2WFF3

Equine rhinitis a virus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
226
structure length
226
Chain Sequence
APIRVVSVPESDSFMSSVPDNSTPLYPKVVVPPRQVPGRFTNFIDVAKQTYSFCSISGKPYFEVTNTSGDEPLFQMDVSLSAAELHGTYVASLSSFFAQYRGSLNFNFIFTGAAATKAKFLVAFVPPHSAAPKTRDEAMACIHAVWDVGLNSAFSFNVPYSSPADFMAVYSAEATVVNVSGWLQVYALTALTSTDIAVNSKGRVLVAVSAGPDFSLRHPVDLPDKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords P1
publication title Equine Rhinitis a Virus and its Low Ph Empty Particle: Clues Towards an Aphthovirus Entry Mechanism?
pubmed doi rcsb
total genus 23
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2009-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wff300
4N53B 1ASJ2 2WZR3 3VBUB 1VAKA 3CJIC 1AYM1 1PGL2 1VBC3 1D4M2 2HWE1 2RS33 3VBUA 2RS11 1SMVA 1C8NA 1B35B 3TN91 1AR61 5ACA2 1PO13 1BMV2 1FPN1 1ND3C 1GFF2 4WM8B 4CDQB 1ASJ3 2BFUL 1PGW2 1RUD2 5A33B 4RR3C 4WM7A 1FMD1 3VBSB 5CFDB 1AUYA 1D4M3 1HRI2 4WM8A 4CDQA 4IV3A 1R091 5A33A 1ZBE2 4RHV2 1VBE1 3NAPC 4Q4X2 5ACA3 5C9AC 3VBSA 5CFDA 4N43A 2IZWA 3ZXAC 4RR3B 4FTEA 4GH4C 1RUD3 1BEV1 1VRH2 1C8M1 1NY71 1EV11 1FOD2 2HWC2 1HRI3 1ZBA1 3M8LA 3NAPB 5DDJ1 5C9AB 1Z7S3 4RHV3 4Q4X3 1BBT1 5C4WC 4Q4V2 1VBD2 3DPRC 1VBB1 4AEDC 1POV1 1VRH3 1CD3G 1RMU2 4NWWA 1FOD3 2HWC3 1MEC2 1HXS1 2XBO1 2WS91 1HRV2 1COV1 5C4WB 3DPRB 1AYN2 5CFCB 4Q4V3 1VBD3 2MEV1 1PO21 1RUH3 4YVSB 1RUJ1 4GB31 2VQ0A 1RUI2 1MEC3 1MQTA 5BNNC 5CFCA 1AL0G 5AC92 4CDWA 2R071 5ABJA 4YVSA 2ZTNA 2PLV2 4Q4W2 2RS51 1VB2A 1AYN3 1R081 4Y5Z0 1RUE2 1QJX1 2RR11 3JBG2 3JD72 1F8VA 2HWF1 2RMU2 1PO11 1QJU2 4QPIB 1NG0A 1CJDA 1RUI3 1QJZA 3S6PA 4IV1B 3ZFEA 3VBOA 1VBA2 3VBFB 4PDWB 3VBUC 1EAH1 4QPIA 2PLV3 4Q4W3 5D8AA 4FTBA 4RQPB 5BNPA 4IV1A 1RUE3 3JB4C 2BPA2 3JBG3 3VBFA 1TME2 4PDWA 1AR92 1QJY2 1RUG1 3JD73 2RMU3 5ACA1 1QJU3 3VBRB 4RQPA 4CEWA 1A6CA 4WM7C 1VBA3 4WM8C 4CDQC 1PIV2 4IV3C 2RM22 1POV0 3VBRA 1RUC1 1AR71 3VBSC 5CFDC 2GH8A 1QQP1 1V9U2 4N43C 1X33A 1TME3 2WFF2 1AL22 1QJY3 1Z7S1 4WM7B 1X36A 1AR81 2HWD2 4IV3B 3VBHA 3J8F2 1RVF1 2HWB2 2RM23 5BNOA 2XPJA 2X5IB 4N43B 4JGZB 5K0UB 2GSYA 1R1A2 1OOPB 1TMF1 2WFF3 2R061 1H8TB 2X5IA 4JGZA 5C8CA 5K0UA 2HWD3 5L7OB 1NCRA 3J8F3 2TBVA 1RUH1 1OOPA 1AYM2 2HWB3 3ZFGA 1H8TA 5FOJB 1RHI1 2HWE2 5L7OA 2RS12 4FSJA 4Q4Y1 5JZGA 1ND2B 1ZBE3 3HAGA 1PVC1 3TN92 1AR62 2BFUS 1FPN2 1NCQB 1W39A 1MQTC 3LOBA 5CFCC 3IDEA 4EJRA 1ND2A 2R041 4CDWC 1AYM3 5ABJC 4CDXB 4YVSC 4GMP1 1FMD2 1RUF1 1NCQA 2RS13 1R092 4CEYA 2WWSA 4FTSA 3TN93 1AR63 1VBE2 4CDXA 1MQTB 1FPN3 2WLPA 1RUE1 3ZFFA 5FMOL 4CDWB 5ABJB 1K5MA 1BEV2 3ZFEC 3VBOC 1OHFA 1C8M2 1RMU3 4QPGB 1NY72 1EV12 1FMD3 2WZR1 4QPIC 5D8AC 4RFT0 1R093 1ZBA2 1HRV3 5BNPC 4IV1C 5DDJ2 3VBFC 4PDWC 1VBE3 4QPGA 1VBC1 2RS31 1BBT2 3ZFEB 3VBOB 4RQPC 4CEWC 1VBB2 2FZ2A 1BEV3 2QQPA 2Y26A 5J96B 5D8AB 1C8M3 4YVWB 4NWVA 1EV13 1ASJ1 4RS5A 5BNPB 1HXS2 3VBRC 2XBO2 5AC93 2WS92 1ZBA3 1F2NA 1COV2 5DDJ3 1PGL1 4SBVA 4YVWA 4CEWB 1D4M1 1BBT3 1HQNA 2MEV2 1VBB3 1PO22 3VBHC 1POV3 3FBMA 1RUJ2 4GB32 1BMV1 1PGW1 2DF7A 5BNOC 2XBO3 1RUD1 2WS93 2R072 4Y4YA 1COV3 1E57A 4CDUB 1NOVA 1HRI1 2RS52 3VBHB 3VDDB 1R082 1NA1B 2X5IC 2MEV3 1QJX2 1PO23 2RR12 4GMP0 4JGZC 1AR93 5C8CC 1NCRC 5K0UC 1ZBE1 4RHV1 2HWF2 4Q4X1 4GB33 5BNOB 1OOPC 1PO12 4CDUA 3VDDA 3ZFGC 1NA1A 1VB4A 1H8TC 1PIV3 4JGYB 5L7OC 2R073 1VRH1 1EAH2 3JB8A 5JZGC 1FOD1 2HWC1 4N53A 5C8CB 2RS53 1R083 1NCRB 1V9U3 1QJX3 5GKAC 2RR13 4JGYA 1AL23 1RUG2 2HWF3 3ZFGB 1ND2C 4Z92B 4Q4V1 1VBD1 3CJIB 5JZGB 1B35A 1NCQC 1EAH3 4CEYC 1RMU1 1MEC1 2ZAHA 1RUC2 4CDXC 3CJIA 1AR72 1HRV1 1QQP2 1R1A3 3ZFFC 1ND3B 1RUG3 1Z7S2 1HX6A 1K5MC 1AYN1 4LLFA 1AR82 4CEYB 1DDLA 1RVF2 1ND3A 1IHMA 1RUI1 1RUC3 2HWE3 3ZFFB 4QPGC 1AR73 5AC91 4RR3A 1K5MB 1QQP3 1RB8G 1TMF2 2R062 2PLV1 2BUKA 4Q4W1 5A32B 1AR83 4GH4B 3JBG1 4RS5C 3JD71 3NAPA 1RUH2 1RVF3 2ZZQA 2RMU1 5C9AA 1WCDJ 1QJU1 5A32A 4GH4A 1RHI2 1VBA1 4YVWC 1M06G 4Q4Y2 1TMF3 2R063 1PVC2 4RS5B 4AEDB 5LK7B 1TME1 1AR91 1QJY1 2R042 5C4WA 2FZ1A 3DPRA 4AEDA 1RHI3 1OPOA 1RUF2 1PIV1 4Q4Y3 1PVC3 2RM21 5FMOS 4CDUC 1V9U1 4BCUA 3VDDC 2WFF1 1NA1C 1AL21 2BBVA 2R043 5BNNB 4GMP3 2HWD1 2WZR2 3J8F1 1HXS3 1RUF3 4N53C 5J98B 2HWB1 4JGYC 5BNNA 1VBC2 2RS32 1R1A1 1RUJ3 1B35C
chains in the Genus database with same CATH superfamily
3FZ3A 2QQLA 1PX3A 3LDBA 1W8NA 1D7PM 3KZ4C 4FT8A 1ULOA 1NAEA 3RDIA 4I0AA 3USUA 4QU2A 4KL1A 1V6KA 2B4KA 2BZDA 4DIQA 5JSOA 5C33A 4JHZA 2WNVB 1A8DA 2HWE1 2RS33 1REEA 2YBSA 1SG3A 4GKXA 2DCYA 1FT9A 4XAAA 1VMFA 4Y22A 5FJHA 3VBUA 4B3NA 4E4HA 1C8NA 3NV1A 2XGXA 1B09A 3TN91 1BVVA 2AACA 2X29A 3NKGA 4O65A 1BMV2 1E5RA 2GDFA 4CDQB 4Z1VA 1A78A 5BYNA 1SHWB 2R0HA 4BQ5A 1RUD2 3CLPA 2LM3A 4Y20A 5HPOA 2XXZA 3NV3A 5C3RA 2ORXA 3ATGA 5L73A 3KF5A 1D4M3 1IPJA 1HRI2 5L19A 1LJ7A 1SCSA 1GSLA 1D4VB 2A6XA 5F2WA 2DUPA 3FHIB 3WCRA 4ATFA 4IE7A 4BIOA 3VGIA 1ZBE2 2PAMA 1VBE1 2GC3A 4Q4X2 4H7LA 3NMBA 3VBSA 1S0EA 3GXUA 3J7HA 5GLZA 4COZA 1V70A 4FXGB 5T5LA 5CAZA 5FPXA 3T0DA 1HLCA 2WC2A 3O0XA 1PZ9A 4AAPA 2OT7A 1RIRA 3FLPA 4S2HA 4ZY9A 3T3YA 2PHTA 3B9CA 1RTVA 1G9AA 4JDNA 4OQ8A 2E53A 3RZLA 2UY9A 4CCCA 1RITA 1UOGA 3VZLA 5DDJ1 4XCBA 2MHFA 4XPVA 3E6BA 1Z7S3 4BZ4A 2TNFA 3Q8AA 4EN0A 2VOXA 2OX0A 1N3OA 2BTVC 3HBKA 1UW8A 4AGGA 4CU7A 3RYRA 4AEDC 4CE8A 1POV1 2RDQA 1CONA 2Y6JA 1VRH3 1CD3G 3IMMA 3PVEA 3QH6A 4XFCA 3PJYA 3DF0A 2E51A 1JU3A 4AQSA 1MEC2 2JDUA 2VZTA 5FP9A 1HXS1 1HV1A 3BTXA 3FHQA 1AXKA 1S0FA 5CKQA 1CAWB 1COV1 1W6NB 3HEIA 4EYUA 2XVKA 5IK7A 4KWLA 1RJ8A 1LOFC 3D6EA 3LGRA 3OTFA 3OUIA 3WG4A 5J7MA 1OFSA 3DPRB 3O1SA 2CL2A 3AZWA 3KCCA 1H1MA 1JZ6A 4UF0B 4GWNA 5CFCB 4XBNA 4BH9A 3HR9A 4X8NA 2R7EB 4PHZA 4PIZA 1ZRRA 3SITA 1DYPA 2Z4FA 3RMXA 1RUI2 4C91A 4J25A 5KR7A 4LORA 2FBEA 3OUJA 5BNNC 5T50A 2K0GA 5AC92 1O3QA 4DY3A 1ODNA 1ZNPA 4AVBA 2FDJA 1Q8QA 1QGLA 2E26A 2RV9A 3LB9A 2C9AA 4OVEA 4Q4W2 4COYA 1VAMA 5FYUA 1ULGA 3LIHA 3N7MA 1AYN3 1VB2A 1R081 2JE7A 1UMZA 2D43A 4P5HA 4UWDA 3ACHA 3MLKA 4XDQA 4Y5Z0 3U1XA 1YJKA 4B7EA 3FLTA 1EPWA 3O1UA 2JJ6A 3WR0A 1W06A 3SCHA 4CCKA 4E8CA 1OQDA 1QJZA 4CUAA 1IZ3A 4Y4RA 1WD3A 2VO5A 4IV1B 2QQIA 1OKQA 3E5UA 3VBOA 3ZFEA 5JSRA 1JYNA 2WSUA 2W68A 1UY4A 3FLRA 1XC6A 2UYBA 2GAUA 4D6RA 3V0BB 3PJQA 4QHZA 1G9BA 3Q8BA 1UXXX 5BNPA 1RUE3 2WNVC 2YY1A 4YNIA 2BPA2 1TME2 1AR92 1I5PA 4WZCA 1BXHA 1SLIA 2RMU3 5FV3A 2PA7A 2Q0AA 1DZRA 1QJU3 3HNYM 1LEDA 1ST8A 5FYTA 3VBRB 5A6YA 4RQPA 2GC2A 3CNAA 4WM7C 4CCOA 2HLEA 5C3SA 4XJ9A 1NQDA 2K2SA 2TEPA 5ANNA 2P17A 5T5PA 3WDYA 4CDQC 2D3SA 4IV3C 4WVMA 2R30A 4PLNA 4QDQA 3KWVA 4HANA 1OPMA 4WV8A 1GZWB 3WDTA 3WNXA 2B8MA 4YM1A 5DAQA 3POFA 2ZKLA 1Q3EA 2W1WA 4LHLA 4TZDA 1YQCA 4QX3A 4YW1A 1C5IA 1N1TA 5IWFA 3MI8A 3VKFC 1QQP1 3GNEA 4DRVA 2WABA 3WW1A 4X8PA 2VBDA 3RQ0A 1Z7S1 3VV1A 1WLDA 4MZUA 1ZM1A 1YYNA 4ARYA 1X36A 4LO8A 2E7TA 5FY8A 3VBHA 4XMAA 3PTYA 4Y5TA 5A70A 1NUKA 5FXZA 3AP5A 3IMNA 2PTMA 3WNLA 4P9WA 1JYCA 2RM23 3RRDA 2IFRA 5FK7A 1TNRA 4JGZB 4AFBA 5K0UB 3CU7A 2SBAA 2YC4A 1QMJA 1DIWA 1HQLA 3VHNA 3AK0A 5BXXA 4YGDA 2R061 3I2GA 3VZNA 3BGAA 2UU8A 4UXAA 4CCDA 3ZYGA 3TEYA 3WDVA 3EQEA 3V64A 4CCLA 2JB4A 2W3JA 2JKXA 3SQOA 5HXMA 5L7OB 3CDZB 3T4VA 2YBKA 5E88A 5ANQA 1NXMA 1XE8A 1OOPA 2E32A 4V2VA 5FPZA 4BE3A 2EAKA 2YHJA 3VDAA 2FDGA 3H1WA 4CPBD 3I2DA 1OH4A 1H8TA 1CN1A 1GU3A 1Q43A 3UJOA 1RHI1 2HWE2 1W6MA 2VH9A 2Y33A 5LA1A 2YGLA 5JOZA 1H9PA 4LMFA 5L9BA 5C3OA 5FLIA 4CU9A 2O1QA 5D1IA 2VCBA 1CGPA 4YYOA 3HAGA 4IEZA 3TN92 3O1MA 1OSGA 4D3WA 2X8KA 1XOYA 3MPBA 3N35A 4QXBA 1XJAA 4RA0A 3U37A 4A44A 5IVFA 4OI1A 3WF2A 1HB1A 5CFCC 4EJRA 4F3JA 2OVUA 3FHAA 3ZMOA 5A6XA 3U75A 1AYM3 3D0JA 2XJTA 1IS6A 5I0UA 2WIIB 5L9RA 4OCTA 3ECQA 1GQHA 1RUF1 2ZZJA 3ILFA 4LKSA 4XYXA 4XZUG 5L36A 4P9JA 4QQOA 2ZX0A 2JB8A 3FMGA 2WWSA 3FUQA 1V6MA 4P9LA 3H8XA 1LULA 4E4SA 4FTSA 3LE0A 4IEVA 4ZZ5A 3HN1A 1VBE2 1Z0HA 2PHLA 4A6OA 1D2SA 1FPN3 1MS5A 1RUE1 3ZN4A 4PBOA 2JDAA 1DYKA 2Y6LA 4O7XA 4ZU4A 3EBRA 1RMU3 4QPGB 3AL6A 4NHKA 2DVDA 2WZR1 1RGSA 4LOTA 5D8AC 1X82A 2AH2A 2YU2A 3BPZA 3KCYA 4YW4A 2H6CA 3OF1A 4C1XA 4IV1C 3S30A 5DDJ2 2IC1A 3RZMA 4OHYA 4XBQA 5FPBA 1WGPA 1UYZA 2I07B 2G19A 4CEWC 3ENRA 2EXJA 5FYBA 2FZ2A 5J96B 2Q1ZB 3N9NA 1SPPA 3CBNA 4QX1A 2Z2SB 3E97A 1C8M3 3LA3A 1SDWA 1ULFA 4UFHA 4NWVA 4XF9A 5F2SA 5CKNA 4RS5A 5GZEA 2PYTA 1OUSA 1RUNA 1HXS2 2VR4A 4LEJA 3VBRC 3EO6A 4XJUA 1ZBA3 5BPXA 4ET7A 1HW5A 3WF3A 1A8MA 1COV2 3ZXGA 1OXCA 2A7AA 3WXPA 1FV3A 4OFGA 1S1AA 4PLMA 3NO8A 4GA9A 3M1HA 3NV2A 3NNLA 1J1LA 1W90A 5JAXA 2JWPA 1LESA 4FCAA 1VBB3 2DCKA 4HETA 4G3YC 3GZEA 3DYMA 3ZIWA 3O0WA 5DMYA 1OKOA 3RJ2X 2BQPA 5A7NA 1EYBA 2QFEA 3D0SA 3N7JA 3RWKX 4XF1A 4BQ2A 4XUNA 2BEOA 2W2IA 4HN1A 4BXSV 3B69A 2VUAA 5FQ0B 5IATA 4Y4YA 4K6BA 4FPJA 3W5NA 3ZSEA 1E57A 3WNOA 2F6BA 3Q8CA 4KBBA 4CDUB 1NOVA 2GMEA 3MF9A 1SFYA 4QM9A 5LWBA 2LRPA 1R082 2Y60A 1YLLA 3AYCA 1GLHA 5FBZA 5I0TA 2XJVA 4GMP0 4JGZC 1GOGA 4XDPA 5K0UC 4MGTA 3JXSA 2A70A 2AZ5A 1CX1A 2Q4SA 4GB33 4LK7A 1DLCA 4MG2A 4LO4B 4BYYA 3VDDA 1FNYA 3UETA 4RYDA 2AYHA 5A80A 3S0MA 5L7OC 3PIJA 3BVCA 3JCIA 3JZVA 3CIHA 4AVVA 1CWPA 1FOD1 2HWC1 4M3CA 4IDZA 3T1MA 4N53A 5HI0A 5KC5A 4FOWA 2HYXA 2JDYA 2W52A 3HQUA 5DXDA 3KHCA 3OJBA 5EYXA 4NHMA 5GKAC 3RZZA 4A7YA 2RR13 1QY4A 4DUWA 4ITCA 3GZAA 4JTNA 4M4RA 4NOTA 4ARXA 1LKNA 2P3YA 1QKQA 4R52A 3N7KA 2ADDA 1YQ6A 4Q4V1 1VBD1 3A21A 4A2UA 4DUVA 3SMHA 4LBOA 3VZKA 1H2MA 4QQLA 2B42B 3WD5A 1RMU1 3VDBA 4XCAA 5C7GA 1QEXA 3T2QA 1QDCA 2ZAHA 1YFWA 1DGWA 1CIWA 1QDOA 3MO4A 3I49A 2R1DA 1QQP2 3ZFFC 1XQNA 2VMIA 2W39A 3AKQA 4JTOA 1RUG3 1NZIA 1Z7S2 1HX6A 1K5MC 5GLTA 4L97A 2KR2A 3ZXKA 5IYYA 4LLFA 3R4UA 2PHFA 3NV4A 2VBPA 3TB0A 4YM3A 3ZXLA 3RWNA 3TEWA 3PU8A 3U78A 1UY2A 1J3PA 3M4FA 4KWKA 4CZSA 3GBWA 1H6XA 1JZ4A 5DQ0A 3H8RA 1ND3A 1E5SA 2D97A 3FX3A 4AYUA 2XJUA 4N9IA 2R6QA 1ZZ9A 3D4KA 3B02A 1LHWA 3OGRA 4L8QA 4QPGC 2Y0OA 1ENQA 3AMNA 4RR3A 4DINB 4XUPA 3UGHA 5F5CA 5C5TA 4S2DA 1OT5A 2CGOA 2R062 3POEA 1BQPA 4KG0A 5FCCA 5LA9A 2W1UA 2D3PA 2ZMKA 5EHDA 1N3PA 5A32B 5K9YA 5FXWA 4Y33A 2YG0A 3JBG1 4XQDA 1EY2A 2OIIA 3JD71 1RVF3 2QVSB 1WCQA 1X8MA 2YGMA 3L9JT 3WVJA 1WCDJ 5C9AA 3GM8A 2O14A 1ZX5A 1XBFA 4GH4A 4P9YA 1RHI2 4Y1ZA 1VBA1 3HJRA 2V09A 4O9GA 3NNMA 1M06G 4RSUA 4JQTA 1NZCA 2CSGA 5K4LA 1CPNA 1TMF3 4PLOA 2O0OA 1OFNA 1UNBA 4XIOA 5D21A 3U14A 3RFRA 1GZCA 2WWUA 2C26A 4BQWA 4YSFA 2CDOA 4PI0A 1S2KA 1QJY1 3I3BA 4C90A 1W6QA 3MEPA 3VKMA 2WO1A 1W2AX 2XMLA 1LENA 4LITA 1BVP1 3N9QA 4YARA 3AZXA 3VKOA 1OURA 5FBJA 1FNZA 1ZRIA 2VW2A 3GGLA 1OPOA 1RUF2 1CX4A 4MO3M 3TBDA 4Q4Y3 3WNKA 3DUIA 4OLLA 3GYDA 2OQ7A 4FPFA 1NLSA 4K9SA 4NE9A 3NJYA 1GWLA 3O1OA 3CO2A 1HQWA 1OQ1A 4ZPIA 4V1PA 3WNPA 1FX5A 4CDUC 4IUGA 4BCUA 1JUHA 1GQPA 2YPJA 1OD3A 4LO6B 5FP4A 4XIKA 2ARXA 4LKFA 2D6MA 5LASA 2ZHKA 3PIGA 3ILRA 4K1ZA 3NL1A 2HWD1 2WZR2 3J8F1 2P3KA 2DTWA 4LBMA 1W9FA 4FQZA 4IEOA 3UNPA 5JMCA 4XF3A 5F9TA 2HWB1 5F7UA 5A3MA 3OUHA 1ZRDA 4MXWA 4NIAA 2ZEZA 2WQZC 3U0ZA 4BQXA 3I2JA 5GALA 4HONA 1Q56A 1D2QA 2V5DA 3ZN5A 4CP9B 3USUB 3VUOA 2DUOA 2R16A 2VMFA 2ZGUA 2ZPXA 1O8PA 3NQHA 4PQ9A 5FXVA 1RUJ3 3ZPYA 1B35C 4R9BA 3BCWA 4AZZA 3O1PA 3RYKA 3WW3A 3LSDA 3VBUB 1DU3D 4EWDA 1PZ8A 1XYPA 2CWMA 3B5LB 3O7OA 4TLFA 3VD9A 2FMYA 2NPIA 2EIEA 3DCQA 1UOJA 2GNMA 1ULPA 1H30A 3VDCA 3WG2A 1QOTA 4YFZA 3ITQA 1LHOA 1DCSA 1VBC3 3EHKA 3LZZA 3T2TA 4LJHA 4GJYA 2D6KA 5T54A 1UMHA 2FDHA 3GJAA 2DURA 3IDBB 3MV01 3N9PA 3OGJA 3WNNA 4FPOB 1AR61 5FZ9A 1CAXA 1LOGA 1MS9A 3NJXA 5F32A 5ACA2 1GFF2 2V4AA 4JDOA 4JCKA 2FDKA 2ZXQA 5FPLA 1ASJ3 3AKSA 3HBZA 4BXFA 3AKRA 4LUKA 4CCNA 1F5JA 3IAPA 5FZEA 4FOVA 1H4HA 2D6OX 5FYCA 1W2UA 2WWJA 2XJRA 2PAEA 3VBSB 3KD4A 2AUYA 2BU9A 3MIDA 2P3JA 1VMHA 2WO7A 4QGMA 2KA3A 4AXOA 5FYVA 3NAPC 1LR5A 1KDMA 5J09A 4KU7A 5JI7A 5CFDA 4QAWA 1W6OB 2QNKA 4N43A 4NVPA 5GLVA 5A1AA 1DQ6A 1NXD1 2WSVA 4NAOA 5LCWL 4NR1A 1CR7A 5TSWA 3KQRA 2CHHA 3K2OA 4D7YA 3POBA 3ORJA 4A45A 3M3OA 3WP3A 3WF4A 3BIEA 2FQPA 5FZMA 1FOD2 1GWMA 2HWC2 5FY0A 3UT0A 3SC7X 2A3WA 2Q8OA 1BK0A 3ASIA 3AVSA 4TLGA 3S57A 4Q0SA 3I8TA 3M8LA 3PUAA 5LW9A 1PMHX 3RZHA 3T4HB 1QNYA 1CQ9A 4RHV3 2A6WA 3K3NA 5FK8A 1I3HA 4Q2FA 1KD7A 3MW4A 1LU1A 4LBLA 3WQBA 4DS0A 5CVRA 3BU7A 3M2MA 2EAAA 4D94A 5A7WA 4Q4V2 1VBD2 5C4WC 4D6SA 2QTWB 2YROA 1W9SA 2ZMNA 2F4PA 4URAA 2BGCA 2VOTA 3BTZA 1RMU2 5FPAA 1WA6X 1DGWX 4NWWA 4AK3A 3C3VA 5FMBA 3URFA 2XBO1 1TQ5A 2WS91 2DVBA 3ELNA 4KGQA 1WCKA 4ISQA 3H3ZA 4LBNA 4W8JA 2W5FA 3K4ZA 1XXNA 5FZBA 1LODA 1S2BA 4L9BA 3TNPB 5I8YA 1RINA 3I2HA 1XU2A 3HOBA 4YW5A 4PCRA 3O5SA 3DL3A 1UZYA 2MEV1 1PO21 5CG9A 1C57A 4P9XA 5FLJA 4ZU7A 2W1QA 4NN0A 1RUJ1 1US3A 3ZSJA 3LOIA 1W0NA 2IXJA 2K9ZA 5IW0A 2W47A 5F5IA 1MQTA 5CISA 4IE6A 4LHKA 2XG3A 1AL0G 1HKDA 4CDWA 2WQ4A 1XNKA 2R071 5ABJA 2X05A 4YVSA 3C7FA 2VCCA 1JN2P 3GJBA 3DXUA 4KWUA 4CU8A 3A23A 2WNUA 4G4FA 5F3CA 4B1MA 1LHUA 2RS51 4AHWA 4LBKA 4ASMB 1SBDA 4LNVA 4DEVA 5LY1A 1QJX1 3HQXA 3JBG2 3VKLA 1YUDA 3JD72 1F8VA 1EP0A 2ET1A 2QQWA 2QJVA 2VTXA 5FYHA 3LIGA 3VD5A 5JUVA 4HXCA 2UWCA 3T0BA 3SLIA 3S6PA 3OYWA 4EN7B 1W6PA 4OHXA 1VBA2 1TEIA 4FFHA 2PELA 5FOBB 3VBUC 3I3QA 1EAH1 3J4UH 2VW0A 3ROUA 3N3HA 2CNAA 4L2NA 4BHPA 4QPIA 2PLV3 4YM0A 4FTBA 3SISA 2BVBA 2BW8A 1ZZ6A 3NVCA 3P3NA 4RQPB 2VZPA 1DQ5A 3UKVA 3LF7A 4WVZA 1J3RA 2FHRA 1CAVA 1LTEA 3JB4C 1V6IA 3USSA 3VBFA 5JMOA 4ZHNA 1Q8OA 4E27A 1QJY2 4MLOA 2Z79A 4IERA 4AI9A 3THCA 5HCBA 4BJ0A 2B9UA 5LRSA 1A6CA 2A73B 1S0DA 2J1AA 2ZHMA 4OQ9A 4AWDA 4BOWA 2VXJA 1C4RA 1G9DA 3TNQA 3OD0A 3GHMA 5DG1A 3ALQA 3PLQA 1AXZA 1BLZA 1X9PA 2A5ZA 5F5AA 5FYYA 1POV0 4HK9A 1RUC1 3S7EA 3MV11 3HIFA 1UY1A 2JIGA 3VBSC 3O1TA 3I3EA 2Y6FA 1X33A 5IK5A 3BUCA 1PK6A 4WM7B 1XE0A 3POWA 5T5JA 1RUOA 3U11A 1K3IA 4HL0A 3AFGA 5FZHA 2HWD2 3B01A 4IV3B 2ZGSA 3J8F2 4W6WA 3C7OA 4EQVA 3AMMA 4QQHA 2NLRA 1LEMA 3PUIA 2ENRA 4XXAA 2P4EA 2WDBA 2HWB2 2QQJA 2EICA 3AZVA 5LBFA 5BNOA 3I2KA 2ZGLA 4L99A 3M3CA 2GSYA 1KFXL 1LU2A 3U07A 1OOPB 2WFF3 5FFOC 1NT0A 4RL7A 4TXWA 4FO9A 4FPHA 4F7ZA 1H8TB 1AZDA 2VMDA 2X5IA 4I3GA 4KH9A 1W6MB 4X6RB 5E16A 5C8CA 1EPZA 1NCRA 3HWJA 3IDCB 2OPWA 1BHGA 4NPMA 3WV6A 5IK8A 1YFUA 1ZZ8A 3ZFGA 1HB4A 1DF0A 4BA6A 2QBXA 5IVCA 2Y38A 1UZZA 5I91A 3MIFA 1H4GA 3PL0A 5CG8A 4IEQA 4XQ4A 4FSJA 4MGZE 4FP2A 5H9PA 2VXRA 3H1YA 3IM0A 5JZGA 4I01A 4ONUA 4XF4A 5DAVA 1PVC1 5FZ7A 4C0HA 5JXIA 1AR62 4DO0A 2D6PA 3AMQA 3LDRA 5FWEA 5K7PA 5JXGA 5LBEA 2VW1A 3Q9OA 3AYAA 4Q8KA 1W39A 2HEVF 1PM4A 4Y24A 5BV6A 4KMQA 4Q26A 2VE1A 3FFQA 1ND2A 2PAKA 4N7UA 4D0QA 4D8MA 4DXSA 1HIXA 2D5FA 4S2GA 4V2WA 2JDNA 2VMEA 4YW7A 2ZBJA 1DBNA 4ZKTB 1XSRA 2EIGA 5SV5A 2ZACA 2FDFA 4LT5A 1NCQA 2AGSA 4MHUA 4XQWA 2RS13 5JVVA 1YFXA 4CEYA 3QACA 5IVBA 2DUQA 4B7KA 4NPRA 1WD4A 3T09A 1SLCA 2O8QA 2YMZA 4K8FA 4A3XA 5IUQA 3KVBA 1OVSA 1JOJA 1XNTA 3ZFEC 3VBOC 1XNCA 1XYOA 1OHFA 4HVRA 2MPFA 3KHBA 4JAAA 1FMD3 2H6BA 2P37A 4B1LA 3MPPG 2JDKA 1YEWA 4JQRA 1UOBA 1YQ8A 1R093 3H3UA 5A3OA 1HRV3 4M3CF 1W0PA 5BNPC 1VAVA 4XBLA 2VTFA 1UQXA 2BWCA 1SPPB 2IUWA 4PT6A 1CAUB 1JZ5A 1VJ2A 2RS31 1X7NA 3LPGA 1LHVA 4LQRA 1I1EA 1ZVFA 2JDPA 3TEXA 4RQPC 2C4XA 2VQAA 5LRRA 1APNA 3ZSLA 1T2XA 2RJ2A 1BEV3 4LR4A 2Y64A 3IAQA 2KXLA 2WLQA 1G9FA 5D8AB 3ZYHA 2ZGOA 1EV13 4XFBA 1O8SA 1WWYA 4QM8A 4J1XA 2XBO2 3IB3A 2WS92 4FFFA 4B4QA 4DNYA 3KCXA 4RGGA 1OLMA 4CEWB 1D4M1 1W9WA 5A3NA 1BBT3 5B2GB 4Z07A 2EIDA 5EP9A 3VZJA 4YG0A 1D0HA 5FZDA 2MEV2 3CZJA 1PO22 3S7IA 3RG0A 3VBHC 1DZQA 4O61A 4OUMA 5CEHA 1MZFA 2CY6A 2VZ3A 1RUJ2 4AEMA 4CXYA 4UFMA 4IL7A 5EXOA 4GALA 4KBZA 3J9SA 1UU4A 1PGW1 4IEWA 2Q30A 3WINE 1ZZCA 1REFA 1NE4A 4MUVA 2R072 1UD1A 5DN2A 1SLAA 4RFRB 4HKWA 4W6YA 1AX2A 3GCXA 1JZ2A 3RZKA 2J1TA 2RS52 3VDDB 4NPLA 1KDKA 5FRAA 2D6LX 2ID4A 1R1ZA 1QJX2 2QCSB 2VNGA 3BYWA 4PIYA 2FMDA 3I4IA 4UFIA 4Y5SA 5FKCA 3H1MA 3T08A 4AHXA 3HT1A 3ZDSA 3MUY1 3WNMA 1OOPC 3DKQA 3B00A 1NA1A 2ZEXA 3Q8EA 4BQ1A 1KRIA 1H8TC 3IIIA 4AI3A 2W46A 4MGKE 1VRH1 3FJSA 1EAH2 1PX4A 1WBFA 4E2QA 3BODA 5F3GA 3KT4A 4QKBA 4BK4A 1VE0A 2Q5TA 3K46A 1FAYA 1LCLA 3M7AA 4OZOA 3T0AA 2VZVA 2HH9A 4Q27A 4JGYA 4LOSA 4MGIE 2HWF3 1ZYBA 4C1WA 4P00B 4NHLA 3WUCA 1F15A 2BDRA 5SV8A 3IWZA 4YLZA 1DZTA 1Y4WA 3POIA 4UBGA 4WVWA 1XNBA 3ZN6B 1I6XA 4AVAA 1SBEA 4D6QA 2YXSA 5DAPA 1QJFA 1CZSA 1GUIA 3A0NA 2Z42A 1Y3TA 3ILNA 3S5QA 4FOQA 4HOOA 4QX7A 3W58A 1JYVA 2B5HA 2QQVA 5CU1A 4M0NA 3NWKA 1RUC2 2ETEA 1VMJA 3CJIA 4ZS2A 1JZ8A 4NRMA 1UYXA 2DFCA 4GULA 2UYAA 1HRV1 3GDBA 5FZ3A 3TOJA 1R1A3 3PUQA 1ND3B 1IKQA 2VMHA 3FE5A 4EROA 1KJLA 4QXHA 1AYN1 4QGLA 1IGOA 1PMIA 2LROA 1Z78A 3MFAA 3ZX7A 2ES3A 4QQ2A 2B9VA 2HEWF 2IFWA 2OA2A 4GAZA 5EQUA 1DDLA 2ARAA 4QMAA 3OBTA 3SKVA 5FTTC 5EFUA 4P02B 2WT0A 3ZFFB 5FZ6A 3ZOIA 3KF3A 1AR73 1G8WA 3OPZA 2LTNA 3OSDA 4A4AA 3QD6A 4PQQA 1K5MB 3AFKA 5C5UA 3SXWA 5CZKA 1RB8G 2BUKA 3LSEA 5G05L 1KQRA 1KGYA 1AR83 1H1IA 1H2LA 3DKWA 3PVNA 4GD4A 4GH4B 1OLQA 4GWIA 2ARCA 3VHRA 3MICA 3AP9A 4RS5C 1A3KA 2KD7A 4P08A 4XXPA 4GXLA 3K51A 4ASLA 5FZOA 2RMU1 1QJU1 3KV6A 3AVRA 2C9KA 1GP6A 1W8FA 2D98A 2HEYF 2CGNA 1NKGA 3CJXA 4MSVA 5JOWA 3OBAA 1IPSA 4H2AA 1QH6A 5LBBA 1W6QB 4A6SA 1I5ZA 2VAUA 4MGSA 4BQ3A 3VL9A 1PHMA 1SACA 4EE2A 3QH7A 1PVC2 1XNAA 3S5AA 3APBA 1AHSA 1URXA 4IE4A 5EWSA 1HB3A 2CDPA 1PMJX 2QQOA 2CAVA 2QZ3A 2Q1MA 3ZXFA 5LK7B 1VALA 3C8XA 5EV7A 2QUOA 1CAWA 1W6NA 2R32A 3DV8A 1MZEA 4AQTA 2V73A 4H7MA 2FZ1A 3DPRA 4MH0E 5F37A 2JDZA 5FO9B 2DBNA 4GQ7A 4ES9A 5FY1A 4YW3A 1O6UA 1YQ2A 3I7DA 4LK6A 1O7FA 2RM21 3ST7A 5CYYA 1TG7A 1I9RA 2W87A 3OB8A 1GR3A 1W04A 5FP8A 3VDDC 2AR6A 2BBVA 1HN0A 1UPSA 3WQ0A 2NMOA 2R043 1X9TA 3AYEA 4BLIA 1O59A 4OULA 4MXWB 1RXGA 4G9SB 4GMP3 5JWPA 3MDPA 1GNZA 4Z82A 2XJSA 4EN6B 4N53C 2D40A 3V0AA 2ZA9A 5J98B 4QHBA 2PFWA 4DOUA 3I54A 3SCFA 2VU9A 3I59A 2RS32 2WO2A 4QB1A 5JPMB 1MS0A 1R1A1 2GU9A 3AYDA 4CRQA 1WZXA 4WBBA 3UJQA 4ATEA 2CU5A 3RNSA 3BIWE 3FN9A 4NIIA 3NJZA 3POGA 3SCGA 3RZGA 1TVGA 1PGSA 2XKPA 1F4HA 1Y43B 1J59A 5DZGA 3OBRA 3PUHA 3P6BA 5ERLA 1AYM1 1U5IA 4NIGA 3D3AA 4A3ZA 1D4M2 4XUOA 3RPQA 2JD9A 4UFLA 3UGGA 4CXXA 2LS6A 1AVBA 1SMVA 1U0AA 5JPNB 1HJFA 2LW8A 1UAIA 1B35B 1LOAA 2VUJA 4HVOA 5JLVA 3PNAA 5BUVA 3MF6A 5KXDA 2CAUA 4KG8A 1PO13 3ABZA 1FPN1 1ND3C 4Q5OA 5FAXA 3RSJA 1XRUA 3AJZA 5B4NA 4CSWA 5GZCA 4CVUA 4YZ1A 5IAVA 3UV9A 3IPVA 1PGW2 1M4WA 4AI1A 2BP6A 4M00A 4LIVA 2XOMA 2ATFA 1YFYA 4QQPA 4RR3C 2JICA 5B4XA 2EALA 3WQ1A 4COUA 4I2OA 3R6SA 1Y9QA 5CFDB 1AUYA 2A6VA 4WM8A 4XJ8A 1K45A 2A6YA 2A75A 3JUUA 3PVOA 3SH3A 2VY0A 5E8AA 4CYDA 2J1UA 2DTYA 2ET7A 3NJVA 5DZEA 1O5UA 2YB7A 1A34A 1IQAA 4IGOA 5A33A 2HBTA 3UKTA 5C9AC 3HMYA 3IIAA 3LKJA 1OVPA 4XURA 3LFIA 3ZXAC 4DMIA 3MHZA 4IEUA 3ZM8A 4FTEA 2VBBA 4GH4C 2WBKA 1RUD3 2HJIA 5HCAA 4XVHA 1VRH2 2FDIA 3OGGA 1W8TA 1C8M1 3E5XA 2WQ8A 1NY71 3C7HA 3DYOA 1O3SA 1SLLA 1HRI3 1Q8SA 2VZQA 1N47A 1LHNA 3E1F1 1POQA 3P3PA 4KGGA 1ZBA1 5FZGA 4JDMA 2OPKA 3NAPB 4DFSA 5IJRA 2LUWA 3MLLA 5L9VA 5JOXA 1RXFA 3ACLA 4Q4X3 1PM7A 2HYKA 3DYPA 5FPVA 1UYYA 1V6JA 3POJA 2ZEWA 4MGYE 1SZBA 2P2KA 1VBB1 2QKDA 2OYZA 2GP3A 3ZPOA 4XFHA 4C0BA 3WP5A 4XZPA 3VD4A 3L2HA 4Y26A 3MW3A 3RI9A 4BQ4A 3AKTA 3LCPA 4HG6B 2OZ6A 1AX0A 4K21A 4IW3A 4QPYA 3O12A 3T2PA 1HRV2 3T2OA 3U10A 5JCTA 1MPXA 3NKTA 4FPCA 5C4WB 1H9WA 2R49A 2PQQA 3HN3A 1AYN2 4KU8A 3BTYA 4AFCA 2Y6GA 4L0PA 5IVJA 1IQDC 1RUH3 1T6GC 4OYUA 4W6XA 4LA2A 4YVSB 5FWJA 1GWKA 1K5JA 2VQ0A 4GB31 3WF1A 1VLNA 3K3OA 1MEC3 4YGCA 3ZR5A 4Q29A 4XFIA 4FOYA 3R4DB 1V0AA 3ZYFA 1DLLA 1SCRA 3SH5A 3WY6A 4FPGA 2WKKA 4S2FA 2ZHNA 4FVVA 5CA6A 1C1FA 1JS9A 3JQWA 4BDVB 4IGPA 3MZHA 4MVTA 3OYWB 3J7LA 1RUE2 1W6PB 3L2YA 4XTMA 4DXTA 1OH3A 2RR11 4XJZA 5A3PA 2V4VA 2XB6C 3CMGA 2NQYA 3AX4A 2DV9A 3KVAA 2SLIA 2RMU2 1V00A 2JENA 4AL9A 1PO11 1QJU2 4QPIB 1UXZA 1NG0A 4TWTA 1RUI3 2QQKA 5FUPA 3SH4A 5KBFA 4MOAA 5IK4A 4OMCA 4XILA 5I8SA 3VBFB 3RYPA 2XUMA 3EXUA 1UWWA 1YI9A 2RHPA 4LBQD 5GLWA 3MBWA 2VOKA 1S55A 4Q4W3 1OA2A 3KMHA 4DXRA 5GZGA 1Y9MA 5GZDA 1WMFA 5FO7B 3WG3A 4LKEA 2WZ8A 2VNRA 2ORZA 3WT3A 4PDWA 2GALA 2W92A 4E2SA 1RUG1 5T52A 2D6NA 1WW6A 5BNQA 3NRUA 5FO8B 1AXYA 5FY4A 5H9RA 4UOJA 1S0BA 1AF9A 2B39A 2WN2A 3LFMA 2YYOA 3MIHA 2P3IA 4Y22B 5FZFA 3RI8A 4XFFA 2L9LA 1XE7A 3T1LA 3RZJA 4BIFA 2WR9A 1PK6B 4IQPA 4EWAA 1ENXA 1SLBA 2YU1A 5FY5A 4AVTA 1JZ3A 1LAJA 1RL3A 1L7LA 1W03A 2RM22 4XW3A 2VULA 2DWRA 3A22A 2P34A 4I3PA 5F8PA 3KB5A 5CFDC 3K75B 4N43C 1LOEA 3KV9A 1TME3 4Y20B 4DY5A 1JI6A 1L7RA 1OA4A 1Q8PA 3I97A 1NQJA 2ADEA 3KM5A 2EXKA 4PBPA 4JRLA 1DQ1A 3UKNA 3GF6A 1RJ7A 2ZGRA 1H8VA 1RVF1 1AX1A 3ACGA 1UL9A 2VZOA 3JQXA 1GNHA 4H14A 5JR2A 3F2ZA 3LQCA 4ZXEA 2XPJA 2X5IB 3IBMA 4CP1A 4CU6A 1QIQA 4I02A 2W9XA 1RYYA 4AE2A 4HSLA 1W2NA 4LXLA 2W1SA 4AEJA 5HCFA 2VCAA 1R1A2 1VPHA 1JXNA 1G6NA 1TMF1 2YFUA 1WLCA 3D5OA 4H3WA 4IE0A 4OUSA 1VR3A 3VZOA 4AR2A 2YC2A 4CCEA 2BV4A 2JG9A 3WHTA 4HPKA 5A1FA 3EB7A 1UX6A 2CV6A 4R9DA 3B94A 2TBVA 1BK1A 2VTXJ 1RUH1 4OI4A 1K42A 4IXLA 3IKWA 1AYM2 1SLTA 1XSQA 2VM9A 4COVA 4M3CE 1O91A 2RJLA 1W2OA 1LGNA 5GLUA 3ZKYA 2X10A 1LRHA 5JDBA 3K4DA 4JV4A 4QKDA 4Q4Y1 3J26N 2VECA 1ND2B 1XB9A 5FMCA 2JD4A 3JU9A 3VD7A 3WF0A 1DP0A 4FP3A 4CCJA 3POYA 1FPN2 1IS5A 5DABA 5FZ4A 3CHXA 1MR5A 1NCQB 1X50A 3AP6A 1JU4A 5DAWA 2RG4A 1MQTC 3PMSA 3CEWA 4ASKA 1G9CA 1OA3A 1W8WA 2Z69A 4LTAA 4W50A 3SKJE 2I2SA 2IXHA 4NUBA 4CDWC 1W05A 5F3EA 5A6QA 5ABJC 2DBIA 5LEJA 4YVSC 2RDNA 1REDA 1UOFA 1N1YA 3DECA 4OHWA 4PF5A 4Q0VA 2WNUC 5C3PA 2E7AA 1SBFA 4GWMA 4OUEA 4QDSA 1HB2A 1CESA 3TN93 4CDXA 5T3NA 2WLPA 1ALYA 3O14A 1JBCA 3UESA 2XL9A 1GV9A 5C70A 2BGPA 4R4ZA 3RJRA 2E6VA 4ES8A 2D44A 2ZEYA 3EMRA 1VIWB 4JKKA 4Q0UA 4XC9A 5IFTA 3MFCA 4NMIA 1C8M2 2VZUA 4XACA 5J37A 1NY72 1Q5OA 2YUEA 5KC6A 5K8SA 1J58A 2AREA 4HT1T 5FY9A 1W8OA 4QPIC 2WZPP 1YJLA 2QDRA 1PNFA 5HBAA 4RFT0 3AXDA 1WW4A 1ZBA2 4FAGA 1T6BX 1VP6A 1U5XA 4EV0A 5IT6A 2GP5A 5CB7A 1NLRA 3W20A 3VBFC 1UZVA 5J48A 1VBE3 2J42A 1L3JA 1VBC1 2VMCA 2ZGKA 4P5YA 3FL7A 3WEZA 3ZFEB 2XWBB 3BB6A 3VBOB 3WP4A 2DYCA 2GMPA 1VBB2 3OEAA 2I45A 5FZ0A 3THTA 5JSPA 1XNDA 2R0FA 3W9AA 4JKLA 2QQPA 1W28A 2Y26A 4B29A 5FREA 3W59A 3WHUA 3UK9A 1ASJ1 5A3LA 1G86A 5CKMA 5BNPB 1YIPA 2OUHA 2VC9A 2A71A 4OHZA 1W2TA 5DDJ3 5FDBA 2BOIA 1PGL1 2VZRA 4SBVA 1F31A 3K77A 4YVWA 1PK6C 2RJKA 1GBGA 4XAEA 4Q1RA 5A7PA 4BU2A 1ZA7A 2VNVA 2XLGA 1HQNA 5I0RA 2ZGMA 3I2IA 4DZGA 3H9AA 1ZA4A 3IDAA 4FXKB 1POV3 4WVMB 4JRAA 2WNEA 3FBMA 3M3EA 3K4AA 4GB32 3E6DA 5HXVA 1WW7A 2QDNA 1QWRA 2NZ9A 4Y1UA 5BNOC 1PVXA 2IXCA 5DAXA 2F4LA 1COV3 1MS4A 4YZ4A 2OXBA 1YRZA 3HT2A 2LALA 1EUUA 4QX0A 2FCVA 4U2AA 3N36A 2D3RA 3U4SA 5FY7A 1NA1B 2C24A 3VBHB 5BY5A 1E5HA 2X5IC 3SEPA 3EJKA 3TYJA 5C8CC 1W8ZA 2RR12 2XLAA 1NCRC 4RHV1 2JG8A 2NMNA 3AXEA 1WLWA 2ZGPA 1Q8VA 1PO12 3X29B 4BWOA 1DGLA 2EIBA 3ZFGC 3SEEA 1DQ0A 2DVGA 1IPKA 2ZGNA 1QH7A 2WUHA 1PIV3 4JGYB 2WL1A 3N9OA 4K1YA 3B93A 4CP9A 4OI0A 3T30A 5LATA 2VVEA 5JZGC 1QHDA 1CJPA 4IETA 4XOGA 4QHOA 1J1TA 1R083 4UT5A 4MGQA 4ZZ8A 4LUMA 3ON7A 3BOPA 3WP6A 1V9U3 5AFEA 1R64A 3R4SA 1AL23 1S2EA 1RUG2 1JOPA 2XVLA 3RS6A 1O3TA 3KQ4B 4URTA 1ND2C 4K3UA 4GWJA 4Z92B 2A6ZA 3CJIB 3PURA 2IXIA 4AVSA 1ACCA 4J1WA 4ZXKA 1W3XA 3VHPA 1P8JA 2G4IA 3H7YA 1NCQC 3QBQA 1UMIA 2EVXA 4HKOA 5KHHA 1QXJA 4CEYC 3U4XA 5KHKA 4HK8A 4SLIA 5A6ZA 5C3QA 2O8OA 5LBCA 1TNFA 2Z5WA 4CXWA 4ORFA 3AZYA 3UL2A 2HKXA 2GH2A 1F4AA 4YGEA 5FYSA 2GN3A 3Q8FA 4YFWA 1H0BA 4DRRA 1RVF2 2NYYA 3POSA 4AG4A 4OMDA 1IHMA 2GNDA 3GBFA 5C6CA 1GOFA 2FD8A 3KGLA 4MXVA 2FCUA 5JIAA 5CADA 4LHSA 4LBQA 5IVVA 1W6OA 2OKXA 2Y6HA 2E7QA 1GANA 3AMPA 4K40A 1OMIA 1J83A 1QQP3 2VZ1A 2Y6KA 1KS4A 2V72A 3B9IA 5FZOB 4CP2A 1TMF2 1JTZX 2K46A 2PLV1 5T5OA 4XABA 2E63A 4UW4A 1ENSA 4NROA 3OCPA 3ZMNA 4LKDA 1UU6A 5KHJA 1D0GA 1RUH2 2VNOA 2ZZQA 1UCXA 5JXJA 1IKPA 5J3UA 4KI5M 4CA9A 1IG0A 2XQRA 2C0ZA 4R9AA 1FATA 1U5YA 5DUUA 1HV0A 4Q4Y2 4QB2A 2PN5A 2R063 1WCUA 5HV0A 2G9GA 1UY3A 1GP4A 3ETQA 4HZFA 4RS5B 3OGVA 3W5MA 4C8DA 4RGKA 1DYOA 4K8RB 3MUZ1 1DGRA 4Z8BA 1JH5A 2XJPA 1V6LA 1XU1A 2VL4A 5F39A 2BNOA 3ZXDA 3WDXA 4YZ5A 3ZYBA 3MYXA 4FBFA 4AEDA 3GBGA 1RHI3 4XF0A 5DUWA 4AOCA 1UF2C 1PIV1 4Z2AA 3CF6E 4FPEA 5FMDA 3WCSA 1X8EA 4AI0A 2BERA 2W0XA 1KITA 1YXWA 2JEMA 1MZ6A 2JX9A 3P5BA 4JKMA 4Y1VA 5APAA 2ZX4A 4I09A 4AFMA 4DUXA 1V9U1 2WA3A 1LOFA 4YM2A 3V0AB 2WFF1 1NA1C 1AL21 3ME2A 3PTRB 4GJZA 1JYTA 1BCXA 3ACIA 3I59B 4UI9L 3RVHA 4EN8B 4PIXA 1UZ0A 2B46X 4FFIA 3WDWA 2YBPA 3DN7A 3OY8A 5GJ6A 1RUF3 3PMEA 5DPNA 2DCTA 5LA2A 2VQTA 1V6NA 3AJYA 4JGYC 4N8MA 4NO4A 5BNNA 1VBC2 3WG1A 4MYEA 4CUCA 4DQAA 3DGTA 4ZU5A 4EZHA 1YO8A 2VQUA 4RD7A 4DPNA 3WQ7A 4CTEA 1MVEA 3VL8A 2N7GA 4M3CB 2XKOA 4N53B 4XMIA 2ILMA 3MIGA 1ASJ2 2WZR3 3INAA 3CQOA 1VAKA 1C5HA 4MADA 3AC0A 4N90A 3CJIC 2AEYA 4LHNA 3N9MA 4JZRA 4YG6A 5FP7A 3SHRA 4Y3OA 1NYWA 2KM2A 3P1IA 3OBZA 3WSOA 4BMEA 1PGL2 2ZOEB 2J1VA 2RS11 3IPVB 5H9SA 1UX7A 1G7YA 1CZTA 2E31A 2W94A 1H6YA 2HBUA 4HSJA 4HKLA 4E4DX 2WNVA 2P6CA 3QOPA 4WM8B 5FLHA 2BNMA 4JX0A 1S0JA 3BPSA 4UW5A 2BFUL 2JE8A 4GZ9A 1WW5A 1MS3A 3ZR6A 1US2A 2VCMA 3ZDVA 2VUCA 1FXZA 5FZIA 5LK5A 3V56A 2V5YA 5A33B 2EXIA 4WM7A 4XE9A 1FMD1 1O4TA 1F9KA 3LDKA 5DUVA 4YPJA 4META 4CDQA 1WUVA 2AENA 2WINB 3QCWA 2BGOA 1R091 3J7NA 4IV3A 1QOSA 5FUIA 1ULDA 4Q0QA 4RHV2 4P9GA 2W95A 5ACA3 1QXRA 1UKRA 3VHOA 2IZWA 2J1SA 1JW6A 2UY8A 4NRQA 1ZREA 2GC0A 4RR3B 1BJQA 1BEV1 1YC61 4IEPA 4E2GA 1KFUL 5FYZA 3KLSA 3ZYPA 1EV11 4WZFA 2AC1A 2DCJA 4QGNA 4QT6A 4QXKA 4NIHA 1ZZ7A 5FP3A 4AAXA 5T55A 4NHYA 5C9AB 5JXHA 2G9ZA 3D82A 2JKBA 4TSVA 2QZ2A 5FXXA 1IOAA 1BBT1 3I2FA 4BQYA 4CUBA 3AM2A 1KXGA 4D7SA 2JE9A 1FI2A 3DPRC 3FBYA 4PJYA 4YWAA 5ISLA 5AFBA 3HPNA 2WFPA 1DGRN 4HMZA 1OC1A 3ZXEA 3ZO0B 4FPYA 1FOD3 1HN1A 2BWAA 2HWC3 1EUTA 5FZAA 4JHTA 1PZ7A 1BKZA 1UIJA 5F3IA 2OZJA 3GCWA 1LB2A 2WZEA 3IT8A 3MGUA 1UO9A 2AEZA 3MLJA 2P1BA 5J36A 4AVCA 3NNGA 3H0OA 2OQ6A 4FAHA 5AVPA 4Q4V3 1DG6A 1VBD3 4N7IA 1W0OA 3K48A 4UYBA 5A1LA 3R05A 1H2KA 4OHVA 1KS5A 3O1VA 3OD4A 5F6LB 2ZGQA 3FC0A 4QX8A 4FPLA 4UF0A 5CFCA 3VLBB 2IVJA 4R4XA 2XONA 3TWIA 1FYUA 1W9TA 2ZJCA 1UN1A 3KV4A 4FFGA 5IVEA 1C1LA 2Y8KA 2NM1A 2ZTNA 2PHRA 1W9YA 2PHUA 2PLV2 4YW2A 2WJSA 4MHRA 2UWAA 3A0KA 2B45X 2WAOA 4XEZA 5C8WA 4AHZA 1YCIA 3ZIXA 1Y9GA 2XVGA 3G7DA 3WLUA 3E6CC 4NHXA 1WMDA 3HNBM 3KS7A 2HWF1 3F95A 4ISRA 1IS4A 1N1VA 1UKGA 2CTVA 1CAUA 4KNCA 1CJDA 4PF1A 3CZUA 4QDRA 5KXEA 2D93A 1OLRA 4O9EA 1O5LA 1YQ5A 1DFQA 5JOYA 4UW6A 4PDWB 4XJAA 1OD5A 2P6HA 3EYPA 1F35A 2Q1FA 5KXCA 5A3TA 3PDQA 5EJZB 1Y7BA 2DFBA 2GNBA 5D8AA 1DQ2A 3KT1A 5FZKA 2JDHA 3AMHA 1GICA 3OPWA 4IV1A 4F8AA 2WO3A 3AP7A 4NAMA 1IS3A 5LB6A 3JBG3 5AVAA 2J1RA 4Y1YA 4W65A 3JD73 1BZWA 1N1SA 5KHGA 3V0BA 3W21A 5ACA1 5F6KA 2JECA 4CEWA 1JOBA 2EA7A 3HVDA 3LEMA 4FPKA 4UW3A 4XHXA 5EZWA 4XETA 3ES1A 1VBA3 5C71A 1ZRCA 4WM8C 1PIV2 1GNYA 4E8DA 4H55A 1CAXB 4MV2A 3FUOA 1OLME 1QNWA 4J6GA 5JR7B 1ENRA 2GZWA 2VZSA 3RMYA 2GN7A 3VBRA 5FR3A 5HCHA 1AR71 1GOHA 2VVDA 3KV5A 1W8HA 4QD2A 2PQSA 2GH8A 2OW4A 3E5QA 1V9U2 1S0CA 2WFF2 3AZZA 1AL22 1QJY3 2DU1A 2ARBA 4P9IA 1GZ9A 3FWEA 2XH6A 1LOCA 1GZWA 1AR81 4TTGA 4DEQA 1KJRA 1MZ5A 2YDEA 3OG2A 4UFJA 5E6HA 2XWJB 3KT7A 4AGRA 4FQ4A 2VJXA 4UFKA 2VVFA 4AHYA 1NE6A 2Y34A 1JYIA 2G1MA 3IZOA 1TZOA 5DUXA 2XL7A 2JG9B 4Z2WA 4HPKB 4N43B 5EJ1B 2JIJA 1U5ZA 3DXTA 3O0VA 5FZ8A 3NNFA 3HNMA 4YRDA 5FJKA 1JYWA 1QOOA 3V65A 2MNGA 4GIQA 3ZKUA 1K12A 2CWSA 2WN3A 4JGZA 5K0UA 1W99A 2HWD3 4RGAA 2WT2A 3J8F3 3TRSB 2QQMA 2WA4A 2A3YA 3H50A 3NSTA 3B7MA 3G6JB 3MIEA 1ODMA 2H0VA 3N7LA 4P14A 2DU0A 2PXJA 5KWRA 2HWB3 2RDRA 5FOJB 2ZX1A 5A7WB 5FZLA 5L7OA 2RS12 1MACA 1UIKA 4BPZA 4BM8A 3ZN6A 1OF4A 5IVYA 4D7TA 3LD8A 1ZBE3 3O1RA 3PUSA 2BNNA 2BFUS 1GMMA 2I74A 3THPA 1ULCA 2JDMA 2VGDA 1LOBA 5FIXA 4BMBA 4LBJA 4LA3A 4XJWA 3LOBA 2IWGB 5GZFA 3IDEA 4AQ2A 2R041 4LIUA 3VKNA 2VUDA 4BLJA 5F5QA 3C7EA 2BRTA 4CDXB 4LLOA 4GMP1 1FMD2 2QQUA 2QQNA 4HVQA 1WKYA 1SFPA 1WMEA 3MW2A 3H8UA 1MVQA 1R092 1YNAA 3ETPA 3M70A 4DXZA 1BYHA 1OUXA 2VMGA 5FZ1A 3WX5A 4QX2A 4ZONA 1AR63 2H0BA 3A7QA 5M0TA 4YW6A 1MQTB 2RDSA 1ZRFA 3ZFFA 4YGBA 1UU5A 5FMOL 4CDWB 2C5DA 5IFPA 4L92A 5ABJB 2D7FA 1K5MA 1BEV2 2DVAA 5LY2A 3M3QA 4Q1PA 2WNUB 3OGSA 3KSCA 4QU1A 2B7YA 3FFZA 1EV12 3HD8B 1VRBA 3OOXA 3KGZA 2DDUA 1ONAA 4XUQA 2EF6A 2G9FA 4IESA 1SDDB 3H7JA 1ZZBA 3LEKA 4PDWC 1J84A 4QPGA 3VB9A 2BOJA 1BBT2 4EZ4A 2W91A 1YIFA 5EJ3A 2GNTA 5D2AA 4QXCA 2YPDA 1O3RA 1RC6A 1XYNA 1WMXA 4HBNA 4M4PA 1QF3A 4YVWB 4Q8LA 3H8OA 4A7KA 4XUTA 2PHWA 5I8TA 3M3IA 3UGFA 1CAVB 3C2UA 5AC93 1WA4A 4ZS3A 1F2NA 3LPFA 1TE1B 4IE5A 4QKNA 4AFAA 4E4ZA 5KHIA 1OF3A 2NP0A 4GKYA 3LAGA 5A7SA 1CPMA 2VD7A 3D8CA 2RVAA 4B8EA 2VOWA 4HFSA 1C28A 1LNSA 3RGBA 1UZWA 3A4UA 1BMV1 4YG3A 5F1RA 4AEKA 4IEXA 2DF7A 2XBO3 1E5IA 1RUD1 2WS93 4JVAA 2VOVA 1SFNA 5A3WA 3B3QE 1S4CA 4CPBA 3BN6A 5I0DA 4WVVA 2JG8B 5DZFA 1CVNA 1YI7A 3NW4A 5IHRA 1UY0A 5G04L 5J1XA 3BKZA 2OS2A 2ZGTA 1HRI1 3GZUC 3LWCA 4IEYA 2YZ4A 4INDA 1JYXA 1KEXA 2JG9C 4M01A 3AP4A 4LULA 3ZLIA 1OBNA 1WBLA 1PO23 2MEV3 3J7MA 3VZMA 1AR93 4R9CA 5FQ0A 2XLFA 3WDUA 1GKBA 1ZBE1 2HWF2 3AB0A 4Q4X1 5BNOB 1LECA 4LO5B 4CDUA 4FI9A 3BOWA 4AI2A 1VB4A 4B4PA 4D69A 5I0SA 4CCMA 2R073 1CIYA 1SQ4A 1W8UA 3WZ1A 3JB8A 3ZXJA 4AF9A 3LEGA 4LE3A 4UAPA 4HLTA 2XR4A 4EN9B 2C6SA 1LGBA 2RS53 4LO7A 5C8CB 1NCRB 4AQ6A 2ERFA 2GMMA 1QJX3 2D5HA 2Q8DA 1J3QA 3BI3A 2WYSA 2Y0IA 3ES4A 3ZFGB 2CGPA 1AJKA 2F17A 2P5BA 2XUEA 1GQGA 2ZX3A 1O4ZA 1UYPA 1HJGA 1GYKA 4PI2A 2A3XA 4R8HA 3SNMA 4I0BA 5JZGB 4XFAA 1B35A 5FKBA 2PHXA 1EAH3 3CL1A 1SEFA 1MEC1 2RE9A 2WNOA 2YV8A 2J7MA 2Q8CA 1H2NA 4CDXC 1AR72 4UBHA 3WW4A 2ZS6B 1GP5A 4A41A 2WT1A 3ZYJB 5A3UA 4MX3A 5E1RA 2BJSA 1OQEA 2OUJA 1MS8A 4NJ4A 4HN0A 2VPVA 3GHNA 1OI6A 2XDVA 1H1AA 1AR82 1N3QA 3N4MA 1IG3A 4LBQB 4A42A 5KXBA 4U36A 5EYYA 5FUNA 3PU3A 5A7QA 4CEYB 2J1EA 1C3HA 1U12A 4XTPA 2Q8EA 2R1BA 3VN4A 3NNJA 3HQRA 4K7JA 1RUI1 3TEZA 3AL5A 1JMUB 2IXKA 1RUC3 2HWE3 3OPTA 1JUIA 3VD3A 5AC91 4W4ZA 4QPWA 4BK5A 2GC1A 5HV4A 3ACFA 3TAYA 1MS1A 3BU0A 1S0GA 4OZXA 4IGQA 4DB5A 3UYJA 4AI8A 1F5FA 3IN9A 4Q4W1 1JHNA 5CIRA 1QJEA 2FCTA 2X53S 4L11A 3ZYIB 1JODA 4E9KA 4AW7A 2W08A 2ZAAA 2C1FA 1DQ4A 3NAPA 2BYVE 1DHKB 1YHFA 2TUNA 3OEBA 3MIBA 4KQ7A 4EWEA 2ZKNA 4NIDA 4TN7A 3BALA 2WRAA 3BTAA 4QX5A 5A32A 2DVFA 3WUDA 4YVWC 2UWBA 5LA0A 1WCSA 2XQXA 2WAAA 1WLTA 5FPUA 2EXHA 1CZVA 2IVIB 3LEIA 4OI2A 2ZABA 4YZ2A 4AEDB 3GALA 4Y1XA 1UPIA 2VG9A 3ZVXA 2PHDA 4QKFA 4X6QB 5JI9A 1TME1 3ZSKA 4LE4A 1AR91 1YWKA 2E9QA 1L7QA 3I3DA 4JC1A 3I2OA 5IAXA 2R042 3PHMA 5GM0A 1LGCA 2ZCWA 3ZSMA 5C4WA 4YZ3A 1PNGA 2ZHLA 1HDKA 4Q0PA 4BISA 1XPWA 3GZTB 4LPLA 4N9HA 5JIUA 2QE3A 3DEMA 4AGVA 3I3MA 1AJOA 2DCZA 2ZMLA 3R0RA 4I30A 3PVBB 5CNAA 3CKHA 1QU0A 1FV2A 1V6OA 3LA2A 2UURA 5I93A 5CBLA 1JHJA 1PVC3 3AKPA 4QB6A 4XDOA 5FMOS 4A7ZA 4BB3A 2JG8C 2XHKA 1O4YA 5EPAA 3WOGA 3OY8B 2XJQA 5FYIA 2CYFA 3THDA 5LZ6A 1NLQA 3C7GA 5LEKA 2XHNA 4M0HA 1NX9A 1STMA 1ULEA 5EIYB 5BNNB 2JXAA 5FZCA 3QLQA 5H9QA 3LA7A 3H3LA 1HXS3 3H42B 4KWJA 5E89A 4K20A 5FYMA 4CUGA 2J22A 3ZYRA 2PMWB 2YC0A 4QWNA 5A7OA 4XHBA 2ZX2A 5DG2A 2X09A 1W3VA 2BVVA 4XFGA 2WYFA 4I0WB 4NRPA 2BBAA 2YFZA 1QXPA 3WW2A 2IXLA 1S0IA 2NN8A 4TYSA 3N9LA 4CP0A 4AFDA 4B4RA 4COWA 2A1XA 1GZTA 2E33A 1JZ7A 4F83A 4RN5A
chains in the Genus database with same CATH topology
3FZ3A 3KZ4C 4FT8A 3RDIA 4I0AA 3USUA 4QU2A 4KL1A 1V6KA 5JSOA 5C33A 2WNVB 1A8DA 2HWE1 2RS33 1REEA 4GKXA 3VBUA 2DCYA 1FT9A 4B3NA 4Y22A 1C8NA 3NV1A 2XGXA 1B09A 3TN91 1BVVA 3NKGA 2X29A 1BMV2 2GDFA 4CDQB 4Z1VA 1A78A 5BYNA 2R0HA 1RUD2 3CLPA 2LM3A 4Y20A 3NV3A 3ATGA 5L73A 5L19A 1D4M3 1IPJA 1HRI2 1LJ7A 1SCSA 1GSLA 1D4VB 2A6XA 2DUPA 3FHIB 3WCRA 4ATFA 4BIOA 3VGIA 1ZBE2 2PAMA 1VBE1 2GC3A 4Q4X2 4H7LA 3VBSA 1S0EA 5GLZA 4COZA 1V70A 4FXGB 5T5LA 5CAZA 5FPXA 1HLCA 2WC2A 3O0XA 1PZ9A 1RIRA 3FLPA 4S2HA 2PHTA 3B9CA 1RTVA 1G9AA 4JDNA 2E53A 2UY9A 1RITA 3VZLA 5DDJ1 4XPVA 2MHFA 3E6BA 1Z7S3 4BZ4A 2TNFA 4EN0A 2VOXA 1N3OA 2BTVC 1UW8A 4AGGA 3RYRA 4AEDC 1POV1 1CONA 1VRH3 1CD3G 3PVEA 3QH6A 4XFCA 3PJYA 3DF0A 2E51A 4AQSA 1MEC2 1HXS1 1HV1A 1AXKA 1S0FA 1CAWB 1COV1 1W6NB 5IK7A 2XVKA 4KWLA 1RJ8A 1LOFC 3D6EA 3LGRA 3OTFA 3WG4A 5J7MA 1OFSA 3DPRB 2CL2A 3AZWA 3KCCA 1H1MA 5CFCB 4GWNA 4XBNA 4BH9A 3HR9A 4X8NA 4PIZA 1ZRRA 3SITA 1DYPA 3RMXA 1RUI2 4C91A 2FBEA 5BNNC 5T50A 2K0GA 5AC92 1O3QA 4DY3A 1ZNPA 4AVBA 1Q8QA 1QGLA 3LB9A 2C9AA 4OVEA 4Q4W2 4COYA 1VAMA 4DRVA 1ULGA 3N7MA 4P5HA 1AYN3 1VB2A 1R081 2JE7A 1UMZA 2D43A 4Y5Z0 3MLKA 4XDQA 4B7EA 1YJKA 3FLTA 1EPWA 2JJ6A 3WR0A 3SCHA 1OQDA 1QJZA 1IZ3A 1WD3A 4IV1B 3ZFEA 1OKQA 3E5UA 3VBOA 5JSRA 2WSUA 2W68A 3FLRA 2UYBA 2GAUA 3V0BB 3PJQA 1G9BA 5BNPA 1RUE3 2WNVC 2YY1A 4YNIA 2BPA2 1TME2 1AR92 4WZCA 1BXHA 1SLIA 2RMU3 2PA7A 2Q0AA 1DZRA 1QJU3 1LEDA 3VBRB 4RQPA 2GC2A 3CNAA 4WM7C 4XJ9A 1NQDA 2K2SA 2TEPA 2P17A 5T5PA 3WDYA 4CDQC 2D3SA 4IV3C 4WVMA 2R30A 4PLNA 4HANA 1OPMA 4WV8A 1GZWB 3WDTA 3WNXA 2B8MA 4YM1A 4TZDA 4LHLA 2ZKLA 1Q3EA 4YW1A 1C5IA 1N1TA 3VKFC 3MI8A 1QQP1 3GNEA 3WW1A 4X8PA 3RQ0A 1Z7S1 3VV1A 1WLDA 4MZUA 1ZM1A 1YYNA 1X36A 4LO8A 2E7TA 3VBHA 4XMAA 3PTYA 3AP5A 3IMNA 2PTMA 4P9WA 1JYCA 2RM23 3RRDA 2IFRA 4AFBA 1TNRA 4JGZB 5K0UB 3CU7A 2SBAA 1QMJA 1DIWA 1HQLA 3VHNA 3AK0A 5BXXA 4YGDA 2R061 3VZNA 2UU8A 4UXAA 3ZYGA 3WDVA 3EQEA 3V64A 5L7OB 5E88A 1NXMA 1XE8A 1OOPA 5FPZA 4BE3A 2EAKA 2YHJA 3H1WA 3I2DA 1H8TA 1CN1A 1Q43A 3UJOA 1RHI1 2HWE2 1W6MA 2VH9A 2YGLA 5JOZA 1H9PA 5FLIA 2O1QA 5D1IA 1CGPA 4YYOA 3HAGA 4IEZA 3TN92 1OSGA 4D3WA 2X8KA 3MPBA 3N35A 4RA0A 4OI1A 5CFCC 4EJRA 4F3JA 2OVUA 3ZMOA 1AYM3 3D0JA 2XJTA 1IS6A 5I0UA 2WIIB 3ECQA 1GQHA 1RUF1 2ZZJA 3ILFA 4XYXA 5L36A 4P9JA 4QQOA 2ZX0A 3FMGA 2WWSA 3FUQA 1V6MA 4P9LA 4FTSA 1LULA 4E4SA 4IEVA 3HN1A 1VBE2 1Z0HA 2PHLA 1D2SA 1FPN3 1MS5A 1RUE1 3ZN4A 4PBOA 1DYKA 4ZU4A 3EBRA 1RMU3 4QPGB 4NHKA 2DVDA 2WZR1 1RGSA 5D8AC 1X82A 2AH2A 3KCYA 3BPZA 4YW4A 2H6CA 3OF1A 4C1XA 4IV1C 3S30A 5DDJ2 2IC1A 4OHYA 4XBQA 1WGPA 2I07B 4CEWC 3ENRA 2EXJA 2FZ2A 5J96B 2Q1ZB 3WG3A 2Z2SB 3E97A 1C8M3 3LA3A 1SDWA 1ULFA 4XF9A 4NWVA 4RS5A 5GZEA 2PYTA 1RUNA 1HXS2 4LEJA 3VBRC 3EO6A 4XJUA 1ZBA3 5BPXA 1HW5A 1A8MA 1COV2 3ZXGA 2A7AA 3WXPA 1FV3A 4OFGA 1S1AA 4PLMA 3NO8A 4GA9A 3M1HA 3NV2A 1J1LA 5JAXA 1LESA 4FCAA 1VBB3 2DCKA 4HETA 4G3YC 3ZIWA 3O0WA 3RJ2X 2BQPA 1EYBA 2QFEA 3D0SA 3N7JA 4XF1A 2BEOA 4HN1A 3B69A 2VUAA 5FQ0B 4Y4YA 4K6BA 4FPJA 3ZSEA 1E57A 2F6BA 4KBBA 4CDUB 1NOVA 2GMEA 3MF9A 1SFYA 4QM9A 1R082 1YLLA 3AYCA 1GLHA 5FBZA 5I0TA 2XJVA 4GMP0 4JGZC 5K0UC 2A70A 2AZ5A 2Q4SA 4GB33 4LO4B 4BYYA 3VDDA 1FNYA 2AYHA 3S0MA 5L7OC 3JCIA 3JZVA 4AVVA 1FOD1 2HWC1 4M3CA 3T1MA 4N53A 5KC5A 4FOWA 2W52A 5DXDA 3OJBA 5EYXA 4NHMA 5GKAC 3RZZA 4A7YA 2RR13 1QY4A 4ITCA 3GZAA 4JTNA 4NOTA 1LKNA 1QKQA 4R52A 3N7KA 4Q4V1 1VBD1 4A2UA 3SMHA 4LBOA 3VZKA 1H2MA 4QQLA 2B42B 3WD5A 1RMU1 1QDCA 2ZAHA 1YFWA 1DGWA 1CIWA 1QDOA 2R1DA 1QQP2 3ZFFC 1XQNA 2VMIA 2W39A 3AKQA 4JTOA 1RUG3 1Z7S2 1HX6A 1K5MC 5GLTA 4L97A 3ZXKA 4LLFA 3R4UA 2PHFA 3NV4A 3TB0A 4YM3A 3ZXLA 3RWNA 3M4FA 1J3PA 4KWKA 4CZSA 3GBWA 1ND3A 2D97A 3FX3A 4AYUA 2XJUA 4N9IA 2R6QA 1ZZ9A 3D4KA 3B02A 1LHWA 4L8QA 4QPGC 2Y0OA 1ENQA 3AMNA 4RR3A 4DINB 4S2DA 2CGOA 2R062 4KG0A 1BQPA 5FCCA 2D3PA 2ZMKA 1N3PA 5A32B 5K9YA 3JBG1 4XQDA 1EY2A 2OIIA 3JD71 1RVF3 2QVSB 2YGMA 1X8MA 3L9JT 3WVJA 5C9AA 1WCDJ 1ZX5A 4GH4A 4P9YA 1RHI2 4Y1ZA 1VBA1 2V09A 4O9GA 1M06G 4RSUA 1NZCA 1CPNA 1TMF3 4PLOA 2O0OA 1OFNA 4XIOA 1GZCA 4YSFA 1S2KA 1QJY1 4C90A 1W6QA 3MEPA 3VKMA 1LENA 1BVP1 4YARA 3AZXA 3VKOA 1FNZA 2VW2A 1OPOA 1RUF2 1CX4A 3TBDA 4Q4Y3 3DUIA 4OLLA 3GYDA 4FPFA 4K9SA 1NLSA 3CO2A 1HQWA 1OQ1A 4V1PA 1FX5A 4CDUC 4BCUA 1JUHA 2YPJA 4LO6B 4XIKA 2ARXA 2D6MA 2ZHKA 3ILRA 4K1ZA 3NL1A 2HWD1 2WZR2 3J8F1 2P3KA 2DTWA 4LBMA 4FQZA 4IEOA 5JMCA 4XF3A 5F9TA 2HWB1 5A3MA 1ZRDA 4MXWA 2WQZC 3U0ZA 5GALA 1Q56A 1D2QA 3ZN5A 3VUOA 3USUB 2DUOA 2R16A 2ZGUA 2ZPXA 4PQ9A 1RUJ3 3ZPYA 1B35C 4R9BA 3BCWA 3RYKA 3WW3A 3LSDA 3VBUB 1DU3D 4EWDA 1PZ8A 1XYPA 2CWMA 3B5LB 3O7OA 4TLFA 2FMYA 2NPIA 2GNMA 1H30A 3WG2A 4YFZA 1QOTA 1LHOA 1VBC3 3EHKA 3LZZA 3T2TA 5T54A 2D6KA 2DURA 3IDBB 3OGJA 4FPOB 1AR61 1CAXA 1LOGA 1MS9A 5ACA2 1GFF2 4JDOA 4JCKA 1ASJ3 3AKSA 3HBZA 3AKRA 4LUKA 1F5JA 4FOVA 1H4HA 2D6OX 1W2UA 2XJRA 2PAEA 3VBSB 3KD4A 2AUYA 3MIDA 2P3JA 4QGMA 2KA3A 4AXOA 3NAPC 1LR5A 1KDMA 5J09A 4KU7A 5JI7A 5CFDA 1W6OB 2QNKA 4N43A 4NVPA 5GLVA 1DQ6A 1NXD1 2WSVA 4NR1A 1CR7A 5TSWA 3KQRA 4D7YA 3M3OA 3WP3A 2FQPA 1FOD2 2HWC2 2A3WA 2Q8OA 3ASIA 4Q0SA 3I8TA 3M8LA 1QNYA 1CQ9A 4RHV3 2A6WA 1I3HA 4Q2FA 1KD7A 3MW4A 1LU1A 4LBLA 4DS0A 5CVRA 3BU7A 3M2MA 2EAAA 4D94A 5C4WC 4Q4V2 1VBD2 2YROA 2ZMNA 2F4PA 2BGCA 1RMU2 1DGWX 4NWWA 4AK3A 3C3VA 3URFA 2XBO1 1TQ5A 2WS91 2DVBA 3ELNA 4KGQA 1WCKA 4ISQA 3H3ZA 4LBNA 1XXNA 1LODA 1S2BA 4L9BA 3TNPB 5I8YA 1RINA 1XU2A 4YW5A 4PCRA 3O5SA 3DL3A 1UZYA 2MEV1 1PO21 5CG9A 1C57A 4P9XA 5FLJA 4ZU7A 4NN0A 1RUJ1 3ZSJA 3LOIA 2IXJA 2K9ZA 1MQTA 4LHKA 2XG3A 1AL0G 1HKDA 4CDWA 2WQ4A 1XNKA 2R071 5ABJA 4YVSA 1JN2P 4G4FA 2WNUA 1LHUA 2RS51 4AHWA 4LBKA 4ASMB 1SBDA 4LNVA 1QJX1 3HQXA 3JBG2 3VKLA 1YUDA 3JD72 1F8VA 1EP0A 2ET1A 2QJVA 2UWCA 3SLIA 3S6PA 3OYWA 4EN7B 1W6PA 4OHXA 1VBA2 1TEIA 2PELA 5FOBB 3VBUC 1EAH1 3J4UH 2VW0A 3ROUA 3N3HA 2CNAA 4L2NA 4BHPA 4QPIA 2PLV3 4YM0A 4FTBA 3SISA 2BVBA 2BW8A 1ZZ6A 3NVCA 3P3NA 4RQPB 1DQ5A 3UKVA 4WVZA 1J3RA 2FHRA 1CAVA 1LTEA 3JB4C 1V6IA 3USSA 3VBFA 1Q8OA 4E27A 1QJY2 4MLOA 2Z79A 4IERA 5HCBA 2B9UA 5LRSA 1A6CA 2A73B 1S0DA 2ZHMA 4AWDA 4BOWA 1C4RA 1G9DA 3TNQA 3OD0A 3GHMA 5DG1A 3ALQA 3PLQA 1AXZA 2A5ZA 1POV0 4HK9A 1RUC1 3S7EA 3HIFA 3VBSC 1X33A 5IK5A 1PK6A 4WM7B 3POWA 5T5JA 1RUOA 3U11A 4HL0A 3AFGA 2HWD2 3B01A 4IV3B 2ZGSA 3J8F2 4W6WA 3AMMA 4QQHA 2NLRA 1LEMA 2ENRA 4XXAA 2HWB2 3AZVA 5BNOA 2ZGLA 4L99A 3M3CA 2GSYA 1KFXL 1LU2A 3U07A 1OOPB 2WFF3 5FFOC 4RL7A 4FO9A 4FPHA 4F7ZA 1H8TB 1AZDA 2X5IA 4I3GA 4KH9A 1W6MB 4X6RB 5E16A 5C8CA 1EPZA 1NCRA 3HWJA 3IDCB 3WV6A 5IK8A 1YFUA 1ZZ8A 3ZFGA 1DF0A 4BA6A 2Y38A 1UZZA 5I91A 3MIFA 1H4GA 5CG8A 4IEQA 4XQ4A 4FSJA 4MGZE 4FP2A 5H9PA 2VXRA 3H1YA 3IM0A 5JZGA 4I01A 4ONUA 4XF4A 4C0HA 1PVC1 1AR62 5K7PA 2D6PA 3AMQA 2VW1A 3Q9OA 3AYAA 4Q8KA 1W39A 2HEVF 4Y24A 5BV6A 4Q26A 3FFQA 1ND2A 2PAKA 4N7UA 1HIXA 2D5FA 4S2GA 2ZBJA 1DBNA 4ZKTB 2EIGA 5SV5A 2ZACA 4LT5A 1NCQA 2AGSA 4XQWA 2RS13 5JVVA 1YFXA 4CEYA 3QACA 2DUQA 4B7KA 4NPRA 1WD4A 1SLCA 2O8QA 2YMZA 4K8FA 4A3XA 5IUQA 1JOJA 3ZFEC 3VBOC 1XNCA 1XYOA 1OHFA 4HVRA 2MPFA 4JAAA 1FMD3 2H6BA 2P37A 3MPPG 4JQRA 3H3UA 1R093 1HRV3 4M3CF 1W0PA 5BNPC 1VAVA 4XBLA 2BWCA 1CAUB 1VJ2A 2RS31 1X7NA 1LHVA 1I1EA 1ZVFA 4RQPC 2VQAA 5LRRA 1APNA 3ZSLA 1BEV3 4LR4A 2KXLA 2WLQA 1G9FA 5D8AB 2ZGOA 1EV13 4XFBA 4QM8A 4J1XA 2XBO2 2WS92 4B4QA 4DNYA 3KCXA 4RGGA 4CEWB 1D4M1 5B2GB 1BBT3 4Z07A 3VZJA 4YG0A 1D0HA 2MEV2 1PO22 3S7IA 3RG0A 3VBHC 1DZQA 4OUMA 1MZFA 2CY6A 1RUJ2 4AEMA 4IL7A 5EXOA 4GALA 3J9SA 1UU4A 1PGW1 4IEWA 2Q30A 3WINE 1ZZCA 1REFA 1NE4A 4MUVA 2R072 1UD1A 1SLAA 4HKWA 4W6YA 1AX2A 2RS52 3VDDB 1KDKA 5FRAA 2D6LX 1R1ZA 1QJX2 2QCSB 2VNGA 4PIYA 2FMDA 3I4IA 4AHXA 3H1MA 3HT1A 3ZDSA 1OOPC 3B00A 1NA1A 4BQ1A 1KRIA 1H8TC 4AI3A 4MGKE 1VRH1 3FJSA 1EAH2 1WBFA 4E2QA 3BODA 3KT4A 2Q5TA 1FAYA 1LCLA 3M7AA 4Q27A 4JGYA 4MGIE 2HWF3 1ZYBA 4C1WA 4NHLA 3WUCA 5SV8A 3IWZA 4YLZA 1DZTA 4WVWA 4UBGA 4AVAA 1XNBA 3ZN6B 1I6XA 1SBEA 2YXSA 3A0NA 2Z42A 1Y3TA 3ILNA 4FOQA 3W58A 2B5HA 5CU1A 4M0NA 3NWKA 1RUC2 2ETEA 3CJIA 2DFCA 4GULA 2UYAA 1HRV1 3TOJA 1R1A3 1ND3B 1IKQA 2VMHA 3FE5A 4EROA 1KJLA 1AYN1 4QGLA 1IGOA 1PMIA 1Z78A 3MFAA 3ZX7A 2ES3A 4QQ2A 2IFWA 2HEWF 2OA2A 1DDLA 4QMAA 3OBTA 5FTTC 5EFUA 2WT0A 3ZFFB 1AR73 1G8WA 3OPZA 2LTNA 3QD6A 1K5MB 3AFKA 3SXWA 1RB8G 2BUKA 3LSEA 1KQRA 1AR83 1H1IA 1H2LA 3DKWA 3PVNA 4GH4B 3VHRA 1OLQA 3MICA 3AP9A 4RS5C 1A3KA 4XXPA 4ASLA 4GXLA 3K51A 2RMU1 1QJU1 2D98A 2HEYF 2CGNA 5JOWA 3CJXA 4MSVA 1QH6A 1W6QB 1I5ZA 3VL9A 1PHMA 1SACA 3QH7A 1PVC2 3APBA 1AHSA 1URXA 5EWSA 2CAVA 2QZ3A 2Q1MA 3ZXFA 5LK7B 1VALA 5EV7A 2QUOA 2R32A 1CAWA 1W6NA 3DV8A 1MZEA 4AQTA 2V73A 4H7MA 2FZ1A 3DPRA 4MH0E 5FO9B 2JDZA 4GQ7A 4ES9A 4YW3A 3I7DA 1O7FA 2RM21 3ST7A 1I9RA 1GR3A 3VDDC 2AR6A 2BBVA 1UPSA 3WQ0A 2NMOA 2R043 3AYEA 4BLIA 4OULA 4MXWB 4G9SB 4GMP3 5JWPA 3MDPA 1GNZA 4Z82A 2XJSA 4EN6B 4N53C 2D40A 3V0AA 2ZA9A 5J98B 4QHBA 2PFWA 4DOUA 3I54A 3SCFA 2VU9A 3I59A 2RS32 5JPMB 1MS0A 1R1A1 2GU9A 3AYDA 4CRQA 4WBBA 3UJQA 4ATEA 3RNSA 3BIWE 3NJZA 3SCGA 1PGSA 2XKPA 1Y43B 1J59A 5DZGA 3OBRA 1AYM1 1U5IA 1D4M2 3RPQA 1AVBA 1SMVA 1U0AA 5JPNB 1UAIA 1B35B 1LOAA 2VUJA 4HVOA 5JLVA 3PNAA 5BUVA 3MF6A 5KXDA 2CAUA 4KG8A 1PO13 1FPN1 1ND3C 5FAXA 3RSJA 1XRUA 3AJZA 5GZCA 4YZ1A 3UV9A 3IPVA 1PGW2 1M4WA 4AI1A 4M00A 4QQPA 2ATFA 1YFYA 4RR3C 2JICA 4COUA 2EALA 3WQ1A 4I2OA 3R6SA 1Y9QA 5CFDB 1AUYA 2A6VA 4WM8A 4XJ8A 2A6YA 5HI0A 2A75A 3JUUA 3PVOA 3SH3A 2VY0A 5E8AA 4CYDA 2DTYA 2ET7A 5DZEA 1O5UA 1IQAA 5A33A 3UKTA 5C9AC 3HMYA 3IIAA 3LKJA 3ZXAC 4DMIA 4IEUA 4FTEA 4GH4C 1RUD3 2HJIA 5HCAA 1VRH2 3OGGA 1C8M1 3E5XA 1NY71 1O3SA 1SLLA 1HRI3 1Q8SA 3P3PA 1N47A 1LHNA 4KGGA 1ZBA1 4JDMA 2OPKA 3NAPB 4DFSA 2LUWA 3MLLA 5JOXA 3ACLA 4Q4X3 1PM7A 2HYKA 1V6JA 4MGYE 2P2KA 1VBB1 2QKDA 2OYZA 4C0BA 4XFHA 3WP5A 4XZPA 3L2HA 4Y26A 3MW3A 3RI9A 3AKTA 3LCPA 2OZ6A 1AX0A 4K21A 4QPYA 3O12A 1HRV2 3U10A 5JCTA 3NKTA 4FPCA 5C4WB 1H9WA 2R49A 2PQQA 1AYN2 4KU8A 4AFCA 1T6GC 1RUH3 4W6XA 4YVSB 4LA2A 4GB31 2VQ0A 1VLNA 1MEC3 4YGCA 4Q29A 4XFIA 4FOYA 3R4DB 1DLLA 1SCRA 3SH5A 3WY6A 4FPGA 2WKKA 4S2FA 2ZHNA 4FVVA 5CA6A 1C1FA 3JQWA 3MZHA 4MVTA 3OYWB 1RUE2 1W6PB 3L2YA 4XTMA 2RR11 4XJZA 2XB6C 2NQYA 3AX4A 2DV9A 2SLIA 2RMU2 1V00A 2JENA 1PO11 1QJU2 4QPIB 4TWTA 1NG0A 1RUI3 5KBFA 3SH4A 5IK4A 4XILA 5I8SA 3VBFB 3RYPA 2XUMA 3EXUA 1YI9A 2RHPA 4LBQD 5GLWA 2VOKA 1S55A 4Q4W3 1OA2A 3KMHA 5GZGA 5GZDA 1WMFA 5FO7B 2VNRA 3WT3A 4PDWA 2GALA 4E2SA 1RUG1 5T52A 2D6NA 1WW6A 5BNQA 5FO8B 1AXYA 5H9RA 1S0BA 1AF9A 2B39A 3MIHA 2YYOA 2P3IA 4Y22B 3RI8A 4XFFA 1XE7A 3T1LA