3HT1A

1.2a structure of the polyketide cyclase remf from streptomyces resistomycificus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
142
Chain Sequence
MMKRVHRTDVKAEIVREPGAKETTHRKLIDTPDGADRFVLTEFEVSPNGSTPPHFHEWEHEIYVLEGSMGLVLPDQGRTEEVGPGEAIFIPRGEPHGFVTGPGQTCRFLVVAPCERPPVRNVFLSEDPYEYTQMPEYTSLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The polyketide cyclase RemF from Streptomyces resistomycificus contains an unusual octahedral zinc binding site
pubmed doi rcsb
source organism Streptomyces resistomycificus
molecule tags Lyase
molecule keywords RemF protein
total genus 32
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ht1A00
3SCHA 5JSRA 2OPKA 1WA4A 3VHRA 2H0VA 3RYKA 4QGNA 3LA2A 4ZU5A 3WW1A 2XHKA 3ZDSA 4H7LA 3UKVA 1LRHA 1HW5A 1ZVFA 3I54A 1PMIA 4HN1A 5LEKA 4N9HA 3CO2A 4HSJA 5KHKA 5FDBA 1LB2A 5I0UA 4XFIA 3ELNA 4EWDA 1CGPA 5KHJA 1X8EA 3E97A 4JTOA 4IEPA 3I59B 4IESA 3BCWA 4HN0A 4WVZA 2F4PA 1UIJA 3ROUA 2D5HA 5KHIA 1L3JA 2PFWA 2H6BA 3BPZA 3ST7A 4EROA 1LKNA 4KU8A 3D0SA 4IEUA 4Q0PA 5KHHA 1YFUA 4FAGA 3LA7A 1CAXB 3H1WA 3OTFA 5KHGA 3H1MA 4B29A 2CAUA 3NKTA 5CADA 4YARA 2CGPA 4QGLA 5F1RA 1O5LA 3CEWA 5CVRA 3SHRA 1UPIA 3H9AA 5K8SA 5FLIA 3WW3A 2Q1ZB 3CLPA 3L2HA 1CAXA 2UY9A 3KSCA 1YHFA 1ZX5A 4CYDA 4Q0VA 4HZFA 1QXJA 3EQEA 4LUMA 4XFAA 1RUNA 2D93A 3IIAA 4ONUA 4KWLA 2VPVA 1ZRRA 4MGYE 1ZRFA 5KBFA 4TLFA 5FPXA 3U11A 3LZZA 4XFHA 5C8WA 4UBGA 4FAHA 3PVBB 4MZUA 5D1IA 1GQGA 4X6RB 4MX3A 1J3RA 4MGZE 2QCSB 1OMIA 3IBMA 1UCXA 5BUVA 2K9ZA 3HT1A 5I93A 4MUVA 1ZZ8A 4HBNA 4HVRA 1SFNA 2OYZA 4PJYA 2FMYA 1XE7A 1FXZA 1H1MA 1Q5OA 4AVCA 5JR7B 4F7ZA 1RUOA 3GYDA 4EV0A 2QVSB 4BIFA 4IETA 1UD1A 4YYOA 4BHPA 2OA2A 2D40A 1J3PA 2ZKLA 2HJIA 3JZVA 2DCTA 1H1IA 3HIFA 1ZZBA 1O3SA 4N9IA 3DL3A 1IPKA 3H1YA 3RPQA 3MZHA 2WFPA 4JTNA 1YUDA 2MPFA 4I2OA 3C3VA 4ZU7A 1NYWA 4XFGA 1UW8A 3PLQA 4XF3A 3KGZA 3UKTA 2GZWA 4YSFA 4D7SA 3I7DA 1WLTA 1IPJA 2Q0AA 1EYBA 4LEJA 3WW4A 2O8QA 5I0RA 1RL3A 5BXXA 1JUHA 5JCTA 4MGIE 3OF1A 3FHIB 3SCFA 5I0TA 3E6CC 4QMAA 3H3ZA 2Y0OA 5J7MA 1ZNPA 1O3RA 5JSPA 5T3NA 1NE6A 2GH2A 2PYTA 4EWAA 3DN7A 5AVPA 4Q0SA 1RC6A 5I0SA 3FE5A 1OD5A 3FZ3A 2IXHA 1J1LA 1VJ2A 2IC1A 1VP6A 2GU9A 4IERA 2VECA 1YWKA 4LLOA 2Z69A 2BYVE 1RGSA 5HI0A 5JSOA 2IXCA 4LA3A 2CV6A 4I0BA 4IEOA 1EY2A 4MGKE 1CAUB 3E6DA 4Q0UA 5EFUA 4YRDA 1X82A 2GC3A 1CAWB 2BNNA 4R8HA 4RD7A 4L2NA 3IDBB 2ATFA 3TNQA 4I02A 4K8FA 2PAMA 4AQ2A 3FFQA 2BGCA 4JVAA 5FQ0A 4ZU4A 5I8YA 1V70A 2EVXA 2CAVA 1YLLA 4XF9A 3UKNA 1NE4A 4E2QA 4I3PA 2B5HA 2C0ZA 2PTMA 2QJVA 3ACLA 2PAEA 4LULA 3NVCA 5C6CA 3LA3A 1SQ4A 1Y3TA 4AVAA 4JV4A 4I01A 2OZJA 2UYAA 4PIZA 4MH0E 2D5FA 4HLTA 5E16A 2GC1A 3H7JA 4PIYA 5LRRA 2PHDA 2O1QA 3ES1A 3CJXA 4IEZA 4LA2A 4J1XA 3NL1A 3U10A 2BEOA 1O7FA 1Y9QA 1EPZA 4META 2PQQA 3CL1A 2H6CA 2KXLA 3EJKA 1FI2A 3N4MA 4J1WA 2IXLA 4QM9A 4XF0A 5FPZA 4GULA 2PA7A 3M70A 5J48A 5I8SA 3QOPA 3FWEA 2XKOA 3S0MA 3S7IA 1O3QA 2ZCWA 5FLJA 4QM8A 4XF1A 1GQHA 2XKPA 1YFYA 1YFXA 4LTAA 3SXWA 3B02A 3DKWA 4ORFA 3PNAA 1J58A 5FLHA 1CAWA 4WZCA 5BY5A 2QDRA 5JAXA 4KL1A 3ES4A 3RYPA 1RTVA 1XRUA 5J3UA 3E5XA 1ZREA 3BALA 1O4TA 4BH9A 1ZZ6A 2EA7A 2N7GA 1TQ5A 2IXKA 4LUKA 1O3TA 2XGXA 3WW2A 3OGJA 3SMHA 1UIKA 1VR3A 1ZZCA 4IEXA 3HT2A 2ETEA 3HQXA 1X7NA 2K0GA 4UXAA 2PHLA 3E5QA 4KWKA 2VQAA 1ZRCA 2BNOA 2P17A 4AVBA 4KWJA 3H7YA 4BYYA 4O9EA 4AQ6A 2UYBA 4OLLA 3KGLA 3I59A 1CAVB 5BV6A 4HMZA 1ZZ9A 3RNSA 1DZRA 1NZCA 5LRSA 4P9GA 3KMHA 4L11A 1CX4A 1EP0A 3NJZA 1NXMA 1J59A 4XF4A 3NSTA 4I09A 1SEFA 1CAVA 1OFNA 5I8TA 4HVOA 5FQ0B 5I91A 4X6QB 4QXKA 1PM7A 3G7DA 4HSLA 2FQPA 4NVPA 3GBFA 4Z07A 3EBRA 3TNPB 3RZZA 4QX5A 1U12A 3ETQA 2XL7A 3H50A 3D0JA 2E9QA 4E2GA 1I5ZA 2WC2A 2PAKA 2V09A 4IEVA 3OD0A 2IXJA 4QGMA 3BB6A 2OZ6A 1QXRA 4DINB 2I45A 4EWEA 3U0ZA 3RDIA 2IXIA 4XEZA 3MYXA 3MPBA 2Z2SB 3E5UA 2EAAA 1LR5A 4XFFA 4WBBA 3DV8A 3FJSA 4IEYA 2QNKA 4I0AA 1DGRA 4Q0QA 3EO6A 2XLGA 5E1RA 4AXOA 3FX3A 4Q29A 3CF6E 5FCCA 3MDPA 4XETA 1DZTA 2BNMA 2UY8A 4XFCA 1YFWA 5BPXA 1OI6A 1QWRA 4UBHA 3RYRA 4F8AA 4O9GA 3EHKA 2B8MA 4FT8A 1DGWA 1X8MA 3QACA 2ET7A 2B9UA 1O5UA 2Q30A 3BU7A 3LAGA 2MNGA 4R52A 4KU7A 5EZWA 1J3QA 1ZRDA 4FBFA 1CAUA 5LEJA 4IEQA 1Q43A 3H8UA 1QY4A 3NW4A 4MV2A 3E6BA 3IDCB 3O14A 1XE8A 2MHFA 2GC2A 2GC0A 2HKXA 3M3IA 2XLFA 2XL9A 4A2UA 4YNIA 3USSA 4E2SA 2ET1A 4IEWA 4OFGA 3OCPA 3D82A 3R6SA 3S7EA 1ZZ7A 3H3UA 3SCGA 3IWZA 1WGPA 1G6NA 1FT9A 4D7TA 1Q3EA 3LOIA 4XFBA 2Q4SA 5CU1A 4HVQA 1I6XA 3LWCA 4Z82A 2XLAA 4PIXA 2GAUA 3KCCA
chains in the Genus database with same CATH superfamily
4CDUB 3MO4A 1LEMA 2OPKA 3TRSB 3MIDA 5C8CB 3OBZA 1LGNA 1DYOA 2H0VA 3RYKA 3LA2A 1AUYA 2RM22 3KD4A 2C9AA 3GJBA 2D6KA 5DZGA 2YG0A 3UETA 4EZHA 4CP2A 4YGBA 1OQ1A 5DAXA 4Q2FA 2BW8A 4YW1A 4Y20A 1WMFA 4L99A 1PMIA 1QOOA 1NCRB 3ZN4A 5IYYA 1W9SA 5K9YA 4LBQD 4XACA 5FJKA 2BBVA 4ISQA 4AEMA 4HXCA 2QDNA 3VD4A 1ULDA 3ZFFC 4YG0A 2FHRA 2DCYA 4HSJA 1LGBA 2HWB3 4B7EA 1LB2A 3Q8CA 4LBNA 4LMFA 4NAMA 4EWDA 3KV5A 1MEC1 1CGPA 2JX9A 1DGRN 2QQKA 4UW5A 1NXD1 3E97A 2O0OA 4DNYA 3OUHA 2A70A 4JTOA 1A8MA 1AL22 2DBIA 1R1A3 2VC9A 4HN0A 4CCNA 2GDFA 1TMF1 2XJRA 4WVZA 4M00A 4DRVA 2W52A 1U0AA 3T4HB 1GP4A 4MXWB 3MIEA 4QPIC 3SC7X 2JECA 1BVVA 2VAUA 3ROUA 5FK8A 2Y64A 1E5IA 1Q8PA 2D5HA 4LIVA 4N8MA 3EXUA 1W8UA 1WCDJ 2ZBJA 3HN1A 1XJAA 3J9SA 3MIFA 1LKNA 3VBRA 3ZN6A 3D0SA 3NMBA 2A73B 5D2AA 3O12A 3ZXJA 4XBLA 2BOIA 1Z0HA 1Z7S1 2E51A 3K75B 4K8RB 1WMDA 3CZUA 3OTFA 1KS5A 1VRBA 5EYXA 2NMNA 5DDJ3 3B3QE 2R0HA 5FMDA 1YCIA 5FOJB 2CGPA 5DMYA 4GB31 2VULA 3CEWA 5CVRA 1COV1 5JDBA 2WNUA 1UZYA 4Y5TA 5K8SA 2WL1A 4Q4Y3 1SCRA 2Q1ZB 3GALA 4CDXB 3L2HA 3MFAA 1AR93 1HQNA 3KSCA 3BUCA 1QJY1 4IV3C 4BWOA 3IPVB 4FQZA 2WJSA 1MACA 4CP1A 2V73A 1SBEA 2LALA 2YROA 1ND2C 4LQRA 1W39A 2F4LA 4XFAA 2SBAA 4RFRB 1V6NA 5ACA1 4OCTA 4YVWC 2G4IA 1XNDA 4NIIA 2HWC3 4ONUA 5JWPA 3TN91 5LY1A 1S4CA 2QQIA 4WM7C 3ZXDA 4AI9A 2JE8A 5ERLA 3WD5A 4XJWA 2PHUA 4JCKA 2VZSA 4TLFA 1NLRA 3RWKX 5FZDA 4XFHA 5C8WA 4UBGA 1F4HA 1LGCA 4Q4V1 3HVDA 4MX3A 2EXKA 1UYZA 4YWAA 4Y1ZA 4XABA 3AC0A 2GMMA 4YZ3A 2GN3A 2VBPA 1TME3 3GCWA 5I93A 1WZXA 1ZZ8A 5FZ8A 1U5ZA 4HBNA 4HVRA 2OYZA 5JMOA 5C9AC 2EIGA 4UFLA 5KXDA 1XE7A 4K3UA 5JXGA 2R16A 4AVCA 3SKVA 5JR7B 2OX0A 4F7ZA 1RXFA 3HEIA 4NHLA 1UOFA 5C3SA 3W20A 4BU2A 5LCWL 4XE9A 4JGZA 3O1PA 3O1MA 4IETA 5J36A 3AMNA 4TLGA 1R093 2W92A 3KV6A 2VZQA 4BHPA 1IPSA 1VBE1 1A78A 1J1TA 2HJIA 3JZVA 2ZHNA 4UFJA 4QD2A 1PGSA 1ASJ1 4FTEA 1DGWX 1H2MA 2PLV2 2WNVC 1UOGA 2YZ4A 3CMGA 3MW4A 5FP8A 1DIWA 5A1LA 1O3SA 3H1YA 2YU2A 4W8JA 4JHTA 1QJU3 2DUPA 3WY6A 4AFCA 3RPQA 4B3NA 3MZHA 2C26A 3FFZA 3VZOA 2Y0IA 2ES3A 2WUHA 2MPFA 1LU2A 4KH9A 5CFDB 4C8DA 2VNOA 4DEVA 4I2OA 3LIGA 3HJRA 3T2OA 1ASJ3 4XF3A 1GZCA 1I5PA 4TXWA 2GZWA 4CPBD 1XB9A 2CYFA 4D6RA 2WFF1 4ES9A 1K42A 3IMNA 2ZZQA 4IV1A 4I0WB 4K6BA 4CTEA 2RS11 4CEWC 3BU0A 2I07B 4MADA 2ZGLA 1QJX2 4Q4X1 2FDHA 3FHIB 3BTXA 4N53B 3ZPYA 4LE4A 5FYUA 2EXJA 5DAPA 1UZ0A 4QMAA 2EALA 3ZSJA 3N7MA 4LXLA 5DUXA 1WMXA 2DU1A 3IPVA 3MFCA 3PJYA 3WR0A 3PDQA 5CIRA 4EWAA 4Q4X3 1FYUA 1URXA 3QH7A 1HB4A 5AVPA 4KG8A 1FOD2 2LUWA 3Q9OA 4Q0SA 5JPMB 1RUC1 5JIUA 2OQ7A 4A45A 2A75A 3OEAA 2ZPXA 1N3QA 4P14A 4YG3A 2WFF3 3RRDA 4AI3A 1OD5A 1M4WA 3FZ3A 5FZAA 2IXHA 3AXDA 1YQ6A 2WZ8A 4LIUA 5GZGA 2WZEA 1VP6A 2GU9A 3I4IA 1JUIA 1KEXA 1JU4A 1UY3A 1AR83 1C8M2 1YWKA 2VD7A 2VECA 2XH6A 3HNBM 1D4M2 1IQDC 1GZ9A 4UFIA 2F6BA 1ULPA 4NIDA 5DN2A 2QQWA 1ALYA 1JOBA 1O8PA 1N3PA 2R061 2YC2A 4PBOA 3FL7A 1PO13 1UYPA 3TWIA 1QJFA 3ETPA 5DUWA 2A71A 4Q0UA 3ZYPA 2QTWB 4FOVA 2D3RA 2J1RA 2VU9A 2ZEYA 4YRDA 3OGGA 3AP4A 1X82A 4UOJA 2ORXA 4A4AA 3T2PA 2CDPA 4XYXA 4XUOA 1WUVA 4OMDA 4XBQA 3IMMA 4DEQA 1JYVA 3ECQA 2ATFA 1Y43B 2WA3A 3KVAA 3TNQA 3DYPA 1W03A 4AQ2A 4JVAA 1GV9A 2WSVA 4Z8BA 3VLBB 2VOXA 1ZBA3 3L2YA 4AVTA 2C0ZA 4TZDA 2QJVA 1QGLA 2PAEA 3NVCA 2P3KA 4Y22B 5FFOC 3VKLA 5A6XA 3LA3A 5FZ3A 2CU5A 1F9KA 3AZVA 1EAH3 2DVDA 5DG1A 4AFAA 1WW6A 4DO0A 5JOWA 1I1EA 2RDSA 4JV4A 1XBFA 3OYWA 1PGL1 1PVXA 4C1WA 3AP6A 5E16A 5FMOL 5FZHA 5AC91 3H7JA 1NCRA 3KT7A 3FLPA 5KXEA 3VD5A 3K4AA 1UU4A 1RHI2 1C3HA 2O1QA 4QQ2A 3ZYHA 3NL1A 1BBT3 4P9XA 3WDVA 3I97A 1AXKA 3N35A 3N9LA 4LK7A 4K21A 4CCMA 5CBLA 4DUXA 3I8TA 2JG8B 2PLV1 2H6CA 5FPUA 3N4MA 2IUWA 2K46A 5DPNA 3T2TA 1APNA 3AZXA 5CYYA 2YBSA 2GNBA 1HN1A 3FHAA 3M70A 4GULA 5CKMA 5A3UA 2VJXA 5J96B 1HDKA 5D8AB 3C7HA 1KXGA 2ARXA 3IAQA 4PLOA 2WNUC 2R49A 3ABZA 3D4KA 3HQUA 2RMU3 4EQVA 1HLCA 1UYXA 3MEPA 2ZEXA 4IUGA 3SISA 3DKWA 2VXJA 4ORFA 3BIWE 2VOWA 1J58A 4JGYC 5FLHA 3LCPA 5C3QA 1CAWA 2Y8KA 4GAZA 1MVEA 4W50A 4KL1A 5LBCA 1GBGA 3ES4A 3RYPA 2A6XA 1BVP1 1S55A 5HPOA 1XRUA 1B35A 3J7HA 3ZMNA 4QQOA 5C3OA 5HXMA 3M4FA 3VDCA 1GLHA 2WS91 4FO9A 1UL9A 3NQHA 1W0PA 1UPSA 3DF0A 1IZ3A 1U5YA 1S0CA 5IVYA 1TQ5A 3IM0A 4NRMA 3SH4A 2DYCA 2IXKA 2WNUB 2WBKA 1FOD3 3AP5A 2XGXA 4XUPA 4YW5A 1UN1A 5CNAA 3OGJA 3WW2A 1ZZCA 2TBVA 4IEXA 4KNCA 4TSVA 3R4UA 4UI9L 4NO4A 3CNAA 3HQXA 1MVQA 3MIHA 1VMHA 2DVBA 2YC4A 5L19A 1W8ZA 1NZIA 1X7NA 3LOBA 4JGYB 4YW3A 4CEYA 4CCKA 3WNMA 1MQTA 2R1BA 3WSOA 1F35A 2D6LX 4JGZC 3B9IA 3WNOA 2QQLA 3ZFEA 2JKXA 5EIYB 4KWUA 3E5QA 5BNPC 2FBEA 2FCVA 4WVWA 2Z4FA 3HAGA 4QXBA 3WP4A 3ZYGA 1PO12 2VQAA 2VG9A 1EUUA 4FI9A 4EN7B 1IHMA 4GXLA 4NE9A 1KDMA 4OUMA 3KHCA 2EIBA 3WZ1A 2O8OA 5A7OA 4XZUG 1ZRCA 1W6OB 4AVBA 5A32A 3JQXA 4JKLA 4KWJA 1MS1A 4LE3A 5LK5A 1W0OA 2AEZA 1HX6A 1DFQA 1BKZA 1LHOA 1R083 4LKSA 4AI8A 5ABJA 3K4ZA 4QDRA 3C2UA 4RS5B 1ND3B 1SMVA 3KF5A 2W95A 3A21A 3CHXA 1DZRA 2WYSA 4PF1A 1DLCA 3V65A 2HEVF 3AKQA 4PDWB 3KMHA 2X29A 4K1ZA 4Q4W2 3WG4A 4WM7B 4P9JA 3KZ4C 1SFYA 1G9BA 4H55A 2P6HA 3ZXLA 4YM2A 1YRZA 3AX4A 4A44A 3A7QA 4JDOA 4N43C 4YW4A 1RMU2 4GH4C 4RS5A 3ZXKA 2WDBA 3T0BA 5A33A 5IUQA 5I91A 4H2AA 3CIHA 3CJIB 5T55A 1H8VA 2XWBB 4A42A 1RUH2 1Q8QA 3GCXA 4ZZ8A 1QH6A 1BEV2 2YUEA 5FY9A 1PM7A 4HSLA 2AH2A 2VVEA 1CONA 3GBFA 2QUOA 2XBO1 1AZDA 1CZSA 3Q8BA 1H2LA 2JDYA 5A33B 1YIFA 2R062 4QKDA 3VDBA 3RZZA 4DRRA 4QX5A 3A4UA 1KS4A 5BNOC 1JYNA 1UU5A 3H50A 2QZ3A 1HKDA 1JYCA 4E9KA 4E2GA 4HG6B 2ZGPA 1D4M3 4YG6A 2IXJA 3ZKYA 1KITA 3BB6A 4P9WA 3O1SA 2RS52 1IS6A 1QXRA 4DINB 2I45A 2Y38A 4EWEA 5JVVA 4XEZA 1VBA3 4GH4B 3KQ4B 4N43B 4Q1RA 3URFA 4XUNA 1G9AA 3LSDA 2EAAA 1NOVA 1LR5A 1NY72 3RMYA 4WBBA 1WCUA 1SBFA 1BBT1 4JAAA 2QNKA 5DAVA 4CZSA 2VZ3A 5EJZB 2BPA2 4BIOA 2PQSA 3PUQA 1QJEA 3K2OA 4N7UA 1W2AX 2KR2A 1XYNA 3WF1A 3RZMA 1FNYA 2RM21 4QDSA 4BZ4A 2D97A 3MDPA 4XETA 2WT2A 4KG0A 4G3YC 1FATA 1ULGA 1X33A 1Y7BA 1YFWA 4UBHA 4DOUA 1ZBA1 1TMF3 4AQSA 1XOYA 2RVAA 5IAXA 4A3XA 2VZPA 3LPFA 4OVEA 1GOHA 1N1YA 1O6UA 3AJZA 4IE7A 4PT6A 4ZPIA 5LA9A 1O5UA 2R041 3BU7A 4AVVA 3LAGA 3USUA 5FPVA 5IK4A 4AGVA 1H6YA 3WHUA 2HWB1 2BJSA 5IVBA 5M0TA 1Q43A 1OBNA 2ZX0A 4MV2A 3JUUA 2QQPA 1W9WA 2IVIB 3VBSB 3IDCB 3CQOA 1XE8A 2D44A 4N53A 1HRI3 4OQ9A 2VBDA 4WVMB 1B35B 1KFXL 1JTZX 2HKXA 1UU6A 3VHNA 2VCMA 5FY8A 4E2SA 2CWSA 3O1UA 4TTGA 1UF2C 3R6SA 3W21A 1ZZ7A 2YGLA 3I3BA 3SCGA 3ZYIB 1H6XA 1K5JA 4W4ZA 5J37A 5CFDA 4D7TA 1Q3EA 3POSA 1AR63 1BYHA 3PUSA 2VQ0A 3VBFC 1WD3A 1Z78A 4CDWA 2D7FA 4XHXA 2GAUA 3AYAA 3H1MA 4YVSA 3FBYA 3V0BA 1B09A 1WA6X 2ZTNA 1WA4A 1SLCA 5F3GA 4BCUA 4QGNA 4XDQA 2AR6A 3H3LA 3LEMA 3MF6A 4JHZA 2XHKA 4QWNA 4ZU5A 3WW1A 3ZDSA 4CXYA 2HBUA 4RN5A 3SEEA 5BNPA 1LRHA 1BJQA 5FTTC 4DXTA 2PN5A 3VBHB 3GBGA 1V6KA 4XXAA 4XVHA 2BFUS 4R9AA 1VIWB 2Y60A 1C28A 2VR4A 3TEYA 3U75A 2GMEA 3UGHA 1MEC2 1QH7A 4ISRA 3V0BB 2JG9B 4OI4A 5IAVA 3TAYA 5KXBA 1UMZA 5SV8A 3K51A 1N1TA 2NLRA 2VW0A 4FFGA 4RQPC 4XFIA 5ABJC 2DBNA 3OOXA 3BTZA 1X8EA 3MUY1 1ZBE1 3QD6A 4URAA 1ZA7A 4YZ4A 2AEYA 3EYPA 3I59B 1IS4A 3QLQA 3BCWA 5FZ6A 2EICA 3VD7A 2B39A 4QHZA 4OYUA 2BVVA 2IFRA 3V56A 1HRV2 1X9TA 3PTRB 4XZPA 1H9PA 5A3LA 5F5AA 3KLSA 1PVC2 2YDEA 4BJ0A 3R4SA 1FMD3 3PURA 3CKHA 4YM1A 3VDDA 3ZFEC 3N3HA 5IK5A 2FZ2A 1UIJA 1UNBA 5FY5A 2ZABA 4P9LA 1AR81 4FXKB 3BTAA 2XVGA 4CUBA 4DMIA 1MPXA 3OD4A 3WNPA 2AUYA 5D21A 2H6BA 3ST7A 5K4LA 1LU1A 2LM3A 2BDRA 2RM23 4KU8A 4MYEA 2XBO3 4Q0PA 1JMUB 3ZO0B 1JZ4A 1VALA 2X05A 5IATA 1UX7A 4BMBA 2XWJB 4E4DX 4CP9A 5GJ6A 3H1WA 2VTXA 4CDXA 1WW5A 4YZ5A 3ZIWA 4B29A 1RUH1 2CAUA 4QPWA 1SDDB 1GZTA 1RUD1 2JKBA 4W65A 1H8TB 4NHKA 4HKWA 3MGUA 5A32B 1UOJA 2Q8DA 4QPYA 5FLIA 3HMYA 1AL0G 4AL9A 2UY9A 2VTXJ 4E4ZA 1EV12 5C7GA 3WF0A 1W6NA 1YHFA 1YXWA 3I2KA 4GWMA 1ZX5A 5LA1A 4Q0VA 1A6CA 3EQEA 2DFBA 1RUNA 2HWC2 3LPGA 1UZVA 1UWWA 1VB4A 2JDKA 3WINE 1F4AA 2A6YA 3U78A 5DDJ1 1ZRRA 3B94A 3WF2A 1N3OA 3QBQA 4BQ4A 5LZ6A 1ZRFA 5A3TA 3HD8B 3IT8A 4FPKA 3UJQA 5KBFA 5HV0A 3AL6A 3MIBA 1O4YA 2YHJA 2Z79A 4FQ4A 1COV3 3LZZA 2X5IA 2R0FA 4JRLA 4NIHA 2W3JA 5D1IA 2D6PA 3BVCA 5IK7A 3I3MA 2WQZC 2ZX2A 1LJ7A 1QMJA 2E7QA 1OMIA 2JG8C 2IZWA 3HT1A 4MUVA 5CA6A 4IGOA 4L0PA 4R9DA 1FOD1 4FPYA 1FXZA 4Q26A 1AX1A 5FUIA 1Q5OA 3OUIA 3ZFFA 3BI3A 3D5OA 3C8XA 3M8LA 5JZGC 4YPJA 2ZMKA 3DXTA 3VB9A 2DVGA 4QAWA 2YU1A 3WDWA 1R092 4B1LA 4D0QA 4EV0A 2FD8A 4JZRA 1S0IA 2OW4A 1JXNA 1REDA 4XQDA 4QQPA 4EN0A 1W6QA 4DB5A 3AP7A 3K46A 1J3PA 2ZKLA 1T6BX 3AFKA 1MS3A 4KQ7A 4S2HA 2VGDA 4YLZA 2HWB2 4GWNA 1LODA 2WN2A 3HIFA 1TG7A 4WVMA 5L9RA 4HETA 5LW9A 3S30A 5BNQA 1SLBA 3ACHA 4OHXA 4CU6A 1VMJA 5FKBA 1QNWA 2I74A 3WCRA 3K77A 2JG9A 1ND3A 2GNMA 1GU3A 1W99A 2RS53 3PMEA 1AL23 2E7AA 4IW3A 5DUVA 2RMU1 5DXDA 1DBNA 5DUUA 5KXCA 4XFGA 3DGTA 1UW8A 3I3EA 1MR5A 5FZCA 3VBFA 5KC5A 3HNMA 5CISA 3RS6A 4YSFA 2ID4A 1QKQA 1IPJA 4E4SA 5FRAA 1LHWA 5HBAA 1W05A 3WW4A 4HKOA 5I0RA 3DXUA 1YIPA 5C3RA 4MGIE 5A6YA 3RZJA 1QJX3 4FPEA 4XJUA 2WLPA 3QCWA 1JW6A 1XSQA 2AYHA 5AC92 3CU7A 4ATEA 1QNYA 1NE6A 3AFGA 2ZGOA 2PYTA 3OSDA 5FOBB 3NV3A 1D2QA 1AR72 3THTA 1MS4A 1Y9GA 5CFDC 3AYEA 2XR4A 4G4FA 4RGKA 3OBRA 4QDQA 5IW0A 1KJRA 2Q8OA 2WQ4A 4MO3M 2ORZA 4DUVA 1VLNA 5FREA 1J1LA 1F2NA 4S2DA 3MBWA 4AVSA 4COZA 2VM9A 2WO2A 3ZOIA 4PLNA 1EV11 2Z69A 5AFBA 1RGSA 5HI0A 3EMRA 1G9FA 1OKOA 2ZX1A 5F5IA 4LA3A 1DLLA 4MHRA 4B1MA 5F9TA 3MW3A 4X8PA 1XQNA 2J1EA 4MHUA 4I0BA 2J22A 1OPOA 4D69A 3E6DA 3WDUA 1HRV3 2R073 3WV6A 5JOZA 2YY1A 1GUIA 4FPJA 5FZKA 1LECA 3RZKA 4CDUC 3N9NA 3WF3A 1V6JA 3DYOA 2GC3A 1GWMA 2R7EB 2RDRA 2ZAHA 3G6JB 3VDAA 3DEMA 1OLRA 3I3QA 2DU0A 3IDBB 1VBC1 4AK3A 2ZMLA 1W28A 4I02A 5FZ7A 3ZFGC 3LSEA 1CPMA 3LD8A 1IG3A 5I8YA 4YZ1A 1RVF2 5G04L 5FYBA 1GWLA 3WG1A 1DQ4A 3UKNA 2G9GA 4E2QA 1POQA 2ZGQA 3UL2A 4CDUA 5C5TA 3NNFA 1FMD2 1NKGA 3FHQA 3O0WA 3POFA 4LULA 5K0UA 1EAH1 3U4SA 3D8CA 3M1HA 3WQ7A 1OHFA 1Y3TA 1BMV2 2VMIA 4XJ8A 5FZ4A 4IGQA 4I01A 2UYAA 3EB7A 4OI1A 1QOSA 1QQP1 3MF9A 3VDDC 1OH3A 4PIYA 3JBG1 4N90A 3LKJA 5CKNA 1XNBA 2PHDA 4IE4A 3WUCA 5ACA2 3WXPA 3NNLA 4LA2A 3SQOA 1G8WA 5DAQA 4XUTA 2WNVB 5SV5A 5A3MA 2BEOA 1JU3A 5LBFA 1PMJX 4AYUA 4AW7A 4CDQA 3Q8FA 1PO23 5GLWA 5T5LA 2R1DA 5FYIA 2MEV1 4CA9A 5FPZA 1VBD3 4OHWA 5HCHA 2JDPA 1S0GA 2K2SA 5J48A 5I8SA 1XU2A 4L92A 4CU9A 3NAPA 5I0DA 1A34A 2XKOA 1YYNA 1N1VA 4CEYB 2A6WA 2Q1FA 2RMU2 1KD7A 1RUJ3 1EUTA 2ZCWA 2XOMA 4QM8A 2XJVA 1AYM2 2XKPA 5FZ9A 1E5SA 1GOFA 2J1AA 3WNNA 2VCAA 3P5BA 4LTAA 3SXWA 3ZXFA 1PVC3 3ZXAC 1OA4A 4YFZA 5ANQA 2EIEA 1V6MA 2YFZA 3VZJA 3PNAA 1XE0A 3WP6A 1F5JA 1GSLA 3KM5A 3POEA 1OD3A 2WS92 2VBBA 4XTPA 4D8MA 3N7KA 4KGGA 1K5MB 1RTVA 5J3UA 1BEV1 3E5XA 4JDNA 2XDVA 3IKWA 3LDKA 3ZXEA 3BALA 4PDWA 4GA9A 3ZN5A 1ZZ6A 2ZXQA 1VBB2 3POGA 2VUDA 2ILMA 2P4EA 4D94A 4YGDA 3ZR5A 2Y6JA 5FXWA 5J1XA 1UO9A 2X5IC 2ZS6B 2RJLA 4BQ3A 1ENSA 2JIGA 4LUKA 1AR73 1R64A 5D8AC 3VL8A 1TZOA 2RR13 4MGSA 4DXSA 1RMU3 5LATA 4EN8B 4FFHA 4ZXEA 4NUBA 1M06G 1VR3A 3N9QA 4M3CB 4EE2A 3ILNA 5GZCA 4FPOB 4XJAA 5FV3A 3OY8B 5IJRA 4Y1XA 2X53S 3MLKA 5IVEA 1QF3A 4NJ4A 4FPLA 4QPIA 4NPRA 1FPN3 2WWUA 4KWKA 5KWRA 1Q8OA 4BM8A 4KBBA 1WMEA 2YBPA 3VBRC 4LT5A 3C7OA 2BNOA 1LHVA 1SLAA 1W6QB 3F95A 4JX0A 2RR11 4GWJA 2VMHA 4ITCA 4O9EA 2G19A 2NQYA 4M01A 1ND2B 4AQ6A 4OLLA 1JBCA 3IDEA 1W6PB 3UGFA 1OQDA 1PZ9A 1CJDA 1NCQC 2DFCA 3GJAA 4RA0A 1NCRC 2DUOA 3UGGA 4IE6A 4UW6A 1AR91 4HMZA 2HLEA 3PMSA 1H9WA 3ZFFB 1EAH2 2ZX3A 2HYKA 3NAPB 4B4QA 3PVEA 5IT6A 5LK7B 1W8NA 2ZGRA 1EP0A 3NJZA 1J59A 2E31A 2BGPA 4XF4A 1SPPA 1WW4A 5FPAA 1SEFA 1CAVA 1S2EA 3H0OA 4P02B 1GQPA 1ONAA 3B69A 4HVOA 4CCEA 2Y6KA 1OVPA 2ZA9A 3ACIA 4X6QB 5FP7A 1YJKA 1VMFA 2CWMA 3J8F2 4UF0B 3G7DA 3ORJA 2FQPA 1YQ5A 5CEHA 5J98B 3POBA 3I2JA 4CDWC 4M3CF 3TNPB 2FDJA 5L73A 1RYYA 2VZRA 3NV2A 1H2NA 4GALA 5FYVA 4AGGA 2VTFA 2XL7A 2TNFA 1PNGA 2Q8EA 1W8TA 5GLZA 2V72A 1JYWA 5H9QA 2Z5WA 5J09A 1J84A 4WM8C 2WC2A 4FOYA 4CUAA 4IEVA 3OD0A 1JYXA 4CCOA 2HWD2 1ULEA 3OGRA 3U0ZA 2IXIA 3AXEA 2VUAA 3L9JT 2XMLA 3CBNA 3MYXA 4FOWA 4EN6B 1TE1B 3MPBA 3LDRA 1PGL2 1RUC2 4P00B 4XFFA 1UYYA 2UURA 5JXJA 4PQQA 3KCXA 1WBFA 3DPRC 1NG0A 4C0HA 3LFIA 5F37A 1HXS3 1SLIA 4Q0QA 4WM8A 4QU2A 1UKGA 1VAMA 4CP9B 2DUQA 3EO6A 5LASA 5L9VA 5E1RA 3VBUC 1F8VA 2J1VA 1WWYA 4COWA 4PLMA 5DQ0A 2XQRA 2P3IA 4YM3A 2UWBA 2Q1MA 1QQP2 1NX9A 3LDBA 3RI8A 3SKJE 1HXS1 1TME2 1W2TA 1X9PA 3AJYA 2NMOA 2BFUL 5BPXA 2CHHA 5FZIA 1JZ8A 5EQUA 5A7SA 3EHKA 1E5RA 3OBAA 1JHNA 2ZGUA 4JKKA 4FT8A 5G05L 5JI7A 3VBUA 1DGWA 2KA3A 5FWJA 5K0UC 4HOOA 1RUI1 3M7AA 3RMXA 3VGIA 2Q30A 5C4WB 2MEV2 1J3QA 1LHUA 4FFFA 3KT4A 4FBFA 3TB0A 4CDXC 3ZN6B 1VE0A 2C6SA 4NHYA 1QY4A 2B42B 3E6BA 4AF9A 2JD4A 3LGRA 3O14A 1AYM1 4QKFA 1N47A 5GLTA 4CPBA 2J1SA 2XLFA 2XL9A 4A2UA 4OZOA 4PI0A 5JZGB 2DURA 1CZVA 1ULOA 4YFWA 5LB6A 4Y1UA 4UF0A 1H8TA 4WZFA 2VMGA 4LPLA 4IEWA 4OFGA 2UWAA 1KFUL 4INDA 1V6OA 1W04A 4ZY9A 3BODA 4MVTA 3IWZA 3HNYM 2A5ZA 5DZEA 2R043 4RL7A 1SDWA 2RHPA 4Q4W3 3N9PA 2BV4A 4LO8A 4BISA 2XPJA 5CU1A 2OS2A 1I6XA 2WT0A 3LWCA 4GJYA 4Z82A 3ZYJB 1DYKA 2ZACA 4QX2A 3ZXGA 5JSRA 4RR3C 2XJQA 3I3DA 4XDOA 5FK7A 4M0NA 3CDZB 1LULA 2HWF3 2A3XA 2CNAA 3VBSC 1N1SA 1GR3A 1PO11 3K4DA 3LF7A 4RHV1 5FYHA 2LS6A 4QT6A 1LESA 1HW5A 4LHSA 4D6SA 3I54A 4HN1A 2IVJA 5JUVA 5LEKA 1AVBA 2DF7A 2NM1A 2VMDA 3OJBA 1NQJA 1PO22 3PU8A 4N9HA 5LBBA 4ASLA 1W8OA 3HR9A 2J1UA 1RUE3 5BYNA 5KHKA 5FDBA 3C7FA 2ZHMA 3P6BA 1XU1A 1REEA 1W3VA 2ZHLA 3VBSA 2UU8A 1OC1A 2YMZA 4UT5A 2VH9A 4HK8A 4R9CA 4ATFA 1F15A 2DCJA 2YFUA 3NWKA 4FP3A 1L7RA 2PHTA 5EXOA 1CD3G 4IEPA 1DQ0A 4LBMA 2WZPP 2VMEA 3HQRA 1I3HA 1W2OA 2W87A 4RR3B 3ACFA 4Y33A 1AHSA 1GP6A 1RMU1 4LBOA 3JCIA 1QU0A 4S2GA 3B01A 1OVSA 2G1MA 1AX0A 1Q8SA 2GSYA 1JZ3A 4Q5OA 3NJVA 2VZTA 4L97A 4PBPA 1LOAA 1SPPB 2AACA 1FNZA 5KHIA 1L3JA 2CY6A 1GKBA 4IV3B 3GM8A 3BPZA 4QPIB 2ZKNA 4CDWB 4EROA 4EZ4A 2NN8A 2BTVC 1Q56A 3I2FA 1D2SA 4PHZA 4IEUA 5FXZA 3LFMA 5KHHA 1YFUA 2A3WA 3PUAA 3TEXA 3LA7A 4FAGA 4NAOA 1WLCA 1AL21 1EPWA 1LOFC 1W6PA 4U36A 2W94A 1ND2A 3KB5A 4GWIA 4Y5Z0 3NKTA 4OULA 3RI9A 3V64A 4YARA 4QGLA 3OGSA 1H4GA 5F1RA 1O5LA 3MPPG 4ZHNA 1JYTA 1RUG2 3SHRA 4A7YA 2DTYA 1OLME 4CU7A 3H9AA 1OOPC 4QXCA 4M4RA 3SITA 2HYXA 4M0HA 4NR1A 4Q1PA 3CLPA 5B4XA 4QHBA 4WVVA 1CAXA 1W8FA 4PF5A 3APBA 3M3QA 1JOJA 4XW3A 2DTWA 2VQUA 4NMIA 2QQMA 3SNMA 3WDTA 3U1XA 3JD73 4CSWA 2ZZJA 2CDOA 3B7MA 4BQWA 1ULCA 2JB4A 3POIA 5FZOA 4J25A 3ZX7A 4Y4YA 4HZFA 4O65A 5FY7A 4OUSA 4LUMA 5C33A 1ODMA 4LBLA 3ZM8A 1AYN3 4YW7A 1LEDA 4A7ZA 2D3PA 1H30A 4QPGB 2D93A 3T0AA 5JOYA 3T2QA 3Q8AA 4HONA 4KWLA 5L7OB 5CG9A 1R1A1 1SZBA 2OPWA 3VDDB 5JXHA 4D6QA 2AENA 2VPVA 4Y20B 1AJKA 2BZDA 5FPXA 1FV2A 4BB3A 1ZYBA 3U11A 5CFCC 1V9U3 1G9DA 2WLQA 1NLQA 3PVBB 5A3NA 4AEKA 2WABA 2RDQA 2PHXA 4L9BA 3C7EA 1JZ5A 3VBOB 4PI2A 3ZYBA 3VBRB 1WLWA 3BOPA 4QX8A 2NZ9A 1R091 5F2WA 2VY0A 2FMYA 4PJYA 4UFHA 3NV1A 1A8DA 1DZQA 1AYN1 4RSUA 1K5MA 2VNVA 1W9TA 4BK5A 5BNNB 1IG0A 3SLIA 3T30A 5T54A 4AFDA 4CEYC 3WNXA 1RUOA 3TN92 1RUF3 1PNFA 3GYDA 1IS5A 5EHDA 4RHV2 3KCYA 1JI6A 1B35C 1PK6B 1SBDA 2A6ZA 2P3YA 1XNAA 4Q8LA 2OA2A 2D40A 2YXSA 5IFTA 1JYIA 2B45X 2DCTA 2I2SA 1H1IA 4FXGB 1ZZBA 2BOJA 4N9IA 5IVJA 1H8TC 3R4DB 4P5HA 1V6LA 3P3PA 4Q8KA 1IPKA 4XJZA 5K0UB 2WFPA 4JTNA 1RUD3 2YGMA 5HXVA 5FXXA 4XAAA 1AXYA 5GLUA 1FPN1 1MQTB 1XNKA 2FCUA 2ZAAA 4XPVA 2GN7A 1H2KA 3C3VA 1CN1A 1R1ZA 4K1YA 2XONA 4FP2A 3OB8A 3KGZA 5FY0A 1PHMA 3E1F1 3UKTA 1NA1C 4ASMB 5T50A 3NJYA 4D7SA 3VD9A 3IAPA 2G9FA 1ZBA2 3LIHA 5C5UA 3NJXA 2D3SA 1CIWA 2DCZA 2O8QA 2DDUA 1RL3A 5BXXA 3T0DA 1FMD1 2W91A 2JIJA 3MV01 5JCTA 3OF1A 2AGSA 4RYDA 3OPZA 1BMV1 2YYOA 5DZFA 4FVVA 3E6CC 4P9YA 2KM2A 5JOXA 2HWE2 1R082 3O5SA 2Y0OA 4OMCA 4XDPA 1S0FA 1NA1A 5J7MA 1RVF3 1XPWA 4AEDA 4C90A 1ZNPA 1XSRA 1O3RA 5JSPA 1SCSA 3BN6A 5JXIA 2GH2A 3OY8A 1HB3A 5A7QA 4DFSA 1CVNA 1GNHA 1W8WA 2A3YA 1MZ6A 3IN9A 4UFKA 4M3CA 4Z2WA 4OHZA 1ZBE2 3VUOA 1RC6A 3POYA 5I0SA 3FE5A 1S2BA 2E53A 3RG0A 3GBWA 4LKEA 1YI7A 2Y33A 5C71A 1EV13 2RJ2A 4O7XA 4LOTA 2VZUA 3N9OA 1PVC1 2AREA 4LLOA 3W9AA 1WW7A 2BYVE 2VW1A 2YB7A 5DABA 1JS9A 2IXCA 4ES8A 3ZFEB 2P3JA 2CGNA 3MLLA 1FAYA 2WWJA 1C57A 4IEOA 4MGKE 2QQNA 4OQ8A 1RUE2 2W08A 3THPA 2FDGA 1BZWA 1C1FA 1GICA 1RINA 1UOBA 3NNMA 2D6MA 3V0AB 4CU8A 2BNNA 5JPNB 1RHI1 4AWDA 4RD7A 5LBEA 3K48A 2E7TA 2WT1A 4K8FA 2PAMA 2WWSA 5EYYA 3AMMA 4ZU4A 1V70A 2RJKA 4URTA 2CAVA 1RITA 3HN3A 1NE4A 1VBB1 1XNTA 3PVNA 4NROA 2LRPA 2EXIA 2VE1A 1PK6C 3ACLA 3J26N 3JB4C 1UXXX 4GJZA 4AR2A 4DY3A 4NWWA 4AFMA 1ST8A 5C6CA 1OXCA 5T5PA 3WX5A 1MS0A 3JBG2 2C1FA 2WNOA 3TYJA 4P08A 4AVAA 2DCKA 4OUEA 1HRI1 3GHNA 5AFEA 2KD7A 4HK9A 1RUG3 2D5FA 1C5IA 4HLTA 4RGGA 2GC1A 3AB0A 4Q4Y2 1WCQA 2Y6LA 2XXZA 2ZGTA 5FZBA 1HJGA 3NRUA 2VNRA 2BVBA 3PUIA 2NYYA 3ZSKA 3CJXA 3ILRA 3X29B 1PK6A 3B5LB 2C5DA 4BXFA 1YC61 3VBFB 1H4HA 1HRV1 3VZLA 4AHZA 4PCRA 3ZVXA 5A6ZA 5DDJ2 1O7FA 2ZGMA 1Y9QA 1EPZA 3RZGA 3AVRA 2XJUA 1DF0A 4META 2OVUA 1W6MA 2PQQA 3W5MA 3T3YA 2YV8A 1XNCA 2W39A 3EJKA 5FBZA 5IVCA 1KJLA 2IXLA 3M2MA 4QM9A 4XF0A 1JN2P 1LENA 2VMFA 2PA7A 3HWJA 1NCQB 2ADDA 1K45A 1DQ5A 4DPNA 1RUJ2 1VAVA 1VBD2 4IE5A 4JQTA 4R9BA 4XMAA 1S0JA 2VVFA 1I9RA 3S0MA 1BHGA 2JENA 3AMPA 4OI2A 5F3IA 1V6IA 4Y1VA 5FLJA 2H0BA 2OIIA 4XF1A 1HQWA 3KV4A 1UX6A 1GQHA 3AKTA 4KBZA 3ZSMA 2VOKA 1YFXA 1FX5A 4Y26A 3H8OA 3A0KA 3B02A 3VZKA 2ARBA 4CXWA 4XILA 3DYMA 4XIKA 2C4XA 1AR62 1ULFA 5BY5A 2QDRA 4BE3A 1G9CA 1QDOA 3I2HA 4AQTA 4JQRA 1C1LA 4QPGA 2WZR2 4YZ2A 1OF3A 1VBA1 3B00A 2XJPA 3J8F1 4D7YA 3PJQA 1KQRA 2C24A 5EJ3A 3PTYA 3P1IA 1E5HA 2E32A 2N7GA 2WO1A 2VZ1A 2J7MA 4JGYA 5H9RA 3RZLA 1HQLA 1TMF2 2GNDA 3OBTA 4EJRA 3M3EA 4AI2A 3IB3A 4Y24A 1WCKA 4XOGA 3ATGA 1DHKB 1OSGA 3AZYA 5FO7B 3VHOA 1GP5A 4OI0A 1CWPA 5FJHA 2WAOA 2RV9A 2A1XA 3QH6A 4W6WA 1O3TA 2WO3A 1LAJA 5FYMA 5F2SA 1V00A 5CZKA 2XUMA 1IS3A 4RFT0 2W9XA 4Z1VA 1UIKA 1S0EA 1PX4A 1TNFA 3A22A 3WG3A 3ENRA 2ETEA 4U2AA 4LLFA 2ARCA 3J4UH 3J8F3 4CVUA 1TEIA 4NPMA 3U4XA 4FPGA 2WIIB 4CCCA 2K0GA 4DS0A 3C7GA 2P37A 3MIGA 4GB33 3BPSA 2JB8A 3J7MA 3W58A 4LITA 1RIRA 2PHLA 5FO8B 1VB2A 3O0XA 1OT5A 4XBNA 2JDNA 3UNPA 4MGTA 1JH5A 3R0RA 3FBMA 2P1BA 1XXNA 3IZOA 4FTBA 5LY2A 2ARAA 2FMDA 3DECA 2QFEA 1IQAA 4XCBA 3T09A 4LBJA 4BDVB 2OUHA 2P17A 4HPKB 4XHBA 4EYUA 3H7YA 5E8AA 2VNGA 4ZS3A 2WO7A 4NWVA 3OEBA 4AZZA 3J7NA 4E8CA 2QQOA 3ZKUA 4CP0A 2P6CA 2YC0A 3GGLA 3I59A 3N36A 4J6GA 2XBO2 2PXJA 2WA4A 3LQCA 3WNKA 4AEJA 3RNSA 3DKQA 1NZCA 4NIAA 1NQDA 3GF6A 3MHZA 4P9GA 2X8KA 4H3WA 4L11A 3THDA 4QX0A 2OQ6A 4QB1A 5EPAA 1CX4A 1V9U1 1NXMA 4COUA 1PZ7A 3B93A 2Y6FA 2HWE3 4CEWA 2QBXA 3WQ0A 1OFNA 5FQ0B 4FTSA 3FLTA 3N9MA 4JC1A 3VBHA 1PX3A 4BMEA 3A23A 3T4VA 3WP5A 4HKLA 3WF4A 4D3WA 3O7OA 4NHMA 1BCXA 4NVPA 4AOCA 4AI0A 1ENXA 2ENRA 4SLIA 1BBT2 3AVSA 4CEWB 1VBC2 3PL0A 5TSWA 4YVSB 1MZ5A 1U12A 3ETQA 3JD71 5KR7A 5F8PA 3T1LA 4NOTA 3D0JA 1Z7S2 5GZDA 4B8EA 2E9QA 2NPIA 3LEIA 1VBD1 4QKNA 1I5ZA 3ZLIA 2JWPA 2QQUA 3VZNA 3NO8A 2VMCA 5AVAA 2PAKA 2A6VA 2V09A 1E57A 3KS7A 4CCLA 2GP3A 4QGMA 1SLTA 3WUDA 1SFPA 2OZ6A 1COV2 4K9SA 3RDIA 1JZ6A 1DGLA 1HV1A 1DYPA 2JDAA 3KT1A 4YGEA 3KV9A 4LBQA 5FR3A 2Z2SB 3E5UA 4K40A 4QXHA 5BNPB 2V4AA 2ZHKA 3VKFC 2OUJA 4GIQA 3S57A 5L36A 5JZGA 3FJSA 1RXGA 1AX2A 1KRIA 4LO6B 2BP6A 2WZR1 2XB6C 5FY4A 3CZJA 3ASIA 3PU3A 1HXS2 5A7WB 3IDAA 4XMIA 1U5IA 3WOGA 1D0HA 5FAXA 2B9VA 2QQJA 4JDMA 4Q29A 2WRAA 4MOAA 2JDUA 4GMP1 5GM0A 1DZTA 1OUSA 3USUB 5JLVA 5FIXA 4MXVA 3OGVA 5HCAA 4AHWA 2BBAA 4OHYA 3SH5A 4RQPB 1OI6A 4Y3OA 3VKMA 2W47A 4BXSV 1C8NA 4MXWA 2W1SA 1PZ8A 5FZEA 1XC6A 2JE7A 3T08A 2AZ5A 1ND3C 4HPKA 5FZMA 1GOGA 4B4RA 1HN0A 5FPLA 1X8MA 2EIDA 4P9IA 3QACA 3I2GA 2ET7A 2ZGKA 4G9SB 1AXZA 3VV1A 1PIV1 4R52A 4CRQA 4Y1YA 1CAUA 5LEJA 5A80A 3VN4A 4O61A 2WYFA 2YBKA 1VRH3 3NW4A 5F32A 1MZFA 4FCAA 4H14A 1L7QA 1BQPA 2MHFA 2XQXA 3H8RA 2WKKA 5A1FA 1OLMA 2RS31 2VOVA 3M3IA 4BQ2A 2VVDA 3A0NA 3USSA 3S6PA 2DV9A 2OXBA 3HBKA 3PHMA 4ZXKA 3MUZ1 2W46A 3OCPA 4QKBA 1HJFA 1C8M1 4XQ4A 4AHXA 3H3UA 2R042 2D98A 3WP3A 1VBA2 1YQ8A 1G6NA 1FT9A 3RVHA 1XYPA 3FMGA 4YVWA 2GNTA 2J42A 1QJZA 1QXPA 5DAWA 3TEZA 4C0BA 4HVQA 5HV4A 4WM7A 4XC9A 1QOTA 2OKXA 1RUI3 4GD4A 4IXLA 5F6KA 3UK9A 1MS5A 3SCHA 5FBJA 3VHRA 1S0BA 2E26A 3WHTA 5C9AB 1RUG1 4BQYA 3O0VA 3GXUA 3ZMOA 4H7LA 4QPGC 3M3CA 2HWF2 4GQ7A 3UKVA 3UJOA 5EJ1B 2D6NA 3N7LA 3CJIA 1ZVFA 4I30A 3OPTA 4GMP3 1W3XA 1UY0A 1YQ2A 3B9CA 5GKAC 5C9AA 1SHWB 1YNAA 3WT3A 2IWGB 1BLZA 3CO2A 1OH4A 2R072 4A6SA 5IFPA 5L7OA 1X36A 5A6QA 4PQ9A 5I0UA 3BIEA 3VBOA 3VKOA 1VRH1 3AKPA 3ZFGA 1AR92 3ELNA 4K20A 2J1TA 1QJU2 5C8CC 2WQ8A 5KHJA 4LORA 1ZA4A 2AC1A 5ABJB 4IESA 4ET7A 4IL7A 4MSVA 1NT0A 1AYN2 3PIGA 2VZOA 4XURA 4BQ1A 4GKYA 5KC6A 5FZGA 2BWCA 2YPDA 3ZR6A 3V0AA 2F4PA 4OHVA 5T52A 2JICA 1UKRA 2CTVA 5FYZA 3GZUC 5BNOB 5C8CA 4R4ZA 1OLQA 3I2IA 1GNYA 2PFWA 3U37A 4HL0A 3P3NA 1V9U2 2CSGA 4CUGA 1NA1B 3ALQA 3ME2A 4IV1C 3S5QA 5CG8A 1VBB3 4KGQA 4COYA 1CAXB 4Q4V3 5BNOA 4DIQA 4UW4A 5KHGA 1UMHA 4Z92B 2VUJA 1JZ7A 5CADA 5HCFA 1BK1A 1PGW1 3KF3A 1VBC3 4B4PA 3MLJA 4TYSA 4M3CE 1UY2A 2HEWF 4H7MA 4ZONA 3FLRA 1V0AA 1UPIA 2BRTA 2RR12 1VBE3 3WW3A 1UXZA 4AEDC 4Q27A 3AYCA 4IGPA 3JD72 2D43A 2X09A 4F83A 2FDIA 4MLOA 4GKXA 4RS5C 4XTMA 5FZ1A 4CYDA 4LO4B 5JR2A 3VBHC 1R1A2 5JMCA 1KGYA 2CGOA 1QXJA 5B2GB 1O8SA 2QKDA 1W2UA 2JG8A 3BYWA 5A70A 1QEXA 3IIAA 5ANNA 1CPNA 4DXRA 1P8JA 4PDWC 5FPBA 1UAIA 1O91A 1WKYA 4FSJA 4MGYE 5H9PA 2XUEA 5IVVA 4FPCA 4RR3A 1GANA 3HBZA 4UYBA 3RFRA 4C1XA 2E6VA 4LNVA 3H8XA 5C4WC 1DQ2A 3ITQA 5GZFA 4FAHA 5FUPA 4MZUA 1GQGA 4X6RB 1J3RA 3F2ZA 1T2XA 3MI8A 4MGZE 1HB2A 5D8AA 2QCSB 3FN9A 4AAPA 1GFF2 3IBMA 1W8HA 1D4VB 1UCXA 4AEDB 3AKRA 2IFWA 5BUVA 1QIQA 2K9ZA 4BK4A 5CAZA 1OPMA 1SFNA 1GYKA 3D3AA 4DZGA 1JZ2A 3LB9A 3OG2A 1H1MA 1REFA 4YVWB 5ISLA 5FYYA 4BQ5A 1RUF1 2QQVA 3TOJA 5T5OA 2VO5A 3S5AA 4E27A 4JRAA 1MZEA 2QVSB 3TEWA 1MS9A 2HWF1 4BIFA 1JOPA 1UD1A 2P5BA 2W2IA 4YYOA 1PMHX 4KMQA 4N53C 4DY5A 3WDXA 3O1OA 1UZZA 4XAEA 3SH3A 3ZSEA 2HBTA 2PLV3 3JU9A 1ACCA 1UZWA 1IKQA 1G7YA 1FPN2 1F5FA 1L7LA 1SACA 2R071 4LBKA 3IIIA 5FMCA 1TNRA 4Q4W1 3VD3A 5BNNA 2BUKA 3DL3A 5FZ0A 1RUE1 5CFCB 1LTEA 1VBE2 2UWCA 4Y22A 5E89A 1YUDA 4QB6A 4S2FA 1C8M3 1Y4WA 1W9YA 1ASJ2 2XHNA 2RS32 3PVOA 2DVFA 4JKMA 2W5FA 4YW2A 4DUWA 4UAPA 1H0BA 3LEGA 1IKPA 1CJPA 1NYWA 4ZU7A 4UW3A 3PLQA 1AR71 4HFSA 2Y6GA 4E4HA 3UYJA 1HRI2 4YVSC 3ZDVA 3I7DA 1WLTA 5DG2A 5BNNC 2Q0AA 1EYBA 4LEJA 1HB1A 1R081 2Q8CA 4BLIA 1A3KA 4BOWA 4YGCA 1JUHA 1LOFA 1STMA 2ZGNA 2JG9C 1NAEA 1RUI2 1XYOA 4BQXA 2XVLA 3SCFA 2XG3A 5I0TA 3T1MA 3H3ZA 3ACGA 1LOEA 4LO7A 1YI9A 3VZMA 2E63A 1W6NB 2W1QA 2ZJCA 5FYTA 3WCSA 1CX1A 2B4KA 4N7IA 4XUQA 1UQXA 1W2NA 1Y9MA 2LROA 5T3NA 4ARYA 4IV3A 2PHFA 2JD9A 3AMHA 5T5JA 3DN7A 3RJ2X 2JDHA 4A41A 2ZEWA 2W68A 4XIOA 4ZS2A 3JBG3 3POWA 4Q4V2 3VBOC 1HV0A 1PGW2 1WD4A 5GALA 1NUKA 3ON7A 4LBQB 1O3QA 2VQTA 3NV4A 1VJ2A 3MW2A 2IC1A 4IERA 2CL2A 2PMWB 2WAAA 4A7KA 5HCBA 1RUJ1 4L8QA 5JSOA 1GWKA 2VXRA 1VRH2 2MEV3 5FUNA 5A1AA 2CV6A 4P5YA 1QJU1 3GZAA 5FZOB 2GP5A 3HOBA 4C91A 1C4RA 4BA6A 1EY2A 3POJA 1CAUB 3ILFA 1OA2A 3KHBA 5L7OC 4UFMA 3CJIC 5EFUA 5A3PA 3WQ1A 1O4ZA 1QHDA 2VW2A 3Q8EA 3AM2A 1W9FA 2JJ6A 3N7JA 1OUXA 2QZ2A 4IQPA 1CAWB 4IV1B 2ZEZA 4R8HA 3D6EA 4L2NA 1MQTC 4QX7A 2EF6A 1UY1A 4RQPA 1K3IA 5F3EA 4SBVA 3FFQA 2BGCA 5FQ0A 3I49A 1DCSA 3NNJA 5F5QA 2EVXA 1QQP3 1YLLA 1PM4A 2GMPA 3H42B 1OQEA 4XF9A 4AG4A 4I3PA 2B5HA 2PTMA 3GHMA 1JODA 4Y5SA 2R32A 3AK0A 1OF4A 3KQRA 1OA3A 2WINB 4GMP0 4I3GA 1SQ4A 5IWFA 5A7WA 4EN9B 1GMMA 1CR7A 2O14A 2JXAA 5FYSA 2WFF2 2G9ZA 1RUF2 2OZJA 1W6MB 4PIZA 4QU1A 1RJ7A 4MH0E 5K7PA 3BKZA 2RS12 1LOCA 3WNLA 1NY71 5FP4A 5LRRA 4CXXA 4Y4RA 3GNEA 3RQ0A 3ES1A 1RB8G 4IEZA 4J1XA 3LEKA 2TUNA 1RHI3 4V2VA 4JGZB 3U10A 5F6LB 3RWNA 1RVF1 2P34A 2RE9A 1PIV3 3PIJA 4OZXA 3CL1A 1CQ9A 4Z2AA 2KXLA 1FI2A 2B7YA 4J1WA 5F39A 4AHYA 3OYWB 2DWRA 2R063 5CB7A 3U07A 1D7PM 4K7JA 4FPFA 1WCSA 1T6GC 2Z42A 3K3OA 3FUQA 1POV3 3FUOA 3QOPA 1OOPB 4LK6A 1D4M1 2XJTA 3FWEA 5EP9A 1QJY3 3S7IA 2ZX4A 1CZTA 2RS33 1QDCA 1X50A 5L9BA 5FZFA 1YO8A 4AGRA 1LOGA 1YFYA 2X5IB 4CUCA 2JDZA 1ENQA 4M4PA 1O59A 1LNSA 2EAKA 3PUHA 4WZCA 5JAXA 1US3A 2D6OX 3THCA 1MS8A 2WZR3 2FZ1A 2ZMNA 2OT7A 4R4XA 1CESA 3R05A 5LA2A 3ZIXA 3ZYFA 3RZHA 2TEPA 2PHWA 1NLSA 1ZREA 2WSUA 1O4TA 3I2OA 5B4NA 3ZSLA 4BH9A 2E33A 5FP3A 4V1PA 2EA7A 2W1UA 5FYCA 1RJ8A 5C4WA 2VL4A 4CCDA 2A7AA 4RGAA 1AF9A 1LOBA 4UWDA 4NN0A 2R30A 2FDKA 3SMHA 5A7PA 3VL9A 2RS13 5FMOS 1AR82 3O1VA 2P2KA 3DCQA 2VUCA 2Y6HA 3HT2A 5FMBA 5A3WA 2W1WA 4QQHA 5LA0A 4TN7A 1H1AA 1BEV3 4CCJA 3J7LA 4X8NA 2HWD3 3BTYA 3MV11 5IVFA 1S2KA 1DP0A 2ADEA 1NCQA 2GH8A 4UXAA 4LKDA 4B7KA 4MGQA 4A3ZA 2HWE1 2BQPA 3VHPA 1W06A 1Z7S3 2BWAA 4HANA 4YW6A 5APAA 4MG2A 2V5DA 3JB8A 2V5YA 3TBDA 1K12A 3AZZA 1DQ6A 4NRPA 4LHLA 3VBUB 4BYYA 4NPLA 1U5XA 4KI5M 2UYBA 4NRQA 3KGLA 3U14A 3HPNA 4FPHA 3NNGA 3UESA 1CAVB 4LHKA 2WR9A 3ZYRA 5BV6A 1LHNA 4LR4A 4NHXA 2WNEA 5LRSA 4XXPA 1YEWA 5IK8A 3DUIA 1GZWB 2WS93 1ZM1A 1OOPA 4QX3A 4LO5B 1SLLA 2RG4A 1G86A 4QQLA 3SEPA 4TWTA 4QB2A 3UT0A 5FZLA 4WM8B 3NSTA 3OUJA 4CE8A 1OURA 2YPJA 3AP9A 4I09A 2Y26A 1ZRIA 4LJHA 2HWD1 2BERA 5I8TA 1RUH3 3RSJA 2R6QA 1GNZA 2BU9A 2ZOEB 2EXHA 3TN93 1BXHA 4GZ9A 4QXKA 3ZPOA 3WDYA 5E88A 5ACA3 1CIYA 1ODNA 3INAA 4GB32 4Z07A 3EBRA 4W6XA 1WBLA 3AMQA 4XQWA 3AL5A 3BOWA 4LKFA 3JXSA 3O1TA 1J83A 5C3PA 1POV1 2PELA 2XVKA 5CFCA 4E8DA 5FP9A 2ERFA 2WN3A 3DPRA 2NP0A 5CKQA 4AFBA 4YM0A 1RUD2 3FC0A 4DQAA 3AZWA 4IDZA 4XJ9A 1FV3A 4A6OA 1TME1 1AJOA 4LOSA 3LE0A 3I2DA 5EV7A 1K5MC 4FFIA 1W6OA 4Q4Y1 2GALA 3DV8A 4XCAA 4BLJA 4IEYA 1UMIA 3VKNA 4I0AA 1OFSA 1DGRA 2LTNA 2Y34A 5F7UA 1S0DA 4HT1T 2VZVA 2XLGA 5FKCA 1OKQA 5FXVA 4DXZA 3O1RA 2VOTA 2V4VA 3MICA 5EWSA 4AXOA 3FX3A 2HWC1 4ZZ5A 5AC93 1DU3D 1LCLA 3CF6E 1POV0 4QHOA 5FWEA 3WLUA 3KWVA 2JEMA 1KDKA 1C5HA 4RHV3 5FCCA 4AI1A 4CDQC 3W5NA 3W59A 2LW8A 1D0GA 2BNMA 2UY8A 1Q8VA 4XFCA 5F5CA 2VCBA 1W90A 2FCTA 3GZEA 1QWRA 4LHNA 3RYRA 3GDBA 3OPWA 4QX1A 4F8AA 1PIV2 4O9GA 3NAPC 1IGOA 2B8MA 2RDNA 4AAXA 1F31A 1ZBE3 5F3CA 1TVGA 2JE9A 1VPHA 4ZKTB 2B9UA 2HEYF 2HH9A 1DDLA 2MNGA 5EZWA 4KU7A 1SG3A 1ZRDA 2Q5TA 1AR61 1YQCA 1QJY2 2X10A 1ENRA 1DG6A 2QE3A 5C70A 4IEQA 1HIXA 3DPRB 3H8UA 4ASKA 1US2A 3ZFGB 1WLDA 1S1AA 5FY1A 5A3OA 2L9LA 1MEC3 2C9KA 2GC2A 3NKGA 2BGOA 3KVBA 2FDFA 3GZTB 2GC0A 2JDMA 2SLIA 3AKSA 3WEZA 3UV9A 4CDQB 4W6YA 4COVA 1DQ1A 4F3JA 1UY4A 2DVAA 2W0XA 5GZEA 4YNIA 4NIGA 2WNVA 2ET1A 5H9SA 5IHRA 3K3NA 4WV8A 3WVJA 1IOAA 2RS51 4N43A 3D82A 1AYM3 4GH4A 5E6HA 1YJLA 1JHJA 2PHRA 3AYDA 3M3OA 3RGBA 3S7EA 1PO21 5A7NA 1WGPA 5GLVA 5JI9A 2ZGSA 3JQWA 1RUC3 3RJRA 1W0NA 2XJSA 4V2WA 2VCCA 1QJX1 3LOIA 2B46X 4IE0A 2Q4SA 4Q4X2 4XFBA 5LWBA 3BGAA 3WQBA 4ARXA 5FO9B 4BPZA 3WG2A 1BK0A 2XLAA 2F17A 4FOQA 4PIXA 1GZWA 1ZZ9A 1VAKA 3KCCA 4AE2A 5JIAA
chains in the Genus database with same CATH topology
4CDUB 1LEMA 2OPKA 3TRSB 3MIDA 5C8CB 1LGNA 2H0VA 3RYKA 3LA2A 1AUYA 2RM22 3KD4A 2C9AA 2D6KA 5DZGA 4CP2A 4YGBA 1OQ1A 4Q2FA 2BW8A 4YW1A 4Y20A 1WMFA 4L99A 1PMIA 1QOOA 1NCRB 3ZN4A 5K9YA 4LBQD 2BBVA 4ISQA 4AEMA 2QDNA 1ULDA 3ZFFC 4YG0A 2FHRA 2DCYA 4HSJA 1LGBA 2HWB3 4B7EA 1LB2A 4LBNA 4EWDA 1CGPA 1MEC1 2JX9A 1DGRN 4UW5A 1NXD1 3E97A 2O0OA 4DNYA 2A70A 4JTOA 1A8MA 1AL22 1R1A3 4HN0A 2GDFA 1TMF1 2XJRA 4WVZA 4M00A 4DRVA 2W52A 1U0AA 4MXWB 3MIEA 4QPIC 2JECA 1BVVA 3ROUA 1Q8PA 2D5HA 3EXUA 1WCDJ 2ZBJA 3HN1A 3J9SA 3MIFA 1LKNA 3VBRA 3ZN6A 3D0SA 2A73B 3O12A 3ZXJA 4XBLA 1Z0HA 1Z7S1 2E51A 1WMDA 3OTFA 1KS5A 5EYXA 2NMNA 5DDJ3 3B3QE 2R0HA 5FOJB 1YCIA 2CGPA 4GB31 2VULA 3CEWA 5CVRA 1COV1 5JDBA 2WNUA 1UZYA 5K8SA 2WL1A 4Q4Y3 1SCRA 2Q1ZB 3GALA 4CDXB 3L2HA 3MFAA 1AR93 1HQNA 3KSCA 1QJY1 4IV3C 4BWOA 3IPVB 4FQZA 2WJSA 1MACA 4CP1A 2V73A 1SBEA 2LALA 2YROA 1ND2C 1W39A 4XFAA 2SBAA 1V6NA 5ACA1 4YVWC 2G4IA 1XNDA 2HWC3 4ONUA 5JWPA 3TN91 4WM7C 3ZXDA 3WD5A 4XJWA 2PHUA 4JCKA 4TLFA 1NLRA 4XFHA 5C8WA 4UBGA 1LGCA 4Q4V1 4MX3A 2EXKA 4Y1ZA 2GMMA 4YZ3A 2GN3A 5I93A 1TME3 1ZZ8A 1U5ZA 4HBNA 4HVRA 2OYZA 5KXDA 5C9AC 2EIGA 1XE7A 4K3UA 2R16A 4AVCA 5JR7B 4F7ZA 4NHLA 4XE9A 4JGZA 4IETA 5J36A 3AMNA 1R093 4BHPA 1VBE1 1A78A 1J1TA 2HJIA 3JZVA 2ZHNA 4QD2A 1PGSA 1ASJ1 4FTEA 1DGWX 1H2MA 2PLV2 2YZ4A 2WNVC 3MW4A 1O3SA 1DIWA 3H1YA 1QJU3 2DUPA 3WY6A 4AFCA 3RPQA 4B3NA 3MZHA 3FFZA 3VZOA 2Y0IA 2ES3A 2MPFA 1LU2A 4KH9A 5CFDB 2VNOA 4I2OA 1ASJ3 4XF3A 1GZCA 2GZWA 2CYFA 2WFF1 4ES9A 3IMNA 2ZZQA 4IV1A 4I0WB 4K6BA 4CTEA 2RS11 4CEWC 2I07B 2ZGLA 1QJX2 4Q4X1 3FHIB 4N53B 3ZPYA 4LE4A 2EXJA 4QMAA 2EALA 3ZSJA 3N7MA 5DUXA 2DU1A 3IPVA 3MFCA 3PJYA 3WR0A 5CIRA 4EWAA 4Q4X3 1FYUA 1URXA 3QH7A 5AVPA 4KG8A 1FOD2 2LUWA 3Q9OA 4Q0SA 5JPMB 1RUC1 5JIUA 2A75A 4P14A 2ZPXA 1N3QA 4YG3A 3RRDA 2WFF3 4AI3A 1OD5A 1M4WA 3FZ3A 2IXHA 3AXDA 5GZGA 1VP6A 2GU9A 3I4IA 1JUIA 2XH6A 2VECA 1AR83 1C8M2 1YWKA 1D4M2 1GZ9A 2F6BA 2R061 1ALYA 1N3PA 4PBOA 1PO13 3TWIA 5DUWA 3ZYPA 2A71A 4Q0UA 4FOVA 2D3RA 2VU9A 4YRDA 3OGGA 3AP4A 1X82A 4XYXA 1WUVA 4XBQA 3ECQA 2ATFA 1Y43B 2WA3A 3TNQA 4AQ2A 4JVAA 1GV9A 2WSVA 4Z8BA 3VLBB 2VOXA 1ZBA3 3L2YA 4TZDA 2C0ZA 2QJVA 1QGLA 2PAEA 3NVCA 2P3KA 4Y22B 5FFOC 3VKLA 3LA3A 1F9KA 3AZVA 1EAH3 2DVDA 5DG1A 4AFAA 1WW6A 5JOWA 1I1EA 4JV4A 3OYWA 1PGL1 1PVXA 4C1WA 3AP6A 5E16A 5FMOL 5AC91 3H7JA 1NCRA 3KT7A 3FLPA 5KXEA 1UU4A 1RHI2 1C3HA 2O1QA 4QQ2A 3NL1A 1BBT3 4P9XA 3WDVA 1AXKA 3N35A 4K21A 5CBLA 3I8TA 2JG8B 2PLV1 2H6CA 3N4MA 3T2TA 1APNA 3AZXA 2GNBA 4GULA 3M70A 5J96B 1HDKA 5D8AB 1KXGA 2ARXA 4PLOA 2WNUC 2R49A 3D4KA 2RMU3 1HLCA 3MEPA 3SISA 3DKWA 4ORFA 3BIWE 2VOWA 1J58A 4JGYC 5FLHA 3LCPA 1CAWA 1MVEA 4KL1A 1GBGA 3ES4A 3RYPA 2A6XA 1BVP1 1S55A 1XRUA 1B35A 3ZMNA 4QQOA 3M4FA 1GLHA 2WS91 4FO9A 1UL9A 1W0PA 1UPSA 3DF0A 1IZ3A 1U5YA 1S0CA 1TQ5A 3IM0A 3SH4A 2DYCA 2IXKA 2WNUB 3AP5A 1FOD3 2XGXA 4YW5A 3WW2A 1UN1A 5CNAA 3OGJA 1ZZCA 2TBVA 4IEXA 4KNCA 4TSVA 3R4UA 4NO4A 3CNAA 3HQXA 1MVQA 3MIHA 2DVBA 5L19A 1X7NA 3LOBA 4JGYB 4YW3A 4CEYA 1MQTA 2R1BA 2D6LX 4JGZC 3B9IA 3ZFEA 3E5QA 5BNPC 2FBEA 3WP4A 4WVWA 3HAGA 3ZYGA 1PO12 2VQAA 2VG9A 4EN7B 1IHMA 4GXLA 1KDMA 4OUMA 3WZ1A 2O8OA 1ZRCA 1W6OB 4AVBA 3JQXA 4KWJA 4LE3A 1MS1A 5LK5A 1W0OA 1HX6A 1DFQA 1BKZA 1LHOA 1R083 4AI8A 5ABJA 3C2UA 4RS5B 1ND3B 1SMVA 1DZRA 3V65A 2HEVF 3AKQA 4PDWB 3KMHA 2X29A 4K1ZA 4Q4W2 3WG4A 4WM7B 4P9JA 3KZ4C 1SFYA 1G9BA 4H55A 3ZXLA 4YM2A 1YRZA 3AX4A 4JDOA 4N43C 4YW4A 1RMU2 4GH4C 4RS5A 3ZXKA 5A33A 5IUQA 5I91A 3CJIB 5T55A 1H8VA 2XWBB 1RUH2 1Q8QA 1QH6A 1BEV2 2YUEA 1PM7A 4HSLA 2AH2A 2VVEA 1CONA 3GBFA 2QUOA 2XBO1 1AZDA 5A33B 1H2LA 1YIFA 2R062 3RZZA 4DRRA 4QX5A 3A4UA 1KS4A 5BNOC 1UU5A 3H50A 2QZ3A 1HKDA 1JYCA 4E9KA 4E2GA 2ZGPA 1D4M3 4YG6A 2IXJA 3BB6A 1KITA 4P9WA 2RS52 1IS6A 1QXRA 4DINB 2I45A 2Y38A 4EWEA 5JVVA 4XEZA 1VBA3 4GH4B 4N43B 4Q1RA 3URFA 1G9AA 3LSDA 2EAAA 1NOVA 1LR5A 1NY72 3RMYA 4WBBA 1SBFA 1BBT1 4JAAA 2QNKA 4CZSA 2BPA2 4BIOA 4N7UA 1XYNA 1FNYA 2RM21 4BZ4A 2D97A 3MDPA 4XETA 2WT2A 4KG0A 4G3YC 1FATA 1ULGA 1X33A 1Y7BA 1YFWA 4UBHA 4DOUA 1ZBA1 1TMF3 4AQSA 4A3XA 4OVEA 1N1YA 3AJZA 1O5UA 2R041 3BU7A 4AVVA 3LAGA 3USUA 5IK4A 4AGVA 3WHUA 2HWB1 1Q43A 2ZX0A 4MV2A 3JUUA 2QQPA 3VBSB 3IDCB 1XE8A 2D44A 4N53A 1HRI3 4WVMB 1B35B 1KFXL 1JTZX 2HKXA 1UU6A 3VHNA 4E2SA 2CWSA 1UF2C 3R6SA 1ZZ7A 2YGLA 3ZYIB 3SCGA 5J37A 5CFDA 4D7TA 1Q3EA 3POSA 1AR63 1BYHA 2VQ0A 3VBFC 1WD3A 1Z78A 4CDWA 2D7FA 4XHXA 3AYAA 2GAUA 3H1MA 4YVSA 3FBYA 3V0BA 1B09A 2ZTNA 1WA4A 1SLCA 4BCUA 4QGNA 4XDQA 2AR6A 3MF6A 4ZU5A 3WW1A 2XHKA 3ZDSA 5BNPA 1LRHA 1BJQA 5FTTC 2PN5A 3VBHB 3GBGA 1V6KA 4XXAA 2BFUS 4R9AA 1VIWB 1C28A 2GMEA 1MEC2 1QH7A 4ISRA 3V0BB 2JG9B 4OI4A 3TAYA 5KXBA 1UMZA 5SV8A 3K51A 1N1TA 2NLRA 2VW0A 4RQPC 4XFIA 5ABJC 1X8EA 3QD6A 1ZBE1 4YZ4A 3I59B 1IS4A 3QLQA 3BCWA 2B39A 2BVVA 2IFRA 3V56A 1HRV2 4XZPA 5A3LA 1H9PA 3KLSA 1PVC2 2YDEA 3R4SA 1FMD3 4YM1A 3VDDA 3ZFEC 3N3HA 5IK5A 2FZ2A 1UIJA 2ZABA 4P9LA 1AR81 4FXKB 3BTAA 2XVGA 4DMIA 3OD4A 2AUYA 2H6BA 3ST7A 1LU1A 2LM3A 2RM23 4KU8A 4MYEA 2XBO3 4Q0PA 3ZO0B 1VALA 4BMBA 2XWJB 4E4DX 5GJ6A 3H1WA 4CDXA 1WW5A 4YZ5A 3ZIWA 4B29A 1RUH1 2CAUA 1RUD1 2JKBA 4W65A 1H8TB 4NHKA 4HKWA 3MGUA 5A32B 4QPYA 5FLIA 3HMYA 1AL0G 2UY9A 4E4ZA 1EV12 1W6NA 1YHFA 1YXWA 4GWMA 1ZX5A 4Q0VA 1A6CA 3EQEA 2DFBA 1RUNA 2HWC2 1VB4A 3WINE 2A6YA 5DDJ1 1ZRRA 3B94A 1N3OA 3QBQA 1ZRFA 5KBFA 3HD8B 3IT8A 4FPKA 3UJQA 3MIBA 1O4YA 2YHJA 2Z79A 4FQ4A 1COV3 3LZZA 2X5IA 2R0FA 4JRLA 5IK7A 5D1IA 2D6PA 2WQZC 2ZX2A 1LJ7A 1QMJA 2E7QA 1OMIA 2JG8C 2IZWA 3HT1A 4MUVA 5CA6A 4R9DA 1FOD1 4FPYA 1FXZA 4Q26A 1AX1A 1Q5OA 3ZFFA 3D5OA 3M8LA 5JZGC 2ZMKA 2DVGA 4EV0A 3WDWA 1R092 1S0IA 2OW4A 1JXNA 1REDA 4XQDA 4QQPA 4EN0A 1W6QA 4DB5A 3AP7A 1J3PA 2ZKLA 3AFKA 1MS3A 4KQ7A 4S2HA 2VGDA 4YLZA 2HWB2 4GWNA 1LODA 3HIFA 4WVMA 4HETA 3S30A 5BNQA 1SLBA 4OHXA 1QNWA 2I74A 3WCRA 2JG9A 1ND3A 2GNMA 3PMEA 2RS53 5DXDA 1AL23 2E7AA 5DUVA 5KXCA 2RMU1 1DBNA 5DUUA 4XFGA 3DGTA 1UW8A 1MR5A 3VBFA 5KC5A 3RS6A 4YSFA 1QKQA 1IPJA 4E4SA 5FRAA 1LHWA 5HBAA 3WW4A 4HKOA 5I0RA 1YIPA 4MGIE 1QJX3 4FPEA 4XJUA 2WLPA 3QCWA 1JW6A 2AYHA 5AC92 3CU7A 4ATEA 1QNYA 1NE6A 3AFGA 2ZGOA 2PYTA 5FOBB 3NV3A 1D2QA 1AR72 3THTA 1MS4A 5CFDC 3AYEA 4G4FA 3OBRA 1KJRA 2Q8OA 2WQ4A 1VLNA 5FREA 1J1LA 1F2NA 4S2DA 4AVSA 4COZA 4PLNA 1EV11 2Z69A 5AFBA 1RGSA 5HI0A 1G9FA 2ZX1A 5F9TA 4LA3A 1DLLA 3MW3A 4X8PA 1XQNA 4I0BA 1OPOA 4D69A 3E6DA 3WDUA 1HRV3 2R073 3WV6A 5JOZA 2YY1A 4FPJA 1LECA 4CDUC 1V6JA 3G6JB 2GC3A 2ZAHA 1OLRA 4AK3A 2DU0A 3IDBB 1VBC1 2ZMLA 4I02A 3ZFGC 3LSEA 1CPMA 5I8YA 4YZ1A 1RVF2 3WG1A 1DQ4A 3UKNA 2G9GA 4E2QA 3UL2A 2ZGQA 4CDUA 1FMD2 4LULA 3WQ7A 3O0WA 5K0UA 4AVTA 1EAH1 3D8CA 3M1HA 1OHFA 1Y3TA 1BMV2 2VMIA 4XJ8A 4I01A 2UYAA 4OI1A 1QOSA 1QQP1 3MF9A 3VDDC 4PIYA 3JBG1 4N90A 3LKJA 1XNBA 2PHDA 3WUCA 5ACA2 3WXPA 4LA2A 1G8WA 2WNVB 5SV5A 5A3MA 2BEOA 4AYUA 4AW7A 4CDQA 1PO23 5GLWA 5T5LA 2R1DA 2MEV1 5FPZA 1VBD3 4OHWA 1S0GA 2K2SA 5J48A 5I8SA 1XU2A 4L92A 3NAPA 2XKOA 1YYNA 1N1VA 4CEYB 2A6WA 2RMU2 1KD7A 1RUJ3 2ZCWA 4QM8A 2XJVA 1AYM2 2XKPA 4LTAA 3SXWA 3ZXAC 3ZXFA 1PVC3 4YFZA 1OA4A 1V6MA 3VZJA 3WP6A 3PNAA 1F5JA 1GSLA 3KM5A 2WS92 4XTPA 3N7KA 4KGGA 1K5MB 1RTVA 5J3UA 1BEV1 3E5XA 4JDNA 3IKWA 3ZXEA 3BALA 4PDWA 4GA9A 3ZN5A 1ZZ6A 1VBB2 2ILMA 4D94A 4YGDA 2X5IC 2ZS6B 2RJLA 1ENSA 4LUKA 5D8AC 1AR73 3VL8A 2RR13 1RMU3 4EN8B 1M06G 1VR3A 4M3CB 3ILNA 5GZCA 4FPOB 4XJAA 3OY8B 4Y1XA 2X53S 3MLKA 1QF3A 4FPLA 4QPIA 4NPRA 1FPN3 4KWKA 5KWRA 1Q8OA 4BM8A 4KBBA 1WMEA 3VBRC 4LT5A 2BNOA 1LHVA 1SLAA 1W6QB 2RR11 2VMHA 4ITCA 4O9EA 2NQYA 4M01A 1ND2B 4AQ6A 4OLLA 1JBCA 3IDEA 1W6PB 1OQDA 1PZ9A 1CJDA 1NCQC 2DFCA 4RA0A 1NCRC 2DUOA 4UW6A 1AR91 4HMZA 3PMSA 1H9WA 1VAKA 3ZFFB 1EAH2 2ZX3A 2HYKA 3NAPB 4B4QA 3PVEA 5IT6A 5LK7B 2ZGRA 1EP0A 3NJZA 1J59A 4XF4A 1WW4A 1SEFA 1CAVA 3H0OA 4HVOA 1ONAA 3B69A 4X6QB 2ZA9A 1YJKA 2CWMA 3J8F2 3G7DA 2FQPA 5J98B 4CDWC 4M3CF 3TNPB 5L73A 3NV2A 1H2NA 4GALA 4AGGA 2XL7A 2TNFA 1PNGA 5GLZA 5H9QA 2Z5WA 5J09A 4WM8C 2WC2A 4FOYA 4IEVA 3OD0A 2HWD2 1ULEA 3U0ZA 2IXIA 3AXEA 2VUAA 3L9JT 4FOWA 3MYXA 4EN6B 1PGL2 1TE1B 3MPBA 1RUC2 4XFFA 2UURA 3KCXA 1WBFA 3DPRC 1NG0A 4C0HA 5L7OA 1HXS3 1SLIA 4Q0QA 4WM8A 4QU2A 1UKGA 1VAMA 2DUQA 3EO6A 1F8VA 5E1RA 3VBUC 4COWA 4PLMA 2P3IA 4YM3A 2UWBA 2Q1MA 1QQP2 3RI8A 1HXS1 1TME2 3AJYA 5BPXA 2BFUL 2NMOA 3EHKA 1JHNA 2ZGUA 5JI7A 4FT8A 3VBUA 1DGWA 2KA3A 5K0UC 1RUI1 3M7AA 3RMXA 3VGIA 2Q30A 5C4WB 2MEV2 1J3QA 1LHUA 3KT4A 4FBFA 3TB0A 4CDXC 3ZN6B 1QY4A 2B42B 3E6BA 4AF9A 2JD4A 3LGRA 3O14A 1AYM1 1N47A 5GLTA 2XLFA 2XL9A 4A2UA 5JZGB 2DURA 4YFWA 4Y1UA 1H8TA 4WZFA 2VMGA 4IEWA 4OFGA 2UWAA 1KFUL 4INDA 1V6OA 3BODA 4MVTA 3IWZA 2A5ZA 5DZEA 2R043 4RL7A 1SDWA 2RHPA 4Q4W3 4LO8A 2XPJA 5CU1A 1I6XA 2WT0A 3LWCA 4Z82A 3ZYJB 1DYKA 2ZACA 3ZXGA 5JSRA 4RR3C 2XJQA 4M0NA 1LULA 2HWF3 2A3XA 2CNAA 3VBSC 1N1SA 1GR3A 1PO11 4RHV1 4QT6A 1LESA 1HW5A 3I54A 4HN1A 5LEKA 1AVBA 2DF7A 2NM1A 3OJBA 4N9HA 1NQJA 1PO22 4ASLA 3HR9A 1RUE3 5BYNA 5KHKA 5FDBA 2ZHMA 1XU1A 1REEA 2ZHLA 3VBSA 2UU8A 2YMZA 2VH9A 4HK8A 4R9CA 4ATFA 2DCJA 3NWKA 4FP3A 2PHTA 5EXOA 1CD3G 4IEPA 1DQ0A 4LBMA 2WZPP 1I3HA 4RR3B 1AHSA 1RMU1 4LBOA 3JCIA 1QU0A 4S2GA 3B01A 1AX0A 1Q8SA 2GSYA 4PBPA 4L97A 1LOAA 1FNZA 5KHIA 1L3JA 2CY6A 1GKBA 4IV3B 3BPZA 4QPIB 2ZKNA 4CDWB 4EROA 2NN8A 2BTVC 1Q56A 1D2SA 4IEUA 5KHHA 1YFUA 2A3WA 4FAGA 3LA7A 1WLCA 1AL21 1EPWA 1LOFC 1W6PA 4U36A 3RI9A 1ND2A 3KB5A 3NKTA 4OULA 3V64A 4YARA 4QGLA 5F1RA 1H4GA 1O5LA 3MPPG 1RUG2 3SHRA 4A7YA 2DTYA 3H9AA 1OOPC 3SITA 4M0HA 4NR1A 4Q1PA 3CLPA 4QHBA 4WVVA 1CAXA 4PF5A 3APBA 3M3QA 1JOJA 4XW3A 2DTWA 3WDTA 3SNMA 3JD73 2ZZJA 3B7MA 1ULCA 3ZX7A 4Y4YA 4HZFA 4OUSA 4LUMA 5C33A 4LBLA 4A7ZA 1AYN3 1LEDA 2D3PA 1H30A 4QPGB 2D93A 5JOYA 4KWLA 5L7OB 5CG9A 1R1A1 3VDDB 2AENA 2VPVA 4Y20B 1AJKA 5FPXA 1FV2A 1ZYBA 3U11A 5CFCC 1V9U3 1G9DA 2WLQA 3PVBB 4AEKA 2PHXA 4L9BA 3VBOB 3VBRB 1WLWA 3BOPA 2NZ9A 1R091 2VY0A 2FMYA 4PJYA 3NV1A 1A8DA 1DZQA 1AYN1 4RSUA 1K5MA 5BNNB 3SLIA 5T54A 4AFDA 4CEYC 3WNXA 1RUOA 3TN92 1RUF3 1PNFA 3GYDA 1IS5A 4RHV2 3KCYA 1B35C 1PK6B 1SBDA 2A6ZA 4Q8LA 2OA2A 2D40A 2YXSA 1JYIA 2B45X 2DCTA 2I2SA 1H1IA 4FXGB 1ZZBA 4N9IA 1H8TC 3R4DB 4P5HA 1V6LA 3P3PA 4Q8KA 1IPKA 4XJZA 5K0UB 2WFPA 4JTNA 1RUD3 2YGMA 5HXVA 5GLUA 1AXYA 2ZAAA 1FPN1 1MQTB 1X