3BPSA

Pcsk9:egf-a complex
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
530
structure length
435
Chain Sequence
SIPWNLERITPPRYRADEYQGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHWQLFCRTVWSAHSGPTRMATAIARCAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDAVTAVAICCRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/lipid transport
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title Molecular basis for LDL receptor recognition by PCSK9.
pubmed doi rcsb
source organism Homo sapiens
total genus 128
structure length 435
sequence length 530
ec nomenclature ec 3.4.21.-:
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF18459 PCSK9_C1 Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain
A PF18463 PCSK9_C3 Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain
A PF18464 PCSK9_C2 Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.690 Mainly Beta Sandwich Jelly Rolls Proprotein convertase subtilisin/kexin type 9 3bpsA02
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3bpsA01
1SCDA 1ST2A 2Z2XA 3A3PA 5ARDA 1LW6E 5FAXA 1V5IA 1V6CA 1WSDA 1GA1A 1Q5PA 4DZTA 2IXTA 1P8JA 1SCNE 3CO0S 3A3NA 1EGQA 5SICE 5AMXA 3I30X 1GTJ1 4H6XA 3AJ9A 1WMEA 1XF1A 1AQNA 3VHQA 2G4VA 5JMOA 1P7WA 1TM1E 1KDVA 1S2NA 1SH7A 3DE5X 4I0WB 1Y33E 1SIOA 2Z2ZA 1CNMA 1MPTA 1AH2A 4AKSA 4JP8A 1A2QA 1BJRE 1EA7A 1GA4A 1JEAA 4ZARA 1TECE 2SNIE 4CFZA 1IAVA 1PTKA 1WMDA 2DP4E 4C3VA 3VYVA 2IY9A 3L1KA 3Q5GA 5JXHA 2HD4A 1SUEA 1Y1KE 3PRKE 4KPGA 1C9JA 4K8RB 4H6VA 3AJ8A 1BE6A 4OMCA 3BGOS 1IC6A 1PEKE 1GA6A 1AU9A 4YN3A 1SPBS 5AQEA 1YU6A 4RYDA 2PWAA 2V8BA 1Y9ZA 2WWTA 2W2QA 1TO2E 1SBHA 1TM5E 4Z2AA 3WHIA 1UBNA 2ZWPA 2PMWB 1KE2A 3UNXA 4AKTA 3TI9A 3DE4X 4KG7A 3DWEX 1SBCA 3F7OA 1DBIA 1GNVA 1ST3A 3OSZA 1SUPA 3D9QX 3DVQX 3LPCA 3DE6X 4KB5A 4B5LA 2SICE 4NE9A 1HT3A 1SUAA 4ZOQI 3QFHA 4LVOA 1SIBE 4MZDA 1VSBA 3T41A 1AV7A 2ID8A 1GT91 1TM4E 3AFGA 1SBTA 1ZVKA 2PRKA 2XTJA 2ZWOA 2HPZA 3GT4A 1SUBA 3Q40A 1TO1E 1SN7A 1TM7E 2Z57A 1YJBA 1SBIA 3DDZX 1NDQA 4FONA 3VTAA 5B1EA 1R6VA 4DJ5X 1TM3E 2ST1A 3DW1X 1WMFA 3QMPA 3LPDA 4H6WA 3PTLA 3VV2A 1SCAA 1Y3DE 4NE7A 1SIUA 3I34X 3HJRA 3A3OA 1Y34E 5ARBA 1YJAA 2W2MA 3SICE 1BFUA 3VV3A 4HX2A 2PKCA 2Z56A 2W2PA 1C9NA 1SVNA 4LVNA 1Y48E 1T1GA 3DE1X 1AF4A 1YJCA 1PJ8A 2WUWE 1C9MA 1GCIA 1Y3CE 5K7SA 3DE7X 3QTLA 2PQ2A 3WQBA 1THMA 3CNQS 1SUDA 4DWWA 1T1EA 4GI3A 1KE1A 3GT3A 4J94A 3EE6A 5JXIA 2P4EA 3DE3X 2X8JB 1C3LA 3F7MA 1OT5A 3DVSX 1OYVA 1SCBA 5ARCA 3P5BA 5AVJA 1NDUA 4NMXB 2ZRQA 5I9SA 3DE0X 5B1DA 1SUCA 3ZXYA 2E1PA 3EIFA 4M1ZA 1MEEA 2SBTA 2W2NA 2WV7A 1KDZA 1S02A 2PYZA 1GNSA 2XRMA 2DUJA 1BFKA 5FFNA 3TI7A 3EDYA 1ZVJA 4CFYA 2X8JA 3VSBA 1S01A 1NLUA 2W2OA 1CSEE 4BWGA 1BH6A 1PFGA 2QTWB 1GTG1 1SCJA 3DW3X 3D43A 1Y3FE 2PWBA 3GCWA 1TK2A 4C3UA 3WIVA 2ID4A 3GCXA 1P7VA 5FBZA 1GTL1 3DYBA 4WOCA 1WVMA 1TMGE 1AVTA 3DVRX 3DE2X 4OMDA 1DUIA 1T1IA 5AVKA 1SBNE 4HVLA 3LPAA 2DQKA 1OYOA 3ZXXA 2Z2YA 3BPSA 3I2YX 2Z30A 5CW1A 1KDYA 3F49S 3I37X 2B6NA 2GKOA 1R0RE 1AK9A 3WIUA 1BE8A 3TECE 3BX1A 5JXGA 1R64A 1Y4AE 3H42B 3SQOA 2TECE 1Y4DE 4CG0A 4WOBA 1Y3BE 2Z58A 2SECE 5JXJA 3LXUX 1SELA 2WUVA 4OV6B
chains in the Genus database with same CATH superfamily
2H11A 1US8B 4EYUA 1VPVA 4XJ9A 5JZGB 2BHSA 2AT1A 1SCNE 4IHJA 3PK0A 1TMF3 4G8BA 1P77A 4RLSA 3HB9A 2D5IA 4D4GA 3VMMA 1IZYA 2IEIA 4U5QA 4B4KA 4GB31 3SIXA 4A82A 4JBHA 4AJOA 3J7LA 4ND4A 2ISSD 1LEMA 4B34A 2AYHA 4CDXA 3ZLVA 2OBMA 2FLVA 1FF9A 1T5LA 3AZVA 2CGPA 2Z2IA 4F8YA 5IKMA 2JIRA 4C0BA 2O5RA 2VH5R 5EEGA 1HZZC 3O74A 4UFHA 5DYYA 2A9QA 4ZZIA 4BNIA 5FBRB 2BCGY 4ZHNA 3NBQA 1AQLA 1J2YA 5CLJA 4W4ZA 1GZVA 2HD4A 5JPCA 3OKFA 2PZAA 1YB4A 2HU2A 2JFZA 3MXOA 1ZD8A 2ICAA 1RUJ3 1JDTA 3FW1A 3W2TA 3AU9A 4QX2A 2RAPA 3ZWAA 2V5UA 2YWXA 4A3ZA 2JZOA 3COPA 1JIXA 3QQ5A 1BMFD 3S1AA 4BBJA 1DMSA 4RPKA 5CK4A 3O7WA 3GNTA 4M88A 3V0BA 4NEHB 5C8YA 1KJ8A 2R6JA 1J20A 2GJ9A 1PR4A 2PMWB 1R9JA 4U2EA 1I1OA 2C58A 3IEPA 2MDTA 3GG9A 5C18A 4YT5A 2AUYA 1GG8A 4DFDA 1R0CA 3D9QX 3HEBA 1CAXA 3L9JT 3CZ4A 4EFLA 1IBKB 3FR8A 4V2IA 4LX8A 1YZHA 4CCSA 1GGKA 2A8YA 1N1TA 1G3IA 3ZDZB 3OM1A 1UNBA 1U8ZA 4OCZA 4M01A 1ONOA 2ZIFA 1XR3A 2Q99A 1O97C 3MLEA 4Y0AA 4FFLA 3RVNA 3QTBA 5AYVA 5EERA 3AFGA 1E5QA 2DPLA 2VSNA 3C43A 5LOVF 3UJDA 3ZSEA 3K46A 2NSHA 1M8PA 1BEZA 4RHFA 3H50A 2X8LA 4XKJA 3OO1A 3D31A 1SA0A 4QDJA 5LIPA 4HY3A 4RTJA 4AQ6A 4MKGA 4LXGA 1QH7A 3ACBA 3OZWA 3MIDA 1NAHA 3C5HA 3F5QA 3FUWA 3I34X 3KBOA 1ND2C 4XYGA 2JVIA 4CDUA 1QC5A 4O4JA 2CY0A 2UZ4A 1UD1A 3SQNA 3I3QA 3WOHA 2H5EA 5BT9A 4CKYA 3VLBB 5IWFA 4TMYA 5JZVA 4JOQA 2I99A 3MELA 1SHKA 3HDYA 1VB4A 1XMSA 2RG7A 4J0DA 1CGPA 1TMKA 4MI3A 1TKCA 5KQRA 4JX0A 2VNSA 5I45A 1B3BA 2CD9A 4HDNA 2OP1A 2AYZA 4DIKA 1YQGA 1IZZA 1N3IA 3SZRA 4NCBA 2VOXA 3LD8A 1OT5A 2X8KA 4QQPA 2PBLA 3F0TA 5K8VA 1Z34A 4PJYA 5ARCA 4MP6A 1IG3A 1Y8QA 3LTNC 2ZRQA 5A4DA 4LDZA 2Y77A 2VOTA 5JSQA 1K75A 5JTUA 1SNYA 3MBKA 5JG7A 3HUDA 4DEVA 5I7RA 4IDAA 4DVJA 1ZJ4A 4LQLA 3L8CA 1NYWA 4UTOA 3TK1A 1RYHA 2QDXA 5AK4A 3KTDA 5LSAA 3EXAA 1S01A 3K5PA 2FSGA 5TT0A 2IH2A 3O1PA 1CB7A 3FYTA 4BMPB 3B6EA 1MXFA 1PMJX 1XLVA 2R2GA 4DR1B 4HVAA 3KJZA 3QVUA 1SHLA 4QPPA 1NW4A 3ZDYB 3OE7D 1FLVA 4EVIA 2O9JA 1JBEA 2IFTA 2B46X 1Z0ZA 2JDHA 4BISA 1T5BA 4D6XA 3N0VA 3WYFA 2HDOA 1E7RA 2DDUA 4P9GA 1PQ4A 4HLDA 3K15A 3AL6A 4LO5B 1BMTA 1YF3A 3T4EA 2YJNA 3WOVA 2PS1A 3A1DA 4IICA 1EUDB 1C8KA 4MYCA 2IZZA 2NV2B 1ISHA 1XLTC 4NVPA 2G4IA 1MC5A 3CNEA 4BFTA 4TYMA 1BCXA 2QL6A 5BNNB 4WADA 4IIEA 2OHHA 5EMMA 3S5AA 1I10A 1AR63 1LU9A 4WM8A 4DY5A 1JBKA 2YMPA 3MWDA 2XMGA 4AEDA 5IW0A 1U3DA 1F17A 3T1MA 2J3LA 2P9YA 4RXTA 4BB3A 4URUR 1CJTC 1KFXL 1VL5A 5KYXB 4ZWNA 2Q5EA 3F74A 3M3OA 2WFAA 5LOVB 2OZEA 5E8JA 5REQA 3V8BA 5IATA 3TDMA 4HVTA 1QMPA 3EGCA 1M2WA 4U3JA 3I7DA 5L51A 1JPVA 3WWEA 2MCFA 4DSTA 4QB2A 3SJUA 4PYOA 1QFZA 4QECA 2ANBA 3FTNA 2DCKA 1UBLS 1OJ7A 4HSEA 4QX0A 4Q4Y3 3EZ6A 5HXVA 1M74A 3CZPA 3DE5X 3M4YA 3BKWA 1W0JA 1P4SA 4Q4HB 2YPDA 3ETJA 1WPRA 3HR8A 1A98A 5JCPA 3W4IA 1P9NA 2W5UA 3GV0A 2GDZA 2EF0A 3MBIA 1GPJA 2GWHA 2AGSA 4M86A 1EYBA 5CNKA 3VPCA 2QLTA 3P2YA 3KQKA 3B1ZA 3CZ9A 1C9JA 5ULLA 5C8XA 1PKEA 3NJXA 5F3EA 4WK2B 3T1OA 4Z86A 1V8OA 1YRZA 3MRXA 3WBFA 4C5AA 3T3GA 2DSTA 1ZXXA 2EXXA 4B1MA 4K1XA 2ZAAA 3V6MA 2QUBA 2QX9A 4HX5A 2QAJA 1BJKA 2AR0A 3FBGA 4U7JA 4O4HF 4CUZA 1OOPB 4OHKA 1PM4A 5BV2P 1N5KA 3EEOA 4NBLA 3R6TA 2QRHA 2VHYA 5FYIA 2VF7A 1ESNA 3KPYA 1IS6A 4F46A 1S8AA 5K1ZA 4R8RA 4BNZA 1WLDA 3IB6A 2W46A 3S70A 4QYWA 2YFKA 4WN3A 3TZHA 1DZRA 5KC5A 4GMKA 5ALIA 5GJVC 1ASJ1 2Q5HA 1KEEB 4JKKA 1ZK0A 3U44B 4IGOA 3JQ7B 2CFTA 2DKFA 3SZ3A 1FAYA 2A6WA 3TBFA 3C14C 4CM9D 4JXXA 1Z4MA 2HHLA 3PNLA 3OM9A 2W98A 2F7SA 2J32A 3USUA 4MQEA 2Y0DA 4NCNA 4LF8B 3QMPA 5KTYA 3Q8LA 4DMHA 2ZMKA 1E2NA 4LC1A 1BDMA 2DULA 1N1VA 3ZCQA 1XDSA 3UOGA 3ABSB 1M3SA 1S2BA 3GJ5A 4GU5A 2H5JA 3KQHA 3LUJA 4NF2A 4IPTA 5G0UA 4C7VA 1FIUA 1CJVC 3RSLA 4ZICA 1XKLA 4QZVA 1HDCA 4NU0A 4EL5A 3JD3A 1VBA1 2VHXA 2DAPA 1ESMA 2OZPA 4MW7A 5FK8A 1AL21 2ZRMA 4GPD1 5T5PA 5IJ9B 2WINB 4D82A 4TSFD 3N05A 4HN2A 2A7QA 3A4UA 5DJ5A 4FXKB 3UH1A 5DHUA 3UK6A 2WA1A 1P9WA 1UAGA 3TXXA 3GLGE 2A9KA 3OHSX 4DCVA 5AICA 5EQTA 1W5EA 3R7NA 3AT1A 2PAFA 4QOFA 2MTBA 3RG0A 3M4FA 1QYXA 4E14A 4L5BA 3E2IA 2JLBA 4HNAB 1GRCA 4JSYA 5DAWA 1WQ1R 2PZFA 1SLIA 3VSBA 4EY6A 4XIKA 3CRW1 4C01A 5FUVA 2YDXA 4CUBA 4KRGA 4GVLA 3OCWA 1DG3A 3RS3A 2A3WA 4COKA 4YUXA 2CV0A 3SJBA 1TK2A 3OP1A 1P9RA 3B3AA 2QSUA 4D3SA 4BQ4A 1CUXA 1REFA 1ISPA 2OEPA 2CKMA 4O4HB 1UXIA 4LOAA 3SKXA 2CK3D 5KWSA 4G36A 1OYOA 3C4JA 1MIHA 2BFMA 4CEIA 1AHPA 3JVIA 2DBNA 1EXWA 3QEAZ 1Q8SA 5LP6F 1SVMA 4ZO8A 1NJ1A 4LDAA 5I5GA 4L9WA 5BNPC 2XV1A 3CNOA 3KAJA 4J3NA 3GLKA 3HCCA 4JUDX 3LO8A 2QDRA 2PAEA 1G8MA 3ST7A 1KSFX 2C8JA 3Q8WA 2QLFA 3WV6A 2JFBA 5A1LA 1E2MA 2Z2JA 2UUCB 2HHAA 1XYGA 2JFXA 3W2IA 2ZEXA 3WW2A 4NCAA 4NJEA 1FC0A 4CMBA 2XQXA 2WNIA 4GXLA 4IGFA 1JPUA 3B6IA 8LDHA 4HZFA 3MMSA 5IWAB 1HEYA 2HA4A 4MA4A 3PCXA 4Q1DA 4JXZA 5AUNB 4BO6A 4OUKX 2GXAA 2PN1A 1R4MA 3QFFA 4K03A 1CONA 1GN9A 2LPMA 4KUEA 2GR9A 2RKWA 1ZZ9A 4FKMA 1GZWA 4FB4A 4ZHQA 3P7MA 3KDPA 4JLAA 1AGXA 2GUGA 4U0KA 4KNCA 1P5ZB 5ECYA 5IT0A 3A6EA 3U6BA 4A4DA 3HA7A 2EX4A 2IZ5A 5K09A 3GIWA 4I36A 2RGAA 4BNVA 5AM5A 2ZRBA 5AJVB 3VSEA 1S2LA 3SHWA 1A2QA 1ETUA 2VDKB 2ZBJA 4RADA 1O0SA 1MX3A 1ILWA 4UZEA 3UJ6A 1IONA 5C31A 2PXHA 4CR8A 1URXA 3UOWA 1QTNA 1OC4A 3OKCA 2C4MA 3G49A 3L6EA 2ZJZA 5FYDA 2ZMLA 3ZKWB 1NQUA 2HMWA 4GL2A 3WWPA 2HWUA 2FUCA 3P3PA 1JYIA 4QGHA 4CDNA 1X39A 4RGQA 1E79D 3ANMA 4G4SO 5DOVA 1U2DA 3K70D 3OUHA 3GNEA 1UYPA 2PKRA 4RK1A 1H9BA 4OI1A 2UURA 4PHCA 4YM0A 3E9NA 4BFSA 3GBVA 4IV3C 5FWXA 4LY6A 4Y3UA 5LUBA 3B3QE 5CVRA 3IKTA 1GGMA 4S2HA 4AG5A 4BVEA 5ALKA 1NV9A 2K87A 5HF5A 2O0OA 2NP0A 1WXXA 1XRRA 1L3JA 3M2MA 2CLOB 2YNMD 4Q4JA 3LY5A 2BE9A 3ACFA 4FYJA 4ETIA 4LQ4A 2HREA 1EKXA 4BNDA 1ASJ3 1TIBA 5FBWB 3WIEA 2HK8A 1ORRA 2QPTA 3U40A 3O26A 4ZYVA 4EGQA 4X6QB 4D92A 5AC92 2YHBA 4N6NA 1RZUA 4D1YA 5LP6B 1V45E 2QTHA 4H27A 3VJLA 1E2IA 4IFTA 4LJ9A 3L92A 3H2JA 3Q3HA 1M34B 2WIFA 4EI9A 1D4M2 2EJWA 4IDEA 2D13A 2C4XA 5JW6A 3SSMA 5HRCA 5IFKA 1CRLA 1OFIA 3WWYA 2Q4BA 3QUTA 5DVZA 2EP5A 4BLVA 1G7SA 4HTFB 3MLJA 1C9NA 3AVTA 2QRMA 3IAAA 1CV2A 3KL4A 2G1PA 2DFKB 5FNZA 3BGAA 2F8MA 1O87A 3RYRA 2DEUA 1E9AA 4Y9TA 4HB3A 5A5EA 3SYNA 3N7MA 2O3TA 2BMVA 3SJCA 1TMYA 4NOTA 2GD0A 4MV9A 2JCYA 1UANA 3KWMA 5KO2A 3O95A 5LQRA 4ODIA 1Y1TA 3SVLA 4FO9A 4D69A 2DY0A 5FXZA 1KAMA 3KXKA 4B09A 2EAAA 1MEOA 1N36B 1Z5GA 1JYNA 5D6NA 4YR9A 2CVQA 5BP7A 2Q5QA 5FZAA 2X0IA 2AOTB 2GBGA 3I28A 1B35A 5CG1A 3G13A 1SXJC 1OPRA 5BNTA 3QNMA 5A3UA 3K1ZA 3IUYA 3LUDA 3AXTA 3KP1A 4JP3A 3QGMA 1GFSA 1JAXA 1U80A 1UUFA 3NIFB 4S24A 2O8NA 5AVTA 4UTRA 3L2OB 4NRQA 1USKA 1NSTA 4BUZA 3L6CA 3I42A 4JEMA 4NJMB 1RXIA 1ZHOA 2FDKA 2BP7B 2AN5A 2IY7A 4IEUA 3QBVA 5IYYA 4RM2A 2R6ZA 5ABPA 1KVQA 1QCYA 2PGNA 1RCFA 2GVNA 3ESXA 2NOAA 3PQFA 3AY3A 3VX4A 1Y9DA 4PAQA 3WIUA 1U31A 3ZWBA 1A69A 1C7ZA 4ONEA 5FBVB 2R96A 3VC7A 5DHSA 2QMQA 3VHXB 5HS4A 2CVPA 3B1VA 3NHPA 1KFEB 2R0HA 4AE2A 1LLCA 621PA 1E6CA 3TKYA 3ICEA 4D3XA 2HCFA 1ZR2A 1GQPA 3EA5A 4YCJA 1GEEA 1DAMA 3ZFFB 4YLYA 1A95A 1NR5A 1S2NA 3FJOA 3GPIA 5H4GA 2XUEA 4COWA 1JIVA 4TM8A 1J8YF 4LGMA 4H16A 2EEZA 5C4WA 3GLIE 4TLAA 4OFBA 4QPIA 1GKYA 2HJ9A 5K6AA 3DMYA 3MGBA 1QP7A 4MV6A 3VNQA 3G1UA 3T7JA 1NY6A 4JNCA 5FZOA 4WA8A 3ORRA 2E1RA 1JFFA 2PL5A 5FYZA 1PR1A 3N9NA 3VDNB 1G6NA 1PT5A 4TL7A 4LE2A 1PNRA 4PWYA 1DKRA 4CV3A 4IIJA 4JDMA 4LGVA 3ACHA 2EYUA 3AC0A 4I0BA 1DEOA 4B2PA 1RE1A 2NYRA 1OC2A 1HY3A 4EP1A 5DGCA 4UFOA 3CZ5A 4AEJA 3OFSA 1Q43A 2BLNA 3R0IA 2ZXQA 4NATA 3REOA 3NTQA 4DDTA 4LK3A 4PLOA 5EXXA 2A9VA 2VHEA 1ZBDA 5JOQA 3PUZA 3SX2A 3H17A 5L45A 3RYFA 1J8VA 4A6OA 4MQMA 4RA6B 4ZZ3A 2R6R1 2C6SA 1I9CA 4YVSB 1E2QA 5CBPB 1NM5A 1M1UA 3MLKA 1LKZA 5C2JB 2R3SA 2ZBQA 3B9IA 1B23P 4N8EA 2JFYA 3G2QA 3OZCA 1WXDA 1ST3A 3V34A 1JZ2A 5H9WA 2O59A 5EFOA 3BRSA 1I24A 1UPSA 5FO9B 2EJBA 4YG0A 4HN1A 3MT0A 5KWEA 3E61A 3W2EA 2JL1A 4A8JC 5IFTA 2ID8A 3H1BA 2RJ2A 1HE5A 1UKZA 4RE6A 1NA1B 2BBAA 2TMGA 5KPJA 2J85A 4HNRA 2BM0A 2QV0A 3TNLA 3AL2A 4I0AA 3L7YA 4AAPA 1JHAA 1T0IA 4MHSA 1EHYA 4LRYA 3B69A 1U3VA 1I3CA 3PJEA 1GL6A 1SOMA 4RSMA 4DXRA 2BFCB 1HIXA 4G5HA 2H0RA 4A6SA 2GM4A 4UAUA 5B4NA 2BLLA 3RVHA 1SLCA 1YZUA 3F46A 3ZR6A 4UAGA 1XEWX 2GRUA 5BV7A 5JSZB 2QMZA 1ZZ7A 1YCGA 1NVMB 5MFZA 2VPXA 1UIMA 2G70A 4MQUA 3A2MA 3TWIA 1H1LA 4GLFA 1Z5PA 3ILVA 1JX6A 1AA9A 3NV3A 4ZU5A 1E5LA 1DF0A 2JFFA 3GJYA 3M1AA 3JAMA 1V5FA 4YRRA 3KC2A 2GC3A 3RIGA 3F67A 4DCTA 3SKYA 1M6YA 4LV6A 5HUQA 1C4OA 5EFZA 4R1NA 2GPWA 2V9PA 1N9GB 1AKMA 1ULZA 1ZCZA 1PNQA 1FQOA 1DC5A 5HJEA 4C0HA 2P5YA 1YQUA 4R1UA 1GZ9A 4D4LA 1WVGA 1GR1A 2EKZA 1TEZA 3BZWA 3BSSA 5SZKB 5HILA 1S2KA 3N9LA 4MEJA 1LK5A 4PEVA 2IZ0A 1JHZA 2JAQA 2PJDA 1O8SA 5DX0A 4GOND 1PQPA 3F4KA 1FNDA 3IQDB 3OGRA 3K0AA 4KTVE 3GD7A 4Y2UA 4EGSA 5EJ1B 1T1JA 3GDBA 4KL1A 5F7JA 2OQIA 1G5FA 3B52X 4QU8A 3L8ZA 4QDXA 4BEJA 1VKHA 4LNUB 2H52A 3I39X 1JB9A 4GIQA 3T5TA 2HU8A 1H8EA 2FPSA 3I52A 1QF3A 2C1EA 3L07A 3EVDA 4M46A 4IMPA 4WXMA 4GM0A 3MC1A 3K32A 3LSDA 3EVZA 4MW4A 2EVWX 3CRQA 3SIPA 3URMA 1S2GA 2GA9A 1DADA 2QTLA 4WK0B 4IV1A 3WE7A 2RK4A 4DMRA 4FPJA 4W6XA 3DMTA 1RUE2 2B1GA 3DYPA 4XR4A 1R6AA 1D9XA 3H42B 1W96A 1LS1A 2R8ZA 3TSYA 1CDEA 1U1EA 4UMVA 4DLSA 1ADJA 1VB3A 2BWJA 1JDSA 1OPOA 1W93A 1NSYA 4BCDA 2I4IA 3LEIA 1XNQB 1WLYA 4J0CA 1QEXA 3FLAA 4KV9A 1BHO1 3II6X 2XRYA 4GJZA 1MO5A 1ODCA 3BBPA 3ON7A 4AF7A 5LBBA 4Q39A 2Y05A 1DV1A 4A44A 1K8RA 3W1EA 1MU0A 4DLNA 4SBVA 1ISGA 3IODA 3K1AA 2GS9A 1BYIA 3VKVA 3VBRB 1VA5A 3HU3A 5IKOA 5AM4A 4D4JA 4UU0A 3GJAA 5FMBA 5C71A 2AH5A 5FTWA 1ZVQA 4ZQFA 4A23A 5FP0A 3DSRA 1YRHA 4BKPA 2C7GA 2DURA 1YKFA 1MZ6A 4P22A 4F97A 5KSOA 4IIGA 5IAOA 4UBJA 2Y66A 3KD2A 3IJEB 3NGMA 4M9ZA 1Z0DA 2XTMA 4LG1A 4PIYA 5HZMA 1WLCA 2R84A 4ZARA 5A32A 1UP7A 3FWHA 4OFGA 1NLSA 3ZY4A 4ZHSA 4UZFA 2PSEA 5FB3A 3KQSA 3L1JA 3LFTA 3PT5A 1YULA 3S5QA 2ZHNA 3RJ5A 4CP9B 4RZXA 1O2DA 4I4TF 3DMPA 1NTOA 5H81A 1XDWA 1UQUA 1PO23 2BGTA 3RU3A 1O3YA 2VDPB 2X86A 2R072 2JHAA 4QT6A 2H51A 1Z7S1 4DV2B 3G9QA 1HQCA 4NVRA 1O97D 3O1VA 4RF5A 2X1VA 4WY8A 4D4HA 4I3PA 1FZTA 5IX8A 2HR1A 4BV2A 1F9EA 2QTNA 3LF7A 4GRIA 5EJFA 1W06A 3ZBQA 3S6PA 2Q5OA 1U8CB 1VP9A 3DUFB 1FI2A 4JT2A 5GOTA 4YI3A 2CAUA 3UA3A 3KSRA 5BN3B 5E8RA 3V7YA 3SXJA 3U26A 1G9DA 2FN4A 2XQRA 3EZ7A 1JNXX 5LCWL 2GN9A 3U7HB 4JEIA 4E15A 3PGLA 1E69A 1QNLA 5E2BA 1TADA 2YWRA 1CZVA 3AZZA 4ES6A 1TCBA 2D5FA 4AVVA 2HMVA 4NHXA 1Z4KA 3VZMA 2A2ZA 4LYGA 2V1UA 1IZ3A 2WFF1 2XTJA 5GJ6A 4OGGA 3NJ8A 2CBXA 3DZBA 1ZM1A 3ZWDA 4ARVA 2XWJB 1KQGA 2NPIA 2FPXA 2VCYA 2GOYA 3OF3A 2HYDA 4YBZA 1V35A 1R6BX 2R62A 2CLHB 3WLEA 2AFIB 4M9QA 3LHDA 1R10A 4F72A 2QW1A 1EP1B 1ORDA 2X3FA 2Q27A 2E33A 2QRNA 2D6OX 1CY2A 2NMOA 4LJKA 1N8KA 4QJ3A 2XZLA 4KBBA 1D1SA 4HX2A 4C5BA 3D3QA 4E7PA 5DM0A 2BFEB 1XMXA 2B35A 4BE4A 3FB4A 1MEC1 3IT0A 1WU8A 1NYQA 1AURA 1G8HA 2E6UX 3UAXA 3A4NA 3FUCA 5F32A 1MVNA 2PZKA 4OKSA 4MUVA 1H5UA 1Q0PA 1LLQA 2DC1A 2ZTSA 3AXSA 3D54D 5DNUA 1ZMRA 4J03A 3D6JA 1KH3A 1RAHA 4TVKA 2OR3A 4F3CA 4MCJA 4WZ6A 1LZLA 2Q6OA 1QQP1 3KKKA 5TPZA 4POAA 1QORA 5CX4A 5DW0A 2J1SA 1KEPA 5EP9A 3L6RA 1D2CA 1N32B 5GJCA 4C14A 4XDZA 1QIHA 2ZDHA 5C7YA 4AMZA 4I4TB 5CXUA 1NG1A 3FCCA 3ES9A 4NAMA 3KS9A 1SQ4A 3IOCA 3P4UA 3EUWA 4RVSA 4BKOA 2P2ZA 2FSUA 2RS13 2HQRA 5FOSA 4D7SA 3KIPA 3RTCA 4JGYC 1E2HA 4LVCA 2C8VA 1LCLA 2JZCA 1E1RD 4WWHA 1KPGA 3VU0A 1YDHA 3STYA 3NWJA 3R0XA 3DHEA 4P4NA 3BFVA 3TSOA 2WQ8A 3V1MA 1A8PA 1SB8A 3FTEA 2CJYA 2YV2A 3S8YA 4FHGA 2NYUA 1T2EA 5C6CA 3SCGA 3MVEA 5BSRA 2EWVA 5ALSA 1EDOA 3TVTA 4D3YA 1J5PA 1U1IA 4CMEC 3WCRA 3MPPG 3E4DA 5A6VA 3M6AA 5FZ4A 3DCJA 1K3TA 5A9SA 5T8KA 4HAYA 4EKYA 4MAMA 3TW8B 2OTCA 3HVRA 5TIIA 2HWYA 5FKCA 2QZZA 2PA7A 2FFJA 4EH1A 3VOAA 3QVKA 4G0QA 4JR2A 5FZHA 2WU1A 3M4JA 4OKIA 4P0TA 1OTXA 3CUYA 4X91A 4K26A 1NRWA 2E0IA 5SV5A 3UAGA 4LPSA 5CFCA 1SVWA 5KOHB 3SHQA 3DPRB 3NOOA 2VY0A 2LIVA 4INDA 4BL5A 1TUIA 4CUCA 1H2LA 1V6SA 3U4HA 4TZTA 4C7BA 1XB2A 5B3AA 4ZU4A 3DP7A 4IFIA 5IAJA 2V4AA 1JMYA 1EEHA 5FL7D 1CRZA 2HXYA 4M1YA 4DCGA 4L9RA 3MIBA 4JFAA 3GLGA 1GU1A 1DQ6A 4JKYA 3MTAA 1Q2XA 2W8BA 3FHQA 3UESA 2D0PB 3KKPA 3IT8A 4IY1A 4QLBA 3UGGA 3OCCA 2GF0A 2WS93 1SXGA 3NZEA 1PWXA 3WYDA 3QU5A 2BEWB 3CF2A 3WGMA 4JH0A 2DTDA 5FUPA 3FVVA 1QBGA 3KAQA 5DDJ3 4PGHA 3RVDA 5JAOA 4BBZA 1OV4A 3TSWA 3JPYA 2N7GA 3VKLA 2XVGA 2VCAA 4YACA 1IPJA 3ENQA 3JQCA 4FXOA 4N5HX 5HTKA 2A1UA 1U12A 4DLKA 3UC5A 1IHOA 2YFZA 3R4CA 1P1IA 3WYGA 2FOLA 3AP5A 4B7KA 4EA6A 5E3JA 4FFBA 4MPRA 4GO1A 2AEMA 4JJGA 3T5AA 4XFHA 3ZOIA 3NBFA 2VRBA 2DKNA 4FX2A 2XUGA 3T1TA 2X4DA 1V9U2 3SY8A 2XB2A 2W68A 2D5BA 2QUHA 1R0KA 5LD2C 5LN1A 3FUOA 4YO8A 2ZWOA 3A6LA 4RCYA 1SWVA 1XN1A 3G9TA 4ZO6A 3T35A 1N4DA 1YJBA 4KNYA 4ZN6A 4O65A 1FNZA 4B6SA 2O6HA 2DTXA 4QUIA 4IRMA 2B8WA 4NE7A 4Y22B 2WRZA 4TXJA 5C5TA 2QYSA 1E20A 2G28A 5JV5A 1R4NB 4BZZA 3L05A 2EA7A 5CYPA 4D96A 5DWDA 3GCZA 3RCBA 2OKXA 5L3QB 3IKJA 3ET4A 4JSRA 4XH9B 1N2OA 3JXSA 1RVF1 2VBBA 3RT7A 1YU9A 1VCIA 1BK1A 3S8MA 2IS6A 3OB8A 2Q4SA 3THXB 5CYYA 1MV5A 2QMEA 3RE1A 3CIHA 4ER5A 5GM0A 2MYPA 3V33A 4EHKA 4AZ3A 5BSWA 1A9QA 4X3PA 4H7LA 2JDNA 3PE4A 4FD3A 2QRVA 4OEHA 2PSDA 4BYMA 4C0AC 2QG6A 3G5LA 3ZYRA 1QQP3 1KO1A 2ODTX 1KC3A 2K2WA 3K53A 2QN7A 4AICA 2I54A 3NDRA 4O2BA 4PC7A 2XX3A 1IZ0A 2AENA 3LOPA 1WB4A 4BGUA 2H17A 4FB5A 3V9AA 1AQIA 2GI4A 1CJPA 4V03A 1ZX1A 1KAQA 1DDLA 2WIIB 4NMWA 2HMYB 1IEQA 1RLIA 1M6WA 5D21A 2X13A 4OSOA 1ZITA 2CHHA 1OUMA 2VJYA 2XT0A 4YAJA 1XYNA 2NU9B 3ZWWA 3QSYA 2EC5A 1SBYA 4R1LA 2I6QA 3CX8A 1W4AA 1K45A 4J2TA 2HU5A 4DRZA 1OI6A 3DUIA 1UYXA 2II6A 4R16A 1TEVA 3W79A 3EG9A 3I9NA 1VQ1A 4MRRA 2J3IA 2MNGA 4AKHA 2QM7A 1XD2B 4UVGA 3HKCA 3R5KA 4JI1B 4LYFA 4CUKA 2GZWA 3IA7A 1N5JA 4LOKA 4OLLA 1F3LA 4AF8A 1QQAA 1AK9A 3VU9B 2PXJA 4FT2A 4D57A 3KELA 4IVPA 5CMLA 4B3GA 1QWRA 1JKFA 2R0QC 3CEPB 2QM3A 5IXSA 5MGNA 5I93A 2PEZA 4EHFA 3IBTA 3AF5A 5BT8A 2G9QA 2H4HA 3TN7A 4F1WA 4YFVA 1ZXLA 4G1CA 1KHHA 3TIGA 3HP1A 1SKMA 5AJXA 2VATA 2OVBA 1NOKA 3GH3A 3SHTA 2YYAA 1H8VA 4DO0A 2PY6A 1SCSA 5TPWB 2WJ4A 4Q18A 2LKDA 4PQQA 2ZIXA 4PYNA 1A4IA 1AXEA 5KSYA 4Q15A 2JHCA 1NOJA 3U13A 5E1RA 3U4IA 2ZB3A 4MOAA 3JALA 1NXWA 4I4LA 1ZRCA 3GRPA 3TH5A 2HRRA 1CX9B 4FS8A 4OJQA 2JXAA 2Q1ZB 4NQRA 1RYBA 3EFHA 1FYXA 5KQMA 1JS9A 3WQHA 4CW7A 3BH6A 4OLFA 3AYCA 4A2WA 3I6YA 2WA2A 5LP1A 3EF3A 4LHWA 4DUGA 3T4XA 1HQLA 4L92A 1T0HB 4IWYA 4FPOB 3NDBB 1OKKD 3EODA 3SH3A 2O8EB 3NAPC 2RB5A 5DEIA 3BVPA 4BXFA 2X7JA 1WXEA 4E07A 3E9CA 5AVZA 3VUOA 4BP1A 4DCOA 5FIXA 3STHA 2XL9A 5JR2A 4E5VA 1Z06A 2HJGA 1GP6A 1LKNA 4IWXA 4KWIA 4F3KA 1CHNA 1WP9A 1HXS1 1SEFA 4FPYA 1WNTA 4GX1A 2P4SA 1W2NA 2XODA 1OB2A 1ISFA 1IXSB 3B5LB 3GUUA 5AOCA 4MI1A 1TLFA 1YA4A 4A0FA 5HQTA 3GBGA 3H3XA 1P9LA 4S1OA 2QBYB 4F12A 2ZZNA 3BFJA 3KQTA 4DQDA 2DHDA 2EBUA 1NYRA 3ORJA 1POQA 1L5MA 1VLJA 1R9GA 2OV3A 4A6EA 1EVEA 1P18A 3OSUA 5B1SA 4PIZA 1N2CA 1TLLA 4UCFA 2R8RA 2ORYA 3C2UA 4DV1B 2D43A 4IDFA 3WLMA 4RK0A 4AGVA 4DJEC 2FQYA 4HDOB 5F5AA 5ANQA 1XWFA 4KQMA 1PT8A 1FYWA 1TYBE 1PD0A 1V9LA 5IP5A 3Q15C 2FPLA 4E1AA 2ARCA 1V1RB 4N4AA 1M6EX 3LYAA 5EPEA 3AMVA 1T3SA 1CQJA 4ZXKA 4YMIA 2IWHA 1J0CA 3DDNA 2R1VA 3N2LA 1XYOA 1PZFA 1L9XA 4BCBA 4JQYA 1RVF3 3PB3A 3F3YA 2HMTA 2XNSA 1YL7A 1FPQA 2DUQA 4IWNA 4XETA 4FP3A 2HBUA 4KFCA 2YICA 4DWWA 2HWWA 2HSWA 5CFOA 2OAQ1 4QG3A 3FDIA 1A4XA 1XNTA 5IT6A 2OZ6A 2AK2A 1A78A 3ZHQA 2I4NA 5EXTA 2PJUA 3OPYI 3K30A 1G8AA 3PIIA 2GPBA 3MMNA 1ZNPA 4KR0A 2J7KA 1KZ4A 4RS4A 4YV0A 2WV7A 2CDPA 3GGLA 2FMXA 4ML3A 3SYRA 1DGRA 5GV7A 3CH4B 3EYPA 4AMUA 2YH2A 3C5VA 1BFKA 2ZUEA 5K3OA 4D6RA 4NOJA 3EDYA 3CNBA 5L3VA 1RLOA 4JI4B 1UDXA 5P8WA 2IYFA 5HZGA 10MHA 3FDXA 3V4OA 1JSLA 4LZPA 3KTFA 3L0OA 5EZSA 2HIMA 4XPIB 3W06A 4XVUA 2D3WA 1SIWA 4RVGA 4ASUD 1OVGA 1VE5A 1V7QA 3A6ZA 1GTMA 1L5OA 3KT7A 1KXZA 1BQ4A 1NFRA 4YZ4A 2ZJ5A 1Z4JA 1KH1A 4RACA 5HMLA 3LC0A 4UULA 5GLZA 5A4KA 4H3SA 1JALA 1GPMA 4DRXA 2R79A 3WWZA 1RUG2 4TKVB 4EN6B 3E8MA 4XAEA 4H60A 3GFSA 2DR0A 1QV9A 1JYSA 2VZUA 3NTOA 2OO5A 4I3GA 3HAGA 2E63A 3PUSA 4LRTB 1ENPA 4IIYA 3CURA 2NU7A 3V46A 2QENA 2H59A 1LV7A 1UL9A 2JRCA 5DN2A 4PCAA 1EX6A 1WQ4A 4ZTUB 2FK7A 1L3CA 2QQPA 5J5CA 3VR5A 4AW9A 2A5DA 4HVOA 4EAAA 4AURA 5J40A 2BE7A 1N6RA 2ZREA 2R6HA 4AI9A 2BPOA 2C84A 4RKFA 4NWVA 4O08A 2JB8A 4CG1A 3MYRA 1TT5A 3MJDA 2I80A 3SISA 5K7PA 2O50A 1UBTS 2OM2A 4G0PA 4BNGA 4BECA 3LKZA 1NKVA 4IDBA 2BGRA 1MGPA 4ND8B 1OX4B 4ER6A 5JD3A 4PHGA 5ILOA 2QSYA 3UCXA 2RB4A 2XR1A 2JG9A 2XOKA 1Q56A 1C29B 2XEXA 4CT5A 4W8OA 4NRMA 5AO9A 5EE0A 4N43A 1CQ9A 1LBQA 4QO7A 4CMAA 2QP4A 3HNYM 4A36A 1G3RA 1W0CA 3LF2A 4NNPA 3DONA 3MT8A 3IUEA 1E7QA 2OCKA 5J47A 2GCIA 3NMUF 4PLVA 2L69A 1X0VA 3HR7A 3R74A 2IH5A 1E4EB 3K3PA 4LBZA 4Q4W2 3NT4A 3GXBA 3OQ1A 2I67A 3OWOA 1V11A 2HKIA 3WSVA 2PMEA 1HQNA 2ILVA 5M5BA 5KNCA 2EP7A 5BSGA 2P9TA 1VMAA 3LXMA 3NKTA 3KSDO 2GF2A 2E4UA 4FOYA 3T1LA 2PYIA 3SN6A 4LAFA 2IUSA 2UYYA 3B6JA 3LLUA 3TTTA 3VSCA 2CGNA 4TS1A 5CFDB 4NHYA 1BWSA 3WNCA 2PRKA 3WTCA 2G77B 3G5AA 4KITB 4HPJB 3VQTA 2B2NA 5A7OA 1GPAA 2GBPA 1ATZA 1ZH2A 2EJTA 5A3LA 5DRYA 3L9WA 1WZXA 5E4TA 3L3BA 5TGZA 3ACLA 4WESB 2H2AA 2ZX4A 1FXUA 3HA2A 1NG0A 4MS3B 1RZRA 3KF3A 2GNDA 5JCTA 3L4BC 3G6JB 4ZMBA 3VGIA 4INJA 3TBDA 5ALVA 1NW5A 3G17A 4I30A 5KVCA 4PQRA 2G1UA 2R49A 2VQ0A 4LA3A 1ZCFA 3RYCB 4J1TA 3GHNA 3PNYA 1DYPA 1NUSA 4AYWA 3UO8B 4RSUA 3MIGA 4CCNA 1RQPA 3GEMA 4EGFA 4G0MA 3G0GA 1W2OA 5H7XA 3ZYCA 1HSZA 2WZR1 1HG0A 1U8TA 1WUIS 1VJTA 4GMGA 4IE0A 3NHBA 2FRDC 2WJVA 3RS9A 4ABTA 3PD0A 2AI3A 4MV2A 3H1TA 2KLBA 5CTAA 5JQGF 1JA9A 2D3TA 4NHKA 2E1PA 2PGAA 4XLZA 3SJZA 2PX6A 2OC9A 1QNWA 2SBTA 3LA6A 3CZQA 4R71A 2PAMA 2XWSA 1X7DA 2VZRA 1WG8A 1PG0A 4ZC1A 2OWEA 4GB33 1OASA 3NLLA 4UBHA 3KKNA 3W6NA 1IHDA 4RTNA 2VXYA 1AS0A 3GDWA 5EZYA 3GALA 4B35A 1XA4A 1QTRA 1SCJA 3N76A 3RC9A 3ZHYA 1C80A 4XFJA 1N0UA 2KB0A 2B7YA 2QFEA 3QUQA 3WP3A 3LQYA 2D2VA 1EHCA 1R8XA 4JI3B 1DTWB 3LYUA 4KQEA 2AGVA 4CM7A 1QFMA 1DBVO 1YQ9A 4NHEA 2GEBA 4X54A 4XDHA 1X1AA 2RKBA 2XJPA 2PELA 4DIUA 4GMP1 3TN92 2G5CA 5BRNA 3NNSA 1L7OA 2ADOA 4YB8A 2H8KA 3K9GA 4O5OA 3MLLA 5B7GA 1K5MC 3RMYA 2RIRA 4ZRNA 3QEMA 5DTJA 3UG6A 3MCZA 4OUDB 3INAA 1GFZA 1ZS9A 3BH7A 2P6NA 1P1KA 4WM7C 1B09A 1T0PA 1QH8B 4MICA 1AHNA 2ZTNA 4AVAA 1YV9A 1ESCA 2D00A 3Q41A 4DS3A 3DNFA 5F9TA 4XTRA 3FTFA 2J9ZB 4K1LA 5C80A 1D4VB 1VMIA 1N2ZA 2GZHA 4Q1CA 2FSFA 2ATXA 4ZOLF 5I7AA 1E1DA 2FXVA 1RD4A 3A0UA 4UTXA 1X8LA 1ZZBA 5FPQA 1U2GA 3RFVA 2WWSA 4BFYA 5CBKA 1QS0B 4HG2A 1P5JA 3SHFA 4C0WA 3WJAA 3GCGA 2RHLA 2VKQA 2AS0A 4Y1VA 1PTJA 3K0SA 1EGMB 3VDDA 2NN3C 1JFLA 5TQ2B 1OH6A 5AH0A 1N2JA 3OZRA 1LUAA 3I76A 4ZEVA 1NW8A 1U81A 1SDDB 3ALQA 3LVBA 2ZWAA 3NM4A 1LZKA 4YH1A 4GZMA 1H6YA 3IAEA 2REBA 5DHTA 5YASA 4LFBB 2LW7A 3G0BA 4LNAA 4IEXA 4J0HA 3HP7A 1TYCA 3B82A 4HX9A 1JIIA 5BSTA 2ONYA 4Y2YA 1SUEA 4GMHA 3E7XA 1L6IA 2FZWA 3OFND 3VPFA 4N9HA 1F0PA 2A14A 2FDIA 1W2AX 3D6UA 2XXAB 5JQGB 1RBYA 4OLJA 4AI0A 3W5BA 3TQSA 2ZI9A 5BQ3A 1KJYA 4KFRA 3GLHA 2EATA 2GM9A 2R6QA 2GB4A 3W9YA 2EJCA 1F2UA 1DCFA 1LOAA 1CQWA 3WLPA 1RAAA 4CKWA 1UBHS 3EQ8A 1UQXA 5BO5A 4XUNA 4MJLA 3U0VA 4FK8A 4QGBA 1EFRD 2X0KA 1W6OA 2H0AA 3M4ZA 4NNOA 2CE7A 2JIZA 1LDMA 4HXFB 5FXWA 1SU6A 1MVQA 3FDZA 5KTTA 4FFSA 4LEJA 2P77A 2R25B 2GLUA 4OJNA 1JJBA 2VQAA 5CB6A 2V7QD 5ALMA 2A3RA 2E4AA 4MRSA 3RPEA 3BFKA 4HKLA 3P0JA 5IVKA 1ND3B 3WZLA 3PTYA 5LK5A 1X9IA 2ZRHA 1D4ZA 3IP7A 5KOYA 1DPFA 1R4ZA 3R1IA 5KINB 2CNOA 1X80B 2HA0A 1G9TA 2ZW9A 1NJSA 4XUOA 4DMCA 3LPLA 3KB6A 1T9GS 3BUCA 4YCSA 4IEEA 4RFRB 5KHAA 5I4KA 2CSXA 1ZPDA 3DMDA 4OHCA 2ZBUA 4CLHA 5JI7A 3EA4A 4Z1MD 3HZOA 3WLOA 4EB8A 4M60A 5C7OO 3A6GA 2BGGA 2G0NA 1XTQA 4ZOLB 2C92A 3OEED 2QYHA 4CVUA 5KI6A 2J1EA 1CUWA 2VK4A 1YI9A 3QYPA 4P31A 3DVAB 5K01A 5A1AA 3M5WA 1MZ5A 1VMFA 1QVWA 4LXXA 1PK6B 5M3BA 3EA0A 3DE3X 3ZFGA 3I04A 1RR6A 1ZOIA 1LPSA 1UXJA 2QX7A 1KTVA 2Q9BA 5FOXA 5L3RA 1JPNA 1JZQA 1F6BA 3DLTA 3ZXYA 1T3TA 4CJXA 2PHZA 3NJRA 1P2SA 2H8GA 2OAP1 3DYVA 1EBUA 1GPDG 4JLMA 2A5GA 1KY4A 1L4EA 3PL1A 3T2OA 4L2IA 1A5TA 3OM0A 5BSHA 2AR9A 3ZD7A 5HQJA 3IPRA 1N7HA 2XHEA 3RT1A 4DEYA 3M6MD 3NW9A 2OXRA 2W6MA 1ZN9A 4L28A 1KBZA 5K3FA 3VVCA 4YNBA 3PX2A 1CKEA 3U4CA 4QBHA 4JEUA 2O0KA 1PQWA 2NSDA 3FFBA 4AUMA 5C5EA 1LDEA 5LQNA 4P9IA 4FDUA 4QICA 1X9PA 1J8FA 4Y98A 2WKKA 2F4NA 1ZK4A 3BTAA 4Q3AA 4GMP3 5CA0F 5CW1A 3RSCA 3V1KA 2JH3A 5FUBA 3H75A 3PJGA 5TE9A 2QAGC 2VSQA 3KQWA 2ZR0A 1EFTA 3BE5A 2KM1A 1UXOA 4HDMB 3BQMB 2D54A 1LSUA 3J80A 4MSVA 5GZFA 4FQ4A 3BD7A 1A8MA 4BNWA 3T1HB 2AIRA 3AWDA 2J33A 3K35A 3KLPX 4W6QA 4KX3A 4GH4C 2C5DA 2BWCA 4UPDA 1CRQA 2VTXA 2KWIA 1Z0IA 3AG5A 4E5DA 2NADA 2WUVA 3U07A 2GILA 4AJIA 4BPZA 1R6UA 1ZC3A 5EHNA 3IDAA 3TOJA 3QXGA 4JBGA 1VLLA 2UZ0A 1JR3D 1XE8A 1RRGA 1BMV1 1ZUNB 2RMU1 4QWMA 4ZCPA 3VKUA 1L9KA 5FTLA 2HEGA 1PX4A 3ZLBA 2DBQA 4RSGA 3MI8A 4G5FA 2D06A 1EP0A 3O8CA 5EIBC 2VO1A 3V4SA 2B25A 4H7PA 3I6QA 2C1FA 4XVQA 2B83A 3EEFA 1BH2A 3IMFA 3EZNA 3OU7A 3O0VA 3NXKA 1XAHA 4BK4A 4U39A 5HRAA 4U9HS 2VT2A 3FUXA 1RUD1 2F9LA 4HUQB 3T1QA 3AEXA 1UOQA 1C4KA 4DLZA 3CNAA 3H11A 4HRAA 4ETWA 2C03A 2P6CA 3TZEA 4N6GA 2VHJA 2I62A 5TEWA 4C6TB 4LXLA 3B1YA 4M9RA 5AJWA 3DO8A 3COZA 1Z37A 1VBA3 3DHYA 2BEJA 2L0XA 3EVEA 5KHKA 4O1HA 1O4WA 1KJRA 2BFOA 1HR0B 2YRFA 3A1CA 1AL23 1WEHA 2I3BA 4LXUA 1A0OA 2VOJA 1UBCA 3VGPA 1G6Q1 1QK5A 1ZGCA 2GJKA 2QNRA 4QAWA 1FUUA 4FI3F 1RP7A 3BCWA 3OZGA 2YOFA 4CEYB 2IYVA 3NUGA 3WAGA 2YMQA 3ATGA 1WXQA 1DG1G 3E2MA 5BWNA 1L3IA 3I2HA 3FPBA 1TQHA 3KYCA 4FIZA 2B20A 2AREA 4CLXA 3M82A 1XBFA 3A9VA 3HXPA 5J4VA 3VKHA 4S2DA 2G67A 4N8SA 2JGDA 2PMKA 2H06A 3W78A 2NQYA 1NYTA 5ALYA 1L5SA 1IN6A 3DZFA 5CA0B 4FHEA 1T3ZA 1RMU1 2JZNA 2Q45A 4RD0A 5K8TA 3BIFA 1RPAA 4GQBA 3KZ4C 5HTOA 4CL0A 1XJQA 5IVPA 3JATB 2EZ8A 4MDHA 4MZUA 1YK1A 4ZODA 1Q44A 4RLQA 3VTFA 4BO3A 3HDHA 1Z4QA 2ZE6A 4EI2A 5HBGA 4XBQA 2IEYA 4KN9S 4KXXA 2A5LA 4X66B 1REQB 4R0NA 5HMMA 3G8AA 3QJYA 1NN5A 4R8MA 1FFAA 3ANXA 4E4YA 1BW9B 4V0OA 1SB9A 3FVQA 4MV8A 5CKNA 1YAJA 4F45A 3EIEA 1VG0B 2CN1A 2XCSB 5BN5B 2R6GA 3KJEA 3RSGA 2PEYA 3OCZA 2W92A 2QVYX 4LKSA 1YD7A 5A6SB 1N2CE 3USES 3RREA 2PHXA 3RZHA 5JCOC 1KJWA 2ZGOA 1T6XA 4DPKA 1USWA 3HHEA 2J9YB 1LOFC 2RARA 1C3LA 1ODKA 3PFKA 4ZO4A 4Z7OB 4BYGA 2V6MA 4B6FA 2LGJA 4HDKB 1K7CA 3K2IA 4XB2A 2GN4A 5CLLA 4EN8B 3N9MA 3W2FA 2XPJA 3WW4A 3GEHA 4HWKA 4NESA 5DOZA 1AK2A 4XC9A 3OCXA 3GL9A 1VMHA 3UATA 4ND6A 1KEUA 1JKIA 2PXCA 3OX2A 2FWMX 2GGSA 1ULGA 2IC5A 2VMIA 3CZRA 1P7PA 3CUEF 4GPBA 1UBOS 2O0MA 4GNRA 4MAFA 1SBFA 2D2XA 5CM9C 4RSHA 1M33A 3IP9A 1IQPA 2Z1NA 1LW7A 3QPVA 1LA2A 2ZXFA 4JV5B 3OBZA 4ARYA 2FZEA 2PGXA 2Y67A 2NZJA 1NTRA 1JEQB 2VAUA 3PNVA 1KOJA 1JWLA 1I36A 1PO7A 1BKDR 4AVCA 4RZ3A 3GJ4A 1P39A 5IVEA 2FEWB 1N3YA 3DEKA 2DRIA 1C1XA 3WDUA 2ZIAA 2F67A 3OQIB 1IM8A 1JA1A 5KTPA 4XTPA 3O4IA 4TWBA 1V43A 4QAQA 4D56A 5BN1A 3TNFA 2G8NA 4A91A 1GNQA 2QQ0A 3VXKA 1UBRS 2MSKA 5CLHA 1V00A 4BQWA 4PSKA 5D87A 4CIYA 1PS0A 2K5UA 3CB4A 3EPJA 2UVPB 3I2GA 1HOTA 3GUVA 5TQJA 1UO9A 1N6OA 3RS0A 2ZHLA 1NE4A 2MWMA 3MJCA 5FAXA 2BDUA 3B1WA 3M8KA 4PN3A 4NAOA 1QZTA 2VW2A 1PR9A 2P41A 4DIOA 3JXEA 2OV4A 4R2MA 4FFMA 3ANYB 4IE6A 1QFYA 1YAHA 4TT3D 3CY6A 3X1XA 2I6XA 4GOOD 4P4SA 1Z4IA 2IQ5A 2XPCA 4H14A 1GFIA 4OJTA 2E21A 4MR8A 4ENVA 2ZEJA 3AKQA 1QGUA 4KBGA 5J59A 5TMEA 2EFGA 3DAOA 1XZMA 4YRDA 2QQGA 4MEAA 5B7PA 4Q9HA 1PBNA 3FL7A 3KSZO 1QU0A 1LBSA 4CKEB 4DS0A 2JFPA 4E2FA 1ODJA 5EG5A 2VF4X 3I6BA 4HVQA 1LLUA 1T35A 5IYZF 3N1UA 5FRDA 1AS2A 1AKEA 4B7CA 3WF1A 3FNIA 2VTXJ 1K8XB 4RR3C 2P3OA 4XD2A 3DEHA 5JWHA 4XWAA 1CEQA 1DX6A 1P6UA 1VBD1 5DP1A 3C7OA 4Y2XA 4OB6A 1RQ2A 2TNFA 4DA8A 1DBNA 3IDQA 3IUPA 1LQTA 3KXIA 1OHHD 3VKWA 1PGL2 3QLUA 1WCWA 2A35A 1K86A 5BQPA 2WHPA 2XWPA 1BGWA 1UMHA 3OBRA 1N57A 4M1SA 3O03A 2ZJOA 1NI3A 5ALNA 1Q1AA 3BUSA 4EL0A 3SI7A 3NKFA 5KXCA 1JUHA 3D6MA 2FCTA 1L5KA 2BONA 4QVIA 1KR2A 2AUTA 2FXIA 1H2YA 3E5RA 1Q21A 2IYNA 4ILKA 3UYJA 3EIQA 1MC1A 2JKYA 3CE9A 1BVP1 1HT3A 1YC5A 4P81A 1U9ZA 1AGNA 2YYYA 3NTLA 5KBFA 1DL5A 1Y3AA 1V4NA 2WWWA 2IOYA 4GT1A 1OXKB 3D4NA 6ADHA 2VYND 3L06A 3O21A 3HFSA 4RA9B 3PQDA 1RMU3 1HFEL 5ED0A 5CB0A 2ZEYA 1B15A 1KEVA 1QHHB 3IMCA 2N75A 1H94A 1ZAKA 1B0AA 1K5DA 3V1UA 1P91A 2AXNA 3FFQA 3VTKA 3REQA 4IJVA 4NOKA 3KD3A 3Q9LA 3HUUA 1BKYA 3D2AA 5CHEA 4RF2A 2VJQA 4WVLA 2X4LA 4ZV7A 1UIJA 3AH8A 3ZVLA 3EC2A 4M49A 2RM21 3RC2A 2QLMA 1UJ2A 3RV3A 1DX9A 3JZFA 4LY9A 1YTLA 3NKGA 2GTHA 4QXPA 2JG8B 1YB6A 5DCUA 5EINA 3TJMA 1LECA 1MZVA 3SH5A 4KMOA 4HF7A 2XBO1 3IAUA 4R01A 1AF7A 2PHUA 3C3CA 2ATIA 4ZZ0A 2DCMA 3C3EA 1RTVA 5LLDA 4X92A 3ZGVA 5D5QA 1KJNA 3QVVA 3TIFA 2X9GA 1IWPB 3WGUA 2ETEA 1BXZA 3S6JA 4BP9A 3DE0X 2YMMA 4B4OA 1X7YB 4Z7QB 1MRNA 1T8TA 4META 1QJ4A 1V5EA 3L77A 3T6KA 2VTVA 4XWWA 3OQBA 1RIFA 3X29B 2PT9A 4MKRA 5IYZB 4JLJA 1W6QB 1L7PA 4DMKA 3RRZA 4BNTA 3RLIA 4CCCA 2E51A 4RORA 5EL0A 3AX4A 1BYUA 3VD7A 3FCAA 2X10A 5JRJA 5K4HA 4XR9A 4TN7A 5K2OA 4ZQGA 3JD72 1P1HA 1KJLA 3AM5A 1CAUA 2JI9A 4JIMA 2IZ6A 2G5GX 5A7QA 3BIXA 2W5FA 3U7IA 4ZRDA 4DA7A 3C6YA 2X5NA 3DPIA 3ENNA 2XWBF 4JBXA 5KKAA 3K0CC 1YH3A 2BEKA 1IJBA 3IJRA 5DWVA 3L93A 1S0EA 1E5RA 3BTXA 4QQLA 4KU7A 2RE9A 2Y6FA 3I54A 3N2GB 3FYUA 4Q9NA 2WVAA 2PX0A 3HZRA 1Y4AE 3ECCA 1L5YA 3U75A 2QAIA 2WT0A 1PIWA 3IFSA 3O1TA 5F5CA 2VSOA 4PFSA 4N01A 5EHIA 4RGKA 3ZWOA 2JGNA 2QSJA 3RVQA 4DIDA 1FSZA 1S7GA 2Z1DA 4ESHA 2DOKA 4DBZA 1LU2A 1QK3A 5K3DA 3UHOA 1FFGA 3BJRA 3LUGA 1H2EA 1I5PA 2ILTA 3NHKA 3WNQA 4B3RB 1F0KA 4WKOA 4N53A 4LSZA 1N2XA 2DUWA 4DWOA 2HIAA 3HJBA 1UZLA 2BW8A 3CW9A 3PEVA 1AQNA 4DOMA 3GDFA 2XXJA 3VBHA 3V2GA 5KDDA 2NM0A 1I0IA 1WAMA 4V1PA 2BBOA 3H5TA 4ZO7A 1Z0AA 4ZJPA 3OEAA 1Q0UA 3ZYGA 1ADYA 4ARCA 4OB7A 5LLSA 4MAAA 2AX3A 2W6JD 3O9MA 3FPAA 4CU8A 4XUEA 3LIIA 4KQFA 4QG7A 3D8RA 4ZAYA 2VZ0A 1OA4A 3B1JA 1QR6A 4LRWA 2BUKA 4CE6A 4LWZA 1HE8B 2A0UA 4JLVA 3WBJA 4YARA 2GEUA 4BEVA 3LFHA 4MNTA 3DGTA 2BTQA 3RZGA 1H2MA 2WP0A 1VBD3 1VL8A 1WMAA 1AVBA 4D0LB 2IHTA 5TRTA 4MARA 4X94A 3K4AA 4JB0A 1WCKA 1T13A 3TYJA 5DLQC 4NC9A 3OZTA 5AR1A 4YAUA 4PYLA 2FPUA 2QSZA 4IIVA 3VGJA 2PH7A 5FBLB 2WJSA 2RSLA 1NBIA 4E8DA 3WHIA 3OJFA 5F73A 4AJNA 1UC9A 4IVNA 4W5WA 3H5WA 1KE2A 3HSSA 2AI2A 1XZLA 2OQ2A 1IVSA 3SDBA 3S4YA 2ZUFA 5FWNA 4O4IA 3JQ9C 4JBNA 3P0IA 5B7QA 4FUQA 3USCS 6LDHA 2BF4A 2WE8A 2DVMA 4DDMA 1P1JA 3JQAD 1AX1A 5JVVA 3BMCB 3CXRA 1DU4A 4FNOA 1X7WA 3GM8A 2GMEA 4Z2WA 2X9LA 3GLHE 2Q30A 2XWBB 1X14A 1NBWB 4WNAB 2P90A 1AYM1 1GOHA 1WW8A 1SUBA 4KO1S 4ERXA 1BXGA 3ROKA 2JFWA 2H6BA 2D7CA 3O8OA 5FWDA 4YREA 4B3IA 1R0LA 4GXQA 3AESB 4BIIA 3K70B 3FSEA 2P91A 4RS5C 5EPUA 4EZ4A 4RHCA 3SBOA 3NH9A 2PWPA 2GKSA 4RF3A 1RYEA 4MH0R 5I8ZA 3UETA 4Z9AA 1WB6A 3SJAA 3GQBB 4MWBA 4CCLA 1T1GA 2H2DA 4NYJQ 2P6RA 3TW4A 2LS6A 3KBBA 5FA6A 1AB6A 1II0A 1T91A 1HFJA 3AFKA 1ARZA 3K4ZA 2IYPA 1JZSA 2XBO3 2LM3A 3FSGD 2MINB 4P7JA 2XUZA 4WBNA 1WETA 3WNVA 3ZJTA 3DBHB 1I6MA 5T41A 4C2BA 2ZJ0A 4A8PA 3L79A 2JD4A 1NIPA 1BMDA 1GP4A 3D8CA 3O94A 5DAPA 3SIRA 1MG0A 4JI0B 4ZAFA 2XOXA 3ZYFA 3MWEA 3EIFA 4IO1A 2OYRA 1GL3A 2BTOA 1U5ZA 4N03A 3HYSA 1X19A 4KMSA 4BN5A 2P5TB 1NXQA 5ADWA 3WRVA 5IULC 2F59A 1JDBC 4K6CA 4Q4V1 5ANRB 4R2LA 3N8IA 1EVLA 1N9ZA 4KQJA 4YG3A 1FFBA 4CQMA 5I7SA 1KI6A 3ASZA 2GN7A 3NVKI 1M0WA 3RVSA 1AJKA 2REOA 1QKKA 2L19A 4CM1A 5FBZA 2GZAA 4JODA 3GIDA 5HIAA 1K06A 2VHZA 1ENZA 5EFUA 4RAQA 1SCUA 2VJOA 3EGEA 4RGBA 3HUFA 2HO5A 2GTIA 3W9SA 3I53A 4CPBD 1T6BY 2HRCA 2OA2A 5JNRA 3MEQA 4HUJA 2NUPB 3EVTA 1VKZA 5L7YA 3HGQA 2YJ6A 1Y37A 5KNDH 5T4BA 4LTDA 1Z7S3 1YFXA 2BPA2 1W52X 5FYVA 4ZALA 4LOJA 2IYOA 5L6LB 2RBEA 4F4UA 5F78A 2E7TA 3SGLA 4CDXC 3FTCA 1H69A 2I66A 3GRUA 4TMXA 1DIHA 2E4YA 2QY9A 1INLA 3WL7A 3HH8A 3TSAA 4PNEA 3D7SA 4ZAGA 5KMGB 3MPUA 4RHEA 1XL1A 2ZROA 4OQ9A 4U7PB 1P8JA 1I9RA 2OCAA 1JFTA 5F51A 1CJBA 2WY2D 1KP9A 3AJ9A 3UH0A 4KI7A 2HFJA 2O3SA 1RYDA 4LF6B 3NATA 3DTNA 1DVRA 3UXHA 2BGUA 4D26A 4ND5A 3RJTA 3R5XA 3NWKA 3KV9A 1HZJA 4UREA 5DXJA 2VQUA 3TGPA 1LULA 2WFF3 3ZZNA 5AI9A 1Y33E 3W90A 2C97A 3QITA 2G8LA 4G65A 3IDCB 3ZN2A 5E6HA 3I5MA 2FE4A 4WXPA 4I7EA 1WUHS 1U5CA 2XECA 1NAIA 2WB2A 4MV5A 2JFOA 1R5OA 4XFBA 3BTUA 2FLKA 4Y5Z0 2EICA 5CEEA 2DT8A 4YW3A 3QXHA 4Z4IA 2CXHA 2J87A 1CUEA 5BUVA 1R8YA 2EERA 7REQB 9LDBA 1QMJA 2YVAA 4CRQA 5CAEB 3K0FA 1A5ZA 4B32A 1K0FA 1MEC3 3FJYA 5F77A 4EB6B 1IY1A 1YU6A 3R7WA 4JA0A 1BDBA 4YRBA 3N8KA 1SD5A 1CNFA 1P4RA 5HV4A 5AKIA 5A4IS 1YCHA 4MO9A 3SX0A 2O8VA 2JANA 2EKLA 4IO0A 5D51S 3E9DA 1EBBA 2NTNA 5U1PA 4MUIA 4YQFA 3KHSA 2H4ZA 1Z8FA 1RRKA 5JFTA 4GHWA 3C0KA 3R7BA 2FZCA 4FI9A 4CDUC 4Q1RA 4KRXA 3DE6X 3FROA 3IMEA 1GV9A 3OM8A 4E3WA 3DHWC 1YCFA 5BVGB 1ETHA 2JJ1D 3D7KA 3NYRA 2D7JA 3EFBA 4A1FA 4FR0A 1IK4A 5EIAA 3GFRA 4MULA 2WTAA 1AYM3 3LBIA 3E23A 3M1LA 1TYDE 1LRHA 3H2GA 4ZS3A 5F3CA 2B8MA 4L4RA 3WNDA 1CRPA 2Q8EA 1CUHA 3WXMA 2F8LA 4LNHA 5F5NA 5DASA 2O0JA 5FEUA 5GZEA 3A27A 4WBSA 1EDZA 1RHMA 5K8IA 3EZFA 1IOVA 4E2YA 1SXHA 4R2JA 4MV1A 4JAAA 3A3OA 4MKIA 1FUEA 2PO7A 3FHLA 2RS32 2P3LA 4DREA 2GCPA 1ZU5A 1RXUA 1THTA 1SVNA 3OVMA 2C5SA 5EWMB 3IPYA 3MS4A 5LYJF 2OW4A 3HCPA 3OTIA 3WW1A 4DQVA 1VL1A 1BS1A 4JC4A 4DUPA 1CYDA 1ZISA 3QTLA 2UYCA 3HQ4O 2IXIA 1PVDA 3OQMA 1GRVA 5JWPA 3FPHA 4DJAA 4IGQA 4ENTA 4E2XA 3HQRA 4MRVA 1J4AA 5JS1A 1ZWLA 3GZJA 1FX5A 4NU6A 4IE5A 3RKSA 1KRWA 5KC6A 2GEDA 2B42B 1K5HA 2C5AA 4KBFA 2H63A 2XUDA 3T9FA 1NW6A 2NUBA 4FP9A 4BB0A 7ABPA 4AI8A 1KR5A 3FWPA 5DTRA 2C3OA 4KL8S 3U0ZA 1I6WA 2CLKB 3EQ2A 4JI7B 4B4VA 4MR9B 1SLBA 3TVYA 1U94A 2FW7A 3NHAA 1EG2A 1PLJA 1M2OB 5A03A 4Q4V3 3WDYA 2WFLA 4OVEA 3IJ5A 3B38A 4N82A 2HWC1 4LWPA 4UNPA 5AVSA 4D6PA 4BIFA 4WM8C 2CBGA 1UJMA 1CQZA 2DB3A 4AEDC 4FOTA 2F43A 3I59B 1DI0A 4BYYA 1DCKA 2EOAA 3QPAA 3LQ4A 1CUFA 2DVGA 1KEWA 2DH5A 1EH5A 8ATCA 2FPPA 2XKKA 1X9TA 4B3JA 2WNSA 4NAUA 4WXEA 3ROQA 2HMAA 5K03A 4CCWA 1XVVA 3FG9A 2OKGA 1XC7A 3SKVA 1XI2A 5ERLA 2H0BA 1MRSA 3JBG2 3CL1A 4LK7A 3NKLA 3HXTA 2NYAA 1M06G 1HRKA 2C7BA 3I12A 2VI5A 1C3HA 1IRXA 4MQFA 3RM3A 2QQIA 3HR4A 2NXJA 3ZU3A 5CJJA 1K42A 3OPMA 4KSBA 2W6OA 4FGJA 4FQZA 2VRNA 1YNOA 2PZ8A 1H2FA 5EIBD 2VDVE 5T4HA 5KU7A 3QKSA 3I0MA 1UXGA 1ZOOA 1WLSA 1DC8A 3WWCA 1QJX2 2VOEA 1ST2A 4Q3NA 4ZCQA 4IG4A 1QAMA 1JODA 4D3FA 1GTSA 4OX9Y 3IKVA 3O7OA 1VJ5A 4DT1B 5I3ZA 3HY6A 3C4VA 4CCJA 4IG9A 1Z26A 2PS3A 5FZ3A 2XLFA 1XJ5A 1S1CA 5CAZA 2P3YA 1PG2A 3I3BA 4Z49A 1WU7A 5FZ8A 3O0DA 5LBTA 1G16A 4I0WB 3P9YA 2PCJA 5LYJB 3A31A 3LP8A 3WA7A 1C5KA 3RSQA 3OLZA 1XTSA 1Y3HA 3BVCA 4MS1B 1Q6ZA 2V96A 3H1FA 2GXUA 2SNIE 1QFXA 3F6SA 3EXG2 4LOIA 3S5UA 4HT3B 1LQ2A 3DH0A 3LECA 2W0SA 4HSLA 5EYXA 4D97A 1QOPB 4TMTA 1LI4A 2KHZA 1CS0B 2CLMB 4QARA 1Y7BA 2ORVA 4WVWA 1C4XA 1RP1A 3LIGA 3EJKA 5FJKA 1GYQA 1NNUA 3V1TC 1C4RA 1LODA 1MVOA 5EQDA 1E1QD 4YFWA 2KXLA 4H31A 3H86A 2DWQA 3JY6A 4MLDA 4QNNA 1Y89A 1SXJD 4F4DA 4URYR 1V6AA 1V6JA 1KAHA 5DN9A 4AAYA 4I55A 2Z69A 4AKTA 2RR12 4N7JA 1RKUA 4PLTA 3K8ZA 1N5RA 4MI9A 3WRYA 4JLUA 2PAAA 3ORSA 5LA6F 4KOEC 2YHIB 3NYWA 4LMPA 3V1NA 1EB9A 1N6NA 3NNDA 1E1YA 4MIKA 4Y6OA 2YJ4A 5J96B 5HS6A 4HT1T 4BQSA 5LBFA 1SMKA 3A9SA 1LVHA 1GILA 4PQFA 5K4LA 2ENRA 5LDDC 4MVJA 4BLRA 3TRKA 2P3IA 5B55A 1GIAA 1GWNA 2JI7A 1IUKA 4F6LA 2C0QA 3E1SA 1O6BA 2VOKA 1E3IA 4I4IA 1BEEA 2AJDA 4R3UC 3NH6A 1Y5IA 3PENA 1EDDA 2CT8A 3VKNA 1F5FA 1RADA 2BI7A 4G24A 1NVAA 2UDPA 1UM9A 1UBFA 5DYIA 3NVMB 3M1YA 4JJEA 3CU7A 1TT7A 2GXSA 3EVFA 5HSGA 2WKPA 2B4YA 1QGLA 4C9BA 3C7EA 5HKBA 1QCZA 4QDKA 3HT2A 1RKQA 5GKAC 1ECJA 3T1YB 2FCUA 1H2KA 1A1SA 5G4KB 1W05A 2KM2A 4HAUA 4F7DA 2WINI 1T5SA 1QYVA 3OE4A 3KYDA 1RLMA 1SVUA 2XYVA 2HEIA 1ND2B 4IJKA 5DPNA 1C9MA 3F98A 4BKRA 2H4JA 1BC5A 1O5OA 4AWDA 2OVFA 3DECA 4LZAA 4O3FA 4Z0HO 3VV1A 4HAVA 5J4KA 1OYYA 5CEJA 4H4DA 1OLUA 2GN1A 1DC6A 1I14A 2ZMNA 1LJ7A 3I4FA 2XDWA 3T9BA 5JFOA 4PDWA 2JGIA 2P6HA 1CBUA 2VZ1A 3UKNA 2X2EA 4W8HA 1X9HA 3CU5A 4M55A 2IYSA 4MUMA 3EDQA 4O9EA 1H4VB 4QWWA 4XUGB 3KJFA 2RHOA 4FHCA 4QDRA 1EX7A 2HDNB 3DOOA 4H3VA 1A04A 5J98B 3H1AA 3UJ3X 1N7GA 3WNNA 4LOSA 2PMCA 1O6FA 2HCBA 4M98A 4M38A 2OPKA 3PR1A 3DAPA 3U0BA 1ZKMA 4CPDA 5JOYA 5CH3A 4KQ6A 1G8KA 2GBCA 3GLFB 4EUSA 5FWAA 4YGEA 2PWBA 4KGVA 3MIEA 1D4AA 1OUXA 3UT5A 4CFSA 2NSLA 3GMTA 1UT8A 2ZR9A 3MJFA 3G85A 2OD9A 2CJXA 2OO7A 2R8BA 2Z3VA 1SOUA 1KAEA 1FJGB 1BHSA 2QS9A 2TRSB 5A6XA 1KDYA 4J1QA 1R0RE 2RGXA 4RIHA 5LA6B 5L53A 3OGVA 3MM4A 2JKVA 2G7ZA 3H9UA 4MA0A 3O90A 2WMDA 2I29A 3BD9A 1N1YA 3K2BA 3O73A 4RW0A 3NHFA 2CHVA 3TEJA 2CDNA 2A9OA 2Q49A 4GD4A 4QT4A 4JLBA 3VHOA 2D2EA 2Q2QA 1JW6A 2QVCA 1Q7TA 3DUWA 5CB4A 2QQKA 2N46A 4NIIA 3F2VA 2ATFA 3AVWA 2BHRA 3F71A 5JYBA 3WT3A 4V2VA 3MINA 1HXS3 1ZHHA 1PCXA 1CEYA 3GLUA 1E5DA 3KB5A 1MZPA 1TME2 1YCDA 5KSWB 4JFRA 3CLSC 4PONA 2YHAA 1K6XA 4HNTA 1OPXA 1M2KA 3THPA 3TTYA 4GPTA 3NWEA 1DELA 4MDYA 4AJPA 4F4JA 1FNSA 2QN2A 1TM1E 2VVTA 1FV3A 1KDVA 1U2DC 5BN4B 1DOZA 1D6MA 3VHPA 5INTA 4FYPA 1TZKA 3POGA 3RS5A 2HFKA 3R0ZA 2RHCA 2R8EA 4I4CA 1EV11 4HZGA 1F20A 2IYUA 2QUOA 5KDLA 1ZJYA 4HXGA 3ONVA 3OBBA 3ICOA 4QDTA 3VZBA 3H5IA 4AJ4A 4P14A 2Y9PB 4CFZA 2VDRB 5CFQA 2NP6A 1K66A 1HW5A 1NP6A 2RHMA 4LIVA 1L5NA 3M6FA 4HD8A 1NI4B 4QVKA 5FORA 1J1ZA 1DDIA 3E1GA 5F3DA 3EOBI 5AFSA 1LY1A 1QRSA 1RZ3A 4OQYA 1IOLA 1UJ4A 4LRSB 4OQZA 1X8KA 4FJ0A 4LZWA 4MUFA 1QJU1 1OFSA 1VYHA 1XO1A 4UDNA 5B1IA 5KTKA 4FKBA 2DF7A 1ZRNA 1LVGA 2JDPA 2XQIA 3PJYA 1W04A 1I2BA 2J09A 3T3YA 4K88A 2C4VA 4YRLA 5JECA 2YHJA 1GCGA 4QX7A 1Z47A 3MTDA 1XNAA 5TNXA 4EUNA 4PTZA 2IEAA 3RC1A 2OOKA 2XL7A 5B64A 1ZBA2 4L11A 3LPGA 5EXPA 3X43A 3LPCA 3OOYA 3WGGA 3KR1A 4KB5A 2FW6A 1UY2A 4RABA 2DU8A 2Q9UA 1N8TA 5A3RA 4OKNA 3U10A 1UFQA 3CT6A 1EIWA 1BVUA 1JA0A 5LZ2A 4K40A 3RK0A 1TZCA 4MCAA 2CZQA 1NXVA 1D3AA 1NQDA 3FCOA 3SS8A 5FPTA 1MNQA 1UKBA 4HWGA 3JZMA 3UGKA 3KQUA 4KWKA 4U0JA 3KJXA 5GOZA 3WQSB 3SYTA 4I1VA 4RETA 3T0IA 1WTAA 4IETA 1U9YA 821PA 4DJ5X 3H7JA 3CRRA 4Y1RB 4GP9A 3BMQA 4BHTA 1H6DA 1RQXA 5KCMA 5EJ6A 3VH1A 3R9XB 4A2UA 4M3CA 4KWLA 4CBVA 5ENDA 4R9RA 2HWD1 1NMEA 2C2MA 2UZIR 2J6CA 4TWTA 5A4AA 2UYBA 3AM4A 1B35C 3F6BX 5T3NA 1GQQA 4RM3A 1J2UA 3TLZA 5IS2A 3WR5A 1L5FA 1A8IA 3GGPA 3D5OA 4PW0A 1NF9A 3EGDB 4GI3A 1DUSA 1K7EB 4HGQA 1ZD4A 5HCAA 2MEV1 2C9MA 1C0PA 3V65A 2WNUA 1HE2A 3ZU6A 1WF6A 1II8B 1QE0A 4JL6A 3TMAA 2D2FA 1PFYA 4GD3Q 4CIWA 4L2NA 5ES3A 1SUCA 1WZ2A 1Y6ZA 2V98A 2Y8EA 5G02A 2X6QA 2ZBPA 3DC2A 3NRJA 3Q2KA 4H0FA 3PC8A 5IT9A 4WEQA 1VC2A 5FDBA 2XIJA 5C3UA 4FUTA 3S27A 4XGNA 4FAHA 1U2RA 1RACA 1EINA 1O58A 1P1CA 3E97A 3L0PA 3THOA 1W3VA 3NNJA 2O7QA 4F11A 4XF1A 2ZYTX 4BO1A 5E16A 5EWLB 2A88A 4B74A 4C89A 4J43A 3Q6IA 1EIZA 2VZLA 5KB3A 1TJ5A 4E03A 1QIEA 4NUBA 4GDFA 4ASKA 5C4WC 5HF6A 1SG0A 4U6NA 4QPIC 3S1SA 3G0CA 4U2CA 5K6AC 2R85A 4GI7A 3VBFA 1QKQA 3C5EA 1T2UA 5JISA 4QB1A 3VUFA 3AEUB 1ABFA 1KETA 1WBLA 5A06A 1XL0A 2YUIA 5I7VA 4TYQA 2FBEA 2WDZA 3LRTA 3NYQA 3O8BA 3WGHA 1UMCA 4IX9A 2WJIA 1GSHA 2Z58A 5H82A 1VGQA 5IVVA 1PFVA 3T09A 3NDJA 1FRVA 1YJLA 3NWOA 1YUDA 1CUDA 3A3YA 4WOPA 2I4OA 3G6KA 5D8AA 1LH0A 3LEGA 3FWYA 5CT6A 1DZ3A 3COSA 5FBJA 4RANA 1B8VA 4FGLA 1QJY2 3GLQA 2J46A 1GWKA 1WDMA 4RPCA 1EK6A 3KVAA 1N5MA 3KT0A 5I9TA 1TZ2A 4BFZA 4NMIA 1C81A 3GOHA 1ULPA 1GZHB 4D0QA 4LO6B 1EV13 4QOGA 2HWE2 2F1JA 4ZMRA 1NM5C 3TOVA 1L4NA 2VP9A 4XI9A 1VFPA 2QU8A 3WLAA 3M3PA 2CSUA 2RGUA 4L16A 4X95A 1PNTA 1A9ZA 3QUAA 2F3PA 2IXFA 1VRH2 3NXSA 3LWCA 2XA1A 5JXHA 2H57A 1XZCA 1CY1A 5AM1A 3L49A 4EW2A 4G37A 2DH6A 4HKTA 4HCJA 5MN6A 2EIBA 1BX3A 4HNQA 1R8JA 2HX1A 4HLCA 3KMHA 2QQNA 3F6CA 1VYVA 4FE3A 1WDLA 2W37A 4QQ8A 2WZR3 2WJGA 3GYBA 4MYTA 3UHJA 4PO3X 5I8YA 3D7RA 1UMKA 2CSGA 4PY2A 3GGGA 3K1JA 3G82C 4BAZA 4FFGA 2G9ZA 3IVXA 3UJCA 1PE0A 3CPJB 2XH6A 1NPTO 5KUTA 4EE2A 4GYKA 4S2UA 2OX0A 1SCIA 1RRCA 5LWQA 4I99A 4GYWA 1OQAA 4IV3B 3WNPA 1B8NA 1B74A 2VYQA 2JJ2D 4PU0A 5FI3A 1XQ1A 5ALOA 4OM8A 2J0UA 2OGUA 3ASVA 4JELA 3QEJA 3MIFA 5D3MA 3LAGA 2W2TA 2J1TA 1YDFA 1Z33A 1QZXA 3H84A 4OQLA 1N6LA 5D1NA 4Y2QA 4OLAA 3AFOA 1A9XB 5G0WA 3A6JA 3EXFB 4EV0A 3C8ZA 5HR5A 1FP4A 1E5XA 3FZQA 5EKUA 2FQ1A 5EUQB 5DYWA 1AM4D 2FKAA 5KEIA 3ZG6A 1FP2A 5JMTA 4IIFA 3DF0A 1FNYA 1E2GA 1E18A 2V7UA 2OILA 2C29D 3QUSA 1HMPA 2HWD3 2QZ4A 4MW1A 5JSYA 3O12A 3MJTA 4R1TA 3BWEA 5JRZA 4W6YA 1E3DA 2I9PA 4C88A 4DCPA 2CLFB 5AW4A 4HDSB 1E1CB 4XWGA 5LATA 4J9VA 2MEV3 1J7JA 3GRAA 5AJYA 1ODMA 5IVDA 5BWCA 2P4EA 2VPZA 1BSVA 1ZIYA 1X42A 5SYAA 5TF0A 1NVFA 2A57A 2DLDA 4ENPA 4G0VA 1PO12 5IK7A 1T8SA 4N9QA 4CGYA 1MOSA 5HUHA 2NT3A 4XILA 3KZXA 1KQOA 4MUNA 5HHTA 1KSGA 1O8PA 1N6KA 3W05A 2XF8A 3K9BA 2J59A 4IV1C 4OP3A 3UQZA 1NRIA 3CUVA 2DT5A 1P29A 3OZXA 4M22A 3JAWB 3DMTC 3LLVA 3QE2A 3RUHA 4JUIA 3DTTA 4KG8A 2C94A 2H18A 1G38A 4BNHA 1GXSB 1G7CA 2C9DA 4P32A 1ISSA 4QQ2A 3BWVA 4LYHA 5ITZA 3ADKA 4MGQA 2HNBA 4G2TA 1SXJB 4HB0A 4ZDWA 2AN9A 2JLRA 1HTBA 1P0CA 4RFSB 4W5QA 4IJMA 3INRA 2BKVA 4XMIA 3AI7A 3EFOB 3KJIA 3GUYA 5EKDA 3CLHA 4ZIRA 2VZQA 5CT8A 3B5JA 2C0ZA 1AY0A 2Q1YA 3OJBA 3IAXA 3RFUA 3Q3JB 5GWXA 5BUCA 1S0JA 2VCBA 1BEV1 1V41E 3FNRA 4RO0A 1R2QA 4IESA 4CMJA 1H9CA 4QKDA 3A0NA 2LDBA 1ZI6A 3FAZA 4CE8A 3U9SA 4PIPA 1K7YA 3FNHA 4F0JA 2NQTA 2C1ZA 4JL5A 2XH8A 3SOPA 2BISA 1TZMA 1D6JA 2P2SA 2Z8XA 2IHKA 3JYHA 1GITA 2WWHA 5I7UA 1IG0A 2WHEA 3T7CA 1HTTA 4S2GA 1YLLA 1V7CA 4Q7KA 4A45A 2AVNA 1YS7A 2PSSA 3POJA 4IKEA 4EVRA 1FS5A 1V8FA 2C00A 4ARZA 4QODA 3SQWA 5BR8B 3M70A 1IBRA 1YTUA 1IKPA 1BJRE 4OQ8A 3FRHA 3ITNA 1M10A 1CRWG 1H1IA 1JJ7A 2GEKA 3P9IA 5DLEA 5FYTA 4FVTA 1S3GA 1HH4A 4LSWA 3GGOA 3GGCA 4P92A 4HATA 4JLDA 4CYDA 4ROTA 4LTAA 3EO6A 1EGAA 5FF9A 5FJJA 4IUGA 4DB4A 1N5IA 3R6GA 2PUFA 3KHKA 5LA0A 1IWBB 3SC4A 1IC6A 5MHTA 1GA6A 3FZGA 4R0MA 1HDOA 3U3KA 4IXDA 3Q1KA 4N5LA 1HNZB 2BTVC 4OMUA 2G88A 1OAOA 2YG0A 2CNDA 2C4KA 2FEXA 3WLRA 1U6KA 1Z4NA 2G40A 3MK31 3RHTA 4B6GA 1DOAA 4PNZA 1O1YA 2NMVA 1QIIA 3D6TB 3L2HA 1I7QB 1JHDA 1MA0A 1U3GA 4TWRA 4FFPA 5HZKA 5BMOA 5L6MB 3QQPA 1WW7A 2XWJI 4CQNA 4YALA 3WDWA 5HIJA 4HK8A 1XCJA 5KHLB 1AKRA 3BIWA 3FN9A 3VHLB 1IS3A 4P9XA 5KXEA 2XMLA 4JI5B 4Q3DA 4PIXA 1K88A 1U5BB 4EAQA 4IL7A 2R7KA 1CAVB 4WCVA 4ZJYA 1PR2A 1UK7A 3O2NA 5CR9A 3ERCA 2R2AA 4A8JB 2QUIA 1JQEA 3EXEB 4H7KA 5CXQA 4R8VA 1BDJA 3QVOA 4ZKEA 4Y6LA 2WLQA 3BOWA 2OT7A 3SDSA 4TZ6A 4FEEA 1YJAA 1VDZA 2HWB1 2AB0A 1L7DA 1EUTA 1FRFS 2JI8A 3WKCA 1FDWA 2Q29A 3OZSA 3VVMA 2C3PA 4MVJE 4BVFA 2PXAA 4I8XA 2QGZA 1Y81A 1Q57A 3LKVA 5FBKA 5J58A 1W30A 1UOFA 1GCIA 4LBOA 2WP8J 3DWIA 5C1PA 4YMSA 1GSIA 1M7BA 3TLYA 3RIXA 3B85A 1QV6A 3PNQA 3K77A 4R3WA 4NQZA 3E15A 3VFDA 1QFSA 2FPKA 1I94B 2BR5A 3MHPA 4JVMA 5J4YA 2EDAA 4QHYA 1L7QA 1C0LA 3ETHA 3PI6A 3MWLA 3P97A 4QLOA 4FFFA 4HRXA 2ZACA 1B3RA 4EJSA 4M1EA 3EPRA 3EXIB 1BU8A 3ZDAA 3ITDA 3OPNA 3RQIA 2OAGA 4F9TA 3KZNA 2RMU3 1WDWB 1I51A 4IFBA 2H00A 2P0EA 3DQQA 2Q7OE 3RF7A 1XJAA 2OWDA 3FYDA 5FZGA 1KOGA 5ER9A 3GJBA 4MGTA 1JUDA 2JAHA 1J06A 1Z28A 5C5CA 3E3AA 1PGW2 4FT4A 3ZZMA 2PLV2 3UMGA 5FTNA 1PGSA 3WIVA 2J9RA 4G4JA 4KYTA