1R093

Human rhinovirus 14 complexed with antiviral compound r 61837
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Human rhinovirus 14 complexed with antiviral compound R 61837.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 38
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1990-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1r09300
5AC92 4IV3B 3VDDB 5C9AA 5BNPB 1AR91 5A32A 1RUJ2 4FTSA 1COV2 1RUJ3 1COV3 1PGW1 2RM21 3VBRA 4AEDC 4Y4YA 1VBD2 2HWF1 2WFF1 3VDDC 2ZTNA 1VBD3 4IV1A 1R081 4CDWC 4WM7A 1TME1 1NY71 2DF7A 1K5MC 3VBUA 1SMVA 3VBSA 5CFDB 1RMU3 3ZFEB 3VBOA 1RVF1 1PO12 3IDEA 5L7OB 1PO13 4WM8B 4CDXA 2BFUL 2HWE2 3JD71 2WLPA 2HWE3 2IZWA 1V9U2 1HXS1 2ZAHA 1V9U3 1X36A 1VBE1 2MEV2 1AR71 2WS91 2MEV3 5BNNA 3ZFEC 3HAGA 1X33A 1HRI2 2BFUS 1HRI3 1R091 5L7OC 3ZFFB 1NCRC 4Q4V2 4RHV1 1H8TA 4Q4V3 3CJIC 3NAPB 2FZ2A 1PVC2 3JB8A 4JGZA 5JZGA 4GH4B 5J98B 5C4WC 5A33A 1TMF2 1TMF3 1AYM2 4RR3A 1AYM3 1F2NA 5CFCA 1RUD1 3ZFFC 1IHMA 1RUH1 5ACA1 1ZBA1 4YVSB 4Q4W2 4JGYA 3NAPC 4Q4W3 2BPA2 4Q4X2 1RUF1 1OHFA 4Q4X3 3VBHB 3FBMA 2XBO2 1RUC2 2VQ0A 5C9AB 2XBO3 1RUC3 4PDWA 5D8AA 2RS52 3DPRC 2RS53 1MQTA 2BBVA 4YVSC 1POV0 1PGL2 4GMP1 1GFF2 2HWC1 1AR63 3VBRB 3VBHC 1VB2A 4CEWC 1AYN1 3JBG3 5C9AC 1R1A1 2R071 2R042 1NOVA 4WM7B 2PLV2 1QJU2 2R043 1D4M1 2PLV3 1QJU3 1FOD1 1VB4A 2RS12 2RS13 3VBOB 5K0UA 2GSYA 4FSJA 4Q4Y2 1ASJ1 3VBRC 1C8M2 4Q4Y3 2HWD2 1C8M3 5AC91 4CDXB 1VBA2 2HWD3 2WZR2 1POV3 4CDWB 1VBA3 1RUI3 2WZR3 5ABJA 4NWVA 1HQNA 4WM7C 1EV12 1K5MB 1RUG2 1VRH2 1EV13 1RUG3 5C8CA 1VRH3 1RUJ1 4RFT0 3VBUC 1M06G 1E57A 1Z7S1 3VBOC 1BEV2 1W39A 4CEYA 1BEV3 1C8NA 2HWB2 4CDXC 1VBD1 2HWB3 5J96B 1RMU2 4JGZB 5JZGB 5FMOS 1HRV2 3J8F2 2RM23 1HRV3 1ND3A 1PIV2 3J8F3 4YVWA 3TN91 1PIV3 5BNNC 4BCUA 1PO11 2HWF3 1NCRB 2TBVA 4NWWA 1R082 5CFCB 2GH8A 1TME2 1R083 4SBVA 4N53B 3CJIB 1TME3 3ZXAC 1H8TC 2HWE1 1BMV2 4JGYB 4JGZC 1V9U1 5JZGC 5C4WB 1AL0G 1AUYA 1NG0A 4AEDA 4IV3A 1HRI1 1ND2A 3ZFGA 1QQP2 5BNPA 1QQP3 5D8AB 5CFCC 4QPIA 4N53C 2R062 4Q4V1 2R063 1OOPB 4JGYC 1PVC1 1PO22 4RQPA 1PO23 1B35A 1ZBE1 1VBC2 2RMU2 1R093 1AL21 1VBC3 1AYM1 2RMU3 3DPRB 4PDWC 4CDQA 5D8AC 5GKAC 1VBB2 1OOPC 1VBB3 1RHI2 4Q4W1 4CDUA 5CFDA 1RHI3 3ZFEA 4CEWB 1OPOA 4Q4X1 5K0UB 1MEC1 4WM8A 2XBO1 5BNOA 1BBT2 1RUH2 1DDLA 5A32B 1BBT3 1RUH3 2RS51 3JB4C 2X5IA 1RUE2 2BUKA 1RUE3 1AR62 1EAH2 1FMD2 5FOJB 1EAH3 5LK7B 1FMD3 4N43A 1QJX2 3JBG2 4QPGA 5K0UC 4CEYB 1QJX3 1AR82 3VBFA 1AR83 4IV1B 5ABJC 2R041 2PLV1 1QJU1 3VBUB 4GH4A 3VBSB 5C8CC 1ND3B 2RR12 2RS11 2HWC3 2RR13 4Q4Y1 4CEYC 1C8M1 1RUI2 1NCQA 2QQPA 2HWD1 1POV1 1VBA1 2WZR1 4IV1C 1QJY2 1A6CA 1QJY3 4GB32 2RS32 4GB33 1COV1 1EV11 1RUG1 1VRH1 2RS33 1FPN2 3VBSC 5DDJ2 5BNNB 1ASJ2 1FPN3 1ND3C 5DDJ3 4YVWC 5FMOL 1ASJ3 1BEV1 1AR92 1ND2B 3ZFGB 5AC93 4EJRA 1AR93 4FTBA 4FTEA 1H8TB 2HWB1 4QPIB 4RS5A 1NA1A 1PGW2 2RM22 1Z7S2 1RMU1 1Z7S3 5A33B 1HRV1 3J8F1 4RQPB 1B35B 1PIV1 2HWF2 4Z92B 2WFF2 4RR3B 2WFF3 4IV3C 3S6PA 1QJZA 1ND2C 3ZFGC 5BNPC 4CDQB 1CD3G 1NY72 4QPIC 2FZ1A 1BMV1 3TN92 4CDUB 2MEV1 1RVF2 3TN93 1RVF3 4RQPC 1B35C 3VDDA 4RR3C 4LLFA 4PDWB 3JD72 5BNOB 1QQP1 3JD73 4CDWA 1MQTB 4CDQC 1HXS2 2X5IB 1HXS3 1VBE2 1K5MA 1AR72 2WS92 2R061 2WS93 1VBE3 1AR73 4CDUC 1HX6A 5CFDC 1R092 1PO21 4N43B 1TMF1 4QPGB 4Y5Z0 1VBC1 2RMU1 4WM8C 4RHV2 3VBFB 4RHV3 5BNOC 1F8VA 1MQTC 3LOBA 2X5IC 1PVC3 1VBB1 1VAKA 1RHI1 1WCDJ 1ZBE2 1ZBE3 1AL22 2ZZQA 4N43C 4QPGC 5L7OA 2XPJA 1RUD2 4GMP0 1AL23 1RUC1 1NCRA 1NCQB 1RUD3 5ACA2 5ABJB 3VBFC 5ACA3 1ZBA2 4N53A 3CJIA 1BBT1 1RB8G 1ZBA3 1CJDA 2Y26A 1RUF2 5C8CB 1RUE1 1RUF3 5C4WA 4GH4C 1PGL1 1AR61 1EAH1 1MEC2 1FMD1 1MEC3 1QJX1 3JBG1 3ZFFA 1AR81 1NCQC 4RS5B 3NAPA 1NA1B 1OOPA 2HWC2 3M8LA 4GMP3 4YVWB 2WWSA 1AYN2 1AYN3 2RR11 1R1A2 2R072 1R1A3 2R073 3DPRA 1RUI1 1D4M2 1FOD2 1D4M3 4YVSA 4RS5C 1FOD3 1QJY1 1NA1C 4GB31 2RS31 3VBHA 4CEWA 4AEDB 1FPN1 5DDJ1
chains in the Genus database with same CATH superfamily
1OD5A 4UFJA 5LBCA 1DIWA 4KG8A 3H1WA 4JV4A 1GP5A 2WNUB 1T6GC 2J1SA 5A6XA 3S0MA 3B9CA 3ITQA 3O7OA 5H9SA 2WN3A 1DGWA 1UMZA 2D7FA 4FFFA 4LOTA 4FTSA 4XHXA 1W05A 2WA3A 3ILFA 5IK7A 4JQRA 2RM21 4XEZA 3RPQA 3I54A 2PHFA 2VNRA 1WCQA 2D6MA 4Y4YA 1LAJA 2ZCWA 1V6MA 4UFMA 4XF3A 2HWF1 5CBLA 3ATGA 5JAXA 4NJ4A 2ZHLA 2ET1A 1DU3D 3JU9A 1WD3A 1LHUA 2ZX2A 4WM7A 3RZMA 1Q43A 4XCBA 1D4VB 2ZHMA 5L9RA 3DECA 4S2HA 3LCPA 5FY0A 3DYOA 1K5MC 3VBSB 1UY4A 2VU9A 4GKYA 1RMU3 2Y60A 3AKRA 1POQA 2XJRA 3VBOA 3VBSA 1K45A 2YZ4A 3ZSJA 2A6VA 1QH7A 1WA6X 2DVAA 4WM8B 3RJ2X 1REFA 2NLRA 2ZAAA 1U0AA 3NNLA 4ARXA 2DV9A 2EXKA 3D0SA 1DHKB 4QKBA 2HWE2 3JD71 3G6JB 3VGIA 4YSFA 1YQCA 2RV9A 2HWE3 1G9FA 1AX0A 4ITCA 4XQDA 1V9U2 3QACA 1CAUB 1VE0A 1V9U3 1VBE1 3J7LA 1AR71 3OBTA 3NJZA 2ZA9A 1C3HA 1M4WA 4LO4B 3T4VA 3FX3A 1YIFA 1X33A 1BVVA 4AGGA 1HRI2 5JSPA 3DN7A 1HRI3 4YW3A 5JR2A 2CV6A 1SDDB 1W8OA 5KWRA 4BIOA 5FRAA 4OI1A 4DEVA 5L7OC 1PHMA 1GV9A 1UU4A 2Q4SA 4K1ZA 5JLVA 3H8XA 5HCHA 3MEPA 4RHV1 2DTWA 2IXCA 4XVHA 3SCGA 3ZMNA 4D0QA 1LOFA 4P5YA 5A7WA 2A3YA 4AVSA 4NRPA 3IIAA 4OUEA 4WVWA 5GZGA 4GH4B 1GWMA 1VIWB 4IUGA 5LWBA 2VMGA 2A3WA 1SBFA 1ACCA 1H9WA 1HV1A 1UIKA 2C26A 3ES4A 4XUNA 4YGBA 3H7YA 4COWA 1JZ4A 2DVFA 3AJZA 4RR3A 1X82A 4D69A 1PMJX 4TZDA 4L99A 2V5YA 1RUD1 4JKKA 3SHRA 3JQXA 3L9JT 4NO4A 4PHZA 1IHMA 1RUH1 2QQIA 4DPNA 5ACA1 2E31A 4YVSB 4Q4W2 4XBNA 3ZIWA 4OHWA 4Q4W3 4QWNA 5FO7B 2Y6FA 2D43A 3HD8B 4MGIE 4DEQA 2ZEYA 4CU7A 3MLJA 3BTXA 4TSVA 4Y1VA 4PI0A 3TNPB 4RFRB 2FMYA 4LBMA 3ZX7A 2A6YA 1APNA 5JOWA 5C3QA 5FWEA 4H7LA 3BTYA 4EROA 2SBAA 2WAOA 3I3BA 5A1LA 3KMHA 5F5IA 1L7QA 4XAEA 2YG0A 3O1PA 4CCKA 2DCKA 1OUXA 5E8AA 4Y1UA 1RIRA 4QQLA 3HT2A 1D0GA 2HWC1 3OYWA 1AR63 4NIHA 4CEWC 1S55A 1AYN1 2A6WA 2QNKA 4UFHA 2ARAA 4FFIA 4J1WA 1UOFA 3WNOA 2R042 4CP0A 1H2LA 4URTA 1UYYA 2PLV2 2R043 1OKQA 2PLV3 4YWAA 3HN3A 3BU7A 3AK0A 3KVBA 2CSGA 4K21A 5T5JA 3WT3A 1IKPA 1F5JA 2CNAA 3M3OA 4ARYA 4EZHA 1UWWA 1O6UA 2UYAA 3E97A 2RHPA 5K4LA 3VBRC 4QGMA 1F5FA 3OJBA 2HWD2 2UY8A 1CESA 2X8KA 3POSA 3ES1A 2BVBA 4FCAA 4RGKA 2HWD3 4Y20B 5HXVA 4CDXB 4EN8B 4CDWB 1W0NA 3PVBB 4COYA 2O8OA 2WNOA 1UZVA 2WKKA 3FUOA 4KI5M 3NV1A 4NWVA 2CWSA 1HQNA 2WWJA 2Y34A 2VVFA 4O9EA 3NO8A 4BA6A 1LGBA 1RUG2 4SLIA 5DPNA 4XF9A 4B3NA 1RUG3 4XIOA 5JPMB 4RFT0 2W1QA 4Q0QA 1QDCA 1Z7S1 1OLMA 1OUSA 4XUPA 1MS1A 1UNBA 1L7LA 1LOGA 1W9FA 1HJGA 2R49A 3O5SA 3RWKX 3V56A 5A70A 1WLTA 3G7DA 2WZ8A 1HIXA 1KD7A 4QB1A 4Y4RA 4HVRA 4DXRA 5KHGA 2JG8C 5FY1A 3KF3A 5FXWA 3WV6A 4DY5A 1WGPA 2C5DA 5T5OA 1Y7BA 3O1UA 5JPNB 1DZTA 5I0DA 3LOIA 4GWJA 4QKDA 4LQRA 4FQZA 2RM23 4O61A 4RGAA 5C7GA 3ZO0B 1SLCA 2DDUA 2DU0A 2QQOA 1F9KA 1N1SA 2PN5A 1CAWB 1OF4A 4AHXA 1PO11 1ZA4A 2HWF3 4NWWA 4Z07A 3HR9A 3MI8A 3P1IA 3WQ0A 3OGRA 3CJIB 2R0FA 3AXEA 3H3LA 1H8TC 1VMHA 3DYMA 5A1FA 3AZVA 4XURA 5E6HA 3TEXA 4EYUA 1VMFA 4JGZC 4QPWA 1XNTA 1AUYA 4RL7A 4D8MA 2YC4A 4TTGA 2F17A 1AVBA 4S2FA 1AXZA 1UO9A 1G8WA 2AACA 2PAEA 3LA2A 4EN6B 3ZOIA 2BJSA 1QQP2 3AZZA 3ECQA 2X05A 1GQGA 1QQP3 4Y22A 4PIXA 1UW8A 5D8AB 3RNSA 5JVVA 1GP6A 3RYPA 2ZGKA 2G9FA 2P2KA 2A70A 2PA7A 1RGSA 4QQOA 4N53C 2EAKA 3KD4A 5FPXA 2DCJA 4NUBA 5FLHA 1I5PA 1OOPB 4YYOA 1HQWA 1KS5A 4GZ9A 1PVC1 4BK5A 5HCAA 3KGZA 1PO22 2P37A 4HK8A 3JCIA 2HJIA 4AGVA 4CCEA 1PO23 1W8TA 3ORJA 1OC1A 4AE2A 1ZBE1 4HN0A 4CUCA 3OPWA 1MZ5A 3K4ZA 3ZR6A 1AL21 2YPJA 1AYM1 5G05L 5GZFA 4DO0A 4F83A 5FZ6A 3U78A 3DPRB 4Z8BA 4PDWC 1DG6A 3BGAA 3WF4A 4KWLA 5CAZA 1NT0A 1ZA7A 1ZVFA 3PVNA 4COVA 1YFWA 1UPIA 1XYPA 2WR9A 2OA2A 4YGCA 4XFCA 3BPZA 3H50A 4ZXEA 4A3XA 4R9BA 1RHI2 3HQRA 1EUUA 3VD5A 4AFMA 4I2OA 1RHI3 1OPOA 2YFUA 4Q4X1 4LBQB 3A4UA 4LR4A 4PIYA 2QQKA 4N7IA 5FLIA 3OG2A 2VPVA 3MW3A 2E33A 1UYZA 4XUTA 4IGOA 2QQNA 2CHHA 5FZ3A 1RUH2 4HG6B 1Q8VA 2ZGTA 5A32B 1RUH3 1G9CA 3S7EA 1ZYBA 3BALA 4B4RA 3HN1A 3I59A 1JZ8A 3IPVA 1SLAA 3PUQA 2W9XA 4WVVA 1OQDA 2CY6A 3N7JA 2GNDA 3C8XA 1J3QA 4M3CA 5K0UC 2W39A 3GBWA 2H0BA 3O12A 1SEFA 3ALQA 4JC1A 4K1YA 5FBJA 2PHWA 4FP2A 5FYSA 1DQ1A 3WR0A 1SFPA 5FZIA 2YMZA 1CAVB 3AYAA 4C0HA 2BVVA 1KGYA 3WLUA 1WKYA 2JG9B 3OPTA 4ASKA 1NXMA 1X7NA 1FI2A 3VBUB 5JOZA 4JHZA 4QX5A 3UJOA 4UWDA 1QOTA 5LEJA 4HPKB 3MLKA 4YLZA 3FWEA 4P9WA 5JXIA 2XLAA 2HWC3 4QGNA 3SCFA 4XUQA 1SG3A 2Y0OA 3FBYA 1ULGA 4FPFA 5K8SA 3HEIA 4P9GA 4Q4Y1 3D4KA 1C8M1 2ZZJA 2WYFA 4XFAA 3N4MA 1HJFA 4K7JA 1H8VA 1LODA 3POFA 3B69A 1NKGA 1FATA 3CQOA 2RS32 1JZ6A 4UF0A 1VRH1 2RS33 4B7EA 3JXSA 3VBSC 4ES8A 5BNNB 2GN7A 3KT4A 4YVWC 1ND3C 4L0PA 4DFSA 1JZ5A 2EXIA 1KJLA 1WW6A 2HBTA 4W6WA 3DKQA 5FMOL 4BYYA 3EQEA 4GJZA 2NM1A 1YXWA 3BVCA 1XXNA 3ZFGB 1BCXA 4EJRA 3KWVA 5GLUA 4PF5A 3SEEA 3M2MA 4J1XA 5A3NA 3AMNA 4X8NA 4FXKB 5CB7A 1OPMA 3OD0A 2J7MA 2QQVA 1WLWA 4RS5A 4YPJA 1A34A 5C8CC 4QX1A 5GLTA 1O4YA 3CNAA 4MXWB 2QQLA 1Z7S2 1CAXB 1Z7S3 4QX2A 4BQ5A 5A33B 2O14A 1LGCA 1QXRA 3MIDA 4N9IA 4FAGA 5IUQA 3N3HA 2NMOA 5C70A 1YCIA 4D6QA 4QAWA 2XKPA 3ZYRA 4W8JA 4P9LA 4I30A 2ZOEB 3OGSA 1ND2C 4R4XA 2JDNA 4DUWA 3NNGA 3VZKA 1YEWA 4CDQB 2WNUC 5E16A 1CD3G 1NY72 3SH5A 4NE9A 4PCRA 4Y24A 1ULEA 1YNAA 2G4IA 3HQXA 2VL4A 4LK6A 3HNBM 1BMV1 3X29B 5FUIA 3AVRA 4IDZA 1JUHA 2MEV1 1OF3A 4EN9B 1RVF2 5FY5A 3WX5A 5IK4A 3J26N 3ZSKA 5CG9A 2BWCA 1RVF3 5FY8A 1B35C 4RR3C 3FHQA 1BLZA 1ULFA 2JDAA 5LA9A 2FDKA 1GQPA 5FQ0A 1EPWA 3IIIA 5BNOB 4YARA 1PK6C 1MQTB 1BK0A 1S2KA 2X09A 1HXS2 3VV1A 2P5BA 3WSOA 2X5IB 3TEZA 1SLIA 1HXS3 2QDNA 1K5MA 4Z82A 4H7MA 3B3QE 4OLLA 2HYXA 2R061 3I2GA 1A78A 4Y1ZA 2DWRA 3IZOA 2P1BA 1N1VA 1XB9A 3Q8FA 4CDUC 3U07A 1AHSA 4BQ1A 4N43B 4Y5Z0 1QKQA 1SPPA 2R1BA 3WZ1A 4QDSA 4DIQA 3WW4A 5JIUA 4CP1A 4FQ4A 2BRTA 4WM8C 2VY0A 4GXLA 5GZDA 5EFUA 1XBFA 3LOBA 2VQUA 1IG3A 1GYKA 2Z69A 3ZXDA 5F37A 3SNMA 1FNYA 2DUPA 3ZVXA 4W50A 1XQNA 1PVC3 5E88A 1VBB1 4G9SB 1AF9A 2JE8A 1V6IA 1ZBE2 2L9LA 1LHVA 1ZBE3 5FZ1A 1AL22 4YZ5A 1Q8SA 3A23A 3FHAA 5L7OA 4GJYA 3GDBA 4GMP0 1AL23 4KQ7A 2I07B 3THTA 2XPJA 2ADDA 4DUXA 3M4FA 2EIBA 3GHNA 2GZWA 1ZBA2 3VD7A 2BNNA 4LIUA 4XTPA 1BBT1 1XRUA 1ZBA3 5KC6A 3M3EA 2Y26A 1GWKA 2EALA 2UWAA 1G86A 3PURA 1PNGA 1RUE1 1HKDA 5FZDA 1UXXX 2NMNA 4GH4C 3GJAA 4M4PA 3C3VA 4FXGB 3DF0A 2XQXA 2PHDA 3WOGA 2PELA 4B7KA 2FD8A 2FCUA 3WHTA 3JBG1 1RTVA 3I3QA 4XFIA 4QGLA 1NCQC 4NHKA 4XJWA 3VHRA 3BIWE 4PLOA 1Q8OA 5B2GB 2QTWB 1S4CA 1H2KA 1NA1B 2D5HA 4YW2A 3U1XA 3URFA 5A1AA 4OULA 1TZOA 1FYUA 2WNVB 2MHFA 4MGZE 1CIWA 1IQDC 2BZDA 3MO4A 3WG4A 3VZOA 5A3LA 4Q0VA 1CIYA 5A3WA 2RR11 3FLRA 5T50A 1J1TA 1WLDA 4QHBA 3QLQA 5C3SA 1W6NA 2W3JA 3O1MA 5F3IA 4C90A 3NW4A 4Q0UA 1RUI1 4CXWA 1W8NA 5BYNA 5C33A 4YNIA 5GJ6A 4KH9A 2NZ9A 3K77A 2WSVA 4U36A 5FP9A 2J1EA 3VKFC 4A3ZA 4GB31 4Y5SA 3QH6A 1KQRA 3OB8A 2FDJA 2WRAA 3MZHA 4IERA 4NOTA 5FP7A 1OSGA 4CEWA 4CUAA 3WF0A 4AEDB 4C0BA 5C71A 4MHRA 4KMQA 5I8SA 3V0BB 5BNPB 5F2SA 4CP9B 3ZSEA 1AR91 4AI3A 1UKRA 1DLCA 3CZUA 1UZWA 1MS4A 4LPLA 3V64A 1EP0A 2Z79A 4I0WB 5JOXA 1T2XA 2YBKA 5F5AA 1RUJ2 1DQ5A 3K3OA 1RUJ3 2Z2SB 2FQPA 3H1YA 5FCCA 1PGW1 4Y33A 4WVZA 1JOJA 1XSRA 3VBRA 3SH4A 2GNBA 3VHNA 1EY2A 5FOBB 4XUOA 1YC61 1ZNPA 4CVUA 2QZ3A 3J9SA 3UGGA 1VBD2 2WFF1 4LBLA 5EYYA 3TWIA 3U10A 3VDDC 5IVFA 1VBD3 1YFYA 5L36A 4HKOA 4R9CA 4IV1A 1R081 2P4EA 5FZAA 4CDWC 1NX9A 1SBEA 1YFXA 5E1RA 3KCCA 4MYEA 2VUAA 3I2DA 3MFAA 1GZ9A 2PAKA 1DCSA 1GLHA 4PLMA 2DF7A 4Q1PA 5D2AA 3SLIA 4BJ0A 4LHLA 2GALA 3LWCA 4B1LA 4UFKA 4CRQA 4CSWA 3T0DA 5FYTA 5CFDB 2JEMA 4UT5A 3ZFEB 4QQ2A 4BQ4A 4EWEA 4JHTA 1XNAA 3THPA 3IDEA 2JG8A 2OZJA 4HSLA 5JR7B 5FZBA 3FE5A 1H0BA 3KVAA 3RFRA 4HETA 4HSJA 4NPRA 3PDQA 1F4AA 2W5FA 5FZLA 1S0JA 1SZBA 2Q1MA 2IZWA 2P3JA 3RQ0A 5KHJA 2ZAHA 4MADA 5DXDA 2XKOA 1W0OA 1UPSA 1QU0A 2MEV2 2WS91 3B93A 4A45A 5C8WA 1JYWA 3VZNA 2IWGB 2MEV3 1LHOA 4LKDA 1L3JA 5JXGA 5LB6A 2RVAA 4LJHA 4E4DX 2LW8A 3KB5A 4Q0PA 5DZFA 4AYUA 2B46X 2HEYF 3W59A 1ULCA 1JU4A 1Y9GA 5EHDA 4NVPA 1I3HA 4ZZ5A 5LBBA 2Z5WA 1Z78A 3NNMA 1H8TA 3WG3A 4DMIA 3ZMOA 4HMZA 1ULPA 2PHLA 3CJIC 5F6LB 5AVAA 2FZ2A 1H2NA 4LE4A 3TNQA 4JGZA 2ZKNA 3NSTA 3KT7A 3FLPA 5FZ0A 3UETA 3PU3A 2W94A 3VLBB 1KXGA 4XXAA 1SLBA 3T2TA 5I0TA 1H1IA 4YRDA 3Q8EA 4CCLA 3IMMA 4PQ9A 2Y6JA 5J48A 1DGLA 2VZSA 3E5QA 1F2NA 4FBFA 1BHGA 2QQMA 2BP6A 3ZFFC 4AK3A 4JDNA 2AEZA 4RD7A 4DNYA 3MLLA 2XL7A 2XJTA 4ZU4A 4R4ZA 3NAPC 3GZUC 4BB3A 1W8ZA 2Y8KA 1RUF1 2HKXA 4TLFA 5DZGA 3WCRA 4XDOA 3FBMA 2LALA 3I2FA 4P08A 2E51A 4ZXKA 2YPDA 2PHXA 2DVBA 4C1WA 1LU1A 3HOBA 2D97A 3N7MA 4PDWA 3U14A 4D94A 1XOYA 3BOPA 1V6KA 1RUNA 2RS52 3ZM8A 4LO8A 3DPRC 2FHRA 2LROA 2RS53 4ZKTB 4RGGA 2GMPA 3HJRA 3MPPG 4AQTA 2K9ZA 1OT5A 2W08A 5I0SA 1OA3A 5I91A 4GMP1 3POJA 2CL2A 4LEJA 5A3PA 2VE1A 4QXBA 3VHOA 4QB2A 2IVIB 3K2OA 3VBHC 5F1RA 1JU3A 1NXD1 4IGQA 1UAIA 3RMXA 3BU0A 4FPLA 3WDXA 2C4XA 1PGSA 3JBG3 2E53A 4XJAA 4XYXA 3OPZA 2EA7A 3MIHA 4HVQA 4LITA 5C9AC 4AW7A 1R1A1 5IVJA 2YROA 2ZS6B 1P8JA 4WM7B 5KHIA 1W6OA 2W92A 1ZRCA 5M0TA 3MUZ1 1J58A 1FOD1 3I2KA 2IXKA 3RVHA 2NQYA 2RS12 5T54A 1DP0A 5C3OA 1HB4A 2RS13 3VBOB 2VTFA 5K0UA 1IPJA 1LULA 4KWKA 3U37A 1O8PA 4FSJA 1UX7A 3LB9A 1ASJ1 1ZM1A 1W28A 2FCTA 4RN5A 3BKZA 4A7ZA 5AC91 2WZR2 4EWDA 1POV3 2WNEA 4JRAA 1RUI3 2WZR3 3POEA 5EJZB 1N3QA 5KBFA 1EPZA 1IPKA 2AR6A 1C28A 2X29A 4IEZA 2AREA 4GWIA 1AJKA 3K75B 3NNFA 5FMCA 3VBUC 1LU2A 3T1MA 1M06G 2ZEXA 1OLME 3NNJA 4UFLA 1O5UA 2JIJA 1JZ2A 4KU7A 3UJQA 3ETQA 1W6MB 1W39A 2V5DA 4GULA 2JDMA 3RI9A 1ENXA 3PTRB 2AUYA 3HNMA 4XW3A 2HWB2 4EV0A 4JZRA 1QMJA 2HWB3 1RL3A 2XHNA 3N7KA 4Z2WA 2B8MA 5CIRA 2YFZA 4CCNA 2GH2A 2W2IA 3AZXA 3TB0A 1IS5A 5LASA 1ZZ9A 3GJBA 5F5CA 4BQ3A 1LJ7A 1YIPA 1RMU2 1HRV2 1GZWA 4QU2A 1HRV3 1ND3A 1PIV2 1LNSA 2V73A 4YVWA 2BTVC 5FTTC 3TN91 3CEWA 1SFNA 1PIV3 3WG1A 5BNNC 2ARXA 1DQ0A 1QH6A 3RRDA 4CP2A 4ONUA 1V6JA 4OUSA 3S5QA 1MS3A 4DUVA 5JSOA 3WNPA 1R082 1JYNA 2GH8A 1R083 1W8FA 4AHWA 4QMAA 5EWSA 2KR2A 3AP5A 3SC7X 1W6QA 2WQ8A 3OBAA 4I01A 4OI2A 2D6LX 1O3RA 1RITA 3TRSB 5C4WB 5JZGC 3JQWA 3POYA 4NIIA 3IDBB 4A44A 2W1UA 4XFFA 1I6XA 5FMDA 5BPXA 5EYXA 5KXEA 2B4KA 1KFXL 1ND2A 2IXHA 2R16A 4BIFA 1GP4A 1XNKA 5ANQA 4XABA 4DRVA 4LHKA 2WNUA 2BW8A 2XWJB 3TYJA 1ZRRA 5CFCC 1N3OA 5FY9A 2CTVA 4QKNA 3LDRA 5LW9A 3ACHA 4Q4V1 4QM8A 3VL9A 5FAXA 3WCSA 1O3QA 3WP5A 3VKLA 2YGLA 3QD6A 3H3UA 4JGYC 1KFUL 1JYIA 1GZTA 2W91A 3FMGA 1IZ3A 1SDWA 4HANA 4LBOA 1B35A 2ZHNA 1JUIA 1QHDA 2V4AA 2WO1A 5LK5A 1VBC2 4KWUA 2RMU2 4XE9A 4L9BA 1VBC3 2RMU3 4CU6A 1PK6A 2VR4A 2K0GA 2ZEZA 2P6HA 2BEOA 4E4ZA 5C3PA 2VUCA 3NV4A 1LECA 1JXNA 4CDUA 1HB3A 3N9MA 1UYXA 1OI6A 2VBDA 3CO2A 5FYCA 2VZUA 1NLSA 3AYEA 3NL1A 3WW2A 4WM8A 5HBAA 2O8QA 2XBO1 3PU8A 4NRMA 5FPLA 3KQRA 3INAA 1DDLA 5J7MA 1QWRA 5CYYA 4Y1YA 4MGTA 1MACA 4LA3A 1PX4A 2VW1A 3NJXA 2DBIA 5FZFA 2TNFA 4AQ6A 5EP9A 3WD5A 2NYYA 4BH9A 3AYCA 4DS0A 3SXWA 1UF2C 1AR62 4CPBA 3IN9A 1FMD2 1R1ZA 4M3CE 2XB6C 1FMD3 5CISA 1QJX2 5LK7B 3VZMA 4GIQA 3ON7A 2VNOA 4A7YA 1QJX3 1HV0A 3ZLIA 1AR82 1XPWA 4CYDA 2IC1A 3AKPA 1AR83 2AENA 3B5LB 3FFZA 3AJYA 3K4AA 4QB6A 1LGNA 2ZGUA 1GKBA 3ZN5A 3SKJE 1GZCA 3BCWA 4K6BA 2BWAA 1WMXA 2ZGNA 2XONA 1JYXA 3AMMA 3C7EA 2DVGA 4E8DA 1QJU1 3E6BA 3I3DA 1ENSA 3OTFA 2QCSB 3CU7A 1XYOA 1MS5A 2XJVA 3AZYA 4GH4A 2VVDA 4ZONA 3WW1A 1LB2A 5JCTA 4BWOA 3CMGA 4Y26A 4ZPIA 4CEYC 4LKFA 1NCQA 3POBA 4GQ7A 1TNFA 3U4XA 1F4HA 1VBA1 4XF1A 2WUHA 3H1MA 4IV1C 3RZZA 2WYSA 2GC3A 4YW7A 4Q27A 2WBKA 2GN3A 1EV11 3ZYFA 5JOYA 3V65A 2GP3A 4JRLA 5DDJ2 5IYYA 3A0KA 1ASJ2 4YW5A 2E7QA 5DDJ3 3B7MA 1ASJ3 2VBPA 1UZZA 4JCKA 2J1RA 3ST7A 2VD7A 3U4SA 1BEV1 3WDUA 1V00A 5AC93 3EB7A 3H8RA 3IM0A 2Y6LA 2ZX3A 4QPYA 4FTEA 4R8HA 1DGWX 3MPBA 1Q8QA 4IEVA 3RZHA 2OUJA 3ZXEA 4JTOA 3MDPA 2RM22 3MFCA 1UD1A 4IE7A 2GAUA 2B9VA 3C7OA 2RJLA 4N90A 5IHRA 1CGPA 1CQ9A 3J8F1 2EAAA 4IE4A 1WW5A 1S0IA 2DVDA 2HWF2 4CPBD 4Z92B 2QZ2A 1E5IA 1QNYA 3O0VA 3MV11 2VCMA 1S1AA 2KA3A 1REEA 3AVSA 1NAEA 1QJZA 2FMDA 2R32A 3U0ZA 4EE2A 1BYHA 5BNPC 1S0FA 4NMIA 4YW6A 2ARBA 1Q5OA 1VR3A 4BQ2A 2V72A 5CKNA 4W65A 4HKWA 1CWPA 4NIDA 4HL0A 4QPIC 2QQUA 4MOAA 1PX3A 4HFSA 4QDRA 3KV5A 1BVP1 2WO2A 1OFSA 5JDBA 1VPHA 2ARCA 5F3CA 3TN92 2BOJA 3K48A 4OQ9A 2VOWA 5CA6A 3TN93 4XFGA 4YGDA 1UQXA 1ZZCA 4BZ4A 2D44A 4RQPC 4QT6A 3VDDA 2AZ5A 3I97A 1G9BA 2GU9A 1JH5A 3JD72 3N9OA 4NROA 5FYBA 1LTEA 2QUOA 5T5PA 3JD73 3ZYBA 4CDWA 4Z1VA 1V0AA 2BGOA 3BN6A 1YJKA 3VD9A 1KDKA 2YBSA 1QJEA 1UMHA 4JAAA 5DAQA 4E4SA 1VBE2 5FR3A 1AR72 1DQ4A 1W04A 3IKWA 1F31A 4YG6A 1VBE3 2GC0A 1AR73 3IPVB 3AL5A 4ZU5A 1GUIA 4YZ2A 2LRPA 2Z4FA 1HX6A 3PL0A 4V1PA 3RG0A 3T2OA 5CFDC 4A42A 2JE9A 1SCRA 1ONAA 2F4LA 5HXMA 1WMDA 3WNMA 1JHNA 1EYBA 4NHYA 4RHV2 4LK7A 3S5AA 2YU2A 4FOYA 4RHV3 5CKQA 5KC5A 2ZGQA 3I7DA 2GMEA 3WUCA 3CIHA 1BJQA 2AYHA 3KS7A 5F2WA 5SV5A 4AVTA 2OYZA 5A7NA 1NLQA 3D8CA 3J7MA 1WCDJ 3NQHA 4DRRA 1MVQA 4K40A 2CYFA 2QVSB 4I02A 2ZZQA 4MH0E 2X53S 2QE3A 4QPGC 1MZFA 1RUD2 4FT8A 1CAWA 4NR1A 5DUUA 3SMHA 3WUDA 5FZ8A 1RUD3 4IW3A 1JZ7A 2JDKA 2RG4A 5ACA2 2OZ6A 3N9LA 5ABJB 1MS0A 3VBFC 1DZRA 5ACA3 4CCJA 1OH4A 2YHJA 3CJIA 3LFMA 5AFEA 4AVBA 1UY0A 1RB8G 5DN2A 4E2QA 4CA9A 2G9GA 4Q8KA 4Q5OA 5FJKA 5C8CB 2Q8CA 4QKFA 3ELNA 3RYKA 4UF0B 1JYVA 4HVOA 4D7TA 2JXAA 3NKTA 2VZVA 2RJKA 5IVBA 2H6BA 2OPWA 1EAH1 2XVGA 4G3YC 5ERLA 5JI7A 3W21A 3T0BA 3WQBA 4X6RB 2Q8DA 4CZSA 1O8SA 4QHZA 3ZFFA 4YZ3A 4BOWA 5I8TA 1ENQA 3RZLA 3OF1A 2DCTA 2VJXA 4W6XA 4BMEA 1SACA 3HBKA 3FZ3A 4RS5B 2PFWA 3NV3A 2FCVA 1X9TA 3NAPA 4ZS3A 2B39A 3TEWA 3LD8A 4CXYA 1J3PA 2VOVA 3PUHA 1OOPA 4FPEA 5EIYB 2W52A 1H1AA 3EMRA 5EZWA 2HWC2 3M8LA 1OQ1A 3M3IA 3PIJA 5F6KA 3SQOA 4A2UA 1C5HA 3LE0A 2VMHA 5GM0A 1AYN2 4R9DA 2W46A 1AYN3 4EWAA 2BGCA 1NUKA 1W03A 1JI6A 1YWKA 2XJUA 4DOUA 4INDA 5AVPA 3KM5A 5D1IA 3Q8BA 3SH3A 3ZYIB 3DPRA 4LE3A 5LY1A 2OS2A 5JXJA 1Y3TA 3NRUA 3W5MA 3HNYM 2EF6A 3NWKA 3FUQA 1QJY1 3IT8A 1OXCA 5IK5A 2VOKA 4NIAA 2XGXA 3FC0A 2OIIA 1W9YA 2WT0A 3VBHA 4LUMA 2PMWB 4DB5A 1FPN1 4OUMA 4L92A 5KR7A 4IV3B 4XXPA 5H9QA 5C9AA 4AL9A 1U5XA 2ZACA 5DUVA 5FQ0B 5FXZA 2E7AA 4I0BA 4MGQA 4YW4A 3E6CC 5A32A 4TXWA 5FY4A 1XSQA 4QDQA 3W58A 3ENRA 4Q2FA 5T5LA 4ORFA 2ATFA 1GNZA 4ES9A 2QQJA 3HMYA 3ROUA 3H8UA 1WBLA 1UU5A 2XOMA 5JMOA 2VULA 3WDTA 1MR5A 1OMIA 4AQ2A 2FBEA 4FPCA 3ACIA 4R9AA 1CAVA 2WT1A 3FLTA 3POWA 5F3GA 2WDBA 4CU9A 1TME1 4U2AA 1JYCA 1I5ZA 3VZJA 2ZGOA 1FV2A 3SISA 4CCOA 2DCYA 3OD4A 1GSLA 2CDPA 3NJVA 4MX3A 3VBUA 3WNNA 4IEUA 1Y4WA 3ZYJB 2DFBA 3C2UA 3MV01 4AFDA 5FK8A 4Z2AA 3LEGA 3AL6A 5I93A 5L19A 4QQPA 5K7PA 3ILRA 5LZ6A 1PO12 3VB9A 2G1MA 2R0HA 1PO13 5FZCA 5L7OB 5FLJA 3ME2A 2YYOA 3KV6A 3MBWA 4Y5TA 3UGFA 2E63A 4A6SA 2WLPA 5DUWA 1NQJA 3OEAA 4Q1RA 1XE0A 2C1FA 2VCCA 4AXOA 1PNFA 4BQWA 2OUHA 1ENRA 4BLJA 3W20A 3PHMA 2WZPP 3CJXA 2DU1A 3UK9A 5CVRA 4AVAA 1U12A 1XE7A 1KS4A 1TG7A 3PTYA 3QOPA 3ZKYA 5BNNA 4LIVA 5BNQA 2GC1A 3EXUA 1R091 2YXSA 5DABA 3VKOA 3A7QA 1BQPA 2PYTA 3KCXA 4P14A 5ANNA 3ZYPA 4UBHA 2EVXA 1UOJA 1PMHX 2DCZA 1RYYA 1US3A 2QBXA 4PF1A 4XQ4A 1OH3A 1PVC2 2WZEA 3JB8A 1JZ3A 5JZGA 1LESA 3IMNA 4L11A 4FPKA 3GALA 4XJ9A 5HCFA 4HN1A 2XLFA 3UYJA 3EYPA 2IXIA 5A33A 2R6QA 5C4WC 2P3YA 4FPJA 2P34A 1S0CA 2MPFA 1AYM2 5I0RA 1ZRFA 2IVJA 4L2NA 1AYM3 3PLQA 3L2HA 5CFCA 3S57A 2A7AA 5FZHA 2VTXA 3LA3A 3Q8CA 5F39A 5FPVA 1HB1A 2ZX0A 2ET7A 5A6QA 2JDUA 4JGYA 3LKJA 2A6XA 4XMAA 3R4SA 4QU1A 3H0OA 4D6RA 4UW6A 4Q4X2 4BHPA 3N9PA 4ET7A 1OHFA 4NHLA 4Q4X3 3WQ7A 3RJRA 2HH9A 5A7PA 1JN2P 2R7EB 4YFWA 2PQSA 4OHZA 4X6QB 2VZ1A 2EICA 5GLWA 4FPOB 4AEMA 1K12A 3KV4A 5HI0A 1A8DA 2I74A 4MG2A 4XHBA 4M00A 1MQTA 1G7YA 4LORA 1DYKA 4F3JA 4YVSC 4K8RB 2DBNA 2ZMNA 4ZZ8A 4AEJA 5IAVA 3MGUA 1YFUA 1GFF2 3VBRB 1XNCA 2D6OX 3WVJA 1XC6A 5KHKA 3RSJA 4QX0A 2VW2A 1W6PB 3OY8A 4ZHNA 2B5HA 4IE0A 2R071 2ZGRA 1VRBA 3DXUA 1NOVA 1DGRA 4ASMB 3HWJA 5J3UA 1FX5A 4NRQA 1XE8A 3B94A 3Q9OA 1D4M1 3UKVA 3ZXKA 1UOBA 5BY5A 2QQWA 4XMIA 1VB4A 2RDNA 1GICA 2JKBA 3SITA 2OT7A 4Q4Y2 4XDQA 3GCXA 4ISRA 2BOIA 2VMDA 3MIEA 4XJ8A 1C8M2 4Q4Y3 5GALA 4AI1A 1GWLA 4HT1T 2GDFA 2Q1ZB 1UCXA 1C8M3 3ASIA 2JG8B 3TBDA 5J36A 2GNTA 2DUOA 1QDOA 1IGOA 4LKSA 3THCA 4BK4A 4YZ1A 5LRSA 1J59A 2VECA 1X9PA 3PVEA 5FZEA 2B9UA 2JKXA 4AI0A 3RWNA 5KXBA 1QJFA 1LOAA 1OURA 1Y43B 1VRH2 2F6BA 1V6NA 3WW3A 4BQXA 3B01A 1VRH3 1RC6A 3LSDA 4RA0A 4OMCA 1UOGA 1E57A 2JD9A 4AG4A 2CWMA 4HBNA 1DBNA 4KNCA 3T1LA 1CR7A 2NN8A 4CEYA 4UW3A 4KU8A 1C8NA 2OX0A 1WW7A 4GKXA 4KWJA 3OGVA 4M4RA 4CDXC 4W4ZA 3T2PA 3D0JA 5J96B 1BXHA 2VMFA 3DEMA 5CG8A 2JICA 4MXVA 3O0WA 4I09A 2VXJA 2ILMA 5IW0A 4JGZB 4KL1A 1FXZA 5CNAA 2WNVA 4TYSA 1GOFA 2YB7A 1W9TA 2YGMA 5EXOA 1MS8A 3NMBA 5FKCA 4TN7A 2VGDA 3N36A 4PIZA 3T2QA 1JS9A 1PZ9A 1YQ8A 2NP0A 1NCRB 1O5LA 4S2GA 1PZ8A 1TME2 4SBVA 4N53B 4WV8A 4CE8A 5JI9A 1W3XA 1TME3 2ZMLA 4AAPA 3H3ZA 2HWE1 3ZYHA 1BMV2 1YI9A 4XQWA 4BE3A 3IDCB 1LOCA 1SCSA 3D3AA 5CEHA 1J83A 1V9U1 3IWZA 3T08A 4AEKA 3AKSA 3RZKA 4D6SA 3JZVA 1CPMA 2PHRA 3ZN6B 2VTXJ 4BDVB 4YM3A 4AEDA 1W9SA 5A3OA 5J09A 1GBGA 4MSVA 1K42A 1HRI1 3V0BA 1G9AA 1IS4A 4IXLA 5BNPA 3BIEA 4YG0A 1ZX5A 1PM4A 3DCQA 4CP9A 3LDKA 5A7QA 5ISLA 3B00A 2UU8A 4QPIA 3PMEA 2R062 5FZ7A 5J37A 2OQ7A 2VM9A 2R063 2XDVA 4XACA 3VN4A 4AFCA 1JHJA 3USUB 3V0AB 4K8FA 4M3CF 1LRHA 1D0HA 3KCYA 5FYUA 1ST8A 2VG9A 1U5YA 4NHXA 1W9WA 4PBPA 4RQPA 1LHWA 3O1TA 5D21A 1R093 3BODA 4I0AA 1UN1A 4LO5B 3KLSA 3HBZA 3TAYA 4HOOA 4WVMB 2ZGSA 5D8AC 5H9RA 1PVXA 2YC2A 1O4TA 1CZVA 1W6OB 4MHUA 5GKAC 4ASLA 2IFWA 2PQQA 3H8OA 2F4PA 1VBB2 2J1TA 3LFIA 1OOPC 1VBB3 4Q4W1 4FPGA 3DL3A 5CFDA 3ZFEA 2OVUA 2DUQA 3NV2A 5K0UB 1F35A 2UYBA 3WEZA 4Q0SA 2XL9A 2W1WA 4KGGA 4RSUA 1CZTA 1BBT2 3WF3A 2XUMA 2A3XA 4WBBA 1BBT3 1SLTA 5F9TA 2PHUA 2JB8A 3JB4C 2RDQA 3ACGA 1RUE2 4TLGA 4LTAA 3WHUA 2BUKA 3A22A 1RUE3 3I2JA 3WNXA 2WN2A 2A75A 3VUOA 3AM2A 3B9IA 1LR5A 2ZHKA 3I2HA 2MNGA 3E1F1 2H6CA 3VKMA 3O0XA 1QY4A 3H42B 1W8WA 3JBG2 4QPGA 1FV3A 2VW0A 3POIA 4OHVA 1FNZA 5CKMA 4B4PA 2JX9A 3P3NA 3PUSA 3VBFA 3AFGA 5FYIA 4XTMA 4AI2A 2ETEA 5FZOA 4FOVA 5ABJC 4LMFA 2R041 3CBNA 4DZGA 4GAZA 5T55A 2PLV1 1LKNA 2E26A 5LRRA 1WD4A 3I4IA 4WZFA 4FO9A 4XFHA 1GZWB 2Q8EA 1HN0A 1Y9MA 1NZCA 2J42A 2BV4A 5FXVA 1QOOA 1ND3B 5KHHA 2RR12 5BXXA 2A71A 2RR13 4GWMA 4A4AA 3SEPA 4IEOA 2GP5A 2ES3A 4I3PA 1WWYA 3DKWA 1OVPA 1RUI2 2WC2A 3AP9A 3K4DA 3SCHA 4GD4A 2HWD1 5DG2A 3UV9A 3PJQA 2ZABA 1W3VA 1S0DA 1IOAA 3D5OA 2WABA 1HW5A 2JG9C 3EBRA 4GB32 1UZ0A 3RZGA 1W2OA 2ORZA 4GB33 1COV1 1DYOA 1RUG1 1B09A 2PTMA 4LXLA 5C5UA 2A5ZA 4IGPA 3BTAA 3H7JA 2JJ6A 1AX2A 4IEQA 4MVTA 3D6EA 4V2WA 1YUDA 2Q30A 4CUGA 2D6PA 1AR92 1ND2B 5FV3A 1GANA 5F32A 3ZPOA 1AR93 4C91A 3RDIA 4XIKA 3AC0A 4O7XA 4P9IA 4XBQA 3CF6E 3T0AA 1TNRA 1W2TA 3QCWA 5FYYA 4LBNA 1UL9A 1RJ7A 2D3RA 5A7WB 2WA4A 3ZXGA 1PGW2 2D98A 2Y6KA 3KHBA 3ZDVA 1A3KA 1Q8PA 4BXSV 1NE4A 2I45A 2JWPA 3OUJA 1H4GA 4IL7A 1OQEA 1LENA 4PI2A 1B35B 1W2AX 5BUVA 2WFF2 4RR3B 2BQPA 2UWBA 2VCBA 2WFF3 4IV3C 2XR4A 2XUEA 5FKBA 3ZFGC 1PK6B 3RS6A 1V70A 3WF2A 3R4UA 5JWPA 4N7UA 4BPZA 3VD4A 1ODMA 1YYNA 1MZEA 1OLQA 4ZS2A 5FP8A 1RXFA 2FZ1A 4JDMA 3ETPA 1W2UA 3RYRA 3HPNA 5FBZA 4BLIA 1QNWA 1KDMA 4CDUB 2V4VA 4DXZA 5A7SA 3ZYGA 5JUVA 2BNMA 2YC0A 5L9VA 2ENRA 4LLFA 4E4HA 3W5NA 1ZZ7A 4NN0A 1QQP1 4IQPA 4CDQC 3F95A 4G4FA 2WS92 2R30A 1D2SA 5F5QA 2WS93 2JIGA 3UNPA 1G9DA 3GBGA 3T09A 4H3WA 3SKVA 1YQ5A 3OYWB 3DUIA 1WCSA 5JSRA 1PO21 1K5JA 1TMF1 1UZYA 1W6MA 3PUIA 4GA9A 4LHNA 2A6ZA 4UXAA 3USSA 4JKLA 4FP3A 5BNOC 2W1SA 4NAMA 3TEYA 1F8VA 1MQTC 2OKXA 2KXLA 2NPIA 3AP7A 1NYWA 2X5IC 4PLNA 4F8AA 2UURA 4D7SA 4PQQA 1MVEA 4BMBA 3LPFA 1VMJA 1VAKA 1RHI1 5FYZA 1JBCA 3GYDA 3AX4A 4N43C 2I2SA 2XWBB 3MICA 4XAAA 4BISA 4DQAA 5HPOA 3BPSA 1RUC1 1YO8A 2VNGA 1NCQB 5DAWA 4LA2A 1DGRN 4X8PA 4GWNA 3ACLA 5A3MA 3VDCA 3K46A 1CJDA 3OUIA 4MV2A 2ZGMA 1RUF2 1S0GA 1CAUA 3KZ4C 3DV8A 1RUF3 4YG3A 3P6BA 1IS6A 3NJYA 3MIGA 5DAXA 5C4WA 1PGL1 1LHNA 1O7FA 1MPXA 1WCKA 5FYHA 1KITA 1W2NA 3ILNA 4IE6A 3CL1A 2WSUA 4YM1A 3CKHA 2HBUA 2WJSA 3EO6A 3NKGA 1CZSA 2P3KA 4D7YA 2FDGA 3QBQA 3ZSLA 3M7AA 2VZQA 3R05A 4UW5A 4BQYA 5LA0A 5EPAA 2JDYA 3AYDA 2VZTA 3PMSA 1IS3A 4OMDA 5FO8B 4GMP3 1ZRDA 1FT9A 3AKTA 1H1MA 1V6LA 2CGOA 4QX3A 3UGHA 1YI7A 1ZZBA 2CAVA 1QEXA 2VNVA 3PUAA 4QXHA 4LOSA 1R1A2 3LAGA 2VZ3A 2SLIA 3CLPA 2X10A 5JIAA 4KGQA 1R1A3 1W99A 5IVYA 4YZ4A 1GMMA 1S2EA 1FOD2 4YVSA 1FOD3 5FXXA 1NA1C 2BYVE 4UYBA 4AHZA 2VVEA 3OSDA 2UWCA 4AVVA 2B7YA 2WNVC 2QFEA 2JENA 2RS31 5FUPA 3OGJA 1HDKA 2Q1FA 4DY3A 3O1SA 1XJAA 1TEIA 3I2IA 2O0OA 4S2DA 5GLZA 4Y1XA 1ODNA 1ULDA 3VDAA 5AC92 3VD3A 3LQCA 3GBFA 3VDDB 3LIGA 3N9NA 1QXPA 4Y22B 4FAHA 3J4UH 2QKDA 1N3PA 3GXUA 5FP4A 4ATFA 1URXA 1HLCA 1C1FA 1COV2 4XOGA 3WF1A 2XJSA 1COV3 5AFBA 3O1VA 3E5UA 5FREA 3GZTB 2WQZC 3KHCA 3LEMA 4K9SA 3OCPA 2V09A 2FDHA 5LBFA 2YUEA 4AEDC 1LOEA 3KSCA 5CADA 4HK9A 3PVOA 2ZTNA 1WA4A 2B45X 2YBPA 1D7PM 2DTYA 1Q3EA 3TOJA 5HV4A 4P9XA 2WFPA 3O1OA 1NY71 3MYXA 5EJ1B 5IK8A 2WAAA 3F2ZA 3P5BA 4JQTA 1SMVA 1YQ6A 3ZPYA 4Q29A 1JOBA 4WZCA 2XHKA 5FYVA 3RMYA 1ULOA 3BOWA 3GM8A 1RVF1 1WMFA 2EIEA 1OVSA 5DAPA 1J1LA 4AWDA 3MHZA 4H55A 4Y20A 4CDXA 1E5RA 5LATA 2BFUL 4QM9A 1U5IA 4Q26A 5DG1A 5LBEA 1XYNA 3I59B 3VZLA 2C0ZA 2K46A 1HXS1 4HKLA 1CX1A 1QIQA 1WW4A 1X36A 4MZUA 1AXYA 1UY2A 2G9ZA 2Q0AA 1O3SA 2ZEWA 2Y6GA 3ZFEC 3HAGA 4LUKA 4M3CB 1S2BA 1A8MA 3OBZA 5A80A 2BFUS 4O9GA 2W0XA 2YY1A 2Y64A 1SQ4A 2IXJA 4P02B 4O65A 3WP3A 4HXCA 2VZRA 1GR3A 5DZEA 3U75A 3ZFFB 1NCRC 4ATEA 4MUVA 4Q4V2 4QD2A 4QQHA 2VMCA 4Q4V3 4FPHA 1IQAA 4XETA 1UYPA 3NAPB 4IEWA 3AP4A 4JTNA 1XNBA 5A3UA 5J98B 3MW2A 1LEDA 5A6YA 1WCUA 4QX8A 1DYPA 5JXHA 3RGBA 1TMF2 5B4XA 1TMF3 2C6SA 4JKMA 4PBOA 3AXDA 4YM2A 2K2SA 5KXCA 2WINB 5FYMA 3HIFA 2D3SA 1X8EA 2E9QA 4AF9A 5LEKA 2W47A 3O1RA 3GZEA 4HZFA 1ZBA1 2FDIA 4A41A 1N47A 2ZXQA 1JW6A 2OPKA 4XF0A 1F15A 2D6NA 2BPA2 2VQTA 3ZIXA 1OLRA 3VBHB 4C8DA 3JUUA 3BUCA 1W90A 1C5IA 2XBO2 2YDEA 1RUC2 2VQ0A 2EIGA 1TVGA 2XBO3 5C9AB 1NZIA 1RUC3 2VAUA 2WL1A 2P3IA 3BYWA 3MIFA 5D8AA 4KG0A 2XLGA 1UU6A 2ZPXA 3ZXLA 1DFQA 1SLLA 3PJYA 2BBVA 4MO3M 1CX4A 3CHXA 5FZ4A 5IWFA 1POV0 2JECA 1PGL2 5IVCA 2CGPA 3HVDA 5FDBA 5IVEA 1RINA 1EUTA 3APBA 1H30A 1VB2A 2HYKA 1LCLA 4XBLA 5J1XA 3AB0A 2VZOA 5GZCA 2WO3A 4IETA 3WXPA 1H4HA 5BV6A 3PIGA 3VL8A 4P00B 1DZQA 1W8UA 2XJQA 3A0NA 1QJU2 3FHIB 1SFYA 3J7NA 2E7TA 1PMIA 1QJU3 2JB4A 3GHMA 5FWJA 1DLLA 3OOXA 3GZAA 3GF6A 5I0UA 4E8CA 2RDRA 2GSYA 4LBQA 3WP4A 3DGTA 5FFOC 3CDZB 1YRZA 2VUJA 4N8MA 5CZKA 1TE1B 3KGLA 3FJSA 3R0RA 3ZN4A 1PM7A 1VBA2 1YQ2A 3T3YA 2TEPA 3S7IA 1VBA3 1S0BA 5ABJA 1X8MA 2ZGPA 3T30A 5FO9B 3WG2A 1XNDA 3I3EA 1OA2A 4QXCA 4WM7C 1EV12 1K5MB 3UKTA 3UESA 2G19A 1EV13 5FIXA 5LCWL 5C8CA 4IESA 1RUJ1 4FVVA 4NPLA 2HEVF 3VBOC 1PZ7A 1BEV2 1SPPB 2CU5A 1BEV3 4MGSA 1IPSA 2IFRA 2JDHA 1NQDA 1VP6A 4LLOA 5DAVA 5APAA 4COUA 3I49A 2LM3A 2WQ4A 4CTEA 1U5ZA 1VBD1 3ACFA 1V6OA 2DURA 3S30A 3GNEA 5CU1A 5FZKA 3UL2A 4P9JA 3KQ4B 4A7KA 5KXDA 2JG9A 1GOGA 4OI4A 3E6DA 4YFZA 5JZGB 4D3WA 4HPKA 5FMOS 1AXKA 3J8F2 1VJ2A 3J8F3 1H6YA 1VLNA 3AP6A 1LOBA 3T4HB 1RJ8A 4P9YA 1WMEA 4BCUA 4R52A 1ZREA 5IFPA 1OBNA 4F7ZA 2E32A 1HN1A 2TBVA 4UAPA 4CCDA 5CFCB 5IFTA 3BTZA 5B4NA 5FY7A 4I3GA 3ZXAC 2C9KA 2W95A 2ZKLA 2ZX4A 3MW4A 3WP6A 4B1MA 3M1HA 4HLTA 3ZXFA 4LT5A 1LOFC 4JGYB 2C24A 2C9AA 4OVEA 1GOHA 2YV8A 1AL0G 3H9AA 3OBRA 1REDA 3M3CA 3W9AA 3ZR5A 1NG0A 4Q8LA 3ZXJA 1H6XA 2VQAA 4IV3A 4W6YA 4LBQD 2BNOA 3ZFGA 1QOSA 4FI9A 4BXFA 2WWUA 4ZY9A 4AAXA 1CJPA 2VXRA 1ZZ6A 4H2AA 4DXTA 1AJOA 2VCAA 4XF4A 4N9HA 4A6OA 5C3RA 1D2QA 4XILA 2GMMA 4YM0A 4NIGA 1US2A 4CCCA 4DXSA 1QXJA 1H9PA 2VOTA 4C1XA 3WNLA 4MXWA 1KEXA 4TWTA 1Z0HA 3POGA 1O59A 1CAXA 5GLVA 1XU1A 3VHPA 4LO6B 3MIBA 4KBBA 1UX6A 4NPMA 5FPZA 3ZSMA 2AGSA 2HEWF 1BZWA 3BB6A 1W6NB 2RJ2A 4K20A 2XVLA 3OY8B 3M3QA 5DQ0A 3MF9A 2CAUA 2LUWA 4OI0A 4H14A 4CDQA 5JMCA 4CUBA 2ID4A 4CXXA 3N7LA 1NLRA 2D40A 1SBDA 5HV0A 1JTZX 3IAPA 4IE5A 3DYPA 1L7RA 3LEKA 3R6SA 4OHXA 2Y6HA 5LA1A 1OD3A 4JVAA 1CVNA 1N1TA 2WLQA 3K51A 5IJRA 4CEWB 4YGEA 3J7HA 1UY1A 3NVCA 2FDFA 1E5HA 4UW4A 2D3PA 1MEC1 4M0HA 3C7HA 3A21A 4BM8A 4CCMA 4LULA 1MZ6A 1DQ2A 4UFIA 5T52A 5K9YA 5FMBA 5BNOA 4MGYE 2QJVA 2XG3A 2OW4A 1J84A 4UOJA 2P6CA 5LA2A 2AEYA 2WIIB 2RS51 2X5IA 3C7GA 1HB2A 4URAA 1QF3A 2P17A 3HT1A 3RZJA 1RUOA 1C57A 3N9QA 3B02A 2JDPA 4XZPA 2XXZA 4AI9A 1EAH2 4B29A 5FOJB 1EAH3 3LIHA 4K3UA 2XMLA 4N43A 5EQUA 2HLEA 4AFAA 2J1UA 4CEYB 4ZU7A 3IAQA 3LPGA 4QXKA 5FUNA 2IUWA 3KV9A 5F7UA 4IV1B 5DMYA 3OUHA 3PNAA 1WBFA 2PAMA 3WDWA 2E6VA 2ZX1A 5FJHA 4V2VA 1HQLA 1GU3A 1I1EA 1JYTA 1T6BX 3DXTA 2VUDA 3I3MA 1UMIA 1VALA 4ISQA 4LBJA 4XZUG 2ZMKA 2RS11 1S0EA 3ZDSA 4IEYA 4E27A 2EXJA 1ZRIA 3LF7A 4COZA 1CONA 3MF6A 3LDBA 3P3PA 4J25A 1R64A 1UY3A 4XFBA 2QQPA 4FOWA 1POV1 2ERFA 2WZR1 2W87A 1QJY2 2KD7A 1A6CA 3AFKA 1W8HA 1QJY3 5FK7A 4MGKE 1OFNA 1CPNA 4FFHA 2ZBJA 1NE6A 2N7GA 3AMPA 5A7OA 3UKNA 2AC1A 3ZKUA 4OCTA 2LS6A 1STMA 1FPN2 4UI9L 1WZXA 1YHFA 5E89A 1FPN3 2VMEA 3ABZA 2AH2A 2Y33A 4QX7A 4RYDA 5FZMA 3VDBA 1IG0A 3QH7A 3IB3A 3KF5A 3EHKA 4XJZA 4FTBA 4AHYA 4OHYA 2D5FA 2J1VA 5F3EA 1H8TB 2HWB1 3WNKA 4EN0A 4AI8A 4AQSA 1ZZ8A 4QPIB 4EN7B 2A73B 5IVVA 1CN1A 1NA1A 2Q5TA 1RXGA 3WINE 2JE7A 3KT1A 2J1AA 2LTNA 4E2SA 1UIJA 1RMU1 4P5HA 2VMIA 3AMHA 1HRV1 4FFGA 2JD4A 1C4RA 4HONA 4RQPB 4XC9A 2W68A 4YW1A 5A6ZA 1PIV1 2Y0IA 4MLOA 2OXBA 4OZXA 5L73A 2XH6A 2RE9A 3S6PA 1W6PA 1GNYA 2ZGLA 5FPBA 4Y3OA 4LHSA 2XVKA 2BBAA 4XCAA 1UXZA 1DF0A 4FOQA 4M01A 2DYCA 4PT6A 5G04L 2J22A 3D82A 3LEIA 3IBMA 2D6KA 2ADEA 3WQ1A 4OZOA 2YU1A 3FN9A 4EQVA 2VC9A 2VH9A 1IKQA 2PHTA 4J6GA 1H2MA 4PDWB 4XPVA 1O3TA 4FPYA 3MUY1 2KM2A 1W0PA 1GQHA 1KJRA 2XJPA 2RDSA 2XQRA 4E9KA 5FZ9A 5SV8A 3WDYA 4CU8A 2D93A 4AOCA 5LY2A 1BK1A 2Z42A 4QHOA 4UBGA 1FAYA 2H0VA 3R4DB 4LKEA 1AX1A 1AZDA 5TSWA 5I8YA 2DFCA 3LA7A 2CGNA 3O14A 2VBBA 4EZ4A 4LBKA 1R092 4OQ8A 4M0NA 4QPGB 1I9RA 3OGGA 5FP3A 5C5TA 5FPUA 2WO7A 4AGRA 3LZZA 3WY6A 1VBC1 5IATA 2RMU1 3E5XA 3VBFB 1X50A 2CDOA 3U11A 5FZOB 1JMUB 1Q56A 2GNMA 1OA4A 1WLCA 3GGLA 3AKQA 3LGRA 3K3NA 4AZZA 1KRIA 2R1DA 4OFGA 1E5SA 5EV7A 3AMQA 1YLLA 2IXLA 5GZEA 1VAVA 5IAXA 1J3RA 4DINB 1O91A 1VAMA 2BERA 2BGPA 2TUNA 1MS9A 5HCBA 5T3NA 1NCRA 3Q8AA 3THDA 2GC2A 4XJUA 3N35A 4LNVA 4KBZA 2B42B 4N53A 3EJKA 2QDRA 2EIDA 4OYUA 4B4QA 2VZPA 1JOPA 1WUVA 2Y38A 1G6NA 2ORXA 1UKGA 3WDVA 4BU2A 3I2OA 1Y9QA 2Q8OA 3GCWA 1K3IA 1AR61 3ZN6A 3UT0A 3OEBA 1MEC2 2UY9A 5H9PA 5C6CA 1FMD1 5EJ3A 2ZJCA 1MEC3 5FPAA 1QJX1 3HQUA 4PJYA 4AVCA 5A3TA 3C7FA 2VO5A 4IEXA 4IEPA 1ALYA 3BI3A 1BKZA 2VOXA 1AR81 4AFBA 4B8EA 1GNHA 4META 5F8PA 4L97A 1OKOA 4L8QA 3USUA 3V0AA 5L9BA 3IDAA 4JDOA 2WWSA 3LSEA 1C1LA 4YVWB 4NAOA 2JDZA 3L2YA 1LEMA 1TQ5A 1XU2A 4GALA 2R072 2OQ6A 1JODA 2R073 1DQ6A 2BDRA 2EXHA 5IT6A 4WVMA 4JX0A 4AR2A 1D4M2 2WT2A 3M70A 1SHWB 1W6QB 1D4M3 2A1XA 3AZWA 3I8TA 4RS5C 3VKNA 1YJLA 3RI8A 4LO7A 4XDPA 1O4ZA 4NHMA 5DUXA 1QGLA 4E2GA 3FL7A 1N1YA 3FFQA 2O1QA 2PXJA 1W06A 2BU9A 5FZGA 5DDJ1 3CZJA
chains in the Genus database with same CATH topology
1OD5A 1DIWA 4KG8A 3H1WA 4JV4A 2WNUB 1T6GC 3S0MA 3B9CA 3O7OA 5H9SA 1DGWA 1UMZA 2D7FA 4FTSA 4XHXA 2WA3A 3ILFA 5IK7A 4JQRA 2RM21 4XEZA 3RPQA 3I54A 2PHFA 2VNRA 4Y4YA 2D6MA 2ZCWA 1V6MA 4XF3A 2HWF1 5CBLA 3ATGA 5JAXA 2ZHLA 2ET1A 1DU3D 3JU9A 1WD3A 1LHUA 2ZX2A 4WM7A 1Q43A 1D4VB 2ZHMA 4S2HA 3LCPA 1K5MC 2VU9A 4GKYA 1RMU3 3AKRA 3VBSA 2XJRA 3VBOA 2YZ4A 3ZSJA 2A6VA 1QH7A 2DVAA 4WM8B 3RJ2X 1REFA 2NLRA 2ZAAA 1U0AA 2DV9A 2EXKA 3D0SA 1DHKB 2HWE2 3JD71 3G6JB 3VGIA 2HWE3 1G9FA 1AX0A 4ITCA 4XQDA 1V9U2 3QACA 1CAUB 1V9U3 1VBE1 1AR71 3OBTA 3NJZA 2ZA9A 1C3HA 1M4WA 4LO4B 3FX3A 1YIFA 1X33A 1BVVA 4AGGA 1HRI2 5JSPA 3DN7A 1HRI3 4YW3A 2CV6A 5KWRA 4BIOA 5FRAA 4OI1A 5L7OC 1PHMA 1GV9A 1UU4A 2Q4SA 4K1ZA 5JLVA 3MEPA 4RHV1 2DTWA 2IXCA 3SCGA 3ZMNA 1LOFA 2A3YA 4AVSA 4WVWA 3IIAA 5GZGA 4GH4B 1VIWB 2VMGA 2A3WA 1SBFA 1H9WA 1HV1A 1UIKA 3ES4A 4YGBA 3H7YA 4COWA 2DVFA 3AJZA 4RR3A 1X82A 4D69A 4TZDA 4L99A 2V5YA 1RUD1 3SHRA 3JQXA 3L9JT 4NO4A 1IHMA 1RUH1 4DPNA 5ACA1 4YVSB 4Q4W2 4XBNA 3ZIWA 4OHWA 4Q4W3 5FO7B 2D43A 3HD8B 4MGIE 3MLJA 4TSVA 4Y1VA 3TNPB 2FMYA 4LBMA 3ZX7A 2A6YA 1APNA 5JOWA 4H7LA 4EROA 2SBAA 3KMHA 2DCKA 5E8AA 4Y1UA 1RIRA 4QQLA 3HT2A 1D0GA 2HWC1 3OYWA 1AR63 4CEWC 1S55A 1AYN1 2A6WA 2QNKA 4J1WA 2R042 4CP0A 1H2LA 4URTA 2PLV2 2R043 1OKQA 2PLV3 3BU7A 3AK0A 5T5JA 4K21A 3WT3A 1IKPA 1F5JA 2CNAA 3M3OA 3E97A 2UYAA 2RHPA 3VBRC 4QGMA 1F5FA 3OJBA 2HWD2 2UY8A 1CESA 2X8KA 3POSA 3ES1A 2BVBA 4FCAA 4Y20B 2HWD3 5HXVA 4CDXB 4EN8B 4CDWB 3PVBB 4COYA 2O8OA 3FUOA 2WKKA 4NWVA 3NV1A 2CWSA 1HQNA 2VVFA 4O9EA 3NO8A 4BA6A 1LGBA 1RUG2 4SLIA 4B3NA 4XF9A 1RUG3 4XIOA 5JPMB 4RFT0 4Q0QA 1QDCA 1Z7S1 1MS1A 1LOGA 2R49A 3O5SA 3V56A 1WLTA 3G7DA 1HIXA 1KD7A 4HVRA 5KHGA 2JG8C 3WV6A 4DY5A 1WGPA 2C5DA 5T5OA 1Y7BA 5JPNB 1DZTA 3LOIA 4FQZA 2RM23 4RGAA 3ZO0B 1SLCA 2DU0A 1F9KA 1N1SA 2PN5A 1CAWB 4AHXA 1PO11 1ZA4A 2HWF3 4NWWA 4Z07A 3HR9A 3MI8A 3WQ0A 3CJIB 2R0FA 3AXEA 1H8TC 3AZVA 4JGZC 1AUYA 4RL7A 1AVBA 4S2FA 1AXZA 1G8WA 2PAEA 3LA2A 4EN6B 1QQP2 3AZZA 3ECQA 1GQGA 1QQP3 4Y22A 4PIXA 1UW8A 5D8AB 3RNSA 5JVVA 3RYPA 2ZGKA 2G9FA 2P2KA 2A70A 2PA7A 1RGSA 4QQOA 4N53C 2EAKA 3KD4A 5FPXA 2DCJA 5FLHA 1OOPB 4YYOA 1HQWA 1KS5A 1PVC1 5HCAA 3KGZA 1PO22 2P37A 4HK8A 3JCIA 2HJIA 4AGVA 1PO23 4AE2A 1ZBE1 4HN0A 1MZ5A 1AL21 2YPJA 1AYM1 5GZFA 4F83A 3DPRB 4Z8BA 4PDWC 1DG6A 4KWLA 5CAZA 1ZVFA 3PVNA 4COVA 1YFWA 1UPIA 1XYPA 4YGCA 2OA2A 4XFCA 3BPZA 3H50A 4A3XA 4R9BA 1RHI2 4AFMA 4I2OA 1RHI3 1OPOA 4Q4X1 4LBQB 3A4UA 4LR4A 4PIYA 4N7IA 5FLIA 2VPVA 3MW3A 1RUH2 1Q8VA 2ZGTA 5A32B 1RUH3 1G9CA 3S7EA 1ZYBA 3BALA 4B4RA 3HN1A 3I59A 3IPVA 1SLAA 4WVVA 1OQDA 2CY6A 3N7JA 2GNDA 4M3CA 1J3QA 5K0UC 2W39A 3GBWA 2H0BA 3O12A 1SEFA 3ALQA 4JC1A 4K1YA 2PHWA 4FP2A 1DQ1A 3WR0A 2YMZA 1CAVB 3AYAA 4C0HA 2BVVA 3WLUA 2JG9B 1NXMA 1X7NA 1FI2A 3VBUB 5JOZA 4QX5A 3UJOA 1QOTA 5LEJA 4HPKB 3MLKA 4YLZA 3FWEA 4P9WA 2XLAA 2HWC3 4QGNA 3SCFA 2Y0OA 3FBYA 1ULGA 4FPFA 5K8SA 4P9GA 4Q4Y1 3D4KA 1C8M1 2ZZJA 4XFAA 3N4MA 4K7JA 1H8VA 1LODA 3B69A 1FATA 2RS32 1VRH1 2RS33 4B7EA 3VBSC 4ES8A 5BNNB 2GN7A 3KT4A 4YVWC 1ND3C 4DFSA 2EXIA 1KJLA 1WW6A 4W6WA 5FMOL 4BYYA 3EQEA 2NM1A 1YXWA 3ZFGB 1XXNA 4EJRA 1BCXA 5GLUA 4PF5A 3M2MA 4J1XA 3AMNA 4X8NA 4FXKB 5CB7A 1OPMA 3OD0A 4RS5A 1WLWA 5GLTA 1O4YA 3CNAA 4MXWB 1Z7S2 1CAXB 1Z7S3 5A33B 1LGCA 1QXRA 3MIDA 4N9IA 4FAGA 5IUQA 3N3HA 2NMOA 1YCIA 3ZYRA 2XKPA 4P9LA 4I30A 2ZOEB 1ND2C 4R4XA 3VZKA 4CDQB 2WNUC 5E16A 1CD3G 1NY72 3SH5A 4PCRA 4Y24A 1ULEA 1YNAA 2G4IA 3HQXA 1BMV1 3X29B 1JUHA 2MEV1 4EN9B 1RVF2 5IK4A 3WX5A 5CG9A 3J26N 3ZSKA 2BWCA 1RVF3 1B35C 4RR3C 1ULFA 5FQ0A 1EPWA 5BNOB 4YARA 1PK6C 1MQTB 1S2KA 3VV1A 1HXS2 2X5IB 2QDNA 1SLIA 1HXS3 1K5MA 4Z82A 4H7MA 3B3QE 4OLLA 2R061 1A78A 4Y1ZA 2DWRA 1N1VA 4CDUC 3U07A 1AHSA 4BQ1A 4N43B 4Y5Z0 1QKQA 3WZ1A 2R1BA 3WW4A 5JIUA 4CP1A 4FQ4A 4WM8C 2VY0A 4GXLA 5GZDA 5EFUA 3LOBA 2Z69A 3ZXDA 1GYKA 3SNMA 1FNYA 2DUPA 3ZVXA 1XQNA 1PVC3 5E88A 1VBB1 4G9SB 1AF9A 1V6IA 1ZBE2 1LHVA 1ZBE3 4YZ5A 1AL22 1Q8SA 5L7OA 2XPJA 4GMP0 1AL23 4KQ7A 2I07B 3THTA 3M4FA 3GHNA 2GZWA 1ZBA2 2BNNA 4XTPA 1BBT1 1XRUA 1ZBA3 5KC6A 3M3EA 2Y26A 2EALA 2UWAA 1G86A 1PNGA 1RUE1 1HKDA 2NMNA 4GH4C 3C3VA 4FXGB 3DF0A 3WOGA 2PHDA 4B7KA 2PELA 3WHTA 3JBG1 1RTVA 4XFIA 4QGLA 1NCQC 4NHKA 4XJWA 3VHRA 3BIWE 4PLOA 1Q8OA 5B2GB 1H2KA 1NA1B 2D5HA 4YW2A 3URFA 4OULA 1FYUA 2WNVB 2MHFA 4MGZE 1CIWA 3WG4A 3VZOA 5A3LA 4Q0VA 2RR11 3FLRA 5T50A 1J1TA 1WLDA 4QHBA 3QLQA 1W6NA 4C90A 3NW4A 4Q0UA 1RUI1 5BYNA 5C33A 4YNIA 5GJ6A 4KH9A 2NZ9A 2WSVA 4U36A 3VKFC 4GB31 3QH6A 1KQRA 3MZHA 4IERA 4NOTA 4CEWA 1OSGA 4AEDB 4C0BA 5I8SA 3V0BB 5BNPB 3ZSEA 1AR91 4AI3A 1UKRA 1MS4A 3V64A 1EP0A 2Z79A 4I0WB 5JOXA 1RUJ2 1DQ5A 1RUJ3 2Z2SB 2FQPA 3H1YA 5FCCA 1PGW1 4WVZA 1JOJA 3VBRA 3SH4A 2GNBA 3VHNA 1EY2A 5FOBB 1ZNPA 2QZ3A 3J9SA 1VBD2 2WFF1 4LBLA 5EYYA 3TWIA 3U10A 3VDDC 5L36A 1VBD3 1YFYA 4HKOA 4R9CA 4IV1A 1R081 4CDWC 1SBEA 1YFXA 5E1RA 3KCCA 4MYEA 2VUAA 3I2DA 3MFAA 1GZ9A 2PAKA 3SLIA 1GLHA 4PLMA 2DF7A 4Q1PA 4LHLA 2GALA 3LWCA 4CRQA 5CFDB 2JEMA 3ZFEB 4EWEA 4QQ2A 3THPA 3IDEA 2JG8A 2OZJA 4HSLA 5JR7B 3FE5A 1H0BA 4HETA 4HSJA 4NPRA 1S0JA 2Q1MA 2IZWA 2P3JA 3RQ0A 5KHJA 2ZAHA 5DXDA 2XKOA 1W0OA 1UPSA 1QU0A 2MEV2 2WS91 3B93A 5C8WA 3VZNA 2IWGB 2MEV3 1LHOA 1L3JA 4E4DX 3KB5A 4Q0PA 5DZFA 4AYUA 2B46X 2HEYF 3W59A 1ULCA 4NVPA 1I3HA 2Z5WA 1Z78A 3WG3A 1H8TA 4DMIA 3ZMOA 4HMZA 2PHLA 3CJIC 5F6LB 5AVAA 2FZ2A 1H2NA 4LE4A 3TNQA 4JGZA 2ZKNA 3NSTA 3KT7A 3FLPA 3VLBB 1KXGA 4XXAA 1SLBA 3T2TA 5I0TA 1H1IA 4YRDA 4PQ9A 5J48A 1DGLA 3E5QA 1F2NA 4FBFA 3ZFFC 4AK3A 4JDNA 4RD7A 4DNYA 3MLLA 2XL7A 2XJTA 4ZU4A 4R4ZA 3NAPC 3GZUC 1RUF1 2HKXA 4TLFA 5DZGA 3WCRA 3FBMA 2LALA 2E51A 4ZXKA 4C1WA 2PHXA 2DVBA 1LU1A 2D97A 3N7MA 4PDWA 4D94A 3BOPA 1V6KA 1RUNA 2RS52 4LO8A 3DPRC 2FHRA 2RS53 4ZKTB 4RGGA 2GMPA 3MPPG 4AQTA 2K9ZA 2W08A 5I0SA 1OA3A 5I91A 4GMP1 4LEJA 2CL2A 3VHOA 5F1RA 3VBHC 1NXD1 3RMXA 1UAIA 4FPLA 3WDXA 1PGSA 3JBG3 2E53A 4XJAA 4XYXA 3OPZA 2EA7A 3MIHA 4HVQA 5C9AC 4AW7A 1R1A1 2YROA 2ZS6B 4WM7B 5KHIA 1W6OA 1ZRCA 1J58A 1FOD1 2IXKA 2NQYA 2RS12 5T54A 2RS13 3VBOB 5K0UA 1IPJA 1LULA 4KWKA 4FSJA 3LB9A 1ASJ1 1ZM1A 4A7ZA 5AC91 2WZR2 4EWDA 1POV3 2WNEA 4JRAA 1RUI3 2WZR3 1N3QA 5KBFA 1EPZA 1IPKA 2AR6A 1C28A 2X29A 4IEZA 2AREA 1AJKA 3VBUC 1LU2A 3T1MA 1M06G 1O5UA 4KU7A 3UJQA 3ETQA 1W6MB 1W39A 4GULA 3RI9A 1ENXA 2AUYA 4XW3A 4EV0A 2HWB2 1QMJA 2HWB3 1RL3A 3N7KA 4Z2WA 2B8MA 5CIRA 2GH2A 3AZXA 3TB0A 1IS5A 1ZZ9A 1LJ7A 1YIPA 1RMU2 1HRV2 1GZWA 4QU2A 1HRV3 1ND3A 1PIV2 2V73A 4YVWA 5FTTC 2BTVC 3TN91 3WG1A 3CEWA 1SFNA 1PIV3 5BNNC 2ARXA 1DQ0A 1QH6A 3RRDA 4CP2A 4ONUA 1V6JA 4OUSA 1MS3A 5JSOA 1R082 2GH8A 1R083 4AHWA 4QMAA 5EWSA 3AP5A 1W6QA 1O3RA 4I01A 4OI2A 2D6LX 1RITA 3TRSB 5C4WB 5JZGC 3JQWA 3POYA 3IDBB 4XFFA 1I6XA 5BPXA 5EYXA 5KXEA 1KFXL 1ND2A 2IXHA 2R16A 4BIFA 1XNKA 4DRVA 4LHKA 2WNUA 2BW8A 2XWJB 3TYJA 1ZRRA 5CFCC 1N3OA 2CTVA 3VL9A 4Q4V1 4QM8A 3WCSA 5FAXA 1O3QA 3WP5A 3VKLA 2YGLA 3QD6A 3H3UA 4JGYC 1KFUL 1JYIA 3FMGA 1IZ3A 1SDWA 4HANA 4LBOA 1B35A 2ZHNA 1JUIA 1QHDA 5LK5A 1VBC2 4XE9A 2RMU2 4L9BA 1VBC3 2RMU3 1PK6A 2K0GA 2BEOA 4E4ZA 3NV4A 1LECA 1JXNA 4CDUA 1OI6A 3CO2A 1NLSA 3AYEA 3NL1A 3WW2A 4WM8A 5HBAA 2O8QA 2XBO1 3KQRA 3INAA 1DDLA 5J7MA 1QWRA 4Y1YA 1MACA 4LA3A 2VW1A 2TNFA 4AQ6A 3WD5A 2NYYA 4BH9A 3AYCA 4DS0A 3SXWA 1UF2C 1AR62 3IN9A 1FMD2 1R1ZA 4M3CE 2XB6C 1FMD3 5LK7B 1QJX2 3VZMA 4GIQA 2VNOA 4A7YA 1QJX3 1HV0A 1AR82 4CYDA 2IC1A 3AKPA 1AR83 2AENA 3B5LB 3FFZA 3AJYA 3ZN5A 1LGNA 2ZGUA 1GKBA 1GZCA 3BCWA 4K6BA 2BWAA 2ZGNA 3AMMA 2DVGA 1QJU1 3E6BA 1ENSA 3OTFA 2QCSB 3CU7A 1XYOA 1MS5A 2XJVA 3AZYA 4GH4A 2VVDA 3WW1A 1LB2A 5JCTA 4BWOA 4Y26A 4CEYC 1NCQA 4GQ7A 1TNFA 3U4XA 1VBA1 4XF1A 4IV1C 3H1MA 3RZZA 2GC3A 4Q27A 2GN3A 1EV11 5JOYA 3V65A 4JRLA 5DDJ2 3A0KA 1ASJ2 4YW5A 2E7QA 5DDJ3 3B7MA 1ASJ3 1UZZA 4JCKA 3ST7A 1BEV1 3WDUA 1V00A 5AC93 3IM0A 2ZX3A 4QPYA 4FTEA 4R8HA 1DGWX 3MPBA 1Q8QA 4IEVA 2OUJA 3ZXEA 4JTOA 3MDPA 2RM22 3MFCA 1UD1A 2GAUA 4N90A 1CGPA 2RJLA 1CQ9A 3J8F1 2EAAA 1WW5A 1S0IA 2DVDA 2HWF2 4Z92B 2QZ2A 3O0VA 1QNYA 1S1AA 2KA3A 1REEA 2R32A 1QJZA 2FMDA 3U0ZA 1BYHA 5BNPC 1S0FA 2ARBA 1Q5OA 1VR3A 4W65A 4HKWA 4HL0A 4QPIC 4HFSA 1BVP1 1OFSA 5JDBA 3TN92 3K48A 5CA6A 2VOWA 3TN93 4XFGA 4YGDA 1ZZCA 4BZ4A 2D44A 4RQPC 4QT6A 3VDDA 2AZ5A 1G9BA 2GU9A 1JH5A 3JD72 1LTEA 2QUOA 5T5PA 3JD73 4CDWA 4Z1VA 1YJKA 1KDKA 4JAAA 4E4SA 1VBE2 1AR72 1DQ4A 3IKWA 1F31A 4YG6A 1VBE3 2GC0A 1AR73 3IPVB 4ZU5A 4YZ2A 4V1PA 3RG0A 1HX6A 5CFDC 2JE9A 1SCRA 1ONAA 1WMDA 1JHNA 1EYBA 4RHV2 4FOYA 4RHV3 5KC5A 2ZGQA 3I7DA 2GMEA 3WUCA 1BJQA 2AYHA 3KS7A 5SV5A 4AVTA 2OYZA 3D8CA 1WCDJ 4DRRA 1MVQA 4K40A 2CYFA 2QVSB 4I02A 2ZZQA 4MH0E 2X53S 2QE3A 4QPGC 1MZFA 1RUD2 4FT8A 1CAWA 4NR1A 5DUUA 3SMHA 3WUDA 1RUD3 5ACA2 2OZ6A 5ABJB 1MS0A 3VBFC 1DZRA 5ACA3 2YHJA 3CJIA 5AFEA 1RB8G 4AVBA 4E2QA 2G9GA 4Q8KA 5C8CB 3ELNA 3RYKA 4HVOA 4D7TA 2JXAA 3NKTA 2RJKA 2H6BA 4G3YC 1EAH1 2XVGA 5JI7A 4X6RB 4CZSA 4BOWA 3ZFFA 5I8TA 4YZ3A 1ENQA 3OF1A 2DCTA 4W6XA 4BMEA 1SACA 4RS5B 3FZ3A 2PFWA 3NV3A 3NAPA 2B39A 1J3PA 2VOVA 1OOPA 4FPEA 2W52A 1H1AA 5EZWA 2HWC2 3M8LA 1OQ1A 3M3IA 5F6KA 4A2UA 1C5HA 2VMHA 5GM0A 1AYN2 4R9DA 1AYN3 4EWAA 2BGCA 1YWKA 2XJUA 4DOUA 4INDA 5AVPA 3KM5A 5D1IA 3SH3A 3ZYIB 3DPRA 4LE3A 1Y3TA 2EF6A 3NWKA 3FUQA 1QJY1 3IT8A 5IK5A 2VOKA 2XGXA 3FC0A 2OIIA 2WT0A 3VBHA 4LUMA 4DB5A 1FPN1 4OUMA 4L92A 4IV3B 4XXPA 5H9QA 5C9AA 1U5XA 2ZACA 5DUVA 5FQ0B 2E7AA 4I0BA 4YW4A 3E6CC 5A32A 3W58A 3ENRA 4Q2FA 5T5LA 4ORFA 2ATFA 1GNZA 4ES9A 3HMYA 3ROUA 3H8UA 1WBLA 1UU5A 2VULA 3WDTA 1MR5A 1OMIA 4AQ2A 2FBEA 4FPCA 4R9AA 1CAVA 2WT1A 3FLTA 3POWA 1TME1 4U2AA 1JYCA 1I5ZA 3VZJA 2ZGOA 1FV2A 3SISA 2DCYA 3OD4A 1GSLA 3ZYJB 4MX3A 3VBUA 4AFDA 4IEUA 2DFBA 3C2UA 5L19A 5I93A 4QQPA 5K7PA 3ILRA 1PO12 5L7OB 2R0HA 1PO13 5FLJA 3ME2A 2YYOA 2E63A 2WLPA 5DUWA 1NQJA 4AXOA 4Q1RA 2C1FA 1PNFA 2OUHA 1ENRA 4BLJA 3PHMA 2WZPP 3CJXA 2DU1A 3UK9A 5CVRA 4AVAA 1U12A 1XE7A 1KS4A 3PTYA 3QOPA 5BNNA 5BNQA 2GC1A 3EXUA 1R091 2YXSA 3VKOA 1BQPA 2PYTA 3KCXA 4P14A 3ZYPA 4UBHA 2EVXA 2DCZA 4XQ4A 1PVC2 3JB8A 5JZGA 1LESA 3IMNA 4L11A 4FPKA 3GALA 4XJ9A 5HCFA 4HN1A 2XLFA 5C4WC 2IXIA 5A33A 2R6QA 4FPJA 2P34A 1S0CA 2MPFA 1AYM2 5I0RA 1ZRFA 4L2NA 1AYM3 3PLQA 3L2HA 5CFCA 2A7AA 3LA3A 2ZX0A 2ET7A 4JGYA 3LKJA 2A6XA 4XMAA 3R4SA 3H0OA 4UW6A 4Q4X2 4BHPA 1OHFA 4NHLA 4Q4X3 3WQ7A 3RJRA 1JN2P 4YFWA 4OHZA 4X6QB 4AEMA 5GLWA 4FPOB 5HI0A 1A8DA 2I74A 4XHBA 4M00A 1MQTA 1G7YA 1DYKA 4F3JA 4YVSC 2ZMNA 4AEJA 3MGUA 1YFUA 1GFF2 3VBRB 1XNCA 2D6OX 3WVJA 5KHKA 3RSJA 2VW2A 1W6PB 3OY8A 2B5HA