3BPSA

Pcsk9:egf-a complex
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
530
structure length
435
Chain Sequence
SIPWNLERITPPRYRADEYQGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHWQLFCRTVWSAHSGPTRMATAIARCAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDAVTAVAICCRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title Molecular basis for LDL receptor recognition by PCSK9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/lipid transport
total genus 128
structure length 435
sequence length 530
ec nomenclature ec 3.4.21.-:
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF18459 PCSK9_C1 Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain
A PF18463 PCSK9_C3 Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain
A PF18464 PCSK9_C2 Proprotein convertase subtilisin-like/kexin type 9 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.690 Mainly Beta Sandwich Jelly Rolls Proprotein convertase subtilisin/kexin type 9 3bpsA02
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3bpsA01
3DE5X 4HX2A 4B5LA 5ARBA 1SBNE 1TM3E 4GI3A 4H6XA 1TM1E 2E1PA 3D9QX 1IAVA 1Y3CE 1ZVJA 3AJ8A 1SIBE 3TECE 3VSBA 1AH2A 3F7MA 2Z57A 1GNVA 5K7SA 4HVLA 4I0WB 3VV2A 1SBCA 3GT4A 1Y4DE 3PTLA 2Z2XA 1SVNA 3A3OA 2SICE 1SCNE 1S2NA 5ARDA 3DE3X 1PFGA 1TK2A 3I37X 2ZWOA 4CFZA 2WV7A 2XTJA 3I30X 1Y9ZA 4NMXB 4AKTA 1BJRE 3BGOS 1SPBS 3DVRX 3BX1A 2ZRQA 1Q5PA 5AQEA 1LW6E 1WMDA 4K8RB 2IY9A 2IXTA 2DUJA 3TI7A 4KB5A 1GA6A 1SCBA 2PKCA 3QMPA 5FFNA 1EGQA 4NE7A 1AVTA 1GT91 3CO0S 2W2NA 2HPZA 1TO1E 1T1IA 1YJBA 3PRKE 1ZVKA 1SCJA 2PQ2A 5JXHA 1SBTA 5AMXA 4NE9A 4LVNA 2PWBA 1NDQA 1YJCA 1PEKE 4ZARA 1AQNA 1C9JA 3F49S 1PTKA 1DUIA 1Y1KE 5I9SA 1OT5A 5AVKA 1EA7A 1T1EA 3DE6X 3SQOA 3VYVA 2Z30A 2Z2YA 5JXJA 2PYZA 4OV6B 1THMA 1SUDA 2TECE 3OSZA 3DW3X 1VSBA 3ZXYA 1S02A 4KPGA 4OMCA 1NLUA 5FBZA 5FAXA 1Y3DE 2W2QA 3WIVA 3DE7X 5JMOA 4RYDA 2WWTA 1C3LA 2Z56A 1Y34E 1GTJ1 3VHQA 3SICE 1GTG1 3WIUA 3AJ9A 3CNQS 5CW1A 3UNXA 1OYVA 2HD4A 3WQBA 1AK9A 4KG7A 4Z2AA 4JP8A 3DVSX 3D43A 3DW1X 3Q5GA 3QTLA 1IC6A 4LVOA 1SUEA 1TECE 4C3UA 3EDYA 1SBIA 3T41A 3LPDA 2ST1A 3ZXXA 5SICE 1R6VA 5B1EA 1KDYA 4H6VA 3DE1X 3DE4X 1WMEA 1ST2A 3Q40A 1GA4A 1SIUA 2DP4E 1XF1A 3VV3A 3EIFA 3BPSA 2DQKA 2W2OA 1Y4AE 1WMFA 1SCDA 1Y48E 2ID4A 3DWEX 1PJ8A 4YN3A 5B1DA 3DDZX 4AKSA 2P4EA 3L1KA 2W2MA 1JEAA 2XRMA 2SNIE 1AF4A 1V6CA 1SN7A 1C9MA 4CG0A 3GCWA 3A3PA 3F7OA 4DWWA 3H42B 1GTL1 4C3VA 4DJ5X 1Y3FE 2Z2ZA 2X8JA 1BH6A 1CSEE 3AFGA 2V8BA 3QFHA 1GCIA 3DVQX 2ZWPA 1P7WA 3VTAA 2PMWB 1SUAA 3LXUX 1HT3A 3DE0X 5AVJA 2WUWE 1SUPA 1V5IA 2PRKA 1BFKA 3A3NA 4MZDA 2W2PA 4DZTA 1A2QA 3TI9A 4CFYA 1SUBA 3LPAA 1KE2A 4ZOQI 3EE6A 1TO2E 1R0RE 4M1ZA 3GT3A 3GCXA 3DYBA 4H6WA 2X8JB 4OMDA 1BE8A 1SH7A 4FONA 1GA1A 2WUVA 4WOCA 3LPCA 1Y3BE 1S01A 1Y33E 4WOBA 1DBIA 1SIOA 1MEEA 1SUCA 2QTWB 5ARCA 1T1GA 4J94A 3I2YX 1NDUA 1UBNA 1OYOA 1BFUA 2SBTA 1R64A 1MPTA 2B6NA 3P5BA 1CNMA 1KDZA 1P7VA 1WSDA 5JXIA 1GNSA 1ST3A 1AU9A 1WVMA 2Z58A 2G4VA 2GKOA 1YJAA 1AV7A 2PWAA 1YU6A 1SBHA 3DE2X 1TM4E 1SELA 3HJRA 1SCAA 2SECE 1KE1A 1C9NA 2ID8A 5JXGA 1KDVA 4BWGA 1TMGE 3I34X 1BE6A 1TM5E 1TM7E 3WHIA 1P8JA
chains in the Genus database with same CATH superfamily
4D3WA 1Y7LA 2WNEA 3TB6A 4PX3A 4IE4A 2AWNA 2RKOA 3VX4A 1E3WA 4W65A 1UH5A 4AECA 3PD1A 1ZC3A 4EUHA 4X92A 5ISLA 1L7BA 2HPAA 4JJAA 3V4OA 2GBFA 3FDJA 1RXEA 2BSXA 5E2IA 2XMQA 3N8NA 4WDQA 5C32A 4QA9A 4WZFA 4H2AA 3KZKA 4B6FA 1QS0B 1PQ4A 3LX5A 1XXHA 5A71A 4DKJA 5EE5B 4YB8A 5U9CA 3LIGA 1LEMA 1THZA 2WZCA 4YVFA 2WV7A 1DQ5A 2IFRA 3IUEA 5KVAA 16PKA 5KKAA 4RETA 4L9SA 1Y7IA 4IIDA 2AFHB 1FS6A 4IETA 4ZAZA 5FKBA 4Y4YA 2WLSA 1XE7A 1R8SA 1KORA 3JWJA 1CVNA 4MUGA 1QZZA 2QGFA 1YQ6A 1R4MB 2R96A 1SBFA 1UIMA 2O2YA 3CO0S 3KJEA 1BX3A 4ML3A 3CVOA 1YJBA 1NBME 1X1RA 4GNRA 2GSDA 3R3XA 1Z62A 3BODA 4Y6GB 4G5SA 3VYWA 1OZGA 4FP9A 1YR7A 4V0SA 2OTCA 3S30A 2FSUA 3IP1A 1XRJA 3ANNA 1VIAA 1QJU1 5KBYA 1YJCA 2ZJ0A 4LE3A 2YIVX 1J8VA 3NETA 3MELA 1RE1A 1AR62 1OOPA 2GH8A 3JRNA 3K72B 1JI0A 4IXLA 4D25A 4QYMA 4UQLA 4OKIA 3OPNA 4LOJA 5H02A 4EYOA 1H5NA 3LBFA 1A5SB 1K66A 4OMCA 2IUUA 4ENPA 2CMHA 2NMOA 5JSPA 2I0FA 4H9GA 1PHRA 3KQQA 2KD7A 1GTG1 1SZJG 1H85A 2X29A 3V65A 2XYHA 3HP1A 4MMYB 4LCEA 2BBAA 5B1SA 3TLZA 3SQNA 3DC2A 3OSDA 4LMBA 2ZX4A 3EHDA 4EVRA 1EQAA 3E9MA 2FW8A 4A41A 4QQFA 1R8YA 2I2FA 5ERYA 2X9GA 5EC8A 3RZZA 1DBPA 5EJFA 3AX4A 1QQP1 5SICE 4BWYA 3GN1A 4HZFA 3OPYI 2JZCA 4PPQA 5CW2A 1XWIA 3PXBA 1QKKA 4W8OA 4RTQA 3REQA 2XJQA 2HXSA 1Y4AE 2OHFA 3BEOA 3FJYA 4ZZ0A 3HJAA 1EWQA 1Y48E 4ZHQA 4ET7A 4KXVA 4P9XA 3EPJA 2EFGA 5DSTA 4H31A 3ZLIA 3DMDA 4R1SA 1E5VA 2IWHA 1NSFA 2A3XA 3DC7A 1HV0A 2IIQA 5DN6A 3N58A 4ZPIA 3K9CA 3IHWA 3NTRA 3MT8A 3BWXA 2J9FA 4W5WA 3EVNA 2GVZC 1G59A 2QGZA 3DKPA 1NXOA 4KBGA 3KOUA 3BBLA 1JFFB 4FI3C 5ADUS 3WBBA 4F7DA 5MHTA 1XBFA 2XDYA 1KQGA 4AL9A 5GWXA 3CZRA 1SU8A 5JSOA 5JWHA 1Q0SA 2OK8A 4Z6KA 3AXDA 3OAAD 2GEKA 1GZVA 4DO0A 2YB7A 3UJOA 3HGTA 1E9EA 4BPBA 4DABA 3VJRA 1XWFA 4W63A 5L95A 2DPLA 4B29A 4GKYA 2PQ0A 4TTRA 4I09A 4CCLA 4Z51A 3JTMA 4GZMA 4CMBA 3GO4A 1DJLA 3S2FA 3CLSC 4YYOA 4HZGA 1KRWA 3WYAA 4QXPA 4X6RB 3DMPA 1BDHA 2BFBB 4EITA 5F3CA 2XITA 3HRHA 3PQ7A 3LFIA 2CE7A 2AFIB 5JO9A 5KQMA 2AEYA 5IXJA 3ETNA 2V09A 5IYZB 1DJMA 2VMDA 2C84A 3DV9A 1ZJ6A 1M6EX 3Q8EA 4FFGA 1COZA 5LA2A 3TLGA 4XR4A 2I6TA 1PRYA 3WCRA 5EP2A 4YDRA 4XWKA 1XYOA 2IP1A 4DZRA 3AP6A 1D3AA 5EMMA 4NABA 3MLEA 4D6SA 4ISCA 3RU2A 1RVF3 3G02A 4GOKA 3EDCA 2EC5A 4QDOA 3N36A 4GEKA 4U7HA 4BISA 2ZBPA 2HEWF 1FPN1 1X8XA 1VB2A 4RY9A 2XONA 4QELA 2H8GA 3TD9A 4FHCA 3ZD6A 4X8HA 1UXHA 5TDHA 3QBEA 3ROKA 3W6PA 1N4DA 2PS0A 4JKLA 5A0VA 5EHQA 2IXIA 5FL7D 4AHXA 1M6HA 2PUJA 3V1KA 2ZITA 1QYWA 4MWZA 4GP6A 3F5SA 4BXSV 4O4IF 4EABA 1WDMA 4E4DX 4G4IA 5B1IA 2ODBA 3WW1A 2YV1A 3N6RA 3LA3A 5C0OE 1W6OB 3X3HA 2V9CA 2R85A 1SR8A 2XYRA 4QLOA 1GN8A 4KC0A 5IJ9A 3IILA 3OJLA 3SOZA 2ZAGA 1W0CA 5EZYA 1EZZA 4FLFA 5ICEA 5GLVA 2D4AA 2Y99A 5TQVA 2C3YA 2WFF3 3I2OA 3J81k 1CLUA 1UYPA 4ZV7A 3GNEA 2IS6A 4R8HA 4EN8B 1PUXA 5AVAA 2O2IA 1PHMA 3TLBA 2VH5R 1QDEA 5CFLA 4XC9A 4FC6A 1EV11 1WY7A 3FM9A 1B26A 1JH9A 5T64A 2B7BA 1GP4A 3PDIA 5D1NA 3ICQB 4DPLA 2YFQA 1W5SA 3NTUA 4FFVA 2Q9UA 5C1OA 2XUOA 4PPYA 3EVZA 2QKDA 1PEKE 2ADOA 1RWOA 5LZ7A 2QN6A 3FN9A 1GOHA 1MKYA 1OT5A 2BJVA 5K0SA 4X45A 5BUVA 2VDLB 4LA3A 4YMTA 1W8NA 4LOAA 2VG8A 4FNGA 3KVAA 4NH4A 1PIV3 4AJ1A 1G4HA 1VSTA 4BIOA 2W2XA 4XIOA 3G6WA 1ZCZA 2JE8A 1IWPB 4EI7A 1F06A 2EVWX 2Z2SB 5A03A 4I99A 2ZI7A 1BOOA 5DYWA 4ZALA 3TSWA 4FVVA 2PNFA 4MHTA 3ZYIB 5CJ2A 5FK8A 4QYSA 5JTUA 2BI8A 1N77A 3AX6A 5FZLA 1CIYA 3Q1KA 4IRXA 3RVNA 4GOMD 1MS4A 3L4BC 3IRVA 3WF4A 2WT4A 4NENB 1CVRA 1HM5A 1N2JA 1XX6A 4YARA 1EFCA 1QQ5A 2HIMA 3QTLA 1D6JA 4N41A 1JYVA 4F6CA 3ED1A 3COYA 3SQDA 4JGZC 3G6KA 3UAZA 4WLFA 5HM8A 1L7VC 2QTLA 2FWBA 4A8HA 4BZ4A 3W6OA 3U44A 1WMEA 4ATNA 3FLMA 1TMKA 4ZQBA 4E12A 4WT7A 3E4CA 1T36A 3EXHC 1XF1A 1QGUB 121PA 4GPAA 2WR9A 1P1BA 2XOEA 1UMBA 4M98A 4NRPA 4B6PA 3A1NA 1WTAA 3OLCX 2DFNA 4RKYA 4HRAA 4M0MA 3KVRA 3KB6A 3WLHA 4M0FA 4C3VA 2BP7A 3FE5A 2HQ1A 1E3SA 2XVYA 2CUNA 5JJLA 3KX2A 4UF0A 2PJDA 1FFXB 1GFWA 7YASA 2FWRA 1YQEA 1X19A 2BMFA 1XDBA 1KOLA 2WYSA 1SUPA 3SYMA 3D6MA 4L0DA 4CV0A 5EI5A 3HLYA 1BK1A 2ZZKA 2JFNA 3L7MA 2O52A 2CW5A 2QY9A 3PJEA 4M1ZA 4WKNA 1BVP1 4GJYA 2VT2A 2VQUA 1RWXA 1FE8A 4IDPA 1TME1 5BSEA 9LDBA 4TT3D 1HX7A 4LXHA 2FPIA 2ZGLA 4BO6A 2E37A 1N92A 4I1PA 1IHYA 4AI6A 4XYMA 3ASIA 1Z2PX 1VBD1 5F5CA 3LUHA 2N0SA 2NMVA 3QHQA 1POQA 1U0TA 4LYYA 3EGDA 2J1SA 5J48A 1U7UA 5KC8A 1ODNA 2Q5IA 4AY6A 1U31A 4XPVA 2BBWA 2R65A 2F64A 1JQKA 3STVA 1X3LA 2VPQA 4GBGA 4YJ2B 5DDJ2 5AKKA 4WFIA 1MW9X 1NQJA 4J75A 1H4SA 3A9RA 1UKEA 4RZSA 4CV3A 3OGSA 3U14A 3GELA 2EZ4A 2J1RA 2IS2A 5JTTA 3RRZA 3ACGA 1C9NA 2XNDA 3RFFA 5JMTA 1NYLA 3KZVA 1GFIA 2FN4A 1PD0A 3LKZA 1UQUA 4CCMA 3UAWA 1HR0B 4RR3B 3S8YA 2CLEB 4ZV9A 8ADHA 4J3FA 3TD2A 1PGL1 3I39X 4AN1A 1GPYA 3FOWA 4LR4A 5F12A 4PTYA 3CEJA 2V96A 3I9NA 1R8JA 2X2PA 1ORHA 1NG1A 4Z1MD 5KIAA 3AIMA 1ATZA 4NI5A 4LNUB 3USCS 1PQYA 2BW8A 2HSEA 2IPMA 3FPJA 4LI0A 3N0VA 5JS8A 4LKDA 3CZJA 5IT6A 2SICE 1SD1A 5AKEA 1ZN8A 3VDDC 4R83A 2VJMA 2PO7A 5EMLA 4R68A 1OBCA 4OK6A 1UMDB 3PL0A 1ULGA 3NJZA 3RHFA 4L16A 3LKBA 1AT1A 3DBRA 4FKBA 1LU9A 4LDRA 5AI4A 1ZZ6A 4JP1A 3TDMA 4XCVA 1KY4A 3LECA 4E5UA 4C30A 5KQRA 5IW8A 2FUNB 1YTLA 4CLHA 3POEA 2AK2A 4FBGA 3F2VA 4Q5OA 1AGXA 3PGMA 1JZ2A 3MRTA 4J4HA 1O91A 3TEXA 4A82A 2NQ2C 1E61A 5L9AA 1MV5A 2C9KA 4ER3A 5HTOA 4LBQB 2E21A 2HW8A 1VSQA 4PZDA 1C50A 3V7UA 1GKKA 4ZS3A 2YXBA 1UPAA 2ZGMA 3SSOA 5F9HA 4EZBA 2O8BA 3OZ7A 1JJBA 4C06A 4BMZA 5C9ZA 4Q1CA 5L3SA 5CDUA 4QNRA 3OSZA 2QX9A 3JQAB 1N5OX 3VSAA 3G49A 1T5IA 2OECA 3PLAE 4XKJA 1NW3A 1CUSA 4IIVA 2FDJA 2F1KA 4B84A 1RM4A 1NI4B 5CJPA 3WGMA 2IYPA 1GPH1 2FP3A 2JGFA 4ZGWA 5A6ZA 4CTNA 3HR7A 4PN7A 1VBB2 1IJFA 1TQ5A 4KR9A 1QVVA 1EJBA 5CFPA 5KWIA 3F4LA 1EJ2A 1GQFA 2IUTA 1UOBA 2FQYA 2FK8A 3D2LA 1DC3A 1ULFA 2JAXA 4KG7A 4JP8A 2VJPA 3LVRE 5B57C 4J2OA 3EXAA 4BQWA 3I8SA 4CEYA 3KD2A 3RUIA 4DSTA 6AT1A 1ISHA 2XIQA 1VB5A 1CEEA 4R51A 4IH4A 2B6HA 5B2GB 3ZKAA 3TPCA 4Z4FA 4M4PA 4BFTA 4HMQA 2BTQB 1CAUB 5DNEA 3FGPA 1M2VA 4GRDA 2M98A 2AJCA 3KT4A 4DEVA 2VYND 4D99A 1YQWA 3BSSA 4N7BA 4GZ9A 1E4VA 4EYSA 4WASA 2MHCA 3QV1A 4HP8A 1V26A 1ZIPA 3CZ4A 4G8JA 1IKQA 1X13A 2W7TA 1X9HA 4Y30A 1JDBB 5J43A 1K5JA 1QYIA 1WIWA 4N43C 4KMSA 4ZCMA 4FYJA 4RPJA 4NV0A 4X1IA 4DW8A 3EG9B 2W6ID 3AVYA 3IIAA 5BOVA 2P9EA 3M3QA 4EWLA 3ACDA 1RI2A 2H2AA 1RADA 1HYBA 3PTZA 1U5CA 1RMU1 1KH1A 3TW8A 4EJMA 4PQGA 1OKQA 4EE2A 3OGVA 1UMCB 5BORA 2OA2A 1MNAA 2VZ0A 3T3NA 2ZFUA 3RVJA 2GB4A 5I9TA 1OF3A 3NV9A 3IQWA 5DWVA 1JQJC 2AEEA 4XFGA 1KD7A 3N7MA 1CX1A 2XRYA 4P14A 3P45A 1QIHA 1DRUA 3EMVA 1JZQA 5EE0A 4YQEA 2IXGA 3OEBA 1V3VA 4CWAA 1Q8OA 2TNFA 3UM9A 5C8CB 1YA4A 1G60A 2B4QA 1YK0A 2AH5A 1Z5OA 2WTXA 3DMYA 2GARA 3NONA 3ROFA 4C14A 4IEVA 3NJRA 5EEHA 3EXIA 1NVUQ 1WSDA 3IPRA 5HK8A 1ZOIA 3ILXA 3HT1A 1GPKA 1QLWA 1JHQA 1M67A 2VO5A 3OZDA 1UUFA 2FSGA 1J1UA 2C54A 1ASJ1 4MEBA 4ENSA 1JU4A 5A4IS 3CMCO 1V43A 2Q4TA 5FX2A 4CN8A 4JCCA 4LZNA 2B2XA 2BCJQ 4GMP0 3KMHA 3A0RB 1AUQA 4S2EA 3EYWA 1FOD2 5B3JC 5HJ5A 3OIGA 1PEDA 2FSVC 2JHPA 3QEKA 1I0LA 2WVGA 8ABPA 2C5GA 4C5BA 2UVDA 5KOHB 2RCNA 2MSEB 5JJKA 1LPOA 1E3MA 4N54A 5EZWA 3GRUA 5JAQA 4U6SA 4UVEA 2QDXA 1V3QE 2JI7A 2VBPA 3RLFA 3A3YA 1C1LA 4RZUA 3RNOA 4JVMA 4L27A 3PZRA 2ZYSA 4ZZ5A 4ZWNA 4I0WB 1W2AX 3H75A 1QX4A 1Y7TA 2LVBA 1QUFA 1T5HX 1Z63A 1Q7GA 4FFWA 4PXAA 1T9DA 5KTTA 3TBFA 1J1LA 1X8KA 3WL7A 1O87A 1FFCA 2B8WA 4AG4A 1VLJA 5DEIA 2XQKA 3KP1A 3S5QA 5EG5A 1DG9A 2J5KA 1IU9A 1VPLA 1JG7A 3ZDCA 5DTQA 3BCSA 3ZXIA 4LWZA 4XQ9A 5FRAA 5HCBA 4HX9A 1ZIYA 2WU4A 3KHCA 3D0JA 4R05A 2O7NA 4UU7A 3POIA 3EBRA 3KVNA 2XJRA 3A25A 2I34A 3C1OA 1NXMA 3O8RA 3IMNA 4LHEA 3MW8A 2XZPA 3GNQA 3DV0B 1CG6A 2ZPXA 4FEYA 2PBRA 2XMZA 2C7BA 2OAEA 1J3RA 1TJ3A 3N87A 1G8MA 1OASA 3THRA 2EERA 4HPWA 3SIWA 1J59A 3QU7A 5JZGB 2QMQA 2GCOA 4MVCA 4GC9A 3CN7A 2JDYA 2JAUA 4GLFA 1VBD2 1U2TA 4Q9HA 2Z9DA 3GEHA 3ZYHA 1AV6A 1Q8VA 4EQVA 2G1PA 4QB6A 4FTEA 1YHNA 4S0XA 1QNWA 1SVUA 4KNVA 3I83A 4KQHA 4RQUA 4YAFA 4Z49A 1Z8DA 1Y3IA 1VSBA 3ZXYA 5D21A 3HCFA 3IUMA 4JBNA 4TMYA 4Y2UA 2OGTA 4B3XA 3IB6A 3CBNA 5CG9A 1ND3C 1N75A 1Y7HA 3LGRA 4OB8A 3GEPA 4LDAA 4M6WA 2VXOA 1Y4WA 2XNHA 1ELOA 1GSHA 3FVTA 2QCSB 4MGSA 1K8ZB 4W6ZA 1YZHA 3AXTA 4IMJB 3RVMA 3LPLA 3RAGA 4YC7A 3MSCA 5CLLA 2J0UA 4KGZA 3SFZA 2AGSA 3PGVA 5B55A 1J3QA 3JASB 1EP1B 4W7SA 1R6VA 4YCCA 4ZONA 2RONA 4PYMA 3HMYA 3L1HA 2V59A 3RIEA 5CB8A 1C4WA 1WSBA 1IM5A 4HAYA 4CM6A 2XXAA 3R4UA 4ZU7A 1ZM3A 2Q6TA 4WK0B 3OO0A 3G79A 1MG5A 3SMHA 1C7ZA 2WIFA 1VHWA 3CONA 2DV9A 2IWGB 4KQEA 2PLFA 4R3NA 4UNRA 4XQEA 5ACA3 1RYYA 1RRKA 1Z8NA 3GROA 4YRJA 3EQ8A 1CAXB 1ZU5A 2QPTA 5KOYA 2ARAA 3RVLA 1QZ3A 3FC0A 2O6LA 3OETA 1GP6A 4F3NA 1VCNA 5AVWA 1NQUA 4P2GA 3SBXA 4OVKA 1ACMA 3RRXA 1RCFA 3B01A 4DWJA 3CLPA 3NM4A 2CNWA 2QJWA 7AT1A 4FO9A 2XBO1 3ESZA 2NM0A 1PJ3A 2ZX0A 2JFPA 3VBSA 1FCJA 3ZGXA 5ALEA 3IO3A 1JTVA 5CA1B 3T3DA 3NBXX 1PE0A 4MB2A 2YXEA 5I8PA 1M34B 4KTTE 1BHJA 2KLBA 2X8KA 1V11A 4UFKA 3PI7A 3MHZA 4B4QA 3IR6A 1MC4A 1U99A 2BPA2 3UJ7A 1JIQA 1SFYA 5ISMA 2DDUA 4LNAA 1E1KA 3OCYA 4HVRA 3BPZA 5HZHA 2I4MA 1SQ5A 4L3VA 1G9XA 4GKBA 1SUCA 1VDMA 3UK6A 4EQ6B 4LJKA 1TX4B 4V0OA 1A8MA 4NBWA 1RQRA 1NQXA 3LT0A 3SR3A 3PL5A 2Q3JA 2IWRA 2ZE7A 5ALZA 4CF3A 4MVJF 2YU2A 4AF7A 2CNAA 1VALA 4WCDA 5D8AC 1PEAA 1U9IA 2GWRA 1A77A 3JWGA 2VNOA 1XTVA 4BBPA 2BFEA 4KWUA 2KHZA 3SX4A 1ADFA 4JUFA 1LD3A 2AQHA 4CIYA 2CGOA 3AJZA 5ILOA 4GU5A 1EVZA 1ZI8A 4BX2A 4H35A 6REQA 3FLAA 4RSMA 3MA0A 4QFDA 3IA2A 4IDNA 3WDSA 1XQ9A 1VIVA 1XOYA 3ZR6A 2C6SA 1ULEA 4QREA 1R6TA 4L6AA 1W3VA 1WMBA 4FHZA 2EW8A 3T1YB 3UWOA 4EB6B 4I4TB 1TNFA 3W2EA 3LSYA 1JI6A 1XNAA 3MYXA 1O6ZA 3F7TA 2DMRA 3IH5A 1SZCA 1YB2A 3ENVA 1JLHA 4GWKA 2YRFA 4BVFA 1YULA 3CMMA 4YG6A 4COVA 1HTWA 2O8FA 1G6NA 4EDHA 4IKEA 2Q46A 1FB5A 3WG3A 1W52X 4KO2S 2ZB3A 3D2AA 5H9RA 1RPAA 2G8LA 4PHFA 5F2SA 2ILVA 4KN9S 3PD0A 3IIJA 2VK2A 4N47A 4FE4A 3N0TA 1WMXA 3N2ZB 5LW9A 3RWBA 3FZNA 3MJDA 5FMBA 2CXOA 1JEQB 1BD3A 2IZWA 2O7QA 2FPPA 5ALDA 1QPZA 4U36A 4GXRA 1LQTA 3WP4A 3D3EA 3IALA 4PBRA 5CM8B 2WT9A 2B8MA 4MUBA 2GO7A 2H1OA 3VZMA 4N12A 5HI0A 3GJ4A 5CNJA 5EKXA 3HO8A 3B7GA 4OI1A 1VIWB 3WK5A 3D4KA 3VR3A 3ILYA 5LQMA 2XI4A 3OKFA 6ABPA 5LD2B 3QWBA 3VNRA 1FX0B 4FXGB 3R3WA 3H65A 3VKFA 1PZ7A 2D2VA 4RS4A 1L0BA 4RGVA 3GUYA 3WP0A 3EGCA 3G0HA 2K2WA 2RS53 2WYWA 5AKHA 2VRCD 3OTOB 4Q3EA 4RSGA 3S5UA 3AKSA 5H8WA 3OPMA 2YINC 5DXDA 3DS8A 3EG5A 4GICA 4QM7A 4L0QA 4L2IA 3OEWA 3FPHA 3E2PA 2UV8A 2PUCA 1L8OA 4XWYA 3BMQB 1H8HD 3M6XA 5CYPA 1H6AA 4EGQA 3L0DA 2CGPA 1SLIA 3L1VA 2WJIA 3NH6A 3JAWB 3C8HA 1QYDA 1D4M1 1FK8A 2A70A 1IB6A 1R4NB 4BLTA 3VC7A 2NG1A 3H8SA 1QK5A 1ECBA 4B3GA 3P97A 4MW4A 3GLKA 3G68A 2ZQZA 2ZGPA 4G3YC 1DLIA 4ZCIA 1KDYA 4TYYA 1U81A 4O4HA 3EIEA 2PRYA 1B0AA 2QTCA 1U6IA 2NZXA 3DKKA 3T5AA 4LF4B 3JD72 3Q3JB 4FYHA 5K2OA 1FTGA 4QOGA 3ZU6A 4M3CF 3EXG1 3DOOA 2ENUA 2FUKA 1QF6A 1PL6A 1J49A 3OUUA 3OX4A 3NXSA 2WC1A 5DYIA 1D6MA 3K48A 4REQB 4AYXA 4W7IA 3DR3A 4XGKA 3U7GA 2HWD2 4TKVA 1F6WA 2VHUA 3OCJA 3DP9A 5JYDA 1TC2A 3UXYA 2JI9A 4KJZA 4J4BA 5KX5B 4KU4A 5FQOA 3Q7EA 2OT7A 5L7WA 3MQ4A 5G0VA 5T7BA 5JI3E 3PVCA 3HBMA 3W0LB 1NDHA 1N0VC 2Y1KA 1P7WA 2PO5A 3S1LA 1LA2A 1L8LA 5LYJF 2NU6A 4F3RA 1RXWA 3O0XA 4HG2A 4EI2A 2VH1A 3KB1A 4EI8A 1T15A 1MQTB 3JCZA 4HGQA 3WGOA 4V2VA 2VUJA 3TL2A 1CU1A 2JA2A 4MGYR 4RPLA 4LDJA 1PP4A 1W5FA 3KJGA 3KNZA 5CFDA 3GBFA 2F43A 4UTRA 1RYMA 4DV0B 3IDBB 4E3ZA 2V65A 3U81A 3IPXA 2WR8A 2WSLA 1Z0FA 5EIWA 1JH8A 4DIDA 3PNPA 4K26A 4YWAA 4HKLA 2HMVA 2XQJA 3I4FA 3THDA 1BKZA 2D54A 4X6XA 3V33A 1NM5C 2I99A 1RUG3 3NMUF 3DVAA 3WDUA 2FW6A 1QHFA 5CB4F 1IOVA 2CV6A 5GZDA 1YB1A 3ZU2A 1MJGA 1MPTA 2J1AA 1FQOA 4GI1A 5F3RA 4DMHA 4X97A 1XCOA 3POWA 1VBC3 2QL7A 3PIGA 3T5TA 1CY1A 4CIXA 4CBVA 1P3Y1 1Z2EA 1JB1A 3DM5A 1M6YA 3L7BA 3GJ6A 1I3LA 1SD5A 1GDHA 3WFJA 1L5RA 4MUIA 4HETA 4RSUA 2YIMA 3CEMA 2XVZA 4Q4X3 1SLBA 5C52B 1P8JA 1KS9A 2P0YA 1LF0A 2J07A 2HY7A 4TL7A 3DEMA 4QXCA 1G7SA 5J3JA 2QUZA 5FOBB 3AYAA 3EIQA 3ENWA 4BB3A 4RNCA 5K8CA 4PNHA 3FUVA 2Y1XA 3CPHA 3N2YA 3H8WA 1KQNA 4ZJUA 4JR2A 2WFZA 1UXKA 2E4WA 4LZZA 3EAFA 1L5SA 4XABA 4YPFA 1U5ZA 2H65A 5DUXA 4XSVA 5JZBA 4GOOD 1H2AS 1UOOA 4ICIA 3UZUA 4NVPA 4HYEA 2O50A 2YDXA 2GMEA 4BNVA 1J97A 3T4VA 2CWMA 3FUTA 4FEAA 2Z2IA 2C7QA 1E57A 2ZTNA 1GPAA 1GGMA 2ZJ7A 4P4SA 2DR0A 2C78A 4XZUG 1PJ4A 5ICFA 5CP8A 3CCCA 3WWOA 3NU1A 4QKDA 1BJQA 2GMWA 3DOUA 2WG0A 4DT1B 3V8QA 1YI8A 1TO1E 2DFTA 3W3ZB 4PLMA 4I30A 5JG7A 4TXHA 4HOYA 3OUZA 1QJY1 5AIAA 4FFMA 1X7HA 2ZJ8A 5B4VA 2FSHA 4FDVA 1YOVB 3BHMA 4QYWA 3U4IA 2FXIA 2HGZA 4KN5A 4XVQA 2FMYA 1CP2A 3U16A 1ZSNA 5FAKA 4WGFA 1CC1S 1V9LA 1OW3B 5FQ0B 2F6BA 4R2MA 3J7LA 5JCOA 3WJ1A 4GMGA 2YJ4A 4BE7B 1P2FA 3ND6A 1EGAA 1BOFA 3DE7X 4KLZA 3Q1LA 5A6XA 3Q8CA 4PYNA 2R072 3EEBA 4ENTA 2IELA 2JLBA 1BFDA 2YIJA 4L28A 3GRCA 1Q0ZA 4R8MA 4D8TA 5A1LA 2ZACA 3IIMA 3O93A 3C3JA 2F3QA 4HONA 4LGMA 1TCVA 4JAAA 1X8MA 2JAQA 1IZYA 3F6YA 2YUTA 3X29B 3ZE8A 4CKXA 1TUIA 1OIXA 5FA8A 4NPAA 3SE0A 3PQCA 2TS1A 1WXEA 5C8VA 4IIUA 4FJ1A 5FFMA 5JR7B 1YMUA 4ZDKA 1UJCA 2H4ZA 1XC6A 3VV3A 4KQIA 3GLIE 4AMUA 1Y5RA 3K16A 3RASA 5FUIA 2F9MA 4TZKA 5D3ZA 4BQEA 1P4JA 4KXMA 2IE0A 3IBCA 4HPKB 2BFDA 5A1AA 3RRNA 1V7ZA 1ZMXA 1RFLA 1SN7A 4MROA 1WLWA 4MO9A 1GNZA 5A7WB 1SLAA 1WUVA 4Q7QA 1PS9A 3J7TA 4WM7B 2FR0A 4MV7A 3HSYA 3Q3HA 3I9FA 2ZTSA 5B64A 4YHBA 4BPZA 4PZUA 3C7HA 3A6ZA 4RKQA 1Z33A 2IUYA 4CCSA 3HJFA 1CDDA 1W25A 3KB8A 4BXOA 4BP9A 3X1MA 5BQ5A 1YACA 3LXUX 3KJHA 4U7JA 4QQOA 4MGKR 4F3CA 1J7JA 3FTCA 4CP9B 1BKSB 5H83A 1MDBA 2YVAA 2HF8A 1VPDA 1OWNA 4HGRA 1JS1X 3GLGB 1QK4A 3T7JA 8MHTA 4DMLA 1H2MA 5BN4A 1OPOA 1C3VA 3UQZA 3GGOA 1IXSB 1KXZA 1IZ0A 2F1JA 1NLMA 1K97A 1DBVO 1ZD8A 1OLUB 3QPAA 1MO3A 1RAGA 5EXTA 5KNDA 3ZXEA 3ITEA 2WU0A 2PT6A 2Z3VA 2XCQA 5JXIA 5ECYA 4XUCA 3FL7A 5I0TA 1SUFA 1A34A 3CVJA 2YWFA 1REFA 2E9QA 2Y0PA 1UXJA 4KR2A 1YU6A 3WB1A 2REQA 4EENA 3JVUA 4FFPA 3BZBA 1D4M2 2AQKA 1ZNPA 2IVIB 2SECE 3M83A 3PFFA 2JATA 3TVYA 1AKYA 4W1SA 1EUDA 3EBPA 1L1QA 3KGZA 3WW4A 3V97A 3NNGA 1FDIA 1Z68A 5A1FA 2YN4A 1TM7E 4GGOA 2BGCA 4M86A 1JMYA 3GW8A 5FOQA 3IP7A 5MGNA 3VD4A 3PUKA 3KT8A 3RUDA 4JC0A 3PNOA 5K5EA 2ZR0A 1TM1E 4LK3A 1JHUA 3ZO0B 1L4NA 3ZQJA 2BGRA 2DF7A 3E7PA 4NAOA 4KGVA 2PSFA 5BUQA 2QBXA 3TOCA 4ZU6X 2ZWAA 4ES8A 1BCSA 2KMLA 1C1XA 4TT8A 3SBDA 1CUJA 1YJKA 3JQ9C 1W49A 2VNHA 1OJ7A 3G2IA 2GN4A 1BK0A 4NYJR 2HI0A 4LV6A 4AKTA 1T3GA 3AIOA 1BKYA 3N7TA 4EL5A 1RRMA 1D0VA 3V0BB 2GZ3A 1RDFA 3OZSA 1WY5A 4A8JB 3FN4A 2EJWA 2VSQA 1J20A 4J25A 4EN6B 5FTJA 2E4UA 3CF6E 2Y68A 3SFTA 2WIBA 1P62B 3DT8A 1XD2A 3P2EA 3NTLA 4O0LA 3HC7A 4R3WA 1D09A 5JAIA 3KEGA 4B43A 1R4AA 2P90A 2R6ZA 3LPNA 1D7OA 2ZAHA 3HYTA 2IHKA 3D8SA 3D2CA 4X6YA 5IAKA 2ZSKA 4PAQA 2QQIA 2PQSA 2I45A 5GZ6A 3ZV7A 4R31A 2HK7A 4DA4A 2X05A 5FWAA 4NMIA 3UK2A 3Q7TA 5HNKA 4LQDA 3AUXA 5FCCA 5A3PA 1Z5NA 3I9JA 1UBRS 4CCYA 2D8MA 3CEHA 5IVHA 2I2CA 4NEHB 5GADl 5D2CA 5DYNA 3KL4A 1D7PM 2I2WA 3L04A 4HDAA 3BM5A 4UBNA 1Q1ZA 1GOTA 1I13A 1Z2DA 1Z7S1 1WLSA 2GTHA 4NDAA 1ZCFA 4P4UA 3OTWA 1Y6JA 5FYHA 3AVRA 3RS5A 1QH1A 2VDUE 4JU8A 4CCAA 3H9JA 2NT3A 2IGTA 2HWWA 1AA6A 4E46A 4XFHA 3AVOA 4CETA 2CSXA 2DTYA 2NXJA 5NLLA 5E6SB 2AVNA 5DMHA 3T7DA 4G09A 3VVLA 1IC6A 3EDYA 1CB0A 4QC2A 3H2ZA 1T9BA 1YQXA 4P9NA 3MN1A 4TMVA 1G7CA 2AOWA 2Y27A 3RVQA 3O8OB 3P9KA 2XUEA 2NTYC 3EISA 1M5RA 1GA4A 1U4OA 3ESXA 1CEXA 4WXHA 5AVPA 1YQGA 5JW6A 5JBQA 3Q7PA 1DE0A 2GEUA 3GLHA 3L05A 3PFBA 1LR5A 4D9FA 1DWOA 4NULA 1P1RA 1RACA 3OICA 1RXVA 3B9CA 1JG3A 3T5CA 4EECA 2XVAA 2WP0A 4TL9A 1J2UA 4IE5A 4NROA 4YVWA 1H3FA 4HYTA 1MZ6A 4YP5A 2XAAA 4MPPA 3ZWYA 5EQDA 3GHYA 4MQ5A 1Q7RA 4CQMA 3RQIA 3KQNA 1UBUS 5T5OA 4ZT2A 4R54A 3W5DA 4JI3B 1T8PA 3H7JA 4FJ2A 4KE7A 3EAGA 4DTCA 1OZFA 1AR83 4BFLA 3QIVA 4FPKA 2WFLB 4Q8KA 2DFDA 2GSWA 4C3OB 1QJY2 2W9XA 1DDLA 4OF4A 1XJ0A 3ONNA 4MWSA 3ZQ4A 1H8EA 1YHZA 1GUDA 3FFBA 5MFZA 2DT5A 4U7PB 3U80A 2KPOA 2AFVA 2ARCA 3W6ZA 3BMNB 2D1RA 4ACBA 3V1LA 2JLUA 2AYXA 2FFHA 2I1WA 5L3RA 1DYKA 1MU0A 1KYQA 1XL1A 4G2NA 4YJ3B 5BVHA 4Q5IA 1J8QA 4G25A 4N03A 1PSDA 2V6IA 1J99A 4NV1A 4K6KA 3GJQA 5ARCA 1HI9A 2HK9A 4MMXB 1IG3A 3L4JA 4Y1FA 4XSGA 1F17A 4IICA 2C9MA 5C5UA 3P5BA 1C30A 4R3UC 3V1UA 4I3FA 2HKIA 1Z73A 2EAKA 2XCIA 1E63A 1P4SA 2IBTA 1JG6A 3QBQA 3ZHBA 3PQ2A 5IJRA 1XU1A 1M66A 4QICA 3ZN5A 5DZSA 5KVVA 3VRHA 4MIKA 2R48A 5ICSA 2RB5A 4QX2A 3WP6A 1AMOA 1UK8A 1FLNA 2LTAA 3U3KA 3JQQA 4MQEA 3O21A 2CB9A 1C80A 2BE9A 5HQTA 1DQ6A 2MYUA 1MIOB 3RFRA 2H7XA 1S9DA 1CS4C 2W2LA 5F23A 1ZGJA 3AKPA 4BRUA 2OZLA 1MB9A 1T5LA 3ZFGA 2EGGA 2IU0A 5F1KA 1PWEA 4DRYA 3I9V6 2XYVA 4MCAA 5EJ4A 4TWAA 4BE9A 3GVXA 4G23A 2ZIVB 4E5MA 4OBBA 5JD5A 2E6KA 4HX5A 1RHJA 4HK4A 4OA8A 1XLWA 5LEJA 4D8XA 3HN2A 3N7AA 4OYLA 5JCXA 2ZUFA 1DTWB 2VXBA 5DGDA 1CX9B 2B5WA 2EBHX 3P27A 1DXHA 4IHJB 5H9PA 1UDWA 5F3EA 4RJJA 3NAPA 2PX6A 2VS1A 2GK6A 3WLFA 1QKQA 1KY2A 4UHKA 4XWTA 5FI1B 1NR1A 2VMIA 3KKNA 2XUIA 1SXJB 3S5JA 2W0XA 3LGXA 1E79D 4FT4A 5FO8B 1SKYB 3PFGA 5C5EA 3OM9A 2JFVA 1UOJA 4Y6PA 2XYQA 3HVRA 1DC7A 2HCRA 2YWDA 5F35A 3ICOA 5D3MA 2RM23 3NOQA 1POXA 3X1DA 1SKUA 1E0AA 1PHPA 1K68A 5LWQA 1Q6ZA 1AX0A 1E8NA 3ZD8A 4UCQA 1RQ2A 5DBIA 4CUGA 2CL0X 2IODA 1KFJB 3VU0A 1G4UR 2OE2A 4L75A 4A6SA 1RRVA 2H0RA 4OFGA 3GDBA 2XOKD 2WHQA 4F2WA 5FY1A 3M34A 2OXIA 1NXTA 2ACWA 1GQOA 3F71A 4BC0A 2W47A 4P9GA 3T4EA 3BXPA 3E5NA 1VLNA 1PGJA 1VTKA 4URYR 4X6QB 4BQ3A 4R4JA 3IQEA 4BLIA 5C81A 1RCUA 3N7KA 3K51A 1ZWLA 1THMA 1GGNA 1TCAA 3ISTA 3LXXA 4KPGA 1Z56C 1YVPA 3F8WA 4JR1A 4JBIA 2WWTA 3FUQA 3A6JA 3GOHA 3ZTYA 4LMAA 1H8TB 2ZRMA 3QG5A 2OUJA 1SDDB 4F5EA 3CF2A 1HN0A 3JWEA 2KBFA 4A10A 3GUHA 2DVDA 1RJ8A 5JIUA 3NBZC 3ENQA 4FMCB 4B85A 2NU7B 4PX9A 2WNVB 3MFQA 4JT9A 3PUQA 4YRGA 4OAPA 5BRNA 3QVGB 1CS0B 1NT0A 5IDYA 1S8NA 5DM2A 2IDJA 3TR6A 3O8CA 2WINI 5BSVA 1R66A 1WCKA 4LISA 4GD3Q 5B6JA 1CV2A 1KFUL 4MQ6A 4AD8A 1NUHA 4AXXA 3KPVA 1KSHA 3N5CA 3VKMA 2BMVA 4AX8A 1PZEA 3GYGA 2BBTA 4D1YA 3RADC 1U0LA 4ENVA 2JBAB 3LQQA 1V16A 2WM8A 4J0CA 4XE5A 1GZ5A 1SK8A 5FV3A 2ZMKA 3PC3A 3CJXA 1Y1TA 1OBVA 3ECSA 3HBNA 5A05A 4M8SA 1ZM1A 4LECA 3PJYA 4HUTA 4HAIA 3HJTA 4Z9XA 1PKEA 5T6MA 4QGGA 2E33A 3UF0A 4U7WA 5KTNA 5IHXA 4Q34A 3CQ9A 3CZ5A 3E7XA 1GTRA 3TN91 4D4LA 4DV1B 2QDKA 4OLBA 1IY8A 3HH8A 1RKVA 3K9BA 1PLLA 5FWNA 4ZHNA 4MWBA 1XDGA 4M54A 4NDZA 3BE5A 3S1AB 5C4GB 1ODLA 1NVVR 3HKBA 2WWIA 1Y3TA 3O0WA 1T13A 4J1TC 2GMMA 1YKFA 1ODIA 4QBGB 1WXXA 1NU8A 5KYKA 3JQFA 3CKLA 1DAPA 3BXGA 4OXKA 4RORA 3EQ7A 3HL0A 3ZHSA 3DAHA 2P5YA 4IILA 3AT1A 4GF5A 2Z4SA 4X95A 1S3SA 1WCIB 4M00A 5BNFA 1JDUA 4HEA6 3EUWA 4RMGA 5DM0A 4HLCA 3W78A 1NCQB 2XCSB 4JTNA 4B47A 4JLKA 1N2ZA 5AJUA 3KSMA 4N0PA 3VBHA 3GEMA 4AUNA 3FOZA 3ZV5A 3VSCA 1SIOA 4G85A 2O0LA 2QUKA 4IQ8A 3A9TA 1GQRA 3QIAA 2Y34A 5IM4A 1W36B 4MULA 1SWVA 1RBZA 4KYIB 3T9BA 4X91A 3FZ3A 1CFZA 4CDXA 4QPIC 5HF6A 4RGBA 4EKYA 4G0NA 2RHLA 3LWCA 1IH8A 1IN8A 1U2SA 3WLIA 1S8AA 1P4RA 2C59A 5DT2A 1E5DA 1BQPA 3DF9A 4XI9A 1P45A 1A9XA 2QLFA 3UHJA 4ZYLA 1TJ4A 4PXYA 3ZVLA 1ZISA 2PUVA 5TGTA 4C4PA 2CMFA 5EXSA 4P1ZA 1XVUA 3PENA 1AGRA 4U8HA 4DNPA 2ZXUA 1QZUA 4CEHB 1X80B 2JGNA 1COWD 2J5BA 2DQ4A 2C77A 4XMAA 1WA4A 1KZ1A 1ZVJA 3HZZA 2SHKA 1VPTA 4B45A 4YMHA 4FMDB 5CAEA 1W2NA 2P75A 5JCJA 5LU8A 5JDCA 3NTXA 1Y82A 2PT5A 2XZDA 2FDGA 1RZRA 5I51A 1T26A 3UB2A 2P4QA 3H3FA 1SFNA 5KCMA 2QQ0A 4WFJA 3JRXA 3KWJA 2B0JA 4HJRA 4TQ9A 3VX3A 3S2ZA 5HCNA 1D1TA 2VTKA 3DDUA 1DAKA 2N46A 3DBIA 4RGAA 4JI0B 4KB5A 3TOSA 4FYKA 4AB1A 3WO1A 3CH4B 4G9GA 3V4VB 1DWQA 3BCHA 4TMTA 2VW0A 1ESDA 3V1YA 1N1YA 4IJUA 5CBPA 2IYNA 3F3SA 3F4BA 3DTVB 1EX9A 2NP6A 1BLZA 2BV4A 4I5DA 1NDQA 4OJTA 3ZGNA 3G85A 3QPCA 2CFOA 2DOKA 1KBZA 1T8UA 2RHMA 5TQ2B 3GC6A 1MA3A 4CM7A 3FPAA 3K9WA 1EUCA 3ZCQA 3SQOA 1DEAA 2HTFA 2FMTA 1QE5A 3ND7A 4XBQA 4JT4A 5SYNA 3PXCX 5LKAA 5G4KB 2V3CC 1ORVA 4DUYB 1YUNA 4PPFA 5TNXA 1C1DB 4YRKA 1MFPA 2JFQA 3E4DA 5BPFA 1JJVA 4QRHA 1SXQA 3QF4A 3AONB 1EI9A 1NUKA 1Q83A 2QLNA 1JJFA 2BHLA 2QP9X 1RMTA 1LQ2A 2AE2A 3IKVA 2VCYA 1QJU2 1HRV3 1AQYA 1M2EA 4XFFA 4QHSA 3LY8A 2WM9B 3G8YA 3Q5EA 3AXSA 1I5OA 4QGHA 4ER5A 3TEMA 1VIMA 3WL4A 4UASA 3PFCA 1CUHA 3FKQA 1GBGA 5LZ8A 4ZU3A 5F21A 2HA6A 5TJ9A 3WMGA 1KO5A 1FUEA 4TGLA 1AR93 4XM2A 3WDMA 4V0LA 4B6QA 5C9AA 3QKSB 3RBAA 1OOEA 3ER8A 4MW2A 3LHSA 4OBWA 2Q49A 3VDNB 3CYFA 4TL8A 2L17A 4D96A 1TZKA 2ETVA 4MWGA 2EP5A 2QN7A 2VHWA 2H52A 1NIPA 2J9XB 4H1TA 2XE6A 4BN0A 1DQPA 3TQOA 1I5EA 4F5DA 2H92A 2VUDA 3DMRA 5F5XA 3H42B 4AWXA 2XLAA 1FZTA 3E8MA 1YJ5A 2WZPP 1VMAA 4BQQA 2A84A 1QQP2 4GOND 3HJNA 2HCTA 3NEPX 3B5JA 4QUEA 3EEIA 3QA3E 3IDEA 3QD6A 2V7QD 2W93A 2Y3IA 3RV3A 5BPHA 2RH5A 2JBWA 3UHFA 1KS5A 4JOBA 4COUA 4AN0A 2B4KA 2N1MA 3LAGA 4ZREA 4XD7A 2O8VA 3T7TA 1Q91A 1O8CA 1OBNA 3MWEA 4MYCA 5JNTA 1VIDA 4K6GA 2GK3A 2X9VA 1UOGA 3ZYJB 3FFTA 1Q6YA 1BHO1 2P6RA 3OZUA 3RANA 1ONSA 3Q87B 3KUKA 2UYBA 3F2ZA 3E58A 2IIBA 1C8M3 1OPMA 5KYXB 1MS1A 4MS3B 3Q7SA 4DCCA 2MEV1 1H1DA 2OCDA 3N74A 3QLUA 1XPWA 1EGMB 1B35B 4LY3A 2E2WA 4Q3DA 1ZRFA 3QEJA 3K1ZA 1ZC4A 4MRMB 4UC0A 3I3EA 3L1UA 2OAP1 4LY0A 2YOFA 2K7ZA 4HVQA 2YHIB 2E6VA 1SMKA 3ZHCA 3MAGA 1LPNA 2E87A 1KARA 3U2QA 5GGXA 5AK3A 3UV6A 2JLCA 1G3MA 3ANTA 2P67A 1OLQA 1I9GA 3I9MA 1WWYA 4NFYA 5KTYA 3D31A 1TM5E 3EJKA 5LRRA 4JUIA 4K86A 2VTDA 2LNDA 2IUEA 4OXNA 2JD9A 5U4QA 4BOYA 1KY5A 3CH6A 3ALQA 1LBTA 2GD2A 2PQQA 3H3XA 2ZGQA 2IE8A 2JH3A 4LYDA 1FRZA 2QK4A 3C6QA 1O4ZA 1VRBA 2JXAA 2YV4A 4MW0A 2C03A 3FI0A 4NS1A 3PVBB 4C91A 1EWVA 4WEOA 4OD0A 5FUQA 1FPN2 2XD9A 3U26A 3H9AA 1UX6A 1ZZEA 1QMJA 5IM4F 1U94A 1NAIA 1H2YA 3QFCA 4R1MA 4TRNA 1NVEA 3KYDA 3VNUA 1NRWA 3PE3A 3E9ZA 3VSEA 3U49A 1I6KA 3ZHUA 3U0BA 4LBZA 1AXEA 5D01A 1KZHA 3PGA1 5LBTA 5FIXA 4K9DA 1K45A 1V9CA 3MXOA 1S2OA 1Z37A 1BWQA 3OWOA 2JICA 5BWNA 4HK9A 1ULDA 2C42A 4FFHA 1SB8A 1T1IA 3PRHA 3OZFA 3FDFA 3GLFA 5BW4A 2H31A 3A22A 3IA7A 3ACCA 5EJ5A 2UZIR 3NNNA 2RI0A 3MEQA 1JUDA 4MVJA 3AK0A 4BO3A 4LKSA 4A7ZA 4BYYA 5E16A 4D79A 1VL8A 2H16A 3PR3A 3M1IA 4H4EA 5DHTA 2JEOA 3GJSA 1UY2A 5I47A 3V4LA 3K6SB 2JK1A 1LRKA 3ILHA 4UHDA 4CN9A 2V7PA 2D97A 4KN8A 2CWWA 1EV12 1J0XO 3PEUA 3NWPA 4QOIA 1XB2A 1ORTA 4PZEA 3EQ6A 2QAIA 4W4TA 4GMHA 2HIAA 1SZPA 3L9JT 4O3MA 4IVPA 1Q12A 3M9XA 3BIXA 5K4LA 1USIA 4NHXA 3F74A 2FDCA 2FZWA 2WLQA 4IGQA 4O2BF 3OBAA 2O1XA 3LFTA 5JATA 1RT9A 4FQ7A 5F73A 3ESBA 3RRMA 4PHTA 5E9JA 3QE3A 4D94A 4ME6A 3IUJA 1HURA 3ZXAC 3Q5GA 2X6RA 2VO1A 2CJWA 4MCJA 4TQUS 3WNKA 3CPJB 4LKFA 1W2UA 2Y0BA 2B5HA 5A4DA 5JUWA 4OKSA 1Q21A 3KQUA 1K7YA 2XZTA 5PNTA 2VDWA 1N2EA 5AHWA 1HQNA 5I4KA 3N86A 4RK5A 4CUBA 4DY6A 3RU3A 1KAMA 3D8UA 3JXSA 2Z5FA 3NHWA 3IULA 2O07A 1QOZA 4CDUC 2CK3A 2TMYA 3WG9A 4NPMA 4FX2A 4DXTA 3VR6A 5FZBA 1VGVA 4Z92B 4P08A 1PR3A 4D4JA 4RVDA 1YCGA 3CLKA 2OESA 1MO4A 4ND4A 5GVSA 5EYPB 1M54A 5KEIA 5IVCA 4AQDA 4MUAA 4J0IA 5AVXA 1DIHA 4WXEA 2WA1A 5BV7A 3CJQA 3V2IA 4LYFA 4U9UA 1BBT3 5L7OC 3KCYA 4Y18A 4PBSA 4QVGA 4DLWA 3BGVA 2JVIA 2ODTX 5LQNA 4IFTA 4B74A 2JGKA 4P5DA 4Q00A 1Y89A 3C97A 2D2IA 3D1LA 1XXHE 3OHSX 4YRNA 3NYIA 3RTGA 1JNYA 5IT4A 2A67A 1UFQA 4P34A 5FJIA 4F3KA 3U7IA 3FG9A 2CC2A 1BCRB 4EHLA 2HWUA 1DVRA 1DIOB 1YDGA 3TZBA 3D2BA 1BMDA 3BRWA 1POV1 2VYVD 2BWCA 3VR5H 4Z4IA 4YJGB 2YBPA 4YMVA 1COV3 3VOSA 2HOQA 3ISJA 5GJBA 1C14A 3VR5D 1F51E 1X92A 4JLDA 3OCCA 4UHBA 3GH1A 1GV0A 4MA5A 5LP6B 5LA1A 5EHNA 1M2FA 3ZR5A 1H65A 1A8QA 1YR9A 4B4OA 5K0UA 5E6UA 2C2HA 1UOQA 5ALRA 3FPKA 3GFQA 1G8FA 4D6YA 1TKCA 1JQ5A 3ZYZA 2HDOA 4JS0A 2QQUA 3ONDA 1WKYA 3IQIX 1D5WA 1FRQA 2G4VA 1W94A 1UC8A 4XCAA 3CLVA 4AGVA 4N5MA 1TNRA 1SA0A 1YXWA 1Q7EA 3LMKA 3T9FA 2YV8A 3LQ4A 1TME2 1QE0A 2WZEA 3DF0A 3AESB 2LBPA 4OHPA 4HH1A 5KSPA 5IT0A 1K86A 1CYDA 3PU8A 4GXLA 4M3CA 5A7QA 1L4MA 1G9TA 4YHHB 3ZXDA 4LQRA 3W05A 1PVOA 2AZMA 3U7RA 5DX0A 3SYTA 3TK1A 2OM6A 2ISCA 4OX9Y 3EA0A 4IH1A 4F06A 1ZIXA 1WZCA 1P0CA 3D7LA 5HHTA 2Y26A 1EXVA 1ZR2A 1X7WA 3FWNA 3D8NA 1ZM9A 2JHAA 4UUAA 1G8PA 3ORJA 3VVCA 2Y1DA 2XTAA 2YJ6A 3B6MA 3ROXA 2VBCA 1XQXA 3R7NA 4HDSA 3O1SA 5KNCA 1OBOA 4JLSA 2PGXA 3ADPA 2VQSA 3TNLA 3IM0A 4MGIR 4G8BA 4P9YA 5LYJA 4Y1UA 5BUCA 1PGL2 1RPTA 1RHI3 1PZ9A 1IVNA 2IDMA 4HLUC 3UGJA 4NR1A 4UFPA 4RTPA 2QRGA 3BUCA 1T5TA 2HU8A 4HYQA 1T0HB 2FPSA 1IWBB 4RESA 4U2CA 2P41A 3M1LA 3QUSA 3MRSA 4QYIA 5BYJA 5LMZA 1DEXA 3I01M 1ZW6A 5EUMA 3U4HA 3Q3GE 1P29A 3WXMA 2B34A 4CPBA 3T7KA 4MPDA 2R00A 3NAZA 3RI9A 5K20A 5K8LA 4J1XA 1SCJA 5JSYA 4IJ5A 2JI4A 2PWYA 4F4DA 4UNPA 5DLDA 1DFIA 1JI3A 5FXVA 4OREX 4M01A 5L4LA 4BP8A 2A92A 5CB4A 3GAFA 2GN0A 5KYUA 4O65A 4HDOB 3T3HA 1FI2A 4UXJA 3I3BA 2A4KA 4Y6SA 4JJGA 2WZQA 3DZFA 2CVFA 4Q8LA 4LJSA 2WT8A 1OKKA 4ODIA 1IN4A 1DCFA 3EARA 5A32B 4RD4A 5CFCB 1M0SA 2ZB7A 3WNNA 1NFFA 5AHXA 3IJEB 2RV9A 5FADA 3PEWA 1JX6A 3DKVA 2ZIXA 2H6EA 2CDRA 3OZVA 1I5ZA 5JISA 1DB3A 3RYIA 1N9GB 3RQ0A 4IG4A 3GZNB 2LKCA 1QQBA 4CLRB 5FUVA 4FE3A 1U0OC 5CFZA 4XIGS 3K0SA 3SC2A 3CWCA 3F97A 4I19A 1F2UA 1SG0A 4TKUA 3N59A 1GGFA 3IDQA 3URKA 1XLTC 5FZOB 4NZZA 3USUA 5AJWA 4MUNA 4EPWA 4X20B 5KJEA 2X8AA 4QODA 3WYGA 5A5GA 3HCCA 4OGFA 2GOYA 1YDEA 2KQUA 5E0KB 8OHMA 3D64A 1V25A 3DOEA 1PUIA 1NG0A 2UU9B 5COBA 2L9LA 3PGKA 3OT1B 1WW6A 2RDNA 1JKJA 2P9BA 5K6RA 1GDDA 4P3NA 4WVVA 1XNJA 2Y2VA 5DHFA 1YZKA 3L6BA 1QMPA 5EMHA 4CRWB 3PSAA 4B35A 3HM9A 1LOGA 4Y0VA 3JQPA 4EFDA 1U1DA 2DFKB 3R5TA 4LX8A 3NKLA 2F1IA 5L3QB 4X63A 4GQAA 3A06A 3DDWA 5GIOE 2YY6A 4YS6A 4KI0A 4LYAA 2BE7A 1T0BA 2HXGA 1ONPA 3EB9A 3N2LA 4EATA 3HTXA 3EIHA 1N25A 4Q0QA 3PNSA 1MRNA 1UU5A 1TVMA 3PE4A 2WSBA 1UKZA 4G0OA 1LEHA 5ADWA 4F84A 2FPMA 2HPHA 4KX5A 1ZMTA 1S8FA 4A6XA 5A3JA 4O7XA 2P3LA 4IDGA 2X9NA 4MJXA 1QXSA 3VBCA 3OTFA 2XDWA 2Q6LA 2CDBA 1PLKA 3JQEA 2QAGC 3RSGA 4J9VA 3CISA 5HJ2A 2HF2A 5JOWA 4OGLA 4PC3A 2FDHA 5FZGA 1DQ0A 1JYTA 4UEKA 4LOSA 1DPGA 4KRYA 3SS7X 4YASA 3HY3A 1ADBA 4BQXA 3Q88A 2C5FA 4LMRA 4MH0R 3LPCA 1TU0A 5JVVA 5E89A 1T6NA 2DHQA 4XDZA 3KD4A 3MT0A 1DC4A 3H2GA 4H3SA 3EIOA 2BMWA 1E9VA 2EA7A 3VA7A 1RMQA 1RMU2 1NN0A 4O1HA 1U2DA 1NE6A 2GPAA 3OP1A 5JPCA 4O9GA 2DTEA 3L7AA 2G19A 1WOMA 4NARA 4N0DA 5L8VA 2ZBDA 3COZA 4KV7A 4IIJF 2MHFA 4DADA 4MS1B 2AJBA 1MOPA 2X86A 5DB4A 1TDJA 2WQ6A 4P5EA 4MX8A 3ONVA 5FY7A 4ND5A 4TX1A 4FPGA 3CA8A 1TOAA 1JAHA 2H1FA 5KYYB 3BTZA 2ZRDA 1LHUA 5CB0A 1CQIA 4WTOA 3ZJYA 3PLNA 4AROA 4E4SA 3W8NA 3HA3A 2JLYA 1AYM1 4K1YA 5A04A 1PI3A 3TXAA 3UWKA 3MAAC 1GPUA 5AXBA 2W94A 1QNLA 1ASJ2 1FU8A 3NRJA 3DE3X 2GILA 3H18A 4UW3A 1QGOA 3K31A 1BQ4A 3BVCA 4IUYA 1O3SA 2ZWOA 1Z0ZA 3W04A 2CY6A 3PF8A 5DWDA 4XLLA 1DOZA 4ILEA 1A50B 2R44A 2Y6JA 5C46F 3SP1A 3E9NA 4NECA 3FPCA 2C4XA 1KMMA 3KT3A 3W5HA 4BQSA 4DV6B 2BJSA 2RDSA 2GHQA 1H2FA 1OLSB 2P4SA 4U2GA 4XF3A 4B48A 1ZXBA 1NRIA 2DZDA 1QOTA 2PKCA 3ECCA 4ZU1X 1GAWA 5JEDA 2A0WA 2IOYA 4ZCRA 3LB9A 2X10A 1IIRA 4AKHA 4AWAA 2HPZA 3WX0A 3Q5DA 2I1QA 1LFDB 5EQJB 4JUDX 4PZ0A 2XGMA 1SOMA 1XSQA 1Y9JA 1RUOA 3JR7A 5HUQA 4AICA 2PWBA 2P1BA 1ZRDA 4YUXA 4RAOA 2I66A 4YV0A 3ES1A 3K2EA 2Q2OA 4P36A 3S44A 1W6NB 3COSA 1ZZ9A 2O0MA 1YQDA 5J40A 3V32A 1ZMOA 4WCFB 2IITA 5FYBA 4AEDA 3HCEA 4DMIA 2NUAB 3SS8A 2QQGA 1GPBA 3FXAA 1ML4A 5A1TA 4Q7KA 2VJBA 1VZ3A 2FQ1A 3CWZA 4P86A 4NOJA 5E1DA 1MZVA 3HU5A 1XJWA 4UBOA 5BNOC 3J80A 3UBMA 3QMVA 1TAUA 3WADA 2UY9A 1UPCA 3E6BA 4LJ7A 3O91A 4MHUA 2ZRLA 2Y05A 2FDIA 1K7SN 3AU8A 5DLYA 2X1LA 3BXEA 1H5UA 5ED0A 2V55B 1WETA 2PX4A 5DZGA 3ZXGA 5ITZB 4LGCA 1ZHOA 1GMMA 5IKPA 4DUZB 1TUGA 3TH5A 2W58A 3DBOB 2HDNB 5KWEA 5KJ1A 3NTVA 5BNNA 2NO6A 4AP5A 1NU6A 3ZXKA 1IKPA 1WNFA 5L6MB 1ND5A 1GPJA 2AR7A 4UFIA 4D80A 4IMIB 3KTOA 4IW3A 2EX4A 3WP3A 5FNVF 1M1YB 2VCAA 2GHRA 2W2MA 5JSUA 3GF6A 3WAGA 2BZDA 3KLSA 4JT8A 3G2MA 3UMSA 1F1JA 5FUNA 4WV8A 5HXMA 4L5JA 2H4JA 4KFCA 4Q4HB 3LS2A 4MGYE 5GALA 1OFSA 1V5WA 3T3GA 3QXHA 4OXIA 1JOJA 2GD1O 4C7OB 2AOUB 3MLLA 3VBRB 2AC1A 3WNQA 3LW7A 4QQPA 1Q3KA 1KEVA 2Q1FA 2J1LA 3CRW1 2ARKA 4K6CA 4RVOA 2QMOA 2DPGA 2DXIA 4L5AA 4KUGA 2VOEA 2BGLA 4C4OA 2C04A 3B00A 4S1VA 1YRWA 4X90A 3AMVA 2QQVA 1J33A 4FFOA 2OYRA 5AI5A 1PBNA 5AJYA 4EK9A 1FSFA 1XZEA 2G7MC 3PXEA 3ASVA 3SJ7A 1G55A 1CZHA 2ZTHA 3G0BA 3I73A 1KVTA 3VGIA 2ZJFA 3KVBA 5JHHB 4IINA 2J1TA 1R9GA 3RVKA 1E2JA 4BQFA 3PSHA 3BJRA 3NGLA 4M1SA 3BOPA 4RJIA 4YALA 3U1XA 2XBO2 4YCAA 3SKVA 3ZBUA 3K73O 1PKXA 1U3UA 3H99A 5IUKC 1VE7A 1TVCA 3RU9A 3O7OA 1TM2A 3HS3A 2ORXA 1QYRA 2JFZA 3L7DA 4DVGA 1YR3A 1ID1A 2GRJA 2JA1A 1Q8PA 2E1RA 3VH4A 3L8YA 4BNDA 3JSXA 1OIVA 4ENWA 4LBQD 4MQBA 1JQ3A 3X1ZA 1HYQA 4EROA 3RT9A 3H11B 2WFPA 4HQ0A 5AC91 4V2WA 1JEEA 4Y2SA 5ALIA 4HSEA 2I7TA 1PR1A 1E3DA 2HA3A 4LDQA 5AUPB 4PF1A 3IQGX 3OJXA 3JQAD 5BSWA 4JITA 5IAEA 3SCFA 3P3PA 5K6AA 3H5NA 5FP4A 2NM1A 5JPDA 1OFVA 2JH9A 1W9SA 1RP1A 3VBUC 4XOUA 5LLDA 2LALA 5IJAA 2BSQA 4DYDA 4TT3A 3ETQA 1RJWA 2VDRB 1R0XA 4DQVA 1S55A 1ZM4A 2B99A 4BQ4A 4Q4W3 3OEYA 2YWXA 4V1CB 4BH9A 2ETEA 3MIHA 2Y60A 1Y37A 1ZJJA 2EJUA 4JB3A 3I37X 4GOJA 1XP8A 3RC1A 3W34A 4GB31 3QTTA 3O92A 4PDWC 1JDTA 3GEBA 3QOFA 4L2NA 1P44A 3CZMA 4RS3A 4DSOA 1MZPA 2X8LA 3RS8A 5HUHA 4BUZA 1FJHA 4QDSA 2OGWA 4RX1A 2WE7A 3N0XA 1RRCA 1KOJA 1AYN1 4ZYWA 2B98A 4I5IA 2PYTA 2JB9A 3WRYC 4PQRA 2J45A 2QTTA 2G7ZA 2JDHA 2X5IA 4CMIA 4YNIA 3TLKA 4UHCA 4LBJA 4JHZA 3LEGA 2Q5JA 5JQGF 1AM4D 1IATA 3ZV4A 2H0AA 2QTMA 1N47A 1YS9A 4Q1AA 2HKXA 3FUWA 4IGAA 2FRXA 3M7IA 2QP4A 4QTZA 4Z1MA 1JQAA 3L7OA 1UINA 3PC8A 2I67A 3HFGA 1JL3A 4J8PA 3M4FA 2ORVA 5AVKA 3ZE1B 5F1YA 1R6BX 2ET6A 4LJ9A 1XZDA 3DP7A 5AW3A 4JGIA 1SAYA 4QXKA 1C9KA 2ZZNA 1VBA3 4CEWB 1H1TA 1LGNA 1PVXA 4P22A 2C7OA 3UWMA 4OLLA 2FZ2A 1GUAA 4PZ9A 3D6HA 3PFNA 2XNSA 1GTJ1 3GLVA 5IK2D 1EK6A 2NSJA 4IOLA 2VVEA 4ARYA 2F62A 1JLMA 2W8BA 4ZC8A 3VBFB 1D2AA 4FD2A 2ATXA 1FFDA 4J0EA 3K77A 4CF7A 5F9TA 1QTIA 4GR4A 1BO6A 4GKXA 4L8WB 2B4AA 2DKFA 5BNPC 3OF5A 3QE4A 4MV6A 1QHSA 5BN3A 4M4RA 5L7TA 3BCUA 3GNSA 4EARA 3WW3A 3RPEA 2ON6A 5P21A 3QEMB 3FNRA 3EN0A 2CUZA 1J5EB 2YZ2A 4NIAA 3KYIB 3L0IB 1OA0A 2PGIA 2I7DA 5TGZA 2ZI9A 1RWMA 3EVTA 4WBSA 1Q7BA 3L8FA 5KPDA 2YC2A 3T3OA 1RITA 2Q4SA 4KQKA 2XVGA 4U9HS 2HWE1 2Z83A 4MGKE 1OPRA 1Q20A 3O7MA 1WBDA 1N2GA 1HDIA 4CJXA 3R24A 3GYBA 1M1XB 1VAMA 4EELA 4EG4A 5AOAA 2OHHA 3I5MA 2LCQA 1BH6A 4MXWA 4YI5A 5GM2A 1N1VA 3CLRC 4S24A 4R41A 1JALA 4Y5TA 1QAQA 5GAJA 5T5LA 4LTDA 3FYCA 1A7JA 4ZT4A 5AK0A 2QLLA 3BMOA 3EXG2 4OHMA 2WUWE 3QVVA 3FHCB 3IQHX 3JZVA 3DQPA 3OPTA 2HWC3 4OHBA 5DX1A 1VPWA 1NNI1 1OX5A 4E5DA 4MWCA 3KJZA 5CDFA 2XV1A 2VF4X 5BMVB 3HM2A 3E5HA 1G4AE 4TMZA 4ZTUB 2TRSB 3PWTA 4PNPA 1DBIA 4HNGA 3K5WA 1WUKS 4YJKA 2NYRA 2WG1A 2O6HA 4A2WA 3V6MA 3GFFA 4RZHA 3B85A 3OJBA 4CKBB 3RC9A 2ERCA 1E5TA 4FTSA 4TM8A 3U11A 1LRHA 1XAIA 2PLAA 2XQIA 4I6EA 3TBHA 3GRRA 1FNMA 2XMRA 4J90A 4RJ2A 1HDCA 3GRZA 1AR73 2J32A 1Y8QB 4AM8A 4WUVA 3AB3A 1U04A 3F0TA 3V1MA 1UWVA 4J7AA 2IHTA 1ULPA 2QNIA 4QEZA 3EZ6A 3PFIA 3BULA 4Y2XA 3ZW8A 1GZTA 2JG8A 1Z26A 4NQZA 1Z45A 3MXTA 3ZMNA 3NPAA 3ZD7A 4FFBB 1OFHA 5FREA 2HRRA 1IN5A 5IJXA 4EV0A 4HWPA 3RZGA 2VGDA 5G3ZA 5IJWA 5HZMA 3IBMA 1E4EB 3RRDA 3K0HA 1W9WA 5JD4A 1YI1A 3OECA 2E89A 3DKQA 2J1UA 2EBWA 1G5HA 3VVBA 3JVVA 1FMFA 1Y4DE 4LY6A 2RS31 2Y8KA 1J2YA 2YZ7A 2JGDB 5EPEA 2W4QA 1OFIA 1FNCA 5FZAA 4IDDA 2X0DA 5DM1A 3O94A 4N7IA 1Z4KA 2VK8A 4A6EA 1PK6B 1CIWA 2ZXEA 2C61A 2FZCA 3C7GA 1MZEA 1AB5A 1F14A 1ZG3A 5EP3A 2HHLA 1P5HA 4GYKA 1PM7A 3SX0A 2VPPA 2HWB3 5CVVA 1NWCA 1DAMA 4QZVA 4NHKA 5HX7A 4P3KA 2RGXA 4X64B 3FD8A 1FAYA 1AX1A 3LT4A 3PU6A 1MAAA 3A9UA 3SDZA 4Y6QA 2WU8A 1JH5A 1ZY2A 2WK1A 2CZGA 1YR6A 1A4XA 3RYFB 2UYQA 2V4VA 1XNBA 3J81A 2D4HA 3BFXA 4CT0A 5G05L 3RVSA 4NY1A 8ATCA 4OYUA 4N40A 1OQDA 5K3CA 2WJWA 5GPBA 2R7MA 3UUFA 4BNJA 3HK2A 1NBOA 3L6EA 4E4YA 4OMUA 2BQPA 2VNSA 3E03A 3ULKA 4DCMA 3D02A 2X5KO 4R52A 3WGTA 1CQZA 3VQTA 1K5HA 3O4HA 2OMEA 1PJCA 2FLWA 1LCIA 5AKXA 1QTNA 3PF9A 2K87A 4S2DA 3ESAA 2ZHMA 4RY8A 3SDBA 4BZWA 4OLJA 4CU9A 4MWOA 3E0XA 3FTNA 5FPUA 2YZ4A 5KKCA 3VZRA 4Q9LA 2ZJYA 4ZDWA 2VUIB 4FZJA 2PY6A 1U0NA 4ZZ8A 4YR7A 4XCQA 3HE3A 2JKXA 4CQNA 5CFRA 4LLOA 1ZGGA 3DVSX 1XRQA 5CIQA 3R3SA 5EHDA 3GJ7A 3STUA 3AEUB 4MB0A 5A3WA 4BNHA 1NV8A 1T3HA 1JHJA 3X1XA 1VKOA 1P3JA 3TBKA 3TTWA 5HKKA 3H8VA 3B1YA 5LNK1 4EA8A 2X7HA 2G9ZA 3KPWA 2WM3A 3ZN6B 1B16A 5LY2A 2YW2A 1ZMBA 2KSQA 3KOWA 1CJSA 4DR2B 1M8KA 3OFVA 3DEKA 1Q0QA 3M1AA 3V3KA 1JHDA 2ZGRA 2OC9A 1Q16A 2JIQA 3HUDA 2XVLA 1BQ3A 3CJIC 1PJBA 2MPFA 1UPBA 1CIVA 4AVCA 1GKYA 3GY0A 5DKFA 2C4UA 1XRNA 1AYN2 5IP5A 4BLWA 1LHOA 1RTVA 2R6HA 4FPYA 1TADA 2VPXA 1EUUA 2QE7A 3HHEA 4CDMA 3UUWA 2NQTA 2O9JA 5JARA 3AYEA 3AKCA 2W46A 2QI9C 5I8ZA 4QXBA 1PZGA 3AR6A 4M53A 4R6WA 2YPDA 2FMXA 4XIKA 5CH3A 2XWBB 1C57A 4EW1A 2A1IA 4JLOA 3C87A 4FP3A 2RGDA 1SFPA 3B6IA 1ULHA 5TQ0B 2RIPA 2I4RA 2BNNA 2VQ6A 3GMDA 1SZBA 3KR0A 1PZFA 2A1UA 3O8DA 1M3SA 2FN3A 1IOZA 4G5GA 1UKRA 4DHEA 2XG3A 2OR3A 5I8WA 3GDGA 1GUIA 5CADA 4KJXA 4AYTA 1DDGA 4NZPA 4INZA 5FP0A 4Z0TA 1IXZA 2XB6A 1MJHA 2BMJA 1DQZA 4KO3S 2EHDA 4OQYA 4D82A 3NKGA 4OLAA 3AMQA 3DZIA 1AL23 4C78A 3DEHA 4AJIA 4WX2B 5HQ3B 2QNBA 1SVLA 1N3LA 2EZUA 4YT5A 2QRQA 1J25A 3BU0A 3AHHA 3MW3A 4V39A 3T34A 5EWJB 1CZKA 2OCKA 3WR5A 4Z3OA 2X4IA 4ZRMA 4MAFA 4N7MA 2RCYA 1XTQA 5ERXA 5I8SA 1KR2A 4KPUA 1XSRA 2CZCA 3LSDA 4EJSB 3IUBA 4L9AA 2XUMA 1E1QD 3OX2A 3OCVA 1W48A 5HIIA 1LZLA 2DSNA 1P2GA 3RUAA 2XQXA 4ES6A 1A95A 1H9CA 2VZ3A 4EG0A 3R4SA 1EFVA 2JIBA 4S2GA 4G5XA 5IKEA 1G2PA 4ZKDA 1P7ZA 4XJZA 2I03A 2VZUA 3KKPA 1E9DA 3ACFA 3MRXA 5IWCA 2YV5A 4GSYA 3KUDA 4H27A 2WLPA 3A2NA 2HFJA 4WADA 5A9SA 3CR8A 1G98A 1UO9A 3B5IA 4ZO9A 3ND5A 5I3CA 2C2MA 3EOBI 2PDAA 2RGWA 4TKMA 2WYOA 4AJEA 1XNRB 2ZETA 3IEMA 4ROTA 3TL3A 5DTJA 2JCSA 3O2NA 3MJCA 2BW0A 4KQFA 5HDBB 5BURA 2IXKA 1GU3A 4IV5A 2P3IA 1ZGBA 5DV9A 3ZQ6A 2UUAB 3BYWA 4YLGA 2EW1A 2W6JD 4PM4A 3OD1A 4EF6A 1SXHA 1G5RA 2QN2A 4DYHA 5EPAA 2ZJ6A 2QRNA 4RO0A 2HR1A 4MYRA 1V6NA 2RR13 3JBG3 2CKDA 4L78A 2PHXA 5FBRB 4M55A 4Q0UA 2CHGA 1LGYA 4RS5B 4RCVA 4DGSA 3F5MA 3U3ZA 4FMBB 1T24A 3FWYA 2QR5A 3SHWA 3CZ9A 1AGYA 4GH4C 1VP9A 4Y2QA 3VPAA 3DLBA 4KXQA 1TJPB 1OLXB 2K6GA 3QE0A 3PNQA 4LHYA 3PJQA 4M1YA 2GPYA 4IIBA 1IFXA 1ND6A 2J3DA 2Y67A 3FR7A 1R0KA 3RU7A 2PL9A 1GPDG 4A6DA 4TKLA 2IXFA 4QQ2A 3K9NA 4AZ3A 1F4AA 4NJ4A 3EGWA 2P3OA 2LCFA 1GZ4A 1IXYA 4AGGA 4LQLA 2X0EA 5KC6A 3UKJA 1F2TA 2Q1YA 2NN8A 4GL2A 1T0PA 3OBIA 1M6VA 1YT5A 4OAQA 2Y1WA 4QOEA 1E3JA 3C3AA 4QJIA 2OXFA 2H29A 2R043 521PA 3CLHA 7ADHA 4KNWA 1C9DB 3MJSA 3CJTA 3M6VA 1JR4A 1IQAA 3ZHTA 5JSQA 1C3JA 1EAH1 1JIUA 2ISSD 1YRAA 1EKXA 4M99A 3DT6A 5IAAA 3H05A 4XTMA 3SE7A 1KVRA 4PU0A 2VUCA 4L73A 1S2LA 1Z7S2 5H68A 4GGPA 1VKRA 1DU4A 3BPSA 1NX9A 1UEIA 4U2FA 2NAPA 3SVZA 5EHGA 4XPIB 3R5HA 1AUYA 1FTWA 4MSVA 3A1WA 3RV4A 1XU4A 5ALJA 4Q16A 1W8TA 2VRCA 3RZJA 4CF5A 1HPLA 4JJIA 5CU1A 1N6RA 4A7KA 1JQBA 5BN5B 3GUUA 3GGJA 1Z78A 5GINE 2B3TA 4JLPA 4UJ5A 4NJOA 1H8HA 1XG5A 3MS4A 1OWMA 3KS7A 1R0CA 2RGUA 3FUCA 3TNQA 3LQFA 2RS11 3AERB 1VG1A 4A2QA 2QSYA 1PS8A 5A3RA 1GPMA 3A3NA 4JL5A 5HG0A 3THYB 3ZHZA 1JTEA 4LHKA 5IKOA 2G17A 3T7CA 3GMTA 1F0PA 1PZHA 3NUZA 4RHYA 3NYQA 3DN7A 3VU9A 1GG9A 3IS3A 2NACA 2RGAA 5K03A 3FNHA 2RJNA 1JWBB 4HUQA 1N3BA 5A33A 4PV7A 3FB1A 2I62A 3K70B 1LULA 1EWYA 4IM7A 5G02A 4BCBA 3ZWNA 3U62A 1EE1A 2GBCA 1WUJS 3UJ3X 1RI4A 1DRWA 4G9BA 5FO0A 4HVTA 4O2BA 2R4TA 5JADA 3A10A 3ZFFC 1P9WA 3CRVA 1O1YA 1LJ8A 4LIVA 4EYGA 3AR5A 4URTA 1PIWA 5G04L 4KE8A 5FPKA 4Y1VA 5DOZA 2FX2A 1W8WA 2RJ2A 1KDKA 4KO4S 3SHVA 4A8TA 1D0GA 1G0OA 3S28A 3TGPA 1E5SA 4UULA 1C8LA 2G83A 4DY3A 3DL0A 2FEAA 3KVYA 1CW2B 2DFVA 3AYXB 3QK7A 4AJ9A 4DLYA 1TT5B 4ESEA 2X42A 4HNQA 5ARBA 4AJOA 1LNSA 5KI6A 3TZLA 2CDOA 4C0BA 4IFIA 1NQWA 5F4ZA 2WNUA 2E1PA 1M1ZA 1RQNA 2WO1A 2OB2A 3TZEA 3OIVA 1DIBA 1WKBA 5CD9A 3WOVA 1W8FA 3BS4A 1W1IA 3GEIA 3DAOA 4G26A 3A26A 4A0FA 3SH4A 1JKIA 1L7AA 2KM2A 2FVYA 1XMQB 2YH2A 4EZHA 3C98A 1NA1B 3VR0A 2WDBA 1BX0A 4MTLA 1S2KA 5LBEA 5CB7A 4C7VA 3OIWA 4C0LA 2O3SA 5DI3A 3L0BA 4MICA 1R37A 4AK3A 1LKZA 2HJIA 4ARUA 4XJUA 2ZIWB 4PS0A 4REOA 4BBAA 4TWTA 3E22A 1FXSA 2VJYA 3GPIA 1CQJB 5FDFA 3R3VA 1LDGA 1N5IA 5FZCA 3GLSA 4HTAA 4J2TA 1J56A 1FXWF 1TKAA 2IFWA 1NCRA 3B6EA 4RXTA 1XNDA 2WAOA 1U9ZA 2Q1TA 3FSGD 1IEQA 3EB7A 2CNDA 4ND3A 4HDMA 3NI2A 1SVOA 4H17A 3B1KA 2DTXA 2VYFA 3PPXA 3DCQA 4D8MA 4RVSA 2D2XA 2VTBB 3S99A 5ELLA 1ZBA1 3RZKA 1AS2A 2AG8A 4ID3A 4Q03A 2J87A 1QHHA 3LV8A 4QBHA 4XIYA 4X6UA 3HADA 3UV7A 4JEHA 5DLEA 4Z86A 4ES9A 3FFXA 2AN9A 2VXJA 1Y3DE 4RD2A 5DHSA 3KPYA 3RPQA 1PL8A 4UI9L 2QVCA 3WD5A 2VJLA 4JUBA 3EXEA 4M88A 1QU3A 3H8XA 2OG1A 3VC3A 1UT8A 3NHAA 2HIGA 3R8XA 1NVBA 2CVHA 3GRFA 2ZW9A 4QB2A 5B36A 3C5CA 2GJ9A 2BFFB 5AI9A 4B3JA 1JZSA 1RHRA 4CT5A 1JR2A 2DBYA 2ZWIA 1N7HA 3FPSA 2CXUA 3FCUB 1FSSA 3BFVA 1AK1A 3RVOA 4XJXA 2FX3A 3P8ZA 2FP4B 5CEJA 3OLVA 2Q4DA 4ZA2A 4ZC1A 2X14A 1H6BA 2CFTA 2B7YA 1Y9GA 1W46A 5AW4A 4E3WA 2DQKA 4CCKA 2C8VA 1O5OA 1K98A 1Z0IA 3K2BA 3M5WA 1JDJA 5LXTA 2C92A 4JIMA 3ZWCA 2B4TO 2YASA 1RQGA 1TB4A 1UBLS 4HH0A 3LCVB 5J23A 4AWDA 3IBSA 2YYAA 3VR1A 1FFWA 4BLOA 1RHUA 3WSWA 1ACCA 2X8JA 3OIDA 3DOHA 5H1YA 3QXGA 3JD1A 4O2AB 5TQJA 5CTAA 4E5SA 2PRJA 1TLFA 3AEKB 4EAQA 3MK31 5REQA 1QF3A 5KSWB 3CC8A 4JLMA 3MWDB 5KQSA 1AJEA 3U37A 2GJ4A 2GRUA 2IHJA 1CJCA 1QUEA 4TVOA 1LPPA 3QKRA 3CEPB 1LBEA 2IU3A 3INGA 2HMUA 2NN3C 2VRWA 2AACA 5FO9B 4C29A 4YUYA 3SK0A 4QBIA 2FN9A 3SNMA 3W9UA 2DT8A 5EHIA 3NO4A 4LZLA 3TN92 4C08A 3GP3A 3S2SA 1IZ7A 1K6XA 1FP1D 1EJ0A 3N8GA 4CODB 3POYA 1V41E 4JH0A 1WNTA 2GU9A 4G0UA 1E7WA 1GG5A 4DJDC 5A7GA 2J7PA 4ASMB 4H55A 4BZZA 3PHLA 3VO9A 3JY6A 1X7YA 4KKXB 2Q7XA 1GN9A 1YDHA 3TQRA 3MC1A 2P4UA 4DR4B 1J2JA 4FOTA 3C7AA 3L93A 4G0YA 4CKCA 5C35A 5HW0A 4B2YA 2A4MA 1QFMA 3BK2A 4QAQA 4PWYA 3ETEA 2LP4Y 4YMUA 4C2UA 4CDQA 3PDJA 2UURA 1U2PA 1MQAA 3ETHA 2OT3B 1KPGA 4TTQA 3CEWA 1J8FA 1ISSA 1XMSA 2C2BA 2IYQA 4R1OA 1NZDA 4Q48A 4AIRA 4HEQA 4C89A 1XIVA 4OKNA 4PBPA 2YX1A 4JHTA 3AY3A 4OUKX 4ECEA 3B9PA 1CRWG 4C0HA 2JD2A 4ZKEA 3S7ZA 3EK2A 4ZOLF 3SCGA 1WCDJ 1UKBA 1U3GA 4I2OA 4NCNA 2DUQA 3FYHA 5EA2A 2G08A 5BOSA 3S4YA 4DA6A 4B7CA 2BELA 3R1IA 1CF4A 3WB0A 5HBGA 1F4VA 1C7FA 5DIFA 3GQBA 1W85A 2W90A 4PBOA 1KEPA 3TCKA 4ZN6A 3GLHE 3W2FA 5TC4A 1CQWA 4BGEA 1YE3A 2ORYA 3OZBA 3G0OA 3WGVA 2WO2A 2CVQA 5JLJA 2Z9CA 3W8EA 2D1QA 2PH1A 3HJUA 4G89A 4OMFG 3L0YA 1TEVA 1LQUA 3QLVA 1HYEA 4YPOA 2V6MA 4Y67A 4AY2A 3ZZTA 4HZIA 2WVJA 1U3CA 2PJRA 5SY4A 2PD3A 3ZD9A 3O1PA 4MYTA 2FGKA 1M2JA 1RWNA 5EJ9A 3ERCA 4NAUA 4N65A 4Q4V3 3GRAA 5LMCA 3PJFA 1G2QA 4D9KA 4CDWB 3KQVA 3TF5A 3PWZA 4HXGA 4UE6A 3MTGA 4NBLA 3TCNA 1RLOA 1SLLA 1MEOA 3KAKA 3IUPA 2Z2YA 1F0YA 3KTAB 4CCCA 3VH2A 4IIJA 1VAVA 3ZEAA 4LV8B 4YJ2F 3ZI0A 1SY7A 2H18A 2IY8A 3LCCA 5JI2E 2Z79A 2VQEB 1NKGA 5DAXA 4O8ZA 4I1VA 1YQUA 2X40A 1UIJA 3IDFA 3B51X 3KS9A 5F78A 1WQ3A 4YFZA 1MFZA 4I2NA 4AEMA 2FZLA 3MJ4A 1N7GA 4XYLA 4FINA 1RUI1 1GNPA 1FUIA 4ZOEA 2YC0A 4ZS2A 1D6SA 3BDIA 1KWGA 3IURA 4IXNA