3HT1A

1.2a structure of the polyketide cyclase remf from streptomyces resistomycificus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
142
Chain Sequence
MMKRVHRTDVKAEIVREPGAKETTHRKLIDTPDGADRFVLTEFEVSPNGSTPPHFHEWEHEIYVLEGSMGLVLPDQGRTEEVGPGEAIFIPRGEPHGFVTGPGQTCRFLVVAPCERPPVRNVFLSEDPYEYTQMPEYTSLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RemF protein
publication title The polyketide cyclase RemF from Streptomyces resistomycificus contains an unusual octahedral zinc binding site
pubmed doi rcsb
source organism Streptomyces resistomycificus
molecule tags Lyase
total genus 32
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ht1A00
1YFXA 2UY8A 3IBMA 4XFCA 5BY5A 2XHKA 4IEQA 5J48A 4IETA 3GBFA 4F8AA 5D1IA 3HIFA 5FQ0B 4AVCA 1Q5OA 3LOIA 5I91A 3O14A 2D93A 2PAMA 3KGZA 1QY4A 3WW3A 3R6SA 3SCHA 2QCSB 3H9AA 2VQAA 5KHGA 1Y3TA 2D5HA 3U11A 3RPQA 1ZRCA 2HKXA 1J3RA 3OGJA 4LA2A 3RDIA 3M70A 1CX4A 2QDRA 1SEFA 3CJXA 2FQPA 1CAXB 3NW4A 4I09A 4IEUA 1RUNA 1ZNPA 3CL1A 4Z82A 3FFQA 2K9ZA 3H3UA 2PAKA 3LA3A 5FQ0A 5I0UA 1UW8A 4O9EA 3BB6A 2CAVA 3GYDA 1X7NA 4FT8A 1O3SA 4J1XA 3H7YA 4FBFA 4MX3A 4HSJA 3E6BA 4XF0A 2D40A 2VECA 5FLHA 4XFIA 4XF3A 1YWKA 2B8MA 1V70A 4TLFA 1O3QA 1CAXA 4HVQA 2IC1A 1H1MA 2CV6A 1WGPA 4KL1A 4LUKA 4ZU5A 4EWEA 3KGLA 3PNAA 1J1LA 2ATFA 2MNGA 3B02A 5FPZA 5KHKA 2PAEA 3LA7A 4PIZA 2MHFA 1YFYA 4HBNA 2QJVA 5FCCA 3MDPA 4JTOA 2FMYA 5J7MA 2I45A 2PYTA 4IEYA 2IXKA 4IERA 2Q30A 3ROUA 3DL3A 1I5ZA 3S7IA 4MH0E 3QACA 4HLTA 3EQEA 1WLTA 3E5UA 4HMZA 3H1WA 4KU7A 5FLIA 4QMAA 5I93A 1ZVFA 1EPZA 4XETA 1QXJA 3UKNA 2Z69A 1G6NA 4ZU7A 5JSRA 3OTFA 1PM7A 1CAVB 1QWRA 4WZCA 4GULA 5JCTA 4LULA 3DV8A 3CLPA 4IEPA 3CF6E 3RYRA 1ZRRA 3ELNA 3BPZA 4MUVA 1EP0A 1LKNA 3HT1A 2IXIA 3H1YA 3HT2A 1O3TA 1NE4A 4YARA 1ZZ7A 2UY9A 4N9IA 4YRDA 4WVZA 3ZDSA 5EZWA 3SHRA 1JUHA 4AQ2A 2B5HA 4JTNA 1UCXA 5C8WA 1EY2A 1LR5A 2VPVA 3DN7A 4IEOA 1CAVA 2BEOA 3HQXA 2IXCA 3EHKA 2BYVE 3LZZA 5KBFA 4HZFA 2PHDA 2OYZA 4ZU4A 4QM8A 5BUVA 4MGIE 2H6CA 1I6XA 3E6DA 2UYBA 2WC2A 4R8HA 2OZJA 3FX3A 5KHIA 4EROA 4EWAA 2EAAA 2IXHA 4F7ZA 2QNKA 5JSOA 1SFNA 1J59A 1GQHA 4AVBA 5HI0A 5LRRA 4BHPA 2UYAA 4MGYE 2PA7A 5KHJA 2GC1A 3SCFA 1Q3EA 1L3JA 4LEJA 4XFBA 2ZCWA 1RGSA 5FLJA 3H7JA 3IWZA 4QX5A 4XFHA 5CU1A 3FHIB 2XL9A 3NVCA 5E16A 4MGZE 3QOPA 1ZREA 2PTMA 1QXRA 4LTAA 3WW4A 2BGCA 5FDBA 3CEWA 4MV2A 2XGXA 3L2HA 4BIFA 3ACLA 3EBRA 1ZZCA 1TQ5A 4A2UA 1J3PA 4XFGA 4RD7A 3H3ZA 2PQQA 2ET7A 2GU9A 4EWDA 1UD1A 5J3UA 4BYYA 4AXOA 2OPKA 4Z07A 2BNNA 1NZCA 3LA2A 4LLOA 3SXWA 3KSCA 3EJKA 3G7DA 1ZZ8A 2Z2SB 2K0GA 1FXZA 5I8YA 3ES4A 3IIAA 3FE5A 1YLLA 4I0BA 2GC0A 1VR3A 3VHRA 3FWEA 4HVRA 4B29A 2GH2A 4MGKE 5F1RA 5JAXA 2WFPA 1CAUB 3H8UA 3H50A 1EYBA 2BNMA 2OA2A 4I3PA 4UXAA 5I0RA 4PIXA 2XLGA 4H7LA 4Q0SA 4K8FA 3KMHA 3D0SA 3OD0A 1DGWA 4Q0QA 3M3IA 1SQ4A 4XF9A 4Q0UA 4QGMA 1ZX5A 1RUOA 1FI2A 1YUDA 2P17A 4QGNA 3PVBB 1ZZ6A 1NXMA 4CYDA 4HN0A 1CAWB 4OFGA 4YYOA 3ETQA 4N9HA 3WW2A 4I02A 1O4TA 3LAGA 1CAUA 1O5LA 2CGPA 2KXLA 1YHFA 3MZHA 2ET1A 3RYPA 5CVRA 5I0SA 1LRHA 4XEZA 3BU7A 1X82A 1HW5A 4KWLA 3ES1A 5I8SA 1UIKA 3OCPA 1VP6A 1ZZBA 5JSPA 1YFUA 1GQGA 3FJSA 4IEWA 4X6RB 4D7SA 4YNIA 4IEVA 3ST7A 3SCGA 1CAWA 2QVSB 4ONUA 5BV6A 5BPXA 2Y0OA 5FPXA 2D5FA 2C0ZA 2GAUA 1VJ2A 1OD5A 2GC2A 5JR7B 4L2NA 5E1RA 5EFUA 2DCTA 1OMIA 3SMHA 1DZTA 5I0TA 3MYXA 3E5QA 3C3VA 3E5XA 5K8SA 3IDBB 3TNQA 2H0VA 4E2QA 2Q0AA 2XKOA 2XLFA 1PMIA 4O9GA 2EA7A 3PLQA 3KCCA 1ZZ9A 1XE7A 1H1IA 4EV0A 3BCWA 3D0JA 4L11A 1J3QA 1Q43A 2O1QA 4FAGA 3N4MA 2IXLA 4E2SA 2GZWA 3H1MA 1O5UA 2B9UA 1YFWA 2XL7A 5T3NA 3U10A 4E2GA 2Q4SA 3RNSA 1X8MA 4D7TA 4R52A 4AQ6A 2XKPA 3TNPB 4QGLA 3S0MA 2XLAA 2BNOA 3DKWA 3I7DA 4HN1A 1O7FA 2H6BA 3NL1A 4PIYA 4I0AA 1XRUA 3USSA 1XE8A 3I54A 3FZ3A 1Y9QA 4OLLA 4WBBA 1CGPA 4Q0VA 4XFFA 1ZRFA 4PJYA 2F4PA 2ETEA 2EVXA 4DINB 3RYKA 5I8TA 3S7EA 1DGRA 2ZKLA 5C6CA 4NVPA 1IPJA 1OI6A 2V09A 2O8QA 4IESA 4QXKA 1UPIA 3NSTA 4JV4A 3I59B 4KWJA 3OF1A 1NYWA 1DZRA 5CADA 1IPKA 1NE6A 3E97A 4HVOA 4ORFA 2PFWA 3WW1A 2E9QA 1UIJA 1WA4A 1J58A 2N7GA 1ZRDA 4FAHA 5AVPA 3MPBA 4P9GA 1U12A 4KWKA 1LB2A 5BXXA 3IDCB 2CAUA 3LWCA 5LRSA 1OFNA 3CO2A 3BALA 1O3RA 1RC6A 3D82A 3NKTA 4IEZA 2GC3A 2PHLA 3I59A 1FT9A 2MPFA 3JZVA 4JVAA 4YSFA 4IEXA 4Q0PA 4UBHA 3E6CC 4KU8A 4MZUA 5LEJA 5KHHA 3UKVA 4AVAA 4XFAA 2IXJA 4BH9A 4UBGA 3EO6A 4HSLA 4J1WA 3UKTA 1X8EA 1RTVA 2Q1ZB 4XF4A 4XF1A 3U0ZA 4I2OA 4QM9A 4I01A 4Q29A 4X6QB 4META 2OZ6A 1RL3A 3NJZA 4LA3A 5LEKA 3RZZA 4LUMA 2HJIA
chains in the Genus database with same CATH superfamily
3N9MA 2PXJA 1URXA 2UY8A 1RUE2 4UF0A 5BNNB 3BTYA 2PN5A 2HWB3 4NO4A 3WCRA 3C2UA 4IETA 3GBFA 4M3CE 1PO13 5FQ0B 5JLVA 2IZWA 2G4IA 1LOBA 1BBT1 2LTNA 3O14A 3RG0A 1ZM1A 1QJY2 1V6KA 2HEWF 4BMEA 4YFWA 2DFBA 4GMP3 1AR82 3AP5A 2VQAA 4BQ4A 3DPRA 1QQP1 4Y20A 3WDUA 5AC91 1NZIA 1JH5A 3AK0A 4QU1A 1AYN3 1UOFA 4EN8B 2R071 4LA2A 2IUWA 2K2SA 1QJX2 5FOJB 2Y38A 2VMCA 3P1IA 1GP6A 2WRAA 3CZUA 4DO0A 3JBG2 1IKPA 3POFA 4I09A 3VDDB 2A6WA 1RUNA 4TWTA 2D6NA 1TE1B 4Z82A 2CL2A 4GQ7A 1NQJA 1RIRA 2K9ZA 2YV8A 2PAKA 3GCXA 1NY72 4OQ8A 5FOBB 1G8WA 3CZJA 3PMSA 1VBC3 1WW5A 5CFDB 3BB6A 2CAVA 3GYDA 4Z2AA 4LBNA 4HT1T 1UMHA 2RVAA 3CDZB 3H7YA 3HOBA 1PZ7A 3C7EA 3POBA 1KD7A 4LNVA 4HSJA 5F3GA 1OUSA 5FLHA 4XF3A 2WZ8A 1NCQA 3UGGA 5A3WA 3FHAA 1TMF2 1V70A 4JKMA 1PMHX 3T2QA 4CUBA 3TN91 4MGTA 4MHUA 5FMCA 2VTXA 2WFF3 3VBHA 4C90A 1NCRC 4EYUA 5C9AA 5GALA 2A6VA 1U0AA 1D4M3 1HXS2 2Z5WA 1YQCA 4RQPA 5FXVA 4OMDA 3WP3A 1YQ5A 2F4LA 4FQZA 3LF7A 1LU2A 5E6HA 4BWOA 5FZOA 1UY4A 2GMPA 2X29A 2YMZA 3PNAA 2R32A 4YVSB 2ZACA 1X9TA 3MEPA 4PT6A 4M3CB 2P2KA 4BE3A 1I1EA 3PVEA 2PHTA 4NHXA 1Y4WA 2XJPA 2MHFA 4MXVA 1SDWA 3U1XA 3MDPA 3I3MA 4JTOA 3MIGA 3D6EA 1PMJX 3AYEA 1W9YA 2FMYA 2A73B 4RHV1 2PYTA 4NAOA 4IERA 3KCXA 2W46A 1GQPA 2G9FA 3AL6A 3RZGA 1UKRA 2AYHA 5CISA 1N47A 3X29B 4MH0E 1DQ6A 1KJRA 4Q4Y1 4EN0A 5L73A 1POV1 5JXIA 1LEDA 3AZVA 1YC61 5G05L 3KCYA 1AYM3 1SG3A 2VUAA 2OS2A 2Y6GA 1ZVFA 2VUJA 5FMOS 3H8OA 1GU3A 3IMNA 2DU1A 4TZDA 3OTFA 4Q8LA 1PM7A 1Y9GA 3OG2A 1SBEA 4QPIC 2JKXA 2GSYA 4YG6A 4WZCA 4LULA 4JKLA 1VRBA 3DV8A 3WDYA 5DAQA 1JMUB 1Z7S1 2AREA 4K1YA 3DGTA 3RYRA 5IAXA 1PVXA 1OA4A 4N7IA 2NMNA 4LIVA 2YXSA 4S2GA 1IPSA 1CPMA 1RINA 5A6YA 5BNPA 3MBWA 1AZDA 2D6KA 2OXBA 3HQUA 4FFHA 4LKFA 4FQ4A 4NHKA 4RFRB 4XAAA 3AMQA 4W6XA 1H2NA 4YARA 2P3KA 3K75B 4QHOA 2JDUA 1ZZ7A 2UY9A 4N9IA 4YRDA 1WW6A 2BBVA 3SC7X 4WVZA 1KDMA 3I3DA 2VZOA 3H42B 3C7HA 2VTFA 3BN6A 3DN7A 5FZ6A 4HK8A 5LASA 3ZR6A 2D98A 4CPBA 4TLGA 4Q8KA 2BPA2 3RQ0A 2ARAA 2BYVE 2O14A 3P3NA 5KBFA 4E8CA 3BTZA 1U5IA 2OYZA 2W39A 1W3XA 4H14A 1ENSA 3J26N 4NJ4A 1F31A 1LCLA 1R1ZA 5FZHA 1WBFA 4PLNA 2WNOA 3B69A 3NNJA 3AYCA 1OPMA 4E4SA 2VBBA 1XBFA 3FX3A 3NWKA 5KHIA 1AX1A 2IXHA 1SLCA 3WSOA 1QGLA 3BI3A 1PK6A 2RR13 3I2GA 4XDQA 2ADDA 2TEPA 4R4XA 5DUXA 2FZ1A 1SFNA 3OGSA 3VDCA 1ULFA 1ULOA 3GZAA 3SISA 1YXWA 3ME2A 3MICA 1WLCA 4QXBA 1DQ4A 1H4HA 3ETPA 4HPKA 4K20A 3URFA 3VBOB 5CA6A 4MGYE 4UFIA 3OSDA 1DZQA 4XW3A 3WZ1A 4XJZA 5AVAA 2FDGA 1S0DA 3WY6A 4N90A 2NP0A 5KC5A 1VBA3 1RGSA 2ID4A 3MI8A 3BU0A 4XZPA 2WS92 2A7AA 5CAZA 3H7JA 1AR63 1GR3A 4L92A 5C8CA 5FO9B 1XSRA 3DPRC 2JE8A 5JOZA 2LS6A 3I2IA 2ZMLA 4XFHA 2DTWA 2VG9A 3MW4A 4LT5A 4PLOA 1AR72 3WF1A 3ZYPA 5CU1A 2JG9C 3QOPA 4A42A 4URTA 1ZREA 4LHLA 4CEYB 1IG0A 3GJBA 3J7HA 2JECA 2BGCA 3B00A 2FD8A 3R4UA 1B09A 4JQTA 2D44A 4YFZA 3J8F1 1H6YA 3GCWA 3A22A 4QPGB 3JD71 1WCQA 2TNFA 5LATA 2GU9A 4EWDA 1UD1A 1K5JA 4LBJA 4QAWA 5J3UA 1R093 2WAAA 2DCZA 1ODNA 5EP9A 3T2TA 3QBQA 1JN2P 2CHHA 4Z07A 4AGGA 3UJQA 1PGW2 1FNZA 1H0BA 1NCQC 2XJQA 3LKJA 3OD4A 4FPFA 1BEV2 3SNMA 2WO2A 1ZZ8A 4B1LA 1ENXA 1WMDA 3T2PA 3VBHC 1E5HA 3BVCA 3HBZA 5FIXA 3POIA 4YW5A 1RUH3 3VLBB 2GH2A 1ZA7A 2R6QA 5IK5A 2WFPA 1ZYBA 1MPXA 5H9QA 2VXRA 4ASLA 3O1MA 3OBRA 5T5JA 2OA2A 1FX5A 4Z2WA 3JQXA 1HV0A 2YHJA 2XLGA 4H7LA 1IQAA 4LE3A 4QKFA 4NROA 4GWJA 3ZFEA 1ND3B 2AEZA 3WDWA 3KMHA 2DCJA 3K4DA 4ITCA 1YIPA 3UL2A 4KGQA 2NQYA 3UNPA 3K3OA 2DUQA 1VBB2 4Q0UA 1C5HA 2CTVA 2D97A 4HKWA 4XUTA 1SPPB 4FOQA 1JZ4A 5ERLA 3AKSA 3F2ZA 1D0HA 3ENRA 3GXUA 1HJGA 4K7JA 5C5UA 5IVEA 1NXMA 5EQUA 4XBQA 3ZR5A 1PGL2 4ET7A 2JG8B 1EV12 2WNVC 4CYDA 4N7UA 4YYOA 4KQ7A 3IZOA 4M0NA 3NAPB 4QHZA 3WW2A 3DUIA 4IE6A 3ZFGB 3LAGA 1CAUA 3O7OA 4WVMA 3WX5A 2Z42A 4B7KA 4BQ2A 1G9DA 4CDUA 2CGPA 1YHFA 1F5JA 2Z79A 5A6ZA 1W3VA 2ET1A 2KD7A 3RYPA 3MZHA 3I49A 2QZ2A 3WNLA 5FZ4A 1DBNA 2D6MA 2OQ6A 1HN1A 2CGOA 1W6OA 3ES1A 2I07B 1ND2B 1QXPA 2ZAHA 1OQ1A 1VP6A 3OCPA 4XYXA 5T52A 4HKLA 5CKNA 4CU6A 2RS12 5JSPA 2W08A 3IPVA 2VGDA 3SH3A 1LHOA 3JB4C 3OJBA 1RUE1 4LOSA 3EYPA 5GLWA 4V2VA 5JR2A 3U75A 5A7WA 5JXGA 2DFCA 1PNFA 2R0FA 3H3LA 4YNIA 1RUG2 5BNPC 4IEVA 3KF5A 4A7YA 2ES3A 1TEIA 4LBQB 1JYTA 3KVBA 1QJY1 2JDAA 4ONUA 3UYJA 2IVJA 2JEMA 4CXXA 5A3NA 3O1PA 5EV7A 5ABJA 3AVRA 5BNQA 2ZGMA 5E8AA 5FYZA 1AR81 5JMOA 3GNEA 1VJ2A 3VBUC 4ES9A 1XU1A 4NE9A 5JR7B 2W1UA 4LE4A 3FFZA 4QB2A 1ZBA2 4MHRA 4YW2A 1H9WA 5EPAA 1DU3D 4GKYA 1QJX1 1TZOA 1OMIA 2YPJA 4PBPA 4B1MA 4LBLA 3ACIA 3NKGA 3SMHA 4NHLA 2VAUA 1DZTA 3HQRA 3WDVA 1CIYA 3PU3A 3TEWA 3E5QA 3C3VA 3WVJA 2DDUA 4WV8A 3HPNA 2VMFA 4KI5M 4CDQA 1COV1 3WHTA 1NY71 1VLNA 4E2QA 2D3PA 4YM1A 3RI9A 1DGLA 2ARXA 4N43A 4BDVB 1OC1A 2Y6LA 4BU2A 4K9SA 4B3NA 1PMIA 1AJKA 2WSUA 3ZN6B 4LKDA 4O9GA 3LOBA 1LOFC 3AYAA 3PUSA 1PZ8A 1JU4A 2ZMNA 3B9CA 1BBT2 2QUOA 4C8DA 4L11A 3ZYRA 4DIQA 3ACFA 1UQXA 2A70A 4OMCA 4XXAA 3NNMA 4FP2A 1W99A 2R041 4BK4A 4IV1A 2X53S 4RR3A 5JOXA 1SFYA 3VZNA 5KXCA 3O1TA 1RHI2 2B9UA 4AEKA 1JYIA 5T3NA 4E2GA 5A6XA 2B9VA 2Q4SA 3AL5A 4Y5Z0 3ZSEA 1TNFA 1LGBA 3W5NA 2Y60A 5FZLA 4GKXA 3ACHA 3TNPB 4PCRA 2F6BA 2ZGRA 4BQ3A 2A6XA 1OQEA 4YVWA 3S0MA 2XLAA 4ES8A 4FTBA 1SLLA 5T50A 5K0UA 4XHBA 2BGPA 1I5PA 2JDZA 5CZKA 1MS5A 1O7FA 2DV9A 3AJYA 1IS3A 5FO7B 4WVWA 2ZTNA 1XOYA 5CYYA 4WM8C 3ZX7A 3LE0A 3W58A 4FTSA 5CIRA 1ZA4A 3ATGA 3USSA 4XABA 3MF9A 1W6MA 4NHYA 4YW7A 1N1TA 5H9RA 2WNUA 2V73A 1S4CA 4Q1PA 1GUIA 2WZEA 3B7MA 3THCA 5C70A 3W59A 4N53B 5GLZA 2W1SA 1R1A3 3D8CA 4OZXA 3ZXFA 3DYOA 2ZX3A 2W68A 2R7EB 2XQRA 3QD6A 4JGYC 2F4PA 2NN8A 5DUUA 1VAMA 5F5CA 2RDRA 3AMNA 4LBKA 3VZLA 4BIOA 4LOTA 3GF6A 5LY2A 3USUA 4DXSA 2C24A 3WNNA 3LSDA 1YQ2A 3OGRA 5A3OA 4D6RA 2HYXA 4C1XA 1MZ6A 2G1MA 1H8TA 3NSTA 5FZAA 4OQ9A 4CEWA 4JCKA 4KWJA 3FL7A 1V9U3 2V4VA 1LHNA 5FZDA 1NE6A 1NOVA 2QQIA 5BYNA 2XONA 2BGOA 5C3RA 1RITA 2VD7A 3M3CA 4CXWA 1J58A 4CCMA 4FPCA 1QMJA 1QJU2 2WO7A 5F5AA 1T6GC 4LK6A 1B35A 5FBZA 5LW9A 4RS5B 3O1UA 2VMGA 1H30A 4RHV2 1U12A 4LMFA 1VIWB 1LB2A 1VBD3 2CAUA 5BNOC 3AFGA 1NKGA 5GZDA 3BALA 1O3RA 4CU8A 4JHZA 1RC6A 4QPYA 3NKTA 5JXJA 1XC6A 2GNMA 4QPWA 1OHFA 3S5QA 1FT9A 1O4ZA 4JVAA 4W4ZA 5A1FA 1POQA 1LECA 1CZTA 1VMHA 3KVAA 4YZ4A 1S0IA 5IW0A 5ACA3 4MZUA 4Y4YA 5JOWA 5FXXA 4ASMB 2A1XA 5FZ1A 2D3RA 2VOTA 1R083 4LKSA 3IDAA 2ZHMA 4JGZA 4Q4W3 5KHHA 3UKVA 3POGA 4YZ5A 1SBFA 2YZ4A 2RMU3 2X5IA 3LDRA 3P6BA 3OPTA 3W9AA 2D3SA 4YM3A 4QDSA 4CDUC 2Q1FA 4BH9A 4MLOA 4N43B 2LM3A 1CQ9A 3LEMA 5J98B 1BVVA 2TUNA 3EMRA 2EIGA 5A80A 1JOBA 3VBFB 1AR93 1RTVA 3UESA 2Q1ZB 4F3JA 4FO9A 2XPJA 2VU9A 5FR3A 4R9DA 4FXKB 4QM9A 4IE4A 5FJKA 2DVDA 1QQP3 1UN1A 1W8HA 2VMIA 2VMHA 5DN2A 4AHWA 5L7OC 2P5BA 2PHFA 1W6QA 2VL4A 2P6CA 2HJIA 4GZ9A 4ZS3A 5ABJC 3K48A 2WS91 5BY5A 2XHKA 3PIGA 3O1SA 4NWVA 5A3TA 5J48A 4AQTA 1MR5A 3JUUA 1FAYA 5GZFA 3BTXA 2AR6A 1Q5OA 5I91A 1U5XA 5LBBA 1UYXA 2DUOA 2KM2A 2PAMA 1AR71 1MS9A 3KGZA 4CCCA 1W6PB 4NRQA 3SCHA 2HWE1 3VD4A 4I30A 5KHGA 1YQ8A 1Y3TA 2HWD1 4AEDB 1IGOA 2D5HA 1ZRCA 2WLPA 5FY7A 2JE9A 3K2OA 3RMXA 3I3EA 4MVTA 2DUPA 5FYUA 2B46X 1CX4A 1V6JA 2QDRA 3RDIA 3TN93 1SEFA 3DYPA 1RXFA 3CJXA 1CAXB 3FN9A 5BNNA 2EAKA 2UURA 4Y22B 1ZNPA 4K40A 4AAPA 1HRV2 3CJIC 3CL1A 3PJQA 4IL7A 4LPLA 1ACCA 3FFQA 4S2DA 4FVVA 2P3JA 3AP7A 3I3BA 4HG6B 5FMDA 5FQ0A 4QT6A 2ZGLA 4BLJA 1UW8A 1DP0A 1PGW1 1EAH1 1BEV1 2B7YA 1BQPA 3ZXKA 2VZRA 3V65A 5EXOA 3MW3A 1Q8SA 1STMA 1GZWA 1MEC2 1RXGA 1C8M1 3I4IA 4DXTA 4XF0A 2I74A 2V72A 4XFIA 5LWBA 1DQ5A 4JDNA 4FFGA 1VB2A 3FUQA 4IGOA 4Y3OA 1C5IA 3RMYA 1NT0A 2W0XA 2L9LA 1P8JA 5IFTA 2ARBA 4HANA 1HKDA 4Y5TA 1C1FA 3PJYA 4P5HA 5FRAA 4COYA 2W5FA 2BTVC 4HVQA 3T2OA 3VUOA 3ZSMA 1HDKA 2R1DA 4Q4Y3 3VDDA 1CWPA 1OVSA 3A7QA 4W8JA 4KG0A 2QTWB 4PDWB 5A7QA 4CP2A 4IV3B 4ZU5A 2BU9A 1J1LA 1PO12 1DQ0A 3DCQA 3AP4A 3T09A 2JB4A 2DVGA 5CFDA 1OSGA 2PAEA 3LA7A 4PIZA 5IFPA 3I8TA 5GZGA 4DEQA 2GH8A 4HBNA 4K3UA 2PHXA 4KH9A 2AC1A 4DQAA 3VZJA 1US3A 3J7NA 5DQ0A 1XNAA 3ZFFB 1W0NA 4CSWA 1PGL1 2W91A 3CBNA 3LQCA 5J7MA 1EV11 1GBGA 1Z7S3 2GN3A 2R49A 2XDVA 2YC2A 3PUQA 1OOPA 2JDNA 1OBNA 2SLIA 4KNCA 4LXLA 2Q5TA 4OUMA 5F8PA 1RVF3 3MLLA 4CZSA 1I5ZA 2WINB 3N7JA 1ZBE2 3PMEA 3VBRB 5F37A 4ISQA 1LTEA 3GGLA 3POJA 2ZABA 1YQ6A 1US2A 3ILFA 1T6BX 5E89A 1LAJA 2VMDA 4PF5A 1NUKA 2DBIA 3ILNA 1K5MC 1SLIA 2UWAA 4QKBA 4Y1YA 1S1AA 4GB33 3KZ4C 4R9CA 1L7RA 4YVSA 2RS11 4A3ZA 1OQDA 2BERA 1BJQA 3UKNA 1NA1C 2VZTA 4M3CA 4XJAA 4ZU7A 4FOVA 2B45X 5JSRA 1UO9A 5CFCC 1CAVB 1NXD1 3ZXJA 1B35C 2OUJA 4CDXC 1LOEA 1RMU1 1RUG1 3NV3A 4DUXA 3VD9A 4XBNA 3NRUA 1W6NB 4XJ8A 1PGSA 1WMXA 1KS4A 5T55A 1QH6A 1EP0A 3KF3A 3KQRA 2Q8DA 3HT1A 1LNSA 4RGAA 3DF0A 3UV9A 1JS9A 1UMZA 2MEV2 1NLRA 3MFAA 1JTZX 2J1UA 3KQ4B 3RZMA 1DQ2A 4D69A 1IQDC 1AVBA 4AQ2A 2YYOA 3BOWA 3U37A 1IKQA 4DB5A 2ZHKA 4JTNA 2XMLA 3VKFC 2PMWB 4YW3A 2HEVF 2ZEZA 2VPVA 1M4WA 3N36A 4IEOA 3WQBA 2XXZA 4P9YA 3VHOA 2BEOA 2VNOA 2X5IC 1RJ8A 5F7UA 1VBE1 4YWAA 2Y6FA 2ORZA 5D8AB 1VALA 2ZZQA 4HZFA 2PHDA 2JDMA 1RUJ2 4KWUA 1A8MA 4M00A 3Q8FA 3TOJA 1KFUL 4MGIE 5HBAA 3E6DA 2VY0A 1UYZA 3O0XA 2WC2A 3WNKA 4CDWB 1SCRA 4AL9A 1LOGA 4Q4X2 3Q8CA 5F32A 1AYM2 1XU2A 4EWAA 1VRH1 4JHTA 4YGBA 3OPZA 2ZGUA 1UYYA 4S2HA 1C28A 1GZWB 1RHI1 1J59A 4MG2A 1FOD2 1PX4A 2J22A 1YO8A 4EZHA 5AFBA 4AAXA 1GQHA 5HI0A 3FHQA 5FUNA 5LRRA 2VNGA 4AI2A 5KHJA 2CSGA 2XUMA 3NJXA 3B5LB 3SCFA 1NCRB 1CR7A 4D6QA 3J8F3 5HCAA 4LEJA 5LA2A 4A44A 3JD73 3NO8A 3D4KA 4ZY9A 2WSVA 2ADEA 1WMEA 1G9FA 1S2BA 2Y6HA 2BVBA 1WW7A 4XMIA 1HIXA 1UU4A 1COV2 2ERFA 3U4SA 1UOBA 1QIQA 1A8DA 1QJFA 2ZEXA 1UU6A 1WCSA 4CCLA 2NYYA 5DXDA 3I2OA 2XL9A 2ENRA 4C1WA 3TEYA 3VKNA 1QXRA 2JD4A 4CVUA 3T08A 5JZGC 5FDBA 1ASJ2 1OOPB 2XGXA 3L2HA 5TSWA 5KWRA 3VBOA 2YC4A 3ACLA 2R042 1TQ5A 4DZGA 2I2SA 1LHUA 4A2UA 1J3PA 2ZA9A 3PTYA 4XDPA 3A23A 1RUD2 2ZEYA 1A78A 3C7FA 2R1BA 4XFGA 3PUHA 3H3ZA 2GMEA 1SHWB 2NM1A 4ARYA 4CU7A 4FTEA 2VZ3A 4BYYA 3WF4A 1W8WA 2QFEA 2Y0IA 4AXOA 1F9KA 5DG1A 3KWVA 3ORJA 1ST8A 4NR1A 4YM2A 1W8NA 2BNNA 3LA2A 4LLOA 1QJU1 2RS53 4QPIB 2C9KA 2RR12 5FZCA 3ES4A 3F95A 4QXHA 4BQWA 4O65A 4G4FA 4CEYA 2DU0A 2CDOA 2GC0A 3ZYHA 1JODA 3W21A 4LIUA 1QDCA 3FWEA 3O1VA 1HRI1 4QX3A 5SV5A 5CEHA 1NLSA 1SDDB 1Y43B 4AEMA 4P9JA 5FK8A 5DDJ3 4QPGA 2W1QA 2WA3A 1WD3A 3H8UA 3PTRB 1MQTC 3H50A 3MW2A 5FPAA 1V0AA 1VMFA 4INDA 4E4DX 4YM0A 1U5YA 1OLQA 5I0RA 4NAMA 1HX6A 5F9TA 2XG3A 4K8FA 2GP5A 2YDEA 3OD0A 4BQ1A 2FDHA 3LDKA 2W92A 1DGWA 1UY1A 2HWC3 3M3IA 4FPHA 4IXLA 4XF9A 1ZX5A 1LGNA 2ZGPA 2J1AA 5LBCA 1KXGA 1RUE3 2C4XA 1UAIA 5JI9A 2ZMKA 2QQLA 5JOYA 3IKWA 4AQSA 4HN0A 1CAWB 1XPWA 3ZPOA 1QJY3 1O4TA 2RS32 4PBOA 5FP3A 2NPIA 4OHVA 5C7GA 1OT5A 1JYNA 1WCDJ 2R062 2KXLA 3HVDA 2WN3A 1AR83 3K4AA 3ASIA 2JIJA 2WWUA 1LRHA 1R092 2R16A 1JOJA 4LITA 5HCFA 1HW5A 4KWLA 1UIKA 1ND3A 1POV0 1QJX3 2D7FA 3MV11 2JDKA 2VOKA 1PIV3 3JBG3 3OEBA 3V0BB 1AXZA 2C9AA 2DCKA 4IEWA 1SPPA 4WM7C 1GNYA 3AVSA 3C8XA 3AX4A 5EWSA 3SCGA 3EB7A 2JG8A 2FCUA 3LB9A 3LD8A 2SBAA 2YG0A 4NPRA 5H9SA 4ATEA 4AZZA 3NAPA 2G9ZA 3M3EA 3ZFGA 4DEVA 5BPXA 3B93A 2HBUA 2Y0OA 3ALQA 2W3JA 4Q4V3 4QQHA 5FWJA 1D2SA 2GAUA 2D5FA 2C0ZA 1S0GA 4MGSA 1Y9MA 1OD5A 2E32A 4QX7A 3WXPA 2GC2A 4LLFA 3U14A 1W03A 4U2AA 2WO3A 4XCAA 4IE5A 4B4RA 1DCSA 3BIEA 2DVAA 5E1RA 1ND2A 3PU8A 1TMF3 2DCTA 2VVFA 3B3QE 4NPMA 1UNBA 1KEXA 1JZ7A 2WLQA 2JG9B 1DLCA 2DF7A 1HXS3 2P37A 1DQ1A 3MYXA 1HRV1 4JRLA 3TNQA 1FPN3 4FFFA 4LBQA 4CUCA 5FYSA 1BKZA 2E31A 2XKOA 2XLFA 1FATA 5ISLA 4RSUA 5LBEA 3M3QA 3IMMA 3KM5A 4LO8A 4MO3M 2WZR1 1V6MA 5HV4A 2EALA 2ZX0A 1MEC1 3NNGA 1JYCA 1AJOA 1Y7BA 1H1IA 4AVVA 4UI9L 3AB0A 1BHGA 1MVEA 3H0OA 4LBMA 3RGBA 3WDXA 1Q43A 4Q26A 4E2SA 2DVBA 2O8OA 2PLV2 2ZXQA 2HWE2 3HWJA 5H9PA 1MACA 3SKJE 3AFKA 2WO1A 1O5UA 1C3HA 1IHMA 1YFWA 2HWD2 4XPVA 3THPA 1PO22 3LFIA 3RNSA 1I3HA 4DXZA 4B4QA 5A3PA 2ZGSA 1W9TA 4AEJA 4C91A 4P9LA 1PO11 5FREA 2XVKA 4L97A 5FY1A 3T1MA 1E5IA 1REDA 3LDBA 1W06A 4JDOA 2VZUA 3AMPA 3N7MA 3WUDA 3ZN6A 5CB7A 3ZSKA 1GZ9A 3RI8A 3I7DA 3DKWA 3T0DA 4Y4RA 4GMP1 4HN1A 5C5TA 1ULGA 1H6XA 2OKXA 1JYXA 1QHDA 4MGQA 1XRUA 3ZVXA 1QOSA 2IVIB 4XTMA 1EAH2 1AUYA 1N1VA 2CDPA 4CUAA 1AX2A 5IT6A 2GMMA 3FZ3A 5C9AC 3AZZA 1ULCA 1C8M2 1ZBE1 4AE2A 1YJKA 1UYPA 1QKQA 4RQPC 2E7QA 3PVNA 2LALA 4AI0A 5LK7B 5FP4A 5FJHA 1W2TA 2WNVB 4XQ4A 2Q8OA 3RYKA 4AGVA 3S7EA 4BXFA 1XYPA 1DGRA 1W90A 3MUZ1 1TME2 4NPLA 2F17A 3RSJA 1IPJA 1FNYA 1OI6A 1FMD2 2WNEA 4QXKA 5F5QA 1DG6A 4XACA 4DS0A 2FZ2A 1UPIA 4NMIA 2VH9A 5L9BA 4GH4B 2W9XA 1NYWA 1DZRA 3O0VA 4DRRA 3CKHA 3ZMNA 2K46A 4UFKA 3WUCA 2PFWA 3ZYFA 4IW3A 3HAGA 2XJTA 1JW6A 5JUVA 1QF3A 2WQZC 1G86A 2VTXJ 3AKPA 1WA4A 4FCAA 4V1PA 4XJ9A 3WW1A 1PNGA 5FMBA 1YI9A 3ZYGA 1ZRDA 4KG8A 2Y6KA 3RWNA 4N53A 4PLMA 1W8ZA 3MPBA 2JD9A 4P9GA 2MEV1 3UJOA 1AL22 5FZIA 3VB9A 4Y24A 5I8TA 2JDHA 5C4WB 3MIBA 1WCUA 3D82A 1MS3A 2ZOEB 3WF2A 4IEZA 3LIGA 2BZDA 2GC3A 1BK1A 4LHSA 2JDYA 2PHLA 1EPWA 4XUNA 3VBUB 1W8TA 2HBTA 2MPFA 2P34A 3T3YA 3TWIA 1OLMA 4OI2A 2E63A 2YU2A 3VN4A 5D21A 4IEXA 4Q0PA 1BMV2 3WOGA 3ZPYA 4XMAA 4PQ9A 2E53A 3ZN5A 1KRIA 3MIEA 1XYNA 3M2MA 3WLUA 1FV2A 4WZFA 1RUJ1 1NQDA 1UF2C 3SEEA 1UZWA 3AZWA 3HEIA 1RMU2 4H2AA 4RS5A 5DMYA 1TVGA 3N35A 1NLQA 1OH3A 1R1A2 4XFAA 1GSLA 4LKEA 1PVC3 2QQUA 4Q4X1 4UBGA 3EO6A 1AYM1 3O12A 3JB8A 3Q9OA 4MYEA 5C33A 5K7PA 4Q27A 4E8DA 1ND3C 4AFBA 1XXNA 1QEXA 1XE0A 2FCTA 1FOD1 5FYTA 4I01A 4X6QB 5FMOL 5FO8B 4META 1OLRA 1YRZA 5KXDA 2ZS6B 5FZ8A 5FAXA 4COUA 5L9RA 3ZYJB 2ZHNA 3T0AA 3C7OA 2VZ1A 3H8RA 5FY0A 4LHKA 2B39A 3O5SA 5KXBA 1PX3A 2HEYF 3IBMA 4YPJA 3ZFGC 3VBSB 1A3KA 1WW4A 2W47A 4FPLA 3ZSLA 1CPNA 4C0BA 2XJVA 3OYWB 4JQRA 1VBE2 2VO5A 4JX0A 3OPWA 4LO6B 4F8AA 3ZSJA 4AVCA 3LOIA 4Q2FA 4FI9A 4UWDA 1ZRIA 1OLME 4E4ZA 2D93A 3ZIWA 4O7XA 3VBFA 1WUVA 1QY4A 1PK6C 1ND2C 1BEV3 3R6SA 3WW3A 4A4AA 4WM8B 3U11A 2WBKA 1ASJ1 1TG7A 3RPQA 2HKXA 3ZM8A 1VRH2 5JMCA 3BODA 3PUIA 5ACA2 5FZ9A 1J84A 3NV2A 3WQ1A 5C71A 2A75A 4A41A 1RUD1 1WBLA 2LROA 1RUF3 2LW8A 4G3YC 3NW4A 5A1LA 4JGYB 1U5ZA 4IEUA 1H9PA 2RMU2 3M4FA 2UU8A 5JXHA 1K42A 5EJZB 4TSVA 3H3UA 5LA0A 3V0AB 5C8CC 1REEA 3BIWE 4O9EA 3NQHA 4NIAA 1V6OA 1W6PA 2G9GA 1AR92 2RR11 1UMIA 1VBB3 2ZAAA 5FBJA 3RJ2X 1S2KA 1F5FA 1DYOA 3L9JT 3E6BA 5CKQA 4OUSA 2D40A 4XDOA 3VV1A 4AEDA 3O0WA 2FDKA 1YWKA 4OUEA 3K51A 2B8MA 5GLTA 1EV13 3RRDA 4TLFA 5K4LA 1RUC2 3ZKUA 1CAXA 4A7KA 4Y22A 4M4PA 2IC1A 1JYWA 1V6IA 4ZKTB 1H1MA 3GZTB 2CV6A 4YGEA 2WWSA 1XNKA 1EUTA 3GZUC 3WG4A 2HLEA 4YZ1A 5BNOB 4LUKA 1AR61 2WYSA 3SKVA 1RUI2 1UX6A 1SLTA 3CMGA 3KGLA 4CP1A 1ENRA 1WMFA 3A0KA 2MNGA 2FDIA 2RS13 5C3OA 3WNMA 5FYIA 1VAVA 3JQWA 4OHXA 2DWRA 3O1RA 1N1YA 3MHZA 1GP5A 2VXJA 2J1TA 4BQYA 4I0WB 3K3NA 3WP5A 1D2QA 1AF9A 2I45A 5FP8A 3B01A 4IEYA 2IXKA 4UAPA 2Y6JA 3ZKYA 4BMBA 4D94A 4QHBA 2RS31 3RS6A 2VR4A 2QQJA 2Q30A 3B94A 4CPBD 1W9WA 3DL3A 2R061 3AC0A 4XBLA 3S7IA 2JKBA 2WJSA 5DAWA 2XHNA 4DY5A 3AM2A 4L9BA 4HLTA 3EQEA 4Z1VA 1HRI2 2XBO3 5A32B 1R091 4HMZA 1JZ5A 4PDWA 2JB8A 4XCBA 1ZBA3 4IV3A 2RM23 5DAXA 1SLBA 3ZFEC 1X33A 1EPZA 3AXDA 4CE8A 2ZPXA 1QXJA 4ARXA 1G6NA 5L19A 3KHCA 3GJAA 5FZBA 3MIFA 4NHMA 5A3UA 1JZ6A 3Q8AA 4UW4A 4GULA 5JCTA 4CRQA 4W6YA 4N53C 3ZFFA 5L7OB 4DPNA 1F4HA 2ZX4A 3CF6E 5EYYA 4AFMA 1ZRRA 4OVEA 4MUVA 1E57A 3ILRA 3ZXAC 3ZMOA 3JXSA 4A6OA 1LKNA 3K77A 3R4SA 4ZXEA 3VBRA 5KC6A 1YYNA 2WDBA 4HFSA 4XUPA 3HT2A 2VQTA 3LPGA 2P3YA 2QQMA 2BFUS 5FXZA 4C0HA 3RZLA 5CG8A 1O3TA 1Q56A 2Y33A 1BBT3 2IFWA 5LBFA 1Z0HA 2VOXA 3ZDSA 3SHRA 4DRVA 5IVFA 1OF4A 3AMHA 1RHI3 5AC93 2VNVA 1LR5A 4PF1A 1CAVA 5JVVA 1JZ8A 2B42B 3KT7A 3N7LA 4J25A 2C1FA 3VZKA 3HQXA 2R073 5DPNA 2VQUA 5HXVA 5A70A 1H2LA 3EHKA 1W6NA 2W87A 3N9NA 4JDMA 3LZZA 4HK9A 4H7MA 3VZOA 1WA6X 4YW4A 3C7GA 4WVVA 1RVF2 2E7AA 5FKBA 3VDAA 4AI3A 2J1VA 4YW6A 2H6CA 3CJIB 1OKOA 3NMBA 2CY6A 2RG4A 5FZ7A 2Y26A 3T30A 5FFOC 4CCJA 3AJZA 3J9SA 1O8SA 1N1SA 3ZXDA 3VHPA 2X09A 2EAAA 3KT1A 2PLV1 4GB32 4R9BA 1G9BA 2RJKA 1UXXX 3U07A 1HB1A 1F4AA 3A21A 1AL0G 1HQNA 4Q1RA 1V6LA 2DURA 2VOVA 1CN1A 3FMGA 1PO21 4XAEA 5C3QA 4QWNA 1Q8PA 3GZEA 2QQVA 4AVBA 3OY8B 1OKQA 5B4NA 2VZQA 4BHPA 4QDRA 4CDQC 1XNTA 1OPOA 3ZXEA 4FOYA 4L99A 2EIBA 2DCYA 5D8AA 1IS6A 4N43C 4PHZA 4XFBA 5FPLA 4DXRA 2ZCWA 5ANQA 3ZXLA 5HCBA 3VBFC 1QNYA 2EIEA 5T54A 4G9SB 4JRAA 5EYXA 3V56A 4CDWA 1W9FA 1LHVA 5A7SA 1CX1A 5K9YA 2WABA 1H2KA 2OUHA 1BK0A 3AZXA 2BBAA 2WZR2 5LA1A 1QJU3 4IV1C 3NVCA 4RR3C 5E16A 2ZGTA 5GKAC 5T5PA 4AFDA 4MGZE 1X36A 5C3PA 2D43A 1N3OA 4QX0A 2PTMA 3DKQA 2YBPA 2WZPP 5IK7A 3VDBA 2QQKA 1GWMA 4RHV3 3GDBA 4EQVA 4YGDA 2AUYA 4XE9A 1TME1 2HWF2 2A5ZA 1NCRA 1FMD1 3KB5A 4FXGB 4QQOA 3WP4A 5JWPA 4RD7A 2PQQA 4FPGA 4YVWC 1POV3 2BQPA 2HWB2 1CESA 5AFEA 2CGNA 5K0UC 1IOAA 4YGCA 1K5MB 3PIJA 2FDJA 2BOIA 2GALA 1GLHA 2EXIA 3EXUA 2OPKA 2YB7A 1NA1B 3MLJA 5DZEA 2V4AA 2RJ2A 3EJKA 2WNUC 3KSCA 4OI4A 1JBCA 2Z2SB 5FZMA 4B7EA 5CFCB 3N9PA 1FXZA 3IIAA 2D6PA 4CDXB 3N7KA 1YLLA 2JX9A 3OOXA 4I0BA 1W9SA 1AL21 4IE7A 1VR3A 3VHRA 4UW3A 1AYN2 2WUHA 2JE7A 3KV5A 4MGKE 1VB4A 2VBPA 3MIDA 5F1RA 2J42A 3CHXA 3K4ZA 1W8UA 4GD4A 2IFRA 1KS5A 5A33B 1A6CA 1DIWA 1H8TC 4X8PA 3VD5A 4CEWC 2BNMA 2YUEA 2C26A 4I3PA 4UXAA 2W52A 1VE0A 5FP7A 4GWMA 1AHSA 1YEWA 1BMV1 2XWJB 4Q0SA 1VBC2 2PELA 2A3YA 5FUIA 5F6LB 5DAVA 4QPIA 1SQ4A 5EHDA 3BUCA 4QGMA 1G7YA 3OGGA 1RUOA 4AHYA 4OZOA 1FI2A 1CJPA 2P17A 4AHXA 2FDFA 1R1A1 3BTAA 2QE3A 4IGQA 1O4YA 4EJRA 5IVVA 2V5YA 5KXEA 4OHWA 4NWWA 3NV1A 3ETQA 3POYA 2WFF2 1KJLA 3UETA 2YY1A 4LO7A 1TNRA 4IV3C 3RZHA 2BUKA 1SBDA 1D4M2 4AK3A 4PI0A 4EN9B 4SLIA 1V9U1 2BVVA 5F6KA 4R9AA 3M7AA 4XEZA 4AW7A 3BU7A 1S0JA 1X82A 5I8SA 4M0HA 1BXHA 3S6PA 1GQGA 2GN7A 2RV9A 4JGZC 4P9IA 4ZONA 3GALA 1GOHA 5T5OA 1UU5A 3WINE 4B4PA 3AYDA 3RVHA 2J1RA 4F83A 1HRV3 3ST7A 5G04L 4HXCA 1W8OA 1CAWA 4XC9A 5FZEA 4DNYA 1APNA 2ZGKA 3OBAA 4K6BA 5ANNA 5BV6A 2NZ9A 5F2SA 2X10A 4XTPA 5FY5A 3T4VA 5LB6A 1MEC3 1IS4A 2QQWA 2BJSA 4D6SA 1NX9A 4COWA 5EFUA 3VGIA 4CP9B 5ACA1 4MOAA 5CKMA 5FZGA 3FBYA 1H4GA 1PHMA 4Q4W1 4ATFA 4UFMA 1KGYA 1WLWA 3WV6A 2VCBA 2YROA 3V0BA 1S0CA 2ZGQA 4ZZ8A 5JZGB 2RMU1 5LY1A 4P9XA 4FOWA 4Y1XA 3ACGA 5K8SA 1L7LA 3FUOA 2UWCA 2H0VA 3BPSA 4AVSA 3VKOA 2NMOA 1UZZA 1VPHA 1O8PA 1UY2A 4OULA 3KS7A 5L9VA 1HLCA 2W2IA 1T2XA 1YJLA 4BA6A 1AR91 1JXNA 2VC9A 3DEMA 2EA7A 2BFUL 3PLQA 3KCCA 4LHNA 1ZZ9A 1F15A 4QX8A 4I3GA 1C57A 1XE7A 2ZJCA 4EV0A 1Q8VA 1O91A 3BCWA 5FPUA 3MV01 1J3QA 1K12A 2O1QA 4DOUA 4FAGA 4TTGA 3N4MA 3DYMA 2Q8EA 1CZSA 5J09A 1RUC1 3HBKA 3H1MA 1V00A 4YG3A 4XILA 4BJ0A 1JZ3A 4XUQA 2JG9A 3GHMA 3WQ7A 5D8AC 2XL7A 5BNNC 1PIV2 1ZBE3 2BV4A 3U10A 3OUHA 3PDQA 3WG1A 1X8MA 4D7TA 3GM8A 4NRMA 4MXWB 2XKPA 3BGAA 3J7MA 3M1HA 4RFT0 3VD3A 1GICA 5D2AA 3PUAA 1RUI1 5FK7A 2QBXA 1ENQA 4CDWC 2VUCA 5T5LA 1MQTB 3LEGA 3PHMA 3LEKA 3NJVA 1E5SA 4D3WA 4E9KA 1EUUA 3WNXA 1GOFA 4Q4V2 3WNPA 5JIAA 1E5RA 1S0FA 1JI6A 2W95A 3LEIA 3U78A 1RB8G 4XIOA 2AEYA 4RGKA 3NL1A 4I0AA 2Y8KA 1BLZA 3RZJA 5FPVA 1OVPA 1LEMA 3MF6A 3QCWA 3ON7A 3I54A 1Y9QA 4WBBA 4AR2A 4OCTA 1ZRFA 2QZ3A 4TYSA 4YLZA 4ZHNA 3BKZA 4BXSV 3LIHA 1X50A 4PJYA 2ORXA 3VDDC 1W04A 3WR0A 2VULA 2MEV3 5LK5A 4OI0A 3OBZA 2ZKLA 3R4DB 5JDBA 3P3PA 1FPN2 1OF3A 4NVPA 1UY3A 5LCWL 2CWSA 1BVP1 2G19A 2O8QA 2V09A 2YC0A 2WYFA 4IESA 3Q8BA 1I9RA 1VBA2 3WF3A 2FMDA 4JV4A 5CFDC 3I59B 3QH7A 2CU5A 3OF1A 2P4EA 4L8QA 5FYHA 4UFHA 2LRPA 4QU2A 3KD4A 1DGRN 3E97A 3I2HA 1WKYA 1AR62 1RYYA 3HN1A 2ARCA 1DYKA 3A4UA 2WA4A 2YBKA 1DYPA 1LODA 3VKMA 1W0OA 2PHWA 4QD2A 1OOPC 2N7GA 1RUJ3 2CNAA 1KDKA 4Z8BA 4FAHA 4WM7B 3H8XA 5AVPA 2DTYA 1SCSA 2CWMA 1W28A 2WL1A 4KWKA 4NUBA 2WNVA 5BXXA 3LWCA 4Q4X3 1OFNA 4QX2A 3CO2A 4YW1A 2Q8CA 4LO5B 1OD3A 4YVSC 4BOWA 1S0BA 2JXAA 3WNOA 4GH4A 1GZCA 1Q8QA 2RDQA 3VHNA 4YSFA 2OIIA 1FOD3 2AACA 2VM9A 2VW0A 5A7NA 2E26A 4UBHA 3LFMA 1W8FA 3S57A 5LEJA 1KQRA 5EIYB 3Q8EA 4E27A 1N3PA 1OUXA 3ITQA 1RVF1 4FFIA 4FPKA 1CZVA 4UF0B 3ZYBA 1M06G 1H8VA 4BQXA 3SITA 4YZ2A 3FLTA 2ZEWA 3MUY1 5FWEA 1COV3 2IXJA 3WEZA 3MO4A 3KHBA 3J7LA 3ZXGA 4CU9A 1RUH2 4Q5OA 4J1WA 3UKTA 3L2YA 1IG3A 5DZGA 4GB31 2VCMA 5C4WA 4JKKA 2AGSA 2FBEA 2RJLA 4X8NA 1XNCA 3K46A 3GHNA 4XF4A 1GNHA 3N9QA 4XQDA 3VBUA 2V5DA 3DPRB 4Y20B 4JZRA 4Q29A 1ASJ3 5F2WA 3G6JB 5FZ0A 4OHYA 3NJZA 1GWLA 4W50A 2R043 5LEKA 4B8EA 2BW8A 2D6OX 1CONA 2LUWA 3AKRA 3T1LA 5J96B 3CU7A 3RZZA 3V64A 1RUD3 1GFF2 5F3IA 2VNRA 1YFXA 1HB4A 5M0TA 3S5AA 4XFCA 2BP6A 5HCHA 1LJ7A 5DG2A 4IEQA 1GV9A 4RYDA 4XOGA 4AFAA 4AFCA 5D1IA 3HIFA 4K1ZA 3TEXA 4CXYA 4QXCA 1WD4A 2OPWA 4UW6A 1LGCA 1LOFA 2YU1A 3IAQA 4AVTA 2QCSB 3H9AA 1JOPA 2XVLA 4TXWA 3POSA 5IATA 2AZ5A 1X9PA 1RJ7A 2WQ4A 1J3RA 1NCQB 1WLDA 3FLPA 4AGRA 2HWF1 3TYJA 2R0HA 3OGJA 3UGHA 2VZPA 3M70A 4D8MA 1CVNA 3VBHB 5C9AB 1QJEA 2QKDA 2WIIB 3FC0A 2FQPA 4K21A 3CIHA 1W2NA 4D0QA 2FHRA 4RQPB 2HWB1 3WG2A 3VBSA 1J83A 1WZXA 4JC1A 4ZS2A 3S30A 3OYWA 4CCKA 5FZOB 1XNDA 2QQNA 2BWAA 1DF0A 3LA3A 1PVC2 2PHRA 5I0UA 1HQWA 4CTEA 4AG4A 3W5MA 1HJFA 1O3SA 3AMMA 1X7NA 4FT8A 5GM0A 4J1XA 5A3MA 1O6UA 3WDTA 1GP4A 4UT5A 4FBFA 4MX3A 4P08A 1XQNA 1XB9A 2DYCA 4WM8A 2VECA 2WWJA 2B4KA 3WP6A 2XJRA 1AYN1 3VBOC 1QOTA 3ZO0B 4GJZA 1O3QA 2RS33 4ISRA 2X8KA 1LU1A 2R063 3N3HA 1UPSA 3LPFA 4JGYA 3IT8A 4O61A 4OYUA 1WGPA 2WQ8A 4KL1A 3MGUA 2ZX2A 4EWEA 2C6SA 3V0AA 1VBC1 2ATFA 2VW2A 3B02A 2Q1MA 2OX0A 5FPZA 1ONAA 2OW4A 5KHKA 5GLUA 3QH6A 4SBVA 4BIFA 1AXYA 5IJRA 2WKKA 4XQWA 1YFYA 4QB1A 2QJVA 5FCCA 4HETA 1K3IA 4CEYC 3RFRA 4NIHA 2XUEA 1HB3A 4M4RA 5FYVA 4GMP0 5IK4A 3O1OA 1JU3A 2WFF1 4A45A 2CYFA 3MFCA 2GDFA 3ROUA 4A3XA 4QPGC 3MIHA 1D4M1 4H55A 5BNPB 1RUF2 5FY9A 1UY0A 1CJDA 2PQSA 4IQPA 3QACA 1WLTA 3E5UA 3H1WA 4KU7A 5BNOA 3DECA 5FLIA 1PZ9A 1QDOA 4CCOA 4UOJA 4QMAA 5FY4A 5I93A 4H3WA 4XETA 5FKCA 5C3SA 2Z69A 4HONA 4XHXA 2XJSA 2RS51 1QWRA 4QDQA 4RA0A 2P6HA 3ZLIA 4UFLA 2GNBA 2WR9A 3SLIA 3CLPA 4CUGA 3N9LA 4IEPA 5DAPA 1Z78A 4AQ6A 5FYBA 3DXUA 3ELNA 3BPZA 2ZHLA 3FLRA 4MADA 4MSVA 5FZKA 4Y1UA 5GZEA 2Y64A 5DDJ1 2PHUA 4BK5A 2WS93 2IXIA 3H1YA 2E51A 3NV4A 4FPOB 1OURA 4GH4C 4Y33A 1NE4A 3HJRA 3JU9A 4BPZA 4BZ4A 5A32A 4COZA 3VZMA 1AR73 5FY8A 4AI1A 1PK6B 5E88A 1JUHA 2PLV3 2B5HA 2HWE3 3I2JA 5EZWA 1DDLA 1UCXA 5C8WA 2HWC1 3KLSA 1EY2A 1V9U2 2HWD3 4KBBA 4NN0A 4OHZA 1SACA 1UZVA 1PO23 1WWYA 3I2DA 4FP3A 1GOGA 4NIIA 4HPKB 1GMMA 2GNDA 2IXCA 2WN2A 5L7OA 1HV1A 2JG8C 3ABZA 1UL9A 3UT0A 3NAPC 2VZVA 3BOPA 5HV0A 3FBMA 4FSJA 4ZU4A 4V2WA 4QM8A 5BUVA 5C4WC 1LESA 1CIWA 2DBNA 2VCAA 2QDNA 5FYMA 1I6XA 3WD5A 1C4RA 2UYBA 1VBD2 3VL8A 4FPYA 4R8HA 5C8CB 1MZFA 2XBO2 2OZJA 4EROA 1EAH3 2RM22 4F7ZA 2YGLA 1C1LA 2BRTA 4D7YA 2A71A 2QNKA 4QQPA 5LZ6A 1OA2A 1C8M3 4P14A 5JSOA 5FYYA 1PIV1 3JBG1 4Y5SA 4LORA 4XZUG 3AKQA 2XOMA 2UYAA 2PA7A 3RJRA 1D0GA 5DUWA 2GC1A 2R30A 1AX0A 1TME3 1R082 4Q4W2 1Q3EA 2D6LX 1L3JA 2WAOA 3I2FA 1FMD3 3KV9A 1YI7A 2J1EA 3NNFA 4IGPA 4CA9A 4Q4V1 5FLJA 1KFXL 3CJIA 4XJWA 1SFPA 5F3EA 3MPPG 4XUOA 1GWKA 2VZSA 3WF0A 2RDNA 4KBZA 3SH4A 2HH9A 3HNMA 3IDEA 1UWWA 2O0OA 1Q8OA 4QQLA 3IWZA 2P3IA 4J6GA 4QX5A 1TMF1 1ULEA 3IAPA 3FHIB 4IE0A 1K45A 3HMYA 5L36A 5JPNB 5IWFA 5FXWA 5AC92 1QQP2 1HXS1 1W05A 4LTAA 3WW4A 1W2UA 2JENA 2XH6A 1GKBA 3CEWA 1AL23 2EIDA 3OY8A 1ULPA 4L0PA 4M3CF 1H1AA 3VBSC 5DZFA 3EBRA 1FPN1 2R072 1ZZCA 3NJYA 5GZCA 1ALYA 1VBA1 1MS4A 5IK8A 3OEAA 1D7PM 2ET7A 2VJXA 1N3QA 1G9CA 2XVGA 2J7MA 3OUIA 4EE2A 1WCKA 4AYUA 3IB3A 1GANA 4N8MA 5FPBA 1A34A 1BCXA 3ZFEB 3ZDVA 1UZYA 3LCPA 1NZCA 3PURA 3SXWA 3G7DA 2K0GA 3THDA 5I8YA 1QOOA 5FTTC 1LENA 3TEZA 3FE5A 4XJUA 1RMU3 1RUG3 2YGMA 3TBDA 4COVA 2NLRA 3HD8B 4P00B 1YIFA 2BDRA 3CNAA 3SQOA 2VW1A 1NAEA 3PL0A 4HVRA 1UZ0A 4B29A 4KGGA 2A6YA 3HNYM 4UYBA 4ZXKA 1JHJA 3TN92 2VCCA 4BLIA 1CAUB 4WVMB 5JAXA 3GBGA 3SEPA 4CDUB 1S0EA 3A0NA 5A6QA 2KR2A 1EYBA 1XSQA 1JZ2A 1HB2A 1HQLA 4KMQA 4ZZ5A 2TBVA 3HNBM 1K5MA 1PM4A 3M3OA 4PIXA 4EN7B 1QU0A 4DFSA 1W6OB 4GA9A 2E33A 4AI8A 4EZ4A 1NA1A 3D0SA 5I0DA 3IN9A 4AI9A 1S2EA 5A1AA 5IVJA 5IVBA 4Q0QA 3IPVB 5CFCA 4A7ZA 5A7WB 3AZYA 1YUDA 4QGNA 3ECQA 1OFSA 4CDXA 3OB8A 2QQOA 3PVBB 1ZZ6A 1VBE3 2OQ7A 1RUH1 4GXLA 4BISA 1MS8A 4OFGA 5IVCA 1GNZA 4N9HA 4I02A 5A7OA 5ABJB 2EXKA 3P5BA 5IYYA 1O5LA 4K8RB 4LBQD 5A33A 3AXEA 4AOCA 4DUWA 3VD7A 4Q4Y2 3WCSA 5CVRA 2W1WA 2AENA 1SMVA 5I0SA 5JIUA 2ZX1A 3APBA 5IUQA 3WQ0A 2J1SA 2H0BA 1FV3A 2EICA 1VRH3 3UK9A 3IIIA 4DMIA 2OVUA 2RHPA 1ZZBA 1W2AX 2HYKA 4P5YA 4LK7A 3UGFA 5HPOA 1OA3A 1YFUA 3D3AA 4AHZA 1LULA 2A3XA 2JWPA 4FPJA 4M01A 1F8VA 2VOWA 3HR9A 3FJSA 2DVFA 5A7PA 4X6RB 4D7SA 2VE1A 4QKDA 4RS5C 2UWBA 4XURA 4CDQB 1QJZA 1Z7S2 5IVYA 2BWCA 1HN0A 2GNTA 2IWGB 1UKGA 2QVSB 4NRPA 1MS0A 4AF9A 4PQQA 4LQRA 4LR4A 5FPXA 5F3CA 5J37A 5J1XA 4P02B 5JPMB 1YCIA 2BOJA 3RZKA 1NG0A 4LBOA 4MV2A 3HN3A 4W65A 5A3LA 4L2NA 1F2NA 2ZBJA 3NNLA 2W94A 1UX7A 5B2GB 4IV1B 4RR3B 1RUC3 1L7QA 2FCVA 4RL7A 4PI2A 5EJ3A 2XWBB 1W0PA 2JIGA 5I0TA 4HOOA 3VL9A 1JYVA 2Z4FA 1DHKB 3E5XA 1BZWA 3IDBB 2X05A 1PVC1 1QH7A 2ZGNA 3W20A 2Q0AA 3KV4A 4BM8A 1RUI3 3OUJA 4LJHA 4QB6A 4YVWB 1UOJA 3J4UH 3ZOIA 2VQ0A 2YFZA 2ZGOA 3MLKA 5K0UB 4BB3A 1SZBA 2XQXA 3D0JA 1J1TA 3AP6A 4EN6B 1W6MB 2IXLA 4CP9A 2KA3A 2GZWA 2WNUB 3INAA 2QQPA 2VMEA 5CBLA 2VUDA 2XB6C 3I3QA 5DABA 3N9OA 3TB0A 4HKOA 4R4ZA 4A6SA 5IHRA 2RDSA 2JDPA 2A3WA 5JZGA 4R52A 1HRI3 1V6NA 4NIGA 1R64A 3OGVA 3USUB 1ULDA 5EJ1B 4DUVA 4RGGA 4DY3A 3M8LA 4QGLA 3ZIXA 1O59A 2YPDA 1H8TB 4CCDA 2YBSA 4LO4B 1CD3G 1UXZA 4CEWB 5FYCA 2BNOA 5FUPA 3WT3A 5FZ3A 2OT7A 4QKNA 4BCUA 2XR4A 4U36A 2EF6A 2H6BA 3AP9A 3TRSB 1FYUA 1XNBA 4PIYA 4AEDC 2VVDA 4QQ2A 3VKLA 5JI7A 4CP0A 4P9WA 3LSEA 1XE8A 4W6WA 5FZFA 3SH5A 4HL0A 4BQ5A 5FV3A 4OLLA 1B35B 1CGPA 4Q0VA 4XFFA 1RUF1 4UW5A 5APAA 4XVHA 3B9IA 3D5OA 1KITA 1SLAA 2ETEA 4Y26A 3AKTA 2EVXA 2ILMA 3KT4A 4MXWA 4YZ3A 4DINB 5B4XA 1GYKA 3QLQA 1XJAA 3I2KA 5C6CA 2EXJA 4S2FA 3J8F2 2WT0A 3JD72 4E4HA 2P1BA 2GP3A 1MQTA 2C5DA 2WT1A 2ZKNA 3BYWA 1VBB1 1MVQA 4FPEA 4YG0A 5CADA 5SV8A 1MZEA 4QX1A 2XJUA 1IPKA 4HVOA 4IDZA 4RN5A 5F39A 4GWIA 2EXHA 4ORFA 1OH4A 4NIDA 2VBDA 3DXTA 4XXPA 4AWDA 1LOAA 1ODMA 1UIJA 2E9QA 4JGZB 4NOTA 5CG9A 1JUIA 3CQOA 2E6VA 1REFA 2X5IB 4IUGA 5CNAA 2ZZJA 1LOCA 4JAAA 3IDCB 4GIQA 4PDWC 5LRSA 1VAKA 4OI1A 3I97A 2RE9A 5J36A 1S55A 3JCIA 3POEA 3I59A 3WG3A 2JICA 1XYOA 3JZVA 1YNAA 4ASKA 4Z92B 4Y1ZA 1VMJA 5DUVA 2JJ6A 3ZFFC 4CCEA 3E6CC 4KU8A 3E1F1 3R0RA 1MZ5A 1W6QB 1C8NA 4ZPIA 3WHUA 1OXCA 3OBTA 5FP9A 1UOGA 2RS52 1AXKA 5GLVA 1JHNA 5LA9A 2A6ZA 5KR7A 1DLLA 3THTA 4GAZA 3ZYIB 4AVAA 4WM7A 1W2OA 2AH2A 5HXMA 5F5IA 3R05A 3ZN4A 3IM0A 3POWA 3VBRC 3KV6A 5IAVA 1VBD1 3T4HB 1H2MA 1BYHA 4GWNA 3RWKX 2XBO1 4GALA 4UFJA 4Y1VA 5GJ6A 4GJYA 4HSLA 2VVEA 3TAYA 1DGWX 1GZTA 1LHWA 1ZBA1 2RM21 5DDJ2 1X8EA 1IZ3A 4CCNA 2WZR3 4TN7A 4XF1A 1G9AA 1IS5A 2WT2A 1D4VB 3U0ZA 4I2OA 1QNWA 1DFQA 4XIKA 3GBWA 1MS1A 2YFUA 2E7TA 3PVOA 2OZ6A 1RL3A 4URAA 4LA3A 1W39A 2HWF3 1R081 1F35A 2Y34A 3U4XA 2HWC2 3T0BA 3LGRA 4LUMA
chains in the Genus database with same CATH topology
2UY8A 1URXA 5BNNB 1RUE2 2PN5A 2HWB3 4NO4A 3WCRA 3C2UA 4IETA 3GBFA 4M3CE 1PO13 5FQ0B 5JLVA 2IZWA 2G4IA 1LOBA 1BBT1 2LTNA 3O14A 3RG0A 1ZM1A 1QJY2 1V6KA 2HEWF 4BMEA 4YFWA 2DFBA 4GMP3 1AR82 3AP5A 2VQAA 5AC91 3DPRA 1QQP1 4Y20A 3WDUA 1JH5A 3AK0A 1AYN3 4EN8B 2R071 4LA2A 2K2SA 1QJX2 5FOJB 2Y38A 3JBG2 1IKPA 4I09A 3VDDB 2A6WA 1RUNA 4TWTA 2D6NA 1TE1B 4Z82A 2CL2A 4GQ7A 1NQJA 1RIRA 2K9ZA 2YV8A 2PAKA 1NY72 5FOBB 1G8WA 3PMSA 1VBC3 1WW5A 5CFDB 3BB6A 2CAVA 3GYDA 4LBNA 4HT1T 4LNVA 3H7YA 1PZ7A 1KD7A 4HSJA 5FLHA 4XF3A 1NCQA 1TMF2 1V70A 3TN91 4C90A 2WFF3 3VBHA 5C9AA 1NCRC 5GALA 2A6VA 1U0AA 1D4M3 1HXS2 2Z5WA 4RQPA 3WP3A 4FQZA 1LU2A 4BWOA 2GMPA 2X29A 2YMZA 3PNAA 2R32A 4YVSB 2ZACA 3MEPA 4M3CB 2P2KA 4BE3A 1I1EA 3PVEA 2PHTA 2XJPA 2MHFA 4MXVA 1SDWA 3MDPA 4JTOA 3MIGA 3D6EA 3AYEA 2FMYA 2A73B 4RHV1 2PYTA 4IERA 3KCXA 2G9FA 1UKRA 2AYHA 1N47A 3X29B 4MH0E 1DQ6A 1KJRA 4Q4Y1 4EN0A 5L73A 1POV1 1LEDA 3AZVA 3KCYA 1AYM3 2VUAA 1ZVFA 2VUJA 5FMOS 3IMNA 2DU1A 4TZDA 3OTFA 4Q8LA 1PM7A 4QPIC 1SBEA 2GSYA 4YG6A 4WZCA 4LULA 3DV8A 3WDYA 1Z7S1 2AREA 4K1YA 3DGTA 3RYRA 1PVXA 1OA4A 4N7IA 2NMNA 2YXSA 4S2GA 1CPMA 1RINA 5BNPA 1AZDA 2D6KA 4NHKA 4FQ4A 3AMQA 4W6XA 1H2NA 4YARA 2P3KA 1ZZ7A 2UY9A 4N9IA 4YRDA 1WW6A 2BBVA 4WVZA 1KDMA 3DN7A 4HK8A 2D98A 4Q8KA 2BPA2 3RQ0A 2BYVE 3P3NA 5KBFA 1U5IA 2OYZA 2W39A 4H14A 1ENSA 3J26N 1F31A 1LCLA 1R1ZA 1WBFA 4PLNA 3B69A 3AYCA 1OPMA 4E4SA 3FX3A 5KHIA 3NWKA 1AX1A 2IXHA 1SLCA 1QGLA 1PK6A 2RR13 4XDQA 2TEPA 4R4XA 5DUXA 2FZ1A 1SFNA 1ULFA 3GZAA 3SISA 1YXWA 3ME2A 3MICA 1WLCA 1DQ4A 1H4HA 4HPKA 4K20A 3URFA 3VBOB 5CA6A 4MGYE 3WZ1A 1DZQA 4XW3A 4XJZA 5AVAA 1S0DA 3WY6A 4N90A 2NP0A 5KC5A 1VBA3 1RGSA 3MI8A 4XZPA 2WS92 2A7AA 5CAZA 3H7JA 1AR63 1GR3A 4L92A 5C8CA 5FO9B 3DPRC 2ZMLA 4XFHA 2DTWA 2VG9A 3MW4A 4LT5A 4PLOA 1AR72 3ZYPA 5CU1A 2JG9C 3QOPA 4URTA 1ZREA 4LHLA 4CEYB 2JECA 2BGCA 3B00A 3R4UA 1B09A 4YFZA 2D44A 3J8F1 4QPGB 3JD71 2TNFA 2GU9A 4EWDA 1UD1A 5J3UA 4LBJA 1R093 2DCZA 3T2TA 3QBQA 1JN2P 4Z07A 4AGGA 3UJQA 1PGW2 1FNZA 1H0BA 1NCQC 2XJQA 3LKJA 3OD4A 4FPFA 1BEV2 3SNMA 1ZZ8A 1ENXA 1WMDA 3VBHC 3HBZA 4YW5A 1RUH3 3VLBB 2GH2A 2R6QA 5IK5A 2WFPA 1ZYBA 5H9QA 2VXRA 4ASLA 3OBRA 5T5JA 2OA2A 1FX5A 4Z2WA 3JQXA 1HV0A 2YHJA 2XLGA 4H7LA 1IQAA 4LE3A 3ZFEA 1ND3B 3WDWA 3KMHA 2DCJA 4ITCA 1YIPA 3UL2A 4KGQA 2NQYA 2DUQA 1VBB2 4Q0UA 1C5HA 2CTVA 2D97A 4HKWA 4FOQA 3AKSA 1D0HA 3ENRA 4K7JA 1NXMA 4XBQA 1PGL2 2JG8B 1EV12 2WNVC 4CYDA 4N7UA 4YYOA 4KQ7A 4M0NA 3NAPB 3WW2A 3DUIA 3ZFGB 3LAGA 1CAUA 3O7OA 4WVMA 3WX5A 2Z42A 4B7KA 2CGPA 1G9DA 4CDUA 1YHFA 1F5JA 2Z79A 3MZHA 2ET1A 3RYPA 2QZ2A 1DBNA 2D6MA 2CGOA 1W6OA 3ES1A 2I07B 1ND2B 1QXPA 2ZAHA 1OQ1A 1VP6A 3OCPA 4XYXA 5T52A 4HKLA 2RS12 5JSPA 2W08A 3IPVA 2VGDA 3SH3A 1LHOA 3JB4C 3OJBA 1RUE1 5GLWA 2DFCA 1PNFA 2R0FA 4YNIA 1RUG2 5BNPC 4IEVA 4A7YA 2ES3A 1TEIA 4LBQB 1QJY1 4ONUA 2JEMA 5EV7A 5ABJA 5BNQA 2ZGMA 5E8AA 1AR81 3GNEA 1VJ2A 3VBUC 4ES9A 1XU1A 5JR7B 4LE4A 3FFZA 1ZBA2 4YW2A 1H9WA 1DU3D 4GKYA 1QJX1 2YPJA 1OMIA 4PBPA 4LBLA 3NKGA 3SMHA 4NHLA 1DZTA 3WDVA 3E5QA 3C3VA 3WVJA 4WV8A 4CDQA 1COV1 3WHTA 1NY71 1VLNA 4E2QA 2D3PA 4YM1A 3RI9A 1DGLA 2ARXA 4N43A 4K9SA 4B3NA 1PMIA 1AJKA 2WSUA 3ZN6B 4O9GA 3LOBA 1LOFC 3AYAA 1PZ8A 2ZMNA 3B9CA 1BBT2 2QUOA 4L11A 3ZYRA 2A70A 4XXAA 4FP2A 2R041 4IV1A 2X53S 4RR3A 5JOXA 1SFYA 3VZNA 5KXCA 1RHI2 2B9UA 4AEKA 1JYIA 5T3NA 4E2GA 2Q4SA 3ZSEA 4Y5Z0 1TNFA 1LGBA 4GKXA 3TNPB 4PCRA 2F6BA 2ZGRA 2A6XA 1OQEA 4YVWA 3S0MA 2XLAA 4ES8A 4FTBA 1SLLA 5T50A 5K0UA 2JDZA 1MS5A 1O7FA 2DV9A 3AJYA 1IS3A 5FO7B 4WVWA 2ZTNA 3ZX7A 4FTSA 4WM8C 3W58A 5CIRA 1ZA4A 3ATGA 3USSA 3MF9A 1W6MA 1N1TA 5H9RA 2WNUA 2V73A 4Q1PA 3B7MA 3W59A 4N53B 5GLZA 3D8CA 1R1A3 4OZXA 3ZXFA 2ZX3A 2W68A 3QD6A 4JGYC 5DUUA 2F4PA 2NN8A 1VAMA 5I8TA 3VZLA 3AMNA 4LBKA 4BIOA 3GF6A 3USUA 3LSDA 4C1XA 1MZ6A 1H8TA 3NSTA 4CEWA 4JCKA 4KWJA 1V9U3 1LHNA 1NE6A 1NOVA 5BYNA 1RITA 3M3CA 1J58A 4FPCA 1QMJA 1QJU2 1T6GC 1B35A 5FBZA 4RS5B 2VMGA 1H30A 4RHV2 1U12A 1VIWB 1LB2A 1VBD3 2CAUA 5BNOC 3AFGA 5GZDA 3BALA 1O3RA 1RC6A 4QPYA 3NKTA 2GNMA 1OHFA 1FT9A 1O4ZA 4JVAA 1LECA 4YZ4A 1S0IA 5ACA3 4MZUA 4Y4YA 5JOWA 4ASMB 2D3RA 4Q4W3 1R083 5KHHA 4JGZA 2ZHMA 3UKVA 4YZ5A 1SBFA 2YZ4A 2RMU3 2X5IA 3W9AA 2D3SA 4YM3A 4CDUC 4BH9A 4MLOA 4N43B 2LM3A 1CQ9A 5J98B 1BVVA 2TUNA 2EIGA 3VBFB 1AR93 1RTVA 4F3JA 2Q1ZB 4FO9A 2XPJA 2VU9A 4R9DA 4FXKB 4QM9A 2DVDA 1QQP3 1UN1A 2VMIA 2VMHA 4AHWA 5L7OC 2PHFA 1W6QA 2HJIA 5ABJC 3K48A 2WS91 5BY5A 2XHKA 4NWVA 5J48A 4AQTA 1MR5A 3JUUA 1FAYA 5GZFA 2AR6A 1Q5OA 5I91A 1U5XA 2DUOA 2KM2A 2PAMA 1AR71 1MS9A 3KGZA 1W6PB 3SCHA 2HWE1 4I30A 5KHGA 2HWD1 1Y3TA 4AEDB 1IGOA 2D5HA 1ZRCA 2WLPA 2JE9A 3RMXA 4MVTA 2DUPA 3RDIA 2B46X 1CX4A 1V6JA 2QDRA 3TN93 1SEFA 3CJXA 1CAXB 5BNNA 2EAKA 2UURA 4Y22B 1ZNPA 4K40A 1HRV2 3CJIC 3CL1A 3PJQA 4IL7A 4S2DA 3FFQA 4FVVA 2P3JA 3AP7A 5FQ0A 4QT6A 2ZGLA 4BLJA 1UW8A 1PGW1 1EAH1 1BEV1 2B7YA 1BQPA 3ZXKA 3V65A 5EXOA 3MW3A 1Q8SA 1GZWA 1MEC2 1C8M1 3I4IA 4XF0A 2I74A 4XFIA 1DQ5A 4JDNA 1VB2A 3FUQA 3RMYA 1C5IA 2W0XA 2ARBA 4HANA 1HKDA 1C1FA 3PJYA 4P5HA 5FRAA 4COYA 2BTVC 4HVQA 3VUOA 3ZSMA 1HDKA 2R1DA 4Q4Y3 3VDDA 4KG0A 4CP2A 4PDWB 4IV3B 4ZU5A 1J1LA 1PO12 1DQ0A 3AP4A 2DVGA 5CFDA 1OSGA 2PAEA 3LA7A 4PIZA 3I8TA 5GZGA 2GH8A 4HBNA 4K3UA 2PHXA 4KH9A 4DQAA 3VZJA 3ZFFB 1PGL1 5J7MA 1EV11 1GBGA 1Z7S3 2GN3A 2R49A 4KNCA 1OOPA 2SLIA 4OUMA 2Q5TA 1RVF3 3MLLA 4CZSA 1I5ZA 2WINB 3N7JA 1ZBE2 3PMEA 3VBRB 4ISQA 1LTEA 5E89A 2ZABA 3ILFA 4PF5A 4Y1YA 3ILNA 1K5MC 1SLIA 2UWAA 1S1AA 4GB33 3KZ4C 4R9CA 4YVSA 2RS11 1OQDA 1BJQA 3UKNA 1NA1C 4M3CA 4XJAA 4ZU7A 4FOVA 2B45X 5JSRA 5CFCC 1CAVB 1NXD1 3ZXJA 1B35C 2OUJA 4CDXC 1LOEA 1RMU1 1RUG1 3NV3A 4XBNA 1W6NB 4XJ8A 1PGSA 1KS4A 5T55A 1QH6A 1EP0A 3KQRA 3HT1A 4RGAA 3DF0A 3UV9A 1UMZA 2MEV2 1NLRA 3MFAA 1JTZX 1DQ2A 4D69A 1AVBA 4AQ2A 2YYOA 3BOWA 4DB5A 1IKQA 2ZHKA 4JTNA 3VKFC 4YW3A 2HEVF 2VPVA 1M4WA 3N36A 4IEOA 4P9YA 3VHOA 2BEOA 2VNOA 2X5IC 1RJ8A 1VBE1 5D8AB 1VALA 2ZZQA 4HZFA 2PHDA 1RUJ2 1A8MA 4M00A 3TOJA 1KFUL 4MGIE 5HBAA 3E6DA 2VY0A 3O0XA 2WC2A 4CDWB 1SCRA 1LOGA 4Q4X2 1AYM2 1XU2A 4EWAA 1VRH1 4YGBA 3OPZA 2ZGUA 4S2HA 1C28A 1GZWB 1RHI1 1J59A 1FOD2 1YO8A 5AFBA 1GQHA 5HI0A 5LRRA 2VNGA 4AI2A 5KHJA 2XUMA 3B5LB 3SCFA 1NCRB 1CR7A 3J8F3 5HCAA 4LEJA 3JD73 3NO8A 3D4KA 2WSVA 1WMEA 1G9FA 1S2BA 2BVBA 1WW7A 4XMIA 1HIXA 1UU4A 1COV2 2ERFA 1A8DA 1UU6A 1WCSA 2NYYA 5DXDA 2XL9A 2ENRA 4C1WA 3VKNA 1QXRA 2JD4A 5JZGC 5FDBA 1ASJ2 1OOPB 2XGXA 3L2HA 5TSWA 5KWRA 3VBOA 3ACLA 2R042 1TQ5A 4DZGA 2I2SA 1LHUA 4A2UA 1J3PA 2ZA9A 3PTYA 1RUD2 1A78A 4XFGA 2R1BA 3H3ZA 2GMEA 2NM1A 4FTEA 4BYYA 2QFEA 2Y0IA 4AXOA 1F9KA 5DG1A 4NR1A 4YM2A 2BNNA 3LA2A 4LLOA 1QJU1 2RS53 4QPIB 2RR12 3ES4A 4G4FA 4CEYA 2DU0A 2GC0A 1QDCA 3FWEA 1HRI1 5SV5A 1NLSA 1Y43B 4AEMA 4P9JA 5DDJ3 4QPGA 2WA3A 1WD3A 3H8UA 1MQTC 3H50A 3MW2A 4INDA 4E4DX 4YM0A 1U5YA 1OLQA 5I0RA 1HX6A 5F9TA 2XG3A 4K8FA 2YDEA 3OD0A 4BQ1A 1DGWA 2HWC3 3M3IA 4IXLA 4FPHA 4XF9A 1ZX5A 1LGNA 2ZGPA 1KXGA 1RUE3 1UAIA 5JI9A 2ZMKA 5JOYA 3IKWA 4AQSA 4HN0A 1CAWB 1QJY3 1O4TA 2RS32 4PBOA 2NPIA 4OHVA 1WCDJ 2R062 2KXLA 1AR83 3ASIA 1LRHA 1R092 2R16A 1JOJA 5HCFA 1HW5A 4KWLA 1UIKA 1ND3A 1POV0 1QJX3 2D7FA 2VOKA 1PIV3 3JBG3 3V0BB 1AXZA 2C9AA 2DCKA 4IEWA 4WM7C 3AX4A 5EWSA 3SCGA 3LB9A 2JG8A 2SBAA 4NPRA 5H9SA 4ATEA 3NAPA 3M3EA 3ZFGA 5BPXA 3B93A 2Y0OA 3ALQA 4Q4V3 4QQHA 1D2SA 2D5FA 2C0ZA 1S0GA 2GAUA 1OD5A 3WXPA 2GC2A 4LLFA 4U2AA 4B4RA 2DVAA 5E1RA 1ND2A 1TMF3 2DCTA 2VVFA 3B3QE 2WLQA 2JG9B 2DF7A 1HXS3 2P37A 1DQ1A 3MYXA 1HRV1 4JRLA 3TNQA 1FPN3 4LBQA 1BKZA 2XKOA 2XLFA 1FATA 4RSUA 3M3QA 3KM5A 4LO8A 2WZR1 1V6MA 2EALA 2ZX0A 1MEC1 1JYCA 1AJOA 1Y7BA 1H1IA 4AVVA 3AB0A 1MVEA 3H0OA 4LBMA 3WDXA 1Q43A 4Q26A 4E2SA 2DVBA 2O8OA 2PLV2 2HWE2 3HWJA 5H9PA 1MACA 3AFKA 1O5UA 1C3HA 1IHMA 1YFWA 2HWD2 4XPVA 3THPA 1PO22 3RNSA 1I3HA 4DXZA 4B4QA 2ZGSA 4AEJA 4C91A 4P9LA 1PO11 5FREA 2XVKA 4L97A 3T1MA 1REDA 4JDOA 3AMPA 3N7MA 3WUDA 3ZN6A 5CB7A 3ZSKA 1GZ9A 3RI8A 3I7DA 3DKWA 4GMP1 4HN1A 1ULGA 1QHDA 1XRUA 3ZVXA 1QOSA 4XTMA 1EAH2 1AUYA 1N1VA 1AX2A 5IT6A 2GMMA 3FZ3A 5C9AC 3AZZA 1ULCA 1C8M2 1ZBE1 4AE2A 1YJKA 1QKQA 4RQPC 2E7QA 3PVNA 2LALA 4AI0A 5LK7B 2WNVB 4XQ4A 2Q8OA 3RYKA 4AGVA 3S7EA 1XYPA 1DGRA 1TME2 3RSJA 1IPJA 1FNYA 1OI6A 1FMD2 2WNEA 4QXKA 5F5QA 1DG6A 4DS0A 2FZ2A 1UPIA 2VH9A 4GH4B 1NYWA 1DZRA 3O0VA 4DRRA 3ZMNA 3WUCA 2PFWA 3HAGA 2XJTA 1JW6A 1QF3A 2WQZC 1G86A 4FCAA 3AKPA 1WA4A 4V1PA 4XJ9A 3WW1A 1PNGA 1YI9A 3ZYGA 1ZRDA 4KG8A 3RWNA 4N53A 4PLMA 3MPBA 4P9GA 2MEV1 3UJOA 1AL22 4Y24A 5C4WB 3MIBA 3D82A 1MS3A 2ZOEB 4IEZA 2GC3A 1BK1A 2PHLA 1EPWA 3VBUB 2P34A 2MPFA 3TWIA 4OI2A 2E63A 3VN4A 4IEXA 4Q0PA 1BMV2 3WOGA 3ZPYA 4XMAA 4PQ9A 2E53A 3ZN5A 1KRIA 3MIEA 1XYNA 3M2MA 3WLUA 1FV2A 4WZFA 1RUJ1 1NQDA 1UF2C 3AZWA 1RMU2 4RS5A 3N35A 1R1A2 4XFAA 1GSLA 1PVC3 4Q4X1 4UBGA 3EO6A 1AYM1 3O12A 3JB8A 3Q9OA 4MYEA 5C33A 5K7PA 4Q27A 1ND3C 4AFBA 1XXNA 1FOD1 4I01A 4X6QB 5FMOL 5FO8B 4META 1OLRA 1YRZA 5KXDA 2ZS6B 5FAXA 4COUA 3ZYJB 2ZHNA 4LHKA 2B39A 3O5SA 5KXBA 2HEYF 3IBMA 3ZFGC 3VBSB 1A3KA 1WW4A 4FPLA 3ZSLA 1CPNA 4C0BA 2XJVA 3OYWB 4JQRA 1VBE2 4LO6B 4F8AA 3ZSJA 4AVCA 3LOIA 4Q2FA 4E4ZA 2D93A 3ZIWA 3VBFA 1WUVA 1QY4A 1PK6C 1ND2C 1BEV3 3R6SA 3WW3A 4WM8B 3U11A 1ASJ1 3RPQA 2HKXA 1VRH2 5JMCA 3BODA 5ACA2 3NV2A 3WQ1A 2A75A 1RUD1 1WBLA 1RUF3 4G3YC 3NW4A 4JGYB 1U5ZA 4IEUA 1H9PA 2RMU2 3M4FA 2UU8A 4TSVA 3H3UA 3V0AB 5C8CC 1REEA 3BIWE 4O9EA 1V6OA 1W6PA 2G9GA 1AR92 2RR11 1VBB3 2ZAAA 3RJ2X 1S2KA 1F5FA 3L9JT 3E6BA 4OUSA 2D40A 3VV1A 4AEDA 3O0WA 1YWKA 3K51A 2B8MA 5GLTA 1EV13 3RRDA 4TLFA 1RUC2 1CAXA 4A7KA 4Y22A 2IC1A 1V6IA 4ZKTB 1H1MA 3GZTB 2CV6A 4YGEA 2WWSA 1XNKA 3WG4A 3GZUC 4YZ1A 5BNOB 5JOZA 4LUKA 1AR61 1RUI2 1UX6A 1SLTA 3KGLA 4CP1A 1ENRA 1WMFA 3A0KA 2MNGA 2RS13 1VAVA 3JQWA 4OHXA 2DWRA 1N1YA 4I0WB 3WP5A 1D2QA 1AF9A 2I45A 3B01A 4IEYA 2IXKA 4BMBA 4D94A 4QHBA 2RS31 3RS6A 2Q30A 3B94A 3DL3A 2R061 4XBLA 3S7IA 2JKBA 2WJSA 4DY5A 3AM2A 4L9BA 4HLTA 3EQEA 4Z1VA 1HRI2 2XBO3 5A32B 1R091 4HMZA 4PDWA 1ZBA3 4IV3A 2RM23 1SLBA 3ZFEC 1X33A 1EPZA 3AXDA 2ZPXA 1QXJA 1G6NA 5L19A 3MIFA 4NHMA 4UW4A 4GULA 5JCTA 4CRQA 4W6YA 4N53C 3ZFFA 5L7OB 4DPNA 5EYYA 2ZX4A 3CF6E 4AFMA 1ZRRA 4OVEA 4MUVA 1E57A 3ILRA 3ZXAC 3ZMOA 1LKNA 3R4SA 3VBRA 5KC6A 1YYNA 4HFSA 3HT2A 5CG8A 2BFUS