3WDYA

The complex structure of e113a with cellotetraose
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
296
structure length
296
Chain Sequence
YHLVDDYGRGNGFFDKFNFFTGDDPTHGYVDYVSRDVAAGAGLIGERDGRTYMGVDFTNPASGRGRRSVRLESKNTYEHGLIVIDLAHMPGSVCGTWPAFWTLGTGDWPYGGAIDIIEGVNDNTFNHMVLHTSDGCTIDNDGFTGNLKTSNCYVYAPGQDANAGCGIEATDPNSYGKGFNSIGGGIYATEITPNGISIWFFPRGSEPGDVLGDNPNPANWDTPAAKFAGGGCDWEGKFNAQRLIFDVTFCGDWAGNVWGIGGCASRAANCVDFVRDNPSAFAESYWLVNSLRVYAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mutagenetic analyses of a 1,3-1,4-beta-glucanase from Paecilomyces thermophila
pubmed doi rcsb
source organism Paecilomyces
molecule tags Hydrolase
molecule keywords Beta-1,3-1,4-glucanase
total genus 76
structure length 296
sequence length 296
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wdyA00
4KBBA 3ZXLA 4XILA 1C1FA 1OKQA 2GNBA 4NOTA 4P9YA 3V65A 1F31A 1N3PA 1UN1A 4YLZA 3WUDA 4CTEA 1JOJA 1CIWA 4YZ3A 4AGVA 4XBLA 1DYPA 4M01A 3GALA 3O5SA 5JOZA 5E88A 3AZZA 3B01A 3VKFC 4PBOA 4XHXA 2VU9A 2VXRA 1QOOA 2A71A 4HL0A 5GLUA 2D6KA 2ZGRA 2CYFA 1V6JA 4TYSA 1C1LA 5E8AA 3V64A 3PMEA 4BMBA 1A8DA 4Y1ZA 3WNXA 2W52A 3V0BB 1MZ5A 5JOYA 1WLDA 4XJ9A 4GWNA 3VUOA 2ZAAA 5JDBA 1S0IA 4YFZA 5CB7A 3UJOA 5T52A 4YG6A 1YXWA 1WBFA 4JC1A 3IKWA 4LBNA 3V0BA 2FMDA 3OYWB 1N1SA 5CNAA 1LESA 1DQ2A 4OZXA 1GZWB 3TAYA 3USUA 4BOWA 1V6OA 1S0FA 4Q1RA 2YROA 1Q8PA 4FPYA 2VW0A 3ZSKA 1CONA 3OY8A 2GNTA 2JDZA 1G7YA 4U36A 1QMJA 5DXDA 2JECA 4JRAA 3UJQA 3ILRA 5GALA 3AJZA 4ISQA 3VKNA 2GMPA 2GMMA 3AXEA 4FQZA 4YGEA 2JD4A 5L73A 2WLQA 1G8WA 4LBQA 2ARBA 3VV1A 1W6MB 1AX1A 1FX5A 4AGRA 1PZ7A 2R1BA 2A5ZA 2GNDA 2ZKNA 4YZ2A 2VH9A 1SLAA 1FV2A 1WD3A 1UPSA 2JE9A 2PHWA 1HQLA 4Q8KA 5GZGA 4GXLA 1IKPA 1IS6A 2AR6A 5T55A 4XBNA 1V00A 1A3KA 5JLVA 3RMXA 1SACA 1LHNA 2A70A 4FOQA 5H9PA 2C5DA 2ZMNA 3IM0A 3N3HA 4DQAA 4F83A 3B69A 2CY6A 2B7YA 1SBFA 2PELA 3WG4A 1LEDA 4YM3A 3T1LA 3KM5A 1SBEA 1MS9A 3RQ0A 3SNMA 4FPEA 4BMEA 4YGDA 1IOAA 2CWSA 3QLQA 2G4IA 2ZHNA 5KXDA 1BKZA 3A0NA 2WNEA 4XZPA 2D44A 4NO4A 1SLTA 5T5PA 3L2YA 1LU1A 3M1HA 1MVQA 3PVEA 4DPNA 2VW2A 4GKYA 4ATEA 2ZGTA 2EXJA 1N3OA 2E7TA 3AXDA 5IK7A 1HLCA 2D7FA 3WCRA 2ZA9A 4BQ1A 2DURA 2P3IA 2GN7A 4GWMA 2DTWA 4P9XA 2WQZC 1IKQA 2GNMA 2WT2A 1DYKA 3ZSMA 2A6WA 2LALA 1HKDA 1VLNA 1CQ9A 1AX2A 5EWSA 4Y20A 3NV2A 3D6EA 2GDFA 1LULA 3ZXJA 2PHXA 3RMYA 2DYCA 1SLBA 1J1TA 4AGGA 2D6LX 5JVVA 3FLRA 3IPVB 3WG1A 2WKKA 1WW7A 3UK9A 1LECA 3WDUA 1JYIA 1AXZA 1RITA 1V6MA 2A6VA 2DUQA 2KM2A 2ZABA 4FPGA 1WW4A 3JU9A 4PQ9A 4RA0A 3WDTA 1AX0A 2P34A 3SH3A 5EYXA 4ASMB 1AF9A 1FNYA 4WZFA 5GZFA 1LOBA 2ZGKA 5IK8A 2DUOA 1RIRA 1LHWA 1S0DA 2ZBJA 3ASIA 3OGGA 4LBMA 2DTYA 1H9WA 4Y1YA 3SITA 3WDWA 1YO8A 1CVNA 3GNEA 3AK0A 4FQ4A 3ILNA 4XXPA 4DRRA 5GJ6A 1KQRA 1QNYA 4TZDA 2D6PA 3RS6A 2DVAA 1S0JA 4YGCA 5HCBA 4FOWA 5KXCA 5KXBA 3MW4A 1JHNA 2ZGQA 4ZKTB 4JCKA 1WBLA 2AH2A 1CN1A 1Q8VA 4RL7A 4Y20B 4AWDA 1SCRA 2NMOA 2A7AA 2UURA 1D2SA 5SV8A 5CBLA 2A3WA 2AGSA 2P3KA 1MS3A 3PVOA 1LU2A 4BM8A 1APNA 1C57A 1GKBA 1LOFA 2SLIA 3NWKA 4XBQA 5FREA 5LK5A 5IK4A 2P2KA 4HANA 2Z42A 4Y22A 4BLIA 2DVDA 1LGCA 2V5YA 4XMAA 3AYDA 3WHTA 5DZEA 1W6OB 1BYHA 3DGTA 4U2AA 1IS5A 1HQWA 1AJOA 1JUIA 3POSA 1LEMA 1DQ0A 2D3PA 4XMIA 1UL9A 2WT1A 5JOXA 3HN1A 1O4YA 3JUUA 1AXYA 4Y22B 3INAA 3R05A 5HCFA 2NP0A 1QDOA 1KJRA 4Q1PA 2A3XA 4WV8A 1QNWA 1UZZA 4LBLA 4M3CB 1DQ5A 1X50A 4FPJA 1Q56A 3IPVA 3ATGA 1W6QB 3D5OA 4R9BA 2ERFA 4UW6A 4YFWA 1KJLA 5IT6A 4Q2FA 1WCSA 2P3JA 4XYXA 4M3CA 3AYAA 2NMNA 2ZGSA 1LCLA 2OW4A 3Q9OA 1Y7BA 2NZ9A 2UWBA 4YM1A 2DVGA 3UL2A 1FV3A 3OJBA 1N47A 1WLCA 3TB0A 5T5JA 5GZEA 1H30A 1V6NA 1W6OA 1DFQA 3FLPA 4GALA 4XHBA 2ZMKA 2VUAA 5GLVA 1GZ9A 2PHFA 3WLUA 1FYUA 2AYHA 4FOVA 1LOAA 2R16A 1YRZA 3V0AB 2D3RA 2GN3A 1WW5A 2YY1A 1QOSA 1W0PA 3ZXKA 2FHRA 3ZSJA 2R1DA 4AVVA 3SISA 2WT0A 3OBTA 3POYA 2ZGLA 4L8QA 2A3YA 1S0EA 1Q8OA 4YW2A 4FPKA 1IS4A 3WUCA 1VAVA 1W6QA 3U4XA 4XJ8A 1N1YA 4K1ZA 1SLCA 3I4IA 2EALA 4DRVA 3QCWA 2AREA 3AZVA 3HR9A 3MPPG 4K20A 2ES3A 2UWAA 1MS8A 2BQPA 3VKLA 1UMZA 3WHUA 1G86A 1QGLA 3R4SA 2AENA 5EYYA 2ZHMA 5H9QA 3M3CA 3R4UA 1S1AA 2R0HA 2XB6C 1OFSA 4M3CF 3BTAA 3RRDA 2VW1A 1ENQA 1U0AA 1WD4A 2PHRA 5IK5A 2HYKA 4R9DA 1YIFA 2YV8A 2ZGUA 3AP7A 4GA9A 5E89A 1SBDA 1FAYA 2GALA 1CPMA 4R9CA 4XJAA 3DUIA 1GLHA 4C1WA 2WJSA 2ZZJA 1ENRA 1LOCA 3MEPA 1ULEA 4DS0A 3FLTA 2UWCA 2OVUA 1JXNA 1WLWA 2D6OX 2SBAA 1SLIA 4GKXA 2WSUA 3M3OA 4YW4A 3W58A 2A75A 3AP4A 1PZ9A 1GNZA 2JE7A 2W08A 4YW5A 1C4RA 2ZGOA 4XE9A 5JMCA 5DZFA 3O0VA 3LCPA 2AUYA 2YZ4A 3SH5A 2I2SA 1JBCA 4MYEA 3N7JA 4FPFA 4IQPA 5DUUA 1BZWA 4FPHA 1DQ1A 2ARXA 5JOWA 3ILFA 2DU1A 3ENRA 1R1ZA 2V73A 1SCSA 1ONAA 3RSJA 2EXIA 4Y24A 3A4UA 2JKBA 4YZ1A 1CESA 1DHKB 1N1TA 3POWA 1Q8QA 3WG2A 3N7LA 2JJ6A 3ZYRA 5DUVA 1GNHA 1UX6A 1WW6A 2Q5TA 4YZ5A 3PVNA 4LBQB 4P14A 1BXHA 2W39A 4PBPA 3AP6A 2ZGMA 1GV9A 3MW2A 1EPWA 1NXD1 3NV3A 1GYKA 4ATFA 1DZQA 1LHOA 2YMZA 3B3QE 1DGLA 1LGBA 1G9DA 3AYCA 3BODA 1SLLA 1NLSA 1Z0HA 1VALA 1LHUA 1JN2P 1LOEA 3H0OA 4Q27A 4Z8BA 1MVEA 3N36A 1AJKA 3WZ1A 1LENA 1QDCA 3D4KA 3ZXFA 1GZCA 2NM1A 4XTMA 1W6MA 2DVBA 4XXAA 4C1XA 4M3CE 3AFKA 1S0BA 3FBYA 1WUVA 2DU0A 5F5QA 5T50A 2ZMLA 1CJPA 5T5OA 4UW5A 3C2UA 3O0XA 4YM0A 1MZ6A 2E6VA 4YM2A 4YW1A 5BYNA 2EXKA 2CNAA 3OY8B 4XJZA 3AZXA 3N7KA 4YW3A 1MS0A 3M3EA 1LJ7A 2ZGPA 4Q8LA 4ITCA 1YI7A 1ULDA 2H0BA 1LTEA 2LTNA 1OQ1A 1Q8SA 1S0CA 2R49A 1I3HA 2WSVA 1DIWA 2D3SA 3T2TA 1G9BA 1GICA 3NV1A 5KXEA 1H9PA 1AZDA 3N35A 4FP2A 4UW3A 1O4ZA 1SFYA 4XTPA 3WOGA 3ZXEA 3WG3A 3AP9A 1CPNA 3AJYA 5IUQA 3WDXA 4H55A 4YG0A 2DUPA 5GM0A 5F9TA 1W0OA 2NYYA 3KQRA 2E51A 1XQNA 2ZHKA 3A0KA 3LSEA 2PHUA 4K1YA 2CTVA 3M3QA 4LBQD 3WDVA 4D69A 2TEPA 3NV4A 3O0WA 1S0GA 1ULCA 4PF5A 1MACA 1ULGA 1LGNA 1MS4A 3O12A 1B09A 4WVWA 4Y1VA 3ZVXA 1ZM1A 2A6XA 2DV9A 4ISRA 3VKOA 1W6PA 4FVVA 2XG3A 1V6LA 1LOGA 2DVFA 2E53A 1BQPA 2RHPA 4YGBA 1D0HA 3FUQA 1GANA 2UU8A 1AVBA 1W6NA 4AVTA 1JW6A 1JYCA 1W6PB 3PJQA 4Q26A 5DUWA 3WVJA 1I1EA 3ZSLA 2D6NA 4SLIA 4FP3A 2EIGA 1VIWB 1QU0A 5T54A 2ZGNA 1LHVA 5H9RA 2ZHLA 1MS1A 3SLIA 3ZYPA 3M2MA 1GSLA 2A6ZA 2OUHA 5FRAA 1BJQA 4PCRA 3AYEA 5AVAA 1MS5A 2P37A 3B9CA 5EXOA 3B00A 4Y1XA 2PHTA 1TEIA 4FOYA 1G9FA 2YXSA 5DG2A 1V6IA 3AZYA 1DBNA 3BOPA 4K21A 5CAZA 4LBJA 1N1VA 1LODA 2DWRA 2CWMA 5HCAA 1DQ6A 1MR5A 4LBOA 1QOTA 3IMNA 1W6NB 2E7QA 3OBRA 4W65A 4BLJA 1HDKA 1KRIA 4BPZA 4WVVA 2C9AA 3I8TA 1VAMA 1Z78A 5GZDA 3WV6A 4XJWA 3HMYA 2VY0A 1DLLA 3V0AA 5H9SA 4I30A 4XIKA 3OPZA 3WDYA 1URXA 1UKGA 1N3QA 1IS3A 1F5FA 2D6MA 2R0FA 2W68A 3RG0A 3OYWA 1FATA 1YYNA 2D43A 4Y26A 5GLZA 4ZXKA 3AZWA 1GBGA 2EAKA 1UAIA 1ZA4A 3APBA 3AX4A 4CRQA 4FPCA 1V6KA 4XDQA 4XJUA 4XIOA 5CA6A 4UW4A 5DUXA 1G9AA 2GMEA 1QF3A 4R9AA 4FPLA 3VKMA 1DQ4A 1A78A 1KITA 4YZ4A 3SH4A 4P9WA 1RINA 1KDMA 1PZ8A 5GLWA 4Y1UA 1FNZA 1LOFC 1G9CA 3IN9A 5DG1A 2EXHA 4M00A 4XOGA 1AXKA 1F9KA 4FPOB 1CR7A 1QKQA 5T5LA 2ENRA 1GZWA 3FUOA 3USUB 3LSDA 3BIWE 3MW3A 4CZSA 3CNAA 3ZPYA 4YG3A 3N7MA 3W59A 2OUJA 4AVSA 4LBKA 2EF6A 2ZACA 3T1MA 4DFSA 2NN8A 3FFZA 1ULFA 4AYUA 1KDKA 1UZYA 3AP5A 3WCSA 5GLTA 5GZCA 5DZGA 2A6YA 1ENSA 2CL2A
chains in the Genus database with same CATH superfamily
4S2DA 5A6QA 4KBBA 4XFFA 1WMEA 1C1FA 3ZXLA 3BIEA 3HQXA 4RR3A 1YQ2A 1JOJA 4Z2WA 3ROUA 3GZTB 4AGVA 4XBLA 1DYPA 2DDUA 3AVSA 4M01A 5LB6A 3VBHA 5FAXA 2O14A 4L0PA 4XDOA 3B01A 3TEYA 1UO9A 2VU9A 5FY7A 3JCIA 3ZN6A 1W9YA 1CAUA 4H7MA 5CVRA 3CL1A 2CYFA 5I8SA 4TYSA 1C1LA 3LD8A 4YVWC 3OGVA 4BMBA 4DEVA 5JCTA 2J22A 3GGLA 4C0HA 5FDBA 4Y1ZA 4AHYA 4M4RA 4P00B 2VECA 1H8TA 5JR7B 3I3BA 1QJEA 4XAEA 5CG8A 1O4TA 1AYM1 1PGSA 1X36A 3CJIA 5JDBA 5CB7A 1VRH2 5T52A 2PAMA 3V56A 2N7GA 1SPPA 5LRRA 4ARXA 2PHLA 3OPWA 3W20A 1YXWA 3H1MA 5LEJA 2WS93 3IKWA 3V0BA 1NCRA 4HOOA 2BP6A 1N1SA 1DQ2A 4OZXA 3TAYA 2WAOA 1Q8PA 5LASA 1GP4A 2VGDA 5FK7A 3I59A 2GC3A 1DG6A 4KL1A 1DZTA 1GOFA 2EICA 1H2NA 2VQ0A 2GMMA 2W9XA 5AFBA 3P3PA 4P02B 4YGEA 2JD4A 2FDJA 3KT4A 2WLQA 4HPKA 4XEZA 1G8WA 5L73A 2ARBA 4HFSA 1FX5A 3RJRA 5C5UA 1O6UA 4RR3B 2BDRA 1BK1A 2VH9A 5BNPC 1WMDA 1W8WA 2XJVA 4J1XA 1XNAA 2Y6HA 4GXLA 1IS6A 5T55A 2KXLA 2JIGA 5FZ9A 1D7PM 1W8HA 5JLVA 3BU0A 4HXCA 4QXKA 2I74A 2WO7A 2C4XA 1AHSA 2ZMNA 3GJBA 5FZIA 4F83A 2XWJB 4MO3M 3WG4A 1LEDA 4CCOA 4YM3A 3T1LA 4H14A 3GBFA 3D3AA 2CAUA 1T2XA 3LA3A 4KWJA 2IVJA 1MS9A 3G7DA 3MLLA 2HWF3 2FDIA 2EA7A 1IOAA 2VO5A 3QLQA 5L9VA 2R062 3WX5A 3EYPA 1C8M3 4INDA 4NO4A 4B3NA 5T5PA 3C7HA 3ACGA 2QCSB 4JGYC 5BNNC 4Z92B 3EMRA 3KGLA 4AQ2A 4JAAA 4GKYA 4ATEA 4CCCA 2ZGTA 5FO9B 2B9VA 5D2AA 4AHWA 1O8SA 5BXXA 1LAJA 5C9AA 2ZA9A 2P3IA 5I0TA 1IPSA 4YRDA 4PLMA 1UU6A 1FT9A 1W8OA 3S5AA 2GNMA 4WVMA 1WCUA 1OQDA 3ZSMA 2WN2A 3NKTA 4Y5SA 4UBGA 3U11A 4DUVA 5C8CA 5JXGA 1PIV2 4BQYA 5EWSA 3VDAA 4AI3A 4LHSA 3BU7A 5G05L 3MIDA 4PIZA 2Q8DA 1NCQC 5FPLA 2DYCA 2VMGA 4JTOA 1JYNA 1J1TA 3IPVB 2VMHA 4QX7A 1PK6A 1VBA2 2WZR3 5CEHA 4LA2A 4UAPA 3ZYJB 1Q43A 2XR4A 2YU2A 4BXSV 1RITA 1V6MA 2A6VA 3KLSA 2BFUS 2DUQA 3W21A 2JDKA 3IIAA 5BNPB 1WW4A 1QJY3 1XOYA 3G6JB 2AEYA 4PQ9A 1AX0A 3SMHA 3WDTA 2P34A 3OD4A 3RYKA 1C8M1 3WP6A 1HB4A 4XW3A 2JDNA 3UNPA 4MX3A 4XVHA 5IK8A 2ZGKA 1AR93 1AR63 3OGGA 3ASIA 5AVPA 3ZXDA 5A6XA 2YGMA 4LBMA 4WM8B 1AR73 3GZEA 3J4UH 3SCFA 2WZPP 3WDWA 1YO8A 3KVAA 3AK0A 5J98B 4QKFA 4XXPA 5LBCA 4OQ9A 1ZREA 3B9IA 1OKOA 2VZRA 1ZZ8A 2D6PA 1W04A 4GD4A 5A6ZA 3Q8FA 1WA4A 4HONA 1S0JA 1CX4A 4YGCA 1F15A 4FOWA 3ORJA 1OA3A 4Q8KA 4AI9A 3U14A 1OA2A 2QBXA 3K3OA 2E26A 4JCKA 4ZS3A 3ZYHA 1TNFA 1GWMA 1FOD3 3MBWA 4URTA 1IPJA 3MI8A 4HVOA 2QQUA 5SV8A 1D2SA 4XDPA 3J7HA 1JZ5A 2P3KA 4XFIA 1LU2A 3U37A 1XE7A 4MHUA 2Z42A 3OUHA 1LGCA 2V5YA 2YBSA 1XPWA 4CEWC 1BYHA 3ZPOA 2RS31 3PDQA 3S6PA 5CU1A 2B9UA 4HSJA 4XMIA 1ZBA1 1O4YA 4XACA 3INAA 3R05A 5FXXA 1D2QA 2NP0A 1ND3B 3POIA 2XJSA 2A3XA 2XOMA 3CJXA 3JZVA 4WV8A 4XCAA 1ALYA 3OF1A 3VDDC 2QE3A 4CU7A 4I0BA 3UGFA 4D6RA 5HV0A 3IPVA 1RUF3 4Q4V2 1W6QB 1QIQA 2ERFA 4OVEA 2BGPA 1IHMA 5K0UA 4AAXA 5I8TA 3ZOIA 2PYTA 4B29A 2BERA 3NL1A 4XYXA 3N4MA 3KHBA 2G9FA 3TN91 5BY5A 5FCCA 2JG9C 2ZGSA 1QXJA 3KS7A 1Y7BA 3GDBA 4NHMA 1WLCA 1R081 1MZFA 5GZEA 1H30A 3ZR5A 1D4VB 1CZTA 1W6OA 3FLPA 1NLQA 2E63A 1HXS3 5GLVA 3U75A 1GZ9A 2PHFA 1UF2C 3RYRA 4R4ZA 1LOAA 4OUMA 3S57A 4XUNA 3POEA 1QOSA 5LY2A 1TNRA 2GP3A 4QB6A 2D97A 5J1XA 2R32A 1XNCA 3ZR6A 5FZ7A 2QQPA 1ST8A 2RM22 2Y38A 3OBTA 3POYA 4DEQA 1S0EA 2Y6GA 2K0GA 3I3DA 1EV11 4YW2A 1TMF3 3UGHA 4S2FA 3WF0A 1D4M1 1YC61 5I0SA 2WRAA 1Y3TA 3DL3A 3HAGA 4IE7A 3FFQA 1SLCA 3JD73 4K1ZA 5C5TA 3THCA 3QCWA 2WNVA 1AL22 3AMHA 2F6BA 4R8HA 5IFTA 1J84A 5FP7A 1UWWA 2AREA 4LO4B 3AZVA 3I3QA 3HR9A 1D4M3 1ND3A 4A7KA 1DCSA 3D0SA 4IV3B 2DFCA 4XF1A 1SZBA 1O5LA 1D0GA 1IQDC 1JZ2A 1RUI3 2WNUA 2VCCA 5I0UA 1PMIA 1QGLA 5KHIA 3R4SA 4PIXA 2HEYF 3THTA 2WAAA 4H3WA 1UQXA 3O1MA 2R0HA 4LPLA 2WC2A 1VP6A 3BTAA 2QQKA 4Q4W2 4B7EA 5D8AB 4AFAA 3B7MA 4HK9A 5A3LA 4YVWB 2PHRA 2OIIA 3VBRB 2HYKA 5IK5A 4R9DA 1AL23 2YV8A 4MHRA 4XF9A 4D8MA 5KHHA 4OI4A 5C8CC 1U12A 3OBAA 2IXIA 1X7NA 1GLHA 2VZQA 3DUIA 2ZZJA 2PXJA 3WNOA 4DS0A 4GMP3 4E8DA 1NY71 3J7LA 2D6OX 4GKXA 2SBAA 3GHMA 3K77A 2VZUA 4YW7A 2F4PA 2C26A 1C4RA 1W3XA 4FT8A 2ZGOA 4AI8A 5DZFA 3O0VA 4WVMB 3LCPA 1NCRB 4EROA 1JBCA 3MFCA 4AL9A 1W28A 4FPHA 4OCTA 3A23A 5AC92 5J36A 5A70A 1JZ7A 1DQ1A 2Q8CA 5J09A 4OUSA 3IDBB 2TUNA 3ENRA 2WNVB 4MADA 4NUBA 5B4XA 4BE3A 3ZKYA 3RSJA 3VZLA 3A4UA 1RUD3 1XB9A 2Y6JA 1N1TA 1UYXA 3RYPA 1SDDB 2VZ1A 1DLCA 1CZVA 1UX6A 2P3YA 4AEDC 4YZ5A 1HRI1 4LBQB 5J7MA 3LE0A 2XUEA 5FMOS 1GQHA 4P14A 2WNUC 3WF1A 4AF9A 4BH9A 1OXCA 3PJYA 2Y6FA 1GV9A 3NV3A 4ATFA 1WA6X 1GYKA 2RR11 4UFKA 3PUQA 2LW8A 1DGLA 1QH6A 2UYAA 5FYYA 3AYCA 1NLSA 3H0OA 4I01A 4Z8BA 3LGRA 4CDXB 2VQTA 3IDEA 3TNPB 3T2PA 1B35A 4K40A 3I2IA 2QQIA 2D93A 3MIHA 2F4LA 3ACLA 3OTFA 4HSLA 4IW3A 3WZ1A 5CKNA 5EJZB 4LQRA 2YFZA 4XTMA 4AI1A 1PM7A 1H2KA 2X5IC 4C1XA 2O8OA 1S0BA 3HBKA 3JB4C 4PIYA 3TWIA 2DU0A 2WINB 3BTXA 1JI6A 1CJPA 2J1VA 2ZTNA 4NAOA 5T3NA 4UFIA 3OGJA 2JG9B 1CIYA 1RJ7A 3OY8B 4BXFA 4HKLA 3MIEA 4QDRA 3N7KA 2YU1A 2RS53 4L97A 4XJZA 4BCUA 4D94A 3MDPA 3BTYA 1M06G 4DXZA 1FMD3 3DPRB 1ULDA 5LWBA 2R063 1COV2 1UCXA 2JKXA 4GULA 5FUPA 5K9YA 3GCXA 4E27A 1NG0A 1IG3A 4DUWA 4IEXA 1ZZCA 4CCLA 1ODNA 1RUOA 1W9TA 2XVGA 3E5QA 1DGWA 1JMUB 4XTPA 5KC6A 2JDAA 5FZGA 1A6CA 4KBZA 5FUIA 3WDXA 2XJPA 4H55A 1O5UA 3ZYGA 3WQ1A 1QJX1 2LRPA 4BZ4A 4I3PA 1ZRCA 2W47A 2YC2A 1XQNA 3A0KA 2PHUA 5FBJA 5FYCA 3I49A 3NV4A 3O0WA 4EWAA 4UWDA 2H6CA 1ULCA 3PURA 3ST7A 1MACA 2RR12 3AMNA 4TLFA 4YVSB 1MS4A 3OPTA 3VBRC 3VBOB 3ZVXA 1E5HA 1H2LA 1HW5A 1ZM1A 4HVQA 2BNMA 2IUWA 2WUHA 4ISRA 4K6BA 4PDWC 4FVVA 2XG3A 3VKOA 3VLBB 3ZXAC 4CEYC 2DVFA 3BN6A 3LOIA 4N8MA 5FPBA 1OSGA 4YGBA 5LZ6A 1CGPA 1KS4A 3NNJA 1W6NA 1GWLA 2VL4A 3I97A 3QD6A 4QKNA 4Q5OA 3RNSA 3T4VA 4I09A 4M0HA 2Z2SB 1VRH3 3PJQA 1O8PA 4QXCA 3H8RA 2K2SA 4FP3A 1ASJ2 1VIWB 1XYNA 1UOFA 5L7OC 3HT2A 2E9QA 2ZHLA 5FZ4A 4XUPA 2XKOA 1W9SA 1GSLA 1YJKA 2A6ZA 2OUHA 1POV1 2HWF1 1TZOA 3CMGA 4PCRA 3UKTA 1L7LA 3AYEA 3EJKA 4PI2A 5ERLA 2P37A 4MV2A 5EXOA 4LHLA 1K5MC 2WA3A 1G9FA 4AFBA 1HJGA 1NY72 3PU8A 1ZBA3 2WN3A 2Q4SA 3N9QA 4MH0E 1E5SA 3AZYA 1RXFA 1K12A 2OQ7A 2O8QA 4LLOA 3JD71 4LLFA 3J7NA 4RHV3 3LOBA 1DQ6A 1MR5A 4LBOA 3ABZA 1QOTA 1WMXA 2JG9A 5A3WA 3IMNA 3OBRA 4KNCA 4FO9A 4WVVA 1VRBA 3I8TA 3TEZA 4PI0A 1Z78A 4XURA 3DPRA 3HMYA 1CAWB 2VY0A 3IMMA 4LK6A 4LKSA 4GWIA 4A6OA 3AMMA 3VBOA 1URXA 3JBG2 2XBO1 5IVVA 3RZKA 1N3QA 1AL21 3BYWA 1BVP1 3OYWA 1FATA 1YYNA 4NR1A 3DEMA 1YEWA 2R071 3APBA 5CZKA 2RS12 4LTAA 2C0ZA 2JIJA 5DUXA 1UOGA 3RZJA 1QF3A 1A78A 3SH4A 3VD7A 2WWSA 2QQNA 1QJX2 2JB8A 4N43C 2R7EB 1W8TA 2J7MA 4LULA 4QT6A 3VZMA 1KDMA 2VZOA 5GLWA 4CXWA 4ES8A 5IAVA 1G9CA 3NAPA 1W2AX 1PNGA 5FIXA 1F9KA 4NPMA 4XFHA 4QXBA 1QKQA 2BOIA 3PTRB 4QXHA 5T5LA 4QMAA 2E7AA 3BIWE 3VHNA 1SG3A 2MEV2 3CNAA 3HBZA 4YVWA 4EWDA 2PQQA 5CG9A 3UV9A 2Y60A 3PU3A 2W1WA 1VBC3 3T1MA 4DFSA 3ME2A 3FFZA 3VDDB 1UZYA 2QQOA 5L9BA 4RQPB 5GLTA 1HRI3 3WCSA 5GZCA 4NIIA 2E31A 2CL2A 2XXZA 5J37A 3V65A 2HWB3 4NOTA 4CTEA 1F31A 1N3PA 4YLZA 2F17A 4YZ3A 4MUVA 3CDZB 3LIHA 3RZLA 3N9PA 2NQYA 2VBBA 2PFWA 3O5SA 3RZHA 1FOD1 1WLTA 3AZZA 2QJVA 4PBOA 2A71A 3CZJA 2RS32 1X9PA 3C3VA 4DIQA 1XYPA 2BWCA 3ACIA 4QHBA 3CIHA 4X8PA 4XPVA 5D8AC 1MQTB 5JXIA 1A8DA 4A4AA 4GQ7A 4JQRA 2BRTA 3PLQA 1MZ5A 4QWNA 3W9AA 5JOYA 1BMV1 3WP3A 3CO2A 3LA7A 1EPZA 1Q5OA 1S0IA 5C70A 2JWPA 3UJOA 4N9HA 4TN7A 1F35A 1ULOA 4KWLA 3RZGA 2FDGA 2WS92 2Y26A 2TNFA 4QQLA 5FP3A 2FZ2A 1UY4A 1RUH3 4RD7A 1PGW1 2HWE2 2RS51 4D6SA 2PMWB 1US2A 2IVIB 1NX9A 2HWE3 3OYWB 2ZX4A 2WZ8A 4N90A 1LESA 5DDJ1 4ASLA 3GM8A 1C5IA 2WZR1 3USUA 4BOWA 1PHMA 5CADA 4ZS2A 1S0FA 2YROA 4FPYA 1AR92 2VVDA 3C7GA 3PMSA 4HK8A 4JQTA 4LO8A 3H3UA 1CONA 5CISA 2GNTA 2JDZA 2R042 3FWEA 3KF3A 1QMJA 3FMGA 3NNGA 3OEAA 4JRAA 4RN5A 1TVGA 3T4HB 3AJZA 4IV1C 2XHKA 3AXEA 4FQZA 4RGGA 5A1AA 2J1RA 3H7YA 4LO6B 3FN9A 3SKVA 4LBQA 2E32A 2VM9A 2WDBA 4FSJA 2R1BA 2ZKNA 5JIAA 3UT0A 1UYYA 2FCVA 5GZGA 5LA2A 3HT1A 1YQ5A 2AR6A 1V9U3 1V00A 1A3KA 5F32A 3PHMA 3RMXA 2BBVA 1QJU1 2DCZA 2A70A 3N3HA 2EIEA 2RMU1 2CY6A 2JDMA 1UU5A 4HETA 3SKJE 1SBEA 4JVAA 1QH7A 3H9AA 3ZIXA 4OI2A 2LM3A 3WNLA 1QJU3 4DXSA 4YGDA 1UMIA 3N9NA 1QJU2 2RS11 4CXYA 4B7KA 5FYIA 2HWC1 3TN93 2BBAA 1VBB1 1MVQA 1ZZ7A 1R083 1JHJA 1E57A 2ET1A 2VW2A 3VZJA 4CCEA 3HEIA 3MZHA 1PO23 1L7QA 1N3OA 2E7TA 3AXDA 5A80A 1PM4A 1PO22 4NPLA 3E5XA 2HWB2 3DKWA 2DURA 2HYXA 2BYVE 4GWMA 3WW1A 2DTWA 1HV1A 1D4M2 3DXUA 5FZCA 2WQZC 2WT2A 1JYWA 5EFUA 1RTVA 5D21A 1RUF1 2WLPA 2WQ8A 4LHKA 3FE5A 2L9LA 1OPOA 4IGPA 2RJKA 4JGZB 4PHZA 4XFAA 1RUG1 1VBA1 1WCQA 2HH9A 4HVRA 5FYTA 4N43A 2J1UA 1GQPA 5A3UA 4I2OA 4BQ5A 1T6GC 1XNBA 2O1QA 1W8ZA 2PHXA 3R6SA 1F2NA 4LUKA 5KHGA 1VBE1 3PUSA 1OPMA 1SLBA 4CEWA 2W1SA 3FLRA 5JVVA 3F2ZA 4KI5M 3CZUA 3UK9A 1W8UA 2OZ6A 1EYBA 1JYIA 3LFMA 2ZABA 3ITQA 4FFGA 2OS2A 2VZ3A 2ADDA 4FPGA 2BGOA 4RA0A 3H8OA 5F3GA 5A7SA 4EZHA 1OMIA 4NJ4A 5EYXA 3ETPA 1ZA7A 5L19A 1W2TA 5DAPA 1JYTA 2VMDA 5GZFA 2WFF1 4S2GA 4QU2A 3C7EA 1LHWA 1VE0A 2B5HA 2XWBB 5FYBA 5EHDA 1HXS1 1X8EA 2WO2A 1HQNA 1MZEA 5JXHA 1UYPA 3VBUB 1AYM3 1CVNA 1RUE2 4FQ4A 4AFDA 1S55A 1HV0A 5GJ6A 3DCQA 4TZDA 1QNYA 2VCBA 1ZZ9A 5FY1A 2FZ1A 2ZZQA 4RGAA 5FKBA 3RS6A 2DVAA 4Y5TA 1OT5A 3OGSA 5L9RA 2QUOA 5KXCA 4UFMA 5JWPA 5KXBA 1WCKA 1JHNA 3FX3A 4OI1A 1O7FA 1JU3A 2AH2A 1Z7S3 4RFT0 4RL7A 4NIDA 4HN1A 3DYMA 1CJDA 4AWDA 1QQP3 1SCRA 2NPIA 2W1UA 5CBLA 2A3WA 2CHHA 4BU2A 4QX0A 1LOFA 2SLIA 1R1A1 4DNYA 5FO8B 5IK4A 2ZOEB 4NWWA 4AK3A 1UU4A 4QX8A 4BLIA 1DZRA 2DVDA 4XMAA 1O3TA 3PUIA 3DGTA 4U2AA 1IS5A 2RDSA 1ZX5A 2VTXJ 4B1LA 3ZYFA 2D3PA 2JB4A 2W5FA 2WT1A 1E5IA 1Y9MA 2BZDA 4FXKB 5HCFA 3P5BA 4UI9L 3IAQA 5EV7A 5FY8A 4IEPA 1RUC1 4GB32 4QKBA 5KHJA 4AEJA 4ASKA 4QPYA 3MPBA 1DQ5A 3Q8CA 1X50A 4M3CB 3BVCA 4O7XA 2JG8C 3VD4A 4CDQB 1DP0A 4OYUA 4Z07A 3ZFGA 2VOXA 1WCSA 5KC5A 3KSCA 4CP2A 4YM1A 4LUMA 3J8F2 3HQRA 2UWBA 3UL2A 2GAUA 3OJBA 1N47A 3TB0A 3UKNA 2D5FA 5G04L 4FBFA 4CSWA 5KWRA 5IJRA 2ZMKA 2UY9A 4K7JA 5K0UC 1FYUA 1HN0A 2PLV2 4FOVA 1BEV3 5DMYA 1VBC1 2X10A 3LEKA 4WM8A 4QQ2A 2D3RA 2PTMA 3NVCA 4E4SA 3ZXKA 5J96B 1RUH1 1WZXA 5LW9A 1RUI2 2RS13 2XVKA 3ZSJA 4AQTA 1YFXA 3SISA 2B42B 4L8QA 4AVVA 4O9EA 4CP0A 1TMF2 1H4HA 5AC91 3WSOA 4KU7A 3N9LA 1LNSA 3U4XA 5KR7A 1N1YA 3FBMA 1PVC2 3SCHA 4HPKB 4FTBA 1VBD3 2OXBA 3POJA 3URFA 3U10A 1K5JA 1W39A 5LY1A 4KU8A 3P1IA 1V9U1 3AKSA 4IEQA 3DV8A 4K20A 4CDWB 4A3ZA 5BNOB 2ES3A 4RQPA 1MS8A 2BQPA 4IEOA 3T2QA 4P9JA 3BUCA 2MEV3 1G86A 3A22A 5SV5A 1OBNA 3GBWA 5EYYA 1QJZA 1YIPA 5JI7A 5L36A 1F4AA 1OLMA 1IGOA 4M3CF 4Q4Y1 5KHKA 1NE6A 1MQTC 1XE8A 2VW1A 3POBA 3BPZA 5JR2A 1O91A 3KD4A 4P9LA 2JICA 4ZXEA 3KB5A 2XQXA 1S2BA 1VBD2 1YIFA 2ZGUA 3BKZA 4GA9A 4L11A 4Q4Y3 5E89A 4AEDB 2ZEYA 1YFYA 3ZFFA 4V2VA 2XHNA 4RHV2 2AEZA 5A1LA 3T0DA 1RMU1 4F8AA 1BCXA 1OF3A 2UWCA 3VN4A 2ARCA 2VVEA 1SLIA 3M3OA 4Q0VA 3W58A 4P5YA 4RSUA 1GNZA 4CU8A 4YW5A 5LK7B 5JZGB 2OT7A 2QZ3A 5F5IA 2ADEA 5JPNB 3SH5A 2VQUA 4GH4C 4H2AA 1YNAA 3H42B 4A3XA 3N7JA 4FPFA 4XQ4A 5DABA 1ZZBA 3VBOC 2ARXA 4V1PA 3ILFA 1R1ZA 1JOBA 5FP4A 2X53S 4BQ2A 4WVZA 1R091 1DHKB 5FZKA 1X9TA 2D40A 5ABJA 5ACA3 2YB7A 4CU6A 3ZYRA 4D0QA 5DUVA 1IPKA 1GNHA 4OHYA 2IXHA 1XBFA 2VD7A 4AHXA 1OQEA 3VBSB 2W39A 1RB8G 5FY9A 3KT7A 4PBPA 2ZGMA 3MW2A 4PJYA 4LIUA 1DZQA 1JOPA 1RJ8A 2E33A 1GOGA 2YMZA 2XLGA 1LGBA 1ZBA2 2VOKA 5FZOB 1G9DA 4YNIA 1BBT2 1VALA 1LHUA 1FMD2 1MVEA 1OH4A 1JODA 1RMU2 3DPRC 4NROA 4QPIC 1UY1A 4CDUA 3CEWA 1GMMA 5LATA 1QDCA 2BPA2 4LOSA 5FOJB 1HJFA 4OHVA 3J26N 3DF0A 1W6MA 2DVBA 4GWJA 1UOBA 4XXAA 2VAUA 3AFKA 4CCDA 4E4ZA 2IXCA 1PGL1 3MUY1 5T5OA 2VVFA 4UW5A 4YM2A 4YM0A 4AW7A 4NIGA 3KQ4B 3CKHA 4WM8C 1PVXA 2QFEA 5FR3A 5FZMA 3P6BA 2VNGA 2WZEA 3MUZ1 1MS0A 3K75B 3NJVA 2ZGPA 5IW0A 1CWPA 1LTEA 3QOPA 3SEPA 2YHJA 4XCBA 1R1A3 2R49A 1I3HA 1NE4A 4J6GA 3VBUA 4IE5A 4EN0A 1UOJA 4TTGA 1OOPC 3T2TA 4AR2A 5A3PA 2WABA 2Z5WA 5KXEA 4FP2A 4R52A 1K45A 2HEWF 2A73B 3C8XA 3ZXEA 4PF1A 3WG3A 2C9KA 1CPNA 3AJYA 4UF0A 3ZM8A 4NVPA 1W3VA 5JZGA 2Q30A 1XSRA 3GXUA 2DUPA 2W91A 1W0OA 4RQPC 1EAH1 2XONA 2ZHKA 3LSEA 2CTVA 3M3QA 5DQ0A 4AI2A 2TEPA 4ARYA 5JUVA 5FMBA 1TME2 1PMJX 1LGNA 5FXVA 4C0BA 1B09A 2VCMA 3H3LA 2BGCA 2A6XA 5JSPA 1W6PA 1V6LA 3IB3A 4NWVA 4UOJA 1BQPA 4H7LA 5IVFA 5HBAA 3HOBA 5AFEA 2UU8A 1AR72 3I7DA 3K4DA 4AVTA 5F3EA 5JPMB 2AZ5A 2B39A 5A7NA 4CCMA 1GP5A 2P1BA 1JYCA 2IWGB 4QM8A 4Q26A 3MHZA 3O7OA 2Y33A 2W46A 3Q8AA 4Q4W1 1PIV1 2W92A 1QU0A 2DBNA 3RWNA 1CAVA 3GCWA 3GF6A 3SLIA 3ZYPA 5FJHA 3M2MA 1JZ4A 1XNTA 3MIFA 5FUNA 5A6YA 2CGOA 5FRAA 1BJQA 1I6XA 3W5NA 4FAHA 4SBVA 4IV3A 4Y1XA 2PHTA 4FOYA 3HNMA 2WR9A 4IV1A 3ZFFC 2I07B 2Y34A 5C4WB 5DG2A 1PO13 1VMFA 4LNVA 4A6SA 4K21A 4BIFA 1A8MA 1LODA 1YQ6A 4W50A 2KA3A 1MEC1 1PX3A 2DWRA 4XF3A 5HCAA 2P6CA 4QQPA 3IWZA 2JDHA 5FBZA 2JX9A 4BK4A 1W0NA 4RS5B 4BLJA 4QGLA 3K48A 4BPZA 2RM21 2BNNA 2C9AA 1VAMA 2CU5A 1FXZA 5FXWA 3VBRA 3WINE 4XJWA 2D98A 4IE4A 1DLLA 4B8EA 2BTVC 5IVBA 1NQJA 4LORA 4XIKA 5BPXA 5DDJ2 3WDYA 5JSOA 2R041 3PTYA 1GU3A 1F5FA 2R0FA 1W2OA 2D6MA 3RG0A 3ZFEB 2ORXA 2D43A 4Y26A 2VNRA 1QWRA 1GFF2 2EAKA 1UAIA 1ZA4A 2K46A 3AX4A 1FMD1 4NIAA 4UW4A 2OX0A 4OFGA 3TN92 3E97A 2HEVF 1POV0 1R1A2 4QX3A 1NQDA 1QJX3 1KITA 3DYOA 4P9WA 4IE6A 4HBNA 2QQLA 1RINA 4LE3A 3VHOA 1R082 1PZ8A 4DY3A 3VBHB 2RMU3 1LOFC 3IN9A 1BK0A 5DDJ3 4JX0A 5DG1A 1K5MA 4BJ0A 3HD8B 5JOWA 4JRLA 2V72A 3TNQA 4FPOB 1CR7A 3FL7A 1POV3 1GZWA 2ENRA 2MPFA 3LWCA 5FZ6A 4IUGA 4E9KA 2H0VA 4Y3OA 2P5BA 1BLZA 3L9JT 3ZPYA 3WP5A 2DCKA 3KV6A 4LBKA 3KVBA 3UKVA 5IYYA 2NN8A 2QZ2A 1JH5A 1ULFA 3LA2A 5FYHA 1AR61 1NA1B 3AP5A 2QKDA 5DZGA 2X8KA 4I0AA 5IATA 4KWKA 2VULA 4MSVA 4META 4P9YA 2GNBA 1UN1A 2JG8A 3LB9A 4K8RB 5FTTC 4LMFA 5I93A 1U5ZA 5EIYB 2V5DA 4XF0A 4BB3A 1QY4A 1OOPB 3HPNA 5FPZA 3THDA 4MXWA 3UESA 5B4NA 2IXJA 3NAPB 3OB8A 2RS33 4XHXA 2VXRA 1WCDJ 4HL0A 2G9ZA 4N9IA 2RV9A 3KCCA 4MZUA 4OUEA 5GLUA 5FZLA 3PVBB 3S30A 2D6KA 2ZGRA 4B4PA 5HV4A 3V64A 4MGIE 4KQ7A 4GJYA 2GP5A 3RI8A 4NHLA 1NZCA 4QPIA 2C24A 5A32B 3S7IA 3WNXA 2W52A 1H4GA 4MG2A 4CU9A 1J59A 3MLJA 5EP9A 3TOJA 3VUOA 2ZAAA 4W8JA 1VBB2 5J48A 2FMYA 3GZAA 1SHWB 4IV3C 1WBFA 4CDWC 4DXTA 4LBNA 5BNOC 4RR3C 1CAXB 1PK6C 1DU3D 4RYDA 5FY5A 4XC9A 2DCJA 1US3A 1XRUA 5CNAA 2QDRA 5F3IA 3T3YA 3AKRA 5LA9A 4CDUC 3VZOA 4EV0A 1Z7S2 3KV9A 4Q1RA 3ZFFB 5FZOA 1JTZX 1SFPA 2VW0A 3ZSKA 3OY8A 1UY2A 3JBG1 1R093 2IC1A 5DXDA 2C1FA 3TEWA 3ZKUA 3MF9A 2OKXA 4LA3A 2XMLA 3VKNA 2W3JA 2R072 4CE8A 2R073 1YUDA 2PQSA 4YARA 3VV1A 1AX1A 1AR81 1RHI2 2P17A 3WNPA 1RUI1 2GNDA 4AAPA 2RVAA 4YZ2A 1SLAA 4DUXA 1FV2A 1UPSA 2JE9A 2PHWA 2B8MA 4RS5C 1BEV1 2WO1A 1I5PA 1IKPA 4BM8A 3I2FA 2DCTA 5JXJA 2KR2A 1SACA 1LHNA 3VD3A 5H9PA 4FOQA 1X82A 3O1RA 3IM0A 4OHZA 4DQAA 5ANNA 3B69A 4CUGA 4FAGA 4F7ZA 2PELA 5A3TA 4I02A 3VDDA 1B35C 2ID4A 3KM5A 3J8F1 4PLOA 5JZGC 1OVSA 4G9SB 4NIHA 2CWSA 2ZEWA 3NNFA 2G4IA 2ZHNA 3R0RA 4IGOA 2J1AA 2RG4A 3A0NA 5FKCA 5C3SA 2D44A 3J8F3 2MHFA 2XVLA 1SLTA 1OOPA 2WQ4A 2Q1FA 3AKPA 1NUKA 3U1XA 3M1HA 3T0BA 2VBPA 3PVEA 1NYWA 3RJ2X 4DPNA 2JXAA 5IK7A 4CCKA 3VGIA 3VBHC 5FWJA 4AG4A 2D7FA 5EQUA 5CFCB 2IXKA 4BQ1A 2GN7A 3NRUA 3RZMA 1CX1A 3M4FA 1IKQA 4M0NA 4QPGA 3VL9A 2HLEA 4DXRA 5FOBB 3OUJA 4DINB 1FPN2 1AR83 2LALA 1YFUA 4YSFA 5FYZA 1MEC3 1NAEA 1CQ9A 1AX2A 2QQWA 4PQQA 3NV2A 4UF0B 2ZEZA 4TWTA 2GDFA 3MF6A 1I5ZA 5F39A 4FTEA 1UY0A 4A7YA 4TSVA 4OULA 1RUC3 1ZRDA 4ES9A 2WKKA 4QD2A 1WW7A 3CU7A 4FCAA 3UGGA 3WDUA 3VDCA 3WP4A 2QQJA 5CKMA 4MGQA 1H6XA 1EP0A 4ZHNA 2YYOA 4NRPA 4ASMB 1AF9A 2BWAA 1RUE1 2RR13 2VJXA 2OPKA 1LOBA 4WZFA 3KMHA 2DUOA 2ET7A 2HWD1 5ANQA 2ZBJA 5ABJC 3SITA 4CP9A 1H9WA 1UPIA 1OF4A 1CAVB 2EVXA 3VB9A 3VDBA 1OD3A 1RUE3 2D5HA 4JDNA 2ZX1A 3LPFA 5A7WA 1W8NA 4GAZA 4QHOA 3POGA 5F1RA 3ILNA 4L99A 3DXTA 1J58A 2VC9A 2X5IB 2JDUA 2ZEXA 1KQRA 4EN9B 4NHXA 5FZHA 4CXXA 2CDOA 5IAXA 5HCBA 1XYOA 4AFMA 2ZX2A 2ZGQA 3HWJA 4AZZA 4CDQC 4ZKTB 1JZ3A 1WBLA 1AYN3 1CN1A 1Q8VA 3LDBA 1UNBA 5FYUA 4EWEA 2JE8A 2RDQA 2UURA 3MV01 1BHGA 3PVOA 2AGSA 1H6YA 2W87A 3NWKA 5LK5A 4EZ4A 2P2KA 1AYN1 4N53A 4Y22A 5JAXA 5A3MA 1QJY1 1ASJ3 3LEGA 4E2QA 2ZJCA 3SHRA 2FD8A 2VMFA 5F6LB 3AKQA 1RUD2 4NRQA 5FZ1A 2UY8A 1HQWA 1JUIA 4NN0A 5FLJA 5CFCC 1LEMA 2Z4FA 3SEEA 1DYOA 2HKXA 2DF7A 4N7UA 3HN1A 1AXYA 2XGXA 1PO21 2W94A 1AR71 3JBG3 4Q1PA 5FLHA 4JKLA 1UZZA 2GC1A 5IVEA 2HWF2 1HX6A 1SFNA 1UXXX 4UW6A 3EHKA 4R4XA 4YFWA 3WQBA 5IT6A 1VJ2A 1JYXA 5BV6A 4MGTA 2P3JA 2ZAHA 3ES1A 3QH6A 1RMU3 1U5XA 1YLLA 4P5HA 5A7WB 3ZYIB 1W9WA 2PLV1 4G4FA 1LCLA 2OW4A 4IEWA 3ZIWA 5LBEA 4WZCA 1PVC1 3ECQA 4NMIA 4GALA 4XHBA 4EE2A 3AM2A 1GR3A 1GZTA 2PLV3 4LITA 3H7JA 5DAXA 1OUXA 2IFRA 4COVA 4XQDA 2OZJA 1VB2A 2HWC2 2R16A 1YRZA 4I0WB 5F37A 3V0AB 4AFCA 2V4VA 1WWYA 1ASJ1 4OLLA 1K5MB 2ZGLA 3POFA 2A3YA 3ZYBA 2BVBA 3WUCA 3ZFEC 1VAVA 1W6QA 4EQVA 2JD9A 5B2GB 1QQP1 3AMQA 4XETA 4CUCA 3I4IA 2EALA 3A21A 4HT1T 4CUAA 1HB2A 1V0AA 2MNGA 4LR4A 4UBHA 1VAKA 1YCIA 2WZR2 3MPPG 1DDLA 5F7UA 1NA1A 3ZN4A 4ZZ5A 3K46A 4IGQA 3VKLA 1POQA 5LA1A 4K3UA 2VMCA 3WHUA 4CDXC 2AENA 3LKJA 2ZHMA 3M3CA 3WW2A 1S1AA 2XB6C 5I0RA 3RRDA 3ZFGB 3PIJA 4PDWB 1C3HA 1ENQA 1U0AA 2WNUB 4LKFA 4EJRA 3M8LA 4BIOA 1K42A 3LDKA 5KBFA 2VXJA 1SBDA 1IG0A 1FAYA 3ZDSA 2GALA 1CPMA 2BV4A 4R9CA 3J7MA 3K4AA 5DAWA 1LOCA 3BCWA 4LHNA 4C8DA 3FLTA 1S4CA 5FZFA 1PMHX 1DF0A 4BQ4A 2VZSA 1JXNA 1WLWA 4KGGA 3HJRA 1DGRA 2JE7A 2W08A 5C33A 1HIXA 1LRHA 4IL7A 4XE9A 1SDWA 3OG2A 4A41A 5JMCA 2WWUA 3ZDVA 5K7PA 1NCRC 2VZTA 1XSQA 2YZ4A 3S7EA 4CEYB 2I2SA 4QPWA 4MYEA 4JGZA 3Q8BA 1B35B 2Q8OA 4IQPA 2XH6A 2Y0OA 4HG6B 4FFIA 1REDA 1BBT3 1ND3C 3E1F1 1ACCA 1GWKA 1H8TB 2EAAA 1SCSA 2W2IA 3AKTA 3AL5A 5FWEA 1JYVA 1OLRA 2BVVA 3O1PA 2XPJA 1CESA 3POWA 5IVJA 1Q8QA 3N7LA 2JJ6A 5CFCA 3ACHA 1RC6A 1WW6A 5A7QA 3PVNA 4UXAA 2XLAA 2ZKLA 1CAUB 1HB3A 1F4HA 2R043 1W03A 4Q0QA 2X29A 3RGBA 2ORZA 3E5UA 1LHOA 2VQAA 1PO12 1NT0A 3BODA 1TE1B 3O1VA 4KG8A 3I59B 5FO7B 3OEBA 4WM7C 1TG7A 1PIV3 3N36A 4V2WA 3VZKA 3BTZA 1AJKA 2BU9A 1O3QA 1SPPB 3D4KA 3ZXFA 4QX1A 4CPBA 1GZCA 1UYZA 2XLFA 4M3CE 3NNMA 4NHYA 3LZZA 2W1QA 1KEXA 2PAEA 5A33A 3SXWA 5F5QA 2OQ6A 2HWB1 3C2UA 3O0XA 1MZ6A 2E6VA 4JHZA 4YW1A 3SCGA 3WF2A 2CNAA 2RDRA 1PNFA 5A7PA 2IFWA 2O0OA 1RUF2 4Q4V3 4YW6A 4YW3A 3KT1A 5C3PA 1LJ7A 4JKMA 4Q8LA 4BK5A 4ITCA 2H0BA 4JTNA 1OI6A 4NHKA 2LTNA 1Q8SA 3ETQA 3KHCA 5A1FA 4MGZE 4O61A 1DIWA 1VBC2 3BI3A 3N35A 1YHFA 2VOVA 1DGWX 1O4ZA 1SFYA 4N53B 1VBA3 5L7OB 1SMVA 1Y9GA 3FHAA 4XFGA 4KMQA 4COUA 4YG0A 1EV12 3VD9A 2IXLA 2JDPA 5GM0A 2NYYA 1NA1C 3KQRA 2E51A 4K1YA 4ZU5A 4ZXKA 4C91A 5JI9A 1KD7A 3T0AA 4D69A 1QXPA 4X6QB 4PF5A 5FZ8A 2I45A 4LO7A 3QACA 4Q0PA 1UW8A 2DV9A 1H1AA 4GZ9A 3U4SA 3EB7A 3LFIA 3RWKX 3ZFGC 1LOGA 4DO0A 1RUJ2 2X09A 4OZOA 2E53A 1XNDA 2B46X 4Q4X3 3VL8A 1D0HA 1HB1A 3FUQA 5FP9A 3VZNA 1PGL2 3LAGA 1UD1A 3ZMNA 3I54A 3ALQA 3NNLA 4QB1A 3ZO0B 1ZYBA 1TQ5A 1JW6A 3VBSA 3VHRA 4E8CA 4QAWA 1W6PB 1VBB3 2LUWA 5DUWA 3VBUC 3WVJA 4EN8B 5A33B 1H0BA 4PLNA 2VNVA 4Q4X1 5FFOC 4JGYB 5FXZA 5T54A 4E2SA 5LBFA 2ZGNA 2R061 2YFUA 3P3NA 3TYJA 3WNKA 1HN1A 1MS1A 3Q8EA 4D7YA 4E4HA 3HIFA 4AQ6A 4AEKA 1NLRA 1HRV2 2TBVA 4L9BA 2C6SA 1XE0A 1FOD2 3MICA 4HN0A 4BQ3A 4QGNA 5HCHA 4OQ8A 3GHNA 2GH2A 3IAPA 5FPXA 4AVAA 1BMV2 3T2OA 2YXSA 1QHDA 2ILMA 4X8NA 2V4AA 1V6IA 1HRV1 3CLPA 5CAZA 2Q1MA 1J3PA 5JMOA 1CAWA 1N1VA 2WS91 2BW8A 1RUG3 3L2HA 2CWMA 1W99A 4J25A 1W6NB 4CVUA 2E7QA 4W65A 4JV4A 1HDKA 2CSGA 1KFXL 2Q1ZB 2VNOA 1KRIA 4LO5B 5F2WA 5GZDA 4QGMA 1EUUA 1HRV3 1H1MA 3V0AA 3N9OA 4W6XA 1O3SA 1RYYA 4I30A 1HXS2 1W2UA 4FFFA 5CYYA 1R092 4COWA 3VBFC 2QQVA 5IWFA 1IS3A 3LIGA 1KFUL 3IZOA 2YBPA 5GLZA 1ZRFA 3E6CC 3AZWA 3RDIA 1H8VA 4XDQA 4XJUA 4HKWA 5CFDA 1ZBE3 3NAPC 4XIOA 1G9AA 3NQHA 4IXLA 3ZFEA 3CBNA 2YG0A 3UETA 1A34A 3VKMA 1DQ4A 5CFDC 3ON7A 1OLQA 4JGYA 4YZ4A 3WD5A 1EAH3 1J83A 4CDWA 5BNOA 1JUHA 1Y43B 4Y1UA 4BQXA 3O1TA 2YPDA 4GIQA 3CJIC 1CD3G 3PL0A 1C5HA 3HNYM 4M00A 4XOGA 1JZ8A 1EV13 2CAVA 1F5JA 2WIIB 2WL1A 3H1YA 3FUOA 3QBQA 2ZCWA 4BHPA 1MEC2 2WWJA 3E6BA 2EIBA 3MW3A 4PDWA 4QKDA 4JGZC 5C4WA 3JXSA 4YG3A 3N7MA 3A7QA 4QX5A 2OUJA 3H8UA 4RGKA 2RJLA 1OHFA 5BNQA 1L3JA 3JD72 4DB5A 4A7ZA 3BOWA 2A6YA 1ENSA 2BEOA 2XL7A 4COZA 3UYJA 3CQOA 4TLGA 3AC0A 2WNOA 4IEZA 3LDRA 4XILA 1OKQA 2KD7A 4LK7A 3WUDA 1BEV2 1CIWA 1XC6A 4XAAA 1O59A 3WW3A 3GALA 3HNBM 4ZPIA 1MQTA 3KCXA 1YFWA 3H3ZA 4NRMA 4YWAA 1AR82 1RHI1 3IDCB 1OLME 5E88A 5FV3A 3N9MA 4JDOA 2Q8EA 3RZZA 1QOOA 3VKFC 3U0ZA 2FBEA 4P9GA 2XBO2 1V6JA 5E8AA 4COYA 4DZGA 3OSDA 2Y0IA 3PMEA 5CFDB 2K9ZA 1ZRIA 4AEMA 3V0BB 1J1LA 1WLDA 5FMOL 4XJ9A 1UZWA 4GWNA 5GKAC 4E4DX 5HXMA 4YFZA 2DCYA 4CDUB 5C6CA 4YG6A 3K2OA 3ACFA 3WR0A 5F5CA 3RFRA 4EN7B 4JC1A 1NOVA 5DPNA 1PX4A 2FMDA 4MGKE 2Y64A 4A42A 3ZN5A 3KWVA 5FK8A 4CP1A 1GZWB 4CDQA 4S2HA 2XJQA 1OC1A 1AYN2 1V6OA 2G19A 5F2SA 3TEXA 2WFPA 5FMDA 4JZRA 3M7AA 1G7YA 3AL6A 4U36A 2JECA 1RUD1 3AFGA 3UJQA 5D1IA 1VMHA 2FQPA 3MLKA 3ILRA 5GALA 3T09A 4ISQA 4B4RA 4D3WA 4XFCA 2GMPA 3KCYA 2HWD2 3RVHA 4Q29A 1REEA 2VOWA 1W6MB 2P6HA 4AGRA 4BWOA 1PZ7A 1E5RA 2A5ZA 2PN5A 1WD3A 2XDVA 1HQLA 3RI9A 1COV1 3I2KA 2VG9A 4XBNA 4XUQA 4BQWA 1CAXA 2C5DA 4JKKA 1GP6A 2B7YA 1SBFA 2ZS6B 4UFHA 2GSYA 3KF5A 4YPJA 5ACA1 4LIVA 2HWC3 4OHWA 4CCJA 2HWD3 3RQ0A 3SNMA 4FPEA 2ZX3A 4BMEA 3LEIA 1QXRA 3CHXA 5KXDA 4LOTA 5C9AB 1BKZA 2WNEA 4XZPA 5ACA2 2YGLA 4OMCA 3L2YA 1LU1A 2JDYA 1VRH1 3LF7A 1FPN1 5FZEA 5K4LA 3VD5A 5A3NA 2YC0A 1PVC3 3D8CA 3FZ3A 2W0XA 2EXJA 2YC4A 2VUCA 2ATFA 1WGPA 5C8CB 1HLCA 4KG0A 3WCRA 3I2JA 4N43B 3BB6A 3OBZA 4MGYE 4QDQA 4P9XA 1FPN3 1DYKA 1GQGA 1ZRRA 3NJZA 2A6WA 2WBKA 1HKDA 4QDSA 1ND2B 1VLNA 2MEV1 1RXGA 4RHV1 1ULPA 1VB4A 4YVSC 4Y20A 1RUNA 5L7OA 1COV3 5C3QA 3D6EA 4FTSA 1LULA 3ZXJA 3X29B 4UYBA 3RMYA 3KZ4C 4L92A 4LT5A 3I3EA 4AGGA 2D6LX 4WBBA 3WG1A 1XU1A 3M3IA 4Q4Y2 2FDHA 2WFF2 1LECA 3BGAA 2VBDA 1LKNA 2WFF3 4Q0UA 5CIRA 1AXZA 3EXUA 4BISA 2KM2A 4CPBD 1QEXA 2Y8KA 1KGYA 3LEMA 4WM7B 3JU9A 2HBUA 3WF3A 3PIGA 3SH3A 4BYYA 2VTFA 1TME3 2YBKA 4IV1B 3R4DB 1FNYA 4IE0A 2R30A 4A45A 1UZVA 4QB2A 3IBMA 2AC1A 1RIRA 1S0DA 2GU9A 1HRI2 2J42A 3NO8A 4Y1YA 2DTYA 2GH8A 3O14A 1RUJ1 1XJAA 3NW4A 3O1UA 4LEJA 4XUOA 3WXPA 4B4QA 4QQOA 5C8WA 5FQ0A 5HI0A 5K0UB 5BNNA 3GNEA 1NKGA 3VBFA 4QHZA 3GYDA 4DRRA 4HKOA 2ZPXA 4LKEA 4B1MA 5IVCA 3OUIA 5C3RA 1BVVA 5FZAA 4Y5Z0 1G6NA 3MW4A 5F8PA 2NLRA 1VR3A 1RL3A 1SQ4A 2BJSA 1S2EA 1STMA 2JG8B 2VOTA 1VBE3 4Y20B 1S2KA 2OA2A 4FXGB 2NMOA 2A7AA 2FCUA 4DRVA 4EN6B 1MS3A 1SEFA 4MXWB 1ND2C 1APNA 1C57A 1GKBA 1TMF1 2EIDA 2PHDA 4JDMA 4XBQA 5FREA 1F8VA 4HANA 1Q3EA 1Z7S1 3S0MA 4W6YA 2QQMA 3THPA 3WNNA 2LROA 1RUH2 2P4EA 3AYDA 2B45X 5DZEA 1W6OB 4QPGB 2QTWB 4NPRA 3WHTA 3KV5A 5A32A 4OHXA 1AJOA 3U07A 3NJXA 3POSA 1DQ0A 3GJAA 1PO11 1UL9A 4OMDA 5JOXA 3JUUA 4Y22B 2Y6KA 1LB2A 4QU1A 1QDOA 4N53C 1KJRA 1GUIA 1RVF1 2J1EA 4Y33A 4Y4RA 1QNWA 4LBLA 2ETEA 3HVDA 5FY4A 3MIBA 3WY6A 4UFJA 3I2HA 1K3IA 4FPJA 1Q56A 1GNYA 5C3OA 1OFNA 1V70A 3ATGA 2VZPA 3C7OA 3D5OA 4R9BA 5CKQA 3B5LB 4AHZA 1KJLA 2Z79A 5FZ0A 4Q2FA 4O65A 1I9RA 4GMP1 3VBFB 4M3CA 1QJFA 3AYAA 2NMNA 3Q9OA 1AR91 2NZ9A 5HXVA 2DVGA 1FV3A 4GJZA 4D7TA 3I2OA 5T5JA 4YVSA 1V6NA 1OD5A 1I1EA 1DFQA 1W8FA 4IEVA 2VUAA 4Z1VA 3FC0A 1W90A 3WLUA 5TSWA 2AYHA 5M0TA 4CP9B 2GN3A 2YY1A 1WW5A 4AVCA 3NJYA 5ISLA 1UX7A 1W0PA 4D6QA 3DN7A 3HQUA 5IHRA 4Q4V1 3JQXA 1NZIA 4QPIB 3U78A 2FHRA 2XJTA 3H8XA 2R1DA 1PGW2 2HWE1 2QNKA 2WT0A 1YWKA 2RM23 5F6KA 2J1SA 1Q8OA 4AE2A 3AB0A 4FPKA 1IS4A 4Y4YA 4CA9A 1AR62 5FY0A 4XJ8A 4URAA 3MO4A 5A7OA 3TRSB 4EYUA 4AOCA 1REFA 3AVRA 4MGSA 1RGSA 5J3UA 2QDNA 2XQRA 4DY5A 1VPHA 5D8AA 2UWAA 1Y4WA 5FZDA 2ZXQA 2AACA 1UMZA 2IZWA 4N7IA 3EQEA 4ZONA 1Y9QA 5H9QA 3R4UA 4LXLA 4MOAA 1OFSA 1NXMA 2XJUA 3SC7X 5C4WC 2YPJA 4Q4X2 5A3OA 4GH4B 4XUTA 1WD4A 4HLTA 3I3MA 1LR5A 4LJHA 2XUMA 4CDXA 4AXOA 5E16A 3AP7A 3H1WA 4ET7A 4A44A 4XJAA 1UZ0A 4C1WA 2XL9A 2WJSA 4RFRB 1ENRA 1L7RA 1RUG2 3MEPA 4J1WA 1IZ3A 5FPVA 3RPQA 1ULEA 3B93A 1OUSA 2OVUA 1EUTA 2XJRA 3ZLIA 5FYSA 4LE4A 2GC2A 2WSUA 3PNAA 4W6WA 4YW4A 4BA6A 4Z2AA 2WO3A 5C71A 2A75A 3AP4A 1PZ9A 1IQAA 5E1RA 4CUBA 5I0DA 5APAA 1WKYA 4CCNA 1RUJ3 2AUYA 3F95A 2BNOA 3JQWA 4GMP0 3DKQA 1BZWA 1ND2A 4HMZA 4QQHA 1WMFA 5DUUA 1H1IA 4A2UA 5HPOA 1JZ6A 3GBGA 4IETA 2FCTA 2DU1A 3EO6A 3MGUA 1OH3A 2V73A 2R6QA 1ONAA 5K8SA 2EXIA 2RE9A 3PUAA 4Y24A 2JKBA 1UMHA 3NKGA 3WT3A 4YZ1A 3OOXA 1AL0G 3CJIB 1C8M2 3WG2A 1R64A 1V9U2 4F3JA 1X33A 2G9GA 2VMEA 2H6BA 2Q5TA 1JU4A 1EAH2 4ZY9A 1XU2A 2LS6A 3MFAA 4DMIA 2PAKA 3LPGA 4LKDA 2RMU2 2VCAA 1BXHA 2VPVA 5LRSA 3I2GA 3AP6A 1KXGA 5ABJB 1EPWA 1NXD1 3OD0A 4K8FA 1TME1 1UKRA 3B3QE 1EY2A 4GH4A 5LA0A 1SLLA 1Z0HA 4Q27A 5I8YA 4IEYA 1JN2P 1LOEA 3I2DA 4MXVA 4Q0SA 2OYZA 1UY3A 3KGZA 5EPAA 3B02A 4KGQA 5FYMA 1LENA 2HJIA 4ONUA 3QH7A 2NM1A 4ZU4A 5I91A 3B94A 3D0JA 4E2GA 5JSRA 2JEMA 1GOHA 3FHQA 3LQCA 3FBYA 1RVF3 3FHIB 1WUVA 5T50A 3TBDA 4WM7A 2ZMLA 3K51A 2DFBA 4ZZ8A 1X8MA 5BYNA 2Q0AA 1MPXA 4FI9A 3BPSA 4QM9A 4D7SA 2EXKA 4ZU7A 1H8TC 3KV4A 3SQOA 2OPWA 2BUKA 2WNVC 3AZXA 5FJKA 3M3EA 3CF6E 2GC0A 2VUJA 1QJY2 2CV6A 1ZBE1 2RS52 2V09A 1W06A 1YI7A 2QVSB 2VE1A 4KH9A 5DN2A 5FLIA 2XBO3 1OQ1A 2WYSA 3K4ZA 3WW4A 1S0CA 1VMJA 2WSVA 5FQ0B 1YQ8A 5BNNB 2D3SA 1G9BA 1GICA 3C7FA 3NV1A 1H9PA 1AZDA 2G1MA 1RUC2 4GB31 1CZSA 1J3QA 4UW3A 5FP8A 3BALA 3VBSC 3WOGA 1UXZA 3HN3A 3AP9A 3MV11 5IUQA 3ZSEA 1P8JA 3OCPA 5IFPA 5FZ3A 5F9TA 4CEYA 1UIJA 4NE9A 4C90A 3WDVA 4LBQD 3H50A 4IDZA 5LBBA 5EJ3A 2BFUL 4X6RB 5C7GA 1S0GA 2J1TA 1U5IA 1ULGA 3IT8A 3O12A 2UYBA 4WVWA 4Y1VA 1BBT1 3WF4A 3JB8A 1M4WA 2CDPA 5BNPA 1NCQA 4I3GA 2GZWA 4PT6A 2BOJA 4Q4W3 2RHPA 5DAQA 2ZX0A 1C28A 1GANA 4HZFA 1AVBA 1AYM2 5E6HA 3O1OA 3WQ7A 4OI0A 3M70A 3OGRA 2PA7A 5BUVA 1YI9A 2VZVA 3DECA 4CYDA 3ZSLA 1T6BX 2D6NA 3D82A 3NSTA 2EIGA 4JHTA 4L2NA 4SLIA 4W4ZA 4CEWB 2YUEA 4M4PA 4UT5A 1C8NA 1LHVA 4MLOA 5H9RA 3ES4A 4UFLA 2YDEA 3J9SA 5C9AC 4IESA 4ORFA 2VR4A 2B4KA 4AI0A 1ZZ6A 4QX2A 4IEUA 2ARAA 5AVAA 4GB33 1QQP2 1W05A 1MS5A 3B9CA 3K3NA 3IDAA 2DBIA 3B00A 1TEIA 4AVBA 1KS5A 4IERA 1OA4A 4G3YC 3ZMOA 5AC93 3S5QA 4K9SA 4NAMA 5LCWL 3ZN6B 1DBNA 3BOPA 3WQ0A 4LBJA 4XQWA 1PK6B 1RHI3 2JENA 2FDFA 1OURA 1W9FA 2XKPA 5IVYA 5LEKA 2RJ2A 2X05A 3WV6A 4P9IA 4TXWA 5H9SA 4AEDA 2WYFA 3AMPA 1RVF2 1VBE2 2RDNA 3WNMA 3IIIA 1U5YA 3OPZA 1JS9A 5DAVA 1ODMA 1VBD1 3ELNA 1UKGA 5FYVA 3EBRA 3DYPA 2W68A 4XZUG 4YYOA 1ZNPA 3WEZA 2VMIA 1GBGA 4CRQA 1W2NA 1XNKA 1ZBE2 4FPCA 1V6KA 4P08A 3USSA 2Y6LA 1H2MA 2Z69A 5CA6A 3T08A 1J3RA 4O9GA 1ZVFA 4FFHA 2GMEA 2CGPA 3MYXA 4R9AA 3E6DA 4FPLA 5JOZA 3O1SA 4XFBA 2FDKA 1OVPA 2CGNA 2W95A 3W5MA 4DOUA 4KWUA 1ENXA 4RS5A 1FNZA 2VTXA 1XXNA 3NMBA 2VUDA 2EXHA 1YQCA 2HBTA 5EZWA 4QPGC 5F5AA 5F3CA 4XABA 1AXKA 1NCQB 1UIKA 2WA4A 3FJSA 4Z82A 5EJ1B 5FPAA 5FMCA 3ZX7A 4AQSA 3USUB 5JIUA 3LSDA 1O3RA 4CZSA 3MIGA 5FPUA 3W59A 2A1XA 5FZBA 3T30A 3PUHA 2X5IA 4AVSA 2EF6A 2ZACA 3ZXGA 1DGRN 1YJLA 4AYUA 1KDKA 1AUYA 4BDVB 1FI2A 4XF4A 3VHPA 4MVTA 3GZUC
chains in the Genus database with same CATH topology
4S2DA 4KBBA 4XFFA 1WMEA 1C1FA 3ZXLA 3HQXA 4RR3A 1JOJA 4Z2WA 3ROUA 3GZTB 4AGVA 4XBLA 1DYPA 4M01A 3VBHA 5FAXA 3B01A 2VU9A 3JCIA 3ZN6A 1CAUA 4H7MA 5CVRA 3CL1A 2CYFA 5I8SA 4TYSA 1C1LA 4YVWC 4BMBA 5JCTA 4C0HA 5FDBA 4Y1ZA 4AHYA 2VECA 1H8TA 5JR7B 5CG8A 1O4TA 1AYM1 1PGSA 1X36A 3CJIA 5JDBA 5CB7A 1VRH2 5T52A 2PAMA 3V56A 2N7GA 5LRRA 2PHLA 5LEJA 1YXWA 3H1MA 2WS93 3IKWA 3V0BA 1NCRA 1N1SA 1DQ2A 4OZXA 3TAYA 1Q8PA 2VGDA 3I59A 2GC3A 1DG6A 4KL1A 1DZTA 1H2NA 2VQ0A 2GMMA 5AFBA 3P3PA 4YGEA 4Z92B 2JD4A 3KT4A 4HPKA 2WLQA 4XEZA 5L73A 1G8WA 2ARBA 4HFSA 1FX5A 3RJRA 4RR3B 1BK1A 2VH9A 5BNPC 1WMDA 2XJVA 4J1XA 4GXLA 1IS6A 5T55A 2KXLA 5JLVA 4QXKA 2I74A 1AHSA 2ZMNA 4F83A 2XWJB 3WG4A 1LEDA 4YM3A 3T1LA 4H14A 3GBFA 2CAUA 3LA3A 4KWJA 3MLLA 1MS9A 3G7DA 2HWF3 2EA7A 1IOAA 3QLQA 2R062 3WX5A 1C8M3 4INDA 4NO4A 4B3NA 5T5PA 2QCSB 4JGYC 4AQ2A 3KGLA 4JAAA 4GKYA 4ATEA 2ZGTA 5FO9B 4AHWA 5BXXA 5C9AA 2ZA9A 2P3IA 5I0TA 4YRDA 4PLMA 1UU6A 1FT9A 2GNMA 4WVMA 1OQDA 3ZSMA 3NKTA 4UBGA 3U11A 5C8CA 1PIV2 5EWSA 4AI3A 3BU7A 3MIDA 4PIZA 1NCQC 2DYCA 2VMGA 4JTOA 1J1TA 3IPVB 2VMHA 1PK6A 1VBA2 2WZR3 4LA2A 3ZYJB 1Q43A 1RITA 1V6MA 2A6VA 3KLSA 2BFUS 2DUQA 5BNPB 3IIAA 1WW4A 1QJY3 4PQ9A 3G6JB 3SMHA 3WDTA 1AX0A 3WP6A 3ZYGA 2P34A 3OD4A 3RYKA 1C8M1 4XW3A 4MX3A 5IK8A 2ZGKA 1AR93 1AR63 3OGGA 3ASIA 5AVPA 3ZXDA 2YGMA 4LBMA 4WM8B 1AR73 3SCFA 3J4UH 2WZPP 3WDWA 1YO8A 3AK0A 5J98B 4XXPA 1ZREA 3B9IA 1ZZ8A 2D6PA 1WA4A 1S0JA 1CX4A 4YGCA 4FOWA 1OA3A 1OA2A 4JCKA 1TNFA 1FOD3 4URTA 1IPJA 3MI8A 4HVOA 5SV8A 1D2SA 2P3KA 4XFIA 1LU2A 1XE7A 2Z42A 1LGCA 2V5YA 4CEWC 1BYHA 2RS31 3S6PA 5CU1A 2B9UA 4HSJA 4XMIA 1ZBA1 1O4YA 3INAA 3R05A 1D2QA 2NP0A 1ND3B 2XJSA 2A3XA 3CJXA 3JZVA 4WV8A 1ALYA 3OF1A 3VDDC 2QE3A 4I0BA 3IPVA 1RUF3 4Q4V2 1W6QB 2ERFA 4OVEA 1IHMA 5K0UA 5I8TA 2PYTA 4B29A 3NL1A 4XYXA 3N4MA 2G9FA 3TN91 5BY5A 5FCCA 2JG9C 2ZGSA 1QXJA 3KS7A 1Y7BA 4NHMA 1WLCA 1R081 1MZFA 5GZEA 1H30A 1D4VB 1W6OA 3FLPA 2E63A 1HXS3 5GLVA 1GZ9A 2PHFA 1UF2C 3RYRA 4R4ZA 1LOAA 4OUMA 1QOSA 1TNRA 2D97A 2R32A 1XNCA 2QQPA 2RM22 2Y38A 3OBTA 3POYA 1S0EA 2K0GA 1EV11 4YW2A 1TMF3 4S2FA 1D4M1 5I0SA 3HAGA 1Y3TA 3DL3A 3FFQA 1SLCA 3JD73 4K1ZA 3QCWA 2WNVA 1AL22 3AMHA 2F6BA 4R8HA 2AREA 4LO4B 3AZVA 3HR9A 1D4M3 1ND3A 4A7KA 3D0SA 4IV3B 2DFCA 4XF1A 1O5LA 1D0GA 1RUI3 2WNUA 5KHIA 5I0UA 1PMIA 1QGLA 3R4SA 4PIXA 2HEYF 3THTA 4H3WA 2R0HA 2WC2A 1VP6A 3BTAA 4B7EA 4Q4W2 5D8AB 4AFAA 3B7MA 4HK9A 5A3LA 4YVWB 2PHRA 2OIIA 3VBRB 2HYKA 5IK5A 4R9DA 1AL23 2YV8A 4XF9A 5KHHA 4OI4A 5C8CC 1U12A 2IXIA 1X7NA 1GLHA 3DUIA 2ZZJA 4DS0A 4GMP3 1NY71 2D6OX 4GKXA 2SBAA 3GHMA 2F4PA 1C4RA 4FT8A 2ZGOA 4AI8A 5DZFA 3O0VA 4WVMB 3LCPA 1NCRB 4EROA 1JBCA 3MFCA 4FPHA 5AC92 5J36A 1DQ1A 5J09A 5JOWA 4OUSA 3IDBB 2TUNA 3ENRA 2WNVB 4BE3A 3RSJA 3VZLA 3A4UA 1RUD3 1N1TA 3RYPA 1UX6A 4AEDC 4YZ5A 1HRI1 4LBQB 5J7MA 5FMOS 1GQHA 4P14A 2WNUC 4AF9A 4BH9A 3PJYA 4ATFA 1GV9A 3NV3A 1GYKA 2RR11 1DGLA 1QH6A 2UYAA 3AYCA 1NLSA 3H0OA 4I01A 4Z8BA 3LGRA 4CDXB 3TNPB 3IDEA 1B35A 4K40A 2D93A 3MIHA 3ACLA 3OTFA 4HSLA 3WZ1A 4XTMA 4AI1A 1PM7A 1H2KA 2X5IC 4C1XA 2O8OA 1S0BA 3JB4C 4PIYA 3TWIA 2DU0A 2WINB 1CJPA 2ZTNA 5T3NA 3OGJA 2JG9B 1RJ7A 3OY8B 4HKLA 3MIEA 4XJZA 3N7KA 4L97A 2RS53 4D94A 4BCUA 3MDPA 1M06G 4DXZA 1FMD3 3DPRB 1ULDA 2R063 1COV2 1UCXA 4GULA 5K9YA 4E27A 1NG0A 4IEXA 1ZZCA 1RUOA 2XVGA 3E5QA 1DGWA 4XTPA 5KC6A 1A6CA 3WDXA 2XJPA 4H55A 1O5UA 3WQ1A 1QJX1 4BZ4A 4I3PA 1ZRCA 1XQNA 3A0KA 2PHUA 3NV4A 3O0WA 4EWAA 2H6CA 1ULCA 3ST7A 1MACA 2RR12 3AMNA 4TLFA 4YVSB 1MS4A 3ZVXA 3VBRC 3VBOB 1HW5A 1H2LA 1ZM1A 4HVQA 2BNMA 4K6BA 4ISRA 4PDWC 3VKOA 5JPNB 4FVVA 2XG3A 3VLBB 3ZXAC 4CEYC 2DVFA 3LOIA 1OSGA 4YGBA 1CGPA 1KS4A 1W6NA 4DOUA 3RNSA 3QD6A 4I09A 4M0HA 2Z2SB 1VRH3 3PJQA 2K2SA 4FP3A 1ASJ2 1VIWB 1XYNA 5L7OC 3HT2A 2E9QA 2ZHLA 2XKOA 1GSLA 1YJKA 2A6ZA 2OUHA 1POV1 2HWF1 3UKTA 4PCRA 3EJKA 3AYEA 2P37A 4MV2A 5EXOA 4LHLA 1K5MC 2WA3A 1G9FA 4AFBA 1NY72 1ZBA3 4MH0E 2Q4SA 3AZYA 4LLOA 2O8QA 3JD71 4LLFA 4RHV3 3LOBA 1DQ6A 1MR5A 4LBOA 1QOTA 2JG9A 3IMNA 3OBRA 4KNCA 4FO9A 4WVVA 3I8TA 1Z78A 3DPRA 3HMYA 1CAWB 2VY0A 3AMMA 3VBOA 1URXA 3JBG2 2XBO1 1N3QA 1AL21 1BVP1 3OYWA 1FATA 1YYNA 4NR1A 2R071 3APBA 2RS12 4LTAA 2C0ZA 5DUXA 1QF3A 1A78A 3SH4A 2WWSA 1QJX2 4N43C 3VZMA 4QT6A 4LULA 1KDMA 5GLWA 4ES8A 1G9CA 3NAPA 1PNGA 1F9KA 4XFHA 1QKQA 5T5LA 4QMAA 2E7AA 3BIWE 3VHNA 2MEV2 3CNAA 4YVWA 3HBZA 4EWDA 2PQQA 5CG9A 3UV9A 1VBC3 3T1MA 4DFSA 3ME2A 3FFZA 3VDDB 1UZYA 3WCSA 4RQPB 5GLTA 1HRI3 5GZCA 2CL2A 5J37A 3V65A 2HWB3 4NOTA 4CTEA 1F31A 1N3PA 4YLZA 4YZ3A 4MUVA 2NQYA 2PFWA 3O5SA 1FOD1 1WLTA 3AZZA 2QJVA 4PBOA 2A71A 2RS32 3C3VA 1XYPA 2BWCA 4QHBA 4X8PA 4XPVA 5D8AC 1MQTB 1A8DA 4GQ7A 4JQRA 3PLQA 3W9AA 1MZ5A 5JOYA 1BMV1 3WP3A 3CO2A 3LA7A 1EPZA 1Q5OA 1S0IA 3UJOA 4N9HA 4KWLA 2WS92 2Y26A 2TNFA 4QQLA 2FZ2A 1RUH3 4RD7A 1PGW1 2HWE2 2RS51 3OYWB 2HWE3 2ZX4A 4ASLA 4N90A 1LESA 5DDJ1 1C5IA 2WZR1 3USUA 4BOWA 1PHMA 5CADA 1S0FA 2YROA 4FPYA 1AR92 2VVDA 4HK8A 3PMSA 4LO8A 3H3UA 1CONA 2GNTA 2JDZA 2R042 3FWEA 1QMJA 3FMGA 4JRAA 3AJZA 4IV1C 2XHKA 3AXEA 4FQZA 4RGGA 3H7YA 4LO6B 4LBQA 4FSJA 2R1BA 2ZKNA 5JIAA 5GZGA 3HT1A 2AR6A 1V9U3 1V00A 1A3KA 3PHMA 3RMXA 2BBVA 1QJU1 2DCZA 2A70A 3N3HA 2RMU1 2CY6A 1UU5A 4HETA 1SBEA 4JVAA 1QH7A 3H9AA 3ZIXA 4OI2A 2LM3A 1QJU3 4YGDA 1QJU2 2RS11 4B7KA 2HWC1 3TN93 1VBB1 1MVQA 1ZZ7A 1R083 2ET1A 1E57A 3VZJA 2VW2A 1PO23 1N3OA 2E7TA 3AXDA 1PO22 3E5XA 2HWB2 3DKWA 2DURA 2BYVE 4GWMA 3WW1A 2DTWA 1HV1A 1D4M2 2WQZC 2WT2A 5EFUA 1RTVA 1RUF1 2WLPA 4LHKA 3FE5A 1OPOA 4JGZB 2RJKA 4XFAA 1RUG1 1VBA1 4HVRA 4N43A 4I2OA 1T6GC 1XNBA 2O1QA 2PHXA 3R6SA 1F2NA 4LUKA 5KHGA 1VBE1 1OPMA 1SLBA 4CEWA 5JVVA 3FLRA 3UK9A 2OZ6A 1EYBA 1JYIA 2ZABA 4FPGA 4RA0A 1OMIA 5L19A 5EYXA 5GZFA 2WFF1 4S2GA 4QU2A 1LHWA 2B5HA 2XWBB 1HXS1 1X8EA 1HQNA 1MZEA 3VBUB 1AYM3 1CVNA 1RUE2 4FQ4A 4AFDA 1S55A 1HV0A 5GJ6A 4TZDA 1QNYA 1ZZ9A 3RS6A 2FZ1A 2ZZQA 4RGAA 2DVAA 2QUOA 5KXCA 5JWPA 5KXBA 1WCKA 1JHNA 3FX3A 4OI1A 1O7FA 2AH2A 1Z7S3 4RFT0 4RL7A 4HN1A 1CJDA 4AWDA 1QQP3 1SCRA 2NPIA 5CBLA 2A3WA 1LOFA 2SLIA 1R1A1 4DNYA 5FO8B 5IK4A 2ZOEB 4NWWA 4AK3A 1UU4A 4BLIA 1DZRA 2DVDA 4XMAA 1O3TA 3DGTA 4U2AA 1IS5A 1ZX5A 2D3PA 2WT1A 4FXKB 5HCFA 5EV7A 4IEPA 1RUC1 4GB32 5KHJA 4AEJA 4QPYA 3MPBA 1DQ5A 4M3CB 1X50A 2JG8C 4CDQB 4Z07A 3ZFGA 2VOXA 1WCSA 5KC5A 3KSCA 4CP2A 4YM1A 4LUMA 3J8F2 2UWBA 3UL2A 2GAUA 3OJBA 1N47A 3TB0A 3UKNA 2D5FA 4FBFA 5KWRA 2ZMKA 2UY9A 4K7JA 5K0UC 1FYUA 2PLV2 4FOVA 1BEV3 1VBC1 4WM8A 4QQ2A 2D3RA 2PTMA 3NVCA 4E4SA 3ZXKA 5J96B 1RUH1 1RUI2 2RS13 2XVKA 3ZSJA 4AQTA 1YFXA 3SISA 2B42B 4L8QA 4AVVA 4O9EA 4CP0A 1TMF2 1H4HA 5AC91 4KU7A 3U4XA 1N1YA 3FBMA 1PVC2 3SCHA 4HPKB 4FTBA 1VBD3 3URFA 3U10A 1W39A 4KU8A 1V9U1 3AKSA 4IEQA 3DV8A 4K20A 4CDWB 5BNOB 2ES3A 4RQPA 1MS8A 2BQPA 4IEOA 4P9JA 2MEV3 1G86A 5SV5A 3GBWA 5EYYA 1QJZA 1YIPA 5JI7A 5L36A 1IGOA 4M3CF 4Q4Y1 5KHKA 1NE6A 1MQTC 1XE8A 2VW1A 3BPZA 1O91A 3KD4A 4P9LA 2JICA 3KB5A 1S2BA 1VBD2 1YIFA 2ZGUA 4GA9A 4L11A 4Q4Y3 5E89A 4AEDB 1YFYA 3ZFFA 4RHV2 1RMU1 4F8AA 1BCXA 2UWCA 3VN4A 2VVEA 1SLIA 3M3OA 4Q0VA 3W58A 4RSUA 1GNZA 4YW5A 5LK7B 5JZGB 2QZ3A 3SH5A 4GH4C 1YNAA 4A3XA 3N7JA 4FPFA 4XQ4A 3VBOC 1ZZBA 2ARXA 4V1PA 3ILFA 1R1ZA 2X53S 4WVZA 1R091 1DHKB 2D40A 5ABJA 5ACA3 3ZYRA 5DUVA 1IPKA 1GNHA 4OHYA 2IXHA 4AHXA 1OQEA 3VBSB 2W39A 1RB8G 3KT7A 4PBPA 2ZGMA 3MW2A 4PJYA 1DZQA 1RJ8A 2YMZA 2XLGA 1LGBA 1ZBA2 2VOKA 1G9DA 4YNIA 1BBT2 1VALA 1LHUA 1FMD2 1MVEA 3DPRC 1RMU2 4QPIC 4CDUA 3CEWA 1QDCA 2BPA2 5FOJB 4OHVA 3J26N 3DF0A 1W6MA 2DVBA 4XXAA 3AFKA 4E4ZA 2IXCA 1PGL1 5T5OA 2VVFA 4UW5A 4YM2A 4YM0A 4AW7A 4WM8C 1PVXA 2QFEA 2VNGA 1MS0A 2ZGPA 1LTEA 3QOPA 2YHJA 1R1A3 2R49A 1I3HA 1NE4A 4J6GA 3VBUA 4EN0A 1OOPC 3T2TA 2Z5WA 5KXEA 4FP2A 4R52A 2HEWF 2A73B 3ZXEA 3WG3A 1CPNA 3AJYA 4NVPA 5JZGA 2Q30A 2DUPA 1W0OA