3WDYA

The complex structure of e113a with cellotetraose
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
296
structure length
296
Chain Sequence
YHLVDDYGRGNGFFDKFNFFTGDDPTHGYVDYVSRDVAAGAGLIGERDGRTYMGVDFTNPASGRGRRSVRLESKNTYEHGLIVIDLAHMPGSVCGTWPAFWTLGTGDWPYGGAIDIIEGVNDNTFNHMVLHTSDGCTIDNDGFTGNLKTSNCYVYAPGQDANAGCGIEATDPNSYGKGFNSIGGGIYATEITPNGISIWFFPRGSEPGDVLGDNPNPANWDTPAAKFAGGGCDWEGKFNAQRLIFDVTFCGDWAGNVWGIGGCASRAANCVDFVRDNPSAFAESYWLVNSLRVYAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-1,3-1,4-glucanase
publication title Structural and mutagenetic analyses of a 1,3-1,4-beta-glucanase from Paecilomyces thermophila
pubmed doi rcsb
source organism Paecilomyces
molecule tags Hydrolase
total genus 76
structure length 296
sequence length 296
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wdyA00
4Q8KA 2DWRA 5F5QA 1APNA 1LOBA 2ZA9A 2P3JA 3UL2A 3WHTA 1Q8SA 1S0DA 4M3CF 1CJPA 4W65A 3TB0A 1SBFA 3ENRA 3M2MA 2DU1A 3ZSJA 1KJLA 2D44A 5IK8A 3N7KA 1IKQA 4YGEA 3WDUA 2GN3A 5GLUA 2EF6A 1V6OA 1AZDA 1AX2A 1S0FA 3N35A 1ULDA 3WZ1A 1CQ9A 3APBA 1O4YA 3WCRA 1N3QA 2DTYA 2W39A 4P14A 2ZBJA 1GLHA 4HL0A 4BPZA 3IPVB 4YW5A 1SLTA 1MZ6A 1G9DA 2ZGUA 2UWAA 3IM0A 2ZACA 1BQPA 2D6MA 3FBYA 1IKPA 2UWBA 1LOCA 1G8WA 2EAKA 3OJBA 3AJZA 4YGBA 1YIFA 5JVVA 3SH4A 3C2UA 1Z78A 4Y1VA 1YRZA 2VXRA 2GMEA 4XXPA 1IOAA 5FRAA 4YZ2A 3ZSKA 2A71A 1AX0A 2D3RA 3OYWA 1SLIA 1QGLA 2EXHA 2ZGQA 1UAIA 2ZGMA 3NV2A 4K1YA 2DV9A 2ZHKA 3POYA 2JDZA 1HLCA 3JUUA 1WW6A 2ZGLA 2ZMLA 1QKQA 1JOJA 1LU1A 3D4KA 2JKBA 5T5PA 3DUIA 1W6NB 1LEMA 1FX5A 1LOFC 1VIWB 1UPSA 1WLCA 2JJ6A 2WNEA 2WLQA 1OQ1A 4PCRA 5IK7A 4C1XA 3USUB 1W6OB 3FUOA 3VKFC 1DHKB 2R1BA 1LOGA 4FPCA 2I2SA 1DQ5A 4HANA 1DQ0A 4Q1PA 1YYNA 3W59A 5E88A 2Z42A 3ASIA 5CNAA 1W6QB 2GMMA 4BM8A 5CAZA 4YM3A 4LBJA 1MVEA 3OY8A 4M3CB 4YLZA 2NP0A 3ILFA 3V64A 3RG0A 2P37A 4Y26A 2D43A 1QU0A 2ERFA 4FPJA 2AREA 1FV3A 3GNEA 4SLIA 2ZKNA 1MS5A 1BKZA 2DUOA 3WDXA 1V00A 4OZXA 4FPOB 2CWMA 2D7FA 2E6VA 4YGDA 5HCFA 1C57A 2P34A 4DS0A 1N1YA 2UURA 1B09A 1CIWA 2JECA 2NMNA 1QF3A 1S0GA 1J1TA 2CTVA 1BZWA 2EXIA 2ZHLA 3PVEA 4XE9A 4XIKA 5IK4A 4M00A 2VU9A 1GICA 1ENSA 1LEDA 1I3HA 1GZ9A 1GBGA 1GNZA 2C9AA 1XQNA 5GJ6A 4YFWA 2D6KA 4FQ4A 5T52A 2ZHNA 4JCKA 3U4XA 2G4IA 1JN2P 3T1LA 1DFQA 1N1SA 5LK5A 4MYEA 1Z0HA 1OKQA 3NV4A 4LBLA 3V65A 1RIRA 3FFZA 4XZPA 5JOWA 4WVWA 1DQ1A 1Q8VA 1V6LA 4XOGA 5H9QA 3RRDA 4FOYA 3POSA 2WSUA 2A6XA 2DURA 1AXKA 4Y1UA 2YMZA 3WG2A 4FQZA 4Y20A 1C1LA 1MVQA 1RINA 3WDTA 1SLLA 5F9TA 2V5YA 4GWMA 3AXEA 1G86A 1Q8QA 2R1DA 4I30A 2EALA 1LGCA 1NXD1 4XMIA 1V6MA 3VKNA 1HDKA 1UX6A 2EIGA 2EXJA 3IMNA 4TZDA 3QLQA 4WZFA 1LGNA 2R0HA 3IN9A 2JD4A 4Y1ZA 4Q8LA 3FLPA 1A8DA 1DZQA 5JDBA 2YV8A 1LECA 2OUJA 4NO4A 1SFYA 1Q56A 1WW4A 1QOTA 2E53A 1AX1A 3MW4A 1FNYA 2ZGNA 5GALA 5BYNA 5IT6A 3N3HA 2VH9A 3PMEA 2CL2A 5HCAA 1G9BA 1V6KA 1H30A 4Y22A 3RQ0A 3ZSLA 1DYPA 2V73A 4F83A 5JOXA 2ZZJA 1TEIA 2ARXA 1S1AA 3A0KA 4LBNA 5KXCA 1FATA 1QOSA 2WT2A 3M1HA 1KITA 2D3PA 1S0CA 4U2AA 4FPFA 3WG3A 3ZVXA 1KDMA 1O4ZA 3D5OA 1MS3A 4BLJA 5T50A 1UZYA 1SBEA 1ZA4A 1Q8OA 3O5SA 4FP2A 2E7QA 3V0BA 3VKLA 1Y7BA 4YG0A 4JRAA 2OVUA 3GALA 2D6OX 1LENA 1WD4A 1MS8A 4YM2A 3AZVA 1WUVA 1VAMA 2OUHA 3AP5A 1QNYA 2A6VA 5GZDA 3I8TA 3R05A 3FUQA 4UW3A 3AP9A 2PHWA 1WD3A 4WV8A 1W6MA 2A3XA 3MW3A 5GLTA 4Z8BA 1JYIA 2W08A 3INAA 4XJUA 4M01A 3O0VA 1WW7A 5H9SA 2PHXA 4PBOA 1W0PA 4YZ1A 2WT1A 3NWKA 4AYUA 1HKDA 5FREA 3I4IA 1URXA 1W6PB 4XILA 2D6PA 2YXSA 3A0NA 2W68A 3AJYA 3ATGA 3AXDA 4XYXA 1SACA 2GNMA 1WLDA 1LOEA 3AP6A 4AWDA 5DZEA 3B3QE 4FOQA 3B9CA 3KQRA 3WDWA 5IK5A 2D3SA 3VV1A 5L73A 2WT0A 3VUOA 2TEPA 4Y1XA 2A6ZA 4ISQA 4ATEA 3SH5A 3ZPYA 2GALA 4LBQB 3IPVA 3NV1A 4DFSA 2A3WA 3PVOA 1GKBA 5CBLA 2GNDA 2E51A 5DUUA 2A7AA 5H9RA 3N7LA 1LHOA 4AVTA 4AVSA 1BJQA 5H9PA 3POWA 1JBCA 2GNBA 1PZ7A 2D6NA 1LCLA 3Q9OA 4FPEA 5KXBA 1LGBA 2FMDA 1PZ8A 5GLWA 2AH2A 2PHTA 4FPGA 1LHUA 3DGTA 5DUXA 1F5FA 3T1MA 3WG1A 4XHXA 2VW1A 1S0IA 4CZSA 3UJQA 1QOOA 3TAYA 4LBKA 1ULCA 1WBLA 1W6NA 2NMOA 3H0OA 5T5LA 3CNAA 4ZXKA 3B00A 3USUA 1W6OA 2SLIA 4LBQD 2CWSA 1F9KA 3ILNA 1QDOA 2P3IA 3N7JA 2NM1A 3ZYRA 5E89A 5T55A 1UN1A 4WVVA 1KRIA 2NN8A 2FHRA 2VW2A 1OFSA 2GN7A 3AYEA 4LBOA 3SITA 1W6QA 4YZ4A 1AXZA 1CPMA 4DRVA 2WSVA 2OW4A 2PHRA 1NLSA 1FYUA 5DXDA 5DG1A 4XMAA 3WNXA 3ZXEA 5HCBA 3VKOA 2DVDA 4Q27A 3SNMA 1GNHA 1LESA 4GA9A 4YM0A 5T5OA 1ZM1A 4NOTA 1LHNA 4M3CE 5JLVA 2A5ZA 1FNZA 2H0BA 1V6IA 1GZWB 1SCSA 2W52A 4XTPA 3MW2A 4YG6A 2WJSA 1MZ5A 4UW6A 1MS4A 1H9PA 1C1FA 4DRRA 1S0JA 3UK9A 1ULEA 2DVBA 3PJQA 1SBDA 4FPYA 4RL7A 4AVVA 4XJ9A 1UZZA 3RMYA 1UL9A 1S0BA 4YGCA 1VAVA 3KM5A 3LSDA 1CR7A 4YW4A 1LHVA 3RSJA 1WW5A 3M3QA 1LJ7A 1AF9A 4FP3A 4XDQA 3O12A 3ZXFA 5GLVA 1QMJA 4DQAA 1LOAA 3AYDA 4P9XA 1IS6A 1YI7A 5KXEA 4XBLA 1ENRA 1ENQA 3AZWA 3PVNA 1MS9A 3MPPG 3OPZA 2VW0A 3SH3A 1UKGA 1X50A 3WHUA 4ITCA 4FPLA 5SV8A 5JMCA 2B7YA 1D2SA 5DG2A 1G9AA 5DZGA 1FV2A 1HQWA 2ZGPA 4GKYA 2ZABA 2NZ9A 1JHNA 5DUVA 1C4RA 2YZ4A 2A70A 2SBAA 4Q2FA 2ZGSA 1W0OA 5GZFA 4P9YA 2A6WA 4DPNA 3V0BB 1G9CA 2JE7A 1CESA 1RITA 4ISRA 5GM0A 1DYKA 3OBRA 2RHPA 2ZHMA 1JXNA 5AVAA 3WUCA 1GV9A 1N3OA 4BQ1A 1N1VA 4AGVA 3WG4A 4UW5A 3RMXA 1KJRA 5DZFA 3WCSA 3ZXKA 1DLLA 1GSLA 4BLIA 4XJZA 3AZYA 4R9AA 5GZGA 3AYCA 3ZSMA 2XG3A 4K1ZA 3SLIA 1QDCA 1QNWA 2R0FA 2AR6A 5DUWA 4PBPA 1LU2A 3D6EA 4BOWA 5GZCA 1MS1A 3HMYA 5CB7A 4CRQA 2XB6C 1LOFA 3AK0A 2ZGTA 5JOYA 2DVGA 3WDVA 1YO8A 2ZGRA 3OYWB 4FVVA 3AZXA 5EYXA 4XHBA 4KBBA 1WCSA 2AUYA 1PZ9A 1H9WA 2KM2A 1KDKA 4R9DA 4ZKTB 3ILRA 4L8QA 3WOGA 2EXKA 1D0HA 1LULA 3W58A 3M3CA 2PELA 2CY6A 2P3KA 2Q5TA 4XBNA 3B01A 4XXAA 1N3PA 1EPWA 2ZGKA 4ASMB 1V6JA 4GKXA 4YM1A 5EXOA 3FLTA 4R9BA 2GNTA 3OY8B 4YW2A 2ARBA 1G7YA 2NYYA 1GZCA 2DUQA 2PHUA 4FPKA 4Q1RA 4XTMA 5JOZA 5GLZA 3WV6A 4FOVA 2UWCA 1MACA 2A6YA 1W6PA 3QCWA 1BYHA 1SLAA 1SCRA 1GANA 4Q26A 3AYAA 2A3YA 4YW1A 3WDYA 3V0AB 2VY0A 5T54A 3AP7A 3A4UA 4YW3A 4K20A 2D6LX 2VUAA 1R1ZA 4PF5A 1JW6A 1SLBA 1VLNA 3AFKA 4BMEA 2ZAAA 3B69A 1AXYA 4LBQA 5EWSA 4YZ5A 1CPNA 3BIWE 2R16A 3HR9A 1AJKA 1U0AA 1LTEA 2GMPA 2DVAA 2LTNA 4JC1A 5CA6A 3AZZA 3M3OA 1AVBA 2AENA 2DUPA 4P9WA 4ATFA 4BMBA 5KXDA 1CN1A 1IS3A 2YROA 2ZGOA 2YY1A 4UW4A 4M3CA 3AP4A 4XBQA 4AGGA 4GALA 1YXWA 1ULFA 4GWNA 1N47A 1WBFA 4XJWA 4Y24A 2CYFA 1VALA 4FPHA 4Y20B 3AX4A 1AJOA 1SLCA 5GZEA 1DQ6A 4CTEA 4Y1YA 1IS5A 2E7TA 4AGRA 4R9CA 1I1EA 2JE9A 1DIWA 1S0EA 3IKWA 4IQPA 4U36A 3O0XA 3OBTA 4FOWA 1N1TA 4YG3A 3MEPA 4YZ3A 1DQ4A 1JUIA 1LODA 1G9FA 3L2YA 3LSEA 1HQLA 3ZXJA 3V0AA 1DQ2A 1CVNA 4XJAA 4XIOA 3T2TA 3R4UA 3BODA 4GXLA 4PQ9A 4RA0A 3LCPA 2AGSA 2ZMKA 3UJOA 3R4SA 3ZXLA 1ULGA 2HYKA 2BQPA 3NV3A 1IS4A 5E8AA 2DTWA 2CNAA 2DYCA 4Y22B 1FAYA 3VKMA 1Q8PA 3WLUA 1JYCA 1DGLA 1LHWA 3N7MA 1KQRA 2PHFA 3N36A 4H55A 3O0WA 4XJ8A 5EYYA 1GZWA 5T5JA 4YFZA 3BTAA 1DBNA 1BXHA 2DU0A 1MR5A 1F31A 2A75A 4LBMA 1UMZA 2WQZC 3ZYPA 4K21A 2WKKA 3FLRA 3JU9A 1ONAA 3RS6A 3BOPA 2AYHA 1V6NA 2GDFA 1A78A 2LALA 2ENRA 4D69A 3SISA 1A3KA 2UU8A 1GYKA 2P2KA 3HN1A 3WUDA 1MS0A 1WLWA 2ZMNA 1CONA 2R49A 3OGGA 5IUQA 4C1WA 2C5DA 4TYSA 3WVJA 1W6MB 3M3EA 2ES3A 2DVFA
chains in the Genus database with same CATH superfamily
4RSUA 2DWRA 3KF5A 5F5QA 5BNOB 2Y6FA 1APNA 1RUH3 3WHTA 4Z2AA 3J7MA 5FXVA 3FL7A 2R6QA 2VZOA 1CJPA 4JX0A 4MH0E 1SBFA 4PI2A 2QTWB 5TSWA 2HWE1 3I59B 2VE1A 3N7KA 1F2NA 3QOPA 3RWNA 4GWJA 4IV1B 1AX2A 2CAUA 4KWLA 4OHYA 3IZOA 2W1SA 3SMHA 1CQ9A 3VDAA 2CSGA 1RUI3 4LKSA 3E97A 5FBZA 5FY7A 1HJGA 2WYFA 3WCRA 2ZTNA 4QDRA 1N3QA 2RM21 1UY3A 2W39A 4P14A 5FYUA 2BYVE 4GH4A 3ZFEC 5A1FA 4CEYA 1W8OA 1HV0A 1G9DA 1RMU3 2ZGUA 3LF7A 1ZNPA 2P5BA 2EAAA 3I7DA 2ZACA 3FBYA 1XU2A 1IKPA 4AFCA 1LOCA 5JVVA 5L9VA 3BTYA 1QJU3 4Y1VA 1YRZA 1XNBA 2X8KA 3OPWA 2VZQA 1O3QA 3N9QA 4QM9A 3BPSA 4XFAA 5FRAA 1MEC1 1EAH2 1AX0A 1DGWA 3VBUB 4XIOA 4XTMA 5FMBA 1QJX2 4NIHA 1DG6A 1HLCA 3JUUA 5A33A 2ZGLA 1JOJA 1T6BX 1KXGA 1FX5A 2WNEA 5DAPA 5JR7B 2WNVB 3POIA 4FBFA 1YQCA 3NJZA 4NUBA 4UXAA 3FUOA 3UT0A 1DHKB 2R1BA 5FYSA 4AFBA 2RS33 2TNFA 4FPCA 1FPN2 3LQCA 3WP6A 1T2XA 1ZRRA 1GOFA 2V5DA 4BB3A 3MIEA 3K3NA 1F4AA 1OSGA 1ZZ9A 5A7WB 5CNAA 4CEYC 1NCRA 1OMIA 4YM3A 4E4ZA 3BTZA 4P00B 2VTXA 1O5LA 3M4FA 4EV0A 3MYXA 2BPA2 1H4GA 4LOTA 2D43A 2ERFA 4OMCA 2AREA 1QJEA 3GNEA 4E2QA 2ZKNA 4XFFA 1MS5A 2XVGA 2XKPA 5F3IA 1NZCA 3VBSA 2VQTA 3MUZ1 2D7FA 4C0HA 3PU8A 1C57A 2ZEWA 2PQSA 3UGHA 2D5FA 2UURA 2XQRA 3OB8A 2VNGA 1XXNA 2EXIA 1Z7S2 1K5JA 1HJFA 2CTVA 5EV7A 5IK4A 4HXCA 4M00A 4BHPA 3RZKA 4XQ4A 1GICA 1X9PA 3WNPA 3H3ZA 1DZRA 1I3HA 1GZ9A 2VGDA 3K3OA 1ND3A 5CISA 5LCWL 3WX5A 4JCKA 3U4XA 2G4IA 2IVJA 4XEZA 5CG8A 4JDNA 5JI9A 3UNPA 4WVZA 2B4KA 3LGRA 5FAXA 3CMGA 2BNNA 1R1A3 2RDQA 4LBLA 4YW6A 3V65A 3W20A 4XZPA 4RGAA 3GF6A 4A41A 1V6LA 2J1EA 4XOGA 5L9BA 3RRDA 3E6BA 3JQXA 1QJY2 4JGZB 2A6XA 2XJRA 2DURA 1NCRC 4Y1UA 2XJSA 5FXWA 3UGGA 4AI8A 1XSQA 3MPBA 2B8MA 4JAAA 3WDTA 3JD71 1SLLA 1AYN2 3J7LA 4A6SA 5A6XA 4LIUA 3AXEA 1G86A 1X36A 4I30A 4JKMA 3VKNA 4UFJA 3VBSC 4QX5A 1HDKA 1UX6A 2BW8A 2EXJA 4IV3A 4O65A 3S5AA 4QMAA 4Y4YA 4A7YA 5A7OA 5LW9A 5ACA1 1LGNA 2JDKA 1E5SA 1DZQA 1JOPA 2QQUA 3RZJA 1WW4A 4AFDA 1SPPA 1AX1A 2F6BA 3LIHA 3U11A 1YFXA 1AR72 1RYYA 1EUTA 2GU9A 3J7NA 3ZFFC 1J84A 4UAPA 2VULA 3I2IA 5FXXA 1IG0A 3VD5A 1OD5A 1RUF2 2WIIB 4Y22A 3ZSLA 2V73A 2WZPP 5JOXA 5FYTA 1ZBA1 2JICA 3Q8BA 1PNGA 3IAQA 1SQ4A 3POBA 4LHKA 1UW8A 3Q8FA 5FYCA 3RYRA 4GD4A 4BLJA 1H8TB 2IXLA 1YQ5A 3NJXA 3Q8EA 5LBBA 1DCSA 1Q8OA 5FQ0B 4AF9A 1NT0A 3VKLA 1Y7BA 2WZR3 4JRAA 1WMFA 3GALA 3JCIA 2D6OX 3KGLA 4IV3C 1LENA 4AR2A 2XBO1 2PAKA 2XH6A 3K4ZA 3GJBA 3AP5A 1QNYA 4WM8A 2WO2A 1RUD2 3I8TA 5GZDA 4J6GA 2JG8B 4UW3A 5J1XA 1HXS2 1PMJX 1WD3A 1MQTA 1CAWA 2PHWA 1NXMA 2BERA 3MV01 4D7SA 1JYIA 1C8M3 1UPIA 2D98A 4A4AA 4XJUA 1TQ5A 2OX0A 3O0VA 4FCAA 5JPNB 1SDDB 1WW7A 3ZN6A 5H9SA 2JE8A 3VZJA 4YW7A 2I74A 2PHXA 4PBOA 3VBOB 3ZR6A 1HB1A 3JBG1 3NWKA 1GZTA 5T3NA 4NIDA 2J1AA 1UY2A 2C9KA 5FREA 1BBT1 4EROA 3VDCA 1AYM2 1LR5A 5IAVA 4L2NA 4BIOA 2WS91 4XAEA 1W6PB 4HPKB 4XILA 3VBRA 3WY6A 3HNBM 5EPAA 1H8VA 1W9FA 4XAAA 4JKLA 4YRDA 5DQ0A 3SCFA 5ABJB 3MF6A 1E5HA 4FOQA 3WDWA 4HT1T 5JXIA 1W04A 5KHKA 2E31A 1XNDA 1UXZA 1ALYA 2RE9A 5LK7B 4XFHA 4OI2A 2TEPA 5IVFA 1CD3G 3SH5A 2Y6HA 4KI5M 1W9WA 3PVOA 1VB2A 2VOTA 2VQ0A 3VZKA 4FTBA 4WM8C 5H9RA 5IVBA 4KL1A 2Q30A 5H9PA 2RVAA 2BUKA 1JBCA 2GNBA 3ORJA 1MQTC 4QXBA 3BOWA 2Z4FA 2Y0IA 1H4HA 1PZ8A 5GLWA 1HB2A 2YFZA 3J7HA 2Y8KA 3DGTA 2CGOA 1F5FA 1TME3 5DDJ2 3ZM8A 4EJRA 5J3UA 3PU3A 1J3RA 4BXSV 1CAUA 2QZ2A 1S0IA 5FPXA 5IVCA 2AC1A 3UJQA 3DEMA 3WP3A 1IPKA 1VR3A 2ILMA 1ULCA 4M0HA 3VBRC 2GH8A 3MDPA 1W6NA 5C8CB 5KHJA 1NUKA 3EXUA 5I0DA 4QQLA 3CNAA 4YWAA 5IVJA 4NHXA 3S7IA 1YQ6A 3ILNA 1QDOA 3N7JA 4XF4A 2N7GA 4CCMA 2YBSA 5E89A 5A3NA 1NE4A 4HLTA 1XOYA 5F7UA 2KD7A 5FZ3A 1UCXA 3AYEA 2GN7A 3LKJA 4H2AA 5FZCA 5FYHA 2XJUA 1W8TA 4QXCA 2OW4A 1EAH3 5JWPA 3LEGA 4QPIA 4CCDA 5DXDA 1QJX3 3VKOA 5I8TA 2K2SA 5CZKA 1ASJ2 3RZHA 5F6KA 1ZM1A 4M3CE 2IVIB 2FDKA 3OGJA 2VXJA 2J42A 2XJPA 5FZ7A 3K77A 2HWF2 3AVSA 2W2IA 1FPN3 1MZ5A 4OUMA 4XC9A 1C1FA 4DRRA 3EJKA 1ULEA 4LE4A 5E6HA 1SBDA 4XJ9A 3N9PA 1FXZA 3ZFEB 1R64A 4MXWB 4LHSA 3N9LA 5A3TA 4EE2A 3MFAA 4CXWA 3KM5A 4EZHA 1XNAA 1LHVA 5CFDA 4XDQA 2WNUA 3GBGA 2HWD1 1QMJA 2HBUA 2W95A 1BEV1 3VD9A 1W8ZA 4ORFA 4LHNA 4S2DA 1ENQA 2XLFA 1JZ8A 1OVPA 1MS9A 2XGXA 3MPPG 2VW0A 4QQ2A 1COV1 1X50A 1Z7S3 4FPLA 2B7YA 3VDDA 2W94A 4QPIC 2DDUA 5DG2A 4KGGA 2JDPA 1FMD3 3F2ZA 4QKFA 4XFCA 2R32A 2BZDA 2AEYA 2A70A 2NPIA 2SBAA 2UY9A 2VZVA 2XVLA 4KWJA 3RI9A 4AHYA 4DB5A 2ZGSA 4D6QA 2VVEA 2VBDA 3TNQA 3V0BB 4S2GA 5D21A 2UYBA 1XNCA 1Y43B 4MLOA 4QB6A 2Y38A 2IXKA 5FUPA 4P5HA 3H7JA 2FDHA 5GM0A 1DYKA 1YFUA 3I2HA 3OBRA 4GJYA 2CV6A 2RS13 2ZX0A 3I3MA 1N3OA 1QJY3 3IWZA 3OSDA 4GB33 3HPNA 4GH4B 3ZR5A 4E2GA 3RMXA 4L99A 5DZFA 5C71A 4PLOA 1PVXA 2JEMA 2OA2A 3WF0A 2Y0OA 5APAA 5CFDC 2WNUC 2RMU2 4UFLA 4R9AA 4Q0PA 4X6QB 4XF9A 1UXXX 5I8YA 4OI0A 1TVGA 4XZUG 1QDCA 1QNWA 4AI9A 4FXGB 3CLPA 4JRLA 1LU2A 2LW8A 3D6EA 4CCEA 4DUWA 4K7JA 5GZCA 3WW1A 3OEBA 3RPQA 2K46A 5JOYA 3WDVA 5FP4A 3EMRA 2ZGRA 4HSJA 3LDBA 1RUG1 4KBBA 1D0GA 4N43A 4XHBA 5FPLA 5A33B 2P6CA 2WN3A 4LOSA 4OI4A 5EIYB 1H2MA 4URAA 1PNFA 1PM7A 1UNBA 2ZZQA 3D0SA 4N7IA 4N8MA 4LUMA 1R083 2EXKA 4I0WB 1RUOA 1ZRDA 4K8FA 3ZYHA 2QDNA 3B01A 1QIQA 1L7LA 1N3PA 1PK6A 4XXAA 3RVHA 3WSOA 1C5IA 4ASMB 1PO11 1V6JA 4Y5Z0 3UESA 4TLFA 3LOBA 2WWJA 1J3QA 1NCRB 2JDNA 2QVSB 4R9BA 4YW2A 3VHRA 1AL23 2JDUA 5FZ9A 1GZCA 2DUQA 3OBAA 1DGRA 2HWB1 3MIGA 3U10A 5GLZA 4LE3A 2OZ6A 5JOZA 1JTZX 3VBSB 5IW0A 4Q0QA 1SCRA 3BI3A 1GANA 3LEIA 5FZHA 1XC6A 3WDYA 3R4DB 1RUD3 1UYZA 5T54A 2BEOA 3A4UA 3NL1A 4NHKA 4AQTA 1D7PM 3E5UA 1JUHA 1R1ZA 2NLRA 3C7EA 3PTYA 1SLBA 2JB8A 4OQ8A 1ND3B 1O5UA 1VLNA 2RM22 3VL9A 4BQWA 2ZAAA 4MG2A 4QQPA 3ME2A 1B35A 3ZXKA 2GMPA 2G9GA 2IFWA 5K0UB 5A3LA 3NRUA 3KQ4B 1D4M1 2ZPXA 4QX8A 5K4LA 3I49A 1AYM3 2DUPA 5A80A 5A7WA 1MPXA 3P6BA 1PK6C 4LIVA 4Q4W2 4MOAA 3U07A 3B9IA 1JYNA 1VPHA 1UU5A 3VZMA 3VD4A 2PHDA 3OD4A 4BXFA 2QFEA 2RJLA 4NWVA 4IE4A 4DUVA 1NG0A 1OD3A 1MEC2 5GZEA 1NZIA 4PI0A 3W9AA 1DQ6A 2VMIA 4Y1YA 1OLMA 4CYDA 4K3UA 1ZBE2 2R071 4AGRA 1I1EA 2JE9A 4CP1A 1RUH2 4IV3B 5KR7A 5FMDA 3DN7A 3Q8CA 1H2KA 3OBTA 1S2EA 3VL8A 2Z5WA 5F5IA 1ZX5A 1LODA 1OLME 5F8PA 1RXFA 3MUY1 4MHUA 4NPRA 3KCCA 5I0TA 1O8PA 3SXWA 3R4UA 1SPPB 3W5MA 5F5CA 4IDZA 4QHBA 5FCCA 5FY9A 4BIFA 3UJOA 3QACA 4NROA 1B35C 4QX3A 2VUJA 4P02B 1S4CA 2JIJA 4OZOA 3ACHA 3NV3A 3JB8A 5D2AA 5E8AA 4B1MA 1L7RA 1VRH1 4Y22B 3VKMA 4HVOA 3AL5A 2OIIA 1DGLA 4ZS3A 2WFF2 4XJ8A 3TNPB 1EP0A 1ULOA 1QH6A 1PGW1 2JD9A 4Y3OA 2BGPA 5EYYA 4CCOA 4QDSA 2WRAA 2EVXA 2HWC3 4COUA 2QQLA 3M3IA 3ZYPA 3MGUA 3CZUA 1OUSA 3O1UA 1W03A 2WKKA 3FLRA 3JU9A 2HLEA 4L0PA 2O8OA 3SEPA 2HYXA 1X9TA 5BNNB 1A6CA 1VBE3 2GDFA 1A78A 2LALA 1F5JA 1O6UA 2XOMA 3AVRA 4HSLA 1A8MA 3B94A 4MADA 2UU8A 1GYKA 1RHI1 4OYUA 5A1AA 5HV0A 3H3UA 1AR81 1MZEA 1F8VA 2CU5A 3RNSA 3E6CC 3WF2A 1LB2A 2G9ZA 4WM8B 2R49A 2YBPA 3WXPA 4AI1A 5B4NA 4LHLA 4RS5A 1MQTB 2GAUA 4IL7A 2ES3A 3AMQA 4Q8KA 2JXAA 1JI6A 1LOBA 2HWF3 3ZN6B 3T4HB 1Q8SA 5DAXA 3AMMA 3GHNA 2BFUL 4W65A 2RS32 5E1RA 2KA3A 1IKQA 3JD72 4YGEA 3ZYFA 2GN3A 2IXCA 5GLUA 4PJYA 5FWEA 1V6OA 1AZDA 1VMFA 5FOJB 3BKZA 1O3SA 3H8RA 5JZGA 1C3HA 4FFIA 2R7EB 4UFIA 4AAPA 5EFUA 4AHXA 4BISA 1VAKA 1JU4A 3O7OA 4CPBD 4RFRB 4XQWA 2ZBJA 4ZXEA 4EN9B 4LKEA 1W2AX 3WW3A 4E8DA 1WZXA 5CFCC 1M06G 4AVCA 1SLTA 5DAQA 1PGL2 2WFPA 2V72A 1UYYA 3B7MA 4XW3A 2JG8A 2UWAA 3IM0A 2PQQA 1KS5A 3S7EA 1GOHA 2C6SA 2UWBA 1UOFA 2EAKA 3FHQA 3OJBA 3AJZA 4RS5C 4YGBA 3C2UA 4EYUA 1ZYBA 1PO23 2XMLA 3O14A 4XXPA 3WINE 1GU3A 2JENA 2VMDA 3RYPA 5CG9A 3D3AA 4QX0A 1K5MA 4OHWA 1CAUB 1R1A2 2D3RA 2QNKA 2ZGQA 2ZGMA 4NE9A 4H14A 3LFIA 2R063 3LAGA 1W2UA 1WW6A 2RS51 1QKQA 5T5PA 1O7FA 2F4PA 1W6NB 1LEMA 1HQNA 1LOFC 1UY0A 1VBC3 4KU8A 1HRI1 4PCRA 4DINB 4PIXA 2ZAHA 4ZHNA 1EV11 1OH4A 2XBO2 3BCWA 4FAHA 2RMU3 4G3YC 4QAWA 1LOGA 4LUKA 3BB6A 5CFCA 4EWEA 2Y64A 1GP6A 1HB4A 2JX9A 4HANA 4Q1PA 1ZREA 5FUNA 1OLRA 3ZYGA 3ASIA 4INDA 4ASKA 3VB9A 5CAZA 2WO7A 3OY8A 4HG6B 4M3CB 4QPIB 3ACIA 2ARAA 2JG8C 4AVBA 2OPKA 3JBG2 2W91A 4LR4A 4YSFA 2BP6A 3CU7A 1STMA 1QU0A 3ACGA 5IUQA 2VECA 2QQPA 1UMIA 4KU7A 1BBT2 2FMYA 2J22A 3E5QA 2OXBA 5FZBA 2XJTA 4FPOB 5KC6A 2DBNA 4DS0A 1TMF3 2P34A 4DXSA 2ZHLA 4I3PA 4META 3ZXGA 1J1TA 3PTRB 1BZWA 4PIYA 1K5MC 5EHDA 4B8EA 1FOD1 2B46X 2GP5A 2VU9A 4NMIA 1GBGA 4QXKA 3SCGA 5GJ6A 5CU1A 4YFWA 4O61A 3I3EA 5T52A 3QH6A 4CXXA 4IUGA 1UO9A 1JN2P 5J36A 1DGRN 1RTVA 2WNUB 3HAGA 2HWE3 4XVHA 3FFZA 3ES4A 2HEYF 1HV1A 1Q8VA 4BYYA 1HRV1 2DCYA 3PHMA 4FOYA 1RUC1 5FZOA 5BNPA 3WQ0A 4IE0A 1JS9A 4AEJA 3O1OA 3VDDB 3HJRA 1Y9GA 3OD0A 3T4VA 2RM23 3FWEA 4AVAA 4GWMA 1C8M2 5J48A 4V2WA 1Q8QA 1YFYA 4G4FA 4XUTA 1GQHA 1HIXA 3USSA 3L9JT 1VBB1 4TZDA 5D8AB 2YYOA 2XR4A 2VBPA 3BGAA 3QLQA 3ZLIA 4WZFA 2JD4A 5CADA 4FI9A 5IHRA 1XE7A 2VMGA 4P08A 2WYSA 1L3JA 1WMEA 1LECA 1PVC1 2OUJA 3BN6A 1SFYA 4CCKA 5C8CC 1QOTA 1FNYA 2ZGNA 5IT6A 4CCCA 2A1XA 1UOJA 2FCVA 2J1RA 2VH9A 4R8HA 1MEC3 4V2VA 3WQ7A 4MGIE 1NX9A 3FHAA 5HCAA 4IEQA 4LJHA 4XFIA 4CU6A 5J37A 5KWRA 1ZBE3 2B9VA 5FYBA 5I8SA 4UFMA 4CCLA 4CP2A 2VZSA 4COWA 3ZKUA 2P17A 1ZZ8A 2ARXA 4KNCA 1QOSA 4ASLA 2D3PA 2C24A 5F2WA 3WG3A 3VHNA 1Q3EA 3MLJA 4RQPA 4F3JA 3AB0A 1SBEA 3GZEA 1RGSA 1ZA4A 4W8JA 3WEZA 4LNVA 3I54A 2E7QA 4N43B 4P9LA 3CJXA 4QQHA 3AFGA 4QGLA 3V0BA 3KHCA 5FR3A 3LA3A 4XUQA 4YG0A 5AC91 2PTMA 1TME2 2G19A 2VZUA 3AZVA 2XLAA 4HKOA 2W9XA 2OUHA 5BV6A 4EN0A 3EO6A 4IW3A 2HWD2 2WO3A 3AP9A 3N9OA 1PX3A 3AKSA 2WFF3 1PK6B 5GLTA 4Z8BA 1OF3A 1UU4A 5LBCA 3INAA 4JHZA 4A44A 5C3RA 2QJVA 1W3VA 3NKTA 1COV2 4DEVA 2YPDA 1W0PA 2WT1A 4ZZ5A 4AK3A 4AYUA 4HONA 3T0AA 3U78A 2QCSB 4NAOA 3J8F1 2ZEZA 3AJYA 3AXDA 4FFFA 2IUWA 1WLDA 4AQSA 5C3PA 4AEDA 3B9CA 3KQRA 2LRPA 2RR11 4BDVB 2RJ2A 3J4UH 2J1UA 3ZMOA 2QKDA 1X8EA 2EIDA 4URTA 3WR0A 1R091 4Y1XA 1POV0 1JHJA 2A6ZA 3K2OA 4F8AA 5LWBA 3AMNA 2GALA 4TSVA 4B4RA 4DFSA 1B35B 4I3GA 2GNDA 2QBXA 5A7QA 5IVYA 5FZLA 5DUUA 3IMMA 5JIUA 1POV1 2GC1A 3I2DA 4HKWA 1YIPA 1BJQA 3JD73 3KGZA 4L97A 5SV5A 1LCLA 3Q9OA 4GH4C 5KXBA 1LGBA 4GJZA 5EP9A 4DZGA 3DXTA 5FFOC 3H8XA 3AKQA 2XHKA 4HMZA 5DUXA 1LHUA 2DFCA 3WG1A 1GR3A 5ACA3 4QGNA 3KMHA 1GWMA 1DU3D 2VW1A 2VCCA 3GYDA 1JU3A 4UBGA 4CZSA 3O1VA 1YFWA 2XVKA 2GC0A 2MEV2 3GZTB 2RV9A 1ZZBA 5T5LA 5B2GB 3H7YA 4LK6A 3B00A 1YHFA 2SLIA 1QY4A 4AEDC 1F9KA 1FMD2 2WA3A 3H1YA 1UYPA 1EUUA 3AM2A 3LIGA 3ZOIA 4E27A 3ZYRA 5T55A 5FMOS 4WVVA 1BMV1 5JXJA 2NN8A 1ZBA3 3T30A 2YGLA 2VW2A 5IJRA 4JQRA 3SITA 3M70A 1QJZA 1UZWA 1J83A 1PO12 1AXZA 1CPMA 3FJSA 4HBNA 5K0UA 3VZLA 2DCZA 2GH2A 1AR61 1NA1A 2EA7A 2Q8OA 3WNXA 4OULA 3ZXEA 2FDJA 4IESA 2RS12 3TWIA 2HWB2 2O0OA 1GNHA 2VMHA 4UI9L 4GA9A 3DV8A 3SQOA 4GB32 3WNMA 4NOTA 2A5ZA 4CUGA 1OPMA 2XKOA 2H0BA 1V6IA 1QJU1 2XBO3 2W52A 3P3PA 3FHIB 3H9AA 4DXTA 3THTA 3ZN4A 2WJSA 2RDRA 4HZFA 3BU0A 2DVBA 4FPYA 4PLNA 4RL7A 1UL9A 4CCJA 5CFCB 1S0BA 3A23A 4PDWA 3CBNA 3VLBB 4YGCA 3O1MA 3E6DA 3LSDA 1CR7A 1GUIA 4Q4X2 3JBG3 4N90A 3BALA 2CGPA 4ZU5A 3N9NA 4OI1A 1BBT3 1ND3C 3HT2A 4DQAA 4RS5B 3AYDA 4OQ9A 2WS93 1UWWA 1YI7A 3IT8A 5KXEA 2BOIA 3D0JA 4XBLA 1X33A 3AZWA 2VMCA 5K0UC 5F32A 1U5IA 1R082 4ITCA 5FLHA 5IVVA 5JMCA 4TWTA 4E4DX 1NA1C 3GZAA 1YQ2A 2VOXA 1W8NA 2ZABA 2Q1ZB 4RR3A 5HBAA 3T2PA 4DEQA 1P8JA 5A7NA 3E5XA 4Q2FA 1KEXA 5GZFA 3KCYA 4CCNA 1WCKA 3A22A 1AL22 2PLV1 4P9YA 5C9AA 4XDOA 5JZGB 5K9YA 1AL0G 1QXPA 4B7KA 1OC1A 1UIJA 4JTOA 1RITA 5BNNA 5A32A 1JXNA 3WUCA 4X8PA 4BQ1A 2GP3A 5LA2A 1VMHA 4AGVA 4UWDA 4YVSA 4UW5A 4PDWC 1QHDA 1E57A 5A3PA 1DLLA 1GSLA 5FZAA 2OYZA 1ZRFA 1QH7A 4NN0A 4CU8A 1VRH2 5GZGA 3AYCA 4PIZA 2XQXA 4MSVA 1YUDA 3FX3A 5AFBA 1H6YA 5KBFA 2AR6A 2YB7A 4LPLA 4Z07A 4BOWA 5A6QA 3NAPA 4Q4Y2 3HQUA 1MS1A 1JYVA 2IZWA 1CIYA 1K5MB 2VMFA 4GIQA 2XJVA 1UKRA 4CDUB 4FVVA 1K12A 3AZXA 3DF0A 3T0BA 4RR3C 1OA3A 3IB3A 1WCSA 3WNKA 1OF4A 2XWJB 3WT3A 4R9DA 1S2KA 2YGMA 2XONA 2XL7A 4L8QA 4ZU4A 1RHI2 3B93A 5C9AC 1AR82 1D0HA 1QQP1 4QXHA 1RUE1 1NQDA 2E63A 2X53S 3M3CA 3IIAA 5FYZA 5BNNC 4BQYA 4XBNA 2W1UA 2VZRA 1EPWA 3I3BA 4LLFA 3MLLA 3SKJE 4YVSC 3ZXAC 4GKXA 4MHRA 4YM1A 1H2NA 5FPZA 1V0AA 1OURA 2GNTA 3OY8B 1UMHA 2ARBA 1G7YA 1W2OA 5FPBA 2PHUA 2Y26A 4FPKA 4LK7A 1CJDA 1JMUB 4ES9A 1REEA 2ZOEB 4FOVA 2UWCA 1MACA 2A6YA 3ACLA 3QCWA 3I3QA 3VZNA 1IPSA 1PMHX 3Q8AA 5FP8A 3NAPC 2A3YA 3PIGA 1W39A 1W2TA 4YW1A 4D6SA 4DMIA 5JAXA 3GGLA 4KH9A 3AP7A 4D8MA 2HWD3 2D5HA 3KSCA 1RVF1 4Q0VA 4PF5A 1BEV3 2Z69A 4BMEA 3DKQA 3B69A 1AXYA 4LBQA 5EWSA 1COV3 1WKYA 2DCJA 2HWC2 1JZ4A 4AZZA 1UOBA 4DXRA 2DVAA 4WZCA 1GWLA 2B5HA 3AZZA 3M3OA 1OI6A 1OH3A 4BMBA 4ATFA 5KXDA 1IS3A 1VBE2 2PFWA 2ZGOA 4UW4A 2VD7A 1F4HA 4EWAA 4M3CA 1BLZA 4IERA 5BNPB 1CX1A 1VMJA 5FZOB 1UOGA 1YXWA 4AG4A 2C1FA 2VJXA 5C3OA 5JR2A 3LB9A 1N47A 4XJWA 4FPHA 5J96B 1SLCA 3O1RA 5A70A 2B9UA 4CTEA 1GP5A 4JKKA 4Z92B 1TNRA 4R9CA 1JYWA 2XUMA 3MF9A 3RJ2X 2Y60A 1ND2A 3O1SA 4IQPA 4CSWA 2VZ3A 2BBVA 2WUHA 3KF3A 4N53B 2RG4A 4XF0A 1NAEA 4YG3A 3TBDA 1JUIA 2PA7A 3L2YA 3ZXJA 4Z1VA 5FPUA 1DQ2A 5I0SA 2VM9A 1S55A 4IEZA 4NPLA 3T2TA 3BODA 2WBKA 4LKFA 2Z2SB 3WF1A 3LCPA 1HB3A 4F7ZA 1U5YA 3NQHA 1K45A 3H42B 4SBVA 5FJHA 5I0RA 3AL6A 5M0TA 2BQPA 1IS4A 5JUVA 4IGPA 2DTWA 2WN2A 1YI9A 5FO7B 1NYWA 2MEV3 2XXZA 2WL1A 3E1F1 2PHFA 5ISLA 3O0WA 5CKMA 4AFAA 5IFTA 1VBD1 1DP0A 3H1MA 1GZWA 4HN0A 3NKGA 1BXHA 4I01A 1MR5A 5L9RA 1US3A 4V1PA 4JGYA 1UMZA 4K21A 1NLQA 2QE3A 4RQPB 5F5AA 3G6JB 5LEJA 5FYYA 1PX4A 1ONAA 1XJAA 1NKGA 3HVDA 5D8AA 4BWOA 1PO22 1V6NA 5FO9B 1PO13 5LY1A 4GWIA 3SISA 2DFBA 2P2KA 3HN1A 3C7GA 4I0BA 3WUDA 5HXMA 1WLWA 3H3LA 2HWB3 2FZ2A 2R062 5FZGA 5FY1A 3RI8A 3M3EA 2DVFA 2QUOA 1VBC2 1Y4WA 3CKHA 3GZUC 4A2UA 2VMEA 2P3JA 1RUC2 3PMSA 1S0DA 2BNMA 2P1BA 3SKVA 1H2LA 3UL2A 4WM7A 3TB0A 3IAPA 3KWVA 2F17A 1W9YA 1KJLA 5DAWA 3FN9A 2BOJA 1XYNA 3TN91 2EF6A 2WAAA 2NQYA 5CIRA 3LDRA 3W5NA 1X82A 5FTTC 1TG7A 2J7MA 2QQWA 1UIKA 4NAMA 4Q4X3 3N35A 3VDDC 1ULDA 3WZ1A 4AEDB 4Q5OA 4FAGA 5JXGA 2W3JA 3APBA 2EIBA 3AMHA 3ZIWA 3BVCA 2DTYA 4CDQA 5C4WA 4CUAA 3MHZA 4E4SA 5LZ6A 5D8AC 1O91A 1GLHA 1TMF2 1GQPA 4LO8A 4RD7A 3PDQA 3MFCA 2VC9A 1MZ6A 3OG2A 2JDYA 1QXRA 1XNTA 2FCUA 2XDVA 4LA3A 4RHV1 4CE8A 5I91A 1CGPA 1OPOA 1I5PA 3KHBA 1RB8G 3EHKA 3SH4A 4CDXA 1W28A 1YIFA 2R073 2VAUA 1NCQA 1Z78A 3C7HA 4CU7A 2VXRA 1IOAA 1AR91 4ARYA 4YZ2A 5FZ4A 4AFMA 2HWE2 4WM7C 1D2QA 1Z7S1 3RZZA 5DMYA 1SLIA 2WQ8A 4K1YA 1LAJA 1IQAA 2YPJA 3POYA 1C8NA 2OQ7A 5FY8A 4MXVA 1I9RA 3D4KA 5LBEA 1LU1A 4BH9A 2JKBA 2BNOA 3DUIA 1KFXL 1WLCA 1VIWB 5F3GA 1UPSA 5F1RA 5ANNA 2ZKLA 3U14A 1JOBA 4C1XA 3P3NA 3C3VA 4C0BA 2JKXA 5F2SA 1VRH3 4D7TA 4N43C 2I2SA 1DQ5A 1DQ0A 5C4WC 3W59A 4Q4Y3 3SCHA 3ETPA 5E88A 4B4PA 4NRMA 3K75B 1W3XA 2GMMA 4FFGA 3K51A 2Y6JA 4K9SA 4BM8A 4ZZ8A 4I0AA 3QH7A 4YLZA 4XCAA 1O4TA 1UYXA 1NA1B 4B7EA 3DKWA 3UKVA 2D97A 3RG0A 2P37A 2ZX4A 3MBWA 4SLIA 4CVUA 4FPJA 1JYTA 3RWKX 5A6YA 2JG9A 1BKZA 4CDXC 2DUOA 4HOOA 3WDXA 1AYN1 1V00A 3EBRA 1NCQC 4OZXA 5G05L 5BY5A 5FZFA 3J8F2 2E6VA 4GMP0 1RHI3 1D4VB 1AR83 5FZ1A 1B09A 1CIWA 2NMNA 4XIKA 1S0GA 1CAXA 3DCQA 5A6ZA 5LA0A 4A7KA 4IEXA 2RR12 1ZRCA 2ORZA 3ZX7A 2PN5A 4COYA 3EQEA 4OCTA 4N9IA 1ENSA 3DYPA 3NVCA 1LEDA 1YLLA 4GMP1 4BQ3A 3GXUA 1RJ8A 1XQNA 3WP4A 1R092 3POEA 2D6KA 2QQVA 4PDWB 2TBVA 2ZHNA 4GQ7A 4ET7A 1AR71 3KVBA 2H6BA 1DFQA 2EICA 5LK5A 4MYEA 5JOWA 1OKQA 2ZX3A 4HN1A 1RIRA 1RUF1 3I2FA 1BCXA 1PIV1 3KT7A 1CWPA 4LORA 4GAZA 4LTAA 2WSUA 2WZEA 1AXKA 1LNSA 2WINB 2XUEA 1US2A 3WG2A 1W8UA 1BHGA 2OT7A 2RDNA 3KCXA 1H1IA 1YEWA 3LD8A 4FQZA 4Y20A 3THPA 1JZ6A 2AZ5A 5KC5A 4DY3A 3HN3A 4RR3B 2R1DA 2BU9A 1K3IA 4NHYA 4QU1A 1V6MA 3ST7A 2EIGA 1PM4A 4HKLA 2ZEYA 5C9AB 4LQRA 2Q1MA 4QWNA 1YJKA 3H8UA 3FLPA 1XU1A 4QX2A 4X8NA 4C8DA 2VQAA 3U1XA 5JDBA 2YV8A 4B4QA 4NO4A 4XFGA 5A32B 2YC0A 1Q56A 1BMV2 1HXS1 1RXGA 3MW4A 2RJKA 5FXZA 4YVSB 4IEYA 5FBJA 4XF1A 1SHWB 4NHLA 3PMEA 2BRTA 3X29B 5ERLA 4UFKA 3PUQA 4MVTA 4NHMA 4Y4RA 4XUOA 4BZ4A 3C8XA 3UGFA 1IHMA 1KD7A 1WCUA 2I45A 1AYM1 1WA4A 2RS53 4YNIA 5GKAC 4EN7B 2H0VA 3ZYIB 1S1AA 3NAPB 2WT2A 1KITA 1EV13 4YARA 3ZVXA 1KDMA 1O4ZA 4CDWA 4OUSA 1MS3A 1UZYA 4J1XA 4XUNA 2WC2A 1RUJ1 1OXCA 2OVUA 2JDAA 4O7XA 4AEKA 1MS8A 4YM2A 4ES8A 5ACA2 1JZ5A 1VAMA 3GCWA 2IFRA 1UF2C 3HBKA 3R05A 1EY2A 2VCAA 4A45A 3ZFGA 4WV8A 3MW3A 4D0QA 4DNYA 3OPTA 1XRUA 3VBFA 2JDMA 1V9U1 4LXLA 4YZ1A 5DDJ1 1FOD3 5HV4A 5LBFA 1XNKA 2F4LA 3T0DA 1ZBA2 4JV4A 3SC7X 2D6PA 3A0NA 4UBHA 4XYXA 3CJIA 4IEWA 2GNMA 1BK0A 2ZXQA 5LRSA 1NY71 3AP6A 4KWUA 1PGSA 4LITA 4CDUA 5F39A 2VCBA 3ALQA 2VBBA 4CDWC 5IK5A 2CHHA 3RZGA 3VV1A 3UETA 3ZIXA 1SFPA 2IXJA 5L73A 2WT0A 3VD7A 2HEVF 5FZDA 1ODNA 1HRV3 3PL0A 4KQ7A 1REFA 4ISQA 4ATEA 3UYJA 3IBMA 2VR4A 1J3PA 4P9JA 4LBQB 1RUC3 3IPVA 5JZGC 3HIFA 3NV1A 3M8LA 1REDA 2A3WA 1GKBA 1ZVFA 4J25A 5CBLA 4QKNA 5JI7A 4LO7A 4Q4V1 3N7LA 4AVTA 4JQTA 4AVSA 5JMOA 3ZFGC 3A7QA 3RGBA 2FMDA 1ASJ1 3H50A 5FIXA 2DCKA 1VBB3 5A3WA 1HX6A 1UY1A 2FDFA 5B4XA 3VBFC 2IC1A 4FPGA 1OFNA 3T1MA 4QHZA 4LA2A 4XHXA 5HXVA 2FCTA 1VB4A 4FSJA 2MPFA 1GQGA 4QQOA 2WS92 1QOOA 3RYKA 5F3CA 1ST8A 4LBKA 3HT1A 5C33A 1WBLA 4W6WA 2NMOA 2VO5A 3OBZA 2E32A 4IE6A 1ND2B 1VBA1 1GWKA 3USUA 4XETA 1W6OA 4UYBA 4CDUC 3MICA 1QQP2 2BVBA 2NM1A 3C7FA 1RUE2 2KR2A 2PAMA 3WF4A 1UN1A 1KRIA 2FHRA 4IGQA 2GC3A 3DYOA 1W6QA 1GNYA 2R041 1J58A 2QZ3A 2VVFA 2WSVA 3FMGA 3VHPA 1JODA 1FYUA 1OQDA 1U5XA 1EPZA 3LEKA 5FUIA 1OVSA 5T5OA 3D8CA 5AC93 2VOKA 2YHJA 5JLVA 1JZ2A 3OTFA 4RGKA 3MO4A 2VNVA 1GZWB 1SCSA 3BYWA 4JGYB 1NQJA 1VJ2A 4YG6A 2ADEA 5FOBB 4UW6A 1MS4A 3GBWA 5C8WA 1H9PA 4XQDA 1UU6A 3THCA 2WA4A 2V09A 1OUXA 3PJQA 3SEEA 3RMYA 3MIFA 2H6CA 4N53A 3T2QA 1VAVA 2VZTA 3M3QA 2BV4A 2QQIA 2VOVA 4B3NA 3O12A 1KFUL 1SMVA 4MUVA 1LOAA 4P9XA 4LMFA 4YYOA 4Y5SA 3J8F3 4NPMA 2J1TA 3PVNA 1RUNA 3OPZA 4OLLA 5FY5A 4AE2A 4AOCA 3TEYA 3JB4C 3N4MA 3K4AA 5SV8A 1D2SA 2RR13 4WM7B 3NJYA 3WNLA 2ARCA 2Y34A 2ZGPA 4RFT0 3WQBA 3S0MA 4LO6B 2NZ9A 2I07B 3ECQA 3R6SA 5DUVA 1RL3A 2YZ4A 1R093 3U75A 5BNPC 3POGA 5FZ8A 2A6WA 3HWJA 4DPNA 4Q29A 3NO8A 1I5ZA 3NNFA 5CVRA 2VUCA 2JE7A 1CESA 1IZ3A 3IIIA 4XPVA 1POV3 5A7SA 4OHZA 4CDQB 5C4WB 2WLPA 5AVAA 3SHRA 1N1VA 1PMIA 4JDOA 4N53C 3ZSEA 1KJRA 2OS2A 4I02A 5FV3A 4FT8A 4KG8A 3NNLA 5FLIA 3UKTA 3AMPA 4XJZA 4P9IA 2XJQA 3AZYA 4P5YA 1BEV2 2ADDA 5JPMB 4RN5A 4CDXB 3I97A 3ZSMA 2XG3A 4K1ZA 2IXHA 4AEMA 1NCQB 3LA2A 4PBPA 3NJVA 4H7MA 3RZLA 3QBQA 3HMYA 1VBD2 4CRQA 1YNAA 2XB6C 2FZ1A 4QKDA 2A73B 2ZGTA 1EYBA 1YO8A 3KV6A 3GJAA 5D1IA 2R30A 3TEZA 1V70A 2ATFA 2KM2A 2Q1FA 1JZ7A 5FYIA 3ILRA 3LE0A 4RQPC 1AR63 2E26A 3WOGA 1LULA 4AHZA 3ZXLA 3W58A 2D93A 2E9QA 2PELA 1U12A 2P3KA 2Q5TA 5FY0A 1YWKA 5IVEA 4O9EA 4BK5A 3WP5A 4AQ2A 2C0ZA 3AKRA 4Q4W1 3JXSA 2P6HA 3FE5A 4DOUA 1POQA 3WV6A 2JG9B 3LWCA 5AFEA 1BYHA 2LM3A 2WR9A 4QPGA 5LRRA 4W50A 1SLAA 2ORXA 3WNOA 1GOGA 1ZBE1 3TN92 3U4SA 4CP9A 4HVRA 4Q26A 3AYAA 1RUH1 2VG9A 3BTXA 1ULPA 4H7LA 1CAXB 3DPRA 2GZWA 3B02A 1RUG2 1CAVA 4OFGA 3FC0A 5C6CA 1JW6A 2J1SA 3NMBA 4TLGA 3AFKA 3GM8A 4C91A 5JSRA 3KD4A 1ACCA 5IATA 5K8SA 1F15A 1CPNA 4HETA 1U0AA 1LTEA 5BPXA 5CA6A 1RUI1 1KGYA 2AENA 1W2NA 4RHV2 1NOVA 1KS4A 3EYPA 5FZ0A 3RJRA 4LO5B 2PXJA 2Q4SA 3CIHA 3IDEA 3PJYA 4TN7A 3TRSB 1S2BA 3MIBA 3AP4A 1QXJA 2WFF1 4GALA 1O59A 2PLV3 3BPZA 1RMU1 1AR92 4BU2A 1YCIA 1WBFA 2YG0A 2O14A 4XF3A 5FY4A 4Y20B 4TTGA 2VNOA 4NWWA 2BTVC 1IS5A 1W99A 4WVMA 5FK7A 4QPGC 4A7ZA 4IEOA 4XURA 2RDSA 5F3EA 1S0EA 2FQPA 3IKWA 1VRBA 3URFA 5A1LA 3FFQA 3O0XA 4CEWA 1N1TA 5CYYA 1DQ4A 1QWRA 4GULA 3ZFFA 3HQXA 3LSEA 1O3TA 3DPRC 3V0AA 1VE0A 2WNOA 1CVNA 5L36A 4OHVA 4DUXA 4GXLA 3I2KA 2XWBB 4L92A 4BK4A 4D7YA 2AGSA 4OMDA 5LA9A 2QQKA 4IE7A 1Q43A 1UY4A 3WD5A 3HOBA 1D4M2 2BFUS 4UT5A 1ZRIA 1WGPA 3LOIA 3BU7A 3RZMA 2VL4A 1M4WA 2DYCA 2RS31 1FAYA 1Q8PA 3WLUA 2ET1A 1JYCA 2B45X 3N36A 4H55A 2CDPA 2PAEA 5T5JA 3BTAA 1F35A 2DU0A 1F31A 4LBMA 3T2OA 3WNNA 1QQP3 1MZFA 3OOXA 4CDWB 3VGIA 1RUE3 3VBHA 2R072 4KG0A 3RS6A 3JZVA 2VCMA 4HK9A 4QHOA 5L7OA 1ODMA 4QM8A 3LPFA 2ENRA 3ELNA 5FLJA 5G04L 4D69A 5C3SA 2E7AA 5JSOA 4EN8B 2JWPA 3OGSA 5DN2A 2CDOA 2GC2A 4FXKB 1SZBA 4CEWC 1PGL1 3OGGA 1DZTA 2YDEA 5JSPA 1AHSA 2C5DA 4X6RB 3V56A 3ZFGB 3WVJA 2R0FA 1PIV2 4FTEA 3S30A 3VBFB 5FZEA 3B5LB 2ZA9A 3M7AA 2VUDA 4M3CF 4ONUA 3ENRA 3M2MA 1RVF3 2DU1A 2D44A 5CKQA 3ZSJA 1R1A1 4A6OA 5IK8A 3WDUA 1PGW2 4ZS2A 2BDRA 2LROA 3CJIB 5HCHA 1ENXA 4XDPA 3WW2A 1S0FA 1BK1A 5A7PA 2W92A 3RDIA 1WA6X 5A3MA 1DYOA 1O4YA 5FP7A 4D6RA 4XFBA 2PHLA 2AEZA 3VBHC 2EIEA 4MGKE 5L7OC 1GMMA 2W0XA 1OLQA 4HL0A 4W6YA 4BQ2A 4BPZA 3IPVB 4YW5A 5C70A 4BE3A 2VPVA 4LT5A 5FZ6A 1BQPA 2D6MA 2CGNA 2PMWB 3EB7A 2HH9A 3ETQA 3TAYA 1G8WA 4C90A 4NIGA 1VP6A 1G6NA 1I6XA 1QJFA 5FMCA 2GMEA 2WAOA 3FBMA 5BXXA 4MGQA 3C7OA 2A71A 2X05A 3ZSKA 2VOWA 3MIHA 3AKTA 3OYWA 1QGLA 2EXHA 3NV2A 1UAIA 2DV9A 2ZHKA 1O8SA 2JDZA 4NJ4A 5FP9A 2ZMLA 3R0RA 4BQ4A 1RUJ2 1CZTA 2JJ6A 2YFUA 3PUHA 5FKCA 4D94A 5IK7A 2WLQA 1OQ1A 2OZJA 3USUB 1W6OB 2ZCWA 3VKFC 4N7UA 4AI2A 4Z2WA 2W1QA 3OF1A 5EZWA 1YYNA 3NNMA 2WZR1 2Z42A 2ZJCA 1VBD3 1C28A 1W6QB 5IWFA 1ZZ7A 1MVEA 4LBJA 1IQDC 1TZOA 1V9U2 2NP0A 3H8OA 3ILFA 4ZPIA 2K9ZA 3V64A 4Y26A 1FV3A 2P4EA 1CZVA 1C8M1 3UV9A 2CWMA 4YGDA 5HCFA 3GCXA 3KT4A 1H1MA 1N1YA 4Q0UA 2YUEA 2JECA 2ETEA 1NY72 1QF3A 3PVEA 1OOPB 1FT9A 1HW5A 4XE9A 5LATA 3NSTA 3ZYJB 5C3QA 4UF0A 4TXWA 1WWYA 2RS52 4PLMA 1GNZA 2C9AA 2ZX1A 4UOJA 4B1LA 1HRI2 2G9FA 3CL1A 4FQ4A 4S2HA 4EQVA 5LEKA 1EV12 2D40A 3IDCB 1XYOA 4OUEA 1DGWX 3T1LA 4XUPA 1N1SA 3BUCA 3HEIA 2UYAA 1Z0HA 1Y9QA 3NV4A 4Q4V2 1YQ8A 4WVWA 1W06A 1DQ1A 2WWUA 3TN93 5H9QA 2MNGA 2OQ6A 1XYPA 5IYYA 1A34A 3POSA 4JZRA 1YJLA 1SFNA 2YMZA 3GDBA 1W8HA 4Z82A 1OHFA 2W5FA 4L11A 1RUG3 5EJ3A 2Y6GA 1C1LA 2Y33A 1MVQA 1RINA 5F9TA 3ZYBA 3GHMA 3W21A 2V5YA 1ZZ6A 2QQJA 2EALA 1LGCA 1NXD1 3ITQA 4LULA 4XMIA 3IMNA 1E5IA 1PHMA 1VBA2 1FOD2 1TME1 2R0HA 3IN9A 4N9HA 1WMXA 2ET7A 2WWSA 4Q8LA 4RHV3 4Y1ZA 3T09A 1A8DA 3KB5A 3VN4A 1SEFA 4ZY9A 1SDWA 2E53A 1W8WA 2AACA 1ND2C 5GALA 5BYNA 4JVAA 1JH5A 1HN1A 1AR93 2BWAA 2R042 3P5BA 3N3HA 3TYJA 2CL2A 4MO3M 2ZS6B 1G9BA 3VDBA 2ZX2A 3OUIA 2BVVA 1V6KA 1H30A 4XABA 3RQ0A 1DYPA 1HRV2 4F83A 4IETA 2ZZJA 4QDQA 1TEIA 3PNAA 2QDRA 3A0KA 1AUYA 1IGOA 2BBAA 1FATA 4LBNA 5KXCA 3M1HA 2O1QA 1S0CA 4PT6A 4U2AA 4FPFA 5FZMA 1EAH1 2Q8DA 5F37A 1DDLA 2V4AA 3D5OA 4KBZA 4LO4B 4RGGA 3ZDVA 3KV4A 5LASA 4ZU7A 5T50A 1QJX1 2B39A 2W47A 2VQUA 2X5IA 3TOJA 4FP2A 3O5SA 1UZVA 4IE5A 1VBB2 4BQXA 5FKBA 4YVWA 4FFHA 3MLKA 5ANQA 1IPJA 4JGYC 1WD4A 1D4M3 1GP4A 1WUVA 2PYTA 3K48A 4M4RA 4CEYB 2A6VA 2YU2A 4CPBA 1FPN1 3FUQA 1PVC2 2W1WA 3PVBB 5K7PA 4E4HA 3MZHA 1W6MA 2A3XA 2B42B 1AYN3 2X09A 3FZ3A 4NIIA 3S5QA 2W08A 5EJ1B 2K0GA 1W9TA 4M01A 5BNOA 1OA4A 2V4VA 3H1WA 3AKPA 3LPGA 5C5UA 4XACA 1ZZCA 4AW7A 4EZ4A 5LB6A 1HKDA 3I59A 2LS6A 4GMP3 1LRHA 3I4IA 3S6PA 4CP0A 3THDA 1URXA 2C4XA 3ON7A 2YXSA 4H3WA 4QPGB 4Y33A 2W68A 5BUVA 3ATGA 4IV1A 4AI3A 1SACA 2MEV1 3PIJA 4NRPA 4A3XA 3P1IA 4CP9B 1AR73 1LOEA 1ZA7A 2WZ8A 3PURA 4AWDA 5LA1A 5DZEA 2FD8A 3B3QE 1Y9MA 4BCUA 3DPRB 1O3RA 2W87A 1FMD1 2D3SA 1WMDA 1CAVB 1RUF3 2X5IC 4CA9A 5EQUA 1PIV3 5FP3A 3AC0A 3VUOA 5AC92 3CEWA 3OUHA 4WBBA 4LLOA 4BJ0A 2DBIA 2W46A 3ZPYA 1DLCA 4FO9A 4YVWC 1UQXA 5L19A 2VZPA 4DY5A 1DF0A 2E51A 2XL9A 5C7GA 4YPJA 2A7AA 4CDQC 1LHOA 3I2JA 2Q8EA 3CDZB 4QD2A 3POWA 4FPEA 2RS11 1PZ7A 1W8FA 2D6NA 5I0UA 4CXYA 2FDIA 5CEHA 1QJY1 4HVQA 4GB31 4JDMA 5BNOC 2AH2A 2PHTA 4IEPA 1LKNA 3IDAA 3KS7A 2HBTA 4MZUA 3BIEA 4MGZE 4MX3A 3VBUA 3HNYM 3HQRA 1HXS3 2YC4A 1C5HA 4KWKA 4LEJA 4WVMB 1XBFA 5FZIA 4IV1C 3H0OA 1H0BA 3JQWA 4JTNA 2WNVA 4PHZA 4ZXKA 4CEWB 4LBQD 2CWSA 1H1AA 4Q4X1 3ZFFB 2P3IA 2YC2A 4AXOA 1U5ZA 2YU1A 1XB9A 3VHOA 2UY8A 5JXHA 2ZEXA 1OFSA 1W90A 4LBOA 5DABA 4IEVA 4YZ4A 1QEXA 4DRVA 3KZ4C 1WLTA 2PHRA 1NLSA 2VZ1A 1R081 2QQOA 1X7NA 4R52A 4R4ZA 4QU2A 4XMAA 4ZONA 1H6XA 5DG1A 5HCBA 2DVDA 3A21A 4Q27A 4OHXA 5FK8A 3SNMA 1LESA 2VTXJ 4AL9A 4YM0A 1BVVA 3O1PA 1RUJ3 1TNFA 1LHNA 1Y3TA 1OT5A 1FNZA 2XLGA 5E16A 3TEWA 4XTPA 4E2SA 3OUJA 1AL21 3CF6E 4CUCA 3MW2A 2JG9C 1W05A 3VBUC 4LKDA 3VBHB 5FJKA 1S0JA 3UK9A 4O9GA 5L7OB 4AVVA 3J9SA 1UZZA 4RYDA 1CZSA 3KVAA 1IG3A 1V9U3 4YW4A 3RSJA 1K42A 1NE6A 1WW5A 1RUD1 1LJ7A 2WNVC 3CHXA 1NLRA 1AF9A 4FP3A 5DDJ3 4EWDA 4NIAA 4MGTA 3ZXFA 1RUI2 5GLVA 1IS6A 4PQQA 4L9BA 5FMOL 4BA6A 3U0ZA 5LY2A 1ENRA 2HKXA 3LEMA 3SH3A 4JGZA 3HBZA 5A3UA 1UKGA 4CUBA 2Q0AA 2KXLA 4Q4Y1 3WHUA 1AR62 2DF7A 1RMU2 2LUWA 1G9AA 5DZGA 1FV2A 2P3YA 1HQWA 1W0NA 5FZKA 3WW4A 4CU9A 4GKYA 3WQ1A 4BQ5A 1JHNA 4GZ9A 4DIQA 3WF3A 2JDHA 3F95A 1C4RA 3PUIA 2Y6LA 4DXZA 1HRI3 3K4DA 4I2OA 1QJU2 1W0OA 3OCPA 4QB1A 1G9CA 4K40A 1Q5OA 5CKNA 5C5TA 5FPVA 4Q4V3 4E8CA 4ISRA 2OKXA 3T3YA 3GBFA 2RHPA 2ZHMA 1GV9A 4OVEA 2BGCA 1ASJ3 3KV9A 3WG4A 1CAWB 3ABZA 2BGOA 5J09A 3WCSA 5I93A 3POFA 4BLIA 3CZJA 1W9SA 2X10A 3UKNA 3N9MA 3DYMA 3SLIA 5DUWA 4E9KA 2Z79A 3ZXDA 4EN6B 1VBA3 4JGZC 3VBRB 1UZ0A 5HI0A 5CB7A 2VVDA 2QQMA 1LOFA 3AK0A 5JIAA 4AI0A 3I2OA 5F6LB 4IGOA 2DVGA 3OYWB 1H8TA 5AVPA 5EYXA 2IXIA 3ZKYA 5FQ0A 4AAXA 4JHTA 2XHNA 2Q8CA 2AUYA 1PZ9A 5EJZB 3PLQA 4Q0SA 1H9WA 2PLV2 1KDKA 1TE1B 1UD1A 2R043 2X29A 4ZKTB 2DCTA 2HWC1 1UX7A 1E5RA 1BVP1 4MV2A 3ROUA 4KGQA 4D3WA 5DPNA 2CY6A 2IWGB 3NNJA 2VTFA 3POJA 3ZMNA 3KT1A 3LA7A 1RC6A 2ZGKA 1VBE1 1XE0A 5KHHA 5FYMA 1OKOA 1JYXA 4QX7A 3FLTA 1WCDJ 4NRQA 5EXOA 3PUSA 3RFRA 3VBOA 1YC61 2WQ4A 5FDBA 2NYYA 4COVA 4MGSA 3HD8B 4Q1RA 4NVPA 4KMQA 4M0NA 2FBEA 4S2FA 5DAVA 1W6PA 4HPKA 2FDGA 2HWF1 4I09A 4W4ZA 5ABJA 3V0AB 2HJIA 3U37A 4ARXA 2VY0A 5IFPA 4J1WA 4P9GA 1GFF2 1PVC3 3L2HA 4R4XA 4COZA 5KHIA 4YW3A 3I3DA 2JIGA 1WCQA 1H8TC 4K20A 2D6LX 2VUAA 3MV11 4UF0B 4B29A 4FTSA 3CJIC 1XPWA 4QPYA 4YZ5A 3BIWE 2R16A 3ACFA 1AJKA 2LTNA 3HR9A 4JC1A 2XPJA 2QQNA 1AVBA 3VD3A 2L9LA 4P9WA 1CN1A 4IXLA 5FPAA 3ZN5A 3TEXA 2YROA 2YY1A 1CX4A 5A3OA 4A42A 4XBQA 4AGGA 2E33A 3S57A 1ULFA 1T6GC 2MHFA 1L7QA 4GWNA 3DECA 3VBOC 4Y24A 2CYFA 2ID4A 4NR1A 1VALA 4A3ZA 4W6XA 3AX4A 1AJOA 4QT6A 2WABA 4HK8A 4AHWA 3LDKA 2E7TA 1HN0A 4M4PA 1DIWA 1PO21 5C8CA 2JB4A 1OOPA 4MGYE 1JZ3A 4U36A 3ZPOA 5JCTA 3QD6A 5IAXA 4FOWA 3VZOA 5ABJC 4QPWA 3MEPA 4YZ3A 3OGVA 1G9FA 1RVF2 3I2GA 3KLSA 1HQLA 1XSRA 4K6BA 3ZO0B 3O1TA 5CFDB 2VNRA 4XJAA 2C26A 4QKBA 2R061 3K46A 4XCBA 1XE8A 2O8QA 4PQ9A 4RA0A 2YBKA 2WZR2 2ZMKA 1VBC1 3HNMA 3R4SA 2GSYA 3ZDSA 1ULGA 3CO2A 1OQEA 2HYKA 4AQ6A 3MIDA 1RJ7A 2RMU1 3PUAA 4HFSA 5FYVA 1SG3A 4QGMA 4QB2A 2CNAA 3D82A 4K8RB 5FWJA 3LFMA 3OEAA 1LHWA 3N7MA 4UFHA 1KQRA 3CQOA 1J59A 2BWCA 3J26N 4G9SB 3T08A 4YFZA 1DBNA 4IEUA 2TUNA 4PF1A 2A75A 3DXUA 2WQZC 3KV5A 3NNGA 2CAVA 5BNQA 1OBNA 2G1MA 5HPOA 3IDBB 2X5IB 2BJSA 3LZZA 2WDBA 1FI2A 3BOPA 2AYHA 1J1LA 2Y6KA 3G7DA 2HEWF 3ZFEA 4DO0A 4MXWA 4Q4W3 5J98B 3DL3A 4YVWB 5J7MA 1A3KA 1TMF1 1OOPC 1OA2A 1MS0A 4QX1A 5FO8B 2ZMNA 1CONA 1X8MA 2J1VA 4C1WA 3OGRA 4TYSA 2OPWA 5KHGA 2WO1A 1W6MB 3MI8A 4Y5TA 3NW4A 3ES1A
chains in the Genus database with same CATH topology
4RSUA 2DWRA 5F5QA 5BNOB 1APNA 1RUH3 3WHTA 2R6QA 1CJPA 4MH0E 1SBFA 5TSWA 2HWE1 3I59B 3N7KA 3QOPA 1F2NA 3RWNA 4IV1B 1AX2A 2CAUA 4KWLA 4OHYA 3SMHA 1CQ9A 1RUI3 5FBZA 3E97A 3WCRA 2ZTNA 1N3QA 2RM21 2W39A 4P14A 2BYVE 4GH4A 3ZFEC 4CEYA 1HV0A 1G9DA 1RMU3 2ZGUA 1ZNPA 2EAAA 3I7DA 2ZACA 3FBYA 1XU2A 1IKPA 4AFCA 1LOCA 5JVVA 1QJU3 4Y1VA 1YRZA 1XNBA 2X8KA 1O3QA 4QM9A 4XFAA 5FRAA 1MEC1 1EAH2 1AX0A 1DGWA 3VBUB 4XIOA 4XTMA 1QJX2 1DG6A 1HLCA 3JUUA 5A33A 2ZGLA 1JOJA 1KXGA 1FX5A 2WNEA 5JR7B 2WNVB 4FBFA 3NJZA 4UXAA 3FUOA 1DHKB 2R1BA 4AFBA 2RS33 2TNFA 4FPCA 1FPN2 3WP6A 1ZRRA 3MIEA 1OSGA 1ZZ9A 5CNAA 4CEYC 1NCRA 1OMIA 4YM3A 4E4ZA 1O5LA 3M4FA 4EV0A 3MYXA 2BPA2 1H4GA 2D43A 2ERFA 2AREA 4E2QA 3GNEA 2ZKNA 4XFFA 1MS5A 2XVGA 2XKPA 1NZCA 3VBSA 2D7FA 4C0HA 1C57A 2UURA 2D5FA 2VNGA 1XXNA 2EXIA 1Z7S2 2CTVA 5EV7A 5IK4A 4M00A 4BHPA 4XQ4A 1GICA 3H3ZA 1DZRA 1I3HA 1GZ9A 2VGDA 1ND3A 3WX5A 4JCKA 3U4XA 2G4IA 4XEZA 5CG8A 4JDNA 5JI9A 4WVZA 5FAXA 3LGRA 2BNNA 1R1A3 4LBLA 3V65A 4XZPA 4RGAA 3GF6A 1V6LA 4XOGA 3RRDA 3E6BA 3JQXA 1QJY2 4JGZB 2A6XA 2XJRA 2DURA 1NCRC 4Y1UA 2XJSA 4AI8A 3MPBA 2B8MA 4JAAA 3WDTA 3JD71 1SLLA 1AYN2 3AXEA 1G86A 1X36A 4I30A 3VKNA 3VBSC 4QX5A 1HDKA 1UX6A 2BW8A 2EXJA 4IV3A 4QMAA 4Y4YA 4A7YA 5ACA1 1LGNA 1DZQA 1WW4A 4AFDA 1AX1A 2F6BA 3U11A 1YFXA 1AR72 2GU9A 3ZFFC 2VULA 1OD5A 1RUF2 2WIIB 4Y22A 3ZSLA 2V73A 2WZPP 5JOXA 1ZBA1 2JICA 1PNGA 1SQ4A 4LHKA 1UW8A 3RYRA 4BLJA 1H8TB 2IXLA 1Q8OA 5FQ0B 4AF9A 3VKLA 1Y7BA 2WZR3 4JRAA 1WMFA 3GALA 3JCIA 2D6OX 3KGLA 4IV3C 1LENA 2XBO1 2PAKA 2XH6A 3AP5A 1QNYA 4WM8A 1RUD2 3I8TA 5GZDA 4J6GA 2JG8B 4UW3A 1HXS2 1WD3A 2PHWA 1MQTA 1CAWA 4D7SA 1NXMA 1JYIA 1C8M3 1UPIA 2D98A 5JPNB 4XJUA 1TQ5A 3O0VA 4FCAA 1WW7A 3ZN6A 5H9SA 3VZJA 2I74A 2PHXA 4PBOA 3VBOB 5T3NA 3JBG1 3NWKA 5FREA 1BBT1 4EROA 1AYM2 1LR5A 4L2NA 4BIOA 2WS91 1W6PB 4HPKB 4XILA 3VBRA 3WY6A 1H8VA 4YRDA 3SCFA 5ABJB 3MF6A 4FOQA 3WDWA 4HT1T 5KHKA 1XNDA 1ALYA 2RE9A 5LK7B 4XFHA 4OI2A 2TEPA 1CD3G 3SH5A 3PVOA 1VB2A 2VQ0A 3VZKA 4FTBA 4WM8C 5H9RA 4KL1A 2Q30A 5H9PA 2BUKA 1JBCA 2GNBA 1MQTC 3BOWA 2Y0IA 1H4HA 1PZ8A 5GLWA 3DGTA 5DDJ2 2CGOA 1F5FA 1TME3 4EJRA 5J3UA 1J3RA 1CAUA 2QZ2A 1S0IA 5FPXA 3UJQA 3WP3A 1IPKA 1VR3A 2ILMA 1ULCA 4M0HA 3VBRC 2GH8A 3MDPA 1W6NA 5C8CB 5KHJA 3EXUA 4QQLA 3CNAA 3S7IA 3ILNA 1QDOA 3N7JA 4XF4A 2N7GA 5E89A 1NE4A 4HLTA 1UCXA 3AYEA 2GN7A 3LKJA 2XJUA 2OW4A 1EAH3 5JWPA 4QPIA 5DXDA 1QJX3 3VKOA 5I8TA 2K2SA 1ASJ2 5F6KA 1ZM1A 4M3CE 3OGJA 2XJPA 2HWF2 1FPN3 1MZ5A 4OUMA 1C1FA 4DRRA 3EJKA 1ULEA 4LE4A 1SBDA 4XJ9A 1FXZA 3ZFEB 4MXWB 3MFAA 3KM5A 1LHVA 5CFDA 4XDQA 2WNUA 3GBGA 2HWD1 1QMJA 1BEV1 4ORFA 4LHNA 4S2DA 1ENQA 2XLFA 1MS9A 2XGXA 3MPPG 2VW0A 4QQ2A 1COV1 1X50A 1Z7S3 4FPLA 2B7YA 3VDDA 4QPIC 5DG2A 4KGGA 1FMD3 4XFCA 2R32A 2NPIA 2A70A 2SBAA 2UY9A 4KWJA 2XVLA 3RI9A 4AHYA 4DB5A 2ZGSA 2VVEA 3TNQA 3V0BB 4S2GA 2UYBA 1XNCA 1Y43B 4MLOA 2Y38A 2IXKA 4P5HA 3H7JA 5GM0A 1DYKA 1YFUA 3OBRA 2CV6A 2RS13 2ZX0A 1N3OA 1QJY3 3IWZA 4GB33 4GH4B 4E2GA 3RMXA 4L99A 5DZFA 4PLOA 1PVXA 2JEMA 2OA2A 2Y0OA 5CFDC 2WNUC 2RMU2 4R9AA 4Q0PA 4X6QB 4XF9A 5I8YA 4OI0A 1QDCA 1QNWA 4FXGB 3CLPA 4JRLA 1LU2A 3D6EA 4K7JA 5GZCA 3WW1A 3RPQA 5JOYA 3WDVA 2ZGRA 4HSJA 1RUG1 4KBBA 1D0GA 4N43A 4XHBA 5A33B 4OI4A 1H2MA 1PNFA 1PM7A 2ZZQA 4N7IA 3D0SA 4LUMA 1R083 2EXKA 4I0WB 1RUOA 1ZRDA 4K8FA 2QDNA 3B01A 4XXAA 1PK6A 1N3PA 1C5IA 4ASMB 1PO11 1V6JA 4Y5Z0 4TLFA 3LOBA 1J3QA 1NCRB 2QVSB 4R9BA 3VHRA 4YW2A 1AL23 1GZCA 2DUQA 1DGRA 2HWB1 3MIGA 3U10A 5GLZA 4LE3A 2OZ6A 5JOZA 1JTZX 3VBSB 4Q0QA 1SCRA 1GANA 3WDYA 3R4DB 1RUD3 5T54A 2BEOA 3A4UA 3NL1A 4NHKA 4AQTA 3E5UA 1JUHA 1R1ZA 2NLRA 3PTYA 1SLBA 1ND3B 1O5UA 1VLNA 2RM22 3VL9A 2ZAAA 4QQPA 3ME2A 1B35A 3ZXKA 2GMPA 2G9GA 2IFWA 5K0UB 5A3LA 1D4M1 2ZPXA 1AYM3 2DUPA 1PK6C 3U07A 4Q4W2 3B9IA 3VZMA 1UU5A 2PHDA 3OD4A 2QFEA 2RJLA 4NWVA 1NG0A 1MEC2 5GZEA 3W9AA 1DQ6A 2VMIA 4Y1YA 4CYDA 4K3UA 1ZBE2 2R071 4AGRA 1I1EA 2JE9A 4CP1A 1RUH2 4IV3B 3DN7A 1H2KA 3OBTA 3VL8A 2Z5WA 1ZX5A 1LODA 4NPRA 3KCCA 5I0TA 3SXWA 3R4UA 4QHBA 5FCCA 4BIFA 3UJOA 3QACA 3ZXLA 1B35C 2VUJA 3NV3A 5E8AA 3JB8A 1VRH1 4Y22B 3VKMA 4HVOA 2OIIA 1DGLA 2WFF2 4XJ8A 3TNPB 1EP0A 5EYYA 1QH6A 1PGW1 2EVXA 2HWC3 4COUA 3M3IA 3ZYPA 3MGUA 2WKKA 3FLRA 3JU9A 2O8OA 5BNNB 1A6CA 1VBE3 2GDFA 1A78A 2LALA 1F5JA 4HSLA 4KU8A 5CFCA 1A8MA 3B94A 2UU8A 1GYKA 1RHI1 1F8VA 3H3UA 1AR81 1MZEA 3RNSA 3E6CC 1LB2A 4WM8B 2R49A 3WXPA 4AI1A 4LHLA 4RS5A 1MQTB 2GAUA 4IL7A 2ES3A 3AMQA 4Q8KA 2JXAA 1LOBA 2HWF3 3ZN6B 1Q8SA 3AMMA 3GHNA 2BFUL 4W65A 2RS32 5E1RA 2KA3A 1IKQA 3JD72 4YGEA 2GN3A 2IXCA 5GLUA 4PJYA 1V6OA 1AZDA 5FOJB 1O3SA 5JZGA 1C3HA 5EFUA 4AHXA 1VAKA 3O7OA 4XQWA 2ZBJA 4EN9B 1M06G 3WW3A 5CFCC 4AVCA 1SLTA 1PGL2 2WFPA 3B7MA 4XW3A 2JG8A 2UWAA 3IM0A 2PQQA 1KS5A 3S7EA 2UWBA 2EAKA 3OJBA 4RS5C 4YGBA 3AJZA 3C2UA 1ZYBA 1PO23 3O14A 4XXPA 3WINE 2JENA 3RYPA 5CG9A 1K5MA 4OHWA 1CAUB 1R1A2 2D3RA 2QNKA 2ZGQA 2ZGMA 4H14A 2R063 3LAGA 1W2UA 1WW6A 2RS51 1QKQA 5T5PA 1O7FA 2F4PA 1W6NB 1LEMA 1HQNA 1LOFC 1VBC3 4EWEA 4PCRA 1HRI1 4DINB 4PIXA 2ZAHA 1EV11 2XBO2 3BCWA 4FAHA 2RMU3 4G3YC 1LOGA 4LUKA 3BB6A 2JX9A 4HANA 4Q1PA 1ZREA 1OLRA 3ZYGA 3ASIA 4INDA 5CAZA 3OY8A 4M3CB 4QPIB 2JG8C 4AVBA 2OPKA 3JBG2 4LR4A 4YSFA 3CU7A 5IUQA 1QU0A 2VECA 2QQPA 4KU7A 1BBT2 2FMYA 3E5QA 2XJTA 4FPOB 5KC6A 4DS0A 1TMF3 2P34A 2ZHLA 4I3PA 4META 3ZXGA 1J1TA 4B8EA 1BZWA 4PIYA 1K5MC 1FOD1 2B46X 2VU9A 1GBGA 4QXKA 3SCGA 5GJ6A 5CU1A 4YFWA 5T52A 3QH6A 1JN2P 5J36A 1DGRN 1RTVA 2WNUB 3HAGA 2HWE3 3FFZA 3ES4A 1HV1A 2HEYF 1Q8VA 4BYYA 1HRV1 2DCYA 3PHMA 4FOYA 1RUC1 5BNPA 3WQ0A 4AEJA 3VDDB 3OD0A 2RM23 3FWEA 4AVAA 4GWMA 1C8M2 5J48A 1Q8QA 1YFYA 4G4FA 3USSA 1GQHA 1HIXA 4TZDA 3L9JT 1VBB1 5D8AB 2YYOA 3QLQA 4WZFA 2JD4A 5CADA 1XE7A 2VMGA 1L3JA 1WMEA 1LECA 1PVC1 2OUJA 1SFYA 5C8CC 1QOTA 1FNYA 2ZGNA 5IT6A 2VH9A 4R8HA 1MEC3 3WQ7A 5HCAA 4MGIE 4IEQA 4XFIA 5J37A 5KWRA 1ZBE3 5I8SA 4CP2A 4COWA 2P17A 1ZZ8A 2ARXA 4KNCA 1QOSA 4ASLA 2D3PA 3WG3A 3VHNA 1Q3EA 3MLJA 4RQPA 4F3JA 3AB0A 1SBEA 1RGSA 1ZA4A 4LNVA 3I54A 2E7QA 4N43B 4P9LA 3CJXA 4QQHA 3AFGA 4QGLA 3V0BA 3LA3A 4YG0A 5AC91 2PTMA 1TME2 3AZVA 2XLAA 4HKOA 2OUHA 5BV6A 4EN0A 3EO6A 2HWD2 3AP9A 3AKSA 2WFF3 1PK6B 5GLTA 4Z8BA 1UU4A 3INAA 2QJVA 3NKTA 1COV2 1W0PA 2WT1A 4AK3A 4AYUA 2QCSB 3J8F1 3AJYA 3AXDA 1WLDA 4AQSA 4AEDA 3B9CA 3KQRA 2RR11 3J4UH 3ZMOA 2QKDA 1X8EA 3WR0A 4URTA 4F8AA 1R091 4Y1XA 1POV0 2A6ZA 3AMNA 2GALA 4TSVA 4B4RA 4DFSA 1B35B 4I3GA 2GNDA 5JIUA 5DUUA 1POV1 2GC1A 3I2DA 4HKWA 1YIPA 1BJQA 3JD73 3KGZA 4L97A 5SV5A 1LCLA 3Q9OA 4GH4C 5KXBA 1LGBA 4DZGA 5FFOC 3AKQA 2XHKA 4HMZA 5DUXA 1LHUA 2DFCA 3WG1A 1GR3A 5ACA3 4QGNA 3KMHA 2VW1A 1DU3D 3GYDA 4UBGA 4CZSA 1YFWA 2XVKA 2GC0A 2MEV2 3GZTB 1ZZBA 5T5LA 5B2GB 3H7YA 3B00A 1YHFA 2SLIA 1QY4A 4AEDC 1F9KA 1FMD2 2WA3A 3H1YA 4E27A 3AM2A 3ZYRA 5T55A 5FMOS 4WVVA 1BMV1 2NN8A 1ZBA3 2YGLA 2VW2A 4JQRA 3SITA 3M70A 1QJZA 5K0UA 3VZLA 1PO12 1AXZA 1CPMA 3FJSA 4HBNA 2DCZA 2GH2A 1AR61 1NA1A 2EA7A 2Q8OA 3WNXA 4OULA 3ZXEA 4IESA 2RS12 3TWIA 2HWB2 2O0OA 1GNHA 2VMHA 4GA9A 3DV8A 4GB32 4NOTA 2A5ZA 1OPMA 2XKOA 2H0BA 1V6IA 1QJU1 2XBO3 2W52A 3P3PA 3FHIB 3H9AA 3THTA 3ZN4A 2WJSA 4HZFA 2DVBA 4FPYA 4PLNA 4RL7A 1UL9A 5CFCB 1S0BA 4PDWA 3VLBB 4YGCA 3E6DA 3LSDA 1CR7A 4Q4X2 3JBG3 4N90A 3BALA 2CGPA 4ZU5A 4OI1A 1BBT3 1ND3C 3HT2A 4DQAA 4RS5B 3AYDA 2WS93 1YI7A 3IT8A 5KXEA 3D0JA 4XBLA 1X33A 3AZWA 5K0UC 1U5IA 1R082 4ITCA 5FLHA 5JMCA 4TWTA 4E4DX 1NA1C 3GZAA 2VOXA 2ZABA 2Q1ZB 4RR3A 5HBAA 3E5XA 4Q2FA 5GZFA 3KCYA 1WCKA 1AL22 2PLV1 4P9YA 5C9AA 5JZGB 5K9YA 1AL0G 1QXPA 4B7KA 1UIJA 4JTOA 1RITA 5BNNA 5A32A 1JXNA 3WUCA 4X8PA 4BQ1A 4AGVA 4YVSA 4UW5A 4PDWC 1QHDA 1E57A 1DLLA 1GSLA 2OYZA 1ZRFA 1QH7A 4NN0A 1VRH2 5GZGA 3AYCA 4PIZA 4MSVA 5AFBA 1YUDA 3FX3A 5KBFA 2AR6A 4Z07A 4BOWA 3NAPA 4Q4Y2 1MS1A 2IZWA 1K5MB</