7A 4FXKB 3RMYA 4FPFA 4RQPA 2R6QA 3R05A 1YQ2A 5EXOA 2CAVA 3CMGA 5FO9B 3FFZA 2XWJB 5C8WA 5DUUA 4YVSA 1RUG3 1S0DA 3L2HA 4W65A 4Q4W3 2PHUA 3IZOA 2WKKA 1NCQC 5LB6A 2LROA 3BTXA 2QQMA 2CDPA 4GD4A 4UF0B 5T5JA 1Q8SA 1WA4A 1ZZBA 2RMU2 3HEIA 3ZFGA 1RB8G 2GNTA 1LOBA 4QPGA 4MVTA 1YYNA 2B46X 1WW4A 1D4VB 1QGLA 2Y6JA 1UL9A 3MDPA 4HETA 3LIHA 4BZ4A 2HH9A 4I0BA 4TTGA 3AMQA 3VKOA 2Y34A 3ZFEA 4AVCA 1JUIA 3AFGA 4LBMA 5JOZA 1V6IA 4AYUA 3O1VA 3PUQA 4ATFA 5BNPA 1PGL1 4CU6A 2QBXA 1VE0A 2XJTA 4QKDA 4KQ7A 5F5AA 2Q1MA 4BIFA 3UGFA 3WF0A 5JAXA 4X6RB 3FHAA 1O3TA 3ON7A 4S2HA 4A6SA 2BGOA 3OEBA 3ZSEA 4E8DA 4D7TA 5CYYA 3AP4A 2CDOA 1I5PA 1SEFA 2VPVA 2D3RA 1O8PA 4Q8LA 2ZMLA 5DAWA 3ZFFB 3N9QA 1PZ8A 1O7FA 3MYXA 4GJYA 4R4XA 1O4ZA 4P00B 1BHGA 3BN6A 4LBQB 2HEYF 1UN1A 1X8MA 5C4WB 3WDTA 1JH5A 4QB6A 5C7GA 4UI9L 3WDXA 1W8TA 1PMHX 4H3WA 1AUYA 4QQOA 4NAOA 2EIDA 3JB8A 1FOD2 4AW7A 1V0AA 3NJVA 4URTA 5J48A 2OS2A 4N53B 2B45X 1Y43B 3VBUC 4NHMA 2A3YA 1C8M1 4V2WA 4IE7A 4QHZA 3UKNA 3AP7A 3K4ZA 5F6LB 3RNSA 2A71A 3O0WA 3RRDA 3OCPA 3HWJA 2V5YA 4TWTA 1U5YA 3ETPA 4CEWB 2GN3A 4LULA 3RVHA 5BXXA 1FNZA 4SLIA 5LK7B 4W6WA 3MIBA 2DV9A 4FQ4A 4QGMA 2RS33 3RS6A 3TOJA 3T0BA 2BFUL 5DZFA 1FYUA 1Q5OA 3K4AA 1RUG1 4EV0A 5FZHA 4Z82A 2X10A 4F3JA 1HJFA 1MS5A 1ULGA 1WLDA 2PFWA 2BU9A 1PO23 3PU8A 4CE8A 2BERA 3ZYBA 2F6BA 2IVJA 5AVAA 2XGXA 2G19A 2X29A 4LKFA 2ORXA 3FX3A 5FV3A 1JHJA 3N7LA 3LSDA 5LASA 1F5JA 3J7LA 2YYOA 3WEZA 4MHRA 3CLPA 4DRRA 4E8CA 2HWB3 4IV1B 4EN6B 1RUH3 5KXEA 1QOTA 2XKOA 3CJXA 4NWWA 4OUEA 3T2TA 1UIKA 4EN0A 1UAIA 5FZOB 1JZ5A 4KWLA 4YM0A 1Y4WA 5JPMB 2WO7A 4HONA 1PK6A 2ZTNA 3ORJA 4Q4X2 2JD4A 4AEKA 1MS9A 5DZGA 2DUOA 4BQYA 3D82A 2OZJA 2P6HA 4HT1T 1AF9A 2ZGTA 4JVAA 4AAPA 4BQ2A 1JI6A 2YMZA 4YW6A 1GMMA 1QHDA 1QOOA 5FZEA 1C1FA 1X9PA 4WM8A 1YQ5A 5LA0A 5FO8B 1MS4A 2VZQA 4YYOA 1JS9A 4KMQA 3ZFFC 1KQRA 1PMIA 1W6NB 3BPZA 4B8EA 4CDQC 4E9KA 3LIGA 1E57A 1MEC3 1CAWA 4XILA 3J8F1 4QDSA 3UV9A 4XFHA 3WG1A 4JGYA 4E4ZA 3WNXA 3S0MA 5IK8A 1NA1B 2XQXA 3NV1A 1IQDC 3PIGA 4JC1A 2FQPA 1IS4A 2J1UA 4N53C 5BY5A 4LK6A 1YIPA 1R082 4Y1VA 3RI9A 4DPNA 4FPJA 1VLNA 2VZ3A 2J22A 4JGZB 4NAMA 1PO12 2RS31 1SLAA 2WWSA 2YV8A 3LA7A 5DDJ3 1U5XA 1WMEA 5JI7A 1NA1A 1WZXA 5F2WA 3O1PA 4MGZE 1LHOA 3ELNA 4CEWC 1RXFA 2WQ8A 3H7YA 3OYWA 1EV13 5C5UA 1Q43A 4O61A 1OQ1A 5CFDC 2FD8A 2A75A 5FP9A 1BK1A 2ZA9A 1D2QA 3LCPA 5C5TA 1JHNA 2O8QA 1IS3A 5DXDA 1U5ZA 4N7IA 3KT4A 4JKLA 2IXKA 5TSWA 3WQ1A 3LD8A 4J1XA 2QE3A 3T2OA 2EAAA 1GQGA 1XC6A 1RUH1 4A41A 4A2UA 4RGKA 4S2DA 2R16A 3H1YA 1QJU3 1ZX5A 4CRQA 3E6DA 5JMOA 2ZOEB 3M3OA 1UZYA 3VB9A 3U78A 4XJAA 1COV2 3BIEA 3T2QA 3BPSA 5FBJA 2P6CA 1ONAA 4LHLA 4Q0UA 1O3SA 3IB3A 2HYXA 1DDLA 4R9BA 2MEV3 2NYYA 1GZCA 1UKRA 1RUD3 2XJRA 4HFSA 5FOJB 4XIKA 5IK5A 3ATGA 4CU9A 1JODA 3AZVA 3BU7A 4G4FA 3S7EA 4AHXA 4NPRA 2D6PA 1GLHA 4NMIA 5E88A 2PHLA 4JX0A 4WVWA 4GMP3 1MEC1 4ITCA 1XNDA 4YW2A 2R30A 2P3IA 3VD4A 3VBSB 1TMF3 4AGGA 3DPRA 1H8TA 2DUPA 4KGGA 5JCTA 1DG6A 1UNBA 3KF5A 2WZPP 4DFSA 4O7XA 1ASJ3 1NZIA 1YFXA 1FNYA 1LENA 4GWIA 4WM7A 5FAXA 3VBHB 1RUJ2 2ARBA 4ZS3A 3WOGA 4BM8A 2PAEA 5A3PA 2AEYA 3MLJA 2VVFA 4JCKA 3AL5A 3DN7A 3TRSB 1VMFA 4DS0A 4LBKA 5DDJ1 3K3OA 5A7WA 4MGSA 3KV5A 3OUHA 3GBWA 4XURA 3DCQA 5FCCA 1ULPA 2JG8B 1YFYA 3PVOA 3NAPA 1EV11 2IXCA 2H6BA 4YARA 4JGZC 1UYPA 1HXS2 2VG9A 4PBPA 5FUPA 1VBB3 4JKMA 1SFYA 2QZ2A 3ZN5A 1AXKA 1KEXA 5K9YA 5FO7B 1BJQA 2X5IB 1R092 1GUIA 4J25A 1OPOA 4GB33 2JG8A 3I2KA 1W6MB 4I3GA 4QHOA 1OQEA 2D6OX 4OHWA 5LBEA 1WBLA 1GV9A 1O3QA 5A6QA 2VZTA 1TME2 4B1LA 2Y6HA 1UZVA 3RG0A 1QJU1 3KV4A 2E7TA 2UWBA 2EALA 2YGLA 3BOPA 4UBGA 4FFHA 4FVVA 4RYDA 4ASMB 1QXRA 5FPVA 4BCUA 1AR92 2X5IA 4FT8A 4P5HA 3VKMA 4AFAA 2YBSA 4Z2WA 2HWD2 2W08A 5DAQA 3VBOB 1W6OB 3PUHA 5FY5A 4A44A 1N3OA 1OOPC 2JICA 2QQIA 3C7OA 1LODA 5JZGB 4BWOA 3W20A 3ZDVA 4DUWA 2MEV1 2XHNA 4YW1A 2J1VA 1RUD1 1MVQA 4NO4A 4HSLA 1JOPA 2GNDA 2OW4A 1JZ2A 3I3QA 1XYPA 3GZAA 3IBMA 3LPFA 5F6KA 2Z4FA 2DDUA 1BKZA 4CCDA 1W6OA 1NLRA 1XU2A 1CX1A 1OVPA 3E1F1 4TN7A 4AVSA 2JEMA 4GMP1 3GBFA 2OPWA 3ZYPA 5LA2A 5EP9A 2DTWA 4JDNA 3AMMA 1UY1A 5CU1A 2AYHA 5FPXA 3NL1A 1TMF1 2WSVA 4JTNA 3KHCA 3U4XA 1STMA 3KF3A 4UOJA 5EIYB 4EN9B 5A32A 5JDBA 5LA1A 1HRV3 1E5IA 1GICA 5JR7B 1ASJ1 2O14A 4CUBA 4FCAA 4AQTA 4PDWB 1JYNA 4LE3A 5FXVA 2JENA 2NN8A 2J1EA 2VULA 3IM0A 3I3DA 3VBSC 1YXWA 2UY8A 3DYPA 3B7MA 3JBG2 3MV01 4NUBA 4RN5A 5GM0A 1HQWA 4DINB 4ONUA 5J98B 5J1XA 4AZZA 3WNNA 3PU3A 1NY72 4Q4V2 3N35A 2QQNA 5F3EA 5J3UA 1LKNA 1JW6A 2JE8A 3W9AA 1U12A 2ZGKA 1VBB1 4KWKA 3O1UA 3NSTA 3SCHA 1VRH2 3OJBA 3K46A 3OPWA 3WX5A 5FMOL 4LQRA 2Q8CA 2HYKA 2AENA 1CAXB 4GB31 3ZMOA 4EWEA 3GYDA 3O1RA 1ZNPA 5FZ0A 5A3TA 1RUF2 3AFKA 2AR6A 1WCUA 4PBOA 5CVRA 2O1QA 3N9PA 4LOTA 1J3PA 4A7KA 2WFF2 2GP5A 1A8DA 1O3RA 3DF0A 3PTRB 2C6SA 3ACHA 2XJQA 4IE0A 2BUKA 2SBAA 3SEEA 4LLOA 2JDMA 3HN1A 1WMXA 4IGPA 4AEMA 1REDA 3GJAA 4Y22B 3ZPOA 3MIFA 3ABZA 5DZEA 5A6ZA 4XJ9A 4QX1A 4PHZA 1FATA 3KVBA 2JDUA 3ZSLA 3TN93 3VKNA 3POSA 2GNBA 4XABA 1B35A 1VBC3 3H3ZA 2GC0A 1OF3A 1AVBA 1S2EA 2ZGMA 4HBNA 4Q26A 4AAXA 4BE3A 4CXYA 5JZGC 3VDCA 3POEA 1DGRN 4Y1ZA 3M2MA 3BCWA 3MI8A 4P9YA 1PGW2 5JLVA 2ZAHA 2PHTA 3I97A 2WNVB 4GH4C 4XHXA 3VHRA 2XPJA 3WHUA 4LBOA 1FI2A 1HRV1 2GMEA 1PNGA 3NW4A 3ZN6A 1OUXA 4DRVA 1OLMA 3ZYRA 4RSUA 1ND3A 2BNOA 3DKQA 4CSWA 1KFUL 1CONA 3I4IA 3VBRB 3ZX7A 5C9AB 4CXXA 4AFDA 5DUXA 3TEZA 3PUSA 5IAXA 5FPZA 5C8CA 2VNGA 1CESA 2WNUB 3T0AA 5BNNB 4FTSA 5CFCB 4XFBA 2C1FA 1MS0A 2FDKA 1W6PB 4AEDB 3USUB 5HPOA 1O91A 2QDRA 1R1ZA 2WYSA 3FLRA 4BB3A 1E5HA 3WP5A 1Z7S2 3C2UA 4KH9A 5C9AA 2VU9A 3KCXA 1MS3A 2ZHNA 4AK3A 3EQEA 2HWF2 2K46A 2YG0A 2E33A 4YZ5A 2EXKA 2HWE2 3MICA 2XDVA 4AEDA 5KC6A 4QQLA 3WY6A 3UGHA 1YI9A 4LE4A 1H0BA 3HD8B 2FMYA 1AXYA 3ZOIA 5JSOA 4BLIA 1H2MA 4FFFA 3W5MA 1L3JA 3ZSMA 2QNKA 1S55A 3W21A 2D5FA 4UXAA 4Y1YA 1RUE2 2FDGA 1CAVA 2YPJA 4MSVA 1IPKA 1YWKA 5CKMA 2WBKA 1A6CA 2LALA 2C9KA 2PN5A 3NV4A 1PZ7A 2QTWB 3MW4A 3OPZA 3ZR6A 2H0BA 4CDXB 1CN1A 1REFA 3WF2A 4R9CA 3ZPYA 1UO9A 1RVF3 1SFPA 2PYTA 3TN91 1LEDA 4Y20B 4IE4A 2DCJA 1VBC1 4WVZA 5HCBA 5M0TA 1UZZA 4WZFA 4QX5A 4GWNA 1W2UA 4CU7A 1BMV2 4K8FA 4R4ZA 1ZA7A 5LWBA 2VJXA 1XNAA 2LUWA 4QWNA 4HN0A 2C4XA 4HVOA 1RUOA 2J1TA 5EJ3A 1S1AA 2ZEZA 4LHSA 3KCCA 1OXCA 1AR72 2D43A 2JDAA 3GBGA 2CL2A 1AR82 1PX3A 1F8VA 1ZBE3 5A1AA 4M0NA 3J9SA 4QPIB 4RS5B 1LHWA 1YC61 3X29B 4N7UA 3WLUA 1LULA 1W6QA 4NRMA 1XE8A 4FPYA 4PI0A 4YPJA 3T4HB 2ARCA 4OUSA 2ZABA 1UMIA 4LNVA 2R1BA 1G9AA 2WR9A 5BV6A 2RDNA 3VBFA 3GF6A 5FQ0B 3K51A 3VZKA 3WF1A 2B8MA 5IVCA 5FYBA 4XMIA 5BNOB 1HN1A 3OOXA 4OUMA 4C90A 1HB4A 3N4MA 4UBHA 3WG4A 4YGCA 3VHPA 4QMAA 1ZRRA 3CDZB 4XJ8A 3ZXKA 1IGOA 1MS8A 2PAMA 5APAA 3DGTA 1UKGA 2B4KA 3ASIA 1AX1A 4QQ2A 2Q8EA 2ARXA 3WNMA 4P02B 1MPXA 2WNUC 2Y0IA 1G86A 5BNNC 4MGTA 5K0UC 1NQJA 2PTMA 1RC6A 3ENRA 4XJWA 1MACA 1HX6A 1DGWA 1NCRC 2RS13 2XOMA 3FHQA 3J26N 3J7HA 3EBRA 1W9FA 4PLNA 4RL7A 5EYYA 5L9RA 2PLV2 4MX3A 4U36A 1NAEA 5CEHA 3GHNA 2RR12 4CCNA 2WT2A 1V00A 2VM9A 1EAH3 5A7NA 4DQAA 5J37A 1J58A 1ODMA 2OYZA 3WDWA 4L8QA 5FYIA 4XDQA 4XPVA 5ABJA 4MOAA 5T50A 3S5QA 1H1MA 1RVF1 2YU2A 3ACIA 3E5QA 3KV6A 4FO9A 3AP6A 5FXWA 4AGRA 2P2KA 4DXZA 1C5IA 3VDDB 5KR7A 3ACLA 2VUAA 2CGPA 5IVJA 3AP5A 3MEPA 1WLWA 1W0OA 4CP9A 5FMCA 3D0SA 4P9WA 3B5LB 4XUPA 4BHPA 4IV3A 4CDXC 2OVUA 3MIDA 2CSGA 1W9WA 1MQTB 4K21A 2WYFA 1RUI2 5FZBA 4YW5A 1K5MA 4Y3OA 2ZGOA 3ZKYA 1URXA 5B4XA 2IZWA 1PVC3 2W91A 1Z78A 1W2AX 3MIHA 2HLEA 3WT3A 1ZBE1 3VDDA 3KZ4C 3ZLIA 3U10A 2LW8A 5LRRA 2VL4A 4AFCA 4BPZA 4XFCA 4Z1VA 1W06A 3A23A 4XFAA 4QX3A 1OD5A 2I74A 4UYBA 1MQTA 2PELA 4FAHA 1H8VA 1PHMA 2CNAA 2X09A 2W1SA 5FUNA 1H6YA 1AL23 3LZZA 1ZM1A 4CU8A 3GXUA 2JG9A 2W92A 1OBNA 2ZX1A 3BODA 4K9SA 4RS5C 3WP3A 4IE6A 2GAUA 1HDKA 4OCTA 4XXAA 4BQXA 1GWKA 2O8OA 1S0EA 1O5UA 3ACFA 3OBAA 4LO8A 1YO8A 4M3CB 4RGGA 2P1BA 3OUJA 2R063 4RHV3 4CCMA 1O4YA 1V9U3 1VAKA 3AXDA 1E5RA 5FYTA 3B94A 4OZXA 2N7GA 4QXCA 3RSJA 4IE5A 4CDWB 4N43C 4DMIA 1RHI3 5BNOC 3PJQA 3CKHA 2RS11 2WZR3 1AJOA 1UU6A 4P9GA 1R1A2 4HMZA 2XBO1 2VCMA 1CZTA 1EAH1 3HPNA 2WUHA 4QXKA 5DUVA 2R1DA 2ZGSA 4W8JA 1RUC3 4IESA 3C7GA 2FDIA 4N8MA 4XUQA 4PIZA 1JYWA 5I0SA 5LBFA 5GZGA 4YGBA 5GLZA 2PXJA 4I0AA 3IIIA 1PZ9A 1NLSA 5T5PA 4AF9A 1IZ3A 5JWPA 3JZVA 2GMMA 3LFIA 1BYHA 3MLKA 2G1MA 2TEPA 2WS92 1OHFA 4TLGA 4MH0E 3WZ1A 4AL9A 2FBEA 2CTVA 4RQPB 1BXHA 1WMFA 2Z5WA 4DOUA 3WW3A 5EJ1B 1NOVA 1I3HA 2QZ3A 2R043 3WF3A 1ST8A 4YVSB 3RWKX 1G9DA 1OKQA 2CGOA 3B3QE 1ULOA 4INDA 1J59A 1DQ5A 2GZWA 3POIA 2JX9A 1H6XA 1PVC1 2XVLA 3KGLA 2G9GA 3OGGA 1FV3A 2RHPA 1DU3D 3INAA 4KBBA 2DCZA 3FMGA 5F8PA 2VCCA 5FY7A 4OQ9A 3ZFGB 1UPSA 4K1ZA 4QPGB 5FPUA 4XTMA 3N9MA 3SCGA 1BEV2 1JU4A 4O9EA 2PHFA 4HSJA 2WLQA 3ZFEB 1AYM2 3H8UA 2WINB 3BALA 4XQ4A 3U1XA 1U0AA 3LOBA 2DVBA 1AL21 1ENRA 3I59A 1YJLA 5FTTC 5FZFA 5ACA3 2B9UA 2W46A 3CEWA 2PMWB 2ERFA 2ZEYA 5BNPB 3K3NA 4W50A 1X33A 2FMDA 3I2IA 1HW5A 3WNPA 2A6WA 3WNOA 2GNMA 2R061 1NXMA 1O6UA 3AZZA 4RHV1 1V9U1 4S2FA 3UETA 2EICA 4CUCA 1G9FA 2IWGB 2G4IA 4OZOA 2Y6FA 5D8AC 3HR9A 4PQQA 4FSJA 1RHI1 1SG3A 3A7QA 5FKCA 3ME2A 2WZR1 4PLMA 3ZR5A 5GLVA 3EB7A 1DZTA 3UL2A 1VMJA 1LNSA 3PLQA 1OF4A 1UXXX 5L7OB 1IOAA 1FMD3 1DZRA 4LIUA 4JKKA 3S6PA 4ORFA 1RUC1 4EE2A 1H2KA 4CDWC 4HOOA 1OD3A 3RMXA 3KLSA 1RUG2 5AC93 4R52A 1GWLA 3PVEA 4XJUA 3VHNA 3C7HA 4JDMA 2ZGPA 4Q4W2 3GZUC 4PCRA 3WF4A 3LA3A 5KXBA 5L7OA 2OX0A 3T30A 1LEMA 1QNWA 3ZXEA 1VAVA 2B39A 2PHXA 5GZDA 3J8F3 3UESA 4NOTA 5A7PA 1MZ6A 3LWCA 1ACCA 3POBA 3IMNA 1PX4A 3MPBA 3T08A 2R041 3ILNA 1X82A 2EF6A 3VHOA 3ZIXA 4C0BA 2ZHKA 4H2AA 2H0VA 4LKDA 3AC0A 4ATEA 5T54A 5FZAA 3ES4A 4ZS2A 2A1XA 2VMIA 4TXWA 2PA7A 4FPKA 1NE4A 2OZ6A 5CG8A 3PURA 4QQHA 2D5HA 1N3QA 2ZMKA 1W99A 1RMU2 5F32A 4FPEA 1DQ6A 4UFJA 1XE0A 1VALA 5T55A 1OFNA 1VB2A 3WXPA 2BBAA 2ZZJA 3E97A 4YVSC 5DPNA 3CNAA 4Q27A 4Q4Y3 4Q5OA 2JE7A 3O0XA 2VXRA 2EIBA 3DL3A 4QKBA 2ILMA 3UJQA 1QJY2 5ACA1 3O0VA 2RVAA 5FYUA 2QQPA 2VGDA 3POWA 2YFUA 4L0PA 4PT6A 2KA3A 2E6VA 5A70A 3WHTA 4XF3A 1M4WA 1WW7A 3KS7A 4IEPA 2IXJA 5F2SA 3VZOA 4GZ9A 3HNBM 4DEVA 1XRUA 1DLLA 2BZDA 3ETQA 3K75B 5A3MA 4ISQA 4QPWA 3ZFEC 3I49A 3O1TA 1PK6B 4WV8A 1DQ1A 5BNPC 1J1LA 3I2HA 1E5SA 1OH3A 1G7YA 2XB6C 1C28A 4OI0A 4FXGB 3CHXA 5FYYA 3CIHA 5CFDA 4WM8B 2ZX0A 5LBCA 1XXNA 1FMD1 4PJYA 1Y7BA 3PVNA 3RYKA 2XKPA 4GMP0 2D3SA 2YBKA 4NRQA 1CAWB 1B09A 2MHFA 5EYXA 5GZCA 3M3CA 3TBDA 4ES9A 5AC91 4JGYB 4C1XA 1DZQA 3DV8A 3GCWA 1XNTA 4AQ2A 3DXTA 1HRI2 3AXEA 2LTNA 4DB5A 4E2GA 1NX9A 1PO22 2K0GA 3QH6A 2EXJA 2FCUA 4QT6A 3VD7A 1R083 1KS4A 1SPPA 3CO2A 4I30A 4Q1PA 1PO13 4F7ZA 2KXLA 1W9SA 2C9AA 4DO0A 5C4WC 1HB1A 5EV7A 1UWWA 4BIOA 3FUQA 4NIAA 4F8AA 1BVP1 2WQZC 1SCSA 5DMYA 3OB8A 2FDHA 3P5BA 4Y5SA 2VZVA 2HWB2 1UX6A 2ZCWA 1LJ7A 4KU7A 1GQHA 5F3IA 3BVCA 4RFT0 3ZSKA 3OYWB 5FBZA 1DYKA 5T5OA 3MUY1 1QJFA 3OBZA 1YI7A 5DG2A 4XFIA 1EYBA 4AOCA 4QU1A 3WQBA 1CR7A 3B69A 4IQPA 3KGZA 1RIRA 1C4RA 2OPKA 2VH9A 4JTOA 5FMBA 5JXIA 3MHZA 2DU1A 4YW7A 4BQ4A 3OD0A 4Q4Y1 1VPHA 4XMAA 3AK0A 3LB9A 4FPGA 2Q8DA 5C33A 4JHTA 3WNKA 5LEKA 1Q56A 5CKNA 2XQRA 1Q8QA 2O0OA 1LAJA 1VRBA 1C5HA 2PHRA 3BIWE 3LDBA 4D8MA 1COV3 2FDFA 1SBDA 1CIYA 4Y4YA 1AYN3 3AZWA 3VLBB 2CY6A 3Q8EA 4UFMA 2VMGA 3H50A 4LBNA 3EO6A 4L99A 2Y6KA 4ZPIA 1WLTA 3DXUA 2RDSA 4KWUA 4OI1A 3SLIA 4F83A 5HBAA 3TEYA 1D4M3 4LXLA 3KM5A 4XF9A 5GALA 1DCSA 4QM8A 1PM7A 1RGSA 2P3KA 4YW4A 4FOWA 3WG2A 3CQOA 3SH3A 3QACA 4PIYA 4FP3A 1GOHA 2PQQA 3DEMA 4I02A 1PK6C 5A6XA 4IV1C 2AGSA 3LEMA 3LDKA 3KD4A 2QQKA 3WVJA 5I8TA 5G04L 2VQ0A 4L11A 3DPRB 4K1YA 4Q0VA 1H8TB 2ID4A 1VBA2 4KNCA 3RJ2X 1IS6A 4QAWA 2XXZA 1K3IA 1VBD2 1N1TA 1N1SA 1ODNA 2ZACA 1R081 4K6BA 5DN2A 5H9PA 4BA6A 4AEJA 3T1MA 4WM7B 3V0BA 1RINA 2V4AA 1V6OA 1PO11 3M3QA 1UYXA 1X8EA 2ZKLA 3I2OA 1ZBA2 4Q0PA 1YQ6A 1VP6A 2HWC3 5A7WB 2WJSA 3RI8A 1G8WA 2Q1ZB 5D1IA 1MZFA 5FWEA 1JMUB 2XJUA 4Y33A 4AI8A 1QKQA 2DU0A 3CL1A 1CAUB 4PI2A 1MVEA 3NAPB 4K40A 4E2SA 1QJU2 1HXS3 5B2GB 3KV9A 4Q2FA 1W8ZA 1DHKB 1HV1A 2OUJA 3FBMA 3WG3A 1UY2A 2DTYA 1JZ7A 3NQHA 3C8XA 1NA1C 1R093 2WAAA 5CZKA 3ALQA 5FZMA 1S0FA 5FYVA 3ZO0B 4AI2A 4H14A 2Z79A 3I7DA 1CAUA 1POQA 3BB6A 3MW3A 4HKOA 4D0QA 4NROA 1UXZA 1LHUA 1J1TA 1CPNA 1AHSA 1OURA 2NM1A 2UY9A 2SLIA 3TWIA 1XNCA 3S30A 2VBDA 4DIQA 5C6CA 1ZRCA 4MO3M 2TNFA 1COV1 2WFPA 3IPVA 3SXWA 1WCSA 2IXLA 1BCXA 1AYN1 3NVCA 1SBEA 2HWD3 4Q0SA 5KC5A 1OA4A 4XAEA 4JRLA 4KL1A 5JIAA 4QDRA 1POV3 4GA9A 2YC0A 4XAAA 3HN3A 4CEYA 1TMF2 1D4M1 2VTXA 3OSDA 1RXGA 1PMJX 2DYCA 3AYCA 4I09A 4O65A 4QKFA 3CJIA 1JYXA 3ES1A 4GWMA 2VBBA 3POFA 1JZ3A 5FK8A 3WQ0A 2D44A 2ZMNA 1GZTA 1VBE2 2B9VA 4XACA 4MXVA 4CDUA 1LOFA 5FZLA 1GP6A 1W9TA 2ARAA 3JD72 4LO6B 4MUVA 1AR62 3IDCB 3PUIA 4MGIE 1ULDA 2E63A 3BKZA 4GKYA 4KG0A 5GZFA 1DLCA 2XUMA 2UWAA 2GU9A 3KQ4B 2JDKA 3NKGA 4RFRB 3N3HA 4XUNA 3MW2A 1PGSA 3D5OA 5FRAA 3I2DA 2RS53 4NWVA 5A32B 2D6LX 2ZGRA 4LBJA 4HKLA 3QOPA 4DXRA 3MZHA 1QIQA 4TZDA 4G3YC 4PIXA 4HKWA 3GZEA 3SKVA 2IVIB 3GCXA 4LOSA 4Y26A 3THDA 1I5ZA 3THCA 3FE5A 3UJOA 1OLQA 1OMIA 2HWC1 1L7QA 4D6SA 1OA2A 3DPRC 1NQDA 3K77A 4CPBD 1H8TC 4RR3A 5K8SA 1IKQA 2RDRA 3T09A 2WC2A 1YCIA 4YG0A 3T1LA 2FZ1A 1HIXA 2QQLA 3NJZA 1ND2A 4WM7C 4E4DX 2VMDA 1HQNA 2ET1A 1HXS1 5F37A 4IGQA 5J7MA 1IPSA 4CYDA 1VRH3 3TB0A 1EPZA 5IYYA 3W58A 1Q3EA 2QFEA 1R091 1NT0A 3OG2A 5I0RA 1DGLA 4EN8B 2ZX3A 3NAPC 2A6VA 1G9BA 4WZCA 3VBHC 1ZRFA 4HPKA 5KHIA 3CZJA 5JI9A 5FMDA 4GH4A 3RYRA 2W1QA 1IKPA 5HXMA 4P5YA 2R32A 2OA2A 3V56A 3CU7A 4I01A 4BQ5A 5K4LA 1QJX2 4B4RA 4AR2A 3KQRA 3KSCA 2QQUA 4Q0QA 4A4AA 3URFA 2HWD1 3ZXJA 2JG8C 3AM2A 4MLOA 4HK8A 4XIOA 2NP0A 4D6RA 1POV1 2WWJA 4P9JA 3ILRA 2B5HA 2W68A 1QNYA 1WBFA 4LA3A 5DAPA 3TNQA 3N9OA 2RJ2A 3GZTB 2X5IC 5KHKA 1OC1A 2XVKA 1DP0A 5FZ3A 1C57A 4KBZA 1B35B 2WSUA 5GKAC 1A34A 5FY4A 3APBA 2RM22 2ZBJA 3PL0A 4O9GA 2BNMA 2E7AA 4FI9A 3B01A 4I3PA 4AI9A 4COWA 2WT0A 2KM2A 2JJ6A 1WA6X 1V70A 3KT1A 3LEKA 3FC0A 1APNA 1SBFA 2VAUA 3GJBA 2GH2A 3JU9A 3QD6A 1UD1A 4IEOA 2BJSA 5JPNB 2RS51 4IEZA 4A45A 5HCHA 2NZ9A 3VBOC 1X36A 3U0ZA 3ZN6B 2XLAA 4IEWA 4PQ9A 5I0TA 3AKRA 2W94A 3IN9A 3D8CA 5T3NA 2AZ5A 1ND3B 2CHHA 4LO4B 4HLTA 4MXWA 4R9DA 4D7SA 3Q8CA 3I3EA 1JZ8A 4IETA 2Y8KA 3H8RA 3I2FA 1NY71 5GLUA 5C8CB 2R073 4UW6A 3U14A 2JWPA 4IERA 1W04A 5KXDA 1XPWA 1GQPA 2BRTA 2XH6A 4C91A 4E27A 4NN0A 1A3KA 1VRH1 1Z7S3 1XOYA 2LS6A 1ZZ9A 4YFWA 5F5QA 2VCAA 4CCJA 4SBVA 2F4LA 5A6YA 3AJYA 4UFKA 3L2YA 1NKGA 5IVVA 4MGKE 2BFUS 1JYIA 4C1WA 4BXFA 5F7UA 4PDWC 5L9VA 2E53A 2PHWA 1KJLA 1TQ5A 4L92A 3SKJE 1W8FA 2Q30A 3TN92 3AJZA 1BBT2 1VBC2 1FPN3 4YVWA 3FFQA 3QBQA 4LBQD 4XC9A 4QD2A 1PIV2 1CJDA 4BQ1A 1UOFA 3IDAA 4HVRA 4P9XA 1CAVB 2VTFA 2GP3A 3J4UH 3T2PA 4CCOA 2HEWF 4NRPA 5EJZB 1V6NA 1QWRA 1S0BA 3O5SA 1OQDA 1V6LA 2BYVE 3LAGA 2QJVA 2DCYA 3OGSA 3WW1A 2BBVA 3ZYJB 4XW3A 3RWNA 3O1SA 1W8HA 4ZU4A 4R8HA 2WA4A 4XBNA 2BNNA 1PGW1 2P4EA 5I91A 1AR73 4QKNA 1LRHA 5K0UA 1REEA 3WSOA 3WDVA 1XE7A 1W28A 2GN7A 4RD7A 1OVSA 2VZPA 1GU3A 1NCRA 2ENRA 5FYSA 1B35C 1HN0A 3FUOA 1H4GA 4FPLA 4NHLA 3WD5A 3ECQA 4BQWA 3AYDA 2TUNA 1MR5A 2E26A 1WW5A 1G6NA 1D0HA 1W90A 2R7EB 2E9QA 4QXHA 3VD5A 3F2ZA 1W6QB 5L36A 1CJPA 3SISA 2ZS6B 4KU8A 1UCXA 3V0AA 3ITQA 5D21A 3Q8BA 1UY4A 3AYEA 3SCFA 3VBFB 5LW9A 2R49A 4GULA 2R071 4QX7A 3WUCA 2GDFA 5A7OA 1AJKA 3HVDA 4BJ0A 4EQVA 1IG3A 4IEYA 1HJGA 1V6JA 4M4PA 3T3YA 5FIXA 4PF1A 4CP0A 3VDAA 5CADA 3NV3A 1UU5A 1XNBA 1Z7S1 1QMJA 3ZSJA 1SACA 4COVA 4YG6A 1NE6A 2NLRA 1NYWA 3WP4A 5I93A 2WNVC 1EUUA 2HWE1 1YFWA 2ZGNA 3LE0A 5JSRA 5C8CC 2VUCA 1YQCA 3WQ7A 3DUIA 1WWYA 3IKWA 1YQ8A 3AKSA 2ADEA 3VD3A 1OH4A 1W3XA 2YB7A 3VN4A 2ZHLA 3VBRC 5C9AC 1EP0A 2E32A 1SFNA 4I0WB 1FPN1 4AXOA 1UX7A 4LK7A 2Q0AA 2Q1FA 1FV2A 1XYNA 4K7JA 2BWAA 1UF2C 5IWFA 1OFSA 1WCQA 2A6YA 2VMFA 5CFCC 1ZA4A 4NPMA 5GJ6A 4AEDC 4B1MA 1JZ4A 1LESA 1ULEA 5J96B 2OQ6A 1WD3A 4MGYE 3AL6A 4LO5B 1TNFA 4M4RA 5IW0A 2HBUA 2VY0A 3C7FA 2OKXA 4A7ZA 5ABJB 5IK7A 3ZXAC 5C3RA 3OF1A 4NPLA 1QJEA 2RE9A 4HL0A 4XEZA 3ZKUA 1ZBE2 2XBO3 1HKDA 1JZ6A 2A6XA 3H1MA 3LA2A 1UYZA 4JZRA 1JTZX 1DF0A 1W8NA 4CP9B 2Y60A 2RJKA 5C3QA 2AACA 4DUXA 1KGYA 1KITA 1RL3A 2J7MA 3P6BA 4IV3B 4TSVA 1AR71 4YNIA 1S0JA 1H30A 1K5MB 4Y1XA 4QB2A 1LTEA 1AR81 2ZEXA 2W52A 3ZIWA 5C3OA 5CNAA 3HQXA 5AVPA 2D98A 1KXGA 4AVTA 4NE9A 3OGVA 1F2NA 3AZYA 3PMSA 4NVPA 5FP3A 3HAGA 2JB4A 4GALA 4OHVA 1KDMA 1SCRA 4AVVA 1JOBA 5KXCA 5JUVA 5EPAA 3Q8AA 5T5LA 4BDVB 2Y64A 3NNFA 4EROA 4TLFA 4Y24A 3IT8A 3B93A 5A3NA 2MPFA 4OFGA 3RQ0A 1QF3A 2RS12 2XHKA 1SLCA 3Q9OA 1DGRA 4AVAA 1US2A 4P9LA 2JG9B 4CUGA 3UNPA 3JQXA 1QXJA 4YLZA 4BLJA 4IGOA 1JYTA 1GZ9A 1UOBA 3AZXA 3I2GA 1TNRA 2WO2A 4JAAA 4MZUA 5CB7A 1D2SA 3EHKA 3VD9A 5A33A 2A73B 3HBZA 5FWJA 5C3PA 2VMEA 2OXBA 5ANNA 1TG7A 2QQWA 4QPIC 2Y26A 4QU2A 2JDYA 2D93A 2MNGA 5FZDA 1C8NA 1GYKA 1SMVA 3MF9A 5DAVA 2UWCA 1R1A3 1ENXA 4FPCA 3VZLA 4LORA 4YM3A 5D2AA 3I8TA 3RZHA 3HQRA 4XUOA 2HJIA 3K2OA 1QQP2 4OHXA 1US3A 5E1RA 4OI2A 2VTXJ 2DFCA 2J1SA 3AMNA 4LKSA 1OSGA 5SV8A 3RPQA 3I2JA 3W59A 4MHUA 1NCQA 4H7LA 5F5IA 1RITA 2EVXA 1W8OA 5LK5A 5LEJA 5LZ6A 1LOGA 5JVVA 2QQVA 2WS93 4MADA 4XCAA 2WN2A 3FLPA 3ZYHA 4A7YA 1O4TA 2A7AA 2BVBA 5A3UA 3H8XA 3UK9A 1MS1A 3GHMA 4XXPA 5FK7A 1RUI1 4EZ4A 2W5FA 2VOVA 2VW2A 3ZVXA 5CIRA 3EXUA 1AL22 5D8AA 3CZUA 2AC1A 2VQTA 3FJSA 4W4ZA 3JQWA 4L97A 5F9TA 2ZJCA 4NJ4A 3IIAA 3IMMA 1OKOA 4IEVA 5BYNA 2VUJA 5J09A 1WKYA 4DXSA 2E51A 3U75A 2R062 4RHV2 4XCBA 4IV3C 1BEV3 1GZWA 2FDJA 5I8SA 2CU5A 2VXJA 5FZ4A 5H9SA 1AYM3 3P3NA 4FBFA 2LM3A 3EJKA 1PGL2 1LOEA 4EYUA 4FQZA 3N7JA 3VDDC 3I59B 4B3NA 5IATA 3RZJA 5L73A 2RMU3 3WUDA 5FOBB 2CGNA 5FYZA 2YHJA 4QX8A 2CV6A 3NMBA 4NIGA 3VBUA 1OI6A 1MQTC 2V09A 5SV5A 1GR3A 4M0HA 3LQCA 3H1WA 4LBLA 4XETA 5LATA 1QU0A 4HVQA 1YUDA 3VKLA 3WCSA 3LPGA 5CA6A 5F1RA 1DYOA 3SNMA 1CPMA 3QLQA 2ZKNA 3OD4A 2ZXQA 1C1LA 1L7LA 1R1A1 1J83A 4P14A 1JN2P 4QGLA 1C8M2 1HB2A 1KD7A 3EYPA 2WZEA 4IEXA 1HV0A 2XVGA 3G7DA 1LHVA 5FJHA 5FMOS 2DURA 2P3JA 2NMNA 2R042 2DF7A 2BTVC 3DKWA 3HJRA 5LY2A 3N9LA 1QH6A 2JD9A 3KT7A 5E8AA 3BOWA 3HOBA 4W6YA 1FOD3 4AI3A 1LR5A 2W9XA 1F31A 3HQUA 3OY8B 3D0JA 3H7JA 3PUAA 4H7MA 4ISRA 3QH7A 4N9HA 4COZA 1QJZA 2VMHA 3RYPA 2P5BA 2WS91 2K9ZA 4QPYA 1S4CA 5IAVA 1OT5A 5L19A 3WINE 2VMCA 4BMEA 2WA3A 3B00A 3OBRA 3AYAA 4X6QB 3KHBA 1PNFA 1F35A 3C3VA 2EIGA 3OY8A 1LGNA 4RGAA 2BEOA 1JYCA 2CAUA 2WNOA 4UF0A 4B7EA 5ACA2 3R0RA 5C71A 3EMRA 2XWBB 3IWZA 4AHWA 2H6CA 3VL9A 1EUTA 4HK9A 3WW2A 4FP2A 1RMU3 4UAPA 3BI3A 1HQLA 5CAZA 2X05A 4CCEA 2VOTA 1BEV1 2C24A 5FKBA 2JDZA 5FZ9A 2VW1A 4CDQB 4CP2A 1AYM1 1FAYA 3ZYIB 4N90A 3R4UA 2VO5A 4XBQA 5A3OA 4YM1A 1QJY3 2ATFA 2Y33A 4PF5A 1MZ5A 1SLTA 4CZSA 4Z07A 5GLWA 1VR3A 2RMU1 1PM4A 1TZOA 3AKQA 4RQPC 2VD7A 5F5CA 2LRPA 5FLHA 4COUA 4D7YA 1SQ4A 4E2QA 3E6BA 5AFEA 3RZLA 3FBYA 1FMD2 3ZFFA 4AI0A 4CDQA 4EZHA 1I6XA 4LBQA 1NZCA 2UYAA 5C4WA 2VQUA 3WR0A 5AC92 1EY2A 1GP5A 1NG0A 4BU2A 1Q8PA 4CTEA 2IXIA 3THPA 2D6MA 3USSA 4YRDA 2VW0A 4QDQA 5A3WA 2VZRA 3ZFGC 4IDZA 4QPGC 1UU4A 3CF6E 4N53A 4DY3A 2HBTA 5HCAA 5FY8A 4S2GA 3MF6A 4LLFA 5ERLA 5CFDB 1X50A 2VVEA 4Q4X3 4EWAA 2R0HA 3NJXA 3J8F2 5FXXA 2XMLA 2ZAAA 4UW3A 4ES8A 1N1YA 3O1MA 1IG0A 1XBFA 1T6BX 2WZ8A 4Q4W1 4OI4A 1HRI3 4CEWA 5LA9A 1AXZA 1FOD1 4D69A 4OMCA 1GWMA 4YZ1A 1EPWA 3JCIA 3NWKA 2JE9A 2PAKA 1SPPB 2RS32 4X8NA 4IEQA 3RGBA 4YGEA 1LECA 3I54A 5EHDA 5HV0A 2E31A 2P17A 2VZOA 3QCWA 1FXZA 2L9LA 2Q4SA 1GOGA 4J6GA 1OLME 4Q4Y2 4X8PA 1DYPA 5L7OC 4XF4A 2E7QA 2DFBA 1XSRA 3GALA 1QOSA 1XNKA 4YM2A 4QM9A 1W9YA 2YC4A 4LUMA 2VE1A 2DBIA 3PNAA 2C26A 1GSLA 1UY0A 1RMU1 3J7NA 1W0PA 4MG2A 5CG9A 2YBPA 1S0CA 4RA0A 2VECA 4ZONA 1K42A 4IV1A 3NV2A 2P37A 2B42B 2A3WA 4GQ7A 5C3SA 2PQSA 1DFQA 3VKFC 5I0DA 5CBLA 1RUH2 4UFHA 1ZYBA 1T6GC 2JKBA 1QJY1 1XQNA 3UYJA 5FZOA 1GFF2 2YY1A 2ETEA 1QY4A 2OQ7A 4XF0A 3MFCA 1LOAA 3LEIA 3POJA 1W03A 4V1PA 4CUAA 1N47A 1ZZ8A 1D7PM 1H9WA 1SLLA 1W3VA 2P34A 4OULA 5JSPA 3WCRA 3A0KA 1UPIA 3M8LA 2QDNA 3OGRA 4IUGA 3PVBB 2XUEA 5FP8A 3MFAA 3IDEA 4BOWA 3RZZA 5FZ1A 1WMDA 3TNPB 5IVFA 1POV0 1LB2A 3U07A 2AEZA 4M3CF 3FHIB 3KB5A 3B9CA 5GZEA 5FFOC 1K45A 5A1LA 5FY9A 1CVNA 2VBPA 4YSFA 1F9KA 2YZ4A 4AWDA 4LMFA 3SHRA 1W6NA 2ORZA 3MLLA 4LA2A 2AREA 2WLPA 2WDBA 1AX0A 4Q4X1 1MEC2 1TE1B 4DY5A 1CGPA 1X7NA 3ROUA 5L9BA 2A70A 4R9AA 5FR3A 4LT5A 2WWUA 2ZX2A 4YGDA 1HRI1 1O59A 2IC1A 4UW4A 1S2KA 3GDBA 1VBA3 1PO21 1VJ2A 2HEVF 2PHDA 4IXLA 5JMCA 4XQWA 1VBD3 4JGZA 3OUIA 1VB4A 3UKTA 1FX5A 3PDQA 5F3GA 5CISA 3AX4A 3T4VA 5JOYA 2V5DA 3V0BB 3MIGA 2Z2SB 3SH5A 1CX4A 1YNAA 5DDJ2 2EAKA 4XE9A 1JBCA 1ZBA3 3OGJA 1J84A 2V73A 3MGUA 1RJ8A 1C3HA 1WD4A 1LGCA 4OVEA 1UOJA 2HWB1 4L2NA 4FFIA 1EV12 4OHYA 1HLCA 3KWVA 2QUOA 4WM8C 1BZWA 1OOPB 3S7IA 4CCKA 4ZZ5A 5BNQA 1XB9A 5FZ7A 4FFGA 4GWJA 1RUJ3 4NIDA 1KS5A 3ACGA 3O14A 1MZEA 2GSYA 3KCYA 3BU0A 3E6CC 3GGLA 2FHRA 2VZUA 4JGYC 5J36A 1AYN2 2BV4A 2DUQA 1CIWA 1K5JA 2DVFA 2VQAA 1YJKA 4XOGA 1AZDA 3LOIA 1OOPA 4ET7A 2F4PA 3WNLA 2W47A 1D4M2 3K4DA 5JXJA 5FZ6A 2WNEA 4GIQA 3KVAA 1ALYA 3O1OA 3I3MA 3PIJA 1JXNA 4K8RB 3IPVB 3L9JT 3UGGA 4B29A 3A21A 5IHRA 4URAA 1CQ9A 1Q8VA 2RJLA 1BK0A 1DQ4A 2BGPA 2TBVA 4GKXA 2VC9A 4YZ3A 3UT0A 4LTAA 3JXSA 2MEV2 4CEYB 3H42B 1TME3 4FOVA 1RUD2 4Z8BA 1JYVA 2VUDA 1TVGA 4KWJA 4NR1A 4XJZA 3CJIB 1AR93 1N3PA 2YU1A 1IS5A 3IDBB 2XG3A 4FOQA 4IL7A 5IJRA 4Q8KA 2JKXA 3ZM8A 3LEGA 1F4AA 1RJ7A 1VBE3 4QQPA 3N7MA 1O8SA 4XTPA 3VBSA 5GLTA 4CDUB 3JD73 1AR63 2J42A 4LHKA 2HWC2 4FTEA 4Q29A 2W95A 2W3JA 2ZPXA 4FTBA 1YFUA 4A6OA 3C7EA 3OBTA 3SC7X 3M3EA 4WVMB 2D40A 4FAGA 2Z69A 2D97A 1Z0HA 1VBA1 1ASJ2 4C8DA 3M70A 3VBHA 1BLZA 1VBD1 4EWDA 5JOWA 3FLTA 1NXD1 4J1WA 4WBBA 1W8UA 4Y5Z0 1FT9A 4UT5A 2YROA 5JR2A 4I2OA 5FY0A 5IFTA 1ZBA1 5CKQA 3TAYA 1WCKA 2BDRA 3S57A 1IPJA 4FPHA 4WVMA 5FP4A 1IHMA
chains in the Genus database with same CATH topology
5FWJA 5FZOB 3PTRB 5A3PA 5LY1A 5F39A 5A1LA 3AL5A 5FY9A 4V2VA 4UF0A 5FZDA 3K3OA 4ASKA 5A7WA 4HONA 4D6QA 5A7SA 3KV5A 4IGPA 5IVBA 5FJKA 5FYSA 2PXJA 5FYUA 2W2IA 3ZPOA 2XXZA 5IVCA 4AAPA 5FYBA 5K4LA 3U4SA 3KVBA 5A80A 3OPTA 3K2OA 4QXHA 5FZEA 5F2SA 5FUPA 4BISA 5FZ9A 4GD4A 2WWUA 4UF0B 5A7WB 4D6RA 2WWJA 2Q8EA 5FZ8A 5LW9A 5FWEA 4QX7A 4Y33A 3PDQA 5F5IA 5F3GA 5A7OA 3N9OA 2VD7A 3NJYA 5F5CA 3KV9A 5FYYA 5FZ3A 4EZHA 3PUQA 5FY1A 3KV4A 5CEHA 5FY4A 4CCNA 5IVYA 5FY7A 5FYMA 5A7NA 5FZMA 5F5AA 5FPUA 2YBKA 3N9MA 4XDPA 5FPVA 5FYVA 4AI9A 4BU2A 4GAZA 4CCKA 2YBSA 4EZ4A 5FP7A 5FZ7A 5ISLA 4CSWA 5A3WA 5FY5A 5FYIA 3DXTA 5FYHA 3PUSA 3N9QA 4GJYA 5F2WA 5FY8A 5FZFA 5FYCA 4DIQA 5E6HA 3N9NA 3KV6A 2YU2A 5FXXA 2XMLA 3K3NA 5FXWA 5IWFA 5FP9A 5FZ4A 5KR7A 4DO0A 5IVJA 5A7QA 5F3CA 2OQ6A 4EYUA 4LIVA 2OS2A 4TN7A 3AL6A 5FZ6A 5IW0A 5A1FA 4V2WA 3KVAA 5F3IA 2XDVA 5FZBA 4LITA 4Y4RA 4Y3OA 3LD8A 5FYZA 4QX8A 4URAA 4QU1A 3ZLIA 5FZIA 4CCJA 4LIUA 3RVHA 5FZLA 5FZKA 5IVVA 3U78A 4CCLA 5FPAA 5FXVA 4HOOA 5FBJA 5FPBA 4BXFA 5FZCA 3AVRA 2Q8DA 5IVEA 4QXBA 4NUBA 2YPDA 2YU1A 5FUNA 2OX0A 3PU3A 1VRBA 5ANQA 5FZHA 2YBPA 3LDBA 5F3EA 5FP3A 3PU8A 5FJHA 4E4HA 5FZGA 2OT7A 5A3NA 3OPWA 5A7PA 4D6SA 2GP3A 5LY2A 4CCMA 3N9LA 3UYJA 4CCOA 5FZOA 4C8DA 5FV3A 3DXUA 5FPLA 5LWBA 4QWNA 4GJZA 2OQ7A 5FYTA 2Q8CA 4QXCA 4LXLA 4CUGA 3PUAA 5FXZA 3AVSA 5FZ0A 5FZAA 4IGOA 2P5BA 5A3TA 5F37A 5FY0A 4IGQA 3N9PA 2XUEA 3PURA 5FP8A 4XDOA 5FP4A 5IVFA 5FZ1A 2GP5A 5F32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FWJ A;  5FZO B;  3PTR B;  5A3P A;  5LY1 A;  5F39 A;  5A1L A;  3AL5 A;  5FY9 A;  4V2V A;  4UF0 A;  5FZD A;  3K3O A;  4ASK A;  5A7W A;  4HON A;  4D6Q A;  5A7S A;  3KV5 A;  4IGP A;  5IVB A;  5FJK A;  5FYS A;  2PXJ A;  5FYU A;  2W2I A;  3ZPO A;  2XXZ A;  5IVC A;  4AAP A;  5FYB A;  5K4L A;  3U4S A;  3KVB A;  5A80 A;  3OPT A;  3K2O A;  4QXH A;  5FZE A;  5F2S A;  5FUP A;  4BIS A;  5FZ9 A;  4GD4 A;  2WWU A;  4UF0 B;  5A7W B;  4D6R A;  2WWJ A;  2Q8E A;  5FZ8 A;  5LW9 A;  5FWE A;  4QX7 A;  4Y33 A;  3PDQ A;  5F5I A;  5F3G A;  5A7O A;  3N9O A;  2VD7 A;  3NJY A;  5F5C A;  3KV9 A;  5FYY A;  5FZ3 A;  4EZH A;  3PUQ A;  5FY1 A;  3KV4 A;  5CEH A;  5FY4 A;  4CCN A;  5IVY A;  5FY7 A;  5FYM A;  5A7N A;  5FZM A;  5F5A A;  5FPU A;  2YBK A;  3N9M A;  4XDP A;  5FPV A;  5FYV A;  4AI9 A;  4BU2 A;  4GAZ A;  4CCK A;  2YBS A;  4EZ4 A;  5FP7 A;  5FZ7 A;  5ISL A;  4CSW A;  5A3W A;  5FY5 A;  5FYI A;  3DXT A;  5FYH A;  3PUS A;  3N9Q A;  4GJY A;  5F2W A;  5FY8 A;  5FZF A;  5FYC A;  4DIQ A;  5E6H A;  3N9N A;  3KV6 A;  2YU2 A;  5FXX A;  2XML A;  3K3N A;  5FXW A;  5IWF A;  5FP9 A;  5FZ4 A;  5KR7 A;  4DO0 A;  5IVJ A;  5A7Q A;  5F3C A;  2OQ6 A;  4EYU A;  4LIV A;  2OS2 A;  4TN7 A;  3AL6 A;  5FZ6 A;  5IW0 A;  5A1F A;  4V2W A;  3KVA A;  5F3I A;  2XDV A;  5FZB A;  4LIT A;  4Y4R A;  4Y3O A;  3LD8 A;  5FYZ A;  4QX8 A;  4URA A;  4QU1 A;  3ZLI A;  5FZI A;  4CCJ A;  4LIU A;  3RVH A;  5FZL A;  5FZK A;  5IVV A;  3U78 A;  4CCL A;  5FPA A;  5FXV A;  4HOO A;  5FBJ A;  5FPB A;  4BXF A;  5FZC A;  3AVR A;  2Q8D A;  5IVE A;  4QXB A;  4NUB A;  2YPD A;  2YU1 A;  5FUN A;  2OX0 A;  3PU3 A;  1VRB A;  5ANQ A;  5FZH A;  2YBP A;  3LDB A;  5F3E A;  5FP3 A;  3PU8 A;  5FJH A;  4E4H A;  5FZG A;  2OT7 A;  5A3N A;  3OPW A;  5A7P A;  4D6S A;  2GP3 A;  5LY2 A;  4CCM A;  3N9L A;  3UYJ A;  4CCO A;  5FZO A;  4C8D A;  5FV3 A;  3DXU A;  5FPL A;  5LWB A;  4QWN A;  4GJZ A;  2OQ7 A;  5FYT A;  2Q8C A;  4QXC A;  4LXL A;  4CUG A;  3PUA A;  5FXZ A;  3AVS A;  5FZ0 A;  5FZA A;  4IGO A;  2P5B A;  5A3T A;  5F37 A;  5FY0 A;  4IGQ A;  3N9P A;  2XUE A;  3PUR A;  5FP8 A;  4XDO A;  5FP4 A;  5IVF A;  5FZ1 A;  2GP5 A;  5F32 A; 
#chains in the Genus database with same CATH topology
 4XZP A;  4RR3 B;  2X53 S;  5H9R A;  2X8K A;  2XLG A;  3GNE A;  2W1W A;  4LO7 A;  1RUJ 1;  1SLB A;  1ND2 B;  1VBB 2;  5EQU A;  3BTA A;  2UYB A;  4KG8 A;  1JUH A;  3NNL A;  1LOC A;  2RV9 A;  3JBG 3;  3VUO A;  1W6M A;  1BVV A;  4GB3 2;  3U4S A;  1V6K A;  3M3I A;  3V64 A;  1Y3T A;  2ZGL A;  5A80 A;  1ZRD A;  2VZS A;  4DEQ A;  4Q4V 3;  1XJA A;  3DEC A;  3LSE A;  3ZYG A;  4CA9 A;  2WAB A;  4XVH A;  3OTF A;  1G9C A;  1F5F A;  1I9R A;  3PJY A;  2QCS B;  4HPK B;  4QHB A;  4E4S A;  5FZ8 A;  1U5I A;  2A5Z A;  3D6E A;  4GH4 B;  1QJX 3;  2F17 A;  2JDP A;  3VBO A;  5K7P A;  4M3C E;  3PTY A;  3HNM A;  2Q5T A;  5DG1 A;  4CVU A;  4JRA A;  5JZG A;  2YUE A;  2GC3 A;  4UFL A;  5FY1 A;  3FL7 A;  1RUF 3;  1D0G A;  2A3X A;  5IVY A;  5FYM A;  1TME 1;  3N7K A;  2WFF 3;  2V4V A;  2RG4 A;  2ZGQ A;  5EFU A;  2EXH A;  3ZYF A;  2G9F A;  4BK5 A;  4HXC A;  5FP7 A;  5ISL A;  1CWP A;  2RS5 2;  5FUI A;  1CZS A;  1AR9 1;  3N36 A;  1UIJ A;  5FYH A;  2FZ2 A;  1K12 A;  5HI0 A;  1VBE 1;  1DQ2 A;  3VZN A;  3BTY A;  2RM2 3;  1O5L A;  1SDD B;  4MGQ A;  3JD7 1;  1AR6 1;  3F95 A;  3O7O A;  4CEY C;  4DZG A;  2CWS A;  3SQO A;  4LUK A;  2AUY A;  2CWM A;  2QKD A;  3U11 A;  3SEP A;  2IFR A;  5KBF A;  4L9B A;  3CJI C;  1HRV 2;  1R64 A;  2RDQ A;  1Y9Q A;  4PDW A;  1WCD J;  4NIH A;  4YZ2 A;  2C0Z A;  2FCV A;  1OUS A;  1SZB A;  4XHB A;  4LEJ A;  4A42 A;  1Q8O A;  4DXT A;  4CDU C;  4HAN A;  1LOF C;  5KHH A;  1WGP A;  4Y5T A;  4AE2 A;  5DAB A;  2D3P A;  2WRA A;  2DCK A;  4MXW B;  5FRE A;  4QGN A;  3RFR A;  3UKV A;  4NHK A;  1RTV A;  1ENS A;  3ZXG A;  3ZXD A;  3E5X A;  3PHM A;  3BUC A;  5FZC A;  2BPA 2;  4G9S B;  1A8M A;  4W6X A;  2JXA A;  2YPD A;  1LU1 A;  3NNG A;  4FPO B;  3JBG 1;  1CAX A;  4BQ3 A;  1QH7 A;  3THT A;  1I1E A;  4U2A A;  1A78 A;  3NNJ A;  3PME A;  5H9Q A;  4RR3 C;  5FLJ A;  2VNO A;  4IW3 A;  4Q4V 1;  1CD3 G;  2UU8 A;  3AKP A;  1W05 A;  2HKX A;  1ND2 C;  2WO3 A;  2VNV A;  5LRS A;  1ZZ6 A;  1HB3 A;  1CZV A;  2G9Z A;  1QJX 1;  4YW3 A;  3NKT A;  1BBT 3;  1GKB A;  2HWF 3;  3JUU A;  3R4S A;  4B7K A;  4COY A;  2D7F A;  3AVS A;  3HMY A;  2XJP A;  2HWE 3;  3AP9 A;  4YVW B;  3MO4 A;  1PIV 3;  3WP6 A;  3RZG A;  4Y22 A;  1TEI A;  4XFG A;  5C70 A;  3R4D B;  4WVV A;  1P8J A;  2ZZQ A;  3U37 A;  1DQ0 A;  1UW8 A;  1RUF 1;  4ZHN A;  5FDB A;  1X9T A;  1XYO A;  1GNH A;  1GNY A;  2I2S A;  2WQ4 A;  4HG6 B;  4ZZ8 A;  1QDO A;  3JB4 C;  4LHN A;  4OHZ A;  3S5A A;  3IAP A;  2WFF 1;  1KJR A;  2D6K A;  5BPX A;  4ARY A;  1ENQ A;  4V2V A;  2BVV A;  1NLQ A;  4TYS A;  1H2N A;  1RUE 3;  4NHY A;  3FWE A;  2YXS A;  2J1A A;  5FJK A;  5B4N A;  2W2I A;  2DVA A;  2W0X A;  4NII A;  2RM2 1;  2XJS A;  2YDE A;  2IXH A;  3FZ3 A;  1GNZ A;  4LJH A;  3RJR A;  2WNV A;  3OPT A;  1GBG A;  4ZXK A;  5KWR A;  2JIJ A;  3DYM A;  3LFM A;  2R07 2;  5K0U B;  1ZRE A;  1SDW A;  3WV6 A;  1OPM A;  1NCR B;  3VBR A;  1W2T A;  5IUQ A;  4EN7 B;  4AG4 A;  2OUH A;  1GAN A;  1UY3 A;  1ULC A;  4XUT A;  3ZDS A;  3AMH A;  2Y0O A;  2WNU A;  5IVE A;  5BNN A;  1AX2 A;  1UZW A;  3MBW A;  5CFC A;  2YGM A;  5LCW L;  1W6P A;  3V0A B;  3USU A;  4YFZ A;  1AR8 3;  1ZZC A;  3ZN4 A;  4ASL A;  4XDP A;  3KMH A;  4GAZ A;  1WUV A;  1S0I A;  3ST7 A;  2I07 B;  4AGV A;  4CP1 A;  1KRI A;  3B9I A;  1T2X A;  1UZ0 A;  4ZU5 A;  4GXL A;  1FPN 2;  1VMH A;  2VR4 A;  2Y6L A;  1LCL A;  1RYY A;  4XBL A;  2AH2 A;  1DGW X;  5FYC A;  4A3Z A;  5I8Y A;  1VAM A;  3FN9 A;  5E6H A;  5G05 L;  3N9N A;  2R0F A;  4ZXE A;  3TYJ A;  1ULF A;  1H1A A;  2QQO A;  2VOX A;  3A0N A;  3H0O A;  3SIT A;  5A7Q A;  1N1V A;  1W2N A;  4OMD A;  5F3C A;  1H1I A;  5JXH A;  4LIV A;  1RUN A;  3J7M A;  2YFZ A;  3NO8 A;  4Z92 B;  3BTZ A;  1ND3 C;  1OA3 A;  2GMP A;  1BBT 1;  5DUW A;  2HWF 1;  2DVD A;  4XF1 A;  1W8W A;  2ZX4 A;  3SMH A;  3POY A;  4LIT A;  2XR4 A;  1ZRI A;  2GC1 A;  2B7Y A;  4Y4R A;  1PIV 1;  4CXW A;  4N9I A;  3WDY A;  4B4Q A;  4AQS A;  2ET7 A;  4Y1U A;  4KGQ A;  4AHZ A;  1AL0 G;  3H3U A;  3HBK A;  5FZI A;  1QDC A;  5E16 A;  2WL1 A;  4AHY A;  4CDX A;  1KFX L;  3LGR A;  2KD7 A;  2JIG A;  4K3U A;  2JEC A;  3A22 A;  2PLV 3;  4H55 A;  4CCL A;  1RVF 2;  5I0U A;  2Q8O A;  4Y20 A;  1LGB A;  2WT1 A;  2RR1 3;  4FOY A;  1BQP A;  2EA7 A;  5IFP A;  3ILF A;  4YVW C;  4EJR A;  4QXB A;  3DYO A;  4P9I A;  2JDN A;  5IK4 A;  1RUE 1;  5JXG A;  3MV1 1;  2OII A;  4Z2A A;  3OEA A;  2BP6 A;  1Y9G A;  5ANQ A;  2BWC A;  2VNR A;  4NHX A;  4LKE A;  1DIW A;  2ZEW A;  4OYU A;  4E4H A;  1WLC A;  4XZU G;  2XL7 A;  1JU3 A;  2NQY A;  2OT7 A;  4QPI A;  4OQ8 A;  3RZK A;  4P08 A;  4AVB A;  4JQR A;  1LHN A;  4LPL A;  4N43 B;  4RS5 A;  1W2O A;  2EXI A;  5FPL A;  2KR2 A;  4YG3 A;  3HT2 A;  1BMV 1;  2ADD A;  2W1U A;  4K20 A;  5E89 A;  3W5N A;  1WW6 A;  2DCT A;  1IQA A;  3IAQ A;  5FQ0 A;  3LF7 A;  5EWS A;  3ZMN A;  3H8O A;  1RUI 3;  5LBB A;  2GC2 A;  4OLL A;  4A3X A;  3POG A;  4N43 A;  4AI1 A;  5BNO A;  5KHJ A;  3M7A A;  5LY1 A;  1UMH A;  2D6N A;  1GOF A;  3MUZ 1;  4C0H A;  2UUR A;  3HT1 A;  4ASK A;  4D6Q A;  2ES3 A;  3BGA A;  4ZU7 A;  5HV4 A;  5A7S A;  5IVB A;  2WAO A;  3P3P A;  1J3R A;  3BYW A;  5IT6 A;  4YZ4 A;  4QX0 A;  2VOW A;  4UW5 A;  1GP4 A;  5EZW A;  3VZM A;  5A33 B;  4ZY9 A;  4YWA A;  2YC2 A;  1F4H A;  4D3W A;  1SHW B;  1OLR A;  3M1H A;  1XU1 A;  4JV4 A;  4BIS A;  4QB1 A;  2CYF A;  4AQ6 A;  1VIW B;  3LDR A;  4M01 A;  2W39 A;  2XBO 2;  5DAX A;  1EAH 2;  2I45 A;  3NJY A;  4UWD A;  5JIU A;  1YEW A;  3VBF C;  3VV1 A;  1QQP 3;  1W0N A;  3H9A A;  2VZ1 A;  4M00 A;  4B4P A;  1ZVF A;  4HN1 A;  3TEW A;  2J1R A;  2V72 A;  3MPP G;  2BGC A;  3ZXF A;  1NCQ B;  2PLV 1;  2WN3 A;  4IEU A;  2IFW A;  5HCF A;  1JOJ A;  3NRU A;  3Q8F A;  2JDH A;  1L7R A;  2EIE A;  2RR1 1;  1UOG A;  4KI5 M;  2Y6G A;  3T0D A;  3O12 A;  4HZF A;  3AMP A;  3D3A A;  5DQ0 A;  1KDK A;  4PLO A;  3A4U A;  2VVD A;  1H2L A;  3H3L A;  2IUW A;  1V6M A;  3RDI A;  1YIF A;  3SH4 A;  3I3B A;  2P3Y A;  4XYX A;  4BYY A;  3V65 A;  1PVC 2;  2QVS B;  5D8A B;  1H4H A;  4D94 A;  4BMB A;  5A3L A;  2BOJ A;  4MV2 A;  1QXP A;  4UFI A;  5A1F A;  2DWR A;  1SLI A;  3M4F A;  2A6Z A;  1YLL A;  3ZXL A;  5KHG A;  4JDO A;  2QQJ A;  4DUV A;  3HNY M;  3G6J B;  3NNM A;  4ARX A;  1GZW B;  5ABJ C;  1F15 A;  2BW8 A;  4CPB A;  2XJV A;  2XON A;  2WII B;  4MET A;  2DVG A;  5AFB A;  1QEX A;  3AKT A;  2DBN A;  1DBN A;  1LU2 A;  5FZK A;  3RZM A;  5T52 A;  5FPA A;  3VZJ A;  2BQP A;  2XLF A;  4M3C A;  5FPB A;  2W87 A;  2ZHM A;  2K2S A;  2GH8 A;  3AVR A;  3B02 A;  3VL8 A;  4Q1R A;  3LKJ A;  4LR4 A;  4XQD A;  2JB8 A;  4BH9 A;  1YHF A;  1NUK A;  1S2B A;  1V9U 2;  3K48 A;  3VBU B;  2XL9 A;  1PVX A;  1K5M C;  4CDW A;  5JOX A;  4JHZ A;  2VCB A;  4XFF A;  2WO1 A;  1YRZ A;  2BOI A;  1RHI 2;  4AFM A;  2NMO A;  2WZR 2;  3GM8 A;  2ZGU A;  3P1I A;  4QX2 A;  5FZG A;  3TEX A;  1W39 A;  1S0G A;  1H9P A;  4JQT A;  3CBN A;  1XSQ A;  2Z42 A;  3WW4 A;  4BK4 A;  2FCT A;  3D4K A;  1UMZ A;  3VGI A;  4BXS V;  4GJZ A;  1Y9M A;  1C8M 3;  1UQX A;  1RUC 2;  5FXZ A;  2VOK A;  1QQP 1;  3HIF A;  4CCC A;  5FLI A;  1UYY A;  2NPI A;  2JG9 C;  4XDO A;  3VDB A;  2Y38 A;  1J3Q A;  1M06 G;  3R6S A;  3AB0 A;  4MYE A;  2C5D A;  4AFB A;  5HXV A;  3WDU A;  4DNY A;  3MIE A;  5F39 A;  2GAL A;  4ZKT B;  5BUV A;  3E5U A;  1ZZ7 A;  4FXK B;  3RMY A;  4FPF A;  4RQP A;  2R6Q A;  3R05 A;  1YQ2 A;  5EXO A;  2CAV A;  3CMG A;  5FO9 B;  3FFZ A;  2XWJ B;  5C8W A;  5DUU A;  4YVS A;  1RUG 3;  1S0D A;  3L2H A;  4W65 A;  4Q4W 3;  2PHU A;  3IZO A;  2WKK A;  1NCQ C;  5LB6 A;  2LRO A;  3BTX A;  2QQM A;  2CDP A;  4GD4 A;  4UF0 B;  5T5J A;  1Q8S A;  1WA4 A;  1ZZB A;  2RMU 2;  3HEI A;  3ZFG A;  1RB8 G;  2GNT A;  1LOB A;  4QPG A;  4MVT A;  1YYN A;  2B46 X;  1WW4 A;  1D4V B;  1QGL A;  2Y6J A;  1UL9 A;  3MDP A;  4HET A;  3LIH A;  4BZ4 A;  2HH9 A;  4I0B A;  4TTG A;  3AMQ A;  3VKO A;  2Y34 A;  3ZFE A;  4AVC A;  1JUI A;  3AFG A;  4LBM A;  5JOZ A;  1V6I A;  4AYU A;  3O1V A;  3PUQ A;  4ATF A;  5BNP A;  1PGL 1;  4CU6 A;  2QBX A;  1VE0 A;  2XJT A;  4QKD A;  4KQ7 A;  5F5A A;  2Q1M A;  4BIF A;  3UGF A;  3WF0 A;  5JAX A;  4X6R B;  3FHA A;  1O3T A;  3ON7 A;  4S2H A;  4A6S A;  2BGO A;  3OEB A;  3ZSE A;  4E8D A;  4D7T A;  5CYY A;  3AP4 A;  2CDO A;  1I5P A;  1SEF A;  2VPV A;  2D3R A;  1O8P A;  4Q8L A;  2ZML A;  5DAW A;  3ZFF B;  3N9Q A;  1PZ8 A;  1O7F A;  3MYX A;  4GJY A;  4R4X A;  1O4Z A;  4P00 B;  1BHG A;  3BN6 A;  4LBQ B;  2HEY F;  1UN1 A;  1X8M A;  5C4W B;  3WDT A;  1JH5 A;  4QB6 A;  5C7G A;  4UI9 L;  3WDX A;  1W8T A;  1PMH X;  4H3W A;  1AUY A;  4QQO A;  4NAO A;  2EID A;  3JB8 A;  1FOD 2;  4AW7 A;  1V0A A;  3NJV A;  4URT A;  5J48 A;  2OS2 A;  4N53 B;  2B45 X;  1Y43 B;  3VBU C;  4NHM A;  2A3Y A;  1C8M 1;  4V2W A;  4IE7 A;  4QHZ A;  3UKN A;  3AP7 A;  3K4Z A;  5F6L B;  3RNS A;  2A71 A;  3O0W A;  3RRD A;  3OCP A;  3HWJ A;  2V5Y A;  4TWT A;  1U5Y A;  3ETP A;  4CEW B;  2GN3 A;  4LUL A;  3RVH A;  5BXX A;  1FNZ A;  4SLI A;  5LK7 B;  4W6W A;  3MIB A;  2DV9 A;  4FQ4 A;  4QGM A;  2RS3 3;  3RS6 A;  3TOJ A;  3T0B A;  2BFU L;  5DZF A;  1FYU A;  1Q5O A;  3K4A A;  1RUG 1;  4EV0 A;  5FZH A;  4Z82 A;  2X10 A;  4F3J A;  1HJF A;  1MS5 A;  1ULG A;  1WLD A;  2PFW A;  2BU9 A;  1PO2 3;  3PU8 A;  4CE8 A;  2BER A;  3ZYB A;  2F6B A;  2IVJ A;  5AVA A;  2XGX A;  2G19 A;  2X29 A;  4LKF A;  2ORX A;  3FX3 A;  5FV3 A;  1JHJ A;  3N7L A;  3LSD A;  5LAS A;  1F5J A;  3J7L A;  2YYO A;  3WEZ A;  4MHR A;  3CLP A;  4DRR A;  4E8C A;  2HWB 3;  4IV1 B;  4EN6 B;  1RUH 3;  5KXE A;  1QOT A;  2XKO A;  3CJX A;  4NWW A;  4OUE A;  3T2T A;  1UIK A;  4EN0 A;  1UAI A;  5FZO B;  1JZ5 A;  4KWL A;  4YM0 A;  1Y4W A;  5JPM B;  2WO7 A;  4HON A;  1PK6 A;  2ZTN A;  3ORJ A;  4Q4X 2;  2JD4 A;  4AEK A;  1MS9 A;  5DZG A;  2DUO A;  4BQY A;  3D82 A;  2OZJ A;  2P6H A;  4HT1 T;  1AF9 A;  2ZGT A;  4JVA A;  4AAP A;  4BQ2 A;  1JI6 A;  2YMZ A;  4YW6 A;  1GMM A;  1QHD A;  1QOO A;  5FZE A;  1C1F A;  1X9P A;  4WM8 A;  1YQ5 A;  5LA0 A;  5FO8 B;  1MS4 A;  2VZQ A;  4YYO A;  1JS9 A;  4KMQ A;  3ZFF C;  1KQR A;  1PMI A;  1W6N B;  3BPZ A;  4B8E A;  4CDQ C;  4E9K A;  3LIG A;  1E57 A;  1MEC 3;  1CAW A;  4XIL A;  3J8F 1;  4QDS A;  3UV9 A;  4XFH A;  3WG1 A;  4JGY A;  4E4Z A;  3WNX A;  3S0M A;  5IK8 A;  1NA1 B;  2XQX A;  3NV1 A;  1IQD C;  3PIG A;  4JC1 A;  2FQP A;  1IS4 A;  2J1U A;  4N53 C;  5BY5 A;  4LK6 A;  1YIP A;  1R08 2;  4Y1V A;  3RI9 A;  4DPN A;  4FPJ A;  1VLN A;  2VZ3 A;  2J22 A;  4JGZ B;  4NAM A;  1PO1 2;  2RS3 1;  1SLA A;  2WWS A;  2YV8 A;  3LA7 A;  5DDJ 3;  1U5X A;  1WME A;  5JI7 A;  1NA1 A;  1WZX A;  5F2W A;  3O1P A;  4MGZ E;  1LHO A;  3ELN A;  4CEW C;  1RXF A;  2WQ8 A;  3H7Y A;  3OYW A;  1EV1 3;  5C5U A;  1Q43 A;  4O61 A;  1OQ1 A;  5CFD C;  2FD8 A;  2A75 A;  5FP9 A;  1BK1 A;  2ZA9 A;  1D2Q A;  3LCP A;  5C5T A;  1JHN A;  2O8Q A;  1IS3 A;  5DXD A;  1U5Z A;  4N7I A;  3KT4 A;  4JKL A;  2IXK A;  5TSW A;  3WQ1 A;  3LD8 A;  4J1X A;  2QE3 A;  3T2O A;  2EAA A;  1GQG A;  1XC6 A;  1RUH 1;  4A41 A;  4A2U A;  4RGK A;  4S2D A;  2R16 A;  3H1Y A;  1QJU 3;  1ZX5 A;  4CRQ A;  3E6D A;  5JMO A;  2ZOE B;  3M3O A;  1UZY A;  3VB9 A;  3U78 A;  4XJA A;  1COV 2;  3BIE A;  3T2Q A;  3BPS A;  5FBJ A;  2P6C A;  1ONA A;  4LHL A;  4Q0U A;  1O3S A;  3IB3 A;  2HYX A;  1DDL A;  4R9B A;  2MEV 3;  2NYY A;  1GZC A;  1UKR A;  1RUD 3;  2XJR A;  4HFS A;  5FOJ B;  4XIK A;  5IK5 A;  3ATG A;  4CU9 A;  1JOD A;  3AZV A;  3BU7 A;  4G4F A;  3S7E A;  4AHX A;  4NPR A;  2D6P A;  1GLH A;  4NMI A;  5E88 A;  2PHL A;  4JX0 A;  4WVW A;  4GMP 3;  1MEC 1;  4ITC A;  1XND A;  4YW2 A;  2R30 A;  2P3I A;  3VD4 A;  3VBS B;  1TMF 3;  4AGG A;  3DPR A;  1H8T A;  2DUP A;  4KGG A;  5JCT A;  1DG6 A;  1UNB A;  3KF5 A;  2WZP P;  4DFS A;  4O7X A;  1ASJ 3;  1NZI A;  1YFX A;  1FNY A;  1LEN A;  4GWI A;  4WM7 A;  5FAX A;  3VBH B;  1RUJ 2;  2ARB A;  4ZS3 A;  3WOG A;  4BM8 A;  2PAE A;  5A3P A;  2AEY A;  3MLJ A;  2VVF A;  4JCK A;  3AL5 A;  3DN7 A;  3TRS B;  1VMF A;  4DS0 A;  4LBK A;  5DDJ 1;  3K3O A;  5A7W A;  4MGS A;  3KV5 A;  3OUH A;  3GBW A;  4XUR A;  3DCQ A;  5FCC A;  1ULP A;  2JG8 B;  1YFY A;  3PVO A;  3NAP A;  1EV1 1;  2IXC A;  2H6B A;  4YAR A;  4JGZ C;  1UYP A;  1HXS 2;  2VG9 A;  4PBP A;  5FUP A;  1VBB 3;  4JKM A;  1SFY A;  2QZ2 A;  3ZN5 A;  1AXK A;  1KEX A;  5K9Y A;  5FO7 B;  1BJQ A;  2X5I B;  1R09 2;  1GUI A;  4J25 A;  1OPO A;  4GB3 3;  2JG8 A;  3I2K A;  1W6M B;  4I3G A;  4QHO A;  1OQE A;  2D6O X;  4OHW A;  5LBE A;  1WBL A;  1GV9 A;  1O3Q A;  5A6Q A;  2VZT A;  1TME 2;  4B1L A;  2Y6H A;  1UZV A;  3RG0 A;  1QJU 1;  3KV4 A;  2E7T A;  2UWB A;  2EAL A;  2YGL A;  3BOP A;  4UBG A;  4FFH A;  4FVV A;  4RYD A;  4ASM B;  1QXR A;  5FPV A;  4BCU A;  1AR9 2;  2X5I A;  4FT8 A;  4P5H A;  3VKM A;  4AFA A;  2YBS A;  4Z2W A;  2HWD 2;  2W08 A;  5DAQ A;  3VBO B;  1W6O B;  3PUH A;  5FY5 A;  4A44 A;  1N3O A;  1OOP C;  2JIC A;  2QQI A;  3C7O A;  1LOD A;  5JZG B;  4BWO A;  3W20 A;  3ZDV A;  4DUW A;  2MEV 1;  2XHN A;  4YW1 A;  2J1V A;  1RUD 1;  1MVQ A;  4NO4 A;  4HSL A;  1JOP A;  2GND A;  2OW4 A;  1JZ2 A;  3I3Q A;  1XYP A;  3GZA A;  3IBM A;  3LPF A;  5F6K A;  2Z4F A;  2DDU A;  1BKZ A;  4CCD A;  1W6O A;  1NLR A;  1XU2 A;  1CX1 A;  1OVP A;  3E1F 1;  4TN7 A;  4AVS A;  2JEM A;  4GMP 1;  3GBF A;  2OPW A;  3ZYP A;  5LA2 A;  5EP9 A;  2DTW A;  4JDN A;  3AMM A;  1UY1 A;  5CU1 A;  2AYH A;  5FPX A;  3NL1 A;  1TMF 1;  2WSV A;  4JTN A;  3KHC A;  3U4X A;  1STM A;  3KF3 A;  4UOJ A;  5EIY B;  4EN9 B;  5A32 A;  5JDB A;  5LA1 A;  1HRV 3;  1E5I A;  1GIC A;  5JR7 B;  1ASJ 1;  2O14 A;  4CUB A;  4FCA A;  4AQT A;  4PDW B;  1JYN A;  4LE3 A;  5FXV A;  2JEN A;  2NN8 A;  2J1E A;  2VUL A;  3IM0 A;  3I3D A;  3VBS C;  1YXW A;  2UY8 A;  3DYP A;  3B7M A;  3JBG 2;  3MV0 1;  4NUB A;  4RN5 A;  5GM0 A;  1HQW A;  4DIN B;  4ONU A;  5J98 B;  5J1X A;  4AZZ A;  3WNN A;  3PU3 A;  1NY7 2;  4Q4V 2;  3N35 A;  2QQN A;  5F3E A;  5J3U A;  1LKN A;  1JW6 A;  2JE8 A;  3W9A A;  1U12 A;  2ZGK A;  1VBB 1;  4KWK A;  3O1U A;  3NST A;  3SCH A;  1VRH 2;  3OJB A;  3K46 A;  3OPW A;  3WX5 A;  5FMO L;  4LQR A;  2Q8C A;  2HYK A;  2AEN A;  1CAX B;  4GB3 1;  3ZMO A;  4EWE A;  3GYD A;  3O1R A;  1ZNP A;  5FZ0 A;  5A3T A;  1RUF 2;  3AFK A;  2AR6 A;  1WCU A;  4PBO A;  5CVR A;  2O1Q A;  3N9P A;  4LOT A;  1J3P A;  4A7K A;  2WFF 2;  2GP5 A;  1A8D A;  1O3R A;  3DF0 A;  3PTR B;  2C6S A;  3ACH A;  2XJQ A;  4IE0 A;  2BUK A;  2SBA A;  3SEE A;  4LLO A;  2JDM A;  3HN1 A;  1WMX A;  4IGP A;  4AEM A;  1RED A;  3GJA A;  4Y22 B;  3ZPO A;  3MIF A;  3ABZ A;  5DZE A;  5A6Z A;  4XJ9 A;  4QX1 A;  4PHZ A;  1FAT A;  3KVB A;  2JDU A;  3ZSL A;  3TN9 3;  3VKN A;  3POS A;  2GNB A;  4XAB A;  1B35 A;  1VBC 3;  3H3Z A;  2GC0 A;  1OF3 A;  1AVB A;  1S2E A;  2ZGM A;  4HBN A;  4Q26 A;  4AAX A;  4BE3 A;  4CXY A;  5JZG C;  3VDC A;  3POE A;  1DGR N;  4Y1Z A;  3M2M A;  3BCW A;  3MI8 A;  4P9Y A;  1PGW 2;  5JLV A;  2ZAH A;  2PHT A;  3I97 A;  2WNV B;  4GH4 C;  4XHX A;  3VHR A;  2XPJ A;  3WHU A;  4LBO A;  1FI2 A;  1HRV 1;  2GME A;  1PNG A;  3NW4 A;  3ZN6 A;  1OUX A;  4DRV A;  1OLM A;  3ZYR A;  4RSU A;  1ND3 A;  2BNO A;  3DKQ A;  4CSW A;  1KFU L;  1CON A;  3I4I A;  3VBR B;  3ZX7 A;  5C9A B;  4CXX A;  4AFD A;  5DUX A;  3TEZ A;  3PUS A;  5IAX A;  5FPZ A;  5C8C A;  2VNG A;  1CES A;  2WNU B;  3T0A A;  5BNN B;  4FTS A;  5CFC B;  4XFB A;  2C1F A;  1MS0 A;  2FDK A;  1W6P B;  4AED B;  3USU B;  5HPO A;  1O91 A;  2QDR A;  1R1Z A;  2WYS A;  3FLR A;  4BB3 A;  1E5H A;  3WP5 A;  1Z7S 2;  3C2U A;  4KH9 A;  5C9A A;  2VU9 A;  3KCX A;  1MS3 A;  2ZHN A;  4AK3 A;  3EQE A;  2HWF 2;  2K46 A;  2YG0 A;  2E33 A;  4YZ5 A;  2EXK A;  2HWE 2;  3MIC A;  2XDV A;  4AED A;  5KC6 A;  4QQL A;  3WY6 A;  3UGH A;  1YI9 A;  4LE4 A;  1H0B A;  3HD8 B;  2FMY A;  1AXY A;  3ZOI A;  5JSO A;  4BLI A;  1H2M A;  4FFF A;  3W5M A;  1L3J A;  3ZSM A;  2QNK A;  1S55 A;  3W21 A;  2D5F A;  4UXA A;  4Y1Y A;  1RUE 2;  2FDG A;  1CAV A;  2YPJ A;  4MSV A;  1IPK A;  1YWK A;  5CKM A;  2WBK A;  1A6C A;  2LAL A;  2C9K A;  2PN5 A;  3NV4 A;  1PZ7 A;  2QTW B;  3MW4 A;  3OPZ A;  3ZR6 A;  2H0B A;  4CDX B;  1CN1 A;  1REF A;  3WF2 A;  4R9C A;  3ZPY A;  1UO9 A;  1RVF 3;  1SFP A;  2PYT A;  3TN9 1;  1LED A;  4Y20 B;  4IE4 A;  2DCJ A;  1VBC 1;  4WVZ A;  5HCB A;  5M0T A;  1UZZ A;  4WZF A;  4QX5 A;  4GWN A;  1W2U A;  4CU7 A;  1BMV 2;  4K8F A;  4R4Z A;  1ZA7 A;  5LWB A;  2VJX A;  1XNA A;  2LUW A;  4QWN A;  4HN0 A;  2C4X A;  4HVO A;  1RUO A;  2J1T A;  5EJ3 A;  1S1A A;  2ZEZ A;  4LHS A;  3KCC A;  1OXC A;  1AR7 2;  2D43 A;  2JDA A;  3GBG A;  2CL2 A;  1AR8 2;  1PX3 A;  1F8V A;  1ZBE 3;  5A1A A;  4M0N A;  3J9S A;  4QPI B;  4RS5 B;  1LHW A;  1YC6 1;  3X29 B;  4N7U A;  3WLU A;  1LUL A;  1W6Q A;  4NRM A;  1XE8 A;  4FPY A;  4PI0 A;  4YPJ A;  3T4H B;  2ARC A;  4OUS A;  2ZAB A;  1UMI A;  4LNV A;  2R1B A;  1G9A A;  2WR9 A;  5BV6 A;  2RDN A;  3VBF A;  3GF6 A;  5FQ0 B;  3K51 A;  3VZK A;  3WF1 A;  2B8M A;  5IVC A;  5FYB A;  4XMI A;  5BNO B;  1HN1 A;  3OOX A;  4OUM A;  4C90 A;  1HB4 A;  3N4M A;  4UBH A;  3WG4 A;  4YGC A;  3VHP A;  4QMA A;  1ZRR A;  3CDZ B;  4XJ8 A;  3ZXK A;  1IGO A;  1MS8 A;  2PAM A;  5APA A;  3DGT A;  1UKG A;  2B4K A;  3ASI A;  1AX1 A;  4QQ2 A;  2Q8E A;  2ARX A;  3WNM A;  4P02 B;  1MPX A;  2WNU C;  2Y0I A;  1G86 A;  5BNN C;  4MGT A;  5K0U C;  1NQJ A;  2PTM A;  1RC6 A;  3ENR A;  4XJW A;  1MAC A;  1HX6 A;  1DGW A;  1NCR C;  2RS1 3;  2XOM A;  3FHQ A;  3J26 N;  3J7H A;  3EBR A;  1W9F A;  4PLN A;  4RL7 A;  5EYY A;  5L9R A;  2PLV 2;  4MX3 A;  4U36 A;  1NAE A;  5CEH A;  3GHN A;  2RR1 2;  4CCN A;  2WT2 A;  1V00 A;  2VM9 A;  1EAH 3;  5A7N A;  4DQA A;  5J37 A;  1J58 A;  1ODM A;  2OYZ A;  3WDW A;  4L8Q A;  5FYI A;  4XDQ A;  4XPV A;  5ABJ A;  4MOA A;  5T50 A;  3S5Q A;  1H1M A;  1RVF 1;  2YU2 A;  3ACI A;  3E5Q A;  3KV6 A;  4FO9 A;  3AP6 A;  5FXW A;  4AGR A;  2P2K A;  4DXZ A;  1C5I A;  3VDD B;  5KR7 A;  3ACL A;  2VUA A;  2CGP A;  5IVJ A;  3AP5 A;  3MEP A;  1WLW A;  1W0O A;  4CP9 A;  5FMC A;  3D0S A;  4P9W A;  3B5L B;  4XUP A;  4BHP A;  4IV3 A;  4CDX C;  2OVU A;  3MID A;  2CSG A;  1W9W A;  1MQT B;  4K21 A;  2WYF A;  1RUI 2;  5FZB A;  4YW5 A;  1K5M A;  4Y3O A;  2ZGO A;  3ZKY A;  1URX A;  5B4X A;  2IZW A;  1PVC 3;  2W91 A;  1Z78 A;  1W2A X;  3MIH A;  2HLE A;  3WT3 A;  1ZBE 1;  3VDD A;  3KZ4 C;  3ZLI A;  3U10 A;  2LW8 A;  5LRR A;  2VL4 A;  4AFC A;  4BPZ A;  4XFC A;  4Z1V A;  1W06 A;  3A23 A;  4XFA A;  4QX3 A;  1OD5 A;  2I74 A;  4UYB A;  1MQT A;  2PEL A;  4FAH A;  1H8V A;  1PHM A;  2CNA A;  2X09 A;  2W1S A;  5FUN A;  1H6Y A;  1AL2 3;  3LZZ A;  1ZM1 A;  4CU8 A;  3GXU A;  2JG9 A;  2W92 A;  1OBN A;  2ZX1 A;  3BOD A;  4K9S A;  4RS5 C;  3WP3 A;  4IE6 A;  2GAU A;  1HDK A;  4OCT A;  4XXA A;  4BQX A;  1GWK A;  2O8O A;  1S0E A;  1O5U A;  3ACF A;  3OBA A;  4LO8 A;  1YO8 A;  4M3C B;  4RGG A;  2P1B A;  3OUJ A;  2R06 3;  4RHV 3;  4CCM A;  1O4Y A;  1V9U 3;  1VAK A;  3AXD A;  1E5R A;  5FYT A;  3B94 A;  4OZX A;  2N7G A;  4QXC A;  3RSJ A;  4IE5 A;  4CDW B;  4N43 C;  4DMI A;  1RHI 3;  5BNO C;  3PJQ A;  3CKH A;  2RS1 1;  2WZR 3;  1AJO A;  1UU6 A;  4P9G A;  1R1A 2;  4HMZ A;  2XBO 1;  2VCM A;  1CZT A;  1EAH 1;  3HPN A;  2WUH A;  4QXK A;  5DUV A;  2R1D A;  2ZGS A;  4W8J A;  1RUC 3;  4IES A;  3C7G A;  2FDI A;  4N8M A;  4XUQ A;  4PIZ A;  1JYW A;  5I0S A;  5LBF A;  5GZG A;  4YGB A;  5GLZ A;  2PXJ A;  4I0A A;  3III A;  1PZ9 A;  1NLS A;  5T5P A;  4AF9 A;  1IZ3 A;  5JWP A;  3JZV A;  2GMM A;  3LFI A;  1BYH A;  3MLK A;  2G1M A;  2TEP A;  2WS9 2;  1OHF A;  4TLG A;  4MH0 E;  3WZ1 A;  4AL9 A;  2FBE A;  2CTV A;  4RQP B;  1BXH A;  1WMF A;  2Z5W A;  4DOU A;  3WW3 A;  5EJ1 B;  1NOV A;  1I3H A;  2QZ3 A;  2R04 3;  3WF3 A;  1ST8 A;  4YVS B;  3RWK X;  1G9D A;  1OKQ A;  2CGO A;  3B3Q E;  1ULO A;  4IND A;  1J59 A;  1DQ5 A;  2GZW A;  3POI A;  2JX9 A;  1H6X A;  1PVC 1;  2XVL A;  3KGL A;  2G9G A;  3OGG A;  1FV3 A;  2RHP A;  1DU3 D;  3INA A;  4KBB A;  2DCZ A;  3FMG A;  5F8P A;  2VCC A;  5FY7 A;  4OQ9 A;  3ZFG B;  1UPS A;  4K1Z A;  4QPG B;  5FPU A;  4XTM A;  3N9M A;  3SCG A;  1BEV 2;  1JU4 A;  4O9E A;  2PHF A;  4HSJ A;  2WLQ A;  3ZFE B;  1AYM 2;  3H8U A;  2WIN B;  3BAL A;  4XQ4 A;  3U1X A;  1U0A A;  3LOB A;  2DVB A;  1AL2 1;  1ENR A;  3I59 A;  1YJL A;  5FTT C;  5FZF A;  5ACA 3;  2B9U A;  2W46 A;  3CEW A;  2PMW B;  2ERF A;  2ZEY A;  5BNP B;  3K3N A;  4W50 A;  1X33 A;  2FMD A;  3I2I A;  1HW5 A;  3WNP A;  2A6W A;  3WNO A;  2GNM A;  2R06 1;  1NXM A;  1O6U A;  3AZZ A;  4RHV 1;  1V9U 1;  4S2F A;  3UET A;  2EIC A;  4CUC A;  1G9F A;  2IWG B;  2G4I A;  4OZO A;  2Y6F A;  5D8A C;  3HR9 A;  4PQQ A;  4FSJ A;  1RHI 1;  1SG3 A;  3A7Q A;  5FKC A;  3ME2 A;  2WZR 1;  4PLM A;  3ZR5 A;  5GLV A;  3EB7 A;  1DZT A;  3UL2 A;  1VMJ A;  1LNS A;  3PLQ A;  1OF4 A;  1UXX X;  5L7O B;  1IOA A;  1FMD 3;  1DZR A;  4LIU A;  4JKK A;  3S6P A;  4ORF A;  1RUC 1;  4EE2 A;  1H2K A;  4CDW C;  4HOO A;  1OD3 A;  3RMX A;  3KLS A;  1RUG 2;  5AC9 3;  4R52 A;  1GWL A;  3PVE A;  4XJU A;  3VHN A;  3C7H A;  4JDM A;  2ZGP A;  4Q4W 2;  3GZU C;  4PCR A;  3WF4 A;  3LA3 A;  5KXB A;  5L7O A;  2OX0 A;  3T30 A;  1LEM A;  1QNW A;  3ZXE A;  1VAV A;  2B39 A;  2PHX A;  5GZD A;  3J8F 3;  3UES A;  4NOT A;  5A7P A;  1MZ6 A;  3LWC A;  1ACC A;  3POB A;  3IMN A;  1PX4 A;  3MPB A;  3T08 A;  2R04 1;  3ILN A;  1X82 A;  2EF6 A;  3VHO A;  3ZIX A;  4C0B A;  2ZHK A;  4H2A A;  2H0V A;  4LKD A;  3AC0 A;  4ATE A;  5T54 A;  5FZA A;  3ES4 A;  4ZS2 A;  2A1X A;  2VMI A;  4TXW A;  2PA7 A;  4FPK A;  1NE4 A;  2OZ6 A;  5CG8 A;  3PUR A;  4QQH A;  2D5H A;  1N3Q A;  2ZMK A;  1W99 A;  1RMU 2;  5F32 A;  4FPE A;  1DQ6 A;  4UFJ A;  1XE0 A;  1VAL A;  5T55 A;  1OFN A;  1VB2 A;  3WXP A;  2BBA A;  2ZZJ A;  3E97 A;  4YVS C;  5DPN A;  3CNA A;  4Q27 A;  4Q4Y 3;  4Q5O A;  2JE7 A;  3O0X A;  2VXR A;  2EIB A;  3DL3 A;  4QKB A;  2ILM A;  3UJQ A;  1QJY 2;  5ACA 1;  3O0V A;  2RVA A;  5FYU A;  2QQP A;  2VGD A;  3POW A;  2YFU A;  4L0P A;  4PT6 A;  2KA3 A;  2E6V A;  5A70 A;  3WHT A;  4XF3 A;  1M4W A;  1WW7 A;  3KS7 A;  4IEP A;  2IXJ A;  5F2S A;  3VZO A;  4GZ9 A;  3HNB M;  4DEV A;  1XRU A;  1DLL A;  2BZD A;  3ETQ A;  3K75 B;  5A3M A;  4ISQ A;  4QPW A;  3ZFE C;  3I49 A;  3O1T A;  1PK6 B;  4WV8 A;  1DQ1 A;  5BNP C;  1J1L A;  3I2H A;  1E5S A;  1OH3 A;  1G7Y A;  2XB6 C;  1C28 A;  4OI0 A;  4FXG B;  3CHX A;  5FYY A;  3CIH A;  5CFD A;  4WM8 B;  2ZX0 A;  5LBC A;  1XXN A;  1FMD 1;  4PJY A;  1Y7B A;  3PVN A;  3RYK A;  2XKP A;  4GMP 0;  2D3S A;  2YBK A;  4NRQ A;  1CAW B;  1B09 A;  2MHF A;  5EYX A;  5GZC A;  3M3C A;  3TBD A;  4ES9 A;  5AC9 1;  4JGY B;  4C1X A;  1DZQ A;  3DV8 A;  3GCW A;  1XNT A;  4AQ2 A;  3DXT A;  1HRI 2;  3AXE A;  2LTN A;  4DB5 A;  4E2G A;  1NX9 A;  1PO2 2;  2K0G A;  3QH6 A;  2EXJ A;  2FCU A;  4QT6 A;  3VD7 A;  1R08 3;  1KS4 A;  1SPP A;  3CO2 A;  4I30 A;  4Q1P A;  1PO1 3;  4F7Z A;  2KXL A;  1W9S A;  2C9A A;  4DO0 A;  5C4W C;  1HB1 A;  5EV7 A;  1UWW A;  4BIO A;  3FUQ A;  4NIA A;  4F8A A;  1BVP 1;  2WQZ C;  1SCS A;  5DMY A;  3OB8 A;  2FDH A;  3P5B A;  4Y5S A;  2VZV A;  2HWB 2;  1UX6 A;  2ZCW A;  1LJ7 A;  4KU7 A;  1GQH A;  5F3I A;  3BVC A;  4RFT 0;  3ZSK A;  3OYW B;  5FBZ A;  1DYK A;  5T5O A;  3MUY 1;  1QJF A;  3OBZ A;  1YI7 A;  5DG2 A;  4XFI A;  1EYB A;  4AOC A;  4QU1 A;  3WQB A;  1CR7 A;  3B69 A;  4IQP A;  3KGZ A;  1RIR A;  1C4R A;  2OPK A;  2VH9 A;  4JTO A;  5FMB A;  5JXI A;  3MHZ A;  2DU1 A;  4YW7 A;  4BQ4 A;  3OD0 A;  4Q4Y 1;  1VPH A;  4XMA A;  3AK0 A;  3LB9 A;  4FPG A;  2Q8D A;  5C33 A;  4JHT A;  3WNK A;  5LEK A;  1Q56 A;  5CKN A;  2XQR A;  1Q8Q A;  2O0O A;  1LAJ A;  1VRB A;  1C5H A;  2PHR A;  3BIW E;  3LDB A;  4D8M A;  1COV 3;  2FDF A;  1SBD A;  1CIY A;  4Y4Y A;  1AYN 3;  3AZW A;  3VLB B;  2CY6 A;  3Q8E A;  4UFM A;  2VMG A;  3H50 A;  4LBN A;  3EO6 A;  4L99 A;  2Y6K A;  4ZPI A;  1WLT A;  3DXU A;  2RDS A;  4KWU A;  4OI1 A;  3SLI A;  4F83 A;  5HBA A;  3TEY A;  1D4M 3;  4LXL A;  3KM5 A;  4XF9 A;  5GAL A;  1DCS A;  4QM8 A;  1PM7 A;  1RGS A;  2P3K A;  4YW4 A;  4FOW A;  3WG2 A;  3CQO A;  3SH3 A;  3QAC A;  4PIY A;  4FP3 A;  1GOH A;  2PQQ A;  3DEM A;  4I02 A;  1PK6 C;  5A6X A;  4IV1 C;  2AGS A;  3LEM A;  3LDK A;  3KD4 A;  2QQK A;  3WVJ A;  5I8T A;  5G04 L;  2VQ0 A;  4L11 A;  3DPR B;  4K1Y A;  4Q0V A;  1H8T B;  2ID4 A;  1VBA 2;  4KNC A;  3RJ2 X;  1IS6 A;  4QAW A;  2XXZ A;  1K3I A;  1VBD 2;  1N1T A;  1N1S A;  1ODN A;  2ZAC A;  1R08 1;  4K6B A;  5DN2 A;  5H9P A;  4BA6 A;  4AEJ A;  3T1M A;  4WM7 B;  3V0B A;  1RIN A;  2V4A A;  1V6O A;  1PO1 1;  3M3Q A;  1UYX A;  1X8E A;  2ZKL A;  3I2O A;  1ZBA 2;  4Q0P A;  1YQ6 A;  1VP6 A;  2HWC 3;  5A7W B;  2WJS A;  3RI8 A;  1G8W A;  2Q1Z B;  5D1I A;  1MZF A;  5FWE A;  1JMU B;  2XJU A;  4Y33 A;  4AI8 A;  1QKQ A;  2DU0 A;  3CL1 A;  1CAU B;  4PI2 A;  1MVE A;  3NAP B;  4K40 A;  4E2S A;  1QJU 2;  1HXS 3;  5B2G B;  3KV9 A;  4Q2F A;  1W8Z A;  1DHK B;  1HV1 A;  2OUJ A;  3FBM A;  3WG3 A;  1UY2 A;  2DTY A;  1JZ7 A;  3NQH A;  3C8X A;  1NA1 C;  1R09 3;  2WAA A;  5CZK A;  3ALQ A;  5FZM A;  1S0F A;  5FYV A;  3ZO0 B;  4AI2 A;  4H14 A;  2Z79 A;  3I7D A;  1CAU A;  1POQ A;  3BB6 A;  3MW3 A;  4HKO A;  4D0Q A;  4NRO A;  1UXZ A;  1LHU A;  1J1T A;  1CPN A;  1AHS A;  1OUR A;  2NM1 A;  2UY9 A;  2SLI A;  3TWI A;  1XNC A;  3S30 A;  2VBD A;  4DIQ A;  5C6C A;  1ZRC A;  4MO3 M;  2TNF A;  1COV 1;  2WFP A;  3IPV A;  3SXW A;  1WCS A;  2IXL A;  1BCX A;  1AYN 1;  3NVC A;  1SBE A;  2HWD 3;  4Q0S A;  5KC5 A;  1OA4 A;  4XAE A;  4JRL A;  4KL1 A;  5JIA A;  4QDR A;  1POV 3;  4GA9 A;  2YC0 A;  4XAA A;  3HN3 A;  4CEY A;  1TMF 2;  1D4M 1;  2VTX A;  3OSD A;  1RXG A;  1PMJ X;  2DYC A;  3AYC A;  4I09 A;  4O65 A;  4QKF A;  3CJI A;  1JYX A;  3ES1 A;  4GWM A;  2VBB A;  3POF A;  1JZ3 A;  5FK8 A;  3WQ0 A;  2D44 A;  2ZMN A;  1GZT A;  1VBE 2;  2B9V A;  4XAC A;  4MXV A;  4CDU A;  1LOF A;  5FZL A;  1GP6 A;  1W9T A;  2ARA A;  3JD7 2;  4LO6 B;  4MUV A;  1AR6 2;  3IDC B;  3PUI A;  4MGI E;  1ULD A;  2E63 A;  3BKZ A;  4GKY A;  4KG0 A;  5GZF A;  1DLC A;  2XUM A;  2UWA A;  2GU9 A;  3KQ4 B;  2JDK A;  3NKG A;  4RFR B;  3N3H A;  4XUN A;  3MW2 A;  1PGS A;  3D5O A;  5FRA A;  3I2D A;  2RS5 3;  4NWV A;  5A32 B;  2D6L X;  2ZGR A;  4LBJ A;  4HKL A;  3QOP A;  4DXR A;  3MZH A;  1QIQ A;  4TZD A;  4G3Y C;  4PIX A;  4HKW A;  3GZE A;  3SKV A;  2IVI B;  3GCX A;  4LOS A;  4Y26 A;  3THD A;  1I5Z A;  3THC A;  3FE5 A;  3UJO A;  1OLQ A;  1OMI A;  2HWC 1;  1L7Q A;  4D6S A;  1OA2 A;  3DPR C;  1NQD A;  3K77 A;  4CPB D;  1H8T C;  4RR3 A;  5K8S A;  1IKQ A;  2RDR A;  3T09 A;  2WC2 A;  1YCI A;  4YG0 A;  3T1L A;  2FZ1 A;  1HIX A;  2QQL A;  3NJZ A;  1ND2 A;  4WM7 C;  4E4D X;  2VMD A;  1HQN A;  2ET1 A;  1HXS 1;  5F37 A;  4IGQ A;  5J7M A;  1IPS A;  4CYD A;  1VRH 3;  3TB0 A;  1EPZ A;  5IYY A;  3W58 A;  1Q3E A;  2QFE A;  1R09 1;  1NT0 A;  3OG2 A;  5I0R A;  1DGL A;  4EN8 B;  2ZX3 A;  3NAP C;  2A6V A;  1G9B A;  4WZC A;  3VBH C;  1ZRF A;  4HPK A;  5KHI A;  3CZJ A;  5JI9 A;  5FMD A;  4GH4 A;  3RYR A;  2W1Q A;  1IKP A;  5HXM A;  4P5Y A;  2R32 A;  2OA2 A;  3V56 A;  3CU7 A;  4I01 A;  4BQ5 A;  5K4L A;  1QJX 2;  4B4R A;  4AR2 A;  3KQR A;  3KSC A;  2QQU A;  4Q0Q A;  4A4A A;  3URF A;  2HWD 1;  3ZXJ A;  2JG8 C;  3AM2 A;  4MLO A;  4HK8 A;  4XIO A;  2NP0 A;  4D6R A;  1POV 1;  2WWJ A;  4P9J A;  3ILR A;  2B5H A;  2W68 A;  1QNY A;  1WBF A;  4LA3 A;  5DAP A;  3TNQ A;  3N9O A;  2RJ2 A;  3GZT B;  2X5I C;  5KHK A;  1OC1 A;  2XVK A;  1DP0 A;  5FZ3 A;  1C57 A;  4KBZ A;  1B35 B;  2WSU A;  5GKA C;  1A34 A;  5FY4 A;  3APB A;  2RM2 2;  2ZBJ A;  3PL0 A;  4O9G A;  2BNM A;  2E7A A;  4FI9 A;  3B01 A;  4I3P A;  4AI9 A;  4COW A;  2WT0 A;  2KM2 A;  2JJ6 A;  1WA6 X;  1V70 A;  3KT1 A;  3LEK A;  3FC0 A;  1APN A;  1SBF A;  2VAU A;  3GJB A;  2GH2 A;  3JU9 A;  3QD6 A;  1UD1 A;  4IEO A;  2BJS A;  5JPN B;  2RS5 1;  4IEZ A;  4A45 A;  5HCH A;  2NZ9 A;  3VBO C;  1X36 A;  3U0Z A;  3ZN6 B;  2XLA A;  4IEW A;  4PQ9 A;  5I0T A;  3AKR A;  2W94 A;  3IN9 A;  3D8C A;  5T3N A;  2AZ5 A;  1ND3 B;  2CHH A;  4LO4 B;  4HLT A;  4MXW A;  4R9D A;  4D7S A;  3Q8C A;  3I3E A;  1JZ8 A;  4IET A;  2Y8K A;  3H8R A;  3I2F A;  1NY7 1;  5GLU A;  5C8C B;  2R07 3;  4UW6 A;  3U14 A;  2JWP A;  4IER A;  1W04 A;  5KXD A;  1XPW A;  1GQP A;  2BRT A;  2XH6 A;  4C91 A;  4E27 A;  4NN0 A;  1A3K A;  1VRH 1;  1Z7S 3;  1XOY A;  2LS6 A;  1ZZ9 A;  4YFW A;  5F5Q A;  2VCA A;  4CCJ A;  4SBV A;  2F4L A;  5A6Y A;  3AJY A;  4UFK A;  3L2Y A;  1NKG A;  5IVV A;  4MGK E;  2BFU S;  1JYI A;  4C1W A;  4BXF A;  5F7U A;  4PDW C;  5L9V A;  2E53 A;  2PHW A;  1KJL A;  1TQ5 A;  4L92 A;  3SKJ E;  1W8F A;  2Q30 A;  3TN9 2;  3AJZ A;  1BBT 2;  1VBC 2;  1FPN 3;  4YVW A;  3FFQ A;  3QBQ A;  4LBQ D;  4XC9 A;  4QD2 A;  1PIV 2;  1CJD A;  4BQ1 A;  1UOF A;  3IDA A;  4HVR A;  4P9X A;  1CAV B;  2VTF A;  2GP3 A;  3J4U H;  3T2P A;  4CCO A;  2HEW F;  4NRP A;  5EJZ B;  1V6N A;  1QWR A;  1S0B A;  3O5S A;  1OQD A;  1V6L A;  2BYV E;  3LAG A;  2QJV A;  2DCY A;  3OGS A;  3WW1 A;  2BBV A;  3ZYJ B;  4XW3 A;  3RWN A;  3O1S A;  1W8H A;  4ZU4 A;  4R8H A;  2WA4 A;  4XBN A;  2BNN A;  1PGW 1;  2P4E A;  5I91 A;  1AR7 3;  4QKN A;  1LRH A;  5K0U A;  1REE A;  3WSO A;  3WDV A;  1XE7 A;  1W28 A;  2GN7 A;  4RD7 A;  1OVS A;  2VZP A;  1GU3 A;  1NCR A;  2ENR A;  5FYS A;  1B35 C;  1HN0 A;  3FUO A;  1H4G A;  4FPL A;  4NHL A;  3WD5 A;  3ECQ A;  4BQW A;  3AYD A;  2TUN A;  1MR5 A;  2E26 A;  1WW5 A;  1G6N A;  1D0H A;  1W90 A;  2R7E B;  2E9Q A;  4QXH A;  3VD5 A;  3F2Z A;  1W6Q B;  5L36 A;  1CJP A;  3SIS A;  2ZS6 B;  4KU8 A;  1UCX A;  3V0A A;  3ITQ A;  5D21 A;  3Q8B A;  1UY4 A;  3AYE A;  3SCF A;  3VBF B;  5LW9 A;  2R49 A;  4GUL A;  2R07 1;  4QX7 A;  3WUC A;  2GDF A;  5A7O A;  1AJK A;  3HVD A;  4BJ0 A;  4EQV A;  1IG3 A;  4IEY A;  1HJG A;  1V6J A;  4M4P A;  3T3Y A;  5FIX A;  4PF1 A;  4CP0 A;  3VDA A;  5CAD A;  3NV3 A;  1UU5 A;  1XNB A;  1Z7S 1;  1QMJ A;  3ZSJ A;  1SAC A;  4COV A;  4YG6 A;  1NE6 A;  2NLR A;  1NYW A;  3WP4 A;  5I93 A;  2WNV C;  1EUU A;  2HWE 1;  1YFW A;  2ZGN A;  3LE0 A;  5JSR A;  5C8C C;  2VUC A;  1YQC A;  3WQ7 A;  3DUI A;  1WWY A;  3IKW A;  1YQ8 A;  3AKS A;  2ADE A;  3VD3 A;  1OH4 A;  1W3X A;  2YB7 A;  3VN4 A;  2ZHL A;  3VBR C;  5C9A C;  1EP0 A;  2E32 A;  1SFN A;  4I0W B;  1FPN 1;  4AXO A;  1UX7 A;  4LK7 A;  2Q0A A;  2Q1F A;  1FV2 A;  1XYN A;  4K7J A;  2BWA A;  1UF2 C;  5IWF A;  1OFS A;  1WCQ A;  2A6Y A;  2VMF A;  5CFC C;  1ZA4 A;  4NPM A;  5GJ6 A;  4AED C;  4B1M A;  1JZ4 A;  1LES A;  1ULE A;  5J96 B;  2OQ6 A;  1WD3 A;  4MGY E;  3AL6 A;  4LO5 B;  1TNF A;  4M4R A;  5IW0 A;  2HBU A;  2VY0 A;  3C7F A;  2OKX A;  4A7Z A;  5ABJ B;  5IK7 A;  3ZXA C;  5C3R A;  3OF1 A;  4NPL A;  1QJE A;  2RE9 A;  4HL0 A;  4XEZ A;  3ZKU A;  1ZBE 2;  2XBO 3;  1HKD A;  1JZ6 A;  2A6X A;  3H1M A;  3LA2 A;  1UYZ A;  4JZR A;  1JTZ X;  1DF0 A;  1W8N A;  4CP9 B;  2Y60 A;  2RJK A;  5C3Q A;  2AAC A;  4DUX A;  1KGY A;  1KIT A;  1RL3 A;  2J7M A;  3P6B A;  4IV3 B;  4TSV A;  1AR7 1;  4YNI A;  1S0J A;  1H30 A;  1K5M B;  4Y1X A;  4QB2 A;  1LTE A;  1AR8 1;  2ZEX A;  2W52 A;  3ZIW A;  5C3O A;  5CNA A;  3HQX A;  5AVP A;  2D98 A;  1KXG A;  4AVT A;  4NE9 A;  3OGV A;  1F2N A;  3AZY A;  3PMS A;  4NVP A;  5FP3 A;  3HAG A;  2JB4 A;  4GAL A;  4OHV A;  1KDM A;  1SCR A;  4AVV A;  1JOB A;  5KXC A;  5JUV A;  5EPA A;  3Q8A A;  5T5L A;  4BDV B;  2Y64 A;  3NNF A;  4ERO A;  4TLF A;  4Y24 A;  3IT8 A;  3B93 A;  5A3N A;  2MPF A;  4OFG A;  3RQ0 A;  1QF3 A;  2RS1 2;  2XHK A;  1SLC A;  3Q9O A;  1DGR A;  4AVA A;  1US2 A;  4P9L A;  2JG9 B;  4CUG A;  3UNP A;  3JQX A;  1QXJ A;  4YLZ A;  4BLJ A;  4IGO A;  1JYT A;  1GZ9 A;  1UOB A;  3AZX A;  3I2G A;  1TNR A;  2WO2 A;  4JAA A;  4MZU A;  5CB7 A;  1D2S A;  3EHK A;  3VD9 A;  5A33 A;  2A73 B;  3HBZ A;  5FWJ A;  5C3P A;  2VME A;  2OXB A;  5ANN A;  1TG7 A;  2QQW A;  4QPI C;  2Y26 A;  4QU2 A;  2JDY A;  2D93 A;  2MNG A;  5FZD A;  1C8N A;  1GYK A;  1SMV A;  3MF9 A;  5DAV A;  2UWC A;  1R1A 3;  1ENX A;  4FPC A;  3VZL A;  4LOR A;  4YM3 A;  5D2A A;  3I8T A;  3RZH A;  3HQR A;  4XUO A;  2HJI A;  3K2O A;  1QQP 2;  4OHX A;  1US3 A;  5E1R A;  4OI2 A;  2VTX J;  2DFC A;  2J1S A;  3AMN A;  4LKS A;  1OSG A;  5SV8 A;  3RPQ A;  3I2J A;  3W59 A;  4MHU A;  1NCQ A;  4H7L A;  5F5I A;  1RIT A;  2EVX A;  1W8O A;  5LK5 A;  5LEJ A;  5LZ6 A;  1LOG A;  5JVV A;  2QQV A;  2WS9 3;  4MAD A;  4XCA A;  2WN2 A;  3FLP A;  3ZYH A;  4A7Y A;  1O4T A;  2A7A A;  2BVB A;  5A3U A;  3H8X A;  3UK9 A;  1MS1 A;  3GHM A;  4XXP A;  5FK7 A;  1RUI 1;  4EZ4 A;  2W5F A;  2VOV A;  2VW2 A;  3ZVX A;  5CIR A;  3EXU A;  1AL2 2;  5D8A A;  3CZU A;  2AC1 A;  2VQT A;  3FJS A;  4W4Z A;  3JQW A;  4L97 A;  5F9T A;  2ZJC A;  4NJ4 A;  3IIA A;  3IMM A;  1OKO A;  4IEV A;  5BYN A;  2VUJ A;  5J09 A;  1WKY A;  4DXS A;  2E51 A;  3U75 A;  2R06 2;  4RHV 2;  4XCB A;  4IV3 C;  1BEV 3;  1GZW A;  2FDJ A;  5I8S A;  2CU5 A;  2VXJ A;  5FZ4 A;  5H9S A;  1AYM 3;  3P3N A;  4FBF A;  2LM3 A;  3EJK A;  1PGL 2;  1LOE A;  4EYU A;  4FQZ A;  3N7J A;  3VDD C;  3I59 B;  4B3N A;  5IAT A;  3RZJ A;  5L73 A;  2RMU 3;  3WUD A;  5FOB B;  2CGN A;  5FYZ A;  2YHJ A;  4QX8 A;  2CV6 A;  3NMB A;  4NIG A;  3VBU A;  1OI6 A;  1MQT C;  2V09 A;  5SV5 A;  1GR3 A;  4M0H A;  3LQC A;  3H1W A;  4LBL A;  4XET A;  5LAT A;  1QU0 A;  4HVQ A;  1YUD A;  3VKL A;  3WCS A;  3LPG A;  5CA6 A;  5F1R A;  1DYO A;  3SNM A;  1CPM A;  3QLQ A;  2ZKN A;  3OD4 A;  2ZXQ A;  1C1L A;  1L7L A;  1R1A 1;  1J83 A;  4P14 A;  1JN2 P;  4QGL A;  1C8M 2;  1HB2 A;  1KD7 A;  3EYP A;  2WZE A;  4IEX A;  1HV0 A;  2XVG A;  3G7D A;  1LHV A;  5FJH A;  5FMO S;  2DUR A;  2P3J A;  2NMN A;  2R04 2;  2DF7 A;  2BTV C;  3DKW A;  3HJR A;  5LY2 A;  3N9L A;  1QH6 A;  2JD9 A;  3KT7 A;  5E8A A;  3BOW A;  3HOB A;  4W6Y A;  1FOD 3;  4AI3 A;  1LR5 A;  2W9X A;  1F31 A;  3HQU A;  3OY8 B;  3D0J A;  3H7J A;  3PUA A;  4H7M A;  4ISR A;  3QH7 A;  4N9H A;  4COZ A;  1QJZ A;  2VMH A;  3RYP A;  2P5B A;  2WS9 1;  2K9Z A;  4QPY A;  1S4C A;  5IAV A;  1OT5 A;  5L19 A;  3WIN E;  2VMC A;  4BME A;  2WA3 A;  3B00 A;  3OBR A;  3AYA A;  4X6Q B;  3KHB A;  1PNF A;  1F35 A;  3C3V A;  2EIG A;  3OY8 A;  1LGN A;  4RGA A;  2BEO A;  1JYC A;  2CAU A;  2WNO A;  4UF0 A;  4B7E A;  5ACA 2;  3R0R A;  5C71 A;  3EMR A;  2XWB B;  3IWZ A;  4AHW A;  2H6C A;  3VL9 A;  1EUT A;  4HK9 A;  3WW2 A;  4FP2 A;  1RMU 3;  4UAP A;  3BI3 A;  1HQL A;  5CAZ A;  2X05 A;  4CCE A;  2VOT A;  1BEV 1;  2C24 A;  5FKB A;  2JDZ A;  5FZ9 A;  2VW1 A;  4CDQ B;  4CP2 A;  1AYM 1;  1FAY A;  3ZYI B;  4N90 A;  3R4U A;  2VO5 A;  4XBQ A;  5A3O A;  4YM1 A;  1QJY 3;  2ATF A;  2Y33 A;  4PF5 A;  1MZ5 A;  1SLT A;  4CZS A;  4Z07 A;  5GLW A;  1VR3 A;  2RMU 1;  1PM4 A;  1TZO A;  3AKQ A;  4RQP C;  2VD7 A;  5F5C A;  2LRP A;  5FLH A;  4COU A;  4D7Y A;  1SQ4 A;  4E2Q A;  3E6B A;  5AFE A;  3RZL A;  3FBY A;  1FMD 2;  3ZFF A;  4AI0 A;  4CDQ A;  4EZH A;  1I6X A;  4LBQ A;  1NZC A;  2UYA A;  5C4W A;  2VQU A;  3WR0 A;  5AC9 2;  1EY2 A;  1GP5 A;  1NG0 A;  4BU2 A;  1Q8P A;  4CTE A;  2IXI A;  3THP A;  2D6M A;  3USS A;  4YRD A;  2VW0 A;  4QDQ A;  5A3W A;  2VZR A;  3ZFG C;  4IDZ A;  4QPG C;  1UU4 A;  3CF6 E;  4N53 A;  4DY3 A;  2HBT A;  5HCA A;  5FY8 A;  4S2G A;  3MF6 A;  4LLF A;  5ERL A;  5CFD B;  1X50 A;  2VVE A;  4Q4X 3;  4EWA A;  2R0H A;  3NJX A;  3J8F 2;  5FXX A;  2XML A;  2ZAA A;  4UW3 A;  4ES8 A;  1N1Y A;  3O1M A;  1IG0 A;  1XBF A;  1T6B X;  2WZ8 A;  4Q4W 1;  4OI4 A;  1HRI 3;  4CEW A;  5LA9 A;  1AXZ A;  1FOD 1;  4D69 A;  4OMC A;  1GWM A;  4YZ1 A;  1EPW A;  3JCI A;  3NWK A;  2JE9 A;  2PAK A;  1SPP B;  2RS3 2;  4X8N A;  4IEQ A;  3RGB A;  4YGE A;  1LEC A;  3I54 A;  5EHD A;  5HV0 A;  2E31 A;  2P17 A;  2VZO A;  3QCW A;  1FXZ A;  2L9L A;  2Q4S A;  1GOG A;  4J6G A;  1OLM E;  4Q4Y 2;  4X8P A;  1DYP A;  5L7O C;  4XF4 A;  2E7Q A;  2DFB A;  1XSR A;  3GAL A;  1QOS A;  1XNK A;  4YM2 A;  4QM9 A;  1W9Y A;  2YC4 A;  4LUM A;  2VE1 A;  2DBI A;  3PNA A;  2C26 A;  1GSL A;  1UY0 A;  1RMU 1;  3J7N A;  1W0P A;  4MG2 A;  5CG9 A;  2YBP A;  1S0C A;  4RA0 A;  2VEC A;  4ZON A;  1K42 A;  4IV1 A;  3NV2 A;  2P37 A;  2B42 B;  2A3W A;  4GQ7 A;  5C3S A;  2PQS A;  1DFQ A;  3VKF C;  5I0D A;  5CBL A;  1RUH 2;  4UFH A;  1ZYB A;  1T6G C;  2JKB A;  1QJY 1;  1XQN A;  3UYJ A;  5FZO A;  1GFF 2;  2YY1 A;  2ETE A;  1QY4 A;  2OQ7 A;  4XF0 A;  3MFC A;  1LOA A;  3LEI A;  3POJ A;  1W03 A;  4V1P A;  4CUA A;  1N47 A;  1ZZ8 A;  1D7P M;  1H9W A;  1SLL A;  1W3V A;  2P34 A;  4OUL A;  5JSP A;  3WCR A;  3A0K A;  1UPI A;  3M8L A;  2QDN A;  3OGR A;  4IUG A;  3PVB B;  2XUE A;  5FP8 A;  3MFA A;  3IDE A;  4BOW A;  3RZZ A;  5FZ1 A;  1WMD A;  3TNP B;  5IVF A;  1POV 0;  1LB2 A;  3U07 A;  2AEZ A;  4M3C F;  3FHI B;  3KB5 A;  3B9C A;  5GZE A;  5FFO C;  1K45 A;  5A1L A;  5FY9 A;  1CVN A;  2VBP A;  4YSF A;  1F9K A;  2YZ4 A;  4AWD A;  4LMF A;  3SHR A;  1W6N A;  2ORZ A;  3MLL A;  4LA2 A;  2ARE A;  2WLP A;  2WDB A;  1AX0 A;  4Q4X 1;  1MEC 2;  1TE1 B;  4DY5 A;  1CGP A;  1X7N A;  3ROU A;  5L9B A;  2A70 A;  4R9A A;  5FR3 A;  4LT5 A;  2WWU A;  2ZX2 A;  4YGD A;  1HRI 1;  1O59 A;  2IC1 A;  4UW4 A;  1S2K A;  3GDB A;  1VBA 3;  1PO2 1;  1VJ2 A;  2HEV F;  2PHD A;  4IXL A;  5JMC A;  4XQW A;  1VBD 3;  4JGZ A;  3OUI A;  1VB4 A;  3UKT A;  1FX5 A;  3PDQ A;  5F3G A;  5CIS A;  3AX4 A;  3T4V A;  5JOY A;  2V5D A;  3V0B B;  3MIG A;  2Z2S B;  3SH5 A;  1CX4 A;  1YNA A;  5DDJ 2;  2EAK A;  4XE9 A;  1JBC A;  1ZBA 3;  3OGJ A;  1J84 A;  2V73 A;  3MGU A;  1RJ8 A;  1C3H A;  1WD4 A;  1LGC A;  4OVE A;  1UOJ A;  2HWB 1;  4L2N A;  4FFI A;  1EV1 2;  4OHY A;  1HLC A;  3KWV A;  2QUO A;  4WM8 C;  1BZW A;  1OOP B;  3S7I A;  4CCK A;  4ZZ5 A;  5BNQ A;  1XB9 A;  5FZ7 A;  4FFG A;  4GWJ A;  1RUJ 3;  4NID A;  1KS5 A;  3ACG A;  3O14 A;  1MZE A;  2GSY A;  3KCY A;  3BU0 A;  3E6C C;  3GGL A;  2FHR A;  2VZU A;  4JGY C;  5J36 A;  1AYN 2;  2BV4 A;  2DUQ A;  1CIW A;  1K5J A;  2DVF A;  2VQA A;  1YJK A;  4XOG A;  1AZD A;  3LOI A;  1OOP A;  4ET7 A;  2F4P A;  3WNL A;  2W47 A;  1D4M 2;  3K4D A;  5JXJ A;  5FZ6 A;  2WNE A;  4GIQ A;  3KVA A;  1ALY A;  3O1O A;  3I3M A;  3PIJ A;  1JXN A;  4K8R B;  3IPV B;  3L9J T;  3UGG A;  4B29 A;  3A21 A;  5IHR A;  4URA A;  1CQ9 A;  1Q8V A;  2RJL A;  1BK0 A;  1DQ4 A;  2BGP A;  2TBV A;  4GKX A;  2VC9 A;  4YZ3 A;  3UT0 A;  4LTA A;  3JXS A;  2MEV 2;  4CEY B;  3H42 B;  1TME 3;  4FOV A;  1RUD 2;  4Z8B A;  1JYV A;  2VUD A;  1TVG A;  4KWJ A;  4NR1 A;  4XJZ A;  3CJI B;  1AR9 3;  1N3P A;  2YU1 A;  1IS5 A;  3IDB B;  2XG3 A;  4FOQ A;  4IL7 A;  5IJR A;  4Q8K A;  2JKX A;  3ZM8 A;  3LEG A;  1F4A A;  1RJ7 A;  1VBE 3;  4QQP A;  3N7M A;  1O8S A;  4XTP A;  3VBS A;  5GLT A;  4CDU B;  3JD7 3;  1AR6 3;  2J42 A;  4LHK A;  2HWC 2;  4FTE A;  4Q29 A;  2W95 A;  2W3J A;  2ZPX A;  4FTB A;  1YFU A;  4A6O A;  3C7E A;  3OBT A;  3SC7 X;  3M3E A;  4WVM B;  2D40 A;  4FAG A;  2Z69 A;  2D97 A;  1Z0H A;  1VBA 1;  1ASJ 2;  4C8D A;  3M70 A;  3VBH A;  1BLZ A;  1VBD 1;  4EWD A;  5JOW A;  3FLT A;  1NXD 1;  4J1W A;  4WBB A;  1W8U A;  4Y5Z 0;  1FT9 A;  4UT5 A;  2YRO A;  5JR2 A;  4I2O A;  5FY0 A;  5IFT A;  1ZBA 1;  5CKQ A;  3TAY A;  1WCK A;  2BDR A;  3S57 A;  1IPJ A;  4FPH A;  4WVM A;  5FP4 A;  1IHM A; 
#chains in the Genus database with same CATH homology
 5FWJ A;  5FZO B;  3PTR B;  5A3P A;  5LY1 A;  5F39 A;  5A1L A;  3AL5 A;  5FY9 A;  4V2V A;  4UF0 A;  5FZD A;  3K3O A;  4ASK A;  5A7W A;  4HON A;  4D6Q A;  5A7S A;  3KV5 A;  4IGP A;  5IVB A;  5FJK A;  5FYS A;  2PXJ A;  5FYU A;  2W2I A;  3ZPO A;  2XXZ A;  5IVC A;  4AAP A;  5FYB A;  5K4L A;  3U4S A;  3KVB A;  5A80 A;  3OPT A;  3K2O A;  4QXH A;  5FZE A;  5F2S A;  5FUP A;  4BIS A;  5FZ9 A;  4GD4 A;  2WWU A;  4UF0 B;  5A7W B;  4D6R A;  2WWJ A;  2Q8E A;  5FZ8 A;  5LW9 A;  5FWE A;  4QX7 A;  4Y33 A;  3PDQ A;  5F5I A;  5F3G A;  5A7O A;  3N9O A;  2VD7 A;  3NJY A;  5F5C A;  3KV9 A;  5FYY A;  5FZ3 A;  4EZH A;  3PUQ A;  5FY1 A;  3KV4 A;  5CEH A;  5FY4 A;  4CCN A;  5IVY A;  5FY7 A;  5FYM A;  5A7N A;  5FZM A;  5F5A A;  5FPU A;  2YBK A;  3N9M A;  4XDP A;  5FPV A;  5FYV A;  4AI9 A;  4BU2 A;  4GAZ A;  4CCK A;  2YBS A;  4EZ4 A;  5FP7 A;  5FZ7 A;  5ISL A;  4CSW A;  5A3W A;  5FY5 A;  5FYI A;  3DXT A;  5FYH A;  3PUS A;  3N9Q A;  4GJY A;  5F2W A;  5FY8 A;  5FZF A;  5FYC A;  4DIQ A;  5E6H A;  3N9N A;  3KV6 A;  2YU2 A;  5FXX A;  2XML A;  3K3N A;  5FXW A;  5IWF A;  5FP9 A;  5FZ4 A;  5KR7 A;  4DO0 A;  5IVJ A;  5A7Q A;  5F3C A;  2OQ6 A;  4EYU A;  4LIV A;  2OS2 A;  4TN7 A;  3AL6 A;  5FZ6 A;  5IW0 A;  5A1F A;  4V2W A;  3KVA A;  5F3I A;  2XDV A;  5FZB A;  4LIT A;  4Y4R A;  4Y3O A;  3LD8 A;  5FYZ A;  4QX8 A;  4URA A;  4QU1 A;  3ZLI A;  5FZI A;  4CCJ A;  4LIU A;  3RVH A;  5FZL A;  5FZK A;  5IVV A;  3U78 A;  4CCL A;  5FPA A;  5FXV A;  4HOO A;  5FBJ A;  5FPB A;  4BXF A;  5FZC A;  3AVR A;  2Q8D A;  5IVE A;  4QXB A;  4NUB A;  2YPD A;  2YU1 A;  5FUN A;  2OX0 A;  3PU3 A;  1VRB A;  5ANQ A;  5FZH A;  2YBP A;  3LDB A;  5F3E A;  5FP3 A;  3PU8 A;  5FJH A;  4E4H A;  5FZG A;  2OT7 A;  5A3N A;  3OPW A;  5A7P A;  4D6S A;  2GP3 A;  5LY2 A;  4CCM A;  3N9L A;  3UYJ A;  4CCO A;  5FZO A;  4C8D A;  5FV3 A;  3DXU A;  5FPL A;  5LWB A;  4QWN A;  4GJZ A;  2OQ7 A;  5FYT A;  2Q8C A;  4QXC A;  4LXL A;  4CUG A;  3PUA A;  5FXZ A;  3AVS A;  5FZ0 A;  5FZA A;  4IGO A;  2P5B A;  5A3T A;  5F37 A;  5FY0 A;  4IGQ A;  3N9P A;  2XUE A;  3PUR A;  5FP8 A;  4XDO A;  5FP4 A;  5IVF A;  5FZ1 A;  2GP5 A;  5F32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...