2H6CA

Crystal structure of reduced cprk in absence of any ligand
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
208
structure length
208
Chain Sequence
FFPIEKLRNYTDMGIIREFAKGSAIIMPGEDTTSMIFLMDGKIKLDIIFEDGSEKLLYYAGSNSLIGRLYPTGNNIYATAMEQTRTCWFSEECLRVIFRTDEDMIFEIFKNYLTKVAYYARQVAEINTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGAHHVTVSKVLACLKKENILDKKKNKFIVYNLEELKHLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CprK Crystal Structures Reveal Mechanism for Transcriptional Control of Halorespiration.
pubmed doi rcsb
source organism Desulfitobacterium dehalogenans
molecule tags Dna binding protein
molecule keywords ChloroPhenol Reduction gene K
total genus 59
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2h6cA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2h6cA01
4U0WA 2EV6A 2HZTA 3QPTA 3V7CA 1G4DA 3HRMA 5DCMA 4BQAA 4ETSA 3E3VA 3T1BA 4XETA 2IA0A 3HHHA 4F7ZA 4QGMA 4IETA 4YIIA 2ET1A 3BPZA 5CVIA 1J59A 3WE2A 4WBBA 2D5HA 2N7GA 1SD4A 1ONVA 3D0SA 2O3FA 1O7FA 4E2SA 4I0BA 1IN7A 3VEPA 2WFPA 2NNNA 3DKWA 4FT8A 5FQ0B 4RB3C 1ZZBA 3L09A 3EO6A 1OPCA 2M5WA 2Z69A 3K0LA 4CYDA 5FFXA 1ZZ7A 3WTWC 2ET7A 3GUDA 2P5VA 4KA4A 5CYVA 4I2OA 3M1EA 4N9HA 4EJTA 2OA4A 3HOTA 5ILVA 1QPMA 1J7KA 5L3DA 5L3FA 3FHZA 4KMFA 2A69F 5CVJA 2Z9OA 3L7WA 1VTNC 1OMIA 2VODA 1ZGJA 1UD1A 5EZWA 5JR7B 1VJ2A 4ZZLA 4N9IA 5F1RA 3CDHA 1UPIA 2J5PA 2WV0A 3DXJF 1B59A 3F3XA 5BV6A 1D8KA 2QCSB 1FZPB 2JPBA 1QNTA 2FA5A 1ZNPA 4G7HF 1XE7A 2W85A 1WLTA 4AQ2A 2VOOA 2PI0A 3WG9A 1FYMA 2CWEA 2GC1A 3KP3A 1ZZ6A 4R1HA 4M6XA 1WRJA 2IA2A 2MLGA 1CF7A 1FXZA 1PM7A 3NL1A 3I58A 3NVCA 2CG4A 1G3WA 3IKVA 4PGHA 4KN4X 4RGSA 4L9TA 1F4KA 1IW7F 3BU7A 2X0LA 5T3NA 3RI4A 2XRNA 3EUHA 1GXPA 1BJAA 3C3VA 3EYIA 1U8RA 2HYGD 1XGMA 2FRHA 2PTMA 3V8KA 4HF2A 3QACA 4ONUA 3RKXA 1XB4A 1NXMA 4UBGA 4IXAA 2Y48A 2QQAA 3QP5A 2RNJA 4BHCA 4ENNA 2K9ZA 4Q4ZF 1TW2A 5KK1A 2HGCA 4D0PA 3I54A 3CEWA 4ZU4A 3EQLF 1MJAA 1S6LA 3F72A 2Q8KA 3KGZA 2DW4A 2OU2A 1I27A 3TQNA 3JAMZ 4QGLA 4XEZA 2QZ8A 3KP5A 2L01A 1Z6RA 2EFOA 3WTTC 4XSXF 4X6QB 4IHSA 5J8CA 2HS5A 1YFXA 1B9NA 2XAGA 1HW2A 2VBXA 1QGPA 4UV8A 2AS5F 1CX4A 2FU4A 2BBYA 4YIFA 4I09A 1R1VA 3ISPA 5BY5A 4YSFA 4EGZA 3HTUA 2GQQA 1LQ1A 1FOKA 4MH0E 2K0GA 4XFFA 4HVOA 1U5TC 4KU8A 1XDUA 3F8MA 1CAUB 2P6TA 2DK5A 2CAVA 2FF4A 5E20A 3SZPA 2Q0AA 4ESJA 3V4GA 4EWEA 3H7YA 2F5DA 1UW8A 5H6RA 5CJ9A 5LHIA 2H6CA 1QBJA 3GFIA 5ICCA 1IXRC 1F5TA 2ZNYA 3O3KA 5FD6A 3BOQA 1LDJA 1YTYA 2DLLA 1REPC 2MPFA 5FGMA 3N97A 2C0ZA 1KGSA 1HW5A 4M9XA 2P4WA 1R1UA 4QLCU 5I8TA 2OAZA 2GA1A 4A0XA 4KDPA 4LULA 3FX3A 1Y3TA 3GVAA 1J3PA 4AD9A 1RTVA 4MGZE 1L3JA 4TLFA 4XFAA 4FAHA 3L9FA 5A2QK 1T2KA 2MA3A 2KIFA 2MH2A 1J3RA 2PMHA 4IEPA 2V79A 4RGXA 4R79A 4Y15A 5BXXA 2W25A 3P9KA 1UCRA 2PAEA 3QP6A 3BY6A 1IN4A 1TQMA 3W6KB 4MGIE 1A04A 2GWRA 5JFRA 2ATFA 3USSA 2PN6A 5D8LB 4QXKA 4YYOA 4LB6B 1ZZCA 4LD5A 3R61A 2CYYA 1GHCA 3SXWA 1SFEA 3ZMDA 2V9VA 4NB5A 3MEXA 4KL1A 2PAKA 3U0ZA 2YSRA 4FBFA 4MNUA 3CO2A 3ES1A 3HOSA 1K6OA 1AOYA 4AQ6A 2VBZA 2HKOA 2FMLA 2XAHA 1IXSB 3DEUA 4XFHA 2KRFA 1GQHA 2VXZA 1W5SA 4MZUA 1TQ5A 4U0VA 4Q0QA 5E18F 1S7OA 2RQPA 3F8NA 4HDUA 4MV2A 4AIHA 1OR7A 1QWRA 3FMRA 4HF0A 3T0YA 2K4BA 2DO7A 4HA8A 3LWCA 2PMUA 2BV6A 3ERED 3WW3A 1B6AA 3HSRA 1MGTA 1KQ9A 2ZO4A 4IHTA 1TBXA 5JSOA 1H1MA 2LSOA 1EP0A 1U2WA 3QOPA 4A0ZA 4TV7A 5HS8A 4IERA 3U2RA 5J3UA 1R7JA 4QWQA 3LOIA 1XN7A 2MH9A 5FLXK 4XSZF 2CSOA 2O8QA 3DV8A 2B5HA 4G6DA 4K2EA 2NAZA 3WTSC 1S3JA 2QBYA 2QM3A 3ZMZA 3Q9VA 2M87A 2KJCA 3TO9A 4PIZA 3ECOA 3TOBA 5I0UA 2RC4A 4M73A 1EV7A 5BQTA 3FJSA 3O6BB 2IVMA 1ZN2A 3VHRA 2K7LA 5D4SA 2V1XA 2EA2A 2VT3A 1SD6A 4LLNA 4R52A 4YNIA 2IC1A 3HT1A 3EDPA 2ZNZA 5FCCA 5JCTA 3JZVA 3GYHX 2IXJA 3ZDSA 1C0WA 3KETA 4YARA 2G7HA 2CO5A 3G3ZA 4I98B 1CAUA 2WTEA 3M70A 3PVBB 1OFNA 4CZZA 5FLJA 2W84A 3KP6A 2ZMEB 3J80K 2DPDA 1T0FA 1EY2A 2O8XA 4O6JA 3B73A 1L0OC 2NRAC 1SQ4A 4KUMA 2GH2A 4JTNA 3BZ6A 5HDGA 3I5UA 2L4AA 1I5ZA 1O3QA 4ZU5A 2HQRA 3FHIB 4PZJA 1ZG5A 4IPAA 2Z33A 5HS9A 4LK1F 4HV5A 2MBFA 3PQJA 3KFWX 2VOPA 1AWCA 1DGRA 2P5LC 4E70A 1H0MA 1X8MA 4MEYF 1HKSA 2ZCWA 1J58A 1KQ8A 1E17A 4A5MA 3H1WA 5L3BA 3R4KA 2R7FA 3RTRA 2VE9A 1O3TA 2HDCA 3RKWA 1XGSA 5LGTA 4FHTA 1CAWB 3WTXC 4O5VA 5K8SA 4MX3A 3LA7A 5LEJA 4UVAA 1ULYA 1CGPA 3IDCB 3VB2A 1CAXB 4MTEA 4QM9A 4JV4A 1IN6A 4JVAA 1HXDA 3BCWA 5EFUA 2V09A 1USSA 4MGRA 2VQAA 5I8YA 1JUHA 3TDUC 5D6EA 1IN5A 2Q2EA 2CGPA 3CLPA 3ST7A 2PG4A 1B1BA 5JI6A 3TO6A 4WF2A 4O9GA 1LB2A 1XCVA 3NKTA 4JBAA 2IXKA 1P2FA 2O03A 1W4MA 1PMIA 3TNQA 1SFXA 3HQXA 4EJOA 1LNWA 3K9TA 1OI6A 1RL3A 3V7SA 4WVZA 1EPZA 1HBXG 1QZYA 3CF6E 2L02A 2O6GE 4H7LA 1TNSA 1X8EA 4IEXA 2XUBA 3BPVA 4OOIA 2HJIA 3NJZA 2XGXA 2P8TA 3GO5A 1X82A 3IDBB 4ZU7A 2JPCA 5HOOA 4KN7X 5DEQA 2XHKA 3V7RA 1J0RA 2PQQA 4CXFA 4PJYA 4DINB 1I1GA 4J1WA 4Z2YA 2QJVA 3KLNA 3T8TA 3JAMK 2GIVA 2Q1ZB 3E6MA 4PGGA 2JTVA 5FD5A 5DCFA 2VE8A 1KU2A 4I01A 5ILUA 4LA2A 3FM5A 2COMA 2EV0A 3RIRA 1O5LA 4P9GA 1QZZA 2NYXA 2ZFWA 5JAXA 1X7NA 4A6EA 1SEFA 2B0LA 3GFJA 3GFMA 1ZRRA 2YR2A 3H3UA 3HHGA 2QENA 3S2WA 1EYBA 3SMHA 3R6SA 2LF7A 1ZARA 3ULQB 1ZRDA 2QLZA 3WW4A 4CHUA 3KE2A 4OIQF 1YHFA 5K5OA 4AIJA 4WWCA 3N4MA 4PDKA 2EWNA 2HFHA 1W5TA 3DPTA 5E1WA 5J48A 1MDMA 6PAXA 5DCMB 2LDUA 4WK8F 1Y9QA 5DV5A 4NQWA 2F5CA 4QGNA 1U5TA 1MZBA 2QNKA 2JZYA 3K1NA 3LAJA 5DYMA 3I64A 4LUKA 1R1TA 3BROA 2ZBKA 3OF1A 1QXRA 5D1IA 4Y17A 4P9UA 3R60A 3CL1A 3MWMA 4A12A 4G8XA 1R22A 3RZZA 4AVCA 3E5UA 1FT9A 4OIOF 1ZG1A 2VBWA 1YG2A 4Z07A 3F21A 3M8EA 5LHGA 3ZMVA 2A68F 1IF1A 4Q0SA 4P55A 1YS7A 3BP8A 1CAXA 1UCXA 1ZHFA 4AVAA 1MD0A 1K79A 4Y13A 2C6YA 5H20A 3CLOA 3FM3A 2QVSB 2EFNA 3QU3A 1WGPA 4Q47A 4M71A 3QAHA 3OTFA 3BJOA 4L0YB 1ON1A 3M9AA 4E2GA 1E2XA 3E97A 1BOAA 2P7CB 2VONA 1DZTA 4PCQA 3CUQA 1SFNA 3FMQA 4KYWA 4FX0A 1NZCA 1XCBA 2QUFA 4OIPF 4Q5SF 1PP7U 3MCZA 3WU1B 3KGLA 1O7LA 1XMKA 5AIPA 2B9UA 1P4XA 4BNCA 1SMTA 4IJAA 1XDSA 5K5RA 3GLXA 5KVRA 5CU1A 2HKXA 3I4PA 3ZPLA 2ETEA 3FE5A 3OOPA 4WXCA 4O3MA 4F8AA 2ISYA 3IC7A 3IWZA 3F8FA 4XFIA 3WTVC 3LAPA 5CVVA 4R8HA 1T39A 4XLNF 2A61A 4HSJA 3GYDA 2F5FA 4JTOA 3K1PA 3Q9SA 2IP2A 2XLAA 1LR5A 4P5OA 4D7TA 2A3SA 2BGCA 5HLHA 3LFKA 1V70A 5ILSA 5I0TA 2PHDA 5F6FA 5E8IA 1HSTA 3COAC 3JSOA 1VR3A 2AXLA 3RJPA 5LRRA 1O3RA 3S7EA 5EEGA 2FEZA 4L18B 4PIYA 2XKPA 2QBYB 1J9IA 1TTYA 3ACLA 2K86A 1H9TA 4HVRA 3KP2A 2P6SA 5JSRA 1ZH5A 3SHRA 3IL2A 4I02A 3LZZA 2PAMA 1RGSA 3G73A 4EROA 1ZG3A 1ZZ8A 4LG0A 1H1IA 1RNLA 5BPDA 4M72A 3ZMUA 4UV9A 1BC7C 4Q29A 4RGUA 1XRUA 1STZA 2XASA 3ROUA 4AWXB 2HR3A 1P4WA 1FP2A 1PUEE 2Z2SB 4UVBA 5HI0A 3IHUA 2O0YA 3H1MA 3CJNA 2PBIA 2HYFA 1BI2A 4BHBA 4QM8A 1FYLA 3H50A 4OIRF 2A5YB 1R5GA 4OU0A 3SQNA 5K1YA 4YFNF 5BOXA 5I91A 5EEHA 2IXCA 1XGOA 1BBYA 2RVCA 5J8FA 2OPKA 2UXNA 2L4MA 5D8KB 3GWZA 1OD5A 2HTSA 2EFPA 5KHJA 2IXLA 2RV8A 4AIKA 4MTDA 5DD4A 3PQKA 1CAVA 2MC3A 4CICA 5J6XA 3J81K 4HLXA 2L3DA 2UXXA 4XLPF 1YFUA 3HYIA 1FYKA 2CFXA 3RPUA 2PHLA 3QU6A 2FOKA 5ICFA 5LEKA 1CAWA 3E5XA 1T38A 3WGHA 5FPXA 2MHFA 4D7SA 5BUVA 5LLQA 1GVJA 3OV8A 4LLGF 2D40A 1EH7A 4GYIA 2CAUA 2EA4A 4XF3A 2FQPA 1SAXA 2GC3A 4KU7A 5CVUA 3K2ZA 3KLOA 5ERIA 1O3SA 5KHGA 3C3WA 5CLSA 2PA7A 4HMZA 1G3TA 3BJAA 1R5HA 2HQNA 2B8MA 3HIFA 4IRHA 3HUGA 2F4PA 1KU9A 4HBNA 3IKTA 5J7MA 1YO5C 4G9YA 4YFXF 2DU9A 5IT9Z 3TGNA 4G7OF 2Q0OA 4GO1A 3ELKA 4U0YA 1FBQA 3OGJA 4Z82A 1TQPA 1YW8A 2OYZA 2ZJ2A 3SZTA 4YRDA 2FXAA 5HDKA 1BI0A 1QY4A 1U78A 1GQGA 3O2PE 3GZ6A 2FBIA 4WZCA 2A6EF 4GYGA 5D5WB 4J1XA 2P5KA 4LTAA 1QXJA 3BB6A 3I0TA 3E6CC 1MJ9A 5BPXA 1O4TA 3ELNA 2VBYA 3GF2A 1YW9A 2IA1A 1ON2A 1LVAA 3HSEA 5TJJA 3MYXA 1R36A 3WODF 3BALA 5JVTA 4ENJA 1HKQA 4XF4A 1BN5A 1FWZA 3FXQA 3L00A 1ZREA 4M6YA 5LBQA 1T98A 3EETA 2ESNA 2Q4SA 1SD7A 2XL7A 3F23A 3H92A 1WQ2A 4HF1A 3ZQ7A 1RI7A 4IVNA 1XE8A 4KWJA 4IEYA 2ZKLA 5HVQC 4BH9A 2H09A 4EJVA 1EH8A 3DL3A 5JR3A 2QYOA 2YX4A 1K78A 2BNNA 5KBFA 1P6RA 3P9CA 1PDNC 1ZRCA 3F6VA 1YUDA 2K4JA 3DF8A 1CF7B 2YX7A 4NHJA 2IPQX 4I7HA 2QVOA 3D0JA 3TNPB 2DPUA 4RB0A 1EH6A 1RUOA 3MFKA 2YPRA 2FNAA 5FLHA 2P7VB 1WA4A 2HTJA 3SCHA 2RN7A 5CADA 3C1DA 4A2UA 2ESHA 1FNNA 4EM1A 5FB2A 5DUKA 3E5QA 2XAJA 4GXOA 2UYAA 3IIAA 1DUXC 4RB2C 1R00A 4A5NA 3H9AA 2EB7A 1O5UA 3W6JB 2VECA 5ED4A 4L2NA 4Q0VA 3V8JA 4XBFA 3IRRA 3PFIA 3I59A 1WWXA 3SFZA 2EVXA 2PEXA 2ZKZA 3KZYA 2FMYA 1FPQA 4OFGA 4ENMA 3U11A 2RDPA 3CUQB 5I93A 3NSTA 4Q0UA 3DFGA 2IRFG 3ECHA 3CJXA 4HQEA 4A0YA 2DQRA 2PFBA 4ZYEA 4L11A 1G6NA 1R23A 1ZAOA 5LGUA 2Z3YA 4KWLA 4ZYHA 3IWFA 4IRIA 4WX9A 1LDKB 4P9FA 2TDXA 4EM2A 1ZVFA 3ZMSA 3WTUC 2PYTA 5E16A 2X4HA 2PLYA 3ABTA 1Z05A 3LSTA 1TNTA 3FXRA 1X3UA 1G3SA 5AIQA 4RGRA 3T5XA 4FAGA 3TKYA 1ZX5A 3C18A 1ZLJA 5HLIA 2HWVA 1IAWA 4HAMA 4HYEA 3GFLA 2ISZA 2VN2A 3GXOA 1RZ4A 2GZWA 4XRFA 4LUMA 5CVRA 2V1DA 2RGVA 4ON0A 4DQ2A 2OD5A 3H1YA 1W7PA 1QQIA 2BEOA 1JHHA 4ZH4F 4YG2F 2ETHA 2FQ3A 1U12A 2DTRA 2IJLA 3F22A 1FI2A 4HV6A 3E6BA 4L5JA 3H8UA 3ETQA 4WXDA 1IPKA 1W7PB 4ASNA 1KQ0A 1FX7A 1ODDA 1YLLA 2R3SA 3PLQA 3KEOA 3GW2A 1U5TB 1L3LA 2WC2A 2QQBA 1OYWA 2UY8A 1DGWA 2KXLA 3WGGA 1FBUA 4BIFA 4EVIA 5D6FA 3VOEA 1Y0UA 5DUIA 2ZXJA 1Z9CA 5H6QA 3CUOA 5FLXZ 4EMSA 5E8GA 2DK8A 4XFGA 4HLYA 3FFQA 2G7UA 4L5IA 3RYKA 1BIAA 5AVPA 4P96A 3MZYA 2FSWA 2GXGA 3F8CA 2GA2A 1OKRA 2QWWA 2RKHA 2F2EA 1KYWA 4OMZA 4KIGA 3HRTA 3H3ZA 3KP4A 5HS7A 4HLTA 5TRDA 1ZGAA 5JHUA 2BYVE 4CDGA 5C8WA 3I7DA 1DPUA 3MPBA 2OA2A 1IPJA 4S05A 2D93A 2OZUA 4IEQA 1U6GA 3CUQC 3M7GA 3LAGA 4HZFA 1LEAA 3HSFA 3H7JA 4AXOA 4KNYA 1ZLKA 4LB5A 2DCTA 5LGNA 3WTZA 2XV4S 3VFZA 3J81Z 3S7IA 1Q3EA 2K27A 2KJBA 3KEQA 3HT2A 3D82A 5L3CA 3I59B 2A6HF 2XKOA 2V6CA 1TLHB 2P17A 3FMSA 1YFYA 2GAUA 3REOA 1YLFA 1I1SA 5LHHA 3ES4A 3M8FA 3MQ0A 2PQ8A 3SHFA 4B09A 1XSXA 1F1ZA 3JTHA 2W57A 2E9QA 1SFUA 2H0VA 3F6OA 4I3PA 3R0AA 3DP7A 1QO0D 3C7JA 3I71A 4IEZA 3RYPA 5F64A 4HW0A 1LEBA 3F8BA 3LQQA 4WXHA 4QMAA 4IEOA 4HN1A 2W24A 4MQVA 2DI3A 5ICGA 1IRGA 1K78B 4UXAA 2JRTA 1SMYF 3E6DA 1K7AA 1IUYA 2UYBA 1YIOA 3FZ3A 2D5FA 4UVCA 2Q30A 4B8XA 2D2WA 4OINF 2Y0OA 3ZMTA 1BIBA 3KZZA 4K8FA 4BXUA 1DPRA 5BMZA 2Z99A 2LKPA 4IEUA 4EQQA 3OCPA 3KMHA 4DNCA 2V1UA 1YWKA 5L3GA 1IN8A 1FSEA 1UIJA 1S29A 4LGWA 2J5OA 2BNMA 2M8EA 4EM0B 2D1HA 4M9ZA 4ESBA 4LEJA 5ICEA 5HLGA 2CW0F 5IT9K 2XLFA 4EJUA 3J80Z 2NNYA 2D45A 2E1CA 5BPIA 4S04A 2XLGA 4KFCA 1B9MA 3WW2A 2DFIA 4QX5A 1Z6TA 4EWAA 2IW5A 4HVQA 3KCCA 1ZYRF 2M30A 4XF9A 4MHGA 4O9EA 4UUVA 5D4RA 2LF8A 3KP7A 2EFQA 2QQ9A 1J1LA 4KWKA 3FXUA 3BPXA 4HX8A 2DBBA 3BWGA 4IRGA 4CGZA 1XSDA 4ZYGA 1PP8F 3MAJA 4GGGA 2JSCA 2XAQA 3EBRA 1TQIA 3GEZA 4KIFA 4AVPA 1RIOH 2EA7A 1YFWA 3RKYA 1Z1DA 2YU3A 4BAYA 3CO6C 2DAOA 4N0BA 2DQLA 3Q5FA 3WU0A 2EK5A 1YQAA 2M45A 1LRHA 5I0SA 2L54A 3GBFA 3ZN0A 1MDMB 4CO8A 2WWYA 4HX4A 1UFMA 4Q48A 5E1ZB 3GZ5A 2A07F 4RAYA 2XROA 4A6DA 5HDNA 5E17F 2BNOA 2OQRA 4JK1X 1ZZ9A 1G3YA 5I8SA 2ADUA 1YW7A 3QPHA 2VPVA 3LA3A 4NVPA 4L9JA 1IXCA 1Z91A 4HQMA 3U9GA 4ORFA 3LA2A 1JHFA 3GX4X 3ZP5A 3RPQA 1BI1A 1D5VA 5E1XA 2OZJA 2R7DA 2H6BA 3SCGA 5DD8A 3D5LA 3NRVA 2IXHA 3DPLC 1XD7A 1JGSA 2STTA 4UHTA 3WGIA 2PFWA 5D5UB 1BC8C 2XVCA 5L3EA 1HSJA 1USTA 4U7DA 4KICA 1T6SA 4EJWA 4E2QA 5KHKA 4RB1A 3U1DA 1R58A 3HRUA 1O57A 1DZRA 2IXIA 3K69A 2EJRA 1XGNA 3JSPA 1FBSA 2O1QA 1P92A 4WCGA 4MUVA 5E1RA 1UB9A 4ZZDA 4LA3A 1Q1HA 1LKNA 3QRFF 4GCVA 3BDDA 4LLLA 4KT5C 2ACJA 4ESFA 2CV6A 4LJZF 1DP7P 5KHIA 2UY9A 3RNSA 4HX7A 2E7XA 3CTAA 3OD0A 3SCFA 1S8NA 2FBKA 1VP6A 1BI3A 4U88A 2PJPA 2FBHA 2STWA 2FE3A 3CO7C 4EGYA 4ENKA 1HKTA 4X6RB 3IRQA 1S7AA 3ML6A 3I53A 2VC1A 4XF1A 5KHHA 3TDZC 3SXYA 1MJBA 3NQOA 4LG0B 5D5XB 3JW4A 4LK0F 1JE8A 1RC6A 1RUNA 1Q43A 4BYYA 4UNOA 2EAAA 1KU7A 1B4AA 2EFWA 2F5EA 4XF0A 3NW4A 1XMAA 4GULA 4HBLA 3WW1A 3NEUA 1UIKA 1J2XA 1YS6A 2QDRA 3L2HA 3R0JA 3U10A 1ZRFA 4EWDA 2MNGA 4G7ZF 4M9SA 4XFCA 1BM9A 4HOBA 2OBPA 4OLLA 2IT0A 5A2QZ 3LWFA 1FP1D 1FSHA 4YFKF 1V3FA 3AAFA 4KIBA 1XSVA 1J3QA 2D1VA 3KSCA 2XL9A 3MZHA 5K5QA 5IT3A 1UHWA 3DQVC 4M74A 2KIUA 3EQEA 3HRSA 3EHKA 3VODA 2HOEA 1GXQA 1WI9A 2MD5A 5BS6A 1KA8A 2O61A 1F9NA 4LFUA 5DDGA 3V8LA 1J75A 2G9WA 4UXNA 3RYRA 4MGKE 2UWMA 3J7AO 3BJ6A 2ZMEA 1HQCA 2BE5F 2GXBA 4HDVA 2Y75A 4Q0PA 1FLIA 4JQFA 1LDDA 3K1MA 2GC0A 3EJKA 1H9GA 4META 3UKNA 4L9VA 4PIXA 3IBMA 3P7NA 3FF5A 1NE6A 1DDNA 2OQGA 5FDBA 3ZN1A 3M3IA 3FZVA 1V4RA 3RDIA 3MDPA 3TOAA 5JSPA 2CQKA 5AONA 3HTSB 2UZKA 5FLIA 4U7BA 1NE4A 2K02A 1OYIA 1U3EM 1FY7A 3T8RA 1WKMA 2VT2A 3UKTA 3WTYC 2NS0A 3UKVA 5FQ0A 4LLOA 2FNPA 2XIGA 3JTGA 3DN7A 4XFBA 4UBHA 2Z5UA 4MGYE 1YYVA 5D5VB 2XAFA 2EV5A 4IESA 4BHPA 1SD5A 4LMYA 1JXSA 4ZYDA 4B29A 1KYZA 1LJ9A 4H0EA 1HW1A 1OYYA 2VC0A 1TW3A 1W7PD 4L9NA 2MLKA 4IEVA 2LNBA 2H94A 3O14A 1Q5OA 4L0ZB 1KU3A 4HSLA 2I45A 1D8JA 2H27A 1P4AA 1D3YA 3B02A 2DT5A 3FWEA 5C6CA 3TO7A 3S0MA 3ABUA 4G6QA 2HEOA 2M1BA 4RAZA 1YFHA 4EV0A 1CAVB 3EYYA 1I6XA 2KKOA 4MQ9F 1MKMA 2Y0MA 5FO5A 4FX4A 4OMYA 5I0RA 4RD7A 3PNAA 4AVBA 4G94A 1IZ1A 3G7DA 2E7WA 1NYWA 2E1NA 4I0AA 4HN0A 4KMUX 1Z7UA 4MEXF 2KIMA 1FC3A 3P9IA 5LRSA 3WE3A 3LQRA 3L2CA 5FPZA 2ELHA 1J5YA 4IF4A 1WSUA 4RS8A 2GC2A 2OZ6A 1NHAA 1UHMA 2JT1A 4IEWA 5FFZA 1IRFA 2GU9A
chains in the Genus database with same CATH superfamily
3S14J 1A6CA 4NQWB 4R4ZA 3OS2A 3HRMA 1H2MA 4ETSA 4YW3A 1YYNA 1BBT1 1MZEA 3V56A 4IETA 3HQRA 1Y56A 3PO3J 2R7QA 3A0HC 1YQCA 1WMDA 3CCEI 4U87A 1RUC3 3BPZA 3D5RC 1PVXA 2VKHA 1EPWA 2JUCA 2A6ZA 2QQOA 4N4OB 1MBEA 3IUOA 1V9U3 1S0GA 1X9TA 3QYFA 1NA1B 3ZDVA 5FYIA 4BQYA 1O7FA 5FY5A 4QHZA 1JKOC 5IFTA 2Y0IA 1VQ7I 1IN7A 2YFUA 2WFPA 4Y1UA 3AXDA 2NNNA 3D8CA 5FQ0B 3VKLA 1V9U2 2WL1A 1KFUL 3L09A 3EO6A 1DIWA 1WPKA 4CYDA 3AVRA 2ET7A 4XE9A 3GUDA 1Y4WA 2FDGA 2JN6A 3H8RA 3OBTA 1UY3A 5L3DA 3FHZA 4KMFA 2A69F 5A7NA 1Y8RB 1UD1A 4RAFA 3OGGA 3VBOC 4ZZLA 1OHFA 4RM3A 3QH6A 3AP4A 2W4SA 3HZJA 4JP0A 1WKYA 4GH4C 3F3XA 1AHDP 4GZ9A 2HXIA 2DYCA 4RR3B 2FZ1A 4JKKA 2W82A 1F5FA 2VOOA 1B09A 3ME2A 2PI0A 1MVEA 4D0QA 5FJKA 2GC1A 3KP3A 3UK9A 1F36A 4R1HA 4D6QA 2X1CA 5BNOC 2XB6C 2P6CA 1CF7A 9ANTA 4HG2A 5B4NA 2CG4A 2WS92 2HWC1 4Q5OA 1F4KA 1IW7F 4CDXB 3BR2A 4AYBN 1WW6A 1BJAA 3C3VA 1U8RA 1UMZA 2YYOA 3CF5F 3V8KA 4ONUA 1XB4A 1H2LA 4UBGA 3PUFA 4IXAA 5A3MA 2K9ZA 2H1KA 1SC7A 1TW2A 1UYXA 1UXZA 4ZU4A 2R30A 1S6LA 4MLOA 3TBIA 2CW8A 3F72A 1K42A 3ESWB 5F6KA 1LOFA 1NK3P 1NLQA 5FRMA 3MGUA 3BTYA 2DN0A 2L01A 1Z6RA 2EFOA 2K85A 1S2BA 2DWRA 4IHSA 4R4XA 4RLFA 5JI7A 3PNTA 4YVSB 5FYYA 1XG1A 3ERMA 5J8CA 2VW1A 4IV1C 1YFXA 2RS32 5IOYA 1R1VA 3ISPA 3VBFC 2VB6A 1C8M1 4YSFA 2O9LA 4CP1A 4EATA 1HDKA 4QPIC 3NNJA 3LMMA 4LBJA 1FOKA 2EIGA 2KFDA 2CAVA 4Y52J 3VGIA 3VDDA 2Q0AA 2VMGA 5EG0A 3H0OA 4ESJA 3V4GA 1RKWA 2AREA 3A21A 2F5DA 3JRGA 1X9PA 2H6CA 1QBJA 2ERFA 3GFIA 2HWF3 1AR61 1C8M3 4PJJA 1X1AA 3BOQA 4JRLA 5IVJA 1YQ5A 1W36D 1V5EA 3BUCA 3V42A 2MPFA 3S5QA 3N97A 3KEYA 3N7JA 1DGRM 2YB7A 4M9XA 2WZR3 1S1AA 2BOJA 3O8HA 1OOPB 3JBG2 2VTFA 1KZHA 1Y3TA 1DGWY 1XPWA 2YU1A 2K2SA 4B3AA 1T2KA 1RUH2 4BU2A 2KIFA 2MH2A 1J3RA 1H8TB 4DY3A 2VQHA 2R7VA 1N1YA 2Q8DA 3WOGA 4RGXA 3CLQA 1X33A 1D0XA 1YX3A 1EA3A 1IN4A 1ITYA 4XDQA 4Y1ZA 3KHCA 3W6KB 1SZBA 4GD4A 2BGOA 2GWRA 2ATFA 2PN6A 4BQWA 1YJNI 3UESA 3QD6A 1X1PA 1U5XA 3FUQA 5K0UB 3FXKA 3SZGA 4MG2A 4UW6A 3MW2A 2V9VA 2VZVA 1IQAA 3BKZA 5D21A 3JREA 1UF2C 5HNHA 2YSRA 3CZ6A 4E7LA 1I3QJ 3ES1A 3HOSA 2IGNA 2VBZA 2JXAA 3DEUA 3WDYA 4MZUA 4FO9A 4U0VA 4JGYB 1J09A 2LY2A 2RQPA 2MEV3 1KDMA 3G6EI 3PUQA 3NNGA 3MMYB 2KP6A 3VHNA 1R1A1 3T0YA 2K4BA 2DO7A 4HA8A 1HA8A 1QPIA 4XZPA 2X85A 2BVVA 1B6AA 3HSRA 2XR4A 4IHTA 3M4FA 4MHUA 4DEVA 1Z78A 2FHRA 5HS8A 3JR9A 2E1OA 3HOVJ 1R7JA 3C7HA 4MHRA 5JOWA 1QOOA 1ZBE2 1G59A 2XF5A 5FLXK 3INAA 4XSZF 4NC7A 2CSOA 4F52A 4NAOA 4A41A 4C91A 1OLRA 1BEV1 1VQKI 4IHVA 3C7FA 2DMTA 1DYKA 2GXAA 1V6MA 1VBA3 4HFSA 1I3HA 2F48A 2NAZA 4UF0B 1REEA 1S3JA 3WDUA 4PJNA 1OH3A 4QX1A 2M87A 3TO9A 2HYXA 3TOBA 1GZ9A 4Q4V3 5EZHA 1GMMA 2ZHLA 3VD7A 1LCLA 3RZLA 3POSA 2P1BA 1AL22 3VHRA 4D6SA 2K7LA 1VRH3 1PM4A 2QQKA 4SLIA 2LBFB 4K6BA 1SD6A 2RS51 4R52A 2IC1A 4UYBA 2ZGSA 1WH5A 2JQ7A 1PO22 4KJZA 4WM7C 4LKFA 4CCJA 2BY2A 3M70A 1OFNA 2JVHA 5J1YA 2W39A 1HLVA 1PZ7A 2VXDA 5C7GA 4L9BA 2NRAC 4Z2AA 4ET7A 1BKZA 2DA7A 2WBKA 5C3OA 4AQSA 3C2UA 1I5ZA 1FTZA 4F92B 2GNMA 2HQRA 5FOBB 4FISA 4DJAA 4HG6B 3LSJA 5EWSA 1U5IA 2VTXJ 5CKMA 1AWCA 3I4MJ 4YVSA 1X8MA 1HKSA 1OLTA 1WJEA 1AU7A 3S1QJ 1E17A 4A5MA 3HN3A 5L3BA 1OSGA 3R4KA 2XWBB 2MG4A 3RTRA 2VE9A 5ABJA 1O3TA 3W2AA 2Y69H 1XGSA 2HWE2 4FHTA 3G1MA 5JWPA 2CGNA 2DA4A 3GBWA 4BJTA 4RMNA 3OYEA 2RS53 1ULYA 2CHHA 3IDCB 3VB2A 4QM9A 5CFCB 3S5AA 1T95A 3J4UH 3RI9A 1FOD1 2LRDA 1USSA 4WVMB 1JUHA 4CP2A 5D6EA 2Q2EA 2Y6FA 4NROA 3ST7A 1CVNA 4RYDA 2PG4A 4DMIA 2R7SA 4LHLA 2WY8Q 2IXKA 1LU1A 1A6IA 1P2FA 1OF4A 3GBGA 2E34A 3JU9A 4EJOA 4FPFA 3K9TA 3C7GA 2DCJA 1OI6A 1RL3A 5K9YA 2KT0A 4XKWA 3T2OA 2RDNA 2O6GE 5CNAA 4XJAA 2W87A 1UHSA 1D0YA 2CRGA 5FKNA 4LHKA 3CHXA 1HJFA 3NJZA 1X82A 2AUYA 4BDVB 2JPCA 5HOOA 1D7PM 2XHKA 4CVUA 5C70A 1TZOA 2P37A 4Z2YA 1TG7A 2QJVA 5LY1A 2M2EA 3FLTA 3L2WA 4PGGA 4AWDA 5J98B 3P3NA 2EQRA 2ELKA 1ODMA 1Z21A 4FPLA 2R073 1FPN3 2PMZN 2W7NA 3K3NA 4AG4A 3FM5A 3RIRA 5JOZA 2ZFWA 4L92A 3OBRA 3OBZA 1SEFA 2B0LA 1C8NA 2YBPA 3GFMA 2YR2A 2W0XA 3D1NI 3DBRB 3HHGA 1EV13 1WD4A 3APBA 1EYBA 2WNUC 1HV1A 1GR3A 1ZARA 3ULQB 4P9XA 2JUGA 1FIPA 2JE9A 3ZX7A 2GALA 1DU3D 1YHFA 2L9LA 4WWCA 3WQ7A 1XSQA 2F4IA 5GTIC 3OYAA 3RQ0A 2EWNA 3VBOA 2VUDA 1BQPA 3F2ZA 1OKQA 6PAXA 3NJVA 1HRI1 1UG2A 3KHBA 4WK8F 5H9RA 1HJGA 4BPZA 4NQWA 5B4XA 4QQHA 2QNKA 3BG6A 2L9SA 1AR63 3LAJA 5BNPB 4FTEA 5FZBA 5DPNA 1FTTA 1AR72 4CXXA 3SDBA 3FHNA 2XBO2 2QQNA 2JE8A 4ISQA 5L9VA 2DT7B 3SH5A 2CH0A 1KDKA 4N7UA 4Y17A 3CMGA 2NP0A 3SJMA 4G8XA 4A12A 4W1UA 4QXCA 3RZZA 4AVCA 1O4ZA 4Y22A 4QB6A 2VBWA 5AC91 4YM3A 1YG2A 4NPLA 3DPRA 4Z07A 3ABLH 5CKQA 1E3OC 2HEYF 2DBNA 4IGQA 4Q0SA 1YS7A 2LKSA 3WCSA 1ZHFA 3POGA 2JD4A 2E6VA 4Y13A 5AVAA 5H20A 4QQ2A 2R7UA 1W39A 1ZBA1 2OUJA 2HWB2 1SPPA 3QU3A 1WGPA 5GADJ 3VBSC 1Z0XA 1JI6A 2R49A 4L0YB 2A6TA 3M9AA 5IWFA 2DOFA 4RGAA 1BOAA 1WCKA 2W1WA 4YFZA 4UFLA 2RMU1 5HV4A 5LATA 4GFBA 3PURA 2FOWA 3K70D 5FZFA 2QUFA 3NKGA 2ZGPA 3MCZA 2TEPA 4DOUA 3KGLA 3IAPA 4BQ2A 2XUMA 1GVDA 1O7LA 1XMKA 2JB4A 1GOGA 2B9UA 1P4XA 4ZC3A 1CZVA 3MEPA 1K5MC 4XACA 4IJAA 2GNBA 1FV2A 4I0WB 4OI1A 3WHUA 3JRDA 2HKXA 2ETEA 2VZSA 1XJAA 2V7FA 1QF3A 1YIFA 3F8FA 4OHWA 1NKGA 5FO9B 4R8HA 1VLNA 1VBE2 2EH3A 3GYDA 1K5JA 2VVEA 2XLAA 1PVC1 1LR5A 2DU0A 2BGCA 2QCOA 2M4GA 1UQXA 5HLHA 3LFKA 3ZFFA 1D0HA 4FPKA 1GZCA 5JUVA 2O0OA 2DMQA 4RA0A 3BG5A 1SBEA 4XNFA 4E4SA 4YGBA 2AXLA 2WO1A 1OFSA 1O3RA 1D2SA 5JVGF 1NCRB 3S7EA 4CTEA 4QPQA 2FEZA 2RG4A 4PIYA 3UGGA 5BNGA 4BQOA 1H9TA 2WB1N 4AVTA 3KP2A 1ZH5A 3LSHA 4AGVA 3WDXA 4CU6A 2PAMA 1RGSA 1ZG3A 1ZZ8A 3PFYA 4LBQA 5KNLA 4XL9A 1UOGA 4S2FA 4XW3A 1NQDA 3T1MA 3SEQA 4Y5Z0 4YM1A 3ZMUA 1BC7C 4RGUA 2XHNA 4YGEA 4ZTJA 1IG7A 4Y22B 1QDOA 4CCDA 2HR3A 3U1XA 5IVVA 1VBB3 3HOYJ 1RETA 2CV2A 5T52A 1PUEE 2HNHA 4UVBA 2O0YA 2J1EA 4QM8A 3BU0A 1N78A 1Q8SA 3ZKYA 4PSWA 3H50A 1B35B 4OIRF 4IQJA 4XLAA 1YJ9I 2EIDA 5J8FA 2OPKA 2UXNA 2BQPA 2L4MA 1XYNA 1W0TA 3GWZA 1AR92 2EFPA 4AIKA 1VBB1 3P3PA 1JS9A 4OCTA 4CICA 3HEFA 3LDRA 4IXLA 1W03A 4XLPF 1YFUA 4WZFA 2CFXA 3LCPA 4W50A 3E5XA 5FZOA 3WGHA 4AOCA 1TL8A 2BHZA 1DYOA 1GVJA 3IM0A 2D40A 1EH7A 3ZLIA 1MBHA 4QB2A 3WUCA 4UFKA 2EA4A 2C4XA 1H8TA 2FQPA 4FPHA 4LOCA 2VJ5A 3MBWA 1O3SA 4LOTA 5EJ1B 5EJZB 3TMOA 2HQNA 3WV6A 3G1LA 2B8MA 4XUPA 2VZ3A 2GOMA 4KQ7A 4HT1T 4LJHA 4HBNA 3IKTA 3AYAA 1DQ0A 2DVFA 5J4VA 1US3A 1GP5A 5IT9Z 2RNGA 3MLLA 4GO1A 3ELKA 2ZABA 3SZTA 5BYNA 4WV8A 4RGGA 1SFOJ 1ENXA 2VLAA 1IS6A 2WB1A 2GP5A 1NH3A 5F6LB 1S9HA 4HPKB 1NCQA 5E79C 1H30A 3AMHA 3CCUI 4OQ8A 4XRMA 3J7MA 2P5KA 1AYN2 4GMP1 4WVMA 3BB6A 1W2TA 2CUEA 4QKDA 1MJ9A 4XR6A 3HMYA 2OUMA 1Q1VA 3ELNA 1UYYA 1COV3 5GLWA 3AL0C 5C5UA 5TJJA 2QEXI 1JUPA 1R36A 3K51A 4YGDA 4ENJA 2VVFA 1HKQA 2QDNA 2D44A 1ULCA 2R4GA 3E7LA 2ZS6B 1BN5A 1FWZA 2WSUA 2A5WA 1H6YA 3FFZA 5DZEA 4Q4Y1 2VBDA 3CDZB 3S17J 1UYPA 2DTYA 2CTVA 3U1KA 4HANA 1DCSA 2QE3A 3HGGA 5C33A 4HRIA 1WQ2A 1V54H 2EIBA 2ARXA 4AK3A 4IVNA 2VIXA 3JRAA 1R083 3DL3A 2GDFA 1POQA 5CPRB 1K78A 2DTWA 1R091 5FZIA 1UKRA 1P6RA 1PDNC 1N3PA 1PX3A 4NWWA 4NHJA 4FXKB 4YPJA 1EUTA 4NC8A 2YPRA 1XPXA 2FNAA 5FLHA 4HPKA 2QTWB 1WA4A 1XE0A 3SCHA 3CMMA 1UO9A 1AX0A 2VL4A 1MBFA 4QSHA 1KXGA 2X5IC 1IS4A 4O65A 1DU0A 2X5IB 4FPOB 1RR8C 2CYFA 2PELA 4E8DA 2FDKA 5HCAA 1O5UA 4NIDA 5FMBA 3W6JB 4II2A 2VECA 3WHCA 2L0KA 1MH3A 5A7WB 3IRRA 3PFIA 1WWXA 5ACA3 4QU2A 2PEXA 5E3MA 3KCYA 1RHI1 3NSTA 2IRFG 3ECHA 1MQTA 3AKZA 3V0BA 2BBVA 3VWBA 4E7JA 4ZYEA 3BGAA 2FDJA 3CC4I 1AJKA 1YQ2A 2Z3YA 2VQLA 3UNGC 4N4NB 1ERDA 3IWFA 4IRIA 5IYDJ 4P9FA 5DUWA 1JMUB 1GQPA 5FZOB 4M3CF 2PHXA 5E16A 5KC6A 5LCWL 1Z05A 3FXRA 3PO2J 1G3SA 2YU2A 4LKDA 4LXLA 4EEFG 1IHMA 4FAGA 2XPUA 1PO13 4AHZA 3TKYA 3A1YA 1ZLJA 4HAMA 2V4JC 3GCMA 2ISZA 2EXIA 2GOXB 3DXTA 4S2HA 2WA4A 1PGL1 5EF6A 1QJY1 2M7BA 1UL9A 4KBBA 3VBSB 3TP0A 1APLC 2HEVF 1Y9GA 3H1YA 3VBHC 2BEOA 4CA9A 2FQ3A 2DTRA 3F22A 2EXJA 1MS4A 2LREA 2SBAA 4JYKA 2XUEA 1CX1A 4UB8C 1ENHA 3M4OJ 1N47A 1TMF1 1ZK8A 1WCQA 2ZHMA 2X6WA 3GW2A 4Q4W1 3WG2A 1PVC3 3I3MA 2VNGA 1E5RA 4AFDA 1OYWA 2KXLA 1QVTA 4MO7A 5F1JA 4EVIA 1Y0UA 4AFAA 5JHFA 3CUOA 2V72A 1AF9A 4LBQB 4DXSA 2G7UA 5HXMA 2VD7A 1BIAA 1WI3A 4L5EA 5AVPA 3F8CA 1OKRA 2D97A 4DIQA 2F2EA 1X4PA 4KIGA 3HRTA 4HXCA 3M2MA 1ZGAA 4I99C 4CDGA 3ZR5A 3WINE 3I7DA 1DPUA 1K4SA 3MPBA 4A6SA 2AO9A 3HKZA 1DQ6A 2OZUA 4IEQA 3TEDA 3T2PA 2VW0A 3VZJA 4U36A 1NCRA 1QEXA 3LAGA 1LULA 1WCMJ 3UV9A 5GPAA 3H7JA 2AZ5A 5LGNA 1YITI 3J81Z 1Q3EA 2DODA 2FMDA 3DECA 4XQWA 3ZPYA 1R1A2 1GV5A 5L3CA 3I59B 2V6CA 4CEYA 2P17A 5A6YA 3FMSA 2GAUA 3ZQIA 4AAPA 1OCCH 1MS8A 2F4OB 1F5JA 5A3UA 3WF0A 4WVVA 1F1ZA 2B45X 3HNMA 3VZOA 4LK7A 1LPQA 3CMYA 2W57A 4A3LJ 3S30A 1HB4A 3KV5A 3F6OA 3CBNA 1T2XA 2DCYA 3C7JA 3G71I 2BZTA 3WD5A 2Q2EB 5T5LA 5F5QA 1O8PA 3F8BA 1PJRA 3K4NA 4QMAA 2EAKA 1QU0A 2EZLA 4QX7A 4JAAA 4LBMA 3IP4B 1LECA 3VZMA 2UYBA 1YIOA 3VL9A 4H55A 3HXLA 1BZWA 2WAFA 1RUC1 4EN8B 5SV5A 3RZKA 4DUXA 2PLV3 4BXUA 5BMZA 5GTHC 3WQ0A 3KMHA 3NJXA 3KPHA 1SLIA 4DNCA 2CNAA 5CAZA 2ARBA 2RJ2A 3HJEA 1NA1A 3OSDA 4AEDA 4P5HA 3RWNA 5D8AB 4DW6A 1HQWA 2D1HA 4LEJA 5LY2A 5IT9K 3J80Z 1RUI2 2D98A 4Q2FA 4XUTA 4S04A 1ZQ3P 2JRMA 2XLGA 4M0HA 4KFCA 1UZVA 1OQDA 2D6MA 2WT2A 4CDXA 3QPSA 3KP7A 1D4VB 3BPXA 1U9NA 2DBBA 5K4LA 1XSDA 4CCCA 2NVTJ 1QJX3 3A02A 4KIFA 3UYJA 4GRIA 4B4RA 3T0BA 4QPWA 1A8DA 1WLWA 3SNMA 5GJ6A 3WY6A 5DN2A 1A6QA 1MEC3 5BNPA 3CO6C 4JGZC 4Q8KA 3E0JB 2M45A 2W48A 1DP3A 1LRHA 2JIGA 4BGDA 1PK6A 1UFMA 3VBOB 3I2JA 5FZLA 4XKVA 3HPGA 4C30A 1P7JA 5FP8A 4A6DA 2CGOA 2Z16A 5HDNA 5E17F 3VKOA 5FY4A 2ZMEC 1Q8PA 2XH6A 2YFZA 5B5EC 2E60A 3AVSA 4P00B 3QPHA 1UOBA 3U9GA 1OR7C 3LA2A 3GX4X 1W8UA 3PNVA 3VYUB 5E1XA 1YRNB 1LTEA 1RUF3 3NRVA 2IXHA 4BS9A 4P14A 5SV8A 3F95A 4UHTA 5IVYA 4XMYA 5LA0A 5D5UB 4W6XA 2XVCA 5L3EA 4XJ8A 4OHZA 2JWPA 4U7DA 1T6SA 5KHKA 4E7ZA 4HK8A 2W3JA 2Q1FA 1UG0A 1DZRA 2IXIA 3K69A 4COVA 2EJRA 1TT5B 1FBSA 1P92A 4BQ4A 4F91B 3S2DJ 2FBEA 1CN1A 4ZZDA 1RINA 3WNKA 2GNTA 3QOEA 2HWF2 5CFCC 4B4QA 5C9AB 1NY72 4YVSC 4QKBA 2OKXA 2VY0A 3ZFEB 1B8IA 1AYM1 3OD0A 3OWTA 4PDWA 4XJUA 3FKJA 3ZYPA 2STWA 1YE9A 5KXBA 1H6XA 2OPTA 2YHJA 2YS9A 5CB7A 3IRQA 4CP9B 3L2YA 3I53A 3GGLA 4XF1A 5KHHA 3SXYA 4YZ3A 5JR2A 2QUOA 4LK0F 3H5RA 4H3WA 4YZ4A 1RUNA 1Q43A 1C5HA 4B1RA 4UNOA 4AIDA 5ABJB 4H14A 4DXRA 1B4AA 2B9SA 2EFWA 2F5EA 2A3YA 1POV3 2JMWA 4GULA 5FP9A 5JLXA 2YU9J 2VMCA 4LR4A 3KV6A 3L2HA 3R0JA 3B9CA 5F5CA 4G7ZF 5JIAA 3MIFA 1W6MB 1YIJI 4XFCA 4HOBA 4QAWA 4OLLA 1ZM1A 5A2QZ 4A3FJ 1PZ9A 4L8QA 5TGTA 1FSHA 4YFKF 5CISA 1GV2A 2YBSA 1K45A 4IW3A 4XMAA 1MBGA 1NK2P 5K5QA 2DURA 2XJTA 3RI8A 2DUQA 2N8GA 3PNYA 5B1AH 1JGGA 2VJXA 4P02B 1J75A 4UXNA 3RYRA 4MGKE 3OSFA 2UWMA 2RHPA 2WS93 2A71A 3BJ6A 1HQCA 1Z7S3 4W65A 4XBLA 2GXBA 4HDVA 3T4VA 3ZR6A 2Y75A 4O7XA 1ASJ1 1FLIA 3GM8A 3P1IA 5E6HA 1RUF2 1DGLA 1H9GA 4META 3FBMA 4UW4A 5DZGA 3UKNA 3THTA 3MIBA 3K4MA 4HOOA 2D6KA 1BR2A 4U7BA 1W8HA 4XCBA 4JKMA 3QYEA 3LIHA 1FY7A 2L7FP 2VT2A 3T8RA 3HVDA 4XM3A 1H0BA 2BY3A 3KV9A 4AHWA 3PVNA 4LBOA 4M3BA 4GJYA 1G9FA 4K1ZA 2PN5A 1AA7A 4UBHA 2Z5UA 4EZHA 3J7AY 5HNFA 4HNTA 4ZYDA 3AFGA 1LJ9A 2BDRA 4XOGA 3O1RA 1TW3A 2ZC2A 2J22A 2LNBA 4NJ4A 1NY71 4CH7A 5FXVA 1KU3A 4DGWB 4HSRA 4HSLA 1JOBA 4QQPA 1G9DA 2VOWA 1MS3A 1D3YA 4PI2A 1R082 3RZOJ 4PHZA 4PBOA 1QJZA 5C6CA 3TO7A 3PMSA 3S0MA 4PT6A 3ABUA 2KM2A 4OHVA 1CAVB 3MI8A 4MQ9F 1PGW1 4FX4A 3ZSMA 2LD5A 1P7IA 3OL4A 5TSWA 4SBVA 3OYNA 2E7WA 1NYWA 2X6OA 2UWAA 5LA9A 1WW7A 5FY8A 2WNUA 1FC3A 2Q1MA 2ZHNA 1TME1 2C9KA 3WE3A 4AUXA 3L2CA 1VZ0A 5FPZA 2ELHA 3HNYM 4E7SA 3S3NA 2E2IJ 2E1MC 3BTCA 4Y20B 3CQZJ 1BHGA 2OZ6A 3RQIA 2JT1A 1QJY3 5DAXA 4IEWA 1IRFA 5K0UA 1BMV2 2HWE3 2EV6A 2HZTA 3QPTA 1G4DA 1VBB2 4V2VA 4BQAA 5DCMA 1S0DA 2RM22 4XETA 2IA0A 1SLTA 4K8RB 2AR6A 4QGMA 5FV3A 2XVLA 4MGSA 2V5YA 4Y26A 4KWUA 1FMWA 4WBBA 4F93B 2WAQN 5ACA1 5A3OA 4NOTA 4YIRX 1ONVA 4JX4A 1UY2A 4JGZA 5FAXA 5FWEA 3H0DA 2P3JA 1IV8A 2XDVA 3NAPB 2E33A 4FT8A 3C7EA 1AUYA 1X1CA 2X53S 2Z69A 2B9VA 1ND3A 1ZZ7A 4KA4A 1QDCA 4N53B 2WSVA 3CJIC 3GJAA 1ND2A 1J7KA 5L3FA 4CUGA 2A6YA 1VTNC 2VULA 5EZWA 4WVWA 5JR7B 1VJ2A 3BTZA 2MD0A 3GZAA 1TWHJ 3FLRA 3O1OA 3DU5A 4Y7NJ 3DXJF 5A32B 1U9OA 1FZPB 2JPBA 5EG0B 1FYUA 2Z1DA 4G7HF 2W85A 3EPZA 1MNDA 4AQ2A 2M34A 3RVHA 2PMWB 3R0RA 3K4LA 1FYMA 2CWEA 1SLBA 2ZPXA 4Q4V2 5FMDA 1LU2A 2D3PA 5DG1A 2IA2A 4P9YA 1CPNA 2ZGKA 3IKVA 2HDWA 4NO4A 5A33B 4KN4X 4B7KA 4RGSA 2NVQJ 3RI4A 5GKAC 3DF0A 1OA2A 2EXKA 1XGMA 2FRHA 2PTMA 3QACA 3KS7A 5IUQA 3RKXA 3N9QA 2XXZA 5J40A 2R5ZB 1H1AA 2ZX4A 2RNJA 4ENNA 1FMD1 4Q4ZF 1LOBA 1ONAA 3IDAA 4CZSA 2CWMA 4NHMA 3EQLF 5GM0A 2DXIA 1DYPA 2VZTA 2Q8KA 3KGZA 4XMIA 2BJSA 3TQNA 4XXAA 4RQPB 1OD3A 4AU7A 3WTTC 2LROA 3GTMJ 4X6QB 1HB1A 1NOVA 4O61A 3AFHA 3VD9A 2VUJA 1B9NA 2XAGA 1LNSA 4XVHA 1QGPA 4WM8A 2AS5F 4DB5A 4I09A 5FK8A 3PM1A 5FIXA 5BY5A 4QXBA 2RDSA 4ZS2A 2HI3A 3O1VA 1GZWA 1IDYA 2GQQA 3DKXA 2BOIA 3S93A 4MH0E 2WIIB 1RB8G 2K0GA 4HVOA 1EF4A 3F8MA 2B42B 3G6JB 1CAUB 2P6TA 4NR1A 3MIGA 5E20A 3MF9A 3SZPA 1D4M2 1XOYA 2QA4I 2O14A 2AYHA 3DEEA 3BOWA 4QX0A 1UW8A 4G9SB 5H6RA 3KYDB 3H8XA 5ICCA 1IXRC 3W3CA 2VMEA 3OPZA 4XIDA 2ZNYA 3WNNA 4YZ1A 1LDJA 4ASMB 5DAWA 3HD8B 5A70A 5FRNA 5FREA 4V19K 3CIHA 3PUAA 5FGMA 2C0ZA 5C9AC 5IYBJ 1KGSA 2DJNA 2RR11 1JI8A 1HW5A 4QLCU 1RUD1 3C8XA 4IKFA 2GA1A 4A0XA 4KDPA 1PO11 2RMU3 4LULA 3WEZA 4XFAA 3BTIA 3L9FA 5A2QK 3BOPA 2PMHA 1SG3A 4Y4RA 1LFUP 1JTYA 3OD4A 5BXXA 4KI5M 3GTQJ 1UCRA 3QP6A 2V6EA 3W21A 2KIQA 4MGIE 2ECCA 4K21A 3VKNA 5JFRA 5FP7A 3USSA 2J1RA 4QXKA 5HXVA 3K4ZA 2E71A 2CYYA 5JXIA 3ASIA 4DS0A 4NB5A 3MEXA 4KL1A 2HWB3 1B72A 3U0ZA 1ETXA 1AOYA 3ACGA 5FPAA 2XAHA 1GANA 1IXSB 2KRFA 1GQHA 1W5SA 4GJZA 1MBJA 4OAYA 4Q0QA 1JHJA 1S7OA 3F8NA 4HDUA 4ES8A 4AIHA 3V0AB 2ZGQA 1QWRA 3FMRA 1RUG1 4BA6A 4C3IJ 2P5BA 3WNPA 5CZKA 3LWCA 1IJWC 4I76A 1GNHA 3PMEA 4N43A 3ERED 3WW3A 2LFBA 3HNBM 3FISA 3LPGA 3RWKX 1X4OA 1WZ2A 1KQ9A 2ZO4A 4X0GA 4PLNA 5JSOA 1H1MA 3MKZA 4OI0A 3OYBA 5FY9A 2JSPA 1R64A 4IERA 2ZJCA 5FYZA 1AR62 4E27A 1XN7A 1BXHA 2XJSA 4LITA 3WNMA 2O8QA 3DV8A 4Q27A 2B5HA 5HLTA 2LRPA 1RR7A 4K2EA 5C8CA 1MACA 4EE2A 1GSLA 3NV3A 3JQWA 2QBYA 3MUZ1 5HCHA 2QM3A 2J1UA 3OY9A 3ZMZA 5BNNC 3Q9VA 2HOTA 2J7MA 3EUHC 5E3LA 3PUBA 1AR81 2BFUL 1VQ8I 2QQWA 5FOJB 4M73A 2QF7A 2DUPA 5A3NA 2IVMA 1RUG2 4E7IA 1G8XA 1YNAA 1UZZA 2V1XA 1JT6A 1W9FA 4GMP3 2AGSA 3MW3A 2IFRA 4YNIA 1K3IA 2R7OA 3LIGA 1FPN2 5C3RA 4FPYA 2ZNZA 5JCTA 3JZVA 1JH5A 3ZDSA 4IE7A 1C0WA 2G7HA 3G3ZA 1V6OA 2OW4A 4LBLA 4QDSA 1MIJA 1APNA 2M9HA 1Z77A 2BERA 5CQGA 2P4EA 4AAXA 3CD6I 3LSPA 2K40A 1V6NA 1HRI2 5EGOB 2GH2A 1OXCA 4B43A 5A7SA 3BZ6A 5HDGA 5KHDA 2L4AA 4ZU5A 1G9AA 3VBFB 3HAGA 4YM0A 2R0HA 4BJ6C 4K20A 3U4SA 2ZTNA 3KFWX 2VOPA 2OQ7A 2P5LC 4E70A 2WFF2 3POWA 1H0MA 4M0NA 2J1AA 1JUMA 2ZCWA 1UZYA 3OYJA 2VJJA 1AYN1 2AEYA 2R7FA 2ZGNA 2CY6A 1O8SA 3VSLA 5CBLA 2RE9A 4YG3A 4HKWA 3BR6A 2ILMA 1RUI3 2HVRA 2RS52 4LKEA 5A7QA 3N7LA 1ZR4A 1QQP1 5JZGA 2AXTC 3LA7A 3PVOA 4A3KJ 1CAXB 4JV4A 3AB0A 2GM4A 3QPLA 1HXDA 5KCMA 3LNQA 3OYLA 5FK7A 4Q4X1 2OJED 3TDUC 3ZXEA 1JODA 2DA3A 1HDPA 1RUF1 3LOCA 3HOWJ 1QH7A 3VD3A 3S3OA 1A31A 1QU3A 1WJDA 4II3A 4WF2A 1LB2A 1N25A 4J19A 1H89C 1W4MA 3TBDA 3TNQA 1WBFA 1SFXA 3HM5A 3HQXA 1LNWA 2R7ZJ 3V7SA 4WVZA 2ZBJA 1CIYA 1EPZA 1HBXG 1QZYA 2L02A 2ZMLA 3PHMA 4AI1A 4URTA 3ABMH 4OOIA 3AP6A 2XGXA 3GO5A 3WHTA 3IDBB 2ZEXA 4KN7X 2PQQA 4PJYA 4CXFA 2D3RA 5EHDA 4DINB 4A93J 5KAIC 3T8TA 4NUBA 2GIVA 1IGOA 4M00A 2ME6A 2H0BA 1JYCA 2WAQA 1BLZA 2XQRA 4I01A 1DZQA 2FD8A 3IH3A 3VHOA 2COMA 2R042 1C4RA 5F39A 1WMXA 1B35C 3KF3A 5JAXA 2X1EA 3LEMA 5KWRA 3GFJA 4HEA2 2XPJA 1LOFC 5C4WB 3H3UA 2NMNA 1OPMA 3JB4C 3R6SA 2LF7A 3NNMA 4GIQA 4CU7A 3KE2A 4OIQF 4AIJA 2JDNA 3AMMA 3N9MA 4IHWA 3VD4A 2LKXA 4DUWA 3DPTA 2R071 3H1CA 5DV5A 5IAVA 2F5CA 1MZ5A 2AQFA 4LQRA 5DYMA 1R1TA 3USUA 2XBO1 5KC5A 4JX0A 2Y64A 4YM2A 2F5VA 3R60A 3CL1A 1GT0C 2DOEA 1R22A 3HG9A 3WXPA 4B7EA 1KS5A 2HWD3 3WG3A 3AKTA 1IDZA 2JIJA 2AQEA 1QRYA 3J26N 4NHKA 3M8EA 4GKYA 2CUJA 3MV11 4P55A 3BP8A 3CCMI 4AVAA 2VASA 1MD0A 1K79A 2QQLA 2QKDA 3JCIA 1D4M1 3GDBA 3AMNA 1D0GA 4EZ4A 4PJMA 3AZWA 1T33A 3MZ8A 2DVBA 5DS9A 1XSRA 3PIJA 3OTFA 5FXZA 3BJOA 4IV3C 3S15J 5GAHJ 1AR73 1DZTA 3BT9A 4HKOA 4XUOA 4Q4X3 1SFNA 1VQPI 3FMQA 4KYWA 3FXJA 2LK2A 2Y6KA 1PP7U 1ETYA 2X09A 2IAIA 4NAMA 2BFUS 5FJ8J 2ZJRF 3OSGA 2JA7J 2R6QA 4W6YA 3KT4A 5A33A 3A01A 1Z7S2 1VQ4I 2HXOA 2DDAA 3I2IA 5IK4A 5LW9A 5FROA 1XDSA 1XYOA 2WLPA 2ZX2A 5DAVA 3N36A 2M0CA 5K5RA 4C3JJ 2LTPA 4AZZA 3ZCOA 3VYRB 2OF7A 4MXWA 1BW6A 3IKWA 1OUSA 2NYYA 3FE5A 3U14A 4CU9A 3OOPA 2BZDA 2A73B 4O3MA 4F8AA 1S0CA 1C3HA 3LAPA 5FYSA 4XLNF 2A61A 2F5FA 4JTOA 3Q9SA 1PGSA 4AE2A 3IH4A 2A70A 3HQUA 1K6YA 4P5OA 4D7TA 2VJ4A 2WYFA 1KITA 2VR4A 1V70A 5I0TA 3OIPA 3SC7X 1ETWA 5LBEA 4LPLA 3N35A 5E8IA 2A6VA 3COAC 5LRRA 4L18B 4P9JA 1FMVA 1YRNA 4G3YC 4V2FA 2XKPA 1UELB 2VPLA 4DBQA 1TTYA 1LEDA 4UFHA 2L5QA 1U0JA 4QX2A 4HVRA 4UFJA 2K3PA 1W9WA 4XJZA 2XGCA 5A7PA 3BN6A 4I02A 2VCMA 1BYHA 2XWJB 4QPGA 3M3QA 1NAEA 1RNLA 4KMQA 3MD2A 4GH4B 1RUC2 3HDDA 1JYVA 4N43B 1XRUA 5IHRA 3ROUA 1S55A 5DQ0A 3AX4A 1XU2A 4AWXB 5F3EA 4QDQA 1WBLA 1P4WA 1FP2A 5BNOB 4B47A 4AW7A 1W0OA 3A22A 3AKRA 3WP5A 1UAAA 2VNVA 2A5YB 2JDZA 4YFNF 5BOXA 2F4MB 5I91A 1XGOA 1BBYA 2OPWA 3WG7H 2WNUB 1XQNA 5H2FC 2HTSA 3VBSA 4MTDA 3J9SA 4BXXJ 3PQKA 3ZQGA 1ULEA 2R7TA 4HLXA 4KT6A 2UXXA 2Q5TA 2YGMA 1W6QA 4IUGA 3HYIA 5EPAA 3KF5A 2HOSA 3VDDC 2BWAA 4A3BJ 1LJ7A 5ICFA 2DFBA 1CAWA 1TMF2 2PMZA 1YXWA 5F04A 3I3DA 3ZIXA 1HV0A 4D7SA 1RVF3 2JJ7A 4LLGF 1SCRA 2BRTA 2VMIA 3BTAA 3K4CA 3BTXA 4GYIA 2D6PA 2HVQA 5EP9A 1IG3A 5GP9A 4D5FA 3CJQB 1W90A 5CVUA 3KV4A 3K2ZA 2WY7Q 5ERIA 1Q8VA 5I0DA 1OCOH 5BNNA 3C3WA 3BJAA 1GYKA 3ALQA 1OQEA 2ZXWH 3JRFA 2VVDA 4YFWA 5A7WA 1YO5C 4G9YA 3W59A 2Q0OA 1AHSA 4U0YA 3OGJA 4DFSA 4Z82A 1TQPA 1YW8A 3VBRB 3NARA 1U5YA 1U78A 2WZ8A 3O2PE 2FBIA 1QJX2 4XLHA 2LG4A 1FEXA 5T55A 4AI9A 1S0EA 2ZA9A 1JZ7A 4LTAA 3I0TA 3AKQA 4BKXA 1GLHA 1SANA 1YOVB 3VKMA 5BPXA 1O4TA 2JG8A 2MYSA 1D2QA 2LC2A 3GZTB 4WM8B 2VBYA 3GF2A 4N7IA 1ON2A 2LVSA 3MYXA 1HXS2 2W95A 2ZACA 2BHYA 3SEEA 3BALA 1VIWB 3BQZA 4IO9F 1A36A 5G04L 3LPFA 2DA5A 4YW1A 5KR7A 2DF7A 5JZGB 4IOCF 5C3PA 1ORKA 1BVP1 2ZX0A 4IQ4A 4CEWC 1W6MA 5LBQA 1TWAJ 1T98A 2EBIA 3EETA 2ESNA 3K70C 4BJ0A 3GTGJ 3F23A 2EILH 2GMMA 3OYIA 4HF1A 2Y60A 4BEHB 2R5ZA 2X51A 1RI7A 2ZGOA 1VRBA 4IGPA 4KWJA 4FETA 2ZKLA 1DF0A 4BH9A 5A1FA 1BEV3 4W6WA 1P8JA 2P34A 1JBCA 5LK5A 4DO0A 4E9KA 1EH8A 2LM3A 2Y33A 3SLIA 4LG3A 2YX4A 3ABZA 3S3MA 4KITB 5C44J 3C2GA 2VNRA 3P9CA 4FSJA 4QPIB 5EZGA 2X05A 1FX5A 4CPBA 4NRPA 4N53C 3JD72 3CJIB 1UOJA 1EH6A 3CCQI 3MFKA 4RGKA 5IP9J 2CS3A 2P7VB 2A7AA 2E32A 3DBHB 1UU6A 5FB2A 2ZAAA 4R9AA 3RMYA 3MLJA 3QCWA 2XAJA 4GXOA 4FOWA 2L9NA 2UYAA 3S57A 3W2WA 2Y34A 2BWCA 1X36A 4B4PA 4LBNA 1Z7LA 3ASOH 4A5NA 2C5DA 3H9AA 4LO8A 4BQXA 2EB7A 3PL8A 5AC92 2ARAA 3W9AA 4DYQA 3V8JA 3ZO0B 2I5UA 3DPRC 2FMYA 3CUQB 3FBYA 1S5LC 3ZXFA 2DUOA 3R4SA 3UKGA 3MFAA 3CJXA 2B39A 4XPVA 1W8ZA 4PF1A 2PFBA 2ZKNA 4FFHA 1R23A 2IUWA 2G19A 4IV3A 5CFDA 1MW7A 5FPUA 1ZVFA 2WFF1 1R71A 1TNRA 3ZMSA 4LLFA 3WTUC 3ETPA 1QJU3 1G9CA 3JQXA 5AIQA 2JX9A 4RGRA 2IXSA 2NXNB 3H36A 3U21A 1W6PA 2HWVA 1ULOA 3GFLA 2W1UA 5GAEJ 1ODNA 3LSEA 2V1DA 1JJ8C 1GUUA 2OD5A 3RSJA 1W7PA 2JA8J 2V26A 3NNLA 3OMYA 1E5IA 2IJLA 4C8DA 2WWUA 2FQ4A 3E6BA 4L5JA 2JA5J 3H8UA 3OYWB 1G9BA 3PUIA 1A8MA 2B46X 2CWSA 1IPKA 3JBG1 4ASNA 3HPNA 2RJKA 1Y8QB 3QLQA 2GNDA 3JD73 2R3SA 3N9LA 2KD7A 3KEOA 2COBA 1U5TB 2WC2A 3I55I 2YUSA 1VNDA 3DUIA 2V9PA 3K7AJ 1D5YA 2XBO3 5DUIA 2ZXJA 1Z9CA 4FE7A 5E8GA 4XFGA 2VZ1A 4OUSA 1Y43B 4D7MA 1BEV2 2FSWA 3VYTB 4UW3A 1ENRA 3CDLA 2W9XA 4CPBD 4RSUA 5JHUA 4V2GA 1DLCA 3DTEA 5C8WA 3VN4A 2W00A 1BA5A 1RPWA 1TWCJ 2IGMA 3G1OA 4BCUA 1U6GA 2ZGTA 2LW8A 1LEAA 1DP0A 1KGYA 3CCSI 1R1ZA 3OUJA 3WNXA 5L7OB 2DCTA 1ZLKA 2VBPA 3WTZA 2XV4S 3VFZA 3S7IA 1GWKA 1MS9A 2K27A 5F7UA 2MEV1 2KJBA 2ZSIB 5EDNA 5FUNA 3VKFC 1YFYA 3VZKA 1I1SA 5LHHA 3M8FA 3MQ0A 1HDDC 2PQ8A 2NOJB 3BG7A 3WF2A 1COV1 5FZ7A 1JZ3A 1C57A 3JTHA 5C5TA 5IPAA 2E9QA 4FQ4A 2H0VA 4XC9A 4I3PA 3R0AA 1UY4A 1IRXA 2NQYA 2DMPA 4AHYA 3RYPA 4HW0A 4Q4Y3 3LQQA 3ZQCA 4BXSV 4BQ1A 2D5VA 2DI3A 3DBLB 5ICGA 1T8IA 4F83A 1E3PA 1K7AA 2R0QC 4G4FA 3KZIC 2OVUA 3FZ3A 1XYPA 2D2WA 4OINF 5JI9A 1R5ID 5FKCA 2A75A 1BIBA 1JKPC 2Z99A 4IEUA 1RRJA 4EQQA 2OXBA 4E7HA 1IN8A 2P6HA 1UIJA 3ZRGA 3MW4A 4AEDB 2J5OA 2VG9A 2BNMA 4Z8BA 1LOAA 4QQOA 4EM0B 1MZFA 4COWA 5FKLA 1ALYA 4EJUA 2NNYA 5BPIA 4AQTA 4JZRA 3SDGA 2DA1A 3SH4A 2IW5A 4FTSA 2M30A 4XF9A 5D4RA 3KX2A 5T5OA 2ZZQA 1TT0A 2JG8B 3AL6A 1ULGA 1AYN3 1POGA 4IRGA 1FOXA 2RS13 2XAQA 3EBRA 2PHFA 4AVPA 2BP6A 1N75A 1IRZA 1DU6A 4A7YA 2VJIA 4DRRA 2HLEA 1LUJB 1TWFJ 1GV9A 4EJRA 2DAOA 2K3FA 2FZ2A 5L19A 2R1BA 3Q5FA 1VE0A 2EK5A 4A3ZA 5I0SA 5C3EJ 1MDMB 2WQZC 2PXJA 5E1ZB 3VL8A 4A69C 2BNOA 2OQRA 4FCAA 5DG2A 2ZGMA 2VPVA 4NVPA 4L9JA 1UZWA 2DMNA 2H1LA 5IYCJ 3FXLA 1IXCA 3B6CA 3A03A 4ORFA 2ZB9A 1W0UA 4AEMA 1BI1A 2R061 4DXTA 2R7DA 4NRQA 2A5ZA 1LESA 5J09A 1JGSA 1D0ZA 4AFCA 3VV1A 3RZDJ 1R9TJ 4GWIA 1G86A 1K5MB 1H9WA 1HSJA 1USTA 4G6TB 3IPVB 5B3SH 4ZTFA 1AR93 4RB1A 3U1DA 1YC61 1R58A 2E51A 4Z92B 4A3CJ 3LOBA 2LR8A 2YGLA 5CKTA 2O1QA 2W1SA 3T3YA 3LSDA 5L9BA 4WCGA 2L7ZA 4MUVA 4LT5A 3E1F1 5E1RA 1UB9A 1OUXA 2IS2A 4M4RA 3OYMA 1C1LA 2OX0A 1Q1HA 1LKNA 3WNOA 1GNYA 4XURA 2ACJA 5K7ZA 2JG8C 5JMOA 2UY9A 4ASLA 1VB2A 4AVVA 4HX7A 3RCOA 1Y1WJ 1AL0G 1IKPA 3J8F3 5T5PA 1HQNA 5GALA 3I2KA 3CCYA 4EGYA 1HKTA 4X6RB 3DU6A 3IN9A 4P9WA 2CMPA 3OEBA 1DDLA 3ML6A 4OWRB 5FZ6A 4UFMA 1LENA 2DFEA 5F2SA 4Y3OA 2Y9YA 3IB3A 3H3LA 1FIAA 5EYYA 1JE8A 3ZSLA 4BYYA 2EAAA 3B5LB 2D3SA 2IS4A 4IEJA 3NW4A 3MV01 2QQPA 1XMAA 3OY8B 2KMUA 3WW1A 2FJ1A 3NEUA 1GKBA 4D1QA 1UIKA 3TYJA 3E1SA 2JDYA 1HX6A 2BVLA 2OUHA 1SLAA 3LFMA 1XX5A 3RFRA 1ZRIA 4KIBA 2WINB 1XSVA 1SLLA 3KSCA 3L2QA 2XL9A 1M06G 3JBG3 4XZUG 4OMDA 5H9PA 2D6OX 5LK7B 1OJLA 2X6XA 3HRSA 3OJBA 1W04A 1GXQA 1WI9A 2MD5A 2O61A 2X5IA 4LFUA 5DDGA 4J00A 1K61A 3NO8A 3J7AO 3J7HA 1ETKA 1YIPA 3FBIB 1I5PA 1CESA 4LK6A 4ARXA 3ZYIB 3LKJA 1OLME 2HWB1 1UZCA 4RQPC 4PQ9A 2DYSH 3MIHA 3FF5A 2DFHA 2OQGA 1DDNA 3MIEA 5FDBA 3FZVA 1V4RA 2WT1A 1MQTC 2LBFA 2G9ZA 3TOAA 1DQ2A 5JSPA 3HTSB 2JDMA 2UZKA 3POJA 5B2GB 4NPMA 3AFKA 2RS31 4BLJA 5K7PA 3FHAA 3OUHA 3ZMNA 3M3YJ 2EIJH 2KZVA 1NCRC 2ZEYA 1IG0A 2FNPA 3JTGA 2HQ5A 2NVUB 4MGYE 2PJRA 1YYVA 3FL7A 5HCBA 2D6LX 2JDPA 2PQSA 4IESA 4JGZB 1JXSA 4B29A 1KYZA 1OBNA 4H0EA 2LMDA 1V6KA 2A3XA 1S0BA 1G2HA 4A44A 2E53A 2HOAA 3O14A 5FPBA 2I45A 1R4NB 5FUPA 4XONA 3IT8A 1C5IA 2RJLA 2H27A 1P4AA 3B02A 1OPOA 4B4CA 4BQNA 4AVZA 3POEA 4XBNA 4G6QA 2HEOA 2M1BA 3I97A 3EYYA 2KKOA 5F5AA 2PHUA 1MKMA 2Y0MA 1EUUA 3I2DA 2Z79A 4AVBA 3S8PA 2JDUA 1UY1A 2FD5A 4LKSA 2E1NA 4I0AA 1MZ6A 1V6LA 4YZ5A 2QZ3A 2XGDA 1Z7UA 4MEXF 4S2DA 1OQYA 4K9SA 3LQCA 3ZFEA 3OB8A 3OYFA 3TN91 3CCJI 3VYSB 2JECA 1RVF1 3WHBA 5C9AA 3A4CA 3MKWB 4IF4A 3L9JT 2ICWG 4RS8A 5FZMA 4Z2WA 1NHAA 1UHMA 5FYVA 1VI0A 2GU9A 2YG0A 1YEWA 2WADA 4U0WA 3AZZA 2QBXA 3J8F2 2QFEA 1W8NA 2Y9ZA 4AGGA 1R092 4MADA 3TW6A 2JK3A 3T1BA 3I2GA 2X8KA 2WABA 1AR91 4TTGA 4ZDOA 5L73A 1WCSA 1AR82 1DBNA 2ET1A 5CVIA 3JB8A 3OIQA 3TN93 1J59A 3WE2A 1CWPA 4XDPA 1MSFC 3SITA 3SKJE 1SD4A 1BK0A 3D0SA 3AZYA 1VBD2 3L1PA 1UOFA 3VEPA 2R7EB 1DLLA 1ZZBA 3TN92 1OPCA 2PJRB 2ZXIA 2PLV1 3RGBA 5FFXA 3ZXDA 5CYVA 4I2OA 4EJTA 1QPMA 1MEC1 5C71A 3WP3A 3SISA 2MSYA 5FMOL 2VMFA 3L7WA 4XIKA 3ZFGB 3ZN4A 1X3WB 1F43A 3C7OA 2WS91 2KZGA 1RMU3 4GKXA 3CDHA 1UPIA 2J5PA 2VU9A 5BV6A 1P9QC 1KEXA 2QCSB 1QNTA 2FA5A 1ZNPA 3FDYA 1K12A 1GWMA 5FKBA 2W46A 3SEZA 1UXXX 4ZHNA 4F55A 3WG9A 1OKOA 1S72I 1Q8OA 4LBQD 1ZZ6A 4YRVA 1O6UA 4M6XA 1WRJA 4I3GA 2YY1A 4YW4A 1G3WA 3AL0B 4GB32 4LIUA 4H7MA 4Q26A 2C6SA 3M8JA 3OUIA 4ZDPA 2EXHA 2ZX1A 4WM8C 5T3NA 3CESA 1H9PA 2MFZA 1EAH3 3FMGA 4M3CB 3CDIA 2HYGD 1NXMA 1Q8QA 2IEKA 3M3OA 2J1TA 2Y48A 3BCAA 5CKNA 1AX1A 1H4GA 2QQAA 4IDZA 2BY0A 2DT6A 5KK1A 4D0PA 3CEWA 2R92J 3DLAA 1VBE1 1ZYBA 4URAA 2I07B 1MJAA 1M1EB 3U37A 2WO2A 4QGLA 3KP5A 2MGQA 4BQ5A 4XSXF 2M8GX 4ANJA 1AL21 4OMCA 5JLWA 2JG9B 1RC9A 2X1DA 1QJEA 3ZFEC 4EN0A 3VBFA 4LE3A 1HW2A 2VBXA 5K7FA 1CX4A 1T6BX 4AM3A 2K9NA 4BJ5C 4IV1A 1NLRA 4PDWB 2F6BA 3D3AA 4E6KG 4EGZA 3HTUA 3FHQA 4PDWC 3LSRA 4AFBA 3ACFA 3MVPA 4KU8A 1XDUA 3W2VA 4RHV2 3ZFGC 2FF4A 5DTDA 3WG4A 1D1BA 4EWEA 1IS5A 3IV5A 5C3SA 3O1MA 3UJQA 2DCKA 4BK5A 4FPGA 4ZZ5A 1O59A 5FZCA 1EKEA 3O3KA 5FD6A 2E36A 1YTYA 3GF6A 1REPC 1R081 3IPVA 4IHXA 3KVBA 1XU1A 1K5MA 5FZHA 5I8TA 2OAZA 1VQOI 1OOPC 1AYM2 4QHOA 2ZZJA 3VHPA 2KL4A 1J3PA 4AD9A 4MGZE 5IW0A 3WVJA 3J7ZI 1LVKA 2V79A 1SHWB 4FTHA 2ENRA 4R79A 2I8DA 1E57A 2W25A 2PAEA 3T4HB 1A04A 5A7OA 4RM2A 3IIIA 1OQ1A 3BI3A 1PGW2 5D8LB 1ZZCA 4FOYA 3WDTA 4WM7B 3R61A 3Q8FA 5FYHA 3ZMDA 4IX7A 1PK6B 5FZ8A 1I9RA 3ZM8A 3T08A 2JENA 4FBFA 4MNUA 3CO2A 4AQ6A 2Y0SN 2HKOA 2WJSA 2FMLA 4J25A 3OIOA 5GZGA 4D7YA 4XFHA 5FZ4A 3P5JA 1TQ5A 1Q56A 2IVIB 4COUA 5C4XJ 3BTJA 4MV2A 1SFYA 2RREA 1RUD2 1W2AX 2WO7A 2PMUA 3RS6A 2Y6GA 4QIWN 4ZXKA 3N9OA 1X2NA 2CU7A 1IQDC 3LFUA 1TBXA 1V5GA 2LSOA 1H8AC 1U2WA 5J1UA 5F3IA 3QOPA 3M3CA 3FXMA 3ZVXA 5ERLA 3FIWA 3U2RA 4XCAA 4QWQA 4D69A 3CJTB 2GBYA 3HN1A 3L2UA 3LOIA 5HCFA 1FNYA 1MMNA 3JRIA 3S1NJ 2XOMA 4Y1XA 1W36C 5FLVA 2W68A 5IP7J 4ZPIA 3WTSC 3I4IA 1AKHA 3GXUA 2VQCA 4FE4A 5A1LA 1C8M2 1S2EA 3KIOA 5I0UA 1HF0A 1EV7A 1YQ6A 5BQTA 3FJSA 2WA3A 1ZN2A 4CXWA 5D4SA 1WMFA 5FYCA 5L36A 3PU8A 5DUUA 2OV7A 3HT1A 2X48A 2ME0A 4IE0A 5FCCA 2ADDA 3GYHX 3WU2C 2R7RA 2IXJA 4AEJA 3KETA 4BMBA 4YARA 4I98B 1CAUA 3ZMOA 3PVBB 1TME2 3BPSA 4XHXA 2WO3A 3KP6A 3HOBA 2ZMEB 3J80K 5FYBA 1EY2A 5LBFA 2VW2A 4O6JA 3B73A 1L0OC 4NHLA 1FOYA 1WVRA 2OT7A 1SQ4A 4JTNA 1VBA1 2GLOA 2QKLB 3I5UA 3HBKA 3JCUC 1Y1VJ 2KR2A 4PZJA 5CFCA 1PX4A 3T2QA 2VUAA 4HV5A 3K4DA 2MBFA 1JZ4A 3PQJA 3Q8BA 4MEYF 1OF3A 4JKLA 2WN3A 5TISC 1QXPA 1KQ8A 1V9U1 3ZQLA 1PUFA 1I6HJ 2HWC2 1LFBA 2Q8EA 3ZXAC 2PHRA 2AACA 4GA9A 3I8TA 5LGTA 1AXKA 1RITA 1UAIA 3UL2A 2YXSA 4OULA 4XAEA 3CJRB 2CW7A 5K8SA 3WP4A 4MX3A 2IS6A 4UVAA 3VBUB 3ZYHA 2IGKA 3DPRB 2VUMJ 2XVGA 4MTEA 1IN6A 4JVAA 2QSFX 3CCRI 3BCWA 2HYJA 4NDLA 1GP4A 2V09A 4MGRA 5I8YA 4JQTA 1IN5A 5JVVA 2RAEA 1JZ6A 4CU8A 4UOJA 1B1BA 5JI6A 1W6NB 4ES9A 1BK1A 4TZDA 4O9GA 4DYCA 3AG2H 1XCVA 1HXS3 4JBAA 4XQFA 2O03A 1PMIA 1JYNA 1PVEA 5J4YA 4W4ZA 3S16J 3CF6E 1CPMA 1SFPA 4FVVA 4CDUB 4H7LA 2YC0A 2W1QA 1TNSA 1X8EA 2KQRA 4IEXA 3T0DA 2RS11 2G4IA 2WN2A 4UW5A 2HYKA 2P8TA 1RUI1 4XKBA 5DEQA 3V7RA 1XC5A 4J1WA 3I4NJ 3SH3A 3KLNA 3RZHA 2Q1ZB 2WR9A 3E6MA 5M5YJ 4FPEA 4GAZA 4N8MA 1XNCA 3ZGKA 5DCFA 3ZQFA 5ILUA 4LA2A 5FKOA 2JICA 5IK7A 1I50J 2EV0A 2QGUA 1QZZA 1LOGA 4TN7A 3LL7A 1U0AA 2XJRA 4XLFA 3S2WA 1X50A 2WBMA 3WZ1A 3F9KA 3AYDA 2QLZA 3WW4A 4CHUA 1W8FA 3TWIA 5K5OA 5LASA 4PDKA 3PDQA 2WA0A 1VF9A 2HFHA 3SFIA 1M4WA 3O0VA 1W5TA 2PHWA 5J48A 3OOUA 1ETQA 2LDUA 1Y9QA 1X1DA 4Y20A 4QGNA 5F0HA 3ZKUA 1OLMA 1XMXA 2JZYA 1JW6A 4JHTA 1ETOA 1QOTA 3BR0A 4LUKA 4CZCA 5BNPC 4PQQA 3OF1A 1QXRA 1WHUA 4OUMA 2V9KA 1W6NA 4XRSA 3MWMA 3N7KA 3ZOBA 2FCUA 4DBRA 3E5UA 1FT9A 4OIOF 1F4HA 1ZG1A 4E7KA 1FNZA 1WZXA 5IFPA 4XICA 4QB1A 1YJLA 2CUFA 5LHGA 2A68F 1IF1A 3W6VA 2WZEA 4YW5A 4JDNA 1REDA 3ZXJA 4GWNA 2ORZA 1K4TA 2OCEA 2VE1A 1ACIA 2HDDA 3FM3A 4AF9A 4XKCA 2EFNA 3W5MA 4BEHA 4RFT0 4OZXA 2XAUA 4L0PA 4M71A 2EZIA 2DOAA 1OOPA 3GTKJ 5T50A 1E2XA 3E97A 2OIIA 1Y7BA 2VONA 4Z1VA 3N3HA 3VDXA 5F37A 1NZCA 4Q5SF 2UUZA 4D7NA 1PYVA 1VAKA 5C4JJ 3ZFFB 4KNCA 3NRUA 3WCRA 3HWJA 3LSIA 5AIPA 2VXRA 5EJCA 2RVAA 2HPMA 1SMTA 1FMD3 3DXUA 4JX6A 2YV8A 3C2HA 3VLBB 2WNEA 3D4KA 3OGRA 4BE2A 3HOUJ 4C2UA 5KVRA 1NCQB 3ZPLA 2NVXJ 3WF4A 1MR5A 4HETA 3WTVC 2JDAA 3K46A 1T39A 3JD71 4Q4W3 1YO8A 4HSJA 4BB3A 3I2HA 2P3KA 5CG9A 3GALA 4A3GJ 3MFCA 3ATGA 3OYGA 2O5RA 3HGYA 2K9LA 2WV1A 1HSTA 1VR3A 2LOOA 3ZXSA 5F5IA 3BZCA 3CC2I 1QQP3 1ULDA 1V6IA 2GP3A 1V5FA 4R9BA 3RJ2X 3ACLA 5DUVA 5JSRA 3FK6A 1RYYA 4AI2A 3Q3SA 2JA6J 1WW5A 3TAYA 1U8BA 4LHSA 4EROA 4UB6C 1OCTC 2KDZA 1H1IA 1BR4A 5BPDA 1CQTA 5JOXA 1RUJ2 3LSGA 4Q29A 1ND2C 2YC2A 4YG6A 1STZA 1W6QB 4MGTA 2LLKA 4QPOA 5J96B 2RDRA 4Y5TA 2Z2SB 2VGDA 4XQDA 5HI0A 3B93A 3H1MA 3CJNA 2KHMA 3ON7A 2JDKA 2HYFA 1CZSA 1BI2A 2CQNA 2WNVB 1B35A 1F4AA 2WNVC 3A7QA 3ILRA 2DVDA 1R5GA 3TEXA 2Y6LA 3SQNA 5K1YA 3QQAA 5EEHA 1TWGJ 1JT0A 2OQ6A 2RVCA 4X6AJ 5FO8B 2DA6A 3DWLE 5D8KB 5IVFA 3THPA 5KHJA 1NCQC 3RZJA 5DD4A 3QYBA 1WWYA 3MIDA 3ZSJA 1LE8B 5J6XA 3J81K 3GZEA 3PIPF 1BMV1 4D3WA 2L9VA 1JU3A 4MSVA 2FOKA 1LODA 1T38A 4GH4A 4Q1RA 1JYWA 2MHFA 5BUVA 1BL0A 3VZNA 3OV8A 4UFIA 3T30A 3Q8AA 4ZXEA 3HKZN 4YG0A 1SAXA 1BR1A 2GC3A 4ARYA 4KU7A 3I2FA <