3WDYA

The complex structure of e113a with cellotetraose
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
296
structure length
296
Chain Sequence
YHLVDDYGRGNGFFDKFNFFTGDDPTHGYVDYVSRDVAAGAGLIGERDGRTYMGVDFTNPASGRGRRSVRLESKNTYEHGLIVIDLAHMPGSVCGTWPAFWTLGTGDWPYGGAIDIIEGVNDNTFNHMVLHTSDGCTIDNDGFTGNLKTSNCYVYAPGQDANAGCGIEATDPNSYGKGFNSIGGGIYATEITPNGISIWFFPRGSEPGDVLGDNPNPANWDTPAAKFAGGGCDWEGKFNAQRLIFDVTFCGDWAGNVWGIGGCASRAANCVDFVRDNPSAFAESYWLVNSLRVYAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-1,3-1,4-glucanase
publication title Structural and mutagenetic analyses of a 1,3-1,4-beta-glucanase from Paecilomyces thermophila
pubmed doi rcsb
source organism Paecilomyces
total genus 76
structure length 296
sequence length 296
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wdyA00
4W65A 3SLIA 4XBQA 1ENRA 4YW5A 5T54A 2OUHA 3DUIA 4AGVA 2AH2A 3ZYRA 4BLJA 2EAKA 2UWCA 1ONAA 4AWDA 5CB7A 1QKQA 2JDZA 2YV8A 3O5SA 3M3QA 1Q8PA 4ATEA 2D6LX 2AUYA 4C1XA 4F83A 2NN8A 1GBGA 3ZXLA 2FHRA 4XJWA 4BM8A 1AJOA 1S0IA 3SITA 3O0XA 2D3RA 5HCFA 1IS6A 1DHKB 3BOPA 4FP2A 2AYHA 1LOCA 2PELA 3WDVA 1RITA 2UU8A 4Y22B 1V6OA 1W6MB 1YIFA 3OYWB 5IK8A 1S0DA 2OUJA 4YGDA 2GNTA 4P14A 1YYNA 5KXCA 1UMZA 2OVUA 3GALA 4CRQA 3L2YA 1ENSA 2A71A 3PVEA 4Y22A 3AXEA 1W6MA 3OYWA 5GLWA 3CNAA 5EYYA 2PHXA 4PBPA 3KQRA 4D69A 2Z42A 2PHUA 1KITA 5IUQA 4M3CE 4K21A 1V6NA 3APBA 5H9PA 2SLIA 3AZYA 4AVTA 2ZGLA 3Q9OA 2GNBA 4PBOA 4XMAA 3B3QE 3WDUA 1UPSA 3AP7A 2UWBA 3C2UA 4BPZA 3OY8B 1IKQA 2E53A 1BXHA 2VUAA 3ZVXA 3PVNA 2TEPA 5T5LA 4OZXA 4Z8BA 4FOVA 1O4YA 3WHTA 1OKQA 3OY8A 2WSVA 1WLDA 2ZGTA 2ZZJA 3N7KA 5T5PA 1MACA 1GNHA 1LOGA 2A6VA 5L73A 4K1YA 3WLUA 1IKPA 1N3OA 1YI7A 1UZYA 4YM2A 1V6KA 1VALA 4TZDA 4HL0A 2P3IA 4YFZA 3WUCA 2WJSA 1LHUA 5T5JA 4AGGA 1MS9A 5GLZA 2ZGMA 1KQRA 2PHRA 1LHVA 4DRVA 3RRDA 1SCSA 2AREA 2UWAA 3ILFA 3MW2A 1QGLA 2VXRA 3BTAA 1DGLA 2D6MA 3LCPA 3O12A 5EXOA 4BQ1A 1FATA 5CBLA 3AFKA 3AK0A 3IN9A 5JMCA 2ZKNA 2Q5TA 4XIOA 1DLLA 4Y26A 5IK7A 4R9DA 4UW4A 2GMEA 1S0BA 5JOXA 2D6OX 1W6OB 3USUB 1CESA 1Q56A 1G9DA 3ZPYA 5H9SA 4C1WA 3W59A 1LGBA 1VLNA 3AJZA 2A3XA 5CNAA 2DURA 2YY1A 1BJQA 1SFYA 1W6OA 2ZAAA 1S0FA 4XDQA 4XMIA 4Y24A 3UL2A 3ZXEA 1AXKA 1JXNA 1KDMA 1OFSA 4YM1A 1FX5A 3SH5A 5E8AA 1SLIA 1PZ8A 3AYCA 3WCSA 1WLCA 3ZSKA 3AYAA 3TB0A 1LU1A 1RINA 3WG2A 3WVJA 1MR5A 1CJPA 2YMZA 3V0AB 4ZKTB 1IOAA 1LENA 2DUQA 2UURA 4YW1A 5AVAA 1LOAA 4ISRA 3HR9A 1C1FA 1ULCA 3A0NA 1CIWA 1EPWA 1CR7A 1YRZA 4XJZA 5FRAA 3V0AA 3OBTA 1APNA 1BZWA 4FPOB 3V64A 1VAVA 1BYHA 1GZCA 3POWA 1Z0HA 5EWSA 5EYXA 1S0JA 1SBEA 4XYXA 4YZ4A 5JDBA 1C1LA 3WZ1A 4WZFA 1LECA 4XTMA 1MZ5A 3AZWA 1SBDA 3ZYPA 1BKZA 3OJBA 4LBQD 1XQNA 5CA6A 1YXWA 5GLUA 1DBNA 4YZ3A 4DFSA 3NV4A 3AP5A 3NV3A 4YW4A 1MS3A 3PMEA 2AENA 4U36A 1JYCA 3O0WA 4GALA 4JRAA 1NXD1 3TAYA 2W39A 1MS4A 5F5QA 1V6MA 1N1YA 1SLBA 2ERFA 4FOYA 4Q1RA 3WDYA 4BMEA 1KRIA 3N7LA 1HDKA 4NOTA 3T2TA 1N1SA 1URXA 2NZ9A 1ULDA 1WLWA 1H9WA 3NWKA 4XBLA 4WV8A 1UX6A 4LBMA 5DG1A 5DUXA 1AX2A 1FV2A 1IS5A 3O0VA 4Y1XA 4PQ9A 1IS3A 1SBFA 1PZ9A 2KM2A 3NV1A 4JC1A 4Y1ZA 3VKMA 3I4IA 2DVAA 4XJUA 1W0OA 4YG3A 4Q8KA 1HQLA 5BYNA 3AP9A 5KXDA 4ITCA 1DZQA 3UJOA 2D6KA 5DUVA 1LESA 1LODA 4LBLA 1R1ZA 2GMMA 3ZXFA 1UAIA 3IMNA 1LEMA 4XIKA 1AF9A 1F9KA 3POYA 2D44A 5T52A 2AGSA 4GWMA 4XXAA 1GZ9A 1Y7BA 1N1TA 2RHPA 4FPHA 4H55A 4LBJA 4ZXKA 1ULFA 3UJQA 5GZGA 4NO4A 5HCAA 2R0HA 1FV3A 5KXEA 5GALA 3R05A 1LGCA 2PHWA 1A78A 1ULGA 2HYKA 3AXDA 1V6JA 2E7QA 4XJAA 4UW6A 1SLLA 5LK5A 3RG0A 3T1LA 4FOWA 3WG1A 1GKBA 3MW3A 3DGTA 5GZEA 3MW4A 2YROA 2D7FA 1G9BA 1QOSA 2DVGA 3QCWA 1TEIA 4LBOA 5FREA 5JOWA 1WW7A 1KDKA 2A75A 3M3EA 4TYSA 2A7AA 2A6XA 1LHOA 2W52A 2WNEA 3R4UA 2ZMLA 2I2SA 3ZXKA 5CAZA 2CL2A 2WSUA 4XHBA 1G9AA 3IKWA 3AJYA 1JN2P 2CTVA 2GMPA 1DQ2A 1G86A 3PVOA 1LOFC 3B69A 1DFQA 3M2MA 3D5OA 1JYIA 4LBQB 2ZMNA 3ILRA 1AZDA 3VKFC 2DWRA 3ZXJA 2ZGOA 5H9QA 2VW2A 3V65A 1Q8QA 4PF5A 3WDXA 1DYPA 3QLQA 2DTYA 1G8WA 3N7MA 4FQZA 1QOTA 2GNMA 4ISQA 4Q2FA 4XHXA 5DUUA 2XB6C 4GWNA 4LBQA 3AP6A 2DTWA 4YW2A 4WVVA 4FPKA 2A6YA 1MZ6A 4P9YA 4LBNA 2V5YA 2D6PA 3N3HA 5DZGA 4XOGA 2VW1A 4FPCA 1LOFA 1AXZA 1ULEA 4SLIA 5GJ6A 1GYKA 3GNEA 3RS6A 4CZSA 4HANA 3USUA 4Q1PA 4M3CF 1V6IA 1LCLA 3VKLA 3LSEA 1LU2A 4L8QA 1QDOA 1C4RA 4ATFA 4AGRA 2P3KA 3MEPA 5KXBA 1I1EA 2DUPA 5SV8A 2R0FA 1ZA4A 4K1ZA 5IK4A 2CWSA 2CWMA 1A8DA 1CVNA 4YFWA 2DVDA 2JECA 2ZMKA 4R9BA 2JKBA 1RIRA 2GDFA 2JE9A 4XE9A 2WT2A 3VUOA 2EIGA 2VU9A 2E7TA 1B09A 1MS8A 2ZHLA 1AVBA 2DVBA 1W6PB 4FPFA 3U4XA 1S1AA 1W6QB 1WBFA 1S0EA 2ENRA 4FQ4A 4YG0A 4YZ2A 2CNAA 2PHFA 4XJ9A 1S0GA 1LGNA 2ZGNA 1GV9A 4PCRA 1LOEA 2D3PA 1W6PA 4M00A 3ZSMA 2G4IA 1W6QA 4BLIA 3W58A 1F31A 3BIWE 1PZ7A 1UN1A 1QU0A 1QMJA 4JCKA 1JUIA 4R9AA 2CY6A 2GNDA 3AYEA 2JD4A 2JJ6A 5IK5A 1N3PA 5GM0A 1ENQA 2NYYA 3H0OA 1MS1A 3JUUA 3POSA 1QDCA 1DQ6A 1WW4A 2EXKA 4Y20A 2XG3A 2ZACA 1Q8OA 2ZBJA 3A4UA 2ES3A 1U0AA 4YW3A 1HKDA 4AVVA 1D0HA 1SACA 1DQ0A 3WG3A 3WV6A 1G9CA 4XXPA 4DPNA 2R16A 3FLRA 3I8TA 4FVVA 1SLTA 1WUVA 3AYDA 5GLTA 5GZFA 1FNYA 4GKYA 5DG2A 4FPLA 4MYEA 2VW0A 1X50A 3KM5A 1WW6A 2EF6A 1JOJA 4FOQA 3VV1A 4WVWA 5HCBA 4FPGA 1MVEA 3IPVB 2EXHA 1HQWA 1N47A 3ILNA 4XILA 5DZEA 1H30A 2JE7A 3ASIA 4BOWA 1HLCA 3WDTA 4FPJA 5GZDA 1O4ZA 3IPVA 4AVSA 3WNXA 1CPNA 2DUOA 1WW5A 3FLTA 3NV2A 4AYUA 2ARBA 2WT1A 1MS0A 2ZABA 1JW6A 1N1VA 4P9XA 4BMBA 4GKXA 5GLVA 2WLQA 5T50A 1I3HA 5E88A 3WCRA 2FMDA 3IM0A 1G7YA 3PJQA 2LALA 4LBKA 3FFZA 4P9WA 3D6EA 3LSDA 4UW3A 3SH3A 4CTEA 1DIWA 1AX1A 1JHNA 1Z78A 2A3YA 1J1TA 2P34A 1N3QA 5DUWA 1NLSA 4M3CB 4IQPA 4R9CA 5JVVA 2ZGPA 3ENRA 5E89A 1LHNA 2C9AA 2VH9A 2ARXA 4YM0A 2DV9A 1DYKA 4FPYA 4Q26A 5JLVA 2ZA9A 2BQPA 1F5FA 1GICA 2NM1A 3AZVA 3HMYA 5T55A 2V73A 4M3CA 5T5OA 4YZ5A 2EXJA 3N7JA 1FNZA 1DQ4A 3WG4A 4UW5A 1Q8VA 4DS0A 1CONA 2D6NA 1LEDA 1LJ7A 2LTNA 3AZXA 4XTPA 2A6WA 3RQ0A 2ZGRA 1WCSA 2YZ4A 4Q8LA 3HN1A 1VIWB 2A70A 1FAYA 4Y1VA 3OPZA 4I30A 3B00A 4RL7A 4XJ8A 5DZFA 1UKGA 2DYCA 3M3CA 1UL9A 2NP0A 4FP3A 2GN7A 4Y1UA 2R1BA 4YGCA 2PHTA 3UK9A 1S0CA 1KJRA 2R49A 3WOGA 3B9CA 1UZZA 3A0KA 2ZGSA 3FUOA 1GNZA 4YG6A 2E51A 1QNWA 2GN3A 1LHWA 3MPPG 4M01A 1AX0A 1VAMA 4GA9A 4DQAA 2EXIA 4Q27A 2D43A 1GZWB 1MVQA 1C57A 4FPEA 1V00A 1CQ9A 2R1DA 3RMXA 3M1HA 4YM3A 3SISA 4ASMB 2B7YA 1GZWA 1WD4A 4KBBA 3D4KA 4YGBA 1H9PA 1LOBA 2DU1A 2ZHNA 3FUQA 3OBRA 3ATGA 1G9FA 3AZZA 3RSJA 5JOZA 1WD3A 1LULA 1CPMA 1MS5A 1YO8A 3INAA 3R4SA 2A5ZA 2P3JA 3M3OA 4U2AA 3SH4A 3ZSJA 2CYFA 4RA0A 2DU0A 2ZGQA 1W6NB 1JBCA 1W0PA 2ZHMA 3N35A 2W08A 3ZSLA 4XZPA 2YXSA 1KJLA 1AXYA 3N36A 1FYUA 1W6NA 1Q8SA 3WUDA 1ZM1A 2WKKA 2P37A 1QOOA 1OQ1A 2P2KA 3WDWA 2DVFA 5IT6A 3WHUA 1SLAA 3VKOA 2C5DA 5JOYA 4YLZA 2W68A 2E6VA 1SLCA 3B01A 3OGGA 1QF3A 2A3WA 1CN1A 2NMOA 2WT0A 2ZHKA 2AR6A 4Y20B 1WBLA 2SBAA 2A6ZA 1GLHA 1D2SA 1LTEA 4XBNA 1V6LA 4K20A 3JU9A 1DQ5A 4Y1YA 3FBYA 1DQ1A 2OW4A 1GANA 3AX4A 2VY0A 3BODA 5F9TA 3V0BB 2EALA 4YGEA 4DRRA 1SCRA 2NMNA 4GXLA 3VKNA 3AP4A 1AJKA 1BQPA 2WQZC 3FLPA 4YZ1A 5GZCA 5H9RA 1IS4A 2D3SA 2H0BA 2ZGKA 1GSLA 3SNMA 2GALA 3V0BA 3T1MA 5DXDA 1QNYA 2ZGUA 1A3KA 3RMYA
chains in the Genus database with same CATH superfamily
4Q29A 4W65A 1Q5OA 3LEIA 1UQXA 1VBC3 2AH2A 4AFMA 2I07B 4K6BA 4BLJA 2EAKA 5K9YA 4IESA 4GH4C 5FZ4A 1UOJA 2XKPA 3FX3A 1W9SA 2JDZA 2J1UA 3B02A 4AVCA 5J48A 2BPA2 4YZ1A 3C7HA 4AHWA 1VBD3 2BRTA 4CCJA 4AEDB 2FDGA 2QE3A 3WQBA 2NN8A 5K0UA 3VBUC 2FHRA 3CO2A 2ZEWA 5JAXA 3SITA 3O0XA 2WFF1 5HCFA 4JTNA 4IEVA 4COWA 1FMD1 4D7YA 2RS13 2WZR3 5HI0A 1AR93 2Q1FA 4Y22B 4PQQA 1V6OA 1W6MB 1C5IA 3NVCA 5FZ9A 3UNPA 3FHAA 2FMYA 4BA6A 1UMZA 2H0VA 3OTFA 3CEWA 3L2YA 4QPGC 1ENSA 3QD6A 4UF0B 1K5MC 2X05A 3CNAA 1YI9A 5EYYA 1CAWA 5FPAA 2J1EA 4D69A 2B8MA 1XNKA 2J42A 1ND3A 1SDWA 3LD8A 1O8PA 4M3CE 3ZN6B 3PTRB 5JXGA 2EAAA 4RSUA 2ZGLA 5BNPA 3RJRA 4PBOA 4XMAA 2BV4A 2WWUA 3WDUA 3SXWA 1NQDA 1W3VA 2W5FA 3AP7A 3IAQA 3ZKYA 1XOYA 3HT2A 1OH4A 4B3NA 1X9TA 4LIUA 1RMU2 2F6BA 2XWJB 3B7MA 3WNPA 2PHLA 4JRLA 1O4YA 1YUDA 3WP3A 5FZEA 3OY8A 2IXKA 2ZGTA 3JB8A 2ZZJA 1VBA3 2VOWA 1H6XA 2Q8OA 1KGYA 1QXJA 2A6VA 2BYVE 3DKQA 5LBCA 2JG9A 3WLUA 4C90A 5C5UA 2Y8KA 3PJYA 1C8M1 4I0WB 2HWD1 3LF7A 3NNFA 5FP3A 2VZOA 4AGGA 1MS9A 2VZUA 3LFIA 4OUMA 5GLZA 3AB0A 4URTA 3DYPA 4OULA 5A3WA 3OB8A 4MLOA 4BQ1A 2VXRA 4I3PA 1DGLA 5EXOA 4XDPA 3HVDA 5CBLA 4IEUA 1EYBA 1POV3 2XJRA 3T3YA 2ZKNA 4COZA 4Y26A 1WMXA 3WR0A 4A41A 3Q8BA 2GMEA 4O7XA 1LKNA 1S0BA 4WBBA 2PLV3 3AMNA 4QX0A 1W6OB 3BPZA 3NAPB 1DGWA 1FPN2 4XFIA 3A22A 2CAVA 1IHMA 1MZEA 2R062 1XNAA 2ZOEB 3AM2A 3H50A 4ZS2A 3E5XA 4QPIB 4XMIA 3I49A 4Y24A 3ZXEA 4DXTA 1JXNA 1QJX2 2J22A 3OUHA 3UYJA 3ZFEC 1GOFA 4RR3C 4E9KA 1DZTA 2ET1A 3AYCA 4JGYB 3U1XA 3F95A 3VDCA 3WCSA 3ZSKA 4N53B 2MHFA 1ENXA 1LU1A 1NCRC 3WG2A 1K12A 3WVJA 4WVZA 5A3PA 3W9AA 3TBDA 1IOAA 2VCAA 2UURA 1U12A 2F4LA 4JDMA 4A7YA 4CE8A 5AVAA 1LOAA 4ISRA 3HR9A 2VR4A 1HB2A 3A0NA 3L9JT 3VDDB 1CR7A 1QJU2 3V0AA 1ND2C 3MIGA 3VZNA 1BZWA 1CX1A 2PAEA 2FCUA 1RTVA 2QQMA 2YC2A 3POWA 4CEYA 1BEV1 4A2UA 4LXLA 1ZZ6A 3LA3A 3IDBB 1C1LA 4XYXA 3WZ1A 1W28A 4K9SA 1JUHA 3AZWA 3GZTB 2XL7A 4QKBA 5FZFA 3ZYPA 4BHPA 1ZBA1 2OT7A 1PM4A 4YZ3A 2F4PA 3JQWA 1VBB2 3NNMA 4CDXA 1XBFA 2LRPA 2Y6HA 3OEBA 1YQ8A 4NE9A 3AP5A 4QQHA 2WNOA 4OZOA 4KQ7A 1MS3A 3PMEA 2JIJA 2JG8B 3WNKA 1JYCA 4AEDC 3C7FA 5K4LA 3C3VA 3SEPA 4HT1T 4LHKA 1MS4A 3MF6A 2XHNA 3EXUA 1V6MA 1O6UA 3DYOA 4HBNA 3JBG1 3N9LA 1W2TA 1HX6A 2BNNA 2Y26A 3N7LA 4CP0A 4E4DX 5IVVA 2V72A 5L7OA 3LAGA 4NHYA 1UZ0A 2DDUA 1UW8A 4XBLA 4P9GA 4LBMA 4FXGB 3LA7A 4Y1XA 3MLJA 4YVWA 2BVVA 1RUC2 1QHDA 1RUG1 1ZRFA 4NIAA 2P17A 1BMV1 1E5IA 4DNYA 4L92A 2VCBA 5CFCC 4AQTA 1HIXA 1K42A 1HQLA 1W90A 2YYOA 4M0HA 5FBJA 2D6KA 4LO4B 3S57A 1VMJA 1FXZA 3K51A 1VRH3 1EAH3 4LBLA 3MDPA 2VECA 1LEMA 4Y5TA 3SCGA 5F39A 4GIQA 4QQPA 1ULFA 4GB32 1ACCA 1HXS2 2VNVA 3HD8B 2ZEYA 1EV13 4KWKA 4TSVA 3UJQA 5AC93 5KXEA 4CCLA 2YHJA 3E97A 1CAVA 3R05A 2IFWA 2WBKA 4MOAA 5C70A 3KSCA 1H8TB 1B35A 1ULGA 2WUHA 2QCSB 4S2FA 1OUXA 4JKKA 4XJAA 3BUCA 4OLLA 3WT3A 4FOWA 3MLLA 5J7MA 3AVRA 4E4HA 1ZBE3 3MW3A 3DGTA 4LKEA 5A33A 3MW4A 4K3UA 1HXS1 1UCXA 2CU5A 5FYIA 2B39A 2FCTA 4HKWA 1LHOA 1OA3A 2W52A 1XXNA 2YPDA 5ABJB 2CL2A 1G9AA 4HXCA 1JN2P 1H1AA 1Y43B 2WFPA 1G86A 5F3GA 3JZVA 1H4HA 1LOFC 3B69A 2XVLA 4GWIA 1AZDA 2DWRA 3M4FA 5H9QA 2VW2A 2RR13 2ZX2A 3NAPC 1TNRA 4RHV1 3FWEA 3IAPA 3POBA 3QACA 1DYPA 4ISQA 4V1PA 1ZX5A 4FQZA 4Q2FA 4PDWA 3KV4A 2QUOA 1TG7A 4YW2A 3CIHA 4WVVA 5FY4A 3UKNA 1MZ6A 4P9YA 3I2OA 3U07A 4LORA 3N3HA 4Q4X2 4XOGA 3ROUA 4A4AA 4QHZA 2PYTA 2IVJA 4MHRA 2JICA 4A6OA 1GYKA 3GNEA 4B7KA 3USUA 4AF9A 4Q1PA 3S5AA 1JU3A 3WY6A 2C24A 4N53C 1LCLA 2RM21 5JZGA 3UGFA 1LU2A 3IIAA 3T4VA 3TEXA 2VZVA 3J7NA 5F5AA 2YG0A 2HWC2 4UT5A 4CCCA 1TME3 1RUI1 5JPNB 4HOOA 5KXBA 1CAUA 2DUPA 3FN9A 2BGCA 4K1ZA 3VDDC 3WXPA 5IK4A 1CVNA 3TN93 2JKBA 3H3LA 3D0SA 1OBNA 5A7QA 4DMIA 2JIGA 2WNUA 2E7TA 1MS8A 3CDZB 3Q8FA 1PO23 2KR2A 4AI8A 1PVC1 2HWC1 3C8XA 3N9QA 4B29A 3LPGA 5T3NA 1JI6A 5C5TA 4OQ8A 2DVBA 4FPFA 1R64A 1S1AA 1WBFA 1S0EA 2K0GA 1PIV1 4P5YA 3K4DA 4B4QA 1SHWB 4F7ZA 3H7JA 3VL9A 1RUF2 3ZKUA 1H2LA 1HW5A 1S0GA 2JKXA 4NAMA 4PCRA 3UESA 4QX5A 2JG8C 3W20A 1A8MA 1LOEA 1WMFA 3SHRA 1W6QA 4PI0A 5ACA2 3WQ0A 3BIWE 4S2HA 2WNVA 4IETA 4JKLA 5IK5A 5F2SA 1W8NA 5GM0A 1ENQA 2RJKA 3H0OA 2W46A 3POSA 4XFAA 4BQWA 5BNNA 4Y20A 3R6SA 2ZACA 3ABZA 5D21A 4QX1A 2ES3A 4YW3A 1XU2A 5EQUA 1ASJ3 3WW3A 3WG3A 5ACA1 3EHKA 4FVVA 5JUVA 5I0UA 1IGOA 2MEV2 4HPKB 5GLTA 4DZGA 1AYM3 4R4XA 2FBEA 5M0TA 2PN5A 2VW0A 4IEOA 3BOWA 2XBO2 4RFT0 1UO9A 3OEAA 3ZPOA 1JOJA 4FOQA 4J1XA 4FXKB 4WVWA 4XCBA 5HCBA 4INDA 2C6SA 4FPGA 2HWB3 2CDOA 2ADEA 3ACFA 1PK6B 4IUGA 5FYMA 1COV1 3KV6A 3T09A 4L99A 1VBC2 5C8CC 3ILNA 3FMGA 4R8HA 4UI9L 1H30A 3GYDA 1WCQA 4BOWA 5KHKA 3DF0A 2VNOA 1GNYA 3ACGA 5GZDA 1O4ZA 1VBD2 2XONA 3FE5A 3FLTA 3GJBA 3WNXA 4AYUA 4XFCA 4YRDA 2ARBA 4JTOA 4D6RA 1O8SA 1JW6A 4NHLA 4P08A 4Q5OA 5FKCA 4AHZA 5GLVA 1YC61 2WZPP 3WF3A 3KF3A 5E88A 2RS12 2WZR2 2RJ2A 3IM0A 4JQTA 3PJQA 3SH3A 3D6EA 3LSDA 4CTEA 5L9RA 2BEOA 4EWAA 1OOPA 4KI5M 2YU2A 2VPVA 4OHWA 1O3SA 5DUWA 1PMJX 3VBRA 4M3CB 5FYTA 4RN5A 1LHNA 2KA3A 3MO4A 1NG0A 1WZXA 3CZUA 4JAAA 2DV9A 1TVGA 1DYKA 4UOJA 2XXZA 2PMWB 4FPYA 4Q26A 2VL4A 5ABJC 4XFHA 4Q0UA 5IHRA 3AZVA 5T55A 5T5OA 5CYYA 3N7JA 4CU8A 1DQ4A 5FAXA 1Q8VA 2D6NA 3AZXA 4MXWA 5FLJA 1NYWA 5FZAA 5C3RA 2NLRA 1R091 2VAUA 1YQ6A 2Y0IA 1C8M3 2ZGRA 3S30A 2A70A 2HWD3 3UKVA 4LEJA 1ZRIA 5BPXA 5DZFA 3AMPA 3ZYHA 1UY0A 1PGW1 3RZJA 3WP6A 3KZ4C 4RQPA 3NJZA 3VD5A 3NW4A 3T2OA 4BQ3A 4CDUB 2IXLA 3OF1A 2BVBA 2IVIB 4AQ2A 1CWPA 1RL3A 4CU9A 2QQUA 3OPTA 4YG6A 2E51A 1QNWA 1J58A 2EIDA 3LA2A 4M01A 3UETA 2Y33A 4DQAA 2WS93 3TEWA 1FI2A 2RS53 2WQ8A 1W9TA 2D43A 1BVVA 1C57A 3UV9A 5KWRA 4FPEA 5FYSA 3T30A 2QNKA 5FK8A 3GCXA 2C1FA 1OSGA 3M1HA 3PU3A 4W6YA 2XR4A 4JGZB 4BIFA 1H9PA 1XB9A 4RS5A 5DAWA 4AE2A 5FUPA 5K7PA 3CJXA 3TEZA 5BXXA 3I2GA 4Q4W3 3T08A 3LPFA 3RSJA 2VQ0A 5JOZA 3VD7A 3RPQA 5JWPA 2UYBA 1W2UA 3INAA 5FR3A 1LAJA 3GBWA 2A5ZA 4ZU7A 5LW9A 1XPWA 2DCKA 5DAVA 1OH3A 3M3OA 4KH9A 4Q0VA 4I0BA 3ST7A 3ZSJA 3U78A 1D4M3 2CYFA 1UMHA 2VCCA 4RA0A 3ZFGA 3B94A 2AC1A 1W6NB 1JBCA 1W0PA 3N35A 1VAKA 4XZPA 1GMMA 2YXSA 3WQ1A 1KJLA 2W47A 4ZU5A 4CCEA 1AXYA 3FFQA 3I97A 4OHVA 4W50A 4CYDA 2BOIA 4MGZE 4IEXA 1BEV3 1X8EA 1RJ7A 4B7EA 4CCNA 3VKOA 2C5DA 5FPVA 3VBHA 2EA7A 4YVSA 4WVMA 2NMOA 2HWE1 3NJXA 1ZBA3 2VTXJ 5FPXA 1PX4A 1WBLA 4NIDA 1GLHA 1D2SA 3ES4A 3GHMA 2BGOA 3AKPA 3FL7A 3J7MA 3J8F3 4AW7A 1V6LA 5FKBA 1GP4A 3MF9A 1FOD2 3BVCA 4KNCA 4CU7A 1AR72 1TQ5A 3JU9A 4LUMA 4Z92B 1YQ5A 3FBYA 3R4DB 1DQ1A 1OLME 2HWF1 3AX4A 3I3DA 4IV3B 3H8UA 1UU4A 1OLMA 4CEWA 4W6XA 2NMNA 3W5MA 4CPBD 2VUJA 1YIPA 1AJKA 1RC6A 3AP4A 3JBG3 4QB6A 1R081 2BW8A 1IS4A 1GFF2 1PK6C 2D3SA 4MGKE 5H9RA 5C4WA 1GSLA 3JCIA 5GKAC 3BI3A 1XSRA 3V0BA 4LITA 4BQXA 1QNYA 1AL23 2Y6LA 3SLIA 4MADA 3WX5A 3K4AA 5FV3A 1E5HA 3HAGA 1YQCA 4AGVA 5I0TA 3OD4A 3MV01 2UWCA 1ONAA 1RUG3 1W8UA 1XE0A 3MYXA 4PF1A 5CB7A 4IEQA 2YV8A 4KU7A 3KMHA 1Q8PA 3CF6E 4TXWA 4F83A 5JMOA 4WM8A 2JWPA 4XCAA 1GBGA 3ZXLA 1AJOA 1S0IA 4LK6A 2CSGA 4GH4B 5CFDB 4QT6A 4D8MA 1IS6A 1WLTA 1DHKB 1JH5A 4FP2A 4I3GA 4ARYA 2QDRA 2PA7A 2UU8A 3OYWB 2VUDA 2O8OA 1RUJ1 1ALYA 1VJ2A 3A23A 4LNVA 4ARXA 2VXJA 3AMHA 5KXCA 2OVUA 1ZA7A 4MZUA 3PVEA 2ID4A 1QH7A 4X6RB 1YJLA 4E2QA 1O3RA 3VBSB 2PHXA 2EVXA 1VE0A 2Z42A 3UT0A 1OKOA 3DKWA 4W4ZA 3P3PA 3ZLIA 1V6NA 1VRH2 4EV0A 2VOKA 2R073 5A7WB 5F7UA 1BCXA 3AZYA 1L3JA 3CLPA 5FYBA 5FZCA 1ZZ9A 3T0AA 4ASLA 2BDRA 4CXYA 2E7AA 1CGPA 1UPSA 3KCYA 4HVOA 2UWBA 4IDZA 5FZ7A 4NIHA 4DEVA 3NKGA 4N43A 2E53A 4CDUC 5I0SA 5AC92 4N9HA 4PI2A 4E27A 3S7EA 5J36A 2B45X 1RUE3 4OZXA 4FOVA 4AZZA 1GQHA 4CA9A 2WA3A 2W95A 1W2NA 1AR62 2IXHA 2WSVA 5DDJ1 1MACA 1GNHA 3UGGA 3KLSA 1LOGA 1UU6A 3OGRA 5L73A 5B4NA 3VD9A 4K1YA 1IKPA 1N3OA 1YI7A 4V2VA 1CAXA 3OPWA 1V6KA 5HV4A 4JGZC 4HL0A 3SKVA 3E6BA 5FP8A 1RUH1 1BLZA 2RMU3 1NA1A 3M7AA 1C3HA 5FZKA 1RUOA 2ZGMA 4OVEA 4TLFA 2E26A 4FI9A 4DRVA 4EJRA 4HZFA 2JDMA 1SCSA 4GULA 2WZEA 3S0MA 2AREA 2UWAA 2C4XA 3BPSA 3ILFA 3LCPA 1TE1B 1C8NA 2ZS6B 3ETQA 3O12A 3PDQA 3ZR5A 1FATA 3NJVA 3AK0A 5DAXA 1H4GA 3D82A 3IN9A 4CP9A 5JMCA 2Q5TA 1DLLA 1W9WA 1HJFA 4KWUA 5IK7A 2RM23 1AR83 4MGTA 5DAPA 1QQP1 4FO9A 1ZZCA 2D6OX 4CPBA 5JOXA 3E6CC 4LKFA 1RHI2 2I74A 2IXCA 5FY9A 5FYVA 3IZOA 3USUB 3JD71 4QM8A 3VBFA 4C1WA 3CJIA 1LGBA 2IUWA 3AJZA 5FZGA 1BBT3 4QDRA 2YY1A 5CNAA 2HEVF 3IB3A 2JEMA 4CDWB 1O5UA 3UKTA 1R1A2 1S0FA 4HONA 1RVF2 1AXKA 1T6BX 1S2BA 5A7PA 4EZHA 3TNPB 3BB6A 4HVRA 1GP6A 1XE8A 4YW6A 2R041 1JYTA 3AYAA 5BY5A 1RYYA 1TME2 1ZREA 1PIV3 5G05L 2H6CA 2WWJA 4NMIA 1GZTA 1C28A 2C9KA 4QGNA 4XFBA 4ZY9A 1LENA 1YWKA 1R1A1 3POFA 3PUSA 4IGPA 4Y3OA 3ES1A 2ZX3A 5BNOA 4EROA 1D4VB 4NHKA 1NCRB 3BTYA 4IV3C 3PNAA 1EPWA 3PIGA 4JVAA 1F5JA 5FRAA 1NY72 4WM7A 4EN9B 1APNA 4FPOB 3V64A 1VAVA 1BYHA 1GZCA 5EWSA 4XUNA 2EICA 5EYXA 1S0JA 1X8MA 5FZ8A 5CISA 2W1WA 5JDBA 3PLQA 3HIFA 1QJY1 4WZFA 5IVBA 3H1MA 5ANQA 1V9U3 1SBDA 2XJUA 1RUD2 1BKZA 4IEYA 3GHNA 5CA6A 3MZHA 1YXWA 1OUSA 3NNGA 4PIXA 2Q30A 5GLUA 2QQVA 1NY71 3I2JA 2X5IA 3NV3A 4KGQA 4YW4A 1VRBA 2D97A 4LT5A 5IVFA 2MNGA 4U36A 3O0WA 4GALA 3ZFFB 3TAYA 4A3XA 2FDIA 1NCQA 2XJVA 4META 4CDQB 1RUD1 2OQ6A 5CFDC 4F8AA 3LB9A 4AHYA 5JXIA 4NOTA 3CHXA 1D7PM 4BQYA 4CVUA 1ODMA 1VBE3 1W39A 1WLWA 1H9WA 3MFCA 2X8KA 3EMRA 1AYM2 1L7LA 4DUWA 1UX6A 1IS5A 3O0VA 1TZOA 2ADDA 1EY2A 4PQ9A 1IS3A 1SBFA 1X33A 2KM2A 4NHMA 5FO8B 1OMIA 3VBSC 5LA9A 4YWAA 4CU6A 1JU4A 2A1XA 2G9ZA 3HBZA 5LEJA 2HWB2 4COUA 1W04A 4QDQA 1KFUL 3OGVA 5BYNA 1GR3A 5KXDA 3ZSEA 1DZQA 3UJOA 1B35C 5FXZA 5DUVA 1LESA 1DU3D 1LODA 4DUXA 2ILMA 4IERA 1R1ZA 3ZYIB 1W8OA 2JDUA 5CFCB 3IMNA 3ETPA 4XIKA 3QOPA 3K46A 2AGSA 3OUIA 4GWMA 4HSLA 4OUSA 4XXAA 5F3IA 4ZXKA 4FPHA 2OPKA 3EQEA 4DINB 3DXUA 1KS4A 4QXHA 4JX0A 3PU8A 5JSPA 2XMLA 5LBBA 1H6YA 1V6JA 1R093 4DOUA 5IATA 4CCMA 2WL1A 4DXZA 3W5NA 4ZXEA 3RYKA 1BVP1 1GKBA 3DXTA 3RZGA 2W94A 5APAA 1G9BA 2D7FA 4A7ZA 1QOSA 5FREA 1TEIA 1WGPA 4MXVA 3O1UA 3I2DA 1RMU1 2ZXQA 5FZMA 4XFFA 2VMIA 2A6XA 1GWLA 2WNEA 1HRV3 2E32A 2VE1A 4XF3A 1JODA 2BBAA 5EZWA 3VDAA 2CTVA 1OXCA 5IWFA 3X29B 5IAXA 2WABA 3PVOA 4P9LA 3LEGA 3M2MA 2GP3A 1T6GC 1DP0A 2ZMNA 3ILRA 4LBQB 2ZGOA 2PFWA 1S55A 3V65A 4QB1A 4PF5A 5FUNA 4B4RA 5FY8A 3T0DA 1J3QA 3KS7A 2RG4A 2GNMA 4GMP3 4XHXA 3MV11 2VQUA 4UFHA 4C0BA 1HRI2 1HN0A 1UY3A 2A6YA 2BFUS 3HPNA 4P9IA 4CDWC 2V4VA 4XVHA 2D6PA 5DZGA 2KXLA 4QMAA 2P4EA 2YFUA 4PJYA 3VZJA 4FPCA 2VMCA 1AXZA 1ULEA 2RS52 3OD0A 4NRPA 3VGIA 2WYSA 2W92A 5F8PA 3OCPA 1MEC2 3MICA 4HANA 4CUGA 3USSA 2WQ4A 5ANNA 5FPZA 2QJVA 3VKLA 1SPPA 4B4PA 1HRI1 5FYZA 3H8XA 1FPN1 1OF4A 3CL1A 5IVEA 4ATFA 4CXXA 5LY2A 4Q4W2 2UY9A 3CZJA 1I1EA 1KD7A 1YCIA 1F4HA 2R061 5SV8A 1ZA4A 2TBVA 1MEC1 2LROA 3H1WA 2AACA 2VD7A 3DCQA 3IT8A 3MLKA 4AVBA 1QJX1 1D4M2 2EIEA 2WT2A 1YLLA 2EIGA 5A3MA 4R4ZA 1W9YA 2Q1MA 2ZHLA 1QJFA 5JIAA 5F3EA 4XUOA 4NIGA 1AVBA 5I8YA 2ETEA 1US2A 3WF1A 1W6PB 3AKRA 3U4XA 2ENRA 4NWWA 1OQDA 4FQ4A 5IYYA 2XWBB 4DB5A 2XDVA 3WW4A 1LGNA 5C9AB 1GOGA 1NUKA 2W9XA 2ZGNA 3M70A 2HWF3 2D3PA 3QBQA 3ZSMA 4E8CA 3ZFFC 1QJU1 2ORZA 5EIYB 1OT5A 2FD8A 1PZ7A 4CDQC 1IQDC 2PAMA 4UAPA 2CAUA 1X82A 2JX9A 1K3IA 1R083 2V5DA 1S2KA 1N3PA 4IV1A 4TLGA 2NYYA 4BB3A 5F1RA 3JUUA 5AFBA 1QDCA 5D2AA 5FZ6A 4M0NA 3I2IA 1U0AA 2DBIA 1ZYBA 5FMDA 1MQTA 4AVVA 1G9CA 5CKMA 1VBB1 4PHZA 4DPNA 3GZEA 4QGLA 3FLRA 5GZFA 3AYDA 2VCMA 5IVCA 1FNYA 2K9ZA 4BQ4A 5A1FA 2WINB 3V56A 4OUEA 1GUIA 3VV1A 3N9NA 2RS32 3N9PA 3IPVB 1F8VA 5FP9A 1RUJ3 5LWBA 1SG3A 3TEYA 1OOPC 2ZX0A 3ASIA 3IDCB 5FQ0A 3WF2A 4Q4Y2 4DXRA 4BIOA 4AVSA 3NV2A 2DUOA 3VBRC 5C8CB 1RUC1 2WT1A 1MS0A 2ZABA 4P9XA 4QXBA 4XC9A 5JR2A 4LA3A 4BYYA 1AYN2 5AFEA 1YFUA 2FMDA 3ELNA 5FIXA 3O1OA 3O1MA 4LBKA 4LHLA 4P9WA 5F5IA 4LTAA 1DIWA 2WWSA 1AX1A 1JHNA 1Z78A 2BOJA 3DPRB 1J1TA 3GBGA 2P34A 3KT4A 4Q4Y1 5G04L 3W21A 4D6SA 1M06G 4QM9A 1H1IA 2XVKA 3VBUA 4R9CA 4N7UA 4QU1A 2C9AA 1EUUA 3ZYGA 4JKMA 2ARXA 4HETA 3C7GA 4YM0A 4O61A 2FZ1A 2LUWA 2YFZA 3A7QA 4GB31 4QPYA 1XC6A 1Z7S2 2Y0OA 4RQPC 3LQCA 5JLVA 1O3QA 2W0XA 1RUNA 2XUEA 2MPFA 2PTMA 2WR9A 1YEWA 2Q0AA 1FNZA 1OURA 3WG4A 2GC0A 5FY1A 4DEQA 3BU0A 1TMF3 1LJ7A 3ZO0B 2QQPA 3AFGA 3AC0A 3AMMA 5FZOB 4XTPA 3VBOB 2O8QA 2A6WA 4QPGA 2JXAA 2D93A 2J1RA 3U75A 1K5MA 4Q8LA 1VIWB 1PNFA 3OPZA 4XJ8A 4RL7A 1RUE2 3M3CA 1UL9A 1Z7S1 4Q0PA 4FP3A 5LB6A 2NP0A 2GN7A 4JDNA 4Y1UA 1Q43A 3I59A 3OUJA 1GWKA 4GWJA 1IPKA 5FZHA 1OHFA 3A0KA 1VR3A 3N9OA 2ZGSA 1GNZA 4Z07A 2GN3A 2W3JA 1LHWA 5FDBA 4XW3A 1XSQA 2L9LA 4XUPA 2VOXA 3HNBM 3Q8EA 4GA9A 1QQP3 5E16A 2EXIA 1BHGA 4Q27A 1GZWB 5EP9A 3WF0A 3LOBA 1I5PA 2RMU2 1V00A 2R1DA 3RYRA 4PIZA 1POV0 1QWRA 4YM3A 3NMBA 4LOSA 2JDYA 2XUMA 1GP5A 3MHZA 4GMP0 2B46X 4NJ4A 1JZ7A 4RFRB 3D4KA 4YGBA 3O14A 1LOBA 5CEHA 5KHIA 3OBRA 1G9FA 4X8NA 3JB4C 4PLOA 4Q4X1 3T4HB 5FO9B 4AVAA 1CIYA 1JZ8A 1VP6A 3VN4A 2JD9A 1CPMA 4LKDA 3ZMNA 3HN3A 1NZIA 3R4SA 4S2GA 5FY5A 2R043 1XYPA 2IXJA 4RD7A 2P3YA 2CGPA 3WQ7A 5LBEA 2QTWB 2DU0A 1HB3A 2ZGQA 1GQPA 1US3A 2B42B 3K48A 1BBT2 1J83A 2W08A 3HQUA 1OD3A 4HLTA 2VZSA 4NIIA 5F3CA 1PO13 4HK9A 5C9AC 2XJPA 4E8DA 1QXPA 3K2OA 5A32B 4MGYE 2OZJA 4Y5SA 2GSYA 3J26N 1ZM1A 5FZLA 1NKGA 1QOOA 2VQAA 4H7LA 2P2KA 3NO8A 1UY2A 5A3LA 3C7EA 2DVFA 5BNOB 4KMQA 5FUIA 4AEMA 5IT6A 3VZMA 5LRSA 1SLAA 3FHQA 5JOYA 2VMGA 4WZCA 2QQJA 1YNAA 2W68A 4Q4V2 4QAWA 4ZS3A 3TOJA 2A3WA 2LW8A 2WT0A 5EJ3A 1EP0A 2BP6A 2XL9A 4G9SB 3VB9A 1WKYA 2SBAA 4K8RB 1NE4A 3H1YA 1WMDA 4JQRA 5C4WC 4XBNA 5C8WA 3ZFEA 4RR3A 2LM3A 1QIQA 1RUF1 1OI6A 4QB2A 4BWOA 4K20A 4KWJA 4Y1YA 4NPLA 1GANA 4Q4V1 1ULPA 5FY7A 1J59A 2QVSB 2EALA 4CUAA 4YGEA 4DRRA 1PGL2 5GZCA 3VKNA 1V9U2 3FLPA 1DYOA 4EWDA 2H0BA 2ZGKA 4AG4A 2XJQA 2VVDA 3OGJA 1ND2A 3URFA 1W05A 2WFF3 3KV5A 4NPMA 5DXDA 1A3KA 4XUTA 1FMD3 2OUHA 5K0UB 2MEV1 4LLOA 2OX0A 4AWDA 4D94A 3BN6A 1UXXX 1PGL1 1VMFA 4Z82A 2YC4A 1XYNA 3O5SA 1XJAA 2XBO1 2AUYA 5F37A 4QX3A 1W2OA 4QHBA 4BM8A 3PUHA 1UPIA 3AKQA 2D3RA 3DPRC 2BWAA 3ZXGA 2RV9A 1LOCA 2PELA 3P3NA 3WDVA 4AEDA 1VBC1 1PMHX 1YIFA 2YUEA 1AR92 3EO6A 5FBZA 1S0DA 5IK8A 2XLGA 1CAWB 4YGDA 4N9IA 2GNTA 5I93A 4P14A 3O1TA 1YYNA 5A6XA 1ND3B 1QH6A 3GALA 5FLIA 1UOGA 1VBD1 4CRQA 1Q3EA 3SMHA 1CZTA 4Y22A 5CG8A 2Z69A 1W6MA 2QQIA 2OQ7A 3OGSA 5I8SA 1JMUB 5BNPB 4IW3A 3U0ZA 5DAQA 5AVPA 4BXSV 1KITA 5A80A 1RGSA 1J1LA 4K21A 3VBOC 2XLAA 2RS11 2WZR1 5H9PA 1OD5A 4PLMA 4UF0A 1OVSA 2GNBA 2F17A 3B3QE 3ME2A 3ZN6A 3C2UA 1E5RA 3P6BA 1RMU3 3OY8B 1UOFA 2J1AA 4A6SA 1NAEA 3ZVXA 1F15A 1C5HA 1W8FA 3BYWA 5HXMA 4QX7A 4D6QA 3LEMA 3WHTA 2JG9B 1BK1A 4LPLA 5FLHA 2VGDA 1OF3A 2GAUA 2XJTA 4QKDA 3I3MA 5T5PA 2P5BA 5FXWA 1VBA2 3G6JB 2ARCA 3P1IA 1H0BA 4XF1A 3AKSA 5CU1A 2JDHA 5FZIA 1W99A 2P3IA 3I2HA 1HRV2 5LATA 5A6QA 4IEWA 1KQRA 2PHRA 4LMFA 4A42A 3CJIC 2HBUA 3Q8AA 1QGLA 2JB8A 3BTAA 1SMVA 4N7IA 4S2DA 2XQXA 2ZJCA 3AFKA 3MIDA 1HV1A 5A3UA 5A7SA 3KB5A 4XIOA 2CHHA 4COYA 3VHPA 3M3IA 1VB2A 5A6YA 2PLV2 4MGIE 2Q8CA 1CESA 1Q56A 3OBAA 5H9SA 4R52A 3ZPYA 2R063 1VLNA 4OMDA 3THCA 2A3XA 2WDBA 2DF7A 2DURA 1BJQA 3ACLA 3HEIA 1W6OA 1KXGA 4LO7A 4O65A 3WF4A 5CZKA 4XDQA 5BNOC 3VZOA 1H2NA 3SH5A 4YM1A 1FX5A 5E8AA 3AKTA 4BDVB 2EIBA 2Y38A 1SLIA 4Z2AA 1KS5A 1PZ8A 4QPWA 1S4CA 4M4RA 4QPIA 1WWYA 1WLCA 3TB0A 1RINA 4HG6B 3LWCA 1MR5A 4QGMA 1UZVA 2C0ZA 2OZ6A 5EFUA 3V0AB 3KQ4B 4JGYA 4LUKA 1JOPA 3WEZA 4N53A 3U11A 5LA0A 4CEYB 1W8ZA 3LZZA 4ONUA 3KT7A 3LIHA 5C3SA 1QJU3 4FT8A 4EQVA 1YRZA 2GH2A 2RJLA 4XJZA 5I8TA 3OBTA 3LDRA 2PHDA 2R30A 1OC1A 5IW0A 1L7QA 3J4UH 1SBEA 4CDXB 1SEFA 2HLEA 3VDDA 4QX8A 4YZ4A 4ZU4A 2YPJA 5LA1A 1LECA 4MVTA 4XTMA 1MZ5A 1YFXA 1VBB3 3NJYA 1DBNA 4FCAA 4DFSA 4C0HA 5K0UC 2Y64A 3NV4A 3ON7A 4D7SA 1KFXL 1FOD1 3K77A 5DABA 5LK7B 1AR71 2WO1A 4CXWA 4YARA 3B93A 4AFCA 2Q4SA 1L7RA 5L7OB 5F5QA 3GZAA 3KV9A 3TRSB 3ZN4A 4IEPA 4Q1RA 1KRIA 4BMEA 2JG8A 5FMBA 3LIGA 3T2TA 1H8VA 1OFNA 4YVWB 1MZFA 2DFBA 1ULDA 4NRMA 1O5LA 3NWKA 2XKOA 4YPJA 2E31A 1ND3C 4NR1A 5FYUA 1AX2A 1FV2A 2Y34A 4IE7A 2YC0A 2VO5A 4DIQA 4JC1A 4Y1ZA 3TNQA 5BNPC 2Q1ZB 3I4IA 4HKOA 3SCHA 2VZRA 1PNGA 3LGRA 5JXHA 3D8CA 5C3QA 5FZ3A 1W0OA 3NSTA 4YG3A 4COVA 4DY5A 1DGWX 3AP9A 3S7IA 4Z1VA 1OLRA 4XURA 3GXUA 3IWZA 1OVPA 4J1WA 3K3OA 2GMMA 1EAH2 3ZXFA 1UAIA 1AF9A 5JXJA 2D44A 4OI1A 1TNFA 4JHTA 1CAVB 3H8OA 1GZ9A 2HKXA 1PX3A 2RHPA 1B35B 1HXS3 1I6XA 2JG9C 5B2GB 2QDNA 5GZGA 1V70A 2G9GA 2VZQA 4NO4A 4OMCA 2HH9A 1J84A 5FCCA 1EV12 3FHIB 1UY4A 5A33B 3VZKA 3WNOA 1A78A 3J9SA 3AXDA 1VRH1 1SLLA 2QKDA 3FJSA 4H14A 1F2NA 3WG1A 1YFWA 3CKHA 5J37A 1K5JA 5F6KA 2XVGA 3CMGA 5GZEA 5L36A 1ZBE2 2YROA 4OCTA 1H8TA 2DVGA 3QCWA 4LBOA 4LOTA 4QU2A 3H8RA 4RHV3 1KDKA 2A75A 2BERA 5J96B 5AC91 2XH6A 2A7AA 4EWEA 1OQEA 1IZ3A 3I7DA 4UBHA 3ZXKA 4E2SA 5CAZA 2WO3A 1TMF2 1F4AA 2Y6GA 3IKWA 1AR61 3I59B 2VMFA 2GMPA 1HB1A 1DQ2A 2E63A 2OYZA 4PDWB 1DFQA 3LDKA 1JYIA 1ZRCA 5ABJA 1U5YA 3BU7A 1QY4A 1O4TA 1Q8QA 4OHYA 2RR12 3WDXA 1I9RA 1W0NA 1G8WA 2DTYA 2R6QA 3QLQA 1XNBA 5FTTC 4OQ9A 2XB6C 3MIHA 3AP6A 2Y6JA 3WNLA 2DCYA 4LBNA 4LJHA 2WN2A 1W9FA 1RUI3 4MH0E 5L9VA 4AHXA 4UFMA 5JZGB 4IGQA 1CX4A 5CVRA 1WCDJ 4NPRA 3TYJA 2GP5A 1WCUA 3PIJA 4GAZA 4M3CF 2TUNA 4FAGA 2ZX4A 2CGOA 4J6GA 5FJHA 1CAUB 1RHI1 1JYXA 2BBVA 4L8QA 1QDOA 1PVC3 2HWC3 5L9BA 5FK7A 1J3PA 4AGRA 3SC7X 1GQGA 1UMIA 3MEPA 4CEYC 3RWKX 3ZIXA 2VUCA 2WNUB 3U37A 1IPJA 4YFWA 2DVDA 2JECA 5KBFA 5EPAA 1RIRA 2HJIA 4F3JA 1RVF1 3TN92 2JE9A 5C3PA 3P5BA 4XE9A 4CDXC 3VUOA 2WN3A 1W06A 1B09A 4NHXA 2IFRA 1YHFA 2TNFA 2XOMA 4D0QA 1PO22 2YGLA 1PO12 1TME1 2FDJA 4IV1C 4UBGA 2DBNA 1W6QB 4FFHA 4NWVA 4YG0A 4YZ2A 1WA4A 2W2IA 4NRQA 4PT6A 3VD3A 4XUQA 2WNVB 3CBNA 4FTSA 3I2FA 2BGPA 5FP7A 1EPZA 3O1VA 3GZUC 2G4IA 1H2MA 5ACA3 3WNNA 4BU2A 5L7OC 1JHJA 1XYOA 2J1VA 5A7OA 3EJKA 3W58A 4JCKA 3L2HA 1UN1A 3O7OA 4Y20B 5BNNB 1JUIA 1A34A 2CY6A 2FDKA 2JJ6A 3F2ZA 1MS1A 2BZDA 1Y9QA 1V0AA 4G3YC 1DQ6A 1WW4A 2EXKA 4YVWC 4IE4A 2BU9A 1LRHA 2XG3A 1Q8OA 3A4UA 1VMHA 2B9VA 2YU1A 3KCXA 1UKRA 4NAOA 1D0HA 1SACA 1DQ0A 1NLQA 1ASJ2 1COV3 4LULA 3S5QA 4XXPA 4ES9A 2MEV3 2R16A 1UF2C 3I8TA 3PHMA 2J1SA 3HBKA 4A45A 4GKYA 5DG2A 4FPLA 4YYOA 4MYEA 4MGQA 1ZRRA 4PIYA 5E6HA 2EF6A 2Q8EA 4I01A 5I0RA 1O59A 4HPKA 2BJSA 2OIIA 2WFF2 1ASJ1 1MVEA 1FMD2 4J25A 2EXHA 1HQWA 1DGRN 3OBZA 5CIRA 4L0PA 2WAAA 5FMOL 5FMCA 4XILA 5EJ1B 4RGAA 1AYM1 4ZHNA 2B4KA 5CADA 3PVBB 3J7HA 1OA4A 2ZCWA 4FPJA 5LA2A 3EB7A 1PK6A 1RXGA 2QFEA 3RZLA 1SFNA 4PLNA 3ZR6A 3ZXAC 5HXVA 1OOPB 5FYHA 2WLQA 2QBXA 4FAHA 4YNIA 2HWB1 1I3HA 3VBRB 1G7YA 2I45A 2LALA 4JV4A 3FFZA 4UW3A 1JTZX 4O9EA 1JS9A 2G19A 4MV2A 1N3QA 1NLSA 3I54A 3VHOA 3ENRA 5A6ZA 2G1MA 3E6DA 4MXWB 2K46A 3HOBA 2BQPA 1GICA 2RDRA 3FZ3A 1UYPA 2V73A 4GQ7A 4M3CA 5FYCA 4YZ5A 2ZEXA 3BALA 5IJRA 4PDWC 2XPJA 2Z5WA 4I2OA 3OOXA 4UW5A 4C91A 2NPIA 1K45A 1LEDA 2LTNA 3ZX7A 4QXKA 2HEWF 4RQPB 2PQQA 3RQ0A 2JDNA 2AZ5A 1MPXA 3KVAA 1C8M2 4LK7A 3LE0A 3B00A 3MUZ1 2HWD2 1UKGA 3MPBA 2DYCA 2VZ1A 3AL5A 1ODNA 2C26A 4LHNA 5F2WA 5KHHA 4BK4A 1KEXA 4M4PA 1O91A 2D5FA 2R1BA 3PUAA 5ISLA 3UK9A 2XLFA 1S0CA 2R49A 3WOGA 4LE3A 1Y3TA 3B9CA 2VZ3A 5JZGC 5SV5A 3FUOA 4A3ZA 3BGAA 2QQNA 4BCUA 3JXSA 4TN7A 5CG9A 4CDUA 3GBFA 4N90A 3LKJA 4LO5B 2WS92 5JI9A 1MVQA 4RS5B 3KWVA 3RMXA 4CSWA 3VL8A 1PVXA 1DCSA 4ZZ8A 2Q8DA 1WD4A 4KBBA 5J3UA 4NROA 4AQSA 3S6PA 1LR5A 2WNUC 2ZHNA 3FUQA 3PMSA 2ZEZA 3ATGA 1Y9MA 3G7DA 4JGZA 2WS91 3THPA 1LULA 2RS51 3E5QA 1XRUA 3ZFGB 4QDSA 3HQXA 4XQDA 5EHDA 4CCKA 3HT1A 4NN0A 3MGUA 3QH7A 4XPVA 4AI3A 1ULOA 3KVBA 3ZYFA 3NNLA 4QKNA 4KL1A 4IE0A 2ZHMA 3WNMA 4XABA 1UIKA 4IE5A 2HEYF 4A44A 5LASA 4CP1A 5BNQA 2HWE3 4Q4W1 2WNVC 1OLQA 2ORXA 3Q8CA 5CKQA 5JCTA 1FYUA 1W6NA 1Q8SA 4AFBA 3LOIA 3WUDA 5IVYA 1DGRA 3WW2A 2P37A 2WYFA 4OFGA 4Y4YA 4YVSB 3VBHB 4WVMB 5BNNC 5JSRA 2JENA 4P9JA 1D4M1 3GF6A 4FTEA 4G4FA 3MIBA 2CDPA 1BEV2 1NLRA 4YLZA 2HYXA 2E6VA 1SLCA 3B01A 3OGGA 4UYBA 3K3NA 5D8AA 3RGBA 1CN1A 2ZHKA 1HJGA 4AXOA 2CGNA 1XE7A 2AR6A 3NNJA 3ALQA 4EN8B 1ZBA2 2A6ZA 2GC2A 3I2KA 1LTEA 1ZNPA 5FJKA 1UXZA 5F6LB 1FOD3 4CEWB 1RB8G 1AR73 5FZDA 5FWEA 3J8F2 1GU3A 5FZ0A 1ZRDA 1DDLA 3K4ZA 4XDOA 3ACHA 2ATFA 1CZSA 1UU5A 4KG8A 5C4WB 3AL6A 5F9TA 2JB4A 4AI2A 3V0BB 2X10A 1Y4WA 1SCRA 1U5ZA 2QQWA 1BQPA 3RFRA 3JBG2 2Y6KA 1HQNA 3HWJA 2O1QA 4IV3A 1REFA 4ASKA 4DY3A 4AFAA 3J8F1 2ZTNA 2VVFA 4LKSA 3PL0A 1U5XA 1SDDB 2ZGUA 3APBA 2Z2SB 4QWNA 3RMYA 2XQRA 3LEKA 1ENRA 2VZTA 4XBQA 1AL22 4YW5A 5T54A 3SQOA 3DUIA 4WM8B 4EN6B 3ZYRA 4XETA 1RXFA 2PQSA 5EJZB 4H7MA 3WINE 2DFCA 1QKQA 1RUG2 3M3QA 5C33A 4ATEA 2D6LX 1BMV2 1IG3A 2QQKA 5E1RA 4IL7A 4HN1A 3ZM8A 4C1XA 1H2KA 4XJWA 2VC9A 3RJ2X 3DECA 3RZMA 5I0DA 1REDA 2JE8A 2RS31 3K75B 5FWJA 5J1XA 1AL21 2IXIA 3BOPA 2AYHA 2W1SA 1RITA 4CP2A 1E5SA 2W1QA 4IEZA 4L2NA 5K8SA 2OUJA 5CFDA 4GH4A 4JDOA 2DCJA 3B5LB 3ZDVA 2A71A 4XACA 3DL3A 3AXEA 3OYWA 4IXLA 5GLWA 2HBTA 4PBPA 2VOTA 3KQRA 2GC1A 2PHUA 3ZMOA 5IUQA 1YJKA 4MGSA 2WC2A 1AYN1 5A1LA 4N43B 4XQ4A 4XQWA 2SLIA 5DDJ3 4AVTA 2R072 3BTZA 1PMIA 3Q9OA 5IFTA 5ERLA 3WP4A 3VBSA 1JYWA 3RZZA 4BPZA 2W87A 1IKQA 5A7WA 3ZOIA 1BXHA 2VUAA 3ORJA 2DCZA 3PVNA 2TEPA 4P5HA 4HVQA 1JZ3A 1RUH3 5T5LA 4Z8BA 5TSWA 1M4WA 4BQ2A 4MSVA 4QQLA 2VBPA 1Y9GA 1AR63 3VD4A 1OKQA 4RYDA 1CAXB 2R071 1WLDA 3MW2A 3N7KA 4I02A 2QQOA 1NA1B 3WW1A 3T2QA 4RS5C 5FXXA 1UZYA 4YM2A 1E57A 1VALA 3FC0A 4RHV2 4TZDA 4YFZA 5LZ6A 1RUE1 3WUCA 1NX9A 2VTXA 2WJSA 1LHUA 2RE9A 3IIIA 4ORFA 5T5JA 5JIUA 3SKJE 4CP9B 1S2EA 3H3ZA 3JD73 5DN2A 3ZDSA 2XJSA 1LHVA 2VULA 3HQRA 3RRDA 1AUYA 1UOBA 1ZZ7A 2IC1A 3ZFGC 4BXFA 1J3RA 2Y6FA 1NQJA 2D6MA 3H42B 5DPNA 5C7GA 4P02B 3VBFB 4UFIA 2WLPA 4R9DA 4UW4A 3CJIB 1RHI3 3THTA 1UIJA 2RMU1 2RM22 1AR82 4Y33A 3RZKA 5KHGA 3GCWA 2VM9A 3RYPA 4AK3A 4QPIC 2WA4A 4BQ5A 4GD4A 1G9DA 2AEZA 2O14A 2YGMA 1RUI2 2P6CA 3W59A 1JOBA 1X7NA 2VQTA 5FYYA 3BCWA 1SFYA 2ARAA 4X6QB 1R1A3 3VBHC 1UYXA 2OA2A 4JGYC 4YVSC 2ZAAA 1NOVA 1RVF3 4E4ZA 3UL2A 4BISA 4DO0A 1AR81 1KDMA 1OFSA 1DZRA 5LY1A 3U4SA 2VMHA 1UNBA 4CDWA 1PGSA 2YB7A 1PVC2 4FFIA 3SCFA 3HJRA 2QQLA 3DN7A 2WAOA 1BBT1 1CJPA 1PIV2 2YMZA 4OHZA 4ZKTB 1QJY3 4CEWC 4WM7B 2DUQA 4YW1A 3RZHA 1C1FA 4KG0A 5LEKA 1ULCA 1I5ZA 4HKLA 2IWGB 1CIWA 4QXCA 4UFLA 2A73B 3THDA 1X9PA 3ZN5A 4E2GA 3N9MA 4NVPA 2FCVA 4QX2A 1YFYA 1Z0HA 1XNTA 1NCRA 1DG6A 1XNCA 4K7JA 3EBRA 4W8JA 5IFPA 1RUD3 2X5IB 3DYMA 4B1LA 4EE2A 3OJBA 4LBQD 1XQNA 5FPLA 5LRRA 1JZ4A 3B9IA 3D3AA 4WM8C 4B8EA 4LHSA 2VBBA 1NCQB 2LS6A 3H3UA 4IE6A 4AAPA 2P6HA 2AENA 4L97A 4X8PA 3RDIA 2VZPA 5LBFA 1ST8A 2WZ8A 1LNSA 1NXD1 3IDEA 4JRAA 4LIVA 4KU8A 2W39A 4HK8A 5A7NA 4OHXA 1D0GA 1N1YA 1SLBA 2ERFA 4FOYA 3WDYA 1V9U1 4L11A 2RDQA 3ACIA 1HDKA 5A1AA 2JDKA 2X29A 3KHBA 1N1SA 3POEA 1COV2 1URXA 4UFKA 3ZFFA 4GJZA 1DF0A 2NZ9A 4N8MA 3O1SA 2D40A 3FBMA 4CDQA 2BTVC 1VBE2 4ZZ5A 5DG1A 5DUXA 2E9QA 1H1MA 4FFFA 2K2SA 2ZKLA 3NV1A 1PZ9A 2VBDA 2WO7A 5FPUA 3VKMA 4Y4RA 1IG0A 2XHKA 5D1IA 2DVAA 2QZ2A 2H6BA 4XJUA 3BTXA 1NXMA 1GOHA 3POGA 3SEEA 4N43C 4Q8KA 4ITCA 1VBE1 4ET7A 5B4XA 2YBSA 1XNDA 4ZPIA 4HFSA 4Y5Z0 1AR91 1F9KA 2BNMA 2ZZQA 3POYA 5EV7A 5T52A 4RGGA 2BFUL 1Y7BA 2ZX1A 1N1TA 1H8TC 2VTFA 4H55A 4LBJA 3RWNA 2YDEA 3H9AA 3U10A 2GH8A 5HCAA 4KGGA 2R0HA 5CFCA 2R32A 1FV3A 3U14A 5GALA 1LGCA 1P8JA 2GU9A 1NA1C 2PHWA 2YBKA 4EYUA 1JZ6A 2HYKA 4O9GA 4EN7B 2E7QA 5LK5A 4UW6A 2IZWA 4HN0A 3RG0A 3T1LA 5C3OA 1R092 4BH9A 5FFOC 4B1MA 5JI7A 1UYZA 4BE3A 4MHUA 4RGKA 1UYYA 4FFGA 5JPMB 1PGW2 5HCHA 4XF4A 3MIFA 3VHNA 5JOWA 1UY1A 1WW7A 3I3BA 4HMZA 1PM7A 1JYVA 3IDAA 3M3EA 4TYSA 4D3WA 1QXRA 4URAA 3R4UA 2ZMLA 2I2SA 5JSOA 4LR4A 2WIIB 2WSUA 4XHBA 3AJYA 4EZ4A 1JYNA 3KD4A 3HNMA 3VBFC 1W8TA 1VBA1 4CCOA 3D5OA 5FMOS 3H7YA 3VZLA 3VKFC 5A3NA 3T0BA 3ZXJA 3ZYBA 4JZRA 1BK0A 3MBWA 3BIEA 3N7MA 1QOTA 5DUUA 3O1PA 1HRI3 1HRV1 1ZZBA 3EYPA 4GWNA 4LBQA 2DTWA 5J09A 4FPKA 3MFAA 1FPN3 3JQXA 1X36A 2V5YA 4TWTA 3E5UA 2OKXA 3VDBA 4AL9A 2VW1A 1LOFA 1SPPB 4SLIA 4C8DA 5FXVA 5JR7B 5A3TA 3NL1A 2O0OA 5GJ6A 3WSOA 1MEC3 3KGLA 3RS6A 4CZSA 1AHSA 3NAPA 1POV1 5L19A 1V6IA 2JDPA 1QJX3 4GMP1 1UWWA 4OI2A 3OG2A 3MIEA 3LSEA 4OI4A 2J7MA 2PLV1 3UGHA 1C4RA 2VNGA 3E1F1 4WM7C 2W1UA 2PAKA 2P3KA 4GZ9A 3POJA 5FY0A 2X53S 2R0FA 2CWSA 2CWMA 3ECQA 5A70A 1A8DA 1GWMA 1POQA 1WCKA 2ZMKA 3ITQA 2W91A 4R9BA 1ZVFA 2GDFA 1W2AX 4FBFA 3RVHA 1W3XA 4W6WA 2VU9A 4YW7A 4XZUG 2G9FA 3BKZA 5HV0A 5FOJB 2X5IC 2J1TA 2E33A 2HWE2 3DEMA 4ES8A 5KR7A 5HBAA 2VNRA 1QJZA 3PUQA 1W03A 2CNAA 4MG2A 1NCQC 5D8AB 2PHFA 2VMDA 4LA2A 4XJ9A 4AI0A 1GV9A 4MX3A 4IV1B 1W6PA 2BNOA 4M00A 4MO3M 2HWF2 5IAVA 4BLIA 4JHZA 1F31A 1NZCA 2YBPA 4R9AA 4WV8A 1QU0A 1QMJA 2GC3A 2GNDA 3AYEA 5C9AA 2D5HA 2JD4A 1MQTB 4H2AA 1R082 4K8FA 3ZYJB 2ZBJA 5FZBA 4CCDA 1SQ4A 1HKDA 3WV6A 3GJAA 2R7EB 4AAXA 4CUCA 4XF9A 3GM8A 1SLTA 1WUVA 4TTGA 4A7KA 4H3WA 1HB4A 2FQPA 3RNSA 1OPOA 1CZVA 1O3TA 3O1RA 1AL0G 3LDBA 1U5IA 1X50A 1F35A 3KM5A 3PURA 1T2XA 1WW6A 4DUVA 4AI1A 1RUC3 1JZ5A 1W8HA 2RS33 1XU1A 2Z79A 4OI0A 5FQ0B 3MI8A 3GDBA 4SBVA 4Q0QA 1HV0A 2OXBA 2OS2A 3KF5A 1N47A 3PUIA 5I91A 1UX7A 2ZPXA 3HNYM 5DZEA 4Q0SA 1RUJ2 4Q4Y3 2JE7A 2GZWA 1VB4A 1HLCA 4K40A 4QKFA 3WDTA 1JZ2A 2BWCA 3IPVA 1CPNA 1WW5A 4AEJA 1SFPA 2Y60A 5HPOA 1N1VA 4BMBA 4GKXA 4GB33 1NE6A 1AYN3 5T50A 3D0JA 2B5HA 1VPHA 3OSDA 3WCRA 4D7TA 3VBUB 5C8CA 5F32A 4BZ4A 5A3OA 2RDSA 4XAEA 2A3YA 2FDFA 1EAH1 1G6NA 3IBMA 2RDNA 1IQAA 1RJ8A 4IQPA 5JVVA 2ZGPA 5E89A 4FTBA 3TWIA 2VH9A 2B9UA 3PTYA 1Z7S3 3DPRA 5CKNA 3CQOA 3KT1A 1FT9A 2ZA9A 2UYAA 3AVSA 1F5FA 2V09A 2NM1A 4QPGB 2VOVA 2AEYA 4XEZA 3HMYA 5FO7B 1EV11 1K5MB 4UFJA 5DDJ2 2EXJA 4GJYA 1W8WA 3KGZA 4EN0A 4DXSA 3WD5A 3ZIWA 4AEKA 4DS0A 1CONA 1WA6X 1DLCA 4FSJA 4QHOA 4V2WA 4AQ6A 1NT0A 1WCSA 2YZ4A 1UD1A 3HN1A 4Y1VA 1FAYA 1ZBE1 4I30A 3VHRA 4BJ0A 1RUH2 2VJXA 2BUKA 4LQRA 5FZOA 4LO6B 3VBOA 3I3EA 4YGCA 1EUTA 2PHTA 2VG9A 4ZONA 1KJRA 5FZ1A 4CUBA 1UZZA 2RVAA 1TMF1 1UZWA 4L9BA 4AR2A 3MPPG 1AX0A 4Q4X3 5DMYA 3IMMA 1VAMA 1A6CA 1CD3G 4MUVA 3T2PA 1QQP2 1OA2A 1QEXA 1CQ9A 1PHMA 3NQHA 2RR11 3SISA 5KC6A 3JD72 4ASMB 4E4SA 2B7YA 1GZWA 4XF0A 3N4MA 2DU1A 3KCCA 3NKTA 4UWDA 3AZZA 5FOBB 4HSJA 4NUBA 4OYUA 4BK5A 1WD3A 3R0RA 3RI9A 4IGOA 1MS5A 2ET7A 2KD7A 3A21A 1YO8A 2P3JA 2V4AA 3MUY1 2ZAHA 3J7LA 4U2AA 4AOCA 2JDAA 3SH4A 2R042 3GGLA 4KBZA 5BV6A 3AMQA 5FP4A 4QD2A 3ZSLA 5D8AC 2DCTA 5F5CA 2WO2A 1LB2A 5BUVA 1YQ2A 3I3QA 2FZ2A 3LFMA 5C6CA 3C7OA 5FPBA 4I0AA 2X09A 4UXAA 3N36A 3CU7A 3M8LA 3KHCA 4Z2WA 2WKKA 2QZ3A 5C71A 1RUF3 1OQ1A 3WDWA 3ZXDA 4YSFA 3TN91 4AFDA 1MQTC 4I09A 1IPSA 5A32A 3WHUA 4Q4V3 3ZFEB 4RR3B 1STMA 1QF3A 4QQOA 1QJY2 2WRAA 1PO21 4LO8A 3VLBB 1PO11 3RI8A 1QJEA 2Z4FA 5IVJA 4XFGA 2VMEA 4P00B 2VVEA 5KC5A 2N7GA 1O7FA 1DQ5A 4QQ2A 2OPWA 4XAAA 2PXJA 2OW4A 1ZZ8A 3POIA 2NQYA 3NRUA 2VY0A 3BODA 4LE4A 4AI9A 1ND2B 2P1BA 4KWLA 5DQ0A 3QH6A 5LCWL 2D98A 1SZBA 1CJDA 1D2QA 2UY8A 2XBO3 2WQZC 4GXLA 2XGXA 3WP5A 2FDHA 5KHJA 3SNMA 2GALA 1OPMA 1WMEA 3DV8A 1REEA 4LLFA 2CV6A 5J98B 3T1MA 1HN1A
chains in the Genus database with same CATH topology
4Q29A 4W65A 1Q5OA 1VBC3 2AH2A 4AFMA 2I07B 4K6BA 4BLJA 2EAKA 5K9YA 4IESA 4GH4C 2BPA2 2XKPA 3FX3A 2JDZA 3B02A 4AVCA 5J48A 4AHWA 1VBD3 4AEDB 2QE3A 2NN8A 5K0UA 3VBUC 2FHRA 3CO2A 5JAXA 3SITA 3O0XA 2WFF1 5HCFA 4JTNA 4IEVA 4COWA 1FMD1 4D7YA 2RS13 2WZR3 5HI0A 1AR93 4Y22B 1V6OA 1W6MB 1C5IA 3NVCA 2FMYA 4BA6A 1UMZA 2H0VA 3OTFA 3CEWA 3L2YA 4QPGC 1ENSA 3QD6A 1K5MC 3CNAA 1YI9A 5EYYA 1CAWA 4D69A 2B8MA 1XNKA 3ZN6B 1ND3A 1SDWA 4M3CE 2EAAA 4RSUA 2ZGLA 5BNPA 3RJRA 4PBOA 4XMAA 3WDUA 3SXWA 1NQDA 3AP7A 3HT2A 4B3NA 1RMU2 2F6BA 2XWJB 3B7MA 2PHLA 4JRLA 1O4YA 1YUDA 3WP3A 3OY8A 2IXKA 2ZGTA 3JB8A 2ZZJA 1VBA3 2VOWA 2Q8OA 1QXJA 2A6VA 2BYVE 2JG9A 3WLUA 4C90A 3PJYA 1C8M1 4I0WB 2HWD1 4AGGA 1MS9A 4OUMA 5GLZA 3AB0A 4URTA 4OULA 4MLOA 4BQ1A 2VXRA 4I3PA 1DGLA 5EXOA 5CBLA 4IEUA 1EYBA 1POV3 2XJRA 4COZA 2ZKNA 4Y26A 3WR0A 2GMEA 1LKNA 1S0BA 4WBBA 2PLV3 3AMNA 1W6OB 3BPZA 3NAPB 1DGWA 1FPN2 4XFIA 2CAVA 1IHMA 1MZEA 2R062 2ZOEB 3AM2A 3H50A 3E5XA 4QPIB 4XMIA 4Y24A 3ZXEA 1JXNA 1QJX2 3ZFEC 4RR3C 4E9KA 1DZTA 2ET1A 3AYCA 4JGYB 3WCSA 3ZSKA 4N53B 2MHFA 1ENXA 1LU1A 1NCRC 3WG2A 3WVJA 4WVZA 3W9AA 3TBDA 1IOAA 2UURA 1U12A 4A7YA 4JDMA 5AVAA 1LOAA 4ISRA 3HR9A 3A0NA 3L9JT 3VDDB 1CR7A 1QJU2 3V0AA 1ND2C 3MIGA 3VZNA 1BZWA 2PAEA 1RTVA 3POWA 4CEYA 1BEV1 4A2UA 4XYXA 1ZZ6A 3LA3A 3IDBB 1C1LA 3WZ1A 4K9SA 1JUHA 3AZWA 3GZTB 2XL7A 3ZYPA 4BHPA 1ZBA1 4YZ3A 2F4PA 3JQWA 1VBB2 4CDXA 3AP5A 4QQHA 4KQ7A 1MS3A 3PMEA 2JG8B 1JYCA 4AEDC 3C3VA 4HT1T 4LHKA 1MS4A 3MF6A 3EXUA 1V6MA 4HBNA 3JBG1 4CP0A 4E4DX 1HX6A 2BNNA 2Y26A 3N7LA 5L7OA 3LAGA 1UW8A 4XBLA 4P9GA 4LBMA 4FXGB 3LA7A 4Y1XA 3MLJA 4YVWA 2BVVA 1RUC2 1QHDA 1RUG1 1ZRFA 2P17A 1BMV1 4DNYA 4L92A 5CFCC 1HIXA 1HQLA 2YYOA 4M0HA 2D6KA 4LO4B 1FXZA 3K51A 1VRH3 1EAH3 4LBLA 3MDPA 2VECA 1LEMA 3SCGA 4GIQA 4QQPA 1ULFA 4GB32 3UJQA 1HXS2 3HD8B 4TSVA 4KWKA 1EV13 5AC93 5KXEA 2YHJA 3E97A 1CAVA 3R05A 2IFWA 3KSCA 1H8TB 1B35A 1ULGA 4S2FA 2QCSB 4XJAA 4OLLA 3WT3A 4FOWA 3MLLA 5J7MA 1ZBE3 3MW3A 3DGTA 5A33A 3MW4A 4K3UA 1HXS1 1UCXA 2B39A 4HKWA 1LHOA 1OA3A 2W52A 1XXNA 5ABJB 2CL2A 1G9AA 1JN2P 1H1AA 1Y43B 2WFPA 1G86A 3JZVA 1H4HA 1LOFC 3B69A 2XVLA 1AZDA 2DWRA 3M4FA 5H9QA 2VW2A 2RR13 2ZX2A 3NAPC 1TNRA 4RHV1 3FWEA 3QACA 1DYPA 4ISQA 4V1PA 1ZX5A 4FQZA 4Q2FA 4PDWA 2QUOA 4YW2A 4WVVA 3UKNA 1MZ6A 4P9YA 3U07A 3N3HA 4Q4X2 4XOGA 3ROUA 2PYTA 2JICA 1GYKA 3GNEA 4B7KA 3USUA 4AF9A 4Q1PA 3WY6A 4N53C 1LCLA 2RM21 5JZGA 1LU2A 3IIAA 2HWC2 1TME3 1RUI1 5JPNB 5KXBA 1CAUA 2DUPA 2BGCA 4K1ZA 3VDDC 3WXPA 5IK4A 1CVNA 3TN93 2JKBA 3D0SA 4DMIA 2WNUA 2E7TA 1MS8A 4AI8A 1PO23 1PVC1 2HWC1 4B29A 5T3NA 2DVBA 4FPFA 1S1AA 1WBFA 2K0GA 1S0EA 1PIV1 4B4QA 4F7ZA 3H7JA 3VL9A 1RUF2 1H2LA 1HW5A 1S0GA 4PCRA 4QX5A 2JG8C 1A8MA 1LOEA 1WMFA 3SHRA 1W6QA 5ACA2 3WQ0A 3BIWE 4S2HA 2WNVA 4IETA 5IK5A 5GM0A 1ENQA 2RJKA 3H0OA 3POSA 4XFAA 5BNNA 4Y20A 3R6SA 2ZACA 2ES3A 4YW3A 1XU2A 1ASJ3 3WW3A 3WG3A 5ACA1 3EHKA 4FVVA 5I0UA 1IGOA 2MEV2 4HPKB 5GLTA 4DZGA 1AYM3 4R4XA 2FBEA 2PN5A 2VW0A 4IEOA 3BOWA 2XBO2 4RFT0 1JOJA 4FOQA 4J1XA 4FXKB 4WVWA 5HCBA 4INDA 4FPGA 2HWB3 1PK6B 1COV1 5C8CC 4L99A 1VBC2 3ILNA 3FMGA 4R8HA 1H30A 3GYDA 4BOWA 5KHKA 3DF0A 2VNOA 5GZDA 1O4ZA 1VBD2 3FE5A 3WNXA 3FLTA 4AYUA 4XFCA 4YRDA 2ARBA 4JTOA 1JW6A 4NHLA 4AHZA 5GLVA 2WZPP 5E88A 2RS12 2WZR2 3IM0A 3PJQA 3SH3A 3D6EA 3LSDA 4CTEA 4EWAA 2BEOA 1OOPA 2VPVA 4OHWA 1O3SA 5DUWA 3VBRA 4M3CB 1LHNA 2KA3A 1NG0A 4JAAA 2DV9A 1DYKA 5ABJC 4FPYA 4Q26A 4XFHA 4Q0UA 3AZVA 5T55A 5T5OA 3N7JA 1DQ4A 5FAXA 1Q8VA 2D6NA 3AZXA 4MXWA 5FLJA 1NYWA 2NLRA 1R091 2Y0IA 1C8M3 2ZGRA 3S30A 2A70A 2HWD3 3UKVA 4LEJA 5BPXA 5DZFA 3AMPA 1PGW1 3WP6A 3KZ4C 4RQPA 3NJZA 3NW4A 4CDUB 2IXLA 3OF1A 2BVBA 4AQ2A 1RL3A 4YG6A 2E51A 1QNWA 1J58A 3LA2A 4M01A 4DQAA 2WS93 1FI2A 2RS53 2D43A 1BVVA 1C57A 3UV9A 5KWRA 4FPEA 2QNKA 2C1FA 1OSGA 3M1HA 4W6YA 4JGZB 4BIFA 1H9PA 4RS5A 4AE2A 5K7PA 3CJXA 5BXXA 4Q4W3 3RSJA 5JOZA 2VQ0A 3RPQA 5JWPA 2UYBA 1W2UA 3INAA 3GBWA 2A5ZA 4ZU7A 2DCKA 4KH9A 3M3OA 4Q0VA 3ST7A 4I0BA 3ZSJA 1D4M3 2CYFA 4RA0A 3ZFGA 3B94A 1W6NB 1JBCA 1W0PA 3N35A 1VAKA 4XZPA 2YXSA 3WQ1A 1KJLA 4ZU5A 1AXYA 3FFQA 4OHVA 4CYDA 4MGZE 4IEXA 1BEV3 1X8EA 1RJ7A 4B7EA 3VKOA 2C5DA 3VBHA 2EA7A 4YVSA 4WVMA 2NMOA 2HWE1 1ZBA3 5FPXA 1WBLA 1GLHA 1D2SA 3ES4A 3GHMA 3AKPA 3J8F3 4AW7A 1V6LA 3MF9A 1FOD2 4KNCA 1AR72 1TQ5A 3JU9A 4LUMA 4Z92B 3FBYA 3R4DB 1DQ1A 2HWF1 3AX4A 4IV3B 3H8UA 1UU4A 4CEWA 4W6XA 2NMNA 2VUJA 1YIPA 1AJKA 1RC6A 3AP4A 3JBG3 1R081 2BW8A 1IS4A 1GFF2 1PK6C 2D3SA 4MGKE 5H9RA 5C4WA 1GSLA 3JCIA 5GKAC 3V0BA 1QNYA 1AL23 3SLIA 3WX5A 3HAGA 4AGVA 5I0TA 3OD4A 2UWCA 1ONAA 1RUG3 3MYXA 5CB7A 4IEQA 2YV8A 4KU7A 3KMHA 1Q8PA 3CF6E 4F83A 4WM8A 1GBGA 3ZXLA 1AJOA 1S0IA 5CFDB 4GH4B 4QT6A 1IS6A 1WLTA 1DHKB 1JH5A 4FP2A 4I3GA 2QDRA 2PA7A 2UU8A 3OYWB 2O8OA 1RUJ1 1ALYA 1VJ2A 4LNVA 3AMHA 5KXCA 2OVUA 4MZUA 3PVEA 1QH7A 4X6RB 1YJLA 4E2QA 1O3RA 3VBSB 2PHXA 2EVXA 2Z42A 3DKWA 3P3PA 4EV0A 1V6NA 1VRH2 2VOKA 2R073 1BCXA 3AZYA 1L3JA 3CLPA 4ASLA 1ZZ9A 2E7AA 1CGPA 1UPSA 3KCYA 4HVOA 2UWBA 3NKGA 4N43A 2E53A 4CDUC 5I0SA 5AC92 4N9HA 4E27A 3S7EA 5J36A 2B45X 1RUE3 4OZXA 4FOVA 1GQHA 2WA3A 1AR62 2IXHA 2WSVA 5DDJ1 1MACA 1GNHA 3KLSA 1LOGA 1UU6A 5L73A 4K1YA 1IKPA 1N3OA 1YI7A 1CAXA 1V6KA 4JGZC 4HL0A 3E6BA 1RUH1 3M7AA 2RMU3 1NA1A 1C3HA 1RUOA 2ZGMA 4OVEA 4TLFA 4DRVA 4EJRA 4HZFA 1SCSA 4GULA 3S0MA 2AREA 2UWAA 3ILFA 3MW2A 3O12A 3LCPA 1TE1B 1C8NA 2ZS6B 3ETQA 4XQDA 4AQTA 1FATA 5JMCA 3AK0A 1H4GA 3D82A 3IN9A 2Q5TA 1DLLA 5IK7A 2RM23 1AR83 1QQP1 4FO9A 1ZZCA 2D6OX 5JOXA 3E6CC 1RHI2 2I74A 2IXCA 3USUB 3JD71 4QM8A 3VBFA 4C1WA 3CJIA 1LGBA 3AJZA 1BBT3 5CNAA 2YY1A 2HEVF 2JEMA 4CDWB 1O5UA 3UKTA 1R1A2 1S0FA 1RVF2 1AXKA 1S2BA 3TNPB 3BB6A 4HVRA 1XE8A 2R041 3AYAA 5BY5A 1TME2 1ZREA 1PIV3 2H6CA 4XFBA 1C28A 4QGNA 1LENA 1YWKA 1R1A1 3ES1A 2ZX3A 5BNOA 4EROA 1D4VB 4NHKA 1NCRB 4IV3C 3PNAA 1EPWA 4JVAA 5FRAA 1F5JA 1NY72 4WM7A 4EN9B 1APNA 4FPOB 3V64A 1VAVA 1BYHA 1GZCA 5EWSA 5EYXA 1S0JA 1X8MA 5JDBA 3PLQA 3HIFA 1QJY1 4WZFA 3H1MA 1V9U3 1SBDA 2XJUA 1RUD2 1BKZA 4IEYA 3GHNA 5CA6A 3MZHA 1YXWA 4PIXA 5GLUA 2Q30A 1NY71 2X5IA 3NV3A 4KGQA 4YW4A 2D97A 4LT5A 2MNGA 4U36A 3O0WA 4GALA 3ZFFB 3TAYA 4A3XA 1NCQA 2XJVA 4META 4CDQB 1RUD1 5CFDC 4F8AA 3LB9A 4AHYA 4NOTA 1VBE3 1W39A 1WLWA 3MFCA 1H9WA 2X8KA 1AYM2 1UX6A 1IS5A 3O0VA 1EY2A 4PQ9A 1IS3A 1SBFA 1X33A 2KM2A 4NHMA 5FO8B 1OMIA 3VBSC 3HBZA 5LEJA 2HWB2 4COUA 1KFUL 5BYNA 1GR3A 5KXDA 3ZSEA 1DZQA 3UJOA 1B35C 5DUVA 1LESA 1DU3D 1LODA 2ILMA 4IERA 1R1ZA 3ZYIB 5CFCB 3IMNA 4XIKA 3QOPA 2AGSA 4GWMA 4HSLA 4OUSA 4XXAA 4ZXKA 4FPHA 2OPKA 3EQEA 4DINB 1KS4A 5JSPA 1V6JA 1R093 4DOUA 2WL1A 4DXZA 3RYKA 1BVP1 1GKBA 1G9BA 2D7FA 4A7ZA 1QOSA 5FREA 1TEIA 1WGPA 4MXVA 3I2DA 1RMU1 4XFFA 2VMIA 2A6XA 2WNEA 1HRV3 4XF3A 5EZWA 2CTVA 3X29B 3PVOA 4P9LA 3M2MA 1T6GC 2ZMNA 4LBQB 3ILRA 2ZGOA 2PFWA 1S55A 3V65A 4PF5A 4B4RA 1J3QA 3KS7A 4GMP3 2GNMA 4XHXA 4C0BA 1HRI2 4P9IA 2A6YA 2BFUS 4CDWC 2D6PA 5DZGA 2KXLA 4QMAA 4PJYA 3VZJA 4FPCA 1AXZA 1ULEA 2RS52 3OD0A 3VGIA 3OCPA 1MEC2 3MICA 4HANA 3USSA 2WQ4A 5FPZA 2QJVA 3VKLA 4B4PA 1HRI1 1FPN1 3CL1A 4ATFA 4Q4W2 2UY9A 1I1EA 1KD7A 1YCIA 2R061 5SV8A 1ZA4A 2TBVA 1MEC1 3H1WA 3IT8A 3MLKA 4AVBA 1QJX1 1D4M2 2WT2A 1YLLA 2EIGA 5A3MA 4R4ZA 2Q1MA 2ZHLA 5JIAA 1AVBA 5I8YA 2ETEA 1W6PB 3AKRA 3U4XA 2ENRA 4NWWA 1OQDA 4FQ4A 2XWBB 4DB5A 3WW4A 1LGNA 5C9AB 2ZGNA 3M70A 2HWF3 2D3PA 3QBQA 3ZSMA 3ZFFC 1QJU1 1PZ7A 4CDQC 2PAMA 2CAUA 1X82A 2JX9A 1R083 1S2KA 1N3PA 4IV1A 5F1RA 2NYYA 3JUUA 5AFBA 1QDCA 4M0NA 1U0AA 1ZYBA 4AVVA 1MQTA 1G9CA 1VBB1 4DPNA 4QGLA 3FLRA 5GZFA 3AYDA 1FNYA 2K9ZA 2WINB 3V56A 3VV1A 2RS32 3IPVB 1F8VA 1RUJ3 1OOPC 2ZX0A 3ASIA 3IDCB 5FQ0A 4Q4Y2 4BIOA 4AVSA 3NV2A 2DUOA 3VBRC 5C8CB 1RUC1 2WT1A 1MS0A 2ZABA 4P9XA 4LA3A 4BYYA 1AYN2 5AFEA 1YFUA 2FMDA 3ELNA 4LBKA 4LHLA 4P9WA 4LTA