3WDYA

The complex structure of e113a with cellotetraose
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
296
structure length
296
Chain Sequence
b'YHLVDDYGRGNGFFDKFNFFTGDDPTHGYVDYVSRDVAAGAGLIGERDGRTYMGVDFTNPASGRGRRSVRLESKNTYEHGLIVIDLAHMPGSVCGTWPAFWTLGTGDWPYGGAIDIIEGVNDNTFNHMVLHTSDGCTIDNDGFTGNLKTSNCYVYAPGQDANAGCGIEATDPNSYGKGFNSIGGGIYATEITPNGISIWFFPRGSEPGDVLGDNPNPANWDTPAAKFAGGGCDWEGKFNAQRLIFDVTFCGDWAGNVWGIGGCASRAANCVDFVRDNPSAFAESYWLVNSLRVYAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-1,3-1,4-glucanase
publication title Structural and mutagenetic analyses of a 1,3-1,4-beta-glucanase from Paecilomyces thermophila
pubmed doi rcsb
source organism Paecilomyces
molecule tags Hydrolase
total genus 76
structure length 296
sequence length 296
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wdyA00
2PHRA 3USUA 4YG3A 4ATEA 4DQAA 4YZ2A 1IS4A 1C4RA 2EXIA 3TB0A 1SLBA 2CTVA 3A4UA 1LHOA 1QDOA 2A71A 2R49A 1V6LA 3BIWE 3WDYA 1WBLA 5IK7A 1SFYA 1KJLA 4YZ5A 1FNYA 5GLZA 3W58A 1DYPA 1V6KA 4XJ8A 1Q8QA 4FPYA 5JMCA 1U0AA 2DVDA 2D6PA 1APNA 4U2AA 4YM1A 3ZVXA 1SACA 2R16A 3PVOA 2NZ9A 3H0OA 1S0IA 3Q9OA 1W6QA 4AGRA 1JHNA 1S0FA 4NO4A 5GLVA 5DZEA 3LCPA 1H30A 3POYA 1URXA 1F31A 5DG1A 1MS1A 4R9BA 3RQ0A 1W0PA 1LHWA 1DIWA 1LOFC 2DVGA 2ES3A 5SV8A 3T1LA 1DQ1A 3W59A 3D5OA 3M2MA 1V6IA 2EXHA 5DG2A 5GZDA 5F5QA 5T5PA 1I1EA 4M00A 1MZ6A 2ZGRA 2A3XA 2ZHKA 4CZSA 4GALA 2HYKA 1YIFA 1G8WA 1GYKA 2ZGKA 4LBNA 3AP7A 3RSJA 4LBQA 1CONA 2ZGLA 1BQPA 1DHKB 1W6OA 3UK9A 1ENQA 5JLVA 2VW0A 2FHRA 4K20A 1VLNA 1XQNA 1HKDA 3AXDA 1LOEA 3INAA 2GMMA 2UWAA 4Y20B 1C1FA 3ZXEA 1N47A 4FPCA 3PJQA 4CTEA 2A75A 3O12A 4KBBA 3WG2A 4XTPA 3R4SA 3USUB 2UURA 4Z8BA 2WSVA 2W68A 1DQ5A 2D3SA 3ZXLA 1UZZA 4HANA 1N1TA 3BODA 4XTMA 2JECA 4FOWA 4ASMB 1LENA 4DPNA 3AK0A 1DYKA 4FOVA 1DQ6A 3SITA 1QNWA 1UKGA 2G4IA 2DVFA 3WHTA 2CYFA 3SH4A 3WOGA 4F83A 1C1LA 1ULCA 3NWKA 5H9SA 3WG1A 2YV8A 3RG0A 1JUIA 5JDBA 3ZSJA 3AZVA 3OYWA 4XHBA 4YZ4A 1W6MB 5GLWA 1IKPA 1UAIA 1AZDA 2R1BA 3AZXA 2JE9A 1LU2A 5DZFA 1W6QB 2KM2A 3ZPYA 1MS3A 4BQ1A 5GALA 2D3RA 3ZSMA 1PZ8A 1LEDA 3RMYA 2BQPA 1S0EA 3B01A 3WDVA 1JW6A 1D2SA 3C2UA 4UW4A 3WDTA 3WCRA 5GLUA 4AVTA 4FPKA 2D6KA 4ISRA 3BTAA 2ZGTA 1W0OA 1BYHA 1N1SA 3M3QA 5KXDA 1IOAA 1SCSA 3AZYA 2CNAA 4ZXKA 2XG3A 3POSA 4UW3A 3SH3A 4YM3A 4FPGA 4LBQB 1OFSA 1Z0HA 3MPPG 2FMDA 1ONAA 4K1YA 4XJWA 4YGEA 2E53A 1LHNA 2P3JA 1W6OB 4AVVA 2SBAA 3N3HA 4AWDA 1MS8A 2ZBJA 2NP0A 1VIWB 1ZA4A 2D3PA 3OBRA 1DQ2A 1VAMA 2A6XA 1MVQA 2A3YA 3FLRA 2LTNA 3IKWA 2WT0A 4K1ZA 5IK8A 1DZQA 3JUUA 2CWMA 2PELA 5JOYA 3PMEA 1UPSA 1A78A 1HLCA 3FBYA 5AVAA 4BLJA 1X50A 2VUAA 3NV3A 3ILFA 2VXRA 4FPHA 1S1AA 1KITA 5EYXA 3AJZA 5CBLA 4Y22A 3I4IA 2ZGMA 1KDKA 2GNMA 3R4UA 3WVJA 3A0NA 1S0JA 1LOGA 4PF5A 3UJOA 4FP3A 2GN3A 4YFWA 1MVEA 3LSEA 2EIGA 1I3HA 1EPWA 3AP5A 1LOAA 4GKXA 1ULFA 2GNBA 4M3CA 1QU0A 3OYWB 5E89A 5EWSA 1LOBA 3TAYA 2ZACA 5DUWA 4M3CF 2A7AA 2XB6C 2DWRA 4P9XA 1AXKA 1N1YA 5CNAA 2CY6A 1BKZA 3RRDA 1SLTA 3APBA 5FRAA 3T2TA 4WZFA 1C57A 3GNEA 4JCKA 4DS0A 3VKMA 3KQRA 1CESA 4W65A 3AP4A 2TEPA 4BPZA 1W6MA 5T52A 4GWNA 4XMIA 1JOJA 1AX1A 1JN2P 1A3KA 1LOCA 1MZ5A 1NLSA 1UL9A 3AFKA 4XJUA 5GM0A 3V0BA 4ATFA 4FQ4A 1DFQA 1VALA 4LBLA 3RS6A 1DGLA 1WLWA 1ZM1A 1NXD1 3NV1A 1WBFA 1V6NA 4LBJA 1V6JA 1D0HA 1BXHA 4BMEA 1GZ9A 5T50A 2EALA 1FV2A 4MYEA 4PBPA 1MS9A 1G9CA 3ZSLA 4WV8A 4AVSA 4YZ1A 2VW1A 1N3QA 4XMAA 3WUCA 2Q5TA 2ZMKA 3ZYRA 4Y22B 1N3OA 4XJZA 2D6OX 2JD4A 2R0FA 2GDFA 1S0GA 1N3PA 2A6YA 3AP9A 3AX4A 3M3OA 4Q26A 4XIOA 2JKBA 4XXPA 4YM2A 1KJRA 2DURA 1H9WA 2ZKNA 1CQ9A 4GA9A 3R05A 4BOWA 1LTEA 3D4KA 3POWA 2YXSA 3AYAA 3NV4A 3B00A 1QGLA 4M3CB 3ENRA 3FUQA 3M3EA 1ENRA 1N1VA 1WCSA 4Y1YA 3ZXKA 1RINA 2AH2A 1FYUA 1QOSA 5HCAA 2E7QA 5GZCA 5KXBA 3BOPA 3V64A 3MEPA 1QNYA 3HN1A 2GNDA 4Y1XA 1SLCA 4XILA 1B09A 1A8DA 1GLHA 3VKNA 1GSLA 1SCRA 1YXWA 3N7JA 1S0DA 2ZGNA 5CB7A 1F5FA 1GZCA 1LECA 1QOOA 2ZA9A 1LOFA 2GN7A 4P9YA 3WZ1A 3IM0A 3MW3A 3LSDA 4XHXA 3N7MA 2NYYA 2A6WA 4YGCA 1MR5A 2ARXA 4R9DA 1S0BA 1WUVA 2D6LX 2E51A 3B3QE 4Q1PA 1Q8SA 3IPVB 2GMEA 2DVAA 2ZGPA 4RL7A 3V0BB 2C9AA 1YO8A 5IK5A 5DUUA 1AF9A 2PHWA 3O5SA 3SH5A 1SLAA 4UW5A 2P37A 4PBOA 1LJ7A 2P3KA 3V65A 3IN9A 3OY8A 2V5YA 1UN1A 3WDXA 3V0AA 3WDWA 4ZKTB 4P14A 1LGCA 1GICA 2AUYA 1F9KA 2EAKA 3SISA 3DGTA 3ZYPA 1Q56A 1Q8VA 1AVBA 2I2SA 1SLIA 2AYHA 2W08A 4CRQA 2A6ZA 2RHPA 5IT6A 4XXAA 2LALA 1H9PA 2DTWA 1Y7BA 4P9WA 2ZHLA 3ATGA 2JJ6A 3B69A 2ZGUA 2P2KA 3NV2A 3AXEA 4DFSA 2V73A 2H0BA 4YZ3A 4YW2A 1LU1A 4JC1A 4FVVA 3WNXA 4YFZA 2W39A 1QOTA 1UZYA 1AJOA 1SLLA 2AGSA 1MACA 5F9TA 1W6NA 2ZZJA 1G9DA 2UWCA 4UW6A 1IS5A 2DTYA 4XBNA 2JDZA 2ENRA 1DQ4A 3SLIA 5E8AA 3O0VA 1SBDA 4TZDA 3WCSA 4YM0A 1GNZA 1LGNA 1YRZA 1Z78A 2A3WA 3MW4A 2ZABA 1MS4A 5LK5A 4Q8KA 3JU9A 5DZGA 4GKYA 1IS3A 1LHUA 4H55A 1QKQA 2WQZC 1G9BA 2YZ4A 4YGDA 1HDKA 1OQ1A 3AYCA 3OY8B 1LULA 1SBFA 4LBMA 3V0AB 4XBQA 3ZXFA 4GWMA 1KDMA 1V6OA 5JVVA 3VKFC 1CVNA 2ARBA 2ZHNA 2D44A 2EXKA 2VH9A 4XDQA 2WLQA 3PVNA 3B9CA 1HQLA 3IPVA 2R0HA 1GANA 3IMNA 2ZHMA 2A6VA 4FPLA 4XZPA 1WW4A 2VW2A 2ZGSA 4I30A 3AP6A 1G7YA 2D7FA 2D6MA 3HR9A 2ZGQA 5FREA 2R1DA 5CA6A 4HL0A 2DUPA 1CPNA 2ZAAA 3VKLA 3O0WA 1HQWA 4LBOA 4Y26A 5JOWA 3CNAA 3QCWA 2DVBA 3O0XA 3WHUA 2A5ZA 3AYEA 2AENA 3FUOA 4AYUA 1W6NB 1YI7A 2ZMNA 1G9FA 4ITCA 3FLTA 4OZXA 5GJ6A 4XE9A 2AR6A 3FFZA 4YW1A 5IUQA 4Q8LA 5GZFA 4Q2FA 4R9AA 4YG6A 5JOZA 1PZ7A 1FV3A 3WG3A 1G9AA 3WLUA 1KRIA 2NM1A 4Q1RA 3WDUA 4XJ9A 2DUOA 2EXJA 1SBEA 5T54A 1CN1A 4ISQA 4FOYA 1AXZA 5EYYA 3WV6A 1WLCA 2D6NA 2GALA 1BZWA 1JXNA 1GZWB 1YYNA 2DU0A 2DU1A 1FX5A 3VKOA 3D6EA 3ZXJA 1WLDA 4FPOB 3AZZA 1PZ9A 1QMJA 2NMNA 5DUVA 1O4ZA 2Z42A 4M3CE 2E6VA 4FPEA 2PHFA 4XJAA 3OPZA 4L8QA 1CIWA 2NMOA 4C1XA 2NN8A 3N7LA 3GALA 1MS5A 4PQ9A 1KQRA 4YW4A 2C5DA 3AZWA 3ILRA 4Y1VA 2P34A 4LBKA 4SLIA 2GNTA 4YG0A 1CPMA 2CL2A 1RITA 1W6PA 5T5JA 3HMYA 5BYNA 2UU8A 1BJQA 1FAYA 2B7YA 4YW5A 5GLTA 5GZEA 3T1MA 5HCBA 2D43A 1GV9A 5CAZA 2SLIA 1MS0A 5H9RA 1UX6A 2VY0A 1WW6A 1IKQA 1Q8OA 1JYIA 1LHVA 3FLPA 3WG4A 2DUQA 1QDCA 4Y1ZA 2ZMLA 4JRAA 3M1HA 3RMXA 4XIKA 4BM8A 3I8TA 2WNEA 2YROA 1WW7A 3N35A 1S0CA 4YW3A 2PHTA 1AX2A 2OW4A 5T5LA 2OVUA 5T5OA 4FP2A 1LGBA 1VAVA 3OBTA 4C1WA 2JE7A 3ILNA 4U36A 3DUIA 2PHXA 2P3IA 1UMZA 2ERFA 4LBQD 4WVVA 4M01A 5EXOA 3VV1A 1LEMA 5JOXA 1LCLA 4R9CA 2DV9A 4Y1UA 3AYDA 1Q8PA 4FPFA 1AXYA 1FATA 2OUJA 5GZGA 1JYCA 3L2YA 1R1ZA 1LODA 2E7TA 1G86A 2VU9A 4NOTA 4BLIA 1J1TA 3A0KA 1RIRA 1GBGA 2AREA 1ULEA 2WJSA 3QLQA 4D69A 5IK4A 4YGBA 2WT2A 3ASIA 1DLLA 1QF3A 4AGGA 3UL2A 2WKKA 1CR7A 1GKBA 1DQ0A 4BMBA 1FNZA 1ULDA 2GMPA 3PVEA 5T55A 1DBNA 1WD3A 3AJYA 5H9PA 5H9QA 4FPJA 3N7KA 4XYXA 2PHUA 1AJKA 1LESA 1JBCA 2WSUA 3M3CA 4IQPA 2OUHA 3MW2A 4RA0A 1IS6A 1V00A 2DYCA 4Y24A 4DRVA 3SNMA 1WW5A 5HCFA 2WT1A 2YMZA 4PCRA 2EF6A 4WVWA 4XBLA 5KXEA 3KM5A 2UWBA 4K21A 5DUXA 5DXDA 1CJPA 1TEIA 4GXLA 3WUDA 3N36A 1WD4A 1W6PB 1OKQA 4XOGA 5E88A 4Q27A 2CWSA 1GZWA 4YLZA 2W52A 2ZGOA 4DRRA 5KXCA 1ENSA 1V6MA 2A70A 1ULGA 4FQZA 3UJQA 3ZSKA 4AGVA 2YY1A 1GNHA 3U4XA 4FOQA 5L73A 4Y20A 3OGGA 1AX0A 3OJBA 3VUOA 4TYSA 1O4YA
chains in the Genus database with same CATH superfamily
4O61A 1OFNA 2PHRA 4DQAA 1YQ8A 2ZOEB 3MFAA 4ASKA 1W90A 4QB1A 2TUNA 3TB0A 4UFMA 3G6JB 3MIGA 5A7WA 1V6LA 4YNIA 1XOYA 5FJKA 2B39A 1Q5OA 1SFYA 2GU9A 5JIAA 4BZ4A 4DXTA 3JXSA 1V6KA 5C71A 1O6UA 5D21A 1RVF3 3ETPA 3PHMA 1PHMA 3KVAA 4WM8C 1H8TA 4AHWA 5JMCA 1U0AA 1WKYA 2D6PA 3IDCB 5J3UA 4OQ8A 2WABA 3H0OA 3P5BA 1ZRDA 4CDXB 2XUEA 3P3NA 1JHNA 2B45X 1H30A 5FKBA 4XACA 3NNFA 1L7QA 1HRV1 1ZRFA 1URXA 1NA1B 3UGHA 1BVP1 3RQ0A 2D40A 4EROA 4YVWB 5FZIA 1CX4A 3ZX7A 1DYOA 1LOFC 2P4EA 3WR0A 1W9WA 5SV8A 4MGTA 3U07A 1V6IA 4XF1A 4YVSC 5GZDA 4BQ2A 5JXGA 4HBNA 1GOHA 4YW6A 3TEZA 4RN5A 2ZGRA 4PIZA 5K9YA 1XPWA 2X10A 2ZGLA 3J8F1 2WA4A 2ZAHA 3U10A 1W6OA 5JLVA 4K20A 5CFDC 1QJX3 3AXDA 3PVBB 3EBRA 3INAA 4RGKA 2GMMA 4NHMA 3ZXEA 3MIBA 1UYPA 1N47A 1I5PA 3BYWA 4L99A 4XF3A 4CTEA 4FCAA 3O12A 1GFF2 4KBBA 1IGOA 3WG2A 5K0UC 2UURA 4KU7A 3WW2A 4Q0QA 1DQ5A 1H4HA 2D3SA 1OHFA 1N1TA 4XTMA 2JECA 5FYHA 3WF3A 1LENA 5FZ8A 4CVUA 1Y3TA 4O9EA 3AK0A 4FOVA 1V0AA 5A7WB 5CEHA 3N9PA 1ZBE1 4S2DA 2CYFA 2LW8A 2VNRA 4QB6A 3SH4A 3WOGA 2D97A 4CUAA 1C1LA 2PHLA 1H8TB 1QJEA 1DF0A 5KR7A 1Z7S1 3NW4A 3ZSJA 4IV1A 2JB8A 1IKPA 4DXRA 4GMP0 5DZFA 1NQJA 2C9KA 2KM2A 1MS3A 1PNFA 2WAAA 3GM8A 4P02B 4BQ1A 2D3RA 1CZVA 3ZSMA 4QPYA 1LEDA 2ZEZA 4Z2AA 4HVOA 2G1MA 1NCQC 3FX3A 4B1LA 3S5AA 4P9GA 3W21A 1W8ZA 4UW4A 3M8LA 1RUF1 5FK8A 5C3SA 4RR3A 5BNNA 2QQJA 5FZ6A 1W0OA 2QJVA 3KGZA 3LDBA 5J36A 3M3QA 4G3YC 2VNGA 3PUSA 3AZYA 5CFCA 4QU1A 4IEUA 2R071 5FPBA 5FYMA 2HWC1 1O7FA 2MHFA 1GWLA 1LHNA 3K4ZA 3W9AA 1RMU1 1W6OB 4AVVA 1MS8A 4NR1A 2Q1MA 3VBHB 1ZA4A 2WN2A 2A3YA 3POBA 2LTNA 5JWPA 4ZS2A 2PELA 4XFIA 1RHI1 2BVBA 1ASJ3 5JR2A 4BLJA 1O59A 4ZY9A 5BV6A 3KB5A 1S1AA 1PO23 4LK6A 1AR92 1HB3A 2JG8A 3FE5A 3POGA 4AFCA 3BPSA 3ZIWA 2GNMA 2IZWA 1JTZX 1S0JA 3JBG3 1FPN1 5FZGA 1QJY1 1Z7S2 2CAVA 2DCZA 2P3YA 4JZRA 5FUIA 1RXGA 4ZPIA 1PK6C 2GN3A 4XFCA 5EJZB 4D94A 3PURA 2B4KA 2GNBA 5G04L 5EWSA 2HWF2 4IV1B 3S30A 3TAYA 3RZMA 1XU1A 4HG6B 4L11A 1RXFA 3KZ4C 4OVEA 1MEC3 2JB4A 4P9XA 1TQ5A 2CY6A 4HVQA 4COUA 3RZHA 3VD4A 5FRAA 4BU2A 4WZFA 1EAH3 4PJYA 1UWWA 5ANNA 1UYZA 2XOMA 5FO7B 2OXBA 4X8PA 4HKLA 4RR3B 1FT9A 4HSLA 3KQRA 5BNNB 3EMRA 1US2A 4NAMA 3WNMA 1PO11 2XJVA 5FY4A 1L7LA 2XWBB 3HD8B 2YG0A 4V2VA 4BPZA 1W6MA 1ASJ2 1C5HA 1ACCA 5CFCB 3O1TA 4GWNA 1VBA2 1JOJA 1JN2P 1A3KA 1MQTA 1NLSA 1VJ2A 3UK9A 3L9JT 4AEJA 1P8JA 1PMJX 1PO22 3DPRA 5FZLA 4ATFA 4ZZ5A 3HVDA 3THPA 3RS6A 3UKTA 2QQNA 3CQOA 2OIIA 1WBFA 3ME2A 1UKRA 3JBG2 4CDUC 4KG0A 3NAPC 1GOGA 3CMGA 4CU7A 2BUKA 2VCCA 3H1YA 4MYEA 4PDWC 4F3JA 2Y6JA 1NE4A 1E5IA 4CPBA 3AL5A 1NG0A 1N3QA 2OKXA 4W8JA 2Q5TA 2JG8B 2ZMKA 5FPAA 3URFA 1MEC2 3KT4A 4NMIA 1N3OA 2H0VA 4ORFA 3ACFA 3AP9A 4Q26A 4S2FA 1S0GA 2A6YA 3KCYA 2XBO3 3GZTB 1M06G 4QKFA 4RS5C 2HEWF 5FY5A 3E5XA 2VTXJ 4CDQA 1EAH2 5BUVA 1H9WA 1OVSA 1PGSA 5F37A 3R05A 1H6XA 5DAPA 2VGDA 5FY1A 1QGLA 2P6HA 4LO4B 4H7LA 2X5IA 2BNNA 3LPFA 4DUXA 4BQ3A 1QIQA 4N7UA 5F8PA 1RINA 2DBNA 4QKNA 2ZEXA 5ABJA 3E6BA 3IIAA 4GAZA 1TG7A 4X8NA 5J48A 5JCTA 2GNDA 2P5BA 3SKVA 1A8DA 3THTA 1SCRA 3N7JA 1SEFA 1TME1 3VDDC 1PO12 5CB7A 3ZYFA 1QOOA 2LUWA 2ZJCA 1JUHA 2RDSA 3MF6A 3GBGA 2WRAA 4C0BA 1SMVA 2A6WA 1W04A 1MR5A 2VMGA 4PIXA 5FP7A 5FP3A 2ARXA 2QQKA 4PLNA 1MQTB 3K3OA 2DVAA 4IEQA 1TNFA 1VR3A 3DPRB 3GXUA 4RL7A 4OUEA 3SCHA 4Z2WA 3WXPA 1AF9A 4LKEA 4CDXC 2RS13 3V65A 3IN9A 1NA1C 3D82A 2EIDA 4R52A 3WT3A 4QKDA 2WBKA 4ZKTB 2AC1A 5IVCA 5FYIA 1GICA 3HNBM 2WNUC 2XJPA 2BZDA 2VZSA 1PNGA 2IUWA 3DGTA 4AI2A 1Q56A 2VVDA 1Q8VA 1AVBA 2I2SA 4KWJA 3N9MA 4NIAA 1DGWX 3RJRA 5FYCA 3KV4A 3P1IA 4CDQB 1XB9A 2R063 1Y7BA 4UWDA 5AC91 2Q1ZB 3DYPA 1D4M3 5FJHA 1QXRA 2JDMA 2V73A 3ST7A 3ZFFA 1WCQA 5JZGC 2Z69A 2GC1A 3VN4A 3RPQA 3WNXA 5ABJB 1RUG3 3NNGA 2W39A 3VZNA 5IVVA 4Z07A 5IVEA 3A7QA 4TXWA 1SLLA 4UFKA 5A6QA 1JYXA 1Y9GA 2RJ2A 1W6NA 3KD4A 2IC1A 2ZZJA 1G9DA 4QQOA 3VL8A 4DZGA 1PM4A 4KWLA 3UETA 4ARXA 3T0DA 1H4GA 2RS12 4QU2A 5JPMB 3ACGA 1RUE3 5FBJA 3VDCA 4TZDA 1AR61 4YM0A 1GNZA 1JODA 5K7PA 4EWEA 3GHNA 2YGLA 4Q8KA 3TN93 2QQMA 4GD4A 5FZKA 5FPZA 4GKYA 4GB33 1BK1A 1ZZ9A 4GJYA 4LNVA 4E2GA 1XSQA 2EA7A 2Y6LA 5EP9A 1BBT3 3OPWA 2VZ3A 1VE0A 3HNYM 1VRH2 1HXS3 2JXAA 4GWMA 4MSVA 2BWCA 1JU3A 2J1VA 3VKFC 1D4M2 2E26A 4PQQA 3VHPA 2D44A 2EXKA 2VH9A 4GJZA 2X53S 1TVGA 4JDMA 4OFGA 5FWEA 1GMMA 5HV4A 5FZHA 1HQLA 4QKBA 5K8SA 1GNYA 1GANA 2R0HA 3LA2A 2A6VA 5AC92 2ZGSA 4D8MA 3AP6A 3WNNA 1W28A 3JD73 4WM7C 3I59A 1JOBA 1PVXA 1NLQA 2YBPA 3LQCA 5FUPA 4LKDA 4HL0A 1F2NA 1CPNA 2DUPA 3CLPA 4J1XA 4P9LA 5E16A 3VBHC 4HKOA 1RUE2 3O0WA 1HQWA 3P3PA 5JOWA 4CXYA 3HBZA 3QCWA 5EZWA 4QAWA 4CCJA 4NRMA 1VRBA 2XL7A 3RVHA 5JXJA 2WDBA 3O0XA 2CAUA 3WHUA 1RUC1 1RUOA 2AENA 4AYUA 1W6NB 1YI7A 4ITCA 1G9FA 4RGAA 3FLTA 2ZX0A 3TN92 4GB32 4LHNA 1GQPA 3WQ7A 1I5ZA 2VZQA 4XFAA 4XE9A 3WY6A 3ZO0B 3FFZA 3MUY1 3ZLIA 4YW1A 1KEXA 4SBVA 1AR62 2E32A 4YG6A 2YC2A 2W94A 4LO7A 4WM8A 1HXS2 2WQ8A 4J6GA 1YQ6A 4Y4RA 3J9SA 5FXXA 3R6SA 4BXFA 3ZXDA 4Q1RA 2DUOA 2EXJA 4IV1C 1IPKA 1CN1A 3LEIA 1OQEA 3HPNA 4AOCA 1NY71 3LOBA 4E2QA 3ECQA 5J96B 3LEMA 4R4XA 5LBFA 3TWIA 3C8XA 1JXNA 3WP5A 2VO5A 2HWE3 1TNRA 1NZCA 2BRTA 4QPIC 2RG4A 4E8DA 4EN8B 1JZ4A 3VDBA 1WLDA 3JD72 1PZ9A 5FBZA 1EV12 5F3CA 2E6VA 3CO2A 1X82A 4RR3C 2PHFA 4YVSA 3OPZA 5BNNC 4HN1A 2NN8A 3ORJA 4JRLA 1MS5A 5TSWA 1YI9A 5LBBA 5FLIA 3QH7A 3VZOA 2G9FA 4AQSA 5CFCC 3MO4A 3TEYA 4UXAA 2PLV2 4CP1A 4AFDA 3UNPA 5JMOA 3KV5A 1W6PA 5CA6A 3BN6A 3I59B 4FO9A 2UU8A 2XONA 3AKPA 1FAYA 3TEWA 1AL23 1ZNPA 2SLIA 1MS0A 1K5MA 3HN3A 3LKJA 5K0UA 2AEYA 3SC7X 1LHVA 1VBD3 1JYIA 2DUQA 4LHKA 4EYUA 4Y1ZA 4ASLA 2ZMLA 4JRAA 4S2HA 3A23A 4BM8A 2ZX4A 2WNEA 1WW7A 3ES4A 4YW3A 2PHTA 4QX2A 4RHV3 2K9ZA 3VD5A 1OLRA 4FP2A 1LGBA 1VAVA 3KHBA 3OBTA 2HWE2 1W2UA 4BQ4A 1HB4A 2QE3A 4LBQD 3KCXA 4URTA 4WVVA 4KGGA 4WM8B 2R041 1LCLA 4E27A 1IHMA 2DV9A 1JMUB 3ZFEC 3RI9A 1JYCA 3L2YA 4BA6A 3PLQA 3A0KA 1RIRA 3CBNA 3RZLA 1GBGA 1CZTA 3W5NA 1HB2A 1UX7A 3MZHA 5FMOS 5IK4A 1NCQA 2WT2A 1DLLA 4AGGA 1REDA 1CR7A 3S5QA 2R32A 2QTWB 4UOJA 2VUCA 3AJYA 5H9QA 4IL7A 4LKSA 4XYXA 4BDVB 2C0ZA 4YVSB 3MUZ1 4G4FA 3M3CA 2VUDA 4IQPA 2OUHA 1Y43B 1XNAA 2VZVA 1V00A 5CKMA 2DYCA 5J98B 3RZZA 4CSWA 5GKAC 1WW5A 4FTEA 5KXEA 3I2DA 2VC9A 4LULA 2LRPA 4AEKA 1MQTC 4GXLA 2ET1A 2GP5A 4PI2A 3RWKX 5CZKA 1WD4A 3JZVA 1W6PB 1OOPC 1OKQA 4XFFA 3WUDA 4XOGA 3UKVA 1UPIA 3NJYA 5C33A 2ZGOA 3ZN5A 1ENSA 2CU5A 3KV6A 3H7JA 2RS51 4N7IA 3ZSKA 4DY3A 2O14A 1Y4WA 5IVBA 2OZJA 3U4XA 3SCGA 3O1SA 1K5MB 2QZ3A 4Y20A 5K0UB 5A3MA 3MI8A 2PHDA 5ANQA 4K1ZA 3OJBA 4XTPA 3ZYHA 4EN9B 5J7MA 4OUMA 2WS91 3USUA 4KG8A 1AL0G 4YG3A 1J58A 2E63A 1WMXA 1IS4A 5FTTC 5D8AC 3AKRA 1AYM3 1SLBA 1W8TA 5I0RA 2R042 1RUJ1 1O3SA 2RS33 1QDOA 2X05A 2RMU3 1FMD3 2HEVF 4IE7A 1ND3C 3WDYA 5FZOA 4JGZC 1WBLA 1PK6A 4CDQC 1OVPA 2X8KA 3POIA 2B9UA 4UFLA 3DXUA 3LIGA 4OHZA 1ZBA3 2DDUA 2RR11 4CCNA 3SHRA 5C4WA 4U2AA 4CXWA 3ZVXA 2VOTA 1SACA 1O3TA 2BGOA 4XFGA 3DKWA 5ABJC 3Q9OA 1S0FA 1NCQB 4E4HA 5DZEA 1W9YA 4JHZA 5D2AA 1ZZCA 4H14A 1F31A 4W4ZA 1KD7A 1MS1A 5DG1A 4GWJA 1W0PA 1PIV1 1DIWA 1W3VA 2DFCA 3NNMA 2DFBA 3PIJA 4JKLA 5EHDA 2ES3A 1R1A1 3T1LA 1XU2A 3M2MA 5LZ6A 5DG2A 5T5PA 4FXKB 1RL3A 4QT6A 4AI0A 2ID4A 4CUBA 2P1BA 5C3QA 1VMFA 2A3XA 2ZHKA 2W87A 1W99A 3TRSB 4LBNA 3ITQA 1CONA 4LMFA 4XF4A 4B4PA 1AYM2 5KC5A 2RS32 3CDZB 3LFIA 4OHVA 2FHRA 3NAPA 1VLNA 1XQNA 5I8YA 5FZ3A 1CX1A 4PDWA 1Y9QA 2UWAA 4Y20B 3S6PA 3M3IA 1C1FA 1JI6A 2FQPA 3PJQA 1UNBA 1ZRRA 2HWB3 4LIUA 2UYBA 3X29B 3USUB 3F95A 3JQWA 3LF7A 3FHQA 2WSVA 3K46A 2W68A 3U37A 4W6WA 3ZR6A 1W8HA 5HBAA 4ASMB 4DPNA 4IEYA 3ZN6B 1CJDA 3I2JA 4RS5A 5A33A 4A44A 4EQVA 5I91A 3T0AA 5FZOB 1UZ0A 1PK6B 1YFXA 2FCUA 5BNOA 3JB8A 1OURA 2YC4A 3RZJA 1HRI3 2Q1FA 3MLKA 4L92A 5H9SA 4QHBA 3WG1A 3H1MA 2YV8A 5C4WB 2QCSB 3D0SA 4AQTA 3AZVA 3OYWA 4XHBA 2BP6A 4AVAA 1WMDA 2R1BA 5KXBA 3ZPYA 5CISA 2PAMA 3ZSEA 4Q4V2 1YQ2A 3HIFA 3LD8A 4LO6B 1GUIA 1C3HA 5FZ0A 3VDDA 2BQPA 4FAGA 5APAA 3B01A 1H8VA 1D2SA 1UW8A 3WCRA 5CG9A 4P08A 1VBB3 5LA1A 4ISRA 3BTAA 4HOOA 1PVC2 5FUNA 3WSOA 1OI6A 1POQA 1YUDA 2GC2A 1XNDA 4MUVA 3UV9A 2GC0A 4ZXKA 3LWCA 1OKOA 3MFCA 2XG3A 3POSA 5A3UA 1JZ6A 4I09A 4CDXA 3RYKA 4LO5B 4ZONA 1D0GA 1X9TA 2FMDA 4YGEA 3C7HA 5IW0A 1SHWB 2P3JA 1EYBA 2VULA 1RGSA 5FP4A 3NAPB 2ZBJA 1ZZ8A 3OSDA 4K3UA 5CVRA 2CDPA 1DQ2A 4DY5A 1AR73 1UIJA 1COV1 1PMIA 4AFAA 1HRI2 1YCIA 2WNUA 2CWMA 4CU6A 4B1MA 4DUWA 1JZ3A 1UU5A 3FBYA 5AVAA 1ZREA 1YC61 3AKQA 2WNOA 1X50A 5FK7A 5JPNB 1YHFA 5FZMA 4Q5OA 2VUAA 3WF1A 1U5YA 3ILFA 5FKCA 4I3PA 4KH9A 4LK7A 1I9RA 5EYXA 3W5MA 3S57A 2VECA 4K7JA 1A6CA 4MOAA 1KDKA 5A33B 1CWPA 5BNOB 3OUIA 4RGGA 3BGAA 4JX0A 2L9LA 5HV0A 1LOGA 4PF5A 1E5RA 4Q4Y3 4RFRB 4NIHA 1VBB2 2WFPA 1ULFA 1YFYA 1QU0A 3OYWB 5E89A 4QD2A 2Y38A 3NO8A 5DUWA 3AKTA 5EIYB 4PLMA 3GF6A 1QJU3 3M7AA 4IEZA 2XKOA 2WO1A 1W2NA 1N1YA 4FFHA 2CGNA 3VDDB 2BERA 3O7OA 3PIGA 4H2AA 4MV2A 1HQNA 4COYA 2G9ZA 4YYOA 4P9IA 1BEV2 2JG9C 4QHZA 1BMV2 2GH8A 3GNEA 4JCKA 4AI8A 5JSPA 4DS0A 1X8EA 4MGQA 5LBCA 5IYYA 3IAQA 4BISA 1NAEA 1W2AX 3ZYIB 3N9LA 4RFT0 3AFKA 1LOCA 3M70A 3CJIC 5A7QA 1DFQA 1VALA 2WZR3 2JX9A 4LBLA 5L36A 1COV2 2J1AA 1WLWA 1ZM1A 3IAPA 1UIKA 2VTFA 2YFUA 1V6JA 1D0HA 3K2OA 2WNUB 4Q4X2 1UQXA 4Q4Y2 5T50A 4BMEA 2C4XA 3O1RA 1SZBA 4UAPA 1MS9A 1G9CA 5C8CA 2JE8A 1QJX1 4J1WA 4YZ1A 2ZEYA 2VZPA 4LJHA 3BCWA 1QJU2 1KXGA 4XJZA 2D6OX 2R0FA 3M3OA 2GDFA 3LDKA 4WM7A 4A7YA 1S2BA 2VD7A 1YJKA 4MG2A 1KJRA 4Y33A 3VBHA 4IGQA 1CQ9A 2FDHA 2PYTA 2PQQA 3AMQA 3K48A 3POWA 4XETA 4CCCA 4F8AA 3B00A 3AMNA 5JXIA 1RVF2 1K5MC 1ENRA 1WCSA 3OG2A 4Y1YA 1MZFA 1AHSA 1FYUA 1QOSA 3HT2A 4Q0UA 2ZKLA 2NLRA 2E33A 3ZKUA 3V64A 1DZRA 1QNYA 4Y1XA 4LQRA 4XILA 1B09A 2G9GA 5A7SA 4CUCA 1AR91 4NPRA 2WWSA 1AYN3 2B5HA 5DAWA 1F5FA 4LUMA 2ZA9A 5FQ0A 1STMA 2J1RA 1RB8G 3EQEA 3MW3A 5DDJ3 3ON7A 3N7MA 5FOBB 2NYYA 5FY0A 3BIEA 5LY1A 4UYBA 5FZCA 1S0BA 1WUVA 3B3QE 2E51A 5DAVA 2FDIA 1PGL1 1K12A 3IPVB 4GMP3 2HWF1 3I3DA 3T4HB 4L0PA 4EWAA 2VE1A 1EY2A 5FYVA 2P37A 4QPIA 3T2OA 4PBOA 5B4XA 2P3KA 4UBGA 3OY8A 5B4NA 2V5YA 1QJX2 1XJAA 4P5HA 4A7ZA 4ZU7A 1UCXA 4TSVA 3WDWA 3AKSA 2TNFA 5C8CB 2O8QA 2VUJA 4XPVA 5FZ9A 4CCKA 1BLZA 4CCEA 2VMHA 3OUJA 3ZYPA 1Q3EA 4DO0A 4JDOA 4CRQA 1UY2A 4CP9A 2Z4FA 1ASJ1 1VB2A 1U5IA 1J3RA 3BPZA 4WM7B 2A6ZA 1QHDA 1VBA1 5IVFA 1PO21 3QH6A 3IDAA 2ORXA 4P9WA 2WQ4A 3ATGA 1AYN2 1J84A 3B69A 4KQ7A 3VD7A 4MLOA 5L7OA 5DABA 5F2SA 1ENXA 3B94A 3JBG1 5DDJ2 4ZU4A 4DFSA 1CZSA 4JTNA 2VL4A 1QXJA 3IBMA 4JC1A 1UZYA 3B5LB 5FZBA 2Z2SB 2C24A 5F9TA 4YRDA 1RUF3 2W2IA 2E31A 3POFA 3HT1A 1MEC1 2DTYA 2JDZA 5FQ0B 3KF3A 4HONA 3Q8AA 1DQ4A 1ND2C 1POV1 3SLIA 3IIIA 2FMYA 3ACLA 5A6ZA 3ZFEA 5L9VA 5FY8A 3LOIA 5FPXA 1PGL2 1EAH1 3KLSA 2JWPA 4R4ZA 5C4WC 2JIGA 2A3WA 3MW4A 1EUUA 5LA0A 1MS4A 1RMU3 3MIDA 3JU9A 3OCPA 3WW1A 1ULOA 3PUHA 5FAXA 5IVYA 4OUSA 2RDRA 1HB1A 1IS3A 1LHUA 4QPIB 3WNKA 4OI0A 2WQZC 3I7DA 4MXWA 1G9BA 2YZ4A 3I2IA 4IXLA 4QQPA 3SMHA 3AYCA 3OY8B 4M0HA 5FZ7A 1LULA 3AMHA 2XDVA 1DGRN 5G05L 5HXVA 3TBDA 3T2PA 1CVNA 4I01A 1UY3A 1W05A 2Q4SA 4FI9A 3C7FA 1SFPA 4HXCA 3GCWA 4CP9B 1OOPA 4FPLA 1IQAA 1O91A 4JQRA 2VW2A 2D7FA 1X33A 3J7NA 4KU8A 2RV9A 1SQ4A 3K4AA 4MX3A 1NE6A 2W1WA 2FDFA 2PTMA 5FREA 4OQ9A 2W46A 5L7OB 2CHHA 2R1DA 2J7MA 4GZ9A 3VKLA 1QWRA 2WFF3 4K6BA 2OX0A 5L9BA 4Y26A 4XQDA 5FPLA 4CU8A 1CAVA 4B4RA 4ZU5A 4QGLA 3SXWA 4JKMA 5D8AA 4W6XA 1ZZ7A 4QM9A 3VBUC 4OCTA 2J1TA 2W1QA 4JTOA 1W2TA 1X7NA 5ERLA 1A8MA 1UO9A 1ND3A 2Q30A 4JGZA 2YYOA 3IWZA 2AR6A 3KWVA 5GZFA 5BNOC 5KC6A 1VP6A 3ZFEB 5BY5A 3WNOA 3WG3A 3I54A 1C8M3 3I3MA 2EAAA 2RJLA 4AVBA 5FOJB 3PTYA 3BU0A 1HX6A 5FZ4A 4NRPA 1PMHX 4ISQA 3MPBA 2V4VA 3DECA 1NLRA 4QX0A 1UOGA 4HSJA 1GWKA 3LEGA 3Q8FA 4DINB 5LCWL 4Q29A 3KMHA 1BZWA 2VZTA 1ULPA 3R4DB 4MXWB 4KL1A 3T08A 4AEDC 1GZWB 1S2KA 1YYNA 2DU1A 1FX5A 2OS2A 3I3QA 3IDBB 3ZXJA 2BBVA 2BNMA 4EZHA 4IESA 3T09A 1QQP3 1LRHA 2WFF2 1OLMA 4C1XA 2RS11 3MF9A 2XUMA 4CCMA 2C5DA 3I2GA 4FBFA 4K8FA 2IXCA 4SLIA 1OOPB 2V5DA 5CKQA 2GNTA 2DCTA 5A3PA 2MPFA 1YFUA 1RITA 2YBSA 2HBTA 4A2UA 2XBO2 4NJ4A 5T5JA 1BCXA 1VMHA 3BUCA 1BJQA 5FYSA 2B7YA 5GZEA 2YPJA 5JR7B 5HCBA 4HK8A 2D43A 3I2OA 2Y6KA 2WO7A 1IKQA 1Q43A 1CAVB 1VRH1 1HV0A 2ZEWA 1L3JA 3CF6E 5D8AB 4LLFA 4XIKA 1D4M1 1TME3 3I8TA 1JZ7A 4BH9A 3CJXA 1BK0A 3BVCA 4ZHNA 1ND3B 1W06A 3N9NA 2OW4A 1V9U3 4JGZB 5FV3A 1RUG1 1W8WA 1U5ZA 2OVUA 3CU7A 5T5OA 1ST8A 4B7EA 4NIDA 2JE7A 2LM3A 2BFUS 1VBC3 2PHXA 5FMBA 2ERFA 3VV1A 1UOJA 1LEMA 1GWMA 2UY8A 4R9CA 1Q8PA 1AXYA 4BLIA 4E4ZA 2E7TA 5FZEA 4C8DA 5L9RA 5JZGA 4LKFA 5C3RA 1RUE1 3OOXA 1WCKA 4GULA 3JQXA 3MBWA 3U14A 2AREA 3H8RA 2Q0AA 1TMF3 3ASIA 1E57A 5F3IA 4C0HA 4EWDA 1GP4A 2DCYA 4GH4A 4NPMA 3OD4A 4Z92B 1GKBA 1UMHA 1W8NA 1NUKA 1ULDA 2GMPA 1H2NA 3PVEA 3TN91 3ZYBA 2WLPA 4GB31 1O3RA 1WD3A 1JH5A 1RUI3 2JDYA 2O1QA 2PHUA 3N7KA 4W6YA 2PN5A 2VCBA 5FLJA 3TNQA 4RA0A 4S2GA 5JIUA 1BBT1 3K75B 3POJA 5HCFA 2JDAA 2WT1A 2YMZA 1HXS1 1UU4A 4PCRA 4WVWA 3ZN4A 3KM5A 1IPSA 3BI3A 4BK5A 5DUXA 2XVLA 5C3OA 1TEIA 1NOVA 2J22A 2VQ0A 1RUH3 1OF4A 5C9AC 5E88A 2IVIB 1F15A 4QDRA 4HLTA 2VCMA 1V6MA 5C5UA 4FQZA 2ARAA 2R062 4AGVA 5ISLA 5IFPA 3BALA 1VBC2 5KHJA 2XLAA 1F4AA 3JD71 4I0WB 4I0AA 1WCUA 2D93A 1EV11 1US3A 3NVCA 4LOSA 5C8CC 1O4YA 4FT8A 4NE9A 3USSA 4NUBA 1RUG2 4J25A 3RFRA 4YZ2A 3U11A 2Y26A 4OULA 2DCJA 3ZIXA 3NKGA 1UF2C 3PJYA 3I3BA 4D7YA 1LHOA 2A71A 1G6NA 2JEMA 2WUHA 2PLV1 2YGMA 3OUHA 3WF0A 4AXOA 5T3NA 2ZXQA 5IK7A 1FNYA 1KS4A 4MO3M 1W9SA 5GLZA 2K46A 2OZ6A 1Q8QA 1GQGA 3ZMOA 3CL1A 2IXHA 1XSRA 3AFGA 2I07B 3HAGA 4YM1A 4D6SA 5A3NA 5JZGB 4XUNA 1R083 2R16A 3PVOA 2YU2A 3OEBA 2WIIB 4AGRA 1S0IA 4MH0E 1W6QA 3MIFA 4XZUG 3VBRC 5GLVA 4BQXA 4GH4B 2VVEA 2ZS6B 4E9KA 1OUSA 1RUH2 3SKJE 2JG9A 2R6QA 2WINB 4BQYA 4R9BA 3KSCA 1T6BX 3AM2A 4AAXA 1LHWA 1BBT2 4HN0A 2WAOA 5EYYA 3LFMA 4URAA 2VMCA 2YPDA 5FY7A 2HWE1 5BNQA 2I74A 3D5OA 3JB4C 3KS7A 1YEWA 4M4RA 3KT7A 3EJKA 5FY9A 4AW7A 1I1EA 5LEJA 1XYOA 2FZ2A 1ZZBA 3E6CC 4BWOA 4M00A 1MZ6A 1RTVA 3CJIA 4CZSA 2F17A 1G8WA 1GYKA 2ZGKA 5F3GA 3AP7A 5A7PA 4NWWA 2XHNA 4LBQA 4IEOA 4NVPA 2ATFA 1OXCA 1HJGA 4MXVA 1KFXL 4C91A 2QQWA 5DMYA 2LS6A 1DHKB 1UY1A 4UI9L 1ENQA 1IQDC 1MPXA 1S4CA 1HKDA 3THCA 1LOEA 5F1RA 2Y8KA 1WA4A 3WW4A 4FPCA 1RUC3 2CDOA 4LA2A 4MGIE 4QX1A 4BHPA 3OGVA 3R4SA 1AL21 2FD8A 1AR83 2P17A 3LIHA 4COZA 1R082 4CCDA 2VOWA 4HANA 5I0TA 4FOWA 2YDEA 1VBD1 3LPGA 2ADEA 3S7IA 3FHAA 3MV11 4OI2A 3CZJA 4LLOA 1DQ6A 1DGRA 1DZTA 5IATA 1VAKA 4MGZE 1EP0A 3MIEA 4XUPA 3WHTA 4HT1T 4DOUA 5B2GB 2ORZA 4EJRA 2HYXA 3J7MA 4RHV1 5FP9A 2F4LA 3A21A 4HETA 4Q4W3 4FAHA 5ACA3 5L7OC 3PUQA 4GIQA 3I3EA 3RG0A 4YZ4A 2FCTA 3B93A 4UBHA 1LU2A 1W6QB 2VZ1A 4OMDA 2OPWA 1ZVFA 2JICA 1PZ8A 4MADA 3RMYA 2JG9B 3SEPA 3WDVA 1ODNA 3C2UA 2VR4A 2XL9A 4HZFA 3WDTA 4NAOA 3N9OA 3NMBA 5GLUA 4FPKA 2HKXA 2ZGTA 5D1IA 1C8NA 3OBAA 4V2WA 5K4LA 1H2KA 3WNLA 4YWAA 1N1SA 5KXDA 1SCSA 3JCIA 2CNAA 5LW9A 3CJIB 1OBNA 1AR82 4UW3A 4YM3A 4FPGA 3FJSA 4LBQB 1Z0HA 3MPPG 4XJWA 2JKXA 1ONAA 2VQUA 4WZCA 3O1VA 1K45A 2XVGA 5I0SA 4AFMA 3N3HA 3MICA 2NP0A 3RJ2X 1VIWB 3D0JA 4I3GA 2VM9A 3FHIB 4IERA 2XLGA 3FLRA 3OBRA 2WNVC 1AL22 2WT0A 3IKWA 4OLLA 4AQ2A 3JUUA 2RDQA 3WP3A 5ACA2 4QX3A 3PMEA 1JS9A 1A78A 1UPSA 1O8PA 1L7RA 4Q4W2 1WGPA 1VBD2 3T0BA 5JI9A 3NV3A 4F7ZA 4QB2A 3CIHA 3BU7A 2ZGMA 3GBWA 3I4IA 4META 5M0TA 5A1FA 4Q0VA 4RHV2 3WVJA 3A0NA 4AEMA 3MIHA 2KXLA 1H1AA 4XF9A 1OUXA 3GGLA 3UJOA 5FMDA 1AYM1 5FWJA 1MVEA 4QDSA 5JAXA 1PM7A 1I3HA 2EIGA 1EPWA 2RS31 3AP5A 4M3CA 1C5IA 3LB9A 1QXPA 3T3YA 1U12A 2Q8CA 4Y5TA 2VMIA 2ZACA 4G9SB 4M3CF 2A7AA 2CGPA 3F2ZA 2XB6C 5DAQA 1ZBA1 4JQTA 3C3VA 3ZN6A 3RRDA 4CEYA 3KV9A 4QM8A 1B35C 3T2TA 3GZUC 2VQTA 3D8CA 4FTBA 3I2KA 1F35A 1ND2A 4FFFA 1A34A 5JUVA 1F4HA 1YIPA 4BCUA 2VNOA 4QHOA 2TEPA 1GZTA 5T52A 3A22A 2BDRA 3DN7A 4H3WA 3C7EA 4XABA 1AX1A 1UL9A 4XMIA 5GM0A 4LE3A 5FPUA 4QMAA 4XFBA 3V0BA 4FQ4A 1ODMA 1DP0A 1QY4A 2XLFA 1ZZ6A 3NV1A 4Q4V1 3WNPA 3BOWA 1V6NA 3ACIA 5E6HA 4NROA 3MYXA 3AVRA 1BHGA 1BXHA 4P5YA 5LASA 4JVAA 5J37A 2PFWA 4HPKA 2OQ7A 4QXCA 5DPNA 5KHKA 2WWJA 4IV3C 5I8TA 5FZAA 4LT5A 1PVC1 3WUCA 1NT0A 1F5JA 2XJQA 2BJSA 2B46X 5CU1A 3WW3A 2JD4A 5KWRA 1N3PA 2QKDA 4XXPA 4YM2A 4AVCA 2RMU2 1FMD2 4N53C 2ZX3A 3B7MA 3RYPA 2DURA 2ZKNA 4D7TA 4XAEA 1LB2A 2K0GA 5A32A 1VBE3 4LUKA 3AYAA 2MEV3 4M3CB 2A1XA 5FYUA 4CCOA 2VMEA 4XURA 1ZBA2 4OZOA 2VAUA 5C6CA 1HRI1 3ZXKA 3AC0A 3VBUA 4A3XA 4E8CA 4A4AA 5I0UA 5GZCA 3BOPA 2IFWA 2HEYF 3MEPA 1OH3A 2HWD3 3HN1A 4CEYB 2YHJA 4BQ5A 1GLHA 3VKNA 1GSLA 2HJIA 1YFWA 1ND2B 3QD6A 1RC6A 1RUD3 4Y5SA 2WZPP 2FDKA 1XNCA 3FMGA 4LHLA 5FMOL 2GAUA 1EPZA 2RM23 4P9YA 4ZXEA 3WF4A 3GZEA 3LSDA 4XHXA 3UYJA 1T2XA 2I45A 2Y0IA 4UFJA 3VHOA 3POEA 1VBB1 4ONUA 4R9DA 2D6LX 3DXTA 4LHSA 5FLHA 4COVA 5BNPA 1Q8SA 2Y34A 1TZOA 4XC9A 3ZXAC 3V0BB 4N9HA 5DUUA 2PHWA 2BVVA 3SH5A 4AEDA 4LXLA 4UW5A 2E7AA 4PHZA 3WEZA 1JZ8A 4GH4C 1LJ7A 5LA2A 4IEWA 5FO9B 3Q8BA 3N4MA 1V70A 2W1UA 5FCCA 3WDXA 1K3IA 1SFNA 1CAWA 4P14A 1VBE2 1BEV1 4HPKB 5F39A 2AUYA 2IXIA 2WYSA 1F9KA 1T6GC 1KFUL 1W8OA 4Z82A 3SCFA 1BMV1 4AL9A 4KGQA 2HWB2 2JDNA 3SISA 2BGCA 1AR71 3B02A 3HWJA 3MHZA 1SLIA 5FR3A 4COWA 2VOVA 3ETQA 2HWD2 5IT6A 2LALA 4X6QB 1RUD2 2JDHA 5A32B 2ZGUA 3OTFA 1W8UA 2P2KA 3H9AA 5A1AA 2UY9A 1Y9MA 1W9FA 2H0BA 2Z5WA 3DF0A 5FYBA 2C26A 3BTYA 4Q4X1 3VBUB 1LU1A 4Q4Y1 2XJRA 3LEKA 5E1RA 1AJOA 2QUOA 4B29A 4CP2A 1IG0A 1AUYA 1CAXA 4MGYE 4LEJA 1FOD3 1W8FA 2WC2A 5HPOA 1IS5A 1DGWA 1QJU1 4XBNA 2FDJA 5FYTA 3UT0A 2ENRA 2JD9A 2W0XA 4AF9A 2VXJA 1WLTA 2W91A 3H3ZA 3O0VA 1JYTA 4RYDA 3WCSA 4BXSV 4NWVA 3OD0A 1OPMA 1Z78A 5BNPB 1PX4A 2KA3A 1XBFA 2QNKA 1RVF1 2P6CA 1LR5A 4D3WA 5DZGA 3H8OA 1W03A 4AEDB 1CIYA 5LEKA 1QKQA 4ET7A 2YC0A 3KQ4B 2WZEA 1REEA 4YGDA 1OQ1A 2N7GA 2HH9A 1R093 5KBFA 1SBFA 5SV5A 5FP8A 1CAWB 2WZR1 1AR72 1KDMA 1V6OA 4BE3A 4DEVA 4OMCA 1KS5A 2VBDA 3GJAA 2QZ2A 2ZHNA 2EVXA 4XDQA 4LE4A 5JSOA 2QQOA 1D7PM 3IPVA 3VBSB 4FXGB 3IMNA 2ZHMA 2X09A 5C9AA 4XZPA 5A1LA 1WW4A 4OHWA 4AHYA 3I97A 1G7YA 3DL3A 4MHRA 3MV01 3HR9A 1FOD2 2ZGQA 2R7EB 3H50A 2AACA 4MHUA 2D98A 4B7KA 5CADA 3LDRA 4LBOA 1NX9A 2JDPA 2QQVA 3AB0A 3TOJA 3E1F1 2A5ZA 1CAXB 3E6DA 3E5QA 3ZYGA 4OZXA 4NHLA 5IUQA 3MLJA 2VPVA 1OF3A 5F32A 1PZ7A 1FV3A 1R092 4RSUA 1X36A 3ZDSA 2GSYA 3WLUA 4LOTA 4Y4YA 3WQ0A 5JSRA 1AYN1 4IETA 4XQWA 1EUTA 2NM1A 2C6SA 4BYYA 2BYVE 4N8MA 4XVHA 1IPJA 1SBEA 1HRV3 3H7YA 5DDJ1 3VBRA 5AFEA 1AXZA 1WLCA 2D6NA 4K9SA 4IDZA 3GYDA 2WO2A 4B4QA 2OA2A 2WZR2 2XQRA 3SQOA 2DU0A 1J83A 1DLCA 3T30A 3VKOA 4GMP1 1UMIA 5F5CA 3S7EA 4AZZA 1H2LA 4FPOB 3AZZA 2NMNA 4AG4A 2OYZA 5DUVA 1O4ZA 2XH6A 3GJBA 4CEWC 3NNLA 2VQAA 2VZRA 4NRQA 1YWKA 4L8QA 1CIWA 2NMOA 2Y6GA 3N7LA 3GALA 2FBEA 1FXZA 4PQ9A 1LKNA 4A6OA 4L9BA 4CDWC 3J8F3 3O1MA 2WYFA 3W20A 2AZ5A 5C9AB 4CA9A 4YG0A 2CL2A 5FMCA 1OMIA 1REFA 4IUGA 1MZEA 3HMYA 5BYNA 3T1MA 4YW5A 2V09A 1RUNA 1UX6A 1HN0A 2VY0A 1Q8OA 3NNJA 5IFTA 3WG4A 4W50A 1QDCA 1M4WA 4IEXA 3RMXA 2E9QA 3WQBA 3H8XA 4FTSA 2W47A 1AR93 1HRV2 3N35A 1E5HA 3PDQA 5LB6A 1ZBE3 2VMFA 3B9IA 4M0NA 4EV0A 1YNAA 5HXMA 3VDAA 5LA9A 3IMMA 1BVVA 1Z7S3 5EJ1B 3VBFA 4E4DX 5KHIA 3ILNA 4RQPA 2VZUA 1SDWA 5EXOA 3T4VA 3MGUA 1JOPA 2IWGB 4Y3OA 4D6RA 4OHYA 4FPFA 5GZGA 2OUJA 2HWF3 2Y64A 4NOTA 1R1ZA 1LODA 4CXXA 2VU9A 3O1PA 1J1TA 1GR3A 2ARCA 3VBRB 3H8UA 3VZJA 1HW5A 2H6CA 3J8F2 1NZIA 3OEAA 4D69A 1F8VA 2Y60A 1H1IA 1UZVA 1GP5A 3IT8A 2BWAA 3L2HA 2QDRA 5L19A 4AI1A 2WKKA 4CEYC 1DQ0A 1FNZA 1WMFA 4I0BA 5LK7B 1LESA 1JBCA 4IE0A 2WSUA 5F6KA 3MW2A 2R073 1H6YA 2HWC3 4NPLA 4DRVA 2XMLA 4YW7A 4XBLA 3PNAA 1VBA3 2BOIA 4K21A 2YB7A 3AMMA 2ETEA 4OI4A 4QQ2A 1CJPA 5EFUA 2XGXA 4QQHA 1SG3A 1ZBE2 2PA7A 4EN7B 2CWSA 4NIGA 1GZWA 2WO3A 2W52A 2XR4A 1RHI3 3UJQA 1ULGA 1DG6A 2ZPXA 2WNVA 3NSTA 2YY1A 4IW3A 1XXNA 4FSJA 4JAAA 4FOQA 1NYWA 5L73A 1ZYBA 3OGGA 1AX0A 2EIEA 4O9GA 3DCQA 4TYSA 3VUOA 4E2SA 2Y6FA 2FDGA 2DBIA 4ATEA 1GU3A 1FPN3 2WFF1 3KF5A 1QJY3 1POV0 3HQXA 1UU6A 1XE0A 4CP0A 1C4RA 2EXIA 4NN0A 1POV3 5FYZA 3I49A 1RUF2 2CTVA 5F5IA 5AFBA 3A4UA 2GP3A 4P9JA 5JI7A 4BQWA 3VBFB 2IXJA 2R49A 3BIWE 4WBBA 3GZAA 4XF0A 4RQPB 5IAXA 3RWNA 5F2WA 4JGYC 1KJLA 4YZ5A 2B8MA 1U5XA 2X29A 3W58A 1DYPA 2FCVA 2XBO1 4XJ8A 3VD9A 4FPYA 3UESA 3M4FA 2DVDA 3VZLA 1APNA 4AHXA 2R072 2HWC2 4X6RB 3WX5A 3ZFGA 1C8M1 3HQRA 3K3NA 2NZ9A 4PF1A 1RMU2 5LY2A 3GDBA 2NQYA 4NO4A 2EICA 2VZOA 1B35A 3LCPA 5EV7A 4M4PA 2Q8DA 5LATA 4ES8A 3POYA 4DUVA 1PO13 4N90A 4AK3A 2XVKA 1WCDJ 2QQUA 4QXBA 1RHI2 2QQIA 3NJVA 5C5TA 2GZWA 3D3AA 3K4DA 2DVGA 2WA3A 2WN3A 2ZX2A 2IFRA 1DQ1A 3BB6A 3W59A 3ZXGA 4FFIA 1QEXA 4HK9A 2EXHA 2QBXA 2VVFA 3OBZA 5F5QA 4XUQA 3K77A 5F7UA 5IHRA 1PGW1 4QPGC 2W92A 2BTVC 1QQP1 4GALA 2HYKA 1FPN2 1YIFA 2BGPA 2XHKA 2ILMA 1QJY2 3CKHA 1HV1A 3RSJA 3WD5A 4A42A 4IE6A 3U0ZA 1BQPA 1OT5A 2YBKA 2WNVB 2VW0A 2VG9A 3VL9A 5BPXA 3UKNA 4LR4A 3HEIA 4XDOA 4IV3A 4LORA 2A75A 3VB9A 2V4AA 2PMWB 3PMSA 5FYYA 4NHKA 4Z8BA 1IZ3A 3ZXLA 4DNYA 4OHXA 1UZZA 3BODA 3FWEA 1H2MA 2EIBA 3VBSC 3T2QA 4ES9A 1RYYA 1DYKA 3H3LA 3RGBA 2BW8A 4N53A 3SITA 2QVSB 1QNWA 3NL1A 2IVJA 1UKGA 4PIYA 3KGLA 3HBKA 2G4IA 4NIIA 2O0OA 2VMDA 2DVFA 2PAEA 3DV8A 4KNCA 1GQHA 4F83A 1V9U1 3EYPA 1XNTA 1ULCA 3NWKA 3ZYJB 1C8M2 1UYYA 2R061 1JUIA 5JDBA 2VTXA 2XXZA 1VBC1 5GLWA 1W6MB 3ZFGB 1UAIA 1AZDA 1YJLA 3AZXA 2JE9A 2Y6HA 3J4UH 1VMJA 3PUAA 5GALA 1UY0A 4CPBD 3CEWA 1B35B 3THDA 2VOKA 4DB5A 1S0EA 2GH2A 2H6BA 1JW6A 4D7SA 3FZ3A 5EJ3A 1TMF1 4AVTA 2D6KA 1PGW2 2RJKA 1XE7A 4YVWC 1WMEA 2B42B 1QQP2 1J59A 4D6QA 1BYHA 5CYYA 1IOAA 1O5LA 3KVBA 1RUI1 3TNPB 5IVJA 4IGOA 4XDPA 2W9XA 4NHXA 3ZPOA 3SH3A 3QBQA 4BIFA 1K42A 1OFSA 1OH4A 1UOFA 1XNBA 4K1YA 2E53A 4V1PA 4QWNA 5CIRA 2SBAA 4XFHA 4UF0A 5EPAA 4AWDA 1TE1B 5A70A 1VRH3 3BTXA 2D3PA 5IK5A 1RUH1 1VAMA 2A6XA 1MVQA 4JV4A 4KWUA 2OQ6A 3E5UA 3ES1A 5FIXA 4IV3B 1DZQA 4DIQA 5IK8A 5JOYA 2X5IB 1XRUA 1HLCA 4HKWA 4B3NA 1ZX5A 5FXVA 2KD7A 4YARA 2VXRA 4FPHA 3U78A 1KITA 5I93A 1TME2 2G19A 2QQLA 3AJZA 5AC93 5CBLA 4Y22A 3R4UA 4N53B 1V9U2 5F5AA 3WQ1A 1JU4A 1JZ5A 4FP3A 4YFWA 3LSEA 1OLME 2J1EA 4IE4A 1LOAA 4GKXA 4KWKA 4XQ4A 1J3QA 2C1FA 4PI0A 4ZS3A 2BOJA 1LOBA 1KGYA 4ZZ8A 1H8TC 1UXXX 5A6YA 1YLLA 1H1MA 2WZ8A 5A7OA 2DWRA 1AXKA 5BNPC 5KHHA 5CNAA 1TMF2 3DEMA 1BKZA 2FZ1A 4MZUA 1SLTA 3APBA 4N43A 5T5LA 1AR63 1R081 3NQHA 2VOXA 1S55A 1C57A 1I6XA 3DYOA 4WVMA 2MNGA 1FI2A 3VKMA 1RUI2 1CAUA 1CESA 4QGMA 4W65A 3PU3A 2Y0OA 3ROUA 3V56A 3O14A 2D5HA 1NCRA 3AP4A 3ELNA 4GQ7A 1X8MA 2NPIA 2DF7A 1W0NA 1JHJA 3RDIA 3RNSA 1W3XA 4HMZA 1SPPA 3DKQA 1MZ5A 4AI9A 3O1UA 1J1LA 2K2SA 4XJUA 2PXJA 1PX3A 4OYUA 4AFBA 2QFEA 1DGLA 4UF0B 3LAGA 5LBEA 1NXD1 3VZKA 3BTZA 1EV13 4LBJA 4QDQA 4XCAA 3OPTA 1GZ9A 1ZRIA 2JDKA 3VBOA 2EALA 1FV2A 4PBPA 5AVPA 2VBPA 5A80A 3ZFFB 3ZSLA 4WV8A 2BU9A 2ZCWA 4AHZA 4AVSA 4BJ0A 1C28A 1CGPA 1UYXA 2VW1A 4XMAA 2HBUA 3ZYRA 2PLV3 4KMQA 4Y22B 2VCAA 3CHXA 1WZXA 4TTGA 1OLQA 2RE9A 3AX4A 4HFSA 2PAKA 4XIOA 4AQ6A 1E5SA 2JKBA 1DU3D 1X9PA 1AR81 1D2QA 1UOBA 1OD5A 4L2NA 4PLOA 1J3PA 4GA9A 4BOWA 1LTEA 3D4KA 4IE5A 2YXSA 1OA2A 3NV4A 5IWFA 1JYNA 1CD3G 3RZKA 4INDA 3ENRA 3OF1A 2Z79A 3FUQA 4O65A 3M3EA 4IGPA 4C90A 2BFUL 1N1VA 3H1WA 3U1XA 4KI5M 5IAVA 4EN6B 2XQXA 5HCAA 2AH2A 2E7QA 5ACA1 3IDEA 4Q4W1 2WR9A 4PT6A 4IEVA 5A3OA 1GP6A 4N43B 4QX5A 1SLCA 2XKPA 4HVRA 2BBAA 4BMBA 1YXWA 1S2EA 2J42A 1W2OA 3C7OA 1S0DA 2ZGNA 2XPJA 3VBFC 4CUGA 4WVMB 1GZCA 1LECA 4RQPC 1LOFA 1CAUB 2GN7A 4LIVA 4DMIA 3WZ1A 3IM0A 3LZZA 2HLEA 1NCRB 4YGCA 4KBZA 4Q1PA 1SPPB 3ACHA 5EQUA 5FPVA 1JYVA 2GMEA 2CV6A 2ZGPA 1HJFA 1YO8A 2C9AA 2LROA 3CZUA 3S0MA 2TBVA 3O5SA 2YFZA 1SLAA 5A6XA 5C70A 4CYDA 3ZDVA 1XYNA 4ARYA 5FDBA 3HQUA 5CFDA 3EO6A 2RVAA 4CEWA 5J09A 1UN1A 4UFIA 3VBOB 3V0AA 1OA4A 3AL6A 1LGCA 1RUC2 4CDWA 2EAKA 4CU9A 1HIXA 5A3WA 2ZTNA 3ZOIA 4A3ZA 4AR2A 2XWJB 5FZ1A 3WINE 2W08A 2AYHA 2YU1A 3AMPA 1ZA7A 2JG8C 5FZDA 3VGIA 3VHNA 1QH7A 2RHPA 3E97A 4LPLA 4XXAA 1H9PA 2DTWA 3TEXA 2ZHLA 1H0BA 2JJ6A 3U4SA 2WL1A 4DXSA 3NV2A 3LA3A 3UGGA 3AXEA 1NY72 4YZ3A 3TYJA 4YW2A 1VB4A 4YFZA 2OT7A 1YQ5A 4FVVA 1QOTA 3C7GA 4N9IA 3SEEA 2AGSA 1MACA 3HNMA 4EN0A 1JYWA 2JIJA 2R043 4Q0PA 2CSGA 5DQ0A 2UWCA 3J7LA 4UW6A 2F4PA 3WF2A 3ZM8A 1UZWA 3IB3A 2GC3A 5DAXA 4TLFA 5E8AA 2VJXA 4BK4A 1SBDA 2ZZQA 2XJUA 1JZ2A 2J1UA 1FMD1 1NQDA 2RMU1 4RD7A 4UFHA 5FO8B 1O5UA 1LGNA 1YRZA 3PTRB 2D5FA 4LTAA 3ZR5A 1UD1A 5DN2A 1D4VB 3U75A 2V72A 3EXUA 2ZABA 5LK5A 3ZFGC 1XYPA 5C3PA 4NHYA 3N9QA 4Z1VA 4XCBA 3RI8A 4H55A 5FXZA 3DPRC 1OPOA 3GCXA 1RJ7A 2AEZA 2Q8OA 5CFDB 3LGRA 3G7DA 1HDKA 1IG3A 4CEWB 2BPA2 4LBMA 3V0AB 2A73B 4XBQA 3ZXFA 5JVVA 3VLBB 3HOBA 1DDLA 2ARBA 4CDWB 4LO8A 3HJRA 4A7KA 4D0QA 2WLQA 3PVNA 2W3JA 3B9CA 1O3QA 4H7MA 4A45A 2RS53 4BIOA 3Q8EA 1YQCA 3I2HA 4I30A 4JDNA 4AE2A 4E4SA 4YSFA 3EB7A 2D6MA 4LA3A 4MGSA 3I2FA 1VPHA 2WS93 2ZAAA 4B8EA 2QQPA 3IZOA 3GHMA 3CNAA 2X5IC 2RDNA 4GWIA 3EHKA 1RUJ3 1VBE1 2DVBA 2MEV1 5A3LA 3FUOA 3AYEA 4DXZA 5LWBA 2HWB1 2ZMNA 4K40A 5GJ6A 5FZFA 1O8SA 1WWYA 2BNOA 3PUIA 2OPKA 4A6SA 4JGYA 5I8SA 2RR13 4Q8LA 4Q2FA 3NRUA 4R9AA 4TWTA 5JOZA 2HWD1 4EZ4A 1OD3A 1OQDA 3FFQA 1HN1A 1G9AA 2XJTA 1WA6X 3ABZA 1RUD1 3VHRA 3KCCA 4MVTA 3NJXA 5A3TA 1KRIA 4UT5A 4QPWA 4XJ9A 1XE8A 5LRRA 2RM21 5T54A 3WDUA 5JXHA 4AI3A 4FOYA 1GOFA 3WV6A 4Q0SA 5KHGA 4Q4V3 1PIV3 3MLLA 4QX8A 3WP4A 2GALA 2RS52 3ALQA 5J1XA 1R1A3 1RJ8A 1UXZA 4JHTA 3H42B 1QH6A 3D6EA 5I0DA 4CDUA 1QMJA 4OI1A 2Z42A 1XNKA 3LA7A 1PVC3 4M3CE 4XAAA 3WP6A 3P6BA 2CGOA 2WS92 4FPEA 4XJAA 2Y33A 4XEZA 4XUTA 2W5FA 4QPGA 1KQRA 3FC0A 2F6BA 3AZWA 3ILRA 3OGSA 4Y1VA 4YW4A 5HI0A 2J1SA 2P34A 3FBMA 1RUJ2 4LBKA 3VZMA 1ALYA 3K51A 1CPMA 4QGNA 4IEPA 3OGJA 1SDDB 3PU8A 2PQSA 2QDNA 2VBBA 4L97A 5CG8A 5IJRA 5C8WA 2W1SA 3ZMNA 3O1OA 2ET7A 2DCKA 2RR12 3GBFA 2O8OA 5GLTA 3FL7A 4QXHA 4WVZA 1GV9A 5CAZA 2MEV2 3FN9A 3UGFA 5H9RA 4A41A 1NKGA 1WW6A 5HCHA 3FLPA 1R64A 2JENA 2KR2A 5FFOC 4AAPA 3ZFFC 4CE8A 3M1HA 4O7XA 2YROA 3VBSA 2R30A 1S0CA 1K5JA 1PIV2 4YPJA 1AX2A 4JGYB 4MGKE 1R1A2 4TN7A 4LITA 4TLGA 4XW3A 4U36A 4C1WA 3DUIA 1LNSA 2P3IA 1UMZA 5JOXA 2BV4A 1ZRCA 4M01A 3ZKYA 1FOD1 2RM22 3R0RA 4P00B 3RZGA 4Y1UA 3AYDA 3KHCA 1FATA 2ADDA 3MDPA 1G86A 4EE2A 4QQLA 1QJZA 3BKZA 3KT1A 1W39A 4FFGA 5F3EA 4XUOA 4DEQA 1ULEA 2WJSA 3H3UA 3OB8A 3QLQA 3RYRA 4YGBA 1QF3A 1LAJA 3UL2A 4N43C 1NXMA 3J7HA 5F6LB 4CDUB 3J26N 1BEV3 3AVSA 1OA3A 4I02A 1NA1A 5BXXA 3OGRA 1DBNA 3QACA 1W9TA 4Y5Z0 5H9PA 3PL0A 4FPJA 5T55A 5LRSA 4PDWB 1AJKA 4YVWA 1QJFA 5A7NA 2Q8EA 5FXWA 4CCLA 4Y24A 1IS6A 4QPGB 1R091 3SNMA 1XC6A 1NCRC 3DYMA 2EF6A 3QOPA 1DCSA 2UWBA 5C7GA 3VD3A 2ZX1A 4K8RB 5DXDA 3Q8CA 3N36A 2VNVA 4RS5B 1O4TA 1COV3 2XJSA 4Q27A 2IXLA 4QXKA 4I2OA 4YLZA 2IXKA 4R8HA 3NJZA 4DRRA 2A70A 5KXCA 1OC1A 2B9VA 4BB3A 2YUEA 5CKNA 2UYAA 1UY4A 4Q4X3 1GNHA 2WWUA 2JDUA 1OSGA 3LE0A 3VBOC 4JKKA 2BEOA 3NKTA 2W95A 4QX7A
chains in the Genus database with same CATH topology
1OFNA 2PHRA 4DQAA 2ZOEB 3MFAA 2TUNA 3TB0A 3G6JB 3MIGA 1V6LA 4YNIA 2B39A 1Q5OA 1SFYA 2GU9A 5JIAA 4BZ4A 1V6KA 1RVF3 3PHMA 1PHMA 4WM8C 1H8TA 4AHWA 5JMCA 1U0AA 2D6PA 3IDCB 5J3UA 3H0OA 1ZRDA 4CDXB 3P3NA 1JHNA 2B45X 1H30A 1HRV1 1ZRFA 1URXA 1NA1B 1BVP1 3RQ0A 2D40A 4EROA 4YVWB 1CX4A 3ZX7A 1LOFC 3WR0A 5SV8A 3U07A 1V6IA 4XF1A 4YVSC 5GZDA 4HBNA 2ZGRA 4PIZA 5K9YA 2ZGLA 3J8F1 2WA4A 2ZAHA 3U10A 1W6OA 5JLVA 4K20A 5CFDC 1QJX3 3AXDA 3PVBB 3EBRA 3INAA 2GMMA 4NHMA 3ZXEA 3MIBA 4L99A 1N47A 5I0RA 4XF3A 4CTEA 4FCAA 3O12A 1GFF2 4KBBA 1IGOA 3WG2A 5K0UC 2UURA 4KU7A 3WW2A 4Q0QA 1DQ5A 1H4HA 2D3SA 1OHFA 1N1TA 4XTMA 2JECA 1LENA 1Y3TA 4O9EA 3AK0A 4FOVA 1ZBE1 4S2DA 2CYFA 2VNRA 3SH4A 3WOGA 2D97A 1C1LA 2PHLA 1H8TB 1DF0A 1Z7S1 3NW4A 3ZSJA 4IV1A 1IKPA 4GMP0 5DZFA 1NQJA 2KM2A 1MS3A 1PNFA 4BQ1A 2D3RA 3ZSMA 4QPYA 1LEDA 4HVOA 1NCQC 3FX3A 4P9GA 4UW4A 3M8LA 1RUF1 4RR3A 5BNNA 1W0OA 2QJVA 3KGZA 5J36A 3M3QA 4G3YC 2VNGA 3AZYA 5CFCA 4IEUA 2R071 2HWC1 1O7FA 2MHFA 1LHNA 3W9AA 1RMU1 1W6OB 4AVVA 1MS8A 4NR1A 2Q1MA 3VBHB 1ZA4A 2A3YA 2LTNA 5JWPA 2PELA 4XFIA 1RHI1 2BVBA 1ASJ3 4BLJA 5BV6A 3KB5A 1S1AA 1PO23 1AR92 2JG8A 3FE5A 4AFCA 3ZIWA 2GNMA 2IZWA 1JTZX 1S0JA 3JBG3 1FPN1 1QJY1 1Z7S2 2CAVA 2DCZA 1PK6C 2GN3A 4XFCA 4D94A 2GNBA 5EWSA 2HWF2 4IV1B 3S30A 3TAYA 1XU1A 4L11A 3KZ4C 4OVEA 1MEC3 4P9XA 1TQ5A 2CY6A 4HVQA 4COUA 5FRAA 4WZFA 1EAH3 4PJYA 5FO7B 4X8PA 4HKLA 4RR3B 1FT9A 4HSLA 3KQRA 5BNNB 1PO11 2XJVA 2XWBB 3HD8B 4BPZA 1W6MA 1ASJ2 1C5HA 5CFCB 4GWNA 1VBA2 1JOJA 1JN2P 1A3KA 1MQTA 1NLSA 1VJ2A 3UK9A 3L9JT 4AEJA 1PO22 3DPRA 4ATFA 3THPA 3RS6A 3UKTA 2OIIA 1WBFA 3ME2A 1UKRA 3JBG2 4CDUC 4KG0A 3NAPC 2BUKA 4MYEA 3H1YA 4PDWC 4F3JA 1NE4A 1NG0A 1N3QA 2Q5TA 2JG8B 2ZMKA 3URFA 1MEC2 3KT4A 1N3OA 2H0VA 4ORFA 3AP9A 4Q26A 4S2FA 1S0GA 2A6YA 3KCYA 2XBO3 3GZTB 1M06G 4RS5C 2HEWF 3E5XA 4CDQA 5BUVA 1EAH2 1H9WA 1PGSA 3R05A 2VGDA 1QGLA 4LO4B 4H7LA 2X5IA 2BNNA 4N7UA 1RINA 5ABJA 3E6BA 3IIAA 4X8NA 5J48A 5JCTA 2GNDA 1A8DA 3THTA 1SCRA 3N7JA 1SEFA 1TME1 3VDDC 1PO12 5CB7A 1QOOA 2LUWA 2ZJCA 1JUHA 3MF6A 3GBGA 4C0BA 1SMVA 2A6WA 1MR5A 2VMGA 4PIXA 2ARXA 4PLNA 1MQTB 2DVAA 4IEQA 1TNFA 1VR3A 3DPRB 4RL7A 4Z2WA 3SCHA 3WXPA 1AF9A 4CDXC 2RS13 3V65A 3IN9A 1NA1C 3D82A 4R52A 3WT3A 4ZKTB 1GICA 2WNUC 2XJPA 1PNGA 3DGTA 4AI2A 1Q56A 2VVDA 1Q8VA 1AVBA 2I2SA 4KWJA 1DGWX 3RJRA 4CDQB 2R063 1Y7BA 5AC91 2Q1ZB 1D4M3 1QXRA 2V73A 3ST7A 3ZFFA 2Z69A 2GC1A 3VN4A 3RPQA 3WNXA 5ABJB 1RUG3 3VZNA 2W39A 4Z07A 1SLLA 1W6NA 3KD4A 2IC1A 2ZZJA 1G9DA 4QQOA 3VL8A 4DZGA 4KWLA 1H4GA 2RS12 4QU2A 5JPMB 1RUE3 4TZDA 1AR61 4YM0A 1GNZA 5K7PA 4EWEA 3GHNA 2YGLA 4Q8KA 3TN93 5FPZA 4GKYA 4GB33 1BK1A 1ZZ9A 4LNVA 4E2GA 2EA7A 1BBT3 1VRH2 1HXS3 2JXAA 4GWMA 4MSVA 2BWCA 3VKFC 1D4M2 3VHPA 2D44A 2EXKA 2VH9A 4JDMA 2X53S 4OFGA 5K8SA 1HQLA 2R0HA 1GANA 3LA2A 2A6VA 5AC92 2ZGSA 3AP6A 3JD73 4WM7C 3I59A 1PVXA 3VBHC 4HL0A 1F2NA 1CPNA 2DUPA 3CLPA 4J1XA 4P9LA 5E16A 5CA6A 4HKOA 1RUE2 3O0WA 1HQWA 3P3PA 5JOWA 3HBZA 3QCWA 5EZWA 2XL7A 3O0XA 2CAUA 3WHUA 1RUC1 1RUOA 2AENA 4AYUA 1W6NB 1YI7A 4ITCA 1G9FA 4RGAA 3FLTA 2ZX0A 3TN92 4GB32 4LHNA 3WQ7A 3ZO0B 1I5ZA 4XFAA 4XE9A 3WY6A 1AR62 3FFZA 4YW1A 4SBVA 4YG6A 4LO7A 4WM8A 1HXS2 4J6GA 3J9SA 3R6SA 3ZXDA 4Q1RA 2DUOA 2EXJA 4IV1C 1IPKA 1CN1A 1OQEA 1NY71 3LOBA 4E2QA 3ECQA 5J96B 4R4XA 3TWIA 1JXNA 3WP5A 2HWE3 1TNRA 1NZCA 4QPIC 4EN8B 1WLDA 3JD72 1PZ9A 5FBZA 1EV12 2E6VA 3CO2A 1X82A 4RR3C 2PHFA 4YVSA 3OPZA 5BNNC 4HN1A 2NN8A 4JRLA 1MS5A 5TSWA 1YI9A 5FLIA 3QH7A 3VZOA 2G9FA 4AQSA 5CFCC 4UXAA 2PLV2 4CP1A 4AFDA 1W6PA 4FO9A 3I59B 2UU8A 3AKPA 1FAYA 1AL23 1ZNPA 2SLIA 1MS0A 1K5MA 3LKJA 5K0UA 1JYIA 1LHVA 1VBD3 2DUQA 4LHKA 4Y1ZA 4ASLA 2ZMLA 4JRAA 4S2HA 4BM8A 2ZX4A 2WNEA 1WW7A 3ES4A 4YW3A 2PHTA 4RHV3 2K9ZA 1OLRA 4FP2A 1LGBA 1VAVA 3OBTA 2HWE2 1W2UA 2QE3A 4LBQD 3KCXA 4URTA 4WVVA 4KGGA 4WM8B 2R041 1LCLA 4E27A 1IHMA 2DV9A 3ZFEC 3RI9A 1JYCA 3L2YA 4BA6A 3PLQA 3A0KA 1RIRA 1GBGA 3MZHA 5FMOS 5IK4A 1NCQA 2WT2A 1DLLA 4AGGA 1REDA 1CR7A 2R32A 3AJYA 5H9QA 4IL7A 4XYXA 2C0ZA 4YVSB 4G4FA 3M3CA 4IQPA 2OUHA 1Y43B 1V00A 5J98B 2DYCA 3RZZA 5GKAC 1WW5A 4FTEA 5KXEA 3I2DA 4LULA 4AEKA 1MQTC 4GXLA 2ET1A 5KHJA 3WUDA 1WD4A 3JZVA 1W6PB 1OOPC 1OKQA 4XFFA 4XOGA 3UKVA 1UPIA 5C33A 2ZGOA 3ZN5A 1ENSA 3H7JA 2RS51 4N7IA 3ZSKA 4DY3A 2OZJA 3U4XA 3SCGA 1K5MB 2QZ3A 4Y20A 5K0UB 5A3MA 3MI8A 2PHDA 4K1ZA 3OJBA 4XTPA 4EN9B 5J7MA 4OUMA 2WS91 3USUA 4KG8A 1AL0G 4YG3A 1J58A 2E63A 1IS4A 5FTTC 5D8AC 3AKRA 1AYM3 1SLBA 2R042 1RUJ1 1O3SA 2RS33 1QDOA 2RMU3 1FMD3 2HEVF 1ND3C 3WDYA 4JGZC 1WBLA 1PK6A 4CDQC 2X8KA 2B9UA 4OHZA 1ZBA3 2RR11 3SHRA 5C4WA 4U2AA 3ZVXA 1SACA 1O3TA 4XFGA 3DKWA 5ABJC 3Q9OA 1S0FA 1NCQB 5DZEA 1ZZCA 4H14A 1F31A 5DG1A 1KD7A 1MS1A 1W0PA 1PIV1 1DIWA 2DFCA 2DFBA 2ES3A 1R1A1 3T1LA 1XU2A 3M2MA 5DG2A 5T5PA 4FXKB 1RL3A 4QT6A 4AI0A 2A3XA 2ZHKA 3TRSB 4LBNA 1CONA 4XF4A 4B4PA 1AYM2 5KC5A 2RS32 4OHVA 2FHRA 3NAPA 1VLNA 1XQNA 5I8YA 4PDWA 1Y9QA 2UWAA 4Y20B 3S6PA 3M3IA 1C1FA 2FQPA 3PJQA 1ZRRA 2HWB3 2UYBA 3X29B 3USUB 3JQWA 2WSVA 2W68A 4W6WA 5HBAA 4ASMB 4DPNA 4IEYA 3ZN6B 1CJDA 4RS5A 5A33A 5I91A 1PK6B 1YFXA 5BNOA 3JB8A 1HRI3 3MLKA 4L92A 5H9SA 4QHBA 3WG1A 3H1MA 2YV8A 5C4WB 2QCSB 3D0SA 4AQTA 3AZVA 3OYWA 4XHBA 4AVAA 1WMDA 2R1BA 5KXBA 3ZPYA 2PAMA 3ZSEA 4Q4V2 3HIFA 4LO6B 4FAGA 1C3HA 3VDDA 2BQPA 3B01A 1H8VA 1D2SA 1UW8A 3WCRA 5CG9A 1VBB3 4ISRA 3BTAA 1PVC2 1OI6A 1YUDA 2GC2A 1XNDA 4MUVA 3UV9A 2GC0A 4ZXKA 3LWCA 3MFCA 2XG3A 3POSA 4I09A 4CDXA 3RYKA 4LO5B 1D0GA 2FMDA 4YGEA 2P3JA 1EYBA 2VULA 1RGSA 3NAPB 2ZBJA 1ZZ8A 4K3UA 5CVRA 1DQ2A 4DY5A 1AR73 1UIJA 1COV1 1PMIA 4AFAA 1HRI2 1YCIA 2WNUA 2CWMA 1UU5A 3FBYA 5AVAA 1ZREA 3AKQA 1X50A 5JPNB 1YHFA 2VUAA 1U5YA 3ILFA 4I3PA 4KH9A 1I9RA 5EYXA 2VECA 4K7JA 1A6CA 5A33B 1KDKA 5BNOB 4RGGA 1LOGA 4PF5A 4Q4Y3 1VBB2 2WFPA 1ULFA 1YFYA 1QU0A 3OYWB 5E89A 4QD2A 2Y38A 3NO8A 5DUWA 3AKTA 4PLMA 3GF6A 1QJU3 3M7AA 4IEZA 2XKOA 1N1YA 2CGNA 3VDDB 3O7OA 4MV2A 1HQNA 4COYA 4YYOA 4P9IA 1BEV2 2JG9C 1BMV2 2GH8A 3GNEA 4JCKA 4AI8A 5JSPA 4DS0A 1X8EA 3ZYIB 4RFT0 3AFKA 1LOCA 3M70A 3CJIC 1DFQA 1VALA 2WZR3 2JX9A 4LBLA 5L36A 1COV2 1WLWA 1ZM1A 1UIKA 1V6JA 1D0HA 2WNUB 4Q4X2 4BMEA 4Q4Y2 5T50A 1MS9A 1G9CA 5C8CA 1QJX1 4J1WA 4YZ1A 3BCWA 1QJU2 1KXGA 4XJZA 2D6OX 2R0FA 3M3OA 2GDFA 4WM7A 4A7YA 1S2BA 1YJKA 1KJRA 3VBHA 1CQ9A 2PYTA 2PQQA 3AMQA 3K48A 3POWA 4XETA 4F8AA 3B00A 3AMNA 1RVF2 1K5MC 1ENRA 1WCSA 4Y1YA 1MZFA 1AHSA 1FYUA 1QOSA 3HT2A 4Q0UA 2ZKLA 2NLRA 3V64A 1DZRA 1QNYA 4Y1XA 4XILA 1B09A 2G9GA 1AR91 4NPRA 2WWSA 1AYN3 2B5HA 1F5FA 4LUMA 2ZA9A 5FQ0A 1RB8G 3EQEA 3MW3A 5DDJ3 3N7MA 5FOBB 2NYYA 1S0BA 1WUVA 3B3QE 2E51A 1PGL1 3IPVB 4GMP3 2HWF1 4EWAA 1EY2A 2P37A 4QPIA 4PBOA 2P3KA 4UBGA 3OY8A 2V5YA 1QJX2 4P5HA 4A7ZA 4ZU7A 1UCXA 4TSVA 3WDWA 3AKSA 2TNFA 5C8CB 2O8QA 2VUJA 4XPVA 2VMHA 3ZYPA 1Q3EA 4JDOA 4CRQA 1ASJ1 1VB2A 1U5IA 1J3RA 3BPZA 4WM7B 2A6ZA 1QHDA 1VBA1 1PO21 3QH6A 4P9WA 2WQ4A 3ATGA 1AYN2 3B69A 4KQ7A 4MLOA 5L7OA 1ENXA 3B94A 3JBG1 5DDJ2 4ZU4A 4DFSA 4JTNA 3IBMA 1QXJA 4JC1A 1UZYA 3B5LB 2Z2SB 5F9TA 4YRDA 1RUF3 3HT1A 1MEC1 2DTYA 2JDZA 5FQ0B 1DQ4A 1ND2C 1POV1 3SLIA 2FMYA 3ACLA 3ZFEA 3LOIA 5FPXA 1PGL2 1EAH1 3KLSA 4R4ZA 5C4WC 2A3WA 3MW4A 1MS4A 1RMU3 3MIDA 3JU9A 3OCPA 3WW1A 5FAXA 4OUSA 4QPIB 1IS3A 1LHUA 4OI0A 2WQZC 3I7DA 4MXWA 1G9BA 2YZ4A 4IXLA 3SMHA 4QQPA 3AYCA 3OY8B 4M0HA 1LULA 3AMHA 1DGRN 5HXVA 3TBDA 1CVNA 4I01A 2Q4SA 1OOPA 4FPLA 1IQAA 1O91A 4JQRA 2VW2A 2D7FA 1X33A 4KU8A 1SQ4A 4MX3A 1NE6A 2PTMA 5FREA 5L7OB 2R1DA 3VKLA 1QWRA 2WFF3 4K6BA 4Y26A 4XQDA 1CAVA 4B4RA 4ZU5A 4QGLA 3SXWA 5D8AA 4W6XA 1ZZ7A 4QM9A 3VBUC 4JTOA 1X7NA 1A8MA 1ND3A 2Q30A 4JGZA 2YYOA 3IWZA 2AR6A 5GZFA 5BNOC 5KC6A 1VP6A 3ZFEB 5BY5A 3WG3A 3I54A 1C8M3 2EAAA 2RJLA 4AVBA 5FOJB 3PTYA 1HX6A 4ISQA 3MPBA 5EYYA 5BNPC 1NLRA 4HSJA 4DINB 4Q29A 3KMHA 1BZW