3HT1A

1.2a structure of the polyketide cyclase remf from streptomyces resistomycificus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
142
Chain Sequence
MMKRVHRTDVKAEIVREPGAKETTHRKLIDTPDGADRFVLTEFEVSPNGSTPPHFHEWEHEIYVLEGSMGLVLPDQGRTEEVGPGEAIFIPRGEPHGFVTGPGQTCRFLVVAPCERPPVRNVFLSEDPYEYTQMPEYTSLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords RemF protein
publication title The polyketide cyclase RemF from Streptomyces resistomycificus contains an unusual octahedral zinc binding site
pubmed doi rcsb
source organism Streptomyces resistomycificus
total genus 32
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ht1A00
3E6CC 3ELNA 2Y0OA 4MH0E 4WVZA 3UKTA 1UPIA 2XLAA 2D5FA 3KGZA 3I59B 1UIKA 2ETEA 4XF1A 2OYZA 5HI0A 4XFBA 1YFXA 3NVCA 4K8FA 4WBBA 3ST7A 4Z07A 4Q0VA 5I0UA 3L2HA 1RUOA 5FQ0A 3LWCA 2BEOA 1RTVA 4PIZA 4Q0UA 4Q29A 5I8YA 1QY4A 4HN0A 3FFQA 2Z2SB 5CU1A 2WFPA 2ET7A 4IEOA 1O3SA 4BIFA 1NE4A 3SCFA 2Q4SA 2IXLA 4L2NA 1ZRCA 1O3RA 4H7LA 5EZWA 4HLTA 4J1XA 4X6QB 4R8HA 4O9GA 5I93A 1OFNA 4BH9A 3LZZA 4BHPA 1SFNA 1CAXA 4IEVA 4KWKA 4YYOA 2XKOA 4QMAA 2IC1A 2QVSB 4FBFA 2D5HA 1ZZBA 3DL3A 3BCWA 3RZZA 3UKVA 1ZRFA 1YWKA 4IEYA 1OMIA 4CYDA 3KGLA 4AXOA 1Q5OA 5I8TA 3G7DA 3IBMA 4LUKA 3ES4A 1CAUA 5FPZA 3MZHA 2GAUA 1NXMA 2OZJA 1FT9A 3LAGA 1DZTA 1UD1A 3ROUA 4IEXA 4Z82A 1QWRA 1VR3A 4AQ6A 1RC6A 1J3PA 4JVAA 4DINB 2PTMA 5BV6A 3CL1A 3HIFA 4MGKE 1XRUA 1YFWA 3H8UA 2XKPA 4XFGA 4XFAA 3IWZA 4TLFA 3E6DA 1CAVB 4IEZA 2FQPA 5E1RA 2UYAA 3WW2A 1U12A 1CX4A 5LEJA 3S0MA 3TNQA 3EHKA 1EP0A 2VECA 2BYVE 1H1IA 3M3IA 1WA4A 2D93A 3E97A 2I45A 3H9AA 3E5UA 3HQXA 2D40A 1ZZ8A 3BB6A 4BYYA 3I59A 4XFCA 4QGMA 4XF0A 2UYBA 4ZU7A 3H1MA 1ZREA 3PVBB 2DCTA 1EPZA 2MPFA 3SXWA 4R52A 1ZRDA 3LA7A 4QGLA 4J1WA 2UY8A 3D0JA 5I91A 4QXKA 4HN1A 3TNPB 1ZZCA 4LA3A 2CAUA 3EQEA 1NYWA 2XHKA 2PAMA 4QM9A 2PFWA 5JSRA 3U0ZA 1QXJA 2WC2A 3GYDA 3NSTA 2BNMA 5C6CA 1IPJA 3DKWA 1FI2A 5BUVA 3KMHA 5AVPA 4MGIE 1NZCA 5T3NA 1DGWA 4IEQA 4A2UA 4FAGA 3I54A 4XFIA 4F7ZA 4AVCA 2ZCWA 1J59A 4D7TA 4XF3A 3O14A 3PNAA 1ZVFA 3CEWA 1RGSA 4LTAA 3WW4A 4YSFA 3KCCA 4EWDA 5CADA 4I3PA 4XF9A 3FHIB 3BALA 5BXXA 1O7FA 3U11A 4IETA 2N7GA 2PAKA 4E2QA 4NVPA 3S7IA 1RUNA 2IXIA 5F1RA 3IIAA 1ZX5A 2QNKA 3M70A 4I02A 3NJZA 5BPXA 5CVRA 3RPQA 1H1MA 4KWLA 2IXKA 1YUDA 2PQQA 4ONUA 1Q3EA 4HSLA 3E6BA 2K9ZA 3BPZA 2Z69A 2E9QA 3D0SA 4XF4A 4WZCA 4OLLA 2IXCA 3BU7A 3R6SA 1CAWB 1O3TA 1CAVA 4YARA 4ZU5A 1LRHA 1YHFA 5JSOA 4ZU4A 5I0RA 2EA7A 3ACLA 3H1YA 3RDIA 1O3QA 3D82A 3PLQA 3CJXA 2MNGA 3SCGA 4HVQA 5FDBA 2XGXA 3ETQA 1Y3TA 2CV6A 5FLIA 1V70A 4D7SA 1VJ2A 2HJIA 4MX3A 1J3RA 1Y9QA 1IPKA 1OI6A 1JUHA 2B5HA 3LA3A 4MUVA 2GC3A 1ZNPA 1Q43A 1EYBA 2PA7A 2ZKLA 3EJKA 4N9IA 2MHFA 2IXHA 4N9HA 2XLFA 3I7DA 4MGYE 4XFHA 4XEZA 1ZZ9A 2EAAA 4LUMA 1G6NA 2B8MA 2CGPA 3LOIA 1LB2A 4Q0QA 5E16A 4KL1A 4HMZA 2PHDA 5I0TA 3H50A 3FE5A 1L3JA 2FMYA 1ZZ7A 3OCPA 3QOPA 3B02A 1DGRA 4YRDA 3E5QA 3RYPA 5FPXA 1X8EA 4QX5A 3JZVA 5FLHA 4Q0SA 2GC1A 2PAEA 3NL1A 4EV0A 2HKXA 3E5XA 1QXRA 3KSCA 4XFFA 2QJVA 3SMHA 5JAXA 4JTNA 4LA2A 3OF1A 1J1LA 2QDRA 4Q0PA 3GBFA 4B29A 2BNOA 3ES1A 4PIYA 2H6BA 2OPKA 4YNIA 4LULA 1RL3A 3VHRA 2GC2A 3CO2A 3HT2A 4FT8A 1O5LA 1FXZA 5JSPA 3USSA 1PMIA 3MPBA 4EWEA 1X8MA 4QGNA 1YLLA 3ZDSA 2ATFA 5LRRA 3S7EA 3N4MA 5KHGA 5FLJA 2Q1ZB 1CAWA 2Q30A 4XETA 4EWAA 2GU9A 4AVAA 1YFYA 2PHLA 3DN7A 2EVXA 4I0AA 1UW8A 3H3UA 4IEPA 4L11A 1EY2A 5KHJA 4P9GA 4RD7A 2UY9A 5I0SA 1I5ZA 5C8WA 4O9EA 3IDCB 3FJSA 5J3UA 2QCSB 1DZRA 3EBRA 2OA2A 5LRSA 3H7YA 2F4PA 1SQ4A 2OZ6A 1O4TA 4KWJA 3WW3A 1LKNA 4UBGA 3MDPA 4EROA 1HW5A 2PYTA 3IDBB 5KHIA 2XL9A 4E2GA 4MV2A 4AVBA 3NW4A 4I09A 4HZFA 2C0ZA 4I01A 3CF6E 1GQHA 3OGJA 1J58A 3UKNA 1UIJA 3U10A 1TQ5A 2B9UA 4LEJA 2KXLA 4MGZE 4UXAA 3FX3A 1X82A 4LLOA 3SHRA 1XE8A 4AQ2A 5FQ0B 2V09A 4OFGA 5BY5A 4IEWA 3LA2A 2CAVA 2Q0AA 5J7MA 5EFUA 3H3ZA 5JR7B 1YFUA 4HSJA 4KU7A 4I2OA 1ZRRA 2O1QA 5JCTA 3MYXA 3SCHA 2XLGA 4IERA 4X6RB 2GZWA 1PM7A 3RYRA 1O5UA 4HBNA 3C3VA 3WW1A 1CAXB 2O8QA 3FZ3A 4JTOA 4I0BA 3CLPA 5FCCA 5D1IA 4GULA 5KBFA 2K0GA 1OD5A 1SEFA 2VPVA 1X7NA 3OTFA 3HT1A 4PJYA 2P17A 4MZUA 4E2SA 1CAUB 4IEUA 3EO6A 2BGCA 2XL7A 3DV8A 1J3QA 4META 2ET1A 2H0VA 4IESA 3OD0A 1WGPA 5I8SA 1UCXA 4KU8A 1I6XA 4FAHA 1XE7A 2IXJA 2H6CA 1CGPA 5KHHA 5J48A 1ZZ6A 4JV4A 4QM8A 3QACA 4ORFA 3H1WA 3RYKA 3RNSA 1LR5A 4UBHA 1GQGA 2GH2A 1NE6A 4F8AA 2BNNA 1VP6A 3FWEA 5LEKA 2GC0A 4HVRA 2VQAA 5KHKA 4PIXA 3NKTA 4HVOA 5K8SA 3H7JA 1WLTA
chains in the Genus database with same CATH superfamily
2BV4A 5EYYA 3ELNA 2VZQA 2Y0OA 3MV01 3TN93 5A6XA 3I4IA 1GUIA 2XJQA 2ZGTA 1EV12 4DEVA 2WNVB 3H0OA 1UIKA 3I59B 1DZQA 3POGA 4XF1A 2OYZA 5I0DA 5H9RA 1HQNA 3FC0A 4XFBA 3JU9A 4QPGC 1K45A 5CG9A 3OGGA 4LOTA 2Q5TA 4IDZA 4LKDA 4DO0A 5JXJA 2MEV3 4W65A 4K8FA 1RUI3 5F37A 3K48A 4WBBA 4GWJA 5IFPA 2NMNA 4E4SA 4COZA 5I0UA 5IK4A 3B69A 5FQ0A 5FK8A 1RTVA 5FO9B 4PIZA 3RGBA 4IV3C 3FL7A 3I49A 4HN0A 3FFQA 2X8KA 1OLQA 4KI5M 3MO4A 5CU1A 2PHUA 3K4ZA 5DDJ3 1WW5A 3LSEA 3OY8A 2D43A 4CEYB 1PM4A 1Y4WA 3MGUA 5LBCA 4LMFA 4HPKB 1POQA 1US3A 1CJPA 5L73A 4RR3C 5T5LA 2Q4SA 1GYKA 5C9AA 4L2NA 4XTMA 1C5IA 2W47A 2YPJA 1XU2A 4UW6A 3NKGA 4HLTA 2E7TA 4XJ8A 5ERLA 3VBUC 5FUPA 4KGGA 3JBG3 4XOGA 1H4HA 3ACIA 3AK0A 1ENXA 4BHPA 3HQUA 1WW4A 4LR4A 2HLEA 1MS9A 3I2HA 4LO6B 5A7WB 1RUJ2 1V6KA 3M4FA 3SNMA 4CU6A 1BVP1 2LUWA 2ZABA 5LA0A 1AL22 3CHXA 4QMAA 5A32A 4M0NA 2QVSB 3PVNA 1IPSA 1QOSA 4PF1A 3BCWA 3T0BA 1ND2A 3WUDA 3NMBA 1C5HA 4R9AA 4ZZ8A 1WCQA 3AKSA 4XXPA 3U78A 2JXAA 5DUXA 4W6YA 1KITA 1ENSA 4BCUA 1V9U2 5FPZA 1CAUA 1XNKA 2Y33A 4G4FA 2GDFA 2ZKNA 2XPJA 1MS4A 2R041 1VBE1 2OZJA 1FT9A 5JZGA 2R0FA 1C3HA 1WCDJ 4CPBD 3T30A 3DECA 2BVVA 3N9NA 3X29B 1R092 1QWRA 1VR3A 4BQWA 2FCVA 1OA2A 1TME1 1PMHX 4JVAA 1MQTA 4XJUA 3ZXLA 4JKLA 1NLQA 1RJ8A 1GBGA 1AL23 3GF6A 1XYPA 3LB9A 3CL1A 1SACA 4IL7A 3VGIA 1KFXL 2VZ3A 2V73A 3TYJA 2VBDA 1W9FA 3H8UA 4BLIA 3I2KA 4EJRA 3CNAA 2E31A 4BA6A 1CAVB 3LDRA 1VBC3 5C9AC 1S2EA 5LEJA 2Y60A 4AI1A 4ASMB 1TMF1 4TWTA 3EHKA 4XIOA 3RJ2X 5FMCA 1EP0A 2RS33 3OBTA 3M3QA 4JCKA 3ZIXA 3OPTA 2D93A 2RS11 3M3IA 4LBJA 3H8XA 1AUYA 5JOWA 5ABJA 1KD7A 2VJXA 4P9WA 2QDNA 3WDYA 1MVEA 3URFA 2D40A 3N9LA 3T1LA 3VBRA 5GLZA 3MV11 4YW2A 2VY0A 4XFCA 1Q8SA 5D8AA 4XTPA 3H1MA 2ENRA 1AYN1 1ZREA 1IGOA 3PVBB 2DCTA 5F2SA 1EPZA 2VBBA 5KC5A 3SXWA 1C8M2 1ND2C 3V0AB 1AR81 2OIIA 3LIGA 1NQJA 3OEBA 1PVXA 3VD9A 5K4LA 1V6MA 4LNVA 4INDA 4Y1XA 4KMQA 3ZYFA 2B7YA 2WFF1 1DQ1A 3AL5A 3AYCA 3D0JA 4XCBA 2ZX3A 2Q8CA 3GHMA 1CZSA 3KV6A 5JZGC 1POV3 4HN1A 4AEDB 2I2SA 2CAUA 1ZM1A 3FHAA 4TLGA 1PGSA 1SLTA 4FOWA 4P5HA 4Y5Z0 1GWMA 2Z4FA 2XHKA 4D6RA 1YI9A 4ITCA 4JRAA 3LOBA 2PFWA 3AYDA 4E4HA 1MQTC 3GHNA 3PUIA 2WC2A 2ZHNA 2X10A 2BNMA 3NSTA 5CIRA 3FFZA 1N1YA 3WDWA 2D98A 1IPJA 4ATEA 1FI2A 1BMV1 4BOWA 1XNBA 1J84A 2UWAA 1NZCA 1UWWA 3Q8CA 2DWRA 2VTXJ 3MEPA 1DGWA 3NNMA 4IEQA 2WWSA 4XFIA 1K12A 1XPWA 2Q1FA 3RZLA 2ZMLA 4FP3A 1HXS1 1ZYBA 3NJXA 2ZCWA 4BQ4A 2VU9A 5A6QA 1OLRA 2VZSA 4BQ5A 3FLRA 1VBA1 4NPRA 2HH9A 1NT0A 5B2GB 4LT5A 1Q56A 4EZ4A 2W1WA 1QJX2 5EPAA 5BNPB 4MG2A 5ABJC 2I74A 3GBGA 5CKMA 4LIUA 4XDPA 3SISA 1AR72 2Q1MA 1O7FA 1OKOA 3VBRC 5AFBA 2BVBA 2ZJCA 2W2IA 3J4UH 4E2QA 3ZM8A 5D8AC 5C3OA 2DVDA 5A33B 4NIHA 1IKPA 5A3TA 1U5XA 3T0AA 3POFA 1ZX5A 5FMBA 3TN91 1Z0HA 3M70A 3O0WA 1AZDA 5BPXA 5CVRA 4CUAA 2JIJA 1UL9A 4EYUA 1YUDA 3WCRA 4ONUA 2IFRA 3ZVXA 3MI8A 2D6OX 3AJYA 3ASIA 1QJX3 3BPZA 2WR9A 2MEV1 3IAQA 2XOMA 2C6SA 2V4AA 4OUEA 3N9PA 4W6WA 5FY0A 1G9DA 4HKOA 2ZGMA 3CJIA 2F17A 1CZVA 5LY1A 1PIV1 4LO5B 4G9SB 4YW5A 3HNYM 3LPGA 2IUWA 1W05A 5K9YA 3DXTA 2C5DA 1GMMA 4ZU5A 2J22A 3NAPA 3WNPA 3LFIA 3GGLA 2LALA 3ACLA 3FN9A 2NQYA 5DDJ1 3W9AA 1O3QA 4TN7A 4A3ZA 3CJXA 5F3EA 2MNGA 4GWIA 2WO1A 2P5BA 3AMHA 4HVQA 1HDKA 5FUIA 4LBNA 1V70A 4YGBA 1AXKA 3ZN4A 4KQ7A 3WF4A 4A3XA 4V1PA 4QQPA 3O1UA 4MX3A 4PF5A 3WF2A 3DEMA 5GZCA 4LLFA 1UF2C 2P6HA 3AP6A 3GCWA 2BERA 1SBDA 3JBG1 1UNBA 1UMHA 3Q8BA 3ZR5A 4BPZA 4MUVA 3VUOA 2YROA 1AR62 2QQLA 1ZNPA 1QH6A 2TEPA 2PA7A 2ZKLA 4LIVA 4Q5OA 2MHFA 2IXHA 4RGKA 3WG4A 4UI9L 1QJU3 5BNOB 1YJKA 4M3CF 5C7GA 1ST8A 2RDSA 2DDUA 2XBO2 4YW7A 2HWD2 1H8TA 1WMFA 1PZ9A 2EAAA 4XEZA 5FZEA 5GLUA 5A3OA 5JUVA 3AZVA 3FMGA 3AKRA 4CEWB 1Z7S2 4EE2A 2PMWB 1NCQB 4NUBA 4ARXA 3QH7A 4KL1A 1VBB1 5APAA 5I0TA 1W2OA 2BFUS 3FE5A 2WAAA 5C5TA 1PVC2 2YGLA 4NRMA 2E51A 3IPVB 3WHUA 4IW3A 1W9SA 5C3RA 4BJ0A 1GLHA 1VMJA 3CJIC 4FPKA 1TNFA 5IWFA 5L36A 5IVJA 2VW0A 1LOBA 1DGRA 3W5NA 1KFUL 3E5QA 4AG4A 1ZBA2 2PLV2 5FPXA 1X8EA 2BTVC 3NAPC 4EZHA 3JZVA 4XXAA 1G9FA 5FAXA 5FLHA 3RJRA 3I2FA 4CXWA 2PAEA 4EV0A 3H8RA 4P08A 5LA1A 3ZFFA 1AR91 1ULOA 5FBZA 4UW3A 5JAXA 2AEYA 1UY4A 4W6XA 1OLMA 3IT8A 2QDRA 1A78A 2JE7A 4B29A 5ACA2 1VBC1 4YW3A 3TEZA 2VZVA 2G9FA 3M1HA 1ND3A 4UOJA 3B3QE 4QB6A 2H6BA 2VGDA 2X29A 2RS31 1OXCA 5BNQA 2OPKA 2QQPA 2OW4A 4NHMA 1CD3G 4PDWB 5F6LB 4Y24A 3RQ0A 3WNXA 3RZJA 2GN3A 2GC2A 2IVJA 4B3NA 1OLME 5IAXA 2JG8A 3POBA 5IVYA 4YGCA 1X33A 1HJGA 1UMIA 4V2VA 3GZEA 4QPIB 3WCSA 4DUXA 1D4VB 1H8TC 1X8MA 2XXZA 1C1FA 1W6MA 3VBHA 4Q4X3 4XBNA 1GZWA 5GZEA 3O1TA 4UAPA 2ATFA 3M3EA 2OXBA 1NAEA 4DRVA 1AX2A 4Y5TA 1V00A 4Y26A 5H9SA 4I30A 5ACA3 1YQ6A 4XETA 1YO8A 1RUD2 3BOWA 5L7OA 3DN7A 4I0AA 5CB7A 3N3HA 1W8HA 1N3PA 3GJBA 1GSLA 4EN0A 1UW8A 1POV1 3PL0A 4IEPA 4M3CB 1WLWA 2J1VA 4JHZA 1HB2A 2DCKA 5EWSA 3BU0A 2A6XA 4O9EA 4JDOA 3MICA 4UF0A 1BQPA 1V6LA 1MS0A 3B00A 4AVTA 4GWMA 3P6BA 1SFYA 3AZWA 5KXDA 2YFUA 5A6ZA 1PNGA 1PK6B 4RHV3 3ZFFC 3VBOA 1OFSA 4FTSA 3GXUA 3NJVA 4RFT0 1F5JA 3LDKA 4EROA 5FOJB 3R4UA 2HWE1 1BHGA 2XL9A 2FCUA 5CFCA 1ND3C 1K5MB 3ZFGB 3M7AA 5FP4A 4BK4A 1KDMA 3MLLA 5FMDA 4FI9A 1A3KA 3AZYA 3CF6E 1WZXA 2DYCA 3GM8A 3OGJA 1YQCA 4BQ1A 3NO8A 4OI4A 4XZPA 3U10A 1I1EA 5EJ1B 2KXLA 2QE3A 3KWVA 4GJZA 1W04A 2JG8C 2LRPA 4FFFA 5EP9A 5KXBA 1CONA 1X82A 4IGQA 4XZUG 1NCRA 4KG0A 3QCWA 3AXEA 5FXZA 4BM8A 4AQ2A 3WOGA 4DMIA 2HBUA 3RZHA 1VBD2 4BLJA 3N9QA 3N35A 3VBHC 5D21A 4CRQA 4Q4V3 2RJ2A 2VMFA 5FUNA 5K0UA 2RM22 4JQTA 3GZUC 1IQAA 1LHUA 5FZDA 1OC1A 1YFUA 1W8OA 4CDWA 5L7OC 3GALA 4HANA 1L7LA 2VZTA 4KU7A 2H0BA 4I2OA 2Y6LA 2RE9A 3ABZA 4E9KA 1UN1A 2RS51 3J26N 2K46A 4MXWA 4XJAA 1DLCA 1BEV2 2CSGA 3VHNA 5FZ8A 4Y33A 2J1AA 3OGVA 4LHKA 4H7MA 3AZXA 2BZDA 4NOTA 5DAWA 3J8F2 2VMHA 1RUE2 1VAKA 2BJSA 4IUGA 4RFRB 4ZPIA 1ODMA 5FFOC 3ZSJA 4EN7B 5CYYA 4DFSA 1CAXB 3VBOC 1U5ZA 4JTOA 4LBOA 3I3EA 1LEMA 3R4DB 2ZX0A 2IWGB 2RM23 3CLPA 3KB5A 4QQLA 1REFA 4N43A 5D1IA 5CFCC 3PUSA 2RG4A 4D6QA 3T2PA 1SEFA 1NLRA 1X7NA 4QX2A 3ZSMA 3ZXGA 1DYPA 2R7EB 1JYXA 2FZ1A 5DG1A 5A80A 2R1DA 3RFRA 1BEV3 5FY9A 5DUVA 3OJBA 2Y6KA 5T5JA 3KM5A 3EO6A 4AI3A 4ZKTB 5T50A 3N9OA 1NCRC 3K46A 2H0VA 3J8F3 1RUE3 5I8SA 5C8CA 2Q8DA 1XE7A 1FNZA 1RUG3 1QJU1 2IXJA 5FY5A 1URXA 1CGPA 1M4WA 2RV9A 1L7QA 2EXHA 1W99A 3OPZA 2OUHA 5KHHA 5K0UC 2A73B 2ZGOA 1LGNA 4P14A 3QACA 4AHYA 5F2WA 4CDWC 1JHJA 4YM0A 4LPLA 2QQIA 4Y1YA 3O1OA 4RS5A 2GMEA 3AP4A 1GQGA 4BDVB 1W8NA 3T3YA 2WUHA 4NE9A 3ZX7A 2YBPA 3KVAA 5FKBA 5HBAA 1HIXA 1OKQA 1AYM3 1YJLA 5FYBA 3B9CA 4QKNA 4BU2A 2VC9A 4RYDA 2XJSA 5IUQA 1KEXA 2XVGA 4PIXA 2YMZA 3NKTA 5T52A 3ZXEA 3JXSA 5K8SA 3UJOA 5D2AA 3JD72 2V5DA 4AHWA 2NP0A 4XILA 2VH9A 4FQZA 3E6CC 3ZXJA 1SDWA 4WVZA 1XSRA 4BE3A 2XLAA 2D5FA 3KGZA 4F83A 1W06A 1NX9A 5J37A 2PQSA 2YV8A 4OUMA 4N43C 5HI0A 5CEHA 4HETA 1QJY2 3VBFA 4YGDA 1B35A 5KR7A 1VMFA 4NIGA 3HNBM 4Y20B 3DCQA 2P3KA 3NVCA 4XBQA 5FO7B 2DBIA 3BPSA 3WDTA 4D0QA 4DZGA 2EXIA 4Y3OA 1X36A 1JI6A 3UYJA 2FD8A 1NKGA 4DXTA 1F31A 3LWCA 4C0BA 3CMGA 2VCCA 4QXHA 4C8DA 4Q0UA 4UFMA 1RHI3 3MLKA 5I8YA 3S5QA 2D7FA 5C8CC 2Z2SB 3ZFEA 2ET7A 2EF6A 2ZEWA 4FSJA 3IDAA 5T55A 4QHBA 2WABA 3W20A 1RUH2 2W52A 5JWPA 1X9TA 1DQ0A 2V72A 3J7NA 4HL0A 1GQPA 3SCFA 5DG2A 4Q4X1 2A75A 3ZR6A 1QJY3 1MS1A 4RS5C 4AL9A 4LK7A 5ACA1 4I0WB 1EUUA 4J1XA 4X6QB 4Y1UA 3ZPYA 4JX0A 4AF9A 5I93A 1KS4A 5FYUA 2E53A 2WZR1 3ETPA 2B42B 2LTNA 3R0RA 4N7UA 3WHTA 1S2BA 4BH9A 3CZJA 4G3YC 3B5LB 2ZS6B 3AYEA 5FY8A 4QU2A 3WV6A 4NO4A 2OS2A 4OQ9A 1E5HA 3ZDVA 4P00B 4KWKA 4DUWA 2P3JA 4HONA 5GZGA 3AMNA 3VDDB 1D4M2 3O5SA 2BW8A 5FYZA 4E27A 2IC1A 2VCMA 3O1SA 4K21A 1ZZBA 4F3JA 5CA6A 4OHVA 3OUJA 1PO13 1WCSA 3CU7A 2NMOA 2J1RA 1OMIA 3LD8A 4RHV1 3ZSLA 3KGLA 4CYDA 2XVKA 4QX8A 2RDRA 3VBFC 4COWA 5IVBA 1B35C 3AVSA 1BCXA 1NG0A 3MHZA 4RN5A 3ES4A 5I8TA 1EAH2 2GAUA 1NLSA 5FZGA 2VR4A 5LA9A 1NXMA 1OBNA 1SBEA 3KF3A 4GALA 4GH4B 4XUOA 3LAGA 3WG3A 3I2IA 3ROUA 4IEXA 2WS92 2GH8A 4YVWA 3L2YA 1HRV2 1LGBA 3LFMA 1ASJ2 5FBJA 5FPLA 2EIBA 3WINE 4AQ6A 3PUAA 1NY72 5JVVA 3BIWE 4KGQA 4OUSA 1MR5A 1CVNA 4OHZA 5JOZA 2PHTA 3NV1A 5EQUA 5LASA 1WD4A 4LO8A 2WDBA 5GZFA 3AB0A 3ZFEC 4TTGA 5JI9A 3TRSB 2FMDA 2WINB 1GOHA 5HCHA 3ZMOA 2W9XA 4XFAA 3E6DA 4ISQA 4Q4V1 2A3YA 2UYAA 3WW2A 2RDQA 3M8LA 1WBLA 1EAH3 1Y7BA 3VD4A 4KG8A 2NZ9A 3WDVA 5JXHA 2O0OA 1F5FA 3Q9OA 1RUC2 1H2MA 4XAAA 1H1IA 4XHXA 5FTTC 2PHRA 4AR2A 2I45A 1CIYA 4UFIA 4YG3A 4Y1VA 3H9AA 3OYWA 1ALYA 1HRV3 3HQXA 4YVSA 4QWNA 3KT7A 4JGZA 3BB6A 1RMU2 2VZUA 3NWKA 5A3NA 2G4IA 4LBQB 1PGL2 4QGMA 1F9KA 4K40A 4XF0A 2VW2A 4ZU7A 4DB5A 2XQXA 4AQTA 4R52A 4B1MA 2VVEA 1NXD1 5FYYA 2ES3A 2JDNA 3LA7A 4XACA 5T5OA 2WT2A 1F2NA 4J1WA 5DXDA 1NZIA 4QQOA 5DN2A 3T4HB 2P6CA 2QQVA 2CY6A 2RM21 2UY8A 1JBCA 3PIJA 3N9MA 5I91A 3TBDA 3WQ7A 4M01A 4QXKA 1LULA 1ZZCA 4GWNA 3WP5A 4LA3A 1BBT2 4FFGA 4OHWA 4DPNA 5A3LA 3VL8A 4YFZA 4YVWC 3A4UA 3USUB 1LTEA 3SKVA 4OI0A 3GBWA 4QM9A 3ON7A 4HK9A 1F35A 1MEC3 1QJZA 1W6OB 1BEV1 1XNCA 4OMDA 4WM8B 3U0ZA 5C6CA 4GB32 3DKWA 1R082 1W6NB 4COYA 1NQDA 1AXZA 2P3YA 4QT6A 3VDAA 4AWDA 3TB0A 4Q4Y2 5L9VA 4A2UA 3DGTA 4FAGA 1HRI2 1SCRA 2B9VA 4F7ZA 1H2KA 1RUG1 4AVCA 5J36A 3BYWA 2R072 4YZ3A 1J59A 1STMA 1ZVFA 3ZMNA 3CEWA 3INAA 3UV9A 2Y34A 3CIHA 2ARAA 4YSFA 4P02B 3S30A 3FUQA 1UYZA 2HWF2 3PTRB 1BBT3 1HB3A 2ZEZA 1LESA 1TNRA 4FTEA 4YVSC 4LO7A 5HCFA 4FPYA 5DABA 4JGZC 5LZ6A 4IETA 4N53A 2VG9A 1AYM1 2N7GA 1S0BA 2PAKA 3AMMA 2FDJA 4CP1A 5AC91 3P1IA 1CN1A 3TEYA 1EV13 3IIIA 1RUNA 1H6YA 1KDKA 1UQXA 2NLRA 5JPMB 2VMIA 2QQMA 3IIAA 1REDA 1H2LA 4CDUB 4GZ9A 3NJZA 3RPQA 4L99A 5DQ0A 1H1MA 5CISA 1C57A 2DFCA 2IXKA 2PQQA 4FPHA 1Q3EA 1GZCA 2OPWA 4FP2A 1P8JA 3O7OA 3O1PA 4M0HA 1DU3D 2HWF3 2JDHA 3HN1A 4LE3A 2E9QA 1VB2A 1E5IA 3DYPA 3FHQA 1HKDA 1CZTA 1SBFA 2IXCA 5ISLA 4Q8KA 2W91A 2BUKA 3N36A 3F2ZA 1CAWB 1H9PA 5LBEA 4Q8LA 5F6KA 3HAGA 2P1BA 4LORA 5FP7A 2HEYF 1UU6A 2HWC2 1RHI1 2YDEA 4YARA 4LBQD 5FZFA 5J1XA 1QJEA 3NJYA 4AAPA 5I0RA 1AF9A 5DPNA 4FQ4A 5LWBA 1LU2A 2QZ2A 3RDIA 4RSUA 3RWKX 2C1FA 4XJ9A 2DTWA 2AUYA 2RMU2 3APBA 2VVDA 3I2GA 2QQOA 2WZEA 2YU2A 5FOBB 4BMBA 2RHPA 1APNA 1QJY1 1SDDB 1LHNA 2HJIA 2XB6C 5FZCA 4CUGA 2CDPA 3JQWA 1CR7A 2E7QA 3MF6A 4BK5A 3FBMA 4TXWA 3KLSA 1OI6A 4NHLA 4WVMA 2E26A 1RUJ3 1LHVA 3VD7A 1N47A 4N53C 4JKKA 5FPVA 4L97A 3VZNA 2JE8A 4Z2WA 4HFSA 3BTYA 1A6CA 4KH9A 1JZ6A 3KHCA 4UW4A 3HQRA 2HWC3 3EJKA 3ZN6A 4N9HA 2HWB2 2ORXA 3RWNA 1K42A 4D8MA 1LECA 1JYCA 3I7DA 3JQXA 5L19A 4CDXA 1V9U3 1XQNA 2ZMKA 4R9BA 4XFHA 5JLVA 3KV5A 3S57A 1H6XA 1W8ZA 4LUMA 4XQ4A 1PO11 1QDOA 1S1AA 4BISA 3NNJA 1LB2A 3MW2A 4ISRA 1JXNA 2WLPA 4ZXKA 1LENA 2WWUA 2W08A 4L9BA 4CDQA 1R093 2XHNA 2R1BA 1BLZA 4PHZA 5GLWA 1L3JA 1RXFA 2GNDA 1H9WA 4PBOA 5BNNA 1IG0A 1W2UA 5FYIA 1W8UA 5JIUA 4YRDA 1V6NA 5J09A 3KD4A 2WIIB 4ZHNA 1W3XA 2QUOA 2WZ8A 4YG6A 2YZ4A 3W59A 3GZAA 4QX5A 1LOCA 5FP8A 5C3PA 1F4HA 4M4RA 3NL1A 4NHKA 4Q0SA 2JDKA 3M3CA 5DUUA 5FZ4A 1QXRA 1SHWB 4D3WA 4H3WA 3U4XA 4JTNA 1D7PM 4LA2A 4Q0PA 3O1MA 1W0OA 2D3RA 4GKXA 2WNUB 3V0BA 4YZ1A 1HV1A 4PIYA 5FZBA 3WF1A 1UOBA 3PU8A 1S0GA 1DDLA 2R49A 1AL0G 2BRTA 1FMD2 3VKOA 4AI2A 4Q2FA 4LULA 1RL3A 4D69A 3VHRA 4P9IA 4QPGB 4EN9B 3HT2A 1HRV1 4DY5A 1C8M3 3K4AA 1E57A 1GFF2 1O4YA 3USSA 1W6QB 4BWOA 1PMIA 3LKJA 3DYOA 5KXCA 4AI8A 2BWAA 3ZXDA 3IAPA 4OHYA 3MPBA 4CDXC 3POJA 4OQ8A 4GKYA 4RL7A 1WLDA 1YLLA 3OPWA 1QQP2 5HV4A 4YWAA 1DHKB 4IV3B 1LOGA 1COV2 3IKWA 4QQ2A 2X05A 3S7EA 2VOVA 3SH5A 5KHGA 4CDQC 3DPRA 4EWAA 1FOD1 4AVAA 1YFYA 2EVXA 3PUHA 4FPOB 3H3UA 5BNNC 5IK8A 1OOPA 4L11A 1CESA 2FBEA 1FMD3 2DCZA 3AKPA 4P9GA 1PO22 4FOQA 2Y6FA 3BTAA 1UAIA 4RR3B 5I0SA 3M2MA 4B7EA 5FZOB 2XG3A 1MEC1 2QCSB 4P9XA 1I5PA 3C8XA 3EBRA 2P37A 2VO5A 3LGRA 5FY7A 3CQOA 2WNUC 3VBUB 4UYBA 4O61A 1WMDA 4M4PA 1R1A2 4Q27A 2D6MA 3H7YA 2GP3A 4R4ZA 2F4PA 3WG2A 2R062 3WUCA 1O4TA 3WW3A 3POWA 2A6ZA 3MDPA 2PYTA 3RMYA 2DURA 1QF3A 1RUI1 1GR3A 1UXXX 2EXJA 4MV2A 1AR73 1W8FA 1WUVA 3NW4A 4E8DA 1UKRA 2J1EA 1JTZX 4Y22A 1VRBA 1WCUA 4JKMA 1DQ4A 1IOAA 2Y6JA 4PQ9A 3UKNA 1UIJA 1RVF2 4P5YA 2VTXA 2A6WA 5E88A 1LJ7A 1YQ8A 3MF9A 4AGRA 3Q8EA 1QXPA 4NPMA 4MGZE 1LNSA 4QB1A 3TEXA 4XC9A 4UXAA 3NV2A 2X09A 4WM7A 4KBBA 3ALQA 1ULEA 1UY0A 1PNFA 1PGW2 1R1A3 1EV11 2ZX4A 5FQ0B 2GNMA 2YBSA 3ENRA 4IEWA 5DMYA 3LA2A 2Q0AA 5FWEA 5J7MA 5EFUA 4OCTA 3OUHA 4OYUA 2A71A 3DPRC 2IZWA 4FPGA 5JR7B 3PVOA 3OY8B 3ATGA 4XPVA 4AK3A 5FZMA 2R0HA 1GICA 3PMEA 1OOPC 2ARCA 4UFHA 4OVEA 4YFWA 4CA9A 1QGLA 4CSWA 2HWF1 3OEAA 1MS3A 1RVF3 5C9AB 2BPA2 2D6LX 2OKXA 1DP0A 2O1QA 1WKYA 2ID4A 5JCTA 3MYXA 3KT4A 2BOJA 2GNBA 2XLGA 4W50A 4IERA 1MS5A 4HKWA 2WYFA 3HJRA 5F5IA 3HN3A 3KQRA 4X6RB 2GZWA 4CCKA 1PM7A 3RYRA 5CKNA 5IVFA 3C3VA 2P34A 5FREA 2O8QA 2ZGLA 3LEKA 1J1TA 5CFDA 4PI2A 4I0BA 3RZGA 5FCCA 2UU8A 1D0GA 1W90A 2ZA9A 4QD2A 5A32B 4XCAA 4B4QA 2K0GA 5KC6A 2CGNA 1OD5A 1SPPA 1ZBE2 1QH7A 2VPVA 3T1MA 1ND2B 2AENA 3HEIA 4H2AA 1AR63 3HT1A 4XMIA 5HCBA 4A7KA 4PJYA 4K20A 2VL4A 4YG0A 1JYTA 5FKCA 4AEKA 2P17A 3A0NA 2FCTA 5DZEA 2VZ1A 3O0VA 4MZUA 1RUJ1 2GMPA 1IKQA 2X5IA 1CAUB 4AEJA 1AL21 2BGPA 1O6UA 4WM7C 2BGCA 3ORJA 2JECA 2XBO3 2HWD3 4FPFA 1W9YA 5HV0A 5JZGB 4JGYA 5JPNB 2Y6GA 2ZMNA 5FXXA 2B46X 2DUPA 1Z7S3 4NIAA 5FXWA 3RI9A 1LHWA 4XE9A 3KT1A 2FDIA 4COVA 3MIEA 4HG6B 1DCSA 1SMVA 1V9U1 1MQTB 5C4WA 4FOYA 2A70A 3HBKA 1VRH2 1PVC3 4MHRA 1ZZ6A 1TZOA 2FHRA 3ACHA 4JV4A 1VIWB 3H1WA 4ORFA 4QHOA 4BQXA 2JD4A 2JD9A 2JG9A 4JAAA 2BP6A 2BU9A 1NA1A 1RUF2 3VBSA 3PURA 3N7JA 1R091 4MLOA 5A3MA 1LR5A 3C2UA 2GH2A 3P3PA 1NE6A 4CCEA 4F8AA 2BBAA 1ZBA3 4YW4A 2PLV3 3VZOA 5LEKA 1HX6A 3BGAA 1JW6A 4AFMA 2GALA 2PHWA 2VQAA 4AI0A 1A8DA 3UGHA 2QKDA 1XNAA 1FNYA 2FDHA 1Y9GA 4HVOA 1A34A 2O8OA 1JMUB 1IQDC 3ZPOA 1HB4A 2WA3A 3WG1A 5ABJB 1K3IA 5M0TA 5LA2A 1UY2A 4E4DX 5CFDC 3VBRB 5FYCA 1JZ4A 2WN2A 1GP4A 1QOTA 2OQ7A 4HKLA 1RITA 2ETEA 4GMP0 4S2GA 5FIXA 5FZIA 2ZX2A 4DS0A 5D8AB 1AX1A 4CTEA 1KJRA 4KNCA 4QPYA 5C3SA 1GWKA 4AFDA 3FLPA 1W6PA 4NJ4A 4MSVA 1UO9A 1HQLA 3ST7A 2YXSA 4CP9A 2R30A 4Q0VA 2X5IC 3L2HA 4FVVA 2BEOA 2VVFA 3MIGA 1SFPA 1W8WA 4NIIA 2AR6A 2DVAA 4JGYC 3D8CA 1C8M1 1W0NA 1QY4A 4E4ZA 2XUMA 4IEOA 2ZPXA 5LW9A 2VBPA 5IAVA 1O3SA 1NUKA 1XNDA 5F39A 5C4WC 4DQAA 1LOAA 1RUD3 2AH2A 4JRLA 2ARBA 1AJOA 3MW4A 2JG9C 1GNZA 3N7MA 1NA1C 3VBSC 5J96B 1YI7A 1QKQA 3IN9A 5EZWA 2UWCA 4LXLA 1DQ2A 4HXCA 5FP9A 4AVSA 2YYOA 2ZGPA 4U2AA 3C7HA 3ITQA 4N7IA 4XIKA 5C33A 2Y64A 3B9IA 4YYOA 2VNGA 5FWJA 3OBRA 2XKOA 3A23A 4BIOA 4EQVA 1KQRA 2GSYA 5EJ3A 4Y1ZA 3U4SA 1W8TA 4FBFA 2D5HA 3HNMA 3TAYA 5C70A 5FRAA 3RZZA 3MBWA 3UKVA 3HD8B 1ZRFA 1V0AA 4RQPA 2BGOA 1ULGA 3D3AA 3VLBB 1EUTA 1U5IA 2W0XA 3C7OA 1QJX1 3AM2A 3G7DA 3IBMA 4XABA 3ZYJB 1GV9A 3RS6A 2DUQA 3P3NA 4XMAA 1FPN2 1QEXA 4Q4W2 2PHFA 1AR71 1FYUA 2WJSA 1HLCA 3U75A 1C8NA 1DZTA 3DF0A 4XQWA 3WDXA 3WQ0A 3WD5A 2W39A 5IYYA 4O7XA 3LEIA 4QX1A 4XURA 1VBD3 5FZAA 2PTMA 2DU1A 5IVEA 3AL6A 5BV6A 5A7QA 2CWSA 4R4XA 1JOPA 2BWCA 2W92A 5A6YA 4HOOA 5LK7B 1VMHA 2Y0IA 5AFEA 1TEIA 4CPBA 1XRUA 3CJIB 2XKPA 1OT5A 4Z1VA 1AVBA 3J7HA 2BDRA 5CZKA 3DUIA 3IWZA 4TZDA 4IEZA 3ZYRA 5E1RA 2FQPA 3AP5A 3ILFA 2V4VA 2BOIA 1UOJA 2DTYA 1U12A 1CX4A 3NAPB 3PHMA 3TNQA 3A21A 3FUOA 4Q4W3 2EIGA 5FXVA 1QU0A 3POSA 2JKBA 3KV4A 2BYVE 1VE0A 2KD7A 1KS5A 1QDCA 4IV1A 3E97A 1YYNA 3MUY1 3VV1A 4QKBA 4W4ZA 4UT5A 1KXGA 4NMIA 4BYYA 2VXJA 2WNVA 3I59A 1JZ5A 4NPLA 2ZGKA 2UYBA 1S0EA 2ARXA 2VULA 1D2QA 1FX5A 1PGW1 5B4XA 2JJ6A 4RQPC 4AHZA 1ZRDA 4C1XA 2P3IA 2UWBA 4XQDA 5F3IA 3WVJA 5A7PA 4JDNA 5DAPA 4CUCA 3O0XA 2E32A 2JDZA 1LEDA 1JU3A 1CX1A 1UXZA 3TNPB 4DY3A 1H8TB 3EQEA 1GOGA 1AR61 2XWBB 3LEMA 1YNAA 2YG0A 2PAMA 4ASLA 4C90A 4CEYA 2YBKA 4HPKA 3GYDA 1JYNA 1US2A 2NYYA 2JWPA 4QKDA 2ZBJA 3MIHA 1JYWA 1OPOA 2XBO1 2HWD1 2IFWA 2Q8OA 5JXIA 1UMZA 2ZGQA 2FDGA 2W68A 4FO9A 4N8MA 2XJTA 1Z7S1 3MUZ1 4NN0A 4OZXA 3VHPA 2PELA 4XUPA 4LKSA 4K1ZA 4QB2A 1O8SA 1G8WA 1ULDA 4XF3A 1LAJA 3O14A 3PNAA 1DIWA 4CE8A 2W46A 2VQTA 3KZ4C 3V64A 1PVC1 1RGSA 2LM3A 3WW4A 2XJRA 5A7WA 4PLNA 5FPAA 3O1RA 5CADA 4B4RA 4IV1C 4XF9A 3LQCA 3ZFFB 4BXFA 4B7KA 2R042 3JD73 1VBE2 1WWYA 3FHIB 3BALA 5BXXA 1ZBA1 2PLV1 2WNEA 3E1F1 4ZY9A 4E8CA 1ND3B 1HJFA 2WNVC 5FY4A 1GP5A 5A3UA 3B94A 3MFAA 4H14A 3S7IA 4PBPA 1TME2 1JHNA 2VQUA 3POYA 4FPJA 2O14A 1SLCA 2QNKA 1GKBA 3UETA 2JG8B 1XSQA 2VZRA 1SCSA 2G19A 5HCAA 2LS6A 3MW3A 5IJRA 3N7LA 1IHMA 3ZSEA 4PT6A 4AFBA 2DCYA 1LOEA 2K9ZA 4K8RB 4TYSA 4XVHA 1W6MB 4P9JA 5JOYA 3VBHB 2Z69A 3D0SA 1GZWB 2QQWA 1TMF2 1IS4A 2R043 4WZCA 1Z78A 1VBE3 4OLLA 1T6BX 1H8VA 1UZ0A 3SQOA 4A7YA 4CEYC 3WLUA 2RS12 2ZHMA 3THTA 2XUEA 4DIQA 1N3OA 3K4DA 1O3TA 1DLLA 1TVGA 2W1UA 1RUH3 4K7JA 4R9DA 4Z8BA 5L7OB 1CAVA 1ENQA 2HEWF 3H8OA 5FYSA 4OI1A 1LRHA 4DUVA 3QLQA 1JZ7A 1VPHA 2TBVA 4LKFA 1OVPA 1C4RA 3LF7A 4OULA 4YLZA 2EA7A 1F4AA 3ZSKA 2BBVA 5JDBA 3AC0A 1AYN2 3D82A 3IZOA 3PLQA 1I3HA 2JEMA 3KHBA 4K6BA 2B45X 1S0DA 2DF7A 2J42A 1RUD1 1GZ9A 1AR82 5T54A 3SCGA 4AOCA 3C7GA 3ETQA 1Y3TA 1MPXA 1GU3A 5FZ3A 3POIA 4D7SA 2JX9A 1VJ2A 1OH4A 1YIFA 2VCAA 3Q8AA 1GANA 5GALA 3VBOB 3IB3A 1MZ5A 2WFF2 3HR9A 3NNLA 3PIGA 5L9BA 4URTA 4LOSA 1D4M3 3OGSA 5FY1A 4AGGA 1YIPA 3IMNA 5IVCA 2BQPA 5CFCB 2RS13 2EXKA 3V0AA 4YW1A 2GC3A 4QDSA 1Q43A 4ZS3A 2R32A 1EYBA 3UT0A 2XLFA 3T2OA 2W94A 5FZ1A 3V65A 1ACCA 1JOJA 5A1FA 4MGYE 5FZ6A 4AEDA 4YZ2A 1G9BA 2PHXA 3QD6A 1X9PA 4NRPA 1C28A 3LOIA 3IMMA 2ZGRA 5EYXA 5JIAA 2XVLA 1NCRB 2PN5A 2XJVA 1HXS2 4PLMA 4MGQA 2WS93 2PHDA 1CJDA 4K9SA 2WLQA 1ASJ3 2DVBA 4UFLA 3VHOA 2WFF3 2FMYA 5J3UA 3Q8FA 1ZZ7A 4EN8B 5FR3A 5K0UB 1ONAA 4AFCA 4UWDA 1EPWA 2A1XA 1WMEA 2WQ4A 4YM1A 1K5JA 4CDWB 2Y26A 3GJAA 5IFTA 2WYSA 3RYPA 5A7SA 1VBD1 5CNAA 2XR4A 2C9AA 3PVEA 4FPCA 3ZKYA 1G9AA 4MXWB 4QU1A 1VB4A 2GC1A 3VKLA 1R1ZA 5EV7A 3W58A 2HKXA 2R6QA 5BNPA 4WVWA 5HXVA 3HVDA 3KSCA 4XFFA 2QJVA 1G86A 4DRRA 1RUC3 4FPLA 3OF1A 1J1LA 3TN92 3GBFA 3OBZA 2BNOA 2YFZA 1S0FA 4DOUA 2VW1A 1RMU3 1Q8QA 4Y4YA 5A33A 4Q4W1 3BTXA 4AGVA 3T4VA 4YNIA 2WQZC 4N43B 1PZ7A 2MEV2 3J8F1 5KXEA 5JMOA 3K3NA 1RUE1 1MZ6A 1O5LA 2C24A 1FXZA 4FT8A 4TSVA 1BYHA 5F5AA 3JB8A 1VLNA 1PIV2 2EICA 3SEEA 3ZKUA 1ODNA 3WQBA 5F8PA 4ET7A 4S2HA 4EWEA 3H42B 2GP5A 4FFHA 4XDOA 1VAMA 4PI0A 4AEDC 1M06G 5DZGA 2JKXA 4YZ5A 3AP7A 2WZPP 4QGNA 4C0HA 2CYFA 5FPUA 3ZDSA 3VZLA 1V6JA 1QOOA 3MIFA 5LRRA 2DCJA 1WW6A 3VKFC 4AFAA 3N4MA 1FATA 1OA4A 5DDJ2 5FLJA 2D44A 5C8CB 3HBZA 1E5RA 2Q1ZB 2B4KA 1F8VA 2FDFA 1B09A 5LATA 2VMCA 4GB33 5KHJA 1QNWA 2XQRA 1R083 2XJPA 4RS5B 2WNOA 4Q4Y3 4YM3A 5FMOL 5FYHA 1N1SA 3FJSA 1XJAA 2D6NA 2CHHA 1HRI3 3G6JB 3JBG2 1MZFA 3NNFA 2C4XA 1PIV3 4JZRA 4XHBA 5LRSA 2R073 2WN3A 3LEGA 3ACFA 1YC61 1OD3A 1I9RA 5BNPC 2JDYA 2OZ6A 1YRZA 4FXKB 4NAMA 4UW5A 1DG6A 1LKNA 1RJ7A 4UBGA 1HW5A 3IDBB 4DXRA 1JZ2A 1MS8A 2WO7A 5LBBA 3HWJA 4AVBA 2X53S 3BOPA 1SLLA 3AVRA 4HZFA 5FP3A 5H9PA 1VBB2 2EIDA 1ZRIA 4I01A 4QAWA 1GQHA 3EB7A 4DXZA 1J58A 3EYPA 5BNOA 4MXVA 5JR2A 1U0AA 1TQ5A 3I2OA 3JD71 3VBFB 1B35B 1R64A 2B9UA 2RVAA 4LEJA 4JHTA 3T2TA 4CEWA 3FX3A 4JQRA 3AFGA 2Z42A 1NCQA 4IGPA 5F9TA 1ULCA 5CBLA 3SEPA 3NQHA 3SHRA 2VNRA 5CAZA 1XE8A 1XNTA 3ACGA 2ZHLA 4QX3A 2QQKA 4OFGA 1OUXA 1L7RA 1OHFA 2JENA 3IPVA 4CCMA 1UPSA 4Q1RA 3WP4A 3ZFEB 1AR92 2RDNA 4IGOA 2VCBA 2ZXQA 1VBB3 1VBC2 2A7AA 1H30A 3RZKA 3OSDA 3ZXFA 3R4SA 3AKQA 1W2TA 3ILNA 1IS3A 1ZRRA 5DAVA 5FMOS 3UGFA 3W5MA 5FYVA 2RS32 3SCHA 2GN7A 5L9RA 5FZ7A 4YZ4A 2ZGSA 5HPOA 4AVVA 1WW7A 1RUH1 1TG7A 5EJZB 3ZYBA 4P9YA 2RMU3 3OUIA 4HBNA 3VN4A 3WW1A 4BXSV 4ASKA 1JZ3A 1DBNA 3ZYIB 1PX4A 1QHDA 2A3XA 4PDWA 1JYVA 1V6IA 1AR93 2HYKA 4GXLA 4ZS2A 5FV3A 3K51A 3KQ4B 4CXYA 2QFEA 5BNOC 1JS9A 2WSUA 4MHUA 3UL2A 2JDPA 4C91A 4QPIA 2HWB3 4MYEA 1D4M1 3NV4A 4IEUA 4CEWC 1CPNA 2D6KA 1NCQC 2XL7A 3DV8A 5CG8A 1J3QA 2ET1A 3D4KA 4IESA 1RIRA 2VMEA 3OD0A 3THDA 1WGPA 3CKHA 2CU5A 3SC7X 4MGTA 4Z92B 1I6XA 4YVWB 4FAHA 2GNTA 2K2SA 4NWVA 2H6CA 3AKTA 2VAUA 1HN0A 1JU4A 1EAH1 2W5FA 4M3CA 5J48A 2OT7A 1UZVA 4QM8A 5IK5A 2L9LA 4LKEA 3LIHA 2HWE2 2J1SA 4XDQA 3RNSA 2WS91 1CIWA 2VUAA 4A44A 3WNMA 4QDRA 5A1AA 1ASJ1 1UX7A 4JDMA 2BNNA 1VAVA 2GC0A 3L9JT 1NY71 4XW3A 3VKMA 5A70A 4XYXA 1BK1A 1PK6A 4CCCA 1RYYA 4M3CE 4AHXA 2JICA 5GM0A 2YC4A 3F95A 3AYAA 1WLTA 3ZFGA 1K5MA 1ENRA 4MH0E 3OYWB 1W39A 4YVSB 3UKTA 1UPIA 2AYHA 3AMQA 2AZ5A 2VE1A 4JGZB 4ES9A 1GZTA 3K75B 4PDWC 1Q8OA 3U37A 2JE9A 4OHXA 3U14A 1RUC1 3ZYPA 1UY3A 2YC0A 5F7UA 1POV0 1W0PA 1YFXA 1UZWA 2NM1A 2HWE3 2R16A 4I3GA 3BODA 5A7OA 3ZXKA 4QQHA 4Z07A 1LOFA 1LCLA 4QPIC 1RMU1 3OD4A 1RUOA 1PGL1 1OUSA 3C7FA 3I8TA 1JN2P 4FCAA 4J6GA 4YW6A 5F32A 5FJHA 2RS52 1UKGA 3DYMA 1UX6A 4Q29A 1GNHA 4OZOA 4WV8A 4X8PA 1O59A 3BUCA 1QQP3 1UU4A 5C5UA 1XOYA 2SLIA 2WFPA 2W87A 2DV9A 1COV3 4EN6B 1KGYA 2DVGA 3MFCA 4AW7A 3WZ1A 1NE4A 4BIFA 4A41A 4WZFA 3WX5A 2Y38A 1OF4A 1UYXA 1DGRN 4RGAA 3VB9A 2IXLA 1ZA7A 1ZRCA 1O3RA 4H7LA 1BBT1 1PO23 2I07B 3KCXA 1GP6A 3QH6A 2E6VA 2C26A 4R8HA 4O9GA 1YXWA 4M00A 3K3OA 3T08A 1OFNA 4D94A 1AHSA 3WR0A 4UFJA 3LZZA 4GB31 3ZOIA 3I2JA 1PK6C 1SFNA 1CAXA 3QBQA 1R081 4IEVA 2E7AA 1W03A 2RS53 2BFUL 4XUTA 4PLOA 2R063 4QKFA 4Q4Y1 2VMGA 2JIGA 1HRI1 3WT3A 3ZFGC 1K5MC 1S4CA 5DAXA 3VKNA 1REEA 3OG2A 2R071 2AGSA 4GJYA 3SH4A 3DL3A 5T5PA 4N53B 1TE1B 2WL1A 1YWKA 1S2KA 4IEYA 3UK9A 1QJFA 1QJU2 3AX4A 5FO8B 4AXOA 3KF5A 3WDUA 1Q5OA 3LCPA 3OOXA 5A3WA 4LUKA 3MZHA 2A6YA 3ZLIA 4KBZA 1JODA 1QMJA 1JUIA 1LOFC 4QXBA 1UD1A 2YU1A 3KS7A 4XUQA 1HV0A 4L0PA 3PMSA 4Z82A 2TUNA 1QNYA 1DQ5A 4ZZ5A 4QPWA 1RC6A 5TSWA 4CXXA 1J3PA 1RINA 4DINB 4CVUA 5FYTA 3UESA 3HIFA 3ZO0B 4MGKE 1O8PA 5F3GA 4B8EA 1OQ1A 2P2KA 1YFWA 5GJ6A 3TOJA 3WNLA 4XFGA 3HPNA 4MGSA 2JB8A 4FFIA 4TLFA 4PCRA 2ZTNA 2VXRA 2WQ8A 2E33A 2D3PA 2KR2A 3V56A 3S0MA 3JCIA 5A3PA 1E5SA 2CTVA 4YPJA 5J98B 2VZPA 4IE7A 3VL9A 2VECA 4A6SA 1HB1A 1WA4A 2AC1A 4LJHA 4IE5A 2VOTA 5LB6A 2XMLA 1DYKA 3B7MA 2TNFA 5DUWA 2HWC1 2DFBA 1WMXA 3E5UA 1ZZ8A 2XWJB 4CU9A 3S6PA 2IVIB 2ZACA 4Y4RA 1SG3A 2DU0A 2LW8A 2ZZQA 3DKQA 4WVMB 5IVVA 3VZMA 4Y20A 2MPFA 2RR12 1OVSA 2RMU1 3I3QA 3J9SA 3MIBA 5IHRA 2W1QA 1ZBE3 1D2SA 4IE0A 4QGLA 3ZN6B 3I3MA 3SLIA 1DGLA 5F5QA 4GMP3 4V2WA 2YUEA 3AJZA 4Q4X2 1LU1A 3IM0A 4CDXB 2RJLA 2W1SA 3GZTB 1BVVA 1IS6A 2WRAA 3M3OA 4U36A 5DAQA 1NYWA 3WQ1A 2A6VA 2KM2A 3VZKA 5FJKA 1HQWA 1S0CA 1FAYA 2WZR2 3LSDA 2HWB1 2QQUA 4YM2A 4CDQB 1A8MA 1QXJA 5JSRA 2G9GA 5JXGA 2ZAAA 4XJWA 3T09A 4BZ4A 4ATFA 1UYYA 1G9CA 4CU8A 1F15A 3KMHA 3SITA 5BUVA 5AVPA 3GNEA 4H55A 1G7YA 4MGIE 4QXCA 1YCIA 5BNNB 1VRH3 4Z2AA 5T3NA 1RB8G 1OPMA 3ZYGA 2FZ2A 2VNVA 2RR13 4JC1A 4CCOA 3I54A 5ANQA 3PU3A 2DUOA 4IE4A 1RUF3 2EALA 4D7TA 1UOGA 3ILRA 1U5YA 1YQ2A 1KRIA 5JMCA 5HXMA 2EIEA 1BK0A 4RHV2 4LQRA 4LTAA 4CP0A 3ZN5A 3GDBA 3KCCA 4EWDA 3THCA 3VDDA 4WVVA 2CL2A 4I3PA 1JYIA 5KWRA 1AJKA 4DNYA 1BJQA 4B1LA 4GQ7A 5DZFA 2VZOA 3U11A 1ZA4A 2QZ3A 3WY6A 2WZR3 4IXLA 4CCDA 3NRUA 3V0BB 4GD4A 4CCJA 1IZ3A 1XC6A 2JDUA 5LCWL 4NVPA 3WEZA 4IQPA 4A4AA 2IXIA 1OSGA 5GZDA 2D97A 2OQ6A 3CBNA 5F1RA 4GH4A 3LDBA 1S0JA 3WSOA 4I02A 4RGGA 4A7ZA 4HK8A 4XBLA 4Y5SA 5FK7A 4ES8A 3R05A 4KWLA 1W2AX 4LK6A 5IT6A 4HSLA 4Q4V2 3E6BA 3RRDA 1FMD1 2J7MA 2VOWA 1IS5A 3C7EA 3A22A 4XF4A 3I3BA 4GIQA 1W28A 4COUA 4CCLA 3GCXA 3BU7A 1YEWA 1IG3A 3R6SA 3DPRB 5GKAC 2HBTA 4YGEA 4DXSA 5C3QA 3RMXA 1CWPA 1OOPB 5E8AA 4NAOA 4D7YA 5LY2A 1AX0A 1W9WA 3PUQA 1QQP1 1AXYA 1PMJX 1DGWX 1YHFA 4URAA 2ZGUA 5JSOA 3AZZA 4ZU4A 3H1YA 1COV1 2ZEYA 4DEQA 2W3JA 5LK5A 1XXNA 2A5ZA 3CZUA 5EXOA 2C9KA 2VUCA 5FDBA 4BB3A 2XGXA 4MVTA 5FLIA 2CV6A 4J25A 3UJQA 2JDMA 2VUJA 5GLVA 4FTBA 3VDDC 4BQYA 1BXHA 1J3RA 1Y9QA 1PO21 2OVUA 3NV3A 4LBQA 1SLAA 4QX0A 2JB4A 3MPPG 1IPKA 1XB9A 3PDQA 4KWUA 1JUHA 2B5HA 3LA3A 4LHLA 4QHZA 2KA3A 5FZKA 2VUDA 2CDOA 2YGMA 5AVAA 5FZ0A 5IATA 3WF0A 1NOVA 2ZX1A 1R1A1 2ERFA 4BQ2A 3HOBA 4N9IA 4Y22B 2R061 3D5OA 3J7MA 4NHXA 3T2QA 2XDVA 1OQDA 4B4PA 4GH4C 4N90A 2DBNA 1W9TA 3WXPA 1ZZ9A 1H1AA 1H4GA 1G6NA 1FPN3 1JH5A 2VMDA 4UFKA 2B8MA 2Y6HA 4WM7B 5A7NA 2CGPA 1UOFA 3USUA 4Q0QA 4ZXEA 2ADEA 3UNPA 5E16A 2Z5WA 1RUG2 2W95A 3CDZB 4NR1A 2G9ZA 4HMZA 1W6OA 2CGOA 1Q8VA 2QBXA 4WM8A 4SBVA 1LODA 3H50A 2XONA 1RVF1 1BZWA 3A0KA 5B4NA 4C1WA 2J1UA 1X50A 1W6NA 4XJZA 2WWJA 3OCPA 3QOPA 3K2OA 4SLIA 2D3SA 4FOVA 3B02A 4D6SA 1VALA 4AQSA 5LBFA 4BQ3A 3RVHA 3KCYA 4MADA 1XYOA 4UF0B 1AYM2 4MO3M 3AP9A 4NROA 5AC92 1H0BA 3KV9A 3E5XA 3LPFA 2LROA 3NNGA 4GA9A 4L8QA 4LITA 4AAXA 4LHNA 4AI9A 3ZYHA 2WSVA 3SMHA 1JOBA 5C71A 4NHYA 2UURA 2WKKA 3BI3A 1WBFA 1PX3A 1V6OA 2Z79A 3ES1A 4LBMA 1WD3A 4ZONA 2YHJA 5EHDA 5CFDB 1FV2A 1MVQA 1O91A 1XYNA 1C1LA 2GMMA 2WAOA 3RSJA 4MOAA 2ZHKA 1W3VA 4CDUA 3A7QA 1Y43B 3AMPA 3CO2A 5CKQA 5G04L 2ZZJA 4PQQA 3VD5A 1SPPB 5FZLA 5JSPA 1SLBA 1T2XA 3N7KA 4A42A 3O1VA 4LHSA 5AC93 1N3QA 4AZZA 1CPMA 3EXUA 2X5IB 3HMYA 3BKZA 1RHI2 3OB8A 5FPBA 4HT1T 3VZJA 4AEMA 2D6PA 2AACA 4JGYB 1ZBE1 1XBFA 4P9LA 4WM8C 3LE0A 1CAWA 2Q30A 4XAEA 4GMP1 2GU9A 1DQ6A 1KJLA 3BTZA 1T6GC 2PHLA 2YC2A 3AXDA 3EMRA 3W21A 2AEZA 2HYXA 2VOXA 5C4WB 2ZEXA 4AE2A 2WA4A 1EY2A 1BKZA 5E6HA 4CU7A 2WBKA 4RD7A 2YB7A 2OUJA 1JZ8A 2UY9A 1I5ZA 5C8WA 4LE4A 2JG9B 3P5BA 4K3UA 1NA1B 3IDCB 3VBSB 3FLTA 3JB4C 4Q26A 3RZMA 1DZRA 1J83A 3I3DA 2OA2A 5H9QA 1UZZA 3WF3A 3POEA 2VNOA 1LHOA 3B93A 3I97A 4NRQA 1MZEA 3WNOA 1VRH1 1SQ4A 3MLJA 1DF0A 2YPDA 4KWJA 3WNKA 2RR11 1UU5A 2ZGNA 5KHIA 1RUF1 5ANNA 2PXJA 4NWWA 4E2GA 5F3CA 1PO12 4QX7A 4S2FA 4I09A 2XH6A 5SV5A 1XE0A 5EIYB 2WT0A 5FYMA 2JDAA 5JI7A 2C0ZA 3D6EA 3ECQA 3THPA 2RJKA 2SBAA 4AYUA 1TME3 3I2DA 3O12A 2QQJA 4BMEA 2WO2A 4CDUC 3AFKA 1WLCA 2ORZA 4CZSA 1OURA 5JOXA 2J1TA 1W6PB 1DYOA 2QTWB 1OA3A 3ZIWA 4LO4B 5GLTA 1H2NA 1ULPA 4CP9B 4LLOA 4CCNA 1CQ9A 4QDQA 5SV8A 1UYPA 1Q8PA 2V09A 2CWMA 1XU1A 4LBKA 1MACA 5BY5A 2CAVA 2VD7A 3VDBA 4FPEA 2ZAHA 3WP6A 5K7PA 3H3ZA 1N1VA 1TMF3 4O65A 3DXUA 1SZBA 1W2NA 2VTFA 4HSJA 4OMCA 5IK7A 2F6BA 3IDEA 2HEVF 3WNNA 2F4LA 2NN8A 1YQ5A 2G1MA 1PZ8A 3PJQA 1PHMA 1SLIA 5G05L 2P4EA 1GNYA 2OX0A 1WA6X 3B01A 1HN1A 4GAZA 2VOKA 2DVFA 2FDKA 1BMV2 1AYN3 3S5AA 5IW0A 3VD3A 2WNUA 3SKJE 3ZXAC 1O5UA 5FZ9A 1AR83 1OQEA 1QIQA 2YY1A 2EAKA 4Q1PA 3FZ3A 5BYNA 1FV3A 2ADDA 2ILMA 1O4ZA 1VBA2 1WCKA 3TWIA 2XJUA 4R9CA 3OGRA 2WO3A 4GULA 4A6OA 5KBFA 5E89A 4QPGA 1UZYA 2A3WA 1W6QA 3OTFA 3T0DA 3RI8A 4RQPB 1FOD2 2Q8EA 4NIDA 3PJYA 4S2DA 3U07A 4X8NA 1DFQA 3TEWA 4E2SA 1GOFA 4OI2A 3BVCA 3WP3A 2ZOEB 4META 4IV3A 1D0HA 1UY1A 3BIEA 5A1LA 2VM9A 1UCXA 1MEC2 2VQ0A 3MIDA 4KU8A 1HXS3 1S55A 1N1TA 4FXGB 1Y9MA 5FZHA 2AREA 4XUNA 3VDCA 3J7LA 1S0IA 1GWLA 3UGGA 2B39A 1VBA3 1FPN1 3ME2A 4RR3A 4CUBA 1ULFA 3FBYA 1LGCA 4RA0A 2QQNA 5FZOA 3RYKA 1RUI2 3OBAA 2WT1A 4UBHA 5F5CA 3RG0A 3SH3A 3VBUA 3BN6A 4A45A 1FOD3 1VP6A 4IE6A 3FWEA 1RXGA 2NPIA 3H3LA 4CP2A 1OF3A 4HVRA 4ARYA 2CNAA 3U1XA 4W8JA 4LBLA 2Y8KA 3K77A 5KHKA 3PTYA 3JUUA 4L92A 3H7JA 4K1YA 3KVBA 2E63A 2V5YA 4IV1B 1OH3A
chains in the Genus database with same CATH topology
5EYYA 3ELNA 3TN93 2Y0OA 3I4IA 2XJQA 2ZGTA 1EV12 2WNVB 3H0OA 1UIKA 3I59B 1DZQA 4XF1A 2OYZA 5H9RA 1HQNA 3FC0A 4XFBA 3JU9A 4QPGC 5CG9A 3OGGA 2Q5TA 2MEV3 4W65A 4K8FA 1RUI3 3K48A 4WBBA 2NMNA 4E4SA 4COZA 5I0UA 5IK4A 3B69A 5FQ0A 1RTVA 5FO9B 4PIZA 4IV3C 4HN0A 3FFQA 2X8KA 1OLQA 5CU1A 2PHUA 5DDJ3 1WW5A 3LSEA 3OY8A 2D43A 4CEYB 3MGUA 4HPKB 1CJPA 5L73A 4RR3C 5T5LA 2Q4SA 1GYKA 5C9AA 4L2NA 4XTMA 1C5IA 2YPJA 1XU2A 4UW6A 3NKGA 4HLTA 2E7TA 4XJ8A 3VBUC 4KGGA 3JBG3 4XOGA 1H4HA 3AK0A 1ENXA 4BHPA 1WW4A 4LR4A 1MS9A 4LO6B 1RUJ2 1V6KA 3M4FA 3SNMA 1BVP1 2LUWA 2ZABA 1AL22 4QMAA 5A32A 4M0NA 2QVSB 3PVNA 1QOSA 3BCWA 1ND2A 3WUDA 1C5HA 4R9AA 3AKSA 4XXPA 2JXAA 5DUXA 4W6YA 1KITA 1ENSA 4BCUA 1V9U2 5FPZA 1CAUA 1XNKA 4G4FA 2XPJA 2GDFA 2ZKNA 1MS4A 2R041 1VBE1 2OZJA 1FT9A 5JZGA 2R0FA 1C3HA 1WCDJ 2BVVA 3X29B 1R092 1QWRA 1VR3A 1OA2A 1TME1 4JVAA 1MQTA 4XJUA 3ZXLA 1RJ8A 1GBGA 1AL23 3GF6A 1XYPA 3LB9A 3CL1A 1SACA 4IL7A 3VGIA 1KFXL 2V73A 3TYJA 3H8UA 4BLIA 4EJRA 3CNAA 4BA6A 1CAVB 5C9AC 1VBC3 5LEJA 4AI1A 4ASMB 1TMF1 4TWTA 3EHKA 4XIOA 3RJ2X 3ZIXA 1EP0A 2RS33 3OBTA 3M3QA 4JCKA 2D93A 2RS11 3M3IA 4LBJA 1AUYA 5JOWA 5ABJA 1KD7A 4P9WA 2QDNA 3WDYA 1MVEA 3URFA 2D40A 3T1LA 3VBRA 5GLZA 4YW2A 2VY0A 4XFCA 1Q8SA 5D8AA 4XTPA 3H1MA 2ENRA 1AYN1 1ZREA 1IGOA 3PVBB 2DCTA 5KC5A 1EPZA 3SXWA 1C8M2 1ND2C 3V0AB 1AR81 2OIIA 1NQJA 1PVXA 1V6MA 4LNVA 4INDA 4Y1XA 2B7YA 2WFF1 1DQ1A 3AYCA 3D0JA 2ZX3A 3GHMA 5JZGC 1POV3 4HN1A 4AEDB 2I2SA 2CAUA 1ZM1A 1PGSA 1SLTA 4FOWA 4P5HA 4Y5Z0 2XHKA 3LOBA 1YI9A 4ITCA 4JRAA 2PFWA 3AYDA 1MQTC 3GHNA 5CIRA 2WC2A 2ZHNA 3NSTA 2BNMA 3FFZA 1N1YA 3WDWA 2D98A 1IPJA 4ATEA 1FI2A 1BMV1 4BOWA 1XNBA 2UWAA 1NZCA 2DWRA 3MEPA 1DGWA 4IEQA 2WWSA 4XFIA 2ZMLA 4FP3A 1HXS1 1ZYBA 2ZCWA 2VU9A 1OLRA 3FLRA 1VBA1 4NPRA 5B2GB 4LT5A 1Q56A 1QJX2 5BNPB 5ABJC 2I74A 3GBGA 3SISA 1AR72 2Q1MA 1O7FA 3VBRC 5AFBA 2BVBA 2ZJCA 3J4UH 4E2QA 5D8AC 2DVDA 5A33B 1IKPA 1U5XA 1ZX5A 3TN91 1Z0HA 3M70A 3O0WA 1AZDA 5BPXA 5CVRA 1UL9A 1YUDA 3WCRA 4ONUA 2IFRA 3ZVXA 3MI8A 2D6OX 3AJYA 3ASIA 1QJX3 3BPZA 2MEV1 4W6WA 1G9DA 4HKOA 2ZGMA 3CJIA 1PIV1 4LO5B 4G9SB 4YW5A 5K9YA 2C5DA 4ZU5A 3NAPA 2LALA 3ACLA 2NQYA 5DDJ1 3W9AA 1O3QA 3CJXA 2MNGA 3AMHA 4HVQA 1HDKA 4LBNA 1V70A 4YGBA 1AXKA 3ZN4A 4KQ7A 4A3XA 4V1PA 4QQPA 4MX3A 4PF5A 5GZCA 4LLFA 1UF2C 3AP6A 1SBDA 3JBG1 4BPZA 4MUVA 2YROA 1AR62 1ZNPA 1QH6A 2TEPA 2PA7A 2ZKLA 2MHFA 2IXHA 3WG4A 1QJU3 5BNOB 1YJKA 4M3CF 2XBO2 2HWD2 1H8TA 1WMFA 1PZ9A 2EAAA 4XEZA 5GLUA 3AZVA 3FMGA 3AKRA 4CEWB 1Z7S2 1NCQB 3QH7A 4KL1A 1VBB1 5I0TA 2BFUS 3FE5A 1PVC2 2YGLA 2E51A 3IPVB 3WHUA 1GLHA 3CJIC 4FPKA 1TNFA 5L36A 2VW0A 1LOBA 1DGRA 1KFUL 3E5QA 4AG4A 1ZBA2 2PLV2 5FPXA 1X8EA 2BTVC 3NAPC 3JZVA 4XXAA 1G9FA 5FAXA 5FLHA 3RJRA 2PAEA 4EV0A 3ZFFA 1AR91 5FBZA 4UW3A 5JAXA 4W6XA 3IT8A 2QDRA 1A78A 2JE7A 4B29A 5ACA2 1VBC1 4YW3A 2G9FA 3M1HA 1ND3A 3B3QE 2H6BA 2VGDA 2X29A 2RS31 5BNQA 2OPKA 2QQPA 2OW4A 4NHMA 1CD3G 4PDWB 5F6LB 4Y24A 3RQ0A 3WNXA 2GN3A 2GC2A 4B3NA 2JG8A 4YGCA 1X33A 4QPIB 3WCSA 1D4VB 1H8TC 1X8MA 1C1FA 1W6MA 3VBHA 4Q4X3 4XBNA 1GZWA 5GZEA 2ATFA 3M3EA 4DRVA 1AX2A 4Y26A 1V00A 5H9SA 5ACA3 4I30A 4XETA 1YO8A 1RUD2 3BOWA 5L7OA 3DN7A 4I0AA 5CB7A 3N3HA 1N3PA 1GSLA 4EN0A 1UW8A 1POV1 4IEPA 4M3CB 1WLWA 2DCKA 5EWSA 2A6XA 4O9EA 4JDOA 3MICA 1BQPA 1V6LA 1MS0A 3B00A 4AVTA 4GWMA 1SFYA 3AZWA 5KXDA 1PNGA 1PK6B 4RHV3 3ZFFC 3VBOA 1OFSA 4FTSA 4RFT0 1F5JA 4EROA 5FOJB 3R4UA 2HWE1 2XL9A 5CFCA 1ND3C 1K5MB 3ZFGB 3M7AA 1KDMA 3MLLA 1A3KA 3AZYA 3CF6E 2DYCA 4BQ1A 3OGJA 3NO8A 4OI4A 4XZPA 3U10A 1I1EA 2KXLA 2QE3A 2JG8C 5KXBA 1CONA 1X82A 1NCRA 4KG0A 3QCWA 3AXEA 4BM8A 4AQ2A 3WOGA 4DMIA 1VBD2 4BLJA 3VBHC 3N35A 4CRQA 4Q4V3 5K0UA 2RM22 3GZUC 1IQAA 1LHUA 1YFUA 4CDWA 5L7OC 3GALA 4HANA 4KU7A 2H0BA 4I2OA 2RE9A 4E9KA 1UN1A 2RS51 3J26N 4MXWA 4XJAA 1BEV2 3VHNA 4LHKA 4H7MA 3AZXA 4NOTA 3J8F2 2VMHA 1RUE2 1VAKA 5FFOC 3ZSJA 4EN7B 4DFSA 1CAXB 3VBOC 1U5ZA 4JTOA 4LBOA 1LEMA 3R4DB 2ZX0A 2IWGB 2RM23 3CLPA 3KB5A 4QQLA 1REFA 4N43A 5D1IA 5CFCC 1SEFA 1NLRA 1X7NA 3ZSMA 3ZXGA 1DYPA 2FZ1A 5DG1A 2R1DA 1BEV3 5DUVA 3OJBA 5T5JA 4ZKTB 3KM5A 3EO6A 4AI3A 5T50A 1NCRC 2H0VA 3J8F3 1RUE3 5I8SA 5C8CA 1XE7A 1FNZA 1RUG3 1QJU1 2IXJA 1URXA 1CGPA 1M4WA 2EXHA 3OPZA 5KHHA 2OUHA 5K0UC 2A73B 2ZGOA 1LGNA 4P14A 3QACA 4AHYA 4CDWC 4YM0A 4Y1YA 4RS5A 2GMEA 3AP4A 1GQGA 3ZX7A 5HBAA 1HIXA 1OKQA 1AYM3 1YJLA 3B9CA 5IUQA 2XJSA 2XVGA 4PIXA 2YMZA 3NKTA 5T52A 3ZXEA 5K8SA 3UJOA 3JD72 4AHWA 2NP0A 4XILA 2VH9A 4FQZA 3E6CC 3ZXJA 1SDWA 4WVZA 4BE3A 2XLAA 2D5FA 3KGZA 4F83A 5J37A 2YV8A 4OUMA 4N43C 5HI0A 4HETA 1QJY2 3VBFA 4YGDA 1B35A 4Y20B 2P3KA 3NVCA 4XBQA 5FO7B 3WDTA 4DZGA 2EXIA 1X36A 1F31A 3LWCA 4C0BA 4Q0UA 1RHI3 3MLKA 5I8YA 2D7FA 5C8CC 2Z2SB 3ZFEA 2ET7A 2EF6A 4FSJA 5T55A 4QHBA 1RUH2 2W52A 5JWPA 1DQ0A 4HL0A 3SCFA 5DG2A 4Q4X1 2A75A 1QJY3 1MS1A 4RS5C 5ACA1 4I0WB 4J1XA 4X6QB 4Y1UA 3ZPYA 4AF9A 5I93A 1KS4A 2E53A 2WZR1 3R0RA 2B42B 2LTNA 2V5YA 4N7UA 3WHTA 1S2BA 4BH9A 4G3YC 3B5LB 2ZS6B 3AYEA 3WV6A 4QU2A 4NO4A 4KWKA 2P3JA 5GZGA 3AMNA 3VDDB 1D4M2 3O5SA 2BW8A 4E27A 2IC1A 4K21A 1ZZBA 4F3JA 5CA6A 4OHVA 1PO13 1WCSA 3CU7A 2NMOA 1OMIA 4RHV1 3ZSLA 4CYDA 3KGLA 2XVKA 4COWA 3VBFC 1B35C 5I8TA 1BCXA 1NG0A 3ES4A 1EAH2 2GAUA 1NLSA 1NXMA 1SBEA 4GALA 4GH4B 3LAGA 3WG3A 3ROUA 4IEXA 2WS92 2GH8A 4YVWA 3L2YA 1HRV2 1LGBA 3WINE 1ASJ2 4OI0A 4AQ6A 1NY72 5JVVA 3BIWE 4KGQA 4OUSA 1MR5A 1CVNA 4OHZA 5JOZA 2PHTA 3NV1A 3ZFEC 1WD4A 4LO8A 5GZFA 3AB0A 5JI9A 3TRSB 2FMDA 2WINB 3ZMOA 4XFAA 3E6DA 4ISQA 4Q4V1 2A3YA 2UYAA 3WW2A 3M8LA 1WBLA 1EAH3 1Y7BA 4KG8A 2NZ9A 3WDVA 2O0OA 1F5FA 3Q9OA 1RUC2 1H2MA 1H1IA 4XHXA 5FTTC 2PHRA 2I45A 4YG3A 4Y1VA 3H9AA 3OYWA 1ALYA 1HRV3 3HQXA 4YVSA 3KT7A 4JGZA 3BB6A 1RMU2 3NWKA 2G4IA 4LBQB 1PGL2 4QGMA 1F9KA 4K40A 4XF0A 2VW2A 4ZU7A 4DB5A 4AQTA 4R52A 2VVEA 1NXD1 2ES3A 3LA7A 5T5OA 2WT2A 1F2NA 4J1WA 5DXDA 4QQOA 2CY6A 2RM21 2UY8A 1JBCA 5I91A 3TBDA 3WQ7A 4M01A 4QXKA 1LULA 1ZZCA 4GWNA 4LA3A 1BBT2 4OHWA 4DPNA 5A3LA 3VL8A 4YFZA 4YVWC 3A4UA 3USUB 1LTEA 3GBWA 4QM9A 4HK9A 1MEC3 1QJZA 1W6OB 1BEV1 1XNCA 4WM8B 3U0ZA 5C6CA 4GB32 3DKWA 1R082 1W6NB 4COYA 1NQDA 1AXZA 4QT6A 4AWDA 3TB0A 4Q4Y2 4A2UA 3DGTA 4FAGA 1HRI2 1SCRA 4F7ZA 1H2KA 1RUG1 4AVCA 5J36A 2R072 4YZ3A 1J59A 1ZVFA 3ZMNA 3CEWA 3INAA 3UV9A 4YSFA 3S30A 3FUQA 2HWF2 1BBT3 1LESA 1TNRA 4FTEA 4YVSC 4LO7A 5HCFA 4FPYA 4JGZC 4IETA 4N53A 2VG9A 1AYM1 2N7GA 1S0BA 2PAKA 3AMMA 4CP1A 5AC91 1CN1A 1EV13 1RUNA 1KDKA 2NLRA 5JPMB 2VMIA 3IIAA 1REDA 1H2LA 4CDUB 3NJZA 3RPQA 4L99A 1H1MA 1C57A 2DFCA 2IXKA 2PQQA 4FPHA 1Q3EA 1GZCA 4FP2A 3O7OA 4M0HA 1DU3D 2HWF3 3HN1A 4LE3A 2E9QA 1VB2A 1HKDA 2IXCA 1SBFA 4Q8KA 2BUKA 3N36A 1CAWB 1H9PA 4Q8LA 5F6KA 3HAGA 2HEYF 1UU6A 2HWC2 1RHI1 2YDEA 4YARA 4LBQD 5I0RA 1AF9A 4FQ4A 1LU2A 2QZ2A 3RDIA 4RSUA 2C1FA 4XJ9A 2DTWA 2AUYA 2RMU2 3APBA 2VVDA 5FOBB 4BMBA 2RHPA 1APNA 1QJY1 1LHNA 2HJIA 2XB6C 4EN9B 3JQWA 1CR7A 2E7QA 3MF6A 3FBMA 3KLSA 1OI6A 4NHLA 4WVMA 1RUJ3 1LHVA 1N47A 4N53C 3VZNA 4L97A 4Z2WA 4HFSA 1A6CA 4KH9A 4UW4A 3ZN6A 2HWC3 3EJKA 4N9HA 2HWB2 3RWNA 1LECA 1JYCA 3I7DA 3JQXA 5L19A 4CDXA 1V9U3 1XQNA 2ZMKA 4R9BA 4XFHA 5JLVA 4LUMA 4XQ4A 1PO11 1QDOA 1S1AA 1LB2A 3MW2A 4ISRA 1JXNA 2WLPA 4ZXKA 1LENA 2W08A 4L9BA 4CDQA 1R093 2R1BA 5GLWA 1L3JA 2GNDA 1H9WA 4PBOA 5BNNA 1W2UA 5JIUA 4YRDA 1V6NA 5J09A 3KD4A 2WIIB 2QUOA 4YG6A 2YZ4A 3W59A 3GZAA 4QX5A 1LOCA 4Q0SA 4NHKA 3NL1A 5DUUA 3M3CA 1QXRA 4D3WA 4H3WA 3U4XA 4JTNA 4LA2A 4Q0PA 1W0OA 2D3RA 4GKXA 2WNUB 3V0BA 4YZ1A 1HV1A 4PIYA 1S0GA 1DDLA 2R49A 1AL0G 4AI2A 1FMD2 3VKOA 4Q2FA 4LULA 1RL3A 4D69A 3VHRA 4P9IA 4QPGB 3HT2A 1HRV1 4DY5A 1C8M3 1E57A 1GFF2 1O4YA 3USSA 1W6QB 4BWOA 1PMIA 3LKJA 5KXCA 4AI8A 2BWAA 3ZXDA 4OHYA 3MPBA 4CDXC 4GKYA 4RL7A 1WLDA 1YLLA 1QQP2 1DHKB 4IV3B 1LOGA 1COV2 3IKWA 4QQ2A 3S7EA 3SH5A 2VOVA 5KHGA 4CDQC 3DPRA 4EWAA 1FOD1 4AVAA 1YFYA 2EVXA 4FPOB 3H3UA 5BNNC 5IK8A 1OOPA 4L11A 1CESA 2FBEA 1FMD3 2DCZA 3AKPA 4P9GA 1PO22 4FOQA 3BTAA 4RR3B 1UAIA 5I0SA 5JDBA 3M2MA 4B7EA 2XG3A 1MEC1 2QCSB 4P9XA 3EBRA 2P37A 3LGRA 3VBUB 1WMDA 1R1A2 4Q27A 2D6MA 3H7YA 4R4ZA 2F4PA 3WG2A 2R062 3WUCA 1O4TA 3WW3A 3POWA 2A6ZA 3MDPA 2PYTA 3RMYA 2DURA 1QF3A 1RUI1 1GR3A 2EXJA 4MV2A 1AR73 1WUVA 3NW4A 1UKRA 1JTZX 4Y22A 1DQ4A 1IOAA 4PQ9A 3UKNA 1UIJA 1RVF2 2A6WA 5E88A 1LJ7A 3MF9A 4AGRA 1QXPA 4MGZE 4UXAA 3NV2A 4WM7A 4KBBA 3ALQA 1ULEA 1PNFA 1PGW2 1R1A3 1EV11 2ZX4A 5FQ0B 2GNMA 3ENRA 4IEWA 3LA2A 2Q0AA 5J7MA 5EFUA 2A71A 3DPRC 2IZWA 4FPGA 5JR7B 3PVOA 3OY8B 3ATGA 4XPVA 4AK3A 2R0HA 1GICA 3PMEA 1OOPC 4YFWA 4OVEA 1QGLA 2HWF1 1MS3A 1RVF3 5C9AB 2BPA2 2D6LX 2O1QA 5JCTA 3MYXA 3KT4A 2GNBA 2XLGA 4IERA 1MS5A 4HKWA 3KQRA 4X6RB 2GZWA 1PM7A 3RYRA 3C3VA 2P34A 5FREA 2O8QA 2ZGLA 1J1TA 5CFDA 4I0BA 5FCCA 2UU8A 1D0GA 2ZA9A 4QD2A 5A32B 4B4QA 2K0GA 5KC6A 2CGNA 1OD5A 1ZBE2 1QH7A 2VPVA 3T1MA 1ND2B 2AENA 3WP5A 1AR63 3HT1A 4XMIA 5HCBA 4A7KA 4PJYA 4K20A 4YG0A 4AEKA 2P17A 3A0NA 5DZEA 3O0VA 4MZUA 1RUJ1 2GMPA 1IKQA 2X5IA 1CAUB 4AEJA 1AL21 4WM7C 2BGCA 2JECA 2XBO3 2HWD3 4FPFA 5JZGB 5JPNB 4JGYA 2ZMNA 2B46X 2DUPA 1Z7S3 3RI9A 1LHWA 4XE9A 3KT1A 4COVA 3MIEA 1SMVA 1V9U1 1MQTB 5C4WA 4FOYA 2A70A 1VRH2 1PVC3 1ZZ6A 2FHRA 4JV4A 4ORFA 1VIWB 3H1WA 2JD4A 2JG9A 4JAAA 1NA1A 1RUF2 3VBSA 3N7JA 1R091 4MLOA 5A3MA 1LR5A 3C2UA 2GH2A 3P3PA 1NE6A 4F8AA 1ZBA3 4YW4A 2PLV3 3VZOA 5LEKA 1HX6A 1JW6A 4AFMA 2GALA 2PHWA 2VQAA 4AI0A 1A8DA 2QKDA 1FNYA 4HVOA 2O8OA 2WA3A 3WG1A 5ABJB 4E4DX 5CFDC 3VBRB 1QOTA 4HKLA 4S2GA 3VUOA 1RITA 2ETEA 4GMP0 4DS0A 2ZX2A 5D8AB 1AX1A 4CTEA 1KJRA 4KNCA 4QPYA 4AFDA 3FLPA 1W6PA 4MSVA 1HQLA 3ST7A 2YXSA 2R30A 4Q0VA 2X5IC 3L2HA 4FVVA 2BEOA 2VVFA 3MIGA 2AR6A 2DVAA 4JGYC 3D8CA 1C8M1 4E4ZA 1QY4A 2XUMA 4IEOA 2ZPXA 1O3SA 1XNDA 5C4WC 4DQAA 1LOAA 1RUD3 2AH2A 4JRLA 2ARBA 1AJOA 3MW4A 2JG9C 1GNZA 3N7MA 1NA1C 3VBSC 5J96B 1YI7A 1QKQA 3IN9A 5EZWA 2UWCA 1DQ2A 4AVSA 2YYOA 2ZGPA 4U2AA 4N7IA 4XIKA 5C33A 3B9IA 4YYOA 2VNGA 3OBRA 2XKOA 4BIOA 1KQRA 2GSYA 5EJ3A 4Y1ZA 4FBFA 2D5HA 3TAYA 5FRAA 3RZZA 3UKVA 3HD8B 1ZRFA 4RQPA 1ULGA 3VLBB 1U5IA 2W0XA 1QJX1 3AM2A 3G7DA 3IBMA 3ZYJB 1GV9A 3RS6A 2DUQA 3P3NA 4XMAA 1FPN2 4Q4W2 2WJSA 1AR71 1FYUA 2PHFA 1HLCA 1C8NA 1DZTA 3DF0A 4XQWA 3WDXA 3WQ0A 3WD5A 2W39A 1VBD3 2PTMA 2DU1A 5BV6A 2CWSA 4R4XA 2BWCA 5LK7B 2Y0IA 5AFEA 1TEIA 1XRUA 3CJIB 2XKPA 4Z1VA