3BPSA

Pcsk9:egf-a complex
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
530
structure length
435
Chain Sequence
b'SIPWNLERITPPRYRADEYQGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHWQLFCRTVWSAHSGPTRMATAIARCAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDAVTAVAICCRSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proprotein convertase subtilisin/kexin type 9
molecule tags Hydrolase/lipid transport
source organism Homo sapiens
publication title Molecular basis for LDL receptor recognition by PCSK9.
pubmed doi rcsb
total genus 128
structure length 435
sequence length 530
ec nomenclature ec 3.4.21.-:
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF18459 PCSK9_C1 Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain
A PF18463 PCSK9_C3 Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain
A PF18464 PCSK9_C2 Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.690 Mainly Beta Sandwich Jelly Rolls Proprotein convertase subtilisin/kexin type 9 3bpsA02
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3bpsA01
1WMEA 3ZXYA 1AK9A 1KDVA 1AH2A 1SBTA 1Y33E 3GCWA 1SUPA 2ID8A 2Z58A 4KG7A 4CG0A 2WUVA 1DBIA 1Y4DE 2DQKA 1GTJ1 3QFHA 1TM1E 1SUCA 3D9QX 4M1ZA 2HD4A 1GNSA 1NDQA 1KDZA 5JMOA 1C9JA 3WIUA 1SCBA 3D43A 1S01A 1SBHA 3A3PA 1YU6A 3I2YX 3LPCA 4LVNA 1MEEA 4HVLA 3VSBA 4KB5A 1S2NA 1SBIA 1SIUA 1CSEE 2WV7A 1Y1KE 2Z2XA 3TI7A 1SIBE 2DP4E 1PFGA 1GT91 3VV3A 5B1EA 2PMWB 1ZVJA 1TM7E 5ARBA 2SECE 1PJ8A 5FFNA 2W2NA 4AKTA 1WVMA 4DJ5X 2TECE 4NE9A 1CNMA 5FAXA 1C3LA 1SPBS 1ST2A 4WOCA 1OYOA 3F7OA 3SICE 1ST3A 3LPDA 1OT5A 1C9NA 3F49S 4C3VA 3PTLA 3H42B 1SCNE 4J94A 1SUBA 3LXUX 1Y3BE 1NLUA 3BPSA 2PWBA 3I37X 1R0RE 1THMA 3A3NA 2WUWE 1R6VA 4OV6B 5K7SA 4DZTA 1GNVA 1SUAA 3EE6A 3TI9A 1GA6A 1VSBA 1AV7A 1OYVA 1A2QA 1SELA 1WSDA 1Y48E 2ZRQA 5AVJA 4NMXB 5AQEA 4C3UA 1EA7A 4OMDA 1TO2E 2ID4A 3VTAA 4WOBA 1T1IA 4K8RB 2X8JB 5ARCA 1SH7A 1SIOA 2E1PA 1AF4A 3EDYA 4CFZA 3AJ9A 1JEAA 1SUEA 3DVSX 3GT3A 5B1DA 2SBTA 4HX2A 3DE5X 4B5LA 1BJRE 3I30X 1AQNA 1YJBA 1T1GA 1YJAA 2HPZA 3BX1A 4MZDA 3DVRX 1XF1A 4JP8A 2P4EA 5I9SA 1SUDA 1AVTA 1UBNA 2B6NA 4ZOQI 1BFKA 3DE1X 1MPTA 2W2OA 2W2MA 3DE4X 1KE1A 1S02A 1KE2A 1BH6A 3Q40A 3DDZX 1KDYA 1T1EA 5AMXA 1LW6E 4ZARA 1SCAA 1GCIA 1SN7A 2PYZA 3WQBA 1IC6A 1P7WA 1GA1A 4CFYA 4I0WB 1TMGE 2PQ2A 3DWEX 3TECE 2V8BA 1GTG1 1TO1E 3ZXXA 1Q5PA 1V5IA 4Z2AA 1BE8A 1TECE 3Q5GA 2SICE 2ZWPA 1Y3CE 3CO0S 4H6WA 2IY9A 1SVNA 1YJCA 3UNXA 5JXHA 1P8JA 1IAVA 2ZWOA 3DE6X 5ARDA 3AFGA 3DE7X 2W2PA 3GCXA 1ZVKA 2Z56A 3BGOS 3CNQS 1Y3DE 4RYDA 2SNIE 5CW1A 3LPAA 5JXJA 1C9MA 2G4VA 3AJ8A 3I34X 3QMPA 5FBZA 1WMFA 2Z57A 2X8JA 1Y34E 3SQOA 1BE6A 3QTLA 1GA4A 1Y9ZA 1SCDA 2PRKA 3DE0X 1GTL1 1EGQA 1TM5E 2XRMA 2PWAA 4KPGA 3WIVA 1SBCA 3WHIA 2QTWB 2GKOA 1V6CA 2DUJA 1NDUA 1SCJA 2W2QA 3VHQA 4AKSA 2Z2YA 3PRKE 4OMCA 3DYBA 3EIFA 3HJRA 4YN3A 3DW1X 2XTJA 1TM3E 3A3OA 3DE3X 4LVOA 5JXGA 2WWTA 3T41A 4GI3A 3DW3X 1BFUA 5SICE 1PTKA 1P7VA 2PKCA 3P5BA 3VYVA 2IXTA 3VV2A 1DUIA 4H6XA 4FONA 1Y3FE 1R64A 5AVKA 4H6VA 4BWGA 1SBNE 5JXIA 4NE7A 1WMDA 2Z2ZA 2ST1A 1TK2A 1PEKE 3F7MA 3OSZA 1HT3A 1Y4AE 1TM4E 3GT4A 3DVQX 3L1KA 2Z30A 1AU9A 4DWWA 3DE2X
chains in the Genus database with same CATH superfamily
1NWHA 2BGIA 3MD0A 2VZLA 1MX9A 2R00A 2B61A 3ZY2A 3KC2A 2A0KA 1DO2A 3WX5A 4CLHA 2HT6A 1C9EA 5AM5A 3JQDA 1X39A 4OXQA 4EK9A 3OZBA 3JQ8B 1E6CA 2A86A 2BTVC 1KMNA 3QVOA 2VRCA 1SQ6A 3NBAA 1A04A 1PJAA 1TCCA 1C9YA 2WB2A 1RUD1 1PX2A 1RM5A 1AUQA 1W04A 5JAMA 3G2KA 3IXMA 2PHTA 5A06A 2X23A 3AKEA 4Q0UA 1PI3A 3B70A 4UTXA 2J3HA 1OC2A 2H16A 4LO7A 5ACA2 1EUDA 5DN6D 1C9MA 1DKPA 1BWSA 2ZSJA 2AT1A 4FPJA 5DGDA 1ENYA 5J4VA 2GEBA 4FT2A 3S5UA 1U5BB 1Z88A 4BQ1A 5BMVB 2CLKB 4M9ZA 4IL5A 3V1MA 4P83A 5JDCC 1B8VA 2I78A 4RSUA 5HJ7A 4EPTA 4J7UA 2VXOA 5AKKA 1E9AA 4ZT3A 1K7XB 1RZRD 3ZGZA 4HFRA 4CM1A 1QLJA 2RB4A 2JFFA 2AX4A 4A6DA 4JI2B 3FL7A 4UBIA 4O2AA 1JXAA 1R66A 1O96B 1K92A 2Y77A 3UHPA 4Y2YA 4JCOA 3O12A 1SCNE 2WR8A 4IO1A 1E9EA 1R9JA 3FR7A 4ZCMA 3CH5A 4QAWA 1SLTA 3D81A 2I1LA 1IHOA 2IXAA 1UBOS 4PQEA 4OI4A 4IGOA 3RT9A 3AUUA 2XR1A 3N0VA 3KSDO 5DMYA 5LP1A 3A9VA 2YBKA 2VSYA 1ACJA 1EG2A 1FQKA 1TUGA 4R9SA 3LXXA 5JUWA 1Q0ZA 1WZCA 3WSWA 2H06A 3FBTA 3M4NA 3M83A 1X38A 4E12A 3FCYA 4LJKA 1JKJA 5CFCA 3MGKA 1Y5RA 4EVQA 1DGRA 2X2EA 4FNGA 2EKLA 3Q9UA 1UC4B 3LYLA 4TLGA 5JDIC 1GRQA 4MGKE 3O2JA 3OF2A 5FIUA 5CMLA 1JG4A 2F3UA 1XZKA 3IP5A 3K9LA 4QX5A 5C80A 4DG9A 1BDHA 2ZJ7A 5LP6C 2OVBA 2QSJA 2DTDA 3EEIA 3IAAA 3CF4G 5C6CA 2AG1A 4I0BA 3W5HA 4XX1A 3PXUA 5FL7D 3ZOKA 4E21A 1AV6A 3IJ5A 4HAUA 5BNFA 3O7OA 1Y8ZA 3ZVLA 2IXLA 4QELA 1NQWA 1FNNA 2ZEWA 4J7AA 4Q4X3 2B9UA 1AR71 3PENA 3W1VA 3UJ3X 4Z8BA 2P11A 4G1MB 1R4AA 3Q0TA 3OG2A 1CRQA 4QQNA 1MB3A 4QHSA 2VT3A 4H1UA 1B09A 1MVEA 3KO8A 2HF2A 1KQFA 5SY6A 4KODA 5KPJA 2V5DA 1I1EA 3VZSA 1QK3A 1TJYA 1XZIA 1Q57A 3MUFA 2VNAA 6NULA 3WLHA 2G80A 4HNQA 4LF6B 4D6PA 1XQ6A 1VKRA 1PT6A 2RHDA 3IBYA 1L3IA 3IP8A 1O7FA 3B48A 2YV4A 2GTPA 3AB0A 3I12A 1W9MA 1WVGA 4LRWA 5C4WC 1N5OX 2QGZA 2OK7A 4YRPA 4BRSA 2C4KA 1T3HA 1D2MA 5CFNA 5CG2A 2NMOA 1QP4A 1Z9BA 3ZWYA 3P2EA 3ZBTA 4ESHA 2PANA 4CRQA 1DIRA 2Z69A 4F3RA 2REQB 3NPAA 5EAIA 2D8AA 4RJIA 5EPUA 4AL4A 2KBEA 5AD1A 1PP4A 4OP3A 3SJUA 5HJ5A 4TRNA 1JJAA 2E6UX 2GX6A 4WNAB 1XTSA 2IUYA 4Q4W1 2N0SA 4YQEA 2XAAA 4UW9A 1KSJA 1GT6A 4JVMA 5KKNB 2GXQA 2C2BA 2M98A 2C7RA 1H3EA 3KV3O 4BGUA 3AB3A 2OC4A 5EXTA 3J7HA 1O87A 2WSVA 2V7QA 1XAGA 3QX3A 4HB3A 1S0FA 4JQRA 1HDKA 1T5TA 4BK4A 3LWCA 4WNYA 3RRFA 4AEDA 1Y6GA 2HREA 2Y6KA 3IAFA 1CUEA 3AR4A 4IVQA 4LRQA 4DV0B 3U78A 1XTJA 2ADFA 3S8MA 5JMOA 3MFYA 4JLUA 5IP5A 3VH3A 3RB8A 2FP3A 1V8OA 4UE2A 1G9CA 3RTAA 1K4YA 4HL6A 1Q0TA 1CEXA 4BJ6A 3FNRA 4FOWA 3GELA 3PTLA 2PYDA 3GJ5A 2AC4A 5DW3A 4LKOA 3B5JA 2R1VB 4IF4A 3KELA 4C76A 3BDIA 4BMYA 3GA7A 2QM0A 3OMXA 221PA 1VJ2A 5JD6A 1TFRA 1JBKA 2E4YA 1KE1A 3AMVA 1C3HA 1PO7A 3TLKA 3QXGA 4ZC1A 4UNNA 3BILA 1CUCA 3KM0A 5U9CA 1H6DA 2ZIAA 4NZPA 3RFRA 1WW4A 3LCUA 4XGKA 4D9CA 1C2YA 4E6PA 2F8SA 1GPYA 1GV1A 1KS5A 1MS8A 4RHCA 3WIOA 4JBNA 5BPHA 4GKVA 1HWYA 3GRCA 1NCQC 3OAAA 2UVPB 3P9XA 1RWBA 1UPFA 3DS8A 4H4CA 4EY7A 1P5JA 4UVIA 121PA 4AXXA 5AKIA 3HN6A 2PMCA 5KYWB 2OHFA 3U31A 1J09A 5FV3A 1TM7E 3W1EA 1G17A 4CF3A 3K1TA 3VFDA 2H5IA 4RGYA 5CLGA 2P2YA 3IPCA 3TQHA 4OFGA 1ZIXA 2WBLC 1I7NA 4QUKA 3RSQA 2WSMA 4UAPA 3IP6A 3WI7A 2YYZA 1C4WA 5E4FA 4IUCS 5CYPA 5LATA 1D2HA 1AKQA 4KRGA 1BEUB 5BOVA 3WBBA 3B60A 3GHYA 4GZ6A 1BHO1 3N2KB 5C9AB 2VJMB 2ZREA 4BBPA 4NMMA 2WJZB 2BP7B 1B0AA 1B76A 1EPZA 5JHHB 4Q37A 1RQNA 1IBLB 1UW8A 3NPMA 3IMGA 3SJZA 2FR1A 1Y4WA 2XUAA 2Z5WA 3POYA 1SZPA 2AREA 1I7PA 4IUBS 5ERLA 3TN93 3CS3A 2IK8A 2ZBUA 1EE1A 1SU6A 2CHUA 2YASA 1NCRA 4M00A 3MG9A 3K70B 4K9DA 4O0LA 3CM0A 1U7HA 4AMZA 5J09A 4QD3A 2OG1A 4R9CA 2VRWA 5A7SA 2ZR8A 3B2EA 3ET5A 5M29A 5FWXA 2NXEA 3MCWA 3UV6A 1SPBS 4GB32 2A1TS 3B01A 5DKFA 3NEAA 2YPDA 2ENRA 4OU4A 2D5AA 1JOBA 2REOA 1M74A 1V7PC 3M49A 2OBXA 4GOXA 3AFNA 3TW8B 1GN8A 1C8LA 2NQTA 3P9QA 2VAMA 1ATZA 2P9CA 1OZGA 1AYN2 2RHTA 4ER5A 2Z8XA 2J0EA 3IVGA 4X3CA 1PFVA 3X0DA 2ON6A 1QJFA 1AS2A 2INGX 1PLLA 3C3BA 2O7VA 2V8OA 4F9EA 2ERCA 3IQWA 4UMFA 2ZR0A 1GNHA 2R8YA 1UBRS 3I9FA 1WD3A 3KWFA 4EG5A 3RPEA 2Y4NA 1FFXA 3OUZA 1HTWA 2VSOA 4BNXA 1JUIA 4Q3EA 2KHZA 3MSCA 1P33A 4BYMA 1KMCA 4OHFA 3ZV5A 4GL2A 4PN7A 3ZWAA 5CB4A 1EAYA 2SLIA 2FW6A 1D6JA 5CFMA 4XIJA 5ALDA 4ZRNA 5H4HA 3HJFA 3TINA 1KU0A 1SUFA 1R6AA 3TSZA 4CCLA 1FPN3 4WZAE 3D6UA 3BYWA 2B92A 4JNKA 1RUG2 1AL0G 3FF1A 2QGFA 3DKKA 4L3VA 2NN8A 1FOD2 5DEIA 4AS1A 2MSNA 4N43B 5IUKC 4QFDA 1ORHA 2YYAA 2IYZA 4X7BA 2HA5A 4IV5A 1K7SN 1JW6A 2FWBA 4Y6QA 2QQNA 2JKZA 5FEUA 2JAOA 3BWVA 1GSOA 1DG9A 3WNKA 4DEYA 3P4YA 4TN1A 4EHAA 4OVKA 1MR5A 2C1ZA 4R6XA 3GW8A 4Y22A 4LOJA 2XMPA 3LTEA 5EPOA 1DQRA 1SVKA 3I4CA 2NO5A 1E3EA 1FU7A 4EHLA 3NV7A 2Y6GA 4NIDA 1OKQA 3H1WA 3ANTA 1WW5A 3QBDA 1KYQA 4WKPA 1PZ9A 3OIVA 1RAFA 3KTAA 5IPFA 2NU8B 4BKQA 1ZYBA 3ZWNA 2WYWA 4YO8A 5IZCA 3C8DA 3S3TA 2BH9A 4WHMA 3DEKA 3N8IA 1LDBA 3F9RA 3PL1A 4FMCB 3VZRA 1W87A 1DZQA 5CHYA 4N49A 5JS7A 4RTOA 4GH4A 1JEYB 3AZQA 2GCOA 3C70A 4DUPA 4DLRA 4OI1A 4UMVA 5DGXA 4IDZA 1HT1E 1P9LA 4UAJA 1AL23 1DFGA 3KZXA 3GMTA 3KOMA 4KVAA 2X8LA 1II9A 1IH8A 1U0GA 1QMPA 2XWJB 5BMOA 5ITVA 5DP1A 4O3MA 1OWMA 1Q8PA 2O8FB 1U28C 3NO4A 4XW2A 3ONDA 1LKNA 1RC0A 5JNLA 2XKKA 2YCBA 4H7JA 1T9KA 3GZTB 5HKKD 2BFFB 1GWMA 1XK6A 1RUE3 3HKCA 4YMGA 1CQJB 3QEAZ 4I4CA 3FLTA 2GEDA 4ND1A 1M33A 3QNUA 4LR4A 1Y4ZA 2GK3A 1OF4A 1UEIA 3E3AA 1W30A 4ZT5A 5J40A 1QJU1 2WF8A 1XDSA 1ND3A 4RR3C 5DZSA 1CY2A 2YY1A 1I4DD 3U7RA 1N5JA 3SMVA 4GZ3A 1Z83A 3U26A 1UX7A 4P22A 5E7JA 5DG2A 4JFRA 4MYUA 2BBWA 4TKMA 4PLOA 5DPMA 3W58A 2YFYA 1JN2P 5HJ2A 5AW6A 3L6RA 1MPTA 4GFDA 2GJ4A 1OPXA 1PJRA 4NYMQ 2RMU3 1KOLA 3LKVA 1JWLA 2Q5HA 5I4CA 3G3EA 1SM4A 3JYHA 2P62A 5AK4A 3QX8A 5GMOA 2CNWA 2QQPA 3AMQA 4K20A 4DHEA 4UBGA 3F7NA 3VVLA 3QTLA 4UD2A 3WG3A 4ER0A 4M4SA 5THQA 2QLMA 3NHMA 1YS1X 4B76A 1QOQB 5A1LA 3P5BA 1EVIA 3O8QB 2AFRA 3QQPA 3L6EA 1SQ0A 4GBED 1L4NA 1Y33E 3TVTA 4C5CA 2NSHA 3U4MA 2WRAA 3IESA 1ZUD1 1PNRA 2IHYA 4BOYA 2WV7A 1HE3A 2QUIA 3I5MA 4MHOA 2GD6A 1PVC1 4YRTA 5IASA 4E2ZA 3EDOA 2QZ3A 2C3UA 3CLRC 4Y0AA 3TAUA 4FHZA 4BECA 1AR63 1DBWA 2ZJFA 4CXYA 1PZMA 2ASEA 1MFPA 2DUUA 2BFBB 3R05A 4E27A 1DG1G 3MQ2A 3NAPC 1UF2C 4PYKA 5ANQA 1W76A 5JSKA 3THXB 1QZTA 4AJOA 2BEWA 4YLGA 5EWJA 3NAZA 5C9AA 2GZDA 4TSFA 5EKDA 1RPTA 1CQZA 2QUAA 3MF6A 3WXBA 1MX5A 1V2GA 1WMAA 4WESA 1P80A 2Q2WA 2XKAA 2XZTA 4J90A 4GULA 3EVBA 2O5CA 2GKOA 5C2JB 2OOKA 4Y9DA 1BFUA 4TXJA 4I9HA 4DCVA 3AYEA 1VI5A 1FPN1 1RABA 2PGJA 4GZ5A 1QJY3 1YZFA 3AI7A 3BPZA 4GBJA 3WWYA 1JHNA 3V42A 1ND2B 3VVCA 1V2HE 4ZEWA 3F3SA 3DOFA 3H3FA 4HBNA 3ALQA 2FR8A 2ZDGA 3EGWA 4BAUA 2WHRA 4PLPA 3TXAA 4Q4LA 5F37A 3AM5A 4XASA 5D01A 4D69A 7GPBA 3H65A 1ZNXA 2XUJA 1ECJA 4LGYA 3LZZA 4AFDA 1BD3A 2R1BA 2D8MA 2HGSA 2WS93 3O3MB 2FEAA 2XA1A 1TPZA 1YE3A 3SIPA 1AR92 1HEUA 1II8B 5E2IA 6PFKA 3H9EO 2ZRPA 1T6GC 4URHA 4NCHA 4LBMA 2JCSA 3NDBB 4IE7A 3INTA 3QEKA 1IY2A 3AVUA 4Q27A 2BDEA 3ZV6A 2IIVA 2I33A 5BUVA 4NS4A 3DKVA 3DXUA 1FB5A 4D9JA 4JL6A 1F0YA 4IZHA 5BN5B 1A9YA 3RJ2X 5F52A 1ID8A 2QD2A 1N5RA 4FFGA 4M4PA 3B13B 3MIBA 3I6IA 4FWBA 2NNLD 3A22A 1J4AA 3CSDA 5IJWA 1HRV2 1J3RA 1BHSA 5JO0A 1F2UB 2VVFA 1AX2A 2VZPA 4CR6A 1T3TA 2O1QA 1VE7A 2JGRA 4DMMA 1B35C 2BHNA 1ZOPA 1LU1A 2R1TA 3ED5A 2AVDA 4EF5A 3AOGA 4XUDA 2PL5A 4ES6A 2GFIA 4ZV7A 3G2PA 1X86B 3C1AA 5DFAA 4AN1A 5AKZA 3AVYA 4BKUA 2X40A 4XQGA 3ILVA 1F5JA 3R6SA 3FZGA 4Y7DA 1L4KA 3PFHA 2WM9B 1W47A 3THSA 4YR9A 3LT2A 3QVVA 4KOEC 4OQFA 4FMCF 5AUQA 4QXMA 3FMFA 3D7LA 4HLCA 3TBFA 5ABJB 1XE8A 2FN7A 3ID6C 3H2JA 2H1WA 2FX2A 1Z6TA 1SC6A 3HNPA 2J09A 2BKAA 1W59A 3WLKX 3ON5A 4ZEVA 4Y22B 4GKJB 3UO8B 1NTOA 4JSYA 3UYKA 4QPDA 1UBSB 5REQB 3TDNA 3O31A 4JJAA 1XO1A 4CTJA 4QX3A 4DXTA 2BEVB 3MYXA 4QUHA 2ZKIA 3E7DA 5EYXA 2IYLD 3U75A 2AUYA 4UHHA 1L5LA 3DFFA 3OUHA 3P3NA 2P34A 4JLKA 4KAFA 4EF4A 4XD7D 4E9KA 1XJCA 4HHEA 5AW0A 4J0GA 3IJRA 4YPOA 2H2FA 3ZN4A 3JD73 4P31A 3AHDA 4P3PA 5HVNA 3AGQA 2QLTA 2VM9A 4E2SA 1WBLA 1QHIA 1P2UA 1ESZA 2CBXA 1AL22 2XZPA 1IN7A 1MG0A 1DL5A 1COV2 1SQFA 1MKYA 3TLGA 2VJOA 3H8JA 3UUFA 5T5OA 2KW5A 2YB7A 1WY7A 1EP9A 4DDTA 4P7GA 4D8TA 3KUXA 2AR6A 3BCWA 3HJRA 4AWXA 1WETA 3TFWA 3DKIA 2EIDA 1K2WA 3JD1A 5I01A 4BBZA 2Q1YA 1FSSA 2R8EA 1DRKA 1HB2A 2FX5A 3QWAA 4EP1A 1DC4A 4C6HA 2GALA 1B4DA 1D2CA 5DBHX 4FPFA 1C57A 3WNOA 1PX0A 1U4SA 1OILA 1YL7A 3C0KA 1GA6A 4PXAA 4BXOB 3CNNA 2HYKA 5AC93 1VRBA 3BJMA 1C0PA 1V5EA 1A9OA 1CZRA 5A7WB 2CDCA 3WL8A 1YFZA 3K4ZA 1ZD1A 2KYRA 4HZFA 4EHBA 3DQZA 3VBHB 3QF4A 3L4KA 1JA9A 5CCXA 2GLUA 5EQDA 4QBHA 2OYRA 1DTWA 1T4GA 4CQJA 3OT5A 3EZ9A 4S05A 2YXPX 1AVBA 2VG9A 1PZHA 3RKRA 1M1NA 1MEOA 1U04A 3KEQA 3VUEA 3BQ9A 1XP5A 4FVTA 2W1QA 4WJKB 3ZUGA 1OX4B 3AESA 4MR7A 1Z6YA 1B8OA 1NA1B 1FRZA 4WXYB 1J84A 1Z34A 4DXZA 4IIJF 3NNMA 1MZPA 4HK8A 1FUIA 1TTTA 1QUFA 5D3MB 4NOTA 3MAJA 4DIBA 3J9SA 5AHRA 1TYEB 3NV2A 3TYJA 1M2NA 4FHDA 1RU3A 1D5CA 2IPOA 1L4EA 2JPDA 1IHPA 5JPDA 3MWGA 1JPNA 2ZSKA 4QLAA 4EGJA 3EAGA 3D5EA 3DE4X 2NYVA 3RC2A 5IVDA 3TEYA 3JAMA 2BF4A 5CYYA 4EATA 4CTNA 1NPTO 3MRXA 3SJCA 4TYPA 2FDFA 2WU8A 4WGFA 5DYYA 4TVSA 4KMRA 2A1TR 1QC5B 1YDWA 4PN3A 2NVOA 1XTPA 721PA 4QASA 1WXHA 2CSXA 3TN91 5IF9A 4PLWA 3K3PA 1SDDB 5FI1B 1BJQA 3AHHA 2DF7A 2BSXA 1RUJ3 2G7ZA 5ALUA 3OGJA 2RDNA 4XCAA 3FZYA 5EA2A 3I49A 2PLV2 1OLSB 4X0EA 1IN5A 1VCIA 2VZOA 5G02A 2V58A 3B82A 2O2EA 5FH9A 1CVRA 3QKIA 5L3QB 2FFRA 1G59A 3GUHA 4P7JA 2C58A 4P80A 5FV4A 4P4UA 1RKXA 3RSJA 5FYBA 1DADA 3UH0A 5JNSA 1P9OA 4I5DA 4LX8A 1N3LA 1U0TA 3KALA 3O83A 4O4JA 3CT4A 3PKIA 3ANMA 2CE7A 4A5OA 2ZAHA 3GJRA 4YM1A 4HMZA 3KYDB 4QNMA 4UNPA 1S1AA 2W2OA 1INLA 1E2LA 2VYVD 1QJ4A 1H9CA 4FXGB 2AX3A 3COWA 2BGKA 5JOXA 3J26N 1LGNA 3G88A 1KJQA 2GPAA 3E3LA 1XLVA 3O0TA 5JZVA 5CHEA 3UVEA 3RK1A 4MB6A 3ND9A 1FUEA 3RNLA 3COYA 4ISRA 1UBGA 4E51A 4YG3A 4Y20B 2ZSAA 4BFLA 4H2AA 4R31A 5FXZA 1SEFA 2ZBJA 3D4OA 1QCZA 2PBRA 4Q0MA 1DXYA 2NUTB 4YARA 5DNEA 3TYXA 4F45A 3ADOA 3RUHA 4B7EA 1UL1X 2P65A 1TNFA 3ZD6A 3PRYA 2CJWA 2M6RA 2C9YA 1OXCA 1G5QA 4Z8XA 4GX5A 5HV4A 1BJRE 1RUF2 2B46X 1H42A 3OCVA 1QDCA 1HFJA 1NNLA 3ZWWA 1GPWB 4PONA 5LWBA 1W1UA 1GZSA 1A78A 2NXJA 4FCAA 3EQ2A 4BUZA 3OOHA 3SH4A 3H1YA 2UY8A 4LE1A 1B2RA 2O52A 2OHIA 3QKRA 3M3HA 1DAKA 3STTA 3GJ8A 4PC2A 1K68A 4Q7JB 2WQ6A 4NMWA 1H6AA 4E3WA 5J2TA 2JLVA 3A6EA 1BRMA 1AB5A 1DBIA 4QX0A 3TZ6A 4CEYB 1E9RA 2WTNA 2VRCD 4NV3A 1H8TA 2E1RA 1N3OA 3COJA 2PSJA 4WK4B 2QN1A 3CF4A 1YO8A 4UU0A 2CMFA 2I22A 1ZR2A 3M2PA 1LCLA 2RCNA 3AP9A 2AGSA 1P0MA 1G8MA 3KPWA 1G8WA 3WRXC 1Z37A 2XV1A 3S99A 1XFAA 2P3JA 2X0RA 3U17A 3WP0A 2VQTA 3TEZA 3UWPA 4UTZA 3P20A 1A4RA 2CY6A 2B98A 4FFLA 1GG9A 1P3JA 3VO9A 3DYIA 4NBNA 3PT9A 1SFRA 1GU3A 3EGXB 5KHJA 2Y8KA 2YNMD 2WI8A 5L7WA 4TYMA 4HF7A 5F4BA 1LRHA 1FNSA 1ZCZA 1YBVA 5DM2A 3B69A 4FIZA 3ZS9A 4J16A 2RS31 1Q83A 1QVAA 5AFSA 1R7RA 1L5MA 1U3TA 1L8OA 4PSAA 4BMSA 1DS6A 5FYHA 4BP9A 3UWKA 4KQIA 3IN9A 2GJKA 4LPKA 2Y1EA 3WLJA 4XMIA 1I4EB 1U8UA 3ZXIA 4C03A 1BGVA 3ZX5A 2O8QA 2CZCA 1U99A 3C6BA 4Q26A 1XZJA 2V45A 1QJU3 1NSFA 3HR7A 3PJQA 4P02B 1YGYA 4MLCA 4TLAA 4K6KA 1ENZA 1DTSA 3RBXA 4RA0A 3RIHA 3K1JA 1D7OA 3JZDA 2Z2KA 4X5OA 1DWPA 1JZ3A 2EG9A 3Q6MA 3M6MD 2QUOA 3E9MA 4M3CA 4ZU4A 2AI2A 2P5SA 4WXRA 5SY4A 1ORDA 1JVSA 1I7LA 1AZWA 4XZ3A 4H6WA 1RVF1 3WA6A 4K05A 2C2XA 4YAFA 1J20A 2YCLA 5K3DA 2XB9A 3GPIA 3WRXA 2JFUA 1RRPA 5JH7B 1O5UA 5FDFA 1SLBA 1U7XA 4N7BA 4LC1A 3HCWA 5DAVA 5P8WA 2V7GA 2YJ3A 2CMGA 5JSFA 3SNHA 1VJTA 3AVXA 3F1LA 2P9ZA 3DCJA 1B1AA 4TLBA 3UFXA 1WDTA 1ZRNA 4K81B 5LQMA 3G0OA 1BX1A 1U8TA 5L8VA 3NVMB 1UDWA 4KXFB 3F67A 1TQHA 3OCYA 2E31A 4HNHA 3VPXA 4MPPA 2FGKA 3C15C 2QVLA 1KQPA 2NUPA 1DCSA 3TW0A 2XQKA 2VHTA 4DXRA 2HUNA 2NWQA 2XJTA 3K6JA 3GJBA 3O4GA 2R32A 4FCCA 4Y67A 4YQYA 1C7FA 5E95A 4L11A 4G0YA 4JUIA 1OA0A 4R81A 2B5VA 2ZG6A 4ZP1A 2CD7A 2ZYTX 5B1HA 4FDTA 3HJAA 5FBHA 3MJRA 4CKYA 4RA6B 1ETHA 3MBOA 3GA5A 2LCFA 4C4RA 4ZDWA 1D09A 4A6SA 1PZGA 5JMWA 4IQ4A 1SUIA 2BUCA 4ZHNA 2HRZA 3BIOA 1HPLA 3VBRB 2GSWA 3HN3A 1DNPA 2GBPA 1I2MA 2YBDA 4K9OA 5GJCA 4KFSA 4HLQB 2W22A 1AA6A 4BZZA 4C6TA 1LRLA 3PR1A 5H83A 4YW5A 2FYTA 1AQLA 1VA5A 4FYXA 1ZCJA 3NNDA 4I1PA 3ZH9B 2O2HA 4YFWA 2H0RA 4N82A 2FF7A 1NVMB 2UWBA 5CNIA 1AYM1 1HL3A 2FPPA 4QTXA 1N1TA 1MJNA 4DPMA 4IMJB 1DU3D 1ZGZA 2EFGA 1O4VA 5G53C 6REQA 4ITRC 2WT9A 1DQ0A 1XLUA 3GLKA 2IPLA 5FZGA 4L72A 1GTZA 3FHCB 4N1AA 5EPEA 3CG0A 3T08A 5IJ0A 3GNLA 3BCHA 2W90A 7ADHA 2PSFA 1JQLB 5EVCA 1YQWA 5JMPA 2J0SA 3ZV4A 3NOQA 4PAQA 2OQ6A 2YIMA 4R1SA 5LMZA 5I4KA 3EASA 5B4XA 4Q4V3 2YXNA 1EJBA 1ND6A 3B1YA 1KGSA 1IHDA 1B74A 5JBNA 3LP5A 1OLUB 3UV3A 5D2AA 4YCCA 3UKDA 3HGQA 1YBAA 3HM9A 2C9DA 2CNWD 1YRZA 3QM1A 2YG0A 1PAUA 1L5ZA 5C0OE 1WHSA 4OAPA 1M8KA 2HJGA 5KJ6A 1Z74A 5CDUA 2CLFB 2ECQA 4BCBA 2KSQA 1BMDA 1P9RA 4URFA 2XKPA 4C0AC 1KTVA 3KUKA 3TMKA 1UXXX 1N0UA 1SLCA 3FC0A 3KL4A 2QWXA 3LQFA 2W93A 5JANA 3MW8A 3NUZA 1KAOA 5KVVA 4MWZA 4LYHA 4AI0A 1Z4MA 5FUXA 5A4MS 4NAHA 4Z2YA 4IEXA 2HX1A 1E5TA 4W4TA 3HL4A 1JRLA 5F35A 1SZJG 3L43A 4X1IA 2Y1GA 3OLVA 1R1DA 1UUFA 2FPGB 3K73O 4QJBA 3VNRA 3R3UA 4N8MA 4X66B 1O95D 1MB0A 2E87A 4GXRA 2FPIB 4G37A 3ELNA 5CA0F 3BZWA 3WO1A 2VUUA 1P81A 3IE0A 5ITZB 5CGQB 1OH6A 4CV2A 1WNFA 3NIFB 3M33A 1BXGA 2CL7X 2D5LA 5KYNA 3FB1A 4D42A 2GPTA 1FX1A 2G77B 1NQ5A 5TQ0B 2ZTUA 3VZOA 4OO3A 4MGZE 3INAA 4RVGA 4CEWA 4PYLA 2BEOA 4D43A 5FBLB 1BYIA 1YQUA 4UHJA 1NVGA 5FL7A 5F3EA 4EV0A 3BX1A 1ABBA 2YN2A 5HF5A 4XTCS 3G0BA 4KKXB 1ULFA 2VAPA 4WBNB 3R0RA 2IYXA 3FKSD 4IXTA 2E51A 1PR0A 1AYN1 4NAUA 2GVZC 4MS1B 1TVGA 4KUHA 4QTZA 4XJSA 1G9FA 1R1A3 2J1SA 2ACEA 2D1FA 1GZVA 3CFYA 3GMIA 2J1AA 5FO0A 2RAFA 4B32A 5AW2A 4CUGA 4YGCA 2VDPB 4MTCA 2OLJA 2C9CA 2NZ8A 4JZKA 4AVAA 1R3DA 2X9VA 3L7JA 1XEFA 3LZCA 1VJDA 1J2YA 4ARIA 3RQIA 1AY0A 1XRJA 1OAAA 4M0KA 3ZS8A 2X2PA 4YDHB 4U2CA 1TCUA 1SHKA 4RFSB 4QYIB 4DSNA 3H2IA 2P6HA 2O8VA 2Q2QA 1DC6A 4IWXA 4ZVLA 5FOJB 4Q4DA 1RBQA 1SVIA 3L7KA 3FUWA 3BPSA 5K4HA 4CXMA 3NVKI 1J8VA 2WAYA 3ANXA 4LNAA 5CNJA 4NLLA 3B6KA 3RUCA 3LC2O 2O4CA 4BQEA 2ZRKA 1AGYA 1GZ4A 2ZSDA 4Q15A 5C8CB 1KPIA 4URAA 4DREA 1ZJ5A 2R6QA 1H2AS 2GETA 5J4YA 3J8F2 2UAGA 1ZK2A 1W5FA 1YRYE 3ZQJA 4EKNB 3S4YA 3DAHA 2GARA 5DHSA 3BGOS 1VL5A 3LHFA 1NVEA 4FNOA 3LMKA 1P0IA 3WWZA 3B3GA 1W29A 3LUKA 1MA3A 3OQVA 1YR6A 4U7WA 2WYUA 3T4EA 1XNQB 5FY0A 1ADFA 3MQFA 1NCQA 2R7MA 4PF1A 5NULA 2C26A 1C7EA 1NVAA 3O75A 3WDSA 4D3WA 3DGEC 4HDMA 4ASLA 3BHNA 5FMCA 3K2EA 3DCNA 2DFBA 3D43A 2XKOA 3KQHA 2AEYA 3M1IA 2F4LA 5T5JA 4CF6A 3ENWA 5ELLA 1UK7A 3FE2A 1EP2B 1E3WB 3ZH2A 2CKDA 3BL6A 4AP6A 2APJA 2VPXA 4UI9L 1F2DA 3NNSA 2GZMA 1K89A 2HSJA 5JFTA 2E0IA 4CLOA 4KH1A 5DP2A 4DC0A 3PUXA 1S7CA 1RHI3 2VP2A 1RXGA 3O4RA 4TT8A 2X53S 4EMSA 4NATA 4FLEA 3KJFA 4D9KA 3H1TA 2RARA 3TPZA 2RV9A 2VBIA 5HK8A 2ZVQX 3VDDA 1BA3A 1SHJA 1DO0A 1A8IA 4UBHA 4UE3S 1YSCA 2AYHA 2XL7A 1K5MA 3SEZA 3HCOA 3FNBA 5A3LA 3FOFC 1XLWA 1DEAA 3THOA 2DV9A 4JB2A 2WO1A 5EE5B 3RVRA 2XMZA 5DHQA 4RDCA 3BMNA 1W4RA 4P00B 4ZVMA 2ZCJA 1F3LA 4C7XA 3ZE8A 1Y37A 3CISA 2J22A 2BTQB 1ZMTA 1O91A 3QHAA 1U12A 2IYWA 4G9GA 4YVWC 4ZHQF 2HDWA 3SIXA 1MC1A 2WAMA 1OKKD 4RY2A 4N03A 2YHBA 1WHTB 1WM1A 1B23P 4JXKA 2FPMA 2E4VA 1STMA 1SRQA 1BU5A 2A35A 5BNNC 4IG4A 2EKZA 4FOOA 4I1OA 2M32A 1CR1A 4LZWA 2EXHA 1YHFA 2X1VA 1P9WA 2OZJA 1PO22 3CNQS 3L0IB 4CDGA 1UCXA 4NCJA 1XWFA 1IBKB 3QFTA 1YRAA 2DX7A 3K4HA 1QRSA 3H5AA 4M1TA 3VBFC 3AFOA 2YIDA 3OC6A 4HQRA 2EJUA 3PFIA 2OCAA 5WRFA 1H0BA 1I51A 3D0RA 3IIKA 2NXWA 3AP6A 3AEYA 1XR3A 2UVQA 2NLRA 4E8CA 2DE0X 1UDRA 1MAHA 2JIJA 3LS2A 2FWRA 3GAFA 4I55B 1D7PM 2PZFA 1T5IA 3MMSA 4AVBA 4IDBA 2ZROA 4KB5A 4IMIB 4X7MA 4BX3A 4DMRA 1WKVA 2P1ZA 4ZCQA 2RD2A 2P5TB 2C1XA 4CIXA 4IM7A 5HKBA 1LV7A 2D6FA 4F92B 4YM3A 2W94A 2QUBA 3KP1A 4C4OA 3ESDA 3DBOB 2F1IA 1FNYA 2EAUA 4AI9A 2XUHA 3DTVB 1OVSA 5EJ4A 3A32A 2RGWA 2DBIA 4OHKA 4A9AA 1W0JD 4KFCA 4N43C 3ZCPA 1SXJC 2VATA 1OLOA 5I8PA 5TPWB 2GCPA 3ZU3A 1J0EA 1OLMA 3ZXKA 1X9PA 1E7MA 4MQLA 4FNMA 5CZKA 2CFRA 1SCUA 4Q3DA 3SCZA 5AUPB 3PJFA 5JTTA 2MSWA 3WK7A 2EAKA 1NP6A 5ENVA 3PX3A 1WLTA 3VDRA 2PS3A 2P3QA 4HDKB 2JDKA 2BGUA 2XZOA 5HK9A 1R6XA 3AL6A 4HNTA 1ZU4A 5ITZA 4GYWA 4XVCA 3I2GA 5HV0A 1WCIA 1XNGA 1YLLA 4M9UA 4ENUA 1PT8A 4FCVA 5BYBA 1F6BA 3W2FA 4G5SA 3K94A 3MMXA 1ZGJA 3SZLA 5JNRA 1DF0A 3ZDVA 1PHMA 4JRLA 1QIHA 1SXJD 1NUHA 4QPWA 3W2GA 2IP2A 4S2UA 1WLSA 1UXJA 4DMHA 2O3TA 3ZBUA 3SYTA 1SELA 4HAIA 4GH4C 5TMBA 1KDKA 2NN3C 3HCNA 1O0CA 3LSTA 4LQCA 2VPYA 2CXHA 5I7HA 5IXSA 4OHVA 4UHDA 2DKFA 2RH9B 5TVKA 1KAMA 1CY7A 3VR1A 5HA5A 2YR0A 4PYQA 4B6FA 3HJNA 1G8SA 3Q7EA 4DUGD 2HEGA 1DX4A 2J5RA 3ZQ6A 4K46A 3DE7X 4EEKA 2FP4A 3B6MA 2C95A 2PRKA 5B3LA 3FW1A 2XB6C 2OD7A 4CR8A 4E4HA 4HP8A 5T6BA 3BIJA 1IXKA 1LJLA 4Y1RB 4RMHA 2F3PA 1I1QB 1Y5NA 4BNYA 3BEOA 4ALIA 4MVWA 4QYMA 2SKCA 4RFSA 3TRKA 3KV5A 4PI2A 3D9QX 3LPGA 4ZI7A 3VN4A 3MYRA 1U5AA 5JOQA 3QHQA 3K4DA 5HP4A 4G67A 4EG1A 2XVZA 3Q72A 2HK9A 2EU8A 1ZUNB 2QN2A 1SQGA 3AJDA 3LDRA 3ZYFA 5D6OA 5DM60 1H5UA 3I6BA 2IV7A 5CAEB 2IHZA 1T2DA 1H4QA 5F23A 5AVTA 5K9YA 1SK9A 5EHDA 2D6OX 2GFHA 4GL4A 3B20A 4LYYA 4WLUA 2P6MA 3TLCA 3KB6A 1CB7A 2TMDA 2HRRA 4AZSA 3ZWPA 1GQHA 4RV5A 1BMFD 3BWXA 4XIYA 3UNXA 4WRRA 4ALJA 5EESA 1QKJA 1NKSA 4ZS2A 3B7MA 3MLAA 1MS5A 5A04A 5KWEA 1HIXA 4EPRA 2EGHA 4MVJF 3L6BA 4EJRA 2FD8A 1MJHA 2G1MA 4N47A 3EX7C 3TPCA 2Y34A 2R0HA 4HUTA 2VPWA 2PTGA 3HBFA 2WWXA 5JAOA 4UQOA 4JLJA 1CUAA 4H7KA 2FWNA 1A9SA 3CV3A 5MFPA 3VSBA 4RPJA 4JASB 4BEWA 2J5QA 5EKXA 1YA8A 4XUTA 2E89A 2J3MA 1K6IA 1H69A 4S2FA 3L93A 2BISA 3OM0A 1D1PA 2YFUA 1D9XA 4MINA 1WSDA 1JU3A 2BFDA 2OZ6A 2IXBA 5A1JA 4NU6A 3IEIA 4ZZIA 4R9BA 2Q0AA 5BSWA 2BM0A 4CU6A 1XCOA 1V70A 4NDZA 5C3QA 1QYVA 3ORHA 3ELYA 2QBXA 1BMV2 1DQ6A 4ENVA 3WGOA 5D8DA 3DFZA 4UQPA 1C8NA 4QX1A 2GKGA 3RBVA 1PDVA 4KE8A 4LZZA 4KPGA 3PNLA 4G1FA 4LJ5A 6CHYA 4J29A 3RVBA 4UEQA 1A7AA 1IHXA 2X1HA 4HGYA 5EJ6A 4Z5XA 4M8SA 4JTOA 1NLZA 4K9KA 3DH0A 2K7FA 5B4UA 5CLIA 3N0TA 2IF0A 2I62A 2W8ZA 1D03A 5DQ0A 1COZA 3EFBA 1JXMA 2ZT5A 3DXFA 3MZHA 5C1IA 3REQB 4L9AA 1HI9A 1OTHA 1R0BA 4D3ZA 1T6BY 3AYZB 1A3KA 2QMEA 5FBWB 3HWX1 1E99A 4CCOA 1OHHA 4BL5A 4I1IA 2PUFA 4RTLA 1Y3BE 4RCVA 3TLXA 4WI1A 2C8VA 2EC5A 4LGVA 4RTKA 2ZRQA 3NYRA 3E3MA 3PGJA 4LJYA 1YRBA 4MW5A 4DNYA 13PKA 3BGWA 4KV9A 1A9TA 1PK7A 1SC1A 3JD72 3GLUA 1P61B 2A5LA 2FPOA 4HVOA 3OHSX 1TLLA 1QOSA 2OAEA 4F0JA 4B7XA 1ULAA 1PL7A 1FOD3 5CDFE 3KYIB 4OGWA 3DD5A 3AYAA 4H7HA 1TI7A 1Z5GA 1GAEO 5LBFA 2PRZA 2TMGA 4QUBA 4YWJA 3DO5A 1DCFA 2QUZA 1LOFA 3BMXA 2VCEA 5SV8A 3HNYM 5FI0B 2Q29A 3TUZC 2GPNA 1HRKA 2NMNA 3EJ6A 3THWA 3KXLA 2L82A 2UUCB 4F86A 2EATA 1DGRN 4TN7A 4RE5A 5J2TB 1HC7A 3NW4A 3G79A 2IXEA 2ZTNA 5K0TA 1OD3A 3KX2A 1JHQA 1CWUA 4YCSA 3OZIA 2A14A 4DKJA 3AY6A 2XBO2 4RABA 2GESA 1AV7A 4BKMA 3S57A 1J7KA 1VBB1 3FI0A 3EHEA 4AGRA 1DEKA 3G1TA 1TU0A 5CBKA 1LPOA 1EZ1A 3O1IC 3FPFA 5A6SB 1H8VA 5EFZA 1CE8B 4IX1A 2QFEA 2H17A 1QO0D 1SCUB 2N1BA 3IDSA 5JDCA 2CAUA 3UL2A 2ZVDA 3CUYA 4KQ6A 1W6MA 2Z8YM 3ROZA 2OW4A 3TRSB 3WHIA 1WCUA 4DV7B 4O08A 2V9CA 3VKLA 5KX5B 2OB1A 1M34B 1QQ5A 3H6KA 3D0SA 1GKUB 3FYTA 1QP7A 4F2HA 4TQGA 4FB5A 3E7WA 2ZYRA 4J16C 3QOWA 1TZOA 5F7UA 1VG1A 5C9ZA 2I4NA 2WIKA 2RB5A 1D2AA 1P3DA 4FSHA 1WXGA 3H5NA 3JASA 4PIZA 5GVRA 5LNK6 5IARA 1L1FA 4Y2RA 4ZYWA 3CINA 1AHSA 3VTAA 4UW3A 3VR6A 3EIWA 2J7KA 1CEQA 3HMKA 3R6GA 1K0UA 2H0VA 1RXFA 4IETA 3KQYA 1UJ5A 5GM0A 2MEV2 1SURA 2IPMA 3VGJA 1TYAE 4RA9B 2BIFA 2OY0A 3I9V6 1ASJ2 4E4SA 4X95A 421PA 4EOGA 1LQ2A 4RD3A 1I13A 2K87A 1OQ1A 3HG7A 2QU8A 1BE0A 4O2LA 1CRZA 2B8JA 1KDPA 1Y34E 1AG9A 1T29A 4EITA 5IT0A 2WIBA 4C14A 3QVKA 1B26A 4NNOA 3ZTWA 1MS9A 3ESZA 4XFJA 4IW3A 3AETA 2WD7A 3F71A 4NP6A 3A9RA 3F2IA 4BTLA 3B6JA 3O1MA 1WLYA 2WHQA 3HYRA 4EB8A 1YT5A 1SG9A 5FOBB 2VSNA 3KLSA 2QBYB 1OPOA 2C1EA 2A1XA 1DXHA 5TPZA 1I6KA 3ENZA 3VHXB 4J6FA 4LN1A 4A0HA 2BLNA 2E85A 2EBHX 1K1EA 2IC1A 1EDBA 1PJ8A 1Z8NA 2V5AA 2V3CC 2KR2A 4NWVA 1MG5A 3H9GA 1LGBA 3HCCA 1JILA 4COUA 3EBPA 4RK7A 5BN3A 4JXXA 5CFRA 2DFCA 4O2BB 4BVBA 3UPDA 4NONA 1KZ1A 1SFPA 4TOIA 4IQFA 3HS3A 5ESXA 3LB9A 4A41A 3HK2A 3GBFA 2C2YA 2VXBA 2BI7A 2Y26A 4L7VA 5IH7A 1T8TA 3GFTA 4CV1A 1ZRFA 3JZVA 4D6XA 5LB6A 5FZ7A 4OREX 2X05A 4JVOA 1UJNA 4JXJA 2PJUA 2BE7A 2WWFA 5HX7A 4XPIA 4L02A 3W6UA 4BCDA 3UXMA 1L7XA 1TM1E 3PNKA 4HDNA 3W7VA 4XBQA 3ZMOA 1WWKA 1XZ8A 4LK2A 3G2QA 1ZM2A 3JWPA 3ZFFA 1P5HA 1FI2A 1Z5UA 4FX5A 4C87A 1Q7TA 4S1TA 3NT5A 4ZEOA 1IHYA 1PR3A 2GVDC 3JWIA 4AOCA 1AM4D 5EXEA 4CP2A 2PX5A 2Q3FA 1TUBB 4DO0A 2HR1A 4ODIA 1LW6E 1B43A 2WSLA 6REQB 2V7XA 4RLSA 1CDOA 1GFZA 1N33B 4Z2AA 5KIAA 4Y1GA 4MQFA 3VBUA 3HSSA 3RTCA 5FX2A 1GD1O 3QKUA 4DPNA 9MHTA 2W4IA 2QRPA 4D46A 5DMXA 3A4IA 3VHRA 1DXOA 4Z9FA 2QJFA 1H4VB 4KQ7A 4ZDKA 3SWWA 4M6WB 1Z2EA 1LLDA 2GN3A 1NW4A 1U9ZA 2J30A 4DBVO 4OP2A 5ABJA 4RPLA 2P9EA 2R3SA 2G5PA 2WT4A 1KSFX 3G0CA 2QVBA 3X1XA 2A30A 4IDNA 3VBFB 4EWAA 3O8CA 1U0HC 2LW8A 4WADA 2WNEA 3N8GA 4E4DX 1KKUA 2YOFA 3BFVA 1FTYA 3CJQA 2IX3A 2E32A 3AZWA 2BEVA 2ZRMA 5LSAA 3FOZA 2VTVA 2PHZA 4Z3OA 3VYWA 2YWGA 1MQ9A 2CXXA 1CLEA 4AG6A 1DLLA 1Q74A 2RGNC 4JP8A 2GEKA 3B6EA 2QJRA 4HMOA 3FDFA 2BELA 5D3KA 5CG9A 3FF4A 4QDUA 1HLCA 3F5SA 1ISHA 4KBZA 1GYPA 3OEWA 2OORA 1FSFA 1HRDA 3T1NA 1YC2A 5LP6B 3R3JA 3VYSB 1G64A 4LVOA 4FUQA 1OH4A 2VQ0A 4NN0A 4Q4Y1 4YYOA 1A9PA 4QKDA 1MZFA 2QPTA 5GQSA 4CLRB 5C8CC 4EKGA 4XJ9A 2Z8YA 3EZFA 4PZEA 4KXQA 2RK3A 3ZDRA 3QENA 1SU8A 4N4AA 3IPRA 3A6ZA 3JY6A 1G1AA 1W9FA 3O82A 3SNKA 5JFGA 1RQLA 2J7PA 2P30A 3OCXA 3H2BA 3T6KA 5D85A 4XF0A 1FPN2 3FMOB 4LUKA 2H00A 3SFVA 4M86A 2PRSA 1PS9A 3DEIA 3HEBA 1NUPA 3E8XA 3PD0A 4G5QA 2W0XA 5FUPA 4NMXB 4WCFC 1ISGA 1UBLS 2QY9A 4OXKA 3BMCB 2Z2IA 5EJ2A 5BQOA 3QFRA 4N9QA 2C2MA 3WP5A 3VZNA 2CYCA 3RYRA 3HJBA 3KJIA 3WLEA 1W6MB 3RGWS 2G07A 5TEVA 2PRJA 4UFJA 1BTOA 3HVKA 1QAQA 3AUFA 1IJKA 5C8VA 2JVKA 3NXSA 3WWEA 3EBOA 2HBYA 1XHLA 4B3XA 3TKYA 4NQZA 2ZABA 4XM0A 2D5IA 3F6EX 4S24A 1G8KA 5IUJC 2YY7A 2CDPA 3MI8A 1FXWF 5FP0A 4JUCA 3KD4A 2XECA 3TCNA 1KOJA 3DHEA 3HOBA 3CH4B 4E14A 1ZW6A 3KSCA 1LA2A 5BSMA 4MA4A 2NPIA 5J98B 4QRHA 3GJAA 5AP9A 4KYIB 4TV9B 2ISQA 2XJ9A 4I6JA 3M4XA 4LBNA 4MUYA 3WRWA 1T9HA 1NA1A 1A97A 3B00A 1ZGAA 4BQIA 1IBMB 1IM5A 3R9KA 4GQBA 1X92A 4MQ5A 3LE8A 1BVRA 1N6OA 1Y1TA 3K77A 3AM3A 3AZVA 1QFSA 1U28A 2QE3A 1XKTA 2J9FA 3R1IA 3CZQA 1WZXA 3K9WA 2ZB7A 1QWOA 4QEDA 3TEWA 1LY1A 5MHTA 1JH5A 3OI7A 1SMVA 2ZAMA 3C39A 2WJWA 2F8TA 3HCEA 4HWRA 4ZAZA 4Z99A 4LORA 1K45A 2A9FA 4M38A 2KPOA 4NPHA 3WZ2A 1SDWA 3T9FA 3RIGA 4CFZA 5GZ3A 1ZH2A 3DN7A 1G0NA 2P3KA 2I71A 2ZHMA 1SHUX 3QVWA 2A6VA 2QBYA 2GCNA 2OAP1 4YASA 5T4HA 1KH2A 2V6GA 1COWA 2IITA 1WB6A 2JRCA 4B80A 3BE5A 1JQ3A 4KO8A 2VE1A 1QM5A 4R8LA 5CTAA 4UOJA 2FW0A 1S96A 1YL6A 5C53B 5ILGA 4LDRA 3CJIC 2JGLA 3H5RA 4G1VA 3CQ9A 1ULBA 2IUSA 2HK8A 3HRHA 3L8HA 2NQYA 3R7LA 2F9FA 1KNQA 3E0XA 3H16A 3FTPA 2IU4A 2YQ4A 5JVDF 2VYVA 1DYOA 2Q30A 2EF0A 2CYFA 5T4BA 4BLOA 1JTVA 1X7ZB 1ZVKA 2Z56A 5CCEA 3MB5A 4YXWD 3EXEB 3LPAA 1LODA 1F8YA 5FTJA 3Q11A 1ZS9A 4IDAA 1U2DA 1TD9A 3JD4A 4MRVA 4FE3A 1C3JA 3UAYA 1OWOA 3BXHA 3RVSA 2ZBPA 1XEXA 1VPEA 2OR3A 1NE2A 1DAHA 1IHMA 4J4TA 3NKTA 4EFKA 4FHFA 4C4PA 2QNIA 3A2LA 2JIRA 3RYHB 1UXZA 3B78A 3ECAA 1Q21A 4W5WA 4O02B 2AKYA 3L9JT 1SXJB 1BCXA 3EPJA 1LEHA 2RHLA 3EZGA 1TVMA 4F7ZA 3MS2A 1QRTA 1ZMBA 4R0VA 3PNOA 2AZTA 2VXJA 1XQWA 3W2TA 4Q47A 4U39A 1H2ZA 2X8KA 2Z4SA 1H2KA 4AMBA 3FVQA 2B4KA 1BZYA 4LQDA 1VIAA 3VV1A 3GGGA 4A44A 5B53A 4NKRA 4P4SA 1UWLA 3GH1A 4MW7A 1L4MA 3R7AA 4MQUA 4W1SA 4YUVA 5LKRA 1JDSA 3NJYA 3P9KA 1JR4A 4J03A 3W6ZA 2FZ5A 3VBSA 5BWBA 1XTIA 1J2UA 3NBKA 4MYCA 2VHUA 2ZX4A 3V3TA 4L1KA 2OCBA 4XJVA 3RI3A 4MLOA 3VBOC 5BRAA 4XXPA 3LDAA 1F15A 1OV6A 1QGAA 4XUEA 5BNPB 4OSEA 2Z9CA 3ZLIA 2JFOA 1XI2A 3P2JA 4L2IA 1U0OC 5J2UA 4LHYA 3IQZA 5GJVC 1BYHA 5AI9A 3CVOA 4RHYA 5KHAA 4S1OA 4FYIA 3E1KA 1N9KA 1HSOA 4ZO6A 1ISMA 4Q1CA 4C04A 5EUMA 2O5VA 2VK2A 4O9EA 4JOQA 4F8AA 5JD5A 3TM4A 3CRNA 3ZGNA 1QRUA 1Y9EA 3Q8EA 1NUKA 4I1YA 2DBVO 1U6IA 2A4MA 4NZYA 2GYWA 1RTVA 2AENA 4WX2B 4QPIB 1O5TA 2YXLA 1GCUA 3ZHZA 4UTNA 3VD9A 5KYUA 2FN3A 5AJWA 2CMDA 4EYEA 3Q7QA 2ZUTA 3B1VA 5JR7B 5HJEA 4X20B 4PY2A 3ZCQA 4EG4A 4LOIA 1QJCA 3R6WA 4HNVA 4ZEXA 1PQWA 4QU8A 1P91A 3PHHA 2C96A 1KY5A 5LA2A 4IZOA 3E61A 5FPVA 1WMFA 1EV12 5FDBA 2BGNA 1CONA 1EG7A 4NMIA 3JUUA 3HQXA 2QSUA 5HEKA 1SBZA 3NDRA 7ABPA 3TOVA 4TTJA 1KZYC 5TJ9A 4IEVA 4WLVA 4YGBA 3E8MA 2PFKA 2VBFA 3ZCXA 3KXKA 3UTCA 1K5HA 3LHDA 4IICA 1H8ED 4J0HA 5L95A 3WG1A 1A4IA 2BSAA 3W4IA 1GNLA 4Q4X2 3KL2A 5FZKA 5AKXA 4U63A 3UJOA 2RHWA 2NU9B 1NF3A 4MS3A 4L57A 1VC2A 1Z8DA 3RRZA 5BSKA 1N8SA 2GN1A 4RPGA 4WK6A 2AH5A 3EJWA 3UGGA 1GFSA 3A70A 5TDHA 3IJEB 3G85A 3IDCB 1KJJA 5HE9A 4BBJA 1T4CA 1OXXK 1XAJA 1LPNA 4P93A 1P8JA 4K1LA 3CR3C 4Q3LA 4DM7A 1Y3AA 2YXBA 521PA 4AECA 1WP9A 4L6IA 1U2RA 3T3IA 2YZGA 4E5KA 4META 3F5FA 2YN4A 4NMLA 3FDJA 1CQXA 4JP3A 2HCBA 2V5UA 5EWLA 4C4AA 4TXHA 3IRUA 2UDPA 4CDRA 1N7GA 4D1YA 1YFUA 1U98A 2WQ7A 1I6WA 3BDAA 4I3FA 4B83A 4OTZA 4Z9XA 3AJEA 1ANKA 1ZN9A 4L8GA 1D2GA 3B8HA 2VR4A 4A73A 2ZRBA 4OMUA 1HDIA 2EHDA 1H9PA 5FFNA 1Q7EA 3I5UA 5F5NA 5F1YA 5IYZB 4BO0A 4KJZA 3I9JA 3E6AA 5FPSA 4DZGA 3BMQB 3R20A 3TJZA 4HEA1 2HN9A 4D02A 3C41J 2F43A 5EIEA 3K9HA 4Y2QA 4R05A 4C0WA 4CM9A 2YDYA 3CC8A 2D1TA 4UFLA 1ZG3A 3JYPA 3FNIA 2FPWA 4MRSA 3MCAA 1N7IA 3LJKA 1F3OA 3WNLA 3CUKA 1XMIA 5LJLA 2HI0A 1W2WB 3ZC3A 5EMHA 1VL6A 3WUDA 3TIXB 1SKBA 3NWEA 5L45A 4KR3A 2FRVA 3L77A 4YJGB 1F31A 1H6BA 4YLZA 3O5SA 1AGPA 3QE9Y 4JGYA 2OUHA 4BHTA 1XNRB 1UDBA 3I3BA 3OBIA 2DR3A 2KBFA 3ZN5A 3RS9A 1A9ZA 3AEKA 5T5PA 3L1HA 5FAXA 1EFCA 2HCJB 1N25A 5BN5A 1P4JA 1GLVA 3K16A 1E69A 3HA5A 4XR4A 5KVCA 4IHQA 5BO5A 4DIDA 1XMSA 3KFLA 3ATGA 3MLJA 4MRRA 1YOVB 4BHPA 3VZLA 2D43A 1E1CB 3VI4B 3OZSA 4Y2UA 1LBSA 2ZOSA 4GLBA 5EPAA 4DNFA 5DGTA 4LZNA 4RHV1 2LGJA 2WOJA 2JATA 1VR3A 3L6UA 2FAXA 2NGRA 4ZU3A 2B8TA 1LBHA 2X77A 4V0SA 1DCTA 4RGAA 5KNDD 3GG2A 1UY0A 3FMPB 3TNJA 4MZUA 3T0BA 2VG8A 3KWMA 1W2TA 3RI8A 4YP9A 2VYND 2FTKE 5DAPA 4D9HA 2PX8A 5EFOA 3FOCA 2ZS7A 5E6RA 1H2LA 4ZK2A 2IZWA 1ZN7A 1C8M1 3Q8LA 5JHGB 1UKRA 3JW8A 4LE3A 2OYSA 3I45A 1XZNA 2BHSA 1O3SA 5LQDA 4GMKA 1FRFS 4RMGA 1Y6RA 2G4CA 4EI2A 2Y9MB 3AEXA 4S3MA 1V0AA 1YF3A 3O7MA 2R5NA 3EH2A 5REQA 1WKYA 4D8XA 5CG8A 4N7MA 4O4IB 4B7KA 1T1GA 1WF6A 3ZXFA 1REQB 3GRFA 1GKYA 4NXMB 1SBFA 3L8MA 4JDOA 1R8YA 1XMVA 4ZIRB 1QAMA 2JAQA 2R6AA 2RHOA 1N34B 1GZHB 3WWCA 3T4UA 2ZW9A 1AYN3 3TN92 1G3UA 1MW9X 4ITUA 2DJ5A 5CNKA 2GZ3A 1EUTA 4IZIA 3V7WA 2BTOA 4OAOA 4RY9A 4ERXA 1F8XA 5C5UA 1NUAA 4EL5A 1NXPA 5T5QA 1UM8A 4YO7A 2WNVA 4UDXX 2JFWA 2AEZA 1E9DA 2VYFA 3HA7A 4WINA 2MTBA 3B7PA 1TRKA 4JENA 1KI7A 1NM5A 4A6OA 4RVNA 4OULA 2IFWA 4KXVA 3MWDA 1SWVA 2IYVA 1U3FA 4FTWA 4JUBA 4D79A 2ISCA 1QJU2 1SQ5A 1V3QE 2Q1WA 3GD7A 1R083 4OMDA 1C81A 2CGOA 2OSBA 3IR6A 3SEQA 4REQB 2G19A 1V47A 2RR12 4NARA 3WLMA 1MEC3 2FUCA 3KPVA 4LSZA 4BO6A 1GMMA 4GVPA 4X84A 3K96A 4MLPA 3ZKAA 3F2ZA 4V1CB 4QYSA 4NK5A 4M87A 1LDMA 4B4WA 1M2VB 8ADHA 2LS6A 4E5DA 3L0DA 1ODJA 1I3NA 4E33A 3U5TA 1K8XB 5F2WA 2W4MA 2Y99A 4IDHA 5CB8A 1Z28A 4FGUA 3CF0A 3EEQA 1CS4C 4AZ0A 1T9CA 3HXOA 4GPAA 5FPHA 3PLAE 2JLSA 3E81A 3P94A 1ZD9A 2CNKA 2AR0A 2D1RA 3ZFEA 2C3YA 1CD3G 2VNKA 1L5WA 4J4HA 3FWPA 2IA5A 5COQA 2QG9A 5DBOA 2Q9UA 4XCXA 1Z2AA 4BLJA 3MWYW 3TLJA 1KJNA 5H4GA 1PQUA 3HJTA 4MS3B 2H4YA 1MB2A 4GVLA 2CFIA 4R4JA 1I7SB 1AQUA 4YJ3B 2PCJA 2QX4A 3Q3VA 1RKVA 2YW9A 1C7RA 4JEUA 4DY6A 1JWAB 1XZDA 1TTQB 4QXKA 1V45E 1YIDA 1UMBA 5A7NA 2ZXEA 5IYZF 1HJGA 1E8MA 1FP2A 3NH9A 4M53A 1ZMXA 4GM1A 1G60A 4OYUA 2UU8A 1WE2A 1PJSA 3DUFB 2FPLA 4NIAA 4PPFA 2R16A 4YHBA 1XE7A 3AVVA 1J0AA 2Q7OE 2D1QA 4U2EA 3ZNOA 3ZJYA 2YRXA 3LOQA 2RGEA 2IFTA 1JYNA 4MICA 2O23A 3P0HA 2JJ2A 1G5FA 2PZJA 3KVYA 3M4FA 1D4FA 3DHVA 3WV6A 4N54A 1G5IA 1V8DA 5GOTA 2WY2D 1NQDA 1H5NA 4YVWB 5TMEA 3ZMNA 4HKLA 3NRCA 3A1VA 5FZ0A 1N1VA 4HB2A 3AHCA 4WW0A 1O9HA 1ZEMA 3CX8A 1YUNA 1IEXA 2CHEA 2GP5A 4PLGA 4ZT4A 3BD7A 1UOBA 1C3OB 5C7YA 1E1NA 5JJBA 2X2OA 4NYMR 1FJXA 2G82A 1KPHA 4WM7A 3AOEA 2XCQA 3I6YA 4TSRA 2NTEA 2WZEA 4NFYA 2QJWA 4QFBA 2X7HA 2ZQZA 4BNJA 3JQWA 4ZC8A 1W5TA 3AIOA 4TV8A 4Q7MB 3IELA 4X65B 5F7XA 2RKBA 3Q5DA 1N2IA 1WUJS 3TOXA 4ET7A 2VI5A 2DDUA 4NABA 2J9ZB 5LASA 1PL6A 2ZU0C 4XI9A 1EGHA 3S44A 1K8YB 4EZEA 3M1HA 1MGPA 1L7OA 5JYCA 3AIMA 1S9DA 3PBKA 3H1FA 1T36A 3WF4A 2D6LX 2D6MA 2VZSA 4DNXA 2AC7A 2JI7A 4OFBA 3WZ1A 4DLUA 4MMZB 5A71A 3OFKA 3HIFA 1KD7A 1CAVB 1ONAA 1E66A 3ND5A 5DCUA 3KYDA 1BRTA 3HB7A 1X7HA 5IAXA 4HH3C 1DAOA 2AMLA 4UU8A 3UKTA 4DSZA 4HFMA 1H4HA 1XZCA 2Q0SA 3J7AC 3VZPA 3PF9A 5BUSA 1QTIA 3WQ1A 2P41A 1JEAA 1QO7A 3GZNA 4O5OA 2VMFA 3JSAA 2VUIB 4I9FA 1U5IA 1Y9DA 3WWDA 1XZMA 1BDMA 2G36A 2VUCA 3E9RA 4GE3A 4K9RA 4HFNA 4LTMA 4GPZA 4AW9A 2P5UA 1SHTX 2V6BA 3T4HB 3VU9B 2PO5A 3AGPA 5HXVA 4RH0A 2IODA 3D2CA 4OMFG 3C7KA 4X94A 2FN9A 3P3PA 2UXBB 4MLDA 2BUAA 5JPNB 2WFF3 2B30A 4I5EA 1BXRB 5EJZB 1VB2A 3AFIA 4QGBA 3LEIA 4R5HA 3GIWA 3GAAA 3AM2A 3U80A 2YUTA 3H99A 2WM3A 1QHFA 1X7WA 3M3PA 3SE7A 1GZWA 2EDCA 4BAZA 5DRYA 4M6WA 5AESA 5FT9A 4LZJA 4LMBA 4FFBA 5IKEA 4B4OA 4HDRA 1TNDA 1PGL1 5FR3A 1BWQA 3BD9A 4B71A 2WSYB 5D7BA 4HJXA 3BIWA 1CJBA 4Q9JA 1YA4A 1LEDA 4QQ8A 3USUA 3GEPA 4TKZA 5KQSA 3ODPA 1NLSA 2KLHA 3NLLA 3RSLA 4PWZA 3R4SA 2B4RO 3MHPA 1BVHA 2OCXA 3HADA 1IQ0A 4MDEA 5FYYA 1YJLA 1R1ZA 1MABA 3ZDSA 2JK0A 3ICCA 3R3WA 2Z6QA 1CRPA 4TTVA 4QECA 1L5QA 3EBRA 3PQ4A 1E7WA 2RC6A 3D3WB 2NTNA 2YJ5A 2QG4A 1NY5A 3WG4A 4BLWA 4D4MA 5H5JA 5P21A 3IB3A 5K4GA 4CP1A 1DJQA 4W6QA 3TLAA 1KAHA 2VJNA 4YNIA 4D3XA 2XX3A 2QE7A 1NONA 1OFVA 1FK8A 4DR7B 1SZDA 2VDOB 4GNRA 3EK2A 1Q1AA 2RS52 3H4IA 5MN4A 2I6XA 5G2OA 1C0EA 1FP4B 4FP3A 2WU4A 2I4IA 1QQP1 1WGPA 1U7UA 4NIHA 2HNBA 1HXHA 4WKGA 1T6XA 5JQWA 5EEGA 1QP0A 5AM1A 2VT2A 5AOVA 2VO1A 1TTPB 4IFEA 4GICA 4E6EA 2H9IA 3H4MA 5FZ9A 2BSQA 4IV1B 3CEAA 4Q4AA 3ORSA 2YXDA 3I9KA 2IELA 4PZYA 1MHPA 4R3WA 4HNAA 1DAPA 4J4BA 5KCZA 2C24A 5EIHA 1IJFA 3LCVB 3EIEA 3UB4A 2HNKA 4LDAA 2R5FA 1YA6A 1GANA 2NP0A 1LI5A 3GLGA 1OY1A 4O59O 3OOXA 4EUFA 3OH8A 1GZ9A 2H65A 4W5JA 3RJ5A 4MS4A 5B1SA 2ZE6A 1Q7GA 2O0HA 4IGIA 3EEBA 4DNQA 5T41A 2AKEA 2L42A 2YHUA 1OU0A 1RQ7A 4B84A 4FYPA 4RL7A 2P1DA 3E6BA 5DT2A 3I3OA 4AVTA 1IOWA 5IJ9B 1C3XA 2GHTA 1E6MA 3PPYA 2DAPA 3AEQB 4E4YA 1G6KA 5AJYA 3EF1A 3W90A 2JLAA 2VF8A 4PDWC 4ME6A 2BBVA 1ISPA 4HC4A 2OWEA 1YFXA 3NC0C 4A8PA 2R84A 2HWF1 2C94A 1M54A 2F2TA 5ER9A 4P9LA 1QKQA 2FQWA 5A7GA 4HWKA 3K0FB 1JFSA 2QPLA 4TS9A 3QELA 5TT0A 2XBLA 2WF7A 5J47A 1HQLA 4M22A 5CH8A 1KE2A 4X8MA 1OXVA 1PFYA 4A1OA 3A04A 3NYIA 1B93A 3QVSA 4JS0A 3GQBB 4D3DA 2SICE 2IS4A 3OT4A 3D3AA 2W39A 4EEXA 4F1KA 5C71A 1D0GA 2J9FB 1MRZA 2OXRA 1Q0LA 4R8HA 4BISA 3JATB 4LRUA 3PD7A 2Y6JA 3HR8A 3K75B 3X29B 2XWQA 3ZHYA 4FYHA 3EXG2 3D7SA 1IONA 3R0XA 1II0A 3LEKA 1MACA 4B43A 2O2XA 4V0NA 2HQOA 1ELOA 1KEEA 2GC0A 4IH4A 1QVZA 5I0SA 2IXGA 3NTVA 2HLDD 1EWQA 2ABWA 2HMWA 4CM6A 3ZJ4A 5LQRA 2BUKA 3LV8A 2JIZA 4MW1A 2D2VA 2IIPA 1W2AX 1JE1A 1Q7CA 4ES8A 3HCAA 3POSA 4AP9A 5AVUA 4A2CA 3EW7A 1GEEA 4IRXA 3ILXA 4G4IA 1CBUA 1HXS2 2PXJA 3UGJA 4KVZA 2XDAA 3AH8A 2KB0A 1JG1A 1EFPA 3DWEX 1Y9MA 3CN9A 3IUJA 4ZREA 1FFAA 4QT4A 4W5RA 2Y0DA 3VDAA 2X13A 2YXSA 3F6RA 3WT3A 4RSRA 1ULGA 3GMDA 4ONUA 4Q1EA 3EWIA 3ZIDA 1GGKA 1P1FA 4MNTA 1QH7A 1ZZ7A 4CUCA 2ISSD 2HV9A 3O9ZA 4PTLA 4D96A 3H1BA 2R043 4DUGA 1E79D 4FWIB 2FUNB 3TWOA 5T4FA 4WVMB 3AXDA 4RE6A 4YRGA 2G83A 3OPWA 5DAWA 3VL8A 3WWPA 4S1VA 3WMEA 4GLJA 3QVLA 2WWWA 2QRZA 3RYHA 2AOXA 1IKPA 1CXZA 5HGXA 2FZ2A 4II7A 1VBD2 1NXQA 3ON7A 4CYDA 1UBCA 3I76A 4FQZA 4UZFA 1SUAA 1VI6A 4OXXA 3QPUA 4N53A 4TMWA 4H3KB 2VZ8A 3KKKA 3M2TA 3CT6A 4HKWA 3ROUA 1YVUA 4O4JF 4HNUA 2FWIA 3FYCA 3DEZA 3WLUA 2QZ9A 4JCCA 1X6VA 1WW8A 3MMZA 2WYVA 1OFNA 4TS1A 3SGLA 4C9BA 4KIFA 2XQGA 1ZJWA 4P33A 3LOBA 2AI3A 1N1MA 4YAIA 3IUEA 1OGYA 3WXPA 4BAGA 5KQMA 1AHPA 3QLJA 1Z5VA 2BDRA 4BGVA 1P7CA 3KSAC 5IANA 4FAHA 1D6MA 1PEKE 3CKHA 3VL9A 4H35A 4JI6B 3VBOA 1THTA 1SA0B 3B9IA 1L5YA 3KJHA 3H2GA 4ZQHA 5FPYA 4PYNA 3LPCA 1U7PA 3LD8A 4Q8LA 1BW9A 5B4TA 2PGLA 3PU3A 4DSTA 2BZGA 4JGGA 4N9WA 3RS2A 4MGZR 2YVLA 3AZOA 3UAOA 4EBBA 2C6SA 1QIMA 2HMVA 2IHKA 1NP7A 3ABIA 5BNOA 1E2NA 4QL3A 1VJCA 4UVDA 2G9FA 2XB6A 5G0VA 4NPLA 1VYTA 1PIV2 1XA0A 4NPMA 5ALFA 4KN8A 1GR3A 3ACIA 2F8MA 2ZYVX 2NP7A 2W6IA 3I72A 4UUOA 2OCIA 1L3BA 3FPKA 2RG7A 3I1FA 2GF2A 1ULTA 2H92A 1H2XA 2MSEB 1QLWA 4X1KA 5KOJB 3AVTA 3CSUA 4GZ9A 1O7JA 4RTRA 2BWJA 2WPDA 4R71A 4H0CA 1MZ5A 3JVIA 1YI0A 3C3AA 4LRTB 2CLDX 1RWPA 3OCPA 4NJMB 4CEWB 2QE7D 4UTRA 4XIGS 4OX9B 4C1NA 4IZ6A 1ENXA 4CEJA 1KAGA 1JTEA 3LVFO 1CZSA 3HGMA 4NRDA 1Z0ZA 1FP7A 2A5FA 4GYKA 1YCIA 2I7DA 3WBKA 1HNXB 4HD8A 2HF8A 4PR0A 5EE1A 4KACA 1X1EA 3WDLA 4WJLA 2G40A 5CBPB 3DFUA 5D3ZA 4O1IA 2EHJA 1Q43A 2J41A 2ZIEA 1EE2A 3JARB 4YRCA 1USWA 2QTBA 3PJYA 1UXHA 1XLTC 1W88B 3IT1A 3LQQA 1D4AA 1D4ZA 2OXTA 2BFCA 2YVAA 2Y8EA 2O2IA 1E3IA 1E5XA 4K9QA 5FO9B 4U8GA 5LA6A 4FR0A 3D0OA 1L6IA 5A05A 1QJX3 4RN5A 5IJ9A 4IOKA 4EEZA 1Q0PA 4TVOA 4MYDA 3ZXDA 4TRRA 3DVAA 4Z4IA 1D3AA 3G59A 1FDOA 1SHWB 5JXIA 1XNAA 5E0OA 3OB8A 2Y6LA 4ZY9A 4FJ0A 2VP9A 3WK4A 3PK0A 1AKEA 3F98A 2WVAA 3V6LA 2NQ8A 4X1YA 1HV0A 4AB1A 1H1MA 1CVNA 3AETB 4IW3B 5HQ3A 3LOUA 3JD3A 3RTDA 3MINB 4ZQBA 1GGVA 3B38A 3GO4A 5CA1A 5HCAA 1THMA 1NJGA 5LZ7A 1ZK0A 3VZQA 5K05A 4PV7A 2UY9A 3V0BA 2GI4A 3PDIB 4AP5A 2P2SA 1UMCB 3DF9A 4RIIA 4BE7B 2PS0A 2PKWA 3ZE0B 2HA3A 5B30A 5JMTA 1E5HA 4ZVSA 3H5IA 2QKYA 1I2BA 1UK9A 3JATA 1Q3EA 1DRWA 1P6XA 3PIJA 3V32A 1HE5A 1S3IA 1SO8A 2HL6A 4EN0A 4P3KA 4NY1A 3FFZA 4TMKA 1ETUA 2NIPA 1PVVA 3TUJC 1WOMA 1BAPA 5CLLA 1WMDA 1KEEB 4WK0B 1WSWA 3ZDCA 4IEZA 2XTZA 1NG9A 2W91A 4ZI3A 2JX9A 5GIOE 4S2HA 4U0KA 3R7BA 4ND6A 3NOXA 3GI1A 5C8YB 4H1HA 3LLVA 5FY4A 4DCOA 3W9SA 2PLAA 1HXS3 4QG7A 3EUAA 1Q5OA 1PV2A 2MPFA 3QY9A 3WKDA 4AQSA 4MI9A 5DZEA 3EFOB 4CPBA 3DDOA 1QE5A 1QPGA 2UU9B 2R0FA 1M2EA 1E77A 1SXGA 3LL4A 9LDTA 5BV8A 1AQNA 3OTIA 1APBA 3UOWA 3ONFA 5E0KB 1I36A 3CLHA 1F4HA 5IVEA 3HBMA 3V64A 3UGQA 4B3NA 2YJTD 3DYVA 5FEMA 1W2NA 5CKNA 2CBZA 4BQOA 4EHJA 3WGMA 1Q14A 5IWAB 1KGYA 3OIFA 1NXD1 4CA9A 3M4YA 3W06A 3NJXA 5DISB 1RUJ1 5HCHA 3MFCA 1M1YA 5KAPA 2EJWA 2QIPA 2PMKA 3NHYA 1QYRA 4XKJA 4Q1RA 3KJZA 3QKWA 4X00A 4BBAA 4JB8A 1R0ZA 3L2HA 2PELA 1QQ7A 2QZZA 4COZA 3USCS 4O4HB 2GBFA 3ZCSA 3TRJA 1GEGA 4CDWA 4CMEC 5H0IA 4PHZA 3MICA 5KR7A 4JWTA 1JH8A 4HH0A 3LDUA 1MJ5A 5JRJA 4CSWA 1UYZA 3ZI0A 3T5PA 1D1SA 5K3EA 5T7BA 1XJAA 4WCFA 2NZVG 5HS4A 2Z5VA 2PKQO 3H8UA 1U8CB 2D4HA 3QA3E 4RVUA 4ZQEA 3MW3A 4JT8A 1ZA4A 3DMTC 4E08A 2BI4A 4BO9A 5IMSA 1TEZA 3USZA 3TIGA 4RHV3 2OHGA 3RSOA 4KLZA 1Y98A 3A0RB 1DGQA 3T1TA 2BE9A 3V34A 2MYNA 4QVIA 2NAFA 4LK7A 2VDVE 4XCBA 3AKDA 4Q4W2 2V97A 1T5DX 2PCLA 4CCCA 3F5MA 2PVSA 1YACA 2AR7A 1U2DC 4RK4A 1A5TA 5AI5A 5DYWA 4YRJA 3F0TA 1F2TA 3GC6A 1Y42X 1IUPA 3CL1A 4JMPA 1AKTA 4ZN6A 3ZGVA 3EG9B 4O29A 5JDBA 2W6JA 3MB8A 4LGMA 5K8TA 2PD6A 2CV2A 5DJ5A 2WINB 3GRVA 4MGEA 3BOSA 1RJDA 3PXCX 1EA5A 2C98A 4QYTA 3OCJA 3EYWA 2XWPA 4EYQA 2ZPXA 4WBNF 2XVXA 3JQBA 1PZXA 4HDAA 5A7OA 3KE9A 1O6CA 2GZ2A 3G9QA 1NXMA 1P5RA 4BB3A 1TNRA 1FF9A 5LBIA 3OFNA 5HBGA 4RCZA 3NBFA 4IIBA 3PVOA 2R6R1 1ZUIA 4TGLA 1J5EB 2P5BA 4H59A 4BNNA 3VSCA 1EEHA 5EMJA 2XYGA 1H66A 4EY5A 2VVTA 4MV0A 1X8XA 4KXMA 3V2GA 4X71A 1RBMA 4EPWA 4AFNA 4TTPA 3OTGA 1Q8SA 3PVSA 5AICA 2RONA 3E3OA 1C8KA 4BO1A 1HRV3 4QDRA 1R27A 3SHRA 3DBLA 3P0EA 4DRRA 1X80B 6LDHA 1NJ1A 1R5JA 4WEOA 4BIFA 4EQ6B 3PHCA 3GLSA 5I3ZA 1Y43B 5GPBA 4OM8A 4AG3A 4PCRA 1W06A 1F0KA 4CDNA 1P1RA 1AUVA 4IKEA 5JXWA 1JHRA 3GLVA 1JXOA 1XDWA 4DXSA 4Q12A 3R76A 1T8WA 1NZCA 2BJSA 3JQAB 1UKGA 3PEFA 3QJYA 5AK6A 1L4YA 4F60A 5IYYA 1ADJA 4L5CA 4ZOQI 1AR93 2AQHA 4EB3A 4H7EA 1TIPA 5EMMA 3D82A 1JE0A 4G89A 3C7OA 4EMTA 1EP1B 2FX3A 2VDQB 4KR7A 5CPBA 4RO0A 3UB2A 4GWIA 3MGUA 3AMHA 5FXXA 3DEYX 3VO1A 1IIBA 4JD5A 3AY0A 2XGMA 2X41A 4HLDA 4B1FA 4TZKA 5FOTA 4CJXA 1Z8HA 1E2UA 5JWPA 3HYTA 2QAIA 1X1DA 2JJ1A 5KSPA 2K9ZA 4X63A 2DCMA 2R6GA 4D4KA 2QGNA 3AM4A 1RUOA 2Y33A 4NHEA 1WZUA 3PYMA 3RFVA 1T3SA 3W7BA 1V25A 2IDMA 3TSWA 4R2LA 2O3QA 5CA1B 1O6BA 4MV1A 3Q8AA 3F8TA 1PJ3A 4FKMA 3UPTA 2FEWB 2QUJA 3FOAA 5JWRA 2HJRA 4LXQA 2VHJA 4PRZA 5EHNA 2ODTX 5DAXA 3S1AA 4XETA 3HTXA 3SH5A 2XSZD 3HFSA 5AI6A 4C1WA 4M7RA 1DAMA 1TMGE 1UQXA 3ZWBA 2A78A 2G04A 3S7EA 2HIHA 4G9EA 5HTOA 1QDUA 3M1AA 2PFSA 2CL2A 1SCIA 3M6LA 5IKMA 4EECA 3QHPA 3RAEC 3OLWA 4DJFC 4EHFA 1ZWKA 3EVNA 4F4UA 4CFSA 1V6JA 2PHUA 4BB9A 4MVJM 4B31A 4BX9A 4COVA 2RGAA 2VH9A 5CH3A 4HUJA 3MD9A 3ZOZA 3LUJA 1NQAO 5JOZA 1JYVA 1WJGA 4FB4A 4IDEA 5K20A 4KNWA 1JZ8A 5TNXA 3WB2A 2GH2A 4X8HA 3I73A 5DX1A 4CRWB 3WGYA 1MQ8B 3ZLBA 2IS1A 2OUIA 5FAKA 5H02A 1WW7A 4RVOA 2E53A 4A8JA 3ED1A 5A6QA 3DGTA 1GAJA 4OYHA 4TTRA 2YWDA 3BRCA 2IT1A 4EHIA 3PJRA 3I9NA 4QO7A 3K51A 1U1EA 2CLOB 4M7OA 1U2EA 1UQRA 4ZVQA 3AKCA 4CL2A 1VAKA 1C1HA 3P32A 2JHPA 2JCGA 3VH1A 2EGGA 4NEHB 4RZUA 4LBYA 3UJAA 4QPIC 3BTVA 1SHZA 5SYNA 3SYKA 3VU9A 2Q8QA 2JZOA 1SFYA 4BMNA 4NPAA 4CMGA 3U5ZB 4Y2PA 1B73A 4LUCA 4G0NA 1ORTA 1GRCA 4AYUA 1WXWA 1HJFA 5JT1A 1XFDA 2JG8A 3DVLA 1A5AB 4Q3CA 4IQ0A 1QEXA 1W7AA 2ZGVA 4GW3A 1KEXA 5M04A 2WMOB 2X0EA 4RKFA 4I30A 3C5WP 4UAUA 3PUAA 2PUEA 1NY71 4JQCA 3P97A 4ITVA 1QKKA 4PBSA 4CM5A 3RVPA 3I01M 1UBUS 1NNEA 1JU4A 2HCFA 4IJWA 2VDWB 5F7ZA 2B8EA 3M3OA 2DQZA 2P77A 4YW3A 4QGFA 5FP4A 2XJ4A 2CUTA 4WTOA 5D00A 5AKLA 3VR6H 4BNGA 2BFUL 4E7PA 5HKLA 3KJGA 2X5XA 5K4AA 2VP5A 3LPFA 3HBZA 3DOHA 4AYXA 5DBEX 4F9GA 3ICEA 2FZCA 2FK7A 3SHQA 2F8LA 4GOMD 4LJ7A 3PI6A 3AFGA 1D1TA 4BV8A 3CR8A 1OIVA 2L69A 5DEOA 4Y1FA 1FOD1 1JV2B 4IGFA 3NM5A 2H1CA 3H5TA 2OQ7A 3S70A 3EGOA 2JD1A 3EOAI 1PWHA 4RHFA 2NUBA 1MW8X 1W4ZA 3IWZA 3VYTB 1UBMS 4E5VA 4PSCA 4AFMA 2HYIC 1R0CA 3KHBA 2ZJBA 3KKOA 1AMOA 3DZCA 2IXJA 4H15A 1XRSB 5E7MA 1EAMA 3OD5A 3VHPA 1V7QA 1D0SA 1MGOA 3IOBA 3W05A 5AK3A 1GIAA 4AF7A 3TNPB 3NEPX 4XYXA 3G2MA 3U4QA 4I19A 4L9WA 3A3NA 3TQQA 4DIEA 2EVWX 2P1BA 3WB9A 4X8PA 2OP1A 2IXDA 1FSPA 1TXGA 5IBRA 1PYOA 1J90A 1P45A 5T8KA 1NOKA 3KXPA 3M8KA 2Q49A 4HAWA 2NZWA 3HMYA 3GJ7A 1CUXA 2ARXA 5ICSA 3R8XA 1DKOA 5ALNA 3WNBA 4OQ9A 4DQUA 3THXA 1NVKA 2QN3A 1D2QA 3D02A 2WQZC 2G72A 3RS7A 1ND2C 4FFNA 3G82C 3GOHA 1IOZA 4AI3A 3SDBA 1J5XA 3ETNA 1OA3A 5KOIA 1XCLA 3THTA 3N2IA 1B35B 1H4GA 2R8RA 2R6HA 2OP0A 4GX2A 5DE3A 3JQGB 1GPLA 2G5TA 3FOBA 3VV2A 4CDXA 2IFRA 3GXBA 2EF1A 4M9CA 1XVAA 3H17A 2R6FA 3S2ZA 1N1YA 3LBYA 3TRFA 4EX7A 3TEFA 3PJEA 4IQGA 3NHPA 3ABOB 9GPBA 4OB6A 5JVVA 2DR0A 5LVAA 2GAOA 3ICWA 3C7AA 1VTKA 2EZ8A 2BHTA 2HLPA 3IA2A 5AVVA 2N47A 1YIOA 1TYBE 3VU0A 2O1EA 4QB1A 3F7OA 2ZMNA 4UFOA 3O1SA 4P86A 1CJPA 3TIFA 3KHKA 4KI0A 4L3OA 1KERA 5IW8A 5C5IA 3WEZA 3P0JA 4BO4A 5IF3A 1TA9A 1QRAA 2RM21 5FWYB 4QHZA 4FGWA 2DJIA 4LXXA 3GEMA 1WP4A 3FJSA 2TRSB 3INGA 2BVVA 4WZCA 1VOTA 2ZZKA 2MSKA 3U81A