2H6CA

Crystal structure of reduced cprk in absence of any ligand
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
208
structure length
208
Chain Sequence
FFPIEKLRNYTDMGIIREFAKGSAIIMPGEDTTSMIFLMDGKIKLDIIFEDGSEKLLYYAGSNSLIGRLYPTGNNIYATAMEQTRTCWFSEECLRVIFRTDEDMIFEIFKNYLTKVAYYARQVAEINTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGAHHVTVSKVLACLKKENILDKKKNKFIVYNLEELKHLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ChloroPhenol Reduction gene K
publication title CprK Crystal Structures Reveal Mechanism for Transcriptional Control of Halorespiration.
pubmed doi rcsb
source organism Desulfitobacterium dehalogenans
molecule tags Dna binding protein
total genus 59
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2h6cA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2h6cA01
4IETA 2P17A 4OINF 4OMYA 3BOQA 5KK1A 3TOBA 4KIBA 3MYXA 1QXRA 1G4DA 4G9YA 2ACJA 2FF4A 5K8SA 4IXAA 4K8FA 5C6CA 1H9TA 4BIFA 3K69A 1J58A 2EV6A 4G94A 1PUEE 4I2OA 2M45A 3ZMTA 1XSDA 2OQRA 1GHCA 2FRHA 4XF9A 2VT3A 5FD6A 2OQGA 1UW8A 2IRFG 3ABTA 1K7AA 2W85A 1RC6A 4IEUA 4EWEA 4ZU4A 3HOSA 5I0RA 3KP2A 2BV6A 2Q8KA 2G7UA 4FHTA 1ZZ6A 2FNAA 2CYYA 1GQGA 2RVCA 2XL7A 3IIAA 5E17F 2IXHA 4I0BA 2O1QA 3LA7A 4IJAA 2Z2SB 5IT9Z 3O14A 3RPUA 4IEVA 1H9GA 3L09A 2EFOA 1W7PB 1XDSA 1Z6RA 4WZCA 3BDDA 4HLYA 1LDKB 4OIQF 4LGWA 5CU1A 1JXSA 1P4XA 4AD9A 1IRGA 4OU0A 5LLQA 1KU7A 3ML6A 1TQ5A 4HSLA 1A04A 4KIFA 3J81Z 2L3DA 1T6SA 2XLAA 1FYKA 1SD5A 3HHGA 4M74A 5CVIA 1YIOA 2B5HA 5I0UA 3KP3A 1ZH5A 2OZJA 4GGGA 1KQ0A 1IW7F 1CGPA 2D93A 4WK8F 4A0XA 4OFGA 2Y75A 1IN8A 3H7YA 2FQ3A 1WGPA 5HLGA 4IHTA 1ZREA 5DEQA 2QCSB 2WTEA 2DQLA 5I0SA 4EM0B 1MJBA 1QY4A 1L0OC 4CO8A 4UXAA 4MGKE 4BYYA 1MD0A 3D0SA 2VE8A 1YQAA 2A61A 2OAZA 4HV6A 2KKOA 5DD8A 1IRFA 2LF8A 2VXZA 2WC2A 3UKNA 1QZZA 5ILUA 4QM8A 1ZZ8A 2A07F 4UXNA 1ZVFA 3USSA 1R58A 2KIUA 3MEXA 5LEKA 1W7PA 1YLFA 2VE9A 1GQHA 1LRHA 3I53A 1CAXA 3HT1A 1O3RA 5FB2A 2V1UA 4P55A 3RYKA 4HDUA 5CYVA 2VBXA 2L01A 5FGMA 3RDIA 1QO0D 3SZPA 4UBGA 4FT8A 2P5KA 2IA1A 2RGVA 1G3YA 3LA3A 1B9NA 1ON2A 4ZYGA 1XN7A 4WWCA 2IP2A 4MH0E 3I5UA 4ONUA 4XF3A 2X4HA 1Q5OA 4IEXA 2PA7A 3KGLA 1Z1DA 2AS5F 1J1LA 3K0LA 4HF0A 4IEYA 3WW2A 3U9GA 2EFPA 2IT0A 4ENKA 2XAJA 2QBYB 2DFIA 1BI1A 1V70A 2QVSB 4UBHA 2HKOA 4FBFA 4ESBA 2V9VA 5LRSA 1USTA 4XF4A 1B6AA 3V8JA 1U12A 1IN5A 4LB6B 3ACLA 1VJ2A 4I0AA 2DW4A 1D5VA 4LG0B 2V09A 5K5OA 3DL3A 4KICA 4GYIA 2E1CA 1FP1D 4DNCA 5KBFA 4WBBA 3EHKA 1ZGJA 4A5NA 2PG4A 5HS8A 2P6TA 4KL1A 3TO7A 4CDGA 5JR3A 1R36A 4YFXF 1KA8A 4JBAA 3P9KA 4LA3A 4WXHA 3I0TA 1FLIA 3GEZA 5K5QA 1TW2A 4CGZA 2W57A 2ZFWA 1IXCA 1T98A 1ZHFA 4I02A 5HDKA 1OR7A 5DDGA 2JZYA 2O61A 5H6RA 5E1XA 4N0BA 4L9TA 4IRGA 2PAEA 4PGGA 1DZRA 3OOPA 4P9FA 2UYAA 2QQ9A 2XL9A 3L2CA 5K5RA 2UZKA 2QDRA 2O6GE 1O7LA 3K9TA 2FNPA 1KU2A 5D5XB 3P9IA 4OIRF 1LB2A 2G7HA 4KT5C 2BNMA 3DPLC 1YO5C 3HRSA 1OYIA 2P8TA 5F1RA 3WTVC 2KRFA 3O3KA 3ZMVA 4L9NA 3CJNA 2RN7A 2BYVE 3S7EA 3K1MA 5JI6A 3V7RA 1O3TA 4IHSA 4LG0A 3HOTA 3J80Z 3JAMZ 1WKMA 3ZPLA 4G7OF 3IBMA 3WW1A 3KEQA 4A0YA 2EA4A 2EFNA 5KHIA 1OMIA 2H09A 1KQ8A 3K2ZA 3M3IA 5J7MA 3V8LA 2EA2A 3RYRA 1BI3A 4IRHA 2VBWA 3LZZA 1R22A 4BHPA 4HVRA 4HX4A 1DGRA 3Q9SA 5JFRA 4BHBA 3ZMZA 2KIMA 3LWFA 4LUMA 2EV0A 3PFIA 3U0ZA 1ZGAA 3ZMUA 2PLYA 1H1MA 1Z7UA 1YFUA 1UCRA 1XCBA 1Q43A 3ROUA 3PVBB 2GA1A 3DPTA 3TOAA 4AVPA 5E18F 4U7DA 1L3JA 1P4WA 2LF7A 1F1ZA 3UKVA 5J3UA 2EVXA 3QAHA 2EAAA 4B09A 3EQLF 1RIOH 1J3QA 1IF1A 3MQ0A 1TW3A 3WTZA 2KIFA 2RC4A 3BALA 3RKXA 4RGSA 2NAZA 2L02A 4XFFA 2XGXA 3N4MA 3SHFA 5D5UB 3I54A 2E7WA 1OD5A 3U10A 3M9AA 1TTYA 3S2WA 1S8NA 2FU4A 3HYIA 2GU9A 4HVQA 4IRIA 3V7CA 1YFWA 1ZRDA 1IN7A 2QQAA 4Y13A 5D6EA 1FBQA 2MC3A 2HOEA 3HTSB 2V1DA 3T8RA 4K2EA 2NNYA 3EYIA 4RGXA 2IW5A 1P6RA 1Z91A 1UPIA 2HEOA 4R8HA 4I7HA 3F8CA 1STZA 5D6FA 3SCFA 1O3SA 3L7WA 3I7DA 4R79A 1ZRFA 4RD7A 4HW0A 1XB4A 2VN2A 5KHGA 2Q30A 1FP2A 1WA4A 5HI0A 4TV7A 4XFAA 2UWMA 5JHUA 2O8QA 3IRRA 1ZAOA 4QGNA 1R23A 3R0AA 2D45A 2IJLA 2B0LA 3EJKA 2STWA 1LDDA 2PMHA 1ZRRA 1G3TA 5LHHA 3GXOA 3KCCA 3MAJA 1J3PA 4HN0A 5IT9K 3LAPA 3MFKA 3FXQA 1KQ9A 3HRUA 2E9QA 2VQAA 1J3RA 2HKXA 2JRTA 2C0ZA 2LKPA 4JTOA 2B9UA 2DQRA 1FWZA 2F4PA 5KVRA 4YNIA 4AIJA 1BM9A 2MA3A 4IEPA 1U5TB 4LK0F 1U2WA 3DFGA 3WTSC 3NVCA 1I1SA 2D1HA 2BNOA 2QZ8A 4H0EA 2ESNA 1T2KA 4AVBA 1HKQA 1V4RA 1EY2A 2OU2A 3REOA 1QPMA 4MHGA 3CUOA 2UXXA 2XV4S 2GXGA 4BQAA 4ZZLA 3SXYA 1EYBA 5E8GA 2MD5A 5LBQA 5FO5A 5L3GA 2PN6A 3HRTA 4U7BA 5EZWA 2B8MA 4GULA 2VOPA 2A6HF 1YS6A 4G6DA 1B59A 5EEHA 2NS0A 1TLHB 4L9VA 2D5HA 4DQ2A 1U5TC 2LNBA 3OCPA 4WVZA 2UXNA 1ZYRF 4IEWA 2PHLA 4M73A 2PEXA 1EH8A 3WTTC 1NXMA 5D1IA 2IXIA 2JT1A 2GAUA 3CEWA 4PIXA 4E2SA 3RKWA 3MDPA 2IXLA 4X6RB 2Q4SA 2K86A 4UVBA 4L0YB 3N97A 5C8WA 4G7ZF 3DV8A 3R61A 3HSEA 2GA2A 1NYWA 5FQ0B 1ODDA 4XLNF 1FSHA 2ELHA 3LAGA 1ZLKA 1YW7A 3ZP5A 3I59B 3M70A 2M30A 3BB6A 4LD5A 2A5YB 4XFBA 1HBXG 5E1ZB 4MEYF 1MZBA 3M8FA 4Q48A 2ZKZA 3CO2A 3JW4A 3NEUA 1CAUA 2HTJA 1CAWB 2EFQA 5FLHA 4BNCA 4LLGF 3VEPA 1SQ4A 3F23A 2OZ6A 4MV2A 3DKWA 4ON0A 1XRUA 2XHKA 4EM1A 3IWFA 3COAC 1LEAA 2V79A 4ZU7A 1YG2A 3GVAA 4MTDA 1YUDA 3P9CA 3WW3A 1UCXA 2JTVA 4XRFA 2K0GA 5I0TA 4L11A 3DN7A 4RGUA 1YTYA 1YFXA 2LSOA 1XSXA 2Q0OA 2HS5A 1BIBA 5JAXA 4HVOA 2CFXA 3NW4A 4KWKA 4BAYA 2GC2A 5BOXA 3JSPA 1YFHA 4D7TA 4M9SA 5KHJA 3H1WA 5FQ0A 3WGHA 4WF2A 1DPRA 1J0RA 4UVAA 1SFUA 3I59A 1O5UA 1FT9A 3DP7A 5CVRA 2DPUA 4YFNF 4L2NA 4JVAA 3ERED 3CO6C 4EWDA 2PI0A 1XDUA 1WQ2A 3LAJA 3GZ5A 1YS7A 2BE5F 1XD7A 1D3YA 4EGZA 1OYWA 1CAWA 1R1UA 2Y48A 1XGMA 2Z99A 2IVMA 3PLQA 2IA2A 2MPFA 4KU8A 4AVAA 3ETQA 4D7SA 4XSZF 3AAFA 2CSOA 3HHHA 1SAXA 3ELNA 2Q2EA 2Z9OA 4Q47A 1HKSA 1U3EM 4HYEA 1ULYA 3BZ6A 4AVCA 2P7CB 4MNUA 4M6XA 2XUBA 4PIZA 2CGPA 1LEBA 4YFKF 1FPQA 2H27A 2XAGA 2R7FA 3JTGA 1PMIA 3GFLA 3SZTA 2I45A 2ISZA 3F72A 4KMUX 3I4PA 2VPVA 1KYWA 1XSVA 4QGMA 4O9GA 1AWCA 4LTAA 4EROA 4N9IA 4Q0QA 2FBKA 2LDUA 4S04A 4KU7A 3DEUA 2R3SA 4MGRA 2ET7A 3H92A 4B29A 2PQQA 1FOKA 4IERA 4UHTA 3IDBB 3WTXC 4MGIE 4Q0SA 5A2QK 2ET1A 5D4SA 2DO7A 4GYGA 4XLPF 2HYFA 5CVVA 4WXCA 2PFBA 5AONA 4H7LA 3KFWX 2VT2A 5J8FA 4M6YA 5FCCA 3E6BA 1S3JA 1G6NA 2D1VA 2D2WA 2XVCA 5LRRA 1FC3A 2AXLA 3KE2A 3WGGA 1REPC 3ZDSA 1UD1A 5I8SA 3RNSA 1OFNA 3BJOA 4WCGA 3MPBA 1XGOA 1B4AA 3PNAA 1W4MA 1NE6A 5BV6A 1YWKA 3RJPA 1FYMA 3L9FA 3WU0A 1FYLA 4QMAA 3OF1A 4Z07A 2XAQA 4RB2C 3H1YA 3WTUC 2ZJ2A 3BJAA 1H0MA 4Q0PA 3U1DA 4BHCA 5HS9A 5LGUA 4HSJA 1J2XA 2Y0OA 2JPCA 1U6GA 3HRMA 4ZH4F 5FLXK 5JR7B 4S05A 4I09A 1WSUA 2L4AA 4U0YA 4CYDA 3WE2A 1CX4A 1XGSA 3F22A 2CAVA 1MKMA 5CADA 2CO5A 3TDZC 3NSTA 3EDPA 3SCHA 2XAFA 5D4RA 3ZN1A 3FZVA 2HQNA 3S7IA 3OTFA 2DAOA 3GF2A 3E5QA 5DCFA 4HMZA 4L5IA 2P7VB 2EJRA 4L5JA 3KP5A 3F6VA 4RAYA 3KEOA 2VBYA 3RZZA 1Q1HA 4J1WA 4O3MA 1S6LA 2QBYA 3K1PA 3GFMA 3TNQA 5BY5A 3DXJF 2DPDA 2RDPA 4FAHA 4O5VA 3RPQA 5BPIA 3CUQB 3QP5A 4EMSA 4A5MA 2K4JA 2VODA 4Q0UA 4META 2JPBA 3FHIB 4I3PA 4NB5A 3TO6A 2P5VA 2BBYA 2CW0F 2MNGA 3CTAA 3MCZA 2GQQA 3T5XA 3GFIA 1XGNA 1R1VA 3HQXA 2DTRA 4EQQA 4KA4A 2IC1A 4EJVA 5E1RA 5DYMA 2FXAA 3FXUA 2A6EF 2JSCA 1ZARA 2PJPA 1QWRA 3FM3A 3M7GA 1J5YA 1FBSA 2F5CA 1SFXA 3RYPA 3GWZA 3O6BB 1RUOA 1R5HA 3F8MA 2V1XA 5ILSA 3CUQC 1B1BA 3GYDA 5CVUA 1ZN2A 3E5XA 4MX3A 4P5OA 1ZX5A 5BUVA 3CLPA 4MQ9F 3CF6E 1XMAA 4ESFA 2RKHA 1O5LA 1K6OA 2VECA 2XAHA 4PIYA 2MHFA 3ES4A 4BH9A 4JTNA 3HT2A 3GBFA 1FZPB 3S0MA 4CICA 2MH9A 5BMZA 3RI4A 1TBXA 3U11A 3ABUA 1GXPA 3VODA 1HQCA 1GVJA 4PJYA 2GIVA 3KZZA 3BPXA 4MGZE 2ZO4A 2EB7A 1CF7B 5EFUA 5CVJA 2IPQX 1BI2A 3F21A 1P92A 1LR5A 4O9EA 3FMRA 3WG9A 2D5FA 4Z82A 1YHFA 3CLOA 1Y9QA 3FXRA 4XETA 2EFWA 3VFZA 5LGTA 4KDPA 2PMUA 4LA2A 1BI0A 2ZCWA 4LK1F 5IT3A 5E8IA 4P9UA 1K79A 3E6MA 4OIOF 2FMYA 4HLTA 2L4MA 1I27A 3RKYA 1RTVA 2NNNA 4KWLA 3KP6A 3BJ6A 4LEJA 4U88A 4U0VA 4PGHA 3GUDA 2F5DA 1U78A 2TDXA 3EYYA 3IKTA 3H3UA 5JVTA 3E3VA 1EP0A 2BNNA 1XMKA 4U0WA 3G73A 3C7JA 4J1XA 1QBJA 3FF5A 4UNOA 4F7ZA 1ZZCA 3VOEA 2DT5A 2OA2A 3BROA 1BC8C 4AQ6A 1WWXA 1UHMA 2GC1A 3I64A 5LHIA 2KJBA 4EVIA 3BCWA 1ZNPA 4ZYEA 4XFCA 2R7DA 2DBBA 4A6EA 5FD5A 2QJVA 4ZZDA 2GWRA 4UUVA 4GO1A 3V4GA 1F4KA 4YIIA 1SEFA 1OKRA 3MZYA 1CF7A 2RV8A 3DF8A 3F8NA 4RS8A 2YX4A 5F64A 4EWAA 2H6CA 4XFGA 1QQIA 2FBHA 5DUKA 1ZLJA 3J81K 3FM5A 4A12A 4F8AA 4M9ZA 4PDKA 3R6SA 2STTA 3TDUC 4EGYA 1HSJA 3F6OA 4HF2A 1MGTA 4JV4A 5D5VB 1SD4A 2YR2A 2OA4A 1O3QA 3G3ZA 1B9MA 2ZNZA 1R5GA 4EJOA 2ADUA 3QACA 4MGYE 2MLGA 1S29A 4HOBA 3NJZA 4A2UA 2XASA 5I91A 4P9GA 2WV0A 3T8TA 4Q5SF 5J48A 5JCTA 4JQFA 3SHRA 2FSWA 3H7JA 4HX8A 4KN4X 1EV7A 1IZ1A 3IDCB 1OI6A 4YG2F 1IXSB 1KYZA 1IPJA 2W84A 5DV5A 1QGPA 3KLOA 1FX7A 4E70A 3G7DA 2VC1A 2GZWA 3GZ6A 4ENJA 4RB1A 5ICCA 2ZXJA 2HFHA 5H6QA 3TO9A 2ZMEB 5E16A 4JK1X 1U5TA 2MH2A 4CZZA 4HX7A 4QWQA 3GX4X 3H3ZA 1YW9A 3EUHA 3W6JB 4QGLA 2CWEA 4ENNA 3CJXA 5DD4A 1TNSA 4FX0A 3R60A 3IHUA 1PP8F 2ATFA 4KMFA 3OV8A 1JE8A 1E2XA 4CXFA 1JGSA 2H0VA 2M1BA 3E6DA 3M1EA 3CDHA 1RL3A 3SFZA 4M71A 4ZYDA 4Y15A 1CAVB 1JUHA 3F3XA 2RNJA 3HSFA 4ZYHA 1NHAA 3JTHA 4KNYA 3BPVA 4ZU5A 3SQNA 5EEGA 2QYOA 3V8KA 1ZG1A 1Z6TA 2Y0MA 4NQWA 4EJUA 3EQEA 1LNWA 1W5SA 1UHWA 1UB9A 4DINB 1BIAA 1J75A 5ICGA 2YSRA 2HYGD 2OZUA 1HW5A 3IL2A 4ASNA 2ZNYA 5ICFA 3FJSA 4RB3C 2K9ZA 1PP7U 3ZMDA 2QM3A 5F6FA 1WI9A 3KLNA 4BXUA 4AIHA 2DCTA 4AQ2A 2ZMEA 2COMA 1W5TA 4MUVA 5CJ9A 1NE4A 3NRVA 2Z5UA 4MQVA 5AIPA 4IVNA 5LEJA 1W7PD 1YFYA 5HS7A 5L3BA 3BU7A 3KGZA 3SCGA 3H9AA 2WFPA 1T38A 2QENA 4OMZA 2DI3A 5L3DA 2E1NA 1RZ4A 4KUMA 2UY8A 5FPXA 1FSEA 2XRNA 3J7AO 2QVOA 3WTYC 1U8RA 2OYZA 2P4WA 5D5WB 3UKTA 4IEOA 2ESHA 4G7HF 5FDBA 2O03A 3E97A 3ES1A 3R0JA 1XCVA 1CAXB 4HN1A 4XF0A 1CAVA 4L18B 2QWWA 1QNTA 5KHHA 4QLCU 1JHFA 2HTSA 4HF1A 4HV5A 4XFHA 3PQKA 1O7FA 2MLKA 1I6XA 4HBLA 1SMYF 2QNKA 2K4BA 3IKVA 4KFCA 4XEZA 3H8UA 3F8FA 5L3EA 5ILVA 4LB5A 3J80K 5I93A 2GXBA 3TNPB 3ECHA 1D8KA 1SMTA 1TQIA 5DCMB 3JAMK 2YX7A 4HDVA 3WODF 3QU6A 3T0YA 1WLTA 1R7JA 1X8MA 3CL1A 1YLLA 4YYOA 1R00A 3ST7A 3KP7A 4Q4ZF 4QX5A 3ZQ7A 2A68F 3C1DA 2HGCA 1FBUA 3F8BA 5J6XA 3ECOA 3LSTA 4B8XA 5D8LB 3LA2A 2DU9A 2QLZA 5J8CA 2IXKA 2CAUA 1TQMA 3C3VA 2IXJA 1HSTA 2HQRA 1FXZA 1T0FA 2M5WA 4GCVA 4FAGA 1P2FA 4HQMA 4YSFA 2DK8A 2N7GA 2PAKA 4QXKA 3NQOA 1J7KA 1QXJA 1X3UA 4FX4A 4QM9A 3EO6A 3LWCA 1LDJA 2J5PA 4LLLA 1VTNC 4HQEA 3C3WA 1I5ZA 2W24A 3KZYA 2EWNA 5DCMA 2H94A 2K7LA 3NL1A 4XF1A 2F5EA 5AIQA 1F9NA 1DP7P 5BPXA 1HW2A 1MJAA 4PZJA 1E17A 2UYBA 1ZRCA 3R4KA 5HOOA 2XKOA 2PQ8A 1AOYA 2CQKA 1UIKA 3OGJA 1OYYA 3U2RA 2OBPA 2C6YA 2WWYA 2D40A 5JSOA 4IF4A 1Z9CA 4P96A 3H1MA 5HLHA 2A3SA 4EV0A 4CHUA 3ELKA 2PFWA 4LMYA 2Q0AA 1ZG3A 1VR3A 1UFMA 2NYXA 1T39A 3LQQA 2DLLA 1I1GA 3FHZA 1D8JA 1ZZ7A 4Q29A 4I01A 3BY6A 5BS6A 1XE8A 3FX3A 2XLFA 3H50A 2GC3A 2KJCA 4ORFA 1DPUA 3E6CC 5E1WA 1EH7A 4AXOA 4N9HA 3TGNA 1K78B 1O4TA 1DGWA 2A69F 5FFXA 2ETEA 4KYWA 3ULQB 4WXDA 1ON1A 5D8KB 2IXCA 2UY9A 3BP8A 4L9JA 5HDGA 2K02A 3CO7C 2VOOA 2F5FA 4XFIA 3QU3A 4G6QA 3MZHA 1HXDA 5JSRA 5BXXA 5TJJA 4AIKA 3WE3A 1IAWA 4UV8A 1HW1A 3LFKA 2HJIA 2FQPA 3TKYA 3FWEA 2ZBKA 2O0YA 3WU1B 4IEQA 4E2QA 2FE3A 4NVPA 1BJAA 1ONVA 4UV9A 1JHHA 2F2EA 4A0ZA 1IN4A 4OIPF 2HWVA 4LLNA 4R1HA 4Z2YA 4YIFA 4E2GA 2K27A 3QPHA 3IWZA 5ED4A 3JZVA 1RI7A 4LULA 3C18A 1USSA 2FBIA 4M9XA 4XSXF 1IXRC 2PYTA 3GFJA 5ERIA 1C0WA 2Z3YA 2ETHA 3QPTA 4L0ZB 4ESJA 3M8EA 4D0PA 3Q9VA 1K78A 2L54A 4HAMA 1FNNA 2ISYA 4LJZF 3IRQA 2EA7A 4GXOA 5E20A 3Q5FA 1G3WA 1SD7A 4G8XA 2P6SA 3RIRA 1Y0UA 1IN6A 3FMQA 1YW8A 3VB2A 2PAMA 2Z69A 5A2QZ 3CUQA 4I98B 2BGCA 1V3FA 4LLOA 1FY7A 5FLIA 5CLSA 1X8EA 2VBZA 2W25A 3RTRA 5JSPA 4LUKA 4TLFA 2YPRA 3P7NA 1F5TA 1OPCA 1SFNA 1GXQA 3MWMA 4HA8A 3T1BA 3SMHA 3HSRA 2OPKA 3KETA 2XKPA 1LKNA 1HKTA 4AWXB 1O57A 1EPZA 4O6JA 2PHDA 5T3NA 2PBIA 3HTUA 1DZTA 3D82A 4MZUA 1MDMB 3SXWA 4ETSA 3GYHX 5FPZA 1Z05A 2BEOA 2M87A 1S7AA 2XIGA 5BPDA 2H6BA 3PQJA 5I8TA 3I71A 1DUXC 3W6KB 2Z33A 3KMHA 3EBRA 3O2PE 5AVPA 3IC7A 2RQPA 5FLXZ 1RUNA 2GH2A 4M72A 1TQPA 1RGSA 1ZG5A 4WX9A 1MJ9A 3QOPA 1L3LA 1BN5A 3EETA 4OOIA 3TQNA 4RAZA 1IUYA 1J9IA 1G3SA 2M8EA 1LQ1A 6PAXA 3HIFA 2XLGA 1H1IA 1IPKA 2FA5A 2YU3A 4KWJA 4IEZA 2HZTA 2QQBA 4IESA 2GC0A 2J5OA 1PDNC 1RNLA 3B02A 3E5UA 1SD6A 1S7OA 3I58A 2OD5A 4R52A 2EK5A 4UVCA 1DDNA 2HDCA 1EH6A 2DK5A 4XBFA 3ZN0A 4EM2A 3LQRA 2XROA 3WW4A 4MEXF 1BC7C 2V6CA 1KGSA 4ENMA 3FE5A 2CV6A 2IA0A 3WTWC 1MDMA 3QP6A 1Y3TA 5HVQC 2O3FA 4KIGA 5LGNA 4NHJA 4HZFA 4Q0VA 2MBFA 2O8XA 4Y17A 5HDNA 4RGRA 5L3CA 2P5LC 1QZYA 3BPZA 5FLJA 2FEZA 1VP6A 5K1YA 3QRFF 1BOAA 3GO5A 2FMLA 2Q1ZB 4YARA 5L3FA 2NRAC 3D0JA 4EJTA 3KSCA 3FZ3A 3NKTA 1UIJA 4YRDA 1TNTA 1BBYA 4KN7X 1X7NA 4X6QB 5ICEA 1SFEA 1CAUB 4RB0A 3ISPA 3GLXA 1P4AA 2CG4A 3DQVC 1Q3EA 2EV5A 3KP4A 2E7XA 2X0LA 3FFQA 4HBNA 1R1TA 5TRDA 5HLIA 4IPAA 2PTMA 3L00A 3L2HA 4MTEA 1X82A 1LJ9A 2VONA 1LVAA 3D5LA 5BQTA 3GW2A 3VHRA 1KU3A 3HUGA 2VC0A 4EJWA 3B73A 5KHKA 2HR3A 3WGIA 2KXLA 2ZKLA 4OLLA 1YYVA 3V7SA 3LOIA 3FMSA 5LHGA 4PCQA 3ZMSA 2FOKA 2G9WA 4LFUA 5DUIA 3JSOA 5H20A 3K1NA 3BWGA 1KU9A 4A6DA 1WRJA 1ZZ9A 3OD0A 1XE7A 1FI2A 2QUFA 1NZCA 5I8YA 1J59A 1ZZBA 4HLXA 1PM7A 5FFZA
chains in the Genus database with same CATH superfamily
1VQ9I 4WV8A 2VW2A 3OUJA 3BOQA 1T08B 4CXXA 1T8IA 4KIBA 2XR4A 4G9YA 2FF4A 3ZQQA 4K8FA 3KT4A 2NOGA 5KHDA 4BIFA 2EV6A 3CZUA 1PUEE 4MVTA 4XF9A 5JLXA 2OQGA 2VQLA 3HAGA 3ZQHA 4AZZA 1UW8A 1DG6A 3DEMA 3ABTA 2W85A 4EWEA 2DVGA 5I0RA 3HOZJ 2G7UA 1O4YA 4GXLA 1EF4A 3MGUA 1KZHA 2CYYA 4DXRA 1GQGA 1NK2P 3FUQA 2NMOA 2DFFA 3R4UA 4Q4Y2 3B7MA 3ILNA 2OS2A 5E17F 4BQQA 4I0BA 4IJAA 1V6NA 3ZOIA 4RDUA 1BR4A 2UV1A 1H9GA 3AL0C 3AKSA 3W2AA 1PO13 1W7PB 1LDKB 2CYFA 1P4XA 5IAVA 1MBGA 3ZFEB 2VH9A 2EZIA 4MXVA 5HNHA 4NIGA 4CP2A 2XB0X 3J81Z 4URTA 2XLAA 1FYKA 1ZQ3P 2DMUA 2B5HA 1ERDA 1YRNB 3ZR8X 3KP3A 4AI3A 3AMNA 1UHSA 2Y75A 5FYHA 2GP3A 2BZTA 4IHTA 3DBRB 1JKQC 3M1CA 2QCSB 2WTEA 1GT0C 5FYCA 1QY4A 1L0OC 2DFBA 5C3QA 3WUDA 3ILFA 2VE8A 3T2TA 3QPSA 1IKQA 1OQEA 4YFZA 3WNMA 4IUGA 4QHZA 3SZGA 5DD8A 2VXZA 2WC2A 1W6OA 4PBOA 3UKNA 2JDMA 5EWSA 2A07F 3ALQA 2VBDA 3USSA 5FZHA 3MEXA 3ZSLA 1YLFA 2BY1A 2JG8B 2HWE2 4L0PA 4C2TA 4NC7A 4CU8A 5C71A 2VBXA 5FGMA 3I2KA 3QH6A 1QO0D 1SFKA 2WZR3 5FZOA 2RGVA 3LA3A 3SEZA 3C7GA 4DZPA 2IP2A 2CQNA 2G0EA 1ASJ2 4ONUA 1REFA 4IEXA 4JGZB 2PA7A 3KGLA 1J1LA 4HF0A 3ATGA 4Y3OA 1AR71 1JKPC 4BJ6C 5DUXA 1SACA 3T4HB 5J98B 1XNCA 1H8VA 2GOMA 2VXDA 1V70A 4ZYAA 4UBHA 4BDYA 3BYWA 2V9VA 4MYEA 1RJ7A 4MO3M 1B6AA 3HPGA 3ACLA 3T08A 1DGRM 3IPVA 1HB1A 4I0AA 5FMDA 4O65A 2V09A 4DXZA 5F3EA 2BBVA 2E1CA 1L7RA 4DNCA 3EHKA 1R9TJ 4I99C 4A5NA 1W6MB 3JBG2 3H5AA 3M1HA 1ULEA 1R36A 3O0XA 3GTLJ 1VQKI 1JYVA 4JBAA 4XOTA 1FLIA 1UY1A 2JUGA 1JTZX 2E6VA 3NAPB 4IL6C 5DDGA 3KHBA 4BE1A 2O61A 3HNBM 2C9AA 5H6RA 5E1XA 2PAEA 4BL0B 1UELB 4PGGA 4OUMA 4XBNA 1AYM2 2XL9A 2BVMA 4DYRA 2XVKA 1FNYA 1O7LA 4UF0B 1KU2A 2QBXA 3P9IA 5EZHA 4K9SA 1R71A 4KT5C 4AYBA 3DPLC 1YO5C 4HNUA 3WQ7A 1YX5A 1UYPA 1VALA 3JRGA 4L9NA 4GAZA 3IV5A 3S7EA 1O3TA 3HOTA 4LO6B 4C3IJ 1UYYA 4G7OF 4C0BA 1K5MB 4CEWA 2EA4A 2VTXJ 2B7EA 1VAKA 5CKMA 1HB3A 1JJ6C 4YW3A 4E7KA 1AYN1 1E5HA 2H09A 4AVZA 2KFDA 1KQ8A 2VXRA 2WSUA 2HWB2 3V8LA 5DS9A 4BDVB 3RYRA 4PBPA 3SC7X 2K3PA 4IRHA 4PFOA 4WVMB 3RQ0A 1OFSA 2Y9ZA 4HVRA 1G8XA 1NCQC 4NC6A 1H8TC 3MEPA 4BA6A 2VU9A 1QJU3 3WDTA 3WF2A 2D43A 3PFIA 1AR83 2YC4A 2ZSHB 1Z7UA 2WJSA 3L1PA 1Q43A 3BN6A 2Q8DA 2D6NA 3HBLA 2GA1A 1JYCA 1L3JA 4XXPA 5IYDJ 3VBSA 1CD3G 3BCBA 4Z2WA 3I4IA 1YI9A 2E63A 4QX7A 2WQ8A 2HBTA 4OUSA 3KEYA 1J3QA 1WCQA 3IP4B 3GM8A 2RS11 1S5LC 3LEKA 1UYXA 3RKXA 2ADEA 5D5UB 2RV9A 4ZJZA 2E7WA 1WW7A 4LBOA 1OD5A 5J4YA 1ONAA 4IE5A 4D6RA 1TTYA 1N25A 1W0NA 3S2WA 1S8NA 4IRIA 2ZHKA 1YFWA 1RHI2 3X29B 1S2EA 4XUQA 4D5FA 3I3DA 4Y13A 5FY1A 1QJX1 1A36A 2CQ7A 3B9CA 2R7TA 2XUEA 4RGXA 2HEOA 1QOOA 3IH2A 2QA4I 1WJAA 3ZSJA 2XJPA 5EJZB 5C4WA 4Y20B 2X05A 2XF5A 1TNRA 2B63J 3FFZA 3L7WA 1W9WA 1GV5A 1VBD2 4RD7A 2VN2A 3ILRA 1ULCA 2Q30A 5HI0A 3TWIA 3R0RA 1YE9A 4TV7A 1MEC1 2IVIB 3IMMA 5JHUA 3F0CA 2O8QA 1FMD2 1R4NB 3R0AA 1MS8A 1U9NA 3RG0A 1WW6A 3AJYA 5J1XA 2STWA 2XB5A 3GXOA 4DBRA 2OW4A 4EN9B 2VQAA 4EJRA 1GUUA 1J3RA 3MFAA 1WLDA 4YZ3A 2B9UA 4L92A 2NQYA 3KM5A 4LKEA 5F2WA 2VGDA 3V65A 1C5HA 2YFUA 4AVBA 1HKQA 1WCSA 1V4RA 1JKRC 2OU2A 4XUPA 3RMXA 3SITA 2XPUA 4MHGA 5CNAA 2UXXA 2XV4S 3M2MA 5FZFA 3Q3SA 2VZPA 3SXYA 1RUJ3 2XRLA 2MD5A 3ZQLA 1RXFA 5DAQA 5LBQA 2XDVA 3LOBA 2KISA 1YHQI 4OAZA 2JE7A 5BNQA 5JOWA 4A7ZA 5EZWA 2B8MA 4GULA 1XTAA 2V4VA 4BQXA 2A6HF 1H1AA 1YS6A 2C9KA 3RZMA 3EXUA 3PIGA 2E7AA 4Y22A 3S16J 1AXZA 1C1FA 2D5HA 1GWLA 4IOAF 5B4NA 1GKBA 3KCYA 4WVZA 1NT0A 3GTOJ 2RREA 1EH8A 3ZXDA 2IXIA 2GAUA 3DEWA 3RKWA 1S2KA 5FPAA 4QPYA 4UFLA 1POV0 2PHRA 5C8WA 3S5QA 3HD8B 3WNKA 3HSEA 1AL22 4IQ4A 2ID4A 5FQ0B 4M3EA 1FIAA 2KDOA 1NKGA 5FY8A 3ZP5A 1JOPA 1ZRIA 3BB6A 4LD5A 4XFBA 2MEV2 2DWRA 3DTIA 2WINB 3DTEA 1DGLA 1UMHA 4MEYF 3M8FA 2XPVA 2W08A 5LA1A 3BI3A 2ZKZA 1CPMA 3CO2A 4DYQA 2HTJA 4BNCA 4LLGF 4MGTA 1NA1C 4FXKB 4MV2A 5M5YJ 2V9KA 1VBE2 3ZXFA 4ON0A 3H42B 5EJCA 1XRUA 1MZ5A 3SH5A 3GZTB 1GU3A 5DM7F 4BE0A 4A3CJ 5LA9A 2UWAA 1DIWA 4JP0A 1LEAA 4N4OB 2V79A 5AC91 5IAXA 3FHQA 4UI9L 2JX9A 1QGLA 4MTDA 3ZN5A 3DYMA 5CQGA 2JTVA 4NHLA 5LBCA 5GALA 3O1TA 5I0TA 2VPLA 2E1MB 1NA1A 4RGUA 1YTYA 3THPA 4OHYA 2Q0OA 1PVC1 2AENA 1L7LA 2GDFA 4D3WA 1MSEC 4M4RA 3K10A 3VBRC 4DY5A 5FMCA 1LHWA 1GANA 2ZAAA 3CIHA 2VJIA 1QHDA 4AG4A 4B1LA 2P34A 3WGHA 1UMIA 1J0RA 5LD2C 1SFUA 3WHUA 5DG2A 1UKGA 4L97A 3DP7A 5EYXA 1KONA 2YS9A 3ABLH 4YFNF 3HOVJ 1HIXA 3KV6A 2ZJRF 3SNMA 1QJX2 4L2NA 3PTYA 4JVAA 1RUI3 3SDGA 2B39A 1H2NA 3I2JA 1YS7A 2BE5F 4AVTA 2DA5A 1OYWA 3I55I 1CAWA 5FKCA 1XGMA 4ASLA 3GZEA 5IVBA 1MZFA 3PLQA 2DUPA 3ZSMA 4XSZF 4IQJA 1SPPA 4NHXA 3ZN6B 3HHHA 3GMEA 1FV3A 4LHSA 1MEC2 2VB6A 4Q47A 2XJRA 1HKSA 1U3EM 2ZMNA 1ULYA 3BZ6A 2ES3A 2YGMA 3VDDA 3PNYA 2YGLA 4PIZA 5JVGF 2X48A 5IFPA 2H27A 2A5ZA 5JXIA 2D6MA 2I8DA 4C2MJ 4QPIB 1BEV2 1VMHA 1QEXA 1AHDP 2GOXB 1JS9A 1LU2A 4LNVA 1OT5A 3GFLA 3QOEA 2MFZA 2ISZA 3F72A 1OBNA 3L2WA 3EUAA 5FLMJ 4EROA 4FP3A 4N9IA 4A3XA 4FPFA 3DEUA 2DMNA 2WNUC 2XONA 4B29A 1W6PB 2K9MA 1FOKA 4W97A 1E3PA 5A2QK 1W3XA 3LEMA 2ET1A 2HYFA 3MHZA 4WXCA 3KFWX 5IVYA 2JDNA 5FCCA 2LFBA 3OPWA 2JDKA 2CDOA 5IUQA 3HDDA 2XVCA 2AXLA 4C30A 2FOWA 2AREA 3ZDSA 5I8SA 5FYYA 1OFNA 3MPBA 1QH7A 1F8VA 4ZS3A 3N36A 2ZX1A 5FPVA 2A73B 5EF6A 4IQPA 4PUSA 3RJPA 1X9TA 3L9FA 1CVNA 1TWCJ 4QMAA 4Z07A 1HLCA 2W2IA 4RB2C 3JQWA 3H1YA 1FNZA 1IQDC 4JCKA 2DVAA 1QDOA 3VLBB 2BW3B 2ZMKA 2Y0OA 1WSUA 3P1IA 4CYDA 2TCTA 2JVHA 1W36D 3G6EI 1MKMA 4JDMA 3A22A 4LBQB 3KVBA 2CU7A 5C3EJ 4LITA 3OTFA 1JZ7A 1SCRA 2OVUA 3E5QA 3LFMA 1NCRC 4L5IA 3OYAA 1KDKA 4V1PA 2W1QA 4YZ5A 3OS0A 2VBYA 2VZVA 1Q1HA 4O3MA 1N3QA 1S6LA 2W46A 1MS0A 1K45A 2P81A 4QTRA 3O1UA 2DPDA 2RDPA 4AEDC 5FWEA 5F7UA 1RYYA 3QP5A 4XKBA 2VODA 2WN3A 2RG4A 4META 2V6EA 5L7OC 5FO7B 1VZ0A 3THCA 1GLHA 1NQDA 2JEMA 4I3PA 4FOYA 3MCZA 4NR1A 3CJIC 2HU9A 5A1AA 2WBMA 2DTRA 4HNVA 4EQQA 2JWTA 2IC1A 5E1RA 4OULA 1SMVA 3AP9A 4CDUB 3FM3A 4AFDA 4Q4V3 3X2QH 1Z7S3 1WD3A 2WO2A 2XHNA 1W2NA 3RYPA 4G3YC 2JDPA 3O6BB 1RUOA 4FFHA 2V1XA 5ILSA 3CUQC 1W5CC 3W2VA 1JBCA 3GYDA 1ZN2A 5EIYB 4R4ZA 1PIV3 5DZEA 4MQ9F 2Y6HA 4E7HA 1J83A 2RKHA 1O5LA 2QQOA 3IN9A 2Y0IA 3ES4A 1T95A 2HWF3 1FZPB 1W04A 3J7MA 1JZ3A 1W39A 4M6VA 3AX4A 3CESA 1TBXA 3V0BB 2FDJA 5CB7A 1JUSA 5T5JA 2W52A 2D6PA 5FRMA 2GIVA 3P6BA 5LASA 3ZPOA 5EFUA 3RJRA 3AK0A 5FYBA 4UW6A 1LR5A 4O9EA 1QJU1 1JZ4A 1IUFA 1GZWA 1YHFA 2DMTA 1AR81 1Y9QA 2WAQA 4XETA 5LGTA 4LA2A 2CWSA 3SQOA 2VVDA 1SFPA 4LK1F 5JXHA 4ZY9A 2GSYA 1Z3YA 1YXWA 5DDJ3 2EICA 4HLTA 1ND2C 3BG6A 3O8GA 2LVSA 4QT6A 4P9LA 1Y9GA 4KWLA 3H35A 3KP6A 5IW0A 2ENRA 4LEJA 5GAGJ 3KIOA 2JXAA 4C1XA 1U78A 2TDXA 3IKTA 5JVTA 1XYNA 5JHFA 1XMKA 4GWJA 3G73A 4J1XA 1QBJA 4QB6A 3BOWA 1NLSA 4F7ZA 1ZZCA 4F92B 4GH4A 3VDCA 5EDNA 2OA2A 4AQ6A 4BJTA 4PDWC 2ERFA 3W58A 4WM7B 4RR3B 3I64A 3BCWA 4YVSA 2R7DA 2DBBA 4IGQA 5E6HA 2RV8A 4RS8A 2YX4A 2E31A 1QQIA 2PJRB 1Y56A 4UW5A 3J81K 3LDBA 1LU1A 4PDKA 1ZA4A 4YW4A 3LD8A 4D94A 1MGTA 2CHHA 2GLOA 1O3QA 2OA4A 3BR6A 1R083 4Z8BA 3S30A 3QACA 4MGYE 3ZM8A 4XN0A 5HCBA 4HPKA 4FPKA 2XASA 1W05A 1XNTA 4P9GA 4R9DA 5FZBA 1WLCA 1UN1A 3S1RJ 1UOGA 4KN4X 1LFUP 1D4M2 4FOVA 1GVDA 3IDCB 1H2MA 3HG9A 4I3GA 3PMSA 3G7DA 1W6NB 2GP5A 5KC6A 1PO21 4RB1A 1MSFC 1RB8G 2WIIB 2HFHA 1MQTA 5H6QA 4AL9A 3FN9A 2MH2A 3ZLIA 2A6XA 1IDZA 4RBOA 4IKFA 4PSWA 4ENNA 3CJXA 1RUJ1 1JH5A 3K70D 1WW4A 4FX0A 2W82A 3R60A 3IHUA 3BGAA 2KR2A 5FOBB 3OYMA 4UUSB 1E0EA 3BTCA 2FHRA 2WYFA 3UNGC 3CDHA 1M06G 1POGA 3IIIA 4YM1A 1RL3A 5T5PA 3SFZA 4CPBD 3LDRA 1CAVB 4FVVA 1V6KA 1TME2 4YG0A 5CEHA 1FAYA 2YUSA 3BPVA 3SQNA 3DPRA 5GKAC 2VZOA 4AYBN 1I5PA 4NQWA 2ZMEC 4OZOA 1LNWA 1W5SA 4HPQA 1OQDA 4DINB 1BLZA 3U75A 2YSRA 5GPCA 4ASNA 2ZNYA 3W3CA 3FJSA 2CJJA 1H0BA 3ZXKA 3ZMDA 2JG9B 3ITQA 4QDRA 5F6FA 4BXUA 1DLLA 2DCTA 2ZMEA 1W5TA 1UZZA 1NE4A 1X2MA 3VB9A 5LEJA 1D0XA 5HS7A 2R062 2WV1A 2KT0A 2WBKA 1RZ4A 1GSLA 2UY8A 1FSEA 1W6OB 4E27A 4P9XA 4IXLA 3QQAA 1EAH3 3UKTA 1N1SA 1SLCA 1H88C 5GP9A 1A78A 3E97A 3ES1A 3LIGA 4HN1A 2QWWA 2OUHA 3VKLA 1QNTA 4OQ8A 1NG0A 1VE0A 3Q9OA 1QJY3 4HF1A 4XFHA 1O7FA 1W06A 4JDOA 2VIXA 2K4BA 3IKVA 3I97A 5FZOB 2YBSA 4A3GJ 5I93A 2ZXHA 3ECHA 4PHZA 2R93J 5A32B 2YX7A 1X1CA 4N53C 3T0YA 1X8MA 4MADA 4IHVA 1O59A 4YYOA 2ZPXA 2OJED 2VOXA 4CDQA 2WSVA 4XAAA 2A68F 3CCYA 1JZ2A 5LBBA 1BZWA 1FEXA 5E3NA 3F8BA 4K40A 4P9WA 3CJTB 2WS92 3ECOA 3HPHA 1QMJA 3TN93 4GB31 2QLZA 5J8CA 3N7KA 1SLLA 3LOCA 1VBB1 5IVJA 3B5LB 3ZMNA 1RUI1 2PHXA 1TQMA 1UJ8A 1OCRH 1T0FA 1GUIA 3T0AA 4GCVA 1RVF1 4P9JA 1W90A 4K20A 2RM21 2O7OA 4HFSA 4QXKA 4E4SA 5B66C 2JD4A 1J7KA 1KS5A 3HBZA 3ACGA 3ZSEA 3CP2A 1HN0A 2WKKA 5FRAA 3C3WA 3H9QA 2W24A 4BY1J 3FMGA 5A6ZA 3KZYA 5DUWA 5DCMA 3ZFGA 4XF1A 5B1AH 4BU2A 2P3YA 5AIQA 1AR63 3PJQA 4M4PA 3WOGA 3A0NA 1HW2A 1PZ9A 4DNYA 1ETOA 2NS8A 4A3LJ 1MJAA 2W92A 2ZGLA 2E2HJ 5KXBA 3ESWB 1ZKGA 1ZRCA 3KYDB 1JI8A 2XKOA 2QUOA 1S0EA 1AOYA 4A3ZA 3AKRA 3EMRA 1QZEA 1CJPA 1REDA 3DBHB 4A3MJ 4ZDLA 1UZ0A 3MICA 2A6YA 1A6IA 4IF4A 3G71I 5JSOA 3H1MA 1RMU3 4DOZA 5HLHA 4CHUA 2X10A 2YC2A 3ELKA 4AEMA 5C3RA 4WM8C 3ZFFA 5AVAA 4Y5TA 1UFMA 1REEA 4FTHA 3LQQA 2E5NA 2DLLA 3ZKUA 1D0GA 2EQRA 1ZZ7A 1IGOA 4Q29A 4HG6B 2GC3A 4FFFA 5FP7A 1AJOA 5E1WA 4X8NA 4XJUA 4AQTA 2EH3A 2R6QA 3IZOA 2CUJA 3WG4A 4XCAA 1IKPA 4KYWA 1IG3A 1A34A 1COV3 3H3LA 4BBRJ 1LFBA 1JT6A 1LTEA 1ON1A 1O6UA 4O61A 3T4VA 1G9BA 1U5YA 1FOD2 1R49A 3CMAI 3K2AA 3CO7C 2D97A 4GDFA 1VQ6I 3VBSB 4IGPA 5FYIA 1HXDA 5JSRA 5BXXA 4K21A 4UV8A 2HJIA 3O8HA 2MW8A 3FWEA 5T50A 4BDZA 3WU1B 4HONA 1ND3A 4IEQA 4E2QA 1MMGA 1X4PA 1ONVA 2ZC2A 3VBHA 4OIPF 2BOIA 3CCQI 4YIFA 5JMCA 3FK6A 3QPHA 1JTXA 3IB3A 1D0ZA 3BKZA 2WFF1 1RI7A 1AX2A 4DUVA 3OBRA 2HWC3 2W5FA 4XDPA 2L9NA 3QPTA 4ESJA 4GJZA 4ZPIA 1K78A 3S1QJ 4HAMA 4ATEA 3POSA 3BPSA 2QQKA 4LJZF 2JWPA 1APNA 5FKLA 1AU7A 2ZX4A 5KAIC 1F15A 3GZAA 3Q5FA 1G3WA 1SD7A 4JQTA 4XIKA 3K46A 3RIRA 1VF9A 1SG3A 1AXKA 3WCSA 4QKBA 5CKQA 1I39A 4I98B 2BGCA 1PNGA 1FY7A 4P08A 2DDBA 3R4DB 4N43B 4TLFA 3OL4A 4RGAA 2L9SA 4W6YA 4LBNA 5CKTA 4DZGA 1R64A 2VQUA 3BG7A 1YQ5A 1GXQA 1MPXA 4NIAA 3MWMA 4HA8A 3SMHA 1JT0A 2GNDA 2CDPA 2LM3A 2XKPA 4Q4V1 4GWNA 1Z7S1 1EPZA 5A3OA 3ACIA 2PHDA 5ACA3 4AQSA 3S14J 4C90A 1MDMB 1RVF2 1W9SA 3WDYA 4ETSA 5FPZA 4M0NA 1Z05A 3AZWA 4D1QA 3HN3A 5K4LA 2HOTA 3KMHA 2DVFA 3O2PE 1DF0A 5AVPA 3BG9A 4GRIA 1RUH3 5FLXZ 3PFYA 2GH2A 4YZ1A 1K83J 1RGSA 3A0BC 5IFTA 1MJ9A 1L3LA 3FBYA 1MBHA 3POWA 1G3SA 2HWF1 1FIPA 3NNJA 1LQ1A 5LY2A 2QQUA 1QJEA 4XHBA 1U0JA 2RS53 1MS4A 1HQLA 5KR7A 1HV0A 3PU8A 4KWJA 4IEZA 3T30A 2J5OA 2RJKA 2ZEWA 3E5UA 3SH4A 1S7OA 1RKWA 1H9WA 4CP1A 4XBFA 2ZB9A 1QU3A 3JRAA 4QXHA 4GWIA 2IS4A 3RWNA 3K4AA 4NC8A 1LFPA 1BKZA 5IOZA 4MEXF 1UZWA 1TT5B 2V6CA 3LFUA 3HB9A 5IATA 1HRI3 4XMIA 4COYA 3HUGB 2F4OB 4EE2A 1OOPC 5DDJ1 4Y17A 1RUE1 2RS32 3SLIA 4RGRA 4B3XA 1UOBA 3LSMA 5FP3A 2P3JA 4ZXEA 5EEAA 2HVSA 2VVFA 3POEA 3AL6A 5H9RA 2QQNA 1H6XA 1LHOA 3U4XA 5L9BA 1NH3A 3EUKL 1ULDA 2NRAC 2NOJB 3D0JA 4EJTA 4NRQA 3NKTA 3UGHA 4ANJA 3SISA 3VZJA 1OKQA 2X1DA 4NNJA 2C5DA 1DYKA 1BBYA 1FYUA 1PGW1 4LOCA 4K7JA 1QIQA 4RB0A 3ISPA 4XDOA 1V55H 2QDNA 4BOWA 1UU5A 3JRHA 5D8AB 2CG4A 4CCMA 3POJA 3DQVC 4ZDOA 2K9SA 3CMEI 1OISA 5TRDA 4IPAA 1I50J 2Y2ZA 2SBAA 2W68A 3J7AY 2HQ5A 2VONA 5M3MJ 4XBLA 1B72B 1JZ8A 2Z4FA 4EJWA 4I0WB 4BE2A 5F9TA 4A6OA 5KHKA 1OUXA 4WZFA 2ZKLA 3B6CA 1GNHA 5CFCA 1JYIA 3ZMSA 3VBOB 2FOKA 2G9WA 2L7FP 1RUG3 4YW7A 5DUIA 4YVWA 4A6DA 1WRJA 4F91B 4XBQA 1VBC2 3LSDA 1FI2A 1HLVA 3TW6A 1PM7A 3WCRA 3ZQCA 4OINF 4N7UA 3DYPA 3PU3A 3WDWA 1PHMA 5A1FA 3TOBA 3VBFC 5K0UC 2ACJA 1N3OA 2VXJA 1QRYA 1J58A 2DUQA 3WHCA 2Y30A 2VT3A 4XLCA 5FD6A 3H5NA 1XYOA 2ILMA 1ZA7A 4XRMA 3CBNA 4ZU4A 2X5IB 3PNTA 1B35B 4V2FA 4BACA 1DYPA 4QXCA 5ERLA 3IDAA 3NAUA 1R1A2 4NDLA 4BCUA 2BFUL 3IIAA 4GA9A 3T2PA 4MOAA 2XVGA 2IXHA 4GZ9A 1O91A 3I2IA 2VASA 3DLAA 3MUY1 4RS5A 1PGL2 4LPLA 1W8HA 1Y43B 3L09A 3INAA 2M0CA 2JQ7A 1Z6RA 4WZCA 3BDDA 4HLYA 1PVXA 2VOVA 4AD9A 4OU0A 5LLQA 2OCCH 1Q8SA 3ML6A 1YNAA 3IH4A 1A04A 2VZ3A 3KV9A 2DA3A 2L3DA 1E3HA 3L2UA 1T6SA 2WA3A 3PVOA 2W94A 1LOAA 3AZZA 1ZBA3 1O8PA 4KI5M 2BBAA 3ZYBA 1WH5A 1WH7A 3AMQA 2A3WA 4FASD 5FROA 4GGGA 1YO8A 3HNMA 2RMU2 2CNAA 4WK8F 4X0GA 4A0XA 4OFGA 4ABZA 1SAUA 5TGTA 4YG3A 1EV13 4BZ4A 2BVVA 4AIDA 1B09A 4LO7A 2ZGPA 5DEQA 4EATA 1SLAA 4EM0B 1YC61 4A45A 2XQXA 4AFAA 4MGKE 2J7MA 3ZFEC 4MG2A 3S57A 2D6OX 1X1DA 3K4DA 4QX1A 1D4VB 3GTJJ 1QQP3 2WAQN 4HSTA 5H9QA 2DOEA 3CCMI 1UAIA 2OF7A 4DXTA 1W7PA 1GQHA 4AF9A 3I53A 1QJY1 3HT1A 4LBKA 2AQFA 2E1OA 1O3RA 2A6VA 4P55A 3NJVA 4FFIA 4UYBA 3J8F3 2L01A 3RDIA 4M3CE 4NAMA 4XORA 3JCIA 4UBGA 4FT8A 2KD7A 1UZYA 2L9LA 3Q8BA 1PGW2 2K9QA 1KFXL 1TWGJ 1ACCA 3J7NA 4JYKA 3BTZA 1Z1DA 1WJBA 3WW2A 2CFOA 2WWJA 3U9GA 5TISC 3TN91 1V5EA 2AGSA 4A41A 4II2A 5FP9A 2ZX0A 4LB6B 4GMP0 2DW4A 5K5OA 2QTWB 4H4KC 3ACFA 3ZOBA 1OR7C 4DS0A 1MBJA 2DCEA 5JOXA 2JG8A 4FCYA 3DPUA 5JR3A 1O4ZA 4YFXF 2VKHA 1F35A 2XAUA 1AKHB 5E89A 3GEZA 5K5QA 1TW2A 3KYLA 4LK7A 2X6WA 3VZOA 2W57A 2L0KA 4Y1VA 1IXCA 4C91A 2DT7B 2WQ4A 1OR7A 5IYBJ 4AI1A 4RQPA 1VPHA 3PUFA 2J1TA 1LEMA 4JGZA 4PJMA 2VJ4A 5LA2A 3OOPA 1LE8B 2CTVA 2R043 2LRPA 5K7FA 2J1UA 5A33B 5BNNB 1BL0A 1LB2A 1OC1A 2P8TA 3H1CA 3ZMVA 1RMU1 5IYYA 3DKYA 1IC8A 1JYWA 3J80Z 4IE4A 4BQOA 3LSRA 4CSWA 3IBMA 3KD4A 3KEQA 3FIWA 2EFNA 2YBPA 2E34A 5DXDA 3NAPC 2M34A 3A02A 1CIYA 3K2ZA 2EA2A 1BI3A 1Z21A 2VBWA 3LZZA 4J19A 1GNZA 3WQBA 2VZQA 1DGRA 4Y5SA 4BHBA 4F55A 4Q4Y3 5JWPA 2KIMA 1OLRA 1C8M2 2EV0A 4HRIA 1ZGAA 3ZMUA 1H1MA 2B42B 1VFCA 3OY8B 3KHCA 1YFUA 1UCRA 2VCBA 4DEVA 1D0YA 3B69A 3K77A 4AVPA 3WP3A 2Y38A 5FZ8A 5A1LA 3S32A 2R0FA 2A7AA 4UF0A 5J3UA 3NWKA 1HA8A 4V2VA 2VUCA 1PO12 2XJVA 1RIOH 3EQLF 1IF1A 1CN1A 3MQ0A 2EALA 1XNKA 1W03A 1NLQA 1K5MA 3HJRA 2NAZA 4XFFA 3MKLA 4DB5A 3N4MA 3SHFA 3PIPF 4YVSB 4YGCA 5K9YA 4H14A 3M9AA 2GU9A 4HVQA 1VQMI 1R091 4WVMA 2W1SA 4RAFA 2FDGA 1IN7A 4CCKA 1FBQA 1X9PA 3OGVA 2MC3A 3HTSB 5LATA 2NNYA 4A69C 1P6RA 1Z91A 1UPIA 4R8HA 4I7HA 1STZA 2VPRA 5D6FA 2BY3A 1O3SA 1UX7A 2MG4A 3VKNA 3TAYA 3B01A 2HWE3 4OMDA 2ZGQA 3MN2A 4HW0A 4HPKB 5FIXA 5F0FA 3HOYJ 4XFAA 2H0BA 2UWMA 1CPNA 3IRRA 4A3IJ 4QGNA 1J09A 2IJLA 5ACA1 5FZ4A 1X1BA 2HI3A 2KZGA 2PMHA 1ZRRA 5LHHA 4AGGA 3KCCA 4CUGA 2Z42A 1ETQA 2WZR2 5IT9K 1TC3C 3FXQA 1KQ9A 2BRTA 3USUB 2HKXA 1Z7LA 2C0ZA 1BBT1 4JTOA 5GZCA 4H55A 3NARA 1RUH1 5DPNA 1EUTA 3F9KA 3WTSC 4FISA 4H0EA 1BMV2 2DVDA 4JX4A 2HNHA 4RM2A 3REOA 1TWFJ 1QPMA 3CUOA 1MZ6A 3AFGA 3GCWA 2WT0A 3JD73 4BQAA 4ZZLA 1EYBA 4ZZ8A 2RS51 2E36A 5F08A 5FO5A 5JLWA 5L3GA 2KMUA 1MVQA 3HRTA 1VMFA 3JBG3 2P1BA 2DMQA 2XVLA 2CQQA 2OQ6A 2VOPA 3WV6A 2BXZA 1B59A 2WQZC 5A7NA 1TLHB 1V54H 3J7ZI 1HXS3 2ORZA 4CVUA 3FXOA 4DQ2A 2DFHA 4BJ5C 1HRI1 2LNBA 2UXNA 1TZOA 1ZYRF 2PHLA 2PEXA 1ODNA 5D1IA 3B9IA 2YB7A 2Q4SA 3M7AA 4L0YB 3I49A 1AYM3 5A7WA 1Y0NA 3GLLA 3OSGA 4ARYA 4G7ZF 4F3QA 5C5UA 2ZHLA 4NPRA 2X8KA 1NYWA 4XLNF 1ZLKA 2PHWA 5FAXA 1F4HA 2PLV1 2M30A 2A5YB 1W6QB 1HBXG 3PL0A 5FMOL 2WO1A 2G1MA 3DLLF 2R071 2VMDA 4BMBA 4EN7B 1MZBA 1QF3A 4Q48A 2VCMA 4IV3C 4LOTA 3I2DA 3AL0B 2HWB3 3VEPA 3F23A 1K4SA 1CESA 2OZ6A 3TB0A 3DKWA 4XJZA 4BEHB 3IWFA 2J1VA 3QYBA 2Q2EB 3FDYA 5LBEA 2OCEA 3I8TA 1YG2A 4CUAA 3P9CA 1FMWA 2CWMA 4WVVA 3NV3A 2MABA 3O1SA 1S7EA 4QB1A 1C5IA 4D8MA 4L11A 3DN7A 2P2KA 1I1EA 2HS5A 1U8BA 4CDQB 2B9SA 3JSPA 2V26A 4RYDA 5JPNB 2DFEA 4NPMA 4M3CA 1OF3A 2O9LA 2VVEA 3H1WA 3VHPA 3CDLA 4YGEA 5FQ0A 3O1OA 5LBFA 3ABMH 2JMWA 1O5UA 1AX1A 1AHSA 2KQRA 1A31A 5JZGA 2DPUA 4D69A 1B8IB 4KGQA 3ERED 2PI0A 3S2DJ 1XDUA 3VGIA 4XKCA 1XD7A 1ZTRA 1D1BA 4EGZA 4OAYA 2E1MC 4U36A 1OLME 2WNVA 4AVAA 1LENA 3AAFA 2CSOA 3HNYM 1RHI3 1SAXA 3QODA 2CRGA 1KITA 4AVCA 4JQRA 3SKJE 3GTKJ 4M6XA 2XJQA 4H2AA 5J47A 3ZN4A 3PVEA 1TMF2 1S0JA 2R7FA 4HG2A 5FFOC 3LFIA 4CYCB 2I45A 1BBT2 1D7PM 1RPWA 4RHV2 4KMUX 3I4PA 4QQLA 1OCTC 3TEYA 1KYWA 3LDKA 2ZXQA 4GWMA 4QGMA 3AL5A 4O9GA 4LTAA 1FMD3 2R3SA 4MGRA 1XX5A 4YM3A 2PHUA 5FJKA 1N1YA 1KXGA 3IDBB 2W0XA 3M8JA 4Q0SA 2TUNA 3BC8A 4GYGA 2BP6A 1STMA 5CVVA 2VT2A 1FX5A 1LOFC 1D0HA 3E6BA 1EV11 2D5VA 4D5CA 1S3JA 2OTLI 1G6NA 4QPIC 3LMMA 5CAZA 2ARAA 4MFEA 4Y5Z0 4HKWA 5CYYA 3WGGA 5FYMA 1IS5A 1UD1A 3RNSA 4D6SA 1LHUA 3WP6A 4CUBA 4D7MA 2ZACA 3BJOA 3RFRA 2JJ7A 2J1EA 1B4AA 1QQP1 5BV6A 5FZGA 3VD4A 1Q8OA 2X51A 2RDRA 1T56A 3E0JB 3T1MA 1LAJA 4BJ0A 3WTUC 3BJAA 1S0IA 1H6YA 3LEIA 3HQRA 4BHCA 1YIPA 3KZIC 3JRIA 3LSIA 3MF9A 2B46X 5EPAA 3WQ0A 1RUC1 2JDZA 1NUKA 3QPLA 5FLXK 2A5WA 4S05A 3BOPA 3VDBA 1BOBA 2L4AA 1LKXA 3WE2A 2FUG2 3LL7A 3FHNA 5CADA 5FREA 3TDZC 3NSTA 4XL9A 3EDPA 1IRZA 3HKZA 2HQNA 3IMNA 2EINH 1AYN3 5GLZA 3GF2A 5DCFA 2B4KA 4KITB 2EJRA 3KP5A 1AL23 1HOMA 2YDEA 3I2FA 3PHMA 1H8TB 4IE0A 5BYNA 3GFMA 2R16A 4KG8A 3AVSA 3GXUA 2CGOA 3OYWB 4OI4A 3WX5A 5FY4A 4Q5OA 1HRV2 2UU8A 4A5MA 1PK6C 2EAKA 1UXZA 1WMEA 4Q0UA 4UWDA 4YW2A 4DO0A 2BW3A 3I56I 5E88A 2MNGA 3CTAA 2GNTA 1WCMJ 4RFRB 1XGNA 4ASKA 3K3NA 2PELA 5A7OA 1W36C 1XYPA 4CCDA 1WBFA 2K85A 4LBQA 1AXYA 2JSCA 2VMEA 2BUKA 1CQTA 2AXTC 4UB8C 1QWRA 2M7BA 1J5YA 4E9KA 3T3YA 1PZ8A 5J36A 4Y1ZA 2L7ZA 2E51A 4XURA 1E3OC 2W91A 3F8MA 4DGWB 1JU4A 2JJ6A 5JPMB 4ZONA 4NWWA 4Y4YA 3ZR6A 3VD5A 2C4XA 3GNEA 4XIOA 2W1UA 3CMGA 4GKXA 2UURA 1RKTA 1XMAA 4L99A 1I3QJ 2VQCA 1DQ6A 1QJX3 5IVEA 2XAHA 4PIYA 1GYKA 1UY2A 3BIWE 2AUYA 2MHFA 1JYXA 2WLQA 4JTNA 4NAOA 3OYBA 2HWD2 4XJWA 5AFEA 1OVSA 1TT0A 3RZKA 2MH9A 2W00A 1X50A 3ABUA 1GXPA 4PJ0C 1MEC3 4XLAA 3BPXA 4QPGC 3IAQA 1CF7B 5KXEA 3WHTA 3F95A 1IQAA 3Q0VA 3F21A 2QZ3A 1DQ1A 4NHKA 4COVA 2D5FA 2VJ5A 3CLOA 4CDUA 1Y9MA 4FE4A 2HZDA 3RQ4A 2LREA 2PMUA 1BEV3 1BI0A 1JUMA 4OIOF 2FMYA 2VQTA 5LA0A 1HCRA 5BNOA 3BJ6A 4U88A 2FCUA 4U0VA 4PGHA 3GUDA 2F5DA 4CDXC 3HEFA 5GM0A 2OKXA 2V7FA 1A8DA 1EP0A 2CV2A 5A3MA 5EJ3A 4ARXA 4CU6A 2JDHA 2FZ1A 3W2WA 1JOJA 4EEFG 2DA6A 2HEYF 4M01A 5IVCA 3BROA 1WWXA 1YJNI 3RVHA 4FOQA 3V0BA 5K7PA 4ZYEA 1XU2A 3RZDJ 2GWRA 4UUVA 1KJRA 1SEFA 5F3IA 5IP6A 3AP4A 4C2UA 1ETWA 1UG2A 4CH7A 4EWAA 4Q2FA 2H1LA 1Y8RB 3FM5A 1HB2A 2J42A 4F8AA 5FZCA 3R6SA 2E2IJ 3NKGA 1HSJA 3C7EA 4HF2A 4JV4A 1ETYA 5D5VB 1SD4A 2YR2A 3K51A 2VM9A 3G3ZA 2HWE1 5J4VA 4LIUA 4EJOA 2P3IA 5EXOA 5BNPB 4YVWB 2D98A 4HOBA 1LCLA 4RR3C 3NJZA 1W9FA 2DVBA 3PO3J 4B3AA 2YG0A 2ZEZA 5J48A 2IWGB 1WJ5A 3SHRA 2FSWA 3HVDA 2PMZA 1ASJ1 1OI6A 2QGUA 2R0HA 2K2SA 2W84A 2LUWA 2E2JJ 1FX7A 4WM7A 3M4FA 4RR3A 1IGNA 2VC1A 5M5WJ 4IE6A 1A3KA 4AVSA 4BQ1A 5H9PA 5ICCA 2LR8A 3U4SA 2ZXJA 3DXUA 4CCCA 4AHWA 3TO9A 3ECQA 1U5TA 2PJRA 4YGDA 4E7IA 4CEYA 5AC93 4QWQA 2YC0A 2CUZA 3LKJA 1YW9A 3PUHA 4F83A 1OCPA 4LQRA 4LMFA 5JI9A 1Q8QA 1PP8F 2KP6A 1GOGA 1JE8A 2ZEYA 2YPJA 1K3IA 4CXFA 4DXSA 5DAPA 2M1BA 1CX1A 3E6DA 3M1EA 3MIDA 3MBWA 4ZTFA 3F3XA 4ZYHA 4JOMA 3JTHA 1ZG1A 5FXWA 1Z6TA 4F3JA 2KRHA 3FLRA 1ZBE2 4UY8I 2M3AA 3FKJA 1BIAA 1DBNA 3VN4A 3WZ1A 2FMDA 2VKVA 1AYM1 4RB3C 1W6NA 2QM3A 5B1BH 3PJYA 1C57A 4QKDA 5A80A 1PNFA 1YQ8A 5FZ7A 3MIBA 1YI2I 1UMZA 5C3PA 4MQVA 5AIPA 2HPIA 4IVNA 1W7PD 3RSNA 1YFYA 2QQWA 5CA6A 3K4CA 4LE3A 3Q8AA 1T38A 3K70C 1PIV2 1DGRN 5TSWA 3S3OA 1BJQA 3MIGA 4CUCA 5FPXA 2M0MA 3D6EA 5A6QA 3O0WA 4UUSA 2LW8A 1U8RA 4NN0A 2BVLA 2HWB1 2F6CA 1W2UA 4IEOA 2ESHA 2ZGKA 3PNVA 2DBIA 2O03A 3MMYB 1XCVA 4MGQA 1CAVA 2XGEA 2ARBA 2JG9C 3ABZA 1I6XA 1SMYF 2WNUB 5FZEA 4XEZA 1XE0A 3H8UA 5L3EA 3J80K 3KQ4B 3TNPB 1ULOA 1W8TA 4XAEA 4FPJA 3WODF 3QU6A 1R7JA 3N9MA 1OVPA 4E6KG 1OCZH 1YLLA 2Y31A 2V9PA 2JG9A 2Z1DA 4NHMA 2R7EB 3ZQ7A 2VL8A 4COWA 3HGGA 2YROA 3WDXA 5KCMA 3MIHA 4BY7J 4B8XA 5D8LB 3LA2A 3S1NJ 2DU9A 2ARCA 4IE7A 2ARXA 3IKWA 1FPN1 5FKMA 3C3VA 2XXZA 1W0UA 3BODA 2M5WA 5JOYA 4FAGA 1TWHJ 4HQMA 2F17A 4YSFA 3VL9A 3WQ1A 1Z77A 2BZDA 1RHI1 5FZLA 4FX4A 4LLFA 3WF4A 5FXZA 1UZCA 3KCXA 3BCAA 5DZGA 3JRBA 3LWCA 3MW2A 5IVFA 4ZS2A 2JIGA 4LLLA 1VTNC 2GXAA 1I5ZA 2RDSA 1F36A 2EWNA 5A32A 4RQPB 4K8RB 3OS2A 4NE9A 5D2AA 4XR6A 3E1F1 2EZHA 5BPXA 3CCUI 1VBD1 4XE9A 3CNAA 1NCRB 3OG2A 1HDKA 2KL4A 3WDUA 3R4KA 5HOOA 2PQ8A 1R082 2CQKA 1FTZA 4LG3A 5FUNA 1HN1A 3MV11 1OYYA 3GJAA 4QX2A 1FMD1 3H36A 4Z1VA 2D40A 2WO7A 1ENXA 1Z9CA 4P96A 4XPVA 5LW9A 4CZCA 1FV2A 3HOBA 3AXDA 4A3EJ 2PFWA 4LMYA 2DODA 1W1WE 2NYXA 1T39A 3LSPA 3K4JA 1D8JA 1JUPA 4I01A 1MBEA 2DYSH 1F9KA 1XE8A 2XLFA 1W8FA 2WZPP 1JZ6A 1DPUA 2VD7A 3LPGA 4Y1XA 3E6CC 4DEQA 3G1LA 4ES9A 2DOAA 4Q4W2 4AI9A 2HEVF 3OEAA 2LG4A 3TGNA 2WB1A 3A0HC 1WCUA 2A69F 3S8PA 4FO9A 5FFXA 2VMGA 2NS7A 2C6SA 3NNMA 3E1SA 1U0AA 2XJSA 4NRMA 2VBPA 3BP8A 1WWYA 3SEQA 2W1WA 5FYSA 2VOOA 5FPBA 4RL7A 2F5FA 3QU3A 1WBLA 1OCOH 4UW4A 4CEWC 5HXMA 3BZCA 2VQGA 1QKQA 3WE3A 1HW1A 3LFKA 4RA2A 2FQPA 3M3QA 3TKYA 1TME3 3SFIA 2DF7A 5FY9A 2R7WA 2OPTA 1VRH1 2PQSA 4PT6A 5LCWL 4TWTA 2X6XA 3UNPA 2FE3A 1JHHA 4MHRA 3VWBA 2F2EA 3AZXA 2HWVA 4LLNA 4R1HA 3JRCA 4H3WA 3AP5A 3P3NA 4E2GA 1K12A 2K27A 3W9AA 2LALA 1UF2C 5HBAA 3C18A 1USSA 2X9DA 1XXNA 4M9XA 1N1VA 1NZIA 2YMZA 3UGFA 1RC9A 2PYTA 1PMJX 1AL21 3NV2A 1C0WA 3RWKX 3FKIJ 4L0ZB 3M8EA 4D0PA 1M1EB 4LBMA 3VBSC 4M3DA 3M3EA 3ZSKA 2R063 3VV1A 4W4ZA 2GH8A 4LKDA 2MEV1 3IRQA 1XNDA 2VNOA 2LY1A 1DU0A 3KLSA 3ZXSA 1VQOI 5L73A 1H2KA 1IN6A 3FMQA 4A3DJ 5GPAA 1ND2B 2JK3A 1V3FA 2CV0A 1F43A 2DCJA 1VBE1 1GWMA 2DJIA 5CLSA 1DFQA 1EAH2 2YPRA 4QAWA 2R92J 3P7NA 4BQ5A 1OPCA 3OBZA 3WP5A 3I3BA 4P9IA 2A6ZA 3OPZA 5ANNA 3T1BA 2HOSA 1Z3XA 4DJAA 5DUUA 3KETA 1LKNA 1O57A 5AFBA 1FPN2 4O6JA 2VNVA 4PDWB 1SBDA 2ZEXA 2PBIA 2QQVA 3HTUA 5J09A 2EIMH 1UY4A 4E7JA 3SXWA 4RLFA 2H6BA 3LE0A 4E4HA 5C4WC 1PGSA 3K4NA 1I6HJ 3S5AA 4FTBA 1Q56A 3IC7A 2RQPA 4M00A 1RUNA 1TQPA 5IP7J 1JOBA 3FK7A 1YIFA 3C7OA 1BN5A 2CUEA 3EETA 4OOIA 2NZ9A 4BE3A 2M8EA 2YU1A 5J1UA 1S1AA 2F6BA 3HIFA 2XF6A 5FTTC 3OYIA 4HOOA 4IX7A 1IPKA 2YU3A 5FKNA 3KS7A 4PLOA 2IS6A 2LP0A 2F48A 4IESA 5A7SA 1RNLA 4N43A 1DQUA 5FZ0A 4LORA 2QKDA 1DDNA 4D7NA 3RZGA 2ZZJA 4C9YA 4EM2A 3A21A 1VAMA 3TEWA 3IUOA 1OJLA 3P3PA 4DY3A 1BC7C 2IGOA 5M5XJ 1BEV1 3AG1H 3FE5A 2CV6A 3WTWC 1MDMA 2MGQA 5HVQC 2O3FA 2BGOA 4KIGA 5LGNA 5A7WB 2O8XA 5C7GA 1PO23 1Q8PA 5E3OA 1AR62 3HJEA 4CXYA 2P5LC 2CGNA 3N05A 3MI8A 2R30A 1BOAA 3GO5A 1KDMA 4QD2A 1W0TA 2L2OA 1W99A 2DDUA 2G9FA 2LRDA 2FD5A 4IGOA 2VE1A 3Q8FA 4FP2A 2E71A 1X7NA 5FY7A 2Y0SA 3ZQFA 3H5RA 4UFKA 2EXKA 4XKVA 4RN5A 1YQCA 1VAVA 4CCJA 1PM4A 4XLFA 4XTPA 4F93B 2E7XA 2X0LA 3FFQA 4HBNA 5A7QA 1VRH2 1GP4A 3L00A 1UWWA 4QIWN 5C8CB 3D5LA 3CZJA 3GW2A 1UL9A 3HUGA 1X1AA 2FCTA 5FYVA 3K4KA 4R4XA 2HR3A 1COV2 1H9PA 2W87A 1W0PA 2KXLA 3KQRA 4II3A 3LOIA 3HKZN 3FMSA 4BMEA 4DMIA 4LFUA 4M3CB 2DURA 4IEJA 3VDXA 3I3EA 2ZGOA 3OYEA 3FLTA 3LNQA 1NY72 2Y64A 3TMOA 1ZZ9A 3H0DA 1XE7A 5JZGB 5FFZA 4IETA 4QQOA 1Z78A 1MBFA 4OMYA 4M0HA 2XOMA 5KK1A 3MYXA 3TEDA 2QSHX 1G4DA 4EN6B 5K8SA 5C6CA 3K69A 3FC0A 4G94A 4I2OA 4XABA 1ZYBA 2OQRA 1GHCA 2WNVB 2FRHA 3O1VA 3UGGA 5D8AA 2YPDA 4A3BJ 2HWC2 1RC6A 4IEUA 2KA3A 5FZKA 2VG9A 3G1MA 4XUOA 3VBOC 3KP2A 1SLTA 4LOSA 2BV6A 4CRQA 2LLKA 4B7EA 1ZZ6A 1B72A 3BTXA 2JSPA 4N53B 3SEPA 3K48A 1O8SA 4J00A 1WI3A 2DA7A 3WINE 2XL7A 1TWAJ 3MPPG 4PJNA 3FXKA 3M3OA 3PUIA 1HC8A 1U5XA 2RDNA 3RCOA 2E26A 1S0DA 2O1QA 3LA7A 4OI2A 2Z2SB 4HSRA 1XSRA 2B45X 4NHYA 1Q8VA 3VBOA 3RPUA 5C4XJ 1KFUL 3QD6A 2EFOA 2GIZA 3QWLA 1MMAA 4LGWA 3CCEI 1JXSA 2VNRA 4GB33 5IPAA 1TQ5A 4HSLA 1VBB3 4IV1A 3RSJA 3RI9A 4M74A 4DIQA 3MW4A 2BOJA 5CVIA 5T52A 1VQLI 3IDEA 3VDDC 3VHOA 1RVF3 3O1MA 2Y33A 4KWUA 2OZJA 5F39A 2RM23 1KQ0A 1IW7F 1CGPA 5J1RA 4BXXJ 1IN8A 5D21A 4QPWA 4AK3A 4OI0A 5HLGA 2OPWA 4OHVA 1ZREA 2X5IA 2DQLA 1UU6A 1B35A 1GQPA 4CDWA 4CO8A 2VMIA 1DP3A 1O4XA 4IDZA 3I3QA 5ABJB 2WABA 4PF1A 2OAZA 2DV9A 4HV6A 3NNLA 2KKOA 3N9QA 4PLMA 1AR92 1QZZA 4QM8A 5FP8A 1R58A 4FPHA 2KIUA 4NMIA 5HXVA 1DDLA 2VE9A 2VOKA 3RYKA 4HDUA 2PHTA 3CC7I 5IYCJ 4LHKA 1Z67A 2NVUB 1WMFA 3A03A 1UOJA 1W3VA 1SLBA 1NG7A 1B9NA 5A6YA 3KF5A 2A70A 4FOWA 4AFCA 1XN7A 4WWCA 4KISA 3MKZA 2ZHNA 2XSJC 4FCAA 1Q5OA 3AYEA 2R5YA 4IEYA 5FJHA 3B00A 1IO2A 5F3GA 2EFPA 2DMPA 2IT0A 4I6ZA 2XAJA 4ENKA 3UJQA 2M4GA 3VZNA 4AAPA 5C9AA 2DFIA 4OHXA 1V5FA 2HLEA 3NWSA 4YGBA 4UFIA 1BI1A 1XSQA 2DU1A 2HKOA 1ENSA 2FDFA 3I9V2 4FBFA 1HJFA 5LRSA 3S6PA 3URFA 1U12A 1IN5A 3DCFA 2QKLB 2W48A 2C1FA 4LG0B 5A3NA 3HZJA 4GYIA 4JKKA 2EXHA 4LBQD 3BR0A 3H9JA 5KBFA 4WBBA 1UU4A 1ZGJA 2PG4A 5HS8A 1QOSA 4GALA 5FBJA 2P6TA 3CD6I 4KL1A 4AW7A 3V42A 1KA8A 4AHZA 1GOHA 3H3VK 3P9KA 2DU0A 4WXHA 3I0TA 4CGZA 2A05A 3LCPA 2VMCA 1BR1A 2WLPA 2EIGA 5FLVA 4I02A 2V72A 1YJKA 2PMZN 3KVAA 2VUMJ 2JZYA 2WFF3 3LIHA 3UK9A 4N0BA 1LJ7A 1DZRA 4Q1PA 2QQ9A 4ASMB 3R4SA 2UZKA 3PSFA 2ZABA 3GF6A 2O6GE 1VBC3 3K9TA 2FNPA 1PX3A 2Q1FA 2G7HA 2BNMA 5J3LA 3HRSA 5IVVA 2QQIA 2KRFA 1D4M1 4KNCA 1A6QA 2E7TA 5GZEA 3THTA 4CTEA 4D9JA 2RN7A 4PFPA 2D3PA 4IHSA 1WKYA 4RA0A 2LMDA 1WKMA 3WW1A 4YLZA 3AVRA 1HB4A 2GNMA 2LBFA 5KHIA 1LHVA 2NMNA 3WD5A 1PX4A 1Y6IA 3M3IA 4ISRA 5J7MA 3DXTA 1LOBA 1AX0A 1AKHA 5E3LA 1VBA2 3J9SA 1R22A 5L19A 2JENA 1LNSA 5FBZA 4HX4A 1EUUA 2L9RA 2AH2A 3Q9SA 1R1A3 5JFRA 5CIRA 3BTAA 3OGRA 3ZMZA 2V4JC 1IG7A 4V2WA 1JTYA 5C3SA 2LY9A 2EBIA 1V9U1 2PLYA 1E5SA 1XCBA 1F31A 5A3LA 4Y1UA 1LE8A 1FATA 3TOAA 2ADDA 5BNOB 5F0HA 1WJDA 1TME1 3U37A 5A33A 5BNNA 1MNMC 3UKVA 1ACIA 2VUJA 2HQAA 1BYHA 3QAHA 3CU7A 3K4MA 3V56A 2ZFUA 5JR2A 2RC4A 3BALA 1IOAA 3I4NJ 2JD9A 3D8CA 4RGSA 1UY3A 4B1MA 1MS5A 2RMU3 2H1KA 1SDWA 2JB8A 4A4AA 1VB4A 3PIOF 1OF4A 4AM3A 3U10A 2FU4A 3HYIA 1RUD2 5JDBA 1WCDJ 2R061 3V7CA 2JRMA 1ZRDA 2XBO2 2QQAA 2HOEA 1OOPB 2E35A 3HL2A 1G7YA 3OY8A 1EKEA 2IW5A 1K61A 2L5QA 1YI7A 1RUE3 2CSGA 4GH4C 3F8CA 1PYVA 3SCFA 4W1UA 3HOUJ 2ZSIB 5A3PA 3THDA 1ZRFA 3OGGA 1XB4A 1WLWA 3NO8A 2BFUS 4YVSC 1FP2A 1WA4A 1IS3A 2OV7A 4P1WA 1CR7A 3H0OA 2JIJA 5FXVA 1ZAOA 1R23A 3T09A 2EXJA 2D45A 3S3MA 1LDDA 3S15J 3AKQA 2BTVC 4HN0A 3LAPA 3MFKA 3HRUA 5F6KA 4DOUA 2GN3A 3I4MJ 3ON7A 2DQRA 2WS91 1FWZA 4P5YA 5KVRA 4GJYA 4YNIA 4RFT0 4IEPA 1U5TB 1U2WA 1QJFA 3DFGA 4CEYB 3P5BA 1T2XA 2D1HA 4A42A 5FKBA 2ICWG 3LB9A 4W50A 2ESNA 1T2KA 3G4SI 4SLIA 3AG3H 1IV8A 2EZKA 2HPMA 1FOYA 2GXGA 2XPWA 3FXJA 4KT6A 2FDHA 5E8GA 4FSJA 4P9YA 2Y6JA 5GADJ 4AGRA 2GMPA 5A6XA 3DUIA 4XONA 5K7HA 2BY0A 4G6DA 3HMYA 5EEHA 2NS0A 4L9VA 1MQTC 1VLNA 4XMAA 1BXHA 3OCPA 4G6TB 3VBFB 5FZDA 4M3FA 5FXXA 3DYOA 1NXMA 4P14A 2JT1A 3NWTA 4E2SA 3W59A 3MDPA 4X6RB 1YQ6A 3USUA 2HVRA 2K86A 1XC6A 4OUEA 4AI0A 3VBUA 3R61A 2ECCA 2GA2A 1ODDA 2NPIA 1TE1B 1PUFB 3LAGA 5CQEA 4WVWA 2WWSA 2WB1N 4JKLA 3I59B 3M70A 1OKOA 4MIMA 4RSUA 3DPRC 2NVQJ 5GAHJ 1V9U2 3OJBA 4FI9A 4J6GA 3JW4A 3NEUA 2J1SA 2XUMA 4JKMA 1OPMA 5FLHA 1SQ4A 2R7UA 1MACA 4JX6A 1F5FA 4EM1A 4DUXA 1H4GA 1ORKA 3VKOA 4ZU7A 2WL1A 4XTMA 4DFSA 1C8M3 1FOD1 1YUDA 3BVCA 4XQ4A 4CP9B 4XRFA 2K0GA 1SFYA 3BR1A 1FJLA 1V6OA 1W8NA 2LSOA 4JX0A 5JAXA 1BVP1 2RVAA 3NW4A 4LIVA 2JE8A 1YFHA 1HV1A 5JXJA 4D7TA 5KHJA 3CQZJ 1EPWA 1HX6A 1DPRA 4XNFA 4UVAA 4BLIA 2Y26A 3WG1A 1W6QA 4EWDA 3CO6C 4JHZA 3LAJA 4C1WA 4G9SB 3GZ5A 3K3OA 2WRAA 1UQXA 4ZHNA 2IVMA 4AUXA 4CPBA 2MPFA 2VAUA 3VZMA 4D7SA 2JA5J 5DMYA 3K4LA 4BEHA 1W8OA 3C7HA 4CDQC 2Q2EA 2FZ2A 4HYEA 1TL8A 5GLTA 4BK4A 2Q1MA 2CGPA 1GFF2 1LEBA 5K7ZA 4YFKF 1FPQA 1J84A 3ASIA 2K9NA 1GNYA 1CWPA 2R7VA 3MLJA 5J40A 4FQ4A 1S4CA 1ULGA 1T0FC 3B94A 1QXPA 1AA7A 2QQLA 4P5HA 1BK1A 3GZUC 3SZTA 3WF0A 3JREA 3ASNH 2VPVA 4JGYB 5FRNA 1S9HA 2VL4A 2Y69H 3SEEA 2FBKA 5EG0B 2LDUA 2VQ0A 1Y1VJ 5DABA 3OYJA 4KU7A 2XMLA 1B8IA 1GZTA 2P37A 4UHTA 4F52A 3WTXC 3CCLI 3CJRB 4MGIE 1BCXA 2O5RA 4Q4X2 2DO7A 3ZFGC 2PFBA 3AG4H 3JRFA 1ULPA 5J8FA 3ZQGA 4BS9A 4Q8LA 2KZVA 1C1LA 2D1VA 2DN0A 3D5OA 2AQEA 5LRRA 1FC3A 5KXCA 9ANTA 3KE2A 4E4ZA 3EPZA 4WCGA 2E19A 1RXGA 1X58A 1NE6A 5GLWA 2FJ1A 1FYLA 4XQWA 3OF1A 3JD72 2XAQA 2X09A 2ZJ2A 4Q0PA 3ZFFC 4CYCA 3U1DA 5HS9A 1MH4A 3PUQA 3GTPJ 2DOFA 5FPLA 4HSJA 1J2XA 3NV1A 4Y7NJ 2JPCA 1U6GA 3HRMA 4ZH4F 1RUF2 1LVKA 1U5ZA 1CX4A 1XGSA 3U1KA 2CAVA 1SVOA 2A6WA 1HXS2 3B3QE 3ME2A 3SCHA 5D4RA 2RS31 3S7IA 3LSEA 3VZLA 2DAOA 2Y0SN 4OQ9A 3QYFA 1QHHD 3OYLA 2P7VB 1Y1WJ 3GJBA 3KEOA 2NVYJ 1KS4A 2QBYA 3K1PA 1WA6X 4S2DA 3TNQA 3H8XA 4YRVA 1ND3C 3DXJF 2ECBA 2VBBA 3JXSA 4HT1T 5BPIA 3CJQB 4LE4A 5FZ3A 4EMSA 2K4JA 3VBHC 5C33A 1POQA 2JPBA 3FHIB 3TO6A 2BBYA 2CW0F 4AFBA 2GQQA 4JHTA 1RETA 1R1VA 2L7MP 5H9SA 5DYMA 2FXAA 2BERA 2UWCA 3FXUA 2A6EF 2PJPA 4W65A 1FBSA 2F5CA 2Y6GA 3GWZA 5DM6F 5B5EC 1EA3A 1R5HA 3GBGA 4S0HB 4URAA 4JZRA 1VBC1 2XJUA 2VLAA 1R093 1NCQA 4KH9A 1V5GA 1H8TA 5BUVA 1S0CA 4XCBA 2XQRA 1IPSA 2P6CA 3CF6E 3MF6A 3RRDA 3ZO0B 4ESFA 2M9HA 3OYWA 3UETA 1CONA 3AKPA 2WT2A 2D3SA 3VKFC 3V64A 2GM4A 3HT2A 3S0MA 3VSLA 4CICA 3WG3A 4YW6A 2D44A 3I3MA 3U11A 3RJ2X 3VODA 3RI8A 2D3RA 4FPCA 5FMOS 1GVJA 3KB5A 2QE3A 4PJYA 3KZZA 3OL3A 1WW5A 3OYHA 4DPNA 4MGZE 2ZO4A 2YXSA 5FY0A 2IPQX 1BI2A 1HQWA 1R1A1 1P92A 4HL0A 4BISA 1WMXA 5FKOA 5HCHA