3HT1A

1.2a structure of the polyketide cyclase remf from streptomyces resistomycificus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
142
Chain Sequence
b'MMKRVHRTDVKAEIVREPGAKETTHRKLIDTPDGADRFVLTEFEVSPNGSTPPHFHEWEHEIYVLEGSMGLVLPDQGRTEEVGPGEAIFIPRGEPHGFVTGPGQTCRFLVVAPCERPPVRNVFLSEDPYEYTQMPEYTSLLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RemF protein
publication title The polyketide cyclase RemF from Streptomyces resistomycificus contains an unusual octahedral zinc binding site
pubmed doi rcsb
source organism Streptomyces resistomycificus
molecule tags Lyase
total genus 32
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ht1A00
4IEQA 4IEVA 1VJ2A 3E97A 2PHDA 3DV8A 2XHKA 4AVAA 1ZREA 2QJVA 2K9ZA 3OF1A 3IDCB 3PLQA 4LTAA 2PYTA 2PQQA 1I5ZA 1NYWA 5I0SA 2N7GA 4RD7A 3WW4A 2EVXA 1ZRDA 3U0ZA 4XEZA 2H6CA 3E6BA 3FE5A 3LA7A 5BV6A 3FHIB 1J3PA 1ZZ9A 2OA2A 1CAVA 1VP6A 2WC2A 3NJZA 5C6CA 4CYDA 1J3QA 1YUDA 2GC1A 3I59A 1QXJA 5FPXA 2BEOA 2GC0A 4QGLA 2DCTA 4D7SA 4JVAA 4KWJA 4LA2A 5JSRA 3D0JA 4UXAA 4E2GA 4Q29A 2D40A 3U10A 4B29A 3BALA 4MGIE 1GQHA 3SCHA 4QM8A 1X8MA 5E1RA 5E16A 1YFXA 3H7JA 1O3RA 1QXRA 4ONUA 4HLTA 4F8AA 1ZRRA 1NXMA 3WW2A 4IEYA 1RGSA 3H3UA 5LEJA 4ZU7A 4PIXA 2EA7A 2XGXA 1FT9A 3CF6E 3WW3A 3I7DA 2UY8A 4KU7A 4LULA 5C8WA 4LLOA 3GYDA 1FXZA 2XKPA 5EZWA 3FX3A 1ZX5A 4E2QA 2GU9A 4UBGA 2MNGA 1GQGA 3M3IA 4P9GA 2QDRA 4X6RB 3ACLA 2PAEA 1O7FA 1XRUA 5KBFA 1U12A 2VQAA 4I0AA 2QVSB 4QX5A 2MHFA 3MYXA 4H7LA 3S7IA 4LA3A 2E9QA 3ES1A 3S0MA 2IXJA 4MUVA 3H1YA 2VPVA 1FI2A 4EWAA 4Q0QA 5LRSA 4PIZA 2XLGA 5KHJA 2Y0OA 2UYBA 5T3NA 1PMIA 3NSTA 5EFUA 3LAGA 3BB6A 1EYBA 4IEWA 4MGYE 1O5LA 4NVPA 1CX4A 3CLPA 1ZRFA 3UKNA 3IIAA 3OD0A 3ETQA 1UIKA 1UIJA 5AVPA 2MPFA 3SHRA 2Q30A 2XL9A 4EWEA 1SFNA 3OCPA 4XFFA 4FAGA 1YWKA 3H1WA 4HN1A 2H6BA 5CADA 4E2SA 1IPJA 4MGKE 2ETEA 4PIYA 1CAUA 3RNSA 4O9EA 4KU8A 5KHHA 3IBMA 4IEZA 3PNAA 4Z07A 3BCWA 2B8MA 2C0ZA 3RDIA 3EQEA 1RTVA 3EO6A 4XFCA 2H0VA 3CEWA 2CAVA 4JTNA 4LUMA 4BH9A 3FJSA 3RYRA 2CAUA 3E5XA 2FMYA 4Q0PA 4QGMA 3RPQA 5HI0A 3M70A 1CAWB 3BPZA 1CAXB 5LRRA 1G6NA 5J3UA 3DL3A 4X6QB 4I0BA 4HVRA 4Q0SA 4OLLA 5FLHA 1Q3EA 2PAKA 4IESA 4XFBA 4I02A 3H1MA 4MV2A 4WBBA 4MZUA 1LB2A 4HZFA 3JZVA 1RUNA 3CL1A 2GH2A 4EV0A 3LOIA 4EWDA 3TNQA 4META 3ST7A 2Q0AA 5K8SA 3NVCA 3H9AA 1OI6A 1ZZCA 4YNIA 4QXKA 3N4MA 4HSLA 3QOPA 4L11A 3MPBA 1X82A 2QCSB 5LEKA 1LKNA 4XF0A 3KGZA 1CAVB 2Z2SB 1ZRCA 1JUHA 3I59B 4J1XA 2CV6A 3MZHA 4JV4A 4PJYA 3E6CC 2P17A 1YFUA 3NW4A 3USSA 1IPKA 5I8TA 3IWZA 4ZU4A 1LR5A 1RC6A 2IXCA 3MDPA 4XF9A 4A2UA 1OFNA 1YFWA 4DINB 2BNOA 3TNPB 4BIFA 5J7MA 1EY2A 3D82A 4AXOA 2IXIA 2Q1ZB 4IERA 5KHIA 2PHLA 2GC2A 2BYVE 4IEXA 1O4TA 3PVBB 4Z82A 1UW8A 1V70A 2GZWA 5CU1A 3ELNA 3RZZA 1WLTA 3ROUA 2D93A 4I01A 3WW1A 3LWCA 2WFPA 5FQ0B 3E5UA 4ZU5A 2IXLA 5BY5A 3HT1A 5JAXA 3RYKA 4HMZA 5I8YA 4OFGA 1XE7A 1RUOA 1OMIA 2XKOA 1DZRA 3HT2A 5I0RA 4QM9A 2XLFA 3KMHA 3FZ3A 1VR3A 3O14A 3NL1A 1ZZ8A 4IETA 2BNMA 1I6XA 3LA2A 1O3SA 3E6DA 4GULA 3L2HA 3UKTA 2VECA 3LZZA 4QMAA 3LA3A 3SMHA 1J58A 4HN0A 4FT8A 3SCGA 4XETA 3KCCA 2IC1A 1O5UA 4BHPA 1YHFA 3FFQA 3OTFA 3B02A 1ZZ6A 3CO2A 4R8HA 2F4PA 2OZJA 2OZ6A 4AVBA 5KHKA 4KWKA 3D0SA 4UBHA 1UCXA 3DKWA 5KHGA 1Y3TA 5FLJA 4KL1A 2O1QA 4LEJA 1PM7A 4XFIA 3KSCA 4FAHA 1YLLA 1J59A 4XF3A 2Z69A 1UD1A 4N9IA 2GAUA 2D5HA 5BPXA 2KXLA 1Q5OA 1CAUB 2XL7A 4HVQA 1J3RA 1NE6A 4AQ6A 4BYYA 4LUKA 1ZZ7A 4K8FA 4J1WA 1DZTA 3RYPA 2GC3A 4XF1A 4IEUA 1DGRA 2EAAA 3QACA 5JCTA 1XE8A 4KWLA 4YARA 5J48A 4Q0UA 5FPZA 1H1MA 2PFWA 3R6SA 3BU7A 4D7TA 5BUVA 2HJIA 1TQ5A 3EHKA 1O3TA 3HQXA 2CGPA 2Q4SA 3HIFA 2K0GA 2ATFA 3EBRA 1H1IA 3ZDSA 4L2NA 4QGNA 5I93A 2PAMA 3H3ZA 2B5HA 4F7ZA 4HSJA 3SXWA 1SEFA 2O8QA 1Q43A 2IXKA 5I91A 5I0UA 3CJXA 5CVRA 5D1IA 3OGJA 1CGPA 5FDBA 3S7EA 3SCFA 4JTOA 5BXXA 5I8SA 4EROA 1ZVFA 4XFGA 1QWRA 4XFAA 1UPIA 4MGZE 4O9GA 3ES4A 4ORFA 5FQ0A 5FLIA 1X7NA 4I09A 2ET1A 2HKXA 3EJKA 3UKVA 2UYAA 3DN7A 4HBNA 5JR7B 2ZCWA 4Q0VA 4YSFA 1NE4A 3G7DA 4HVOA 3VHRA 1J1LA 1ZZBA 2IXHA 3IDBB 4AVCA 1LRHA 1RL3A 2B9UA 3I54A 3H8UA 4IEOA 2D5FA 2FQPA 3C3VA 4XFHA 1QY4A 4I3PA 2PTMA 3H50A 4TLFA 2UY9A 2PA7A 3GBFA 2V09A 1EP0A 4MH0E 3E5QA 1EPZA 3U11A 4YYOA 2BGCA 4R52A 2ZKLA 4XF4A 2OYZA 5JSOA 4IEPA 2XLAA 4MX3A 1O3QA 2BNNA 3FWEA 1Y9QA 5F1RA 1SQ4A 1CAWA 1DGWA 1WA4A 1NZCA 1X8EA 1CAXA 3NKTA 5I0TA 1YFYA 1L3JA 3KGLA 3H7YA 5JSPA 2ET7A 1OD5A 4YRDA 2I45A 4WZCA 2QNKA 4WVZA 1WGPA 4FBFA 2OPKA 1HW5A 4N9HA 5FCCA 1ZNPA 4I2OA 4AQ2A
chains in the Genus database with same CATH superfamily
5F2SA 3VZJA 2JDKA 3APBA 4RFRB 5FO9B 1VJ2A 3LPFA 3L9JT 1ULFA 1IG3A 5IJRA 4ARXA 1AR83 3WDTA 2VGDA 4CP0A 2JD9A 2VVDA 4LBLA 2BWCA 2K9ZA 5LY2A 4AR2A 1JZ3A 3IDCB 1ZREA 3PLQA 5CEHA 1G7YA 1UOFA 4N90A 1W0PA 2DF7A 3MW4A 2PYTA 3AP9A 5IVYA 2PQQA 3POWA 4R9BA 4WM8C 3WD5A 3VHOA 3ZYFA 4A7KA 5I0SA 1RJ7A 2N7GA 2WYSA 4QB6A 3SISA 2VC9A 5FV3A 3HBZA 3JB4C 4RN5A 1RUH3 1G9CA 3MHZA 1ZRDA 4A6SA 1F4AA 2ES3A 1OPOA 1UF2C 2WFF2 1WMXA 3BUCA 2ZX0A 3I2HA 3VGIA 4AQTA 1NX9A 4HT1T 1DGWX 3AYDA 4Y22A 1CAVA 1ND3B 4PBPA 5DDJ2 2ZEZA 3VBUB 2VW1A 4WVWA 2B42B 2GC1A 3CQOA 4NR1A 3KZ4C 4AZZA 2JDHA 3KF3A 3WCSA 3ZYRA 2EIDA 2CWMA 1F2NA 1LOCA 4IXLA 3H0OA 1ULCA 2G19A 3HN1A 1ND2B 3N7KA 1T2XA 4UXAA 5ABJC 2D40A 5F37A 4B29A 1C1LA 1GQHA 1RUI1 4FFGA 5E1RA 3RI8A 1R64A 4F3JA 1MVEA 2R32A 4IE6A 4PBOA 1GZWB 1KS4A 2X5IC 5A3LA 3IMNA 4QB2A 3K4ZA 2PHWA 2WFF3 1RUG2 2Y6KA 1O3RA 4QHZA 1LECA 1QXRA 2HEWF 3V64A 3WQBA 4C0HA 3H8RA 2YG0A 4F8AA 4A3ZA 1ZRRA 3DXUA 4ISQA 4DNYA 1S0DA 5DDJ3 3F2ZA 1YIPA 3WW2A 2W46A 4IEYA 1O8PA 5FZGA 5IFTA 5FKBA 5LEJA 4PIXA 2QZ3A 5FUIA 2EA7A 1LU2A 3I2FA 4UFJA 4AI1A 3U14A 2D44A 4LULA 3LB9A 5C9AA 1MEC2 2VOWA 4LLOA 4OVEA 3G6JB 2EXKA 1W8UA 5A3UA 1D7PM 3KS7A 3IAQA 3R4SA 2WDBA 3ZVXA 2XJSA 1RUG3 1ZX5A 2YU2A 1AX2A 3VBSC 1LHOA 2MNGA 2WYFA 4Q4W2 2ZZQA 1DGLA 5L9BA 2NP0A 4Q4Y2 3M3EA 4YG6A 3W5MA 1ODNA 3KF5A 1ZBA1 3BTZA 4IE0A 2VQAA 2Y6GA 4AVSA 1WLDA 2IXJA 3N7JA 3MV01 2AACA 5TSWA 1MEC3 2ZABA 3BVCA 2VPVA 4RHV2 5LRSA 4BXSV 5A32B 4QB1A 2OQ7A 3HR9A 4HPKB 1CD3G 2XLGA 4PIZA 4CP2A 2Y0OA 4AAPA 5H9SA 1KFXL 2UYBA 3KHCA 4NRPA 2X10A 1GANA 3LAGA 5EV7A 4AQSA 1GP6A 4BCUA 2JDYA 3ACIA 3PUSA 1JH5A 3AKRA 4FPGA 1KEXA 4Q4W3 3OGRA 4Q4Y3 1CX4A 1NY72 4QPIB 5DUVA 1VBE2 5DZFA 4CDWA 1Y9GA 4ES8A 3T0DA 3ETQA 4JRLA 1POV0 2FCTA 4QXCA 1KDMA 2MPFA 4XJAA 5AVPA 3MEPA 4YW4A 4CP9B 4DXTA 3SHRA 3VD4A 5LWBA 3TN91 3PUAA 2XR4A 5KXCA 4LBKA 4N7UA 4RHV3 1R091 2XL9A 3FC0A 4JGYC 2JG8C 4PHZA 3VKLA 2RMU2 3GZUC 1Q8QA 1WCQA 3OCPA 3AZVA 2WAOA 3VBRA 1TZOA 2HEVF 1YWKA 3H1WA 4FAGA 2AREA 3P1IA 1YQ5A 3B3QE 1TMF1 1GP4A 3N7LA 1W2AX 2ETEA 2RR12 4MGKE 4CEWC 1AR91 2P3KA 4O7XA 1CAUA 3LIHA 4NPRA 5FK7A 3Q8BA 1VBE3 3RNSA 4OHWA 1B09A 2A73B 5BNOB 3GDBA 1C3HA 1CJDA 3TB0A 2AEYA 3PNAA 5FZ3A 2W94A 2W92A 4DUVA 3AL6A 3T08A 5JUVA 5FJKA 1AYM3 2C0ZA 4R9AA 2V4VA 1QQP2 2DV9A 5GLWA 2AZ5A 1RTVA 3CHXA 3EO6A 1SLIA 1VAMA 2RMU3 4QHBA 3CEWA 1OLQA 4ZXEA 3W58A 2W1UA 5CZKA 2VR4A 3FJSA 3RYRA 4XURA 4LHLA 3RWKX 1U0AA 2CAUA 3DPRB 3E5XA 3SKJE 4C8DA 2RJKA 2E53A 4RQPA 2RR13 1UYZA 4XDOA 4AE2A 4FP3A 1C28A 1KS5A 2A6ZA 3GM8A 3MUZ1 3ZN6B 4BIOA 3TEZA 4X6QB 4I0BA 3FLTA 4HK9A 2WNVB 3OPZA 1HB1A 4AEDB 1FV3A 3ECQA 3WP5A 1OSGA 2PAKA 1RUC2 1AL22 1IQDC 1AR62 4EZ4A 4DRRA 1ULOA 1UZZA 1SMVA 3WINE 1QQP3 1GOGA 4MZUA 2E7AA 1YQ6A 1PO21 1WBLA 2RS51 1GNYA 5D2AA 3LOIA 2CYFA 4ATEA 2ZEXA 4META 2XJUA 4OUMA 4P9IA 2VQUA 5DAXA 3J4UH 1Z7S2 5L7OA 4YM0A 4LO4B 3WXPA 3NVCA 1NUKA 3R05A 2Y34A 3QH7A 5FY8A 5HBAA 1PGL2 3QOPA 1W3XA 2DVBA 3MPBA 1X82A 4UAPA 4BQXA 3L2YA 2R041 4MO3M 1F31A 2VOKA 5EWSA 1RUC3 1AL23 1LKNA 1REEA 4YG0A 1DLLA 1AR63 1ENXA 3QBQA 4E4ZA 3KGZA 4LPLA 3J7NA 1GWKA 2YXSA 1UOGA 1WCDJ 3I59B 3J7MA 3MIFA 4FOVA 3W20A 1FX5A 4JV4A 4PJYA 3AZZA 5T50A 4RSUA 3RZLA 2HWF2 1SCRA 3USSA 1LHUA 1Z7S3 2JDZA 4QQ2A 3WG4A 5LZ6A 1TNRA 3BTYA 5B4XA 2WL1A 1K12A 1NCQC 3AP7A 4FO9A 3D5OA 1AJKA 3MDPA 2VY0A 4A2UA 1YQCA 2RS12 1CPMA 1WLWA 1YFWA 4LK6A 2BNOA 1NCRC 4M3CF 1YYNA 3TNPB 5FZBA 5EPAA 2WO7A 4BIFA 1BKZA 3F95A 1GU3A 1VRH2 1ONAA 3CNAA 5FY9A 1REDA 4QX0A 4IERA 4XMIA 4CDUA 1QJY2 1I3HA 5K0UC 3TEWA 4K6BA 5JVVA 1N1VA 1BMV2 2VOXA 2HWE2 4GH4C 4KNCA 3ZN5A 1G9DA 3ZPOA 3C7HA 4CCDA 1JS9A 3PVBB 2ZOEB 1LOAA 1SLTA 1UW8A 5GLZA 5C4WA 4U2AA 2HWF3 1OOPC 4J25A 1W6OA 3MW2A 4N7IA 3GALA 2P5BA 4PLOA 4YVSC 1XNTA 4NHLA 4BK5A 2VXRA 3JBG1 2ZGRA 3GJBA 3AYCA 4LKDA 3RS6A 1JOJA 3V0BB 4FOQA 2D6KA 3A23A 4JGZA 4ZU5A 2RS13 1W2TA 2IXLA 1JYNA 2D3RA 4EN0A 5BY5A 1N1TA 2JIGA 1GOHA 1MZFA 1VMFA 2GP5A 1FYUA 5JPMB 3KVAA 4OQ8A 1VRH3 3OEBA 2BRTA 4AI9A 2XKOA 4CU8A 1QJY3 1VAVA 2E6VA 2OVUA 1GSLA 3HT2A 2QQLA 3VBSB 4FTSA 2DVGA 2XLFA 3BYWA 4BQ5A 3AX4A 2LW8A 4K20A 5LY1A 1UN1A 1ZZ8A 4GA9A 1HRI2 2BNMA 3MI8A 3VKNA 3AYAA 2ZGMA 3LA2A 3VL9A 1JOPA 5BNPB 1O3SA 1M06G 3VBHA 1N1SA 3P6BA 4LBQA 3THDA 3KVBA 3LA3A 3B5LB 5GM0A 1V6JA 3VDAA 4CU9A 3RFRA 1UMZA 2XDVA 2ENRA 3IPVB 1O5UA 3NNGA 2W52A 5KR7A 1HRV2 2V4AA 3FFQA 1POV1 3VZOA 1BLZA 2ZGNA 1RUD2 5CAZA 1RUE2 4XHXA 2YBKA 2ZACA 3M8LA 3T1LA 1BK0A 4GXLA 1KQRA 1BVVA 4JKMA 3TWIA 2RVAA 2Y6JA 3AZXA 1US3A 4CXWA 2VW2A 4NIHA 1FV2A 1RVF1 2OZJA 1HRI3 1S4CA 2OZ6A 3VBOB 1UYXA 4YVWA 5FY5A 5KHKA 3T1MA 4XUPA 4HXCA 2XG3A 1W8HA 3DKWA 2E63A 3NKGA 2YPJA 4ZZ8A 1QDCA 3SNMA 1BBT2 1S0CA 3WV6A 2O1QA 3MF9A 5CKMA 1B35A 2F17A 4HOOA 1NT0A 2FDJA 3KSCA 1AYN2 1TME1 1ZA7A 2JG8B 1HRV3 2XBO2 3NAPA 4WVMB 4DRVA 3RJ2X 2QQUA 2DUQA 1RUD3 2Z69A 1SFYA 1UD1A 4D3WA 2Y64A 4XUOA 3LPGA 1RUE3 2KXLA 3VBFA 1Q5OA 5LK5A 5JOZA 2JKBA 4JDOA 5EYYA 4UFHA 4FPFA 4CEWB 1NE6A 1C8M2 3M3QA 1CIWA 5FYIA 2G4IA 4LUKA 1ZZ7A 4BYYA 3ZFFC 3J8F1 3GNEA 3AJZA 4TN7A 1QJU1 2EAAA 4CCKA 5FYZA 2ARCA 4GB31 1VBB1 3T2TA 2W0XA 5B2GB 5J09A 3I2JA 1BBT3 1GWLA 2CDOA 3Q8EA 5FZHA 5J48A 3JUUA 4Y1YA 5D8AC 5FWEA 2ARBA 2PFWA 1AYN3 1NLRA 1ODMA 1PMJX 2XBO3 3POYA 4PF5A 2GH8A 4RL7A 2D3SA 2W47A 1BYHA 2HJIA 3KV9A 4LO8A 3THCA 3ZKYA 3POGA 3T2QA 3HQXA 4PLNA 1LGBA 2CGPA 1NA1A 3AMPA 3HIFA 1EAH2 1C8M3 2DVDA 5GKAC 1XNCA 4PQQA 2W2IA 4F83A 3ZSEA 5IAXA 1JBCA 3MPPG 1COV1 3KV4A 3KLSA 4HSJA 4QKDA 4XVHA 3SXWA 1JYVA 1JYTA 2O8QA 2YC4A 2PHFA 5G04L 1POQA 5I0UA 4OZXA 1Z0HA 3CJXA 5CVRA 1WCKA 5GZDA 1YRZA 2WR9A 3A0NA 5I8SA 5A6QA 5F39A 1XU2A 4XFGA 2DURA 1QWRA 3URFA 1UPIA 1UU4A 2JG9B 3KQ4B 3IAPA 3DUIA 4MGZE 3T4VA 5C5TA 4ORFA 3T2OA 5GLTA 4XW3A 5FQ0A 1BK1A 3UESA 1SBDA 1IPSA 2FDFA 4IV3A 2HWC2 2V5DA 4DZGA 1EAH3 4WVVA 4BM8A 1XXNA 2C9KA 4DEVA 4DY3A 3AFGA 3MGUA 1ASJ2 5CNAA 3DN7A 4HBNA 5JR7B 3PU3A 4BE3A 1ULPA 2ZHLA 1HXS1 2C9AA 5A33A 4AI3A 5CFCA 4MGSA 1CZSA 4B4RA 1RYYA 3BPSA 2DTYA 2JDPA 5GLVA 3IZOA 3N9NA 3U78A 2TNFA 1ZZBA 3K46A 1UO9A 2WJSA 3TBDA 1RL3A 4D8MA 2YYOA 1W3VA 4IEOA 4QKFA 4BQ2A 4QPGC 4XFHA 4QQLA 3KHBA 2VZTA 2PTMA 3HNYM 1DZQA 1H8TA 1K5JA 4NUBA 4XJ8A 4LBJA 3ZYHA 1LOFA 1PHMA 2X8KA 5FZOA 3T09A 4FTBA 3H42B 2HWC3 4OHVA 1BZWA 1O6UA 4NHXA 1NCQB 3UGGA 3S6PA 4I3GA 1QDOA 3T0AA 4W50A 1EP0A 1ASJ3 4LOSA 1E57A 5F7UA 4QD2A 5A7NA 4NIGA 2FDIA 3WP6A 4C90A 2OYZA 4R52A 2BJSA 5JSOA 1IHMA 4IEPA 4GMP0 3VBUC 2BNNA 1MQTA 3LEIA 3FWEA 1DIWA 5K0UB 3M7AA 5FYBA 4RR3A 1SPPB 1V9U2 4XHBA 1H1AA 4GH4B 1CAXA 4QWNA 3NKTA 3PMSA 1W8NA 5I0TA 5C33A 3O1VA 4NOTA 1BQPA 1SLLA 4O65A 3KGLA 3PURA 1OD5A 1OOPB 1S55A 2I45A 2VQTA 4Q5OA 2RM21 4YVSB 3WG3A 1D0HA 4FBFA 1YIFA 3AMMA 4XJZA 4CPBA 2G9FA 4E4SA 4G3YC 1QOTA 5A7WA 4AQ2A 2ZGTA 2J42A 3E97A 1SHWB 2WT2A 2ZAAA 3ON7A 3AXDA 4IGQA 1OA3A 1W8OA 5LCWL 2XHKA 5LATA 1DQ5A 3N9LA 2XJPA 4XTMA 2IFRA 3I2KA 4YW7A 5C8CA 3ZYGA 5I0DA 3OBRA 5FXXA 3WQ1A 1SCSA 1QGLA 1V9U3 3ZSMA 1I5ZA 1NYWA 4FSJA 1A8DA 5KXDA 5JXJA 2D6NA 1W04A 5DUWA 4NMIA 1XYNA 5KXEA 2EVXA 2WSUA 2VZSA 2Z79A 2CU5A 2TEPA 3OUJA 4XEZA 2ORZA 4GJYA 5BV6A 1GBGA 2CHHA 4IE5A 3FHIB 2IVJA 1ZZ9A 1VP6A 3K48A 4AL9A 4B3NA 4CYDA 3OGGA 4AVVA 5ANQA 5FPXA 2P1BA 5F5CA 4CDXB 2BEOA 4E2GA 2VMCA 3PVEA 4FFHA 2BU9A 4QGLA 2HYXA 3KT1A 4JVAA 1MPXA 5JSRA 1MS8A 1SFPA 4Y1ZA 5FPAA 3U10A 3BALA 1F4HA 1K5MB 3LSDA 1X8MA 5JWPA 1WLCA 3ZYBA 2VUAA 3FFZA 3H7JA 4RS5A 4TXWA 4A4AA 2JDAA 3ILRA 3FLRA 4ONUA 2XH6A 4XBNA 5F5QA 2XVLA 1HB4A 3I3BA 1MACA 1S0IA 3KB5A 4O61A 4IUGA 1KFUL 4ZU7A 3AP4A 1V0AA 2VULA 4D94A 5C9AC 1Y4WA 1LOGA 2ARAA 2XGXA 1J1TA 4NROA 5CFDA 1FT9A 2XWBB 2WLQA 3ZFGA 3WW3A 3UL2A 4QX2A 1VBC1 1JYXA 3GCXA 1ZBA2 4YGBA 5FZEA 3P3PA 3GYDA 1GZCA 2FCUA 5FOBB 1UZYA 2Y8KA 1FXZA 2XKPA 4KGQA 4B8EA 4CEYA 2XONA 2HWB1 2QQMA 5A7PA 5EZWA 1PO12 3PTYA 3AMNA 3FX3A 2ZX4A 4BB3A 4P08A 2VUDA 2GU9A 1GFF2 2E7QA 3OGVA 1PK6A 4MG2A 3ZXGA 2KM2A 2V5YA 3U37A 3ACLA 2PAEA 1O7FA 5JOWA 5D8AB 5KBFA 4Y20A 4I0AA 2Z42A 5FZCA 1IS3A 2R061 4IV1A 4LA3A 4W6YA 2E9QA 4ITCA 3JCIA 2EXJA 3UNPA 3CKHA 1ZBA3 3AFKA 2ZGUA 2CTVA 2KD7A 2WQ8A 3H1YA 2X05A 3RWNA 4EWAA 2WO1A 4COVA 1S2BA 1CX1A 4LHNA 3X29B 4BJ0A 2AENA 4C1XA 4CU6A 5A7QA 1PO13 3RMYA 3BB6A 5AVAA 1LAJA 4Q1PA 2HWD1 2I2SA 1EYBA 4CDWC 2DFBA 2NN8A 1W6MB 3HQRA 5C5UA 1ALYA 4COUA 4QAWA 4RYDA 1HQNA 4CCMA 3DPRC 4BQ3A 2BOJA 2BGPA 3NNLA 3NV3A 2JKXA 2W9XA 1TMF2 1W9SA 1R1A2 2P4EA 5GLUA 1CJPA 2J1EA 3QCWA 4UW3A 5GZCA 3H3LA 1UZ0A 1AR92 4X8PA 4PCRA 5EXOA 1XSQA 4COWA 5FYMA 3HN3A 2WZPP 1IS4A 1BEV1 4QU1A 1LULA 1H30A 2WNVC 1AVBA 4LJHA 4AEDC 1EV11 1X9TA 5IWFA 3ZSKA 1JUIA 1GWMA 2I07B 3VD3A 4EJRA 4EWEA 4AG4A 1HN0A 5KWRA 2VU9A 2GSYA 4XFFA 1HX6A 1AR71 3N36A 5FYSA 2WT1A 4XOGA 5JLVA 4CXXA 5CADA 1WW4A 4E2SA 1QJX1 1CIYA 3ZXJA 3I3DA 1VLNA 2ZMLA 2BW8A 3WDXA 4E4HA 4PIYA 1UU5A 1R1ZA 1VBA2 3HAGA 2BQPA 1TMF3 3ALQA 1R1A3 4O9EA 2P2KA 4KU8A 5FYVA 4CDQC 4IEZA 1U5XA 4QPGB 4FPKA 1AR93 1L7LA 2FBEA 3K2OA 4GMP1 4Z07A 1BHGA 3EB7A 2VUJA 2FDKA 4N43A 1H2KA 3PIJA 5E8AA 2E7TA 3JD71 5FREA 1AXZA 1WW5A 2AR6A 2DU0A 4XFCA 5CG9A 4HG6B 4INDA 4IGOA 1IGOA 4JTNA 5LBCA 3WLUA 3A0KA 2CGOA 1PZ7A 4QDSA 4DPNA 4ZKTB 1OPMA 4QGMA 3AXEA 2WAAA 4Q0PA 2VCMA 4NE9A 5FZ7A 4YWAA 3RPQA 3K3OA 2ZEWA 4Z2AA 2ZGOA 3OOXA 2E32A 1UQXA 1CAWB 1VE0A 3WHUA 5LRRA 2R49A 5C3SA 1A34A 1VBA3 1PIV1 1UY4A 4HVRA 4Q0SA 2VMDA 4AHYA 4LHSA 1UXZA 4OLLA 5FLHA 5F5AA 4UF0B 4N53C 1CPNA 2JD4A 3H1MA 2JXAA 4YM3A 1LB2A 2R042 1Y43B 3AKQA 4W65A 5CIRA 5FKCA 1GNHA 5FPVA 4BDVB 1VB4A 3O12A 3J9SA 4EV0A 4U36A 4FI9A 4DEQA 3GXUA 4LO6B 5FUPA 5GZEA 5K8SA 3OJBA 3TAYA 4QX8A 3H9AA 1WWYA 4YNIA 3N4MA 4HSLA 4FFIA 3WCRA 5LA1A 3C8XA 3PTRB 3O0XA 5IHRA 2UURA 2VOVA 5LBBA 3WP4A 4PF1A 1CONA 1OT5A 2VBBA 1OUSA 1T6BX 4XIOA 4A45A 3GJAA 2WA3A 4LE4A 3BU0A 2XPJA 1CAVB 4NHKA 2Z2SB 3O1MA 3AP6A 3D8CA 1LODA 4I0WB 2R043 2VVFA 2DCZA 5H9QA 4IGPA 4XQDA 2NZ9A 3O7OA 4B7EA 1BXHA 2P17A 1DGRN 1XQNA 1QMJA 5CKQA 1DYOA 2HH9A 2J7MA 4OULA 4DFSA 5I8TA 4UW4A 3MUY1 2VNGA 2BERA 2BUKA 3IWZA 3PHMA 4B4PA 2RV9A 2R071 3HNBM 3B7MA 3MV11 4ZPIA 4ZU4A 2IXCA 1TE1B 1OFNA 2W91A 2WZ8A 4LK7A 2BV4A 4NWWA 5FYCA 5BNPC 3ILNA 4DB5A 2JEMA 3MBWA 4JHZA 5J7MA 1EY2A 3IB3A 4ZS2A 3WDVA 1H0BA 2VCCA 3AZWA 5C71A 3LEMA 2BBVA 3HVDA 4ASLA 4IE7A 4R4ZA 1DDLA 1LESA 3ZO0B 2VNOA 2A3XA 1H6YA 2BYVE 2ZGQA 4NAOA 1ZM1A 1YO8A 1RHI2 2PLV2 3RGBA 3VD7A 2C6SA 3AVRA 2GZWA 1PX4A 4JGZC 1WLTA 1IG0A 5C9AB 2D93A 2NM1A 3C2UA 3PUIA 4V2VA 3WDWA 5JMOA 3VZMA 2GN3A 3VBOC 5DAVA 4Y1XA 1UX7A 3HT1A 4QXHA 2LS6A 1RMU2 1XC6A 4XE9A 5CB7A 3RYKA 1GZTA 4ZHNA 5I8YA 4OFGA 1XE7A 4Z8BA 1XE0A 2JX9A 2RDRA 2XJVA 4P5YA 1C8NA 1VMJA 4Y4RA 2RDSA 3O5SA 4NO4A 5F6KA 1PNGA 3RZHA 3POFA 2C26A 3FZ3A 3VBHC 1RHI3 2PLV3 1VR3A 3O14A 5IFPA 3NL1A 5ACA1 5A70A 5LA2A 5IAVA 1JZ5A 2AH2A 4AI0A 3NWKA 3IDAA 5DABA 1NXD1 1U5IA 1UU6A 3L2HA 3LFMA 2VECA 3BOWA 3LZZA 4QMAA 3SMHA 1J58A 5F3GA 4NHMA 1RVF2 2VG9A 4FT8A 2QKDA 1JMUB 2ZKNA 3PJQA 2XMLA 4M01A 4YM2A 5DUUA 4BHPA 1RMU3 5BNNC 4V2WA 1FAYA 1WZXA 1Q56A 1YHFA 5A1LA 1CVNA 2EXIA 5FZMA 3CO2A 1GP5A 4BQ1A 2XUMA 5IVBA 1F5JA 4R8HA 1C5HA 1OBNA 1TME2 1LHNA 2QQWA 5EJ1B 4CDWB 3O0VA 3HBKA 1AR81 3POBA 2F4PA 3W9AA 2UWBA 1F8VA 1E5IA 1Q8SA 4TSVA 3PVOA 3VDCA 1HKDA 1TVGA 4KWKA 3U1XA 1OKOA 2IZWA 1UCXA 3AYEA 1X50A 4GWJA 1KGYA 5A3NA 5DG1A 2YV8A 2MEV2 1Y3TA 3NAPC 3VZKA 5FMDA 1RVF3 1W39A 5ANNA 3VBRB 3ZIWA 2G9GA 1RUH1 3MLKA 3VBFC 3B9IA 2W39A 4FAHA 3HJRA 4Q4V2 2WA4A 4LITA 1J59A 3WOGA 2WT0A 4WV8A 2D5HA 4COYA 4DUXA 3ASIA 1CAUB 1GLHA 4WM8A 3BI3A 1TME3 2YFZA 2WRAA 2JG9C 1W0NA 4HKLA 2ZX2A 4W6WA 3SEEA 3LEGA 1S0BA 4YPJA 3ZR6A 3PVNA 4UW6A 5APAA 1DZTA 4CDQB 2GC3A 4XTPA 3H8OA 2DBNA 4XBQA 4QU2A 2ZAHA 2A6XA 3LF7A 5A6YA 4Q4X2 2YC2A 4Y5TA 4Q27A 2FDHA 1ZRIA 2MEV3 2Q1FA 3MIEA 4P5HA 1OLRA 2K2SA 4H55A 2RS32 4YGEA 4Q0UA 5FPZA 1DBNA 1H1MA 1S0JA 4P00B 2WBKA 2DFCA 4Q4V3 3BKZA 2WNOA 5FY7A 3B69A 5BUVA 4K8RB 3C7GA 1G9BA 1O3TA 5DDJ1 4LKEA 2W3JA 4B7KA 2FHRA 2ADDA 3NNFA 3VHNA 2BDRA 5ABJA 2Q4SA 1LGNA 4E8DA 2K0GA 4ZY9A 3EBRA 1DU3D 3VV1A 4QPWA 3H3ZA 2X5IA 2DCYA 4GWMA 4BU2A 5A6ZA 5F32A 4JX0A 1SEFA 3BOPA 3ZSJA 3OPWA 1Q43A 1O4ZA 2DVAA 2W1SA 2ZJCA 3DYPA 4Q4X3 4N53B 5T54A 3SH5A 5FMBA 1IKPA 1TNFA 4GAZA 4RFT0 1W90A 5HXVA 1CGPA 4JTOA 4W6XA 5BXXA 2CY6A 2RS33 4LNVA 2WZR2 2GALA 1OHFA 1LENA 2AYHA 3FN9A 3OYWA 4YGCA 4ES9A 1RUG1 4BLIA 1QEXA 2LRPA 4O9GA 4OQ9A 1ZYBA 1E5RA 1BJQA 2JENA 1PX3A 5FLIA 1E5SA 5FIXA 1CN1A 3MO4A 4I09A 5SV5A 4G4FA 2BVVA 4Q2FA 3C7FA 1AHSA 2HKXA 3EJKA 1ZBE2 1N1YA 3UGFA 2R1BA 3I2IA 3WUCA 1UWWA 5CYYA 2RDNA 1LU1A 1IZ3A 2UYAA 2WNUC 2VZQA 4FXGB 4XBLA 2ZCWA 3FMGA 3VBSA 1LEMA 2A6WA 1MEC1 4CCEA 3G7DA 4AW7A 1W6QA 2NYYA 4LOTA 2QDNA 4FCAA 4C0BA 1KITA 2IXHA 2WZR3 4Y3OA 4YZ1A 5T5LA 1LOFC 2W1WA 4CRQA 4UOJA 1XU1A 5FBZA 3WX5A 4Q4W1 1W99A 4Q4Y1 1GV9A 3KQRA 1W2OA 3WF4A 3IPVA 2HWE3 4HONA 2BWAA 2PA7A 2RDQA 1ZBE3 3GBFA 4L8QA 4L97A 4P9YA 5AFEA 2FDGA 4PT6A 5DAWA 3J7LA 1SDWA 1MS9A 3LEKA 1NAEA 3K3NA 4QT6A 2RM22 4FPHA 4B1LA 3NNJA 3OBTA 4NPLA 3U11A 2ZGKA 2ZKLA 4CDUB 2ZX3A 4RHV1 2XLAA 3DYOA 4YZ4A 4TTGA 3ZXLA 2Y6LA 2EIGA 4H7MA 4ISRA 1VALA 1PVXA 5IVJA 2FD8A 2XJTA 1RXFA 1W9YA 1Y9QA 2WINB 5F1RA 1SQ4A 4TLGA 5C4WB 3OSDA 1HIXA 3KD4A 1NZCA 1W6OB 1X8EA 3N35A 4CDXC 4EE2A 5AC91 1UXXX 1YFYA 2W1QA 1L3JA 1WCUA 2R1DA 4AHZA 5IK7A 4QXBA 2WWSA 4UFLA 1NY71 4AGRA 4WZCA 1JI6A 1VIWB 4OUEA 2QNKA 4JGZB 1VBE1 4JGYA 4WVZA 1WGPA 2TBVA 3AMQA 4FPLA 3NV4A 2OPKA 4N9HA 4YZ2A 2WN2A 1ZNPA 2PQSA 1K5MC 4MGTA 5L9RA 3ZYPA 4I2OA 2KR2A 4IEQA 5F9TA 2Y33A 2P3JA 2RM23 4IEVA 3POIA 1MR5A 1AYM1 2DCKA 2PHDA 1SBFA 3DV8A 2HYKA 4NHYA 4NAMA 4CEWA 1US2A 5ISLA 3MIBA 2RMU1 3HWJA 2D6PA 4CTEA 2QFEA 3AKTA 2TUNA 3J7HA 3VDDA 5FZ9A 3B94A 4A41A 1RUF2 2AUYA 4EN8B 3S5AA 3P5BA 1FNZA 2C4XA 3A4UA 3CMGA 5JIUA 1ENRA 2RR11 3VBHB 2E31A 4L99A 3WNOA 2ERFA 2DVFA 3PDQA 4GD4A 4XDPA 1AZDA 2FZ2A 3CIHA 4EN7B 2VH9A 2YGLA 2H6CA 3GCWA 3OY8A 4FPYA 3LA7A 4AEKA 2OS2A 2OA2A 5JXHA 2Y26A 1J3QA 1R081 1ULGA 1QXJA 1LOEA 2R6QA 5GJ6A 5BNNB 1QQP1 3S5QA 3FHAA 3CJIA 2GC0A 3DECA 2DCTA 4D7SA 4MHRA 4WM7C 3K75B 4JDMA 5EQUA 4XUTA 4FOWA 5IVVA 4OI4A 2ZS6B 4NN0A 3ZYJB 3D0JA 2J1AA 4CA9A 1RUF3 1RITA 1JZ2A 3LSEA 4S2FA 4Y5Z0 3SCHA 3ACHA 4AAXA 4QM8A 1QOSA 2VTFA 5IK5A 1YFXA 2HBTA 3WNNA 1B35B 4XABA 5FRAA 4TZDA 3CDZB 3NAPB 3ZFGC 1NXMA 1RUC1 2NLRA 1AL21 2HWB2 3RI9A 5EHDA 1RGSA 2P3IA 5IK8A 3VBFB 1H8VA 4K7JA 4LR4A 4IQPA 2ZEYA 1RXGA 3WNPA 3M3OA 2F4LA 5GALA 4KU7A 3WP3A 4H3WA 2W87A 5LW9A 3CU7A 4AI2A 4CEYC 1F9KA 1RINA 2XJRA 3LDKA 1Z7S1 1CESA 1OF3A 3JU9A 3ZM8A 1FMD2 2W08A 4QQHA 3ZX7A 1DCSA 1PGL1 1W6PA 2VZVA 4K1ZA 4YFWA 2RE9A 3W59A 4E2QA 4FQZA 4KH9A 3LIGA 4BPZA 4UBGA 2RHPA 3VKMA 3HNMA 5DZGA 1FPN2 1H2LA 4P9GA 5HV4A 2HWB3 4IV1C 5ERLA 3I8TA 5J96B 1W8WA 1XRUA 3GBWA 4M3CA 2QVSB 5FZ1A 1RUJ2 3MYXA 4A7YA 2D98A 1NA1B 1JYWA 2BPA2 1C4RA 3EYPA 3S0MA 3VB9A 1AL0G 4UI9L 4E4DX 3PUHA 4MUVA 1NCRA 4WZFA 3WG2A 4LKSA 2ORXA 3N7MA 1FMD3 1WA6X 4Y1UA 4YG3A 1PMIA 5EFUA 1YCIA 3PL0A 1Q8PA 3FHQA 4XJUA 1EV12 3D3AA 4GH4A 4IEWA 4DXSA 4MLOA 3TEYA 1YNAA 1O5LA 1MS5A 1I5PA 1FPN3 1OH4A 1DQ2A 3CZJA 4HKWA 4MXWA 4NVPA 3V0AA 2VE1A 1OOPA 1VRH1 4YVSA 4XUQA 3H8XA 1D4M2 3UKNA 3IIAA 2HBUA 2Z4FA 4PDWA 4R9DA 4XYXA 1QJY1 3I4IA 1RUJ3 1BMV1 1UZWA 1OD3A 4IV3B 1WD3A 4XACA 3B9CA 2SBAA 2PN5A 4XXAA 5GZFA 3U4XA 3LOBA 2QQNA 1STMA 2Q30A 4D6SA 3VL8A 5A33B 1K42A 4FXKB 4J6GA 4C91A 2R16A 5FP3A 2EAKA 4LORA 2WNUB 5BYNA 1XPWA 2IVIB 3HQUA 5FZFA 5LB6A 3ZFEA 5A7OA 1C5IA 1EV13 5JI9A 1IPJA 3UJOA 5T55A 2SLIA 5KC5A 2XVGA 3RSJA 1D4M3 1H8TB 5FY1A 5FZOB 1DG6A 3ZPYA 1XYOA 4OYUA 4K21A 3B00A 3WG1A 1JZ4A 1OQEA 1SLCA 2WABA 1W6NA 3LKJA 4KG0A 5T5JA 1HRI1 5FYUA 2QE3A 5JZGA 4LE3A 4GMP3 2CAVA 4ZONA 5DQ0A 2VMFA 5JPNB 4S2GA 2A3YA 4JZRA 3I3QA 1OA4A 2FMYA 2XVKA 3AL5A 4HFSA 2XQXA 4S2HA 2BFUS 4EN6B 1RUI2 4RR3B 3USUB 3WT3A 3PJYA 3KV5A 4KI5M 1CAXB 1HRV1 4L0PA 1JZ8A 3SITA 4D6QA 1V00A 5A6XA 1D2SA 1RUD1 2FMDA 5FPLA 3DL3A 5KXBA 5J37A 1RUE1 2YY1A 5M0TA 1OVSA 2DUOA 4QPYA 4QX7A 2E51A 2XQRA 1BVP1 3BN6A 4MV2A 4WBBA 4AHXA 4ATFA 2BFUL 3ZDVA 4BQWA 3O1SA 4HZFA 3CL1A 4W8JA 1W8FA 1YI9A 3LDRA 4QKBA 3AJYA 4EWDA 2CWSA 4A6OA 3ST7A 4R9CA 5C8CB 1HV0A 1DYPA 4NWVA 1RUI3 4JKKA 5FBJA 1C1FA 1HLCA 3WNLA 3ZFFA 3O1TA 4M00A 1UNBA 4QXKA 4AGGA 1AXYA 4AFDA 4QQPA 3FBMA 3ITQA 1JHNA 5D21A 2AGSA 3ILFA 4NIDA 1MZEA 1N3PA 1WD4A 2VBPA 2WO3A 3LCPA 4UWDA 3SLIA 5LEKA 2R072 1GYKA 2KA3A 3WUDA 4QDQA 1OH3A 5LBEA 5F2WA 3VZNA 4AEJA 4OI2A 5DAPA 4AFBA 1JUHA 2CV6A 2OX0A 3R0RA 4M4PA 3MZHA 2JECA 3NMBA 2OUJA 3QD6A 4Y26A 1SLAA 1W03A 1OQ1A 1V6NA 1VAKA 1Z78A 2GMEA 1OLMA 4YW1A 2DUPA 1YFUA 3NW4A 2BZDA 3RQ0A 3AM2A 3WEZA 1IPKA 1OLME 4CUBA 4KWUA 5FJHA 2VAUA 1P8JA 4WM7B 2JIJA 1DQ1A 2R30A 4GKYA 4XF9A 1IS5A 4DINB 3WSOA 4RS5B 1W6MA 4MYEA 3TOJA 3KWVA 3WNKA 1NZIA 2O8OA 1EAH1 2R073 3ZMOA 3I2OA 1KJLA 3IDEA 3VN4A 4AXOA 1ULEA 4LBOA 4OHYA 2GC2A 2OKXA 2Y6FA 4COZA 2D43A 2A75A 4ASMB 2A3WA 3D4KA 1AXKA 3ZN4A 1JHJA 4IEXA 5CFDB 3ZFGB 2RJ2A 3TN92 1PGW1 1U5YA 3VLBB 5CU1A 1R092 3ELNA 2Y38A 3FUOA 4XILA 4AFCA 3ROUA 1MZ6A 2VO5A 3WDUA 2V72A 3A7QA 3LWCA 3TYJA 3AC0A 2WFPA 4Y5SA 3DCQA 1SBEA 1I9RA 3RG0A 2P37A 5ACA2 4CEYB 2XUEA 3I3MA 1PGSA 1O59A 3UGHA 2HWC1 1JU3A 1LTEA 3UK9A 3I2GA 4HMZA 3WF0A 2WWUA 2YMZA 1UYYA 3VBRC 5F8PA 1PK6B 2EALA 5FMOL 4MHUA 1ASJ1 1DZRA 4QX1A 5DAQA 4LT5A 5I0RA 4Y20B 3KMHA 5HCBA 3THTA 2FZ1A 4L92A 1JOBA 4IV1B 3TN93 2XB6C 3MFAA 2YROA 4IETA 1R093 3LQCA 4GULA 3JQWA 1O4YA 2XHNA 4P9LA 3OG2A 5IUQA 4G9SB 4QDRA 5F3EA 1PNFA 5FWJA 5ACA3 4Z92B 2GP3A 3V65A 4FPCA 4GQ7A 1HJGA 3SCGA 3UETA 3RZJA 5F5IA 4ZS3A 3ZXEA 4CCJA 5FZ6A 3VBUA 1ND3A 3GZEA 3OTFA 2VVEA 4HK8A 2BP6A 3B02A 1A6CA 4DUWA 4BMBA 4AGVA 4B4QA 3OPTA 2YBPA 5C3QA 2ZBJA 2QZ2A 5FFOC 3AB0A 4RQPC 3ZXKA 1TEIA 1UPSA 3ZMNA 1GOFA 3D6EA 4DXRA 5FR3A 5DXDA 3C7EA 1ND2A 4Z2WA 2ZGPA 2AC1A 2CDPA 3A22A 1PO22 1WW7A 4MOAA 3BIEA 2RS52 3D0SA 5B4NA 5K7PA 1V9U1 1FOD1 3PU8A 2JB8A 5KHGA 4D69A 1GZWA 5FLJA 3ZSLA 5L73A 2B46X 3CBNA 3HMYA 4JC1A 2OIIA 4XFIA 1SG3A 1L7QA 3JXSA 1YLLA 4UFKA 4XF3A 4CUGA 2YGMA 4N9IA 5AFBA 3POJA 3ZIXA 5BPXA 2P6CA 3I97A 1FATA 4LQRA 4IW3A 1UMHA 2JDUA 2BBAA 2YC0A 5L7OC 3ACGA 1UKRA 1WW6A 5SV8A 4AQ6A 4QHOA 4A3XA 4J1WA 4YW3A 3RYPA 3U4SA 2ZGLA 5FXVA 1HN1A 1PO23 4N43B 1QJEA 2RS53 4XZPA 5LK7B 2XWJB 1LNSA 4AK3A 1M4WA 3QACA 1JU4A 4AVTA 2XOMA 5T52A 4D7TA 5HXMA 2AEZA 3AP5A 3BODA 1G9AA 4XJWA 1OC1A 4Y22B 2WS91 2OT7A 2W5FA 3OUIA 1KD7A 1UAIA 1TQ5A 3EHKA 3DKQA 1AX0A 4BWOA 1PVC1 4Z1VA 2VNRA 5FUNA 2ZMKA 3GF6A 1H1IA 3ZDSA 2ZXQA 4L2NA 4QGNA 4SBVA 2LUWA 5I93A 2B5HA 5J1XA 1HJFA 4F7ZA 4CCNA 5A32A 4HPKA 5GZGA 2IXKA 3IN9A 5I91A 1REFA 1JN2P 2CGNA 1RJ8A 4P9WA 5C3PA 1HQLA 5D1IA 3OGJA 5JIAA 5A7SA 2D6LX 3SCFA 1NQDA 3ZXDA 1OVPA 1S0GA 1ZVFA 1ACCA 3JBG2 2YFUA 4FQ4A 4XFAA 2YBSA 4YZ3A 4CDUC 1V6IA 1YQ2A 1YQ8A 2ZMNA 4QPIA 4Y1VA 5FMCA 2P3YA 1VBD1 4YZ5A 2P34A 3IIIA 5EP9A 5IATA 3PIGA 1H6XA 1UKGA 3JB8A 1QJFA 5C4WC 2ET1A 1X9PA 1LEDA 2EICA 4CP9A 4HANA 2ILMA 4ZZ5A 1ENQA 1T6GC 3NV2A 3R4DB 2ZPXA 2CSGA 5FZ0A 4A7ZA 1OF4A 2X09A 2VCAA 3RJRA 3VKFC 4Q0VA 4YSFA 1NE4A 1V6MA 4L9BA 3UYJA 4HVOA 3WY6A 4JQTA 5A1FA 5IVEA 3Q9OA 1QNWA 4BZ4A 1GZ9A 1J1LA 1LHVA 1HV1A 4YW2A 3OD4A 5DPNA 2J22A 2UWCA 1NKGA 3JBG3 1LRHA 4JHTA 4JQRA 3Q8CA 1LGCA 1PO11 2A70A 2FQPA 2NMNA 1GKBA 5FO8B 2Y6HA 1QIQA 1UMIA 4S2DA 2A6YA 3H50A 1AF9A 5F3CA 4Q8KA 5BNOA 4FFFA 2VJXA 5AC92 2Q8DA 3NJYA 2YHJA 2E33A 4UYBA 2EIEA 1QJZA 1ZA4A 4P9XA 2IFWA 3THPA 2DBIA 1RB8G 3S57A 4BMEA 2J1RA 4LHKA 5HV0A 1EPZA 4OI1A 4YYOA 2BGCA 1YJKA 4IL7A 2VZUA 1XNDA 3DPRA 4CCCA 4BISA 1KXGA 3DXTA 1AYM2 3WF2A 4LO7A 1MS3A 1NLQA 3SKVA 4XQWA 1DGWA 3ZXAC 4CZSA 3I3EA 3UKTA 3ZN6A 4KMQA 3ZLIA 2VZOA 1LCLA 3H7YA 3SEPA 4YRDA 1FNYA 3N9PA 4AEDA 3IMMA 2WNVA 4CUAA 4Q8LA 1XNAA 3WQ0A 4EN9B 4YVWC 1POV3 2QBXA 3JQXA 1R1A1 1OURA 1VMHA 5A1AA 5FCCA 1K45A 4LO5B 2VM9A 5A3PA 4NPMA 1B35C 2YUEA 4CE8A 3VDDC 1OFSA 3N9MA 3LDBA 3J8F2 1CR7A 4MXVA 3RRDA 2QJVA 2J1SA 3WR0A 4XAEA 4AVAA 3OF1A 1QJU2 2XXZA 4H2AA 2BVBA 1W9WA 2XJQA 4LTAA 4CDQA 1R082 4ET7A 2WQ4A 2GMMA 5JXGA 2NQYA 2ZHNA 4GB32 1VBB2 1JZ6A 2VZ1A 3OBAA 2WZEA 3NV1A 4UFIA 2D97A 2QQOA 1ULDA 3LE0A 4RD7A 3WW4A 4OI0A 3U0ZA 1VBA1 3MICA 3AK0A 4AHWA 1Q8VA 2A71A 2VZPA 4W4ZA 3E6BA 1KJRA 1W2NA 1V6OA 2LROA 3FE5A 1UYPA 4XAAA 3VD5A 1J3PA 3WF1A 2QQPA 5LBFA 2WC2A 3NJZA 5C6CA 5FZ8A 4V1PA 3CJIC 4QX3A 1YUDA 3I59A 4PQ9A 3NJXA 4RGAA 5DMYA 5JMCA 3J8F3 1LOBA 3MLLA 3OB8A 1S2KA 5FPBA 5FY4A 4KBBA 1QJU3 4BXFA 4E9KA 3O1OA 1COV2 4KWJA 1JODA 4FPJA 4LA2A 1OKQA 1R083 3KT4A 3UT0A 1AJOA 4GB33 4OMDA 4Y4YA 1VBB3 2PHTA 2WFF1 4Q29A 3HD8B 4RQPB 1NA1C 2B4KA 2D7FA 4MGIE 4N53A 3VZLA 4RA0A 5E16A 4DY5A 2WIIB 4OCTA 4CCLA 3RZKA 5E88A 5IVFA 4CU7A 2ZX1A 5C3OA 4HLTA 5FAXA 1GR3A 2A5ZA 5L36A 1J84A 2W68A 1QH6A 1LHWA 5FYHA 2FCVA 2VOTA 3H3UA 1UOJA 1JYIA 3UJQA 4BA6A 4WM8B 3K51A 1OUXA 2ZHMA 3CF6E 1DFQA 2E26A 4P02B 3INAA 4LBQD 3I7DA 1D4VB 1COV3 1YI7A 2UY8A 3T0BA 5C8WA 1HXS2 3VKOA 4XC9A 2BGOA 5L7OB 2WLPA 4IV3C 4K9SA 5A80A 5CISA 1L7RA 4LXLA 1IKQA 1XNKA 2VD7A 1OQDA 2EIBA 1YC61 2A7AA 1XBFA 1XNBA 1JYCA 4GKXA 5FXWA 2Q8EA 1GQGA 5CFCC 1W9FA 5JR2A 3M3IA 2Q5TA 2VMEA 3O0WA 1F35A 1DQ0A 2QDRA 3AKSA 4X6RB 3O1PA 3O1UA 5HCHA 1EUUA 3NQHA 2WSVA 2DCJA 3J26N 1U12A 3MIDA 3R4UA 4QX5A 2MHFA 4EYUA 4JDNA 4H7LA 5A3TA 1PZ8A 2ZA9A 3S7IA 5ABJB 2GMPA 3ES1A 2VQ0A 4XCAA 1IQAA 3DYMA 1WBFA 5FY0A 3NJVA 4CSWA 1MS0A 1HDKA 1C57A 1H8TC 1HXS3 3U75A 5BNPA 2X5IB 1FI2A 3IKWA 5DG2A 4Q0QA 4CCOA 3WHTA 2WKKA 5EIYB 5FP7A 5KHJA 2O0OA 2QQIA 5T3NA 3NSTA 4CP1A 4DOUA 3FL7A 4OHZA 4YFZA 2X29A 1E5HA 4MGYE 4PDWC 1APNA 1GNZA 1UY3A 2DDUA 3OYWB 2LM3A 3PMEA 4OHXA 3CLPA 1XYPA 1ZRFA 1X33A 1MQTC 1RIRA 3E1F1 4R4XA 3OD0A 4RR3C 2LALA 3WNXA 3VUOA 1UIKA 1UIJA 4HL0A 3HEIA 3KV6A 3VBOA 1VPHA 1XSRA 2B7YA 3IT8A 4YM1A 1RHI1 1QNYA 2PLV1 5FK8A 5A3WA 4A42A 1W28A 3GGLA 1GUIA 2ARXA 5LA0A 5T5OA 3ZFEC 3VD9A 1IS6A 1F15A 2V73A 4FPEA 5FZIA 2D6OX 1PM4A 1SFNA 4AFMA 1W6QB 2JE7A 1NOVA 1IOAA 4HN1A 4TWTA 4WVMA 2H6BA 2JG8A 5F3IA 1DHKB 3VHPA 3ZXFA 1PMHX 3T4HB 4FVVA 1RMU1 3FBYA 2DTWA 2A1XA 4LBMA 3WZ1A 5C8CC 5HCFA 5DN2A 5KHHA 3IBMA 5FZLA 1H9WA 3M3CA 2WNEA 1S2EA 3I2DA 5JZGC 3BCWA 2B8MA 1QKQA 1CQ9A 3TRSB 2D3PA 3M1HA 3RDIA 3EQEA 5BNNA 4JKLA 2H0VA 2ZHKA 5E6HA 4LBQB 4LUMA 4BH9A 3K4AA 3PUQA 5CA6A 2C5DA 4XUNA 5HI0A 4HKOA 4KGGA 3M70A 5G05L 1VB2A 3BPZA 1MS4A 1WMFA 1LJ7A 1G6NA 3A21A 5J3UA 4E8CA 1UZVA 1J83A 1NLSA 5FXZA 2O14A 4X8NA 4GIQA 2ZTNA 2JJ6A 4JGYB 1Q3EA 1CZVA 1MZ5A 3BTXA 1SLBA 1YJLA 2JE9A 4IESA 4XFBA 4BQYA 3V0BA 2PHUA 2JE8A 4I02A 4XCBA 4AI8A 2QQVA 3MFCA 3SH3A 4YVWB 3TEXA 3BGAA 4RS5C 4DS0A 4GALA 2Z5WA 1W06A 3JZVA 4YW6A 1RUNA 1QHDA 3N3HA 2GH2A 3ETPA 2Q1MA 1VBC2 4GZ9A 1QU0A 4YGDA 1HB2A 3Q8AA 2MEV1 3TNQA 4EQVA 4QKNA 1UL9A 3OEAA 5EJZB 2JG9A 3BIWE 2HEYF 3VDDB 1A3KA 2Q0AA 5FZ4A 2Q8CA 3DGTA 3K77A 5CFDC 4Q4V1 1OI6A 1W9TA 1ZZCA 3T30A 3ATGA 1AR61 4Y33A 1UY0A 3ACFA 4L11A 1JW6A 3S30A 5FOJB 1PZ9A 5H9PA 1N3OA 2QCSB 1UOBA 5JOYA 3RZMA 3OY8B 4XF0A 1G9FA 2JDNA 2CNAA 5A3OA 5DZEA 4AWDA 3KM5A 1ZRCA 3V56A 2R062 3MLJA 1N3QA 3POSA 4J1XA 1AUYA 3SQOA 3WQ7A 2PXJA 4D6RA 1W0OA 3E6CC 1VBC3 4Q4X1 4D0QA 3GHNA 3CJIB 1PK6C 1JZ7A 4FTEA 3RZGA 2QQJA 3EXUA 5DUXA 4E27A 2RS31 3FUQA 3N9OA 4FPOB 4LKFA 1O91A 1QOOA 3POEA 1F5FA 2B45X 4XZUG 3WNMA 1PGW2 4CPBD 5C70A 1JXNA 1LR5A 2B39A 1RC6A 5CG8A 3ENRA 2HWD2 5FZAA 1NCQA 4XQ4A 5IT6A 5LA9A 2Y60A 4M3CE 3MIHA 1DF0A 4DXZA 1N47A 3D82A 4LMFA 2IXIA 2Q1ZB 4NRMA 4YLZA 5KHIA 2A6VA 2HWF1 2PHLA 2CL2A 2R063 3W21A 5C7GA 4MGQA 1W2UA 1O4TA 3T3YA 5K0UA 4Z82A 1BEV2 1V70A 1SPPA 4AOCA 2RS11 4ARYA 3RZZA 3EMRA 4LIVA 2WO2A 2WZR1 5BNQA 4PI0A 4I01A 5K4LA 3WW1A 2GNDA 2VTXJ 1AR72 4BK4A 3WVJA 1H2NA 2WNUA 2R0FA 2WQZC 1Y9MA 2ZZJA 3E5UA 3OUHA 5FQ0B 1ENSA 4Q1RA 2HWD3 5FO7B 5FTTC 1QJX2 1W6PB 4CUCA 4RGKA 5IK4A 5JAXA 2GNTA 4P14A 2HWE1 5CKNA 1BCXA 2DU1A 1WKYA 1ZBE1 2HLEA 2RJLA 4JRAA 4DQAA 5CBLA 1I1EA 1RUOA 1URXA 1GICA 4C1WA 1DLCA 1MVQA 4AFAA 1OMIA 1S0FA 2J1UA 5LASA 2DWRA 2VMGA 4QM9A 3OBZA 3FLPA 5CFCB 3HPNA 4M3CB 3ZR5A 2D6MA 1UX6A 1V6KA 1TG7A 4AF9A 1A78A 1BEV3 3JD72 2EF6A 2GDFA 3UV9A 3VDBA 4XIKA 1I6XA 2VMIA 3O1RA 3E6DA 1NCRB 2YB7A 5EJ3A 1DP0A 4B1MA 1AR73 1NQJA 1D2QA 1H4HA 5FP8A 4HN0A 5HPOA 1DYKA 4XDQA 1ND3C 5IYYA 5JOXA 4FOYA 1XOYA 1QJX3 4XETA 2VMHA 3KCCA 4N43C 5FYTA 5L9VA 2IC1A 2NPIA 3ZYIB 3USUA 4KG8A 3DF0A 4K1YA 4BOWA 4DO0A 1KRIA 4SLIA 1FOD2 4I30A 1X36A 2JWPA 2PHRA 2QTWB 1PIV2 4XPVA 5F6LB 1ZZ6A 2C1FA 4MXWB 4LBNA 3V0AB 4FP2A 4CDXA 2VL4A 3GHMA 2WWJA 1ND2C 3NRUA 4XJ9A 5FYYA 4PDWB 3T2PA 2LTNA 4PI2A 3JD73 1MQTB 3RVHA 4AVBA 3LGRA 5FP9A 3CZUA 4K3UA 4UT5A 2RG4A 4UBHA 3W5NA 5KC6A 1K5MA 2PHXA 4YW5A 5FZDA 5HCAA 2NMOA 2Q8OA 5JXIA 1SACA 1YXWA 2JB4A 4OZOA 2L9LA 4KL1A 3GZAA 4LEJA 2WN3A 1PM7A 4DIQA 1W8ZA 2GN7A 3ZFEB 1H2MA 3M2MA 4MADA 1FOD3 3KT7A 1G8WA 2J1VA 2UU8A 1PIV3 2ADEA 2GAUA 3K4DA 2VTXA 2X53S 5A7WB 4JAAA 1OXCA 1CWPA 4XXPA 4RGGA 2XL7A 3NO8A 4MVTA 1VRBA 2UWAA 1WCSA 4HVQA 1J3RA 4M0NA 2WS92 4LLFA 2QUOA 4K8FA 4NIAA 2F6BA 3B93A 4BLJA 1BBT1 2YPDA 2R7EB 3HOBA 4XF1A 1PVC2 1V6LA 4IEUA 5H9RA 4NIIA 1DGRA 1W6NB 2YZ4A 4M0HA 2GNMA 1AYN1 2XBO1 1RUF1 5JZGB 1XJAA 2YDEA 1XE8A 5JCTA 2BTVC 5C3RA 4IE4A 4KWLA 5K9YA 3P3NA 4KQ7A 4YARA 5L19A 2OQ6A 5JI7A 1U5ZA 1Q8OA 3ABZA 2OW4A 2PMWB 3R6SA 3BU7A 1MS1A 2QQKA 3AKPA 1C8M1 4WM7A 4GWIA 3I49A 4ASKA 2OPWA 5AC93 3KCXA 2JICA 5D8AA 4QQOA 3U07A 3NNMA 2OXBA 4K40A 4MSVA 4AYUA 5A3MA 1HQWA 4N8MA 4D7YA 1GQPA 2B9VA 3SH4A 1ST8A 4NRQA 5J36A 3ORJA 3B01A 1HB3A 2ATFA 1EUTA 1VBD2 2R0HA 2WS93 1NG0A 2I74A 1WMDA 3N9QA 3MF6A 2PAMA 4NJ4A 2C24A 4XMAA 1PVC3 4JCKA 2VXJA 1O8SA 4AEMA 5FPUA 1CZTA 4OMCA 2W95A 5EYXA 1SZBA 4BQ4A 2Y0IA 2G9ZA 4QPIC 5FDBA 1D0GA 3S7EA 5JDBA 2GNBA 4EROA 4URAA 3GZTB 2P6HA 4Y24A 1H4GA 2YU1A 3ME2A 5E89A 3ES4A 4OUSA 3ZFFB 4HETA 1X7NA 1W8TA 1XB9A 3C7OA 3ZKUA 2VCBA 4Q26A 1A8MA 2VZ3A 2WUHA 4PLMA 3ZOIA 1EPWA 3DEMA 3GBGA 4A44A 3M4FA 3SC7X 2IWGB 1VBD3 3UKVA 5FP4A 1WMEA 3QLQA 1UY1A 2ID4A 2DYCA 5FMOS 3AMHA 1W05A 1KDKA 4DMIA 4P9JA 3MIGA 2ZGSA 2J1TA 3VHRA 2JDMA 1UY2A 3RMXA 1Y7BA 1YEWA 1FMD1 2VNVA 3IDBB 3LD8A 4ZXKA 4AVCA 5FZKA 2B9UA 3I54A 4UFMA 3H8UA 4UW5A 5BNOC 1DQ6A 2OUHA 2D5FA 3KCYA 3C3VA 4CXYA 1QF3A 1QY4A 4I3PA 4URTA 3WF3A 2VZRA 1FPN1 3AZYA 4TLFA 1SDDB 2K46A 1AX1A 2UY9A 4QPGA 2H0BA 4GWNA 2V09A 1RUJ1 4M4RA 5IW0A 2VW0A 4IDZA 2VBDA 4EZHA 3OGSA 4MH0E 3E5QA 3QH6A 4KBZA 2IUWA 1DQ4A 1G86A 1WUVA 1AR82 1GMMA 4XF4A 2BOIA 4H14A 4GJZA 4MX3A 1QXPA 5T5PA 1O3QA 2VUCA 2PELA 3BTAA 3LFIA 1CAWA 1WA4A 4CVUA 3AVSA 1S1AA 2G1MA 5J98B 1QH7A 5IVCA 5JSPA 2ET7A 1OA2A 4LIUA 1RUH2 3Q8FA 1H9PA 1JTZX 2EXHA 3MW3A 1K3IA 1D4M1 4UF0A 4TYSA 3WDYA 1S0EA 1HW5A 3IM0A
chains in the Genus database with same CATH topology
3VZJA 3APBA 5FO9B 1VJ2A 3L9JT 1ULFA 1AR83 3WDTA 2VGDA 4CP0A 1ZREA 2VVDA 4LBLA 2BWCA 2K9ZA 3IDCB 3PLQA 1G7YA 4N90A 1W0PA 2DF7A 3MW4A 2PYTA 3AP9A 2PQQA 3POWA 4R9BA 4WM8C 3WD5A 3VHOA 4A7KA 5I0SA 1RJ7A 2N7GA 3SISA 3HBZA 3JB4C 1RUH3 1G9CA 1ZRDA 2ES3A 1OPOA 1UF2C 2WFF2 2ZX0A 3VGIA 4AQTA 4Y22A 4HT1T 1DGWX 3AYDA 1CAVA 1ND3B 4PBPA 5DDJ2 3VBUB 2VW1A 4WVWA 2B42B 2GC1A 4NR1A 3KZ4C 3WCSA 3ZYRA 4IXLA 2CWMA 1F2NA 1LOCA 3H0OA 1ULCA 3HN1A 1ND2B 3N7KA 4UXAA 5ABJC 2D40A 4B29A 1C1LA 1GQHA 1RUI1 5E1RA 3RI8A 4F3JA 1MVEA 2R32A 4PBOA 1GZWB 1KS4A 2X5IC 5A3LA 3IMNA 2PHWA 2WFF3 1RUG2 1O3RA 3V64A 1LECA 1QXRA 2HEWF 4C0HA 4F8AA 1ZRRA 4ISQA 4DNYA 1S0DA 5DDJ3 1YIPA 3WW2A 4IEYA 5LEJA 4PIXA 2QZ3A 2EA7A 1LU2A 4AI1A 2D44A 4LULA 3LB9A 5C9AA 1MEC2 2VOWA 4LLOA 4OVEA 3G6JB 2EXKA 3KS7A 3R4SA 3ZVXA 2XJSA 1RUG3 1ZX5A 1AX2A 3VBSC 1LHOA 2MNGA 4Q4W2 2ZZQA 1DGLA 2NP0A 4Q4Y2 3M3EA 4YG6A 1ZBA1 2VQAA 4AVSA 1WLDA 2IXJA 3N7JA 5TSWA 1MEC3 2ZABA 2VPVA 4RHV2 5LRSA 5A32B 3HR9A 4HPKB 1CD3G 2XLGA 4PIZA 4CP2A 2Y0OA 5H9SA 1KFXL 2UYBA 5EV7A 1GANA 3LAGA 4AQSA 4BCUA 1JH5A 3AKRA 4FPGA 4Q4W3 4Q4Y3 1CX4A 1NY72 4QPIB 5DUVA 1VBE2 5DZFA 4CDWA 4ES8A 3ETQA 4JRLA 1POV0 5AVPA 1KDMA 2MPFA 4XJAA 3MEPA 4YW4A 3SHRA 3TN91 5KXCA 4LBKA 4N7UA 4RHV3 1R091 2XL9A 3FC0A 4JGYC 2JG8C 3VKLA 2RMU2 3GZUC 1Q8QA 3OCPA 3VBRA 3AZVA 4FAGA 2HEVF 1YWKA 3H1WA 2AREA 3B3QE 1TMF1 3N7LA 4MGKE 2ETEA 2RR12 4CEWC 1AR91 2P3KA 1CAUA 4NPRA 3RNSA 1VBE3 4OHWA 1B09A 2A73B 5BNOB 1C3HA 1CJDA 3TB0A 3PNAA 1AYM3 2C0ZA 4R9AA 1QQP2 2DV9A 5GLWA 2AZ5A 1RTVA 3EO6A 1SLIA 1VAMA 2RMU3 4QHBA 3CEWA 1OLQA 3W58A 3FJSA 3RYRA 4LHLA 1U0AA 2CAUA 3DPRB 3E5XA 2RJKA 2E53A 4RQPA 2RR13 4AE2A 4FP3A 1C28A 1KS5A 2A6ZA 3ZN6B 4BIOA 4X6QB 4I0BA 3FLTA 4HK9A 2WNVB 3OPZA 4AEDB 1FV3A 3ECQA 3WP5A 1OSGA 2PAKA 1RUC2 1AL22 1AR62 4DRRA 1UZZA 1SMVA 3WINE 1QQP3 4MZUA 2E7AA 1PO21 1WBLA 2RS51 3LOIA 2CYFA 4ATEA 4META 4OUMA 2XJUA 4P9IA 3J4UH 1Z7S2 5L7OA 4YM0A 4LO4B 3WXPA 3NVCA 3R05A 3QH7A 5HBAA 1PGL2 3QOPA 2DVBA 3MPBA 1X82A 3L2YA 2R041 1F31A 2VOKA 5EWSA 1RUC3 1AL23 1LKNA 1REEA 4YG0A 1DLLA 1AR63 1ENXA 3QBQA 4E4ZA 3KGZA 2YXSA 1WCDJ 3I59B 3MIFA 4FOVA 1FX5A 4JV4A 4PJYA 3AZZA 5T50A 4RSUA 2HWF2 1SCRA 3USSA 1LHUA 1Z7S3 2JDZA 4QQ2A 3WG4A 1TNRA 2WL1A 1NCQC 3AP7A 4FO9A 3D5OA 1AJKA 3MDPA 2VY0A 4A2UA 2RS12 1CPMA 1WLWA 1YFWA 2BNOA 1NCRC 4M3CF 1YYNA 3TNPB 4BIFA 1BKZA 1VRH2 1ONAA 3CNAA 1REDA 4IERA 4XMIA 4CDUA 1QJY2 1I3HA 5K0UC 1BMV2 4K6BA 5JVVA 1N1VA 2VOXA 2HWE2 4GH4C 4KNCA 3ZN5A 3PVBB 2ZOEB 1LOAA 1SLTA 1UW8A 5GLZA 5C4WA 4U2AA 2HWF3 1OOPC 4N7IA 1W6OA 3MW2A 4YVSC 3GALA 4PLOA 4NHLA 2VXRA 3JBG1 2ZGRA 3AYCA 3RS6A 1JOJA 4FOQA 2D6KA 4JGZA 4ZU5A 2RS13 2IXLA 2D3RA 4EN0A 5BY5A 1N1TA 1MZFA 1FYUA 5JPMB 1VRH3 2XKOA 1QJY3 1VAVA 2E6VA 2OVUA 1GSLA 3HT2A 3VBSB 4FTSA 2DVGA 2XLFA 3AX4A 4K20A 1UN1A 1ZZ8A 4GA9A 1HRI2 2BNMA 3MI8A 3VKNA 3AYAA 2ZGMA 3LA2A 3VL9A 1O3SA 5BNPB 1M06G 3VBHA 1N1SA 4LBQA 3LA3A 3B5LB 5GM0A 1V6JA 1UMZA 2ENRA 3IPVB 1O5UA 2W52A 1HRV2 3FFQA 1POV1 3VZOA 2ZGNA 1RUD2 5CAZA 1RUE2 4XHXA 2ZACA 3M8LA 3T1LA 4GXLA 1KQRA 1BVVA 3TWIA 3AZXA 2VW2A 1FV2A 1RVF1 2OZJA 1HRI3 2OZ6A 3VBOB 5KHKA 4YVWA 3T1MA 2XG3A 3DKWA 2E63A 3NKGA 2YPJA 1QDCA 3SNMA 1BBT2 1S0CA 3WV6A 2O1QA 3MF9A 1B35A 3KSCA 4WVMB 1AYN2 1TME1 2JG8B 2XBO2 1HRV3 4DRVA 3NAPA 3RJ2X 2DUQA 1RUD3 2Z69A 1SFYA 1UD1A 4D3WA 1RUE3 2KXLA 3VBFA 1Q5OA 5LK5A 5JOZA 2JKBA 4JDOA 5EYYA 4FPFA 4CEWB 1NE6A 1C8M2 3M3QA 1CIWA 4BYYA 2G4IA 4LUKA 1ZZ7A 3ZFFC 3J8F1 3GNEA 3AJZA 1QJU1 2EAAA 4GB31 1VBB1 3T2TA 2W0XA 5B2GB 5J09A 1BBT3 5J48A 3JUUA 4Y1YA 5D8AC 2ARBA 2PFWA 1AYN3 1NLRA 2XBO3 3POYA 4PF5A 2GH8A 4RL7A 2D3SA 1BYHA 2HJIA 4LO8A 3HQXA 4PLNA 1LGBA 2CGPA 1NA1A 3AMPA 3HIFA 1EAH2 1C8M3 2DVDA 5GKAC 1XNCA 4F83A 3ZSEA 1JBCA 3MPPG 1COV1 3KLSA 4HSJA 3SXWA 3V0BB 2O8QA 2PHFA 5I0UA 4OZXA 1Z0HA 3CJXA 5CVRA 1WCKA 5GZDA 1YRZA 3A0NA 5I8SA 1XU2A 4XFGA 2DURA 1QWRA 3URFA 1UPIA 1UU4A 2JG9B 4MGZE 3DUIA 4ORFA 5GLTA 4XW3A 5FQ0A 1BK1A 1SBDA 4IV3A 2HWC2 4DZGA 1EAH3 4WVVA 4BM8A 1XXNA 4DY3A 3AFGA 3MGUA 1ASJ2 5CNAA 3DN7A 4HBNA 5JR7B 4BE3A 2ZHLA 1HXS1 2C9AA 5A33A 4AI3A 5CFCA 4B4RA 2DTYA 5GLVA 2TNFA 1ZZBA 2WJSA 3TBDA 1RL3A 2YYOA 4IEOA 4QPGC 4XFHA 4QQLA 2PTMA 1DZQA 1H8TA 4XJ8A 4LBJA 1LOFA 1PHMA 2X8KA 4FTBA 2HWC3 4OHVA 1BZWA 1NCQB 3S6PA 4I3GA 1QDOA 1EP0A 1ASJ3 1E57A 4QD2A 3WP6A 4C90A 2OYZA 4R52A 5JSOA 1IHMA 4IEPA 4GMP0 3VBUC 2BNNA 1MQTA 3FWEA 1DIWA 5K0UB 3M7AA 4RR3A 1V9U2 4XHBA 1H1AA 4GH4B 1CAXA 3NKTA 3PMSA 5I0TA 5C33A 4NOTA 1BQPA 1SLLA 3KGLA 1OD5A 1OOPB 1S55A 2I45A 4YVSB 2RM21 3WG3A 1D0HA 4FBFA 1YIFA 3AMMA 4XJZA 2G9FA 4E4SA 4G3YC 1QOTA 4AQ2A 2ZGTA 3E97A 2WT2A 2ZAAA 3AXDA 1OA3A 2XHKA 1DQ5A 2XJPA 4XTMA 2IFRA 5C8CA 3ZYGA 3OBRA 3WQ1A 1SCSA 1QGLA 1V9U3 3ZSMA 1I5ZA 1NYWA 4FSJA 1A8DA 5KXDA 2D6NA 5DUWA 1XYNA 5KXEA 2EVXA 2WSUA 2Z79A 2TEPA 4XEZA 5BV6A 1GBGA 3FHIB 1ZZ9A 1VP6A 3K48A 4B3NA 4CYDA 3OGGA 4AVVA 5FPXA 4CDXB 2BEOA 4E2GA 3PVEA 4QGLA 3KT1A 4JVAA 5JSRA 1MS8A 4Y1ZA 3U10A 3BALA 1K5MB 3LSDA 1X8MA 5JWPA 1WLCA 2VUAA 3FFZA 3H7JA 4RS5A 3ILRA 3FLRA 4ONUA 2XH6A 4XBNA 5F5QA 2XVLA 1MACA 1S0IA 3KB5A 1KFUL 4ZU7A 3AP4A 2VULA 4D94A 5C9AC 5CFDA 1LOGA 2XGXA 3ZFGA 1J1TA 1FT9A 2XWBB 2WLQA 3WW3A 3UL2A 1VBC1 1ZBA2 4YGBA 3P3PA 3GYDA 1GZCA 5FOBB 1UZYA 1FXZA 2XKPA 4KGQA 4B8EA 4CEYA 2HWB1 5EZWA 1PO12 3PTYA 3AMNA 3FX3A 2ZX4A 2GU9A 1GFF2 2E7QA 1PK6A 3ZXGA 2KM2A 2V5YA 3ACLA 2PAEA 1O7FA 5JOWA 5D8AB 5KBFA 4Y20A 4I0AA 2Z42A 1IS3A 2R061 4IV1A 4LA3A 4W6YA 2E9QA 4ITCA 3JCIA 2EXJA 1ZBA3 3AFKA 2ZGUA 2CTVA 3H1YA 3RWNA 4EWAA 4COVA 1S2BA 4LHNA 3X29B 2AENA 4C1XA 1PO13 3RMYA 3BB6A 5AVAA 4Q1PA 2HWD1 2I2SA 1EYBA 4CDWC 2DFBA 2NN8A 1W6MB 1ALYA 4COUA 1HQNA 3DPRC 3NV3A 1TMF2 5GLUA 1R1A2 1CJPA 3QCWA 4UW3A 5GZCA 1AR92 4X8PA 4PCRA 5EXOA 4COWA 2WZPP 1IS4A 1BEV1 4AEDC 1LULA 1H30A 2WNVC 1AVBA 1EV11 3ZSKA 1JUIA 2I07B 4EWEA 4EJRA 4AG4A 5KWRA 2VU9A 2GSYA 4XFFA 1HX6A 1AR71 3N36A 2WT1A 4XOGA 5JLVA 5CADA 1WW4A 4E2SA 1QJX1 3ZXJA 1VLNA 2ZMLA 2BW8A 3WDXA 4PIYA 1UU5A 1R1ZA 1VBA2 3HAGA 2BQPA 1TMF3 3ALQA 1R1A3 4O9EA 2P2KA 4KU8A 4CDQC 4IEZA 1U5XA 4QPGB 4FPKA 1AR93 2FBEA 4GMP1 4Z07A 2VUJA 4N43A 1H2KA 5E8AA 2E7TA 3JD71 5FREA 1AXZA 1WW5A 2AR6A 2DU0A 4XFCA 5CG9A 4INDA 1IGOA 4JTNA 3WLUA 3A0KA 2CGOA 1PZ7A 4ZKTB 4DPNA 1OPMA 4QGMA 3AXEA 4Q0PA 3RPQA 2ZGOA 1CAWB 3WHUA 5LRRA 2R49A 1VBA3 1PIV1 4HVRA 4Q0SA 4AHYA 4OLLA 5FLHA 4N53C 1CPNA 2JD4A 3H1MA 2JXAA 4YM3A 1LB2A 2R042 1Y43B 3AKQA 4W65A 5CIRA 1GNHA 4EV0A 1VB4A 3O12A 3J9SA 4U36A 4LO6B 5GZEA 5K8SA 3OJBA 3TAYA 3H9AA 4YNIA 3N4MA 4HSLA 3WCRA 3O0XA 2UURA 2VOVA 3WP4A 1CONA 4XIOA 2WA3A 4LE4A 2XPJA 1CAVB 4NHKA 2Z2SB 3AP6A 3D8CA 1LODA 4I0WB 2R043 2VVFA 2DCZA 5H9QA 4XQDA 2NZ9A 3O7OA 4B7EA 1BXHA 2P17A 1DGRN 1XQNA 1QMJA 4OULA 4DFSA 5I8TA 4UW4A 2VNGA 2BUKA 3IWZA 3PHMA 4B4PA 2R071 3B7MA 4ZU4A 2IXCA 1TE1B 1OFNA 4NWWA 5BNPC 3ILNA 4DB5A 2JEMA 5J7MA 1EY2A 3WDVA 1H0BA 3AZWA 2BBVA 4ASLA 4R4ZA 1DDLA 1LESA 3ZO0B 2VNOA 2A3XA 2ZGQA 2BYVE 1ZM1A 1YO8A 1RHI2 2PLV2 2GZWA 4JGZC 1WLTA 5C9AB 2D93A 2NM1A 3C2UA 3WDWA 3VZMA 2GN3A 3VBOC 4Y1XA 3HT1A 1RMU2 4XE9A 5CB7A 3RYKA 5I8YA 4OFGA 1XE7A 4Z8BA 2XJVA 2JX9A 1C8NA 3O5SA 4NO4A 5F6KA 1PNGA 3FZ3A 3VBHC 1RHI3 2PLV3 1VR3A 3O14A 3NL1A 5ACA1 2AH2A 4AI0A 3NWKA 1NXD1 1U5IA 1UU6A 3L2HA 3UKTA 2VECA 3BOWA 3LZZA 4QMAA 3SMHA 1J58A 4NHMA 1RVF2 2VG9A 4FT8A 2QKDA 2ZKNA 3PJQA 4M01A 4BHPA 4YM2A 5DUUA 1RMU3 5BNNC 1FAYA 1Q56A 1YHFA 1CVNA 2EXIA 3CO2A 4BQ1A 2XUMA 1F5JA 4R8HA 1C5HA 4CDWB 1TME2 1LHNA 3O0VA 1AR81 2F4PA 3W9AA 2UWBA 1F8VA 1Q8SA 4TSVA 3PVOA 1HKDA 4KWKA 2IZWA 1UCXA 3AYEA 1X50A 5DG1A 2YV8A 2MEV2 1Y3TA 3NAPC 3VZKA 1RVF3 1W39A 3VBRB 3ZIWA 2G9GA 1RUH1 3MLKA 3VBFC 3B9IA 2W39A 4FAHA 4Q4V2 2WA4A 1J59A 3WOGA 2WT0A 4WV8A 2D5HA 4COYA 3ASIA 1CAUB 1GLHA 4WM8A 1TME3 2JG9C 4HKLA 2ZX2A 4W6WA 1S0BA 3PVNA 4UW6A 1DZTA 4CDQB 2GC3A 4XTPA 4XBQA 4QU2A 2ZAHA 2A6XA 4Q4X2 4Q27A 2MEV3 3MIEA 4P5HA 1OLRA 2K2SA 4H55A 2RS32 4YGEA 4Q0UA 5FPZA 1DBNA 1H1MA 1S0JA 2DFCA 4Q4V3 3B69A 5BUVA 1G9BA 1O3TA 5DDJ1 4B7KA 2FHRA 5ABJA 3VHNA 2Q4SA 1LGNA 2K0GA 3EBRA 1DU3D 3VV1A 3H3ZA 2X5IA 2DCYA 4GWMA 1SEFA 3BOPA 3ZSJA 1Q43A 1O4ZA 2DVAA 2ZJCA 4Q4X3 5T54A 3SH5A 4N53B 1IKPA 1TNFA 4RFT0 5HXVA 1CGPA 4JTOA 4W6XA 5BXXA 2CY6A 2RS33 4LNVA 2WZR2 2GALA 1OHFA 1LENA 2AYHA 3OYWA 4YGCA 4ES9A 1RUG1 4BLIA 4O9GA 1ZYBA 1BJQA 2JENA 5FLIA 5SV5A 1CN1A 4I09A 4G4FA 2BVVA 4Q2FA 1AHSA 2HKXA 3EJKA 1ZBE2 1N1YA 2R1BA 3WUCA 1LU1A 1IZ3A 2UYAA 2WNUC 4FXGB 4XBLA 2ZCWA 3FMGA 3VBSA 1LEMA 2A6WA 1MEC1 3G7DA 4AW7A 1W6QA 2NYYA 2QDNA 4FCAA 4C0BA 1KITA 2IXHA 2WZR3 4YZ1A 5T5LA 1LOFC 4CRQA 1XU1A 5FBZA 3WX5A 4Q4W1 4Q4Y1 1GV9A 3KQRA 3IPVA 2HWE3 2BWAA 2PA7A 1ZBE3 3GBFA 4L8QA 4L97A 4P9YA 5AFEA 1SDWA 1MS9A 4QT6A 2RM22 4FPHA 3OBTA 3U11A 2ZGKA 2ZKLA 4CDUB 2ZX3A 4RHV1 2XLAA 4YZ4A 3ZXLA 2EIGA 4H7MA 4ISRA 1VALA 1PVXA 2XJTA 1Y9QA 2WINB 5F1RA 1SQ4A 5C4WB 1HIXA 3KD4A 1NZCA 1W6OB 1X8EA 3N35A 4CDXC 5AC91 1YFYA 4AHZA 1L3JA 2R1DA 5IK7A 2WWSA 4AGRA 1NY71 4WZCA 1VIWB 2QNKA 4JGZB 1VBE1 4JGYA 4WVZA 1WGPA 2TBVA 3AMQA 4FPLA 3NV4A 2OPKA 4N9HA 4YZ2A 1ZNPA 1K5MC 3ZYPA 4I2OA 4IEQA 5F9TA 2P3JA 2RM23 4IEVA 1MR5A 1AYM1 2DCKA 2PHDA 1SBFA 3DV8A 2HYKA 4CEWA 3MIBA 2RMU1 3HWJA 2D6PA 4CTEA 2QFEA 3AKTA 2TUNA 3VDDA 3B94A 1RUF2 2AUYA 4EN8B 1FNZA 3A4UA 5JIUA 1ENRA 2RR11 3VBHB 4L99A 2ERFA 2DVFA 1AZDA 2FZ2A 4EN7B 2VH9A 2YGLA 2H6CA 3OY8A 4FPYA 3LA7A 4AEKA 2OA2A 2Y26A 1J3QA 1R081 1ULGA 1QXJA 1LOEA 2R6QA 5GJ6A 5BNNB 1QQP1 3CJIA 2GC0A 4D7SA 2DCTA 4WM7C 4JDMA 4FOWA 4OI4A 2ZS6B 4NN0A 3ZYJB 3D0JA 1RUF3 1RITA 3LSEA 4S2FA 4Y5Z0 3SCHA 4QM8A 1QOSA 5IK5A 1YFXA 1B35B 5FRAA 4TZDA 3NAPB 3ZFGC 1NXMA 1RUC1 2NLRA 1AL21 2HWB2 3RI9A 1RGSA 2P3IA 5IK8A 3VBFB 1H8VA 4K7JA 4LR4A 4IQPA 3M3OA 5GALA 4KU7A 3WP3A 4H3WA 3CU7A 4AI2A 4CEYC 1F9KA 1RINA 2XJRA 1Z7S1 1CESA 3JU9A 1FMD2 2W08A 4QQHA 3ZX7A 1PGL1 1W6PA 4K1ZA 4YFWA 2RE9A 3W59A 4E2QA 4FQZA 4KH9A 4BPZA 4UBGA 2RHPA 3VKMA 5DZGA 1FPN2 1H2LA 4P9GA 2HWB3 4IV1C 3I8TA 5J96B 1XRUA 3GBWA 4M3CA 2QVSB 1RUJ2 3MYXA 4A7YA 2D98A 1NA1B 2BPA2 1C4RA 3S0MA 1AL0G 4E4DX 4MUVA 1NCRA 4WZFA 3WG2A 3N7MA 1FMD3 4Y1UA 4YG3A 1PMIA 5EFUA 1YCIA 1Q8PA 4XJUA 1EV12 4GH4A 4IEWA 4MLOA 1YNAA 1O5LA 1MS5A 4MXWA 1FPN3 4NVPA 1DQ2A 4HKWA 3V0AA 1OOPA 1VRH1 4YVSA 1D4M2 3UKNA 3IIAA