2WFF3

Equine rhinitis a virus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
226
structure length
226
Chain Sequence
APIRVVSVPESDSFMSSVPDNSTPLYPKVVVPPRQVPGRFTNFIDVAKQTYSFCSISGKPYFEVTNTSGDEPLFQMDVSLSAAELHGTYVASLSSFFAQYRGSLNFNFIFTGAAATKAKFLVAFVPPHSAAPKTRDEAMACIHAVWDVGLNSAFSFNVPYSSPADFMAVYSAEATVVNVSGWLQVYALTALTSTDIAVNSKGRVLVAVSAGPDFSLRHPVDLPDKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P1
publication title Equine Rhinitis a Virus and its Low Ph Empty Particle: Clues Towards an Aphthovirus Entry Mechanism?
pubmed doi rcsb
molecule tags Virus
total genus 23
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2009-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wff300
5D8AB 3J8F1 4Q4X3 1AL0G 1FPN3 3ZFGB 1AR93 1V9U1 4CDWC 1PVC1 4N43A 1AL21 1RUE2 2HWB1 4GH4B 4GMP0 5CFDB 4RFT0 3J8F3 1EAH2 1RUF1 3VBFA 1B35B 1OPOA 1V9U3 1NY72 5BNPA 2IZWA 1PVC3 1BEV3 1TMF2 1AL23 3JB8A 2HWB3 1TME2 1VBB2 1HRV2 1M06G 1HX6A 2WFF3 3VBOB 1RHI2 1RUE1 1RUF3 3NAPC 1VBE2 1K5MC 1VAKA 3VBHC 1ND2C 4GMP1 1EAH1 4PDWA 1W39A 5C9AA 2QQPA 1DDLA 2HWD2 1TMF1 4AEDC 1RUE3 1TME1 1VBB1 1RUD2 1HRV1 5L7OC 2HWF2 1RHI1 4JGZA 1H8TC 1ZBA2 4GMP3 1EAH3 4CDXC 5DDJ2 1R081 1VBE1 4IV3C 5ABJC 1MQTC 4FSJA 1TMF3 1TME3 1VBB3 2HWD1 1HRV3 3VBUC 3VDDC 1RHI3 1NCQB 1VBE3 2WS92 5AC92 2HWF1 2VQ0A 1RUC2 2RM23 4SBVA 1ZBA1 4YVWA 5DDJ1 1BBT2 3NAPB 2HWD3 3FBMA 3ZFFA 1ND2B 4RQPC 5K0UC 1C8M2 1RUD3 3S6PA 1MEC2 1ASJ3 1ZBA3 4AEDB 5DDJ3 1NCRC 1OOPA 5AC91 5C8CA 1RUC1 1NOVA 1VB4A 2XBO2 1RUI2 5L7OB 1CJDA 4CEWA 5D8AC 1BBT1 1EV12 4CDXB 1QJY2 4WM8A 3ZFGC 3CJIC 2PLV2 1C8M1 2GSYA 2WS93 4Q4X2 5BNPB 1MEC1 5AC93 1RUC3 3VBUB 3VDDB 4IV1A 4RS5A 4GH4C 4QPGA 5CFDC 1BBT3 1RUI1 1D4M2 1B35C 4Q4Y2 1EV11 1QJY1 3VBSA 1C8M3 4YVSA 3ZFEA 1AYN2 2PLV1 1MEC3 1AYM2 4RQPB 5K0UB 1PO22 4Q4X1 5C9AB 2XBO3 1RUI3 1PGL2 3VBRA 1EV13 1QJY3 1HRI2 1D4M1 1NCRB 2PLV3 1RB8G 4JGZB 1AR82 1AYN1 2BFUL 5A33A 3JB4C 3CJIB 3JBG2 1PO21 2WLPA 1BEV1 1D4M3 5JZGA 1PGL1 4Q4Y3 4IV1C 4RS5C 1BMV2 1VBC2 1HRI1 2WFF1 2Y26A 1AYN3 1AYM3 4YVWB 1AR81 1PO23 5A32B 3VBSC 1COV2 1RUG3 1NCQC 5C4WC 3JBG1 2FZ2A 4QPIA 1PIV2 4BCUA 1HRI3 2RS52 1BMV1 4RHV2 1VBC1 1VB2A 1AR83 2RM22 1NY71 3TN92 3JBG3 4CEWB 1COV1 3LOBA 5BNNA 2DF7A 1PIV1 1VBC3 1ASJ2 1RUJ3 2RS51 1FMD2 4N43C 4IV1B 4RS5B 2R042 4QPGB 2RM21 1COV3 5FOJB 1R092 1ND3A 3VBFC 5BNPC 4Q4V2 1AR72 1HXS2 1PIV3 5BNOA 3VBSB 1PGW2 4YVSB 3ZFEB 4FTEA 1NA1A 2RS53 1RUD1 1PO12 4RHV3 5C4WB 4NWWA 1ASJ1 1FMD1 3TN93 3DPRA 2R041 2X5IA 1RVF2 3VBRB 1R091 4Q4V1 1F2NA 1AR71 1HXS1 4PDWC 5C9AC 4CDUA 1PGW1 2BUKA 5A33B 1FMD3 1PO11 2RS32 2WS91 1RUH2 2R043 4CEYA 4JGZC 1R093 4N43B 5FMOS 4Q4V3 1AR73 1HXS3 4N53A 1E57A 2WWSA 2ZTNA 4CDQA 1PO13 1QJU2 4WM7A 1VBD2 4FTSA 3VBFB 1QJX3 4RR3A 1RUH1 1RVF3 2XBO1 1FOD2 4JGYA 4YVWC 2FZ1A 4Q4W2 3ZFFC 5CFCA 1QJU1 2RS33 1VBD1 4CDWA 4GB32 1RUH3 4PDWB 1RUG2 2R072 4FTBA 1SMVA 2WZR2 2XPJA 5BNNB 1OOPC 1FOD1 5C8CC 4Q4Y1 4CEWC 1X33A 1QJU3 1QJZA 1VBD3 1VRH2 4Q4W1 5FMOL 4EJRA 4WM8C 1AYM1 4GB31 5GKAC 1RUG1 2R071 1ND3B 2WZR1 1FOD3 1OHFA 4QPGC 1Z7S2 4Q4W3 1K5MA 2HWE2 3VBHA 1RUJ2 3HAGA 1VRH1 4GB33 4YVSC 2R073 3DPRB 3ZFEC 2X5IB 2WZR3 3ZFFB 4AEDA 5CFCC 2TBVA 5L7OA 3JD72 4CDUB 1RMU2 1H8TA 4CDXA 1Z7S1 1VRH3 3VBRC 4IV3A 5ABJA 1MQTA 2HWE1 1RUJ1 1OOPB 5C8CB 4CEYB 1VBA2 5ACA2 3VBUA 4LLFA 4WM8B 3VDDA 4N53B 2ZZQA 2MEV2 1Z7S3 4CDQB 4WM7B 2HWE3 3JD71 1RMU1 5JZGC 4RHV1 2RS12 5J96B 4RR3B 1R082 5LK7B 1POV0 1VBA1 4RQPA 3TN91 5K0UA 1F8VA 1CD3G 1ZBE2 4JGYB 2HWC2 5ACA1 4Z92B 3JD73 1RMU3 2ZAHA 3IDEA 2MEV1 4QPIC 1NCRA 5CFCB 4CDWB 1QJX2 1VBA3 2RS11 5D8AA 3ZFGA 5ACA3 3CJIA 1IHMA 1WCDJ 1POV1 2MEV3 1ZBE1 2HWC1 2R062 2BBVA 4GH4A 5J98B 5CFDA 5BNNC 2RS13 2RR12 1QJX1 1R083 3M8LA 1B35A 5JZGB 5A32A 1POV3 1RVF1 1ZBE3 2HWC3 4Y5Z0 1AR62 1K5MB 3VBHB 1ND3C 3VBOA 5BNOC 1A6CA 2R061 2HWF3 2RS31 1NA1C 2RR11 1C8NA 4QPIB 1QQP2 1NG0A 2RMU2 1H8TB 3DPRC 1AUYA 2X5IC 1AR61 1R1A2 4IV3B 5ABJB 2R063 1MQTB 2BFUS 2GH8A 4NWVA 2BPA2 2RR13 4CDUC 1FPN2 1AR92 1QQP1 4CEYC 1AR63 2RMU1 4N53C 1R1A1 3J8F2 1GFF2 1NCQA 5C4WA 4CDQC 1V9U2 4WM7C 3VBOC 1QQP3 5BNOB 1PVC2 1FPN1 1BEV2 1AR91 4RR3C 2RMU3 1AL22 3NAPA 1NA1B 2HWB2 1HQNA 4Y4YA 1R1A3 1ND2A 2WFF2 1X36A 4JGYC 1RUF2 3ZXAC
chains in the Genus database with same CATH superfamily
4FPCA 1GP6A 3O14A 1OT5A 2D93A 4Q4X3 2XLFA 4WZCA 1HB2A 4KBBA 1AR93 1V9U1 4IGPA 4DOUA 1DYKA 4QX0A 3DKWA 4XJWA 3C8XA 1H2NA 3U1XA 3VDBA 5I8SA 2XOMA 2ZKLA 4HVRA 5FZGA 2A70A 2HWB1 2OW4A 3KCXA 2DCKA 5CFDB 3CEWA 4BIOA 2CDOA 4RFT0 5CKNA 3GZAA 4A45A 1EP0A 3H3UA 1B35B 3F2ZA 2MHFA 1SLCA 1W8OA 2XQRA 1DZRA 3PDQA 5SV5A 3M3OA 2IZWA 4EN8B 1PVC3 2OPWA 4Q0QA 2EIBA 1W6PA 4XBQA 3MW3A 4D0QA 3JB8A 4P02B 2J1AA 5E89A 3LA7A 4LE4A 5FPVA 4YW4A 5LBFA 5C5TA 1XNKA 5C7GA 3IM0A 4C90A 1GANA 1RUE1 1YFWA 2VCCA 1MS1A 1WD4A 3J26N 4D8MA 4WVWA 1BK0A 3SISA 1ULOA 2EA7A 3EHKA 1Q8OA 2BW8A 3SLIA 4E2GA 1SG3A 1XNBA 3GHNA 4COWA 3VBHC 1ND2C 3IAQA 3RZLA 1CAVA 1EAH1 1VPHA 2BNNA 2RDNA 2XJTA 3BB6A 3AYEA 4KU8A 5FZ7A 4FPOB 4ZU7A 4DY5A 2JE7A 2DFCA 1JUIA 1TME1 2QKDA 2VBDA 1W8WA 1NUKA 4LORA 2GMMA 2DVBA 4JGZA 4UW5A 3ZKUA 1CZSA 2YGLA 4GMP3 1SFNA 1HW5A 5DDJ2 3B02A 2WNUC 3GM8A 4AVCA 5ABJC 4FPFA 4LBKA 4BQWA 5IVEA 3POGA 4UFMA 4OHYA 4MXWB 4FSJA 5JLVA 2BBAA 4XBNA 1LGNA 4ASKA 2R32A 3T1MA 1O5UA 3VBUC 2WO3A 5I8YA 4WBBA 5FYHA 3X29B 3T09A 3KZ4C 4D6QA 2VTFA 2VXRA 2HWF1 3LD8A 1RUC2 4SBVA 4C0BA 1ZBA1 3TNQA 4CCOA 5HCFA 2DWRA 4ARXA 1MZFA 1BBT2 3OBZA 4FQZA 4YZ1A 2PN5A 3ACFA 3WUDA 4F83A 1RUNA 1GZWA 1PM7A 1QDOA 2OQ7A 3ZFFA 2VMHA 4R9AA 1OUSA 1Y9GA 2ILMA 3B9IA 1W9WA 3ETPA 4LO4B 3UGFA 1OF3A 5GLTA 1WBFA 1PK6A 4ISQA 2V5YA 2WQ4A 5JI9A 3NNFA 1HJFA 5EP9A 2PHTA 3RSJA 4D6RA 1HN1A 3HBZA 3HN3A 4OZOA 1W6NB 4AFDA 4LKSA 5DDJ3 4AEDB 2CWMA 3FHIB 1I1EA 3WV6A 1NCRC 5C8CA 4HOOA 4R4XA 3U14A 1VB4A 5L7OB 3ZSEA 1N1TA 4XDOA 3ZMNA 2VXJA 2VC9A 1EUTA 4K9SA 4YM2A 2AR6A 4O9EA 1ODNA 4P9GA 4YW6A 5FXZA 2O0OA 1A8MA 2ZS6B 5IFTA 2PLV2 5FBJA 3LEGA 1IPSA 4QXHA 5GZGA 1C8M1 4Q0SA 2E63A 5LBBA 4BHPA 3HD8B 5BNPB 1LRHA 1RUC3 3NJYA 1ST8A 3S5AA 4IL7A 2CSGA 3CHXA 4QPGA 5CFDC 5K7PA 1UU6A 3H1YA 1BBT3 1W6OA 4P08A 2VVFA 2OS2A 2W87A 5FTTC 3BTYA 4B1MA 1B35C 1SCRA 2W0XA 2WQ8A 1EV11 1WMXA 2QQOA 4FBFA 1QJY1 5A3OA 1ULDA 4OHZA 3WNNA 1OBNA 2WRAA 1N1SA 2E7TA 2ZMKA 1CAXB 5D21A 4HN0A 3NW4A 3RZZA 4FAHA 1STMA 2VTXJ 5LZ6A 1OH3A 2DUOA 1WD3A 2BVVA 5IAXA 1PNGA 1TVGA 4XDPA 4CUBA 3ZN6B 2PLV3 5GLVA 4Q1PA 1DHKB 2X29A 3ETQA 3KT4A 5J7MA 2ZGQA 4AGVA 3O1UA 4MUVA 4W6XA 4N7UA 5A33A 3SH5A 2ENRA 4DEQA 5FDBA 3KGZA 1JHNA 3ZPOA 3RYPA 5EXOA 1KDKA 4HSLA 1PO21 2VZQA 1QHDA 4L11A 4RSUA 4XURA 2WLPA 3U75A 2VNVA 3WNOA 1YIPA 1WCKA 4K1YA 1VBC2 1YJLA 1TG7A 2PHWA 3WQ0A 1O91A 3GALA 1OFNA 1F5JA 1UYZA 2Y26A 3THTA 3WDXA 4DXTA 5A6QA 2SLIA 2Y6HA 1JYXA 3LPGA 5FUPA 4FO9A 4AFMA 1YNAA 3QLQA 4Y3OA 3ZN4A 1UYPA 5FPUA 5KXBA 3DKQA 1UZ0A 2FCTA 3PUSA 2X05A 2UWCA 3RJRA 3ACGA 3JBG1 2YV8A 5FZHA 3WP4A 2WFPA 1DBNA 4NHYA 2QDNA 2XLAA 4LIUA 2YC4A 4FFGA 2JDPA 2RS52 5A1FA 2DBIA 1VB2A 5EV7A 5FQ0B 1QDCA 3T4HB 2RM22 5GJ6A 5L9BA 2P2KA 3O7OA 5AVPA 1VMJA 2D5FA 2P37A 3KV5A 2QCSB 2JKXA 3K4DA 3RYRA 1LEDA 1XXNA 4BPZA 5AFEA 2W2IA 2YFUA 1NZCA 1WLWA 3LQCA 3N9PA 5LA0A 2DVAA 2YZ4A 1YYNA 5EWSA 4ASLA 4COVA 4ATEA 5BNNA 2H6BA 3U4SA 3USUB 1VBC3 3WNMA 1DZTA 1LGCA 2R1BA 4LBNA 1RUJ3 2ZXQA 4UWDA 3T3YA 3M7AA 4XPVA 2FCUA 2QE3A 1NLQA 2R042 1NLSA 1WKYA 2D6KA 5J3UA 5A6YA 2VNOA 5HCHA 3WG1A 1WA6X 3HVDA 3JU9A 2KR2A 2Y0OA 4IW3A 4PCRA 5BNPC 4Q4V2 4OUSA 4KNCA 1PMJX 3RZGA 3AMQA 2VY0A 3A0KA 4YVSB 3MUY1 4UYBA 4QX7A 2RS53 3IDBB 2JXAA 2NYYA 3TYJA 1GQHA 4KWJA 3PMSA 1ASJ1 2Q1FA 2R49A 2WINB 1YHFA 4AQ2A 2VU9A 2ZPXA 4HANA 2VO5A 1J1LA 1R091 1UY4A 2V5DA 1VMHA 3ZR6A 5KXEA 3B00A 2XUMA 4D7SA 4PJYA 2W3JA 3POWA 4HK8A 3URFA 2Q30A 4CDUA 2P3KA 3CLPA 3VGIA 1CIWA 1JXNA 2OA2A 3PTYA 3GZTB 3K4AA 1PO11 3I8TA 2OQ6A 5I0SA 1RUH2 1FATA 4UBHA 5GZFA 2R043 2VVDA 3RYKA 4CEYA 4ZZ5A 5C8WA 5IVBA 1DGLA 1IZ3A 3MW2A 4FP2A 4WVVA 2FD8A 4LR4A 1PZ9A 3I2DA 5KC5A 3T30A 2VQAA 4Y1XA 3HWJA 4Q4V3 4IE6A 4FPLA 3SITA 3MIBA 1K42A 3MFCA 4CDQA 2FHRA 2GH2A 2F6BA 1QJU2 1XNCA 3U37A 1XYNA 4ZS3A 1P8JA 5L19A 4URAA 3ZXGA 2ZGNA 2YBKA 5FZIA 5FK8A 5F6KA 5CEHA 3NNGA 3RG0A 3NNJA 4R9DA 4AFBA 1XNTA 2Z5WA 3WX5A 2RDQA 5A3WA 2Q5TA 4HKOA 1FOD2 4NHLA 4E4DX 3U4XA 1JBCA 3ILRA 4ZKTB 2Y6GA 2FZ1A 4KWLA 1N3OA 3WF3A 2VM9A 2UURA 3AKQA 1FYUA 4A3ZA 4CDWA 1RUH3 5CAZA 1QKQA 5EIYB 1RUG2 2R072 1JZ5A 3KS7A 4XZUG 1W8UA 4UW6A 1NX9A 3WUCA 4KMQA 4Y5TA 5DAWA 4K1ZA 2DU1A 5C3QA 2IWGB 2K0GA 4X6RB 5GM0A 1D4VB 2ARAA 1C1FA 2WNOA 4GWMA 3RS6A 4Q4Y1 4QQPA 1UOFA 1QJU3 2X10A 2XJQA 4LPLA 4Q4W1 4EJRA 4WM8C 3FHQA 3LSDA 3T2TA 4CP1A 4Z8BA 5JXJA 4HONA 3ZXDA 1LECA 5FYYA 4CXYA 2GC1A 1V6NA 2XH6A 4XF0A 5BXXA 3JUUA 4DMIA 2EIEA 5JOZA 2W95A 2WZR1 1FOD3 5F39A 2Q8CA 4AZZA 3GDBA 4Q8LA 4BLJA 2HWE2 3MFAA 4MZUA 1UY2A 1UKRA 4A4AA 3E6DA 3HAGA 4JQTA 4PIZA 4E4HA 2JJ6A 3IN9A 1PGSA 1H1MA 3N9OA 3MICA 4YVSC 2R073 5FYSA 1LCLA 5FZ6A 3VUOA 1IS4A 1IG3A 1T6GC 5DUUA 1GMMA 1DG6A 2TBVA 1L7RA 5CZKA 5DG1A 3A23A 4BM8A 3JD72 1GICA 1H8TA 1TZOA 2X53S 1KXGA 1UZVA 1OVSA 3OBRA 4F3JA 2BRTA 2GP3A 1F35A 1OA3A 5FY8A 1OOPB 5FZDA 2W1QA 3QBQA 3AP7A 1V0AA 1NE6A 4TXWA 5FCCA 2RJ2A 4AI8A 3MYXA 4Y24A 2E26A 4EQVA 1H8VA 1VAMA 3AKRA 2ADDA 4LLFA 5ACA2 4XQDA 3AZYA 4M3CE 3IIAA 1TQ5A 2D6NA 4QPYA 1YWKA 2ZZQA 1UNBA 5JMOA 3I54A 3S7EA 3APBA 1FV2A 5A7SA 1HJGA 2HWE3 4OMCA 1O4TA 1QGLA 1RMU1 4LBQD 3W58A 4RHV1 2JDKA 5JZGC 3MF6A 2W46A 3RWKX 3P3NA 3UETA 1MZEA 3TEZA 4XJAA 2NN8A 3OGRA 4QXKA 4HBNA 1LOBA 2HH9A 1CD3G 3DYPA 1JZ7A 5A3PA 4JGYB 1Q43A 1YFXA 4CSWA 3OG2A 4KBZA 3OYWA 1W3VA 3JD73 2A6WA 3S7IA 5BUVA 3BCWA 1YQ8A 2ZAHA 3IDEA 3AP9A 2AUYA 5FZ3A 2R7EB 3ME2A 2Y6LA 4JDNA 4QPIC 4DFSA 4FOQA 4B4QA 3O1VA 4JV4A 4XABA 2VOTA 2RS11 1W8FA 3AXDA 1W6QB 3OY8B 2A7AA 1ZRFA 3I3BA 3OJBA 4DPNA 5ACA3 4IE5A 1UYXA 1WCDJ 1US2A 3EXUA 1POV1 4LO5B 1ZX5A 2ZX4A 1YIFA 1ZVFA 4O7XA 3BN6A 4HL0A 1LEMA 4TYSA 4C8DA 2BBVA 4EZ4A 5EJZB 1JYTA 5B4XA 1CVNA 2B39A 2JIGA 3D5OA 3F95A 4V2WA 1SLAA 4COZA 1ODMA 5F6LB 3TBDA 1QOOA 4XFBA 1UMIA 3IDCB 3ZXEA 3OBAA 4QB2A 1RVF1 1REFA 1X9TA 3C7FA 4TWTA 4XC9A 1K5MB 4AGGA 2ORZA 5APAA 5FY0A 5H9QA 4YZ4A 4XQWA 2ZAAA 3H0OA 3VBOA 1SBFA 4BK4A 1W04A 3IMNA 3IPVB 3WY6A 2CHHA 1HN0A 3U10A 3DEMA 5T54A 1QQP2 2PYTA 3V64A 2VZPA 4LUMA 1XB9A 5KXDA 1ZZ7A 1W2TA 1DGWX 2FMDA 4CRQA 3ROUA 4XQ4A 4NIIA 1MQTB 2BFUS 1YRZA 1W2OA 3MI8A 1SFPA 2BPA2 3NV1A 3PIGA 2PAMA 3PMEA 4YSFA 3OUJA 4Q26A 4NUBA 2KXLA 3EMRA 3Q8EA 4ZHNA 2K46A 4PLOA 3MBWA 2C1FA 3C7GA 2LTNA 4KWUA 2YY1A 2W9XA 2ZEYA 4IEQA 5FJHA 3VD7A 4AI9A 4L8QA 4CE8A 3WW1A 4HZFA 4QX5A 4EYUA 5K4LA 3T4VA 1JYCA 4L9BA 3PNAA 3A21A 3VBOC 4QDQA 1J3QA 1QQP3 2D5HA 5JCTA 3H1WA 3TB0A 5F5IA 1AR91 4QAWA 3AXEA 3NAPA 1AL22 1OKOA 3NV3A 3OF1A 4XZPA 3VHNA 4P14A 3QH6A 1C5HA 4JVAA 4Y4YA 3VBFC 2WFF2 3RGBA 3RZJA 2BV4A 1H2LA 4JGYC 1JMUB 3BODA 3ZXAC 4JRLA 2QFEA 3VV1A 4CVUA 1MS3A 3M70A 4JAAA 1KRIA 3IBMA 1BJQA 3ZFGB 4ES8A 2CTVA 1GZCA 5IVYA 3ZYGA 3N7LA 1QOTA 5HV4A 3POIA 3RDIA 1GZ9A 1PVC1 5E6HA 5SV8A 3IT8A 3BTAA 1RJ8A 4N43A 4XHBA 3HIFA 1UW8A 1UIKA 4GKYA 2JE9A 1LB2A 3K3NA 2XG3A 1O6UA 3VBFA 1OPOA 1KJLA 1QXJA 3AL5A 3B9CA 5JSOA 4MGZE 5IVCA 2VCAA 1J3RA 4IEVA 2VW1A 4M00A 1AL23 1WA4A 3FZ3A 3LDBA 1CONA 4Y20A 5A1LA 2PAKA 5FMCA 1HRV2 3CZUA 1HX6A 2WFF3 4Y22A 4MHRA 4LKEA 2KA3A 1RHI2 1F31A 4I0WB 4ET7A 3NAPC 1S0BA 3J7LA 1VBE2 2I07B 1K5MC 1REDA 4QX1A 1W8NA 2ZABA 4GMP1 4HLTA 3FX3A 4PDWA 2B7YA 1RITA 4RGAA 1DDLA 1LOFA 2HWD2 2ARBA 5LRSA 3EO6A 1H2MA 1QH6A 2VH9A 4RD7A 1XNDA 4XXAA 3KD4A 1FNYA 4CCMA 4YGCA 1RUD2 2JEMA 4AVBA 2YPDA 2JE8A 1UO9A 4FAGA 4B29A 2Y0IA 4FPKA 5FMDA 4CDXC 1FI2A 1R081 3I97A 2JKBA 1MQTC 4PQQA 4W65A 4AHXA 5J36A 5F1RA 1A8DA 3ZDSA 2ZGMA 1AX0A 2X09A 3LIGA 4D6SA 1HRV3 1S0CA 2VBPA 3VDDC 3PUAA 1RHI3 5DUVA 3RQ0A 2BERA 2D44A 5KHHA 3AC0A 3BU0A 1NCQB 4EV0A 1VBE3 2VJXA 2WS92 1ZNPA 1GP5A 5F3GA 1XYPA 4BK5A 5AC92 4YGDA 2CL2A 4YVWA 2C5DA 1G6NA 2ZGPA 3N35A 4LBQA 5DDJ1 4LHNA 4W8JA 4XYXA 2HWD3 2A3YA 3FBMA 1TEIA 2E6VA 4XFCA 4YGBA 2WR9A 4Z1VA 1ND2B 4RQPC 2RV9A 5K0UC 4UF0B 1RUD3 1UY1A 1FT9A 4KG8A 4IEZA 1PMHX 3MO4A 1MEC2 4UFJA 2UYAA 1VJ2A 2P17A 3BPSA 3KF5A 5FLHA 3MV01 3KHCA 5FXWA 4QMAA 4HXCA 1H6XA 3WNLA 2JB4A 5JXHA 4Y5SA 1RUC1 1NOVA 3CJXA 2QQIA 4FFFA 4LBMA 3SXWA 4JKMA 1CJDA 2YU1A 4CEWA 3O1RA 2ET1A 1BBT1 2WQZC 3EQEA 3GHMA 1SCSA 3IDAA 4IESA 3N7KA 1SHWB 3H8RA 3VZKA 2G19A 3ZFGC 3CJIC 2QQNA 2YBSA 3AZXA 1OD3A 5I0DA 3WQBA 3TEWA 2Z42A 3GZEA 2WS93 3DCQA 1N3PA 4Q4X2 5JWPA 5AC93 3VBUB 5FP9A 1KD7A 2Y8KA 5IAVA 1LKNA 1W06A 1W6PB 2VOWA 2ADEA 5A7WA 5FYCA 4XFAA 4DIQA 1H4HA 3L2HA 3OBTA 1JZ3A 1D4M2 4FFIA 3THCA 5FR3A 1O3SA 4RL7A 1JU3A 3O1SA 5FYMA 2VAUA 4IE4A 1ULCA 3VBSA 3VN4A 2YXSA 4YW1A 4Y1ZA 1FAYA 5D2AA 5LBCA 1KFXL 1GNYA 1AYN2 1MS0A 2PLV1 1MEC3 3GZUC 2LS6A 3IZOA 3K2OA 4FPGA 4YW5A 4DRRA 4C91A 1MZ6A 1CAVB 2DVFA 2NMOA 3KT7A 2Y34A 2NM1A 1W2NA 3E1F1 3I59A 5CADA 1RGSA 3G6JB 4QM9A 1NCRB 3OCPA 4OHVA 4CP2A 1WLDA 3UYJA 3WOGA 4JGZB 2RDRA 1VRBA 4BH9A 4Q0UA 3GF6A 1U5XA 3WQ7A 2BFUL 3WG4A 1WMDA 3JB4C 3OEBA 2WBKA 2BVBA 3KLSA 3UESA 4CCEA 2DYCA 4XAAA 3T2QA 3MLJA 1BEV1 2VR4A 1D4M3 2XVGA 1C1LA 3LIHA 3S0MA 5ANNA 1QOSA 2GN7A 4QQLA 4TLGA 5H9SA 1M4WA 4HPKA 1LOGA 1ONAA 1OF4A 1PNFA 2WNVA 4JHTA 1AYN3 1UYYA 5BV6A 3U0ZA 1CQ9A 1PX3A 1HV0A 3VBSC 2YYOA 1COV2 3UJOA 3NVCA 4K3UA 1C57A 4NHMA 4D3WA 1SZBA 1NCQC 5C4WC 3ON7A 3MIDA 1GZWB 3IMMA 4BJ0A 3WINE 3WW4A 2FZ2A 1L7LA 1PIV2 2JG8A 2PXJA 3WDVA 3U11A 1PK6B 5A70A 1REEA 1ZZ8A 1I5PA 2YUEA 5CNAA 1FX5A 2G4IA 4AWDA 1XBFA 1VBC1 2R1DA 4X8NA 1HQWA 1XSQA 3M3CA 1I9RA 1JYWA 5FMBA 4HVQA 4WZFA 1NY71 2JDHA 3TN92 4OMDA 2P6CA 4CTEA 4AI3A 1I5ZA 2ES3A 2QVSB 3FE5A 3W21A 2VNRA 2RDSA 4AI0A 3D6EA 4QT6A 1H9PA 2XL9A 4H2AA 2RS51 5HPOA 1K5JA 1H0BA 1W2AX 3V0BB 5B2GB 2ZEXA 3O5SA 4QPGB 5I0UA 1SQ4A 1COV3 2RM21 4QWNA 1W6OB 3C2UA 2WNVC 3RFRA 1GUIA 1DQ6A 2PHFA 1AR72 1PIV3 5BNOA 1K45A 1BLZA 3LA2A 2WDBA 4OQ8A 4XTPA 4JQRA 3PUIA 4FTEA 4BLIA 4XXPA 1NA1A 2VD7A 5FYTA 4J1WA 2FBEA 5A3TA 2BDRA 3HEIA 1CESA 1WUVA 4NWWA 3GYDA 4ZPIA 3TN93 2MNGA 2R041 3OD0A 2X5IA 2E31A 5F2WA 5L73A 4AQTA 1D0HA 4AYUA 2JDUA 3CQOA 4IE7A 5JAXA 2ZZJA 1IS5A 5M0TA 4V2VA 4Q4V1 3ZIXA 3AP4A 5A7PA 3WG2A 1TNFA 5DQ0A 1GSLA 3ZLIA 3LEIA 4OI1A 3TNPB 3FWEA 4IERA 4P9YA 5CYYA 2LM3A 3VL8A 3VB9A 4NPMA 4XCAA 5A33B 1PZ7A 4ZXEA 2Z4FA 5JUVA 1KFUL 2RG4A 2ZX2A 2RE9A 4GQ7A 4JGZC 4YRDA 4S2DA 1IOAA 2BGPA 1AR73 2XJSA 4N53A 1NZIA 2J1TA 2WWSA 1YI7A 3N9NA 3L2YA 2TNFA 1O5LA 4HN1A 4WM7A 2PHLA 1VBD2 3M3QA 4AI1A 1DFQA 2WL1A 2EICA 1YEWA 3LAGA 4NIGA 4AL9A 1QJX3 3LFMA 3J7NA 1CAUA 3BI3A 4LUKA 2W91A 4RR3A 1S4CA 3LF7A 3WT3A 1RUH1 3E6CC 2XUEA 2XBO1 2J1SA 4EN0A 4D7YA 2O1QA 3T08A 3J7MA 1OKQA 3MIFA 3ZOIA 4AFCA 2ZGSA 2EAKA 4HMZA 5CG8A 2FMYA 2HEWF 3H9AA 1QH7A 2B4KA 4CP9A 3ZFFC 1H30A 4LNVA 4UW3A 1W8HA 1QJU1 2VUCA 4GB32 1HDKA 2A71A 3P5BA 4IXLA 3DGTA 1PK6C 4XE9A 1W2UA 3AKSA 5FZOA 4FTBA 2XPJA 2W52A 4D94A 3OGJA 4DINB 1YQCA 2QQWA 4MXWA 5BNNB 1CPNA 2AEYA 4XJ8A 4XUOA 1C3HA 1FOD1 5C8CC 4AVTA 1URXA 2JIJA 5H9PA 2V4AA 3VKLA 1X33A 4LJHA 1VBD3 5KC6A 2F4PA 4CCLA 1AVBA 1AYM1 3I2HA 2HKXA 3A4UA 4OUMA 3LE0A 5IJRA 1OD5A 3WDTA 1FV3A 1T6BX 2ZJCA 3VZMA 5FXXA 4E2SA 2XB6C 1RUG1 2E32A 2R071 1OFSA 1GLHA 2CNAA 2VMIA 4RFRB 2VQTA 2ZOEB 4XMIA 1UU5A 4QKFA 1OHFA 4MX3A 1PHMA 4QPGC 1Z7S2 1N1VA 1S55A 4P9XA 2CGOA 2XWBB 1U5ZA 1XC6A 1RUJ2 3KGLA 4Y1YA 4U2AA 4PIXA 2W92A 2Q8DA 4GB33 3ZN5A 4GWJA 2D7FA 3KQRA 2JDYA 1UIJA 4AEDA 3HQUA 2QQVA 4HVOA 1SLLA 1YXWA 1MPXA 4LKDA 5L7OA 4M0HA 4A41A 2VZUA 3J7HA 5T3NA 3KVBA 4AQ6A 2F4LA 4CDUB 5A6XA 2HBUA 2VTXA 1OVPA 4MGYE 1LHWA 3P6BA 4IV3A 4KG0A 1DQ1A 2HWE1 1J58A 1LOAA 4M4PA 1ZRCA 4MGKE 1S2KA 4ONUA 3SQOA 4BDVB 4CEYB 1WCSA 1Y4WA 3K75B 2WABA 2R6QA 1V00A 4UI9L 2W94A 4WM8B 2KD7A 4Z2AA 1JZ4A 2BU9A 3UL2A 2YMZA 2ZKNA 1DQ4A 3KCCA 4RN5A 5GLWA 1Z7S3 4CDQB 4BQ5A 2CDPA 1F15A 2W5FA 4JC1A 2E7QA 5IK7A 3JD71 2P34A 1ACCA 2PAEA 2QBXA 4XOGA 1LR5A 3BGAA 1XU1A 3DXTA 3VD3A 3OB8A 2VMDA 5FYBA 3UGGA 1UU4A 4XUPA 4JRAA 2A6XA 1CJPA 2ZACA 2D3PA 2Q4SA 4CU8A 3ZYHA 1ZBE2 5ACA1 2GN3A 2PMWB 4A2UA 3CF6E 5IFPA 4L0PA 2RJLA 4DXZA 3HN1A 1CX1A 4CDWB 4BMEA 2J42A 4JKLA 4Y26A 3HBKA 4OUEA 1D7PM 3WVJA 5D8AA 1HKDA 4EWEA 1J3PA 3HQRA 1S0FA 3DL3A 1IHMA 3H8OA 2A3XA 4O61A 4XFIA 4M3CA 3ITQA 3FHAA 4JTOA 4GAZA 2OPKA 4CU7A 2G9GA 1NXMA 2R062 3NMBA 3VLBB 4OHXA 4GH4A 4QHOA 2VZRA 5FP8A 5BNNC 2P1BA 5FK7A 2XVKA 5IT6A 5F3EA 1CAWA 1UOJA 2W1UA 1MS8A 2WN2A 3M8LA 2Z2SB 2B5HA 4LA3A 5IATA 3WG3A 3AVSA 4HG6B 3NL1A 3H3ZA 3R05A 5JZGB 1BVP1 3WF2A 2GC0A 4QM8A 1VP6A 1ZBE3 1CWPA 1LNSA 4I09A 4Y5Z0 2XMLA 1AR62 5FY1A 1W8ZA 4NRPA 4XEZA 3T0DA 3NNMA 3VZLA 3CNAA 3WHUA 4PF5A 2R0HA 2QJVA 4YM3A 2XJUA 2A6ZA 2HWF3 2RS31 3BPZA 1APNA 4Q2FA 1QWRA 1UN1A 5KHIA 4Q27A 2J7MA 2VG9A 3LCPA 5HV0A 3NRUA 1F4AA 2RJKA 1GYKA 4G3YC 2B45X 4QPIB 3ILNA 5KBFA 3Q8CA 3ZXJA 1NG0A 1UY0A 1Z78A 5FIXA 5IUQA 5LY2A 2G9ZA 4NVPA 3BYWA 3K51A 5CKQA 1H8TB 3HMYA 2VW0A 3KQ4B 2DV9A 3WSOA 2R063 1S0EA 4DZGA 4E2QA 5CA6A 2OXBA 3USUA 3N9LA 4NAMA 3OPZA 1ZREA 2JDMA 3LB9A 4CDUC 1JZ2A 1OUXA 1XNAA 2J1VA 3J4UH 3ZX7A 1XE7A 2NMNA 3LOIA 1QQP1 4CEYC 1AR63 4G4FA 5FPBA 1W0PA 2B8MA 3T1LA 1E5SA 1WWYA 5KXCA 4NMIA 2WO1A 1ULGA 3RVHA 4FI9A 4LOSA 1UD1A 1ZZBA 3AM2A 3J8F2 5EYXA 3WDWA 1O3QA 1CZTA 4CDQC 4PLMA 4CUCA 3ZPYA 5A7NA 5KHKA 4LULA 1RUOA 4OULA 1HQNA 2AENA 2NZ9A 2WWUA 5DAPA 5FYVA 1W28A 2WWJA 2I2SA 4OHWA 2I74A 4YM0A 2W39A 1KJRA 1UCXA 3BOPA 1RUF2 5FLIA 2FDGA 3I2KA 5DUXA 4LOTA 4LO7A 4TTGA 4N90A 1NQJA 1DQ0A 4PBPA 2Q8OA 4K6BA 3B7MA 3ZYBA 1QY4A 2VOXA 3ACIA 3RWNA 4CDWC 2Y33A 4LEJA 4C1WA 1JH5A 1GR3A 2XL7A 1YQ6A 3ZXFA 1AL21 2AGSA 1W99A 2CYFA 1WLTA 5EJ1B 4XF4A 3WD5A 4LBOA 4LXLA 4I0BA 4AVSA 3J8F3 4KL1A 5GZCA 5J48A 2BTVC 1UZWA 2DFBA 4LBLA 4XCBA 5FZ0A 1TE1B 3HNYM 2E51A 2ZA9A 4UFLA 5GLUA 3WCSA 5FY5A 2IXIA 4P9LA 5FWJA 3DV8A 2VCBA 2EXJA 3HQXA 4M3CF 5C3SA 1TMF2 4DB5A 3OOXA 4E8DA 1VBB2 4AHZA 4AXOA 3A7QA 3VBOB 1ENSA 4KH9A 5GZDA 4EN9B 2TEPA 5T52A 5F3CA 4M0NA 1RUF3 3DYMA 1W0OA 1X8MA 3I49A 3LEMA 1VAKA 5T5LA 4WVMA 2RVAA 4W4ZA 3ZXKA 3UK9A 4CCDA 4GJZA 5C9AA 4AHYA 3FLRA 5LASA 3C3VA 2XDVA 4MSVA 4YG3A 4EZHA 4AQSA 2IXHA 3VD4A 1HRV1 3K77A 1GOHA 3BIWE 1RHI1 4AI2A 3I3MA 1H8TC 4GZ9A 5LW9A 2D3RA 3ZVXA 1VBE1 3BU7A 5EHDA 2EXHA 2PQSA 2V72A 2EVXA 4ITCA 3HR9A 2LRPA 1DCSA 3T0BA 1JHJA 1TMF3 4LA2A 5F2SA 1KDMA 2Y60A 1VBB3 1H1IA 2HWD1 1TNRA 2BGOA 1IS6A 2VZTA 5IVJA 4NRQA 4Q0PA 3KM5A 4QKBA 4CCCA 3BIEA 3B94A 1G9CA 2XJVA 4DRVA 3CL1A 1PVXA 3AZVA 5AVAA 2WUHA 3WF4A 5JXGA 4I2OA 1SEFA 4QGLA 2VQ0A 4ZONA 5G05L 2YFZA 1QNYA 3ZSJA 2Z69A 1Q5OA 3O1MA 1K3IA 1X8EA 4YM1A 1S2BA 3NAPB 5D1IA 1JUHA 2YU2A 4AOCA 4MGIE 1W6MA 4UOJA 3AP6A 1Y3TA 3N9QA 3ENRA 4AW7A 2DCYA 1OSGA 4JDMA 1C5IA 5JOWA 3I2IA 1ASJ3 4CU6A 3DECA 3IWZA 1SLIA 3HT2A 3M2MA 4UFHA 4DNYA 2WA3A 1OOPA 1ULFA 5AC91 3PJYA 2F17A 5T5PA 2P5BA 1RUI2 3CU7A 2VZSA 4S2GA 3VDAA 2QTWB 4YGEA 5T55A 4CDXB 3GJBA 3OEAA 3E5XA 2VZVA 4QX8A 4AGRA 4C1XA 2IUWA 4E8CA 1JYIA 3HNMA 2WZEA 3B5LB 3PLQA 1MACA 4FCAA 5CIRA 5IK5A 1MEC1 3QACA 3PUQA 3BALA 4QPWA 3E5UA 4IV1A 4RS5A 1BQPA 5FKCA 3VDDB 2OUHA 4NHKA 4FVVA 4LTAA 4UFIA 4LQRA 3E97A 3A22A 3D0JA 2CU5A 3HT1A 1LAJA 4QX2A 2ET7A 2C9KA 2CGNA 4Q4Y2 4Y22B 3H1MA 5FZCA 1Q8PA 3ZMOA 3KSCA 2XONA 5EYYA 1IGOA 1QJFA 5LBEA 4QDRA 2Q0AA 4NAOA 3K46A 1LHVA 5FRAA 4RQPB 3PUHA 2BP6A 1WBLA 2DUQA 3VZJA 1DU3D 2W1WA 2W68A 3I2FA 4Q4X1 4D69A 3RPQA 5HXMA 1RUI3 5C3PA 3OY8A 1PGL2 3VZNA 3VBRA 4Q8KA 3AMPA 2GDFA 3D3AA 5CBLA 3Q8AA 1HRI2 1D4M1 2C24A 1AZDA 4CU9A 4CXXA 2GZWA 4K8RB 3SCGA 4B7EA 1RB8G 2DCZA 1YUDA 2D97A 2QDRA 1AR82 1AYN1 1UMHA 1MR5A 2YPJA 3ILFA 3CJIB 2CGPA 4A42A 1GWLA 1OLME 4H3WA 1R1ZA 2LUWA 1QNWA 3FL7A 2L9LA 3NQHA 1DQ2A 5JR7B 4FPYA 3GCXA 4WV8A 4I01A 1SPPA 2D43A 5FO9B 2AYHA 1WLCA 4IV1C 4Q4Y3 4RS5C 3OSDA 1BMV2 5ERLA 2GAUA 5CU1A 1BKZA 2C0ZA 1BVVA 1G8WA 4JDOA 4M01A 3ACHA 4FFHA 2TUNA 2ZHKA 5HI0A 2EAAA 5CVRA 1R64A 1QEXA 3NNLA 4YVWB 5A32B 3IPVA 5CKMA 3ECQA 3CO2A 1SBEA 2ZX0A 1LU1A 2JG9A 4N9IA 1RL3A 2OZJA 4NHXA 3H8UA 3WP6A 4BCUA 1JYVA 1WZXA 1HRI3 3BTXA 3RZKA 2BOIA 3QOPA 1XOYA 5A3UA 2E53A 4RHV2 2BJSA 4KGGA 4Z82A 3HJRA 3M1HA 1AR83 4LT5A 4URTA 5FZEA 4DY3A 4IEXA 5J96B 1ZRDA 2VOKA 4NO4A 3VHRA 4CEWB 1COV1 4BQ2A 4MGTA 1ALYA 4L97A 1CIYA 4AAPA 1PIV1 4P5HA 3AVRA 4B1LA 4FPEA 1IPJA 4M4RA 5LK5A 1UL9A 1FMD2 1W9FA 1YQ5A 4N43C 2WJSA 1XE8A 5L9VA 1OMIA 1XRUA 1GV9A 1GP4A 1MVQA 5IK4A 5FOJB 1JOBA 1AX2A 3THPA 3AL6A 3MW4A 1ND3A 1RXFA 3AJZA 1YI9A 2WT2A 3O0WA 4R4ZA 1HXS2 2AZ5A 4UXAA 2EXKA 1AJKA 4ZY9A 3VBSB 4NROA 5F37A 1PGW2 5I0RA 1WCUA 3ZFEB 4K21A 5IWFA 2A75A 1JTZX 4RHV3 4GJYA 3O0XA 2ZGLA 4MOAA 5C4WB 1HIXA 2ZCWA 2XQXA 4IEWA 2OUJA 2DCTA 2IXCA 3I3DA 3IAPA 2PTMA 3V65A 2FCVA 4QQHA 5C33A 2QQUA 4ZXKA 2ZGKA 3AZWA 1I6XA 3DPRA 2R30A 3N7MA 1GQGA 1GOFA 1RVF2 2VQUA 4RGKA 3N7JA 2J22A 3NKTA 4IETA 1MZ5A 2I45A 1F2NA 1AR71 1UX6A 1SBDA 4OLLA 1NLRA 4PDWC 4B4PA 2UWBA 4GALA 1LOFC 3PHMA 5JIAA 3SEPA 4BXSV 2BUKA 3ZYFA 2DVGA 4QKDA 5FP7A 5IVVA 1FMD3 1G9DA 3O1TA 4XILA 3RZMA 1PZ8A 5HCBA 4B7KA 4DQAA 3C7EA 1DP0A 1V70A 2BZDA 2JB8A 2N7GA 4V1PA 5C3OA 5JVVA 3AKPA 5LA2A 1SLBA 1HXS3 4HPKB 4LO8A 2WNVB 4XW3A 4YWAA 1UZYA 1DF0A 1AXKA 2BNMA 3I4IA 5FZMA 5A7OA 3FJSA 2D98A 2B42B 2VGDA 2VW2A 1RXGA 5DABA 3VZOA 4IGOA 1RVF3 2C4XA 2AEZA 2LALA 3DF0A 5JIUA 2HLEA 2JG8B 3ASIA 5EPAA 1U5YA 4YVWC 3AX4A 4OI2A 5F7UA 3ZYRA 5FYZA 4Q5OA 3AJYA 4IEUA 2LW8A 4FXGB 3B93A 1KQRA 5CFCA 1VBD1 1YJKA 3WEZA 3RZHA 2ZHNA 5FY4A 4Y1VA 3NSTA 1KITA 2YC0A 2AACA 2NLRA 1DLCA 3MLKA 5A3NA 1MVEA 4LHLA 4BB3A 4BOWA 3PVEA 1BYHA 1H4GA 1Y9QA 4NN0A 4QXCA 2ATFA 5TSWA 1S0DA 4L2NA 5BNQA 4CEWC 1LGBA 4NIDA 5FMOL 1VRH2 1QJZA 4PI2A 4OYUA 1GNZA 1XSRA 3CZJA 1JOJA 5FLJA 2QQMA 5C5UA 1ZZ6A 5FY9A 1VMFA 3WW3A 3PURA 3Q8BA 3V0AA 5F9TA 2GC2A 4GB31 4CCNA 4KU7A 3WF1A 1GU3A 3KV6A 4FOYA 1ENXA 2JECA 2QZ2A 4HT1T 2WT0A 4QD2A 3SCHA 3MGUA 3RNSA 4ISRA 5BY5A 2E9QA 1DZQA 1QU0A 2P3IA 4LKFA 2QZ3A 1AX1A 2IXLA 3VBHA 2D6MA 4XF1A 4E4ZA 5LRRA 5CB7A 4UF0A 3LWCA 5B4NA 1JZ8A 1V6LA 2IFRA 4AEMA 1KS4A 3M4FA 4QX3A 3RI8A 4AG4A 3ZFEC 5F5CA 1BXHA 1POQA 2X5IB 4HFSA 2CV6A 5J1XA 3ZFFB 3RRDA 5BYNA 5FZAA 1OC1A 1XU2A 2CAVA 5CFCC 4I3GA 2B46X 4R9CA 1A3KA 3L9JT 4NRMA 1JOPA 1XQNA 2HYXA 3E6BA 4OI0A 3UV9A 4JZRA 1Z7S1 2WNUA 1VRH3 4LBJA 3ZIWA 5ABJA 4LITA 2DUPA 1V6OA 2VMGA 2GNBA 1RUJ1 2VBBA 4AHWA 5C8CB 5DAQA 4YZ3A 1VBA2 1DLLA 4WVZA 2VCMA 3THDA 4AF9A 3GJAA 3QCWA 3VKMA 5CG9A 3T0AA 1EPWA 3VBUA 3KT1A 4NR1A 4N53B 4NJ4A 4AVAA 2WO2A 3SHRA 2MEV2 4FPJA 2GP5A 1D0GA 4WM7B 5E1RA 1FXZA 1ZZ9A 2ZMNA 4XF3A 4EROA 3KWVA 3MF9A 3ABZA 1O59A 1CAUB 2JD4A 3FLTA 2DVDA 4RR3B 1R082 4QU1A 1POV0 3MZHA 2GNTA 2WKKA 4XIOA 5FYIA 1SDDB 4DO0A 5IHRA 1UY3A 5FPAA 3SH4A 3FUOA 4CA9A 1LU2A 2WLQA 1OH4A 4YG0A 4MG2A 1F8VA 2HWC2 4IGQA 4Z92B 3K48A 4CP9B 1JI6A 4H14A 3U78A 1LULA 1C28A 5KHJA 1NCRA 2JG8C 1QJX2 2ZHMA 3U07A 1VBA3 3H50A 5FZOB 4L99A 1O8SA 1ULEA 4XAEA 1GOGA 3AZZA 3FFZA 5I8TA 3GCWA 4GWNA 3FFQA 3JQWA 3KCYA 4CUGA 1QJEA 1LOCA 4Q0VA 2UYBA 2A5ZA 2MEV3 1ZBE1 2NQYA 1W9YA 2P3JA 4QXBA 3OD4A 4NIHA 3OUIA 5DXDA 3NV4A 2YGMA 5CFDA 2WZ8A 4CXWA 3C7OA 2FDIA 4QGMA 2RR12 5ANQA 1R083 2J1UA 2GC3A 5FWEA 1B35A 5LATA 2GALA 4AE2A 2ZGUA 2HWC3 4YFZA 3MUZ1 2B9UA 3GBFA 1NQDA 1G9AA 3BVCA 2VULA 4O9GA 5E16A 3NWKA 1MS5A 4AK3A 1GQPA 5BNOC 1A6CA 2R061 2VE1A 4IQPA 5KR7A 5GALA 1YFYA 1NA1C 1VR3A 3O0VA 4KI5M 3GGLA 1LOEA 3AMHA 2FQPA 4XUTA 2NP0A 2XR4A 5C71A 2K9ZA 1ZA4A 5A3MA 3WW2A 2RMU2 2G1MA 1UX7A 5I0TA 4FP3A 1OA4A 4A3XA 1SLTA 3P1IA 3I2GA 2X5IC 1W90A 2EALA 1AR61 3NJVA 1R1A2 4IV3B 4NIAA 1OPMA 2VL4A 3HNBM 2GH8A 4NWVA 4B3NA 2VVEA 2CAUA 2UY8A 2YDEA 3FN9A 4KQ7A 2XKOA 2RR13 3OGVA 4W6YA 3MV11 4FOWA 1NYWA 1S0IA 2QQJA 1VLNA 3INAA 1FPN2 3V0BA 1NT0A 2PHXA 3RMYA 1G9BA 4NOTA 3RJ2X 3USSA 3MPBA 3ORJA 1GZTA 2VUJA 3DXUA 2PHRA 3D4KA 3H3LA 3AYDA 5FP3A 5T5JA 4EE2A 1U5IA 1W03A 3POJA 3PVNA 3R4DB 4N53C 3VKNA 4QQ2A 1BCXA 1GFF2 4KWKA 2ZX1A 1U12A 5FYUA 3VHOA 3IIIA 1V9U2 1UQXA 4WM7C 2PHDA 4XFFA 4Z07A 4X8PA 5IK8A 3I3EA 5IYYA 1OA2A 2OT7A 3B01A 4BIFA 1BEV2 4RR3C 1WW4A 1Q8VA 2RMU3 2HWB2 3LFIA 4MLOA 2ZMLA 2K2SA 3BUCA 1R1A3 4DS0A 1RJ7A 1X36A 3SNMA 2VMCA 4HKLA 1LHUA 1W9SA 2FDJA 4XMAA 2GMPA 1W9TA 5D8AB 1L7QA 3FLPA 3J8F1 1AL0G 4J1XA 1W6NA 5FO7B 1FPN3 2JENA 4PBOA 1SACA 3OPTA 4MGQA 1DYPA 4UAPA 1LHNA 4I0AA 2DU0A 1QXPA 1F5FA 4M3CB 5FZKA 2OX0A 2W1SA 4XDQA 4BA6A 2SBAA 4BWOA 4YW7A 3M3IA 1RUE2 2ZEZA 4YW2A 4CPBD 3ZR5A 4GH4B 4GMP0 4ZU4A 1T2XA 2X8KA 2JICA 2A6YA 1CAWB 3OTFA 4N9HA 3WCRA 4AFAA 2P4EA 1EAH2 1RUF1 4XACA 5E88A 1V9U3 5BNPA 1NY72 5J09A 1US3A 2WA4A 3E5QA 3VD5A 1Y43B 3OPWA 1JODA 3H7YA 2YBPA 1BEV3 4JCKA 3R4SA 1L3JA 1QIQA 3TRSB 4BZ4A 2HWB3 1TME2 4QGNA 3WHTA 3N4MA 1YQ2A 1M06G 3R6SA 1E5HA 4IE0A 2J1RA 2ORXA 1OQ1A 3DUIA 1O4ZA 5FUNA 2C6SA 2BYVE 2EXIA 3WP5A 4AAXA 2O14A 4BQ1A 3UJQA 4DUWA 5C3RA 4FT8A 5FV3A 1CPMA 1CAXA 3JZVA 1W39A 3T2OA 2QQPA 2ETEA 3VL9A 2XKPA 1W8TA 3NKGA 1TMF1 4NPRA 4GIQA 4AEDC 1RUE3 1VBB1 3ZN6A 4AEKA 1N3QA 3KV4A 5L7OC 2HWF2 3J9SA 2E7AA 4LLOA 2JDZA 1ZBA2 1NE4A 1EAH3 4A6SA 1Y7BA 4H7LA 4ZS2A 4IV3C 4IEPA 3W20A 4F7ZA 4K20A 2HJIA 5FBZA 1IKQA 4QDSA 1AJOA 1UPSA 2IXJA 1K12A 1OXCA 2WNEA 3LPFA 4BYYA 2VMEA 4TZDA 1TME3 2UU8A 3N9MA 3BTZA 5FZ8A 4TLFA 5JXIA 1VALA 4DUXA 2WO7A 3LDKA 1Q8QA 5FO8B 1SFYA 4DEVA 4P9WA 1WW6A 1O3TA 1AXYA 2RM23 4ES9A 2WSUA 3ZYPA 4XJUA 3NJZA 4XFHA 2ZGRA 1CR7A 4XVHA 2GNDA 1X50A 2VUAA 4AVVA 1WW5A 1C4RA 1W0NA 2E33A 3NV2A 1UOBA 4NPLA 4XJZA 3B3QE 4B4RA 5JMCA 2NPIA 1C8M2 3N36A 3BOWA 4BQ3A 2XGXA 1S0JA 3S6PA 5FXVA 3N3HA 1ZBA3 2CY6A 5FQ0A 3ALQA 3H8XA 2AC1A 1RYYA 1WW7A 1QXRA 4CCKA 4BQ4A 2HEYF 3VKFC 5EFUA 4ASMB 1DYOA 2XBO2 4K7JA 1IQAA 1A78A 4PT6A 4MXVA 5D8AC 5HBAA 1EV12 4XF9A 1QJY2 1W3XA 4WM8A 5FZFA 2PQQA 4J25A 5GLZA 3TAYA 1H2KA 1UZZA 2XHKA 2GU9A 1OI6A 3PTRB 4BISA 2GSYA 4I02A 1XPWA 2BOJA 2XHNA 4SLIA 4S2FA 4GH4C 2BNOA 5FZLA 3AP5A 3I2JA 4ORFA 4LHKA 3PU8A 1RUI1 1CX4A 1OLQA 4MVTA 1OURA 4COUA 5JDBA 1C8M3 4GWIA 2XJRA 3UKTA 4YVSA 4PQ9A 1X82A 4P9IA 4EWAA 1AYM2 4WVMB 3WR0A 3AMMA 4O65A 1PO22 3HPNA 4U36A 2IVJA 3AFKA 5F5QA 1OQDA 4E4SA 5C9AB 2EF6A 1LHOA 2XBO3 4PF1A 1EYBA 5T50A 3OYWB 1VAVA 1IKPA 1EV13 2DDUA 3PU3A 1QJY3 1EUUA 3D8CA 3P3PA 4HKWA 1J59A 3SH3A 3UT0A 3MHZA 4RYDA 4XFGA 5LEKA 2EIDA 2AH2A 2Z79A 2HEVF 3GBWA 3W9AA 3GBGA 3ZO0B 3MIHA 4K40A 1H6YA 4UT5A 4BMBA 3JBG2 3PL0A 1KGYA 2OIIA 3CBNA 3WNXA 3WXPA 5JZGA 4EN6B 2C26A 1PGL1 1ZA7A 3S57A 4BQYA 4L92A 1HRI1 1UPIA 2WFF1 2XJPA 3OGSA 3PJQA 3BKZA 1GBGA 4XUNA 5HXVA 3ZSKA 1AYM3 4TN7A 3EJKA 3MDPA 3WDYA 3VHPA 3JXSA 1H1AA 3ZYJB 1JU4A 1AR81 1PO23 1ENRA 3LKJA 4ZZ8A 1KEXA 1RUG3 3SMHA 5FFOC 1ZZCA 3QD6A 1W6MB 5I93A 4YNIA 1AHSA 1G9FA 2A6VA 4QPIA 3FBYA 2OZ6A 4XUQA 3TEYA 1NXD1 1V6MA 4CUAA 3EBRA 4XETA 3GXUA 1ZM1A 2Q8EA 1BMV1 2XXZA 2ZGTA 4OFGA 2VOVA 1PX4A 5FZBA 4Z2WA 5IVFA 3POFA 4Y33A 4KGQA 4DXRA 3ES4A 3W59A 2BEOA 3JBG3 1EPZA 3O12A 5J37A 3WQ1A 2BWCA 1WCQA 2W08A 3VD9A 4B8EA 1OLMA 1FNZA 2P3YA 3LOBA 5KWRA 2DF7A 1UOGA 2WC2A 3MPPG 3R0RA 3Q9OA 2VECA 1ASJ2 4GULA 1ZYBA 2Q1ZB 5A3LA 5C6CA 2D3SA 3KV9A 2ZHLA 1B09A 4IV1B 4RS5B 1SDWA 3LA3A 4CPBA 2A73B 3TOJA 1Y9MA 5A7QA 1R092 5EJ3A 5DUWA 3PVBB 1RC6A 5FREA 4N8MA 4Y4RA 4F8AA 3G7DA 2A3WA 2Y64A 1S0GA 1RUD1 1PO12 2AREA 2C9AA 2KM2A 3SKVA 3VDCA 4CYDA 4QKNA 1RINA 1JW6A 4JTNA 3SC7X 1FMD1 2IXKA 3IB3A 5JOYA 1PM4A 5FY7A 3W5NA 2Y6KA 3VBRB 1UKGA 4PIYA 5F8PA 5I91A 3RI9A 2DBNA 4FPHA 4COYA 3FMGA 1F4HA 1CZVA 3ZDVA 5EQUA 1HXS1 1WGPA 5C9AC 3LGRA 1PGW1 3LSEA 2D6PA 1F9KA 1V6IA 1WMEA 5DAXA 5F3IA 2RS32 4PLNA 3B69A 3ZFEA 4GD4A 2WS91 3T2PA 4XIKA 5FOBB 5L36A 1WMFA 4Q29A 3AK0A 2B9VA 4CCJA 1JZ6A 3O1PA 5FUIA 1HV1A 2IC1A 4FQ4A 1R093 5A6ZA 4ATFA 1NAEA 4DUVA 4N43B 5FMOS 1SPPB 2QUOA 5FP4A 4P00B 4IEOA 1E57A 5DN2A 2VPVA 5FJKA 5JSPA 4RGGA 1AF9A 2ZTNA 4LK7A 1HB4A 1E5RA 2HBTA 1PO13 2WSVA 4FTSA 3ES1A 4BQXA 3VBFB 3M3EA 5K8SA 4N7IA 2WZPP 2ARCA 2Q1MA 3POYA 1I3HA 4LO6B 5E8AA 1OQEA 4META 1QF3A 4CZSA 1XJAA 3H7JA 5EZWA 5A80A 4BU2A 5LA1A 1ULPA 1Q8SA 1D2QA 2BQPA 2JG9B 2V73A 3MIEA 4LHSA 4Y20B 1HQLA 2FDFA 4PI0A 2OKXA 4S2HA 4LK6A 4X6QB 3MLLA 4MV2A 2J1EA 2WYFA 4JGYA 3WNPA 4LIVA 4Q4W2 5DAVA 4FOVA 1DGRA 4OI4A 2VZ3A 2O8QA 1W05A 4IDZA 1VE0A 2VMFA 1NKGA 5JR2A 2RS33 1O4YA 3OUHA 4LE3A 1GWKA 3JCIA 4MO3M 2YB7A 4XJ9A 5T5OA 4PDWB 5HCAA 4JX0A 1SMVA 1YC61 1ZRIA 2WZR2 1W6QA 1MS9A 1DIWA 3ELNA 3IKWA 3NO8A 1J1TA 3SKJE 2YC2A 2Y38A 2WN3A 5FPLA 4R8HA 3AYAA 1OOPC 1HB3A 1LTEA 3AB0A 2H6CA 2RHPA 4RA0A 3K4ZA 4OZXA 1E5IA 3UKNA 5ISLA 4BE3A 2UY9A 5JOXA 2IVIB 2QNKA 4ZU5A 2HYKA 2WIIB 4TSVA 5GKAC 5DZGA 2UWAA 2PA7A 3ZSLA 5AFBA 5LY1A 4Y1UA 1ND3B 3NJXA 3KB5A 3ZYIB 2Y6FA 4MH0E 3V56A 3POEA 2OYZA 3D0SA 4IUGA 4HK9A 2ERFA 2VNGA 5DZFA 4Q4W3 3WP3A 1K5MA 2D40A 2WAAA 1A34A 3AKTA 1OLRA 5BPXA 1VRH1 4FXKB 1JS9A 4W6WA 3CKHA 4LBQB 1H9WA 3DPRB 4H55A 3VKOA 2WZR3 4YG6A 5FAXA 4EN7B 3UKVA 3AFGA 1YLLA 4K8FA 2ZBJA 3A0NA 3FC0A 4E9KA 2Y6JA 3C7HA 1MS4A 1CGPA 3Q8FA 4UW4A 1UXZA 1RMU2 2DURA 2OVUA 4CDXA 3VBRC 2EIGA 4QHBA 1BHGA 1MQTA 4A7KA 1N1YA 4C0HA 2YROA 1O8PA 2WT1A 2VZ1A 1S1AA 2XLGA 3D82A 2H0VA 4P5YA 3SEEA 4ARYA 4YZ2A 5C70A 3HOBA 1CN1A 2DCJA 3EYPA 5FZ4A 4DXSA 4JKKA 2FDHA 1GNHA 4UFKA 3VDDA 4W50A 1UWWA 5JI7A 5FKBA 4XTMA 2D6LX 2O8OA 3PIJA 4OQ9A 5LWBA 1HB1A 2JDAA 5FZ9A 4EWDA 5K9YA 2V4VA 1IS3A 4YZ5A 3WDUA 5H9RA 5DMYA 4GKXA 4YFWA 1Q3EA 1RIRA 2D6OX 2RS12 3FUQA 3JQXA 4GXLA 4QU2A 3SCFA 4AR2A 3TEXA 2GNMA 1N47A 4AEJA 5A7WB 4R52A 1PMIA 5LK7B 3S30A 1DQ5A 1J83A 1QMJA 1VBA1 5DPNA 3ZSMA 5JSRA 1JN2P 4RQPA 3CIHA 3TN91 4GA9A 5K0UA 4YYOA 2YHJA 1X9PA 1UF2C 2IFWA 5LCWL 2ARXA 1G86A 3LZZA 1RMU3 4A7ZA 4PHZA 1LESA 2JG9C 2MEV1 2VZOA 3I7DA 2DTWA 5F32A 4A6OA 4A44A 4E27A 5CFCB 4I3PA 4OCTA 4QHZA 2ZGOA 1Q56A 1X7NA 2VUDA 4I30A 4XHXA 3S5QA 3EB7A 3I59B 1U0AA 3GNEA 5A1AA 2G9FA 4CP0A 3ZFGA 3CJIA 2PFWA 4YPJA 3MIGA 4IEYA 5KHGA 1G7YA 1DGWA 1UXXX 2HWC1 2LROA 3ST7A 1O7FA 1RTVA 3ATGA 4Q1RA 5JPMB 1XE0A 3QH7A 3I2OA 4HETA 5J98B 3O1OA 1Z0HA 2R16A 2RS13 4XBLA 1HLCA 3V0AB 3H42B 1QJX1 2DTYA 4J6GA 3K3OA 5A32A 1POV3 2MPFA 3OGGA 5CISA 3WNKA 2YG0A 5LEJA 2A1XA 1GWMA 1EY2A 1BZWA 1DGRN 2PHUA 2R0FA 1KS5A 2BWAA 5FPXA 2GMEA 3VBHB 2JDNA 5K0UB 3R4UA 1ND3C 4R9BA 4MADA 4UBGA 4OVEA 2JWPA 3TWIA 2PELA 2XVLA 5IW0A 2WAOA 3KVAA 4A7YA 3AMNA 4H7MA 3POBA 3I3QA 5FZ1A 5L9RA 4YW3A 2BGCA 2RR11 1LJ7A 1C8NA 5G04L 3MEPA 4D7TA 1ZRRA 1O3RA 1UAIA 3KF3A 4QB6A 3UNPA 4YLZA 3CDZB 2JD9A 5LA9A 4MHUA 2ID4A 1YCIA 2QQLA 3DPRC 1LENA 1AUYA 2W47A 4HSJA 5F5AA 2WNUB 5ABJB 3ZM8A 1IG0A 2JX9A 2H0BA 2FDKA 4BXFA 2ZX3A 2P6HA 3UGHA 4MYEA 3ACLA 2V09A 1S2EA 1YO8A 5DZEA 5GZEA 3DYOA 1UMZA 2ZEWA 1LODA 1D2SA 1AR92 3KMHA 1ENQA 4G9SB 2CWSA 3POSA 1JYNA 2WYSA 5FPZA 3WLUA 1V6JA 2QQKA 4INDA 4QB1A 3CMGA 2RMU1 3RMXA 4QQOA 3WF0A 3ZXLA 1R1A1 4MGSA 1AXZA 4P9JA 1J84A 3KHBA 1NCQA 5C4WA 5JPNB 5LB6A 1IPKA 3LEKA 1V6KA 3AYCA 1XYOA 5BNOB 1PVC2 3W5MA 1FPN1 5DG2A 3DN7A 1YFUA 3LDRA 1NA1B 4NE9A 1GKBA 1IQDC 4YARA 1BK1A 1ND2A 2XWJB 4JHZA 3WZ1A 1VIWB 3ZKYA 3PVOA 4LMFA
chains in the Genus database with same CATH topology
4FPCA 3O14A 4Q4X3 2D93A 2XLFA 4WZCA 4KBBA 1AR93 1V9U1 4DOUA 1DYKA 4XJWA 3DKWA 1H2NA 5I8SA 2ZKLA 4HVRA 2A70A 2HWB1 2OW4A 3KCXA 2DCKA 5CFDB 3CEWA 4BIOA 4RFT0 3GZAA 1EP0A 3H3UA 1B35B 2MHFA 1SLCA 5SV5A 1DZRA 4EN8B 3M3OA 2IZWA 1PVC3 4XBQA 4Q0QA 1W6PA 3MW3A 3JB8A 5E89A 3LA7A 4LE4A 4YW4A 1XNKA 3IM0A 4C90A 1GANA 1RUE1 1YFWA 3J26N 1MS1A 1WD4A 4WVWA 3SISA 2EA7A 3EHKA 1Q8OA 2BW8A 3SLIA 4E2GA 4COWA 1XNBA 3GHNA 3VBHC 1ND2C 1CAVA 1EAH1 2BNNA 2XJTA 3BB6A 3AYEA 4KU8A 4FPOB 4ZU7A 4DY5A 2JE7A 2DFCA 1JUIA 1TME1 2QKDA 2GMMA 2DVBA 4JGZA 4UW5A 2YGLA 4GMP3 1SFNA 1HW5A 5DDJ2 3B02A 2WNUC 4AVCA 5ABJC 4FPFA 4LBKA 4OHYA 4MXWB 4FSJA 5JLVA 4XBNA 1LGNA 2R32A 3T1MA 1O5UA 3VBUC 5I8YA 4WBBA 3X29B 3KZ4C 2VXRA 2HWF1 1RUC2 4SBVA 4C0BA 1ZBA1 3TNQA 5HCFA 2DWRA 1MZFA 1BBT2 4FQZA 4YZ1A 2PN5A 3WUDA 4F83A 1RUNA 1GZWA 1PM7A 1QDOA 3ZFFA 2VMHA 4R9AA 3B9IA 2ILMA 4LO4B 5GLTA 1WBFA 1PK6A 4ISQA 2V5YA 2WQ4A 5JI9A 3RSJA 2PHTA 3HBZA 1W6NB 4AFDA 4AEDB 5DDJ3 2CWMA 3FHIB 1I1EA 3WV6A 1NCRC 5C8CA 4R4XA 1VB4A 5L7OB 3ZSEA 1N1TA 3ZMNA 4K9SA 4YM2A 2AR6A 4O9EA 4P9GA 2O0OA 1A8MA 2ZS6B 2PLV2 5GZGA 1C8M1 4Q0SA 2E63A 4BHPA 3HD8B 5BNPB 1LRHA 1RUC3 4IL7A 5K7PA 4QPGA 5CFDC 1UU6A 3H1YA 1BBT3 1W6OA 2VVFA 5FTTC 1B35C 1SCRA 2W0XA 1EV11 4FBFA 1QJY1 1ULDA 4OHZA 1N1SA 2E7TA 2ZMKA 1CAXB 4HN0A 3NW4A 3RZZA 4FAHA 2DUOA 1WD3A 2BVVA 1PNGA 3ZN6B 2PLV3 5GLVA 4Q1PA 1DHKB 2X29A 3ETQA 3KT4A 5J7MA 2ZGQA 4AGVA 4MUVA 4W6XA 4N7UA 5A33A 3SH5A 2ENRA 5FDBA 3KGZA 1JHNA 3RYPA 5EXOA 1KDKA 4HSLA 1PO21 4L11A 1QHDA 4RSUA 2WLPA 1YIPA 1WCKA 4K1YA 1VBC2 1YJLA 2PHWA 3WQ0A 1O91A 3GALA 1OFNA 1F5JA 2Y26A 3THTA 3WDXA 2SLIA 4FO9A 4AFMA 1YNAA 3QLQA 3ZN4A 5KXBA 2UWCA 3RJRA 3JBG1 2YV8A 3WP4A 2WFPA 1DBNA 2QDNA 2XLAA 2RS52 1VB2A 5EV7A 5FQ0B 1QDCA 2RM22 5GJ6A 2P2KA 3O7OA 5AVPA 2D5FA 2P37A 3RYRA 4BPZA 2QCSB 1LEDA 1XXNA 5AFEA 1NZCA 1WLWA 2DVAA 2YZ4A 1YYNA 5EWSA 4ASLA 4COVA 4ATEA 5BNNA 2H6BA 3USUB 1VBC3 1DZTA 1LGCA 2R1BA 4LBNA 1RUJ3 3M7AA 4XPVA 2QE3A 2R042 1NLSA 2D6KA 5J3UA 2VNOA 3WG1A 3JU9A 2Y0OA 4PCRA 5BNPC 4Q4V2 4OUSA 4KNCA 3AMQA 2VY0A 3A0KA 4YVSB 2RS53 3IDBB 2JXAA 2NYYA 3TYJA 1GQHA 4KWJA 3PMSA 1ASJ1 2R49A 2WINB 1YHFA 2VU9A 2ZPXA 4HANA 1J1LA 1R091 5KXEA 3B00A 2XUMA 4D7SA 4PJYA 3URFA 3POWA 4HK8A 2Q30A 4CDUA 2P3KA 3CLPA 3VGIA 1CIWA 1JXNA 2OA2A 3PTYA 3GZTB 1PO11 3I8TA 5I0SA 1RUH2 1FATA 4UBHA 5GZFA 2R043 2VVDA 3RYKA 4CEYA 5C8WA 1DGLA 1IZ3A 3MW2A 4FP2A 4WVVA 4LR4A 1PZ9A 3I2DA 5KC5A 2VQAA 4Y1XA 3HWJA 4Q4V3 4FPLA 3SITA 3MIBA 3MFCA 4CDQA 2FHRA 2GH2A 1QJU2 2F6BA 1XNCA 1XYNA 5L19A 3ZXGA 2ZGNA 5F6KA 3RG0A 4R9DA 4AFBA 2Z5WA 3WX5A 2Q5TA 4HKOA 1FOD2 4NHLA 4E4DX 3U4XA 1JBCA 3ILRA 4ZKTB 2FZ1A 4KWLA 1N3OA 2UURA 3AKQA 1FYUA 4CDWA 1RUH3 5CAZA 1QKQA 1RUG2 2R072 3KS7A 4UW6A 3WUCA 4K1ZA 2DU1A 2IWGB 2K0GA 4X6RB 5GM0A 1D4VB 1C1FA 4GWMA 3RS6A 4Q4Y1 4QQPA 4Q4W1 1QJU3 2XJQA 4EJRA 4WM8C 3LSDA 3T2TA 4CP1A 4Z8BA 3ZXDA 1LECA 2GC1A 1V6NA 2XH6A 4XF0A 5BXXA 3JUUA 4DMIA 5JOZA 2WZR1 1FOD3 4Q8LA 4BLJA 2HWE2 3MFAA 4MZUA 1UKRA 3E6DA 3HAGA 4PIZA 2JJ6A 3IN9A 1PGSA 1H1MA 3MICA 4YVSC 2R073 3VUOA 1LCLA 1IS4A 1T6GC 5DUUA 1DG6A 2TBVA 5DG1A 4BM8A 3JD72 1GICA 1H8TA 2X53S 1KXGA 3OBRA 4F3JA 1OA3A 1OOPB 3QBQA 3AP7A 5FCCA 1NE6A 4AI8A 3MYXA 4Y24A 1H8VA 1VAMA 3AKRA 5ACA2 4LLFA 4XQDA 3AZYA 4M3CE 3IIAA 1TQ5A 2D6NA 4QPYA 1YWKA 2ZZQA 3I54A 3S7EA 3APBA 1FV2A 2HWE3 1O4TA 1QGLA 1RMU1 4LBQD 3W58A 4RHV1 5JZGC 3MF6A 3P3NA 1MZEA 4XJAA 2NN8A 4QXKA 4HBNA 1LOBA 1CD3G 4JGYB 1Q43A 1YFXA 3S7IA 3OYWA 3JD73 2A6WA 5BUVA 3BCWA 2ZAHA 3IDEA 3AP9A 2AUYA 4QPIC 3ME2A 4JDNA 4DFSA 4FOQA 4B4QA 4JV4A 2RS11 3AXDA 1W6QB 3OY8B 2A7AA 1ZRFA 3OJBA 4DPNA 5ACA3 1WCDJ 3EXUA 1POV1 4LO5B 1ZX5A 2ZX4A 1YIFA 1ZVFA 4HL0A 1LEMA 4TYSA 2BBVA 1CVNA 2B39A 4COZA 3D5OA 1SLAA 5F6LB 3TBDA 1QOOA 4XFBA 3IDCB 3ZXEA 1RVF1 1REFA 4TWTA 1K5MB 4AGGA 5H9QA 4YZ4A 4XQWA 2ZAAA 3H0OA 3VBOA 1SBFA 3IPVB 3IMNA 3WY6A 3U10A 5T54A 1QQP2 2PYTA 3V64A 4LUMA 5KXDA 1ZZ7A 1DGWX 2FMDA 4CRQA 3ROUA 4XQ4A 1MQTB 2BFUS 1YRZA 3MI8A 2BPA2 3NV1A 2PAMA 3PMEA 4YSFA 4Q26A 2KXLA 4PLOA 2C1FA 2LTNA 2YY1A 4IEQA 4L8QA 3WW1A 4HZFA 4QX5A 1JYCA 4L9BA 3PNAA 3VBOC 1J3QA 1QQP3 2D5HA 5JCTA 3H1WA 3TB0A 1AR91 3VHNA 3AXEA 3NAPA 1AL22 3NV3A 3OF1A 4XZPA 4P14A 3QH6A 1C5HA 4JVAA 4Y4YA 3VBFC 2WFF2 1H2LA 4JGYC 3ZXAC 3BODA 4JRLA 2QFEA 3VV1A 1KRIA 1MS3A 3M70A 4JAAA 3IBMA 1BJQA 3ZFGB 4ES8A 2CTVA 1GZCA 3ZYGA 3N7LA 1QOTA 3RDIA 1GZ9A 1PVC1 5SV8A 3IT8A 3BTAA 1RJ8A 4N43A 4XHBA 3HIFA 1UW8A 1UIKA 4GKYA 2JE9A 1LB2A 2XG3A 3VBFA 1OPOA 1KJLA 1QXJA 3B9CA 5JSOA 4MGZE 1J3RA 4IEVA 2VW1A 4M00A 1AL23 1WA4A 3FZ3A 4Y20A 1CONA 2PAKA 1HRV2 1HX6A 2WFF3 4Y22A 2KA3A 1RHI2 1F31A 4I0WB 3NAPC 1S0BA 1VBE2 2I07B 1K5MC 1REDA 2ZABA 4GMP1 4HLTA 3FX3A 4PDWA 2B7YA 1RITA 4RGAA 1DDLA 1LOFA 2HWD2 2ARBA 5LRSA 3EO6A 1H2MA 1QH6A 2VH9A 4RD7A 1XNDA 4XXAA 3KD4A 1FNYA 4YGCA 1RUD2 2JEMA 4AVBA 4FAGA 4B29A 2Y0IA 4FPKA 4CDXC 1FI2A 1R081 2JKBA 1MQTC 4W65A 4AHXA 5J36A 5F1RA 1A8DA 3ZDSA 2ZGMA 1AX0A 1HRV3 1S0CA 3VDDC 1RHI3 5DUVA 3RQ0A 2D44A 5KHHA 1NCQB 4EV0A 1VBE3 2WS92 1ZNPA 1XYPA 5AC92 4YGDA 2CL2A 4YVWA 2C5DA 1G6NA 2ZGPA 3N35A 4LBQA 5DDJ1 4LHNA 4XYXA 2HWD3 2A3YA 3FBMA 1TEIA 2E6VA 4XFCA 4YGBA 4Z1VA 1ND2B 4RQPC 5K0UC 1RUD3 1FT9A 4KG8A 4IEZA 1MEC2 2UYAA 1VJ2A 2P17A 5FLHA 4QMAA 1RUC1 1NOVA 3CJXA 3SXWA 4LBMA 1CJDA 4CEWA 2ET1A 1BBT1 2WQZC 3EQEA 3GHMA 1SCSA 4IESA 3N7KA 3VZKA 3ZFGC 3CJIC 3AZXA 2Z42A 2WS93 1N3PA 4Q4X2 5JWPA 5AC93 3VBUB 1KD7A 1LKNA 1W6PB 2VOWA 4XFAA 1H4HA 3L2HA 3OBTA 1D4M2 1O3SA 4RL7A 1ULCA 3VBSA 3VN4A 2YXSA 4YW1A 4Y1ZA 1FAYA 3ZFEA 3W59A 1KFXL 3GZUC 1AYN2 1MS0A 2PLV1 1MEC3 4DRRA 4FPGA 4YW5A 4C91A 1MZ6A 1CAVB 2DVFA 2NMOA 3KT7A 2NM1A 3I59A 5CADA 1RGSA 3G6JB 4QM9A 1NCRB 3OCPA 4OHVA 4CP2A 1WLDA 3WOGA 4JGZB 4BH9A 4Q0UA 3GF6A 1U5XA 3WQ7A 2BFUL 3WG4A 1WMDA 3JB4C 2BVBA 3KLSA 2DYCA 3MLJA 1BEV1 1D4M3 2XVGA 1C1LA 3S0MA 1QOSA 2GN7A 4QQLA 5H9SA 1M4WA 4HPKA 1LOGA 1ONAA 2WNVA 1PNFA 1AYN3 5BV6A 3U0ZA 1CQ9A 1HV0A 3VBSC 2YYOA 1COV2 3UJOA 3NVCA 4K3UA 1C57A 4NHMA 4D3WA 1NCQC 5C4WC 3MIDA 1GZWB 3WINE 3WW4A 2FZ2A 1PIV2 2JG8A 3WDVA 3U11A 1PK6B 1REEA 1ZZ8A 2YUEA 5CNAA 1FX5A 2G4IA 4AWDA 4X8NA 1VBC1 2R1DA 1HQWA 3M3CA 1I9RA 4HVQA 4WZFA 1NY71 3TN92 4CTEA 4AI3A 1I5ZA 2ES3A 2QVSB 3FE5A 2VNRA 4AI0A 3D6EA 4QT6A 1H9PA 2XL9A 2RS51 1H0BA 3V0BB 5B2GB 3O5SA 4QPGB 5I0UA 1SQ4A 1COV3 2RM21 1W6OB 3C2UA 2WNVC 1DQ6A 2PHFA 1AR72 1PIV3 5BNOA 3LA2A 4XTPA 4JQRA 4FTEA 4BLIA 4XXPA 1NA1A 4J1WA 2FBEA 1CESA 1WUVA 4NWWA 3GYDA 3TN93 2MNGA 2R041 3OD0A 2X5IA 4AQTA 5L73A 4AYUA 1D0HA 5JAXA 2ZZJA 1IS5A 4Q4V1 3ZIXA 3AP4A 3WG2A 1TNFA 1GSLA 4OI1A 3TNPB 3FWEA 4IERA 4P9YA 3VL8A 2LM3A 5A33B 1PZ7A 1KFUL 2ZX2A 2RE9A 4GQ7A 4JGZC 4YRDA 4S2DA 1IOAA 2XJSA 1AR73 4N53A 2WWSA 1YI7A 3L2YA 2TNFA 1O5LA 4HN1A 4WM7A 2PHLA 1VBD2 3M3QA 4AI1A 1DFQA 2WL1A 3LAGA 1QJX3 1CAUA 4LUKA 4RR3A 3WT3A 1RUH1 3E6CC 2XBO1 4EN0A 4D7YA 2O1QA 3MIFA 1OKQA 4AFCA 2ZGSA 2EAKA 4HMZA 5CG8A 2FMYA 2HEWF 3H9AA 1QH7A 3ZFFC 1H30A 4LNVA 4UW3A 1QJU1 4GB32 1HDKA 2A71A 4IXLA 3DGTA 1PK6C 4XE9A 1W2UA 3AKSA 4FTBA 2XPJA 2W52A 4D94A 3OGJA 4DINB 4MXWA 5BNNB 1CPNA 4XJ8A 1C3HA 1FOD1 5C8CC 4AVTA 1URXA 5H9PA 3VKLA 1X33A 5KC6A 1VBD3 2F4PA 1AVBA 1AYM1 2HKXA 3A4UA 4OUMA 3WDTA 1OD5A 1FV3A 2ZJCA 3VZMA 4E2SA 2XB6C 1RUG1 2R071 1OFSA 1GLHA 2CNAA 2VMIA 2ZOEB 4XMIA 1UU5A 1OHFA 4MX3A 1PHMA 4QPGC 1Z7S2 1N1VA 1S55A 4P9XA 2CGOA 2XWBB 1U5ZA 1RUJ2 3KGLA 4Y1YA 4U2AA 4PIXA 4GB33 3ZN5A 2D7FA 3KQRA 1UIJA 4AEDA 4HVOA 1SLLA 1YXWA 5L7OA 4M0HA 5T3NA 4AQ6A 4CDUB 4MGYE 1LHWA 4IV3A 4KG0A 1DQ1A 1J58A 1LOAA 2HWE1 1ZRCA 4MGKE 1S2KA 4ONUA 4CEYB 1WCSA 2R6QA 1V00A 4WM8B 3UL2A 2YMZA 2ZKNA 1DQ4A 3KCCA 5GLWA 1Z7S3 4CDQB 4JC1A 2E7QA 5IK7A 3JD71 2P34A 2PAEA 4XOGA 1LR5A 1XU1A 1UU4A 4JRAA 2A6XA 1CJPA 2ZACA 2D3PA 2Q4SA 1ZBE2 5ACA1 2GN3A 4A2UA 3CF6E 2RJLA 4DXZA 3HN1A 4CDWB 4BMEA 4Y26A 3WVJA 5D8AA 1HKDA 4EWEA 1J3PA 1S0FA 3DL3A 1IHMA 2A3XA 4XFIA 4M3CA 4JTOA 2OPKA 2G9GA 1NXMA 2R062 3VLBB 4OHXA 4GH4A 5BNNC 2XVKA 5IT6A 1CAWA 1MS8A 3M8LA 2Z2SB 2B5HA 4LA3A 3WG3A 3NL1A 3H3ZA 3R05A 5JZGB 1BVP1 2GC0A 4QM8A 1VP6A 1ZBE3 4I09A 4Y5Z0 1AR62 4XEZA 3WHUA 3VZLA 3CNAA 4PF5A 2R0HA 2QJVA 4YM3A 2XJUA 2A6ZA 2HWF3 2RS31 3BPZA 1APNA 4Q2FA 1QWRA 1UN1A 5KHIA 4Q27A 2VG9A 3LCPA 2RJKA 4G3YC 1GYKA 5KBFA 2B45X 4QPIB 3ILNA 3ZXJA 1NG0A 1Z78A 5IUQA 4NVPA 3K51A 1H8TB 3HMYA 2VW0A 2DV9A 2R063 1S0EA 4DZGA 4E2QA 5CA6A 3USUA 1ZREA 3OPZA 3LB9A 4CDUC 3J4UH 3ZX7A 1XE7A 2NMNA 3LOIA 1QQP1 4CEYC 1AR63 4G4FA 1W0PA 2B8MA 3T1LA 5KXCA 1ULGA 1UD1A 1ZZBA 3AM2A 3J8F2 5EYXA 3WDWA 1O3QA 4CDQC 4PLMA 3ZPYA 5KHKA 4LULA 1RUOA 4OULA 1HQNA 2AENA 2NZ9A 2I2SA 4OHWA 2I74A 4YM0A 2W39A 1KJRA 1UCXA 3BOPA 1RUF2 5FLIA 5DUXA 4LO7A 4N90A 1NQJA 1DQ0A 4PBPA 2Q8OA 4K6BA 3B7MA 4CDWC 1QY4A 2VOXA 3RWNA 4LEJA 4C1WA 1JH5A 1GR3A 2XL7A 3ZXFA 1AL21 2AGSA 2CYFA 1WLTA 4XF4A 3WD5A 4LBOA 4I0BA 4AVSA 3J8F3 4KL1A 5GZCA 5J48A 2BTVC 2DFBA 4LBLA 1TE1B 2E51A 2ZA9A 5GLUA 3WCSA 2IXIA 4P9LA 3DV8A 2EXJA 3HQXA 4M3CF 1TMF2 4DB5A 1VBB2 4AHZA 4AXOA 3VBOB 1ENSA 4KH9A 5GZDA 4EN9B 2TEPA 5T52A 4M0NA 1RUF3 1W0OA 1X8MA 1VAKA 5T5LA 4WVMA 3ZXKA 3UK9A 5C9AA 4AHYA 3FLRA 3C3VA 4YG3A 4MSVA 4AQSA 2IXHA 1HRV1 3BIWE 1RHI1 4AI2A 1H8TC 2D3RA 3ZVXA 1VBE1 3BU7A 2EXHA 2EVXA 4ITCA 3HR9A 4LA2A 1TMF3 1KDMA 1VBB3 1H1IA 2HWD1 1TNRA 1IS6A 4Q0PA 3KM5A 3B94A 1G9CA 2XJVA 4DRVA 3CL1A 1PVXA 3AZVA 5AVAA 4I2OA 1SEFA 4QGLA 2VQ0A 1QNYA 3ZSJA 2Z69A 1Q5OA 1X8EA 4YM1A 1S2BA 3NAPB 5D1IA 1JUHA 4MGIE 1W6MA 3AP6A 1Y3TA 3ENRA 4AW7A 2DCYA 1OSGA 4JDMA 1C5IA 5JOWA 1ASJ3 3IWZA 1SLIA 3HT2A 3M2MA 4DNYA 2WA3A 1OOPA 1ULFA 5AC91 3PJYA 5T5PA 3CU7A 1RUI2 4S2GA 4YGEA 5T55A 4CDXB 3E5XA 4AGRA 4C1XA 1JYIA 3B5LB 3PLQA 1MACA 4FCAA 5IK5A 1MEC1 3QACA 3BALA 3E5UA 4IV1A 4RS5A 1BQPA 3VDDB 2OUHA 4NHKA 4FVVA 4LTAA 3E97A 3D0JA 3HT1A 2ET7A 2CGNA 4Q4Y2 4Y22B 3H1MA 1Q8PA 3ZMOA 3KSCA 5EYYA 1IGOA 2Q0AA 1LHVA 5FRAA 4RQPB 1WBLA 2DUQA 3VZJA 1DU3D 2W68A 4Q4X1 4D69A 5K0UB 3RPQA 1RUI3 3OY8A 1PGL2 3VZNA 3VBRA 4Q8KA 3AMPA 2GDFA 5CBLA 1HRI2 1D4M1 1AZDA 2GZWA 3SCGA 4B7EA 1RB8G 2DCZA 1YUDA 2D97A 2QDRA 1AR82 1AYN1 1MR5A 2YPJA 3ILFA 3CJIB 2CGPA 4H3WA 1R1ZA 2LUWA 1QNWA 1DQ2A 5JR7B 4FPYA 4WV8A 4I01A 2D43A 5FO9B 2AYHA 1WLCA 4IV1C 4Q4Y3 4RS5C 1BMV2 2GAUA 5CU1A 1BKZA 2C0ZA 1BVVA 1G8WA 4JDOA 4M01A 5HI0A 2TUNA 2ZHKA 2EAAA 5CVRA 4YVWB 5A32B 3IPVA 3ECQA 3CO2A 1SBEA 2ZX0A 1LU1A 2JG9A 4N9IA 1RL3A 2OZJA 3WP6A 3H8UA 4BCUA 1HRI3 3QOPA 2E53A 4RHV2 4KGGA 4Z82A 3M1HA 1AR83 4LT5A 4URTA 4DY3A 4IEXA 1ZRDA 2VOKA 4NO4A 3VHRA 4CEWB 1COV1 1ALYA 4L97A 1PIV1 4P5HA 4FPEA 1IPJA 5LK5A