1R093

Human rhinovirus 14 complexed with antiviral compound r 61837
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
236
Chain Sequence
b'GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Human rhinovirus 14 complexed with antiviral compound R 61837.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 38
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1990-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1r09300
1R093 1R092 1TMF2 1VBB3 1VBB2 4N43C 5AC93 4GMP3 3DPRA 1PO13 1VBC2 1FPN3 1FPN2 1B35A 3NAPC 1AR93 1AR92 4CEWB 3VBRC 1AL23 2HWF3 1HXS1 4N53A 5FMOL 1BEV1 4PDWB 1QJX3 1QJX2 4GB31 4QPGB 1Z7S3 4WM7A 4YVSB 1AUYA 4AEDC 1F2NA 3TN92 1QJU1 1BBT2 2PLV1 1QJY1 4JGYA 4RS5B 3VBUA 1ZBA2 1RHI3 1RHI2 2MEV1 4WM8B 1RUJ1 1H8TB 1CD3G 3ZFEC 5BNNA 5CFDB 1ZBE2 4Z92B 1GFF2 4LLFA 2HWC1 4RR3C 2ZZQA 1HXS3 4CDWC 4QPIA 1BEV3 4JGZA 4GB33 1C8M1 1QJU3 1EV12 2PLV3 1SMVA 1QJY3 1QJY2 1FOD1 1RMU2 3DPRC 1MQTB 1RUE1 3J8F3 3J8F2 1B35C 2FZ1A 2MEV3 1RUJ3 1R1A1 1PVC2 4N53C 1ND2A 3LOBA 2BFUS 4CDUB 4WM7C 1E57A 1R083 1R082 1AR81 4NWVA 1AR71 1RUF3 1RUF2 5A32B 4JGYC 5A33B 3VBUC 1VB2A 1C8M3 1NCQA 1RUG1 2XBO2 3FBMA 1FOD3 1W39A 5BNNC 1HX6A 1RUE3 1X33A 4CEWA 1HRV2 1R1A3 4CDXC 4QPIC 4PDWA 4YVSA 4QPGA 1EAH1 4JGZC 2GH8A 2BBVA 3VDDC 1POV3 1AR83 1AR82 1V9U1 2RS52 1AR73 1AR72 5JZGB 4Y4YA 1OOPB 2BFUL 1BMV2 1PO21 5C4WC 4RS5A 2HWB1 1RUG3 3IDEA 1TMF1 2HWE3 1RUC2 2HWE2 4WM8A 2FZ2A 1H8TA 1VBC1 1FPN1 5CFDA 2GSYA 2XPJA 3CJIB 5GKAC 5DDJ2 1QJX1 1VBD2 3TN91 1EAH3 1BBT1 1D4M2 2DF7A 1NCQC 2WZR2 3ZXAC 1NG0A 1RUH2 1V9U3 1ZBA1 1PO23 1RHI1 3VBHC 1MQTA 1NCRB 1TMF3 4CEWC 1RUI3 1RUI2 3JBG2 1VB4A 1VBC3 1ZBE1 1CJDA 4PDWC 4CDUA 5C8CA 5C9AB 5J98B 4IV3B 5K0UB 5A32A 4Q4V1 5A33A 3TN93 1BBT3 1EV11 2WS93 2WS92 1RMU1 1H8TC 1ZBA3 1VAKA 3J8F1 4GH4B 5CFDC 5BNPA 1PVC1 5ACA2 1VBA2 4EJRA 1RVF2 4FTSA 1ZBE3 1PGW2 1R081 2R062 1RUF1 3VBSA 4SBVA 4IV1C 5JZGA 1RB8G 4FTEA 2BPA2 1OOPA 4Q4V3 2R071 4Q4V2 4AEDB 4Q4Y2 1EV13 2XBO1 4RHV2 1NA1B 1RMU3 1VRH3 1VRH2 1POV0 4CDUC 4RQPA 1HRV1 3CJIA 1PGL2 1PVC3 2WWSA 5C8CB 1POV1 4RR3B 2RS51 2RS13 2RS12 5CFCB 1BMV1 2R073 2R072 1TME2 1VBE3 1VBE2 1RUC1 2HWE1 2XBO3 1NCRA 1AR61 1RUD3 1RUD2 3VBOB 5BNPB 5L7OB 2RS31 3M8LA 1NOVA 1HRV3 5C9AA 5DDJ1 4IV3A 5K0UA 4Q4X2 4BCUA 1VBD1 1OOPC 1D4M1 1OHFA 2WZR1 3VBSB 1RUH1 2X5IB 2RS53 3HAGA 1K5MB 1ND3B 5LK7B 1ASJ3 1ASJ2 4GH4A 1RUC3 3ZFFB 3CJIC 1RUI1 3JBG1 2RR12 1AR63 1ND2C 1AR62 4RQPB 2R043 2R042 2RS33 2RS32 3ZFGB 2QQPA 4Q4W3 4Q4W2 5DDJ3 4CDXB 1VBD3 1D4M3 2WZR3 4AEDA 3VDDB 5BNOB 2WS91 1RUH3 4NWWA 2ZTNA 1NCRC 1NA1A 2TBVA 1HRI2 1WCDJ 1PIV2 4CEYB 1VBA1 5ACA1 1AYN3 1AYN2 1RVF1 5C9AC 3JBG3 4IV3C 4Y5Z0 1IHMA 1PGW1 4YVSC 4QPGC 2R061 2VQ0A 5ABJB 3VBFB 4RR3A 5CFCA 1QQP2 2RMU2 4Q4Y1 4RS5C 4CDQB 4GH4C 4RHV1 1COV2 4WM8C 2HWD2 5D8AB 1VRH1 1MEC3 1MEC2 2RM23 2RM22 4YVWB 5AC92 3VBHB 1PO12 3VBOA 5L7OA 1PGL1 1FMD1 5ACA3 1VBA3 5FOJB 2WFF3 2WFF2 4N43B 1RVF3 1AL22 2HWF2 3NAPB 1Z7S2 2R063 2RS11 3VBRB 2X5IA 1NA1C 1K5MA 1TME1 1ND3A 1X36A 4Q4Y3 1VBE1 1MQTC 4RHV3 2BUKA 1NY71 1RUD1 3ZFFA 1C8NA 5J96B 3S6PA 5C8CC 1FMD3 1FMD2 3ZFGA 3ZFEB 4Q4X1 5CFCC 1HXS2 4CDXA 1QJZA 1BEV2 4GB32 3VDDA 5BNOA 1A6CA 4IV1B 4CDWB 1QJU2 2PLV2 5C4WA 1TME3 1ASJ1 3VBOC 5BNPC 5L7OC 4CEYA 2MEV2 2RR11 1RUJ2 1NY72 4FSJA 3DPRB 2R041 1B35B 2WLPA 1DDLA 5ABJA 4Q4W1 3VBSC 3VBFA 4N53B 2X5IC 2HWC3 2HWC2 4FTBA 5JZGC 4Q4X3 4WM7B 1K5MC 2Y26A 1ND3C 1C8M2 4CDQA 3JB8A 2IZWA 4JGYB 5D8AA 3VBUB 3ZFFC 3JB4C 4YVWA 1FOD2 1HRI1 3VBHA 1PIV1 1HQNA 4RQPC 1AYN1 1RUE2 1AYM1 2RR13 3ZFGC 2ZAHA 4N43A 1R1A2 5BNNB 3NAPA 1QQP1 2RMU1 3VBRA 5BNOC 4GMP0 3JD71 4QPIB 4JGZB 1COV1 2HWD1 1RUG2 1R091 4CEYC 1MEC1 5C4WB 2RM21 1VBB1 5AC91 4GMP1 1PO11 5FMOS 1HRI3 1M06G 1PIV3 1AR91 2WFF1 5ABJC 1AL21 1AYM3 1AYM2 2HWF1 3VBFC 1ND2B 3ZFEA 5K0UC 1Z7S1 1F8VA 1OPOA 1EAH2 1AL0G 4CDQC 1QQP3 2RMU3 4IV1A 4RFT0 4CDWA 1V9U2 3JD73 3JD72 5D8AC 1PO22 1NCQB 4YVWC 2HWB3 2HWB2 1COV3 2HWD3
chains in the Genus database with same CATH superfamily
1R092 3EMRA 1TMF2 3H3LA 3AK0A 3O7OA 1C5HA 2J42A 2P37A 3F95A 5GZEA 1LAJA 4D6QA 1QNWA 4GMP3 3ZVXA 1S0CA 4DB5A 2OS2A 1VBC2 4META 1FPN3 1UU5A 2DVGA 3H42B 3NAPC 4MZUA 2OYZA 3KQ4B 3VV1A 4CUBA 4LK7A 1JYVA 4N53A 1HXS1 1N47A 4AHWA 2XJUA 5FMOL 1O7FA 3H0OA 4KMQA 1PX4A 3PUQA 4I0AA 4KU7A 5DAQA 1ENXA 2Z4FA 3A7QA 1Z7S3 2VOVA 2YUEA 2X05A 1SLLA 2XOMA 1PGSA 1LHOA 2PAMA 1WUVA 1QJY1 2ZGMA 4JGYA 4QB1A 4IEVA 2XJRA 4RS5B 5CYYA 2NMNA 1HW5A 2WNVC 2GH2A 2XXZA 4R9BA 3WHTA 1JOJA 2AREA 5CADA 3OY8B 2G19A 4FP3A 2DWRA 3DXTA 3VHNA 3ZFEC 1VP6A 1CAVA 5BNNA 3OGVA 1XSQA 2VW0A 3FLPA 4CCCA 1ZBE2 4WZFA 4Z1VA 2HWC1 3DL3A 4RR3C 4ATFA 5IVFA 2W08A 2ZZQA 2VXJA 4MYEA 4AGVA 3AP9A 3MW2A 4XJ9A 2W5FA 1BEV3 3WQ7A 4GB33 2ZX0A 4E4ZA 2VUAA 2Q0AA 3IBMA 5LB6A 4DINB 3PTRB 3WP3A 1DQ1A 4EV0A 1V00A 4V1PA 3BPZA 2V73A 3HVDA 5FPBA 4B7EA 5K4LA 3WW2A 1E5HA 1HB2A 2ZX2A 3CEWA 4QB6A 3U75A 3VKNA 3ACLA 3NV2A 4I0WB 3J8F2 3GCWA 3QH6A 1WCKA 5A3MA 2MEV3 4E8CA 3K4ZA 4LTAA 1PVC2 5JVVA 5JMCA 1QEXA 3MIFA 4N53C 1ND2A 4ISRA 3K3OA 4OUEA 5FZLA 4N7UA 4YZ1A 1E57A 5FLJA 1DHKB 1R083 1AR81 1OD3A 2YFZA 3WF4A 5JXJA 1RUF3 4JTNA 4QX2A 1GNZA 1HKDA 3AFGA 1X50A 1IG0A 4JGYC 4LBQA 4XXAA 3PVBB 1NCQA 1U5XA 1ST8A 4AQSA 3INAA 3I3BA 1W8UA 4OYUA 2G9GA 1AX2A 1G9CA 3VZLA 3TWIA 4BISA 4QD2A 4DY3A 2D40A 5ANNA 2C5DA 3WW3A 4NIGA 2LROA 4F3JA 5B2GB 5BNNC 1TNRA 4FAHA 5C8WA 5C71A 4E4DX 2W87A 1TVGA 4IQPA 1HRV2 3OBZA 4QX0A 5LW9A 2D6KA 4PDWA 2K9ZA 4R52A 1EAH1 1F5FA 2W9XA 3D5OA 3LPGA 4AEKA 5ABJB 2RS52 1AR73 1FV2A 2G9ZA 1ZVFA 2J1UA 2WLQA 3FLRA 4A3XA 5LA0A 2IXIA 4LIUA 4H55A 4FPKA 2YPJA 4AI8A 1J1LA 1JHNA 2FCUA 2YYOA 2QKDA 4ARXA 4FPOB 3GDBA 3WF3A 5CVRA 2IC1A 4KG8A 2QQKA 5A3WA 3SQOA 3KVBA 1FPN1 4AQ2A 1REDA 1Y3TA 4KWJA 3I3EA 3CJIB 4AFBA 3P1IA 1HJFA 4QQ2A 4TN7A 5F32A 1L7QA 2G9FA 5GKAC 4S2FA 5DDJ2 4BE3A 1PVXA 3PVEA 1ZA4A 2HJIA 5T52A 5A7WA 2D43A 1Y7BA 3POJA 1S55A 3DYPA 1NCQC 5A1LA 2VCBA 4DRVA 4M3CB 3SCFA 5J7MA 4QPWA 3NJXA 2BRTA 4I2OA 3N9QA 2E31A 1W0NA 4CPBD 3VBHC 1G9DA 1MQTA 1EPWA 5DUUA 4FT8A 3GJAA 3CMGA 4PLOA 5FDBA 1VB4A 4AG4A 3ACHA 1G6NA 3M3EA 4PDWC 4CDUA 2IVIB 1DYPA 1FXZA 3I8TA 1VAVA 2WQ4A 4Z82A 1KEXA 2XVGA 4XMAA 5LCWL 4IV3B 3M1HA 1GP5A 2GC0A 2XLGA 1UOFA 3KZ4C 1PM7A 5FYIA 2A6XA 2JICA 3HQRA 4YW6A 3TN93 4BDVB 4QDRA 1XYOA 1EV11 3VZMA 4MXWB 3POFA 1O3RA 2WS93 4NHKA 5FLHA 3FE5A 3LA2A 1GU3A 1CAWA 1LGCA 2ET7A 1O4TA 5J09A 4LOTA 5HCHA 1RJ8A 2BW8A 4YW4A 1FI2A 4CE8A 3PNAA 4Y24A 2YXSA 3NJVA 2Y6KA 4INDA 4ES8A 2YU2A 3THPA 4AE2A 3J7LA 1D0HA 1CZVA 4FPHA 5EZWA 2EICA 1UX6A 2E7TA 1R081 3HWJA 2F4LA 1UZYA 1G86A 3ACGA 3LOIA 1T2XA 4FI9A 1Q3EA 1RUF1 1DG6A 3WEZA 3B3QE 2WT0A 4LBMA 2WO1A 2WA4A 3T2QA 5JZGA 1JYNA 2BPA2 4LUKA 5T55A 4XBLA 1N1VA 4Q4V2 4AEDB 2GNDA 1CPNA 1FX5A 3V0BB 2HBUA 2XBO1 3H8OA 4PLNA 1JUHA 4XYXA 2GNMA 1Q8QA 4XAEA 4BIOA 1XXNA 2VC9A 2DFCA 1MVEA 4Q0SA 3C7EA 1OI6A 2H0VA 2ARCA 3ZDSA 1NKGA 3WR0A 4BIFA 1ZZ6A 4CDUC 2VR4A 2XKOA 4TLGA 1VMJA 2QE3A 1XU2A 1DGWA 5A3TA 1RITA 4FCAA 5HCFA 3ES4A 1UZVA 2XHKA 1XBFA 4BQ3A 5FP8A 4IE7A 3WNNA 5JR2A 4P08A 1MVQA 4AI2A 3MGUA 1MS8A 2R072 1ODMA 5F5CA 1VBE2 1WMXA 5CAZA 3S5AA 1W28A 1SBDA 2VOXA 1NLQA 1UY3A 2I74A 3ECQA 3NVCA 1LR5A 1AR61 4F8AA 1TG7A 5BY5A 1CVNA 2QBXA 4H3WA 4NE9A 4Y20A 4XFAA 3M8LA 2JG9B 2DCJA 3VD7A 1FNZA 1NOVA 2A6VA 4COVA 4M4PA 1OUXA 4FBFA 1ENSA 1DBNA 2RE9A 1WLCA 4Q4X2 2P6HA 1OA4A 2KD7A 3BOWA 2VZTA 5JXHA 2GP3A 1H9WA 5DAWA 1RUH1 4E2QA 5B4NA 3B9CA 1OVPA 1W05A 4TWTA 3AP6A 3OD4A 4MO3M 2D44A 2VJXA 2HEYF 2JX9A 3N9OA 2Z42A 1Y9QA 5C3OA 3I2OA 1FATA 2DCTA 3LA3A 1GKBA 2BWAA 2WDBA 4A4AA 4BJ0A 1ASJ2 4I0BA 4GH4A 2A73B 1H2NA 5JMOA 3AYDA 2FMYA 4V2VA 4FAGA 4C0BA 3HT2A 2YU1A 3JBG1 1S2KA 1TEIA 4OHYA 4ITCA 1EP0A 3VKMA 1D2SA 1W3XA 3O1VA 3NNMA 3SEEA 2DTYA 3LF7A 2JG8B 2RS33 3TRSB 1W8TA 2CTVA 5FP3A 4CXXA 4E8DA 2A5ZA 3AXEA 4Q4W3 5IFTA 3UKNA 4CDXB 3S30A 1OXCA 1SLIA 3AKPA 1VBD3 1O8SA 3I2FA 3RZJA 4B4RA 1D4M3 1XYPA 2IFRA 2WZR3 4QGNA 5HPOA 1H1AA 2WS91 3OPWA 1GYKA 2A6WA 4LNVA 5FBZA 3KT4A 2WNUB 3R4UA 4WVWA 5FZ8A 5FK8A 4FO9A 4C1WA 3CZUA 2TBVA 3UJQA 5L9BA 2PHLA 2ZAAA 1WCDJ 4UT5A 1J3RA 2GNBA 1VLNA 4CP9B 5ACA1 2VW2A 1H1IA 1RVF1 4LBQD 2YG0A 5CBLA 5D1IA 4M0HA 3ZYFA 4GKYA 4HKLA 1KJLA 4LE3A 2R061 3RZKA 1OQEA 3AZYA 5F8PA 4JTOA 4FFGA 1ZZ7A 2Q1FA 5CFCA 3VHRA 2QQNA 1QQP2 4UW5A 5J36A 4RS5C 1LHNA 2OPWA 4X6RB 5FO8B 1V70A 3MV11 4ZS3A 2D6NA 4GH4C 1IKQA 3DN7A 1YRZA 3ZSEA 1N3PA 2I45A 4PT6A 1MEC3 5EJ3A 2JE8A 2P3IA 4YW5A 2RM23 4G3YC 3G6JB 2GP5A 3GHNA 4YFWA 1C5IA 3NJYA 2VCAA 1JTZX 1DF0A 3VBOA 5L7OA 4OI2A 1PGL1 1FMD1 2K2SA 1VBA3 4A7YA 5FZCA 1LU2A 3N7JA 4O9GA 4YG0A 1JN2P 4XF0A 4LITA 3PU3A 2VUJA 4Y5SA 4K7JA 2GMEA 3NAPB 1J3PA 4QX3A 5E89A 2DUPA 1Z7S2 2VCCA 4AK3A 2WNOA 3CU7A 3KHCA 1S0JA 2AH2A 1HV1A 4BQ5A 2RG4A 1UYYA 3KS7A 1W2OA 2DCKA 3FJSA 3W59A 1XNAA 1K5MA 1QH7A 2PELA 3A22A 3B94A 1GANA 5FZOB 3U4SA 1CX4A 3FFZA 1GZCA 5FZMA 1XOYA 3GYDA 3HNMA 1JH5A 3SITA 3AZZA 4RHV3 1NY71 4YM3A 4CRQA 3I3MA 3FX3A 1YQ6A 3H8UA 4XDPA 3RMYA 4AGRA 3UKTA 5I8YA 1BKZA 4HT1T 2OUHA 1DLLA 2ZOEB 5C8CC 3OGSA 4HZFA 3BU0A 1S0FA 3ZFGA 3ZFEB 5DAVA 5CFCC 3EBRA 4CA9A 3R05A 5A6XA 3THTA 2R0HA 1PMHX 1QJZA 3Q8EA 1BEV2 2BOJA 5SV8A 4FXGB 2R1DA 4GB32 3RQ0A 2VVDA 3POGA 3VDDA 5F6LB 3AZWA 2ZCWA 1QXJA 1EY2A 3OG2A 3OBRA 3MBWA 5IVEA 2GC1A 4DXZA 3RWKX 3I2GA 3N3HA 3NO8A 3MUZ1 5EWSA 2YGLA 1W8OA 1GR3A 3VBOC 5L7OC 2OZJA 2MEV2 2GMPA 2RR11 4IEZA 3RS6A 2R32A 3M2MA 4FSJA 2G1MA 3R4SA 2JECA 2GMMA 3LE0A 4IETA 3CF6E 3VDCA 4C90A 1GZ9A 4CVUA 4RGAA 3AP4A 5FZGA 4IERA 4OI0A 4Q4W1 1IPJA 3VBSC 1NZIA 4N53B 3RYKA 3VBFA 1RTVA 2DBNA 5EV7A 2BERA 4OULA 2VMHA 1L7RA 3J26N 4ZHNA 4AL9A 1K5MC 2Y26A 2JE7A 3NNJA 5FREA 1W03A 2WL1A 4MHUA 2OIIA 3DGTA 4AI9A 3MDPA 3RVHA 3JB8A 3BYWA 3MFAA 2LS6A 4JGYB 3T0DA 1DQ4A 2AR6A 2EAAA 2EF6A 4YVWA 5FMDA 4BMBA 1HRI1 1OA2A 5LA2A 1F15A 3A0KA 5DPNA 2ZACA 5LEKA 5FYCA 1HQNA 2Y0IA 4RQPC 4DY5A 2JDUA 1AYM1 2CYFA 1J3QA 3ZFGC 1J83A 2C9KA 1S0EA 3MO4A 4CU7A 1CAVB 4DXSA 5BNNB 4NUBA 4XQ4A 5I0RA 3LIHA 2KM2A 3J7HA 4OLLA 2YMZA 4CZSA 4AVVA 2JIGA 2RMU1 2F4PA 1H8VA 1CESA 4JRAA 4L8QA 4U36A 5FRAA 4CP0A 3AKQA 1SHWB 2Y34A 2UWCA 1F4HA 2WN2A 2W52A 4OCTA 4G4FA 2OA2A 2HWD1 3VKOA 1G8WA 1R091 1S0DA 2ZX4A 5FY7A 1MEC1 2JDZA 3I59A 2RM21 4Y1ZA 2GC3A 4CXWA 3AMMA 4KWKA 2JDMA 1YI7A 4GA9A 2V09A 4MH0E 3S5QA 1PIV3 4CYDA 5KWRA 3NV4A 2AEZA 3QOPA 2NP0A 4M01A 3VBFC 2FD8A 1ND2B 3ZSMA 2CL2A 3OD0A 4OQ9A 4YGBA 4A45A 2NLRA 1SFNA 4KBZA 5C7GA 2VCMA 1AL0G 5IK7A 4CDWA 5LRSA 4AI1A 4ZONA 3JD72 1MR5A 2CAUA 3T4VA 3O1OA 1ZRDA 2W1SA 1NCQB 1O5UA 1ULEA 4MLOA 2JEMA 2HWB3 4YVWC 4DZGA 1COV3 2BP6A 1DGRA 1RXFA 3ZXLA 4XJUA 3ASIA 1XE8A 3IDCB 2JE9A 1VBB3 4J1WA 3ELNA 5AC93 2YGMA 2FBEA 1EUUA 1PMJX 4CCDA 2Y33A 2EIDA 5IK5A 4UBHA 1AR92 4RL7A 4NR1A 5I0SA 3MF9A 4CTEA 5BV6A 3N9MA 2HWF3 2RVAA 4PDWB 4FPYA 2HBTA 1QJX2 4WM7A 1A3KA 1AUYA 1DFQA 1F2NA 1NAEA 2W47A 3TN92 4AEDC 5IHRA 4XW3A 1CJPA 3WX5A 5JSRA 1KFUL 4HOOA 1X8MA 2J1RA 4IL7A 1H0BA 1QNYA 1IS6A 2NPIA 5JPNB 2O14A 4K8RB 4O9EA 3UNPA 3IT8A 1RHI3 1UPSA 2YC2A 1YFXA 3U11A 4CU6A 3AP7A 1UY4A 5FK7A 5IUQA 2A6ZA 3KF5A 5FYHA 1V6NA 1VAMA 2AZ5A 4XFBA 4MGSA 2AC1A 1W2AX 2EXKA 4BXSV 4Q8LA 4Z92B 2OUJA 4D7SA 4LORA 3WNXA 1S0IA 3HNYM 3LWCA 4QU1A 2H6CA 1HXS3 4CDWC 1YFWA 3VD3A 1W8ZA 4QPIA 4B4PA 5A7WB 1LULA 4OZOA 2WYSA 3A23A 3QCWA 5CZKA 1GWMA 4IEWA 2R49A 1W6PA 5FTTC 5AFEA 4O61A 1KXGA 1GQHA 5F39A 4TXWA 1ALYA 2FDKA 4BB3A 1OSGA 4U2AA 4EN0A 1LKNA 2VO5A 1QJY3 2YBSA 3HJRA 4QXBA 1GZWA 2YB7A 2BJSA 1MQTB 1U5YA 1I9RA 2VXRA 2PAEA 1JS9A 1Q5OA 1ZM1A 2JG9C 2XH6A 4XETA 3SXWA 1ZA7A 3USUA 2E53A 3IM0A 5BPXA 5FXWA 2ZHKA 1SCSA 3WUDA 1IKPA 2XQRA 3I2KA 4Q29A 4XMIA 5APAA 4DXRA 1JHJA 5FCCA 4WM7C 3OUHA 2B9VA 2YV8A 1D0GA 3IB3A 4LHNA 4CDUB 3CBNA 1GOFA 3CLPA 3N4MA 1KDKA 3X29B 5JSOA 1US2A 2XG3A 3LQCA 4GJZA 4GAZA 3ROUA 3VDBA 1UXXX 2B8MA 2FCVA 2C6SA 1NQDA 3DKQA 1RUG1 1RL3A 2QQIA 4YM0A 4RGKA 3LDBA 3ST7A 2E51A 5F9TA 1LGBA 1DQ5A 4A7KA 5FJKA 4CUAA 5KHIA 2ZGUA 1CAWB 4XZPA 3F2ZA 3MW4A 3WNMA 1KGYA 2VVFA 1F31A 4CCNA 4MV2A 4AHXA 1JMUB 1HX6A 1HIXA 3ATGA 1RGSA 2IXLA 2YZ4A 4AVTA 3KMHA 4FOWA 4YM2A 2XLFA 1AZDA 4E4SA 4CDXC 4QPIC 4YW2A 1GWLA 3ZXFA 4QPGA 3KWVA 2BBVA 4PJYA 1AR83 1V9U1 3VLBB 3H1WA 2UY9A 5JZGB 4BYYA 5A1FA 3O0XA 3EQEA 4N90A 3ZKUA 1BMV2 1SLAA 3O1SA 2JXAA 2HWB1 2P1BA 4FFHA 3RJ2X 4QXKA 2WINB 1OFNA 2HWE2 4WM8A 3QBQA 5A80A 2GZWA 4Z2AA 4HETA 3PDQA 1H8TA 3C8XA 4K20A 4RYDA 2FZ2A 3ZR5A 1WW7A 5K8SA 3H8XA 2WAOA 5FY1A 1WMDA 4QKBA 5FY4A 5FY5A 5CFDA 4R4ZA 5AVPA 2PQQA 1YFYA 3WUCA 4Y4RA 4F83A 2D98A 3FFQA 2VU9A 1O5LA 4NIIA 4KU8A 4IEOA 5FPAA 1O3TA 2R30A 2TUNA 4C1XA 1LGNA 3U78A 2A1XA 1VBD2 1ENRA 3LEIA 4HK8A 1EAH3 3ZXDA 1BBT1 1D4M2 2DF7A 2WZR2 3QH7A 1M4WA 3FBYA 4Y22A 2D6OX 4HVOA 4H7MA 3FMGA 2BNNA 3H7YA 4XCAA 3ZYIB 1ZBA1 1LJ7A 2FDFA 2D97A 1RHI1 2B46X 3KD4A 2ZKLA 4XFCA 5KHHA 3RYPA 3WHUA 5JDBA 3E5QA 3OGJA 3ZLIA 2D6PA 1RUI2 3G7DA 4S2DA 1UCXA 2WN3A 4IEYA 1QJEA 3ZPYA 4CP2A 1ZRFA 1CJDA 3KB5A 3ZPOA 2DV9A 1NLRA 2XL7A 4Q5OA 2DVAA 1LHUA 1UU4A 2ZMLA 5LBCA 5J98B 2CWMA 4TLFA 1MZFA 5F3CA 4J1XA 3LEKA 5A32A 4GALA 3VN4A 4Q4V1 5CISA 3BCWA 5A33A 2VZUA 4BOWA 5GZFA 3WT3A 3K3NA 4TTGA 5KC6A 4NHLA 1NZCA 2W92A 4LO4B 4XJAA 5DMYA 5FZ0A 5I0DA 3BTZA 1RMU1 1H8TC 4KH9A 3AMHA 3QLQA 5FYMA 5JUVA 1DLCA 2J22A 3W21A 1OH3A 3NNGA 4GH4B 5CFDC 3MFCA 5BNPA 2RJLA 1AF9A 2QVSB 4IGOA 1VBA2 3EHKA 1D4VB 1WD4A 3IKWA 4JHTA 1BK1A 4EJRA 1YI9A 2X53S 4EZ4A 4FTSA 4N8MA 3TOJA 1N3OA 5FP9A 1SPPA 5A3PA 5L36A 4JX0A 3ZN5A 3KGLA 4LKFA 2ET1A 3DYOA 1APNA 3O0VA 3SLIA 2YC4A 3E5UA 2W39A 2ZBJA 2P2KA 3NWKA 2DVDA 2CWSA 2OKXA 1N1YA 2CGNA 2R071 3BTAA 4L11A 1PNGA 3TB0A 1GSLA 4YG3A 3A0NA 5DQ0A 1EV13 1N1SA 3E5XA 3DCQA 2WZEA 1QOTA 5IK8A 3RYRA 2VZRA 4RHV2 4D0QA 2WYFA 2Q4SA 2ZHMA 1VRH3 3I54A 2A7AA 2EA7A 3OOXA 2B45X 2I07B 1CAUA 4Q0QA 3AYAA 2W0XA 2OQ6A 4JV4A 1QJFA 1BHGA 1UF2C 2ZJCA 4LMFA 5LWBA 1W8WA 3WV6A 5C5UA 3C7GA 2WWSA 4LHLA 5LA9A 5C8CB 4XJ8A 1ZNPA 3MZHA 2RS12 2ZGKA 1ULCA 5LASA 5CFCB 1YIPA 4GQ7A 4LK6A 5F3IA 3NL1A 4BQ1A 2DTWA 3K4DA 4HK9A 3UV9A 1JW6A 3WG4A 4XAAA 2ORZA 4RFRB 1RUC1 3ZSJA 4EROA 2XDVA 2XBO3 3WCSA 1URXA 1NCRA 3ORJA 2P3JA 2YC0A 4NIAA 2XL9A 1RUD2 1XU1A 2O8QA 4JKLA 4BHPA 5EYXA 3LIGA 2ZGQA 1W04A 3E6BA 4YYOA 1WBFA 3VBOB 5L7OB 3DF0A 4QX7A 2BDRA 4CCLA 1S1AA 4DEQA 2A3XA 2Z2SB 3OSDA 4XJWA 3RZLA 2WIIB 3N7MA 4K1ZA 2WNEA 5FZBA 5K0UA 1KDMA 3I2DA 4L97A 3LGRA 3ZIWA 2XWBB 5BUVA 3H8RA 3VBSB 3WDWA 2NMOA 1SLBA 1UZ0A 2RHPA 3HAGA 4GULA 1PHMA 5G04L 5FWJA 1Z0HA 3W58A 5CB7A 1K5MB 4P9IA 1IPKA 3TEXA 2PHDA 4OQ8A 2JB4A 3IAPA 3VZOA 2F6BA 3NMBA 3TNPB 4AVCA 1GWKA 4DQAA 2XUMA 1GMMA 2WQZC 4QKFA 3WW4A 2YHJA 4OHZA 2A3WA 5F7UA 1GZTA 4BWOA 3MV01 1AR63 1N1TA 1ND2C 1UPIA 1SFPA 2BZDA 4YGCA 5FZEA 3Q8CA 4QXHA 1CAXA 3PL0A 3IPVA 4RQPB 2R042 1DQ2A 3BPSA 3BUCA 2AENA 2JDHA 3ZFGB 3U4XA 2XGXA 5FPLA 4AI0A 2IXCA 2VZVA 2IXKA 4XFFA 1FNYA 2ZXQA 2WT2A 3Q9OA 5E88A 5JLVA 4UFIA 2ZGOA 3UJOA 1XRUA 1WD3A 1XB9A 2VMEA 4N7IA 3VDDB 1A8DA 3B69A 1RUH3 4KGQA 2N7GA 5EPAA 5L9VA 2A70A 3KHBA 1NCRC 5DG2A 1NA1A 1A8MA 2ZGLA 4KWLA 3RRDA 3Q8BA 4WVZA 3ALQA 2HH9A 4HPKB 3SH4A 1KQRA 1X9TA 4OZXA 4QWNA 4XE9A 5FUPA 1PIV2 1RINA 1VJ2A 1XNKA 1X7NA 2C0ZA 2MPFA 1AYN2 2OT7A 2Q30A 3AM2A 4XCBA 1REEA 3JBG3 4ZU4A 2VZ3A 2X10A 4K9SA 1PGW1 4EWAA 1UWWA 5T3NA 2QQOA 5FO7B 3WF1A 1S0BA 3VBFB 2WA3A 1LCLA 3AKSA 1REFA 4LBNA 3T4HB 3E97A 3CQOA 1H9PA 4HKWA 1GOHA 1U5ZA 4JRLA 1ZZ8A 2C24A 4Q4Y1 4UF0A 3E6DA 1UOJA 5GLWA 3BKZA 4UYBA 4PIZA 3SCHA 4XFHA 1LTEA 3LDRA 5FYUA 1COV2 4M3CE 3WQ1A 3H3UA 4Z8BA 2VMFA 2YPDA 3HD8B 1VRH1 1I1EA 1AXZA 1SZBA 2C4XA 3B7MA 5JOWA 2D3SA 4YVWB 4LBKA 3USSA 3VD4A 2B7YA 1LECA 4EWDA 5AC92 4HN0A 5FPZA 4LKEA 2WZPP 1X82A 4OHVA 5ACA3 4LQRA 2WFF3 1TZOA 3BIWE 1XJAA 2ID4A 5I0UA 5J1XA 4E9KA 1RVF3 2YFUA 4R9CA 2HWF2 2OX0A 5DZFA 3TEWA 1CX1A 5M0TA 3O1RA 5KXEA 4BQWA 4OI1A 4XBNA 4AR2A 2NQYA 2R063 1W8FA 4LLOA 3UKVA 1NLSA 1H2MA 4GIQA 5A6QA 3PHMA 4LO8A 1ZREA 1NA1C 5FZDA 5LA1A 1TME1 4YW1A 3LZZA 1MQTC 4FQ4A 2LALA 1H6YA 2YBPA 3NKGA 2B39A 3I59B 1D7PM 1DCSA 2BYVE 5LBEA 2XVLA 1GNHA 1V6KA 3GM8A 1YHFA 3N7KA 1C8NA 4QGMA 5FZ1A 5EHDA 4YARA 4UBGA 2VZ1A 2JDPA 1FMD3 3IIIA 5T5OA 1Y9MA 4WVMA 1JBCA 1US3A 1C4RA 1HXS2 1W9SA 4BH9A 2QFEA 1HB3A 2QUOA 2CSGA 3VKLA 1CQ9A 3POEA 5KBFA 4HKOA 5BNOA 5H9QA 1YJLA 3HT1A 1UN1A 4CDWB 5J3UA 2EXJA 1YNAA 4BXFA 4NAOA 1NE6A 1OKOA 5C4WA 3CZJA 3BALA 4W6YA 1KS5A 4HMZA 4DEVA 4NOTA 1P8JA 1BLZA 5FYSA 5H9PA 4Y3OA 1JU3A 5BNQA 2X8KA 4MHRA 3V56A 4HL0A 2W1QA 1QF3A 2WLPA 3M4FA 4MXVA 5ABJA 1DYKA 2GAUA 2VNGA 1E5SA 4FTBA 2HWC2 5JZGC 1K3IA 4ZXEA 1J59A 1EPZA 1MS9A 2DVFA 4WM7B 3JCIA 4A7ZA 2K46A 5FZ7A 1O3QA 5FP7A 4JAAA 2ZABA 4C0HA 1POQA 4M0NA 4E4HA 4CDQA 3ZXJA 1SG3A 3SCGA 3DXUA 5D8AA 1UO9A 3MIGA 3JB4C 1JYWA 1O59A 1X9PA 5DXDA 1YQCA 3M3OA 3A4UA 3APBA 4HG6B 4L9BA 2ZGNA 4KWUA 3K4AA 3OF1A 3QACA 4Z07A 3THDA 2VE1A 2RR13 3CKHA 2RDNA 2ZAHA 1LHWA 5IFPA 1YCIA 5KC5A 3WP5A 1W6OA 3FZ3A 2LTNA 2F17A 1MZEA 2VNOA 4J25A 1U0AA 2X09A 1SBEA 4I3PA 4IEXA 2FHRA 4NROA 4P00B 5BXXA 3RFRA 5BNOC 2VPVA 4GMP0 3T3YA 3JD71 1QH6A 2O0OA 4QPIB 5AVAA 3ZYBA 3H3ZA 5IAVA 3N7LA 1W6PB 4XDQA 2R6QA 1F4AA 4P9WA 3OUJA 4OMDA 5JSPA 2JWPA 1UNBA 1WW5A 1WZXA 1WBLA 1I5PA 3U07A 1GZWB 5JPMB 2W95A 3WDTA 1PO11 1HRI3 4XF1A 3JQWA 3QD6A 3ENRA 1AR91 2WFF1 3PVOA 2O1QA 4TYSA 3USUB 3MIDA 4A42A 5ABJC 1AL21 1AYM3 4I09A 1MS0A 1V0AA 4QPYA 3AX4A 5JXIA 4HXCA 4QX5A 4NAMA 4P14A 2CNAA 1F8VA 3K2OA 4URTA 5ISLA 1PK6A 1ULOA 1EAH2 2HYXA 1O91A 2PQSA 3R4DB 4FXKB 4UFJA 4XHBA 5K7PA 4CDQC 2RMU3 4IV1A 4B29A 1JYTA 1R64A 5D8AC 4XUPA 4A3ZA 4CCMA 1LOAA 4IEPA 3R0RA 1Y4WA 5LATA 4XUQA 4COUA 2VBDA 2HWD3 1LOGA 3WDXA 1R093 3WQ0A 1QWRA 3ILFA 4YZ5A 3H50A 1F9KA 1YXWA 3W9AA 3PU8A 4MVTA 3DPRA 5A70A 5A3LA 4B1MA 2UURA 1FPN2 4LO6B 3K77A 5EFUA 2J1EA 2CV6A 2Z69A 4HANA 5A7OA 4QHBA 5JIUA 2GDFA 3TNQA 4NIHA 1SEFA 2QQLA 2VMGA 4QPGB 2DBIA 4OUMA 3ZM8A 4DMIA 1C1FA 3PTYA 2E9QA 1GQPA 1Q8VA 3OJBA 2DYCA 4NRMA 1QJU1 2PLV1 4XACA 4P9GA 3IIAA 1MS1A 2ZEXA 2PHRA 1JZ2A 2V5YA 5F2SA 3VBUA 4EYUA 2VBPA 1JZ8A 3I2IA 2ZX3A 4FPJA 1DGRN 4WM8B 1RUJ1 1H8TB 1MS5A 3OB8A 3OUIA 1LENA 4Q8KA 3O1MA 3LEGA 3BIEA 1UYXA 5CFDB 3WF0A 3WP6A 4XFIA 2ZX1A 5I0TA 1PK6C 3U37A 3HN3A 4LLFA 4QM8A 2D5HA 4Y5TA 5KXDA 2VQAA 4YM1A 1WA6X 3TYJA 1ULFA 2CDPA 1ZRIA 1U12A 1UY0A 1C8M1 5E1RA 3BVCA 4Y22B 5T5LA 1WCQA 1CN1A 3MLKA 4XUTA 1JOBA 1EV12 2Z79A 3M3CA 4IXLA 3ZIXA 4EN8B 5CIRA 1FOD1 3ZYJB 2D3RA 4AEJA 4YSFA 3DPRC 1RUE1 3J8F3 4GWJA 3LSDA 3KV6A 3AYEA 1R1A1 1DIWA 3NW4A 3KCCA 1XE7A 1YQ5A 1HJGA 2ES3A 2RDQA 1JU4A 5TSWA 3BU7A 1OURA 2BFUS 5LRRA 5D2AA 1R082 4QXCA 2WKKA 3URFA 1OLMA 1O4ZA 2BEOA 1RUF2 4KI5M 5FZ4A 2P5BA 3SKVA 4XXPA 2GU9A 5A32B 2Y6LA 1OVSA 2P6CA 3NV1A 3AMPA 1OA3A 5FBJA 4CCOA 3C7HA 3P3PA 1PZ7A 3VBUC 5A33B 1VB2A 4NPMA 4JDOA 3SH3A 4ZKTB 2NYYA 4QKNA 4D6SA 1YIFA 5F5QA 2XBO2 4HSLA 3ZXGA 4W6XA 1W39A 4I30A 1AX0A 2QQMA 3OCPA 3WXPA 3ZOIA 3ETPA 4CEWA 1DU3D 1YWKA 2V4AA 3GALA 4LKSA 4CCJA 1WLWA 1RXGA 3MIHA 2NZ9A 1SPPB 5CG9A 4YVSA 4Z2WA 4XFGA 1YQ8A 2H0BA 4QQPA 3VDDC 4AHYA 1H6XA 1AR72 3AFKA 2O8OA 5IWFA 4Y4YA 5FXXA 1PO21 1AXKA 2ZS6B 3FWEA 3V65A 5JOZA 1AJKA 3NJZA 3OEAA 1RUG3 1PM4A 1TMF1 3ZXKA 2WABA 3K46A 4AXOA 5FZ6A 1WCUA 3ZYHA 5HXVA 2VZSA 1VBC1 5A7SA 1CAUB 2TEPA 2AACA 1QMJA 2WO7A 1W2TA 4KGGA 4XF3A 5C70A 3RI9A 4OI4A 4M4RA 4AQTA 1L3JA 1LOBA 5LY1A 1PMIA 2BGCA 3GZUC 3RPQA 2ENRA 1JI6A 5FIXA 3WNLA 1YYNA 2VW1A 5DZGA 4XBQA 1NG0A 4ZU5A 1IS5A 1PZ9A 1RUH2 1V9U3 4BM8A 2DCYA 1GNYA 1RUNA 1HB1A 3PJQA 3RWNA 2XLAA 2EALA 1W2NA 4KL1A 4LBQB 4MGTA 4FPLA 5FQ0A 4XABA 1B09A 2Z5WA 4LULA 4LBJA 4IDZA 2VVEA 2RDSA 1NCRB 2JIJA 2L9LA 2NN8A 1KITA 3CIHA 4GJYA 4A6SA 1V6IA 4CEWC 4COZA 4DO0A 3JBG2 5I8TA 3T0BA 5GZCA 3TEZA 1VIWB 4QDQA 1ZBE1 5FYYA 5FYZA 2W3JA 1ODNA 5H9RA 3HIFA 1JXNA 3OGGA 5FJHA 1SBFA 5I93A 5I91A 3PUHA 4I01A 4P9YA 2BGOA 4F7ZA 5K0UB 1W9YA 3PLQA 2ZA9A 1D2QA 5EQUA 1BBT3 1STMA 2Y38A 2ATFA 3EXUA 3WDVA 1Q56A 2WS92 5FWEA 2VNRA 4WV8A 3O12A 3LCPA 1AHSA 3PUAA 4UWDA 4YZ2A 3ILRA 4K6BA 2R7EB 4KG0A 1ZBA3 3M7AA 4ZPIA 3V0AA 3J8F1 1O4YA 2Y64A 3VZNA 1LOCA 1RUOA 2CGPA 5LEJA 5FZFA 1PVC1 1DZTA 5ACA2 3UT0A 1VPHA 4PLMA 3SHRA 1RVF2 5E16A 2SBAA 1CAXB 1PNFA 1QIQA 3JXSA 1DZQA 1HB4A 2E33A 5DAXA 5FY8A 3T2TA 4BK4A 3KLSA 3W5MA 3KV5A 2YBKA 2ZZJA 3GGLA 4XF4A 1S0GA 5FUNA 2R062 4EZHA 2WAAA 5T50A 1Y43B 1RB8G 4Q0VA 4ASMB 1IQDC 4MG2A 1OOPA 4S2GA 4ZZ8A 4QU2A 1W8NA 3PURA 4Q4V3 3WNKA 3FC0A 4GWIA 1HDKA 2KXLA 2WQ8A 3R6SA 1NA1B 3RMXA 1RMU3 4FPCA 3AC0A 1POV0 4Q27A 2XJPA 4NPLA 1NT0A 2CAVA 3GBFA 1HRV1 4E27A 3MF6A 1W99A 1PGL2 2V4VA 4YGDA 2AUYA 4Y1YA 5A1AA 1W6MA 1TE1B 4J6GA 1XNTA 3C7OA 4LT5A 1W0PA 1XNDA 2RS51 2QQJA 4S2HA 4B8EA 5LK5A 1CZSA 4D69A 4DUVA 1UU6A 4JCKA 1NXMA 1MZ5A 2E26A 4LR4A 5FR3A 4NHMA 1UMIA 1W8HA 4UF0B 2VNVA 3ZKYA 1C28A 1SLTA 2R073 3J9SA 4KBBA 4B4QA 3H9AA 1OC1A 1N3QA 1VBE3 1SLCA 2WT1A 3KCXA 5ANQA 5HV4A 1IS3A 4Y1XA 2WBKA 5FLIA 3RDIA 3M70A 4D7TA 4W8JA 3FHQA 3FL7A 3LEMA 5F5IA 3MICA 4AFCA 3I2JA 3GCXA 1SDWA 4Q0PA 2Q8EA 1MZ6A 3HNBM 3KT1A 1E5IA 4Q2FA 5C9AA 5DDJ1 1S2EA 4M3CF 4YGEA 1IG3A 3VZKA 3O14A 1OOPC 2ETEA 2JJ6A 4HVRA 3T1LA 1W06A 5E6HA 4XURA 2DUQA 5GZGA 3U10A 1QOSA 3PVNA 5HXMA 5GLZA 1I6XA 2PYTA 4LE4A 1NE4A 5E8AA 2RJKA 2P17A 5CKQA 3CL1A 4P9LA 1QXPA 3B01A 4CU8A 5HV0A 4NJ4A 1ASJ3 1KS4A 1ONAA 2VOKA 4FPFA 3AMNA 1RUC3 4IGPA 3TBDA 3LPFA 1JZ4A 3VDAA 2D3PA 1H2LA 5JR7B 5A3UA 2RR12 2VTXJ 2EIBA 4OFGA 3KM5A 4H7LA 2FMDA 2RS32 3AP5A 5GALA 2SLIA 4WVMB 4Q4W2 5IVYA 4RSUA 1W2UA 4PF1A 4D7YA 5FP4A 2ZGRA 3NKTA 4D94A 4Y1UA 1BQPA 3SISA 5BNOB 4N9IA 1Q8SA 1UOGA 4NWWA 4QHOA 2BU9A 1HLCA 4XTMA 3NSTA 2ZTNA 5H9SA 3GNEA 5JI9A 1CPMA 4CSWA 1LOEA 4AVAA 2J1TA 1HRI2 2WNVA 2EIEA 2P3YA 3OYWA 4JKMA 3OPZA 4G9SB 4WZCA 1UXZA 4TSVA 2P4EA 4YW7A 3P3NA 1YEWA 4YRDA 5C9AC 2ZKNA 4MOAA 4Y20B 3BB6A 1JZ5A 4QPGC 5F37A 1CGPA 3HBZA 2VQ0A 4LIVA 2VOWA 3LFIA 1UMHA 4W4ZA 4XDOA 3GZTB 4XF9A 4RR3A 4YG6A 3IDAA 5GLVA 3UGFA 2JD4A 2RMU2 4CU9A 4Q1RA 3S57A 1WW6A 1ENQA 1J58A 1GQGA 1LOFA 4QQOA 4GXLA 4UXAA 4CDQB 2IVJA 1E5RA 1W3VA 4WM8C 2HWD2 3T1MA 2JDKA 2VGDA 2B9UA 5D8AB 4KQ7A 1MEC2 2D6LX 1X8EA 2EIGA 2RM22 3ZN4A 5JOXA 4DFSA 5FZHA 4PF5A 4ZS2A 5C33A 3S0MA 5FYBA 2R16A 4XC9A 4OUSA 5FOJB 2BNMA 5T5PA 3I97A 2OQ7A 2GN3A 2XB6C 1W6OB 1YJKA 2QQVA 5F1RA 4XUOA 2MNGA 2X29A 1OFSA 3GBGA 4FOYA 1LB2A 2CDOA 3MYXA 4XOGA 1J84A 2RJ2A 2X5IA 2PMWB 2DVBA 2QDNA 4LJHA 1UMZA 3WF2A 1ND3A 3RG0A 4Q4Y3 3HMYA 1VBE1 3ITQA 4QB2A 4AEMA 4ZZ5A 1CONA 3NRUA 1WMEA 2R1BA 1SQ4A 4AWDA 3JZVA 1ZZ9A 4YZ4A 3ZFFA 3B5LB 1VMHA 3ES1A 1DP0A 2BNOA 2NM1A 4A44A 5J96B 4MGIE 1S2BA 3V64A 3T2PA 2B4KA 1KFXL 4EN9B 4CCKA 3WY6A 3LSEA 4NIDA 5J48A 4Q4X1 4FOQA 3AB0A 2WO2A 2VQTA 4ET7A 1ZX5A 5JXGA 4I3GA 1V6LA 3ME2A 2BGPA 4RN5A 1O8PA 1LOFC 1PK6B 3ABZA 5EP9A 3ZDVA 4L2NA 4YPJA 1A6CA 4BQYA 2VUCA 4IV1B 3MHZA 3U0ZA 2PFWA 3I3QA 3OGRA 5K9YA 3N35A 3ON7A 1TME3 2YDEA 1ASJ1 3RJRA 1VE0A 3LB9A 1ULDA 5F3GA 4PI0A 4DIQA 5BNPC 4K1YA 3WDYA 2Y0OA 4CEYA 1OBNA 2ARBA 2P3KA 3EB7A 3I3DA 2J7MA 2XONA 3CJXA 3DPRB 3FHIB 2W91A 4LO5B 3O5SA 4JDMA 2HKXA 3KVAA 1AJOA 4L99A 1JZ7A 5C3QA 2X5IC 4AZZA 4DOUA 1QDCA 1RIRA 2VH9A 1UL9A 3VD9A 1LEMA 3KT7A 2GC2A 1ND3C 1XPWA 2A71A 5D21A 4PCRA 3VL9A 3ZX7A 3POIA 2CHHA 4AFAA 3JUUA 2OW4A 4Y33A 2V72A 3POYA 3P6BA 3VBUB 4NO4A 3ZFFC 2DDUA 2Q1MA 1YQ2A 4QGLA 3Q8AA 3VBHA 1CWPA 3MLJA 1LEDA 4TZDA 2AEYA 2C26A 2OVUA 3PUSA 5JI7A 1XQNA 3GZEA 4N43A 3OBAA 5C3PA 5KXBA 3I49A 5A6YA 2XJQA 3NNFA 4W65A 3AMQA 2ADEA 4BU2A 4D6RA 1QQP1 3VBRA 1SCRA 4R8HA 5FZ3A 3VB9A 5FPUA 5FAXA 1Z78A 3ETQA 1L7LA 3WG2A 3A21A 2W1WA 3B00A 2ZPXA 4XIKA 4LUMA 1Q8PA 2JKXA 4BQ2A 2ZEZA 1QY4A 2VY0A 1RUG2 3KV9A 3N9PA 1DZRA 3S7IA 4CEYC 4Q0UA 2XR4A 3L2HA 5FZ9A 4GMP1 4QMAA 5FMOS 4LOSA 4R9DA 1M06G 3J4UH 3D0JA 4NHYA 1C3HA 4BQ4A 2IUWA 1VALA 5AFBA 1T6GC 2J1VA 1K45A 5K0UC 5HBAA 3J7MA 2JD9A 4NRPA 1JODA 1Z7S1 1OPOA 1IOAA 1YLLA 3AKTA 4SLIA 5FZAA 4BMEA 3IZOA 3DEMA 1XYNA 3ZR6A 2LRPA 2PA7A 1V9U2 4LO7A 3ZN6A 2VTFA 2HLEA 4CUGA 3JD73 3MPBA 1OF4A 4ISQA 1UAIA 4FPGA 4IESA 1GP4A 4GZ9A 5LBFA 2UYAA 2HWB2 3POWA 4PBOA 3AVRA 3ZMOA 4XVHA 1O3SA 1NQJA 2UY8A 4K21A 1VBB2 4N43C 3FHAA 4UFHA 4JKKA 1PO13 1QGLA 1K42A 1VR3A 1B35A 4GWMA 5A6ZA 1AR93 5FY0A 4DUXA 2PHXA 4CEWB 1CIYA 3VBRC 1AL23 3MUY1 5CNAA 4LHKA 4FFIA 2EAKA 3K48A 1RJ7A 3SNMA 1BEV1 2VQUA 3WINE 1QJX3 2D5FA 3OPTA 2EXHA 4GB31 3PMEA 4MGZE 4YVSB 4IW3A 5B4XA 3WD5A 4GWNA 4HSJA 1C57A 1OD5A 2WO3A 4BZ4A 5C6CA 1BBT2 1YO8A 4K40A 4LXLA 1OLME 4O7XA 4FQZA 3BGAA 1ZBA2 5T5JA 4IEUA 4NPRA 2GNTA 4AAPA 2A75A 1RHI2 2MEV1 1YUDA 2PHTA 1CR7A 4AVSA 1O6UA 1H4HA 2KA3A 3RSJA 2VMIA 1CD3G 2YROA 2A3YA 4DXTA 3POBA 1SACA 5FPVA 2BQPA 5C3SA 5KR7A 1QHDA 2J1AA 1GICA 2UWBA 5CKMA 4UI9L 1GFF2 4FOVA 5CKNA 3SC7X 2GN7A 2JKBA 2LW8A 1JYXA 2GALA 3H7JA 2WSUA 5FZIA 1LHVA 4QM9A 1LODA 4JGZA 1XNBA 2OPKA 4JVAA 1AVBA 4E2SA 1ACCA 3LD8A 1QJU3 4LHSA 2PLV3 1SMVA 4AAXA 3J7NA 4LBOA 4H2AA 1QJY2 4A6OA 3CNAA 1DYOA 1RMU2 2ZMKA 4JDNA 1W6QA 5FQ0B 4QDSA 2ZGSA 4H14A 3O0WA 2FDHA 3P5BA 5FY9A 1IGOA 1B35C 2FZ1A 5EJ1B 5A7QA 1W6NA 1QDOA 1RUJ3 1UZZA 1WLTA 4JC1A 4LA3A 4K3UA 3M3QA 2ZEWA 2IWGB 3Q8FA 3UGGA 3WLUA 3ZSKA 3LOBA 4ASLA 2ZHLA 2BWCA 2E6VA 1WCSA 3L9JT 4XTPA 4P02B 5DABA 5FMBA 1UY2A 4NWVA 1F35A 3VZJA 3ZYRA 1AR71 1S4CA 1OF3A 4KNCA 4Q1PA 3WVJA 4XPVA 3L2YA 3D4KA 4NMIA 5EXOA 1C8M3 2YY1A 3KSCA 2DU0A 2VOTA 1IZ3A 1OPMA 2EXIA 2FDJA 4LPLA 5FKBA 3WQBA 4A41A 2CU5A 4B1LA 4QQLA 4X8PA 3VL8A 3FBMA 2D7FA 2Y6FA 3B93A 1FOD3 2E7AA 3V0AB 2FDGA 1KD7A 1XC6A 2WWJA 5EIYB 4AFMA 3PMSA 1RUE3 1X33A 3T2OA 3TAYA 2JB8A 1NXD1 1OKQA 1UX7A 2A6YA 1R1A3 2VECA 4Y1VA 5C5TA 3AL6A 3MLLA 4X6QB 3LKJA 4JGZC 2GH8A 4YZ3A 4EE2A 4GKXA 2EVXA 1POV3 2VUDA 5FOBB 1AR82 4PHZA 1EUTA 1GLHA 5FXVA 5L73A 5JAXA 2HEWF 4RA0A 1OOPB 1SDDB 2BFUL 1V6MA 2LM3A 5C4WC 5IK4A 4RS5A 1IS4A 5HCBA 1BVP1 1LESA 4ASKA 4IUGA 4MGKE 4PIXA 3GBWA 3DKWA 3IDEA 4IE4A 3WW1A 1RUC2 2HWE3 3OBTA 3NNLA 2JDYA 3OY8A 1BK0A 4RGGA 3ZXEA 4NRQA 3RZHA 4AYUA 2GSYA 1YC61 1C1LA 2XPJA 2WRAA 1OQDA 4UFKA 1NUKA 1WKYA 4Q26A 1W6MB 2P34A 1QJX1 3JU9A 3RZZA 2KR2A 3K51A 3TN91 3UK9A 5LY2A 3MW3A 3LDKA 3ZXAC 3U1XA 2FQPA 2VMDA 5JIAA 2PHFA 3BTXA 3IMNA 1XSRA 1JOPA 4XQWA 5CU1A 4ES9A 3O1PA 3O1UA 3MPPG 2W94A 2C1FA 1PO23 4MX3A 3WSOA 4D8MA 2E7QA 2Q8OA 3T09A 4JZRA 1JZ6A 3IMMA 1GP6A 2XHNA 2VBBA 4BLIA 2DU1A 3UL2A 4AFDA 1TMF3 2QCSB 2D6MA 4EN7B 3VKFC 1RUI3 2WC2A 2BTVC 2ZGPA 3WNPA 3PUIA 1VBC3 4L92A 5KXCA 5DUXA 1WW4A 3AZVA 3RNSA 2PN5A 5C8CA 3BTYA 3UYJA 5C9AB 1OT5A 2DCZA 2DFBA 1KJRA 4AOCA 1UIKA 2QDRA 3GF6A 4EWEA 2ZEYA 2Q8CA 2VZPA 3SMHA 3RZGA 4PI2A 3AVSA 5G05L 5FMCA 4MGYE 3NQHA 3W20A 1BVVA 1UW8A 5F6KA 1VAKA 1Y9GA 1R1ZA 5IVBA 2VTXA 1W9FA 3HOBA 2VL4A 3GHMA 4FPEA 2PXJA 2TNFA 3RGBA 4DNYA 2ARAA 3WG3A 1PZ8A 2OZ6A 3D82A 1ZBE3 1OLQA 1PGW2 3HR9A 4COWA 2B42B 4XQDA 3MIBA 5F5AA 2PAKA 4UOJA 3VBSA 4SBVA 4IV1C 1QOOA 3I2HA 2Q5TA 4FTEA 1QXRA 5FUIA 1OQ1A 5HCAA 4Q4Y2 5J37A 3AJYA 2UYBA 4HFSA 4O65A 4XZUG 2QZ2A 5DAPA 3GXUA 3ZO0B 3ZSLA 1A34A 1I5ZA 3NV3A 5SV5A 5A3OA 1VRH2 2B5HA 5EJZB 2BBAA 4NVPA 2FCTA 3E1F1 2WNVB 3OYWB 3JQXA 1WMFA 3EJKA 3POSA 4RQPA 2ARXA 4BA6A 2LUWA 2PTMA 3CJIA 1ULPA 2QQUA 1PVC3 4V2WA 5JCTA 3PJYA 1FT9A 1BJQA 3OEBA 2XMLA 4QX8A 4R4XA 5CG8A 1FV3A 2VG9A 1POV1 3HQUA 4XJZA 4RR3B 2RS13 5I8SA 2W1UA 4M3CA 1H1MA 3HN1A 4X8NA 1BMV1 2RV9A 1JYCA 1UQXA 1WA4A 4YLZA 3VHOA 1BXHA 1TME2 5L9RA 2IFWA 3H1YA 4OHWA 1G7YA 1KRIA 4HPKA 2HWE1 2QTWB 3T30A 2ILMA 1V6OA 1Q43A 4BK5A 1G9BA 1LU1A 4CUCA 1RUD3 3B02A 5GZDA 5BNPB 2OXBA 3KCYA 2RS31 5IATA 2VM9A 1JYIA 3OTFA 1OMIA 1IQAA 5EYYA 5CA6A 1WWYA 1HRV3 2HYKA 3D0SA 1RYYA 2XVKA 4IV3A 4BCUA 1VBD1 4P5YA 3WP4A 5A3NA 1MS3A 5BYNA 1D4M1 4ORFA 1OHFA 2WZR1 3LFMA 1WLDA 4XUNA 4OMCA 2K0GA 2X5IB 1H2KA 2XJTA 3HBKA 2RS53 4MXWA 3IAQA 3LA7A 1NX9A 1OLRA 2WJSA 4UW3A 2W46A 4W50A 5DUVA 4LBLA 5GJ6A 1F5JA 1ND3B 4DS0A 1HQLA 4PBPA 3WG1A 5LK7B 1ZRCA 2CGOA 3VHPA 4WVVA 4FFFA 3KV4A 4LEJA 5IW0A 3AYCA 2E63A 2Y6JA 3CJIC 3ZFFB 1RUI1 3WNOA 3ZMNA 1AR62 1DQ6A 3ACFA 2R0FA 5F3EA 2J1SA 2R043 3WCRA 5DZEA 4AVBA 2Y60A 5IAXA 5F2WA 3HQXA 2QQPA 2AGSA 4IGQA 4ZY9A 5DDJ3 5FO9B 5IYYA 2VD7A 1BCXA 2BVBA 1G9AA 3CO2A 1MS4A 5FXZA 1VRBA 4AEDA 2Y8KA 3UGHA 2XJVA 3TEYA 3RZMA 1TNFA 2BVVA 4LA2A 3V0BA 4AW7A 5GLUA 1DQ0A 4LKDA 1JZ3A 4AHZA 2W68A 1W0OA 3IDBB 3KQRA 3D3AA 4UFMA 2JDAA 3MIEA 4Y26A 2ADDA 1EYBA 1YFUA 4QHZA 1VBA1 5A7NA 4JQRA 4CEYB 1AYN3 4QT6A 1UZWA 4CP1A 5JWPA 1SFYA 1GOGA 4AF9A 1VMFA 2CY6A 4XEZA 4FVVA 4IV3C 4UAPA 4Y5Z0 1IHMA 3EYPA 1IPSA 2V5DA 4YVSC 3KF3A 5DG1A 4BQXA 4WBBA 1HN0A 1A78A 5GLTA 4IE0A 1GBGA 2Q1ZB 4COYA 3IWZA 1DGWX 1GUIA 2ZMNA 1UYZA 3MEPA 5KHJA 2D93A 2ORXA 3O1TA 3HPNA 3UESA 3T08A 4RD7A 2ZHNA 4AQ6A 4RHV1 5A7PA 1G9FA 5FYVA 4AI3A 4URAA 1JUIA 2AYHA 1W9WA 4JHZA 1J1TA 4I02A 4ZU7A 4IE6A 3VBHB 1AX1A 1W90A 1V6JA 2H6BA 1PO12 2VAUA 4P9JA 3WDUA 2WZ8A 5GM0A 1UY1A 2JG9A 2ZGTA 4DPNA 2VZQA 2WFF2 5FV3A 4B7KA 2QJVA 4N43B 2DURA 1AL22 1UKGA 4R9AA 3BODA 3IPVB 4ONUA 2WR9A 5DN2A 4C8DA 2RS11 5IT6A 3SEPA 3VBRB 1CIWA 1UKRA 2G4IA 1X36A 3VGIA 3AZXA 3GZAA 5L19A 1ZZBA 4MSVA 1LRHA 4PQQA 3C7FA 5ERLA 5DUWA 4EQVA 2BUKA 1T6BX 2E32A 4E2GA 5HI0A 1BYHA 1RUD1 5LZ6A 4HVQA 3M3IA 4HN1A 1QKQA 2XWJB 1I3HA 3FUOA 4YWAA 1XE0A 3S6PA 1H4GA 2JG8A 3BN6A 1H30A 3GJBA 1MACA 1UOBA 1FMD2 3N36A 4IEQA 4QQHA 5IVCA 4W6WA 5KHKA 2VULA 4OHXA 3CHXA 5IVVA 1WGPA 4CDXA 3D8CA 4OVEA 3DYMA 2XQXA 4FP2A 1BZWA 2UU8A 1LNSA 3N9LA 1UYPA 1QJU2 3WZ1A 3ZN6B 2PLV2 2Y6GA 3S7EA 2WNUA 4ARYA 4PQ9A 1GV9A 5T54A 4QAWA 5IVJA 1W9TA 3I4IA 3AXDA 3CDZB 1NYWA 4B3NA 2UWAA 1XNCA 4NHXA 3FUQA 1OUSA 4YW3A 3KGZA 3RI8A 4CP9A 3AJZA 3DECA 4YNIA 1RUJ2 1NY72 3SH5A 3ZYGA 2MHFA 3AL5A 2IXJA 1HQWA 3DUIA 4UW4A 2R041 2JENA 1OH4A 1B35B 3VD5A 5FKCA 1FYUA 2QZ3A 4A2UA 3EO6A 1ULGA 2WUHA 1DDLA 3W5NA 2DUOA 4CPBA 2HWC3 3FN9A 3K75B 4Q4X3 1U5IA 3ILNA 3T0AA 1HV0A 4C91A 3THCA 4HONA 1ZZCA 3FLTA 1ZYBA 4P9XA 5C3RA 1C8M2 2HEVF 3MI8A 4QKDA 2IXHA 1K5JA 2BOIA 2VZOA 4L0PA 3I7DA 5FFOC 2IZWA 2PHUA 2C9AA 1MPXA 2QNKA 2WSVA 3E6CC 2BV4A 5IJRA 5FPXA 3ZYPA 5FYTA 4P5HA 1FOD2 1AXYA 4XHXA 1PIV1 4AGGA 5FZKA 1ZRRA 3VUOA 3UETA 1AYN1 1RUE2 2XUEA 3LAGA 2JG8C 3WOGA 3U14A 2FDIA 3IN9A 4CXYA 1R1A2 3PIJA 2QQWA 4XIOA 4ZXKA 1UIJA 2ERFA 1HN1A 2Y6HA 3NAPA 4BPZA 1RC6A 4CCEA 1PX3A 2W2IA 2PHWA 3BOPA 3H1MA 4PIYA 2WNUC 3ACIA 1K12A 3C2UA 4JGZB 2WFPA 5FZOA 3D6EA 1QU0A 1COV1 3C3VA 4GD4A 3DV8A 4BLJA 4NN0A 2WWUA 4DUWA 5C4WB 4HBNA 1VBB1 4UW6A 5AC91 2XJSA 1W6QB 4EN6B 4HLTA 2RDRA 1W6NB 1TQ5A 4ATEA 5JOYA 2XKPA 3BI3A 1AYM2 2HWF1 1Q8OA 1UD1A 3ZFEA 3N9NA 4MADA 4N9HA 5KHGA 5LBBA 4XILA 3PIGA 4JQTA 4DRRA 4MGQA 3HEIA 4K8FA 1QQP3 3B9IA 4QX1A 4RFT0 2Q8DA 4YFZA 2VMCA 4MUVA 3SKJE 1PO22 1FAYA 2JDNA 3AKRA 4UFLA 4D3WA 1CZTA 4IE5A 1DGLA 2I2SA 5CEHA 4M00A
chains in the Genus database with same CATH topology
1R092 1TMF2 3AK0A 3O7OA 1C5HA 2P37A 5GZEA 1QNWA 4GMP3 3ZVXA 1S0CA 4DB5A 1VBC2 4META 1FPN3 1UU5A 2DVGA 3NAPC 4MZUA 3VV1A 2OYZA 4N53A 1HXS1 1N47A 4AHWA 2XJUA 5FMOL 1O7FA 3H0OA 4I0AA 4KU7A 1ENXA 1Z7S3 2VOVA 2YUEA 1SLLA 1PGSA 1LHOA 2PAMA 1WUVA 1QJY1 2ZGMA 4JGYA 4IEVA 2XJRA 4RS5B 2NMNA 1HW5A 2WNVC 2GH2A 4R9BA 3WHTA 1JOJA 2AREA 5CADA 3OY8B 4FP3A 2DWRA 3VHNA 3ZFEC 1VP6A 1CAVA 5BNNA 2VW0A 3FLPA 1ZBE2 4WZFA 4Z1VA 2HWC1 3DL3A 4RR3C 4ATFA 2W08A 2ZZQA 4MYEA 4AGVA 3AP9A 3MW2A 4XJ9A 1BEV3 3WQ7A 4GB33 2ZX0A 4E4ZA 2VUAA 2Q0AA 3IBMA 4DINB 3WP3A 1DQ1A 4EV0A 1V00A 4V1PA 3BPZA 2V73A 4B7EA 3WW2A 2ZX2A 3CEWA 3VKNA 3ACLA 3NV2A 4I0WB 3J8F2 3QH6A 1WCKA 5A3MA 2MEV3 4LTAA 1PVC2 5JVVA 5JMCA 4N53C 3MIFA 1ND2A 4ISRA 4N7UA 4YZ1A 1E57A 5FLJA 1DHKB 1R083 1AR81 1RUF3 4JTNA 1GNZA 1HKDA 3AFGA 1X50A 4JGYC 4LBQA 4XXAA 3PVBB 1NCQA 1U5XA 4AQSA 3INAA 2G9GA 1AX2A 1G9CA 3VZLA 3TWIA 4QD2A 4DY3A 2D40A 2C5DA 3WW3A 4F3JA 5B2GB 5BNNC 1TNRA 4FAHA 5C8WA 4E4DX 4IQPA 1HRV2 2D6KA 4PDWA 2K9ZA 4R52A 1EAH1 1F5FA 3D5OA 4AEKA 2RS52 1AR73 1FV2A 1ZVFA 3FLRA 2WLQA 4A3XA 2IXIA 4H55A 4FPKA 2YPJA 4AI8A 1J1LA 1JHNA 2YYOA 2QKDA 4FPOB 5CVRA 2IC1A 4KG8A 4AQ2A 1FPN1 1REDA 1Y3TA 4KWJA 3CJIB 4AFBA 4QQ2A 2G9FA 5GKAC 4S2FA 5DDJ2 4BE3A 1PVXA 3PVEA 1ZA4A 2HJIA 5T52A 2D43A 1Y7BA 1S55A 1NCQC 4DRVA 4M3CB 3SCFA 5J7MA 4I2OA 3VBHC 1G9DA 1MQTA 1EPWA 5DUUA 4FT8A 4PLOA 5FDBA 1VB4A 4AG4A 4PDWC 1G6NA 3M3EA 4CDUA 1DYPA 1FXZA 3I8TA 1VAVA 2WQ4A 4Z82A 2XVGA 4XMAA 4IV3B 3M1HA 2GC0A 2XLGA 3KZ4C 1PM7A 2A6XA 2JICA 3TN93 1XYOA 1EV11 3VZMA 4MXWB 1O3RA 2WS93 4NHKA 5FLHA 3FE5A 3LA2A 1CAWA 1LGCA 2ET7A 1O4TA 5J09A 1RJ8A 2BW8A 4YW4A 1FI2A 3PNAA 4Y24A 2YXSA 4ES8A 4INDA 3THPA 4AE2A 1D0HA 4FPHA 5EZWA 1UX6A 2E7TA 1R081 3HWJA 1UZYA 1G86A 3LOIA 1Q3EA 1RUF1 1DG6A 3B3QE 2WT0A 4LBMA 5JZGA 2WA4A 2BPA2 4LUKA 5T55A 4XBLA 1N1VA 4Q4V2 4AEDB 2GNDA 1CPNA 1FX5A 3V0BB 2XBO1 4PLNA 1JUHA 4XYXA 2GNMA 1Q8QA 4BIOA 1XXNA 2DFCA 1MVEA 4Q0SA 1OI6A 2H0VA 3ZDSA 3WR0A 4BIFA 1ZZ6A 4CDUC 2XKOA 2QE3A 1XU2A 1DGWA 1RITA 4FCAA 5HCFA 3ES4A 2XHKA 1MVQA 4AI2A 3MGUA 1MS8A 2R072 1VBE2 5CAZA 1SBDA 2VOXA 2I74A 3ECQA 3NVCA 1LR5A 1AR61 4F8AA 5BY5A 1CVNA 4H3WA 4Y20A 4XFAA 3M8LA 2JG9B 2DCJA 1FNZA 1NOVA 2A6VA 4COVA 4FBFA 1ENSA 1DBNA 2RE9A 1WLCA 4Q4X2 1OA4A 3BOWA 1H9WA 1RUH1 4E2QA 3B9CA 4TWTA 3AP6A 3OD4A 2D44A 2HEYF 2JX9A 2Z42A 1Y9QA 1FATA 2DCTA 3LA3A 1GKBA 2BWAA 1ASJ2 4I0BA 4GH4A 2A73B 1H2NA 3AYDA 2FMYA 4FAGA 4C0BA 3HT2A 3JBG1 1S2KA 1TEIA 4OHYA 4ITCA 1EP0A 3VKMA 1D2SA 2DTYA 2JG8B 2RS33 3TRSB 2CTVA 2A5ZA 3AXEA 4Q4W3 3UKNA 4CDXB 3S30A 1SLIA 3AKPA 1VBD3 4B4RA 1D4M3 1XYPA 2IFRA 2WZR3 4QGNA 1H1AA 2WS91 1GYKA 2A6WA 4LNVA 5FBZA 3KT4A 2WNUB 3R4UA 4WVWA 4FO9A 4C1WA 2TBVA 3UJQA 2PHLA 2ZAAA 1WCDJ 1J3RA 2GNBA 1VLNA 5ACA1 2VW2A 1H1IA 1RVF1 4LBQD 5CBLA 5D1IA 4M0HA 4GKYA 4HKLA 1KJLA 4LE3A 2R061 1OQEA 3AZYA 4JTOA 1ZZ7A 5CFCA 3VHRA 1QQP2 4UW5A 5J36A 4RS5C 1LHNA 4X6RB 5FO8B 1V70A 2D6NA 4GH4C 1IKQA 3DN7A 1YRZA 3ZSEA 1N3PA 2I45A 1MEC3 5EJ3A 2P3IA 4YW5A 2RM23 4G3YC 3G6JB 3GHNA 4YFWA 1C5IA 1JTZX 1DF0A 3VBOA 5L7OA 4OI2A 1PGL1 1FMD1 2K2SA 1VBA3 4A7YA 1LU2A 3N7JA 4O9GA 4YG0A 1JN2P 4XF0A 2VUJA 4K7JA 2GMEA 3NAPB 1J3PA 5E89A 2DUPA 1Z7S2 4AK3A 3CU7A 1S0JA 2AH2A 1HV1A 3KS7A 2DCKA 3FJSA 3W59A 1K5MA 1QH7A 2PELA 3B94A 1GANA 1CX4A 3FFZA 1GZCA 3GYDA 3SITA 1JH5A 3AZZA 4RHV3 1NY71 4YM3A 4CRQA 3FX3A 3H8UA 5I8YA 3RMYA 3UKTA 1BKZA 4HT1T 2OUHA 1DLLA 2ZOEB 5C8CC 4HZFA 1S0FA 3ZFGA 3ZFEB 5CFCC 3EBRA 3R05A 3THTA 2R0HA 5SV8A 1QJZA 1BEV2 4FXGB 2R1DA 4GB32 3RQ0A 2VVDA 3VDDA 5F6LB 3AZWA 2ZCWA 1QXJA 1EY2A 3OBRA 2GC1A 4DXZA 3N3HA 3NO8A 5EWSA 2YGLA 1GR3A 3VBOC 5L7OC 2OZJA 2MEV2 2GMPA 2RR11 4IEZA 3RS6A 2R32A 3M2MA 4FSJA 3R4SA 2JECA 2GMMA 4IETA 3CF6E 4C90A 1GZ9A 4RGAA 3AP4A 4OI0A 4IERA 4Q4W1 1IPJA 3VBSC 4N53B 3VBFA 3RYKA 1RTVA 5EV7A 4OULA 2VMHA 3J26N 1K5MC 2Y26A 2JE7A 5FREA 2WL1A 2OIIA 3DGTA 3MDPA 3JB8A 3MFAA 4JGYB 1DQ4A 2AR6A 2EAAA 2EF6A 4YVWA 4BMBA 1HRI1 1OA2A 5LEKA 3A0KA 2ZACA 1HQNA 2Y0IA 4RQPC 4DY5A 1AYM1 2CYFA 1J3QA 3ZFGC 1S0EA 1CAVB 5BNNB 4XQ4A 5I0RA 4OLLA 2KM2A 4CZSA 2YMZA 4AVVA 2RMU1 2F4PA 1H8VA 1CESA 4JRAA 4L8QA 4U36A 5FRAA 4CP0A 3AKQA 2UWCA 2W52A 4G4FA 2OA2A 2HWD1 3VKOA 1G8WA 1R091 1S0DA 2ZX4A 1MEC1 2JDZA 3I59A 2RM21 4Y1ZA 2GC3A 3AMMA 4KWKA 1YI7A 4GA9A 2V09A 4MH0E 1PIV3 4CYDA 5KWRA 3NV4A 3QOPA 2NP0A 4M01A 3VBFC 1ND2B 3ZSMA 2CL2A 3OD0A 4YGBA 2NLRA 1SFNA 1AL0G 5IK7A 4CDWA 5LRSA 4AI1A 3JD72 1MR5A 2CAUA 1ZRDA 4MLOA 1NCQB 1O5UA 1ULEA 4YVWC 2JEMA 2HWB3 4DZGA 1COV3 1DGRA 3ZXLA 4XJUA 3ASIA 1XE8A 3IDCB 2JE9A 1VBB3 4J1WA 3ELNA 5AC93 2YGMA 2FBEA 5IK5A 4UBHA 1AR92 4RL7A 4NR1A 5I0SA 3MF9A 4CTEA 5BV6A 2HWF3 4PDWB 4FPYA 4WM7A 1QJX2 1A3KA 1AUYA 1DFQA 1F2NA 4AEDC 3TN92 4XW3A 1CJPA 3WX5A 5JSRA 1KFUL 1X8MA 4IL7A 1H0BA 1QNYA 1IS6A 2NPIA 5JPNB 4O9EA 3IT8A 1RHI3 1UPSA 1YFXA 3U11A 3AP7A 5IUQA 2A6ZA 1V6NA 1VAMA 2AZ5A 4XFBA 2EXKA 4Z92B 4Q8LA 2OUJA 4D7SA 3WNXA 1S0IA 3LWCA 2H6CA 1HXS3 4CDWC 1YFWA 4QPIA 4B4PA 1LULA 5FTTC 3QCWA 4IEWA 2R49A 1W6PA 5AFEA 1KXGA 1GQHA 1ALYA 1OSGA 4U2AA 4EN0A 1LKNA 1QJY3 1GZWA 1MQTB 1U5YA 1I9RA 2VXRA 2PAEA 2JG9C 1Q5OA 1ZM1A 2XH6A 4XETA 3SXWA 3USUA 2E53A 3IM0A 5BPXA 2ZHKA 1SCSA 3WUDA 1IKPA 4Q29A 4XMIA 5FCCA 4CDUB 4WM7C 2YV8A 1D0GA 4LHNA 3N4MA 3CLPA 1KDKA 3X29B 5JSOA 2XG3A 3ROUA 2B8MA 1NQDA 1RUG1 1RL3A 4YM0A 3ST7A 2E51A 5F9TA 1LGBA 1DQ5A 4A7KA 5KHIA 2ZGUA 1CAWB 4XZPA 3MW4A 2VVFA 1F31A 4MV2A 4AHXA 1HX6A 1HIXA 3ATGA 1RGSA 2IXLA 2YZ4A 4AVTA 3KMHA 4FOWA 4YM2A 2XLFA 1AZDA 4E4SA 4CDXC 4QPIC 4YW2A 3ZXFA 4QPGA 2BBVA 4PJYA 1AR83 1V9U1 3VLBB 3H1WA 2UY9A 5JZGB 4BYYA 3O0XA 3EQEA 4N90A 1BMV2 1SLAA 2JXAA 2HWB1 3RJ2X 4QXKA 2WINB 1OFNA 2HWE2 4WM8A 3QBQA 2FZ2A 2GZWA 4HETA 1H8TA 4K20A 1WW7A 5K8SA 1WMDA 5CFDA 4R4ZA 5AVPA 2PQQA 1YFYA 3WUCA 4F83A 2D98A 3FFQA 2VU9A 1O5LA 4KU8A 4IEOA 1O3TA 2R30A 2TUNA 4C1XA 1LGNA 1VBD2 1ENRA 4HK8A 1EAH3 3ZXDA 1BBT1 1D4M2 2DF7A 2WZR2 3QH7A 1M4WA 3FBYA 4Y22A 2D6OX 4HVOA 4H7MA 3FMGA 2BNNA 3H7YA 3ZYIB 1ZBA1 1LJ7A 2D97A 1RHI1 2B46X 3KD4A 2ZKLA 4XFCA 5KHHA 3RYPA 3WHUA 5JDBA 3E5QA 3OGJA 2D6PA 1RUI2 3G7DA 4S2DA 1UCXA 4IEYA 3ZPYA 4CP2A 1ZRFA 1CJDA 3KB5A 2DV9A 1NLRA 2XL7A 2DVAA 1LHUA 1UU4A 2ZMLA 5J98B 2CWMA 4TLFA 1MZFA 4J1XA 5A32A 4GALA 3VN4A 4Q4V1 3BCWA 5A33A 4BOWA 5GZFA 3WT3A 5KC6A 4NHLA 1NZCA 4LO4B 4XJAA 1RMU1 1H8TC 4KH9A 3AMHA 3QLQA 4GH4B 5CFDC 3MFCA 5BNPA 2RJLA 1AF9A 2QVSB 1VBA2 3EHKA 1D4VB 1WD4A 3IKWA 1BK1A 4EJRA 1YI9A 2X53S 4FTSA 3TOJA 1N3OA 5L36A 3ZN5A 3KGLA 3SLIA 2ET1A 3O0VA 1APNA 3E5UA 2W39A 2ZBJA 2P2KA 3NWKA 2DVDA 2CWSA 1N1YA 2CGNA 2R071 3BTAA 4L11A 1PNGA 3TB0A 1GSLA 4YG3A 3A0NA 1EV13 1N1SA 3E5XA 1QOTA 5IK8A 3RYRA 4RHV2 2Q4SA 2ZHMA 1VRH3 3I54A 2A7AA 2EA7A 2B45X 2I07B 1CAUA 4Q0QA 3AYAA 2W0XA 4JV4A 1UF2C 2ZJCA 3WV6A 2WWSA 4LHLA 5C8CB 4XJ8A 1ZNPA 3MZHA 2RS12 2ZGKA 1ULCA 5CFCB 1YIPA 4GQ7A 3NL1A 4BQ1A 2DTWA 4HK9A 3UV9A 1JW6A 3WG4A 3ZSJA 1RUC1 4EROA 2XBO3 3WCSA 1URXA 1NCRA 2P3JA 2YC0A 2XL9A 1RUD2 1XU1A 2O8QA 4BHPA 5EYXA 2ZGQA 4YYOA 3E6BA 3VBOB 1WBFA 5L7OB 3DF0A 1S1AA 2A3XA 2Z2SB 4XJWA 2WIIB 3N7MA 4K1ZA 2WNEA 5K0UA 1KDMA 3I2DA 4L97A 3LGRA 3ZIWA 2XWBB 5BUVA 3VBSB 3WDWA 2NMOA 1SLBA 2RHPA 3HAGA 4GULA 1PHMA 1Z0HA 3W58A 5CB7A 1K5MB 4P9IA 1IPKA 2PHDA 3VZOA 2F6BA 3TNPB 4DQAA 4AVCA 2XUMA 2WQZC 3WW4A 2YHJA 4OHZA 2A3WA 4BWOA 1AR63 1N1TA 1ND2C 1UPIA 4YGCA 1CAXA 4RQPB 3IPVA 2R042 1DQ2A 2AENA 3ZFGB 3U4XA 2XGXA 4AI0A 2IXCA 2IXKA 4XFFA 1FNYA 2WT2A 3Q9OA 5E88A 5JLVA 2ZGOA 3UJOA 1XRUA 1WD3A 3VDDB 4N7IA 1A8DA 3B69A 1RUH3 4KGQA 2N7GA 2A70A 1NCRC 5DG2A 1NA1A 1A8MA 2ZGLA 4KWLA 3RRDA 4WVZA 3SH4A 3ALQA 4HPKB 1KQRA 4OZXA 4XE9A 1PIV2 1RINA 1VJ2A 1XNKA 1X7NA 2C0ZA 2Q30A 1AYN2 2MPFA 3AM2A 1REEA 3JBG3 4ZU4A 4K9SA 1PGW1 4EWAA 5T3NA 5FO7B 1S0BA 3VBFB 2WA3A 1LCLA 3AKSA 1REFA 4LBNA 3E97A 1H9PA 4HKWA 1U5ZA 4JRLA 1ZZ8A 4Q4Y1 3E6DA 5GLWA 4PIZA 3SCHA 4XFHA 1LTEA 1COV2 4M3CE 3WQ1A 3H3UA 4Z8BA 3HD8B 1VRH1 1I1EA 1AXZA 3B7MA 5JOWA 2D3SA 4YVWB 4LBKA 3USSA 2B7YA 1LECA 4EWDA 5AC92 4HN0A 5FPZA 1X82A 4OHVA 5ACA3 2WFF3 3BIWE 5I0UA 4E9KA 1RVF3 4R9CA 2HWF2 5DZFA 5KXEA 4OI1A 4XBNA 2NQYA 2R063 4LLOA 3UKVA 1NLSA 1H2MA 4GIQA 3PHMA 4LO8A 1ZREA 1NA1C 1TME1 4YW1A 3LZZA 1MQTC 4FQ4A 2LALA 3NKGA 2B39A 3I59B 2BYVE 2XVLA 1GNHA 1V6KA 3N7KA 1YHFA 4QGMA 1C8NA 4YARA 4UBGA 1FMD3 5T5OA 4WVMA 1JBCA 1C4RA 1HXS2 4BH9A 2QFEA 2QUOA 3VKLA 1CQ9A 5KBFA 4HKOA 5BNOA 5H9QA 1YJLA 3HT1A 1UN1A 4CDWB 5J3UA 2EXJA 1YNAA 1NE6A 5C4WA 3BALA 4W6YA 1KS5A 4HMZA 4NOTA 5H9PA 5BNQA 2X8KA 3V56A 4HL0A 1QF3A 2WLPA 3M4FA 4MXVA 5ABJA 1DYKA 2GAUA 2VNGA 4FTBA 2HWC2 5JZGC 1J59A 1EPZA 1MS9A 2DVFA 4WM7B 3JCIA 4A7ZA 1O3QA 4JAAA 2ZABA 4C0HA 4M0NA 4CDQA 3ZXJA 3SCGA 5D8AA 3MIGA 3JB4C 5DXDA 3M3OA 3A4UA 3APBA 4L9BA 2ZGNA 3OF1A 3QACA 4Z07A 2RR13 2ZAHA 1LHWA 1YCIA 5KC5A 3WP5A 1W6OA 3FZ3A 2LTNA 1MZEA 2VNOA 1U0AA 4IEXA 1SBEA 4I3PA 5BXXA 2FHRA 5BNOC 2VPVA 4GMP0 3JD71 1QH6A 2O0OA 4QPIB 5AVAA 3H3ZA 3N7LA 1W6PB 4XDQA 2R6QA 4P9WA 5JSPA 1WW5A 1WBLA 3U07A 1GZWB 5JPMB 3WDTA 1PO11 1HRI3 4XF1A 3JQWA 3QD6A 3ENRA 1AR91 2WFF1 3PVOA 2O1QA 4TYSA 3USUB 3MIDA 5ABJC 1AL21 1AYM3 4I09A 1MS0A 4QPYA 3AX4A 4QX5A 4P14A 2CNAA 1F8VA 4URTA 1PK6A 3R4DB 1EAH2 4FXKB 1O91A 5K7PA 4XHBA 4CDQC 2RMU3 4IV1A 4B29A 5D8AC 1LOAA 4IEPA 3R0RA 4COUA 2HWD3 1LOGA 3WDXA 1R093 3WQ0A 1QWRA 3ILFA 3H50A 1F9KA 1YXWA 3W9AA 4MVTA 3DPRA 5A3LA 2UURA 1FPN2 4LO6B 5EFUA 2CV6A 2Z69A 4HANA 5JIUA 4QHBA 2GDFA 3TNQA 1SEFA 2VMGA 4QPGB 4OUMA 4DMIA 1C1FA 3PTYA 2E9QA 1Q8VA 3OJBA 2DYCA 1QJU1 2PLV1 4P9GA 3IIAA 1MS1A 2PHRA 2V5YA 3VBUA 2ZX3A 4FPJA 1DGRN 4WM8B 1RUJ1 1H8TB 1MS5A 1LENA 4Q8KA 5CFDB 3WP6A 4XFIA 2ZX1A 5I0TA 1PK6C 4LLFA 4QM8A 2D5HA 5KXDA 2VQAA 4YM1A 3TYJA 1ULFA 1U12A 1C8M1 5E1RA 4Y22B 5T5LA 3MLKA 1CN1A 1EV12 2Z79A 3M3CA 4IXLA 3ZIXA 4EN8B 5CIRA 1FOD1 3ZYJB 2D3RA 4AEJA 4YSFA 3DPRC 1RUE1 3J8F3 3LSDA 3AYEA 1R1A1 1DIWA 3NW4A 3KCCA 1XE7A 2ES3A 5TSWA 3BU7A 2BFUS 5LRRA 1R082 2WKKA 3URFA 2BEOA 1O4ZA 1RUF2 4XXPA 2GU9A 5A32B 3NV1A 3AMPA 1OA3A 5A33B 3P3PA 3VBUC 1PZ7A 1VB2A 3SH3A 4JDOA 4ZKTB 2NYYA 1YIFA 5F5QA 2XBO2 4HSLA 3ZXGA 4W6XA 1W39A 4I30A 1AX0A 3OCPA 3WXPA 4CEWA 1DU3D 1YWKA 3GALA 1WLWA 3MIHA 2NZ9A 5CG9A 4YVSA 4Z2WA 4XFGA 2H0BA 4QQPA 3VDDC 4AHYA 1AR72 3AFKA 2O8OA 4Y4YA 1PO21 1AXKA 2ZS6B 3FWEA 3V65A 5JOZA 1AJKA 3NJZA 1RUG3 1TMF1 3ZXKA 4AXOA 5HXVA 1VBC1 1CAUB 2TEPA 1QMJA 4KGGA 4XF3A 3RI9A 4OI4A 4AQTA 1L3JA 1LOBA 1PMIA 2BGCA 3GZUC 3RPQA 2ENRA 1YYNA 2VW1A 5DZGA 4XBQA 1NG0A 4ZU5A 1IS5A 1PZ9A 1RUH2 1V9U3 4BM8A 2DCYA 1RUNA 3PJQA