3BPSA

Pcsk9:egf-a complex
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
530
structure length
435
Chain Sequence
SIPWNLERITPPRYRADEYQGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHWQLFCRTVWSAHSGPTRMATAIARCAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDAVTAVAICCRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for LDL receptor recognition by PCSK9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/lipid transport
molecule keywords Proprotein convertase subtilisin/kexin type 9
total genus 128
structure length 435
sequence length 530
ec nomenclature ec 3.4.21.-:
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF18459 PCSK9_C1 Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain
A PF18463 PCSK9_C3 Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain
A PF18464 PCSK9_C2 Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.690 Mainly Beta Sandwich Jelly Rolls Proprotein convertase subtilisin/kexin type 9 3bpsA02
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3bpsA01
1GTJ1 1S2NA 2GKOA 1Y34E 4DJ5X 3WQBA 1S02A 3EDYA 1TM1E 3WIUA 2ZWPA 1SIBE 5ARCA 4KPGA 3BPSA 1P7VA 3L1KA 5JMOA 1SCBA 1SUDA 2HPZA 1PTKA 3T41A 1AH2A 3LPDA 1ZVKA 3ZXYA 1GCIA 1WVMA 3AFGA 5AVKA 2V8BA 1ZVJA 3DDZX 2G4VA 5FAXA 1SUAA 2SBTA 3DW3X 1KE1A 3SICE 4M1ZA 1HT3A 1SUEA 1GT91 2X8JB 4DWWA 1GNVA 2Z2ZA 2W2NA 1TM5E 3DVQX 1MPTA 1PEKE 1AVTA 1ST2A 1V6CA 1WMEA 3LPCA 5FFNA 3TI9A 1OYOA 3WHIA 1C9MA 2ZRQA 3AJ9A 1BE6A 2QTWB 3HJRA 1KE2A 1GTG1 5JXJA 1AV7A 4CFYA 2DP4E 2Z56A 3AJ8A 4B5LA 1SUBA 3PRKE 4KB5A 4AKTA 1SIOA 3LPAA 4ZOQI 5B1EA 3DE1X 3LXUX 3SQOA 2DQKA 3D9QX 3Q40A 3QMPA 1YJAA 2PWBA 4YN3A 1WMDA 3F7MA 3VV3A 1AQNA 1Y3CE 1GTL1 1OT5A 4H6VA 3I30X 4MZDA 1NLUA 1KDVA 5JXGA 1XF1A 2PRKA 2WUVA 3EIFA 3DE4X 3I2YX 1SPBS 2Z2YA 1SBTA 4H6XA 5ARDA 2WUWE 3DVRX 3UNXA 2SICE 3VTAA 4AKSA 2X8JA 3DE5X 4JP8A 5B1DA 4OV6B 4J94A 3DE2X 3OSZA 3A3NA 2PYZA 4RYDA 1SBCA 1T1EA 1C3LA 1EGQA 3VHQA 3WIVA 5K7SA 2PQ2A 4LVOA 1Y9ZA 1SELA 1Y1KE 1Y4DE 3A3OA 1V5IA 4FONA 3VYVA 1AU9A 1PFGA 5AQEA 1ST3A 1Y3DE 3ZXXA 1T1IA 2PMWB 1C9NA 1TO2E 1KDYA 1P8JA 1SCNE 2IXTA 2Z58A 1Y3FE 3CNQS 1SUCA 3DE0X 4OMDA 2PKCA 3Q5GA 4NE9A 1GA4A 1CSEE 1R6VA 1GA1A 1IAVA 1PJ8A 1C9JA 1Q5PA 3F7OA 4NE7A 4DZTA 4ZARA 3DE3X 4BWGA 1EA7A 3I34X 4OMCA 1BFUA 1JEAA 3F49S 1S01A 5JXHA 1YJCA 2DUJA 2W2PA 1BJRE 1NDQA 1SH7A 1BE8A 3GT3A 1OYVA 2WWTA 3VSBA 2SECE 4LVNA 1DBIA 4C3UA 3VV2A 3DE6X 1SCDA 1VSBA 2PWAA 2SNIE 3BGOS 1SCAA 4GI3A 1KDZA 5ARBA 4HVLA 1SIUA 1GNSA 1TECE 2WV7A 3QFHA 1Y33E 3DVSX 2P4EA 2ID8A 1SBNE 3PTLA 5AMXA 1R0RE 1Y4AE 5SICE 5I9SA 2Z2XA 1TM4E 2IY9A 1AF4A 4K8RB 1WMFA 3BX1A 3H42B 3A3PA 3CO0S 3DYBA 1YU6A 3D43A 4WOCA 3DE7X 1AK9A 1TO1E 1SN7A 1TM3E 3TI7A 4CFZA 1SUPA 1IC6A 1TMGE 1BFKA 4C3VA 4CG0A 2E1PA 4Z2AA 1SBIA 1TM7E 1SVNA 1UBNA 2ID4A 5AVJA 2TECE 3GCXA 2XRMA 4NMXB 1THMA 2W2MA 1TK2A 5FBZA 5JXIA 1SBHA 2ST1A 3DW1X 1CNMA 4HX2A 2W2QA 2Z57A 4H6WA 3TECE 2Z30A 1T1GA 3QTLA 3P5BA 3EE6A 1Y48E 2ZWOA 1DUIA 2B6NA 1BH6A 1WSDA 2XTJA 1MEEA 3GT4A 3GCWA 4WOBA 1GA6A 2W2OA 1SCJA 4I0WB 1NDUA 1Y3BE 1YJBA 1P7WA 4KG7A 1R64A 5CW1A 2HD4A 1A2QA 1LW6E 3I37X 3DWEX
chains in the Genus database with same CATH superfamily
2CAVA 2VP6A 1GRQA 4J0EA 5JWPA 5K3AA 3AKPA 3GARA 4CXYA 1NXQA 3E9NA 4CMIA 5E7QA 2XAUA 3VR5H 1QF6A 3N59A 5AW9A 2XCUA 3WSTA 3LA6A 5I8ZA 1YB5A 3LD8A 4Q4LA 1L7OA 4Y98A 4TXMA 2OS2A 3GZUC 1AHPA 1UPFA 3A1WA 4R52A 5HCBA 3IPVA 1HW5A 3G6JB 4K03A 1G9FA 2BYTA 2FN7A 2QMUA 1V8FA 1EVEA 2YWGA 4BNMA 4D7YA 1CX9B 2EGUA 4AECA 3DDCA 5F4ZA 2PCJA 1G9BA 1LNZA 4JN6B 3QUAA 4XFAA 4NK5A 1QZUA 3NHFA 3PWTA 2H5EA 1NXOA 2X4IA 1NM5A 4KR9A 1EE9A 1QXJA 4MSVA 2A0FA 3A9WA 2A0UA 1EYBA 3SMVA 1IOWA 1PQPA 3BS4A 1JR3A 4OA8A 1NR7A 4FFBA 2O0HA 2C77A 1CVRA 3EVZA 5FWDA 3WOGA 3DD1A 4YLGA 3I1FA 2JIJA 1DRUA 4Y1ZA 1IHYA 3RVBA 5I7RA 4PPYA 3L4KA 1PFYA 4BXFA 3N7UA 4UHEA 5A4IS 4BMXA 1W1WA 4L4UA 3TD6A 3JCZA 2HW8A 5EESA 4PO3X 4R3NA 1Q8QA 3B8EA 1ZUWA 4DSTA 3U7HB 4JZYA 4A10A 4R1UA 3UNXA 1ISIA 2P9GA 5H82A 5BSKA 4X45A 1S1MA 4X85A 1NQXA 1SHKA 2P5BA 1W6PB 3GLGA 1EHIA 2X9NA 1MEOA 3K32A 3HCOA 4C89A 3S0JA 1SXHA 1GPMA 2A59A 1Y8ZA 1GRCA 3BH7A 5ALFA 3INAA 3JD1A 3O0VA 2JEMA 2JKZA 3LUDA 4XMAA 1G1MA 4FNGA 4R69A 2Z4RA 4GMGA 1WXQA 1LS1A 3VKUA 2Z9BA 1P81A 2JAPA 4MO3M 4J7UA 4XJ9A 1G9XA 3MPOA 3BN6A 5ECYA 4LY0A 4DCCA 4YWAA 2C5AA 2RBGA 4ZAGA 1JALA 2WJHA 1IHPA 2B8JA 1A97A 3E9MA 4DLXA 5FZ1A 3EYPA 1GPUA 3ZY3A 1I4EB 2DURA 1TJYA 3G85A 5T4BA 3UENA 1MRNA 3I2GA 3BA1A 3GJRA 1YE5A 3A05A 4RHUA 3ZE7A 3RYPA 1S9HA 3DYPA 5T41A 4NZPA 5FFOC 3NWKA 1KZYC 1T6XA 1QKKA 3H2KA 1PR5A 4CKXA 3DAGA 5F6KA 1L9KA 5JAQA 5ESRA 4KX5A 3DGTA 3KT8A 1DFGA 5F2KA 3H9JA 3EF3A 3OD0A 1NUUA 4ZDWA 5EWJB 4LXXA 5EEGA 5CFMA 4UDXX 1NVEA 4I02A 1RMTA 1AR71 2HIGA 1QPGA 1GUBA 3AL2A 5DNWA 4WKPA 2ZWIA 3INYA 1ZBA3 2PFGA 2CEKA 3CVYA 4R9CA 5AYVA 3KIPA 4LQ4A 5DGXA 3E1GA 1T2NA 4MRNA 1SUFA 4RAOA 4KTTE 4KWIA 2JDID 4LO5B 1VALA 3TSYA 3WYDA 4XTRA 4JTNA 1MS3A 1P39A 2NQ2C 1UEJA 2XYVA 4G5HA 4KFCA 3JVDA 3MBWA 3CHYA 5HNKA 1M83A 2ZZMA 3B2QA 2VSYA 1LPPA 1SDDB 1SQSA 4PAQA 1N8KA 2QAJA 4JIMA 3K71B 3WDWA 5K3SA 2DFKB 3D5TA 2GNBA 1H4GA 4CLDA 2H4FA 2OHIA 4H7EA 3T5TA 1JX6A 2A1IA 3JQ6A 2PHWA 3F5DA 4J2HA 3HBAA 4NOJA 5F73A 4CDQA 4LUMA 3BOWA 4ZV9A 1GSOA 4OY3A 1O0BA 1XWFA 2O3TA 3NUGA 1LOGA 3DE2X 5HK8A 2VJOA 4YPFA 3T7EA 2EQ5A 1CSEE 3L8GA 2OZKA 5U4XA 4TV8F 3HADA 5FPVA 2QN6A 1VJRA 4O9EA 4XVUA 3VZQA 4QDRA 4IL5A 4RMHA 4C6TA 4ER0A 4Q4X3 1UXHA 3AT1A 2HBUA 5I8PA 4CEJB 5JUVA 2EJVA 1O89A 1R6TA 3R8CA 1OFIA 1NT0A 1Q17A 1GGHA 2Q3CA 1SBYA 4PDWC 4QXPA 2P3OA 3ER9A 3AGQA 2X8AA 2YJTD 2MOKA 4I08A 4NMMA 4S2UA 3WK4A 2O50A 2BEUB 2C2OA 1QGAA 4HRXA 3E3NA 5JJKA 4Q26A 1ULOA 4HS9A 1ZZ6A 1UMCB 1WOYA 1CC1S 3QJGA 1REEA 3UWOA 1KAQA 3FNBA 2IIQA 1XKTA 4A8JB 5IAOA 4FFVA 3FDIA 1DQZA 5E3HA 3PXXA 3NMBA 3CIHA 4Q1BA 1H6BA 1JZ8A 3VPGA 1RXYA 1JIUA 2JJ1A 3RARA 2BHNA 3T0BA 1U9CA 3BGSA 3H75A 3T7CA 13PKA 5FO9B 1DXQA 4MS4B 1KH2A 4REOA 3NANA 1FTWA 4HF7A 4QM8A 2Y1WA 3VD7A 4CE8A 3WG1A 4W63A 1U0GA 2G3YA 3SC4A 2JA2A 3NVDA 1M2OB 2XTJA 3OZIA 4L6CA 2C9YA 1EHYA 1N4DA 3T5CA 4CQMB 3ILHA 4A4AA 2DYKA 2VF5X 1PKEA 3V2GA 4DJEC 5I0TA 1QJU1 2XONA 1VB2A 4LLOA 4OKNA 2WU3A 3PEFA 1VMFA 4FQ8A 1LZLA 3E5QA 3DDZX 3KQ4B 2R62A 1L7QA 1L8XA 4NFYA 3G7UA 1ISGA 5B3AA 3VYTB 2JICA 3DE1X 1PZ9A 3LQYA 1UY4A 1DLJA 4Z4EA 5H4GA 4PX9A 5C9AC 4R9DA 1ISRA 4KGZA 5B3LA 1V0AA 3O1SA 5LA1A 5A4MS 3VNQA 1IG3A 4HZFA 5BMVA 1KIMA 3OCPA 1XMPA 2RKBA 1QDUA 4IS3A 1DRVA 4EENA 3ZDDA 1YB7A 5E7JA 2VPQA 5HDQA 3VYUB 3NBYC 5FZDA 2FPIA 3FYDA 4Q05A 4F6CA 3P96A 1AUVA 1YXWA 3I59B 1U04A 1WBLA 3AYEA 1RKBA 3RDPA 3BERA 3ANMA 3OKFA 4OFXA 4MRRA 3WNMA 5IKOA 1AQIA 1YFJA 1N2CA 1T9CA 4CI9A 2FUCA 2Y76A 3TB6A 1V6KA 1X74A 2OYCA 4EJRA 3FX2A 5J98B 2AZ5A 2J6BA 3JQ7A 2PHFA 5FTTC 2KXLA 3LDFA 2YV3A 4LDJA 4Q18A 5A6VA 2YINC 2M6RA 5HKKD 1HSOA 2HTEA 3DL2A 1LGNA 2C82A 2IS1A 1WCYA 3PFHA 4BEJA 3KFXA 1GU3A 3QXSA 2DY1A 3EODA 1GWMA 1WA6X 5TF4A 4H08A 4QPZA 2AE2A 3CEAA 1UJNA 4IQ8A 2CE2X 3QWHA 4A1FA 4DLVA 4IM7A 3PEYA 1WU7A 2YOFA 1DEKA 3VO2A 1OR8A 4H27A 1UMCA 4E6PA 3A27A 2VAVA 2O8OA 4QFMA 2ZXEA 3PTAA 2H1CA 3IT3A 1Y82A 1N2ZA 2YICA 3PQ7A 3RIEA 4R4JA 4HSGA 1LI7A 4ENRA 1P2BA 1PI3A 1EX7A 1GFSA 3ITEA 4YW2A 3BRQA 3IAM1 2FCRA 1VRVA 4GU5A 4BC0A 4HAWA 1WGPA 2DHEA 3LVFO 1NG9A 3C3XA 1LLCA 2H48A 1X80A 2VA8A 3DL3A 2V58A 2C4UA 2GFQA 4LOJA 3HPNA 3QKWA 3H7AA 5A3SA 3DUWA 5CFNA 2DKNA 3OPZA 4DWWA 3V55A 3CC8A 1G16A 1XP5A 2WWIA 2BFEB 4MEBA 2Y60A 2ZJBA 1PR9A 1QYIA 3MXOA 5ALLA 3RZLA 3W6OA 2C5DA 3CGWA 2DPHA 1JP7A 1T4GA 4DLNA 4CEYB 2X3YA 3AVUA 4B2YA 3AHGA 3PEUA 1A9OA 3KOWA 1REFA 4XFCA 1ZESA 4OLHA 3IT0A 3MAGA 2G8NA 1TEZA 4KAFA 2YCLA 3LVQE 4X71A 4RGQA 1L3BA 1P8AA 1XTRA 3D31A 4H2DA 2J3DA 1KQOA 4DZTA 3F7OA 4RORA 1T34A 5K3OA 1JHQA 1HRV3 5LOVB 5F98A 2PMBA 5GOZA 4YJ2F 4EROA 1HLPA 5IDYA 2Y1EA 1YB4A 1F17A 1TZOA 2YWBA 3MJSA 2P1RA 5LQAA 2R042 2HEYF 4HY3A 4OXIA 3MJRA 3LC1O 5K8JB 4WX2B 2Q3FA 4PC1A 3VU3A 4I5FA 4EH1A 1CUYA 4IX1A 5LRSA 1U2QA 3MRSA 1IUPA 2HHAA 1JKMA 3GK3A 4MIOA 4Q4W3 4IH4A 2IYOA 3T15A 1ARZA 2QE3A 2XOKA 3C45A 1K2VN 2GXQA 4ZQFA 5AD1A 2ZTLA 3RGGA 4DUGD 3IR7A 3D1LA 3S5UA 5E8AA 1XRLA 4FZRA 5GZFA 1C8BA 1XSEA 4NDAA 3LXUX 1O9HA 4W50A 1HA3A 1HZZA 3W7AA 5AVZA 5HG0A 4HH0A 5LCXA 3LFTA 1V9LA 5DXJA 1HNWB 1CHDA 1I01A 2ZM6B 2IQIA 2N0SA 5DIFA 3LOIA 3CE9A 1OFNA 5ISMA 5C5CA 3QITA 5BNOC 3D2CA 4KYUA 3UMBA 1N1VA 4M1MA 3L43A 5HI0A 2I2BA 3TW4A 2CTVA 4Q66C 2FPPA 1P7ZA 1GQYA 1I2BA 3ZYCA 1RZRD 2WPDD 1CHNA 1RQRA 3LQ4A 1XU4A 4P92A 2ZW9A 3RZGA 3WGTA 3Q5EA 2ATIA 2ZWOA 3ESRA 3C1AA 3TLYA 2GPSA 3DMTA 3ZVXA 5LCWL 3ESZA 4N7BA 2OK8A 2Q4RA 1AF9A 4FW8A 3TN7A 1N7HA 4UD2A 3N6XA 2QYOA 3X1DA 2ZMNA 2J5BA 1V39A 2NZYA 2VCEA 3AEYA 4UJ5A 3LOUA 4JLAA 4RO0A 2VYVA 1I3MA 1DELA 4KOEC 2UURA 1Z6QA 4J0KA 4FX5A 4URZR 4G81A 1T8WA 2Y6LA 5K0TA 1LHVA 1JOBA 3F8TA 4MVWA 2WBKA 4QM9A 3B6EA 2O7QA 3GAAA 1UQXA 2QQNA 2G80A 1YLLA 4JOCA 4L8LA 4DT1B 1OFUX 4LBYA 1AU9A 1ZONA 1W5SA 1KMHA 3URMA 1VYVA 2VN8A 3UJ8A 4XGQA 2FB9A 5KNBH 1K08A 3PDJA 3DBIA 4RLSA 3RYRA 4CTKA 1G5TA 3ZWXA 2QDNA 5LMUB 1XPWA 2QM3A 4XDZA 5FUXA 3PUSA 1B0ZA 1G5QA 1VSTA 4W5QA 1Y1LA 4IIDA 4YLEA 4P9WA 1XKLA 1TRKA 3GEPA 1UIRA 2GN9A 3COPA 5KX5A 3DMGA 1NJGA 3M3EA 4UHBA 1LQ2A 4BFVA 5EKDA 2PG3A 1NSFA 2XNCA 4WXHA 1G7SA 1W39A 1RXUA 5EWLA 2HCJB 4YCLA 3DDWA 5BSFA 2H3HA 1BU8A 1EQAA 1Y3CE 1ZRRA 4Y1FA 3IRVA 3ASVA 1KK1A 3E5HA 3TM5A 4DCGA 4U2EA 1U28A 4YO8A 1WUYA 2PRIA 3UWKA 3AY3A 2GD2A 3LBIA 3IAM6 3LRPA 3P1JA 2GGSA 1TAGA 3S2GA 4GI1A 4O4IF 1XDBA 1Y1RA 4Z1OA 1HM5A 3VZPA 4M01A 3VKLA 1BEV1 4U9HS 5EIXA 3OHPA 1XEWX 5HF8A 3U1TA 1FXWF 3WLEA 3ALQA 1EDOA 3GFSA 4HWRA 2IXAA 4D25A 4F3TA 1PTJC 3QPDA 1CIWA 2YNMA 4BASA 4B9EA 4ARXA 1IZ9A 5DM70 4BFWA 3UGHA 2FCUA 1VPHA 3HVJA 5K8SA 3BJRA 3LZDA 1T4CA 4OLFA 3BXFA 4O2RA 3JQQA 1IDOA 1XNGA 2WC2A 1EY2A 1PJLA 3RHFA 3R23A 4HDRB 5U1PA 1A4IA 4LJYA 1S4QA 3JVVA 1ORHA 4M9QA 3KT7A 3D8CA 4OP2A 3A3OA 2I6FA 4IUYA 2EEZA 5C3UA 1NJ1A 5FREA 3P9XA 3EXAA 3MJHA 3NPAA 1J3QA 1RXFA 1JEYB 4JI8B 3IIIA 5J5CA 3FBMA 3VC3A 1YUMA 2VYFA 1M06G 2BKXA 2QUKA 2PKQO 3QVGB 2YFKA 5HKBA 2BOVA 3TN92 4MEJA 1KHTA 3UOWA 2PUAA 4R8MA 3JQ9C 3IVMA 1NASA 2CHUA 3SLIA 4HFNA 3I4LA 4OJQA 1KSGA 1SR8A 1YNOA 4H15A 1UOQA 2BJVA 3WNLA 1ESNA 4P82A 5SY6A 2RHPA 4F72A 3R5KA 1JXAA 3IUEA 2JKXA 2CWSA 1RIIA 2JL1A 3QLVA 4BVFA 1Z16A 2D6FA 2J67A 3M9XA 5AWFC 1KO7A 4Q3EA 2CT8A 2VAPA 4PBRA 5JS2A 4EYEA 1OWMA 4KRXA 1ZSVA 1JH9A 2PLRA 1UMBB 4YMUA 1S8NA 3VN4A 2HMUA 4OV6B 4PINA 2O20A 1T6GC 2VT3A 5A4JA 1VKOA 4U9IS 1RYBA 4JD5A 1VBB3 4RVNA 4B5KA 1MZPA 3RQIA 4NIIA 3EOZA 3RB8A 2HQ1A 4F7WA 3TRSB 3V3KA 5TE9A 4A92A 1AO0A 5A03A 1B09A 3MOIA 2FJUA 1QPZA 1YBHA 4AULA 1NMXA 3I5UA 4CIVA 3M1AA 2E6VA 4O2BF 3UEOA 2J9XB 1JDZA 1RUNA 1GYKA 4P80A 1SPXA 1SLIA 3DMFA 1E69A 3DDUA 4M0NA 5C52B 1LHNA 3NKVA 3X2SA 4PF1A 4DMMA 3U37A 1PQWA 1KJYA 5IVKA 4OP1A 2WO2A 1FB5A 1OU4A 4WUVA 4UXIA 1F12A 1EDDA 1EV11 4YP5A 1SMVA 3OFND 2GMMA 3NHUA 4A27A 4OUMA 1VLMA 1R16A 2VZRA 3VSCA 2P5YA 2JG9C 2HSZA 4BV8A 1RYMA 2HGSA 1KQNA 2BJSA 3EZFA 5JRDS 1COZA 1LY1A 2P0EA 1MOQA 3T1HB 1ST3A 1IKQA 1C9NA 3FMPB 4FVVA 4GS5A 4AY6A 2QRKA 1M72A 3FYSA 5D6OA 3ILFA 5G05L 2YMQA 1GFZA 4TM7A 4MVJD 2FSIA 1UEIA 2JBAA 3MCZA 3CS3A 3BXPA 1PG0A 3WR5A 1RUC3 3GRKA 4QUAA 1XCMA 1BFKA 4E2FA 2OXRA 2XMBA 4UMEA 3DV9A 2JGAA 3FYUC 1PFKA 1JHXA 1SXQA 4E8DA 5L19A 2QSJA 3R7DA 5BOVA 5CNAA 1Z3CA 3J7HA 5F3CA 3CPSA 1U1DA 3RTEA 2NOAA 2BUKA 1CQJB 3KPVA 3LO5A 1L5HB 5C9AA 1Q74A 3GBPA 4G86A 1TE2A 3F6BX 3WGJA 1A9PA 2NV2B 4MX3A 1I9GA 1NOKA 3GPDG 2DVFA 1LOCA 4MKFA 4PNZA 3SICE 4DUGA 1IATA 1EDZA 3CUEF 1XJAA 1TF2A 2ZUTA 3KYCB 4KNYA 3CWCA 3I2YX 2GYWA 3RVRA 2JG8B 3POBA 1P7CA 5KQPA 5DAWA 3A6EA 4WVWA 2IYXA 4FXKB 3TW8A 2JLUA 3LHIA 4QU1A 1ZMXA 4OUSA 1F8FA 2NTJA 3H9BA 3H2BA 4LHZA 4FGJA 4LNHA 3N35A 5BXXA 1BA2A 3R5SA 3PXAA 1LKNA 1EGMB 1HFEL 2IHTA 1R4MA 1XRPA 1MG0A 2ID8A 4IIJB 1ULFA 1EFTA 3ACDA 3GL9A 1YFZA 3BX1A 2QZZA 2FWIA 1C0PA 1Z4QA 3Q87B 1S0DA 3BN3A 3WLNA 1IY8A 3LPFA 3ZDAA 4DINB 3ZM8A 1DGWA 4OGFA 1B0PA 4TPKA 2YFZA 5KJEA 3SM9A 2R062 4O4JB 5AM0A 4X41A 3LC0A 1G3UA 2IYNA 4QPIB 3NIDB 1Y9EA 1T2CA 1SVKA 4RH0A 4MB6A 5ALJA 2K0GA 5T6BA 3CBNA 3BZBA 2AMYA 4A6OA 2WB2A 2E37A 5DTMA 2IUEA 4LDPA 1DAHA 1LK7A 5G4KA 1KYTA 3AKYA 2FEPA 3EWNA 2VNHA 4FZ3A 3I76A 1RVF2 4W8JA 1Y5NA 1GG9A 2HWC2 5FO1A 1Y3FE 1GGVA 1MABB 4YASA 1YZGA 1ZPDA 1KSJA 1J56A 1WP4A 2BPOA 1OYWA 4IIBA 4RFVA 4LF5B 1J84A 4ENQA 4XWAA 1FS4A 3Q8KA 1DQ1A 2RR13 3ANTA 1ZIYA 4I66A 1QJY2 3MPPG 4AFMA 1KDOA 4RZIA 2Y99A 2YIDA 1TM2A 2ZSUA 2XVZA 5JAUA 4MGSA 4IHJF 3HYLA 4EABA 3GJ7A 5CM8B 1IQAA 4I3GA 1KMNA 2AMLA 3OZAA 4YYEA 3KJEA 3OJEA 1L5FA 2I8AA 1R4NB 2JFFA 3NBUA 2W4IA 1E9FA 2JIBA 1FIUA 3UUGA 4O0MA 5LLSA 1UKRA 2E87A 3R3WA 2VUTA 2BNOA 5TMDA 2LW8A 3KSDO 3S7ZA 3NKFA 1RYHA 1WZNA 3MWJA 1TCVA 2XUPA 3OLXA 1BGWA 3F47A 3OOXA 3JR3A 3FCSB 4YW1A 4NOLA 4UKDA 1U8TA 4HUTA 2BGRA 1JI3A 4AC9A 1OXMA 2W91A 3U19A 3VZKA 4E5YA 2PH1A 1T1EA 1XTSA 2CJWA 1GNPA 1MKYA 2C03A 1G4HA 4KXQA 1S8FA 2PEYA 1YFXA 5HOQA 2W2PA 1YIAA 2GH1A 1K4KA 2UYAA 4M4RA 5EIFA 3N7AA 3NGMA 4MGYR 4CCEA 3SD7A 1Y7BA 3HPQA 5FYIA 1C9YA 4OQDA 2LCIA 4HDRA 1NV9A 3GT0A 4MV7A 3NV3A 2I7DA 2YJ6A 4N8DA 2ZXFA 1F15A 4D74A 2AEFA 1RMU2 4X93A 2QL9A 4PZLA 4DR5B 2V5DA 2MYUA 5C1IA 5L7OA 1XSQA 1E1RA 5F8PA 4JP1A 2RV9A 5FWYB 4W1SA 4KFSA 5FR2A 2P2NA 5M04A 4YVWC 1KZ7B 5C7OO 4EELA 1R8SA 2IXCA 5CT8A 5JSHA 1QH6A 5EAIA 3OUJA 4L16A 1H1TA 1DEOA 4NYJR 4YW3A 1G20A 3F46A 4P4LA 2W1UA 4RZ2A 3AX6A 4FNOA 1Z33A 1W8FA 1KZGB 4M0DA 2VY0A 1MV5A 1D6SA 4D96A 1Z5VA 1G64A 2AD5A 1H8TA 4RJ2A 4XF4A 4WUTA 3ORFA 3FMOB 1SQ4A 5C3QA 4DLTA 3I2FA 2Z8XA 4V0KA 3Q8EA 2G0TA 1I0IA 4ZEVA 3HS3A 1C4XA 1V95A 2P77A 4WV8A 4OQ4A 4L22A 3MM4A 5ENVA 5F7UA 4A45A 1VG1A 3AYXB 1FXWA 5KBFA 1XB9A 1QP7A 5JROA 3F97A 4O5OA 4N9QA 5HKKA 1GRRA 5A2GA 5TPZA 4JDPA 1X1EA 3GEGA 4XJZA 2H06A 4NZZA 4XQ9A 3W0LB 1RITA 1AV7A 1GPAA 2VO5A 1AXYA 4FSXA 1KERA 5BXYA 1NHWA 3SZUA 5IULC 3ZCSA 3WJ7A 3NIFB 3J8F1 2DETA 2XHZA 1OH7A 1QX4A 4C2TA 1TLTA 4WZFA 3MMPA 1EFDN 1FMCA 4TN7A 2OLKA 3ZIDA 2EHJA 2NU9A 2ZT6A 1A4UA 1TUEA 2Q8OA 3FYUA 1OXSC 2H18A 5DHRA 2QTCA 3SH5A 3EGCA 4LA4A 1PLLA 2FMYA 4BGVA 3UHJA 4AEKA 4D99A 3AIIA 4Z92B 3GRPA 2CDBA 1ZM7A 4E30A 1E8MA 5EHZA 2VMCA 1JS1X 2W39A 1BX1A 3BC1A 2BKEA 4R9RA 4TXNA 4RPKA 2WSVA 5H02A 1IN6A 1PVDA 3MTIA 3IPAA 4CHGA 1FQKA 5IAXA 1AXZA 1U0JA 4BP3A 1VZ2A 1UFOA 2AKYA 1OXCA 2CDOA 3BFXA 4AMVA 1RMQA 5JBQA 3SXUB 3I0ZA 3CT6A 2VF8A 5FPSA 3JQ7B 2H0AA 3SCFA 2RGAA 5FT9A 4YFVA 3ZI7A 3RYCA 4IDOA 4ZDIA 1XU1A 4PLVA 4Q03A 3GRCA 1E3MA 1C2YA 3AI2A 3ZJVA 4UTZA 4XLZA 1E57A 4CPDA 4GWJA 2D1QA 3FBWA 1PG5A 3GN1A 5DYYA 1YDWA 2O2ZA 1SQGA 3W5UA 1I4DD 3BWDD 3SE0A 4CDMA 4S1OA 2ZIAA 1PW7A 5FY4A 1P2FA 1KWKA 3T7IA 3EY4A 5CH5A 4X90A 2P3JA 2VMEA 2XV1A 1KYXA 4BJHB 4YCDA 3KWLA 1MQTB 1ISMA 4LOAA 3QU7A 5EUQB 2OG2A 2QQGA 4QDXA 3O95A 3NC1C 8OHMA 2NU8B 1JV2B 2RHRA 3VBCA 1ODIA 2RHOA 4W6YA 2XCSB 1NU6A 5FZMA 4EOGA 3TIXB 4HVRA 3IBYA 4BMEA 1O5IA 4NVPA 2HFJA 3W5NA 2QJVA 4MGQA 3B3QA 3VBRC 1EAH3 3U7JA 3A8TA 4UCQA 3U7EB 4LF4B 4PIXA 1A2BA 2H6EA 2DULA 4PONA 1KVRA 2Q6OA 2DP4E 4DTIA 2IPNA 3VSAA 4ZOAA 5EKXA 3KKOA 1UBCA 3ERCA 4IQ0A 4FT2A 5A7HA 3P2JA 3ZFFA 1XJ0A 4JX9A 3AIMA 4C7OA 3IV7A 1DWPA 1FC0A 5AKZA 7MDHA 4XGIA 4M7WA 4BTVA 2RB4A 1MAUA 2WNVC 1NRWA 3F5QA 1JDNA 4EQZA 4XEZA 3NC4A 2ECFA 5HPYB 1G0NA 4NE7A 4WFKA 4ZKDA 3QLTA 1XCLA 4R1PA 3KHTA 4JKMA 3PFFA 2JB9A 2FK7A 3TBHA 3RV3A 1PZNA 4IRMA 2W2IA 3CCFA 4UQOA 2VHZA 4X1KB 2Q0XA 1E77A 1F20A 4NHKA 4YT8A 1NLSA 5CA6A 4OD0A 5EIHA 2R041 1CZVA 3MF4A 2PSJA 2XL7A 4OGWA 4AW7A 1IQPA 4V0QA 4ZEMA 4H2AA 4UEQA 3AF2A 1U0BB 1JR3E 4C7XA 5FP9A 2NV6A 2LKCA 4EVIA 1NW6A 1Z9BA 1MR5A 2RAPA 4XPIA 1JKXA 3M6AA 3N87A 3IDFA 3KV3O 2Q4EA 2OZVA 4O3MA 2VWPA 2X6QA 1VL6A 3WNXA 2P62A 1O58A 3LTNC 1NR5A 1OURA 2OP0A 4Z1VA 5IJXA 3TDMA 2YASA 1II8B 2FX3A 2R061 2BV4A 4J29A 4ND8A 3MT0A 2ZWAA 4RDXA 4CDQC 5J2UF 4RZQA 1DGLA 3V8PA 1YU6A 3UQYS 4O4HA 4LY3A 4HGZA 1W8OA 3S40A 2KSQA 3ZD7A 2F8SA 2OHVA 4LOSA 8MHTA 3N53A 3O6VA 2XMGA 1ZREA 2XYHA 2H1OA 4IGPA 1CWPA 1AR63 5FXXA 1KJ9A 4RA9B 3WICA 2DTDA 4CCJA 1KNXA 3BMOA 2DVDA 2AMFA 3KQMA 2OR3A 3IP3A 1LB1B 1CN1A 3FDZA 3N7JA 4I1YA 5FXZA 1PD0A 3N9MA 1NA5A 1DC5A 1DLIA 4DA8A 3F90A 2SKCA 1HN0A 3G2IA 8AT1A 2JI9A 2CWMA 2YZKA 4AEDB 3ETHA 1RJ9B 3B3JA 1R082 3QF4B 1E6UA 3LK6A 1X1RA 1HN1A 1BH2A 1CRLA 2ASEA 4J4BA 1QFXA 1RJEA 3P9SA 2OHGA 1N6NA 1KYWA 1N7JA 4V3BA 2A6PA 1Q0QA 3DQQA 1PGW1 4GI3A 3PL0A 3EYWA 5AXCA 4D9GA 1CUWA 4GGPA 1DWOA 2VWQA 2V9ZA 3MEPA 2OB1A 5CXUA 4FFPA 4JCOA 1MC4A 2DSTA 2P3YA 1EJ6A 3C8DA 4OVKA 2FWPA 4MHOA 2J9FB 3K70D 4EGCB 3VVMA 4DREA 1QQAA 3PL1A 1RYDA 5I7UA 3K4PA 1SLCA 2X09A 5KQSA 4ARYA 3VO9A 4RSUA 3I92A 3TCNA 2MDTA 5JIAA 4XD2A 5FYMA 4UCXA 1WBDA 1PHRA 4UT5A 2PGAA 4UU7A 2EOAA 5AC91 2H5IA 1CJSA 1V7PC 4IXNA 1L4EA 4L85A 1JN0A 3L46A 4LVCA 3CPJB 1Z0AA 3T09A 4QTTB 4N54A 4GPTA 4X8MA 2FQYA 2L69A 4QASA 1WSBA 3NEJA 1H2WA 2GKSA 1GCAA 1P5HA 1C0IA 2AE1A 4UDOA 3S1AA 4W1RA 3LQRA 4EX6A 1WF3A 2JI6A 3U5TA 5ELXA 1DJNA 3TD2A 3TDNA 1NTOA 1OLUA 1YCGA 4ID9A 1NQWA 1PO21 3GN2A 5FHRA 1P2SA 3MMNA 2WMNB 2IP4A 4HJRA 1IUKA 4BLSA 1DKNA 5GAJA 1W04A 4GF5A 4NTZA 3CMGA 2JJYA 4K0KB 5AM5A 1LW6E 4X66B 3SVZA 3OF5A 5MFZA 1ZINA 3G0CA 1DC3A 2YYSA 2ZBFA 2HO5A 5CVDA 3VZMA 2VHCA 3RVHA 2R7LA 4ZPJA 1JLLB 2X5KO 4W9NA 4ANFA 3EMVA 3PMEA 1QONA 2QNIA 5JMTA 2J0UB 2PYZA 2OXCA 3P9PA 4LJ9A 3DMDA 3EXIB 3H1AA 2VJCA 1JNXX 2VHTA 3X1ZA 2GRUA 4LISA 5CLQA 3CX7A 4OJMX 3S68A 2B5OA 1JOJA 2B8EA 2RHJA 3PWKA 1AC5A 4KHPB 1EUDA 1UP4A 4TL6A 1TC1A 3LPNA 4Y2JA 5FY8A 1NVKA 3DEJA 3CX8A 4RMGA 3LSTA 1WLDA 1KEPA 2HY7A 3MD9A 3OCUA 3RD5A 3J8F2 4BXSV 2QTRA 3QEOA 2XLFA 1BDBA 2BMFA 4GPZA 4UAJA 5CNIA 3KQYA 2YBPA 4M54A 4C7BA 4JITA 1OAOC 1QMJA 3KE8A 1Q19A 4XOUA 3GDFA 4ITVA 4N48A 1UBJS 1VMJA 2EZUA 1Z5WA 3U26A 1E58A 5HM8A 4Q7MB 2C88A 5IX8A 4M9RA 1PIV2 1MAWA 2IPXA 4ZK2A 1ADGA 4IJ6A 3IEVA 4IDBA 5J2TB 2Q5EA 1F60A 1ZGCA 2VWHA 4GQ7A 2XVGA 3OTWA 5JAOA 1U65A 5EMLA 3FN9A 2NM1A 1YFUA 3ROKA 1E1MA 1WZIA 2RI6A 4TUYB 3RZZA 4IE4A 1SUCA 4Y0NA 2HPHA 3KK0A 1Q5PA 3CU5A 3KV9A 1QE5A 3D3WB 4MUHA 1QHEA 1TYBE 4P98A 1YYNA 2FWRA 2CLIB 1MAVA 1GTSA 3ACCA 4GBGA 2D97A 4W5HA 1XD2B 3A0RB 4BVLA 3PJQA 3X0DA 1A5BB 2QQJA 3V65A 2JIMA 3TNPB 4OSEA 3C8MA 2OYSA 1W88A 3AB3A 2V3CC 1OV6A 2B6HA 3VDDC 4P4NA 1DINA 5KWIA 3ISJA 3AUJB 3U80A 4EJFA 521PA 1W94A 2NXEA 1FE8A 3SC3A 3HKCA 4PNEA 4RABA 1AS3A 3MELA 1G8SA 2WA1A 5CVRA 4H7KA 3Q1LA 2IX9A 4FFWA 2NU7B 1YA4A 4N5LA 1BGVA 1CLEA 1Z5NA 4HS4A 2ZSJA 2HHHB 1JDBC 2XMDA 3ZOIA 1VRCA 2GJAA 2OO5A 2B3DA 3LT2A 2Z5VA 1L4MA 2WMYA 3FWZA 3H6GA 1VL2A 2YHIB 4D3ZA 5KNBA 3MW8A 3ELWA 3K5WA 2JENA 3ZU5A 1EWYA 4D4KA 1I7QB 4HLQB 4GG1A 5B36A 1S2DA 1ZRSA 4KFRA 2EDAA 4CRQA 1W4ZA 4Z99A 5KTSA 2DU0A 4MEAA 2Y68A 1SQ6A 1R1A1 5EMHA 3B94A 5ELLA 4BFLA 1KEWA 2ZVQX 1E1KA 3NHYA 1BLZA 1U11A 2O0JA 1TAQA 1SKQA 2MWMA 1A98A 4LJSA 3PXCX 4HFSA 3BTOA 1F8XA 3CZ9A 3P4XA 4RJTA 5D1IA 3MG9A 1JQBA 3K1JA 4FPKA 4WK6A 3GRFA 2HJVA 2O52A 4JH0A 1AE1A 4I46A 3T4UA 2PAMA 4L1KA 2W92A 4MVCA 5DM0A 8ABPA 3VR1A 3DZ8A 3ND7A 3WY9A 1JJBA 4ASUA 1EJ2A 1KRXA 3SZGA 3A1EA 3T0FA 2C1XA 4PZUA 3QHAA 5JFGA 3NV4A 1LFAA 4BLRA 1SHWB 1S5PA 1O4ZA 3K8QA 2V72A 1XRSB 4C04A 1EUTA 4Q7QA 4RESA 4B4PA 4LBJA 3PDCA 4EHFA 2CJFA 4XUDA 4AAXA 1XAHA 3X2EA 3GIWA 4Y6RA 2EW1A 4MXVA 2K46A 1SKAA 2F67A 1DGRN 4CTJA 2XODA 1NE7A 3CQ9A 2F9FA 2F48A 5FF9A 3AVSA 2D2EA 3FXAA 3V80A 2YV5A 3ITQA 3MWLA 2YFYA 4DCTA 1L3IA 2XB9A 5EPAA 3C98A 4BE9A 3KZ1E 3KQRA 3NMUF 1DRKA 1WWYA 1VE5A 2XBO1 4HUQB 3MERA 5AJZA 4LJ6A 4OVEA 3VUEA 4DFSA 3FI0A 4OQXA 2HSJA 4C2BA 1XPUA 4R2XA 4CG3A 5IJZA 4AI9A 4EUEA 1L4NA 1IQDC 2VDWB 1SXJE 1VKNA 4DWVA 3IEIA 4JDUA 4ZU7A 2CVHA 4RHFA 2BFWA 1TZCA 1Q1EA 5THKA 3VKWA 1CG6A 2DUOA 3WWYA 1E5IA 4CFSA 5C9AB 4JY7A 2Y6UA 4PG7A 4Q7LA 2OD9A 5AJVB 1H2ZA 2R6HA 2HKIA 5CKNA 3LO8A 1IOAA 3HACA 5DE3A 2XWBB 1JG6A 4KCGA 1W36D 1TM7E 1OMOA 1D0SA 4DBVO 2VBDA 1G5PA 1U0HC 5J2UA 1XA0A 3TTSA 4EY3A 5FK8A 2BWAA 3I53A 5CFDA 4ZEXA 4CEIB 1SOMA 5JCOA 4EKIA 4JL8A 2FOIA 1THTA 1OWOA 5K0LA 4GQAA 2EGHA 4L72A 1QQP2 2AJDA 3UB3A 4GLJA 3I9MA 2R1TB 2HIAA 1FUEA 3AR7A 4YJ2B 3ZQUA 1EAH2 3OMWA 3UMMA 3PXDA 2ZWVA 1GZ6A 4NVRA 4P93A 4EWAA 2XJ9A 2EA7A 2EERA 4EB0A 2DFDA 4J94A 2JAUA 3Q7QA 4KPUB 3WIDA 2PX0A 4G5GA 5CDSA 3BE4A 2IXIA 3CLUD 2JATA 3CR7A 3IMFA 3M3QA 4GB32 2DBIA 2D06A 3I34X 1PDOA 3F78A 1CPMA 1GSLA 3PCRB 3OOJA 2EZTA 4WBNF 4O1IA 4C0XA 2OBYA 1SB8A 3TBDA 1P2UA 3P4YA 4I6EA 1Z18A 4NBUA 4BNVA 4TZTA 2ONZA 2I4RA 5DVZA 1GPNA 3I37X 4EN0A 1S2NA 3SY8A 2I03A 1UXJA 2REQB 5IVHA 1FX0A 2ZB4A 3RSZA 5L3VA 3J8F3 2AF4C 2HOQA 4ZAFA 1P9OA 4TTAA 4WN9B 1VBA2 3Q9OA 2XH6A 4WK2B 4EHBA 2UUOA 3REGA 2O7VA 1YQUA 4JP5A 1JIXA 2C0ZA 5ESXA 4F11A 3VLBB 4NDNE 1J06A 3EOBI 5IHPA 4LA2A 1HDYA 4H0CA 2R86A 1SXPA 4URWR 2ZA9A 1AGXA 5JXHA 1BJRE 5JOZA 3SKVA 3AFIA 1RRCA 1GUAA 4RTJA 4CKZA 4YO7A 1XALA 2WY2D 1W75A 4FX2A 2ZABA 1OA4A 2CSUA 1C7FA 2F9LA 2P3QA 5B2EA 4B2LA 3HJFA 4TLCA 2YWRA 1Z5OA 2FW7A 3KAJA 3KOXA 4PX2A 5ICCA 4A3SA 1X14A 2PT9A 2AG8A 2XCQA 5K8TA 5EHDA 2F3SA 4MX8A 4QXOA 3CX4A 3L8ZA 3PPXA 5ABJC 2Q0HA 3U44A 5ILQA 1WVMA 5BR1A 3WVJA 1DEAA 1GPJA 4UEOA 2X8JB 3FOFC 3FGZA 2GEFA 3LQKA 2A9VA 2GI4A 3ZYBA 3I8TA 2CLHB 4KXFB 4KIFA 1AOXA 5JT1A 4OOFA 3G2QA 4LXQA 1PJQA 4XLTA 3NRCA 1H2FA 4AKEA 3WGQA 3MUFA 2ECQA 3ZYGA 2G70A 2WW8A 4QM6A 3K0SA 5DLYA 2LKDA 3V1YA 3O2NA 1Y81A 2BFFA 2QRHA 2ZT7A 4V2IA 4LO8A 4TUYA 1N6PA 1PNTA 1DJPA 4UWDA 3RODA 1VBB1 2BR4A 1DOHA 3NIGB 5GY7A 4LF6B 3U7QB 4GMXA 4HSEA 3ADBA 3D8NA 2TECE 4LOHA 2WNUA 1RQXA 3AF5A 2D5HA 1K7EB 4EFLA 4X5OA 2MINB 5IEJA 1E5VA 1Z88A 5SYMA 4DVGA 2A3XA 4YB8A 4W82A 4OBBA 3IVAA 1SUDA 1U6JA 2PGOA 2R073 3H3XA 1W9FA 3FPCA 2GC2A 4BK5A 4PHTA 3ME2A 1Y1PA 1SZCA 3H17A 1PJRA 2K5UA 3QFCA 2FPUA 2ID7A 2WE8A 3C3MA 2OILA 2CZCA 4RK6A 1TMF2 4P84A 2Q7OE 4UAGA 4WA7A 1WW6A 4FFRA 1P17A 5G02A 1PO7A 1UZMA 2JHFA 1IS4A 4WN3A 1NYTA 2V1XA 1H30A 1NBIA 2RC6A 2PSFA 2EAUA 3OZBA 2P6MA 3PUAA 2ZJOA 3DXYA 4BNTA 5JZ9A 1K98A 3QEMB 3KRTA 2PUTA 1OU0A 4Q0QA 4FPFA 4RA6B 3NHBA 1Z7YA 3Q88A 1EFPB 5CA0B 4BQYA 3CONA 3CDZB 1OD3A 1KYZA 3ITNA 4FYIA 4CXMA 3WW3A 3KQVA 3S2SA 1WUJS 2W48A 1WO8A 4EW2A 5TVGA 4AP9A 1ZNXA 4OQLA 1NF9A 1D5WA 1HYEA 3HGMA 4C0AC 3SHVA 2Q1YA 3A58B 2XXJA 4AEJA 4LK6A 1CAUA 3RHSA 1E8NA 3D8HA 3KQTA 2YU2A 1ZZ9A 3PIIA 3RR2A 1LBIA 2VZPA 3KKZA 1SZPA 4C0LA 3H9EO 4Q5OA 3OGJA 2C3OA 5LN1A 4A7YA 3QW4B 1GKBA 3LLCA 4BLOA 3GHYA 1II9A 2D8AA 2XCRB 3QMVA 5BWLA 2HSGA 3QVJA 5JBIA 4HVTA 1E2BA 1DLCA 4Y30A 5EWSA 4B46A 3V7WA 1QHSA 4LTDA 4YUVA 1A1VA 4AR2A 1D3AA 5BV2P 3FLTA 1P44A 3SZRA 3WNNA 2E4UA 4HN9A 5JJCA 4CLOB 1ZA7A 4ND5A 2X4DA 3UNPA 4A15A 3I62A 3PGJA 2WNSA 4JHTA 3L4EA 3WGYA 4P9GA 1XMJA 3GLIB 2UYOA 5J3JA 2J46A 5T7BA 1HB4A 3TSAA 4UQLA 4U0JA 2VZUA 4FI3F 3AI3A 5AQ1A 3AUSA 5HP4A 1HLDA 2PQ6A 1DIBA 3OE7D 1XMSA 5DAPA 1KO1A 1ATIA 3F9RA 1UEXC 4P3KA 3B6JA 4UOQA 1OD5A 4XWWA 1BIFA 4LC0A 3IUSA 3I5YA 1GGEA 1H2RS 2EKDA 4LTNA 5IH3A 4C7KA 4QUGA 4IHAA 4C90A 4II3A 1OOPC 2H1RA 1LDYA 2AC2A 1WXWA 3RS9A 3D59A 2BKUA 1P8JA 2JG9B 2DG2A 1XC6A 1LHOA 4PQGA 3I04A 1V7CA 4G5RA 3ZOKA 1YIPA 3UTCA 3N05A 2E85A 4M9XA 5LQKA 4G0ZA 3LUJA 4MKRA 2QXUA 1CY2A 2Q6IA 3AYAA 4D43A 4PRKA 2WLTA 5EHIA 4RWEA 1A4XA 4BMZA 4WFQA 1WB4A 5I45A 2ZTSA 1XJ5A 4L50A 3AEZA 3A04A 3KOYA 5L3SB 3PX7A 4RHXA 4B75A 3PNBA 2WICA 1SA0B 4QHSA 2YJ3A 1JZ5A 4BDVB 1HOTA 2WT9A 3IUJA 5DGIA 4BV2A 4GM4A 3GFTA 4EV0A 5GMOA 4W8HA 5D3MA 3QELA 2YZ7A 4RV5A 1RPAA 3ZLTA 1YRYE 3NTRA 3JYHA 4IWXA 2GNPA 3LY5A 1ECPA 4LK2A 4GZ3A 1R092 1IZ8A 1PWHA 2Y8EA 1QJU3 3S5JA 3HU3A 5F9MA 2VT7A 3E1KA 1XXHE 4G37A 1MRSA 2ZB7A 3WHTA 5EQTA 1G6KA 1Z2EA 1FTQA 1I51A 5CG2A 4FONA 2PMDA 3E7PA 4N8MA 3HCWA 3JQAB 1JLKA 1RE1A 3O2JA 2WVJA 4PTLA 5LZ5A 1V26A 5JVDA 2YG0A 2ZRGA 3LY7A 2VULA 1QQP1 3F5SA 2BFUL 4HKLA 3UHPA 1NE2A 3EPJA 2XEXA 1M2VB 1CIVA 1UK9A 1JT2A 3VBOC 2A7XA 3SFVA 1GZSA 3B7PA 2BZ1A 2PUCA 3RK0A 4N49A 1FX1A 4DNQA 4FMCB 4F4JA 5LQMA 1UZNA 2BPA2 3KEQA 4IIHA 3ZHVA 1ZVMA 1DCSA 5A1JA 2LALA 1FMD1 1F2UB 1CIPA 1X1TA 3W1VA 4M0KA 1NXVA 3U4HA 2E5WA 1HB1A 1Q3KA 1J00A 4L99A 1LS6A 2GMPA 1SHUX 2R16A 3IBSA 1SBQA 1V1MB 1QH7A 5C81A 5IK8A 4V1CB 1XYNA 5B1HA 4XC9A 4IFIA 1OVMA 4GZ6A 5K0CA 2K2WA 1TME2 5TC4A 4C14A 3K9NA 4TWBA 2OE2A 3TRHA 2EF1A 5C8CA 2QX9A 4OUDA 4B3DA 1AKVA 2I4IA 2JIGA 4ZGGA 2WFPA 2NAPA 5DAQA 3DA8A 3BKWA 3L05A 5FZKA 1ZD5A 2JRLA 4KQ1A 4ZONA 3A32A 1Z6AA 2A8YA 2FXIA 1LTKA 2ID4A 4EPTA 2POQX 4U4AA 4UBLA 4XJWA 3F71A 4OHFA 2OBNA 1WHTA 1T2UA 5ALSA 4GOJA 1FVOA 5IT9A 4NAOA 3WYNA 4CQLA 2XQRA 4EGQA 1ZOPA 1RWPA 2CEAA 1A8HA 1WKBA 3AV0B 2YX1A 1TUBB 2Y9MB 4PAOA 1T6YA 1UBGA 1BOOA 1OYOA 2ZZKA 1U5CA 4RL4A 1AVBA 4JAAA 3Q2KA 1VIMA 1XQVA 2GETA 4EJ0A 1QWSA 4UTPA 4CP2A 1GWKA 1MA0A 4FCAA 4JJGA 2W22A 3RBVA 2WM2A 4HN2A 2LVBA 3BGDA 3DE0X 1E1CB 1E1YA 1W6UA 1F0NA 2A5YB 2ATCA 2GN6A 5AI9A 3T7DA 3HWWA 3G59A 3O21A 3QPAA 2YRWA 5L6MB 3NSTA 1CZKA 3PGVA 4NHYA 4X8LA 5A04A 3ED5A 1E3SA 1MPXA 3RSGA 3FSEA 4O4JF 4RFSA 3RPEA 1WF6A 4E51A 4FILA 5L51A 1MJHA 4HEJA 4GH5A 4PV7A 1D6NA 1UAGA 3LT1A 1C28A 4TV9F 5CGQB 2PWYA 2QQFA 1PHPA 1J0DA 3WXBA 2X7XA 3RKUA 3T30A 2PBZA 4F2GA 3MS7A 2FSFA 3X1JA 3D6EA 5KHOC 2N47A 3BE5A 3HR8A 3IPCA 4KWKA 4RSMA 3I2KA 2RE8A 3RKSA 2I7TA 1EEXB 4TKVB 3FUVA 4ES6A 2XLGA 3SP1A 3SX4A 4XCAA 5I01A 1E9AA 3A3NA 5FPXA 4E2SA 3EDQA 4UBOA 5AQEA 1U8FO 1VBD2 4YUAA 1CQJA 4BNHA 1QIQA 3FYUB 1MS5A 1ENPA 1D1TA 4IOKA 1K5PA 2DT5A 1LF0A 4HD8A 1N2HA 2P4EA 3R6TA 5KVQA 4AF8A 2AYYA 4W4TA 5F32A 4K9KA 3IHKA 4QRIA 5K2MA 1Y7TA 2OG1A 2XRYA 3AIOA 4EG3A 2XE8A 3H2SA 2D1YA 4WZBE 2BNNA 2QQMA 2X58A 9GPBA 4CV1A 3BWVA 1AKUA 3LDHA 1T9AA 4BB0A 1GADO 1CUUA 4P7KA 4ISBA 2Z1NA 2JD1A 3UY4A 2UYYA 3MTQA 1TME1 3JWHA 1NNLA 1RBQA 1IGOA 1BMQA 3AB0A 3RRMA 2I29A 3CUSA 3PC4A 4P14A 1KIFA 4FFOA 3KETA 2ZBQA 1BD4A 1HFJA 1TEXA 4B6OA 3ZN2A 2FUEA 4BKOA 4V24A 1XA3A 2QW8A 1QOOA 4CMEA 2JI7A 1AJKA 2YUTA 4B2IA 1T1RA 2OV2A 3PNSA 4GT1A 4CL3A 3JASA 3EQ8A 4DDKA 1ADCA 2RS52 2E21A 4H1VA 2BTVC 2I1LA 1T2FA 3E15A 4LGCA 4M46A 1C9KA 4AJEA 1T43A 1YRBA 4KPYA 2JFNA 3FMVA 3P2EA 2CVFA 1MX5A 4ZYYA 1CEXA 2ZRNA 2WZ8A 3ZE6A 2CYFA 3H8OA 3KFLA 5CYFA 5J96B 4S24A 1R1A2 4OQNA 3RJTA 4DW8A 1NP7A 4K86A 4RTLA 5B55A 4N7IA 1X1AA 5F2EA 1HT3A 4GWGA 4BC1A 4I9GA 4OHVA 3K4AA 3V1KA 4CPBD 1VJCA 1P5RA 3MIDA 2B4QA 4O2AB 4J0DA 3UUEA 1DXOA 3KVVA 1HB2A 3EXHA 3UN1A 1AX0A 2FD8A 1Q3HA 4ZI7A 4X6XA 1NMYA 3PWSA 4BEBA 3R3XA 4AJ1A 1QJX1 3OVMA 1VJ0A 2QLBA 2F9MA 3SNKA 1R37A 4UVHA 4D45A 1P4HA 2OFPA 4XLLA 3RUPA 1UO9A 3CL1A 1V3QE 3V4PB 3H99A 1FJXA 3ESAA 4GH4B 1LQTA 1JSXA 3P9KA 4EAAA 2CFRA 3B3QE 4ZT6A 4P7BA 2L19A 4PDWA 1Z8FA 3RI9A 4Q19A 2I67A 3ES9A 1IQRA 4D0GA 1J83A 1TQ2A 4MRSA 3HE3A 2IU4A 4FP2A 4LY9A 1YBMA 1V6LA 2CUKA 3D81A 1F5NA 4GPEA 3H1YA 1O95C 1JH8A 4RCYA 2CYCA 4I4CA 3ZXUB 5HUHA 4GL4A 4V2WA 1ZMRA 5FAXA 4KITB 3OMXA 4M3CF 1E7WA 1OBNA 1E5HA 3N36A 1QFJA 4EG7A 3F7TA 3OBTA 5G40A 4L4XA 1RC1A 2HL6A 1MUUA 1ZJZA 5CFPA 3WDTA 1KU6A 4DL9A 3ACBA 1SD2A 3VYWA 3GAFA 3P1IA 1PNFA 3G2JA 1M1UA 4M86A 1E1QA 4Q15A 1E59A 3W5DA 4I6JA 2GEKA 2Q7DA 2JHGA 1B6GA 2R0HA 3UXYA 1DZRA 1FFEA 3BSSA 1LOAA 3WX0A 1F8GA 1LK5A 5COQA 2OUHA 1DJMA 4LVNA 5D85A 1BEZA 3WGLA 1YHZA 2JG8C 4EW3A 1JG4A 3ZHBA 2X14A 2IOQA 2HF2A 5EIEA 3P2KA 5K0SA 3ZLJA 4FFBB 1WLTA 4N8EA 2GFIA 3QVOA 5CKMA 2GK6A 5F5NA 2P6PA 5LIPA 1E3LA 4K6CA 3QU2A 4ZVNA 5GZCA 1EU1A 5BSWA 1H6DA 5FUWA 3U56A 3RZKA 3E8XA 1V6AA 3FFBA 2H8KA 2XMPA 3PGLA 1ZK3A 1XDZA 2VDJA 1UAAA 3R40A 1D4FA 2CXNA 1YZUA 4YJHA 1PK8A 2GN4A 3UICA 3X3HA 1XX6A 5LK7B 4G0YA 1OFGA 3LQ1A 4N3NA 5A6XA 5LJLA 3V2IA 2DAPA 4GM1A 1RJ9A 5GLWA 4IDPA 3WBKA 3FNQA 1Q0PA 4QX3A 5JEEA 5FYUA 1IIRA 1J5PA 4BNJA 4KMRA 4HDSA 5HVNA 3K0FA 4P81A 2G0AA 3VHXB 2XJQA 2PGJA 5FLYA 3BDAA 4WDQA 1ESCA 2AG6A 2YXDA 5DGDA 4U2BA 4LBWA 3AHDA 3RAPR 4TYNA 3RRZA 3CV3A 2OGTA 1PZMA 1GU7A 4WNCA 3HUTA 1XZLA 4E11A 4NBLA 2RHMA 3L49A 4HX9A 5CIQA 2BKLA 2X77A 3DO5A 4DM7A 1LSOA 2DCUA 2IHKA 3KL2A 4XILA 4R7GA 2NLOA 3UYKA 5DFAA 1JPUA 1DHTA 1I36A 4WKNA 3M2PA 3OIWA 1N5MA 1CUJA 3H18A 2CNWA 1NXD1 3RWNA 2PGXA 2K4MA 2C2MA 4M89A 5A5EA 4E4DX 1JZQA 1DOAA 1NUQA 1J59A 2Y1CA 1LUAA 3MIZA 3N6VA 4A8JC 1P6QA 3USSA 5IVIA 2NMNA 2MSEB 1ZY2A 2DVMA 3JATA 3P8ZA 3V8MA 5EZYF 5TGZA 2WFZA 2E5LB 2ZIFA 4X92A 3OJFA 2WZQA 3GFVA 3G8YA 4JHXA 5C3PA 1RAEA 4JEMA 3L93A 3IAPA 3M6IA 3J7AC 1KSHA 3DZKA 2VK8A 3LXXA 3DV8A 2C4HA 4FFMA 1STOA 2O05A 1SBNE 1BWSA 4MHRA 4WLNA 2AN5A 1H6CA 4XMIA 3FNEA 4KNWA 3WYAA 1IH8A 5K8CA 4RPLA 4YV0A 2G7MC 1GANA 1LBEA 1QB8A 1CFJA 5A7WB 1XVTA 1CT9A 1NBHA 3UK1A 4BL5A 1K45A 1NY5A 4CDWA 3L06A 1D03A 1GP4A 4DHWA 5I4IA 3T7RA 2W42A 5LFAA 5DXAA 3FLRA 4D0RA 5HTKA 3FTNA 1EUZA 4O2AA 5FZFA 3ADDA 1S2LA 3AKEA 2BVBA 4ILEA 4AFNA 1PFQA 3K1ZA 3V0BB 5K20A 3D6JA 1UPBA 3OECA 1HTTA 2DVAA 3BJMA 3JTEA 3CNQS 1QWRA 4GZ5A 4QUHA 3DXTA 4L95C 4GX5A 1ESZA 3ZPOA 1UKCA 4F0JA 3BU7A 2ZAOA 1TA4A 2D0DA 5GLTA 4MGEA 1A5ZA 2CL7X 4EKDA 4ECEA 3N7LA 2EAAA 1VSQA 4Y6PA 1S6YA 5CTJA 4C4YA 1KTVA 1DCTA 1BU5A 1YVDA 3ENZA 1IUOA 1UQTA 1YZQA 4KSYA 5K01A 2ZS9A 4RGAA 3OM8A 1MEC2 3RJ9A 2VW1A 3ZW8A 4D3YA 3QBDA 3I52A 1J8QA 2J4CA 3VKFC 1FNBA 4RK4A 4FCCA 3T1QA 4QQOA 2HMVA 1Z4KA 2GPNA 1WLSA 4BZXA 4DRXA 2MSCB 3FM9A 5E9JA 1K5HA 4KO1S 1SKMA 4PBSA 1OVGA 3U3KA 4GXTA 4DAEA 3ZXXA 1JFRA 3EUAA 4YJKA 3VYVA 1XEAA 2FHRA 4NJMB 5A5VA 3NG1A 2YHAA 4LO7A 2Q4BA 4KVGA 4L3VA 3GLSA 1QFSA 4GWLA 1W2AX 3D43A 4Q3NA 4BNDA 1H3EA 2ZGOA 821PA 1HDZA 2QQWA 2WWUA 1WAMA 1Q57A 2UUCB 5EQJB 3AONB 2QTNA 3AKTA 2X5JO 3A4LA 1EZZA 2O5EA 1QRTA 3R0ZA 1TU3A 1T3ZA 2VH5R 2QQOA 5JZGA 4RKFA 2P2GA 3NXKA 2V96A 1U2SA 5FEUA 1P6XA 3ZHUA 5DT9A 3ZGZA 3N2YA 5FD8A 4UI9L 3ZV4A 1NV8A 5F2WA 2V5YA 2IU0A 2PA3A 2FPGA 5K9YA 1U2DA 1DZ3A 2IX3A 3G2HA 3FFXA 1FRVA 5EE9A 1F0KA 3QA3E 1JQJC 3UM9A 4HPKA 1SOWA 4UNQA 3A6KA 1IZYA 4AZWA 2F4PA 3ORJA 1PGL1 1DYPA 5ALVA 1AK2A 4GWMA 4GKVA 1TG7A 2ENWA 1G21E 4Q9JA 3IELA 1BMDA 1OOPB 3O83A 1F4HA 4P00B 4M9ZA 4JTOA 1X33A 2E4XA 3IIJA 2OM6A 5DCYA 5D86A 4GC5A 4DA0A 1G41A 1X7ZA 3S2ZA 2QR3A 3M34A 3HJHA 2IZZA 1V9U1 4Z0PA 3K9GA 3QOWA 1TT5A 1U7XA 3UMJA 1ZRNA 4B09A 3GC6A 4G89A 3PU3A 1F2TB 3O2SB 4KUHA 4LZAA 2ZU0C 1V7ZA 3C5WP 2QQ0A 4IX9A 1ZD2P 4IG4A 2IUTA 3E58A 5JI9A 1ZKDA 3DAHA 2Q62A 2FZ1A 4UMFA 3OCJA 1U1FA 1Y3HA 1AKYA 1GPLA 5DXFA 1IEVA 2R1VA 2OXTA 4KWLA 1RYNA 3HNOA 3LIHA 4UM7A 4R05A 1I32A 1L5VA 1VG0B 1HNXB 5JOQA 1MOZA 2WLSA 2ZR8A 2N3ZA 2R063 3Q40A 1SEVA 4D6XA 4IMPA 3KR0A 2JKYA 3QVMA 1KA9H 1SK9A 5FQ0B 4IF4A 4DR3B 3LL4A 4KIUA 2OD7A 3BWBA 2BMDA 4PPQA 2XKKA 3QRWA 4FPOB 1IXRC 4U2AA 3ETCA 4OK3A 4AEDA 3E9QA 1RVF3 1C50A 3S57A 4MVJP 4CKCB 1W9SA 4IIGA 4Y6GB 1QLJA 3TKYA 4FOQA 1M8FA 1WM1A 4QNNA 2I34A 4E2YA 1MS0A 2QLFA 3NORA 1T3SA 4AIRA 5LIRA 4CXXA 1FTSA 2YN2A 4Z7OB 2IHNA 5CIYA 4AWDA 4RHTA 2VOTA 3ZBQA 2EKQA 2QE7A 3M5DA 3EWIA 3RYIB 2W43A 4ETNA 1GPBA 3JSXA 1E3EA 4TYMA 5DZGA 3IMCA 1ADFA 3K35A 2POCA 1C8NA 1R0WA 5KWJA 3E2MA 1IXYA 3ENRA 2IH5A 3WD5A 2ZGUA 4JMPA 5IVJA 1UXOA 1S2EA 1WSWA 5T64A 4HATA 5CIWA 2Y1OA 5M0TA 5JJ5A 4MB0A 5ARDA 1VOTA 4RKQA 3H8JA 5CBKA 1EFLA 5IK7A 1R091 4KE7A 1UPAA 5IUKC 1L5OA 5LA6B 3LEGA 2QRGA 4DSZA 1W9TA 2MCFA 1Z6TA 1AYN3 4GOND 4RTRA 3FCYA 1W8HA 1YZTA 2RGDA 4BISA 1BO6A 4RH3A 1WXDA 1FAYA 4N90A 3T5GA 4RS5C 3Q0TA 4CM3A 1JLMA 1QJZA 3OCYA 5TLSA 2D5AA 1E3TA 1D7PM 5B3KA 5GINE 3JATB 2D5BA 4GB33 3RYHA 5AC93 1OJ7A 3LYAA 1ZG3A 2X7JA 3T3YA 5GTDA 3M3IA 3CNLA 3VBUC 3KOZA 3UGTA 2WG0A 1AA6A 3A1TA 1GA6A 1O94A 1M3SA 3Q12A 1EK1A 1E1QD 4MPPA 3WNZA 2EWWA 3VSDA 5JNRA 4MB2A 2ZHNA 1RXIA 4IP0A 3Q7IA 3TYJA 3ZCXA 4JNKA 4R54A 3WLTA 2I76A 4RLFA 2ZGNA 2BM0A 3S6PA 3OA0A 3DXZA 4DIDA 2H1FA 3O3NB 2P2KA 2LDBA 2PWBA 3L7IA 3PQ3A 3E5RA 4QX8A 1TU0A 3IKMB 4IV3B 4QYTA 3I6QA 3KQQA 3NHRA 2V7GA 2IT1A 1R6VA 4GVLA 1R2QA 1NBMA 4H1HA 1NATA 4J9VA 3GV0A 2VC9A 3BGOS 4CLRB 1AM4D 5K8UA 4CUAA 1U81A 2W87A 5CFQA 4ZO4A 4ZDJA 3HN3A 1G2IA 4E1BA 2XB4A 4HRVA 3CRQA 9ABPA 1JVNA 2G72A 2FLWA 1F4PA 4NYIR 3U5ZB 4ZPXA 4EECA 4HMZA 4WZAA 2GASA 1FOD1 5DXDA 1CRWG 2IYPA 2B7YA 3HP1A 1Q0TA 2YXEA 3M5CA 2QTHA 1ZYUA 1SU7A 2OENG 3LYLA 2RS12 4GOLD 4PGAA 3AXDA 2ARCA 2WS93 3VZSA 2CLFB 3C1TA 1XQYA 1UYZA 3K4DA 2BGIA 5KQMA 3WV4A 5IFKA 3EGWA 2LE0A 1C30B 5CTAA 1GXSA 2P7IA 4TVBA 1YK1A 2F6BA 4EWDA 3AVRA 1PDVA 2OQRA 4DIBA 1TQDA 4CCMA 1L5GB 1O96A 4B8ZA 1DAGA 2B83A 5H5JA 1DZIA 4GKYA 2H2IA 4ACBA 5ED4A 2WSMA 3WNCA 1GLHA 2WF7A 5EFUA 2W6ID 3LQFA 2ILTA 4IZOA 3TOVA 3GLTA 3FOWA 4FFSA 1HG1A 3E22A 3DPIA 3DF9A 4HK9A 1XDWA 1CJUC 3AEQA 3QVTA 2PYDA 3RFVA 5E1RA 3BULA 4PCLA 2Z9DA 1L4KA 4UFIA 2QVZX 4DGSA 1ZC3A 2C94A 1YO8A 3QFTA 1Y89A 3H83A 2C7OA 4O61A 2IPAB 2CD7A 2VUJA 1LGCA 1XD8A 3AEQB 5JEDA 2I55A 1H3NA 3VKNA 5DUWA 2I8LA 1PL8A 3H7IA 4Z8BA 1Q7BA 5AM3A 4V0LA 1E0AA 4RHCA 2VAUA 5HF5A 1DC7A 4J0HA 1QGZA 2JWPA 1A34A 4LWPA 3J9SA 4KH9A 1N78A 2DBNA 3NTUA 4B73A 4FQ4A 2UZIR 2LNDA 5I47A 3SFZA 3NP9A 5DBFA 3H65A 1KITA 5BV1A 3DOHA 3CG0A 2WJAA 2ADFA 3ROUA 1L5YA 3COZA 1IZ3A 1SEFA 5K99A 5EIBD 1LVHA 4DXAA 4AGGA 5D6NA 3AU9A 1BTOA 1X36A 2JAWA 4JV4A 3IAFA 3L7JA 4N65A 1COWA 2AW5A 4XFHA 3GNTA 2Y4NA 1EGVB 3JQCA 3FYTA 2IVZA 1VI6A 5FRDA 1CJDA 3U09A 1UW8A 2FQPA 3U3ZA 1RR6A 1CJTC 4YROA 2GQ0A 3EXHB 3IBCA 4XFKA 5JR2A 4PLNA 4L8YA 1QCYA 1M0WA 2X13A 5CFLA 5FPBA 3DPRA 4IY1A 1DTWA 2VHJA 4IDDA 4L5JA 4YRQA 1D4VB 3PXGA 1S96A 2WQZC 3SXPA 3GFPA 2J9YB 2QQUA 2QROA 2G36A 3DNPA 2Y9PB 4ZYVA 3RHZA 1DQPA 4O0LA 4E27A 1G291 4KEAA 1WZXA 4U00A 1ASJ3 2ZYDA 3DLBA 3BKXA 4TL8A 2J87A 3AM5A 3HDYA 4KI7A 3K70C 2PUBA 4GE3A 1UYPA 1XNKA 2WKPA 2X05A 4WXPA 4BCCA 1RYZA 5CU1A 4F2PA 2G4CA 1Y33E 1F35A 3WYGA 1PR3A 3E5UA 3EEFA 2XUKA 3N8NA 3DMYA 2R30A 2EX4A 2WM9B 3A14A 4FAGA 1DJQA 2BMWA 1K6MA 5DX0A 1BBT1 1GFF2 4XJ8A 4EHDA 4FYWA 1VJGA 4DY6A 3TL3A 1W8IA 1AL22 4Y2HA 4I0WB 4EUFA 2B4TO 5H8WA 3SYLA 1J0EA 1B43A 4B48A 3ZLIA 5LEKA 5JATA 1JXNA 4DNXA 4PQQA 2OLJA 5LA9A 3FHTA 1TD9A 3PR2B 4HN0A 1GVNB 3N76A 2GR9A 2J5RA 1K6IA 4BVGA 1G7YA 3CNHA 1TFUA 2JFBA 3MUNA 5LWHA 3R9KA 4JQSA 2WQ8A 3SDBA 5FPAA 3QVLA 5EXEA 1XCPA 1AGNA 3U4IA 3F9IA 1C7RA 1Z7WA 2NMOA 4I36A 1XVVA 4GXRA 4PRLA 2W71A 2A6VA 1NPTO 2ODNA 1LODA 3GHNA 3OUUA 1W6QB 1NAHA 4D0QA 3DSRA 3LPMA 3N28A 3UA3A 2O8BB 5DZEA 4QPIC 4CMAA 3F8WA 4AF6A 3EIUA 4PHZA 1SOUA 3WQSB 5JRJA 4HYQA 3WHLA 4PFJA 5GZDA 5REQA 2PNJA 2QQPA 3AYCA 2ZWMA 4EUKA 4BNGA 3EQ2A 1WNTA 1S0CA 2JJQA 2AZXA 3U1XA 5L9AA 1RMU3 1FYWA 3W5BA 1E2FA 1SY7A 1W48A 4JDNA 3KKLA 2DTYA 3BAFA 4K81B 4DN6A 3QBVA 3TZHA 1UJMA 3WB9A 5IK2A 5DWVA 3B20A 2IHVA 3G89A 4JGZC 2VZSA 1AURA 2AENA 4KWEA 3IT1A 3VX3A 3U7IA 1GQSA 4HETA 4N82A 2A30A 2C99A 4X63A 3ZCRA 5LJIA 1YIFA 4RKYA 3DFIA 3C24A 3A9TA 2AXNA 2ZIVB 3GT7A 3PHGA 1GAXA 4N0QA 4UFKA 4FOVA 4I2VA 4BFUA 4QQPA 1GA1A 2OECA 3D7SA 3EPPA 3JD3A 4XFIA 1M6EX 4NRDA 1GV1A 4BNNA 2Q3MA 2A9KA 5B4XA 1BX0A 1ENZA 1FATA 2ZJ4A 3O0WA 5HIMA 1XE3A 2Q3BA 3ZYHA 1G38A 4EP1A 1LOEA 3H11A 3U4DA 1E64A 3VKFA 1UZWA 4DXZA 5BSEA 1VAMA 4L76A 3TIVA 2PMKA 3PU8A 2FNAA 5DO9A 4I4TB 4MXDA 4MYCA 3TLEA 1PR0A 2GWRA 1Z0HA 3K4QA 2VJDA 3DW3X 2XQJA 3ICQB 3OE5A 4IEXA 1M7GA 2IEDA 1D0GA 3WNVA 5IFPA 3R6SA 1FDRA 4X9XA 1DQ5A 2OO3A 2SBAA 1G18A 1X42A 5E7MA 5C4WA 5KCZA 3ZXEA 1YS6A 4RYDA 2VE1A 3PG5A 3G9UA 2Q3JA 4AKGA 1AUQA 3KQLA 4P32A 1DXHA 1W85B 2P0YA 4YYOA 3THRA 4BBZA 3DT9A 2W0XA 2J5QA 3TEZA 4RJJA 1H65A 3R44A 2I07B 1TYCA 5HE8A 4BO4A 4XYEA 4WY2A 1U94A 1W85A 2OVUA 1E5XA 4CIAA 4FXGB 4BAZA 1E2PA 3RLFA 1VBE3 1Y48E 1M1NA 1UWKA 4PGHA 1Y43B 4YSFA 4DNOA 2VKTA 2R2AA 4IHKA 3ZXSA 4HEQA 2HBZA 3LK7A 3EC1A 3PUKA 1PT6A 2OV8A 2VSXA 1RJDA 3NYRA 1L4HA 1Z0JA 1DV2A 4MNTA 3TDKA 4K9DA 1E6CA 2FR1A 2AYHA 2VTBA 1YD7A 3H8VA 2RHDA 2B36A 4YP7A 2CBXA 4UOEA 4K9RA 1DARA 2JVIA 4MPJA 3DMRA 1AHNA 4CM7A 1YGYA 1KOFA 4ZO7A 3TQHA 1XTQA 3OCWA 5K8VA 3VBHC 2YDXA 5C5TA 4C6TB 2BZ0A 1O4WA 4MINA 2EIBA 4COKA 3HZOA 2GNMA 2HMAA 3T1OA 5FLJA 1HPLA 4V0SA 1MQ9A 2GARA 1T8SA 4QRHA 4RGVA 2C00A 4XJTA 5I9SA 2GS9A 5CX1A 4L97A 2NO6A 1C4WA 3NW4A 1CS0A 5IVCA 3THPA 2D5FA 4EM6A 2GERA 4JL6A 3R20A 3N0XA 1RQNA 1TA0A 3GGPA 2X2PA 4HQKA 3E82A 2W94A 3PTZA 1W2UA 1NF8A 3LNCA 4AQ2A 3NNJA 1ZJJA 4U02A 2O2YA 3ZFFC 4MV0A 4AX8A 4ASKA 3GG2A 2A3WA 4IV3A 4H3VA 3E3OA 3KYIB 2NWQA 3IMEA 4C0HA 1U6IA 2C2KA 5J4VA 1LBTA 3K0HA 5CBPA 4WXYB 3F3KA 1QUFA 5LBUA 3U11A 1C5KA 2HLEA 5FBRB 3SC7X 5AM2A 4UNNA 5LM3A 3PVOA 3K0AB 1X0XA 2EJCA 2P17A 1ZOOA 1KVSA 4F21A 1FDTA 4D3DA 3LBHA 1H2YA 2XWJB 3FYCA 4G3XA 1XG5A 3JQRA 4MPRA 1BSVA 3ZZUA 1JHMA 3QACA 3FPLA 1W9HA 1E98A 2DR3A 3E0XA 2OZPA 721PA 3ZW7A 3A4IA 2BFEA 2BT4A 1O95D 5B3JC 3PIRA 2LPMA 3TG8A 1XVIA 2Q4OA 5EZYA 1WPGA 5CFZA 4G36A 2D59A 4DC9A 3RGBA 3PFIA 3ICVA 4PG6A 3DR5A 3D82A 3UGQA 5CYGA 1D2SA 1AD2A 3BRWD 3LAWA 1GSHA 4A2WA 3QY0A 3HY6A 3PHJA 2HLNA 5IAKA 4RKRA 1MENA 1ACLA 5IK4A 5HKLA 4TXHA 4BB6A 1QJY3 1XQ1A 3KTAA 4DR2B 4HH1A 2QSZA 2ZYTX 5WRFA 4WBSA 2IXDA 2QRUA 4FC6A 3WGNA 1T3HA 4CP0A 1Q95A 1SFPA 4BGUA 4RAQA 5KQRA 4FWBA 3WUDA 2J32A 5CJJA 3TFQA 1GEEA 4ZMRA 3SK0A 3EW9A 3E6DA 2QHXA 5TJ9A 5FTWA 2UWCA 2Y0BA 3K48A 1H9WA 5D8AB 4MR9A 2WJSA 1BN6A 4B3BA 4N41A 1ZH4A 4BX0A 4BX2A 4LF8B 4CYDA 3RSHA 4N3AA 3LI2A 5IKPA 4KUEA 4C4PA 3ZHOA 1NVAA 1I1OA 1ZD1A 5JMPA 4RE5A 4NN0A 2D44A 3AFOA 3QWBA 4B35A 2PN1A 3RVLA 4NRPA 3TAYA 1AYM2 1UBRS 1LA2A 1BVYF 4HNSA 4E22A 1YI0A 3THSA 4LZLA 4FFDA 2ZIXA 3I4CA 1ZU5A 5I4BA 3MB8A 1W1IA 2GP5A 4BRUA 1QHFA 4ER5A 2HJSA 3K7EA 4ZVVA 5HV4A 2AUTA 3O47A 2WT1A 3TX2A 4D6SA 3EXG1 4OHXA 2C3YA 3ZV6A 3ZWNA 4FB5A 4P8RA 1N1SA 2XUHA 5D2AA 1XVLA 2RG1A 3D2AA 1Z4IA 4HNAB 1LPNA 3TIFA 4P31A 3FCEA 5LRRA 3JW8A 2BFAA 1MS9A 5BQ3A 5L8VA 4BEVA 1UU4A 1CDZA 3BTVA 3NVAA 3HP7A 2ISQA 4YJ3B 1XAIA 1NLFA 1FFCA 1Z12A 2B94A 2OCYC 4CF4A 1WZ2A 1O6GA 4XUGB 3SC6A 4YRFA 2HU2A 1M0EA 4YA6A 1VCHA 3LE0A 4NFSA 1VLJA 7REQA 4NU5A 1J0AA 3LXMA 2AC1A 2GKOA 2ZGLA 1HOXA 3HKEA 4KPGA 2IVJA 4UNSA 1UMDB 2CXPA 3UGGA 3T1VA 5IVPA 1S2OA 3LX6A 1RQLA 5J09A 1IE3A 4WVVA 1E62A 2DBQA 2RBKA 3D4LA 5FTNA 1P2DA 5HQTA 4ZICA 1N5DA 4AZ3B 4NAHA 2WHXA 1X7XB 2X1MA 5C8XA 1X1CA 3C43A 3EYAA 4MADA 1W93A 4AJPA 5G2OA 4PIVA 3ZUPA 2CVQA 1QGLA 4OIFA 1Z07A 3HL4A 4HWSA 3RJ2X 1UM8A 1N2SA 2EVWX 1ST8A 1W6RA 5IVDA 3NBFA 1H1AA 3KGLA 3AL0C 2XUEA 3IKJA 5JMCA 5DZFA 3PUHA 1U0LA 1ID1A 4I9HA 1ISPA 2RI1A 4PVCA 3T2QA 5LMNB 3CZAA 1CPNA 1PHMA 3WW1A 1QFZA 4BUZA 5IM4A 1R5JA 4N7RA 5A80A 2XRZA 1PIWA 5IJ9A 3CUUA 1QG6A 3DN7A 1WUKS 1VYTA 2E4YA 2QLMA 1EVQA 1UIKA 4EL0A 3HP4A 4ZQBA 1M2VA 4TS9A 3EPLA 4UBHA 3GHMA 3TB4A 3MA0A 2J6IA 1KH3A 1Z7S2 3OFJA 1ONOA 2DB3A 2I4MA 1UJCA 1PQUA 5PGMA 3VYRB 4C7JA 2NXCA 4QRDA 4DOUA 1PFGA 3NRBA 3VR6A 1JB9A 4PLZA 5FPZA 2VUSA 3CF6R 1Y8AA 4JSRA 4XDOA 4NV0A 5JQGA 1GNSA 3LT5A 4R84A 1YZFA 2NUBA 5GM1A 1RLOA 4RVDA 4WCFB 5K09A 3G1TA 3N58A 5H9SA 3DMPA 1KEKA 4BZ4A 4BAUA 1XDGA 1E4YA 3JQFC 3IHTA 3QXJA 3FVRA 3EG9B 3D5OA 3WGIA 1J25A 5TPWA 2WFLB 4LQLA 3ZPYA 3GLHA 2B0CA 2F43B 3T1NA 3U4GA 1NBWB 2DLCX 4XB1A 1Q11A 3LX5A 1U4NA 5DCUA 3T3IA 1C1YA 4OXXA 2HEIA 2O2DA 1UYYA 4D81A 3A1CA 1KD7A 4WNAA 2FEOA 1QZ3A 3HQXA 1U7WA 3QYJA 3E9ZA 1X19A 4TLBA 3NONA 1U0SY 4YAUA 4MGKR 1RKXA 3K8OE 3ICEA 3GZNA 4C1NA 1NVWQ 5A0TA 1OZHA 1W0JD 4ND1A 4YBZA 2HWKA 1OFTA 2AMJA 1TADA 2IV3A 1XFDA 1ZFNA 2FFAA 1HJFA 2AR7A 3TLXA 1G6OA 4OMCA 1W49A 3O91A 2A1UB 1BE8A 1FPN2 3RABA 2DFNA 2P6HA 1W9MA 3KAKA 5KTYA 3OEBA 3RQSA 4ALMA 4F6RA 4OH1A 3B1JA 1VL5A 3WAJA 1MBZA 1WCSA 3ICCA 2NVUA 1TYEB 4I8XA 1Y80A 4EAQA 3TECE 1SWWA 2O2IA 3KTDA 4XTCS 1YI8A 4CUGA 1W0PA 2O8BA 1J2UA 4PLPA 4H7JA 2R6QA 5EUCA 1A9QA 1KETA 3IMGA 5BY5A 4QJ3A 2CYBA 1R9GA 2RGYA 2H2GA 5JS6A 1HKDA 2ETEA 4JR0A 3LP8A 1NSYA 4C87A 2R6DA 1GTG1 5I9IA 1Z2DA 1KPGA 2JA1A 1WUTA 2A3YA 3D9QX 3TRKA 1OI6A 1H8TC 1EESA 5A9TA 3JSAA 3AR9A 4FD3A 4AL9A 1XE7A 2VDLB 2DUWA 4ARCA 5AKIA 4QGLA 4PLCA 1SBCA 3K2EA 2I4OA 1H4QA 2P2DA 2BISA 4IDGA 1HB3A 5JD3A 2PSEA 2YBDA 3TAHA 2R8ZA 1HE2A 2CHVA 2WTXA 1ZOSA 4YGCA 4DMFA 4BQ5A 3OOEA 3A4YA 5JLVA 2B7CA 1DCKA 2HCFA 1ZVVA 3IGFA 4QKBA 1ULHA 4YIHA 3MC1A 3Q3HA 1YRAA 4NWVA 4JROA 3REOA 1EJBA 1XYVA 2E9QA 3SLGA 5EIOA 3HJUA 4JGZA 3CLRD 5F3EA 3ZDEA 1WW2A 3N8KA 3I9JA 2P4HX 4KWTA 5CK5A 1A2QA 1QVRA 3PJYA 3OBIA 1N1EA 1QGUB 3JQXA 5NLLA 5IUNC 4KXXA 2FSGA 4FI3C 2D6LX 3EHDA 3G0OA 5EY5B 1OW3B 3FLPA 4FR0A 3WGMA 1TM5E 4RFSB 1C3HA 3H3LA 1YASA 2HT6A 3AVVA 4RTSA 3A10A 1NMEA 3IUMA 2RGRA 3SQOA 5KINB 1ZLXA 3BE8A 2DBZA 1BZYA 4OK5A 3KLPX 3JAKA 1JXMA 3UATA 3W2FA 1AR61 2JBWA 1I1NA 5MGBA 2UXCB 4IVQA 1DRWA 1R0KA 1GNHA 4F4HA 4N01A 2NZ2A 4UDYX 2O8NA 1C8M1 3DOOA 3E7DA 3D4PA 4UBIA 3ZS9A 3VBUA 2J1SA 1SXJD 1WQ3A 4OMFG 1AF4A 4LZPA 1RYYA 3EWAA 4Q1AA 2DTXA 3RSJA 1E5DA 1A95A 3NBXX 1NVFA 4H77A 2Q5TA 3MYXA 3VD5A 3ZLUA 3EH2A 2QU7A 2W2OA 1KYQA 2WNUB 1A71A 3THXB 4C2UA 3Q4GA 4MLDA 1ZCAA 2Y66A 1ZC4A 5A7FA 5LK5A 2V5VA 1AT1A 3EWSA 3AFGA 4COOA 3L79A 3N7KA 4QQFA 2VL4A 3K6KA 3IVXA 1QK3A 1HYQA 1ZBE1 1VIWB 3LKBA 3HVRA 4O4LB 3DOUA 1JAHA 4BJ3A 4NONA 3WFJA 3SQNA 2I2CA 1VBFA 1T4BA 3LH5A 3H3UA 2GH8A 2HBQA 4KKVA 3QFFA 2P65A 9MHTA 4YR9A 4MYSA 5DLEA 3RREA 5J9FA 4JV5B 1YJCA 4N9HA 1RRVA 1ND3A 5DG1A 1JQ3A 3USES 5BP7A 1XTBA 1REQB 2AJBA 2FSUA 2NUAA 4LXTA 2DBRA 1TMF3 4NBTA 5F2SA 1QHHB 2ENUA 3AIKA 4TTTS 3PUYA 2Q4TA 1RHI1 2BNMA 3OZVA 2GU9A 4OKSA 3T54A 4BKMA 2ZX4A 4A0GA 3BXXA 1OF4A 2QJWA 3R3SA 1O5TA 2WU8A 3QH4A 3C74A 3SHOA 5B58T 2FDFA 2P2ZA 3I2OA 1N75A 4GR4A 1RPTA 3FHJA 3F6YA 1I5RA 2A1UA 5HKOA 3N2EA 3BTAA 4FM9A 5AM1A 2OMKA 2M2IA 5BPXA 4L2IB 1UU5A 1H0RA 4AW9A 4MW9A 4MGKE 1N2JA 1TI7A 2VNJA 3BK2A 1F4LA 2OOKA 1YDEA 4BRZA 1E8DA 3NNMA 1C9JA 2C92A 2ZVJA 2ZGQA 4P4SB 4HGYA 4OMUA 2HV9A 3NOOA 2D0IA 5F3GA 2G25A 1RUG2 4DEVA 2JGRA 3ESXA 3KZCA 4PSAA 4JRAA 3PRJA 4EG6A 3FE5A 4EY7A 2R8EA 1G7TA 2P3KA 1L1FA 2WT0A 3USUB 3IEPA 1U0RA 3L77A 3P6BA 4YMVA 2JECA 4AE2A 4Y4RA 2BYVE 3K1AA 3AJEA 4UZFA 1FMFA 3SEEA 1NUTA 1GGJA 4UPEA 3HWRA 1VL0A 2QBXA 1PL6A 3H0KA 1E7MA 4TSFA 1C8M2 2PCLA