5F3IA

Crystal structure of human kdm4a in complex with compound 54j
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
350
structure length
342
Chain Sequence
ETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 8-Substituted Pyrido[3,4-d]pyrimidin-4(3H)-one Derivatives As Potent, Cell Permeable, KDM4 (JMJD2) and KDM5 (JARID1) Histone Lysine Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 4A
total genus 106
structure length 342
sequence length 350
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5f3iA01
3PURA 4EZ4A 5A7QA 5FYZA 5IVVA 5FYBA 4XDPA 2PXJA 5A3NA 2YBPA 5FP7A 5FZMA 2GP5A 5F5AA 4QXBA 3RVHA 5IVBA 3PU8A 4LIVA 5A7OA 5A7PA 3AL6A 5FPBA 4BXFA 3N9PA 2XMLA 5FUNA 3KVBA 2YBKA 4EYUA 5IW0A 5FJKA 5FXWA 3OPWA 2XXZA 5A3TA 5E6HA 4DIQA 5F39A 5FPUA 3N9MA 3K3NA 5FP8A 5FZOA 4CCNA 2XDVA 4D6SA 5IVYA 5CEHA 4GD4A 4Y4RA 3PU3A 5FZBA 5IVJA 5FPAA 5IWFA 3U4SA 4V2VA 2YPDA 2YU1A 4LXLA 4C8DA 5K4LA 3LDBA 4QXHA 4ASKA 5FJHA 5LY1A 5A1FA 5F5CA 4IGPA 5FZ4A 5FUPA 5FY9A 5FYIA 5FZ7A 2GP3A 2OT7A 3N9LA 5FZEA 5FZOB 5FZGA 5F3EA 3AVSA 5FXXA 3ZPOA 4BU2A 3KVAA 5FP9A 3PUAA 5F32A 5FY8A 4QWNA 3KV9A 3PUQA 4LITA 5FZ8A 5ISLA 2OX0A 5A3WA 5ANQA 4URAA 4XDOA 5FP4A 4LIUA 4E4HA 2OQ6A 5A7WB 4QU1A 5A7NA 4V2WA 3UYJA 4GJYA 4NUBA 4UF0B 5FYHA 5FZKA 5FXVA 5FY4A 2Q8CA 4IGQA 5FPVA 5FWEA 4Y3OA 3N9OA 1VRBA 5F37A 3AVRA 5FP3A 5FBJA 5FY7A 3NJYA 5F2SA 5FZFA 5IVFA 3PDQA 5FV3A 5A3PA 5LW9A 2OQ7A 2Q8EA 4D6QA 4QX8A 5IVEA 4CCMA 2YBSA 3K2OA 3ZLIA 5F3CA 4AAPA 5A80A 5F2WA 5FZ9A 2W2IA 2Q8DA 2YU2A 5FYCA 5FZIA 4HONA 5A1LA 5IVCA 3DXUA 4UF0A 3U78A 5FZDA 5KR7A 5F3GA 5FZHA 5FYYA 4IGOA 2XUEA 4CSWA 3PUSA 5FY5A 4CCLA 5FWJA 5F3IA 5FZLA 3KV5A 5FYVA 5A7SA 2WWJA 5FYMA 3KV6A 5FZCA 4TN7A 4CCOA 3N9QA 5FYUA 5FXZA 4CCJA 5FYTA 4EZHA 5FYSA 5LWBA 4GAZA 4Y33A 3OPTA 5FZ6A 3N9NA 4DO0A 2WWUA 4QX7A 4CCKA 5A7WA 4HOOA 5LY2A 3KV4A 4D6RA 4GJZA 5FPLA 3PTRB 2P5BA 3K3OA 2VD7A 3LD8A 5FZ3A 4BISA 4CUGA 4QXCA 5FY1A 4AI9A 2OS2A 5FZ0A 5F5IA 5FZ1A 5FY0A 3AL5A 3DXTA 5FZAA
chains in the Genus database with same CATH superfamily
3ZFFA 1FV3A 2RS32 3WY6A 3WG2A 5FYZA 1N1VA 3LDKA 4LO7A 5E1RA 2QCSB 4RS5A 5FZMA 1JHJA 2P3JA 1CAUB 3MW3A 1UMHA 1UX6A 4W65A 1EP0A 2Q1MA 2VPVA 3WT3A 3SH5A 5BNOB 3OOXA 1BK1A 1OA4A 3M2MA 4Y24A 2WO2A 5FPBA 4DXSA 4Y1ZA 1S0IA 1QWRA 3H0OA 2NMOA 5G05L 4URTA 5ACA1 1LNSA 5LA0A 4FXKB 5FXWA 3PVEA 1FV2A 2EICA 2D43A 2IFWA 3IPVB 3VKLA 2YC2A 4RFRB 2A70A 4IL7A 1YQ2A 2B5HA 2IZWA 1RJ7A 3RI8A 2HWC1 2JE8A 2WZ8A 3TRSB 3FHQA 1EPZA 2BDRA 3EO6A 4MHUA 2FDGA 3OY8B 4IEUA 4KQ7A 2VNVA 4RFT0 2YPDA 4CDUA 2WS93 4I0AA 3WG1A 5LY1A 1SBDA 3W9AA 4AVBA 1JYXA 2V72A 2X10A 5GZGA 1UMIA 5FZ4A 4JX0A 2XQRA 2L9LA 1DF0A 1G9AA 4YLZA 4R4ZA 2ZGMA 5FZOB 3I2HA 4FPFA 1QJFA 4ATFA 3MW4A 1HJGA 3J7HA 4MH0E 4JKKA 1AUYA 5JDBA 2LTNA 5T55A 1UX7A 5ABJB 4YGEA 1ZZBA 2MEV2 2DBNA 5I0RA 1XRUA 4CDQA 5L9RA 4QU1A 2TNFA 4L2NA 3ZFFC 3KD4A 2ZHLA 3AB0A 3ZFEB 2BOIA 5FXVA 4ET7A 5FO8B 5ACA2 5FWEA 4RGGA 4RS5C 5JXIA 5LEKA 3KS7A 5CB7A 5CG9A 3ZYRA 5IK8A 4CDWA 2W46A 3VL8A 4UI9L 2W94A 4YW3A 2VC9A 4DUXA 1RXFA 1ZBE2 5T3NA 3JCIA 2D6KA 3AP9A 1UN1A 5DZGA 2RS53 3JQXA 2HWC2 3NNFA 2WNVB 5F2WA 2W08A 4P9GA 1MS8A 4AI2A 3VDDA 4AQSA 1JYWA 1GQPA 1SDDB 2J1UA 4JGZB 1S4CA 4UF0A 1YHFA 3SISA 1I9RA 1VBC2 2AR6A 1S2BA 4AI3A 3N35A 2R0FA 3VD4A 2P4EA 4FTEA 5FWJA 2R16A 1RJ8A 5IYYA 1GWMA 1HW5A 2MEV3 2O8OA 4YFZA 1RUD1 3NQHA 3I2GA 2Y0OA 3LAGA 3OJBA 2CTVA 1ZM1A 4IE7A 3RWNA 3CJIC 1J1LA 4WM7C 1HJFA 5I0UA 2W1UA 1GR3A 3HWJA 3PNAA 2WNOA 3IWZA 3NL1A 4JGZC 1ZBE3 3SH3A 5BXXA 2QE3A 2VZPA 1CPMA 1NQDA 4ZU5A 3HMYA 4AVTA 2WNVC 1YC61 3IDEA 1JU3A 4RA0A 4XHBA 4Q26A 1ZBE1 2GSYA 3A0NA 1NCQA 5LA9A 2RDQA 2PQSA 3DN7A 2DURA 2VCBA 4QDQA 3T0AA 5LK7B 2ZKLA 5GLZA 2FD8A 4RS5B 4CDWC 5IVBA 1REEA 2I2SA 2I45A 3HQRA 5LA2A 3ZFEC 2B46X 5BNOA 5A33B 2DFBA 2UWAA 5KHIA 1H30A 1CJDA 2YBKA 3OG2A 1XXNA 2DUQA 2QQKA 4FQZA 2FMDA 1B35A 3GDBA 4HSJA 4LO6B 4MXWA 1PK6C 5A6QA 3E97A 3WF1A 1KS4A 3VZOA 5FK7A 1AX1A 4XW3A 5FPUA 1ENRA 5FLJA 1LHOA 3WOGA 1W6NB 2BNNA 4TSVA 4FPOB 5JOWA 3ACGA 2QQNA 4QDRA 5EHDA 1JU4A 4FOYA 1GUIA 2XLGA 2VOXA 3UV9A 1RUJ3 1N3QA 3QD6A 3CNAA 4XFAA 3EHKA 4Q4Y3 3RQ0A 3S7IA 5H9SA 2ZX1A 4XUNA 4AEDA 3LQCA 2UYBA 2I74A 3JD73 3ME2A 1W8NA 4KG0A 2VVFA 4D94A 3CLPA 3O1UA 2VW2A 3FE5A 3T30A 4K9SA 1UY0A 3VBRA 5FY8A 3VDBA 1BMV1 1DYOA 1UXXX 2C9AA 2QDRA 4WZFA 5JZGA 2UYAA 3A21A 1FOD2 2P6CA 5FP4A 4DEQA 2RHPA 2ENRA 1BEV2 5A7WB 2RJLA 2JD9A 4YM0A 1PIV3 3WQ7A 1W03A 1NXD1 1KS5A 1WCKA 1AZDA 4META 4AGGA 4OQ8A 3CF6E 4Y3OA 1QOTA 4JDOA 3FLTA 4JHTA 3OSDA 4D8MA 5F37A 4TXWA 4GA9A 5J1XA 3TEYA 2W5FA 4XILA 4HFSA 4HKOA 2JDPA 1RUJ2 2VE1A 1QJY1 3ZX7A 2VZOA 1BKZA 1OA3A 1NY72 5AVPA 1GQGA 5F3CA 2PN5A 3RZKA 1ZRCA 3T09A 1AR93 1TMF2 5JLVA 4DMIA 2W2IA 1GWKA 3H9AA 2ZX0A 3MPPG 1LEMA 2JG8B 4CEYA 1WCQA 3AFKA 2A5ZA 4K1ZA 1F5JA 3KSCA 3BN6A 1RC6A 3RFRA 5EFUA 4GH4C 3KLSA 4FTBA 1AR91 1GNZA 5FY5A 4LUMA 4Z8BA 5DAWA 4OHYA 3Q8AA 5A33A 2BVVA 2PLV1 5DZFA 1W3VA 2D6OX 4QQHA 1KITA 4CTEA 1DDLA 3DV8A 3OGRA 3QOPA 3UKTA 3AP4A 4TN7A 4A42A 4QQPA 5JAXA 1UKRA 2IXJA 4AVCA 2JDNA 2JDYA 3H42B 3LZZA 3LEIA 4XBLA 1ZREA 1KFUL 4Q4X1 3JBG1 1ZA7A 2WWUA 4QPYA 4HOOA 2FDFA 3VBRC 1O5UA 1J58A 1QDOA 1DG6A 4LK7A 3MLLA 2DF7A 1U5XA 4HETA 5FLIA 2MNGA 3DKQA 4S2HA 4XQWA 5A7NA 3USUA 3ZFGA 4AHZA 3V0AA 3JU9A 4MSVA 1ZX5A 1PX4A 3MDPA 1W28A 1TMF1 2WQZC 2JXAA 3PTYA 2P34A 4WVMB 3ZDSA 1OUSA 2QFEA 4I0WB 5A7OA 4Y22A 4CDUB 4IEXA 2VVEA 4K8RB 3KVBA 4WVWA 3VZMA 2WZEA 1GOHA 1BQPA 3WW1A 1QJEA 1RMU2 4KWJA 1QJX3 2PLV2 1BHGA 1ZZ9A 3M4FA 4CA9A 5KBFA 5FZOA 3VBSA 4GH4A 3BVCA 3KCXA 3ZXEA 3MIEA 4K8FA 3GXUA 3WNOA 3ZKYA 2DWRA 2W87A 2E6VA 4FOWA 4K6BA 4YGBA 5LBEA 3U4SA 3ZN6B 2X5IB 3WUDA 1DGRN 1RUD3 3WNLA 4M01A 5K0UA 3URFA 2YB7A 1R64A 1K42A 3P1IA 4PI0A 1H2MA 3I8TA 4CVUA 2Y6LA 2RS13 2J1SA 3CU7A 2MPFA 2OPKA 3D82A 4M0NA 5BYNA 4P00B 1UYPA 4QQLA 1LR5A 5DG1A 4AVVA 5F32A 4H55A 1AR61 1AR82 4JKLA 1MS0A 2WIIB 4HKWA 1F8VA 2GMMA 4XDOA 5IFPA 1N1SA 2ETEA 3AKPA 4XUPA 5FREA 3P3NA 1VBE2 4NPMA 4NUBA 4UF0B 4BH9A 1HV1A 5BV6A 2DCJA 2DCYA 1W8WA 5EYYA 2H0VA 4EN9B 4HL0A 2AEZA 2VCMA 3VBUA 3OEAA 2J1VA 1WMEA 5F2SA 3ASIA 1V0AA 3UETA 4NOTA 1E5IA 2BBVA 2K0GA 4XZPA 1C5HA 1K3IA 4Q29A 1EPWA 1UIJA 4UW6A 1XC6A 1YNAA 2WT0A 3G6JB 1RGSA 4XF1A 2XONA 3ZYGA 4ZHNA 5EQUA 3BTYA 4JCKA 4E4SA 1BBT2 5ABJC 1QEXA 1APNA 5L36A 1PVC3 4HONA 3VZNA 5F9TA 1O8SA 3U78A 1VMJA 2WAOA 1MS9A 3I54A 1ZZ8A 4HVOA 4CSWA 3ZXJA 1YQ8A 1AR83 1HQLA 2Y6JA 3GALA 1D4M2 5D21A 4LR4A 4NHYA 4AEDB 3M3OA 4XXPA 3S0MA 1NOVA 5CU1A 1XNBA 1G9BA 3GBGA 2WWJA 4Q0PA 1WLWA 1W9YA 4N7IA 2QKDA 2P3IA 3ABZA 1W8FA 3N9QA 1UF2C 5C4WC 3KHCA 2HH9A 2VZTA 4AQTA 1POV1 2PQQA 2ZHNA 4GAZA 3HOBA 1VBE1 3POGA 1FX5A 5A7WA 3D5OA 1V00A 5SV5A 2GDFA 1QQP3 1RVF3 4QXCA 5LCWL 1POV3 4Q0QA 2VMDA 1BBT3 3BODA 3V56A 4OUSA 1Y3TA 5C3SA 4YRDA 4J25A 2GNDA 2D5FA 4LJHA 4NIAA 2DVGA 4YVSC 1RUNA 4LT5A 1Q3EA 2PXJA 4BJ0A 5M0TA 4X8NA 1PO11 4MGSA 1S1AA 2WZPP 3ZSJA 5T5OA 4RGKA 5C8WA 5T50A 1OLRA 1JZ7A 3LOBA 2VULA 2VTXJ 5AC93 1W0OA 1H8TA 3K4AA 5HXVA 1G9DA 4OI1A 2J7MA 3VKMA 4UOJA 4JZRA 3AX4A 2W3JA 2X5IA 3JQWA 4H2AA 1C8M1 4LBOA 3RZMA 4O65A 3O1VA 3H1MA 2YHJA 3H8UA 3WEZA 3N7JA 2ZMNA 2NMNA 1QHDA 5A3TA 1LULA 3TB0A 3AFGA 2XJQA 1PVC1 1PMJX 4FPEA 3WDUA 5J3UA 1BMV2 5FP8A 1JYTA 1Z7S1 3FJSA 4DY5A 2DVAA 2R30A 2AUYA 2W1QA 3VZJA 2PMWB 4NAOA 2CV6A 4YNIA 5B4XA 4ZONA 2CDPA 3WDXA 4I2OA 1C5IA 5GKAC 4AHWA 4A7YA 1FYUA 1OQDA 4XCBA 5CFCC 4C8DA 5C8CA 4RL7A 4OULA 4BE3A 4RQPC 1ZZCA 4SLIA 4YVWC 2R063 3VBUB 3GCWA 5FZ7A 5CVRA 1C8M3 2J1EA 4BA6A 1CAXA 4XFGA 2VZUA 1URXA 2BYVE 2RR11 2W1SA 3VZLA 2OVUA 1C1FA 5DUVA 4FO9A 1V70A 2WNVA 3H8RA 1WKYA 2JB4A 3MIGA 4LKEA 2BGCA 5L7OA 3UYJA 1ULCA 1O3TA 5FYHA 4UBGA 1PGW2 4Y22B 4Q0VA 3NWKA 4I3PA 5FY4A 3TYJA 2J1TA 1J1TA 2P3YA 2XJVA 3RRDA 4TYSA 4UW5A 3B3QE 4XIKA 4XTPA 3AVRA 1LOBA 4JRAA 1MEC2 5IVFA 3TEWA 2EIGA 4IV1B 2EALA 4D6QA 3POFA 4BQWA 5DDJ3 5BNOC 3CJXA 1S0GA 1F9KA 1JOPA 1FPN1 1AJOA 2YV8A 3ZLIA 3V0AB 1ZNPA 3EB7A 1WCSA 2H0BA 1B35C 2KM2A 4LOSA 2WBKA 1DU3D 5EWSA 2Q8DA 1W9FA 4CU6A 2R062 1GOFA 5C9AB 5JPNB 1WLTA 2HLEA 4KWKA 4BIOA 1GWLA 1RUF1 1QJX1 3GCXA 3TBDA 3RI9A 3C8XA 1KFXL 4ZS2A 1UL9A 2Y64A 3PUSA 2JDZA 4ZY9A 5F3IA 3CZUA 1YQCA 1VBA3 3T0BA 3HNBM 4JQTA 3R4SA 4ZS3A 3VD3A 1HN1A 2EA7A 1JHNA 4H3WA 5FO9B 4HKLA 3MUY1 5FYMA 1O8PA 5FZCA 5D1IA 2RE9A 1UY2A 3GZUC 1E5HA 1AL21 2ZPXA 5DMYA 4NO4A 3USSA 3WQ1A 1BXHA 4EE2A 1LOAA 5FZ6A 3WG4A 1VMHA 3B5LB 2IFRA 5LY2A 1QY4A 1PZ7A 3HQXA 1V9U1 5FKCA 5BPXA 4C90A 1N3PA 3WP3A 5FY1A 2OS2A 2DUPA 4W6WA 3AL5A 1W6OB 1UXZA 2DYCA 1ND2C 2D7FA 2ZGSA 2DCTA 3ENRA 3F2ZA 3I2DA 1OOPA 4M3CB 4N8MA 4U36A 2RMU1 4XBQA 5CNAA 5FMCA 3TEXA 4CXWA 3V0BA 3U4XA 1IPKA 2SLIA 3NNMA 2C5DA 4HPKB 1ALYA 2BU9A 4P9LA 4X8PA 5CKMA 1LHVA 2FCTA 1YI9A 3I7DA 4IEOA 1PGSA 1GFF2 1GZWA 1ST8A 2YDEA 3AMPA 3BPSA 1HX6A 5E89A 4YW7A 5EV7A 5FMBA 1YEWA 4EWEA 1WW7A 5FZAA 1GZCA 4IV1A 5C3PA 5ERLA 5DDJ1 2J1AA 4CDXB 5I8SA 2Z79A 3RZZA 1HKDA 4HG6B 2XGXA 4CEYC 1C4RA 2HJIA 2XBO1 3A23A 3R05A 1LENA 1MR5A 3OD4A 1CESA 1W0NA 3WDWA 1FPN2 2Y0IA 3K3NA 2BJSA 1H0BA 4QHBA 2RJ2A 4LBQB 2EXHA 3O0XA 2IXIA 3M70A 4AQ2A 3TEZA 4QPGB 1Y9MA 2WS92 3W59A 4QX0A 5DXDA 5ANNA 4MXWB 4PBPA 5DAXA 3WDVA 2RMU3 5FPAA 3GGLA 5BUVA 1NZIA 2WLQA 4BMEA 4KH9A 4PJYA 2BW8A 4JGYA 3SKJE 1OXCA 4V1PA 5K4LA 4QKBA 3GZEA 3DCQA 1HDKA 4Q4X3 5FUPA 3ZYPA 3AMNA 5C8CB 4PLNA 3SITA 4HN1A 3ZPOA 2R1DA 4AVSA 4BQYA 2VTXA 1I3HA 3AJZA 4LA2A 4DXTA 4YW5A 1NE6A 1R1A2 2XBO3 3EBRA 1QF3A 3EXUA 3U10A 4IE4A 5EP9A 1ND2A 1VPHA 1X50A 3DGTA 5H9PA 2PAKA 3WG3A 1I5PA 1DP0A 4GJYA 5B4NA 3ES4A 2FDIA 5FZKA 4QX5A 3PIGA 1HB4A 2Q8CA 2BPA2 3KHBA 4HVQA 2VQTA 4OI2A 4FFGA 1VRBA 2JEMA 3DPRB 3D8CA 3LA2A 5FBJA 5KWRA 4QM9A 1LHNA 2JECA 2RMU2 3O0WA 4XFIA 3Q8BA 4G3YC 3WINE 5GZDA 4C0HA 3FLPA 3O1SA 2QQLA 4XMAA 2XWBB 4Q4Y2 3OGGA 3IBMA 3PUIA 4TWTA 1MQTA 3S30A 1ND3C 2HWD1 4B1LA 4WV8A 5JUVA 2QVSB 4TTGA 2R072 1CZTA 4MGKE 5BNQA 3NAPA 2K9ZA 4UFJA 4LBMA 5FYYA 4A4AA 1MS5A 1TG7A 1GNYA 1H8VA 2LM3A 3AYEA 4GALA 2N7GA 1RB8G 3MFCA 3N7LA 3LDRA 1QH6A 2TEPA 2VOWA 2XBO2 4WVZA 4W6YA 4EV0A 2HYXA 3POJA 1R092 1BEV3 5A7SA 1LOFA 2LW8A 5A32A 3HNMA 4ARYA 5K0UC 2D3PA 1PO23 3BCWA 3PMSA 4CCOA 3QLQA 2VUDA 3HQUA 4H7MA 3VDCA 1DGWX 3POBA 4MUVA 4Y33A 4W6XA 1XE0A 1LAJA 4FPHA 4KBZA 4MGYE 1VP6A 4MO3M 4QX3A 5FZ3A 5DZEA 4MGQA 2A75A 5SV8A 5C71A 5CKNA 3T3YA 1AF9A 4YM2A 1PZ8A 3AKRA 4XTMA 5DABA 1VB4A 2IVIB 1OQEA 1S0CA 3PURA 4NR1A 1O4ZA 2R073 3J8F2 1V9U3 3MLJA 4FPKA 5D2AA 1JODA 3DYMA 4CU7A 5JPMB 4A2UA 1FATA 1PIV1 1CAVA 4CZSA 3WHUA 1Y9QA 5CFDA 3ZXAC 3RZGA 3C3VA 2QNKA 5GZEA 1SHWB 3NJXA 3H1WA 1KJLA 1VJ2A 1ZA4A 3DEMA 2LALA 4H14A 2XVLA 4L11A 3I59B 1CIYA 2X05A 5FUNA 1F15A 4CDQB 3FL7A 1MQTC 1STMA 4CP0A 2D6LX 1GP5A 2ES3A 2B42B 4GKXA 1WMFA 3O12A 3VBOB 1A78A 1UY1A 2ZMLA 1TME3 2ARBA 3H3ZA 1VMFA 4YZ1A 2QBXA 2JE9A 5EJZB 3NAPC 3N9MA 5FLHA 4QX2A 4OHVA 4DFSA 2RDRA 1CAWB 5JXHA 4ITCA 1XB9A 2R49A 3WF0A 3ZR5A 3WQ0A 4ES8A 1LOFC 3MBWA 3APBA 1C28A 3T2QA 3FN9A 1R1ZA 2C1FA 4FPLA 2VQUA 1YCIA 4Q4V2 1ZZ7A 5L73A 1V6LA 2KR2A 3AMHA 1L7QA 2C4XA 1ODNA 4I02A 1WLCA 2GP3A 2I07B 1FOD3 2ARXA 3ON7A 3IMNA 5I0TA 2R042 2VZSA 1UU4A 1GLHA 4L99A 5FZ8A 2XKOA 3OGSA 5ANQA 4YARA 1IG3A 2OQ6A 1ULFA 5C33A 1RMU3 3MHZA 1PX3A 4BQ4A 1EV11 1TME2 1X9PA 2WNUB 4K3UA 3INAA 4NHMA 1RUH3 1QXRA 2WA4A 4XF3A 5FPVA 5CA6A 4E2GA 5E16A 4S2GA 1UAIA 1O59A 1ONAA 1DIWA 2B4KA 4A41A 4LE3A 4QX8A 5A3LA 2AACA 4GWNA 1AX2A 5LA1A 4BOWA 2RDSA 4I01A 2V5DA 1P8JA 5A80A 2B7YA 2PHTA 4NPLA 4FPYA 1QJZA 3MFAA 1MS3A 2W0XA 5K8SA 1XYOA 3AKQA 3ST7A 2HEWF 2RS12 3PVOA 1V6IA 2C0ZA 5FZDA 5I93A 1AL0G 1TZOA 3CDZB 2XJPA 5F8PA 4K40A 5DAPA 1GOGA 2QQJA 4QKDA 1JN2P 3IPVA 1J3QA 3T08A 3ZKUA 2RV9A 1COV1 2X53S 4LORA 2YROA 2IXKA 2DV9A 4KMQA 1NA1C 3RMYA 3KV5A 2VZ1A 2A73B 2D40A 3K51A 1VBE3 4BQ3A 4DB5A 3KV6A 2AZ5A 4QHZA 2AGSA 2JX9A 2XJTA 1W6MA 3AM2A 3VBHB 5CKQA 2Z42A 5FXZA 1D4VB 2A6XA 3NKGA 3ZSLA 5FYSA 3SNMA 4YVWA 3BU7A 1MPXA 1CAUA 5T5JA 2P6HA 1JZ6A 3SC7X 4CCKA 4GWMA 4XABA 2EXIA 1J3RA 2RS11 5BNNA 2WNUC 2XJRA 1DZTA 2GNBA 3J7NA 1X8EA 4PHZA 1RHI3 4Q2FA 3FX3A 1UNBA 2EAKA 1NCRB 3K77A 4CDXA 1UOFA 1JH5A 4ZKTB 1GSLA 4IXLA 1BJQA 2O0OA 1RUI2 1DHKB 3ETQA 4IEWA 4BK5A 3HNYM 2AYHA 4NPRA 2A7AA 2YBPA 4O9EA 4XURA 1HB2A 3OPZA 3WVJA 5K9YA 4WBBA 4UFIA 4MYEA 3IT8A 1BVP1 1OT5A 3HVDA 3O1TA 4OLLA 4R4XA 2IWGB 4QKNA 3CBNA 3S57A 1WGPA 4OUMA 3H1YA 4EYUA 3OBAA 5A70A 3NRUA 3O1RA 1YO8A 3CKHA 4IW3A 1U0AA 4N9IA 3VDDC 4C91A 5DG2A 4M4PA 2DCZA 2ZCWA 3R4DB 2X09A 4FOQA 3ZMOA 4BQXA 4EWAA 4CCNA 3IDAA 4XUQA 2BGOA 2ZX2A 5KC6A 4EN8B 1QQP2 2ZGPA 1RVF2 3I3QA 2K46A 4KL1A 3PVBB 2CU5A 1MQTB 1GU3A 1XNDA 4BQ5A 1F2NA 4V2VA 2J22A 1RUI3 4PBOA 4LNVA 3KF5A 4L9BA 2FDHA 3T4VA 4BHPA 2QQPA 3IAPA 2GNMA 5IAVA 4N43A 1UOJA 2E32A 2UY9A 3UESA 4GMP3 5BNNC 3M3QA 1Q8VA 3KVAA 3OUHA 5FP9A 1N3OA 4LITA 5IT6A 4BM8A 1PGL1 2ZGUA 5A3WA 4PT6A 4CXXA 5D8AB 3ZPYA 1ULEA 1FT9A 4E4HA 5F6LB 3WHTA 3ZSMA 2BP6A 1HQWA 3L2YA 3BGAA 4EROA 2UWCA 4UFHA 4YVWB 1FXZA 1MVEA 5CAZA 1MZEA 4AI8A 2CAVA 1JTZX 2CHHA 4ATEA 5JMOA 4XFCA 5G04L 3O7OA 1UWWA 4QDSA 4UW3A 1RUG1 3SMHA 2ET1A 2ZS6B 4CUCA 4UWDA 1S55A 2JIJA 2XB6C 5K0UB 3VZKA 1PVC2 4DUVA 4YZ3A 5GLVA 3USUB 4PF5A 5I0SA 2A3WA 4PQ9A 3IAQA 2FDJA 5KHJA 1W6NA 4QKFA 1DFQA 1NCQB 4LK6A 4XFBA 1R081 2A1XA 1VR3A 4XFFA 2DVBA 3OBRA 1BCXA 2RR13 1HB3A 2R6QA 4RSUA 2WLPA 2XHKA 4XFHA 4Y20B 2YC0A 1WMDA 3PVNA 2BNMA 3WUCA 1IPSA 4K1YA 3UGFA 3T0DA 2WABA 4LLFA 5IUQA 1YQ6A 4CP2A 4YG0A 1H1MA 2IXCA 4S2FA 2OKXA 3KGZA 3DL3A 2WN3A 1WCDJ 4Q0SA 1XSRA 3TNQA 1XYNA 4BYYA 4Y4YA 1RUH1 5L9VA 4M3CE 2VZ3A 1UIKA 4HBNA 1MEC3 1T6BX 2G4IA 4YVSB 2Z4FA 4KWUA 3CL1A 4YW4A 1YJLA 1ZVFA 2J1RA 4CUGA 4BISA 2C9KA 3RZHA 1H1IA 4OYUA 4BQ2A 3AMMA 3WF4A 3UJOA 2JDUA 1W6OA 3ZN5A 1ZBA1 1NCRC 4Y5TA 1DQ5A 1H9PA 3OTFA 4F3JA 2OYZA 2E7QA 3PLQA 4ARXA 2P17A 2JDAA 1KXGA 1XQNA 3GYDA 3WW2A 1SMVA 3UKVA 1RYYA 1AYN3 3TN92 2B39A 4FFIA 3GF6A 3M7AA 2W91A 4FPJA 1NY71 4KU7A 2VW0A 2PTMA 5F5AA 1CONA 4I0BA 4N9HA 4K20A 3O1OA 4CUBA 3NKTA 5IFTA 4O61A 3QCWA 3E1F1 2PAEA 5FRAA 1UD1A 3OYWB 1JYIA 4JRLA 1EV13 1IHMA 2VNGA 4QPGC 1Y7BA 5A6XA 4AQ6A 2BQPA 4M00A 1JI6A 1UPSA 2V09A 1WW5A 3WNMA 5IATA 5JOZA 2D44A 1REDA 3HPNA 1LOEA 5IVYA 4CEYB 5J48A 4I09A 5LASA 5LRRA 2ZEWA 1XNAA 2C6SA 2CL2A 4R9BA 4Y26A 4CDWB 5HV0A 3POSA 4XYXA 3A22A 3CZJA 3THCA 1C8M2 1CN1A 2XQXA 2E53A 4IGPA 1Z78A 1W2NA 1SBEA 2FBEA 4HXCA 1DYKA 1DZRA 1W2TA 4AFAA 1X82A 4MVTA 2JG9C 3T2TA 3BTZA 2R041 4AXOA 5FXXA 2WO1A 3JZVA 4R8HA 3NMBA 3ZYJB 3W58A 2CNAA 5J7MA 1FMD1 4GB31 3POWA 5FPXA 3I49A 1ND2B 3WX5A 5I0DA 4P9JA 4URAA 1VBB2 1JUIA 2R32A 3M3IA 1PO21 4QPIC 1RXGA 2ZGTA 4DUWA 2GN7A 4WM7B 1H2LA 2GC0A 3CJIB 5HCAA 4M3CF 5CFDC 5DDJ2 2PHFA 4MHRA 1UU5A 4KGQA 5HCHA 2XR4A 2BWCA 1KDKA 2ID4A 4ZU7A 3LA3A 2ZJCA 3D6EA 3GJBA 2GAUA 4L97A 2Y6KA 2YBSA 4IQPA 2P1BA 1XNTA 1PNGA 1LHUA 1IQAA 1RUC1 2ARCA 4TZDA 1D0GA 3ZYFA 1RUG3 2QQOA 3P3PA 2W52A 1CR7A 1HRI3 2GN3A 5JI7A 4AI1A 1FNZA 2R1BA 3B02A 4Y1VA 1Q8SA 1LRHA 3VBFB 3VB9A 1PVXA 4QAWA 3AP7A 3VBOC 5HPOA 1R1A3 3VBHA 4QB2A 1JUHA 3VHOA 1AXKA 2MHFA 5IK4A 4JGYB 1LGBA 3CIHA 3HN1A 4Q1RA 4IEYA 5DUUA 4DOUA 3HBZA 4IETA 1KJRA 5C3QA 4DPNA 4AHYA 2FCUA 1H6YA 3W5MA 5I8YA 3UGHA 1W3XA 4GMP1 4XJZA 2RM22 1CX1A 1W6PA 3ZFFB 2D5HA 4XJUA 5FPLA 3C7GA 1F35A 4OI4A 4CEWB 5FMOS 4XUOA 4AEKA 2XUMA 3KF3A 4GMP0 3JB8A 5F5IA 1DQ2A 3AK0A 1IS4A 3RWKX 1EUUA 1OD5A 3C7OA 3VBRB 3ZOIA 1GP6A 3V64A 2Q1FA 1WWYA 2ERFA 2XLFA 3VV1A 3LF7A 1HRI2 1S2EA 5CADA 1QJY2 4XEZA 4FAGA 4W4ZA 5GZFA 2OZJA 2VG9A 5HCBA 2IUWA 2VBBA 4AI0A 3VBUC 4YZ2A 2HWD2 4YG6A 3I97A 1IPJA 1CZVA 3WZ1A 3AL6A 1R093 1G86A 1RUE1 4N53A 4N7UA 5KXBA 1ZRFA 3N9PA 1AR71 3M8LA 4CPBD 4DRRA 1OLME 4GH4B 5JMCA 5ABJA 4R9CA 3U14A 4NE9A 1D4M1 3EMRA 4IV3A 1AJKA 2QUOA 2OZ6A 2R0HA 3TOJA 5FOJB 3B00A 2F6BA 1CQ9A 1YWKA 2VTFA 4D6SA 3OD0A 1W04A 2XDVA 5BNPB 3HD8B 3LIHA 4KGGA 5KC5A 1SFNA 3E6BA 3LA7A 1NLQA 2Z69A 4LULA 3PU3A 4E27A 3SXWA 1OC1A 5KHHA 4XE9A 1H2KA 1NA1A 3ZMNA 3PJYA 2RS51 2E51A 2IVJA 1HB1A 1OA2A 2AC1A 1A34A 1V9U2 1V6OA 3WF3A 5FUIA 5FTTC 5C4WA 4L8QA 3RDIA 2GC2A 3CJIA 2DBIA 2HWD3 4YPJA 2VM9A 2ZHKA 1UKGA 1TE1B 3MI8A 3WSOA 2WZR2 2DTWA 2HWE3 5GJ6A 1AR81 1H4HA 3IKWA 4JGZA 1AR62 3PMEA 2EVXA 3MV01 3VD5A 1PIV2 3SH4A 2H6BA 1QNWA 1XBFA 1BBT1 3KQRA 3LPFA 2Z2SB 4R52A 5JIAA 4WM8C 2VU9A 5LB6A 4NMIA 3NNJA 3PHMA 2VCCA 4LKSA 4BMBA 1H6XA 3A7QA 4YVSA 1ULPA 5LEJA 5EZWA 1AR72 3HEIA 1IS3A 4R9DA 5APAA 1VE0A 1SFPA 5DAVA 3PDQA 5FZFA 4NRQA 3ZXDA 1H8TC 4HK8A 4BDVB 3P5BA 2VCAA 3ZFEA 2Y8KA 1UZYA 2WQ4A 3AZYA 4H7LA 1ZRRA 2PFWA 2A6YA 4P02B 3VBSB 1E5SA 1X9TA 4LTAA 2QJVA 3FFZA 1CAXB 1AYM2 3ZFGB 4J6GA 2FHRA 2Y33A 4RR3A 5CYYA 4CCDA 4HSLA 1KEXA 4GULA 1E57A 5LATA 1RMU1 4N53B 4Y5SA 1M06G 5FYVA 4CU8A 3B9CA 5FIXA 2E63A 4FFFA 1G6NA 1IZ3A 2DUOA 3E5XA 4YW1A 2EIDA 4Q4Y1 2XKPA 4RQPA 5FYTA 1J83A 1MS1A 2HEYF 3T1MA 2ZGLA 3POIA 3OPTA 5BNPA 1O4TA 1W6QB 4XDQA 2GH2A 3D3AA 3DECA 4DO0A 3AP6A 1AYM1 2P5BA 3PTRB 1D0HA 4LBQD 1CD3G 4COUA 3ILFA 4K7JA 4PF1A 3J8F3 5L7OB 1Q8OA 1VALA 1GZTA 5FZ0A 3BTAA 5JSPA 2VJXA 1VBD1 1QKQA 1W0PA 3B9IA 1T2XA 2BOJA 2WT1A 5A7QA 2Y34A 1O7FA 2WN2A 2YFZA 5IVVA 3J7MA 1WD4A 1PZ9A 1H8TB 1PO12 1Q8PA 1COV3 4XDPA 1U5IA 1K5MC 4QGLA 3ES1A 2XJSA 4JC1A 4N90A 3E5UA 2ZBJA 4ZPIA 4JV4A 3FWEA 4AVAA 2VW1A 2SBAA 5FCCA 4CE8A 1Q56A 1QJX2 4FQ4A 2XH6A 1OBNA 2VNOA 4CU9A 3QH6A 4WM8B 4PIZA 1VLNA 1JBCA 2VMIA 1D7PM 2VR4A 2WWSA 3RZJA 1JYVA 3POYA 3NO8A 4CP9A 1SLLA 1Y9GA 1YFYA 2B45X 3J8F1 1SG3A 2ATFA 1XOYA 2B9UA 2PHUA 4RR3C 5I91A 5J09A 4OMCA 1VBD3 3IM0A 2VUJA 4AF9A 3NW4A 3M3CA 1B35B 1RHI2 3PIJA 1SLBA 3RGBA 1GQHA 1LECA 1LESA 1LGCA 1RL3A 1VRH1 4G4FA 4IUGA 4Q4V3 3I3EA 2FZ2A 1DYPA 2AREA 4YW2A 1LHWA 1W6PB 1T6GC 3WP5A 3BOPA 3SKVA 1G9FA 4QXHA 4ASKA 1GZWB 3WF2A 4WM7A 3UJQA 1WW6A 5A6YA 4PQQA 4XF9A 2WJSA 4E9KA 5BNPC 1V6JA 3MZHA 5FK8A 1PHMA 3WP4A 5F3EA 4GXLA 5JR2A 3OUJA 3PUAA 4QWNA 3VD9A 4EQVA 2JDMA 1KD7A 1NCRA 5CIRA 1BEV1 3MIFA 2BV4A 4BCUA 4LIUA 1L7LA 1RHI1 2WFF3 3ZFGC 2AENA 4AE2A 1UZ0A 3D0SA 4XBNA 4B1MA 1F4HA 3HJRA 1NYWA 4Q8LA 3AYCA 3NV3A 2VO5A 2RJKA 2FDKA 5LZ6A 3VL9A 1MVQA 2Y38A 3MICA 2OXBA 3KMHA 1YUDA 3VHRA 2OQ7A 3VDAA 5B2GB 2KXLA 5FDBA 4RD7A 3K46A 4AR2A 1W9TA 1MS4A 3U11A 4LBQA 3IDCB 2DVDA 1C8NA 1NT0A 1RVF1 3FBYA 4HMZA 5IAXA 1S0DA 4QPGA 1JZ8A 5FZIA 5A1LA 3H3LA 1D4M3 1UO9A 5GALA 1WD3A 2DCKA 1N1YA 1XE8A 2ZAAA 3GHMA 4FFHA 5H9QA 3FMGA 4PDWC 2JG8C 1DQ6A 5JZGB 1NG0A 1L3JA 3WNNA 4C1WA 4IERA 5FKBA 4ISQA 5F6KA 3KQ4B 2XOMA 3KCYA 3O0VA 1OVPA 2ZOEB 4E2QA 2GC1A 3GBFA 3SCHA 3LSDA 4JGYC 1AXYA 1JXNA 3KM5A 4AFMA 4IESA 4Z2AA 1K12A 2OIIA 3ZSKA 2RM21 4RHV3 1J84A 1UZWA 5EYXA 1O91A 2WYFA 2ZHMA 4TLGA 2JG9A 4XACA 1XSQA 3ACFA 5T5LA 3K4DA 2VD7A 4L0PA 3I2FA 4FPCA 3S7EA 3OB8A 2EAAA 5JZGC 1R083 4PDWB 1CGPA 1DGWA 4FSJA 2XUEA 2ZAHA 1FI2A 1WBLA 1NZCA 3RYRA 1QU0A 2WT2A 1AXZA 3JD71 1O3QA 2RR12 2K2SA 5GLWA 4ZXEA 4AW7A 4BIFA 1UW8A 4QHOA 1EYBA 1F5FA 1OI6A 2QQMA 2VUCA 3ZIXA 3S6PA 1SLCA 3PU8A 1JZ3A 2PA7A 1X36A 1G9CA 3RMXA 2VMFA 5H9RA 1RITA 3ZYHA 3NV4A 1KRIA 4RHV2 5A6ZA 2OPWA 2EIEA 1WUVA 4FOVA 4KI5M 1S2KA 2UU8A 4FPGA 2BZDA 3ETPA 2HKXA 1W9WA 1PK6B 4QT6A 4HK9A 4DZGA 1UQXA 2A3XA 1OSGA 5E88A 4COYA 2YG0A 4PLMA 1GANA 3SEPA 4CUAA 1GMMA 4FP3A 4BXSV 1W6QA 1REFA 1UU6A 3EJKA 4A6OA 1AYN2 3TN93 1UOGA 3LDBA 1UY3A 4XHXA 2P3KA 4ZXKA 4GWJA 1X7NA 4YGCA 1SLAA 4I3GA 4ONUA 5FZEA 1ENQA 3B93A 1RUI1 4CCEA 3THDA 1YYNA 3SCFA 2NQYA 4BU2A 1TEIA 2FZ1A 2YY1A 3JD72 2GMEA 1R1A1 3SLIA 4D7TA 4YZ4A 2RVAA 3VKNA 3MLKA 3WQBA 4QQOA 1BZWA 1OPOA 1CPNA 2R071 1W8HA 2NZ9A 2XLAA 4DQAA 2WO3A 5A1AA 3WD5A 2J42A 1W39A 1N1TA 2NN8A 4LBNA 3ZIWA 1OF4A 3BU0A 4UAPA 4YWAA 2WSUA 3KCCA 2P37A 5FV3A 3W20A 4LBKA 2VL4A 1UY4A 1YFWA 2X5IC 3OY8A 2ZKNA 1U5YA 4NIGA 3IDBB 4LMFA 2IXHA 4AAPA 3AYAA 2ORZA 1SBFA 4P08A 5FYCA 4P9XA 5KXDA 2JIGA 4MLOA 4NN0A 1PMHX 1LKNA 3UK9A 3WW4A 1FMD3 3AZVA 3Q8FA 4GB33 5HBAA 5GZCA 2F4LA 4IGOA 2O14A 5D8AA 4D69A 2OUJA 5AC91 5FOBB 4IEQA 1SDWA 5C3RA 2D6MA 3I59A 1WW4A 4MV2A 5JOYA 4J1XA 2WFPA 4QGMA 2BERA 1XU2A 5C7GA 4CDUC 1YI7A 5CFCA 1IGOA 5KXCA 2WS91 4LEJA 4LO4B 4MXVA 4C1XA 1CAVB 1YFUA 3AKTA 3T4HB 4KG8A 4COZA 4GIQA 4CXYA 2VQ0A 2ZEYA 1FOD1 3ITQA 4NHLA 4XIOA 3ZO0B 4DY3A 1WLDA 4FP2A 3D4KA 3Q8EA 5LBCA 3AC0A 1QXPA 3DF0A 1D2SA 3K3OA 3KT7A 4GJZA 1GV9A 1AL23 2HWB3 4AHXA 5FY0A 4XETA 5DN2A 1QNYA 4NRMA 4WM8A 4FVVA 2ARAA 5FMOL 1JYNA 1IKPA 1DBNA 2PAMA 2WA3A 4LO8A 4N43B 5T5PA 1QH7A 3RNSA 4CP1A 2D3RA 1LU2A 2XL7A 1VRH2 2BNOA 3FHAA 3J7LA 1EV12 1TME1 4XZUG 5L7OC 1CWPA 3FLRA 4AAXA 2PHDA 4BXFA 3RYPA 3H8OA 1WA6X 2XMLA 3ECQA 3NSTA 2VBPA 5JSRA 1FPN3 4JTOA 4PI2A 1DGLA 4CEWC 3H8XA 3OPWA 3BTXA 2XXZA 2RM23 1LU1A 3DYPA 4JDNA 3RPQA 4FXGB 2UURA 4OVEA 1HQNA 4EJRA 4LHSA 2PHXA 5T54A 5F1RA 3OYWA 2E33A 5GM0A 1SEFA 3MV11 5L19A 1PM4A 5IVJA 2Y6FA 2NPIA 1O6UA 4R9AA 4UBHA 3E5QA 2E26A 4JQRA 4F7ZA 2QQWA 4Q4X2 1EAH1 1UZZA 3IIAA 3OGJA 1NLRA 1E5RA 2HWF2 5L9BA 5JOXA 2A3YA 2Q0AA 1FNYA 1RUD2 4MX3A 5A3MA 5CZKA 2BGPA 4XXAA 4LUKA 1VBB3 4F83A 1HRI1 4OUEA 4P5YA 4XMIA 5JWPA 1WMXA 3OEBA 2Q8OA 4BZ4A 3R6SA 3JXSA 1UCXA 3OUIA 2ZEZA 1HN0A 3R0RA 3AP5A 4UFKA 4V2WA 1OOPC 3JBG2 3U1XA 5EXOA 1CVNA 1NCQC 1XU1A 3NNGA 5KHGA 1IS6A 5EPAA 1W8UA 2WAAA 3KZ4C 1SCRA 2A6VA 3VKOA 1OFNA 2JE7A 4AGRA 1QOOA 1DCSA 5A3PA 4P9WA 1NE4A 1SPPA 1IKQA 1G8WA 2RS31 2BUKA 4K21A 1YJKA 1SLIA 2ZMKA 3W5NA 4AFCA 1MZ5A 1K5JA 1I5ZA 1IG0A 4EWDA 1YFXA 2HWF3 4Z92B 1C1LA 4LA3A 1PK6A 1L7RA 4WZCA 2O1QA 1CAWA 2YUEA 3BPZA 4JKMA 4PIXA 3THPA 2ZA9A 2VZRA 3NNLA 4WVVA 5F3GA 2AEYA 2VNRA 5FZHA 2HWE2 5EIYB 2JG9B 1RUC3 2VOVA 2P2KA 5GLUA 2RG4A 5FQ0A 4P9IA 1GP4A 3CHXA 3GZAA 3HBKA 3MIBA 3LKJA 4Y5Z0 1W05A 5FMDA 2VGDA 4J1WA 3FUQA 5LRSA 4BPZA 3ACIA 5F5CA 3VN4A 3GHNA 3TNPB 1UPIA 3GBWA 1O5LA 3H7JA 4NROA 1OPMA 5FYUA 1ZZ6A 4JAAA 1QQP1 4EZHA 1JZ4A 3R4UA 1W99A 4LO5B 3CO2A 3N9NA 4MZUA 1A8MA 1G7YA 5FFOC 2CAUA 2EIBA 2KA3A 3WNKA 4AGVA 2TUNA 3I3MA 2G9ZA 2HWE1 3RG0A 1I1EA 3ROUA 3WLUA 1QJY3 4DXRA 2VQAA 2GH8A 4RN5A 2G9GA 2YGMA 4MGZE 3VBFC 3CMGA 2LRPA 1DGRA 3KGLA 4XQ4A 1GKBA 2W1WA 4OMDA 4YYOA 4COVA 2JD4A 4OHWA 3Q9OA 3VDDB 2QQVA 2V4AA 3UL2A 4OQ9A 2Q1ZB 1CIWA 5FP7A 1RUC2 2BTVC 3IB3A 3VLBB 4XUTA 3ZM8A 3H7YA 1VAMA 2XVGA 3G7DA 3WDTA 3P6BA 2XPJA 1ACCA 1SPPB 1DLLA 3ZYIB 1GYKA 1U5ZA 2JKBA 1NAEA 1OMIA 2ZZQA 4WVMA 2ILMA 3I2JA 1ND3A 1OVSA 4QD2A 4Y20A 5CFDB 3BIEA 2ZGNA 3I3DA 3ORJA 4NIIA 5DUXA 3J4UH 5E6HA 4BK4A 2R7EB 1ENXA 2GU9A 4QPIB 1ZYBA 1SACA 1LJ7A 4QPWA 5DAQA 2D98A 2JG8A 2VZQA 1VBA1 1DLCA 3C7EA 4G9SB 2MEV1 3MPBA 4YFWA 4COWA 4DXZA 3B01A 2GNTA 4ORFA 3HR9A 2WC2A 1W6MB 4BWOA 4FBFA 4NWVA 4XOGA 5IWFA 4L92A 2VH9A 5GLTA 2V5YA 2W47A 3Q8CA 1OH3A 1MZ6A 2ZGKA 4LE4A 1XE7A 1RUE2 4LXLA 4EN0A 2VXRA 2WZR3 1COV2 2O8QA 4LKFA 1AR63 1NX9A 4HVRA 4SBVA 1OUXA 1RUOA 5F5QA 2D6PA 1Q43A 5E8AA 5FY9A 4AG4A 4YM3A 4QU2A 1NLSA 1JZ5A 2Y6HA 3MF6A 3H3UA 4Q4W3 2D6NA 1ZBA3 2WINB 5HCFA 1CZSA 2YFUA 4U2AA 3M3EA 1IQDC 5F7UA 1RUH2 2CDOA 3KT4A 1AR73 2ZACA 3ZN4A 3ZSEA 3ACLA 3UKNA 1CJPA 2OA2A 4Q0UA 2JDHA 1UOBA 4XAAA 3U37A 3T2OA 3N9OA 1BYHA 1OURA 2LS6A 2E7AA 2EXJA 5FY7A 3VD7A 3ZVXA 5IK5A 4OCTA 1W90A 2G9FA 2ZGOA 3JB4C 2UWBA 4X6QB 1QJU1 4ASMB 3LIGA 4AOCA 1RINA 1AYM3 2CSGA 3DPRA 3AZXA 1V6NA 4FI9A 5J36A 5A3OA 1VIWB 2YU2A 3UNPA 2RS33 1HV0A 3WCRA 4DINB 2RS52 4LOTA 2LROA 3U0ZA 4JDMA 5BNNB 1SLTA 1OD3A 4B7EA 1ZBA2 4MOAA 4HLTA 2LUWA 3AYDA 3VKFC 1WBFA 1LEDA 2ZTNA 1LODA 3DUIA 3VHNA 4B8EA 2XL9A 4BB3A 4O9GA 4YGDA 4INDA 4M4RA 2WUHA 1S0FA 3ZXKA 3KT1A 1PM7A 1C3HA 1VBA2 4RGAA 4XF4A 3WNPA 5JI9A 4LPLA 2DU1A 1LOGA 4XJ9A 4ASLA 4FCAA 1VBB1 2Q4SA 3FC0A 3LFMA 3VGIA 1OOPB 3HAGA 1QJU3 4M3CA 1DQ0A 4QX7A 3ALQA 3V0BB 3WXPA 4EN6B 3FBMA 1JYCA 1UMZA 3ILNA 3LD8A 5C5TA 2ADEA 1OFSA 1W9SA 3DYOA 5C9AA 1OKOA 4ES9A 4RYDA 5FZ1A 5LBFA 1DZQA 1ND3B 1PO13 1ULOA 1V6MA 2VMHA 3E6CC 1EAH3 2Y26A 2VVDA 2PELA 1AX0A 3O1MA 1NUKA 4QPIA 2PHLA 3O1PA 3ELNA 2C24A 2YPJA 4QXKA 3WP6A 5ACA3 1PGL2 2GP5A 3LSEA 1MZFA 4D3WA 2UY8A 1V6KA 1UYYA 3RS6A 1JS9A 2EF6A 5A7PA 5HV4A 1VB2A 2E9QA 1H1AA 3NJVA 4OHZA 4A3XA 2HEVF 2WO7A 3WW3A 1BVVA 2VOTA 3O5SA 5JCTA 2DVFA 4HN0A 2F4PA 4NVPA 3WNXA 2OW4A 3HIFA 5C6CA 2Z5WA 3NJZA 4AYUA 5FQ0B 5C3OA 1VBD2 1N47A 1A8DA 2WYSA 1SFYA 2QQUA 3ATGA 3IZOA 3OGVA 4KBBA 5F39A 1QJU2 4QX1A 5JIUA 1UZVA 2Q30A 3BOWA 1UYZA 3TWIA 1JMUB 3U07A 1TNFA 5D8AC 1O3RA 5CEHA 4Y4RA 3VBOA 5CISA 3MO4A 1CX4A 1R082 3VBHC 2R061 1EAH2 2IC1A 2VECA 3X29B 2XG3A 2PHRA 2Q5TA 3KB5A 2NM1A 2HWF1 1QIQA 1RIRA 2HWC3 3I2KA 3N7MA 2V73A 1ULDA 4OHXA 5FO7B 2DU0A 5IK7A 1X33A 3L9JT 3LEGA 4XC9A 1K45A 4XF0A 3F95A 3RYKA 4Z1VA 2ZGQA 2WL1A 3A4UA 2HYKA 3AXDA 3PJQA 2OT7A 2RDNA 1Z0HA 3MF9A 2D97A 1VBC3 4IDZA 2GMPA 3WR0A 4D7YA 2WFF2 2WNUA 3TN91 3AJYA 2E31A 1Z7S2 1F31A 3S5AA 1KQRA 4P9YA 4CDXC 3O14A 3GM8A 2WKKA 4IE6A 4CEWA 2DFCA 2ZEXA 1OQ1A 1W06A 4A3ZA 2QQIA 2YMZA 1DQ4A 2VMGA 4OI0A 3OF1A 3WDYA 1QGLA 5IHRA 4RHV1 2KD7A 3QACA 4P14A 3VHPA 4AZZA 5IVEA 3MUZ1 4CCMA 4GQ7A 1XPWA 2H6CA 3FHIB 3OBTA 1C57A 1ODMA 4IE5A 3BYWA 4ZZ8A 1ENSA 2QTWB 5FZ9A 1XJAA 5EJ1B 4IEPA 3AZWA 4E4DX 4IV3C 1W2UA 4DEVA 2VZVA 3DXUA 3GNEA 4FT8A 1AR92 1TMF3 3LEKA 1XNCA 3T1LA 5HI0A 2BEOA 5FPZA 5J37A 4IV3B 4TLFA 1Z7S3 4XJ8A 5AFEA 2VY0A 3GZTB 3MW2A 1A3KA 2WZR1 2YXSA 4HANA 4LKDA 4LLOA 4B7KA 5C8CC 4CCJA 3N4MA 4UFLA 2FCVA 4GWIA 2ZX4A 4Y1YA 4UXAA 4AK3A 2XWJB 5LWBA 4Z2WA 2ORXA 4QB1A 1PO22 2EXKA 3NAPB 1NXMA 3K75B 4D6RA 3K4ZA 4M0HA 5TSWA 4FAHA 1RUF2 4LQRA 1NA1B 2IXLA 3MIDA 3A0KA 4IEZA 4HT1T 1US3A 2BVBA 3LE0A 4CCCA 3B94A 5KHKA 3MIHA 1S0BA 1H2NA 4PIYA 4CDQC 4YZ5A 2WFF1 2CWMA 3BB6A 1POV0 3K48A 3NVCA 4Q5OA 3RJ2X 4FTSA 1FMD2 4GB32 4HZFA 4A7KA 4E4ZA 2CYFA 4JTNA 5A3NA 3M1HA 2XJUA 5DPNA 3BUCA 3LOIA 1FAYA 1DQ1A 1PNFA 5A32B 1YLLA 1OKQA 4QQ2A 1PGW1 1D2QA 3AXEA 5C70A 1S0JA 3E6DA 1OH4A 4DNYA 3THTA 4X6RB 1US2A 1MEC1 1F4AA 5IW0A 2W95A 5FJKA 1ASJ1 1HRV1 1LGNA 1OLMA 1PMIA 1S0EA 2WNEA 3ZR6A 4MG2A 4YM1A 1LTEA 4DIQA 2VOKA 1UYXA 2DDUA 4YG3A 1YIPA 1RUF3 2ZGRA 3SCGA 4YSFA 2C26A 1AL22 5FAXA 3I4IA 3MEPA 5BY5A 4B29A 5FZBA 3SHRA 4RQPB 4D0QA 1H9WA 4Z82A 5DUWA 1QMJA 5CFCB 2WDBA 1W8OA 3OCPA 4S2DA 4EN7B 3RZLA 2GZWA 2JJ6A 2B9VA 1YQ5A 4AFDA 4MGTA 1NQJA 4AWDA 4KU8A 5FJHA 5A1FA 4BLJA 3FZ3A 3ZXFA 1WCUA 5FYIA 2JICA 4B4RA 3N9LA 4HPKA 1B09A 1H4GA 4UYBA 2A6WA 2W68A 3POEA 3MGUA 3GJAA 3CQOA 4OFGA 5FZGA 4CYDA 5HXMA 4NIHA 2ZABA 3KV9A 1ASJ3 1HRV3 2VBDA 2NYYA 3PUQA 1X8MA 4BQ1A 5ISLA 3FUOA 5EJ3A 1TNRA 2CWSA 4JVAA 3VBFA 3UGGA 2ZZJA 2VAUA 4XPVA 2HBTA 3ZXGA 4KNCA 2R043 1I6XA 1U12A 2W92A 4E2SA 4E8CA 2W39A 4F8AA 4ZU4A 3VUOA 4NHXA 3NV1A 2CGNA 2BBAA 4IGQA 3U75A 2G19A 1K5MA 1SQ4A 1AYN1 2Y6GA 1W2AX 4QGNA 2YC4A 1OLQA 3N3HA 4P5HA 4Q1PA 5FP3A 3N7KA 4PCRA 1IS5A 1QXJA 3HN3A 4AL9A 3LGRA 5LW9A 3DKWA 3QH7A 1RUG2 4IV1C 4LBLA 3SQOA 4B4QA 1SCSA 4Y1XA 2TBVA 4XJAA 3FFQA 1VAVA 5KR7A 1HIXA 3AZZA 3J9SA 2NLRA 4CCLA 1ASJ2 1HRV2 2B8MA 5C4WB 4BLIA 3BIWE 3JBG3 2BFUS 3ZN6A 4XAEA 5JSOA 1KDMA 3I3BA 4Y1UA 4UT5A 3NV2A 4AEDC 2PYTA 5T52A 4B3NA 4XQDA 1TVGA 4N43C 2PLV3 2HWB2 4AEMA 1ZRDA 5CBLA 2YZ4A 3IMMA 1GNHA 4Q27A 3D0JA 4JHZA 3KV4A 4XJWA 4NJ4A 4QM8A 5FBZA 4Q8KA 4AFBA 1VBC1 5J98B 1ZRIA 2VMEA 2JB8A 4IE0A 3T2PA 3V65A 3H50A 3LFIA 2E7TA 3C7HA 1LCLA 3I2IA 4XCAA 2DTYA 4EZ4A 3J26N 2VUAA 1VRH3 5FYBA 2CGOA 2JENA 3ZYBA 1BK0A 5LK5A 4CPBA 4LHLA 5I8TA 1O3SA 3EYPA 2ZX3A 4QXBA 3RVHA 1TQ5A 1YRZA 2V4VA 3AMQA 4LIVA 4A6SA 1WZXA 1IOAA 1XNKA 5AVAA 4QB6A 1M4WA 1Y43B 1AVBA 1ULGA 2D93A 3RSJA 4DRVA 3OBZA 4MGIE 1YXWA 2WRAA 3DPRC 2X8KA 5AC92 5AFBA 4RR3B 4LHKA 4I30A 2A71A 1POQA 2CY6A 4GZ9A 3I2OA 1SZBA 2HBUA 3CEWA 4OZOA 2GALA 4IEVA 3TAYA 4PDWA 3B7MA 1GICA 4NAMA 2VMCA 2JDKA 4GD4A 3ZDVA 1Q5OA 2HWB1 2OUHA 3JUUA 2FQPA 5IJRA 1W8TA 4NHKA 5K7PA 3UT0A 1OF3A 4DS0A 1AHSA 2YU1A 2YYOA 1Q8QA 1W8ZA 2FMYA 2GC3A 1K5MB 3SEEA 4A44A 4E8DA 3L2HA 1WA4A 4O7XA 1NKGA 2QZ2A 3ACHA 4PLOA 2QDNA 4Q4V1 4XVHA 4W50A 1R091 4CRQA 5C5UA 1VAKA 1EY2A 3HT1A 3LWCA 2W9XA 1GBGA 1RTVA 3AVSA 3QBQA 3W21A 2X29A 3PL0A 2WSVA 1OHFA 4UFMA 3B69A 5C9AC 3IIIA 1HXS3 2OX0A 4ISRA 1J59A 2QZ3A 1GZ9A 1YIFA 1O4YA 2XVKA 3PUHA 5JXGA 2ET7A 1LB2A 4A7ZA 2AH2A 4ZZ5A 1JW6A 4QMAA 1JOJA 4D7SA 3RJRA 3EQEA 4KWLA 2ZXQA 2BRTA 1J3PA 4NWWA 2WQ8A 4B4PA 1JZ2A 1KGYA 3NJYA 4LHNA 4UW4A 2YGLA 5FR3A 2Q8EA 3WCSA 4N53C 1A6CA 3LEMA 3K2OA 2BWAA 1RUJ1 3N36A 5JVVA 1RUE3 3HT2A 1JOBA 3BALA 4W8JA 3ILRA 3LCPA 1MACA 1BLZA 2WR9A 3AKSA 4LBJA 3ZXLA 5IVCA 3IN9A 2NP0A 4Q4W2 4GKYA 3VBSC 3S5QA 5JR7B 1LOCA 2BFUL 1HXS2 4AEJA 3C2UA 2XHNA 5FZLA 5A3UA 2F17A 3LB9A 2ADDA 1HLCA 4NRPA 3C7FA 3LPGA 5DQ0A 4C0BA 5J96B 5KXEA 3BKZA 2G1MA 1QDCA 1W2OA 2A6ZA 5JXJA 2JKXA 4Z07A 2PHWA 4OZXA 5CG8A 4A45A 4NIDA 3WV6A 1Y4WA 2Y60A 4YW6A 3BI3A 4CP9B 4Q4W1 2CGPA 1QOSA 2VXJA 1XYPA 2JWPA 4AI9A 5LBBA 4MADA 1EUTA 3MYXA 1HXS1 3DXTA 3KWVA 2D3SA
chains in the Genus database with same CATH topology
3PURA 4EZ4A 5A7QA 5FYZA 5IVVA 5FYBA 4XDPA 2PXJA 5A3NA 2YBPA 5FP7A 5FZMA 2GP5A 5F5AA 4QXBA 3RVHA 5IVBA 3PU8A 4LIVA 5A7OA 5A7PA 3AL6A 5FPBA 4BXFA 3N9PA 2XMLA 5FUNA 3KVBA 2YBKA 4EYUA 5IW0A 5FJKA 5FXWA 3OPWA 2XXZA 5A3TA 5E6HA 4DIQA 5F39A 5FPUA 3N9MA 3K3NA 5FP8A 5FZOA 4CCNA 2XDVA 4D6SA 5IVYA 5CEHA 4GD4A 4Y4RA 3PU3A 5FZBA 5IVJA 5FPAA 5IWFA 3U4SA 4V2VA 2YPDA 2YU1A 4LXLA 4C8DA 5K4LA 3LDBA 4QXHA 4ASKA 5FJHA 5LY1A 5A1FA 5F5CA 4IGPA 5FZ4A 5FUPA 5FY9A 5FYIA 5FZ7A 2GP3A 2OT7A 3N9LA 5FZEA 5FZOB 5FZGA 5F3EA 3AVSA 5FXXA 3ZPOA 4BU2A 3KVAA 5FP9A 3PUAA 5F32A 5FY8A 4QWNA 3KV9A 3PUQA 4LITA 5FZ8A 5ISLA 2OX0A 5A3WA 5ANQA 4URAA 4XDOA 5FP4A 4LIUA 4E4HA 2OQ6A 5A7WB 4QU1A 5A7NA 4V2WA 3UYJA 4GJYA 4NUBA 4UF0B 5FYHA 5FZKA 5FXVA 5FY4A 2Q8CA 4IGQA 5FPVA 5FWEA 4Y3OA 3N9OA 1VRBA 5F37A 3AVRA 5FP3A 5FBJA 5FY7A 3NJYA 5F2SA 5FZFA 5IVFA 3PDQA 5FV3A 5A3PA 5LW9A 2OQ7A 2Q8EA 4D6QA 4QX8A 5IVEA 4CCMA 2YBSA 3K2OA 3ZLIA 5F3CA 4AAPA 5A80A 5F2WA 5FZ9A 2W2IA 2Q8DA 2YU2A 5FYCA 5FZIA 4HONA 5A1LA 5IVCA 3DXUA 4UF0A 3U78A 5FZDA 5KR7A 5F3GA 5FZHA 5FYYA 4IGOA 2XUEA 4CSWA 3PUSA 5FY5A 4CCLA 5FWJA 5F3IA 5FZLA 3KV5A 5FYVA 5A7SA 2WWJA 5FYMA 3KV6A 5FZCA 4TN7A 4CCOA 3N9QA 5FYUA 5FXZA 4CCJA 5FYTA 4EZHA 5FYSA 5LWBA 4GAZA 4Y33A 3OPTA 5FZ6A 3N9NA 4DO0A 2WWUA 4QX7A 4CCKA 5A7WA 4HOOA 5LY2A 3KV4A 4D6RA 4GJZA 5FPLA 3PTRB 2P5BA 3K3OA 2VD7A 3LD8A 5FZ3A 4BISA 4CUGA 4QXCA 5FY1A 4AI9A 2OS2A 5FZ0A 5F5IA 5FZ1A 5FY0A 3AL5A 3DXTA 5FZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUR A;  4EZ4 A;  5A7Q A;  5FYZ A;  5IVV A;  5FYB A;  4XDP A;  2PXJ A;  5A3N A;  2YBP A;  5FP7 A;  5FZM A;  2GP5 A;  5F5A A;  4QXB A;  3RVH A;  5IVB A;  3PU8 A;  4LIV A;  5A7O A;  5A7P A;  3AL6 A;  5FPB A;  4BXF A;  3N9P A;  2XML A;  5FUN A;  3KVB A;  2YBK A;  4EYU A;  5IW0 A;  5FJK A;  5FXW A;  3OPW A;  2XXZ A;  5A3T A;  5E6H A;  4DIQ A;  5F39 A;  5FPU A;  3N9M A;  3K3N A;  5FP8 A;  5FZO A;  4CCN A;  2XDV A;  4D6S A;  5IVY A;  5CEH A;  4GD4 A;  4Y4R A;  3PU3 A;  5FZB A;  5IVJ A;  5FPA A;  5IWF A;  3U4S A;  4V2V A;  2YPD A;  2YU1 A;  4LXL A;  4C8D A;  5K4L A;  3LDB A;  4QXH A;  4ASK A;  5FJH A;  5LY1 A;  5A1F A;  5F5C A;  4IGP A;  5FZ4 A;  5FUP A;  5FY9 A;  5FYI A;  5FZ7 A;  2GP3 A;  2OT7 A;  3N9L A;  5FZE A;  5FZO B;  5FZG A;  5F3E A;  3AVS A;  5FXX A;  3ZPO A;  4BU2 A;  3KVA A;  5FP9 A;  3PUA A;  5F32 A;  5FY8 A;  4QWN A;  3KV9 A;  3PUQ A;  4LIT A;  5FZ8 A;  5ISL A;  2OX0 A;  5A3W A;  5ANQ A;  4URA A;  4XDO A;  5FP4 A;  4LIU A;  4E4H A;  2OQ6 A;  5A7W B;  4QU1 A;  5A7N A;  4V2W A;  3UYJ A;  4GJY A;  4NUB A;  4UF0 B;  5FYH A;  5FZK A;  5FXV A;  5FY4 A;  2Q8C A;  4IGQ A;  5FPV A;  5FWE A;  4Y3O A;  3N9O A;  1VRB A;  5F37 A;  3AVR A;  5FP3 A;  5FBJ A;  5FY7 A;  3NJY A;  5F2S A;  5FZF A;  5IVF A;  3PDQ A;  5FV3 A;  5A3P A;  5LW9 A;  2OQ7 A;  2Q8E A;  4D6Q A;  4QX8 A;  5IVE A;  4CCM A;  2YBS A;  3K2O A;  3ZLI A;  5F3C A;  4AAP A;  5A80 A;  5F2W A;  5FZ9 A;  2W2I A;  2Q8D A;  2YU2 A;  5FYC A;  5FZI A;  4HON A;  5A1L A;  5IVC A;  3DXU A;  4UF0 A;  3U78 A;  5FZD A;  5KR7 A;  5F3G A;  5FZH A;  5FYY A;  4IGO A;  2XUE A;  4CSW A;  3PUS A;  5FY5 A;  4CCL A;  5FWJ A;  5F3I A;  5FZL A;  3KV5 A;  5FYV A;  5A7S A;  2WWJ A;  5FYM A;  3KV6 A;  5FZC A;  4TN7 A;  4CCO A;  3N9Q A;  5FYU A;  5FXZ A;  4CCJ A;  5FYT A;  4EZH A;  5FYS A;  5LWB A;  4GAZ A;  4Y33 A;  3OPT A;  5FZ6 A;  3N9N A;  4DO0 A;  2WWU A;  4QX7 A;  4CCK A;  5A7W A;  4HOO A;  5LY2 A;  3KV4 A;  4D6R A;  4GJZ A;  5FPL A;  3PTR B;  2P5B A;  3K3O A;  2VD7 A;  3LD8 A;  5FZ3 A;  4BIS A;  4CUG A;  4QXC A;  5FY1 A;  4AI9 A;  2OS2 A;  5FZ0 A;  5F5I A;  5FZ1 A;  5FY0 A;  3AL5 A;  3DXT A;  5FZA A; 
#chains in the Genus database with same CATH topology
 3ZFF A;  1FV3 A;  2RS3 2;  3WY6 A;  3WG2 A;  5FYZ A;  1N1V A;  3LDK A;  4LO7 A;  5E1R A;  2QCS B;  4RS5 A;  5FZM A;  1JHJ A;  2P3J A;  1CAU B;  3MW3 A;  1UMH A;  1UX6 A;  4W65 A;  1EP0 A;  2Q1M A;  2VPV A;  3WT3 A;  3SH5 A;  5BNO B;  3OOX A;  1BK1 A;  1OA4 A;  3M2M A;  4Y24 A;  2WO2 A;  5FPB A;  4DXS A;  4Y1Z A;  1S0I A;  1QWR A;  3H0O A;  2NMO A;  5G05 L;  4URT A;  5ACA 1;  1LNS A;  5LA0 A;  4FXK B;  5FXW A;  3PVE A;  1FV2 A;  2EIC A;  2D43 A;  2IFW A;  3IPV B;  3VKL A;  2YC2 A;  4RFR B;  2A70 A;  4IL7 A;  1YQ2 A;  2B5H A;  2IZW A;  1RJ7 A;  3RI8 A;  2HWC 1;  2JE8 A;  2WZ8 A;  3TRS B;  3FHQ A;  1EPZ A;  2BDR A;  3EO6 A;  4MHU A;  2FDG A;  3OY8 B;  4IEU A;  4KQ7 A;  2VNV A;  4RFT 0;  2YPD A;  4CDU A;  2WS9 3;  4I0A A;  3WG1 A;  5LY1 A;  1SBD A;  3W9A A;  4AVB A;  1JYX A;  2V72 A;  2X10 A;  5GZG A;  1UMI A;  5FZ4 A;  4JX0 A;  2XQR A;  2L9L A;  1DF0 A;  1G9A A;  4YLZ A;  4R4Z A;  2ZGM A;  5FZO B;  3I2H A;  4FPF A;  1QJF A;  4ATF A;  3MW4 A;  1HJG A;  3J7H A;  4MH0 E;  4JKK A;  1AUY A;  5JDB A;  2LTN A;  5T55 A;  1UX7 A;  5ABJ B;  4YGE A;  1ZZB A;  2MEV 2;  2DBN A;  5I0R A;  1XRU A;  4CDQ A;  5L9R A;  4QU1 A;  2TNF A;  4L2N A;  3ZFF C;  3KD4 A;  2ZHL A;  3AB0 A;  3ZFE B;  2BOI A;  5FXV A;  4ET7 A;  5FO8 B;  5ACA 2;  5FWE A;  4RGG A;  4RS5 C;  5JXI A;  5LEK A;  3KS7 A;  5CB7 A;  5CG9 A;  3ZYR A;  5IK8 A;  4CDW A;  2W46 A;  3VL8 A;  4UI9 L;  2W94 A;  4YW3 A;  2VC9 A;  4DUX A;  1RXF A;  1ZBE 2;  5T3N A;  3JCI A;  2D6K A;  3AP9 A;  1UN1 A;  5DZG A;  2RS5 3;  3JQX A;  2HWC 2;  3NNF A;  2WNV B;  5F2W A;  2W08 A;  4P9G A;  1MS8 A;  4AI2 A;  3VDD A;  4AQS A;  1JYW A;  1GQP A;  1SDD B;  2J1U A;  4JGZ B;  1S4C A;  4UF0 A;  1YHF A;  3SIS A;  1I9R A;  1VBC 2;  2AR6 A;  1S2B A;  4AI3 A;  3N35 A;  2R0F A;  3VD4 A;  2P4E A;  4FTE A;  5FWJ A;  2R16 A;  1RJ8 A;  5IYY A;  1GWM A;  1HW5 A;  2MEV 3;  2O8O A;  4YFZ A;  1RUD 1;  3NQH A;  3I2G A;  2Y0O A;  3LAG A;  3OJB A;  2CTV A;  1ZM1 A;  4IE7 A;  3RWN A;  3CJI C;  1J1L A;  4WM7 C;  1HJF A;  5I0U A;  2W1U A;  1GR3 A;  3HWJ A;  3PNA A;  2WNO A;  3IWZ A;  3NL1 A;  4JGZ C;  1ZBE 3;  3SH3 A;  5BXX A;  2QE3 A;  2VZP A;  1CPM A;  1NQD A;  4ZU5 A;  3HMY A;  4AVT A;  2WNV C;  1YC6 1;  3IDE A;  1JU3 A;  4RA0 A;  4XHB A;  4Q26 A;  1ZBE 1;  2GSY A;  3A0N A;  1NCQ A;  5LA9 A;  2RDQ A;  2PQS A;  3DN7 A;  2DUR A;  2VCB A;  4QDQ A;  3T0A A;  5LK7 B;  2ZKL A;  5GLZ A;  2FD8 A;  4RS5 B;  4CDW C;  5IVB A;  1REE A;  2I2S A;  2I45 A;  3HQR A;  5LA2 A;  3ZFE C;  2B46 X;  5BNO A;  5A33 B;  2DFB A;  2UWA A;  5KHI A;  1H30 A;  1CJD A;  2YBK A;  3OG2 A;  1XXN A;  2DUQ A;  2QQK A;  4FQZ A;  2FMD A;  1B35 A;  3GDB A;  4HSJ A;  4LO6 B;  4MXW A;  1PK6 C;  5A6Q A;  3E97 A;  3WF1 A;  1KS4 A;  3VZO A;  5FK7 A;  1AX1 A;  4XW3 A;  5FPU A;  1ENR A;  5FLJ A;  1LHO A;  3WOG A;  1W6N B;  2BNN A;  4TSV A;  4FPO B;  5JOW A;  3ACG A;  2QQN A;  4QDR A;  5EHD A;  1JU4 A;  4FOY A;  1GUI A;  2XLG A;  2VOX A;  3UV9 A;  1RUJ 3;  1N3Q A;  3QD6 A;  3CNA A;  4XFA A;  3EHK A;  4Q4Y 3;  3RQ0 A;  3S7I A;  5H9S A;  2ZX1 A;  4XUN A;  4AED A;  3LQC A;  2UYB A;  2I74 A;  3JD7 3;  3ME2 A;  1W8N A;  4KG0 A;  2VVF A;  4D94 A;  3CLP A;  3O1U A;  2VW2 A;  3FE5 A;  3T30 A;  4K9S A;  1UY0 A;  3VBR A;  5FY8 A;  3VDB A;  1BMV 1;  1DYO A;  1UXX X;  2C9A A;  2QDR A;  4WZF A;  5JZG A;  2UYA A;  3A21 A;  1FOD 2;  2P6C A;  5FP4 A;  4DEQ A;  2RHP A;  2ENR A;  1BEV 2;  5A7W B;  2RJL A;  2JD9 A;  4YM0 A;  1PIV 3;  3WQ7 A;  1W03 A;  1NXD 1;  1KS5 A;  1WCK A;  1AZD A;  4MET A;  4AGG A;  4OQ8 A;  3CF6 E;  4Y3O A;  1QOT A;  4JDO A;  3FLT A;  4JHT A;  3OSD A;  4D8M A;  5F37 A;  4TXW A;  4GA9 A;  5J1X A;  3TEY A;  2W5F A;  4XIL A;  4HFS A;  4HKO A;  2JDP A;  1RUJ 2;  2VE1 A;  1QJY 1;  3ZX7 A;  2VZO A;  1BKZ A;  1OA3 A;  1NY7 2;  5AVP A;  1GQG A;  5F3C A;  2PN5 A;  3RZK A;  1ZRC A;  3T09 A;  1AR9 3;  1TMF 2;  5JLV A;  4DMI A;  2W2I A;  1GWK A;  3H9A A;  2ZX0 A;  3MPP G;  1LEM A;  2JG8 B;  4CEY A;  1WCQ A;  3AFK A;  2A5Z A;  4K1Z A;  1F5J A;  3KSC A;  3BN6 A;  1RC6 A;  3RFR A;  5EFU A;  4GH4 C;  3KLS A;  4FTB A;  1AR9 1;  1GNZ A;  5FY5 A;  4LUM A;  4Z8B A;  5DAW A;  4OHY A;  3Q8A A;  5A33 A;  2BVV A;  2PLV 1;  5DZF A;  1W3V A;  2D6O X;  4QQH A;  1KIT A;  4CTE A;  1DDL A;  3DV8 A;  3OGR A;  3QOP A;  3UKT A;  3AP4 A;  4TN7 A;  4A42 A;  4QQP A;  5JAX A;  1UKR A;  2IXJ A;  4AVC A;  2JDN A;  2JDY A;  3H42 B;  3LZZ A;  3LEI A;  4XBL A;  1ZRE A;  1KFU L;  4Q4X 1;  3JBG 1;  1ZA7 A;  2WWU A;  4QPY A;  4HOO A;  2FDF A;  3VBR C;  1O5U A;  1J58 A;  1QDO A;  1DG6 A;  4LK7 A;  3MLL A;  2DF7 A;  1U5X A;  4HET A;  5FLI A;  2MNG A;  3DKQ A;  4S2H A;  4XQW A;  5A7N A;  3USU A;  3ZFG A;  4AHZ A;  3V0A A;  3JU9 A;  4MSV A;  1ZX5 A;  1PX4 A;  3MDP A;  1W28 A;  1TMF 1;  2WQZ C;  2JXA A;  3PTY A;  2P34 A;  4WVM B;  3ZDS A;  1OUS A;  2QFE A;  4I0W B;  5A7O A;  4Y22 A;  4CDU B;  4IEX A;  2VVE A;  4K8R B;  3KVB A;  4WVW A;  3VZM A;  2WZE A;  1GOH A;  1BQP A;  3WW1 A;  1QJE A;  1RMU 2;  4KWJ A;  1QJX 3;  2PLV 2;  1BHG A;  1ZZ9 A;  3M4F A;  4CA9 A;  5KBF A;  5FZO A;  3VBS A;  4GH4 A;  3BVC A;  3KCX A;  3ZXE A;  3MIE A;  4K8F A;  3GXU A;  3WNO A;  3ZKY A;  2DWR A;  2W87 A;  2E6V A;  4FOW A;  4K6B A;  4YGB A;  5LBE A;  3U4S A;  3ZN6 B;  2X5I B;  3WUD A;  1DGR N;  1RUD 3;  3WNL A;  4M01 A;  5K0U A;  3URF A;  2YB7 A;  1R64 A;  1K42 A;  3P1I A;  4PI0 A;  1H2M A;  3I8T A;  4CVU A;  2Y6L A;  2RS1 3;  2J1S A;  3CU7 A;  2MPF A;  2OPK A;  3D82 A;  4M0N A;  5BYN A;  4P00 B;  1UYP A;  4QQL A;  1LR5 A;  5DG1 A;  4AVV A;  5F32 A;  4H55 A;  1AR6 1;  1AR8 2;  4JKL A;  1MS0 A;  2WII B;  4HKW A;  1F8V A;  2GMM A;  4XDO A;  5IFP A;  1N1S A;  2ETE A;  3AKP A;  4XUP A;  5FRE A;  3P3N A;  1VBE 2;  4NPM A;  4NUB A;  4UF0 B;  4BH9 A;  1HV1 A;  5BV6 A;  2DCJ A;  2DCY A;  1W8W A;  5EYY A;  2H0V A;  4EN9 B;  4HL0 A;  2AEZ A;  2VCM A;  3VBU A;  3OEA A;  2J1V A;  1WME A;  5F2S A;  3ASI A;  1V0A A;  3UET A;  4NOT A;  1E5I A;  2BBV A;  2K0G A;  4XZP A;  1C5H A;  1K3I A;  4Q29 A;  1EPW A;  1UIJ A;  4UW6 A;  1XC6 A;  1YNA A;  2WT0 A;  3G6J B;  1RGS A;  4XF1 A;  2XON A;  3ZYG A;  4ZHN A;  5EQU A;  3BTY A;  4JCK A;  4E4S A;  1BBT 2;  5ABJ C;  1QEX A;  1APN A;  5L36 A;  1PVC 3;  4HON A;  3VZN A;  5F9T A;  1O8S A;  3U78 A;  1VMJ A;  2WAO A;  1MS9 A;  3I54 A;  1ZZ8 A;  4HVO A;  4CSW A;  3ZXJ A;  1YQ8 A;  1AR8 3;  1HQL A;  2Y6J A;  3GAL A;  1D4M 2;  5D21 A;  4LR4 A;  4NHY A;  4AED B;  3M3O A;  4XXP A;  3S0M A;  1NOV A;  5CU1 A;  1XNB A;  1G9B A;  3GBG A;  2WWJ A;  4Q0P A;  1WLW A;  1W9Y A;  4N7I A;  2QKD A;  2P3I A;  3ABZ A;  1W8F A;  3N9Q A;  1UF2 C;  5C4W C;  3KHC A;  2HH9 A;  2VZT A;  4AQT A;  1POV 1;  2PQQ A;  2ZHN A;  4GAZ A;  3HOB A;  1VBE 1;  3POG A;  1FX5 A;  5A7W A;  3D5O A;  1V00 A;  5SV5 A;  2GDF A;  1QQP 3;  1RVF 3;  4QXC A;  5LCW L;  1POV 3;  4Q0Q A;  2VMD A;  1BBT 3;  3BOD A;  3V56 A;  4OUS A;  1Y3T A;  5C3S A;  4YRD A;  4J25 A;  2GND A;  2D5F A;  4LJH A;  4NIA A;  2DVG A;  4YVS C;  1RUN A;  4LT5 A;  1Q3E A;  2PXJ A;  4BJ0 A;  5M0T A;  4X8N A;  1PO1 1;  4MGS A;  1S1A A;  2WZP P;  3ZSJ A;  5T5O A;  4RGK A;  5C8W A;  5T50 A;  1OLR A;  1JZ7 A;  3LOB A;  2VUL A;  2VTX J;  5AC9 3;  1W0O A;  1H8T A;  3K4A A;  5HXV A;  1G9D A;  4OI1 A;  2J7M A;  3VKM A;  4UOJ A;  4JZR A;  3AX4 A;  2W3J A;  2X5I A;  3JQW A;  4H2A A;  1C8M 1;  4LBO A;  3RZM A;  4O65 A;  3O1V A;  3H1M A;  2YHJ A;  3H8U A;  3WEZ A;  3N7J A;  2ZMN A;  2NMN A;  1QHD A;  5A3T A;  1LUL A;  3TB0 A;  3AFG A;  2XJQ A;  1PVC 1;  1PMJ X;  4FPE A;  3WDU A;  5J3U A;  1BMV 2;  5FP8 A;  1JYT A;  1Z7S 1;  3FJS A;  4DY5 A;  2DVA A;  2R30 A;  2AUY A;  2W1Q A;  3VZJ A;  2PMW B;  4NAO A;  2CV6 A;  4YNI A;  5B4X A;  4ZON A;  2CDP A;  3WDX A;  4I2O A;  1C5I A;  5GKA C;  4AHW A;  4A7Y A;  1FYU A;  1OQD A;  4XCB A;  5CFC C;  4C8D A;  5C8C A;  4RL7 A;  4OUL A;  4BE3 A;  4RQP C;  1ZZC A;  4SLI A;  4YVW C;  2R06 3;  3VBU B;  3GCW A;  5FZ7 A;  5CVR A;  1C8M 3;  2J1E A;  4BA6 A;  1CAX A;  4XFG A;  2VZU A;  1URX A;  2BYV E;  2RR1 1;  2W1S A;  3VZL A;  2OVU A;  1C1F A;  5DUV A;  4FO9 A;  1V70 A;  2WNV A;  3H8R A;  1WKY A;  2JB4 A;  3MIG A;  4LKE A;  2BGC A;  5L7O A;  3UYJ A;  1ULC A;  1O3T A;  5FYH A;  4UBG A;  1PGW 2;  4Y22 B;  4Q0V A;  3NWK A;  4I3P A;  5FY4 A;  3TYJ A;  2J1T A;  1J1T A;  2P3Y A;  2XJV A;  3RRD A;  4TYS A;  4UW5 A;  3B3Q E;  4XIK A;  4XTP A;  3AVR A;  1LOB A;  4JRA A;  1MEC 2;  5IVF A;  3TEW A;  2EIG A;  4IV1 B;  2EAL A;  4D6Q A;  3POF A;  4BQW A;  5DDJ 3;  5BNO C;  3CJX A;  1S0G A;  1F9K A;  1JOP A;  1FPN 1;  1AJO A;  2YV8 A;  3ZLI A;  3V0A B;  1ZNP A;  3EB7 A;  1WCS A;  2H0B A;  1B35 C;  2KM2 A;  4LOS A;  2WBK A;  1DU3 D;  5EWS A;  2Q8D A;  1W9F A;  4CU6 A;  2R06 2;  1GOF A;  5C9A B;  5JPN B;  1WLT A;  2HLE A;  4KWK A;  4BIO A;  1GWL A;  1RUF 1;  1QJX 1;  3GCX A;  3TBD A;  3RI9 A;  3C8X A;  1KFX L;  4ZS2 A;  1UL9 A;  2Y64 A;  3PUS A;  2JDZ A;  4ZY9 A;  5F3I A;  3CZU A;  1YQC A;  1VBA 3;  3T0B A;  3HNB M;  4JQT A;  3R4S A;  4ZS3 A;  3VD3 A;  1HN1 A;  2EA7 A;  1JHN A;  4H3W A;  5FO9 B;  4HKL A;  3MUY 1;  5FYM A;  1O8P A;  5FZC A;  5D1I A;  2RE9 A;  1UY2 A;  3GZU C;  1E5H A;  1AL2 1;  2ZPX A;  5DMY A;  4NO4 A;  3USS A;  3WQ1 A;  1BXH A;  4EE2 A;  1LOA A;  5FZ6 A;  3WG4 A;  1VMH A;  3B5L B;  2IFR A;  5LY2 A;  1QY4 A;  1PZ7 A;  3HQX A;  1V9U 1;  5FKC A;  5BPX A;  4C90 A;  1N3P A;  3WP3 A;  5FY1 A;  2OS2 A;  2DUP A;  4W6W A;  3AL5 A;  1W6O B;  1UXZ A;  2DYC A;  1ND2 C;  2D7F A;  2ZGS A;  2DCT A;  3ENR A;  3F2Z A;  3I2D A;  1OOP A;  4M3C B;  4N8M A;  4U36 A;  2RMU 1;  4XBQ A;  5CNA A;  5FMC A;  3TEX A;  4CXW A;  3V0B A;  3U4X A;  1IPK A;  2SLI A;  3NNM A;  2C5D A;  4HPK B;  1ALY A;  2BU9 A;  4P9L A;  4X8P A;  5CKM A;  1LHV A;  2FCT A;  1YI9 A;  3I7D A;  4IEO A;  1PGS A;  1GFF 2;  1GZW A;  1ST8 A;  2YDE A;  3AMP A;  3BPS A;  1HX6 A;  5E89 A;  4YW7 A;  5EV7 A;  5FMB A;  1YEW A;  4EWE A;  1WW7 A;  5FZA A;  1GZC A;  4IV1 A;  5C3P A;  5ERL A;  5DDJ 1;  2J1A A;  4CDX B;  5I8S A;  2Z79 A;  3RZZ A;  1HKD A;  4HG6 B;  2XGX A;  4CEY C;  1C4R A;  2HJI A;  2XBO 1;  3A23 A;  3R05 A;  1LEN A;  1MR5 A;  3OD4 A;  1CES A;  1W0N A;  3WDW A;  1FPN 2;  2Y0I A;  3K3N A;  2BJS A;  1H0B A;  4QHB A;  2RJ2 A;  4LBQ B;  2EXH A;  3O0X A;  2IXI A;  3M70 A;  4AQ2 A;  3TEZ A;  4QPG B;  1Y9M A;  2WS9 2;  3W59 A;  4QX0 A;  5DXD A;  5ANN A;  4MXW B;  4PBP A;  5DAX A;  3WDV A;  2RMU 3;  5FPA A;  3GGL A;  5BUV A;  1NZI A;  2WLQ A;  4BME A;  4KH9 A;  4PJY A;  2BW8 A;  4JGY A;  3SKJ E;  1OXC A;  4V1P A;  5K4L A;  4QKB A;  3GZE A;  3DCQ A;  1HDK A;  4Q4X 3;  5FUP A;  3ZYP A;  3AMN A;  5C8C B;  4PLN A;  3SIT A;  4HN1 A;  3ZPO A;  2R1D A;  4AVS A;  4BQY A;  2VTX A;  1I3H A;  3AJZ A;  4LA2 A;  4DXT A;  4YW5 A;  1NE6 A;  1R1A 2;  2XBO 3;  3EBR A;  1QF3 A;  3EXU A;  3U10 A;  4IE4 A;  5EP9 A;  1ND2 A;  1VPH A;  1X50 A;  3DGT A;  5H9P A;  2PAK A;  3WG3 A;  1I5P A;  1DP0 A;  4GJY A;  5B4N A;  3ES4 A;  2FDI A;  5FZK A;  4QX5 A;  3PIG A;  1HB4 A;  2Q8C A;  2BPA 2;  3KHB A;  4HVQ A;  2VQT A;  4OI2 A;  4FFG A;  1VRB A;  2JEM A;  3DPR B;  3D8C A;  3LA2 A;  5FBJ A;  5KWR A;  4QM9 A;  1LHN A;  2JEC A;  2RMU 2;  3O0W A;  4XFI A;  3Q8B A;  4G3Y C;  3WIN E;  5GZD A;  4C0H A;  3FLP A;  3O1S A;  2QQL A;  4XMA A;  2XWB B;  4Q4Y 2;  3OGG A;  3IBM A;  3PUI A;  4TWT A;  1MQT A;  3S30 A;  1ND3 C;  2HWD 1;  4B1L A;  4WV8 A;  5JUV A;  2QVS B;  4TTG A;  2R07 2;  1CZT A;  4MGK E;  5BNQ A;  3NAP A;  2K9Z A;  4UFJ A;  4LBM A;  5FYY A;  4A4A A;  1MS5 A;  1TG7 A;  1GNY A;  1H8V A;  2LM3 A;  3AYE A;  4GAL A;  2N7G A;  1RB8 G;  3MFC A;  3N7L A;  3LDR A;  1QH6 A;  2TEP A;  2VOW A;  2XBO 2;  4WVZ A;  4W6Y A;  4EV0 A;  2HYX A;  3POJ A;  1R09 2;  1BEV 3;  5A7S A;  1LOF A;  2LW8 A;  5A32 A;  3HNM A;  4ARY A;  5K0U C;  2D3P A;  1PO2 3;  3BCW A;  3PMS A;  4CCO A;  3QLQ A;  2VUD A;  3HQU A;  4H7M A;  3VDC A;  1DGW X;  3POB A;  4MUV A;  4Y33 A;  4W6X A;  1XE0 A;  1LAJ A;  4FPH A;  4KBZ A;  4MGY E;  1VP6 A;  4MO3 M;  4QX3 A;  5FZ3 A;  5DZE A;  4MGQ A;  2A75 A;  5SV8 A;  5C71 A;  5CKN A;  3T3Y A;  1AF9 A;  4YM2 A;  1PZ8 A;  3AKR A;  4XTM A;  5DAB A;  1VB4 A;  2IVI B;  1OQE A;  1S0C A;  3PUR A;  4NR1 A;  1O4Z A;  2R07 3;  3J8F 2;  1V9U 3;  3MLJ A;  4FPK A;  5D2A A;  1JOD A;  3DYM A;  4CU7 A;  5JPM B;  4A2U A;  1FAT A;  1PIV 1;  1CAV A;  4CZS A;  3WHU A;  1Y9Q A;  5CFD A;  3ZXA C;  3RZG A;  3C3V A;  2QNK A;  5GZE A;  1SHW B;  3NJX A;  3H1W A;  1KJL A;  1VJ2 A;  1ZA4 A;  3DEM A;  2LAL A;  4H14 A;  2XVL A;  4L11 A;  3I59 B;  1CIY A;  2X05 A;  5FUN A;  1F15 A;  4CDQ B;  3FL7 A;  1MQT C;  1STM A;  4CP0 A;  2D6L X;  1GP5 A;  2ES3 A;  2B42 B;  4GKX A;  1WMF A;  3O12 A;  3VBO B;  1A78 A;  1UY1 A;  2ZML A;  1TME 3;  2ARB A;  3H3Z A;  1VMF A;  4YZ1 A;  2QBX A;  2JE9 A;  5EJZ B;  3NAP C;  3N9M A;  5FLH A;  4QX2 A;  4OHV A;  4DFS A;  2RDR A;  1CAW B;  5JXH A;  4ITC A;  1XB9 A;  2R49 A;  3WF0 A;  3ZR5 A;  3WQ0 A;  4ES8 A;  1LOF C;  3MBW A;  3APB A;  1C28 A;  3T2Q A;  3FN9 A;  1R1Z A;  2C1F A;  4FPL A;  2VQU A;  1YCI A;  4Q4V 2;  1ZZ7 A;  5L73 A;  1V6L A;  2KR2 A;  3AMH A;  1L7Q A;  2C4X A;  1ODN A;  4I02 A;  1WLC A;  2GP3 A;  2I07 B;  1FOD 3;  2ARX A;  3ON7 A;  3IMN A;  5I0T A;  2R04 2;  2VZS A;  1UU4 A;  1GLH A;  4L99 A;  5FZ8 A;  2XKO A;  3OGS A;  5ANQ A;  4YAR A;  1IG3 A;  2OQ6 A;  1ULF A;  5C33 A;  1RMU 3;  3MHZ A;  1PX3 A;  4BQ4 A;  1EV1 1;  1TME 2;  1X9P A;  2WNU B;  4K3U A;  3INA A;  4NHM A;  1RUH 3;  1QXR A;  2WA4 A;  4XF3 A;  5FPV A;  5CA6 A;  4E2G A;  5E16 A;  4S2G A;  1UAI A;  1O59 A;  1ONA A;  1DIW A;  2B4K A;  4A41 A;  4LE3 A;  4QX8 A;  5A3L A;  2AAC A;  4GWN A;  1AX2 A;  5LA1 A;  4BOW A;  2RDS A;  4I01 A;  2V5D A;  1P8J A;  5A80 A;  2B7Y A;  2PHT A;  4NPL A;  4FPY A;  1QJZ A;  3MFA A;  1MS3 A;  2W0X A;  5K8S A;  1XYO A;  3AKQ A;  3ST7 A;  2HEW F;  2RS1 2;  3PVO A;  1V6I A;  2C0Z A;  5FZD A;  5I93 A;  1AL0 G;  1TZO A;  3CDZ B;  2XJP A;  5F8P A;  4K40 A;  5DAP A;  1GOG A;  2QQJ A;  4QKD A;  1JN2 P;  3IPV A;  1J3Q A;  3T08 A;  3ZKU A;  2RV9 A;  1COV 1;  2X53 S;  4LOR A;  2YRO A;  2IXK A;  2DV9 A;  4KMQ A;  1NA1 C;  3RMY A;  3KV5 A;  2VZ1 A;  2A73 B;  2D40 A;  3K51 A;  1VBE 3;  4BQ3 A;  4DB5 A;  3KV6 A;  2AZ5 A;  4QHZ A;  2AGS A;  2JX9 A;  2XJT A;  1W6M A;  3AM2 A;  3VBH B;  5CKQ A;  2Z42 A;  5FXZ A;  1D4V B;  2A6X A;  3NKG A;  3ZSL A;  5FYS A;  3SNM A;  4YVW A;  3BU7 A;  1MPX A;  1CAU A;  5T5J A;  2P6H A;  1JZ6 A;  3SC7 X;  4CCK A;  4GWM A;  4XAB A;  2EXI A;  1J3R A;  2RS1 1;  5BNN A;  2WNU C;  2XJR A;  1DZT A;  2GNB A;  3J7N A;  1X8E A;  4PHZ A;  1RHI 3;  4Q2F A;  3FX3 A;  1UNB A;  2EAK A;  1NCR B;  3K77 A;  4CDX A;  1UOF A;  1JH5 A;  4ZKT B;  1GSL A;  4IXL A;  1BJQ A;  2O0O A;  1RUI 2;  1DHK B;  3ETQ A;  4IEW A;  4BK5 A;  3HNY M;  2AYH A;  4NPR A;  2A7A A;  2YBP A;  4O9E A;  4XUR A;  1HB2 A;  3OPZ A;  3WVJ A;  5K9Y A;  4WBB A;  4UFI A;  4MYE A;  3IT8 A;  1BVP 1;  1OT5 A;  3HVD A;  3O1T A;  4OLL A;  4R4X A;  2IWG B;  4QKN A;  3CBN A;  3S57 A;  1WGP A;  4OUM A;  3H1Y A;  4EYU A;  3OBA A;  5A70 A;  3NRU A;  3O1R A;  1YO8 A;  3CKH A;  4IW3 A;  1U0A A;  4N9I A;  3VDD C;  4C91 A;  5DG2 A;  4M4P A;  2DCZ A;  2ZCW A;  3R4D B;  2X09 A;  4FOQ A;  3ZMO A;  4BQX A;  4EWA A;  4CCN A;  3IDA A;  4XUQ A;  2BGO A;  2ZX2 A;  5KC6 A;  4EN8 B;  1QQP 2;  2ZGP A;  1RVF 2;  3I3Q A;  2K46 A;  4KL1 A;  3PVB B;  2CU5 A;  1MQT B;  1GU3 A;  1XND A;  4BQ5 A;  1F2N A;  4V2V A;  2J22 A;  1RUI 3;  4PBO A;  4LNV A;  3KF5 A;  4L9B A;  2FDH A;  3T4V A;  4BHP A;  2QQP A;  3IAP A;  2GNM A;  5IAV A;  4N43 A;  1UOJ A;  2E32 A;  2UY9 A;  3UES A;  4GMP 3;  5BNN C;  3M3Q A;  1Q8V A;  3KVA A;  3OUH A;  5FP9 A;  1N3O A;  4LIT A;  5IT6 A;  4BM8 A;  1PGL 1;  2ZGU A;  5A3W A;  4PT6 A;  4CXX A;  5D8A B;  3ZPY A;  1ULE A;  1FT9 A;  4E4H A;  5F6L B;  3WHT A;  3ZSM A;  2BP6 A;  1HQW A;  3L2Y A;  3BGA A;  4ERO A;  2UWC A;  4UFH A;  4YVW B;  1FXZ A;  1MVE A;  5CAZ A;  1MZE A;  4AI8 A;  2CAV A;  1JTZ X;  2CHH A;  4ATE A;  5JMO A;  4XFC A;  5G04 L;  3O7O A;  1UWW A;  4QDS A;  4UW3 A;  1RUG 1;  3SMH A;  2ET1 A;  2ZS6 B;  4CUC A;  4UWD A;  1S55 A;  2JIJ A;  2XB6 C;  5K0U B;  3VZK A;  1PVC 2;  4DUV A;  4YZ3 A;  5GLV A;  3USU B;  4PF5 A;  5I0S A;  2A3W A;  4PQ9 A;  3IAQ A;  2FDJ A;  5KHJ A;  1W6N A;  4QKF A;  1DFQ A;  1NCQ B;  4LK6 A;  4XFB A;  1R08 1;  2A1X A;  1VR3 A;  4XFF A;  2DVB A;  3OBR A;  1BCX A;  2RR1 3;  1HB3 A;  2R6Q A;  4RSU A;  2WLP A;  2XHK A;  4XFH A;  4Y20 B;  2YC0 A;  1WMD A;  3PVN A;  2BNM A;  3WUC A;  1IPS A;  4K1Y A;  3UGF A;  3T0D A;  2WAB A;  4LLF A;  5IUQ A;  1YQ6 A;  4CP2 A;  4YG0 A;  1H1M A;  2IXC A;  4S2F A;  2OKX A;  3KGZ A;  3DL3 A;  2WN3 A;  1WCD J;  4Q0S A;  1XSR A;  3TNQ A;  1XYN A;  4BYY A;  4Y4Y A;  1RUH 1;  5L9V A;  4M3C E;  2VZ3 A;  1UIK A;  4HBN A;  1MEC 3;  1T6B X;  2G4I A;  4YVS B;  2Z4F A;  4KWU A;  3CL1 A;  4YW4 A;  1YJL A;  1ZVF A;  2J1R A;  4CUG A;  4BIS A;  2C9K A;  3RZH A;  1H1I A;  4OYU A;  4BQ2 A;  3AMM A;  3WF4 A;  3UJO A;  2JDU A;  1W6O A;  3ZN5 A;  1ZBA 1;  1NCR C;  4Y5T A;  1DQ5 A;  1H9P A;  3OTF A;  4F3J A;  2OYZ A;  2E7Q A;  3PLQ A;  4ARX A;  2P17 A;  2JDA A;  1KXG A;  1XQN A;  3GYD A;  3WW2 A;  1SMV A;  3UKV A;  1RYY A;  1AYN 3;  3TN9 2;  2B39 A;  4FFI A;  3GF6 A;  3M7A A;  2W91 A;  4FPJ A;  1NY7 1;  4KU7 A;  2VW0 A;  2PTM A;  5F5A A;  1CON A;  4I0B A;  4N9H A;  4K20 A;  3O1O A;  4CUB A;  3NKT A;  5IFT A;  4O61 A;  3QCW A;  3E1F 1;  2PAE A;  5FRA A;  1UD1 A;  3OYW B;  1JYI A;  4JRL A;  1EV1 3;  1IHM A;  2VNG A;  4QPG C;  1Y7B A;  5A6X A;  4AQ6 A;  2BQP A;  4M00 A;  1JI6 A;  1UPS A;  2V09 A;  1WW5 A;  3WNM A;  5IAT A;  5JOZ A;  2D44 A;  1RED A;  3HPN A;  1LOE A;  5IVY A;  4CEY B;  5J48 A;  4I09 A;  5LAS A;  5LRR A;  2ZEW A;  1XNA A;  2C6S A;  2CL2 A;  4R9B A;  4Y26 A;  4CDW B;  5HV0 A;  3POS A;  4XYX A;  3A22 A;  3CZJ A;  3THC A;  1C8M 2;  1CN1 A;  2XQX A;  2E53 A;  4IGP A;  1Z78 A;  1W2N A;  1SBE A;  2FBE A;  4HXC A;  1DYK A;  1DZR A;  1W2T A;  4AFA A;  1X82 A;  4MVT A;  2JG9 C;  3T2T A;  3BTZ A;  2R04 1;  4AXO A;  5FXX A;  2WO1 A;  3JZV A;  4R8H A;  3NMB A;  3ZYJ B;  3W58 A;  2CNA A;  5J7M A;  1FMD 1;  4GB3 1;  3POW A;  5FPX A;  3I49 A;  1ND2 B;  3WX5 A;  5I0D A;  4P9J A;  4URA A;  1VBB 2;  1JUI A;  2R32 A;  3M3I A;  1PO2 1;  4QPI C;  1RXG A;  2ZGT A;  4DUW A;  2GN7 A;  4WM7 B;  1H2L A;  2GC0 A;  3CJI B;  5HCA A;  4M3C F;  5CFD C;  5DDJ 2;  2PHF A;  4MHR A;  1UU5 A;  4KGQ A;  5HCH A;  2XR4 A;  2BWC A;  1KDK A;  2ID4 A;  4ZU7 A;  3LA3 A;  2ZJC A;  3D6E A;  3GJB A;  2GAU A;  4L97 A;  2Y6K A;  2YBS A;  4IQP A;  2P1B A;  1XNT A;  1PNG A;  1LHU A;  1IQA A;  1RUC 1;  2ARC A;  4TZD A;  1D0G A;  3ZYF A;  1RUG 3;  2QQO A;  3P3P A;  2W52 A;  1CR7 A;  1HRI 3;  2GN3 A;  5JI7 A;  4AI1 A;  1FNZ A;  2R1B A;  3B02 A;  4Y1V A;  1Q8S A;  1LRH A;  3VBF B;  3VB9 A;  1PVX A;  4QAW A;  3AP7 A;  3VBO C;  5HPO A;  1R1A 3;  3VBH A;  4QB2 A;  1JUH A;  3VHO A;  1AXK A;  2MHF A;  5IK4 A;  4JGY B;  1LGB A;  3CIH A;  3HN1 A;  4Q1R A;  4IEY A;  5DUU A;  4DOU A;  3HBZ A;  4IET A;  1KJR A;  5C3Q A;  4DPN A;  4AHY A;  2FCU A;  1H6Y A;  3W5M A;  5I8Y A;  3UGH A;  1W3X A;  4GMP 1;  4XJZ A;  2RM2 2;  1CX1 A;  1W6P A;  3ZFF B;  2D5H A;  4XJU A;  5FPL A;  3C7G A;  1F35 A;  4OI4 A;  4CEW B;  5FMO S;  4XUO A;  4AEK A;  2XUM A;  3KF3 A;  4GMP 0;  3JB8 A;  5F5I A;  1DQ2 A;  3AK0 A;  1IS4 A;  3RWK X;  1EUU A;  1OD5 A;  3C7O A;  3VBR B;  3ZOI A;  1GP6 A;  3V64 A;  2Q1F A;  1WWY A;  2ERF A;  2XLF A;  3VV1 A;  3LF7 A;  1HRI 2;  1S2E A;  5CAD A;  1QJY 2;  4XEZ A;  4FAG A;  4W4Z A;  5GZF A;  2OZJ A;  2VG9 A;  5HCB A;  2IUW A;  2VBB A;  4AI0 A;  3VBU C;  4YZ2 A;  2HWD 2;  4YG6 A;  3I97 A;  1IPJ A;  1CZV A;  3WZ1 A;  3AL6 A;  1R09 3;  1G86 A;  1RUE 1;  4N53 A;  4N7U A;  5KXB A;  1ZRF A;  3N9P A;  1AR7 1;  3M8L A;  4CPB D;  4DRR A;  1OLM E;  4GH4 B;  5JMC A;  5ABJ A;  4R9C A;  3U14 A;  4NE9 A;  1D4M 1;  3EMR A;  4IV3 A;  1AJK A;  2QUO A;  2OZ6 A;  2R0H A;  3TOJ A;  5FOJ B;  3B00 A;  2F6B A;  1CQ9 A;  1YWK A;  2VTF A;  4D6S A;  3OD0 A;  1W04 A;  2XDV A;  5BNP B;  3HD8 B;  3LIH A;  4KGG A;  5KC5 A;  1SFN A;  3E6B A;  3LA7 A;  1NLQ A;  2Z69 A;  4LUL A;  3PU3 A;  4E27 A;  3SXW A;  1OC1 A;  5KHH A;  4XE9 A;  1H2K A;  1NA1 A;  3ZMN A;  3PJY A;  2RS5 1;  2E51 A;  2IVJ A;  1HB1 A;  1OA2 A;  2AC1 A;  1A34 A;  1V9U 2;  1V6O A;  3WF3 A;  5FUI A;  5FTT C;  5C4W A;  4L8Q A;  3RDI A;  2GC2 A;  3CJI A;  2DBI A;  2HWD 3;  4YPJ A;  2VM9 A;  2ZHK A;  1UKG A;  1TE1 B;  3MI8 A;  3WSO A;  2WZR 2;  2DTW A;  2HWE 3;  5GJ6 A;  1AR8 1;  1H4H A;  3IKW A;  4JGZ A;  1AR6 2;  3PME A;  2EVX A;  3MV0 1;  3VD5 A;  1PIV 2;  3SH4 A;  2H6B A;  1QNW A;  1XBF A;  1BBT 1;  3KQR A;  3LPF A;  2Z2S B;  4R52 A;  5JIA A;  4WM8 C;  2VU9 A;  5LB6 A;  4NMI A;  3NNJ A;  3PHM A;  2VCC A;  4LKS A;  4BMB A;  1H6X A;  3A7Q A;  4YVS A;  1ULP A;  5LEJ A;  5EZW A;  1AR7 2;  3HEI A;  1IS3 A;  4R9D A;  5APA A;  1VE0 A;  1SFP A;  5DAV A;  3PDQ A;  5FZF A;  4NRQ A;  3ZXD A;  1H8T C;  4HK8 A;  4BDV B;  3P5B A;  2VCA A;  3ZFE A;  2Y8K A;  1UZY A;  2WQ4 A;  3AZY A;  4H7L A;  1ZRR A;  2PFW A;  2A6Y A;  4P02 B;  3VBS B;  1E5S A;  1X9T A;  4LTA A;  2QJV A;  3FFZ A;  1CAX B;  1AYM 2;  3ZFG B;  4J6G A;  2FHR A;  2Y33 A;  4RR3 A;  5CYY A;  4CCD A;  4HSL A;  1KEX A;  4GUL A;  1E57 A;  5LAT A;  1RMU 1;  4N53 B;  4Y5S A;  1M06 G;  5FYV A;  4CU8 A;  3B9C A;  5FIX A;  2E63 A;  4FFF A;  1G6N A;  1IZ3 A;  2DUO A;  3E5X A;  4YW1 A;  2EID A;  4Q4Y 1;  2XKP A;  4RQP A;  5FYT A;  1J83 A;  1MS1 A;  2HEY F;  3T1M A;  2ZGL A;  3POI A;  3OPT A;  5BNP A;  1O4T A;  1W6Q B;  4XDQ A;  2GH2 A;  3D3A A;  3DEC A;  4DO0 A;  3AP6 A;  1AYM 1;  2P5B A;  3PTR B;  1D0H A;  4LBQ D;  1CD3 G;  4COU A;  3ILF A;  4K7J A;  4PF1 A;  3J8F 3;  5L7O B;  1Q8O A;  1VAL A;  1GZT A;  5FZ0 A;  3BTA A;  5JSP A;  2VJX A;  1VBD 1;  1QKQ A;  1W0P A;  3B9I A;  1T2X A;  2BOJ A;  2WT1 A;  5A7Q A;  2Y34 A;  1O7F A;  2WN2 A;  2YFZ A;  5IVV A;  3J7M A;  1WD4 A;  1PZ9 A;  1H8T B;  1PO1 2;  1Q8P A;  1COV 3;  4XDP A;  1U5I A;  1K5M C;  4QGL A;  3ES1 A;  2XJS A;  4JC1 A;  4N90 A;  3E5U A;  2ZBJ A;  4ZPI A;  4JV4 A;  3FWE A;  4AVA A;  2VW1 A;  2SBA A;  5FCC A;  4CE8 A;  1Q56 A;  1QJX 2;  4FQ4 A;  2XH6 A;  1OBN A;  2VNO A;  4CU9 A;  3QH6 A;  4WM8 B;  4PIZ A;  1VLN A;  1JBC A;  2VMI A;  1D7P M;  2VR4 A;  2WWS A;  3RZJ A;  1JYV A;  3POY A;  3NO8 A;  4CP9 A;  1SLL A;  1Y9G A;  1YFY A;  2B45 X;  3J8F 1;  1SG3 A;  2ATF A;  1XOY A;  2B9U A;  2PHU A;  4RR3 C;  5I91 A;  5J09 A;  4OMC A;  1VBD 3;  3IM0 A;  2VUJ A;  4AF9 A;  3NW4 A;  3M3C A;  1B35 B;  1RHI 2;  3PIJ A;  1SLB A;  3RGB A;  1GQH A;  1LEC A;  1LES A;  1LGC A;  1RL3 A;  1VRH 1;  4G4F A;  4IUG A;  4Q4V 3;  3I3E A;  2FZ2 A;  1DYP A;  2ARE A;  4YW2 A;  1LHW A;  1W6P B;  1T6G C;  3WP5 A;  3BOP A;  3SKV A;  1G9F A;  4QXH A;  4ASK A;  1GZW B;  3WF2 A;  4WM7 A;  3UJQ A;  1WW6 A;  5A6Y A;  4PQQ A;  4XF9 A;  2WJS A;  4E9K A;  5BNP C;  1V6J A;  3MZH A;  5FK8 A;  1PHM A;  3WP4 A;  5F3E A;  4GXL A;  5JR2 A;  3OUJ A;  3PUA A;  4QWN A;  3VD9 A;  4EQV A;  2JDM A;  1KD7 A;  1NCR A;  5CIR A;  1BEV 1;  3MIF A;  2BV4 A;  4BCU A;  4LIU A;  1L7L A;  1RHI 1;  2WFF 3;  3ZFG C;  2AEN A;  4AE2 A;  1UZ0 A;  3D0S A;  4XBN A;  4B1M A;  1F4H A;  3HJR A;  1NYW A;  4Q8L A;  3AYC A;  3NV3 A;  2VO5 A;  2RJK A;  2FDK A;  5LZ6 A;  3VL9 A;  1MVQ A;  2Y38 A;  3MIC A;  2OXB A;  3KMH A;  1YUD A;  3VHR A;  2OQ7 A;  3VDA A;  5B2G B;  2KXL A;  5FDB A;  4RD7 A;  3K46 A;  4AR2 A;  1W9T A;  1MS4 A;  3U11 A;  4LBQ A;  3IDC B;  2DVD A;  1C8N A;  1NT0 A;  1RVF 1;  3FBY A;  4HMZ A;  5IAX A;  1S0D A;  4QPG A;  1JZ8 A;  5FZI A;  5A1L A;  3H3L A;  1D4M 3;  1UO9 A;  5GAL A;  1WD3 A;  2DCK A;  1N1Y A;  1XE8 A;  2ZAA A;  3GHM A;  4FFH A;  5H9Q A;  3FMG A;  4PDW C;  2JG8 C;  1DQ6 A;  5JZG B;  1NG0 A;  1L3J A;  3WNN A;  4C1W A;  4IER A;  5FKB A;  4ISQ A;  5F6K A;  3KQ4 B;  2XOM A;  3KCY A;  3O0V A;  1OVP A;  2ZOE B;  4E2Q A;  2GC1 A;  3GBF A;  3SCH A;  3LSD A;  4JGY C;  1AXY A;  1JXN A;  3KM5 A;  4AFM A;  4IES A;  4Z2A A;  1K12 A;  2OII A;  3ZSK A;  2RM2 1;  4RHV 3;  1J84 A;  1UZW A;  5EYX A;  1O91 A;  2WYF A;  2ZHM A;  4TLG A;  2JG9 A;  4XAC A;  1XSQ A;  3ACF A;  5T5L A;  3K4D A;  2VD7 A;  4L0P A;  3I2F A;  4FPC A;  3S7E A;  3OB8 A;  2EAA A;  5JZG C;  1R08 3;  4PDW B;  1CGP A;  1DGW A;  4FSJ A;  2XUE A;  2ZAH A;  1FI2 A;  1WBL A;  1NZC A;  3RYR A;  1QU0 A;  2WT2 A;  1AXZ A;  3JD7 1;  1O3Q A;  2RR1 2;  2K2S A;  5GLW A;  4ZXE A;  4AW7 A;  4BIF A;  1UW8 A;  4QHO A;  1EYB A;  1F5F A;  1OI6 A;  2QQM A;  2VUC A;  3ZIX A;  3S6P A;  1SLC A;  3PU8 A;  1JZ3 A;  2PA7 A;  1X36 A;  1G9C A;  3RMX A;  2VMF A;  5H9R A;  1RIT A;  3ZYH A;  3NV4 A;  1KRI A;  4RHV 2;  5A6Z A;  2OPW A;  2EIE A;  1WUV A;  4FOV A;  4KI5 M;  1S2K A;  2UU8 A;  4FPG A;  2BZD A;  3ETP A;  2HKX A;  1W9W A;  1PK6 B;  4QT6 A;  4HK9 A;  4DZG A;  1UQX A;  2A3X A;  1OSG A;  5E88 A;  4COY A;  2YG0 A;  4PLM A;  1GAN A;  3SEP A;  4CUA A;  1GMM A;  4FP3 A;  4BXS V;  1W6Q A;  1REF A;  1UU6 A;  3EJK A;  4A6O A;  1AYN 2;  3TN9 3;  1UOG A;  3LDB A;  1UY3 A;  4XHX A;  2P3K A;  4ZXK A;  4GWJ A;  1X7N A;  4YGC A;  1SLA A;  4I3G A;  4ONU A;  5FZE A;  1ENQ A;  3B93 A;  1RUI 1;  4CCE A;  3THD A;  1YYN A;  3SCF A;  2NQY A;  4BU2 A;  1TEI A;  2FZ1 A;  2YY1 A;  3JD7 2;  2GME A;  1R1A 1;  3SLI A;  4D7T A;  4YZ4 A;  2RVA A;  3VKN A;  3MLK A;  3WQB A;  4QQO A;  1BZW A;  1OPO A;  1CPN A;  2R07 1;  1W8H A;  2NZ9 A;  2XLA A;  4DQA A;  2WO3 A;  5A1A A;  3WD5 A;  2J42 A;  1W39 A;  1N1T A;  2NN8 A;  4LBN A;  3ZIW A;  1OF4 A;  3BU0 A;  4UAP A;  4YWA A;  2WSU A;  3KCC A;  2P37 A;  5FV3 A;  3W20 A;  4LBK A;  2VL4 A;  1UY4 A;  1YFW A;  2X5I C;  3OY8 A;  2ZKN A;  1U5Y A;  4NIG A;  3IDB B;  4LMF A;  2IXH A;  4AAP A;  3AYA A;  2ORZ A;  1SBF A;  4P08 A;  5FYC A;  4P9X A;  5KXD A;  2JIG A;  4MLO A;  4NN0 A;  1PMH X;  1LKN A;  3UK9 A;  3WW4 A;  1FMD 3;  3AZV A;  3Q8F A;  4GB3 3;  5HBA A;  5GZC A;  2F4L A;  4IGO A;  2O14 A;  5D8A A;  4D69 A;  2OUJ A;  5AC9 1;  5FOB B;  4IEQ A;  1SDW A;  5C3R A;  2D6M A;  3I59 A;  1WW4 A;  4MV2 A;  5JOY A;  4J1X A;  2WFP A;  4QGM A;  2BER A;  1XU2 A;  5C7G A;  4CDU C;  1YI7 A;  5CFC A;  1IGO A;  5KXC A;  2WS9 1;  4LEJ A;  4LO4 B;  4MXV A;  4C1X A;  1CAV B;  1YFU A;  3AKT A;  3T4H B;  4KG8 A;  4COZ A;  4GIQ A;  4CXY A;  2VQ0 A;  2ZEY A;  1FOD 1;  3ITQ A;  4NHL A;  4XIO A;  3ZO0 B;  4DY3 A;  1WLD A;  4FP2 A;  3D4K A;  3Q8E A;  5LBC A;  3AC0 A;  1QXP A;  3DF0 A;  1D2S A;  3K3O A;  3KT7 A;  4GJZ A;  1GV9 A;  1AL2 3;  2HWB 3;  4AHX A;  5FY0 A;  4XET A;  5DN2 A;  1QNY A;  4NRM A;  4WM8 A;  4FVV A;  2ARA A;  5FMO L;  1JYN A;  1IKP A;  1DBN A;  2PAM A;  2WA3 A;  4LO8 A;  4N43 B;  5T5P A;  1QH7 A;  3RNS A;  4CP1 A;  2D3R A;  1LU2 A;  2XL7 A;  1VRH 2;  2BNO A;  3FHA A;  3J7L A;  1EV1 2;  1TME 1;  4XZU G;  5L7O C;  1CWP A;  3FLR A;  4AAX A;  2PHD A;  4BXF A;  3RYP A;  3H8O A;  1WA6 X;  2XML A;  3ECQ A;  3NST A;  2VBP A;  5JSR A;  1FPN 3;  4JTO A;  4PI2 A;  1DGL A;  4CEW C;  3H8X A;  3OPW A;  3BTX A;  2XXZ A;  2RM2 3;  1LU1 A;  3DYP A;  4JDN A;  3RPQ A;  4FXG B;  2UUR A;  4OVE A;  1HQN A;  4EJR A;  4LHS A;  2PHX A;  5T54 A;  5F1R A;  3OYW A;  2E33 A;  5GM0 A;  1SEF A;  3MV1 1;  5L19 A;  1PM4 A;  5IVJ A;  2Y6F A;  2NPI A;  1O6U A;  4R9A A;  4UBH A;  3E5Q A;  2E26 A;  4JQR A;  4F7Z A;  2QQW A;  4Q4X 2;  1EAH 1;  1UZZ A;  3IIA A;  3OGJ A;  1NLR A;  1E5R A;  2HWF 2;  5L9B A;  5JOX A;  2A3Y A;  2Q0A A;  1FNY A;  1RUD 2;  4MX3 A;  5A3M A;  5CZK A;  2BGP A;  4XXA A;  4LUK A;  1VBB 3;  4F83 A;  1HRI 1;  4OUE A;  4P5Y A;  4XMI A;  5JWP A;  1WMX A;  3OEB A;  2Q8O A;  4BZ4 A;  3R6S A;  3JXS A;  1UCX A;  3OUI A;  2ZEZ A;  1HN0 A;  3R0R A;  3AP5 A;  4UFK A;  4V2W A;  1OOP C;  3JBG 2;  3U1X A;  5EXO A;  1CVN A;  1NCQ C;  1XU1 A;  3NNG A;  5KHG A;  1IS6 A;  5EPA A;  1W8U A;  2WAA A;  3KZ4 C;  1SCR A;  2A6V A;  3VKO A;  1OFN A;  2JE7 A;  4AGR A;  1QOO A;  1DCS A;  5A3P A;  4P9W A;  1NE4 A;  1SPP A;  1IKQ A;  1G8W A;  2RS3 1;  2BUK A;  4K21 A;  1YJK A;  1SLI A;  2ZMK A;  3W5N A;  4AFC A;  1MZ5 A;  1K5J A;  1I5Z A;  1IG0 A;  4EWD A;  1YFX A;  2HWF 3;  4Z92 B;  1C1L A;  4LA3 A;  1PK6 A;  1L7R A;  4WZC A;  2O1Q A;  1CAW A;  2YUE A;  3BPZ A;  4JKM A;  4PIX A;  3THP A;  2ZA9 A;  2VZR A;  3NNL A;  4WVV A;  5F3G A;  2AEY A;  2VNR A;  5FZH A;  2HWE 2;  5EIY B;  2JG9 B;  1RUC 3;  2VOV A;  2P2K A;  5GLU A;  2RG4 A;  5FQ0 A;  4P9I A;  1GP4 A;  3CHX A;  3GZA A;  3HBK A;  3MIB A;  3LKJ A;  4Y5Z 0;  1W05 A;  5FMD A;  2VGD A;  4J1W A;  3FUQ A;  5LRS A;  4BPZ A;  3ACI A;  5F5C A;  3VN4 A;  3GHN A;  3TNP B;  1UPI A;  3GBW A;  1O5L A;  3H7J A;  4NRO A;  1OPM A;  5FYU A;  1ZZ6 A;  4JAA A;  1QQP 1;  4EZH A;  1JZ4 A;  3R4U A;  1W99 A;  4LO5 B;  3CO2 A;  3N9N A;  4MZU A;  1A8M A;  1G7Y A;  5FFO C;  2CAU A;  2EIB A;  2KA3 A;  3WNK A;  4AGV A;  2TUN A;  3I3M A;  2G9Z A;  2HWE 1;  3RG0 A;  1I1E A;  3ROU A;  3WLU A;  1QJY 3;  4DXR A;  2VQA A;  2GH8 A;  4RN5 A;  2G9G A;  2YGM A;  4MGZ E;  3VBF C;  3CMG A;  2LRP A;  1DGR A;  3KGL A;  4XQ4 A;  1GKB A;  2W1W A;  4OMD A;  4YYO A;  4COV A;  2JD4 A;  4OHW A;  3Q9O A;  3VDD B;  2QQV A;  2V4A A;  3UL2 A;  4OQ9 A;  2Q1Z B;  1CIW A;  5FP7 A;  1RUC 2;  2BTV C;  3IB3 A;  3VLB B;  4XUT A;  3ZM8 A;  3H7Y A;  1VAM A;  2XVG A;  3G7D A;  3WDT A;  3P6B A;  2XPJ A;  1ACC A;  1SPP B;  1DLL A;  3ZYI B;  1GYK A;  1U5Z A;  2JKB A;  1NAE A;  1OMI A;  2ZZQ A;  4WVM A;  2ILM A;  3I2J A;  1ND3 A;  1OVS A;  4QD2 A;  4Y20 A;  5CFD B;  3BIE A;  2ZGN A;  3I3D A;  3ORJ A;  4NII A;  5DUX A;  3J4U H;  5E6H A;  4BK4 A;  2R7E B;  1ENX A;  2GU9 A;  4QPI B;  1ZYB A;  1SAC A;  1LJ7 A;  4QPW A;  5DAQ A;  2D98 A;  2JG8 A;  2VZQ A;  1VBA 1;  1DLC A;  3C7E A;  4G9S B;  2MEV 1;  3MPB A;  4YFW A;  4COW A;  4DXZ A;  3B01 A;  2GNT A;  4ORF A;  3HR9 A;  2WC2 A;  1W6M B;  4BWO A;  4FBF A;  4NWV A;  4XOG A;  5IWF A;  4L92 A;  2VH9 A;  5GLT A;  2V5Y A;  2W47 A;  3Q8C A;  1OH3 A;  1MZ6 A;  2ZGK A;  4LE4 A;  1XE7 A;  1RUE 2;  4LXL A;  4EN0 A;  2VXR A;  2WZR 3;  1COV 2;  2O8Q A;  4LKF A;  1AR6 3;  1NX9 A;  4HVR A;  4SBV A;  1OUX A;  1RUO A;  5F5Q A;  2D6P A;  1Q43 A;  5E8A A;  5FY9 A;  4AG4 A;  4YM3 A;  4QU2 A;  1NLS A;  1JZ5 A;  2Y6H A;  3MF6 A;  3H3U A;  4Q4W 3;  2D6N A;  1ZBA 3;  2WIN B;  5HCF A;  1CZS A;  2YFU A;  4U2A A;  3M3E A;  1IQD C;  5F7U A;  1RUH 2;  2CDO A;  3KT4 A;  1AR7 3;  2ZAC A;  3ZN4 A;  3ZSE A;  3ACL A;  3UKN A;  1CJP A;  2OA2 A;  4Q0U A;  2JDH A;  1UOB A;  4XAA A;  3U37 A;  3T2O A;  3N9O A;  1BYH A;  1OUR A;  2LS6 A;  2E7A A;  2EXJ A;  5FY7 A;  3VD7 A;  3ZVX A;  5IK5 A;  4OCT A;  1W90 A;  2G9F A;  2ZGO A;  3JB4 C;  2UWB A;  4X6Q B;  1QJU 1;  4ASM B;  3LIG A;  4AOC A;  1RIN A;  1AYM 3;  2CSG A;  3DPR A;  3AZX A;  1V6N A;  4FI9 A;  5J36 A;  5A3O A;  1VIW B;  2YU2 A;  3UNP A;  2RS3 3;  1HV0 A;  3WCR A;  4DIN B;  2RS5 2;  4LOT A;  2LRO A;  3U0Z A;  4JDM A;  5BNN B;  1SLT A;  1OD3 A;  4B7E A;  1ZBA 2;  4MOA A;  4HLT A;  2LUW A;  3AYD A;  3VKF C;  1WBF A;  1LED A;  2ZTN A;  1LOD A;  3DUI A;  3VHN A;  4B8E A;  2XL9 A;  4BB3 A;  4O9G A;  4YGD A;  4IND A;  4M4R A;  2WUH A;  1S0F A;  3ZXK A;  3KT1 A;  1PM7 A;  1C3H A;  1VBA 2;  4RGA A;  4XF4 A;  3WNP A;  5JI9 A;  4LPL A;  2DU1 A;  1LOG A;  4XJ9 A;  4ASL A;  4FCA A;  1VBB 1;  2Q4S A;  3FC0 A;  3LFM A;  3VGI A;  1OOP B;  3HAG A;  1QJU 3;  4M3C A;  1DQ0 A;  4QX7 A;  3ALQ A;  3V0B B;  3WXP A;  4EN6 B;  3FBM A;  1JYC A;  1UMZ A;  3ILN A;  3LD8 A;  5C5T A;  2ADE A;  1OFS A;  1W9S A;  3DYO A;  5C9A A;  1OKO A;  4ES9 A;  4RYD A;  5FZ1 A;  5LBF A;  1DZQ A;  1ND3 B;  1PO1 3;  1ULO A;  1V6M A;  2VMH A;  3E6C C;  1EAH 3;  2Y26 A;  2VVD A;  2PEL A;  1AX0 A;  3O1M A;  1NUK A;  4QPI A;  2PHL A;  3O1P A;  3ELN A;  2C24 A;  2YPJ A;  4QXK A;  3WP6 A;  5ACA 3;  1PGL 2;  2GP5 A;  3LSE A;  1MZF A;  4D3W A;  2UY8 A;  1V6K A;  1UYY A;  3RS6 A;  1JS9 A;  2EF6 A;  5A7P A;  5HV4 A;  1VB2 A;  2E9Q A;  1H1A A;  3NJV A;  4OHZ A;  4A3X A;  2HEV F;  2WO7 A;  3WW3 A;  1BVV A;  2VOT A;  3O5S A;  5JCT A;  2DVF A;  4HN0 A;  2F4P A;  4NVP A;  3WNX A;  2OW4 A;  3HIF A;  5C6C A;  2Z5W A;  3NJZ A;  4AYU A;  5FQ0 B;  5C3O A;  1VBD 2;  1N47 A;  1A8D A;  2WYS A;  1SFY A;  2QQU A;  3ATG A;  3IZO A;  3OGV A;  4KBB A;  5F39 A;  1QJU 2;  4QX1 A;  5JIU A;  1UZV A;  2Q30 A;  3BOW A;  1UYZ A;  3TWI A;  1JMU B;  3U07 A;  1TNF A;  5D8A C;  1O3R A;  5CEH A;  4Y4R A;  3VBO A;  5CIS A;  3MO4 A;  1CX4 A;  1R08 2;  3VBH C;  2R06 1;  1EAH 2;  2IC1 A;  2VEC A;  3X29 B;  2XG3 A;  2PHR A;  2Q5T A;  3KB5 A;  2NM1 A;  2HWF 1;  1QIQ A;  1RIR A;  2HWC 3;  3I2K A;  3N7M A;  2V73 A;  1ULD A;  4OHX A;  5FO7 B;  2DU0 A;  5IK7 A;  1X33 A;  3L9J T;  3LEG A;  4XC9 A;  1K45 A;  4XF0 A;  3F95 A;  3RYK A;  4Z1V A;  2ZGQ A;  2WL1 A;  3A4U A;  2HYK A;  3AXD A;  3PJQ A;  2OT7 A;  2RDN A;  1Z0H A;  3MF9 A;  2D97 A;  1VBC 3;  4IDZ A;  2GMP A;  3WR0 A;  4D7Y A;  2WFF 2;  2WNU A;  3TN9 1;  3AJY A;  2E31 A;  1Z7S 2;  1F31 A;  3S5A A;  1KQR A;  4P9Y A;  4CDX C;  3O14 A;  3GM8 A;  2WKK A;  4IE6 A;  4CEW A;  2DFC A;  2ZEX A;  1OQ1 A;  1W06 A;  4A3Z A;  2QQI A;  2YMZ A;  1DQ4 A;  2VMG A;  4OI0 A;  3OF1 A;  3WDY A;  1QGL A;  5IHR A;  4RHV 1;  2KD7 A;  3QAC A;  4P14 A;  3VHP A;  4AZZ A;  5IVE A;  3MUZ 1;  4CCM A;  4GQ7 A;  1XPW A;  2H6C A;  3FHI B;  3OBT A;  1C57 A;  1ODM A;  4IE5 A;  3BYW A;  4ZZ8 A;  1ENS A;  2QTW B;  5FZ9 A;  1XJA A;  5EJ1 B;  4IEP A;  3AZW A;  4E4D X;  4IV3 C;  1W2U A;  4DEV A;  2VZV A;  3DXU A;  3GNE A;  4FT8 A;  1AR9 2;  1TMF 3;  3LEK A;  1XNC A;  3T1L A;  5HI0 A;  2BEO A;  5FPZ A;  5J37 A;  4IV3 B;  4TLF A;  1Z7S 3;  4XJ8 A;  5AFE A;  2VY0 A;  3GZT B;  3MW2 A;  1A3K A;  2WZR 1;  2YXS A;  4HAN A;  4LKD A;  4LLO A;  4B7K A;  5C8C C;  4CCJ A;  3N4M A;  4UFL A;  2FCV A;  4GWI A;  2ZX4 A;  4Y1Y A;  4UXA A;  4AK3 A;  2XWJ B;  5LWB A;  4Z2W A;  2ORX A;  4QB1 A;  1PO2 2;  2EXK A;  3NAP B;  1NXM A;  3K75 B;  4D6R A;  3K4Z A;  4M0H A;  5TSW A;  4FAH A;  1RUF 2;  4LQR A;  1NA1 B;  2IXL A;  3MID A;  3A0K A;  4IEZ A;  4HT1 T;  1US3 A;  2BVB A;  3LE0 A;  4CCC A;  3B94 A;  5KHK A;  3MIH A;  1S0B A;  1H2N A;  4PIY A;  4CDQ C;  4YZ5 A;  2WFF 1;  2CWM A;  3BB6 A;  1POV 0;  3K48 A;  3NVC A;  4Q5O A;  3RJ2 X;  4FTS A;  1FMD 2;  4GB3 2;  4HZF A;  4A7K A;  4E4Z A;  2CYF A;  4JTN A;  5A3N A;  3M1H A;  2XJU A;  5DPN A;  3BUC A;  3LOI A;  1FAY A;  1DQ1 A;  1PNF A;  5A32 B;  1YLL A;  1OKQ A;  4QQ2 A;  1PGW 1;  1D2Q A;  3AXE A;  5C70 A;  1S0J A;  3E6D A;  1OH4 A;  4DNY A;  3THT A;  4X6R B;  1US2 A;  1MEC 1;  1F4A A;  5IW0 A;  2W95 A;  5FJK A;  1ASJ 1;  1HRV 1;  1LGN A;  1OLM A;  1PMI A;  1S0E A;  2WNE A;  3ZR6 A;  4MG2 A;  4YM1 A;  1LTE A;  4DIQ A;  2VOK A;  1UYX A;  2DDU A;  4YG3 A;  1YIP A;  1RUF 3;  2ZGR A;  3SCG A;  4YSF A;  2C26 A;  1AL2 2;  5FAX A;  3I4I A;  3MEP A;  5BY5 A;  4B29 A;  5FZB A;  3SHR A;  4RQP B;  4D0Q A;  1H9W A;  4Z82 A;  5DUW A;  1QMJ A;  5CFC B;  2WDB A;  1W8O A;  3OCP A;  4S2D A;  4EN7 B;  3RZL A;  2GZW A;  2JJ6 A;  2B9V A;  1YQ5 A;  4AFD A;  4MGT A;  1NQJ A;  4AWD A;  4KU8 A;  5FJH A;  5A1F A;  4BLJ A;  3FZ3 A;  3ZXF A;  1WCU A;  5FYI A;  2JIC A;  4B4R A;  3N9L A;  4HPK A;  1B09 A;  1H4G A;  4UYB A;  2A6W A;  2W68 A;  3POE A;  3MGU A;  3GJA A;  3CQO A;  4OFG A;  5FZG A;  4CYD A;  5HXM A;  4NIH A;  2ZAB A;  3KV9 A;  1ASJ 3;  1HRV 3;  2VBD A;  2NYY A;  3PUQ A;  1X8M A;  4BQ1 A;  5ISL A;  3FUO A;  5EJ3 A;  1TNR A;  2CWS A;  4JVA A;  3VBF A;  3UGG A;  2ZZJ A;  2VAU A;  4XPV A;  2HBT A;  3ZXG A;  4KNC A;  2R04 3;  1I6X A;  1U12 A;  2W92 A;  4E2S A;  4E8C A;  2W39 A;  4F8A A;  4ZU4 A;  3VUO A;  4NHX A;  3NV1 A;  2CGN A;  2BBA A;  4IGQ A;  3U75 A;  2G19 A;  1K5M A;  1SQ4 A;  1AYN 1;  2Y6G A;  1W2A X;  4QGN A;  2YC4 A;  1OLQ A;  3N3H A;  4P5H A;  4Q1P A;  5FP3 A;  3N7K A;  4PCR A;  1IS5 A;  1QXJ A;  3HN3 A;  4AL9 A;  3LGR A;  5LW9 A;  3DKW A;  3QH7 A;  1RUG 2;  4IV1 C;  4LBL A;  3SQO A;  4B4Q A;  1SCS A;  4Y1X A;  2TBV A;  4XJA A;  3FFQ A;  1VAV A;  5KR7 A;  1HIX A;  3AZZ A;  3J9S A;  2NLR A;  4CCL A;  1ASJ 2;  1HRV 2;  2B8M A;  5C4W B;  4BLI A;  3BIW E;  3JBG 3;  2BFU S;  3ZN6 A;  4XAE A;  5JSO A;  1KDM A;  3I3B A;  4Y1U A;  4UT5 A;  3NV2 A;  4AED C;  2PYT A;  5T52 A;  4B3N A;  4XQD A;  1TVG A;  4N43 C;  2PLV 3;  2HWB 2;  4AEM A;  1ZRD A;  5CBL A;  2YZ4 A;  3IMM A;  1GNH A;  4Q27 A;  3D0J A;  4JHZ A;  3KV4 A;  4XJW A;  4NJ4 A;  4QM8 A;  5FBZ A;  4Q8K A;  4AFB A;  1VBC 1;  5J98 B;  1ZRI A;  2VME A;  2JB8 A;  4IE0 A;  3T2P A;  3V65 A;  3H50 A;  3LFI A;  2E7T A;  3C7H A;  1LCL A;  3I2I A;  4XCA A;  2DTY A;  4EZ4 A;  3J26 N;  2VUA A;  1VRH 3;  5FYB A;  2CGO A;  2JEN A;  3ZYB A;  1BK0 A;  5LK5 A;  4CPB A;  4LHL A;  5I8T A;  1O3S A;  3EYP A;  2ZX3 A;  4QXB A;  3RVH A;  1TQ5 A;  1YRZ A;  2V4V A;  3AMQ A;  4LIV A;  4A6S A;  1WZX A;  1IOA A;  1XNK A;  5AVA A;  4QB6 A;  1M4W A;  1Y43 B;  1AVB A;  1ULG A;  2D93 A;  3RSJ A;  4DRV A;  3OBZ A;  4MGI E;  1YXW A;  2WRA A;  3DPR C;  2X8K A;  5AC9 2;  5AFB A;  4RR3 B;  4LHK A;  4I30 A;  2A71 A;  1POQ A;  2CY6 A;  4GZ9 A;  3I2O A;  1SZB A;  2HBU A;  3CEW A;  4OZO A;  2GAL A;  4IEV A;  3TAY A;  4PDW A;  3B7M A;  1GIC A;  4NAM A;  2VMC A;  2JDK A;  4GD4 A;  3ZDV A;  1Q5O A;  2HWB 1;  2OUH A;  3JUU A;  2FQP A;  5IJR A;  1W8T A;  4NHK A;  5K7P A;  3UT0 A;  1OF3 A;  4DS0 A;  1AHS A;  2YU1 A;  2YYO A;  1Q8Q A;  1W8Z A;  2FMY A;  2GC3 A;  1K5M B;  3SEE A;  4A44 A;  4E8D A;  3L2H A;  1WA4 A;  4O7X A;  1NKG A;  2QZ2 A;  3ACH A;  4PLO A;  2QDN A;  4Q4V 1;  4XVH A;  4W50 A;  1R09 1;  4CRQ A;  5C5U A;  1VAK A;  1EY2 A;  3HT1 A;  3LWC A;  2W9X A;  1GBG A;  1RTV A;  3AVS A;  3QBQ A;  3W21 A;  2X29 A;  3PL0 A;  2WSV A;  1OHF A;  4UFM A;  3B69 A;  5C9A C;  3III A;  1HXS 3;  2OX0 A;  4ISR A;  1J59 A;  2QZ3 A;  1GZ9 A;  1YIF A;  1O4Y A;  2XVK A;  3PUH A;  5JXG A;  2ET7 A;  1LB2 A;  4A7Z A;  2AH2 A;  4ZZ5 A;  1JW6 A;  4QMA A;  1JOJ A;  4D7S A;  3RJR A;  3EQE A;  4KWL A;  2ZXQ A;  2BRT A;  1J3P A;  4NWW A;  2WQ8 A;  4B4P A;  1JZ2 A;  1KGY A;  3NJY A;  4LHN A;  4UW4 A;  2YGL A;  5FR3 A;  2Q8E A;  3WCS A;  4N53 C;  1A6C A;  3LEM A;  3K2O A;  2BWA A;  1RUJ 1;  3N36 A;  5JVV A;  1RUE 3;  3HT2 A;  1JOB A;  3BAL A;  4W8J A;  3ILR A;  3LCP A;  1MAC A;  1BLZ A;  2WR9 A;  3AKS A;  4LBJ A;  3ZXL A;  5IVC A;  3IN9 A;  2NP0 A;  4Q4W 2;  4GKY A;  3VBS C;  3S5Q A;  5JR7 B;  1LOC A;  2BFU L;  1HXS 2;  4AEJ A;  3C2U A;  2XHN A;  5FZL A;  5A3U A;  2F17 A;  3LB9 A;  2ADD A;  1HLC A;  4NRP A;  3C7F A;  3LPG A;  5DQ0 A;  4C0B A;  5J96 B;  5KXE A;  3BKZ A;  2G1M A;  1QDC A;  1W2O A;  2A6Z A;  5JXJ A;  2JKX A;  4Z07 A;  2PHW A;  4OZX A;  5CG8 A;  4A45 A;  4NID A;  3WV6 A;  1Y4W A;  2Y60 A;  4YW6 A;  3BI3 A;  4CP9 B;  4Q4W 1;  2CGP A;  1QOS A;  2VXJ A;  1XYP A;  2JWP A;  4AI9 A;  5LBB A;  4MAD A;  1EUT A;  3MYX A;  1HXS 1;  3DXT A;  3KWV A;  2D3S A; 
#chains in the Genus database with same CATH homology
 3PUR A;  4EZ4 A;  5A7Q A;  5FYZ A;  5IVV A;  5FYB A;  4XDP A;  2PXJ A;  5A3N A;  2YBP A;  5FP7 A;  5FZM A;  2GP5 A;  5F5A A;  4QXB A;  3RVH A;  5IVB A;  3PU8 A;  4LIV A;  5A7O A;  5A7P A;  3AL6 A;  5FPB A;  4BXF A;  3N9P A;  2XML A;  5FUN A;  3KVB A;  2YBK A;  4EYU A;  5IW0 A;  5FJK A;  5FXW A;  3OPW A;  2XXZ A;  5A3T A;  5E6H A;  4DIQ A;  5F39 A;  5FPU A;  3N9M A;  3K3N A;  5FP8 A;  5FZO A;  4CCN A;  2XDV A;  4D6S A;  5IVY A;  5CEH A;  4GD4 A;  4Y4R A;  3PU3 A;  5FZB A;  5IVJ A;  5FPA A;  5IWF A;  3U4S A;  4V2V A;  2YPD A;  2YU1 A;  4LXL A;  4C8D A;  5K4L A;  3LDB A;  4QXH A;  4ASK A;  5FJH A;  5LY1 A;  5A1F A;  5F5C A;  4IGP A;  5FZ4 A;  5FUP A;  5FY9 A;  5FYI A;  5FZ7 A;  2GP3 A;  2OT7 A;  3N9L A;  5FZE A;  5FZO B;  5FZG A;  5F3E A;  3AVS A;  5FXX A;  3ZPO A;  4BU2 A;  3KVA A;  5FP9 A;  3PUA A;  5F32 A;  5FY8 A;  4QWN A;  3KV9 A;  3PUQ A;  4LIT A;  5FZ8 A;  5ISL A;  2OX0 A;  5A3W A;  5ANQ A;  4URA A;  4XDO A;  5FP4 A;  4LIU A;  4E4H A;  2OQ6 A;  5A7W B;  4QU1 A;  5A7N A;  4V2W A;  3UYJ A;  4GJY A;  4NUB A;  4UF0 B;  5FYH A;  5FZK A;  5FXV A;  5FY4 A;  2Q8C A;  4IGQ A;  5FPV A;  5FWE A;  4Y3O A;  3N9O A;  1VRB A;  5F37 A;  3AVR A;  5FP3 A;  5FBJ A;  5FY7 A;  3NJY A;  5F2S A;  5FZF A;  5IVF A;  3PDQ A;  5FV3 A;  5A3P A;  5LW9 A;  2OQ7 A;  2Q8E A;  4D6Q A;  4QX8 A;  5IVE A;  4CCM A;  2YBS A;  3K2O A;  3ZLI A;  5F3C A;  4AAP A;  5A80 A;  5F2W A;  5FZ9 A;  2W2I A;  2Q8D A;  2YU2 A;  5FYC A;  5FZI A;  4HON A;  5A1L A;  5IVC A;  3DXU A;  4UF0 A;  3U78 A;  5FZD A;  5KR7 A;  5F3G A;  5FZH A;  5FYY A;  4IGO A;  2XUE A;  4CSW A;  3PUS A;  5FY5 A;  4CCL A;  5FWJ A;  5F3I A;  5FZL A;  3KV5 A;  5FYV A;  5A7S A;  2WWJ A;  5FYM A;  3KV6 A;  5FZC A;  4TN7 A;  4CCO A;  3N9Q A;  5FYU A;  5FXZ A;  4CCJ A;  5FYT A;  4EZH A;  5FYS A;  5LWB A;  4GAZ A;  4Y33 A;  3OPT A;  5FZ6 A;  3N9N A;  4DO0 A;  2WWU A;  4QX7 A;  4CCK A;  5A7W A;  4HOO A;  5LY2 A;  3KV4 A;  4D6R A;  4GJZ A;  5FPL A;  3PTR B;  2P5B A;  3K3O A;  2VD7 A;  3LD8 A;  5FZ3 A;  4BIS A;  4CUG A;  4QXC A;  5FY1 A;  4AI9 A;  2OS2 A;  5FZ0 A;  5F5I A;  5FZ1 A;  5FY0 A;  3AL5 A;  3DXT A;  5FZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...