2H6CA

Crystal structure of reduced cprk in absence of any ligand
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
208
structure length
208
Chain Sequence
FFPIEKLRNYTDMGIIREFAKGSAIIMPGEDTTSMIFLMDGKIKLDIIFEDGSEKLLYYAGSNSLIGRLYPTGNNIYATAMEQTRTCWFSEECLRVIFRTDEDMIFEIFKNYLTKVAYYARQVAEINTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGAHHVTVSKVLACLKKENILDKKKNKFIVYNLEELKHLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CprK Crystal Structures Reveal Mechanism for Transcriptional Control of Halorespiration.
pubmed doi rcsb
source organism Desulfitobacterium dehalogenans
molecule tags Dna binding protein
molecule keywords ChloroPhenol Reduction gene K
total genus 59
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2h6cA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2h6cA01
3HRTA 2MHFA 5KHHA 1P92A 2GA2A 5TJJA 3T8TA 3E5QA 1MDMB 1SFNA 4PIYA 3I0TA 2OAZA 2PJPA 1ZLJA 4P55A 2LNBA 3DKWA 3PVBB 2W24A 2D2WA 4HSLA 1XMKA 2W25A 2AS5F 4OMZA 2ESNA 2PEXA 1P6RA 3SZTA 3R0AA 1QO0D 3R6SA 3ERED 1U3EM 2HS5A 2FE3A 4UVCA 3KEQA 2EWNA 3K1MA 4LG0B 3L00A 4YFKF 4R8HA 5K1YA 3S7EA 1R1VA 5ICFA 2Z33A 2FF4A 2OYZA 4PZJA 3SCGA 1TTYA 3LSTA 1CAXB 1B9MA 2Y75A 1YTYA 4HAMA 5LHHA 2DPDA 1R5HA 2QQAA 2J5OA 2L54A 1S3JA 2P6TA 3RIRA 2VC1A 2OQRA 4GO1A 4X6QB 4IXAA 2OA4A 2JZYA 3HRMA 2Q0AA 4EQQA 4QMAA 2EK5A 5HI0A 1CAUB 4RB1A 1ZREA 2ZKLA 1CX4A 2H6BA 3R61A 2ZNYA 2P4WA 1ZYRF 4AVPA 3ZMVA 5KHJA 1MD0A 3TO6A 3SZPA 3E6DA 3UKTA 1KQ8A 3RYRA 2D5HA 3O3KA 2DO7A 3KLNA 5H20A 3FXUA 3V8LA 2NAZA 2VBZA 1WLTA 5FGMA 1U5TA 4LB6B 1LDDA 1ZRDA 3TQNA 4GCVA 2HKXA 2B0LA 4IESA 4FX0A 2MNGA 1J0RA 4Q0SA 3HHGA 2GXBA 2A3SA 3SXYA 1XE8A 1IW7F 3I53A 2E7XA 4U0YA 1ZG1A 1K78B 1RNLA 4HLXA 4G7HF 3LAGA 3H8UA 2P8TA 4N9IA 5FO5A 3VOEA 3FJSA 2FMLA 3RNSA 3B02A 2PAEA 3T1BA 4HX7A 4IEYA 2Q2EA 2NNNA 3EYIA 2IXIA 2EAAA 3I54A 4YYOA 3WTSC 1D3YA 3OCPA 1J5YA 4DQ2A 3KP7A 4IJAA 1F5TA 2IT0A 4RD7A 1AOYA 3HTUA 4KL1A 2B5HA 4WVZA 5LEKA 4ESJA 5AVPA 3SQNA 2IVMA 1GXQA 3BALA 3BY6A 2IPQX 4U88A 3HT1A 5KHKA 1TNSA 3U11A 4KIFA 2IW5A 2R3SA 2K0GA 5BOXA 3VODA 1T6SA 1IPJA 5E16A 2IRFG 4EVIA 5JSPA 2H27A 1WSUA 5J7MA 5TRDA 4OIOF 4WWCA 2PMHA 1S7AA 1REPC 4E70A 4XLNF 3NRVA 1XCBA 2HZTA 4CGZA 3GX4X 3SFZA 3J7AO 1FSHA 4NQWA 2WC2A 4MGIE 5BY5A 5D6EA 5JSOA 2XAFA 1L0OC 2F2EA 5FD5A 3KZYA 1QZZA 4IEUA 3F8BA 3O6BB 4HN0A 1SD4A 1XN7A 4L9JA 2FBKA 2IXKA 4KWKA 4HVQA 5J48A 3ECHA 4A6EA 1U12A 1LDJA 1S8NA 4EWAA 3CJXA 4UUVA 3IRRA 2TDXA 4ENMA 1Z6RA 3QP6A 4MQVA 3WTXC 2L01A 5ERIA 2DU9A 2E9QA 3ZN1A 2K4JA 1MJBA 2G7HA 3J80K 3TDZC 4FHTA 1XB4A 1Z91A 1XRUA 4Y17A 3GXOA 3OGJA 4I02A 4A2UA 2NNYA 4KU7A 2QM3A 2W85A 5FPXA 4XF9A 2UY9A 3I7DA 1ZLKA 5D5WB 3NJZA 2EFNA 4UXNA 2ETHA 3BJ6A 3F6OA 4L0YB 2R7DA 1FWZA 3UKVA 2Z69A 2QJVA 3SXWA 4YFNF 2ZMEA 1PDNC 1FX7A 2D1HA 4ONUA 2HYFA 1OKRA 2OZJA 3WW2A 2DBBA 2M1BA 3MYXA 1CF7A 3EBRA 4AVBA 1XGNA 4J1WA 5CADA 5E8IA 2IA2A 1UIKA 2IXCA 2D93A 3K2ZA 4G8XA 3IDBB 1G3WA 2P5KA 1RL3A 4O3MA 1X8EA 2PI0A 3CUQC 4WF2A 4YIFA 2EVXA 2A5YB 3ETQA 1G3SA 3FMRA 3TKYA 3D5LA 4A12A 2O0YA 3TO7A 3CDHA 1IZ1A 1TNTA 1Z05A 4M72A 1LB2A 3H7JA 4MEXF 1O3TA 3WGIA 1U5TC 4CHUA 1YLFA 2YSRA 4D7TA 5L3GA 3LAJA 1ZZ6A 2QUFA 1QXJA 3DL3A 2PFBA 4ESFA 4FAGA 4M73A 1FSEA 1XDSA 5CVRA 4HVRA 4G9YA 1FXZA 3V4GA 4L18B 1EPZA 4LUKA 3GFLA 4PGHA 5E1ZB 1ZARA 3BJAA 5IT9Z 3LA3A 3RTRA 3FZ3A 3DF8A 5AONA 4HLTA 1QNTA 5CVVA 1BIAA 3CUQB 1R58A 4AD9A 5HOOA 5K5OA 4IEXA 3U1DA 1RGSA 4AQ2A 4PJYA 1ZZ9A 3RDIA 2UXNA 4LK0F 3LA7A 2L3DA 1FI2A 2NRAC 2QQ9A 4LFUA 5LGNA 5CU1A 2EV0A 1EH8A 1UFMA 5E20A 3RJPA 4KMFA 4QGMA 2MC3A 4AIKA 3QAHA 1J58A 2PTMA 5JCTA 4WXDA 3CUOA 3GW2A 1Y9QA 1YLLA 4RB3C 2D5FA 4FBFA 1XGMA 3M70A 1V4RA 2JRTA 1VP6A 2VT3A 5D5UB 2V1XA 4O6JA 3KLOA 4LLOA 4O9EA 2CG4A 1GQGA 3I71A 4M6XA 1ZG3A 4NB5A 2VONA 2FA5A 4ASNA 1RI7A 2XIGA 3BROA 3QPHA 4XEZA 3DV8A 3QPTA 1HQCA 2RC4A 3DFGA 5T3NA 4QXKA 2DPUA 3JAMZ 2H6CA 1OI6A 1HKQA 1STZA 5HS9A 3H3ZA 2Y48A 4XFBA 1IN5A 3J80Z 1DPUA 4HMZA 5DCMA 2JPCA 1EH7A 2Q1ZB 3PLQA 2ZMEB 4A5NA 5ILVA 3MPBA 4LEJA 3LWFA 1IN4A 2Q4SA 3HYIA 1KGSA 1ZZ7A 2CYYA 4YIIA 2MA3A 3GUDA 4K8FA 3WE2A 2STTA 4N9HA 4HBNA 4KN4X 1R00A 2K86A 1ZG5A 3K0LA 3K69A 3LFKA 3H1YA 1FY7A 4QGLA 1HSTA 5J6XA 4LLGF 4EWEA 4PIZA 5LBQA 2Y0OA 3M9AA 5LLQA 4YSFA 1KU3A 1OPCA 3W6JB 4PDKA 2UZKA 2EFWA 1HXDA 2B9UA 1J3RA 5ICGA 5C6CA 2HGCA 2EV6A 5CLSA 1LQ1A 1FOKA 2MD5A 2QYOA 3SMHA 4CYDA 1UCRA 3QACA 4RS8A 4EMSA 2C6YA 4XF3A 4WK8F 4Q48A 1PP8F 2N7GA 2M45A 2GQQA 2GAUA 2GC3A 4CDGA 2RGVA 4OOIA 2XAQA 5DV5A 2CQKA 2DAOA 2A07F 3EO6A 1LDKB 5JAXA 4HVOA 1ZAOA 1W5SA 2QLZA 1HW1A 1USSA 4R52A 2ESHA 2ZKZA 5HS8A 2RV8A 5CJ9A 2MPFA 4IEQA 4XFIA 2VXZA 4HA8A 1TBXA 3V8JA 5HLGA 1YUDA 1IF1A 5FLXZ 2BE5F 5A2QK 2UYBA 4A0ZA 1MZBA 2IP2A 2ZFWA 1O3QA 3CO2A 2P7VB 2EA2A 1E17A 2QVSB 4HF0A 1KA8A 2PQQA 1UIJA 3P7NA 1B1BA 4CXFA 1OR7A 3DPLC 4MTEA 5L3CA 3WU1B 2V09A 3V7SA 1EH6A 1YFHA 2G7UA 3CL1A 1IXCA 1Y0UA 2L02A 3B73A 4RAYA 2GU9A 4YRDA 2V79A 1IUYA 3RPQA 3HQXA 2DCTA 2FEZA 3M8FA 3ZPLA 4Q4ZF 1GVJA 4AIHA 1FZPB 1YFXA 2A68F 3W6KB 1BC7C 3WW4A 3H3UA 1S6LA 3PFIA 4G6DA 1O5UA 2V9VA 4UBGA 1F4KA 1Q43A 3M7GA 3MEXA 3LOIA 1CAVA 1PMIA 1XDUA 4H0EA 1I1SA 3ST7A 1X8MA 2M5WA 4LGWA 5E17F 2ISZA 4HQMA 2UY8A 4H7LA 3USSA 4F7ZA 4ZZLA 3Q9VA 5FLHA 2CW0F 4DNCA 1QQIA 1BC8C 3GBFA 3IRQA 5EFUA 2RVCA 3O2PE 4RGSA 2XUBA 2WV0A 2M8EA 1GQHA 4QGNA 3IWZA 1D5VA 1RZ4A 1TQMA 4LB5A 4ZU7A 4ZH4F 1P4XA 3JTHA 4N0BA 1UD1A 1YO5C 1P4AA 5H6RA 3F8FA 3FF5A 4P96A 5DCFA 4M9ZA 2KXLA 5BMZA 5DUKA 1FT9A 2Z2SB 3ROUA 3WGGA 2DW4A 3KETA 2Z99A 4HDUA 5I0UA 5D5XB 4M9XA 3KSCA 1G3YA 3OTFA 4HQEA 1ZGAA 4IRHA 2KRFA 3MAJA 1O3RA 3FXRA 2ATFA 4WX9A 3RYKA 5F64A 2MBFA 4YG2F 2EJRA 1EP0A 3KE2A 5JFRA 5FFZA 2HJIA 5E18F 2WTEA 1WRJA 2LF7A 3L7WA 1ZN2A 4BAYA 2IC1A 4ENNA 2UWMA 2MH2A 3E3VA 2GWRA 2O3FA 4XF0A 3IIAA 1F1ZA 4E2SA 4EM0B 1V70A 3F8CA 4JVAA 4UBHA 1YFYA 3E6BA 3QOPA 1JHHA 1ZRCA 3BPVA 3K1PA 5HVQC 3MWMA 3NKTA 4PIXA 1BI3A 2YX7A 3KGZA 3ZDSA 1IRFA 2HOEA 3OOPA 1Q3EA 3GZ5A 3FZVA 4K2EA 2ZNZA 5DYMA 3ZP5A 4AQ6A 1U78A 1U2WA 3C3WA 1DUXC 1K6OA 3N97A 3V7RA 1RUNA 3L2HA 2FOKA 1BJAA 2FSWA 5J8FA 1HKSA 3F6VA 4MNUA 5ED4A 2JSCA 1UB9A 1MGTA 3SCFA 4EJWA 2QENA 3F3XA 2DQRA 3HTSB 1XSDA 3ML6A 3KP4A 4L9TA 2ZCWA 1YW9A 2IXJA 2GXGA 2NYXA 3GLXA 1RUOA 3ZN0A 5E1WA 3Q5FA 1FNNA 1WI9A 2PA7A 1WQ2A 4OINF 2HTSA 2Q8KA 2VN2A 2ETEA 1QY4A 2H0VA 1WKMA 3JSOA 3KCCA 4Y13A 1YFWA 2PFWA 5DDGA 3EJKA 1JE8A 5JR7B 4A0YA 4R79A 1G6NA 2K4BA 1TLHB 2FU4A 2FBIA 3T8RA 3BCWA 4CICA 2FMYA 2Q30A 3UKNA 1ONVA 5I0TA 3GYDA 3GZ6A 3TOAA 2UYAA 4KA4A 4P9FA 5HDNA 2V6CA 2VOPA 2DT5A 3H9AA 1O5LA 1UHWA 4LULA 2XROA 2FXAA 3ELKA 1H0MA 5IT3A 3F8NA 2CFXA 4PCQA 3KZZA 4ON0A 4PGGA 3SHRA 3OD0A 2IJLA 4Q29A 4HV5A 5E1XA 4JQFA 1D8JA 1TQ5A 5ICCA 1SFXA 4XFHA 2PN6A 2M30A 2O03A 2HYGD 4I09A 3MDPA 1JHFA 3MCZA 3H50A 3EHKA 1J9IA 4MZUA 1L3JA 1LR5A 1NE4A 4I3PA 3AAFA 4TV7A 1XSVA 4Y15A 4EM1A 5F1RA 1D8KA 2E1CA 5FDBA 2ISYA 1SFEA 2BGCA 4XRFA 2O61A 5CVIA 3R0JA 3EQLF 3DXJF 4Q47A 2GC1A 4M9SA 3KEOA 5LEJA 3JAMK 1YW8A 3QU6A 1WWXA 1X3UA 1FYMA 4LLNA 2PQ8A 3IC7A 2EV5A 4HSJA 1U5TB 1QGPA 3HOTA 3V7CA 3JSPA 3D0SA 2VBWA 4HBLA 3CTAA 4ORFA 4CO8A 1R1UA 2D1VA 1DGWA 3J81K 4ZYDA 2Z9OA 3MZYA 4RGUA 3JZVA 2W57A 1SEFA 4IEOA 2PMUA 5K8SA 5DEQA 5BUVA 5F6FA 4JBAA 2STWA 3F8MA 4WCGA 4IEZA 2Z5UA 1P4WA 1CGPA 4YARA 1KU7A 1KU9A 4IEPA 3U9GA 4KWLA 2F5EA 3ZMUA 1TW2A 2OPKA 4UHTA 1X82A 3L9FA 1KYWA 2XLFA 3GFIA 5FPZA 2XHKA 1LEAA 5HLIA 1RC6A 5JHUA 2HDCA 2E1NA 2GC2A 1VR3A 1YYVA 4XSZF 5J8CA 4L5JA 1H9GA 1TQIA 2P17A 1YG2A 2EFQA 1MKMA 2BEOA 3WGHA 4RB0A 1SMYF 4Z07A 2BNOA 2QZ8A 1ZZBA 4Z82A 3R4KA 3K9TA 3LA2A 5L3EA 2VBYA 2XVCA 2PHLA 1CF7B 4FT8A 1FYKA 2ZXJA 4XF4A 3S7IA 5BPXA 4OLLA 1NE6A 2XASA 1SD5A 1SQ4A 2Q0OA 3GVAA 4AXOA 3WG9A 4Q0PA 2ZBKA 2HTJA 4OIQF 4O5VA 3H7YA 4E2GA 4EGYA 1AWCA 1L3LA 3M8EA 3REOA 1BI0A 1J2XA 1H1MA 4IHTA 5A2QZ 1LNWA 4QM8A 4ENKA 5HLHA 3DN7A 2OZUA 2BNMA 2HQNA 3FFQA 3G73A 4BH9A 5FB2A 4HW0A 4M6YA 3NVCA 3O14A 3IHUA 5FFXA 2OD5A 3TNPB 1HKTA 4P9UA 3FHZA 2GA1A 3FX3A 5AIPA 3GEZA 1CAWA 1QXRA 1BM9A 4KT5C 1O4TA 5DD4A 4S04A 1KU2A 4NHJA 1B59A 1Z6TA 4ESBA 5KHIA 5LRSA 3COAC 3E5UA 3C18A 3FMQA 4LLLA 1Z9CA 3HHHA 1HSJA 1EY2A 4IVNA 2XAHA 1PUEE 1H9TA 5KVRA 1ZHFA 1OYWA 3L09A 5DCMB 3ECOA 3CLOA 5ILSA 4GYGA 4GULA 1UW8A 2XLAA 2A61A 3RKXA 1ZRRA 1BOAA 2D45A 3BPZA 4Q0QA 5JSRA 1LJ9A 3ULQB 2L4MA 3FE5A 2A69F 4Z2YA 4A5MA 2OA2A 4RGRA 4AIJA 3MQ0A 3ELNA 3QU3A 3H1WA 2PBIA 4EJVA 4G6QA 2F5CA 4FX4A 4HV6A 4JTNA 2COMA 1ZX5A 2K7LA 4LMYA 3EQEA 4GGGA 4MUVA 1OMIA 5BPDA 3BP8A 2FRHA 4YFXF 4ZU5A 1Q1HA 3KP2A 2G9WA 4IERA 1IAWA 3QP5A 1T39A 1HBXG 2KIMA 3MZHA 1G3TA 1YQAA 2O8XA 4KIBA 3E97A 1ZVFA 2YX4A 1XCVA 4LTAA 1LVAA 4BQAA 4Q0UA 1J59A 4HOBA 3EDPA 2XL7A 3WODF 4XLPF 3M3IA 2QBYA 3EETA 1BI1A 1J3QA 1IRGA 4G7OF 2JTVA 2FQPA 3L2CA 1J1LA 3G3ZA 5E8GA 1YW7A 2QVOA 2K9ZA 3U2RA 3C3VA 4ZYEA 2XV4S 3KGLA 1TW3A 1ON1A 5EEHA 3RPUA 1SD6A 2CSOA 4L9NA 2WWYA 4S05A 2ZJ2A 2P5LC 2HQRA 1OFNA 4LK1F 1BIBA 2IXHA 4MX3A 3CO6C 1XD7A 2KIFA 5I91A 1C0WA 1I27A 4ENJA 3IL2A 3E6MA 1QWRA 1J3PA 1R22A 5ICEA 2KIUA 2OBPA 2OZ6A 3HSFA 4A0XA 5H6QA 4U7BA 4UV9A 4AVCA 1E2XA 3CJNA 4HYEA 3FWEA 1T0FA 1QZYA 3KP3A 5I93A 3FMSA 3RKYA 1Q5OA 3SHFA 4G7ZF 3BDDA 1YIOA 4B29A 2ELHA 2K02A 5K5QA 5FD6A 2DFIA 2LDUA 2JT1A 3PQKA 1LKNA 1NZCA 2C0ZA 4RAZA 3OF1A 3ZMZA 3GF2A 4M71A 2F5FA 2FNPA 3R60A 1ZH5A 4UNOA 5JR3A 1YFUA 4ZYHA 3TGNA 2EB7A 2F5DA 1NHAA 1W7PA 4B8XA 3MFKA 4EJTA 5D8LB 1T98A 4META 3VEPA 1W5TA 3ACLA 4KU8A 4E2QA 4MGRA 3C7JA 2QCSB 4MV2A 4CZZA 1CAUA 5D4SA 2IA1A 1A04A 2OQGA 2VT2A 3TOBA 1DZTA 1QBJA 4JV4A 4HF2A 3FHIB 5K5RA 3LQQA 3IBMA 2KKOA 1USTA 1VTNC 3JTGA 2DQLA 1J7KA 1RTVA 4I98B 4KDPA 1YS7A 4UXAA 4EROA 2PLYA 2O6GE 5L3DA 4P9GA 1B9NA 4ZU4A 6PAXA 4MHGA 2BNNA 5JVTA 5D1IA 1UPIA 1BBYA 3IWFA 2R7FA 1I5ZA 4XFGA 5I0RA 3Q9SA 1O3SA 5HDGA 4ZYGA 5BQTA 3I58A 1IN7A 3HUGA 1NXMA 4D7SA 3BWGA 3IKTA 2I45A 4J1XA 3T5XA 1IN8A 4HN1A 1IXSB 4TLFA 4EGZA 2UXXA 1TQPA 1XGSA 5CYVA 2RQPA 4MGYE 4WBBA 3BJOA 1XE7A 2JPBA 2HEOA 1IXRC 2QQBA 2XLGA 3S0MA 2F4PA 3RI4A 2OU2A 2CWEA 3JW4A 5LRRA 1NYWA 4L0ZB 2B8MA 3SCHA 1O7FA 4LJZF 2H09A 4I7HA 5FLIA 3DPTA 2XRNA 2QDRA 1DPRA 2ADUA 1WGPA 1W4MA 4IRGA 4DINB 1MDMA 1MJ9A 4HF1A 3IKVA 1JGSA 5CVJA 3BOQA 5DUIA 2RKHA 2CO5A 1V3FA 3HT2A 2LSOA 2VC0A 3ABUA 1WA4A 4I2OA 1YS6A 1YHFA 2GIVA 4G94A 4LUMA 3I59A 1KQ0A 1YWKA 1HW5A 3CLPA 4NVPA 2YPRA 5HS7A 1B6AA 2H94A 5D6FA 4HLYA 2KJCA 3NEUA 1FLIA 1ULYA 2ET1A 2FNAA 4MGKE 4KN7X 1SAXA 1UCXA 3OV8A 5BV6A 3J81Z 5EZWA 4IF4A 1PP7U 2D40A 3H92A 5FLJA 3GWZA 3E5XA 4I0AA 2EFOA 4XFCA 5EEGA 4KWJA 2VECA 2DI3A 1Z7UA 5I0SA 3EUHA 3TNQA 4BHPA 3E6CC 4XSXF 3KP6A 1SFUA 1R7JA 4IPAA 5FLXK 1U6GA 4BHCA 5FQ0A 5J3UA 1KQ9A 3P9IA 3ABTA 5I8TA 3ES4A 3GYHX 4BYYA 4MGZE 5E1RA 2KJBA 4IETA 2MLGA 3QRFF 1FPQA 3RZZA 2AXLA 4XFAA 2EA4A 2MLKA 2GH2A 1P2FA 1K78A 4EM2A 4L11A 4D0PA 4HZFA 5LHIA 3HOSA 2GZWA 3HSRA 3NW4A 3HRUA 1ZNPA 4GYIA 2PHDA 1OD5A 1Y3TA 2CAVA 1R36A 2P6SA 2V1UA 4MQ9F 4U0WA 1CAVB 3KP5A 4QLCU 3CUQA 3RKWA 5LHGA 4HX4A 4WXHA 4MTDA 4RB2C 1IN6A 1DGRA 1ZZCA 3BZ6A 2J5PA 4LG0A 4IRIA 3WTUC 4KYWA 4I0BA 5FQ0B 1R1TA 4X6RB 4OMYA 2QNKA 3WE3A 3WTVC 3F21A 2W84A 3HIFA 5BXXA 1LEBA 1CAWB 1Z1DA 4EWDA 4EV0A 1W7PB 4ETSA 3DEUA 1CAXA 2VQAA 4YNIA 3FXQA 3N4MA 3WW1A 1T38A 1I1GA 2XAJA 1BI2A 1FC3A 4LD5A 3H1MA 1FBSA 3FM3A 1G4DA 2CV6A 2ET7A 2HFHA 4ZZDA 2HR3A 5HDKA 3IDCB 4I01A 1LRHA 1XMAA 3DP7A 2L4AA 4KUMA 5I8SA 3ZQ7A 1W7PD 1SD7A 3RYPA 2X4HA 1FP1D 3D82A 3I64A 3P9CA 4IHSA 2IA0A 4IEVA 3T0YA 4KIGA 2LF8A 1K79A 3CF6E 1K7AA 3LQRA 2HWVA 4A6DA 1FP2A 4KMUX 1JXSA 1R23A 4AVAA 1O57A 2PG4A 3HRSA 2YR2A 2VE8A 1BN5A 4FAHA 2VBXA 3ES1A 4R1HA 2Y0MA 5D5VB 2CAUA 3G7DA 5DD8A 5LGUA 1O7LA 2DK8A 4UVAA 2EA7A 4UV8A 3CEWA 1OYIA 5KHGA 2NS0A 2ZO4A 3TDUC 4BNCA 1FBQA 2DK5A 3F72A 2RNJA 2M87A 1T2KA 4XETA 2FQ3A 3NSTA 2P5VA 1XSXA 2A6HF 1U8RA 1X7NA 4KNYA 2CGPA 5L3FA 5L3BA 2BYVE 3GFMA 1DZRA 5BPIA 2EFPA 1S7OA 3GO5A 3DQVC 2IXLA 2VPVA 2QBYB 4L2NA 2XGXA 3EYYA 1VJ2A 5KBFA 2K27A 3KMHA 1OYYA 3NQOA 2O8QA 3LWCA 4LA2A 3FM5A 5FCCA 4WXCA 3LZZA 2RN7A 2WFPA 4IEWA 4XF1A 4BXUA 2GC0A 3F23A 2BBYA 4MH0E 2VOOA 4OFGA 4QWQA 3HSEA 3LAPA 4B09A 3GFJA 2DTRA 3WW3A 1DP7P 4GXOA 2BV6A 3C1DA 2VE9A 4KFCA 1H1IA 5LGTA 1JUHA 4WZCA 4KICA 1FYLA 1EV7A 4UVBA 4O9GA 2YU3A 3VHRA 3WU0A 4L9VA 1ZRFA 3BU7A 3WTZA 3V8KA 1ZZ8A 2XAGA 4HX8A 4P5OA 4Q0VA 1HW2A 1FBUA 5JI6A 4QM9A 3ZMSA 1PM7A 1J75A 1R5GA 3D0JA 1RIOH 1I6XA 2PAKA 1ODDA 4HDVA 4M74A 2QWWA 2PYTA 2MH9A 2XKOA 1EYBA 3BB6A 3BPXA 5C8WA 3M1EA 3I5UA 2VODA 5CVUA 3ZMDA 1ON2A 3U0ZA 3KFWX 1MJAA 4OU0A 3PQJA 5IT9K 2XL9A 2ACJA 4EJOA 4EJUA 1QPMA 2RDPA 4XBFA 3I4PA 1UHMA 2HKOA 2X0LA 3ZMTA 1GHCA 4OIPF 1F9NA 3P9KA 2O1QA 1ZGJA 4BHBA 1IPKA 4JTOA 4F8AA 2PAMA 4MEYF 5D4RA 1B4AA 4OIRF 3WTTC 4U7DA 4JK1X 1S29A 3PNAA 5I8YA 4RGXA 4QX5A 4BIFA 2E7WA 4U0VA 3VB2A 2DLLA 2XKPA 3K1NA 2A6EF 3NL1A 3CO7C 2Z3YA 2V1DA 4Q5SF 1SMTA 1XGOA 4AWXB 4XFFA 5BS6A 5D8KB 5AIQA 3S2WA 4L5IA 3ISPA 3F22A 2LKPA 3WTYC 3U10A 2FBHA 5KK1A 3WTWC 3I59B 2P7CB 4LA3A 1KYZA 1GXPA 1DDNA 3TO9A 5ILUA 3VFZA
chains in the Genus database with same CATH superfamily
3HRTA 2GH8A 2C5DA 5CFCC 2GA2A 5JVVA 4YIRX 5TJJA 4LBNA 4MVTA 1TMF2 3N9NA 1GVDA 3E5QA 1XYNA 1XYOA 5F3CA 1MDMB 4NPMA 1GP6A 1SFNA 3BPSA 3RRDA 2X9DA 5FAXA 1OCPA 2OAZA 3BR5A 1RUI3 4P55A 1HRI1 5A1FA 4LKSA 3JBG3 4EN6B 1QVUA 3ACHA 3LIGA 1P6RA 3SZTA 5FZ9A 4DNYA 1XPWA 1JZ7A 1D1AA 2W52A 1T6GC 2EXIA 4Q4W1 4LG0B 4YFKF 5K1YA 3ETPA 4MFEA 2WAOA 2Z33A 2QQLA 1S4CA 3C7HA 3SCGA 2Y75A 2R4GA 2E63A 1AX1A 3LQCA 3CD6I 4C0BA 5GAEJ 1OH4A 4MGSA 4OVEA 2XJTA 4QX2A 3WZ1A 3HOVJ 1DLLA 1YQ5A 3O0XA 1ST8A 3FISA 4GO1A 2XVLA 2OA4A 2CH0A 3NAPA 4D8MA 4EQQA 5B4NA 1UOJA 3I2OA 3ORJA 3GCXA 5KAIC 1HF0A 2ZKLA 2H6BA 3R61A 3TAYA 1ZYRF 4AVPA 5KHJA 2M2EA 2BQPA 5ISLA 1LAJA 3RYRA 3D3AA 3QOEA 4AG4A 5H20A 5DS9A 1WLTA 1U5TA 3M4OJ 1VQMI 1K4SA 4AEMA 4V19K 1SANA 5DG1A 2VKEA 1WA6X 3DBRB 2MNGA 1RUC2 1V5FA 2XXZA 1AYM2 4JRLA 4Q0SA 1H2LA 3HWJA 5FRMA 1XE8A 3IAQA 3MD2A 2E7XA 1ZG1A 4IV1A 3MW4A 5LA9A 5BNNB 5FP8A 1AL21 3NNJA 1TMF1 5FO5A 1GSLA 1ETQA 3KS7A 4BK5A 3B02A 1JZ3A 3GMEA 4AWDA 1R49A 2HDWA 3WTSC 1H6XA 1XQNA 3X29B 4YM2A 1W0PA 4D9JA 4E8DA 4RD7A 4CDQA 3PUIA 3SQNA 1LOEA 2P3KA 1GXQA 3BY6A 3PU3A 2IPQX 2BY3A 2JG9C 2GM4A 3U11A 4KIFA 2IW5A 1GZTA 1VB4A 1UXZA 2VW0A 1CQTA 3W2AA 4EVIA 2AENA 2H27A 5BNNC 5FZ3A 1WSUA 5TRDA 4OIOF 4WWCA 1C8M1 4IV1B 1X58A 4GB32 1DGRN 3FKJA 2W82A 2HZTA 5JIAA 3V65A 1WCDJ 4H14A 1FSHA 2WC2A 4A3FJ 5F3IA 2CW8A 5C9AA 1M1EB 5JSOA 4RMNA 4CEWC 1SFKA 1XN7A 5LW9A 3VBHA 4HVQA 5J48A 2D97A 3PHMA 4QU2A 3GZEA 4BQXA 1LDJA 1UPSA 1YRNA 3CJXA 4BJ6C 3IRRA 4UUVA 1QHDA 2E71A 4ENMA 1DLCA 2P1BA 1Z6RA 2L01A 5ERIA 5F27A 1SCSA 2G7HA 4CCMA 3J80K 3TDZC 1W8ZA 1XRUA 3GXOA 2QDNA 5J4YA 3OGJA 4I02A 2NNYA 4KU7A 2QM3A 4DUVA 5KC6A 3S5AA 1PZ8A 2CMPA 4A6SA 2UY9A 4GWJA 3I7DA 5D5WB 4XLEA 3Q0UA 2IS6A 1OLRA 3F6OA 3UNGC 1MBJA 4L0YB 1ETVA 1Z7S2 3UKVA 4A3GJ 4YFNF 3MKYB 3OSFA 1BVP1 2YU1A 3FDYA 1WD3A 2OZJA 3WW2A 2DBBA 2M1BA 3QPLA 1CPMA 4JX6A 4OQ9A 2PN5A 2ZOEB 3EBRA 3PJQA 1XGNA 3MIGA 4HONA 2TUNA 5CA6A 1YQ2A 1G3WA 2P5KA 5FO7B 5A3PA 1RL3A 1X8EA 4DIQA 1WLCA 4NQWB 2EZIA 3CUQC 3OL4A 2A5YB 3ETQA 1G3SA 3FMRA 3TKYA 4A12A 5DDJ2 3IDAA 2WV1A 2ORZA 3TO7A 4BDYA 4DYQA 5A33B 4AW7A 2WAAA 1JGGA 2VJIA 2WNUB 1LB2A 4Y1ZA 2GSYA 1WJAA 3H7JA 1I3AA 4CCKA 3FXKA 2DVGA 1SLAA 2HWE2 2VVDA 1QXJA 3KV6A 1AZDA 3DL3A 2JK3A 3BQZA 4Q27A 1FSEA 4RLQA 4ATEA 2PMZA 3BR0A 3ZR6A 4G9YA 5JPMB 3V4GA 4BMEA 5E1ZB 1ZARA 3RKQA 4H3WA 5IT9Z 3FZ3A 4ISQA 3DF8A 2JDAA 3CUQB 4IEXA 5HOOA 2HQ5A 3U1DA 2DUPA 4ZYAA 2J1TA 1QMJA 1Z0XA 4AQ2A 4CPBA 3RDIA 3GTMJ 2UXNA 2ZSIB 1FI2A 5H9SA 5TGTA 4LO6B 2WQ8A 5CU1A 2VB6A 1EH8A 5BNOB 1UFMA 2QA4I 5C5TA 3OY9A 1GQPA 2MC3A 2ZXQA 2JMWA 4K9SA 2VZTA 5JCTA 3GW2A 1Y9QA 4RB3C 2RS52 3ZOIA 1AR72 2D5FA 1XGMA 4D6RA 1V4RA 1VP6A 4Z92B 1HV0A 5K0UA 1XSRA 4O6JA 2QQIA 4NRPA 4O9EA 3CIHA 2CG4A 3QQAA 3LSEA 1NT0A 3KLSA 5LBFA 3KHBA 3E1SA 1SEUA 1PHMA 2OIIA 4HXCA 2R7WA 2FA5A 2B9VA 3DCQA 3OBTA 3CNAA 2G0EA 1RI7A 1JYVA 3DV8A 3IMNA 3QPTA 1OKQA 2XQXA 1MS4A 2DPUA 2H8WA 2RREA 2BDRA 2Y9ZA 3NRUA 4I76A 1AR92 2WWSA 2YROA 4O65A 3H3ZA 3PUAA 4QX3A 3T08A 1MBFA 4LBOA 4XFBA 3QPSA 1DPUA 2VQTA 4D7YA 5DCMA 2JPCA 1A6QA 2NXNB 2ZMEB 1XBFA 5ILVA 3AYEA 2E1MB 2JDUA 1IN4A 2Q4SA 3DUIA 1ZELA 2Y33A 4YGBA 4K8FA 3JRCA 4N9HA 5K7FA 1R00A 2GNMA 4J6GA 4O61A 2HNHA 1ZG5A 3K0LA 1RUI1 3ZXGA 4QGLA 2VQHA 4S2HA 4BMBA 4YSFA 5GPAA 3R0RA 2HQAA 3W6JB 4PDKA 4XONA 4MYEA 1HXDA 2B9UA 1J3RA 2IFRA 4EJRA 2HGCA 4NOTA 1LQ1A 3OPTA 3IN9A 4EMSA 4CCJA 1GDTA 4WK8F 4Q48A 4LR4A 3K4LA 4ZDOA 2XF7A 2A6XA 2GAUA 2A3XA 4GA9A 4C3IJ 3LOCA 2RGVA 1S0BA 3T0BA 1J83A 4AEKA 3DTEA 2J42A 4PUSA 1RB8G 1WVRA 5JAXA 4HVOA 1ZAOA 4LPLA 1USSA 4FFHA 1TNFA 2ZKZA 3PIOF 2VMDA 2NN8A 4IEQA 1ETKA 4KQ7A 2VXZA 3V8JA 2KIQA 4BQNA 4EN9B 1YUDA 1SPPA 4LO4B 5A2QK 4KBZA 2XGEA 2NS8A 4Y3OA 2IWGB 3O0WA 2EA2A 1E17A 1CD3G 3ZMOA 1OR7A 5FO9B 4GJZA 3DPLC 4N8MA 2A05A 3GHMA 3V7SA 1EH6A 2G7UA 2L02A 3WF4A 4YRDA 3RPQA 1V54H 3HQXA 3M8FA 3OS1A 4UB8C 3ZPLA 1B72A 2HWF3 2L9NA 4PBPA 1GT0C 3W6KB 1QDCA 3ZN6A 3WW4A 4QSHA 4A3MJ 2NLRA 1A6CA 1OPOA 2Y0SA 4UBGA 3CCMI 2QZ2A 3MEXA 1QJY2 2KISA 5GTHC 4H0EA 4AEDB 1I1SA 3AMMA 3OOUA 2ISZA 4HQMA 2UY8A 1DZQA 3Q9VA 4DNCA 3GBFA 5A7NA 2WWUA 2RVCA 3RCOA 3O2PE 2X1CA 2XUBA 1N77A 2RDSA 5GAGJ 5EJ1B 3ZXAC 1D5VA 4K1YA 4TLGA 2YMZA 1RZ4A 3HOZJ 1W1WE 5L9BA 4BQYA 5DCFA 4NHMA 1R1A3 4RQPA 1IV6A 3CQZJ 5DUKA 4F93B 1JH5A 4Y5SA 4IQJA 2Z99A 1CJPA 4HDUA 2NS7A 4FQGA 3OTFA 4I99C 1ZGAA 3B5LB 4IRHA 3MAJA 1O3RA 5FKCA 2W2IA 3FXRA 4WX9A 3DEMA 4YG2F 2EJRA 3MV01 3KE2A 5GLVA 5JFRA 3NNGA 5FFZA 4QU1A 2WTEA 3PTYA 4C0HA 2RM23 3WLUA 3ABZA 4LHSA 2RDNA 2DCKA 2W3JA 2VULA 4I0WB 4Q2FA 2D44A 1YFYA 4RS5C 4L8QA 1JHHA 4XN0A 1AR83 1PO11 1V5GA 5H9RA 4IV3B 5HVQC 1C8M2 1AR63 3V0AB 5T52A 4PIXA 2W47A 3KGZA 3RMXA 1IRFA 3OOPA 1X9TA 1QF3A 2ZNZA 1RUE3 2FD5A 2WN2A 3ZR5A 3CF5F 1U2WA 3BC8A 4B1RA 2KPMA 3HR9A 2WABA 3DXUA 3H8XA 1BJAA 3B6AA 2WYFA 5AFBA 2FSWA 4XE9A 2LR8A 3GCMA 2WJSA 1O4XA 4R9BA 2DTWA 4XBLA 2FDKA 5BNPB 2QENA 2K9QA 1HXS2 3KP4A 4L9TA 4IL7A 4MO7A 3OBAA 3OPZA 1YYNA 3ZQFA 5SV8A 2YY1A 3TBDA 1ITYA 5F2WA 4KISA 4IV3C 1RESA 1WQ2A 4OINF 2RHPA 1YRZA 2HTSA 1EA3A 2VN2A 3EJKA 5DDGA 5IFPA 2ZEWA 3U37A 1G6NA 4Z6YA 1OXCA 3AFKA 2FBIA 4HEA2 2KMUA 4OHVA 1PVXA 5EJ3A 4FASD 4CICA 4YVSB 3K48A 2EICA 3GYDA 4LIUA 5FKNA 5CBLA 1DBNA 4KA4A 5HDNA 2K40A 3N7MA 2DT5A 2HWF2 4CEWA 3G2BA 4LULA 1RUJ2 2VMCA 2R49A 2VZSA 1HDKA 3DU6A 4ON0A 2EXHA 2JDHA 4JQFA 4FPYA 1AVBA 2HYGD 3A0KA 3M3YJ 3MDPA 2YU2A 4AL9A 3EHKA 1J9IA 1W6PB 1L3JA 4CDWB 1QJU2 4JKKA 1GNHA 1NE4A 3AAFA 4XC9A 2WNOA 1XSVA 4EM1A 3SH4A 2ISYA 3KVAA 1SFEA 5GAHJ 3DXJF 2UWAA 2GC1A 3JAMK 5KR7A 1MEC2 1X3UA 3TW6A 1FYMA 1UYYA 2PQ8A 3IC7A 2EV5A 3K4AA 1OKOA 1W0NA 2DVFA 4FOVA 2LD5A 3BTAA 3D0SA 4B48A 3IP4B 3ECQA 4HBLA 3IAS2 2ZS6B 4XLAA 1DGWA 3B69A 1SLTA 1W36D 4PHZA 1CX1A 1KS4A 5DEQA 5F6FA 3O1RA 1LHWA 3KYDB 4XKWA 2GALA 2M7BA 2Z5UA 1NH3A 1GWKA 4Y1YA 4YARA 4Q4Y3 2DFFA 3APBA 4QQHA 2VM9A 4N7UA 4KWLA 4CP9B 3OY8A 1TW2A 1LNSA 1W2OA 3MF9A 1OT5A 3NAPC 1YHQI 2CU5A 3H5NA 2XLFA 3GFIA 2D6LX 2VCMA 1RC6A 2HDCA 2KRHA 2E1NA 2GC2A 2ZGNA 4M3FA 5IK8A 4XSZF 2XPUA 3S8PA 1TQIA 2P17A 1NTCA 1YG2A 1MKMA 3WGHA 1IV8A 1C8NA 3WG2A 4EEFG 5JI7A 4V1PA 1SMYF 3KPHA 2BNOA 2QZ8A 1ZZBA 1S7EA 3HXLA 3LA2A 3ZN5A 3MMYB 4QX7A 4F52A 1WLWA 2PHLA 1CF7B 3WDXA 1WJEA 4NC8A 4XF4A 2EBIA 3A4CA 4OLLA 2JDKA 4IE5A 2XASA 4NIAA 1SQ4A 5M3FJ 4CEYB 3TWIA 3O1UA 4AXOA 4Q0PA 3ZFFC 2ZBKA 3GTQJ 2QQJA 1YQ8A 2ZA9A 3PIGA 4XUPA 3RQIA 2XBO3 1AWCA 1L3LA 3W21A 4GXLA 1J2XA 1W0OA 3E7LA 4XYXA 1UU6A 4QM8A 3KIOA 4UFLA 5M3MJ 2OZUA 4XMIA 2ZJCA 1PIV3 4RN5A 4M6YA 4W65A 2CS3A 2ZJRF 1SDDB 3D8CA 3L9JT 4BB3A 3ZXKA 2XPVA 2L5QA 5C8CC 5TSWA 5FFXA 2GNBA 4MXWA 2EQRA 4D6SA 4A3JJ 3VDDA 4PDWA 2DA7A 5K0UC 1UZVA 1Z21A 3LPGA 3S30A 4CH7A 3LIHA 4S2GA 5LRSA 2V4JC 3COAC 4BPZA 3MW2A 4QDSA 3C18A 4QPYA 3U14A 1RUJ3 3OIPA 5FJHA 4XJAA 3HHHA 4LIVA 4YWAA 5GTIC 1EY2A 1PUEE 4CCDA 1OYWA 1UNBA 2RR12 2WO7A 1MQTA 4FFGA 2XJUA 4GYGA 4B1MA 1UW8A 3VBFB 3VBUB 2D45A 3HMYA 5JSRA 1LJ9A 3LDBA 2L4MA 4IE7A 4CDUC 1Q56A 1SG3A 4Z2YA 5FTTC 2OA2A 1KGYA 4OHZA 5IYBJ 1LHVA 2GDFA 4P9JA 3OYFA 4RDUA 2XGCA 3MQ0A 2Q8OA 3ELNA 1RUG1 3H1WA 3QU3A 1OJLA 1R9TJ 1L7LA 5KXBA 3PJRA 4RQPC 5JOWA 1HV1A 4PI0A 2COMA 4YW2A 3VDCA 4JGYC 4XKBA 3AVRA 3PIPF 3LSPA 4LMYA 2D6NA 4GGGA 4DUXA 5H9QA 5BPDA 2X09A 3BP8A 1JZ6A 4YFXF 4FTHA 4ZU5A 5FXVA 1LTEA 4IERA 5FKLA 2QQMA 1IAWA 1LJ7A 3HM5A 1YQAA 1TME2 5F2SA 4GALA 4D3WA 4L92A 1D1CA 4OYUA 2TRTA 2M0MA 4YFZA 3S1NJ 1Q8VA 4BQAA 3LMMA 1XS9A 3S32A 3SLIA 4FO9A 5A1AA 2FZ1A 3EDPA 3PUFA 4JHZA 1PGL1 3OPWA 2BW8A 3OY8B 4QPGB 2JTVA 2FQPA 1JTYA 3DLAA 1COV1 2QVOA 2K9ZA 3C3VA 1JYCA 3KV5A 3CCJI 1TW3A 4JGYB 5LA0A 3RPUA 3OYJA 5FOBB 3RPUD 4L9NA 2WWYA 2HQRA 3A23A 1GMMA 4KT6A 5I91A 4ZJZA 4MSVA 3I4MJ 3NO8A 4D1QA 1H4HA 3POWA 4P5YA 2OBPA 2AXTC 3OB8A 4A0XA 1B35A 2LRPA 4U7BA 1HRV1 3CQOA 5DTDA 1QZYA 3B7MA 1I39A 3FMSA 1TG7A 3FN9A 3SHFA 4CE8A 5L7OC 4FXGB 1N1TA 3KQRA 1UZZA 5FKKA 5L73A 4B29A 3CC4I 2ELHA 3PMEA 1W6NA 1VBE1 4YM1A 3MFAA 2OV7A 3GF2A 2Y6GA 3T09A 4GIQA 3M1HA 4LKEA 1FNZA 3W5MA 2Z4FA 4MO3M 5B1AH 5JR3A 3VBRB 1YFUA 4ZYHA 2EPFA 5A7PA 3TGNA 2EB7A 3MFKA 5ANQA 5HBAA 4NRQA 3ACLA 4MGRA 3BG5A 2X5IC 1ZBA2 4CZZA 4F92B 1CAUA 5D4SA 2IA1A 2JB4A 5M5XJ 5C71A 5B4XA 3LDKA 3N7LA 1FV2A 4JV4A 4PJLA 4RYDA 3POFA 3IBMA 2KKOA 1WMXA 2DQLA 3I55I 5FYZA 5F7UA 4OI4A 4H4KC 4EROA 2PLYA 2JD4A 2X51A 1RUG3 4N43A 5JVTA 2XF6A 5E3MA 1UPIA 3IWFA 1I5ZA 1BBT1 1PK6C 2DVAA 3NV1A 4NUBA 1NK3P 2QTWB 1LOFA 2VU9A 5BQTA 1QU0A 3HUGA 2XONA 2NZ9A 4CA0A 2LM3A 1W90A 1S2BA 3IKTA 4J1XA 4KI5M 1IN8A 4A3XA 5JDBA 3N05A 2UXXA 4HK8A 1XGSA 2V9KA 4BXSV 1AKHB 2CV2A 4WBBA 1VBC3 3HOYJ 2HWB1 1XE7A 3C2BA 4JX0A 3S0MA 2F4PA 1SDWA 3JW4A 2B8MA 2OQ6A 1HRV2 2R0FA 1K83J 1LHNA 3KZ4C 2WBKA 4I7HA 5FLIA 4LMFA 1G2HA 2QDRA 3JCUC 1WGPA 4INDA 1W4MA 5EIYB 1MJ9A 4HF1A 3HG9A 2BW3B 2VMGA 2RKHA 1FOD3 1I5PA 3ZIXA 5FYMA 4J01A 1YIPA 1WA4A 2QCOA 3CCLI 1YWKA 2JVHA 3UJOA 5HS7A 3S1RJ 3ZN4A 4LOCA 3S3NA 3NEUA 3BIWE 3MICA 3R4DB 4OCTA 5E3NA 1UCXA 3HB9A 5GPCA 5BV6A 3EUHC 2WSVA 2D40A 4Y1VA 3GWZA 4Z2WA 4RAGA 3FL7A 4IGOA 3TNQA 3E6CC 3J8F1 3RZDJ 4IPAA 2YHJA 2YB7A 2DOAA 4B8EA 4BHCA 3M1CA 1SVOA 5CQEA 3U1KA 3WV6A 3ABTA 3WNMA 1GBGA 3TP3A 3CCSI 4QX0A 4JC1A 5CKTA 1VE0A 3QRFF 5FWJA 4ES9A 1G7YA 5DAPA 1URXA 4LBQA 4XFAA 1IGNA 2MLKA 2GH2A 2WQ4A 1P2FA 2LOOA 1K78A 5C8CB 2RAEA 1R081 2GZWA 5JLXA 3NW4A 3WR0A 2WS92 2ZHKA 3HRUA 4DB5A 5J40A 3S2HJ 1GZCA 1Y3TA 3AK0A 2M4GA 3B00A 2PLV2 2PMZN 5JVGF 2D3SA 3CUQA 2XPJA 4FPJA 4M3CB 4DRRA 4RGGA 2BXZA 4HX4A 2HWD3 2BOIA 1UOGA 1IN6A 2CDPA 4G3YC 4RGAA 3BZ6A 3QWLA 4B4CA 2NMOA 3GJBA 4DFSA 2VE1A 2VJJA 5A3NA 2X6YA 4X6RB 1ND3B 1NY71 1L7RA 3F21A 2CWSA 2RJLA 3N9MA 3HIFA 5JR2A 1CAWB 1Z1DA 4XDOA 1VIWB 1I1EA 1POGA 1KDKA 5EJZB 5A3OA 2VQAA 3WW1A 1SBFA 5DZGA 3H1MA 3FM3A 1G4DA 1GZWA 4A44A 1HB4A 2A71A 4YZ5A 2HFHA 4ZZDA 4ANJA 3SFIA 3GTJJ 2W08A 1W7PD 1SD7A 1FP1D 4E7KA 4PF5A 3N3HA 3I64A 2Y26A 1AJOA 4II2A 3CF6E 1K7AA 1YX3A 4HKLA 3V64A 3GJAA 1FP2A 3CCYA 3FC0A 4M4RA 2F17A 1O8PA 1YIFA 5LGUA 4GMP1 1O7LA 2JSPA 3WG3A 2KLOA 4UVAA 4UV8A 2V6EA 3FUOA 1DQ6A 4TWTA 1HXS3 3TDUC 4ZHNA 5K7HA 3F72A 4GWMA 1ALYA 2KT0A 1DHKB 5I0DA 1EV11 1F4AA 1FMD3 4CCOA 1FOD2 4B44A 1DZRA 4X6AJ 3S2DJ 1SLBA 4MLOA 1S7OA 4L2NA 3I2GA 1N75A 2ZEXA 1V9U2 1VJ2A 2WT2A 3BTXA 1JYTA 1JZ8A 5KWRA 3FM5A 1N25A 2JIJA 2I8DA 3LZZA 5T50A 2KP6A 2E2IJ 2PX9A 4XF1A 2YS9A 2GC0A 3F23A 3PTRB 3IV5A 4OFGA 2JJ7A 2DVBA 1BEV1 2ADDA 3L2WA 1UY4A 2XB0X 3C1DA 1JUHA 1FYLA 2EF6A 5C33A 4NMIA 4UVBA 3AM2A 4XBNA 3U4SA 3LSHA 2EIEA 3WU0A 2XC7A 3LD8A 1ZRFA 3BI3A 3CESA 4WZFA 1YJNI 4HX8A 2BVLA 5EG0A 2UWCA 3ZKUA 3Q8BA 9ANTA 2VKDA 4FCYA 1R5GA 4NPLA 2J1SA 3AG2H 2K9SA 4QD2A 1D0YA 1SCRA 2R073 5C3EJ 2PHFA 1LOAA 3M1EA 3Q8EA 4L9BA 2LTPA 3HBZA 4P9WA 3LSKA 3NNFA 4M4PA 5FP7A 2JG8A 5GLTA 3FHQA 3DPRC 3KFWX 1MJAA 3GCWA 2EIMH 2VTFA 2EH3A 2M4KA 2WDBA 2ACJA 3ZPYA 1PNGA 2F4LA 4XBFA 4OAZA 1UL9A 1VBC1 1IGOA 1QNWA 1VQOI 5IVBA 4UF0B 4FFFA 1Q8QA 2R7QA 3LB9A 3T4VA 4IUGA 4PQ9A 3OR2C 2LMDA 3DBHB 3F9KA 2L0KA 1KS5A 4F8AA 3M3QA 3GTPJ 1ASJ2 3AMHA 1W2TA 2XF5A 3WTTC 1EPWA 5F08A 1S0GA 5I8YA 2X6OA 4ASLA 2GP5A 4QX5A 1SVLA 2VPRA 3BOWA 4U0VA 5J47A 2W95A 4DEVA 1W8OA 3VB2A 4EN0A 1KZHA 4D94A 2Y30A 3I2HA 2V4AA 1TNRA 4FPOB 4IE4A 2DJNA 1RJ7A 3NL1A 5CISA 5FZ1A 2HXIA 2R7RA 3SEQA 4KH9A 1W9FA 1W6MA 3TN91 4AWXB 3VDDC 3AKPA 5FP3A 1JYWA 3U10A 2FBHA 5KK1A 2P81A 3I59B 4LA3A 1DDNA 1IKQA 4XVHA 3VD4A 3DLLF 1VQ9I 3BT9A 3ZSEA 5KHHA 2ZEYA 1PVC2 4PJ0C 2DUQA 3WDTA 1PO21 1GR3A 1FMD1 2Y6LA 3I0TA 1ZR2A 2UWBA 5AC91 3PVBB 3VBOA 2D2WA 5FYCA 2O0OA 3IZOA 1HQNA 2YUEA 3R6SA 5FPVA 4XMAA 2BTVC 1U3EM 2ZEZA 1DYPA 3KEQA 3CBNA 2GP3A 4ARXA 4YLZA 3TB0A 2LLKA 3HJRA 1UX7A 1TWGJ 3HUGB 3L00A 4IQ4A 1GP5A 1R1VA 1Y56A 3THPA 1UU5A 1G9CA 2W4SA 1NA1B 1TTYA 5FZLA 1CAXB 2RS33 4HAMA 3CC2I 5LHHA 4B4PA 5FZFA 2DPDA 1R5HA 5JLWA 2WYSA 2QQAA 1QOOA 5LB6A 2NMNA 4JOMA 3RIRA 2VC1A 4E7LA 4AVSA 3AMPA 1FOYA 4IXAA 1QHGA 2JZYA 2Q0AA 5FUNA 4QMAA 2KR2A 5HI0A 1CAUB 4RB1A 1ZREA 1CX4A 2HZDA 2ZNYA 2VNVA 3ZMVA 3P6BA 3TO6A 2HI3A 5IK5A 3UKTA 5JXIA 2HWB2 2ID3A 2D5HA 5C3RA 2XHNA 3RZMA 2DO7A 2HVQA 3FBYA 2Q2EB 4XACA 4Y5Z0 3JRIA 4K3UA 5B1BH 1HDDC 1CN1A 3U75A 4E4DX 3M3OA 4IESA 4FX0A 4SLIA 2RR13 1WPKA 1BMV1 2WADA 4NR1A 4BQ2A 3SXYA 5HV0A 2C6SA 1IW7F 3K3OA 4K20A 4HFSA 3H8UA 3MO4A 4NIGA 1ENSA 1UMZA 3WQ1A 2ARBA 5ACA2 1CZTA 5F32A 3VOEA 2FMLA 3LEMA 5D2AA 3O0VA 3C8XA 4FVVA 2W1QA 3ZXFA 3T1BA 4HX7A 5A7WB 4IEYA 4KITB 5FZ6A 2QQKA 2JKXA 5IYYA 2IXIA 1UF2C 3ZFEC 1UN1A 3ZXSA 4A3ZA 4U2AA 1J5YA 1AL23 4DQ2A 1N1VA 1MZFA 2LK2A 4IJAA 1VQNI 3WT3A 5CKMA 1AOYA 4KL1A 1YXWA 4HANA 2WFF2 3TN93 2CFOA 1EJ9A 3ZRGA 5AVPA 1SPPB 2XBO1 1X4OA 4WM7C 2K85A 4JGYA 4GH4C 3V42A 2R3SA 1VQ5I 3VKLA 1IG3A 4FPGA 4CCCA 3VSLA 5JSPA 5M5WJ 1W0UA 1REPC 4E70A 4XLNF 3IDEA 2C9AA 1A5JA 4NIDA 3B6CA 1Q8SA 1ND2A 2DWRA 2R7XA 3OR1C 4KMQA 3JRDA 1L0OC 1TWAJ 5DG2A 3U1XA 1S0CA 3F8BA 4QWNA 1FV3A 3CZJA 1K61A 2IXKA 4KWKA 2FMDA 1U12A 1S8NA 1ULPA 4YG6A 2NVUB 1DGLA 1JHJA 3I97A 2DT6A 2DU9A 3ZN1A 2K4JA 2VOVA 1G9BA 2HH9A 3HDDA 3TMOA 4FHTA 2HPIA 1Z91A 4Y17A 1MBKA 5K7PA 4FP2A 1JYIA 1LEDA 3H0DA 5FPXA 1Y9MA 2PHUA 4XF9A 4AI0A 1LVKA 1A78A 3MUY1 1V6IA 1ZLKA 2K3FA 2SLIA 5ACA1 4QQPA 2R7DA 4U36A 2Z69A 3HEIA 2QJVA 1AR71 3ZYIB 4CDQC 1RUH3 4YW3A 2ZMEA 5A32B 1PDNC 2IAIA 4Y22A 2D43A 3THDA 3VZKA 2D1HA 4ONUA 2O9LA 3OD4A 4DJAA 1CF7A 1D4M3 2RS32 5BNOC 4Y26A 1X1CA 4LO8A 1DQ1A 4NC6A 5E8IA 4D7NA 5FZDA 1H0BA 4JQTA 4OMDA 4UT5A 4O3MA 2X29A 5EPAA 4RR3C 4QXHA 4WF2A 4YIFA 1CPNA 1BK0A 1SFOJ 4IOAF 4BEHB 1AR91 4CDUB 2O0YA 3C2UA 1Z05A 4XLHA 1WWYA 1JUPA 1QIQA 5EZHA 4AU7A 1U5TC 2W46A 1YLFA 1FYUA 4D7TA 3LAJA 1ZZ6A 4BUPA 4ZPIA 2PFBA 4ESFA 4FAGA 2MEV2 2VZUA 3WOGA 1XDSA 5CVRA 2F5VA 3QD6A 4HVRA 1DU0A 4L18B 3A1YA 4PI2A 3D1NI 3GFLA 2RS11 3BG7A 3BJAA 5JWPA 1OCZH 3L2UA 3RTRA 3W2VA 5E88A 5CVVA 1BIAA 4AD9A 4PK4A 4PJYA 1AR61 3CDIA 4U87A 3ILNA 1XYPA 2DFHA 1H8TC 3LA7A 1QJX1 3DTIA 1HRV3 2BY2A 2NRAC 2Y6KA 4CXXA 4Q4V2 1BEV2 2EV0A 4LK6A 1XNDA 3VHNA 4XAAA 2HLEA 2BW3A 2XRLA 1J58A 1OLQA 2YC2A 4RHV2 4WXDA 3CUOA 3POSA 1WH7A 1POV3 4FBFA 1C4RA 1W8TA 1ZBE1 1XE0A 3RG0A 4CZCA 3JB4C 1QA6A 3J8F3 1PGW2 4XICA 3PU8A 3I71A 4ZDPA 3JB8A 4NB5A 1AKHA 1GFF2 5CKQA 4AI1A 4MGTA 4BQ4A 4X8PA 1XPXA 4E7ZA 3KB5A 3U07A 2RC4A 2X53S 2W7NA 5F3EA 3AXEA 2E32A 3HNBM 3UKGA 3JAMZ 1XX5A 2H6CA 3AG4H 4I6ZA 5FUIA 2DURA 3FXLA 1STZA 1RUD1 1MMDA 2E33A 1AR81 5T5PA 1IN5A 3E0JB 5IHRA 1RPWA 4HMZA 5AVAA 2LY1A 1VAMA 4CEWB 2Q1ZB 3LSGA 3PLQA 1QNYA 4A5NA 2ELJA 5J1RA 3MPBA 3WG7H 4ITVA 4LBMA 3USUB 2HYKA 3GZUC 1AR73 4YIIA 4YM3A 4GB31 3WE2A 3POYA 1MH3A 5FY5A 4ZONA 2K86A 2ZGMA 5M0TA 4BXXJ 1S0JA 3EPZA 3J26N 3K7AJ 1X1AA 4LLGF 3GXUA 4EWEA 2RS12 1EUTA 2Y0OA 4AK3A 2WS93 5GKAC 3M9AA 3P5BA 3DYPA 4GDFA 3T1LA 2DA5A 3KV9A 5GP9A 2WA3A 1OPCA 1KJRA 3HBLA 4BE0A 2BVVA 3I3EA 2A5ZA 5ICGA 5C6CA 1QJX2 3JQXA 4TYSA 3ZOBA 3SMHA 2MD5A 1SBDA 4IL6C 4DRVA 4RS8A 4FETA 2C6YA 4XF3A 3CJIC 1ND3A 2X48A 2N7GA 1OCRH 2WNEA 4FCAA 4YGDA 4CDGA 3Q8AA 3QH6A 2CQKA 2A07F 3VLBB 1LUJB 2JENA 4YVWA 3KT7A 3BYWA 4ABZA 3WCSA 4FTBA 2ESHA 3AZWA 1R093 5FYIA 4GFBA 4BIOA 5HS8A 3G6EI 1G8WA 4XFIA 3I3MA 2C1FA 1RR8C 3AVSA 4CZSA 1ULDA 3ZYPA 3W6VA 2XR4A 2ZKNA 3W9AA 1HIXA 2IP2A 1O3QA 5JLVA 2P7VB 4YG3A 5F37A 1U5YA 1S9HA 2QVSB 4HF0A 1KA8A 2VCBA 1RUD2 1UYPA 3H1CA 3DKYA 3K4KA 4CXFA 2YBKA 1GZWB 3R05A 4GH4B 5L3CA 2PXJA 4Y22B 3H42B 4IHVA 1NCQB 3HN3A 1PO12 1Y0UA 2GU9A 4RAYA 1IUYA 3FK6A 2G9GA 2O8OA 2FEZA 1GWMA 2ZHLA 4AIHA 3U21A 2ZMEC 4AEDC 2A68F 2E1MC 4OZXA 1EAH1 4QT6A 1V9U3 3H3UA 4AQSA 4RS5B 3PFIA 2V9VA 4DOUA 1W2AX 4XRMA 1F4KA 4XIOA 1Q43A 1TMF3 3U78A 3M7GA 1UG0A 2YFZA 3ST7A 1X8MA 5JUVA 4BK4A 4CUCA 1N1SA 4ZZLA 5FJKA 2CW0F 3IRQA 5EFUA 4RGSA 1YCIA 1VNDA 4QGNA 5J37A 1PM4A 1OOPA 4LB5A 4ZH4F 1P4XA 4A41A 4FSJA 1P4AA 5FZCA 4P96A 3VBUA 4M9ZA 2FDJA 1JUMA 2Z2SB 3ROUA 2VUJA 2LKSA 2ZXHA 3BG9A 4YELA 4XN3A 5EZGA 2ATFA 2YG0A 5IK4A 4EZHA 4LHKA 4QQ2A 5FZMA 1EP0A 3R4SA 5IAVA 1D0ZA 4BBSJ 4LKDA 2EILH 2HJIA 1WRJA 5LFAA 2A6WA 3S5QA 1ETOA 1ZN2A 3NNLA 2IC1A 4ENNA 3PSIA 2UWMA 1LGCA 2GWRA 4XF0A 3JBG1 2E53A 4EN7B 3OUIA 2QSHX 2O7OA 4UY8I 2RS13 2IGKA 1X33A 4Q4X2 4UBHA 2ZMKA 3QOPA 5ABJB 4XXPA 3A03A 2LVSA 1X19A 3MWMA 1O91A 1QXPA 3C2GA 5FY4A 3ZQQA 4H7MA 4XOPA 1BI3A 2YX7A 3L2YA 3GZ5A 2R7OA 1P8JA 3VSKA 2X8KA 4CCEA 2LY9A 1BQPA 1OLME 4AQ6A 3HKZA 4AAXA 3K10A 1UXXX 3C3WA 1OBNA 5FYTA 1DUXC 4AI8A 1RUNA 3L2HA 5AFEA 2WZR2 1F9KA 4IV1C 3KQ4B 2ZZQA 1GZ9A 5J8FA 2J7MA 5A3LA 4WVWA 1BKZA 1HLVA 1MGTA 3SCFA 1FIAA 2V1NA 4QPQA 1M06G 3BTYA 4CPBD 2CV0A 1E0EA 1UMHA 2R7SA 1YW9A 2IXJA 4D5CA 2NYXA 3GLXA 4XUTA 1SFPA 3POEA 5E1WA 1FNNA 2PA7A 1RR7A 2ETEA 3BZCA 2AACA 1QY4A 2XDVA 4Y13A 5JR7B 3AYAA 4HSRA 1TLHB 2FU4A 1WJ5A 3TW7A 3W58A 4OZOA 1PZ9A 4H55A 3BCWA 4JRAA 1LKXA 1H9PA 1MZ6A 2FMYA 3UKNA 1ONVA 5I0TA 3GZ6A 2J1VA 3H0GJ 2OKXA 3SC7X 3OYNA 2BUKA 2VOPA 1OF4A 4AI3A 1JTZX 2FXAA 3ELKA 1H0MA 1MVQA 3OD0A 2JA2A 3QH7A 4XFHA 1NZIA 2PN6A 1MH4A 2M30A 1G86A 2Q8EA 4E8CA 5FBJA 1QVTA 4AFCA 1GANA 3H50A 4MZUA 5FZKA 4I3GA 4KG0A 4I3PA 2P37A 2H1KA 3AFHA 2VW1A 4P02B 1POV1 5F1RA 3LSIA 1S5LC 1NX9A 1QQP3 2O61A 3ABLH 2DA1A 4Q47A 4M9SA 3KEOA 1HDPA 5LEJA 4OHWA 5C3PA 2R7UA 4R9AA 1X50A 2P3IA 1RKWA 3AL0B 4HSJA 1QGPA 2E7AA 1WW5A 3V7CA 2QQ8A 1QJZA 3JSPA 4O7XA 2VBWA 4HT1T 1I6HJ 1DGWX 3CTAA 4XJZA 4CO8A 2B7YA 3JRAA 3FHAA 2W1OA 2OPTA 3IB3A 3MZYA 4QXBA 4RGUA 5A3TA 1FPN3 3HQRA 1MMGA 1US2A 2STWA 3MIHA 5FZ4A 2VKVA 3B93A 4C9YA 3WHTA 5GLWA 1KU9A 4IEPA 3U9GA 3ZYRA 4PLMA 1CZSA 3O1MA 4ZS2A 4Y33A 1HRI2 2XHKA 2D6PA 1FEXA 5IVFA 1LEAA 5HLIA 5JHUA 2AQEA 1OISA 3IH2A 5A7OA 4IO9F 1KDMA 1H9GA 2EFQA 4RB0A 1MMSA 5DUUA 1D2SA 2KL4A 4BACA 4Z82A 2R5ZA 4NHYA 4C2TA 5L3EA 5HODA 1V6JA 3G1OA 2FHRA 4FT8A 2BWCA 3OYMA 1U5XA 1ACIA 1K42A 2M8GX 1VMFA 1NE6A 1SD5A 1W8FA 2DU0A 3RI8A 1RUF2 2VTXA 1IUFA 4P9YA 3GVAA 4BJ5C 5A3WA 4P9IA 3L2QA 2HTJA 4O5VA 3H7YA 4E2GA 4EGYA 2ZZJA 1REEA 3IPVB 2Y0SN 5A2QZ 4YZ2A 3DN7A 3QYEA 1YEWA 1VMHA 1S55A 4UW5A 1C28A 1V6KA 5FB2A 3NVCA 2RS53 4FISA 2AZ5A 3CMYA 3GEZA 1BM9A 1O4TA 1Y8RB 4S04A 4XQFA 4NHJA 5CFCA 4CYCA 1UY3A 3WINE 3G1MA 1JZ2A 1LCLA 2VZPA 2PMWB 4LLLA 5G04L 2IEKA 1V6OA 4ASKA 2VJ5A 4TXWA 4TZDA 1NG6A 2XAHA 4IVNA 1E57A 2VMFA 2I2SA 5F9TA 3L09A 5F1JA 4DGWB 3FLPA 1ZK8A 2BWAA 5CB7A 5A32A 4HNVA 4CRQA 2VXJA 2L9LA 3ZXEA 3BPZA 3I2KA 3RGBA 2E1OA 3FE5A 3LSDA 5FBZA 4A5MA 1W3XA 4XUOA 2A3YA 4BXFA 4UFHA 1GOGA 2HWF1 2PBIA 3KX2A 3GTLJ 5DZEA 3PURA 3ONQA 4HV6A 3B3QE 5FP4A 3GZAA 1H8AC 2K7LA 1UAAA 1CR7A 4MG2A 3ZQGA 4N4OB 1C1LA 5JXHA 3BTCA 2G9WA 3WQ0A 5L7OA 3KYCB 5EG0B 2KIMA 1G3TA 3BTIA 2HOAA 4D69A 3O8GA 3ACGA 2O8XA 2A6VA 5FKOA 3CP8A 4KIBA 4FP3A 1ZVFA 3T2OA 3MIBA 1LVAA 3ZQLA 4WM7A 4E7JA 2Z42A 4DMIA 1ZTRA 3RFRA 1NA1A 1W39A 3WF3A 4CXYA 2KZVA 2D3PA 2XL7A 4BGDA 3MFCA 1RVF2 5FYVA 4WM8C 2VQGA 4MHUA 3WODF 3A2KA 4RBOA 4W4ZA 3EETA 4G7OF 3ZSLA 3L2CA 4CYCB 1J1LA 2Y8KA 5E8GA 1BBT2 3HNYM 3U2RA 5J3LA 2CDOA 1AHDP 1BEV3 5EEHA 2CSOA 2ZB9A 3ZM8A 1GNZA 2WO2A 4S05A 2P5LC 1BIBA 2IXHA 2DA4A 4NIIA 1E3PA 4JCKA 1C0WA 3T2TA 5KXDA 4QKNA 3IL2A 4BQQA 2E31A 3PMSA 1W36C 1SFYA 4CU7A 4C91A 4UV9A 1HJFA 3F95A 4FTSA 1E2XA 4HYEA 2IVIB 2LC2A 4P9LA 1Q5OA 4G7ZF 1DDLA 4NBQA 1YIOA 3VBRC 2DFIA 3PQKA 1W6MB 3N9QA 2C0ZA 5A70A 2IFWA 1X4PA 1OUSA 4PDWB 3AZYA 3OF1A 1VF9A 4M71A 2F5FA 2FNPA 3R60A 2OCCH 1FAYA 4UNOA 1DQ2A 3VBFC 3G1LA 3VBUC 4Q4X1 2ARCA 3BR6A 1T98A 2KZGA 1OH3A 4DZGA 2QCSB 5GADJ 4DBRA 5JXGA 1A04A 1GYKA 2C9KA 2LS6A 1WJBA 4AFDA 3I9V2 1H1AA 4CCLA 5DQ0A 5K5RA 3ZR8X 3LQQA 4HRIA 1USTA 2JG9A 3AYDA 1VBB1 1VTNC 3QYBA 1FNYA 4OUMA 3C7GA 2PJRA 1J7KA 4B47A 5BNGA 1YS7A 4UXAA 3RSJA 3VZNA 1R1A2 3WY6A 4NNJA 1W8WA 2WNVB 5L3DA 2DA6A 4UW3A 4ZU4A 2VMIA 6PAXA 4DY5A 4PSXA 4PDWC 2PJRB 4PFOA 2CQNA 1BBYA 3TL4X 2DA2A 4KWUA 3Q9SA 2L9RA 1O3SA 5HDGA 4B3NA 2OQ7A 1W04A 5F0HA 1NXMA 1JUIA 1UYXA 2I45A 1RUI2 3M2MA 5T54A 2WUHA 3ACFA 1NCQC 2QQOA 2R063 2P6HA 4FPFA 4A4AA 4EGZA 4XJUA 5CYVA 5J09A 4MGYE 2ZGPA 1DQ0A 3T4HB 2RS51 3E1F1 1IXRC 3SH5A 4CUGA 1TWCJ 3RI4A 3J9SA 5LRRA 3UGFA 2WT1A 4L0ZB 4K6BA 2KDOA 4DYCA 4ASMB 1O7FA 3O8HA 3M3EA 2XRNA 1IG0A 2NOGA 2ADUA 1MSFC 2BFUS 2HYJA 1AYN1 2L9SA 1YI7A 1JGSA 3BOQA 5DUIA 3M07A 1V3FA 3PM1A 2QKMB 3HT2A 4Y4YA 2VC0A 3ABUA 3DGTA 1YS6A 3GTOJ 1YHFA 2GIVA 1OCOH 4G94A 1RHI2 4LUMA 4FFIA 3I59A 5FY9A 2R7EB 2YPDA 1CIYA 1NOVA 2CYFA 2YPRA 5CQGA 4LJHA 2H94A 1PVC3 2JA7J 1D4VB 2KJCA 3HVDA 1JW6A 3PO3J 1ULYA 2FNAA 1SAXA 1TL8A 1BLZA 4AR2A 3OV8A 2D3RA 1PUFA 2ZC2A 4IF4A 3RZLA 3H92A 5FLJA 3BN6A 4I0AA 2EFOA 5I0SA 1JT6A 1DGWY 3MKZA 4BS9A 1SFUA 1ULFA 1MR5A 2XVGA 1RUE1 2YXSA 2VY0A 5CYYA 3ZYHA 5I8TA 1JOJA 5FZAA 4BYYA 4MGZE 5E1RA 4IETA 2JB8A 1HOMA 3PVEA 4CDWC 3BTLA 3MGUA 1F35A 4K8RB 3LDRA 2XQRA 2EA4A 2V5YA 5LCWL 2OVUA 2PQSA 4F83A 2ZAAA 2O8KA 4UFMA 4HOOA 1UKGA 1FMVA 2ARAA 4GYIA 1OQDA 2PHDA 4NJ4A 1W6QB 4JKMA 1OD5A 5EWSA 5CKNA 1JT0A 4YG0A 2TCTA 4M3BA 5FYBA 3KP5A 4QLCU 4AC0A 5DUVA 2JE8A 2BHYA 1T6BX 2P34A 1KFXL 4K21A 1L7QA 5FYHA 2VGDA 3VPRA 3OGVA 2QQPA 2BOJA 1F8VA 1GLNA 4QDQA 1VLNA 5FQ0B 4QPWA 2L2OA 3OGGA 4OMYA 3WE3A 1VQ4I 1N1YA 3ATGA 1Q8PA 3PJYA 5AC93 5GZCA 4UFKA 3OL3A 2DYRH 4QX8A 4YNIA 1T33A 3FXQA 2I5UA 1NG7A 1I1GA 4LD5A 2CV6A 2BV4A 3DU5A 2WB1A 3IDCB 3RZJA 3DP7A 4KUMA 4MXVA 3CJRB 3ZQ7A 5DXDA 2X4HA 4M0NA 3P9CA 3SNMA 3RZGA 2CL2A 3OYBA 4COYA 3D4KA 3T0YA 1VALA 3AKQA 2ZGUA 1VBE3 2LF8A 4JDMA 1K4TA 2A3WA 2NOJB 3IPVA 4QHBA 4DEQA 4URAA 3SITA 4A6DA 1HN0A 4KMUX 1JXSA 1R23A 5JXJA 1MPXA 1QPIA 2VE8A 4UW6A 2EIGA 3ES1A 1ACCA 2Y0MA 1BW6A 1Z78A 3G7DA 5DD8A 2HYXA 2E5ZA 3UGGA 3ZYFA 4R4ZA 3N7KA 5KC5A 3CEWA 2F4MB 1ODMA 3DYMA 2ZO4A 3J7ZI 2IBDA 4OULA 4BNCA 1H89C 2DK5A 1T2KA 2FQ3A 3IAM2 2QSFX 3I2IA 3WP4A 1U8RA 3K4DA 1X7NA 4BQ3A 5CFCB 4KNYA 1HQWA 2CGPA 5L3BA 1VBB3 4Y1XA 1HC8A 2RMU1 5ABJA 3GO5A 2ZX4A 3DQVC 2QBYB 3EYYA 3OYIA 4ZTJA 1RHI3 1R4MB 5HLTA 3B9CA 4GWIA 4C2UA 3NQOA 2E7QA 3LWCA 5FCCA 4XOGA 1DP0A 3T1MA 3CZ6A 1R4NB 2R043 4IEWA 1VQPI 4EE2A 4NO4A 4ES8A 4MH0E 1IO2A 4QWQA 3HSEA 5BNOA 2JXAA 2DTRA 4GXOA 2BV6A 4XIKA 2VE9A 1D0XA 5FY0A 4WZCA 3ASNH 1EV7A 2KA3A 3D5SC 2XMLA 3D5RC 4CUAA 1D0GA 1ZZ8A 5JZGA 2VVFA 3ASIA 3ZKYA 3SKVA 4PLNA 4QM9A 2KDZA 3ZMSA 5GALA 3N9PA 1CZVA 1RIOH 1ND3C 1I6XA 4HDVA 1YC61 2QWWA 3D6EA 4CU9A 1OHFA 1LGBA 5B5EC 2PYTA 2MH9A 1EYBA 5FKBA 3I4NJ 2VW2A 3I5UA 2ORXA 2VODA 3U0ZA 3BIEA 2JUCA 3WU2C 4XUQA 4A3CJ 1N78A 4D6QA 4IXLA 1PIV1 4EJOA 1QPMA 4AI9A 3AP9A 2X0LA 3DKXA 2PHRA 4D0QA 4QDRA 4CP9A 3P9KA 2O1QA 1ZGJA 4JGZA 4G9SB 5J1YA 4BEHA 1B4AA 2JDZA 2DCZA 1SBEA 4AYUA 1FPN2 2ZMNA 3FMGA 3BR2A 3DECA 1N3OA 1WKYA 2LKXA 1CJDA 3VD3A 5B3SH 3A01A 1W9SA 2R072 4COUA 5HV4A 2ELKA 2Q1FA 3K1NA 2A6EF 1VQ6I 5EXOA 3CO7C 4BQ1A 3H3VK 4XTPA 1MSEC 4J00A 1W6NB 1SMTA 3RJRA 2DDUA 2ZJQF 3IUOA 5D8KB 3ISPA 2LKPA 3F22A 4XJ8A 2JDMA 3WTWC 1TME3 1GXPA 3LSJA 2YFUA 5ILUA 3MHZA 1VBE2 4DXSA 3MUZ1 2MHFA 5D8AB 3SQOA 4QQLA 1P92A 5LZ6A 1F4HA 1VBA1 4BQOA 1IPSA 4AFBA 2OW4A 1X3WB 2CHHA 4QAWA 1F43A 2RG4A 3S1QJ 3L2VA 2W24A 1RUF3 4HSLA 1XMKA 1ULEA 3CLQA 1IZ3A 2VOTA 1ETYA 3RMYA 2ESNA 2PEXA 4C30A 1QO0D 3B9IA 3ERED 2HS5A 3CF2A 2EWNA 2VCAA 3INAA 1VBB2 4JZRA 4GZ9A 2FF4A 1MEC1 2UUZA 1B9MA 1YTYA 1XNBA 4P1WA 1JKOC 1Y9GA 4GKYA 2L54A 1S3JA 3R4UA 2HWE1 2W94A 2OQRA 3AC0A 1VB2A 4AE2A 1SMVA 4X6QB 3OBRA 5BYNA 3VYRB 1SHWB 2VZOA 2DDAA 2EK5A 2E35A 5E3LA 1FOD1 1I9RA 1BL0A 3VUOA 1KEXA 2VAUA 4AVVA 2CU7A 1MD0A 5J96B 3E6DA 4FE7A 4QPGA 1NQJA 2OUMA 4OHYA 2CY6A 3KLNA 2L7KA 5EGOA 4LB6B 1QDOA 1VBD3 3TQNA 2YYOA 2HKXA 3NJYA 5BNNA 2B0LA 1AYN2 3PNTA 2JUGA 3SH3A 3I3BA 1K78B 4XL9A 4C8DA 1RNLA 4G7HF 2CJJA 3LAGA 1K45A 2P8TA 4N9IA 1H2NA 1EUUA 1NG0A 3RNSA 4E7HA 2PAEA 2HVRA 3VDAA 2Q2EA 3WP6A 2NNNA 1R092 2EAAA 4A7KA 4YYOA 2QSGX 1K5JA 1RC9A 1F5TA 3DBLB 2IT0A 3HTUA 5ANNA 4P5HA 4EYUA 1VAVA 1YOVB 3OYLA 5LEKA 1LFPA 1W8HA 4ESJA 3J4UH 3BALA 4LE3A 3KF5A 4U88A 5KHKA 2FBEA 4AGGA 1UZWA 2GBYA 4NAMA 3VODA 1T6SA 5IATA 2JICA 3D5OA 2WAQA 1VBC2 5E16A 2IRFG 5FZOB 5LBEA 4Q5OA 1W0TA 2DFBA 2F4OB 5FKMA 2YGLA 2PMHA 2B39A 3JUUA 4WVMA 3CJTB 1KD7A 5DZFA 1OA4A 3Q0WA 1RVF3 5M5YJ 5HPOA 2GMEA 1IQDC 3SFZA 2VKHA 2GXAA 4MGIE 1XB9A 2WS91 1MQTB 4Y52J 2ZGKA 2XAFA 2F2EA 5FD5A 1JJ6C 5IYDJ 4L9JA 5FV3A 2FBKA 1BXHA 4EWAA 2WA0A 1H8VA 2D6OX 4ET7A 1IS6A 3QP6A 2ZABA 4P00B 3WTXC 2E9QA 2RM22 4UUSB 2LBFB 3TBIA 3O5SA 1IJWC 3ZXDA 1XB4A 2DV9A 4A2UA 4Q4V1 1QEXA 4DZJA 4XDQA 1LE8B 5FPLA 2OTJI 4AFMA 2EFNA 4UXNA 2ETHA 3J7AY 2K9LA 4RLFA 5EQUA 1FWZA 1PVC1 3SXWA 3T0DA 4DO0A 5C70A 4XORA 4MHRA 4IX7A 1ZBE2 4B4RA 1FX7A 1GICA 3ZFGB 2LG4A 3BVCA 4N7IA 1OKRA 1N47A 1ENQA 4LK7A 1O4ZA 3MYXA 1K6YA 4AVBA 2CQXA 4ATFA 3OWTA 1F15A 4J1WA 3ZQIA 5CADA 2IA2A 4KBBA 2ICWG 2IXCA 2D93A 3IDBB 1TME1 1V0AA 3AJZA 2I07B 2AHQA 2PI0A 2ZXWH 1LOGA 3OGRA 2EVXA 2MGQA 1QU3A 3QCWA 2VH9A 1QJU3 1MS5A 2DMUA 5F5AA 3WNXA 1ZM1A 1TNTA 3AKSA 3NQHA 5D8AC 2DXIA 1UWWA 1IS4A 3JRGA 3GTKJ 2PLV3 1CIWA 2EAKA 3OYEA 4J19A 1QH7A 4MEXF 1O3TA 3WGIA 2JQ7A 4XKVA 1VBD2 4CHUA 4FOYA 3SEEA 2YSRA 4FI9A 5KAFC 4H2AA 4HKOA 3VKNA 2R062 4UFIA 3SISA 4BLJA 2DBIA 4TTGA 3VBSB 4LKFA 4UYBA 1FXZA 4JAAA 4PGHA 3AG1H 5FZIA 2B46X 3I3QA 3WDYA 3LA3A 3ERMA 3WDWA 5J1UA 5AONA 3G4SI 4HLTA 3I2DA 3ENRA 4HPKB 5K5OA 4IEJA 3OG2A 2LRDA 2XOMA 1ZZ9A 1F31A 2ZXIA 4Q4Y2 3TEXA 4LK0F 5KXCA 3URFA 3HOUJ 3LL7A 2VTXJ 4LFUA 5LGNA 4GQ7A 5E20A 3RJPA 1BMV2 4KMFA 2YC4A 4QGMA 1OUXA 3QAHA 2EZKA 1HN1A 1A34A 1YLLA 5DAWA 1HJGA 3UETA 1H4GA 1JKRC 5FMDA 2VZQA 2VT3A 2V1XA 3VBSC 2VNOA 2ZGTA 1GQGA 4BA6A 4IZZA 4M6XA 4FPHA 1PGSA 2JVGA 4XABA 2VONA 2JD9A 2Y6FA 1IHMA 4ASNA 4CP1A 1ZR4A 4CDQB 5IPAA 2XIGA 4XEZA 3AP7A 1HQCA 3SDBA 2B7EA 3DFGA 5T3NA 4QXKA 4FPEA 1K5MA 5A1LA 2XJPA 3NV3A 3C7OA 2ZX0A 2XBO2 1TWFJ 1PUFB 1S72I 4Q4V3 2Y48A 3O1TA 2F6CA 4JDNA 1VQLI 3J80Z 2BBAA 1VI0A 1Z67A 2L9VA 1EH7A 2DA3A 4V2FA 4LEJA 4RR3B 5FIXA 3LWFA 3H8OA 3VKOA 3HYIA 1ZZ7A 3ZDVA 1KITA 2CYYA 1WCMJ 4N90A 2MA3A 3LPFA 5CNAA 3KWVA 2N8GA 3OYCA 3J8F2 4YVSA 1NKGA 2FD8A 2OPWA 3V0AA 3HL2A 4C1WA 3H1YA 3ILFA 1XNCA 3K6GA 5J6XA 1QQP2 2AO9A 4PIZA 3VD9A 2BFUL 4E7SA 1GNYA 1KU3A 1X3ZB 1GWLA 1DFQA 5DUWA 2W1WA 3T30A 1UX6A 2WL1A 2JG8C 1SACA 3HQUA 4AHWA 2HEWF 2JE9A 3A0HC 5CLSA 5LA1A 1FOKA 4CYDA 3W3CA 1PP8F 2TNFA 1TC3C 3EUKL 5LATA 2XAQA 5DV5A 1CONA 2VL4A 2CUEA 1PO22 1WJCA 2XGDA 5IVYA 1OQEA 1LDKB 4N4NB 1OURA 1X1PA 2QLZA 1I3HA 5EF6A 5CJ9A 2MPFA 3J7YJ 4KGQA 4HA8A 3P3NA 1W5CC 2BHZA 3MPPG 5FLXZ 5A6QA 2ZX3A 2BE5F 3FBIB 3B01A 4FPKA 3VZJA 4KGGA 5C3SA 2P3YA 5A6XA 4XCAA 1MZBA 1NY72 3VWBA 1OVSA 3CO2A 2Y6HA 4YW1A 4L97A 2DCYA 1OR7C 2AR6A 2PQQA 4E4SA 1UIJA 4XQWA 2YBPA 4X1EA 2Y9YA 3JBG2 4MXWB 3WP3A 1JBCA 3GDBA 5F5QA 1E5HA 2DU1A 3S14J 1AL0G 1NLRA 3WEZA 2L7FP 3CL1A 2WNVA 1IXCA 2RJ2A 3B73A 4K40A 4X8NA 3M7AA 3H8RA 2DCTA 1R082 1ND2B 2J1AA 5F6LB 2WLPA 5F6KA 3HOBA 1GVJA 5EHDA 3BOPA 4FXKB 1YFXA 3KD4A 1K5MC 3CDLA 3IM0A 3VN4A 5FR3A 4UF0A 2MSYA 1WZ2A 3LEIA 1O5UA 3GNEA 2EINH 3WNKA 4M3CF 3LOIA 1CAVA 1PMIA 1XDUA 2M5WA 4Y5TA 5E17F 2WSUA 1ETWA 5FLHA 1BC8C 3K77A 1GQHA 5T55A 3LEKA 3IWZA 4PBOA 3I49A 4HKWA 2E60A 1PMJX 2R042 1NLQA 4FPLA 1TQMA 3Q3SA 1TEIA 1UD1A 3F8FA 3FF5A 3HPNA 1WCKA 2BZDA 3OYDA 4GB33 5A7WA 1FT9A 1SLIA 3WGGA 1ORKA 2DW4A 3CMMA 3I3LA 1X2NA 4XZPA 2DYCA 1IS3A 2WNUA 2HU9A 4M9XA 3KSCA 1G3YA 4HQEA 4LT5A 1PGW1 3GM8A 3LSRA 3WSOA 3RYKA 1TT0A 5F64A 2MBFA 4GKXA 3UESA 1OA2A 5E18F 1ZQ3P 3L7WA 3UJQA 2IS4A 2R16A 2RDRA 3FIWA 2MH2A 3V0BA 3E3VA 2VJXA 3BLYA 2O3FA 3I3DA 1IDYA 1BZWA 4COWA 4YW6A 5T5LA 1DIWA 2BZTA 1RMU2 2XAUA 3T2PA 1Y1VJ 1XC6A 3HC7A 1GLHA 5FZEA 5FRAA 3EXUA 1JKQC 5D8AA 2KRCA 1W2UA 1JZ4A 1VFCA 2HOEA 3FZVA 3KF3A 1KQRA 3UGHA 5DYMA 1U78A 3PUHA 4RGKA 4EQVA 4CDWA 1G59A 3UK9A 3N97A 3V7RA 1V9U1 4B1LA 4C1XA 4LO7A 4NWVA 2KHMA 4NROA 3F6VA 5CIRA 1WUVA 5ED4A 2JSCA 3AYCA 4EJWA 3F3XA 1OLMA 3VDXA 2DQRA 3HTSB 5DDJ3 1GV2A 1W05A 3A01B 4W6XA 4Q4X3 2ZCWA 2Y38A 1QH6A 2GXGA 1H8TA 2E2HJ 1AHSA 4RFT0 3H5AA 1RUOA 1ULGA 1CVNA 2HWD1 3Q5FA 4WVMB 1Y6IA 2Q8CA 3AL0C 1ZBA3 1N3PA 2H0VA 1WKMA 3KCCA 1LODA 2FJ1A 2KM2A 1JE8A 4R79A 3DEEA 3A0BC 5EJCA 1W3VA 1WJDA 4A3KJ 2A7AA 4F91B 2Q30A 5A3MA 3BKZA 3TOAA 3M8JA 2UYAA 2E36A 4NPRA 3WHCA 1R083 4P9FA 3JQWA 3H9AA 2LREA 1UHWA 3LEGA 2XROA 2W1UA 5IT3A 2DOFA 3F8NA 2CFXA 1HX6A 4PCQA 4XILA 3KZZA 2LP0A 2UV1A 4Q29A 4LBQB 1RMU1 4HV5A 5E1XA 1TQ5A 4BL0B 5ICCA 3WNPA 1SFXA 1AXZA 1JHFA 2JECA 3S1MJ 4LQRA 1LR5A 3AB0A 2ZGRA 4N53C 1PK6A 5FDBA 1O59A 2ZGQA 1R5ID 4XRFA 5CVIA 3EQLF 2CGNA 1DP3A 4R9DA 5E89A 2R5YB 1NUKA 5GM0A 4LLNA 2VUAA 1TP4A 1SLLA 4NHXA 1U5TB 3K4CA 2CV1A 3B94A 1QOSA 2X6WA <