2H6CA

Crystal structure of reduced cprk in absence of any ligand
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
208
structure length
208
Chain Sequence
FFPIEKLRNYTDMGIIREFAKGSAIIMPGEDTTSMIFLMDGKIKLDIIFEDGSEKLLYYAGSNSLIGRLYPTGNNIYATAMEQTRTCWFSEECLRVIFRTDEDMIFEIFKNYLTKVAYYARQVAEINTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGAHHVTVSKVLACLKKENILDKKKNKFIVYNLEELKHLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords ChloroPhenol Reduction gene K
publication title CprK Crystal Structures Reveal Mechanism for Transcriptional Control of Halorespiration.
pubmed doi rcsb
source organism Desulfitobacterium dehalogenans
total genus 59
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2h6cA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2h6cA01
1C0WA 2XRNA 4E70A 5H6QA 2YX4A 4KYWA 1IN7A 4MTDA 3DFGA 1GXPA 1ODDA 4ZZLA 4MQ9F 1FP1D 1O3SA 3ACLA 2IA1A 1BOAA 2V09A 2Y0OA 5T3NA 3ULQB 4UBHA 2XAFA 5L3FA 4ZU7A 5I0RA 1IN4A 3E6MA 1TNSA 3I59B 4L2NA 1R22A 3FHIB 4F7ZA 3NRVA 1X8MA 1IW7F 4S04A 2DQRA 1SMYF 4MQVA 3KP2A 2XLGA 3JW4A 1D3YA 3DN7A 4EGYA 3WTXC 3KSCA 3BWGA 1BI1A 1WWXA 5L3EA 3I4PA 3KGZA 1JHFA 2VBYA 5L3GA 3JSOA 3NEUA 3O6BB 5JSRA 2HQNA 4UVCA 3GFJA 1OYYA 3ZMZA 3MPBA 5DUKA 1XGOA 2M30A 1K78B 4EGZA 2KRFA 4AIHA 3FWEA 5EZWA 2FF4A 2P7VB 2PFBA 1KQ9A 4WXCA 4YIIA 3FZVA 5ERIA 2UYAA 2P6TA 4ZYDA 3S0MA 5D5XB 1DGWA 3JSPA 4KIFA 1WKMA 5E1ZB 2P6SA 1QNTA 1K78A 2RKHA 1NYWA 3WTVC 4XSXF 1IN6A 3GXOA 4OMZA 3R61A 3HHGA 4HF1A 3QAHA 3HT2A 5LEKA 1KU3A 4X6QB 3K1NA 2L01A 1H9GA 5J6XA 3EQEA 1ZH5A 1SD7A 1BIAA 4IRIA 4Q5SF 3T8RA 2B0LA 2GU9A 2UYBA 2JRTA 5E1WA 4UXAA 5ED4A 5FLXZ 3HT1A 1SD4A 2LNBA 4UHTA 3HOTA 1J1LA 4OLLA 3EQLF 5FB2A 5ILVA 2CYYA 3V8JA 3WW2A 4WBBA 4IHSA 4G6DA 4BHBA 2PHDA 3T5XA 3T8TA 4HQEA 1NE6A 4QLCU 3U0ZA 2W85A 4G7ZF 4AVAA 3I58A 1X82A 2K4BA 3CUQC 5DD4A 5BXXA 2ZKZA 3FXUA 4Q0PA 1CF7B 2O1QA 2YPRA 5FPXA 2IT0A 1LJ9A 4EMSA 5HI0A 2MC3A 4IEZA 4L18B 3IIAA 4RAZA 1BM9A 4I3PA 4GULA 2XAGA 2OA4A 4PIYA 3R0AA 1Z9CA 4P9GA 2FQ3A 3F23A 4EJOA 1UB9A 2RQPA 4XFFA 4EV0A 1TQ5A 1CF7A 3U9GA 1ON1A 1YS6A 5ICEA 1WSUA 1U6GA 2Y0MA 3PNAA 4L0ZB 5J48A 3BDDA 3GF2A 2G7HA 1U8RA 1LRHA 2HKXA 3MQ0A 5HDGA 2COMA 4ESBA 3IRQA 3ES4A 1KYWA 4HVQA 2XAQA 5D8LB 3OOPA 2EV0A 1PM7A 3D5LA 1YUDA 1UW8A 2QYOA 1QO0D 3I53A 4Y13A 3HSEA 2HTJA 2Q2EA 4MH0E 3UKVA 1UFMA 4ZYEA 1EY2A 1USSA 3F8CA 3DF8A 4CICA 4XF0A 3BB6A 2XAHA 5LGNA 3V7RA 2PMUA 3P9CA 3KEQA 1R5GA 4L11A 5KHHA 2EFNA 2C6YA 2Z33A 3D0JA 3DL3A 3N97A 4XFIA 1TLHB 4XLPF 2Z99A 1LVAA 2Y75A 2XLFA 2DT5A 5D5UB 4F8AA 1IAWA 4U88A 4P5OA 5KVRA 5I8TA 3KCCA 1DZRA 3RPUA 4HVRA 4N9IA 1HW1A 4MHGA 3O3KA 5D1IA 2DK8A 3TO7A 3EUHA 5CVUA 5HS9A 4QMAA 2PG4A 1GQHA 1Q1HA 3BALA 1XRUA 1L0OC 3GBFA 3K1MA 3JAMK 1SQ4A 5LRRA 2D45A 4A6DA 4Q47A 1ON2A 4CDGA 1S29A 4KICA 5E8IA 2IJLA 2CW0F 2HFHA 2E7XA 2O6GE 4IEYA 4FAGA 4KL1A 1U5TB 1FWZA 3HRSA 1YLLA 3RI4A 2C0ZA 3WE3A 1SD6A 3CUOA 4YYOA 1ZRRA 2VBXA 4UXNA 4RGRA 3AAFA 5A2QK 1WGPA 4WWCA 3WTUC 5FCCA 1FZPB 4META 3ZMTA 3I64A 4KN7X 3E5QA 3H1MA 1TQIA 1ZVFA 1ZX5A 1P2FA 3E3VA 1FXZA 2UXXA 2CSOA 3BROA 5CU1A 1U5TA 5BQTA 4KA4A 1O3QA 1ZREA 4RGUA 1LKNA 4AQ2A 3L2CA 2ET1A 4WK8F 1JUHA 2HWVA 2GA2A 2DW4A 2IXIA 3KLOA 4HBLA 2LF8A 3ZDSA 2ZJ2A 1CGPA 4XEZA 3F21A 2FBHA 3I54A 4EJUA 3FZ3A 4LEJA 1XE8A 4O3MA 3T0YA 1GHCA 4XSZF 1SEFA 1Y9QA 1XSDA 2MHFA 1IF1A 3O14A 1XDSA 1Z91A 2VBWA 5ICGA 3DP7A 3RZZA 5JR3A 3CO2A 2CV6A 4MEXF 2PEXA 2LF7A 5CVVA 3QPTA 2ELHA 4XBFA 4KIBA 1LDDA 1XGSA 4M73A 4HOBA 4HX4A 2E9QA 1KYZA 1XSXA 4L5JA 2JSCA 4M9ZA 1H9TA 2HR3A 3CEWA 4HZFA 3WG9A 3TOAA 2XL9A 3QACA 3D0SA 4M72A 1UIKA 5HVQC 3CO6C 5FQ0B 1R23A 1DPUA 5H6RA 3VOEA 4AIJA 5CLSA 3COAC 4IETA 1ZHFA 1RIOH 5BUVA 1YO5C 3R6SA 3PFIA 2OBPA 3OTFA 4BHPA 5LHIA 1V3FA 1ZZ6A 3P7NA 1NXMA 1RUNA 4HSJA 2ISYA 5DYMA 1S8NA 4XFHA 3KGLA 2H09A 3UKTA 5LLQA 2XV4S 5I8YA 2WC2A 1I6XA 2VBZA 4HX8A 2QVSB 4RGSA 5JFRA 5AIPA 5DCFA 3H3UA 4KWKA 3IWZA 4Y15A 1MDMB 3ECHA 4CO8A 1JGSA 3HHHA 1XCVA 3EJKA 4JVAA 3GFLA 2VODA 3HQXA 3WW3A 5LGTA 3RKYA 1MD0A 3JAMZ 4I98B 2HJIA 4G9YA 2DQLA 3LWFA 3BCWA 2DPUA 2HEOA 4UUVA 1MDMA 2GQQA 3E97A 4HV5A 5FDBA 4M6YA 3C3WA 3LA3A 1U5TC 2FBIA 4HF2A 1HXDA 4RAYA 5D6FA 4I09A 2HZTA 4ETSA 4I0AA 1P4XA 2NNYA 5A2QZ 1USTA 5KHKA 3T1BA 4WVZA 1VJ2A 1W7PB 2Z3YA 1T2KA 1ZRDA 3M9AA 1X8EA 3SCGA 2O8XA 4HLXA 4ZH4F 1T6SA 1UIJA 4UNOA 5F6FA 1Y0UA 3BPXA 2XKPA 4DNCA 2KIMA 1ZYRF 4NVPA 4U7BA 2IVMA 3B02A 4ON0A 2IA0A 4Q29A 1TBXA 2FU4A 5IT9Z 3O2PE 4M9SA 3SFZA 4IEWA 4OIOF 1BBYA 4HYEA 2EV5A 2W25A 1CAUB 1J3RA 4I02A 5LRSA 2GC3A 1YS7A 1SMTA 2FMYA 4HSLA 3ML6A 5H20A 3MFKA 4DINB 4HX7A 4BHCA 3OF1A 1ZZCA 5ICCA 1H0MA 5BV6A 2OU2A 1FSHA 2RV8A 3RJPA 3H92A 3TGNA 4AVCA 4J1XA 2PQ8A 3EDPA 3WGHA 1O3TA 2WTEA 5CJ9A 4ZU5A 2VXZA 4NQWA 2QWWA 2DU9A 3IRRA 3FXRA 3M3IA 2K02A 4L9TA 4MGRA 4UVBA 1TNTA 2HDCA 5HDNA 1J9IA 2ETEA 2BGCA 3IDBB 3QPHA 2OZUA 3KP3A 2ZCWA 4HV6A 4AXOA 1MGTA 4EQQA 4Q0SA 1ZG1A 3QOPA 1XN7A 2GXBA 3FXQA 1J75A 4LB5A 2V9VA 1J5YA 1HQCA 3CUQA 3KETA 2JTVA 4QX5A 5J8FA 2G7UA 1AOYA 4MGYE 4JBAA 2EA4A 1DUXC 3VFZA 5C6CA 3E5UA 4Y17A 1O7FA 3H1YA 2UZKA 3SHFA 2PBIA 3H50A 2ZNZA 5JR7B 1FYKA 3DKWA 1L3JA 1ZZ8A 1FYMA 4YIFA 3BOQA 4ESFA 3I59A 3OV8A 3U2RA 2UY9A 2GC1A 2PYTA 3S2WA 2IC1A 2ACJA 5EEGA 2UY8A 1F9NA 3S7EA 1ZGAA 4IEXA 1FY7A 2GA1A 4P96A 5KHIA 1MKMA 4Z07A 2PQQA 1FLIA 3BP8A 3J7AO 2MNGA 5J3UA 1Y3TA 2M8EA 1IXSB 5KHGA 1NHAA 3DPTA 3LA7A 2EAAA 2OA2A 5DV5A 1QPMA 2O03A 1IPJA 3OCPA 3L9FA 4IERA 1IRGA 1QWRA 1HKQA 3R4KA 2QM3A 2JZYA 5AVPA 3WU1B 3QU6A 4XLNF 4BXUA 1RZ4A 2V1DA 3L7WA 1OI6A 2N7GA 3C18A 3LA2A 3MYXA 5ILUA 1WLTA 2BNNA 1O7LA 3SXYA 2UXNA 4PGHA 1LB2A 3HSFA 2OYZA 3JTGA 4B29A 4YRDA 4L5IA 3IKVA 2B8MA 1YWKA 1R1VA 2QZ8A 2F5FA 3K1PA 3EYIA 3SZPA 5DUIA 2BV6A 5CVRA 2D40A 1W5TA 1BN5A 1T98A 2NAZA 1O5UA 3K9TA 3BPVA 4LLLA 2EJRA 3FM5A 2R7DA 3FM3A 5E20A 2QCSB 4OU0A 4L9JA 1G3WA 1B4AA 3LAJA 1SFEA 2P8TA 3BZ6A 5E8GA 2XASA 5DDGA 4FHTA 2VQAA 4H7LA 3J80K 4KMUX 1KU2A 2M87A 1R5HA 2A3SA 3WTSC 3ZP5A 3VEPA 2A6EF 4A0XA 2RN7A 1X7NA 3HYIA 3SCHA 2X4HA 4M74A 3V8KA 3FX3A 1XE7A 2W57A 1Z6TA 4NHJA 3U11A 2ZFWA 1SFUA 2OAZA 3GZ5A 5LGUA 4E2QA 4MEYF 4IXAA 5I93A 2D93A 3C7JA 2V1XA 4DQ2A 2EWNA 1HW5A 2QENA 2XKOA 2Y48A 2NS0A 3GO5A 4ENJA 2XIGA 2RVCA 3KLNA 4ONUA 2EA7A 5K5QA 2ET7A 3JTHA 4MNUA 1UHWA 1ZRFA 3ISPA 1K79A 4HVOA 2EFQA 2IXJA 1B59A 3ECOA 2OZ6A 3RTRA 2O0YA 1OYWA 1GXQA 1J59A 2H27A 1E17A 2L4MA 1SD5A 2VPVA 2QVOA 3ZMSA 2EFOA 5E1RA 3M70A 2DCTA 3WU0A 1FBUA 5JCTA 1KU9A 4HA8A 1H1IA 4OOIA 1OMIA 3RYPA 5KBFA 4M9XA 1EH7A 4AQ6A 3SXWA 3EO6A 1FI2A 5FPZA 3HRTA 4UBGA 2EK5A 4EJTA 2H0VA 2H6BA 1F4KA 4RB1A 2DAOA 4M71A 5E18F 1QZZA 1LNWA 3PQKA 3W6JB 2P5LC 2H6CA 4GGGA 1HKSA 1YLFA 4YFKF 3EBRA 1DDNA 2A69F 1B9NA 2QBYB 2V79A 2VN2A 3L09A 4G94A 4UVAA 4EM2A 1ZZBA 2J5OA 3PVBB 2NRAC 4WCGA 4UV9A 1J3QA 1OKRA 3HUGA 5D4SA 1DGRA 4IVNA 2DFIA 5K5RA 1G3TA 4LULA 4CYDA 4XRFA 2VE9A 1MJAA 1YIOA 4D0PA 3LFKA 4KU8A 4Q0VA 2RGVA 2YSRA 4TV7A 3NVCA 3HSRA 4U7DA 1ZG5A 2K7LA 3E6DA 3RYKA 1UPIA 4G8XA 4A5MA 1OR7A 2XHKA 2QBYA 2EFPA 4FT8A 3BU7A 3CF6E 4RB0A 2WFPA 1U3EM 4XF3A 2EA2A 5LBQA 3J80Z 3IL2A 4KFCA 1Q5OA 4LA2A 3DXJF 3MWMA 3KP7A 2K0GA 3GZ6A 4OIQF 1MJBA 2GIVA 3PLQA 4LLOA 5FGMA 2IRFG 2VECA 1ZARA 1R7JA 4XETA 2F5DA 2QDRA 3REOA 4HMZA 4LFUA 1SFNA 4WXDA 1O4TA 4YSFA 3WTZA 2PN6A 4IRGA 2E1CA 3SMHA 4Z82A 3QRFF 2FEZA 1Q43A 3EETA 1Z6RA 3ZMDA 4MGZE 2IP2A 4IF4A 5F64A 3C1DA 2PI0A 3LQQA 2Q1ZB 3ZN0A 4LMYA 2YU3A 1YW7A 2PAMA 4MZUA 4YG2F 2WV0A 2F5EA 2RDPA 2L4AA 1YQAA 4HAMA 2CFXA 3RPQA 2DTRA 4JQFA 4EVIA 1XGMA 5L3CA 2Q4SA 2LSOA 3E5XA 4H0EA 2PMHA 4KDPA 3TDUC 1F1ZA 2E7WA 2HGCA 3QP6A 2JPBA 1ULYA 2IW5A 1QY4A 2BBYA 3EYYA 4IPAA 1L3LA 4QGNA 2AXLA 5TRDA 1QGPA 1BC7C 5CYVA 1ZZ9A 1YFXA 4BIFA 5JAXA 1IXCA 3R60A 5FQ0A 4WX9A 1QQIA 4L9NA 1YG2A 3SCFA 5FD6A 2BYVE 1NZCA 2CGPA 1QZYA 4IJAA 3QP5A 1I1GA 4RS8A 4XFBA 2DBBA 4A6EA 1SAXA 4HN0A 3BJ6A 2GXGA 5BOXA 1P92A 4EWDA 4YFNF 4BYYA 1KA8A 2ZMEB 4QWQA 1ZG3A 4GYGA 1PUEE 1O3RA 2O61A 3TKYA 1V4RA 4EJVA 2XGXA 3PQJA 3U1DA 4AVPA 2D5FA 2STWA 4K2EA 1F5TA 4ENKA 2NNNA 1EH6A 5AIQA 3N4MA 4R1HA 2V6CA 2QNKA 4EJWA 4KUMA 1UCRA 5LHHA 3HOSA 2A5YB 2ADUA 4LUMA 5HOOA 4QXKA 4IEQA 4ENMA 1WQ2A 4MUVA 3IHUA 5I91A 3MDPA 1VR3A 5L3DA 4KWJA 1J0RA 4OMYA 4KU7A 5EEHA 2PAKA 1DZTA 2PLYA 2A07F 1LDKB 2PTMA 1VP6A 1FNNA 4AVBA 1W7PA 3KMHA 1VTNC 3GX4X 4IESA 2D1HA 3B73A 1FC3A 2ZKLA 2BNOA 4MGKE 1GQGA 3WW1A 1NE4A 1TW3A 3V8LA 2Q30A 2XLAA 1G3SA 1IN8A 1WA4A 1LR5A 5FLJA 3F8BA 1T0FA 1K6OA 4MGIE 2D2WA 4D7TA 1TQPA 3FF5A 1Z1DA 4D7SA 4TLFA 2Z2SB 2MD5A 2RC4A 1CAUA 1T38A 3I0TA 2KJCA 3ABUA 4I2OA 3KZZA 3MCZA 3TO6A 4CXFA 2QJVA 5FFZA 2NYXA 2IPQX 2FNPA 1KQ0A 2CO5A 4U0WA 2VC1A 4HN1A 1OPCA 4PIXA 1RL3A 3L00A 2CQKA 1YFHA 5JSOA 4XFGA 2EB7A 1IXRC 3Q9SA 3NQOA 3ZMUA 2W84A 1RI7A 4PIZA 1I1SA 1W5SA 3GLXA 4P9FA 3G3ZA 1DPRA 3GVAA 1H1MA 2GZWA 5C8WA 3GWZA 3BJAA 1UD1A 2B9UA 2OQRA 3Q5FA 1FPQA 3P9IA 1JXSA 1G4DA 2MLGA 3MZYA 5FO5A 1ZAOA 3V7CA 3GW2A 1YW9A 2ZNYA 1Z05A 4GYIA 4LGWA 4AWXB 1YTYA 1QBJA 4JTOA 4WXHA 4A5NA 5K8SA 2FBKA 2OZJA 1U12A 2CWEA 2D1VA 2M5WA 3GFIA 5F1RA 4IEVA 2K9ZA 2Q0AA 4FAHA 4WZCA 1CAVB 4JTNA 2XROA 2F5CA 3FMRA 4GXOA 3HRMA 5E17F 3F22A 2DI3A 4A0YA 4HLYA 5FFXA 4OIRF 5HDKA 5LHGA 4M6XA 3IDCB 3WGGA 2AS5F 2KJBA 4KT5C 3WODF 1FBSA 3H1WA 1IRFA 2K86A 1CAVA 3ELKA 3S7IA 5CADA 1RUOA 2K4JA 4LK0F 4CHUA 4GCVA 2ISZA 4R79A 1HKTA 2IXHA 1J3PA 5D5VB 1BI0A 2G9WA 1XMAA 1R1UA 1I27A 2MBFA 5FLIA 1HW2A 2VT2A 1LQ1A 3CJNA 4QM8A 3CLOA 4ORFA 1ZGJA 1JE8A 3UKNA 2FMLA 2VC0A 2P7CB 3F8FA 2P4WA 3TOBA 3LAGA 2MH9A 3H9AA 2DPDA 1TQMA 3F6OA 1ONVA 2CAUA 4RB2C 2B5HA 1P6RA 1BIBA 3RNSA 2L02A 4N9HA 1OD5A 5D6EA 4P9UA 4LB6B 3MZHA 4KWLA 2V1UA 4B8XA 1OYIA 3KE2A 3ZN1A 4EM1A 4MV2A 1S3JA 3FFQA 4QGLA 2YX7A 2VT3A 4PGGA 1ZLJA 3RKWA 4ZU4A 1UCXA 2DLLA 4CZZA 3DV8A 2FNAA 3GEZA 2GC2A 4EROA 2F4PA 2M45A 3R0JA 5BPIA 3E6BA 4IEPA 4Q0UA 1ZN2A 1FX7A 3LQRA 5J8CA 4IHTA 1W4MA 4A12A 3ZMVA 3H7JA 4L0YB 3F6VA 3LAPA 4N0BA 5E1XA 4G7HF 2OPKA 4IEOA 4JV4A 4LG0B 2VE8A 3RKXA 3KP5A 2MLKA 3DEUA 4ZZDA 2ATFA 2CAVA 3CJXA 3I5UA 4BQAA 1FSEA 2A6HF 4KNYA 2FRHA 1B1BA 2VONA 1RGSA 2A61A 4U0YA 1TTYA 1PP8F 2Z69A 4BNCA 3IWFA 3USSA 2VOPA 2ESNA 3TO9A 1Z7UA 2KKOA 3FHZA 5J7MA 1LEAA 1UHMA 4WF2A 1HSJA 3SZTA 2TDXA 1BI2A 4LG0A 4HBNA 3W6KB 4QGMA 2ZO4A 4RGXA 3JZVA 2RNJA 3FJSA 5IT3A 3KZYA 5HLIA 1G6NA 5BY5A 4LJZF 5I8SA 4O6JA 2EVXA 5JVTA 4ENNA 2GWRA 1KGSA 4G7OF 3GUDA 1RC6A 1X3UA 5D4RA 4EWEA 3MAJA 4S05A 3M7GA 1PP7U 5D8KB 4KMFA 1QXJA 4FX4A 1ZZ7A 1FOKA 3ZPLA 2R3SA 2FQPA 4EM0B 1J2XA 3KP4A 4XFCA 5HS7A 1CAWB 3ZQ7A 2O3FA 1HBXG 3IKTA 4FBFA 6PAXA 2XUBA 4PDKA 3KP6A 4J1WA 2MH2A 2ZXJA 2FSWA 5L3BA 1AWCA 2BNMA 2A68F 1D8KA 1B9MA 3WTTC 1ZLKA 3J81K 1QXRA 2XAJA 2IA2A 1CAWA 2IXLA 2I45A 2WWYA 1XB4A 2ETHA 1IN5A 3WGIA 1O5LA 3CLPA 2Q8KA 3TQNA 2P5KA 1OFNA 3RYRA 1JHHA 3HTUA 5K5OA 1BC8C 1YFUA 3OD0A 3C3VA 4KN4X 2OD5A 4Z2YA 2PJPA 1EYBA 4L9VA 4ZYGA 2XVCA 5D5WB 5HS8A 2L54A 4Q4ZF 1WI9A 4PZJA 3ROUA 4ASNA 3VHRA 4I0BA 5JSPA 2X0LA 1IPKA 4ZYHA 4OFGA 3VB2A 1W7PD 1ZNPA 1P4WA 2PFWA 4O9EA 2OQGA 4K8FA 4HLTA 3KEOA 4JK1X 1FT9A 3F3XA 3CTAA 3E6CC 3V4GA 1EV7A 3VODA 5EFUA 4IEUA 2KXLA 2JT1A 1MZBA 3LSTA 4LLNA 1IZ1A 1J7KA 1R58A 2EV6A 2DK5A 1D5VA 4A0ZA 3M1EA 2QUFA 2PA7A 4BH9A 2Q0OA 2M1BA 1FBQA 5FLHA 2W24A 1XGNA 1IUYA 4HQMA 2P5VA 5CVJA 1PMIA 1Q3EA 2HQRA 5JHUA 2R7FA 5I0SA 4HF0A 2HOEA 4Q48A 4LA3A 2ESHA 3G73A 1TW2A 2GC0A 4G6QA 4O9GA 1REPC 4UV8A 4FX0A 1RTVA 3ST7A 3MEXA 5IT9K 4Q0QA 3IC7A 1J58A 1DP7P 1P4AA 1S6LA 4XFAA 4E2SA 2QLZA 1O57A 1EPZA 1E2XA 4OINF 3HTSB 3I71A 1R1TA 3RDIA 4YARA 2P17A 3GFMA 1T39A 4HDVA 1K7AA 1BI3A 5I0TA 2UWMA 2HS5A 3ETQA 2Z5UA 3FMSA 5CVIA 3OGJA 1YFYA 3HIFA 3F72A 4AIKA 2QQ9A 2K27A 1B6AA 4O5VA 1U78A 2FA5A 4P55A 4RB3C 1S7AA 4PJYA 5ICFA 3NJZA 3LOIA 3H8UA 2BEOA 3K69A 1RNLA 4YFXF 3EHKA 2DO7A 3J81Z 3P9KA 3K2ZA 1V70A 1EH8A 4HW0A 3WW4A 1XDUA 4R8HA 5FD5A 1R00A 3CO7C 1GVJA 5TJJA 4GO1A 2D5HA 1ZRCA 4XF4A 3RIRA 1XMKA 1SFXA 2XL7A 2HTSA 4XF9A 5HLHA 1R36A 3DQVC 5HLGA 1PDNC 1D8JA 1CAXB 5JI6A 4LD5A 2ZBKA 4NB5A 5E16A 3TNPB 3LZZA 1FP2A 5DD8A 3TDZC 2BE5F 1WRJA 3U10A 1U2WA 4B09A 5BS6A 3HRUA 2IXKA 1XSVA 4IRHA 3M8FA 5LEJA 2EFWA 2PHLA 3Q9VA 4EWAA 2STTA 1CAXA 1FYLA 4U0VA 5DCMB 1LEBA 3F8MA 1I5ZA 4E2GA 3I7DA 3LWCA 4HDUA 3ES1A 2VOOA 1EP0A 4CGZA 3SHRA 2HKOA 3K0LA 2GAUA 3QU3A 2ZMEA 4AD9A 1G3YA 1XD7A 2CG4A 5AONA 5K1YA 3D82A 2HYGD 2J5PA 3L2HA 4R52A 2FXAA 5DCMA 3M8EA 1YHFA 3DPLC 5KK1A 2JPCA 2MA3A 1KU7A 1CX4A 4KIGA 1S7OA 4I7HA 3BPZA 5BPXA 2YR2A 5I0UA 4LUKA 2Z9OA 2E1NA 3BJOA 4MX3A 4XF1A 3NSTA 2QQAA 4LTAA 4MTEA 4PCQA 2GH2A 5BPDA 3GYHX 3G7DA 4QM9A 1YYVA 2FOKA 1BJAA 5KHJA 2KIUA 3NL1A 3GYDA 3KFWX 1HSTA 5BMZA 3H7YA 2O8QA 3SQNA 3H3ZA 2L3DA 4LLGF 3FE5A 2MPFA 4X6RB 2FE3A 3NKTA 2LDUA 3FMQA 4OIPF 3TNQA 2IXCA 2H94A 2LKPA 5ILSA 5FLXK 1STZA 1A04A 4I01A 3WE2A 1YFWA 4A2UA 3NW4A 2QQBA 3BY6A 3WTWC 3ERED 2F2EA 3F8NA 3CL1A 5DEQA 1XCBA 2KIFA 2PAEA 3WTYC 1MJ9A 3ELNA 4BAYA 4ESJA 2HYFA 4RD7A 3CDHA 3V7SA 3IBMA 3CUQB 4LK1F 4YNIA 3ABTA 1KQ8A 1LDJA 1YW8A
chains in the Genus database with same CATH superfamily
1K42A 4E70A 5H6QA 3OIPA 1ZR4A 5DN2A 3CKHA 3V65A 4MTDA 3DFGA 2FD8A 5FLVA 1ODDA 4JGZA 2KLOA 3B3QE 2W08A 3ACLA 2IA1A 2A71A 1ULEA 4BK5A 2V09A 3ULQB 4K1ZA 2XAFA 2UWBA 3HNBM 4YFWA 3NRUA 5L3FA 1YJKA 5ABJC 3K70D 5I0RA 1IN4A 2YBKA 1TNSA 3I59B 2CJJA 3KF5A 1QJY3 4F7ZA 1SHWB 5EG0B 4IXLA 2VJJA 5EZHA 3VBFC 3ZYRA 1QJEA 2D6KA 4KJZA 3AP4A 3HOYJ 1W8FA 4EGYA 2K46A 5CZKA 3WTXC 2DYCA 3BWGA 1BI1A 4CZCA 5L3EA 3GHMA 1UMQA 4AHWA 5EG0A 4ZTFA 2R0HA 1BQPA 2HQNA 4UVCA 3GFJA 1OYYA 1D0GA 2WDBA 3LSIA 1XGOA 1D0YA 2YUEA 1M1EB 5EZWA 4XUPA 1UKGA 4FFIA 2P7VB 1KQ9A 4WXCA 2VZUA 3Q0WA 4RFRB 3M3OA 2G4IA 3P3NA 4B44A 2P6TA 3VKNA 3WX5A 1Q8OA 1DGWA 4D1QA 1QNTA 1S1AA 3MIBA 1IN6A 1G8WA 3HHGA 4HF1A 3OIOA 5FPAA 1Q8QA 3EQEA 4EN8B 1SD7A 2Q8DA 4I6ZA 1MEC1 4UXAA 5KAIC 4DXSA 2IS4A 1U9NA 2OW4A 2B4KA 3H0DA 3WT3A 2R041 3OB8A 1TWHJ 2NZ9A 4WBBA 3HVDA 4G6DA 4BHBA 2PHDA 5FIXA 3I4MJ 4HQEA 4AM3A 3U0ZA 4UUTA 4OHYA 2IFWA 2ELJA 4BQQA 4FQGA 4AVAA 3CZJA 3GZAA 1DQ0A 3FXUA 4Q0PA 1PNFA 2YPRA 4YVWA 1FAYA 2IT0A 1LENA 2RDRA 2ZXIA 5FUIA 2YC2A 3IIAA 4I3PA 2XAGA 3WDXA 1KDMA 3VZJA 4PIYA 2EZKA 2WZR1 1LHUA 3F23A 3OGGA 1UB9A 4XFFA 1ZTRA 1YS6A 1WSUA 4D6RA 3PNVA 2Y0MA 3PNAA 4L0ZB 1SAUA 1LESA 5KAFC 4OAYA 2KZVA 4P9IA 2COMA 1OJLA 3ES4A 3RGBA 2WV1A 2YBPA 1OISA 1VRH1 1XPXA 1LHVA 4HVQA 1KS4A 3Q3SA 3D5LA 2DODA 1POV0 5GAHJ 1YUDA 4R4XA 2XUEA 1G9AA 2HTJA 3OYWA 4NROA 3ATGA 3CJTB 2OUJA 1AJOA 4XQDA 4CICA 4XF0A 3POEA 1H30A 2XAHA 1S0DA 5LGNA 2BP6A 3P9CA 1W5CC 1IUFA 3D0JA 3N97A 2QEXI 5C71A 3LSDA 4XIDA 3AZXA 5J40A 4F8AA 1TT5B 3RZKA 2J1RA 2JDMA 1GLHA 3KCCA 1AZDA 4N9IA 4MHGA 5D1IA 2J1AA 2VQCA 1GMMA 4XKCA 5CVUA 3C7GA 3Q8BA 2RS32 1GQHA 4OHVA 3BALA 2X8KA 3CP2A 1TMF1 1ZELA 5JXHA 5EYRA 1SQ4A 4A6DA 4JX4A 1ON2A 4D69A 5FMDA 2E7XA 1U5TB 3ZOIA 1FWZA 4MHRA 2C0ZA 1JOJA 2VBXA 4HK9A 4RGRA 3AAFA 5A2QK 4WWCA 5FCCA 4META 3MVPA 3ZMTA 3E5QA 3WG1A 1D4M2 3CMMA 5IAXA 1P2FA 1FXZA 1XYOA 5CU1A 1U5TA 1ZREA 4AQ2A 2HWD2 4WK8F 5CBLA 1JUHA 3WP5A 2OXBA 2HWVA 1NCQA 1ND2C 2IXIA 4ES8A 5CB7A 2QA4I 2LF8A 3ZDSA 1UMIA 5C3RA 4XEZA 3ZSJA 3KYCB 2E5NA 3OEBA 4LEJA 2QCOA 1SEFA 2MHFA 4XSZF 4PJ0C 5JUVA 2LREA 4BM8A 3O14A 1WJAA 1XDSA 1QHDA 4ASKA 2VBWA 5ICGA 4LHLA 4XAAA 1ZBE3 5CVVA 3QPTA 4PSXA 3HJRA 4NIAA 1DQ6A 4M3CF 4KIBA 3OYMA 4RQPB 3PNYA 2M4GA 4HOBA 1AR91 5EJ1B 4L5JA 1I3AA 2V73A 3CEWA 5A3OA 4OUSA 4DOUA 4DRVA 3TOAA 2XL9A 4OI0A 4Z1VA 3I9V2 3D0SA 5HVQC 3CO6C 5FQ0B 1R23A 2VZ3A 1DPUA 5J96B 2OUHA 5EQUA 2Y8KA 4IE7A 2CV0A 5CLSA 4IETA 4E7KA 4COZA 3KV5A 3OTFA 2OBPA 1OOPB 4P5HA 4QXHA 1V3FA 1TME1 5FZ3A 1OCCH 3W5NA 3F95A 3JUUA 3K4AA 1ND3B 1BL0A 3LDBA 5I8YA 4HX8A 2R5YB 1WCQA 1D0HA 2CTVA 3PO2J 5JFRA 5AIPA 5DCFA 2L7FP 3DWLE 4Y15A 3ECHA 2F17A 4CO8A 1XCVA 2QF7A 2VODA 4X8NA 1MEC2 3WW3A 1CPMA 1OOPA 1PK6C 4AGRA 1T56A 1R092 1Z3YA 3FXOA 2WUHA 4LHKA 2R042 4I98B 1ND3A 4QPWA 5FYYA 3T1MA 5CG9A 3MD2A 2VNOA 3BCWA 1QJX1 1R1A1 2AREA 3PU8A 1V55H 5FDBA 3T2OA 1JHNA 3C3WA 3CDLA 5EJCA 1D4M3 4I09A 3C7FA 2DFHA 1NLRA 3JBG1 4YM2A 5A2QZ 4WVZA 1VJ2A 2Z3YA 1T2KA 2HWD3 3GJAA 1ODNA 4ZH4F 3ALQA 1W90A 5F6FA 4C0HA 1HQNA 2AGSA 2WZR2 2O14A 2IVMA 2LS6A 2JA5J 2YGLA 1GANA 3D6EA 1TBXA 4D5CA 3THTA 3UL2A 3AL6A 4DFSA 2XPJA 4OIOF 2EV5A 2W25A 1CAUB 4BE0A 3PUAA 1SMTA 1E5IA 3ML6A 4D8MA 3AL0B 2CQQA 1VRH2 2WZEA 4LLFA 3PURA 5JOWA 4DYQA 2PJRB 5DUVA 2XF7A 1DZQA 3OF1A 3B6AA 1AX1A 1H0MA 4FOYA 4NC6A 4Q4W3 2RV8A 1ETVA 4PSWA 4CUGA 3TGNA 3DKQA 3OYDA 2WSUA 1GBGA 3WGHA 3LSEA 2QQWA 3DYMA 2QWWA 3LB9A 2DU9A 2PJRA 4COUA 2R0QC 4JAAA 2LM3A 4L9TA 4UVBA 1TNTA 3G2BA 3BR6A 4Q26A 1UL9A 3S3MA 1GUIA 2K3PA 1DLLA 1H2NA 4HV6A 4GIQA 2FDGA 2CDPA 1MQTB 5H9QA 1A36A 5A6YA 3RZJA 5LD2C 3LE0A 4EZ4A 1R093 2CU5A 3RZOJ 4UI9L 3KETA 4RSUA 2JTVA 4DS0A 1OFCX 3HOVJ 1AOYA 3NJXA 4MGYE 2RS53 1DUXC 5FK8A 5C6CA 4LHNA 3E5UA 4Y17A 1MQTA 1KRIA 3H50A 3J7ZI 3ABLH 3O1RA 2PMZN 3ESWB 1FYMA 2LC2A 1ZKGA 3BR2A 3CCMI 1FPN3 2GC1A 3K77A 4WV8A 3S2WA 1Y43B 3PIGA 2JD4A 2UY8A 4CPBA 1WW6A 2R1BA 1JZ6A 1FY7A 4W65A 3N35A 1SBDA 1ZA4A 4Z07A 4HNVA 2J42A 2VKHA 3BP8A 3J7AO 2GNTA 3RZGA 1Y3TA 5KHGA 4BISA 3DPTA 3BTZA 3LA7A 5GLTA 2EAAA 3FLTA 2E31A 5DG1A 4RHV1 5DV5A 1MBJA 1Z7S3 2VC9A 1GVDA 1X1BA 3AXEA 1W6QA 2ZAHA 4UAPA 3OCPA 3L9FA 4IERA 4MSVA 3ZQLA 2V1DA 4UFJA 2KIQA 1JYIA 1HB4A 3POGA 4DJAA 3PIOF 5HXVA 1RUI1 4OQ9A 3KS7A 4KT6A 3SXYA 3JRGA 1WUVA 4IZZA 2IGMA 4MFDA 1W2OA 3JTGA 1GKBA 1AR92 2WFF2 4Q8KA 2EICA 5LW9A 2A70A 2B8MA 4ZYAA 5FXVA 1Q1VA 3K4ZA 1V0AA 2YGMA 4Q4Y2 2M2EA 5FZBA 3QBQA 3ZFFC 3LD8A 1W5TA 4XXPA 3BPVA 3FM5A 3D5RC 1PUFB 5E20A 2BHYA 5IP9J 4OU0A 3CCQI 4LBMA 1YJLA 1G3WA 1HDDC 4CDXB 4A44A 3X2QH 3ZX7A 3GBGA 2ECCA 3R05A 1JTXA 3LAJA 3POSA 4Z8BA 5FKNA 3BZ6A 4XJZA 4AAPA 3ASOH 3ITQA 4QX2A 4RAGA 1PUFA 2HBUA 5F5CA 2XB0X 3SEZA 4Y1VA 2BJSA 1R5HA 3ZXSA 1OURA 3TL4X 3ZP5A 2V5YA 3LGRA 1X7NA 3HN1A 3HYIA 3VD7A 3M8LA 3FX3A 3WU2C 4CDXA 1XS9A 2R92J 1QJX2 1R1A2 1X2MA 4XQ4A 5IYYA 4EN9B 1MNDA 1MVEA 3BOWA 2BV4A 4FTEA 1MMSA 4W6XA 2A3XA 4MEYF 2J1UA 1ETWA 2AACA 3E7LA 3JBG2 3V0BB 4S2HA 2ZGLA 3O1TA 4DQ2A 3AFGA 3QPLA 1D0XA 2XKOA 3HD8B 4BQWA 2RVCA 4C8DA 2MEV2 2EA7A 5K5QA 3JTHA 4IQPA 2KL4A 4MNUA 5D2AA 1UHWA 1ZRFA 1K79A 2E33A 2EFQA 1B59A 3VKLA 1I39A 2O0YA 3DBHB 3MEPA 2J22A 2Q8CA 1J59A 2M7BA 3AG3H 2WB1A 1MBGA 1NH3A 1C8M3 3W2VA 4DZGA 5JCTA 1JZ8A 1KU9A 3HKZN 4OOIA 3RYPA 3MIDA 4M9XA 4AQ6A 2DVBA 4BDYA 2DXIA 3CCJI 3DEMA 3CMGA 2WYFA 5I0DA 5TSWA 3TP0A 3VDDA 2NYYA 3H5NA 4N7UA 1GP4A 4NNJA 4M71A 1QZZA 5T50A 3PQKA 4Q4Y3 4CCDA 3W6JB 3LEKA 2FHRA 4OMCA 1G9DA 1J09A 4GAZA 4AWDA 4GGGA 2WAFA 1RRJA 3C2HA 3MUZ1 2WO7A 3I55I 3HBZA 2A69F 3L2YA 5IVFA 2BHZA 2VN2A 3L09A 4M3CE 5FYMA 4DNYA 1WLDA 1IG7A 3S16J 2B45X 3LOCA 1CZTA 1DGRA 1YIPA 2VGDA 5FY1A 4DUXA 3IN9A 2PMWB 3OSFA 4BJ0A 3LDKA 1YIOA 1IO2A 2XWBB 4KU8A 2EXIA 1KITA 1UY0A 2E36A 3ZFEB 2ZGSA 4DUVA 3JQWA 2IUWA 1EJ9A 1D7PM 4G8XA 2X5IA 1GUUA 1XNAA 1U3EM 1C3HA 2W4SA 3PUQA 2YYOA 4PLNA 2Y0SA 1MS3A 4IV1B 4FTHA 4BEHB 2LTNA 4AYUA 3MW4A 4OIQF 1KJRA 3ZFEA 1JUMA 1K45A 4LLOA 1ZARA 1R7JA 2D44A 3B7MA 1S0FA 2GM4A 3ACFA 3K4KA 1IKPA 3QOEA 1SFNA 3AP5A 4Y26A 4JKMA 3SQOA 2PN6A 3LL7A 1X36A 4IV1A 1DGRN 2CSGA 1VQ8I 3QRFF 5LZ6A 3I4IA 3BTXA 1Z6RA 4IUGA 4A3BJ 5FAXA 2ZHNA 2WABA 1A6CA 1LTEA 5GLUA 2M34A 2F5EA 3I3QA 2L4AA 1C4RA 5F6KA 3A2KA 1SLIA 1UELB 2JDHA 5ANQA 2CFXA 1GSLA 2DTRA 4EVIA 2AHQA 1V9U1 2Y0SN 1XGMA 4QDRA 2I2SA 5DZFA 4NDLA 3TDUC 3DCQA 3QP6A 1ULYA 1W36C 1VAVA 2AYHA 1EAH2 1QF3A 2IWGB 1LULA 4YPJA 1DCSA 4WZFA 3S2HJ 4X8PA 1YX5A 2W94A 1FMD1 4WX9A 5FXWA 1QQIA 4L9NA 4J01A 1QQP2 2WBMA 1I5PA 4BY7J 1RUI2 2CGPA 3WP6A 4BQOA 4IJAA 2RR13 5CKTA 4HN0A 3DUIA 3BJ6A 1FOXA 2GXGA 1Y0NA 1T6GC 5BNPB 1UPSA 3C8XA 1QNWA 2CNAA 1OD3A 4YFNF 1VE0A 4AEMA 3LCPA 1ZG3A 4GYGA 1PUEE 1O3RA 1JYWA 3HPGA 4CDQC 2JDKA 4ZY9A 1V4RA 4EJVA 3PQJA 2QQPA 1S2EA 5FRAA 5FZCA 4AVPA 3H36A 2GDFA 2JDAA 1ZBE1 4R1HA 2V6CA 1UCRA 2WNUB 3WDTA 2XBO2 2RM21 2B63J 5HOOA 4QXKA 1QH6A 2X10A 3IHUA 5I91A 3AKSA 3SC7X 4PLMA 3ZQCA 2X53S 3LDRA 2PAKA 5G04L 3HOUJ 3ME2A 2E19A 1WMXA 2X9DA 2A07F 2PTMA 1FNNA 4AVBA 3ONQA 5G05L 1VTNC 1RPWA 5DS9A 5IHRA 3KEYA 3WHBA 1EV11 2L2OA 4MGKE 4RN5A 1GQGA 4OYUA 3OYCA 1G3SA 1LAJA 1KGYA 1HB1A 1T0FA 4JDNA 3BTIA 4MGIE 2X6YA 1H2KA 2FDKA 3ASNH 2D2WA 1IG0A 4SBVA 1F5JA 3HOZJ 1Z1DA 4ES9A 2VZVA 2ZZJA 4CP0A 1YXWA 1G9BA 1S5LC 1VFCA 1S0JA 2Z2SB 1MS0A 3FXLA 2BVLA 3OS1A 1SDWA 2TEPA 3KZZA 3MCZA 3IDAA 3SISA 5EXOA 4CXFA 4DRRA 2WO3A 4CDWB 2QQLA 4XDQA 4ZHNA 2RQQA 2CQKA 4QAWA 1QJZA 3OPZA 1RUF2 1SLTA 4XFGA 2WRAA 2EB7A 1IXRC 3Q9SA 3I2OA 3ZMUA 3LEMA 1UZZA 4PIZA 3V56A 1I1SA 2IS6A 1W5SA 4HOOA 4CDWA 1TWAJ 1DPRA 5EHDA 2VNVA 1MNEA 1ST8A 5EGOB 3DXUA 3JRCA 3Q5FA 3IV5A 2HYXA 1FPQA 1X58A 3BPSA 2MLGA 3MZYA 1IS4A 2LOOA 2W52A 1BHGA 2LBFB 2ZNYA 5AVAA 1Z05A 1W9FA 4LGWA 4L8QA 1FOD3 5K8SA 5EGOA 2FBKA 3A0NA 5IP7J 2OKXA 2D1VA 5J4VA 3GFIA 4HXCA 4FAHA 1QPIA 5A6QA 1F8VA 1CAVB 1E3PA 4MO7A 4RS5B 3F22A 1MS8A 3HEFA 4HLYA 5FFXA 4HANA 5C3OA 4Q1PA 1JZ2A 3PVOA 4MO3M 4IE6A 3WGGA 4LIUA 5E3OA 3CZUA 4YG0A 4KT5C 3JRBA 3H1WA 1IRFA 2JDYA 2K86A 2V9KA 1CAVA 5BNOC 3C7EA 3ELKA 3S7IA 5CADA 3IPVB 4XKBA 4W4ZA 4JKLA 2ISZA 4R79A 1HKTA 4P9LA 2G9WA 1YIFA 3OYKA 1I27A 1WFXA 4TTGA 1LQ1A 1XC6A 4A3MJ 1JW6A 2VNRA 3AKQA 1S0BA 5HCAA 4AZZA 2KR2A 3F8FA 4LQRA 3N9LA 2QFEA 5F0FA 4A3FJ 3AVRA 3F6OA 4LO5B 1GZWB 2JJ7A 1P6RA 2XSDC 4E4SA 2L02A 2HWF2 5D6EA 4P9UA 4YWAA 3MZHA 2VMCA 2RS51 3ZR6A 1N1TA 5EIYB 1RUF3 1R4NB 4KNCA 1LHWA 2HZDA 2DLLA 2AENA 4CZZA 4MGTA 1K5MA 4W97A 1OPMA 2GC2A 4E7LA 2F4PA 3R0JA 5BPIA 4EE2A 5HODA 4IEPA 4Q0UA 1ZN2A 1KXGA 5IYBJ 2ZGNA 3AMPA 2ZSIB 3H9JA 3ABKH 3QPSA 5T5PA 4Z6YA 4L0YB 3EPZA 2ZHLA 3LAPA 4N0BA 4D7NA 4IEOA 1YITI 1K3IA 2VE8A 1AR62 1TWGJ 2MLKA 3DEUA 4ZZDA 1JXNA 2XR4A 3TRSB 1PX3A 1LJ7A 2ZEXA 1B1BA 2JJ6A 2A61A 1W6MB 3PVNA 5BNNC 4GH4C 1LGBA 4Y4RA 3Q8AA 4BNCA 3IWFA 3USSA 2VOPA 2D6OX 1UHMA 3QD6A 2WL1A 4N8MA 2TDXA 4G6TB 1UWWA 1LNSA 5FLMJ 4MXVA 2ZO4A 4AU7A 1F15A 3KZYA 2O5RA 5BY5A 4LJZF 1IC8A 3ZR8X 2E32A 3JB4C 5I8SA 2ZPXA 4QWNA 3BQZA 4ENNA 1JT6A 2YPJA 1WJBA 3T4VA 1RUD1 4S05A 3M7GA 1LFBA 4AYBA 2B7EA 5DUWA 2Y6FA 3ILFA 5A6ZA 4XTPA 4NHKA 2O3FA 1EA3A 2JKXA 4F55A 3IKTA 2O0OA 2XVLA 1OUSA 2Q5TA 2VZPA 1BJQA 2R7OA 1TVGA 5L3BA 1XMXA 4OAZA 1ZLKA 2HQAA 3GTPJ 5FUPA 3VV1A 5F5IA 2HDDA 4IQJA 2IA2A 2KT0A 2I45A 3AC0A 1NQJA 2VW1A 2L5QA 1XB4A 2ETHA 4AQTA 3WGIA 3V64A 1OQ1A 4XC9A 2JG9B 4MIMA 2P5KA 3RYRA 5GPAA 2I5UA 3C3VA 1VQ5I 3EUAA 4A7ZA 2OD5A 2PJPA 4AYBN 5D5WB 5HS8A 2L54A 1E3OC 5LWBA 4BBSJ 1FMWA 1WI9A 3ZGKA 5JZGC 1KD7A 2VXRA 1DQ4A 5CAZA 2JG9A 3ROUA 2LKXA 1ZA7A 4ASNA 3DTEA 3VHRA 5JSPA 2X0LA 1IPKA 4TYSA 5EF6A 4JK1X 3IKWA 4C2MJ 3F3XA 4ZDOA 4Y1UA 3H9GA 1AR63 3M07A 2VZ1A 3PFYA 1W2UA 2EIBA 5EFUA 4BACA 1UY1A 5FY4A 3ENRA 4CDQA 5C9AB 2JT1A 1MZBA 2DK5A 4AI2A 1C5IA 2KPMA 2W46A 2HBTA 3PIJA 1PM4A 1REFA 2JD9A 5I0SA 3ZXLA 2HOEA 4FPHA 2ZC2A 3G73A 2WY7Q 3ZR5A 5C9AA 5C7GA 2CV1A 1C8M1 4RBOA 4UV8A 4FX0A 2EIGA 5J1UA 2QQJA 5DMYA 2WQZC 5IT9K 4Q0QA 4ZZ8A 1DP7P 3P6BA 1S6LA 4XFAA 4XRSA 4KQ7A 1K61A 4OINF 4XVHA 4MYEA 2JB8A 1VB2A 2P17A 3OD4A 1T39A 4A3CJ 1VBA1 4HDVA 2VBBA 1BI3A 3HGYA 2YPDA 3CLQA 2BBVA 3FMSA 1A3KA 4KISA 2VLAA 1Z78A 1O59A 2Z1DA 1H8TB 3DU6A 1VMJA 1YFYA 2M7AA 2W87A 4XABA 4XXAA 3J7LA 4CTEA 2LFBA 1QJU3 4A42A 4O5VA 2BGOA 3POYA 1UZVA 2WINB 2FA5A 1YQCA 5ICFA 3NJZA 4D0QA 5FZ9A 4YFXF 3P9KA 2KQRA 3K2ZA 3VKMA 3VSLA 2R30A 2ZGQA 2X1EA 3CO7C 3B6CA 5FYSA 4GO1A 2D5HA 1ZRCA 1H8TA 1X4PA 4XF4A 4H4KC 2JUCA 1BEV2 3RIRA 1C1LA 1SFXA 2HTSA 4XF9A 3DPRB 3DQVC 3MMYB 1PDNC 1D8JA 4LD5A 2ARXA 4QB2A 4II2A 2WYSA 3BUCA 1YI7A 2ZX2A 4TLGA 5GTHC 5DD8A 3C2BA 1WRJA 3PUBA 4B09A 1AR83 3HRUA 2IXKA 3J8F3 1BR2A 1FYLA 4U0VA 4XZPA 3WNNA 4CEWB 3T30A 2X6WA 4FISA 3S6PA 4AGVA 4CGZA 3GM8A 2HKOA 3K0LA 3QU3A 3JD71 4C2TA 3D82A 4A6SA 3KQRA 2J5PA 2JIGA 2Y2ZA 1HX6A 3A1YA 3M8EA 2YY1A 2WBKA 3DPLC 4AAXA 1RKWA 1WW4A 2MA3A 1CX4A 4KIGA 4DY5A 4ZS2A 3AMQA 1H8AC 4QX7A 4OI1A 3J26N 2RE9A 1YCIA 5BPXA 2YR2A 2OPTA 4XF1A 2E26A 2R073 3HGGA 4LTAA 3OBTA 5BPDA 1VIWB 3WG7H 3CMYA 1YJ9I 1UAIA 4A7KA 5F3EA 3GYDA 3N9QA 3KFWX 1BCXA 3VD4A 1AYN1 4F3QA 2FDFA 3AP7A 4X6RB 5IK5A 1VBB1 4DXRA 5FPVA 4CP2A 3UNPA 2DUPA 2RR11 3BODA 1W3XA 1OCRH 3A0KA 2K9LA 2IXCA 2LKPA 4MOAA 1E5RA 4DEQA 1YOVB 2LD5A 4OHZA 2Y6JA 1SCRA 5DAVA 3ERED 2JX9A 2EIKH 3F8NA 5A3NA 2VTXA 4CCMA 1UY2A 1Z77A 1YQ8A 2DA5A 4G12A 4LK1F 2QUOA 3BTYA 5EYYA 3J7MA 4QQPA 2XRNA 2ZJCA 1RVF1 3KD4A 2YX4A 4COWA 3HG9A 3LSHA 4DQAA 4MGSA 1XQNA 4ASLA 3ABZA 2XMLA 5BNPC 1RHI3 3ZSKA 2KDZA 1BOAA 3NJYA 4UBHA 4FASD 1U9OA 3OIQA 3ZN6B 4ZU7A 1YO8A 1NCRB 3MIHA 4L2NA 1PMJX 1OSGA 1XG1A 3D4KA 1GYKA 3VBRC 1COV3 2DOEA 2HVSA 2DFCA 4JKKA 3KP2A 5C8CC 1D3YA 1PVXA 1GR3A 5FR3A 3ZN6A 2YFUA 2ZMKA 3KGZA 4PQ9A 1B8IB 1ACCA 5T55A 1CIYA 4XYXA 3O6BB 4BL0B 2JXAA 1Z0XA 5DUKA 2M30A 1HA8A 3AKRA 1W36D 4QT6A 4JGYB 3TN91 4P14A 4C1WA 2PFBA 1TP4A 4YIIA 2BVVA 5EJZB 3FZVA 1UG2A 4WVWA 4HL0A 1B8IA 3S0MA 3WCRA 5D5XB 1WKMA 3CJRB 5FY8A 2P6SA 2RKHA 4I3GA 4JGYA 3WTVC 3O1VA 1QHHD 1AHDP 2ZEYA 1G7YA 4HRIA 1A31A 2XJVA 3HT2A 4X6QB 3K1NA 2BERA 1H9GA 1ZH5A 1VBA2 2B0LA 4JC1A 2GU9A 3HT1A 1SD4A 5A7PA 4EN0A 4LIVA 3HOTA 4E9KA 1R6RA 2CYYA 3TMOA 5CIRA 3V8JA 3APBA 3D8CA 5DPNA 1S9HA 2WAEA 3KHBA 2K4BA 2Z5WA 2HDWA 4HPQA 2VTXJ 2ZKZA 3VDCA 1LJ9A 2E7TA 3WDYA 4EMSA 2MC3A 2R7VA 1JYNA 1OLME 1PO13 2LKSA 4FSJA 5CA6A 4CCEA 3HM5A 2OA4A 4P9GA 2FQ3A 2E1OA 4EJOA 3UV9A 4CDUB 4QPIA 3KCXA 2ID3A 4XHBA 1U6GA 4TWTA 3FFZA 4M01A 4XOTA 2Q2EB 3B9CA 2LVSA 1LRHA 2HKXA 3MQ0A 5IVEA 3V0AB 4RS5C 1QDCA 1KYWA 1XB9A 5D8LB 1US3A 4CDUA 3OOPA 1MMGA 2EV0A 3A01A 2OTLI 1AL22 3JD72 3H9QA 1XSRA 4Y13A 4TZDA 4LOTA 2Q2EA 4JDMA 4MH0E 3UKVA 3ZSMA 4ZYEA 4C3IJ 1R083 2J1EA 2XJSA 1EY2A 3V0AA 4CXWA 3F8CA 4Q27A 4XK4A 4GKXA 3BB6A 3GGLA 4HG2A 2HOSA 2VZOA 4QPOA 2ME6A 3U4XA 4L11A 3KEQA 5A7WA 2GIZA 1NG7A 1NY72 5KHHA 2EFNA 4XMAA 1UZCA 5FO8B 2IVJA 1WBFA 3NARA 1TLHB 3PUIA 5C3SA 4BKXA 1LVAA 2Y75A 2NMOA 2DA2A 3B5LB 1CIWA 1MS5A 1HQLA 1YRZA 1AYN2 3RPUA 3CCUI 3KHCA 5LBBA 1VBB2 4BJTA 4YFZA 2JDPA 3EUHA 1BBT1 3IH2A 3ZOBA 5HS9A 1I1EA 3U21A 1Q1HA 3DYPA 2R16A 3N7JA 5LRRA 2D45A 2RDQA 1I50J 4A3JJ 1S29A 4JDOA 5E8IA 3KQ4B 2HFHA 4LMFA 4JHZA 5CISA 1BK0A 4FAGA 5DAQA 1FNZA 4PCRA 5FZDA 1H6YA 1SD6A 3DEEA 2RS11 1JJ8C 3N36A 1LCLA 1MR5A 5LY1A 3H5RA 1U5ZA 4AR2A 1RVF2 2AC1A 2DA4A 3H1MA 2VXDA 1ZVFA 5LY2A 1HXS2 3E3VA 4XUNA 1SVMA 1JI6A 1GV2A 2XXZA 2ZX0A 1B35B 3GF6A 2DBNA 2GA2A 2DW4A 2DFFA 3KLOA 1NA1C 1W9WA 4ARYA 3KYDB 2ZJ2A 4AFCA 3FZ3A 2JA6J 3RI8A 1XE8A 3C2GA 3T0YA 3OBZA 1Y9QA 4OZOA 2M4KA 1AL23 3CP8A 2JKBA 3THCA 3DP7A 4PI0A 2I10A 1B35A 1MH4A 3WHCA 5T5JA 2QQUA 2QGUA 3THDA 1ONAA 3HN3A 2G9GA 1W6PB 2ELHA 5FXXA 3K2AA 4XBFA 4TSVA 1LDDA 5E8AA 1CD3G 5M5XJ 2JUGA 2JSCA 4M9ZA 4C2UA 3TN92 4HZFA 2QQ8A 3WG9A 3OS0A 5HLTA 2IS1A 4Q4X3 1UIKA 3UETA 4N4NB 1C8NA 2AQEA 4RA2A 4AIJA 1JI8A 5DZGA 3G6JB 5BUVA 5CKQA 1YO5C 3T1LA 5A3WA 3BTJA 3R6SA 2UUZA 5DAPA 5IOZA 3HMYA 1RUNA 5KWRA 5DYMA 5DQ0A 4XURA 2WC2A 2QVSB 2VW2A 3H3UA 4KWKA 3IWZA 1N3PA 3OOXA 4FQZA 4HKLA 3HHHA 4JVAA 2EIMH 3GFLA 1SCSA 2P3IA 2DFEA 3IH4A 4LO8A 3ASIA 4SLIA 3RKYA 1DBNA 1ORKA 2XGCA 3RCOA 1JUPA 4FCYA 4L0PA 2HJIA 2W00A 1VBC1 4JOMA 4LORA 4G9YA 1AUYA 2DQLA 3ZQQA 3LWFA 2DPUA 4UUVA 2QKDA 3IAPA 3PIPF 1BK1A 1GQPA 4HV5A 1U5YA 1OQDA 4M6YA 2M8GX 4MG2A 3LA3A 4Y20A 1HXDA 1H9PA 2RMU2 2DDUA 2WA0A 1VMFA 2NNYA 2VJIA 2FOWA 1TC3C 3VBRA 1HXS3 4DXZA 4UUSB 5KHKA 3C2UA 2DMPA 2R4GA 1ZM1A 1W7PB 2YS9A 5F7UA 1X8EA 4B7EA 1PIV2 4NWVA 4HLXA 2KRCA 1OH3A 3ZFGC 1UIJA 2VQHA 2BRTA 1Y0UA 4DNCA 1ZYRF 4NVPA 4U7BA 3BR3A 3B02A 1QH7A 4K3UA 1ASJ3 1PX4A 4Q29A 4BY1J 5FMOS 4M9SA 4FPCA 4IEWA 2L9VA 4HYEA 1W8UA 1YEWA 2X05A 4U2AA 1ENRA 4HSLA 2QE3A 2B9VA 1YC61 4X1EA 4NQWB 1ODMA 4HKOA 5A80A 1NOVA 4GMP3 1RUG1 2WR9A 1W2AX 3ZYFA 3HL2A 2JWPA 5B1AH 2OU2A 1FSHA 5JI7A 1X1PA 3NKGA 2PQ8A 5CJ9A 2L9LA 2YBSA 1G9FA 4NQWA 2J1SA 3Q8FA 4PFPA 2BXZA 1PZ8A 2K02A 1HQWA 3U14A 5HBAA 3AXDA 2HDCA 5HDNA 1J9IA 3VBHB 3RQ0A 4ZDPA 3IH3A 3FKIJ 3IDBB 4UT5A 1ZBA1 1JYTA 4AXOA 4AI3A 3DPRC 1CJDA 4GWIA 4NOTA 1ZG1A 3ZXGA 1XN7A 3I8TA 3FXQA 4E4HA 1S0GA 2OCEA 2ZX3A 1J75A 5ACA2 2VO5A 4FXKB 5T5LA 5IVVA 4XJ9A 3VBHA 1BBT2 4M3CA 4XHXA 5FY7A 3K4BA 2WWJA 5L7OC 1IKQA 3RJ2X 4CEWC 5FKMA 4UOJA 5A1FA 2RMU3 4K7JA 2HXIA 2ZNZA 4R4ZA 1VQMI 2A6XA 3W2AA 1MNMC 3POFA 5JR7B 4D6SA 1L3JA 3N9PA 1RUH2 4YIFA 3BOQA 1X9PA 5FYTA 5FZIA 2E53A 2UY9A 2RS12 4FE7A 9ANTA 1KJLA 4ZDLA 4K8RB 3S7EA 3A02A 4D3WA 4P96A 3M7AA 3CC4I 3DXTA 3LSMA 2PQQA 4DMIA 3KV6A 4J19A 2Y64A 3Q8CA 5J3UA 5A3LA 1PHMA 3BZCA 4UFIA 1MMAA 1UYYA 5J47A 1BW5A 1UYPA 3RSJA 1CONA 2XONA 2XB5A 4LO6B 2OA2A 1T8IA 4XOPA 1Z21A 2JENA 4YGBA 2O03A 3VBSC 4NAMA 2HPIA 1IRGA 1HKQA 2QM3A 1NAEA 3GZNB 3L7WA 1O4XA 3C18A 5ILUA 1WLTA 4QTRA 2UXNA 1YNAA 2VOTA 4KGGA 2WA4A 3HSFA 4UB6C 2OYZA 2ELKA 1V6OA 1LOAA 3H35A 3OR1C 1W0OA 1N1VA 4LXLA 3UNGC 2QZ8A 4CYCB 1GZ9A 2KD7A 3FBYA 4MLOA 2VMHA 3GTJJ 3ETPA 5DUIA 2BV6A 3H0OA 5L9BA 2BVBA 3MICA 2PHFA 2B9SA 3S30A 3K9TA 1J83A 4S2DA 2FMDA 4YVSB 2R7DA 1MBHA 4JX0A 1FMVA 2VZSA 3UR3C 3GZTB 4L9JA 4CYCA 2VMDA 4WM8C 1A6IA 3VN4A 5F9TA 1RUE3 3PJQA 3W6VA 1W1WE 5E8GA 5F5AA 1NCRC 2XASA 4YVSA 2HEYF 1BVP1 1WD4A 4FHTA 2V6EA 3J80K 4RLQA 4KMUX 1S2KA 5LCWL 1KU2A 2A3SA 3MW2A 1RUH3 2RN7A 1A6QA 1VBC2 3FK7A 2X4HA 4M74A 3V8KA 4G9SB 4KH9A 1W28A 2W57A 4CCOA 4CZSA 3NJVA 5HCFA 5F39A 3ZKUA 2ZFWA 1SFUA 2OAZA 4TN7A 2EIDA 3N3HA 2IVIB 2RDNA 3GZ5A 5LGUA 4XMIA 5AC91 4QB1A 2WAOA 4YW7A 5FZKA 2WA3A 5F32A 3BVCA 2EWNA 1UO9A 3MUY1 2NS0A 4XPVA 4ENJA 2XIGA 1TEIA 2VBDA 4ONUA 1UNBA 2K9MA 1AXYA 2IXJA 1J84A 2DJNA 3ECOA 3BG3A 2ZEWA 1AU7A 3VGIA 1PVC2 2R7EB 1MH3A 2V4JC 3ZIXA 3WG4A 2W1SA 1X1CA 3S14J 5D8AB 2NS8A 2XJQA 4FFHA 2L4MA 2PELA 5FZEA 1UAAA 3MKWB 2QVOA 2I74A 2EFOA 2DCTA 4MGQA 4HA8A 1EH7A 5IOYA 3EO6A 1JH5A 3BTCA 2KRHA 2BBAA 5D8AA 2EK5A 4CEYC 2DUOA 2ORXA 3VLBB 5C3QA 2H0VA 1OKOA 2H6BA 3UYJA 2WAQA 5E18F 4LOSA 1H6XA 3E1F1 1HKSA 4KGQA 1SLAA 1F36A 4YFKF 1RC9A 1SBEA 1VBE2 1LE8B 2QBYB 1HN1A 5J98B 4UVAA 3U78A 1ZZBA 2J5OA 3PVBB 2GMMA 3GHNA 3TBDA 2W5FA 2ZHMA 2WWUA 5M5WJ 5D4SA 2JSPA 4JZRA 2DFIA 3FMGA 1ZBA2 5EEAA 1CESA 1G3TA 3KF3A 4DYCA 3NV2A 4UFMA 4HK8A 3ZXDA 4D0PA 4W6WA 3SEQA 1P7JA 3TEWA 1BYHA 5T52A 2K7LA 1R081 3RYKA 1OR7A 1LE8A 2XHKA 1MIJA 2QBYA 1UF2C 3CF6E 4RB0A 4E8DA 3PO3J 4JRLA 1BW6A 2QKLB 5LBQA 3J80Z 3HDDA 3NNFA 4KFCA 4HONA 2EBIA 2E71A 2YZ4A 3W59A 5A70A 1UJ8A 3MWMA 4Y5TA 3AG4H 3KP7A 2VNGA 3GZ6A 5KC5A 2GIVA 3INAA 4FOWA 3PLQA 1VQNI 2IRFG 1WCMJ 1DQUA 4HMZA 3NAPB 2DA6A 4QSHA 1XOYA 3WTZA 3VHOA 2MYSA 1N78A 3HB9A 1AYM3 4IRGA 2E1CA 2NVTJ 4Y22B 5CFCC 4PFOA 2FEZA 5FTTC 3EETA 1QOSA 4IF4A 5C44J 1RUJ1 4AK3A 1QEXA 2WT0A 2PI0A 4OVEA 2YU3A 1YW7A 1PVC3 3WNXA 2WV0A 2ZX4A 2RDPA 1F5FA 1XNDA 2B42B 5D21A 3AYEA 5IWFA 1AR71 4BXSV 3RPQA 2MSYA 4M3GA 5L3CA 2LSOA 3E5XA 4H0EA 4KBBA 4QQHA 4KDPA 1F1ZA 2FDHA 2F4LA 1QY4A 1IQDC 2XHNA 1QGPA 1BC7C 1F31A 2VI6A 1I3HA 4XR6A 3R4UA 4NIHA 2VKDA 5CFDC 5M3FJ 2ZFUA 3LFUA 3AM2A 5FD6A 5DUUA 2BYVE 5J1RA 1H8VA 1QZYA 4II3A 1HRV1 1SAXA 2DMTA 3I56I 3S8PA 5FPLA 3LEIA 1HIXA 3N05A 1VBE3 1P92A 2ZMEB 3OMYA 3PL8A 3TKYA 2JDUA 1RUC2 4Q4V1 4BJ6C 2C4XA 2D5FA 1JU4A 4OI4A 4R9AA 1T95A 5GZDA 2NNNA 5AIQA 3OGSA 4BE1A 3WV6A 2QNKA 4EZHA 4KUMA 2VQGA 2A5YB 2ADUA 4B1RA 1PO21 4IEQA 5J1XA 4AI1A 1UXXX 1TNFA 4MUVA 4QPGC 3QODA 4IV3B 5K0UB 4KU7A 3VYSB 3C7OA 3MI8A 2ID4A 3SZGA 4I0WB 1MBKA 4BB3A 2PLYA 2VQ0A 3JCUC 1VRBA 5EV7A 1BOBA 4NHLA 1VP6A 4ZTJA 4ZJZA 4Q4X1 3KMHA 1LOCA 2BFUS 1EUTA 3GX4X 2R7QA 2D1HA 1JTZX 2GNBA 2O9LA 2BUKA 4A69C 5A7OA 2QQOA 3V8LA 3GZUC 2Q30A 5K0UA 4B1LA 2ME0A 1FX5A 3UGHA 2CWMA 3K6GA 3O8GA 2DURA 5AC92 1V6KA 4MVTA 1K4SA 2AR6A 2RC4A 2HEVF 4FOQA 3AVSA 5HV0A 3OYFA 5E3NA 2KJCA 4I2OA 3RZDJ 1LOFA 2FDJA 1QOTA 3TO6A 4JX6A 3N7KA 5A32B 2XSJC 3OBAA 5FYHA 2IPQX 1ZR2A 2DYSH 1KQ0A 2CO5A 3U4SA 4Y1YA 4UW4A 2KMUA 2GP5A 4PIXA 1NK3P 4AEDA 1W06A 2XJRA 3AZYA 2DA3A 1RI7A 2DVAA 3P3PA 1S72I 4CA0A 4GB32 2WN2A 3G3ZA 2E1MC 3R0RA 3MKZA 1H1MA 2ZGMA 1JGGA 5F0CA 2X85A 3T0BA 1SG3A 1XPWA 3ECQA 4UY8I 4RGAA 1G4DA 1OLTA 3GW2A 1WI3A 1YW9A 2R7WA 2WNVC 1KONA 3OS2A 3CCRI 3CCSI 3ABMH 4JTOA 2OZJA 1U12A 4QPQA 4IEVA 4JCKA 2FD5A 4WZCA 4YZ2A 2XROA 2F5CA 5F2WA 4GXOA 1OF4A 1MPXA 4A0YA 2W39A 3WNLA 5HDKA 4OIRF 4K9SA 3QLQA 2NLRA 4M6XA 3IDCB 3FLPA 2AS5F 1CJPA 4N90A 1FBSA 3VBOC 2HWB1 1DP3A 2E2IJ 5EDNA 4AF9A 1NLSA 2X29A 3FIWA 5FZOB 1SDDB 5IUQA 4NR1A 1J3PA 3P5JA 1RMU2 2VT2A 1OKQA 3CLOA 2DVDA 2DVGA 5GTIC 2P4EA 3O1OA 1ZYBA 2VC0A 4RL7A 2P7CB 3VDXA 3TOBA 4I76A 1DYKA 2MH9A 3H9AA 2GNMA 2A6YA 5FZOA 4NRQA 2CAUA 2B5HA 4AVZA 2RJKA 2ZGRA 3VKFC 4RMNA 1HRI2 1RUJ2 4BZ4A 4N9HA 3H8OA 1VQ7I 3CDIA 2HWC1 2C26A 2V1UA 1OYIA 2EAKA 5FY0A 3ZCOA 5DAWA 1NUKA 3ZN1A 1AR72 2V1NA 2VT3A 5FWJA 4ZU4A 1UCXA 4LO4B 3SNMA 3WNKA 4YVWB 2HVRA 3GEZA 4KBZA 1BVVA 3E6BA 1GP6A 1RETA 5C4WB 3T2TA 2ZXHA 2R7XA 2QQVA 3QYFA 5J8CA 4IHTA 3H7JA 3ZMVA 3F6VA 2OPKA 4JV4A 1OVPA 3RKXA 2ARBA 1MZ5A 3KP5A 2ATFA 2CAVA 5A1LA 3CJXA 3I5UA 2CYFA 4XUOA 5LBFA 2A6HF 2VONA 1RGSA 1C1FA 3BYWA 1WH5A 5C4WA 5K7HA 3NWTA 1OA4A 1HRV2 1YJNI 1WZXA 2KKOA 1SC7A 3ZO0B 4WF2A 5BNGA 4UW3A 2R061 1BI2A 1UU4A 3EXUA 3W6KB 4QKBA 5FMOL 1EF4A 3JZVA 2RNGA 2PHXA 3T0AA 1E0EA 1GZCA 4Q4V2 1G6NA 1JYVA 2X48A 3OYWB 4O6JA 2GOXB 1VMHA 5JVTA 2PLV2 2GWRA 1KGSA 3DF0A 4UB8C 2Q8OA 1RC6A 1RINA 4RR3C 1WLCA 2WS92 4KMFA 4Z92B 1PO22 1FOKA 5FBJA 2PQSA 2R3SA 2ECBA 2FQPA 2XJUA 1JU3A 1CAWB 2WN3A 3SLIA 3RWKX 5JXGA 2ZTNA 3OYHA 1WJFA 1DGWX 1H0BA 1X3ZB 2FSWA 1RMU3 2BNMA 2A68F 5DM7F 2OC6A 4V2GA 4CE8A 3J81K 3D5OA 4O65A 1LVKA 4YG6A 1JZ5A 4HSRA 2YC0A 2HYJA 1CAWA 5F1JA 3WG3A 3H42B 1VBD1 3CLPA 3QWLA 3FISA 2PX9A 5JMCA 5TISC 4AFAA 4XLCA 1QGLA 1IJWC 2GSYA 5K5OA 1TNRA 3OD0A 4KN4X 1DG6A 4Z2YA 1EYBA 4ZYGA 2A6TA 4BQ5A 3HPNA 1MSFC 3AG1H 4BQYA 2XVCA 4NE9A 4IO9F 3PMSA 3R4DB 4Q4ZF 5DDJ1 5CFDA 3OL4A 1SLLA 4N53C 4PDWB 3OUHA 2NVXJ 3AKTA 4LKDA 4BQ2A 1LOEA 1MS9A 3OPWA 3CJIC 5EWSA 2VPRA 2VM9A 4AGGA 4OFGA 1ZNPA 3VBUC 1FNYA 1P4WA 3DBLB 3KEOA 1GV5A 3BTLA 1FT9A 5DABA 5FMBA 3CTAA 1HJGA 2G19A 1EV7A 3VODA 3SKJE 2KXLA 4N43B 4PDWA 1ULOA 2DOAA 1ETOA 1NCQB 1ETXA 4AG4A 4LLNA 5FJKA 2EV6A 3M1EA 1SVLA 4BH9A 3A23A 2UWAA 4EN6B 2Q0OA 2M1BA 1LFUP 2D3RA 1R5ID 2IEKA 1IUYA 2K2SA 2IBDA 3OSDA 2JVGA 5JHUA 2QZ3A 2R7FA 4BQXA 2H1KA 1W0UA 1POV3 4N43A 2ESHA 1PZ9A 1Z67A 4O9GA 1O4ZA 2KM2A 1IRXA 3ST7A 3K70C 3ZYJB 2QQIA 3MEXA 5IP6A 4X0GA 2WQ8A 2NP0A 5FP7A 2WSVA 2DCYA 5E79C 1RJ7A 1GT0C 2EIEA 2WS93 3CU7A 2QLZA 2VCMA 1EPZA 1E2XA 4JQRA 3HTSB 4YARA 2A6ZA 2FCUA 1OQEA 4AI0A 2EF6A 1K7AA 4FCAA 3ETQA 2MD0A 1UZ0A 1T6BX 4GD4A 2C6SA 3F72A 3Q8EA 3ZSEA 2HWB2 3OWTA 1B6AA 2R5ZB 2HWE1 1U78A 4P55A 4RB3C 3U1KA 4BXFA 4PJYA 5FKOA 4P9JA 3EHKA 2DO7A 3J81Z 3JXSA 1V70A 1EH8A 4HW0A 2A5ZA 5FD5A 3KPHA 4NWWA 2DUQA 3LIGA 3W2WA 2RJ2A 4B1MA 1WH7A 3BG7A 3M3CA 2R5ZA 2W1OA 2VL4A 3RQIA 2JMWA 4NB5A 2X51A 3LZZA 1FP2A 2RS33 1QOOA 4LR4A 4NBQA 3BCAA 3KZ4C 3QYEA 3GDBA 1IG3A 4WM7C 5ABJB 2P81A 3FBNB 3AZVA 1XSVA 4RA0A 3UKGA 4IRHA 1X19A 4LBQA 1YX3A 2EFWA 1C57A 3Q9VA 4EWAA 5DCMB 3VBFB 1I5ZA 1W8WA 3I7DA 2W95A 1OLMA 4DZJA 5LFAA 3G1MA 1AYM1 4M6VA 2D6LX 2LLKA 3SHRA 3OL3A 1M4WA 5KXEA 5ABJA 3NV4A 1G3YA 1ACIA 3ZXEA 2M0MA 2OJED 3G6EI 1HV0A 5GP9A 2W2IA 1Y39A 2BY2A 3L2HA 3M1HA 2FXAA 5DCMA 3VBFA 3O0VA 1YHFA 4ARXA 3WF1A 1KU7A 1S7OA 1DU3D 3UGFA 4Q5OA 2DCJA 1KQRA 3S32A 4CU9A 1UOFA 2QQAA 4XICA 3SDBA 4MTEA 2R062 3I2HA 4F92B 3G7DA 4QM9A 2HYKA 1YYVA 2Y69H 2FOKA 4NHYA 2L7ZA 2KIUA 2BOJA 3MLKA 2COBA 5GJ6A 3USUB 2W92A 1X4OA 4ATEA 3H3ZA 1PNGA 1IQAA 2LH9A 4P1WA 4LLGF 1QXPA 2F6CA 2MPFA 1W39A 4Y7NJ 2FE3A 4YEJA 3NKTA 2VJ4A 3FMQA 4BQNA 4BU2A 4QHOA 1D1BA 2CQ7A 2H94A 4XDOA 1STZA 4Y1XA 1A04A 1EUUA 3USUA 5IY5H 3NW4A 4A2UA 1JBCA 3NNLA 1L7RA 4IQ4A 3BQYA 4V2VA 2VUDA 1GWKA 2KISA 1VNDA 1XCBA 4MFEA 2PMZA 1HCRA 4RYDA 4UF0A 1YW8A 1W9TA 1C0WA 1VBD2 2VMEA 4LHSA 2LUWA 1LOBA 4KYWA 2B46X 2VZQA 5K7ZA 4ZZLA 4M0NA 1FOYA 1Y6IA 1FP1D 5K4LA 1MEC3 1O3SA 4TXWA 2CFOA 3OR2C 2P6HA 2Y0OA 3GJBA 2R043 1HDPA 3RKQA 1UHSA 2ZMEC 2EQRA 5DDJ2 1SFPA 1BKZA 3FHIB 2WO1A 4PBOA 5JPNB 1X8MA 1IW7F 3W9AA 3BOPA 1TMF2 1PYVA 4YGEA 1P8JA 2BVMA 2DQRA 2XDVA 2F4MB 1M06G 3KSCA 2GALA 4AOCA 3JRDA 4ZC3A 2UU8A 3I4PA 2JQ7A 4IV3C 3F9KA 2ARCA 5L3GA 1S4CA 3EYPA 3OGVA 1Q8VA 3HQRA 4C90A 5JSRA 2YB7A 2NXNB 3RFRA 5H2FC 4EGZA 1W6QB 2WZR3 4FTBA 1DQ5A 4RGKA 2JECA 1JZ7A 1YQ6A 3CCYA 1UOGA 4C3JJ 5ERIA 5FRMA 2UYAA 3K2OA 1CZVA 4ZYDA 2VUJA 1Y56A 1X9TA 3CC7I 4AEJA 3JSPA 1NYWA 1VRH3 4COYA 4OMZA 5IT6A 4XDPA 2JG8C 5KC6A 5LEKA 1KU3A 1W05A 5FWEA 2L01A 5J6XA 3GTKJ 3T8RA 5FZ4A 2UYBA 3RJRA 2JRTA 5E1WA 5ED4A 1UZYA 4QIWN 3WXPA 4UHTA 2IS2A 1J1LA 4OLLA 4S2GA 4S2FA 3WW2A 1QJY1 1WPKA 5FJ8J 2KHMA 4JGZC 5FZLA 3T5XA 4BCUA 3T8TA 2D3SA 1RIRA 2W85A 2VH9A 4G7ZF 2EIJH 2MG4A 3NNJA 3CUQC 4E7JA 2CW7A 3OPTA 3J7YJ 5LA9A 5FPXA 2O7OA 3VBUA 2DVFA 1TME2 5JMOA 4E8CA 4L18B 3SYTA 1QA6A 4RAZA 1BM9A 2MGQA 3WF3A 3QH7A 3AKZA 4E7IA 5L9VA 4GQ7A 5F3CA 4GWNA 2RQPA 5E3LA 1ND2B 4XBQA 3U9GA 3KT4A 2BWCA 5ICEA 2BFUL 4MHUA 5J48A 3BDDA 3GF2A 1QVTA 2XWJB 3HKZA 1ND2A 3ZXAC 2XUMA 2W9XA 2C9AA 1ALYA 2AQFA 2HVQA 1PM7A 2W1QA 4K6BA 2D97A 3I53A 3HPHA 3S93A 4K1YA 3HSEA 3ZLIA 1X1DA 4E7SA 1JJ6C 5DG2A 4V2FA 1UFMA 5EYXA 3PMEA 3A0BC 2AEZA 2EZLA 5FZ8A 5EPAA 3LSJA 2PMUA 4FVVA 1R5GA 2ZJQF 2C6YA 1RITA 2QQKA 3DL3A 4LBQD 3M3YJ 4XFIA 4XLPF 2XLFA 3VDDB 5KXBA 2DT5A 3MBWA 1K12A 1XNBA 1IAWA 4U88A 4P5OA 1SEUA 2LALA 5FKCA 3FKJA 2VMIA 4O61A 4FPYA 1Y7BA 3LNQA 3ZQIA 1HW1A 3T09A 4LPLA 5GZFA 1AR93 2WFF3 1PK6B 4QMAA 2PG4A 2VVEA 1XRUA 1FTZA 1TE1B 4OI2A 1UZWA 1T33A 3K1MA 5J3LA 3JAMK 3DLLF 4Q47A 5T5OA 4CDGA 3A7QA 4GDFA 2IJLA 1S55A 2CW0F 3VSKA 3ON7A 1JODA 2X5IB 1TME3 1PK6A 3N9NA 3H5AA 3BTAA 3WP3A 3VL9A 3BG6A 3BN6A 5E89A 1ZRRA 3FN9A 4XE9A 1LUJB 5J1YA 4MXWB 1FZPB 2DOFA 1ZK8A 1GOHA 2D43A 3CCLI 5FYUA 1HN0A 1GFF2 2CSOA 3BROA 4KA4A 3L2WA 1O3QA 4RGUA 1KZHA 1LKNA 2ET1A 2M3AA 3B94A 5J4YA 4HBLA 4G4FA 4MXWA 4YRVA 2WQ4A 1QJX3 1R1A3 1K6YA 1VF9A 1CGPA 4JRAA 3I54A 4EJUA 3CIHA 4N4OB 4O3MA 1GHCA 2HI3A 1IF1A 5IFTA 3JBG3 2K40A 4CCCA 4MEXF 3S1MJ 1SZBA 2LRPA 1JKQC 5C5UA 3J9SA 2E7AA 4FO9A 3CBNA 3K10A 1GOGA 2MEV3 2XG3A 1V5EA 5C4JJ 1XGSA 4K40A 5JIAA 4HX4A 1C28A 2E9QA 3KV9A 1KYZA 1SMVA 1XSXA 1H9TA 4YM1A 1RJ8A 4UFHA 3QACA 1Z7LA 4M72A 4IGQA 3BC8A 5H6RA 3VOEA 2IZWA 1ZHFA 4RHV2 2H0BA 3PFIA 4BHPA 1ZZ6A 4PT6A 3P7NA 2X1DA 4XFHA 3KGLA 2H09A 3PNTA 4D9JA 2XV4S 1I6XA 4RGSA 2ZABA 1MDMB 1LOGA 1LODA 2AUYA 1JGSA 1QNYA 1X50A 2LRDA 3I2FA 2NOGA 3HQXA 4GWJA 2P3YA 4YZ4A 4KITB 4AC0A 3UJQA 1MD0A 4QPYA 5FP3A 3JAMZ 2GXAA 4BXXJ 2VUAA 2VVFA 4XIOA 1TWCJ 1QJY2 3AJZA 1MDMA 1P9QC 2DDAA 2E2HJ 3JQXA 4GKYA 1WLWA 1U5TC 2FBIA 4HF2A 4NO4A 1DF0A 5D6FA 2HZTA 4ETSA 5B5EC 4UFKA 4XIKA 3MKLA 1USTA 3BI3A 3M9AA 3SCGA 2CRGA 4Q1RA 4IHVA 2O8XA 2Y9YA 3MO4A 4BWOA 2V9PA 4C30A 1Y1VJ 1T6SA 3TP3A 2KDOA 3BPXA 2XKPA 1HB2A 2KFDA 4CUCA 2YU9J 1V6LA 2FQ4A 4NC7A 4ON0A 1X2NA 2IA0A 5CPRB 2AH2A 4PI2A 2FU4A 2Y30A 3SFZA 4HKWA 3GCWA 1UYZA 4QKDA 2OVUA 2DU1A 1J3RA 5LRSA 2GC3A 4J6GA 4D5FA 2FMYA 3HXLA 2F5VA 4M3EA 4ITVA 5H20A 1VALA 1C5HA 3IB3A 3Q9OA 4DINB 3UESA 4XQFA 5ICCA 5BV6A 1G9CA 4RQPC 3CNAA 3RJPA 3H92A 4J1XA 1OA2A 1O3TA 3POWA 2VXZA 1ERDA 3SEEA 1SANA 3IRRA 5H9SA 3M3IA 2DFBA 2C1FA 1EAH3 2ADEA 4P9YA 2ETEA 1D4VB 2M0CA 2BGCA 5A7SA 1WCUA 1XXNA 5H9PA 1OOPC 3ERMA 2QKMB 1H2MA 2OZUA 3KP3A 2ZCWA 1D4M1 4EJRA 1MGTA 4Q0SA 5JVGF 1ND3C 3OJBA 1QQP3 2GXBA 1QHGA 3I3LA 4C9YA 1RUI3 4DY3A 2HWD1 4LB5A 2V9VA 1J5YA 1HQCA 3CUQA 3TW6A 3ZFFA 4QX5A 1DP0A 1NXD1 3LKJA 1HV1A 4FPJA 2G7UA 1LEDA 4JBAA 3MPPG 2FJ1A 2OCCH 3VFZA 5JLVA 1O7FA 3H1YA 3I2IA 1W9SA 1A5JA 2DV9A 1AKHB 1VZ0A 4A4AA 1FYKA 3DKWA 2XPWA 3SJMA 2DA1A 4EN7B 2VVDA 2JWTA 4DZPA 4ESFA 2ORZA 4KI5M 3I59A 3OV8A 3U2RA 2XBO3 2DMUA 4GXLA 2PYTA 2X6OA 2XF6A 2IC1A 3OOUA 1A8DA 1F9NA 4IEXA 2GA1A 3BU0A 1AKHA 4Q4W1 1FLIA 1IGNA 5FP8A 1IV6A 1S0CA 1UG0A 2FBEA 2ZACA 1FOWA 1IXSB 2JIJA 4YW4A 1OQYA 4B43A 3RZLA 4F83A 1UY3A 4O7XA 1QPMA 3PL0A 2E7QA 3KV4A 3MHZA 1IPJA 3T4HB 2JZYA 3AL0C 3DPUA 3WU1B 1RZ4A 1RKTA 2N7GA 3LA2A 2VULA 3T2QA 1R091 1SPPB 1K5MB 4DW6A 5FRNA 1LB2A 3ORJA 3RWNA 3RSNA 4B29A 5HNHA 4YGCA 4YRDA 3IKVA 1Q8SA 2D5VA 1YWKA 1R1VA 3K1PA 3EYIA 3FHAA 3HC7A 3ZIWA 3T2PA 2DDBA 4ZXEA 4UWDA 2YC4A 1SPPA 3NAUA 1XNCA 3S5QA 1V9U2 2D40A 2NAZA 4DBRA 1O5UA 3DGTA 3HQUA 1W6OB 4LLLA 2AEYA 3CDZB 2ILMA 2VAUA 3FM3A 2P0WA 4LBNA 1AXKA 2QCSB 1FPN1 5IFPA 2HEWF 3I2GA 4W1UA 1MQTC 5IVYA 2VL8A 2A7AA 3IAS2 3WQ7A 1SFEA 5F2SA 1FMD2 3RS6A 2I07B 4BOWA 1W6OA 2B7YA 4URAA 5DDGA 4H7LA 2M9HA 1GZTA 2Q8EA 1ULGA 3WTSC 2A6EF 1E5SA 4A0XA 1Z7S1 2ZB9A 2R7SA 4DUWA 4NHJA 1GU3A 2VOWA 2WY8Q 3IUOA 4WVMB 2VBPA 2FZ1A 2BW3B 2UWCA 4IXAA 1W8OA 2D93A 2ENRA 3C7JA 5F04A 2V1XA 1ZBE2 2QENA 5IYDJ 2RM22 3KLNA 5H9RA 4M4PA 5FYBA 2OTJI 3VUOA 3MIEA 1UOJA 4FFGA 1SLBA 4WVMA 2VJ5A 2YDEA 2OZ6A 2BW3A 4Y24A 1GV9A 3RTRA 4AL9A 5A3PA 5DTDA 4CH7A 2LY9A 1SD5A 2Y38A 3ZMSA 1GNHA 1EV12 3WU0A 4AFMA 3N7LA 3IAM2 1H1IA 4A3ZA 2XRLA 4C1XA 5C70A 2X6XA 3SXWA 2KZGA 4PLOA 4UYBA 1FI2A 5FPZA 1FTTA 2HWF3 2LY2A 2L0KA 5FZAA 1UY4A 4Y3OA 1WHUA 3S2DJ 1F4KA 4RB1A 2DAOA 3GMEA 1LNWA 5FOJB 4ZPIA 2P5LC 3MFAA 1V9U3 4AUXA 1EKEA 3AP6A 4CDQB 1WCKA 3NMBA 3ZPYA 3EBRA 4DPNA 1DDNA 2HU9A 2V79A 1OFSA 1D2SA 3N9MA 2ICWG 2NRAC 4WCGA 2DCKA 2TNFA 1IS6A 3SH5A 2BY0A 3JB8A 5K5RA 1ZQ3P 3WDUA 4LULA 4CYDA 4CUBA 4XRFA 1T08B 2VE9A 1FMD3 4UFLA 3LFKA 3RQ4A 5A33B 3THPA 4Q0VA 2VZRA 4CDXC 3HSRA 1VPHA 1UPIA 4A5MA 3LF7A 2EFPA 4FT8A 4PJNA 4AE2A 1OHFA 2WFPA 4ITCA 4CA9A 2EA2A 3AG2H 4PF1A 4LA2A 1WGXA 1AF9A 5GM0A 1KFXL 4K20A 1MZEA 2R49A