3BPSA

Pcsk9:egf-a complex
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
530
structure length
435
Chain Sequence
SIPWNLERITPPRYRADEYQGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHWQLFCRTVWSAHSGPTRMATAIARCAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDAVTAVAICCRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for LDL receptor recognition by PCSK9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/lipid transport
molecule keywords Proprotein convertase subtilisin/kexin type 9
total genus 128
structure length 435
sequence length 530
ec nomenclature ec 3.4.21.-:
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF18459 PCSK9_C1 Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain
A PF18463 PCSK9_C3 Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain
A PF18464 PCSK9_C2 Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.690 Mainly Beta Sandwich Jelly Rolls Proprotein convertase subtilisin/kexin type 9 3bpsA02
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3bpsA01
3H42B 1T1IA 1OT5A 3ZXYA 4I0WB 4MZDA 5I9SA 1S02A 1SUBA 3D9QX 1LW6E 1SCJA 3QTLA 2Z2XA 1VSBA 1ZVJA 1JEAA 3I37X 2ZRQA 1SIBE 1TM5E 4HVLA 4H6WA 3GCXA 1XF1A 1GTJ1 3TECE 3AFGA 1Y3BE 2Z2YA 1C9MA 1OYVA 1BH6A 2WWTA 2PWBA 3DE7X 1KDYA 2TECE 1DBIA 1TMGE 1SN7A 1SUAA 3LPCA 3OSZA 5AVKA 1KDVA 3A3OA 3Q40A 1WVMA 4DZTA 4CFZA 3DVQX 5AVJA 1EGQA 1WMFA 3EE6A 1DUIA 2DQKA 3F49S 1AH2A 1Y4DE 1GNSA 1EA7A 1TECE 2W2OA 2Z56A 3F7OA 2E1PA 2W2MA 3I34X 2GKOA 2HD4A 5B1EA 3A3NA 1SUPA 4H6VA 3DW3X 3TI9A 3DVRX 1IC6A 1S01A 3UNXA 1SVNA 3A3PA 2PQ2A 4NMXB 5FFNA 3DW1X 1SCNE 1V6CA 1AF4A 1GTG1 1AK9A 1SBHA 2ZWOA 4K8RB 4WOBA 1BJRE 2ST1A 5FAXA 3VHQA 4NE9A 1OYOA 4KB5A 4B5LA 2Z58A 2XTJA 3PTLA 1SUEA 3AJ9A 1NDUA 1GNVA 4FONA 3DYBA 3LXUX 4HX2A 1BFUA 1V5IA 3Q5GA 4WOCA 2WUVA 3DVSX 3EIFA 1Y9ZA 1AU9A 3SQOA 2DUJA 4LVOA 3BX1A 2V8BA 3GCWA 1AVTA 2Z2ZA 1R6VA 1UBNA 3EDYA 3DE1X 5SICE 1SBTA 2X8JB 4LVNA 5CW1A 1TK2A 1SCDA 4AKSA 2ID4A 3GT3A 1TO2E 1GA6A 3VV3A 1T1GA 5ARDA 1NLUA 1Y3CE 1TM7E 1Y33E 1YU6A 5AQEA 3VSBA 3WHIA 3ZXXA 3T41A 3I30X 4C3VA 3SICE 3VV2A 1SBNE 3VYVA 3DE5X 2X8JA 5JMOA 3DDZX 4AKTA 1SIOA 4Z2AA 5ARCA 1KE2A 1YJAA 4KG7A 1MEEA 1KDZA 2QTWB 1SBCA 1ST3A 1WMDA 2ZWPA 4BWGA 1GTL1 1Q5PA 2SECE 2WUWE 3WQBA 3QFHA 3D43A 4GI3A 1Y3DE 1AV7A 2SBTA 2Z57A 3WIUA 4ZOQI 2W2QA 4DJ5X 3VTAA 1MPTA 1SUCA 1T1EA 1Y1KE 2G4VA 2XRMA 1SPBS 1S2NA 1TO1E 3GT4A 4M1ZA 3BPSA 3L1KA 2HPZA 1GA1A 4OMDA 1P7VA 4J94A 4OMCA 1BE6A 3P5BA 1PEKE 1YJBA 1SUDA 2B6NA 3LPAA 1SBIA 1GT91 4KPGA 2W2PA 1TM1E 2PRKA 5B1DA 3DE6X 3I2YX 1A2QA 3DWEX 3TI7A 3WIVA 2PYZA 3DE0X 2P4EA 5ARBA 5JXHA 5JXIA 1C3LA 1WSDA 4OV6B 3AJ8A 1SELA 1CNMA 3F7MA 1SCAA 3HJRA 1BFKA 1BE8A 3DE2X 1P8JA 1R64A 1PTKA 1SH7A 3BGOS 1AQNA 4RYDA 4JP8A 1GCIA 5JXJA 1P7WA 1WMEA 1Y48E 1Y4AE 1ZVKA 2DP4E 2IY9A 2SICE 4YN3A 1KE1A 4CG0A 3PRKE 5FBZA 1ST2A 1Y3FE 1C9NA 1C9JA 2PMWB 1GA4A 1CSEE 1NDQA 1SCBA 1SIUA 1YJCA 1HT3A 3CO0S 3DE3X 3DE4X 3QMPA 1IAVA 1Y34E 3LPDA 4ZARA 1THMA 1TM3E 4DWWA 2W2NA 4C3UA 1TM4E 4H6XA 5JXGA 1PFGA 2ID8A 2IXTA 2Z30A 5AMXA 1PJ8A 4NE7A 2PKCA 2WV7A 4CFYA 1R0RE 2SNIE 3CNQS 2PWAA 5K7SA
chains in the Genus database with same CATH superfamily
3V1NA 1R0KA 2NYVA 5JC1A 4KIUA 4AW9A 3HVRA 3SC6A 4BMEA 1U5BB 4LEIA 1QO0A 2YYZA 5JAXA 2J3JA 2GKGA 3UCXA 4X54A 1VLQA 2EP5A 5CA1B 1GQYA 1K3UB 1P5HA 3K6KA 4CG2A 5BUQA 1W96A 2VK8A 4WCVA 4BKPA 4I55B 2NXCA 2HKXA 4N53A 1PN3A 3H7YA 4FOSA 4UAVA 4AVYA 1E4EA 1WULS 2GZ2A 1J33A 1FDIA 1SPPA 1UYYA 5JJCA 4ID9A 3AY3A 2DPMA 3ZFEA 3ZGZA 2OEPA 3JVVA 4IE4A 3UJBA 5DN6D 4P9YA 1IZ3A 4GYKA 5ALQA 3OZFA 1KYIA 4OXXA 3BGWA 4D9FA 3DMNA 5FFFA 4AMYA 4ICIA 1IUPA 2CXXA 3UB4A 4GBED 4PZAA 3HA7A 4G9EA 4EL5A 2G06A 4OFWA 3FOFC 1CPMA 3C24A 4H7DA 4I9FA 3RC2A 4KV7A 1NNI1 4NBSA 1BBT2 5CIYA 2ILMA 3JQCA 5AXCA 4WGFA 3S6PA 5HP4A 3DUFB 4D9NA 2D5AA 4L74A 3KDAA 1MBZA 2C42A 5ICEA 1IYZA 2UWBA 5CVTA 3M7AA 1S6YA 5IM4A 3KMHA 1Q1QA 1AYM1 2G1JA 3PDIA 3ESXA 2XVGA 4HNHA 4GMXA 5BQPA 3R3UA 4LQDA 4N5HX 4E1AA 5FPZA 1US8B 1YMQA 3O4IA 5JO9A 2PT5A 5FADA 4HADA 3I8SA 5KAMA 3WQHA 1QEXA 4NUBA 1Q2XA 1V7CA 1C80A 1B0UA 4G23A 4Y9RA 4JB0A 2DOKA 4I8DA 1X33A 2HUPA 4NFYA 1TF5A 4MTLA 2Z1DA 1AL23 2XDVA 4AVSA 4QNNA 1LEMA 2EIXA 1R5NA 3MSXA 1XYNA 5CBLA 5EJ6A 3WDYA 3WP5A 3AKYA 3QG1A 1YC61 5JWPA 4A2WA 4P9NA 3MFYA 5EQFA 3WP1B 2Z6UA 1USKA 2R0HA 2CGNA 4A42A 5I9TA 4BWYA 5KDOA 3ER6A 2AREA 4P9JA 1ZIXA 3B48A 1T2DA 2ZGMA 5JJLA 1F8YA 4QHSA 1A9RA 4MWOA 2VOVA 3SWWA 3PYLA 1IBSA 1SZDA 3AYZB 1JI6A 4W5HA 1QHYA 3DPRC 2JCXA 4EHIA 3KJFA 1N4DA 5HKLA 4WXPA 4US2R 3Q9SA 3CLKA 3CVWA 4ISBA 2OQVA 5GZGA 1W9YA 2J22A 3KKOA 2OMKA 3FDFA 3ZSLA 4B82A 3OT4A 1D6SA 4LC9A 4Z5XA 3U62A 1MAUA 2OCLA 3ZYGA 2YHAA 4JENA 1OI3A 2JDUA 4HAWA 4PSAA 1PMIA 2FFBA 5FUNA 2I7VA 2M6LA 3P3PA 3T94A 4EWAA 3N4MA 3C7TA 5BNIA 4ZZIA 1EFAA 2QZ9A 2P8JA 1FSFA 4NYIR 2O2XA 5EUQB 3ESDA 4P38A 3O92A 1PGQA 3JQPA 2ET7A 4DCOA 5GIOE 4KBZA 3Q12A 3L4BA 3LDBA 3OBTA 4CL8A 3V1LA 4OVKA 2AT1A 4B31A 4FCWA 5C33A 1WUIS 3FLEA 2R7MA 4R83A 1M2NA 3JD72 1XKTA 3PZRA 3TR0A 3PHMA 4PQGA 1MFZA 4PGAA 3A7QA 4MRMB 3A3OA 1H9PA 3FE5A 2R7KA 3TPZA 3SJBA 4OLHA 3T2TA 4IICA 3OBAA 1K8QA 3PMSA 4J1SA 5LYJB 3R3YA 4NI5A 3IBYA 3TSYA 2P7IA 2OHVA 1FMFA 5EJ7A 3WSVA 2VSYA 4MJXA 1KRWA 1IB0A 1XHFA 3VAZA 5A7SA 5HHTA 3C3YA 2FN9A 3B1JA 3ZW9A 3E9YA 1ULUA 3KHCA 4JNCA 4RGYA 3UYLA 4PRZA 1IBLB 1PO13 1QPBA 2ZBEA 3N9LA 5F5AA 1DAPA 3OQOA 3LBNA 4XFHA 1TO1E 3ETDA 3EH1A 2ZJ7A 1PNOA 1XHEA 5KOJB 4ASLA 4ZI2A 4L0CA 3ICQB 4AHXA 2D0IA 3LS2A 4ZHSA 3IAM1 2BZGA 4YDRA 3M7IA 4U8HA 2O8NA 1R6UA 1ENOA 3VUOA 2Q30A 3HEMA 4M0CA 1NW6A 3OT5A 1J5EB 4MDHA 1VE0A 2PFGA 3RFUA 1W0CA 4OHVA 2HLPA 3BMQA 2B7YA 4LRQA 3BXXA 1N5IA 3MIIA 3PQCA 3C4VA 2EATA 1BMFD 2H2WA 1EA7A 4Q1AA 1NA5A 4FPCA 1Q91A 3VC3A 2G17A 3G6JB 3VDMA 3A58B 5ANNA 4LYFA 4LORA 1PWZA 4RAOA 1W34A 3VD7A 4ERNA 3HTXA 3VBHC 2HTFA 2WZR2 3L7BA 4G1BA 3WTBA 1M2OA 3CIOA 3X0DA 4BWGA 3QPWA 4A8JB 1WDTA 3ZXIA 3LP8A 2RSLA 2B1RA 4R9RA 4CN8A 2WNVA 1AXKA 5LBIA 1OXMA 4PC1A 1MABA 4DLBA 2IYRA 3HKCA 4N43A 1FX0A 4CKEB 3CN9A 4MV0A 4BE4A 4MVJP 4IJWA 4YRJA 4KREA 1H85A 3RSHA 5J37A 4P4SA 3EG9B 1RXIA 4KO1S 1VE7A 2JH8A 4ZV9A 3ZHTA 3LQQA 4M53A 2V3WA 1RPJA 3R7FA 1U3CA 1E3QA 3UO8B 2XGOA 4XA8A 2OBBA 3CUUA 4Z9AA 1BSVA 1G7SA 4XGKA 1FK8A 3PEYA 4XXAA 1N78A 1W2TA 3OVMA 4R16A 4F86A 4ZTZB 3WG1A 4CG3A 4DG9A 5BXYA 4BOWA 3R0ZA 4B34A 3WQ0A 4AKEA 1FUUA 1CX4A 4QPIC 2IF0A 1VJCA 3LT2A 3FPLA 3QUCA 3R7AA 2G9QA 3B12A 1DJPA 3C3BA 4XUPA 1OREA 3ACGA 4OD0A 4UM9D 2H2DA 1LTEA 1VBB1 2VZEA 1L5LA 2ZUFA 2P2NA 3VPGA 3DOHA 1E1YA 3TM5A 2OK7A 4BV3A 4C4YA 1DHKB 1I9GA 4CUGA 3TDKA 2IIBA 3STYA 4O3FA 2OGUA 3CKMA 3DT6A 3Q8WA 4CU9A 2X9LA 3R75A 3RJRA 2BP7B 3WG9A 4MTCA 3PE3A 4X00A 4CU6A 1LU9A 3GXBA 1I4EB 1PUJA 3PGA1 4KX3A 3LX6A 3RSGA 3UFXB 2XGJA 1KRXA 3QFSA 3PUZA 1ZQ1A 3GROA 3LXXA 4O61A 2O8EA 3IAS1 3AOEA 1EEHA 1OFNA 1IK6A 2P8SA 5HW0A 2HJGA 1OFVA 3KLBA 3LI2A 3RS9A 3ROZA 2EQ5A 5GQSA 4RX1A 1VB4A 3L7OA 5TT0A 4L5IA 5A3UA 1W75A 4MZXA 3CCFA 3NHYA 4F8JA 2I4NA 3UH0A 1S2NA 5HXVA 1S4MA 4O4HF 5IFPA 4FI3F 3KD2A 1GHTA 1Q14A 4WZBE 1XLTA 4MVJA 4DEVA 3P9NA 3TZLA 3A4MA 3K0HA 5KXEA 3TNFA 3KVAA 4QQOA 2YFZA 3WMXA 1JB9A 4QYIB 2KM1A 1Z0UA 2PZBA 1XI2A 1OV4A 1Z15A 3FOEC 1RAEA 1RZUA 3PYXA 1RUF3 1EK5A 1BEEA 1COV1 5AW1A 2RM21 3AEUA 2GFQA 3CO2A 2ZOSA 1FP4B 4IZ6A 3GMDA 3SY8A 2XQGA 1WZIA 4ZXKA 1GP5A 4FVTA 1NF2A 5CDFE 5KJCA 5CVVA 5DHUA 4YBRA 3HBZA 4HOOA 5TV2A 5BUCA 2GHIA 3NAQA 4YP0A 3IXMA 4PSCA 3TNPB 1E6KA 1YGYA 5HIIA 4IDHA 3O1JC 3WP3A 1NW8A 2EIGA 1RAAA 3ORJA 5AUNB 1O94D 1M6NA 2BFAA 2QS9A 2W6ZA 5SY6A 1VL0A 3WL7A 5I8WA 3RC9A 3QLUA 4Q03A 2VUSA 3ZHXA 5T3UA 5IM5A 4IIUA 1CX9B 1KY5A 1NA1B 3U7IA 1J84A 2G7ZA 3CRZA 1CX1A 2IXHA 3A8TA 4MRNA 2GBCA 1I1OA 5C81A 5KYUA 2ET1A 2DFKB 4FQ5A 3UXHA 5FZHA 1UJ4A 4HXFB 4C14A 3OE7A 4RY2A 1G8YA 4HGQA 4PE5B 1X14A 3H50A 4MQFA 4LE4A 1UMDA 3NWBA 1KO1A 2XUQA 1PVDA 3OZUA 2ZG6A 5TNXA 1JQLB 1Z29A 3PEEA 4JSRA 3W34A 5IYZB 1FFCA 1YR7A 4DDUA 1L5GB 1FX5A 4R84A 3J81k 1XEXA 1REQB 5KKNB 1JBQA 2OAGA 1CC1S 3RVDA 3Q7QA 4RGKA 5JZ9A 4D96A 2XB6A 5B37A 1CLUA 2IPNA 4Y22B 4XIJA 2BGOA 1GZ5A 1QNFA 5LCXA 1QDOA 4QBFA 5B1HA 1XCOA 2HRZA 3ILYA 3HA2A 2VHEA 4ZHNA 4P36A 4IEWA 4BB9A 2GC2A 1U8YA 3ZV7A 5EERA 3PPXA 4Y0VA 1XYYA 2DVGA 4J07A 3F0TA 5DK4A 3KPUA 4H35A 4CYDA 4AKIA 2J41A 2WAYA 3DKKA 3ZKWA 5JIUA 3LZDA 3M5CA 3ROMA 4X8LA 1UINA 1YRZA 2E33A 5TGDA 5ALDA 4Z07A 1F0NA 2EC5A 2XV1A 2BELA 4ND7A 1CUXA 2H7VA 2IIVA 3TEZA 5LLSA 1ICEA 3TSZA 4IJVA 4Z4FA 1DAFA 4RK4A 5CW1A 4DL9A 2VAPA 5CEEA 1ZNZA 3ZVRA 1GG2A 3SLKA 4K1ZA 3FJYA 5GINE 3QJGA 1GSHA 3QU7A 3VR4D 2E5LB 4J0CA 2VCAA 4BEJA 4K40A 2WSUA 2Y60A 1BEUB 2BEUA 4JHXA 3F67A 5K8TA 1SCUB 1OLME 1OAOA 4H14A 1JAYA 5HRCA 3K9WA 4BFUA 3Q3EA 2A9QA 1YDEA 1NQJA 5FPPA 3N36A 1LNQA 2IYQA 4KQWA 4WESA 4TTGA 1ZRMA 3AY6A 1ZXBA 4JVAA 2WA3A 4L27A 1GPKA 1O03A 1FU4A 3JUUA 5A9TA 2Y4NA 3AVSA 1Z6YA 2FE1A 5TF0A 2D74A 5F5CA 4UFNA 2R071 2WNUB 3F3KA 3U3DA 3AIIA 2XNJA 1U7OA 5D5QA 5SYMA 1XZHA 3V56A 4JB3A 3WXPA 4F11A 1W85A 5B2FA 5JD4A 1WPGA 4M0EA 4BE7B 1NKGA 2Z5LA 3IP5A 2ZMKA 2VNAA 1SY7A 3PUHA 5EPEA 2HF7A 2VVDA 2WDZA 4QBHA 1J21A 1ZJJA 2EDAA 2MEV2 1E60A 2LIVA 3A4TA 4P9LA 1Z2EA 3OUJA 4RD7A 4M8IA 1Z07A 4FR5A 3OMWA 5JBQA 2WAMA 1QK4A 2Z6VA 3ONVA 3QFHA 1GGMA 4F4IA 3GGJA 4BMCA 5BNZA 1J23A 2VJQA 3DTTA 4HXYA 2WL1A 4MINA 2DUNA 2UAGA 5I9IA 1RAIA 3VI3B 1YC5A 3JTEA 3DVAB 2JDHA 5EP9A 4FMCF 4X1OA 1F5NA 4MB0A 2A0UA 3L92A 1KYWA 4B80A 3D8UA 4ZS2A 1P81A 1Z6GA 1SWWA 3OCXA 1G21B 4IFTA 1FVHA 3BUCA 1XZ8A 3F9RA 1N0UA 2Z1NA 5IWFA 1UMHA 2OXEA 3MUZ1 2VCMA 2EKZA 2R5FA 5HPOA 1E2DA 3DUIA 2B83A 4X9XA 5DMYA 3KU4A 1VQ1A 3KELA 1HN1A 2PAEA 1MGPA 5G0VA 3VAYA 1X2BA 2XJSA 3OX1A 4YW4A 2ZM6B 1M5RA 5AK6A 1WLTA 4R2HA 1QX3A 2HSDA 4YI5A 4G4SP 3K7EA 1H65A 3II6X 3FPJA 1EINA 3MXTA 2WUVA 4UFOA 4WNCA 5A3RA 1QJY2 1TZCA 3RLFA 1E3MA 2CJWB 1VBKA 4UEWA 4A0SA 3P1JA 1PLKA 2V8OA 3T4VA 1I6WA 4GMGA 3UK1A 4EVQA 2CLCX 1UBKS 1P1RA 1FDVA 5C4WC 1FSZA 1NN5A 2YUIA 1IONA 1E1NA 1E3WB 4DJJA 4Q7MB 3PITA 2Q0AA 1M6WA 1T2XA 2IXFA 2OXRA 3WSTA 2GVDC 4A7ZA 2OXTA 3KX2A 1AUQA 3ILVA 4P8RA 3NOQA 1POWA 4MGIE 2JDKA 1T26A 3IEIA 5CAEA 2X2EA 2HWD2 1GJRA 3DN7A 2JE8A 4BO0A 4R31A 2W98A 2VRCA 1SFNA 4LJ9A 4B6JA 3RJ5A 5EV7A 3TD2A 1DPFA 1OBOA 2VL4A 1XE0A 1E0JA 1FFDA 3BD6A 3IT2A 3VUEA 3TQFA 3HJCA 4ZVVA 1PX0A 4DV1B 3AMHA 1UKCA 1Q6ZA 5LLDA 4Y5TA 2CCGA 4HNGA 3NNLA 4DM3A 4R8HA 1U90A 2FOXA 1ZHFA 3SQOA 2NZJA 2VHJA 2PX8A 3BGIA 3TWIA 1RUF1 3OJCA 1LDNA 3VR6D 1Y33E 1VPDA 3MEPA 1UK9A 1UMCB 3SLRA 2RG1A 5IUJC 5DNVA 3BMOA 1I24A 2I8LA 1EUYA 4KTVE 1W2OA 5ISLA 1UAYA 4QO8A 3BGAA 3LD9A 1VIMA 2YHIB 3SN6A 1BCRB 1I5RA 3JQGA 1R0RE 1BRMA 4OHUA 1JW6A 4KPUA 4CM4B 3ESZA 3TNYA 3QEAZ 5KHOC 1IN4A 5FT9A 1U98A 1XB9A 3EDMA 3W6OA 5DGTA 1JHMA 1VRH3 5IJ9B 3WGVA 3DAGA 3VKUA 2O5RA 3EXEA 3WYDA 4BVHA 2PY6A 3VGIA 3G7NA 1JDUA 1RXUA 5DHAA 1FUKA 1ORHA 2YV4A 2I6GA 2V0GA 4F5YA 2B45X 3AGQA 1H8TB 5KCMA 2X2FA 4O4LF 5E8AA 1DAKA 3AYXB 1NQOA 4Y0NA 3NH6A 2YZ4A 3WAKA 3P6BA 3DL0A 1MEC1 2P9GA 4UFJA 1ONSA 5F8PA 2PS3A 5LK5A 3LCUA 3O4RA 4CDQA 3DTVB 1GG5A 5BNNA 3FTFA 2WTBA 3ZE9A 3ENKA 4POAA 2PRKA 3ZZ1A 4X6QB 1KU6A 2L18A 4CE6A 3PJGA 2JS7A 4GLLA 3IOBA 5A1JA 3P97A 1XZDA 1THMA 1WP4A 1FY2A 5JU6A 1W85B 2ZEYA 1EPUA 2M9MA 4QFDA 4Z7OB 2GM5A 4U00A 3UJ8A 1P9WA 4DZRA 1IFXA 1JBKA 1IC6A 1S0JA 5IKPA 3DTNA 5ALHA 4QT6A 2ZJ2A 5E6UA 4GVXA 1DX9A 1DF0A 3DDUA 2C4KA 4JIGA 3PPVA 3P0FA 1I4DD 3DE1X 1V7PC 1JYNA 3ACDA 3CN7A 2PR7A 2BFNA 3IP7A 1KVSA 4EY7A 2DWUA 4YRBA 2UYAA 1YL5A 2QN8A 1BHJA 1CJSA 5JNRA 3VSDA 4TTRA 2BVNA 3HQRA 4BU1A 2ZX1A 1G8SA 2COUA 5D00A 4HH4A 5K09A 1GR1A 4IHJB 4N43C 4CI9A 1VJRA 5K2MA 2H5JA 3G5AA 5D7BA 1FFEA 3NX4A 1I5EA 5FUIA 2E2WA 3WZLA 3TUJC 1QMGA 1YQXA 1CK4A 4DY4A 1YIDA 3NYQA 3PKJA 4B6OA 4QG7A 3WXMA 4RDHA 3FOZA 2AEEA 4BY9E 1XVAA 1I2ZA 1D4OA 5CMLA 1QTRA 5B6IA 1VHQA 3BE4A 2D2FA 2Q0QA 3HBMA 1PFYA 2BGJA 3ONFA 1QOTA 4CLXA 1E66A 4ND4A 1YV9A 3WXBA 4G1UC 4RLQA 1FSSA 2PZKA 3BL8A 3LC2O 5IARA 1TUEA 1TE1B 1ONPA 3K16A 4FT2A 1YZNA 1DTWB 1YT5A 4BXOA 4EFLA 1NLRA 5A6XA 3DOEA 4GE0A 2DH6A 4AQ7A 1MCZA 4JNKA 4BGEA 3LZCA 2P6CA 1KAQA 1RLOA 1DXQA 5FA8A 2JHCA 1OWPA 4BU0A 2YC4A 4EDFA 1KOJA 1IH8A 2GH2A 1WMXA 1UJMA 1MT3A 1VXOA 4YAIA 3FYUB 4XF9A 1GYQA 2JNWA 1W6MB 5A1AA 2RMU2 3JWEA 5DTJA 3ITDA 4LEJA 2FUEA 2O0OA 3U7GA 1YTUA 5I8YA 5I9NA 2OXBA 1H6BA 4K9MA 4AROA 2ADMA 1UDAA 2VK2A 2HLDA 3KLNA 1SURA 4XASA 5KINB 1Z22A 1DGLA 4LBJA 1V5GA 4YJ3A 2YXLA 3S29A 4PO9A 1FPMA 4RV4A 3ZKUA 3JQ9C 4CUJA 1NX9A 3GRPA 4IIVA 4WNAA 4FMCB 3ZN5A 2PHXA 1L7LA 3VZNA 1QXRA 3RJMA 4Q4Y3 1VBD3 4GH4C 3D5OA 3A1EA 2ILTA 1J07A 4TWZA 1EWYA 1WW2A 3OEYA 4QDQA 4KWEA 4M3CB 3Q8LA 5FZ0A 1O7JA 2O8QA 3L49A 2W91A 4XFGA 2B6NA 3VNBA 3GLFB 1T35A 1UBJS 4LBLA 3CX7A 1RJGA 2ZGLA 5TMPA 5CFQA 4Y3UA 2YXBA 1FEZA 3E4DA 4LHKA 1CY7A 1YASA 4BP1A 2IU0A 2VF4X 2DGDA 4LO5B 1RUNA 4A8JA 1QMPA 1D3AA 2WMOB 3GH1A 5LMNB 3KTOA 1XWFA 2ZX4A 4P7KA 1V47A 2WIKA 3BWBA 4QODA 4OQ9A 3UW3A 2OWEA 4YIHA 4XX0B 2BSQA 4NZPA 2LV8A 3A9UA 3KB2A 2IVIB 4IQPA 1QUEA 4AZVA 1O9BA 1HE5A 2G04A 4QFBA 1RI3A 1CXZA 2JLXA 1AGNA 1XK7A 1RUH2 3ZWPA 2FW7A 3A1WA 2ZROA 2JAXA 4U2DA 4FGKA 3C6ZA 2WINB 1VSUA 3H1YA 3R9XA 2J9GA 2MYTA 2WDPA 1K5MB 3CIFA 4MMZB 4QTXA 4HHEA 1H8TC 2ZAOA 5K5EA 1YO8A 2V7QA 4GVPA 1NMQA 3WWOA 3VPBA 4UBKA 5D87A 2OV1A 5DEOA 4PQRA 1BFKA 1BE8A 5A4IS 1TJNA 5A3VA 4QGAA 4XDHA 4KWIA 2BW8A 3OY2A 4RVOA 5ICFA 4V3CA 3D64A 1TEHA 1IKQA 4Y6GB 1DRUA 3B6IA 1VG9B 1C9YA 4AL4A 2NZWA 2E87A 2G71A 5ITZB 4HDOB 3WLOA 4UHHA 5E3HA 4WHMA 1BH6A 4N8MA 1CD3G 3AL5A 1NXPA 3AO0B 1COZA 3KNZA 2YFUA 3POYA 1NUTA 5EXOA 2TYSB 7YASA 3REGA 4AJ4A 1S96A 3IPXA 3KUUA 1Z4OA 3JD2A 1ZK0A 3N0RA 4Z4QA 3DXYA 1VMIA 4N9QA 2JG8C 3HVUA 3FDZA 2VBGA 4Q21A 3TIXB 4L0QA 2YCBA 3DS8A 5IS2A 4J1TA 3QQ5A 2P3OA 5KXDA 4MITA 5DISB 5JI2E 1HFEL 4ORFA 3IO3A 1R27A 4URYR 2OBMA 2A3YA 5DDIP 3IQHX 2YBPA 5BY5A 3SF8A 4D3DA 3CLSD 2G28A 3VOTA 4M1ZA 2CAVA 1SC6A 1J5PA 1JIIA 2WJZB 5HKAA 1E64A 4KDEA 3LF2A 1FYEA 4CQMB 4RSGA 2PHRA 2OBFA 5JXGA 3IDFA 1P2UA 3AVTA 4NIDA 8AT1A 4CXMA 3AG6A 1IXRC 4YRFA 3K3NA 3KPWA 4MK4A 5A4FS 5IN5A 1U0GA 3GDBA 2PAFA 2BFCB 3C6MA 3VH3A 4E4TA 1AZDA 1J1UA 2PUJA 5FAKA 4FIZA 3EDQA 1DKLA 3WL5A 5D2AA 1V1RB 5IYZF 4O4IF 4CIYA 4UCWA 4YREA 2WS92 4UU8A 5AVJA 5KYNA 1ETUA 2YQ5A 2CLDX 3EWNA 3HKCB 1WMSA 3ZS8A 4Y24A 3C97A 4A9AA 1AL0G 4AQTA 4MNTA 1V5WA 4N9IA 3R3JA 2Z4TA 4NR0A 4YLYA 2PJZA 1YOVA 2KWIA 3RANA 4GM4A 1E3LA 2FY8A 4GX2A 3WEZA 3FSRA 1Y3CE 4ZGGA 3IVXA 1EXDA 5KYTA 4X6YA 5H81A 3VD3A 2QVSB 1EE1A 2CF5A 1DZQA 4DDKA 2C1ZA 2V4ZA 3HXKA 2J1AA 2RHDA 4PNZA 3Q6NA 3AYCA 4Y6SA 4BX0A 3AP7A 2OE2A 1FTNA 4BCBA 1UN1A 2JVKA 5CG2A 2VNGA 3TLYA 1NONA 4ZZ3A 1EE9A 1OXXK 2N1BA 1M1YA 2WNVC 1T0PA 3GMIA 3HEAA 1Z7YA 3UJNA 1PR2A 2FSFA 3ON7A 3HIFA 2WF8A 3ZDCA 5D2CA 1P1CA 1SK8A 2D98A 1NW9B 1EVIA 2YS7A 3BZUA 4X91A 1KIFA 4ALJA 1GWNA 1ZX1A 4OYLA 2AD1A 4M98A 2YRFA 4N4AA 3G82C 5F3DA 2VOXA 3VBOC 4FR2A 2FHPA 3A6PC 2UWCA 1LVGA 3SQDA 3E3NA 2HMVA 4PGHA 2BFEB 5DDJ2 2XOXA 1TCUA 3EWSA 2I78A 3AWDA 3HVIA 3MW8A 4KMSA 3RU2A 2GXUA 3EOZA 4GI1A 1OZ0A 2QE7A 1P2BA 4RMGA 1A96A 4BZQA 4LUMA 4JZRA 3G8DA 1NXWA 4GR9A 4KN9S 4OX9Y 4RIEA 1MJGM 1KI6B 4DQDA 1ADCA 1NBAA 1RUI3 3BCWA 3MTDA 4JP8A 1YZQA 2P2GA 3G0DA 4LUCA 4KZKA 4QYTA 3BZWA 1BBT1 3EZFA 3R7WA 1LF0A 3WCRA 4NTZA 1SHZA 1H23A 4LK7A 1Q3HA 1WZ2A 2PKRA 2VAVA 3T2QA 3HLYA 3R40A 1Q15A 4HGNA 4DZTA 4GO1A 2WWFA 2B42B 4ZT2A 1JKFA 1YBFA 2Z5FA 5NLLA 3WDVA 1FMD3 3O5AA 5IBQA 3B8EA 4FE3A 3OZ7A 5JFOA 3ONWA 3CF4A 1TK9A 2V7EA 4OK3A 3C3VA 1PGNA 1G4UR 3HUFA 4LYDA 2CLHB 2HJRA 2MSWA 3UIEA 4HTFA 3ZXEA 3EPLA 4ZC8A 2YXNA 1SUFA 1YI7A 4LXLA 2GB4A 3A1TA 4CM7A 1W2UA 3ZCQA 4QLOA 1RYEA 3HDHA 3KHUA 1P6QA 4YT8A 2V7VA 1RUJ2 3ZYHA 4RFSA 2X15A 2KLHA 1C41A 4PZDA 4MWDA 2PXJA 2AE1A 5HILA 3VTFA 4ITCA 1E9BA 4QB2A 3TGWA 3USSA 1P2FA 4AVTA 5FBZA 1MAVA 5C8CA 4LE3A 5ACA1 1JSXA 4D6PA 1GKLA 4P9XA 1I94B 4M8KA 1NE4A 2OVUA 1JG4A 5KTKA 2JKYA 2GEDA 3HRKA 2HYDA 2IWGB 4UBIA 2OYZA 4MI6A 2F55A 3I39X 1FVOA 2HO4A 4V0MA 3WMRA 5I3ZA 4CQLB 3HN6A 1IHUA 1UZYA 2N42A 3R24A 4PR0A 4XDOA 4EO4A 4WK2B 2EA7A 3ZXJA 4GA9A 2BUAA 4GWNA 1Q8PA 1HOTA 5JSKA 2NSHA 3NASA 5GJ6A 4A3XA 1ND2A 4BL5A 3EO6A 3D3WB 4W7HA 1BS2A 2CDRA 4OQ8A 1N2HA 2QDXA 1N8KA 4ET7A 1PT7A 3JYHA 1ISMA 4I2NA 4IE5A 1S55A 1BH2A 2XRMA 4IYRA 2HWE2 2PH3A 2REOA 2C58A 5HFJA 2ZYTX 2BGMA 5K01A 4ONEA 1RHI1 4GEGA 2QYHA 1OXTA 1XZBA 3NBMA 1E1RD 2NM0A 3ZFGB 1NKTA 3E9DA 1U8EA 3UFXA 4RCVA 4K2AA 2Q27A 3GEIA 1US8A 3O0VA 3K4AA 4P34A 1ZH2A 1GQ2A 3NT5A 5IBPA 1RABA 4BRUA 1ZD4A 4AJJA 2IP2A 2Z3WA 2NQYA 4XF1A 2Q1YA 4WBSA 1SRQA 2EARA 4YWHA 4RH3A 2ZE8A 4RL7A 5T4EA 1QS0B 1WOMA 2NO4A 1P6XA 5CVDA 3HCBA 1W99A 1D04A 1QR6A 1JSRA 2K5UA 3H2GA 2H65A 5DLYA 4FHDA 1CONA 5COQA 4W5OA 3DL3A 5FTTC 4RYLA 2XD9A 3DHYA 4MJLA 1G86A 3OLVA 4CCEA 3MIBA 1VTKA 2CDCA 5EHNA 1JL3A 3RARA 3AVQA 5CFLA 2CHGA 2O3JA 5AC92 1OIVA 3CZ5A 2RCNA 4WADA 3CTMA 2V3VA 3MT8A 3RRMA 4LO8A 5CVRA 5FOJB 3QV2A 1KU0A 1Q56A 1F06A 2JLUA 2OD9A 2QKDA 2CMHA 4BQYA 1G63A 1GDDA 3B02A 3M34A 3NNGA 3HU5A 2OA2A 1E0DA 1S0GA 2CMDA 5BPFA 3L6BA 3NTUA 4TN1A 1RWPA 1T8TA 3M83A 5FO9B 1EGQA 1T2VA 4M7WA 4X85A 5GONF 4RHXA 3DCYA 2F7SA 3OX4A 4WOPA 5D1IA 3WY9A 3CMMA 4ZV4A 7AT1A 3GUVA 1SQSA 3RREA 1PWEA 1UNBA 4JLUA 3VBFC 3IEVA 3OGJA 3SPXA 1LULA 5LOVB 3O1IC 4S2EA 1CZUA 4BYYA 3IE0A 3FROA 1AQIA 2D06A 2DETA 4EQ6A 3K6JA 2F8SA 4Y2RA 3F6BX 3A32A 2WYSA 2OB1A 4YRLA 4YM1A 1YDMA 4JYBA 5DAQA 1VKJA 4DRXA 3IQIX 2DWRA 2GAUA 1BE1A 3FUXA 1GILA 2ANBA 1N32B 4MV6A 3HXTA 5JRJA 3UENA 5LASA 4HXCA 3RVBA 3H0OA 1X1CA 4MPPA 3ZKYA 5AWFC 5FOBB 1BRTA 4UCXA 4GPAA 4F06A 5THXA 4UPEA 1HYBA 3GLKA 4G36A 1EG7A 3F47A 4KN8A 1DAGA 4GOKA 4JI6B 2P2YA 1NNLA 3NRCA 1YIOA 4WZ6A 2PD3A 2YHJA 3O95A 1ZI9A 3KJEA 3DYBA 3GFVA 4Z2WA 4PI2A 3EH2A 2WZEA 1T2UA 1CE8A 1H2WA 3EZ7A 3OJWA 2XGGA 3EEBA 5AQEA 2PGXA 2HNAA 1J2TA 3THRA 2PDAA 3S5AA 3X3HA 1J9GA 4QQKA 2B92A 3LCRA 4WZAE 4I1PA 3MHTA 4QAQA 4E8DA 2R7LA 1F9KA 4O1IA 1Y8QA 2VZ9A 1W5AA 1Y1KE 3LIPA 3PTYA 1CHDA 1XB2A 2PELA 2HBTA 1U99A 2ODEA 4B1LA 3AESA 4IV5A 3ESCA 3N2IA 1NP7A 2WKQA 2VSFA 4HN2A 1X7GA 4QYXA 5KVVA 5E2AA 1IOWA 4IEYA 1SKBA 4E5YA 5IP5A 4RULA 4CN9A 1OV6A 1D09A 4L9SA 4DIQA 4TN7A 5IG2A 3K77A 5CCXA 4M22A 2OESA 4KDFA 1RMYA 4KNVA 5AM1A 1E5LA 2A2ZA 2FPIA 2HV8A 4EUKA 2X9VA 1KGSA 1X7WB 3VHPA 3EUEA 4GKXA 4I1VA 2C9BA 1YZKA 4ZAGA 5JS6A 2RC5A 4QHBA 1RXEA 3H2YA 2XXJA 4LXXA 1HLGA 3X1ZA 2J3DA 5BV7A 1E94E 2C0QA 1RM3A 4I4IA 5ADHA 5IK7A 2OUJA 1O5LA 1W6PB 3PXXA 1A5ZA 3A0RB 4E11A 5DHSA 4C0BA 1F2UA 4BNMA 2W5UA 1DC7A 3WL8A 3Q10A 4F21A 4RK5A 3AKZA 2FN8A 1KS9A 1U5YA 3EZXA 3FI0A 1DO2A 4BISA 2QD2A 2HWWA 3N2KA 3CMGA 3CL1A 4GM0A 4JLBA 1XK6A 1JG7A 2BZSA 3WHTA 4RA6A 4I50A 3E7WA 2I6TA 4QNRA 4DMCA 1Z6AA 4LCBA 4HXGA 4GOMD 4MW9A 4BB0A 3PVEA 3GDFA 4UPVA 3A23A 4IESA 2X19A 3NNNA 1NLQA 1LV8A 1UKYA 3I3BA 2VPQA 1EVQA 4KOAA 2RE9A 4DUGA 4OA5A 1DRVA 4QM8A 3U1XA 3LLCA 1BU8A 2EZ9A 1ULEA 4YHBA 1Y42X 5TDHA 4RE6A 3F49S 3D2CA 2ID9A 5ECDA 3U2QA 5IFLA 4D6RA 2Q5FA 2XMBA 1HI9A 4RMNA 4TS4A 2XUGA 2J1TA 2IEZA 4RNDB 2J9YB 2WS93 3OETA 1DJOA 5C8XA 5JAUA 3RYRA 1C1YA 3OEBA 3H5VA 1NM5C 4X6RB 2W95A 1OE0A 1P1BA 1G2OA 4WINA 2GTPA 1P4AA 5LP6C 1GOTA 2Y64A 4PC6A 4ETNA 2I45A 2QZZA 4PYQA 1CD5A 3U10A 4MGHA 4PCRA 1O08A 4DMMA 3AR4A 5H70A 4XFKA 3U9TA 1V25A 3BERA 3LA3A 4YVWA 4Y6RA 4LIUA 3JTMA 2P4EA 1E4VA 4JKIA 1T8WA 2I74A 3QELA 4QTTB 2DUQA 2P9QA 3TR5A 3EVNA 3ZCPA 3AYEA 4IZHA 1GRVA 2BM9A 4L8GA 1N25A 4C0HA 1U9ZA 3JQEA 3HT1A 2H1VA 3WDKA 4WM8A 3WNQA 1OPMA 1PJAA 3ABRB 4QKBA 4Q1PA 3QIVA 1V4BA 2P6PA 3C2QA 3IKVA 2C3PA 2ZRHA 4CEHB 1H93A 1QFZA 4NMIA 2WO1A 2MTBA 3KKNA 2EFJA 1ZVVA 1XMOB 2LGJA 5CHYA 3DP9A 1WKVA 2OL4A 4RGBA 4B2LA 4UBLA 2GM4A 5AW6A 3TEXA 1BN7A 2C4WA 4YP1A 3DAPA 1TADA 4GZ9A 2CVHA 1UKGA 1TKCA 3O1SA 2CXQA 4KC0A 1TQ8A 1K6MA 4IL7A 3O8OB 5EXDA 4QWNA 2AXEA 3IP8A 4JXJA 4XAAA 3ZY3A 4UXAA 2Y1GA 4IUDS 4GUDA 2YINC 3PF8A 1OC4A 2DVMA 3WGMA 5BN1A 1X8MA 1WD7A 1F4AA 4PBPA 4E27A 2NYYA 1UYXA 5LA6B 2P40A 4CM3A 3MLKA 4YJKA 2O2EA 4K6GA 5ERXA 3OCJA 3Q8XB 5JOYA 5IVPA 3SXUA 1DOAA 1BBT3 2YB7A 1NCRB 4NWVA 2HQRA 2XB8A 4HX9A 3UAVA 2E55A 3ROXA 3ZCSA 4V38A 4A7YA 4MVTA 2WV9A 5FX2A 1SBZA 3NORA 2ZACA 1AKNA 4ITVA 4GP9A 2AGVA 1K66A 4EG5A 1CZNA 4R40A 4H0NA 2RBGA 1JDNA 3W5MA 2B8MA 2V7UA 2OAEA 2VUUA 3SD7A 1N9GB 5GZ1A 2QG4A 1YFUA 1JHUA 2Y92A 5JFTA 2H16A 3INRA 4IG4A 2HIAA 1GP2A 4RVCA 1II9A 1PCXA 3WNLA 3BDIA 4QM6A 3EFHA 3ZUPA 4X61A 2YY6A 5LB6A 2O7NA 1E92A 4PICA 3U13A 3LDFA 4ZU5A 2Q1FA 2BI4A 1PGL2 2Q3EA 1BA3A 1N2ZA 4RLFA 4QB6A 2I2DA 4HRVA 3DJYA 3SIWA 3RVLA 4QT4A 1UXIA 2JB4A 2XADA 5JCOC 2IZ5A 3J7NA 4E15A 5FY5A 2BSXA 2AQIA 1OD5A 1E9SA 3NT4A 4BEWA 1E59A 1NVVQ 2VSQA 4MMYB 2JIMA 3FCSB 1V35A 1SXPA 2OFOA 5LRSA 3JS5A 4QWWA 1W94A 4UEOA 3S27A 4FPKA 1NASA 1MIOA 5LY1A 4BU2A 5JZOA 1S0UA 3HKDA 2PTGA 1KPHA 1G3QA 2CLSA 1G2QA 1Q1GA 4XCBA 1N8TA 1DKQA 1ZA4A 1ZBA3 3RTEA 1SOAA 2BM8A 3AYAA 1QC5B 5EP3A 2RKWA 2JPDA 2V7BA 2VPVA 5JMWA 1XD2B 1FCJA 1PEKE 5A3SA 3IDEA 3IMCA 5A06A 3YASA 1W9HA 3ZHVA 4BMBA 1ZJWA 4S0ZA 5EYYA 1JEOA 1E6CA 5CR9A 5KJFA 4PIXA 4Q19A 1RHI2 3RG0A 2NO7A 1KJ8A 3R4DB 3OM1A 3TDNA 3FVQA 5DNUA 5GLUA 4IERA 3SFZA 2CV6A 2V54A 2QRUA 5AHOA 5F7OA 1J8MF 2W68A 3EQ2A 2Q4BA 3VO1A 3USCS 1OWMA 4WKCA 2QTVA 1FLAA 3MN1A 3TO5A 1D0HA 1C9MA 4WM8C 3ZZ0A 1JU4A 4BVBA 3G17A 3PXDA 2QVYX 3ND6A 5HF6A 2X10A 2XJ4A 3T1LA 4E0BA 1HL7A 3S5JA 4DXSA 1EJ2A 1U3UA 2IU6A 4QXMA 2P3JA 3NWEA 3GMTA 1SFYA 1SC4A 4HYEA 5FWEA 5FHRA 4M4PA 3IAQA 1NQAO 3T7TA 4O08A 3GXUA 1ACCA 5CNIA 1D2SA 4JI3B 1LPAB 3N2EA 4K6KA 2PZJA 5LP6B 1VRVA 2VUHB 3HCDA 2FP3A 2G9UA 1GP4A 1XCMA 2PKXA 1TNRA 1N33B 4KFRA 4Y30A 4RMHA 4BO6A 2KMLA 2VKQA 2WFMA 3HDGA 5LOVA 3WGLA 2D1QA 3I04A 1CEQA 4EY8A 4BBAA 3C6QA 4C6HA 2XHNA 3DKVA 2WILA 3UHAA 3GCGA 1P5RA 4QVKA 2GK6A 2I7DA 5C18A 4CKYA 1NY71 5FPXA 4Q7EA 5AJWA 3BWVA 4TZKA 5AKZA 4I19A 1VHJA 1N8NA 4DV3B 3PWKA 5FB3A 3RQIA 2GMMA 2C5LA 5BR7A 1KEKA 4DMGA 3BFVA 5JZMA 4J0DA 3K71B 2ECKA 3V2HA 4YRKA 3K09A 4ZMBA 5FZ7A 4MUYA 1N3LA 1NJGA 4RFRB 4OCZA 1QHHA 3S7ZA 4B1FA 3T41A 3CF6R 1TKRA 1YHYA 4DLLA 1HT1E 3ILHA 1ZU5A 3DKRA 1TL7C 2ASVA 2JFZA 1QAOA 3VR3A 2HA2A 1WDKA 4ZMRA 13PKA 3JVDA 2CBXA 2YV5A 2OQ7A 5ALIA 5ITVA 2RMU1 5L73A 3OGSA 1ND3C 1UPXA 2PXCA 1JA9A 3B70A 4B3FX 1PK6A 3WLLA 4B46A 1CJBA 3ADCA 2ZXQA 2D6MA 5FY4A 5DTEA 3GNSA 1UADA 3FDZB 1EUTA 1WCV1 1EV11 2NSYA 2Q1WA 2XF2A 3A14A 5KUTA 3WLPA 3N2YA 1LQTA 3SJUA 4GC9A 1HRKA 4MRMA 4X7MA 3H9QA 3TMAA 4MR7A 4CJXA 2VVEA 2I33A 1J39A 4IDOA 2QK4A 2QQKA 1EAH3 1CEEA 5DHRA 4LXGA 4LULA 5FBLB 1JEDA 4CF5A 2PX4A 3LW7A 5FTKA 2JZCA 1KXZA 3AV3A 5FPQA 4JBWA 1QNYA 4AJEA 4EHKA 2BBTA 3EIXA 1B41A 1ZESA 1TAQA 3F4BA 1G16A 4B6PA 1Z28A 4I66A 4IG9A 2CYBA 4D79A 4BFZA 1MT0A 4GDMA 1MOQA 3VTAA 3L0IB 4J3NA 3VBOB 2FEOA 2NSLA 4QOSA 1W36C 4LXYA 2CEAA 4DLYA 4PFJA 2O3SA 5EIAA 4H4CA 1H69A 2ZT7A 1ST8A 1GRNA 4NATA 3T0AA 4YPJA 4ZCQA 2IXBA 3KZ1E 3M4YA 3X1DA 1Y5RA 1Z2OX 2VTBB 1Z4IA 1QAQA 1TC1A 3K6SA 4I6JA 1C1DB 3ELWA 1NHWA 1AUPA 4IDFA 2A14A 4TYSA 2GTHA 1NE7A 1XRPA 1V9LA 3PVSA 4B75A 4FBMA 3HABA 3DKWA 2Y26A 5LB4A 3A1UA 1QFYA 4WH0A 1YB5A 1V9U2 2VPIA 2XT9A 4MW5A 3MWEA 3J8F3 1I1QB 1AK9A 2C7PA 1UBUS 3MTQA 3QXHA 1RITA 2BTOA 2H00A 1M2HA 5CFNA 1L5MA 1TZBA 3G1TA 3PFNA 3DTYA 3JBG3 4F4HA 2NACA 4XUQA 5FLXA 4U2GA 4PZCA 4BK5A 1IDOA 4MI9A 1SHLA 2Q8CA 4NCKA 5K0GA 3L2YA 3WFZA 5GLWA 5P21A 5EZYF 2HWF2 1TYEB 2PFWA 5KJEA 3KVBA 4YGEA 2P9JA 2G7MC 5DT9A 4N7UA 2XONA 2HH9A 3A9WA 3G2LA 4B40A 5MN4A 3EDYA 1CSEE 4QPNA 4YK7A 3L06A 3C0KA 2XNKA 4OAQA 4QICA 1Z68A 4MS1B 1YQ2A 1L7EA 2H2FA 4W8GA 3DXZA 1ODSA 1JTZX 3ZY4A 1NV8A 5FQ0A 3ZLBA 4UNNA 1BK1A 4F1WA 1MJGA 2JGRA 1AZWA 3WW2A 4DM4A 4NOTA 3ZHOA 4EUEA 4BN5A 3UKVA 5CIWA 3OGRA 2LP4Y 5GVSA 1D4ZA 2DU1A 3ZU2A 3QPUA 3RUHA 2ZX0A 4A45A 3FB1A 1ORRA 1AM4D 4FT4A 4IHQA 1K3IA 4P14A 4QM7A 1VBA3 3O9ZA 4B35A 4AI0A 2XXBA 2RKOA 1N3QA 3BREA 3DOJA 2HA6A 4HN0A 3R7WB 3UL2A 5KU7A 2IWRA 3NT2A 1B3RA 3ABZA 4LYAA 1IGOA 1W35A 4ES8A 5LA0A 1Z3IX 2F3UA 1E79A 1A88A 3RNLA 3ZDVA 3X1MA 1AXEA 4R2IA 1QTIA 4R9SA 5JZVA 2HWXA 1WZEA 4MQ4A 4V0ME 2VF2A 3KKEA 1TT5B 3WNZA 1K7EB 4A27A 2P0AA 3B6ZA 2CB9A 3CIHA 3SH3A 2IHVA 3AJAA 1CCWA 1S1CA 1MV8A 5J58A 1JVBA 4FSDA 4EDHA 4IF4A 3DVRX 1Y0BA 2GZ1A 3U3MA 4F6RA 1LU2A 1UBRS 1JMYA 2VDWB 4TVBA 5KYWB 3RFXA 2JG9A 1OX4B 1P72A 5JSHA 1C4XA 4RELA 3T9EA 4QD3A 1HKDA 2WF6A 4B8EA 1PL7A 4Q00A 3ZYPA 4GWJA 1HE2A 2DVAA 4EG0A 3OQJA 1CY2A 3G8BA 1NUPA 3EXHA 4MV8A 4A73A 4COKA 5DQ0A 2Z69A 2IXIA 1J6UA 2AC2A 2XT0A 4HLDA 1C7EA 4IIJA 1M8JA 4LDJA 3PHHA 3LOIA 4K8FA 3BDVA 4ER5A 4CM8B 1SXQA 1AGYA 4TYNA 3F6EX 4M54A 5FCCA 3ICPA 1NDQA 2GEVA 2NNWB 3ETGA 4ZOBA 3ELNA 2ZEJA 3FPAA 2J3KA 1MAHA 2ORWA 1D0VA 4BRZA 1MA0A 2ASEA 2ONJA 2DPGA 3TAHA 4EG7A 2B36A 4JLMA 3PLNA 5CU1A 2PUTA 5LATA 3ZWVA 2VE1A 2BWAA 5FI3A 2O8DB 2PWBA 4YMLA 1ZN9A 1GEEA 1QANA 4XBLA 4U2FA 5F39A 3DKPA 1QGDA 4DIEA 1W8TA 1YRBA 3HI6A 4I1IA 4TT3A 4WZFA 3PA8A 1IE3A 3ANMA 3ASZA 4NOKA 3WGTA 1XQ9A 2VD7A 4COUA 1JR4A 4W63A 5EP4A 5JSYA 2VTXA 1AVBA 3L9JT 3SM9A 1VFPA 1HYQA 4FD2A 2IHJA 3WKAA 4JSTA 1YQ8A 2RS53 1PTJC 3PIGA 4ALNA 3VBOA 2RK6A 3O84A 4XWAA 2EXKA 3LUKA 2K7FA 4GKJB 4MCAA 4AURA 3JQDA 3H17A 3DHEA 4C0WA 4DREA 3CRRA 1HNWB 5C5IA 1DAEA 3E9EA 3ESQA 2FUG6 5KBYA 5IHXA 5EUCA 5DBIA 1FYUA 4BQFA 5DUXA 1PDOA 3WQQA 4OPMA 1RI5A 4A0GA 1BKDR 1KP2A 3E1SA 2ZREA 1Z6QA 1W8FA 2PD4A 2H2HA 1G6Q1 3ACHA 3FMVA 1L5SA 1ALYA 4G4IA 3QEMA 4ZV7A 5DNCA 1ZM1A 3JYLA 4N7RA 2OCXA 4UF0B 3V6MA 3EAFA 3JPWA 1GUDA 2W90A 3F9IA 3W6PA 4C89A 4N9HA 4NYIQ 1M76A 4RH1A 2N0SA 2XB4A 2W1SA 4QUDA 2QQNA 3DF7A 4AGGA 2HKIA 4MPRA 1OVMA 1H4VB 3S2IA 4Q3CA 1KL7A 2WAOA 3HKBB 4A03A 4Y1VA 2BHLA 5A5VA 1GFIA 3MWKA 3EUFA 2Z4RA 1YB7A 4AN0A 3LDGA 1D0SA 3DV9A 1X3SA 2IUEA 2NZ8A 3FA2A 4ZCMA 5IKEA 4OVEA 4LYJA 1F0PA 4Y4RA 2DP4E 2FZGA 5FYSA 4CG0A 5FLHA 1Z17A 1C1FA 2C8JA 2A5DA 5F7ZA 3AHEA 2J59A 2OECA 3IBFA 2C2HA 2CWDA 1QZUA 5AFBA 4EARA 4XWGA 221PA 4PNHA 3B1YA 2O6LA 1YACA 4ANFA 4LRSB 3HQUA 2CL0X 4GH4B 1E1RA 5CK4A 3N75A 3UT5B 2VO5A 1Q0LA 4CKCB 4S2HA 4XR4A 4BFYA 1W88A 2ZI6A 3AVRA 1W9MA 4BAZA 1O3SA 4WZAA 4FWIB 1R8SA 2FPMA 4WFKA 1UY4A 3VU1A 1JBEA 2B3DA 4RHTA 4JWKA 1UFVA 1QORA 2YJGA 3WL4A 4FSJA 3SG0A 4Y2QA 4E4DX 4BUJA 3KXDA 4LNUB 1M6YA 4RTOA 4QGSA 4RZIA 1VHWA 1I14A 2WUWE 4P9GA 1ZG3A 3U56A 4OSPA 1HBJA 4BCDA 4J6EA 2Y33A 5K6AA 1FOEB 4L4RA 3HJFA 5GJCA 1HM5A 4J1XA 1RWOA 2N47A 4YZ5A 4NCBA 4KI7A 5T55A 1I3MA 4LZJA 3OJOA 3HJRA 3O47A 3MCUA 3DGFC 4DO0A 5EXTA 2HQ1A 2F3QA 4GWKA 3AR3A 3TLCA 2ZAYA 5I9SA 2RR13 3KIPA 3NTQA 2UUAB 5K4HA 3I83A 5EMHA 1RHI3 2C61A 4QSMA 5L9BA 4C76A 2EW2A 2FP4B 3QYFA 2H1IA 5FI5A 4MH0E 5K0BA 4NH4A 3BL5A 4PXAA 3IB3A 2D7DA 4BYMA 5A4AA 4PLTA 4D6SA 4HNAA 3DMRA 3D5QA 3C3JA 3WNXA 3IKLA 5C53B 3RJTA 1AN9A 2N75A 2JRLA 2BRUC 3DA8A 1XJQA 3A1NA 2B8JA 2GNBA 1G9SA 2OB2A 4ZAWA 2TMKA 1E62A 3WF1A 2WD7B 2PIAA 1RIRA 1C7JA 3KCCA 2G4CA 4ZMSA 2PANA 4LPSA 3JWGA 2OOSA 5JXHA 2W00A 4MHSA 1LJ7A 3RYHA 3OOHA 3WOHA 5FWYA 5CJ2A 1W2AX 5BSTA 3HJNA 1OOPB 2G72A 1H5QA 3ELBA 4YCNA 3QTLA 4O33A 3JQAA 1ZVJA 2IODA 1C2TA 3FKSD 3WCSA 5E7JA 3QVGA 4P08A 2AZXA 3NEYA 2QZPA 4BJ3A 2P6UA 1T9DA 2WIDA 3JRNA 2GZHA 2CJFA 3CKLA 2PSHA 2IXGA 2E7QA 3WP0A 3SJ7A 3SS9X 1RUI2 4L0DA 1U94A 5TJHA 4J7XA 5BURA 4N76A 5FJKA 5ENZA 1LI7A 4ILKA 4KW7A 3BJIC 5C3PA 2YDXA 4IX9A 1NC3A 4O8CA 1NF9A 1AA9A 4TX1A 4KUHA 5JCXA 1HK7A 4RL4A 1SPXA 2I99A 2BDEA 2H6EA 1GU0A 3BTUA 2JH3A 3UANA 2J5XA 2E49A 4META 3B1WA 4B7ZA 1PIWA 2ZB8A 1MS4A 1E2LA 2J6CA 2SHKA 2I4TA 1UZMA 1SKYE 2FDGA 3JVEA 4GSYA 1NJ8A 3DXXA 2PMWB 1S2IA 3IMEA 3HZZA 1RINA 3KKQA 3PUWA 4RD2A 1WU7A 4FOLA 5LA6A 1LU1A 3A1DA 1Y5IA 1DG1G 1Y6ZA 2PLV3 2VQ6A 2X5JO 4IFBA 5JAIA 1C8M1 3GQBA 2C9MA 2BHTA 1Y5MA 1DKNA 2AEJA 4L50A 2OCAA 3S55A 1M33A 4KGDA 3LA8A 2IUUA 2QP3A 2GK3A 2RR11 2AR6A 4RK6A 4CF3A 4Z4GA 1ODMA 2IZ0A 2WLTA 4Q5IA 2B35A 3NHAA 4NO4A 3KZVA 2NGRA 3LTNC 4FPYA 4DRRA 4FKMA 1QX4A 2R6CA 3AJZA 4TL7A 4J6GA 1Y82A 3IMFA 3KQQA 3V46A 5LNK1 3QBEA 2WNOA 2Z0MA 4LSGA 2W2PA 5CISA 3LFTA 3M8LA 4MG2A 4E51A 1NVBA 2QL6A 1FXSA 2OHOA 4UF0A 3ZWDA 1TD1A 1CR0A 4BX8A 1VHTA 3BICA 1A5SB 1K68A 3DE3X 4R8SA 1U11A 3EYWA 5FL7D 4FFNA 2A3XA 2E4AA 1Q50A 3RYPA 1TIPA 4XYEA 1K27A 1Z5VA 5DBHX 1NCQC 3C3EA 4U2BA 4LV6A 4G09A 3I12A 4M86A 3EWIA 4JS0A 1PW5A 4D82A 1SHWB 1ZNYA 3UMJA 1V8FA 4BVLA 1RYZA 3ZSEA 2X0RA 1WP9A 1JP7A 4E31A 4IVQA 3E9MA 3IA7A 3HM9A 1CQXA 3DV0B 1W8HA 4ZYUA 3RFVA 3QHPA 2ZRIA 1BVHA 1T0UA 1CUCA 4MQ6A 3PC8C 3OFVA 5HBRA 5CLLA 1TQ5A 2Y8EA 4B87A 5DNAA 5FWJA 4UBJA 3K9FC 1KP3A 2J3HA 4KXVA 3ADOA 5B3JC 5M2QA 3GUUA 2AHRA 1AO3A 2QKYA 4MRVA 4JYZA 1JQBA 2ZB3A 3QQPA 5BWOA 4MOAA 4BN0A 2M2IA 2NTJA 3DLPX 1WQ3A 3ZJ5A 1BDBA 1GTJ1 1O59A 3NBKA 4IHJA 1BXRA 1OW3B 3AOEC 2Y9PB 1XTRA 2MU1A 3FYTA 3S57A 1B93A 3I34X 1ZINA 2JGIA 1R092 1O5IA 1JJFA 5HF5A 4Z53A 1NJ6A 2B5HA 3GK3A 1MQSA 4X7PA 5JPDA 3RJ2X 1RUI1 5CNMA 3GLIB 1YCGA 2HBZA 3FTQA 3H0KA 1O6UA 2HK9A 1QHEA 2P9EA 4DV5B 5TS2A 2P6NA 2WVJA 3VDAA 4UI9L 3DPUA 5KZMB 5FZEA 3SNMA 1IDN1 1UDWA 1ZN2A 3QX8A 2DCZA 4TKUA 4RQTA 4LKEA 4Q02A 2VHXA 2J31A 1YMVA 1H0BA 2WS91 1R88A 4IEEA 3KQLA 4BBZA 5JCZA 1XUOA 3HNBM 4LBQA 5L7WA 4BRWA 5CTAA 3L8GA 4NV0A 3TBDA 3VD5A 1E58A 3U6BA 1O4VA 4MROA 1WX1A 2HLHA 4HGRA 2AEZA 4MS3B 4QU8A 2V09A 1PGSA 2W39A 4UMVA 4XIGS 4IDCA 3LD8A 5PNTA 1A2KC 4EMBA 5FZ9A 3URMA 4XCAA 1PGJA 5SZKB 4L3WA 3CNQS 3RWKX 1GCAA 3MMPA 1HQCA 3FN4A 3UYKA 4GOOD 5F1KA 4GGOA 1DC8A 3W77A 3VDXA 3G3EA 3WRYA 1OH6A 5ELXA 3H6KA 1PFKA 5CEFA 2FCVA 5TF4A 2J0EA 3L0OA 5FZDA 1N1VA 3CLHA 4AJLA 5KYVA 4E30A 3BX1A 2Z2ZA 2GN3A 2LBPA 2GPSA 2WIFA 3IN9A 2DLNA 3DE5X 5A1TA 1A7KA 1NQTA 4DUWA 1ZEJA 3UV9A 2ZATA 4DLNA 3RI3A 4LY3A 1UANA 4DKJA 4LBVA 2G5PA 1ULFA 5LP6F 1AY0A 2ZJ4A 1L5QA 3ROQA 3RUFA 3WG3A 1WNFA 2VZ0A 4M00A 2IYFA 1G5RA 4JELA 2QUZA 2GHTA 2IPOA 1U7XA 5FPTA 3IAS6 2XOKA 2CL6X 1CQIA 2IXTA 4GG1A 4HZUB 3U4HA 2QVLA 4DLSA 2W6IA 4E46A 2ZGUA 5I9MA 3IHKA 2ZSEA 3ENZA 2FDHA 3BD9A 2HWUA 2R00C 4HI0E 1YL7A 3WLUA 2DYKA 3PF9A 4LDNA 1H1IA 1OBHA 3G9QA 4D3FA 2XE7A 4L5BA 4P3PA 2LROA 3G59A 4UOZA 2DVFA 4YGDA 2VMFA 4KCGA 4EA9A 2QT9A 1T3HA 2Y6VA 4XDZA 4XEZA 3WP6A 1T4MA 1XYPA 4LF8B 4DLVA 5KNDH 2G9ZA 2TRSB 5C7IO 3VYVA 4JGYB 2OD2A 4H4EA 3CEHA 4UBNA 5K3AA 4EJ6A 3BPSA 2X5IC 5A7WB 2CWMA 3VU8A 3WIEA 1IPKA 1DU3D 2JFUA 2DWCA 3U4QA 3CLRC 4AW7A 2FCAA 1RTTA 1Z5GA 3M3HA 1X0VA 1G8WA 3GRRA 2C2WA 1E3JA 4BTEA 5EWSA 2DPLA 4TMXA 2HJ9A 1E3TA 1XYVA 4MARA 4FFLA 3NXKA 1IK4A 3FFXA 4F71A 1JQJC 5CD1A 1KYYA 4UU0A 3VYRB 3CZMA 3R3SA 2JIQA 4INAA 4AUMA 3BBPA 3FTNA 5C8WA 3KSAC 4TTJA 4UFHA 1PQPA 4DM7A 2AJDA 3L46A 1DCTA 2FQXA 5BNFA 3H2SA 3D8NA 1I2DA 3AVXA 1EY2A 2BL4A 1PJTA 1M2FA 1RDFA 1DL5A 2QGNA 5LD2C 1YGPA 4BA6A 3I01A 3DMFA 1I2BA 1X7NA 2WO3A 4V2VA 4CBVA 5CA0F 1QQ7A 3HQ4O 5A0FA 4U3JB 5G4KA 4PLPA 5DABA 3I9OA 2XCUA 3O03A 4AAPA 2VXYA 1UMBB 4EV0A 3NHBA 4ZYZA 1NXSA 3MVEA 1AS0A 4LMFA 3F95A 1C30A 5GLVA 4JJ7A 3VOAA 3EVAA 1RUE3 4O2BB 1OJ7A 3VZRA 3TSAA 1W90A 4A8JC 1F7UA 1R0SA 3NAPB 1S89A 2Q2VA 3G1UA 1U9CA 3FSGA 1DOZA 2AF4C 2H5EA 4K7JA 2XQRA 5G3ZA 3OTWA 1NY6A 3T61A 2PWPA 1T6BY 1QYXA 3NWKA 4RMJA 1FYXA 1W25A 2C99A 3LXUX 5ENDA 1HR0B 1HDEA 2M32A 1W19A 1MB2A 1IOVA 3OOXA 1HSZA 1CQZA 4E4RA 1U5CA 1XDGA 4XFBA 1Q21A 4JP1A 1FMTA 2H18A 1H9BA 4IJUA 4FPFA 1IXSB 3P2JA 3SVLA 2IE0A 2P6RA 4XJTA 1UKRA 5BQOA 3THSA 4F2GA 3VPDA 3JX9A 4NEQA 1F15A 2IW3A 3RNSA 1RPNA 3WQ7A 3SZGA 3X1JA 2NV2B 4RS5B 1U0HC 3RO7A 2WJWA 1JX6A 1CHNA 1FJGB 2XTAA 1DCSA 2X4IA 1K75A 3LC7O 3VXKA 1XQ1A 1STOA 2EJBA 3ZXDA 1JEAA 2QTMA 3Q7IA 4P82A 1YNSA 1NAEA 2JFGA 2NU7A 3LPCA 4MWGA 2M98A 2NXNA 2E5WA 3SEFA 4JOBA 1XA0A 1U2DA 1W0JD 4YQEA 1P0CA 5IJZA 5M7EA 1C0LA 3FSEA 4UATA 1VYUA 4M0KA 5A7OA 2NUPA 1T4DA 1MEOA 1YR2A 3FAZA 1TRKA 2W94A 3UOAB 5G41A 2FWBA 1JXNA 5DSXA 4IDGA 4R1TA 2GPBA 3ZVXA 5ALUA 1N2SA 5ARDA 1NMYA 3RWOA 4R3UC 4L0MA 2ERYA 3W3AH 2NU8B 4F2WA 2HF2A 4W1QA 4TV9A 4WVFA 4LO4B 5T5PA 4YAFA 1ZM9A 4AWDA 2OBXA 4CDQC 1T8PA 4NHXA 3AP6A 1EX7A 1PVVA 2JLWA 2G6TA 2X0EA 3B6MA 4MQEB 1XL0A 3JD71 2ZB7A 2ZSFA 3CNOA 3B6KA 1CQIB 3DEJA 4W5WA 4ZARA 4GOJA 2AMVA 1JYIA 3GU3A 3HDQA 1OFSA 5EFUA 5JOQA 3V97A 4FHZA 2X1HA 2PXXA 3QY9A 3HSKA 1RHQA 3LCCA 4QATA 3QPAA 1RQNA 1TGVA 1B35C 4CTKA 4Q1CA 1X42A 4XPVA 5JSRA 2FPGB 4G5QA 2I80A 4F4JA 3SISA 3U11A 1Q0ZA 3MAGA 2AOVA 4CDUC 2QN6A 2DWOA 3O4JA 4PR3A 2XRYA 3GLIE 5JTTA 3NOVA 4UVEA 1NMSA 3CE6A 3DDZX 3FAKA 4WM7C 1YZUA 1EJBA 1BA2A 3MT0A 1VYTA 3V34A 1QO9A 4RJKA 2NYRA 5BP7A 4JGZC 1YONA 4ITUA 1H2YA 3PGKA 4EUSA 5KC6A 1IVSA 2HX1A 4A6EA 3TZQA 4EJSC 5JSZA 2QD5A 1ZLYA 1Q7EA 1D2CA 1LJLA 4MUXA 5E16A 4D7SA 1O8SA 4ZT6A 1AKTA 3SBXA 1A9PA 2P3SA 2LKDA 3C7OA 5DOVA 3E9ZA 4MGKR 4PPFA 3R09A 3BTVA 1CY1A 3ZPXA 4AM8A 3P26A 5KCZA 2CN1A 1RHKA 3TQSA 2C82A 2GN0A 4LMAA 4NNJA 3C3KA 2A86A 2PQQA 1O96A 5JIAA 4QJ3A 2D5FA 4NBTA 1GNVA 3C39A 4RGQA 4JD5A 4K20A 2XBLA 3MUNA 1V3VA 3QP9A 1YVEI 4AWXA 3JASA 1C50A 4KLZA 2IRWA 1FTWA 4ZU3A 3L8DA 1HTWA 2FF5A 2X5XA 2EBFX 2ZJBA 2QVZX 2UVPB 4U39A 1HV8A 3ZR5A 4DLTA 1RC1A 5L36A 5LD2B 2I4RA 5ELLA 3PMEA 3M49A 3I2YX 2EP7A 4EX6A 2YVUA 2WNVB 2YJTD 4M1EA 2Y38A 5JVVA 2JHPA 4ND5A 1A9ZA 4JI2B 3WWPA 4MS4B 4WNAB 1BZWA 5IU6A 4RPLA 4XIIA 3A1SA 3H2HA 1K7SN 3WT3A 3MG9A 1WTAA 3N9NA 1MO3A 1CVIA 3A6KA 3VR6A 4L9WA 2WPNA 2B69A 3W0LB 3O8OA 3RI9A 1I10A 3SH4A 3M3OA 5B1IA 1S2KA 1PR3A 2P37A 5FEUA 1E6LA 4LBKA 2FH5B 4KU8A 2D8AA 1XN1A 4LBMA 2J1SA 5ICMA 4PQYA 2AFIA 4HN1A 1SXJE 2OQRA 5EWMB 4BZ4A 1GKYA 2EF6A 3NSTA 3L1JA 1TEIA 3KR1A 1QTQA 2IDJA 1TVMA 3UJCA 2DBIA 1LXCA 3UK0A 1GTVA 2X0DA 1QHSA 2BFMA 4GXLA 3DPIA 1EAYA 1NW7A 2YWHA 3VKHA 2G83A 1QO0D 4IDDA 2R073 3N7LA 1JWLA 4YI3A 2BLLA 3EVTA 1OH3A 1T3GA 3TZ6A 2XLAA 3NJYA 5K6RA 1EK0A 5I7FA 2A1UA 1N5RA 2CFRA 3L8MA 1D4M2 5K20A 5REQA 5JUVA 1JHJA 1CFJA 2YZMA 4BQXA 3GCXA 2VK4A 4RN5A 1Z5PA 2C2MA 1AQJA 4H7LA 5LYJA 3GAMA 1XZJA 4YMTA 5AVZA 2VR4A 5EQTA 1BAPA 3IQFA 5BNNC 3N3AC 3BTZA 5DAXA 3RYFB 2ZI5A 2A9OA 3RTCA 5C7YA 1ZRSA 4PHHA 3UHPA 1QYVA 1W0OA 4LVCA 1M9NA 4D57A 4NHMA 2QZ3A 4NJMB 2XUJA 4Y9TA 2AMYA 2J9RA 3IA2A 2AACA 621PA 4BP8A 3LPLA 4P00B 1BXRB 3GAFA 3UBMA 3ITQA 5HQ3A 1A2BA 2QQWA 4UE2A 1X1TA 2R84A 5C1BA 2B6HA 3RRYA 3MGAA 4L4YA 3OE7D 2VOKA 4IIEA 2VUCA 3IIJA 1S1AA 3PXAA 3C41J 1NVXQ 4Q47A 3VH2A 3CUVA 1KJIA 2DCYA 1K97A 2OBYA 3VQTA 3E5RA 3M70A 1SU7A 4FEAA 3JAWB 4EBFA 1NT4A 4Q27A 5HS6A 3SX4A 3KV4A 1GKKA 1WABA 4R2LA 3QEKA 5CYFA 4AZWA 1Z0AA 2P75A 3SZMA 2VYNA 3W5NA 1T4BA 4GH4A 5CB4F 4JV4A 2ZI9A 4AC9A 2Z5VA 4DJTA 2EGHA 4YMVA 1VBD2 4RTSA 4D02A 4NMMA 3QKWA 4M4RA 1P45A 5EJGA 1RLIA 1Y1QA 5DMHA 1NP3A 2VT6A 5BY2A 1XKLA 2W8BA 5CFOA 4KQIA 3CT4A 5HZMA 4WNIA 4A6DA 4WVWA 1F35A 4G2NA 5FXVA 5CTJA 3WK8A 2ZJFA 1QQTA 3TDMA 3DL7A 1IJFA 4D9MA 3AZYA 5FV3A 2G3YA 2AUNA 3LCVB 5REQB 4TT8A 2XBMA 3P9QA 3NMBA 4HSLA 2JFOA 3CG4A 3S5UA 2GJAA 3KU1A 3EISA 3EUAA 1RYNA 3KM5A 1YFYA 4XIOA 4EJSB 2V74B 3UC9A 2GPYA 5J4KA 1XFDA 4EMTA 1I2MA 1O95C 3TLGB 5ACA2 2D6LX 5A5FA 2EGGA 2WK1A 2IY7A 3NR2A 3IDZA 1JLHA 3KOZA 1Q7CA 4E1VA 5FMCA 3ICVA 3ZV4A 4H17A 3SJCA 2GAAA 3QVMA 2BKUA 2E4VA 2B78A 2C84A 4MO9A 5F5QA 1OUXA 1ZNXA 3OUIA 3CVXA 3U7QB 2ZU0C 4JR1A 5ALWA 1Y4ZA 1T9GS 2C4TA 3ZHZA 3H9AA 4ATFA 2L2QA 4NJOA 3LQKA 4EWEA 3NM4A 2R4QA 1R8QA 3EYAA 1YYNA 2C2KA 4OQXA 1UPTA 1NXOA 2UZ0A 4YUZA 1UBOS 1L7QA 3CJXA 2A75A 3KEGA 3IESA 1I3HA 1V16B 3TMKA 3FHOA 1BMQA 1F5SA 1V1JA 2GA8A 1TVKA 2ZI3A 4BIOA 3LLSA 2ZBRA 2ZYSA 4WLVA 5J5CA 4UUMA 5FV7A 5CDGA 3L1IA 4BKUA 3NP7A 3TOSA 2IUYA 4QGMA 2PPLA 1EM6A 2C4HA 3TEJA 1K98A 4C5CA 2QQPA 1G9XA 1U0LA 4IJKA 1Y37A 1M3SA 1Q44A 4JEMA 3GA0A 5DAWA 5DGCA 1G291 2XQKA 4KO8A 4LKOA 5AW8A 4YAJA 4IWXA 4TL8A 2R1VB 5CA1A 4OI2A 1ZA2A 2HT6A 5K8CA 3OCCA 4ZQBA 2O5EA 2GCEA 2HWB2 4Q3NA 1I7NA 3MZ0A 4AMUA 2XWJI 3S30A 4HB2A 1LOBA 1J0BA 2OFXA 2XX3A 5CCBA 3OICA 3THTA 1F4LA 4QNMA 3H9CA 4DZZA 4GGPA 1H4GA 1V95A 1FFHA 4B83A 1YQDA 3ABSB 3KB1A 2JHGA 5TS3A 2HL6A 3THWB 1S3SA 4UNRA 2XKOA 4IMJB 1JFFB 1WKCA 3MJDA 5C8YF 1G0OA 3FNGA 2AVDA 1PMJX 2K0GA 2MJLA 5FZOA 4O29A 3U7FB 2WYVA 4Z6KA 4JDPA 2DY1A 2XEXA 5ELMA 3J80A 2RHBA 1TTTA 3SXUB 1YL6A 3M9XA 3NM5A 3PI7A 2I22A 3WDMA 6Q21A 2PWAA 5D01A 3UJDA 4LA4A 1FXZA 1KY3A 5LZ2A 2FW1A 2I8CA 2VRBA 2JAWA 4D0LB 1DVRA 3HVKA 2DFBA 1VBA2 3A2NA 4BNNA 5EIBC 1WMBA 1IN1A 5HZHA 4MI3A 3ECQA 4X6LA 3ZSJA 2I2SA 3MO4A 4LQRA 2PHWA 1A72A 1DKPA 4DR5B 3MJVA 1PIV2 2Y6KA 3R44A 3KT8A 4U5QA 1H3EA 2W1UA 1UWKA 1A4IA 3TVYA 5JANA 4GYJA 2HA4A 1QOOA 1OXSC 2J0VA 4L28A 1BQEA 2XEDA 2JAQA 3AFOA 1ULOA 5EQUA 1DWOA 1M2GA 3EXG2 4NC9A 1F1BA 2B8EA 3FRJA 4UW4A 5IVVA 3DCQA 4JU8A 5JRZA 4B4RA 2OY0A 3D4NA 4KN5A 5JLAA 1QUFA 3EZ6A 3TN93 2GJ4A 4RANA 1SACA 3QVWA 2P62A 1D2AA 4GKYA 4QASA 5LZ4A 3PTZA 1U0NA 4NPMA 3L02A 3HWRA 1A1SA 2JLAA 1NL3A 3D0RA 2ZVQX 1XTPA 1JFVA 2J6IA 4JYAB 1DQSA 2R6GA 5CGZA 3BMOB 1UM8A 4BPZA 4V1CB 1K42A 2OQ2A 4C2UA 1X15A 3H8XA 4J6FA 3GX1A 5BSWA 5ECWA 3KWMA 3ZN6A 2WWXA 5AO9A 3HP1A 4UBOA 1D03A 1TK2A 2DTWA 4BWOA 2CHFA 1E77A 4MX8A 4OSEA 3H83A 2FU5C 3NHLA 3TW6A 4GMP1 5BQFA 1HV0A 3W04A 2H11A 3HXLA 2UUCB 5DAVA 3W5HA 3ROPA 1VRCA 1R12A 2O3TA 3BE8A 4W5TA 3AFKA 5CFMA 3VSCA 2JD1A 1QF6A 3Q8CA 1IHYA 2X0NA 1T34A 3JVIA 4KVZA 5IAXA 3UNPA 2FW9A 2YWDA 3LKJA 5CAEB 2X42A 1LH0A 3U3XA 1O3RA 1YMUA 4LOTA 3UK2A 1GFWA 3RS0A 3QCWA 4MAAA 2IVFA 3T1MA 3CR7A 3G13A 1ULCA 3QXJA 2RS11 5CLGA 1TA4A 1IEQA 4HAVA 3P19A 4PBSA 1LFDB 5IT0A 3AXSA 3L07A 1QF9A 2ZI4A 4M1KA 4CV2A 5BSVA 1W5SA 4QX5A 3DDHA 1O95D 3S5QA 1EEXB 3J4UH 5F7UA 2HBQA 4YMSA 5JALA 5J2TA 1WVIA 3ETPA 3QHQA 5CU7A 3N1UA 2YJ4A 5SZHB 5AJYA 2VPPA 1J09A 3VZDA 1W0KD 4JQZA 5AVOA 3O7MA 2OHHA 4COWA 4BLJA 1YVPA 2C5GA 1RJ9A 2GPJA 1VCOA 3CRVA 2P6OA 3FOAA 5DWQA 1RUH1 3NDBB 2VJMB 2CCJA 2FDKA 3CF2A 5FYBA 1OLUB 3M1HA 1NTRA 3GCZA 3SK0A 4MULA 1MW9X 5AHKA 3ENVA 1W36D 4OBXA 2IUWA 4IEZA 1M2KA 4KFTA 3PP8A 1SEVA 3SI7A 2QSJA 2ZGNA 1Y4WA 2BTQB 5K45A 4NXNB 2BVBA 3MJTA 2CNBA 4L2NA 1EBUA 4LZOA 1C8KA 5K0UB 4OATA 1BO6A 4UTRA 3LSDA 4BQIA 2HWD1 3RASA 3HH8A 4URXR 3DZCA 1WF3A 1Z0JA 4AHYA 3W2EA 3DD1A 1NYWA 3CO5A 5DYYA 2BMJA 3COJA 1RFGE 4GBMA 3PBKA 4LBNA 4TKVB 4Y0AA 2VQDA 2Q4TA 3I09A 4QQFA 3C7AA 4FQZA 4B74A 3SP1A 4OX9B 3AFNA 3VHOA 1BLZA 2PMKA 3NWOA 3UJHA 2IZ1A 3GZUC 3JQ9A 1PNGA 4WEQA 4L08A 2II6A 3LQCA 4LBQB 3K0CA 1A3CA 1M8PA 4I02A 3QV1A 4FSHA 4I55A 3KDSE 5KMGA 4CUZA 2D1TA 2Y0PA 4WT7A 1L7NA 2XVYA 2XBO2 1CKEA 1E6WA 2YN4A 4E8CA 1KEPA 2B5WA 1HNZB 5AKHA 3KYCA 3NJRA 3S2UA 3K8QA 1UPBA 4M0HA 2CL7X 3GJAA 5IVDA 1PL6A 4KWHA 1KQRA 2VJDA 1PGW1 2YGMA 1ONOA 1SLCA 4RK1A 5JAHA 1UC5B 3TOJA 3H5AA 5HM8A 3N8HA 5AVXA 3UJ9A 1KAGA 1B8PA 2QPLA 3A28A 3GGLA 2QEQA 5JCOA 3O3MB 4ZONA 3IAPA 3KYIB 1P1IA 4OQPA 3THYA 3TXXA 4RVUA 3K53A 5J4LA 4J1NA 1C0IA 2IYOA 1QJZA 4UUAA 3IALA 2A30A 3DYIA 1H9AA 2B7CA 1SFRA 2X86A 1SUEA 3A26A 1HFWA 4S1WA 3IDCB 3M6UA 2D6KA 4GPD1 4YLEA 4B44A 1O0SA 1AGPA 1ZMOA 2IE8A 4W50A 1NBMA 1ZN7A 1R10A 4U7PB 1N9KA 2XL7A 1QR2A 1E6EA 2C3UA 2O2SA 3Q1KA 1L8OA 3C4QA 4RIGA 1M7BA 2VMCA 4XEHA 1OX6A 2ZGTA 1N5JA 5LP6A 1HDIA 1C1DA 2QROA 2QTZA 5L8VA 3K6SB 5CB6A 3QWHA 3PKZA 1BMV2 4A0QA 4FXOA 2FG7C 2V5DA 3D7NA 3D7KA 1SCSA 3CXUA 4BQNA 3WWCA 1B8NA 1M1NA 1ISRA 2GC0A 4ZOCA 4QHTA 4MUJA 2BUKA 3A6JA 1FP1D 1LKZA 1M7HA 2WHEA 4O2LA 4MO2A 3FMGA 1OVGA 3JXEA 1TJ4A 2J1UA 1ZD9A 2WJIA 4C2BA 4BYGA 3QUTA 2CMGA 4JVLA 3OTOB 4HFRA 4G5RA 3IXQA 1O91A 4M60A 4KR3A 3OTFA 1E2JA 2ZJCA 5AT1A 2YRWA 4Z9XA 3HNMA 8ABPA 3AK0A 4BVKA 1NZJA 5EE1A 1X86B 2QORA 1CUSA 2NXWA 3ISJA 4TSFA 4A10A 1KYTA 5T5OA 1A7AA 1ISHA 3WRWA 1JYEA 4HX5A 1ZN8A 4Q9AA 2PM8A 2ZQZA 3VVLA 3OHMA 2P3IA 1Z0HA 3ZDQA 2O8BA 3JD1A 5GPBA 1KFKB 5HYVA 3OF2A 2W37A 2H4FA 1CZRA 4A2CA 1XDBA 2WWUA 3TL3A 4TZ6A 3GR6A 5J7MA 1ES9A 4D5GA 3KYBA 4B8WA 3BWDD 4QIHA 5A6YA 4PNEA 1B8UA 5CDHA 2XQFA 4Q4AA 1OAOC 2DJ5A 3F73A 5HCNA 3DYVA 1WLSA 4MW6A 3I4IA 4L22A 1I01A 4YJ3F 5B4NA 3VR4H 3L2OB 4MP6A 1G9AA 3QI7A 3VBSB 3IP9A 4OB7A 2HWC2 1G55A 1HG1A 5LSAA 2YQZA 2D5LA 2FZKA 4QC2A 1L4EA 2QUKA 5LLTA 1JLMA 1DBQA 3L7IA 1DZIA 4Z0TA 1GGFA 2BGNA 5AXDA 4QYWA 1AJEA 1KJLA 4X3CA 4LKFA 2IH2A 5TX7A 2NUTB 4ADSG 4BNGA 1JEYA 2XZLA 5FZGA 4XI9A 3PUSA 4ZI5A 3PUXA 2FSSA 5LK7B 2RHTA 3QUQA 2WNUA 3EA5A 3KB6A 3I4CA 2BEWA 4MRRA 2PZFA 3OEEA 3R7BA 1QJX3 3PFKA 2PV0A 5HUQA 4JH0A 1WW7A 5K4LA 3JWIA 2R8PA 5TQ0A 4NMWA 4KHZA 3TM4A 1PNQA 4YMGA 1HYHA 1KE1A 4E7PA 4EUHA 1MS5A 1E5RA 6LDHA 4AKHA 3RFTA 1YJ8A 1NRIA 1Z18A 5JD6A 4M9XA 3FE2A 3PFFA 2HAEA 1OT5A 1D9XA 4KQEA 4CKZA 3PDQA 3FLAA 1I1NA 2YXSA 4C7OA 1O8PA 5CLIA 3M33A 1UODA 3W5IA 1LHWA 1EKXA 2FZ4A 3WOVA 1U8CB 4FFIA 3EIWA 3QOXA 1LEHA 3TLEA 2X5KO 4F2HA 2R8EA 4A0RA 4QQRA 4RA9B 2ARXA 4IIJF 5FI0B 3FLMA 2MNGA 4X1YA 2L17A 2O7SA 4HB4A 4TWIA 1SBQA 4JXZA 2VXOA 5ALXA 2V5VA 1EVYA 2QGFA 1H2HA 2ZTMA 2BGWA 4GUAA 1WE2A 3OJBA 4UVIA 5A3JA 2X4DA 3EEFA 5AW2A 3RBXA 1KH2A 3L1UA 3U7EB 4HUQB 2UVDA 1L1EA 3L41A 4FFVA 2O8EB 1TQ6A 5DK6A 4MXVA 3NFYA 4CDXC 2MSNA 1Y89A 1SQ0A 2IP4A 5KOHA 2EWVA 2YG0A 3IERA 3WO0A 3BCHA 4Q4HA 5GZEA 3C5HA 4B7CA 4YAEA 3BBLA 4ZU1X 4JDMA 1HY3A 4D3WA 1XAJA 2WPDD 2SNIE 2CDAA 2HK7A 1U5ZA 1ARZA 1ZR4A 4AFDA 1RTVA 2V72A 4NMHA 2JFWA 2VFAA 1V0JA 4WOJA 5TMDA 5CXQA 4PG7A 4O5OA 4Q15A 1MIOB 5LM3A 1YRYE 2ZWMA 4P1ZA 4D4JA 2R00A 3PUYA 4Y18A 4RVNA 4YLGA 4C4ZA 2C9ZA 1EX1A 1QFXA 4XHXA 3AUFA 4ZCTA 3BD7A 1RUE1 2H4HA 1ORVA 5FQNA 4WX2B 1YRAA 1H2ZA 5CXUA 3GVXA 5E2IA 2MSCB 3IQGX 1U2QA 5FUQA 1SQ4A 2JIGA 4DNOA 1SBNE 4F92B 5E95A 2FLWA 2WUDA 1X7XA 2QENA 5DYTA 5TPWB 2PKEA 1T1EA 4BZPA 2R062 4L8VA 4UVDA 4DIMA 3HCEA 3OOYA 5L3SB 5HWSA 3SJAA 3IVMA 3TD6A 3Q9UA 4CXXA 5DF1A 1YVRA 1JHQA 4O1MA 5BNTA 3PU3A 1OXVA 3QEJA 1Z4LA 1WA6X 2HT1A 4EPTA 3RVMA 3V8BA 3KRTA 1OA1A 2XYGA 3ZBTA 1KAOA 1MJ5A 1W4BA 2WQZC 2QTAA 2XSZD 4GPZA 1Y1TA 1OMIA 2ADFA 3AMPA 1VIYA 4KR9A 4EQVA 4CG1A 2ERCA 2HA3A 3C15C 3ANXA 2QM3A 3FZ3A 3TAXA 1UC4B 5C8VA 2XCSB 3GN1A 2WIIB 2AENA 4M9SA 2ZWAA 2GNDA 3KQVA 1PUXA