1NA1B

The structure of hrv14 when complexed with pleconaril
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
molecule tags Virus
molecule keywords Coat protein VP1
total genus 51
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1na1B00
4RR3A 1QJX2 4N43C 2HWD1 2FZ1A 1NCQA 3VBSA 5C4WC 1COV2 3VBOA 1HRI3 2GH8A 1FOD2 4NWWA 2WFF2 4IV3A 3ZFFB 1AR63 3VBHC 3TN92 5CFDB 1RUJ1 4WM8C 1ND3B 4QPIB 1AYN2 2X5IC 1K5MB 1ASJ2 5LK7B 1CJDA 2HWC1 4CDWA 2R042 1PGW1 2WS92 1NOVA 1ZBA1 2X5IB 1NA1C 1COV3 4QPIC 2RM22 2ZAHA 1NCQB 3VBSB 5JZGC 1AYN1 5A33A 1MQTA 1RUJ2 1R1A3 2BBVA 5DDJ2 5L7OC 4YVSB 4Q4Y1 1AL23 5C8CC 5C4WB 4RR3C 4CEYC 2XBO1 4Q4X3 5ABJA 2RS53 1ND2A 1VB2A 3JB8A 4IV1C 5C9AB 5D8AC 1PVC3 1PO23 1ND2B 1QJY3 1QJX1 2BFUS 2R043 1RUI1 5C9AA 2PLV3 1RUC2 1NY71 3ZFEA 2MEV3 5AC91 4CEYA 1NCRC 1POV3 2PLV2 5L7OA 1VRH1 3ZXAC 2XBO3 1D4M2 3VBOC 4GMP3 1VBD1 1B35B 4BCUA 2WZR3 1H8TB 1AL22 3VBUA 2HWB1 4CDXB 5CFCB 2FZ2A 1AUYA 3TN93 1R092 1POV1 4N53C 5K0UC 2RMU1 4Y5Z0 5K0UB 1X36A 1AR81 1RUF2 1HRV3 1RUH3 1EAH1 1EV11 2TBVA 5CFDC 4Q4V3 1VBD2 1V9U2 1BEV2 2HWB3 1RUD3 1HRV2 1RUH2 2RR12 1MQTB 3NAPA 1GFF2 2HWC3 4YVWC 2HWE3 1RUC1 1EV13 1BMV1 1MEC1 4Q4Y2 1C8NA 1VBA1 4CDXA 1AL0G 4RS5C 5C8CB 1C8M1 1AR91 4RS5B 5D8AA 2XPJA 3VBFB 5ABJC 1AR62 5C9AC 1K5MA 4IV1B 1HRI2 1HX6A 2RM21 3VDDA 2WFF3 1RUC3 3VBOB 1C8M3 1VBC2 5A32B 1FPN1 5BNOA 1VBE1 3VBUB 1ASJ1 1OPOA 1RUI3 2RS12 4FTEA 5BNNB 4NWVA 2RM23 3ZFGA 5BNPA 4YVSA 1SMVA 1HXS3 5BNPB 5C8CA 5FOJB 2DF7A 2IZWA 1HXS2 4GMP1 4RQPB 1PO11 4AEDC 1R081 1AR92 5BNPC 1OOPC 1RMU2 3DPRA 1BMV2 2RR11 1QJU1 2R071 3JD71 4RHV2 1FOD1 1AR82 3LOBA 1H8TA 2RMU3 1TMF1 2HWD2 3J8F1 1NCRA 2MEV2 1EAH2 4QPGB 1HQNA 1VB4A 1CD3G 1HRV1 1RUH1 4RHV3 1RB8G 2RS33 5ACA1 4N43A 3VBFA 4WM7B 1RUD1 1EV12 3VBRA 2ZZQA 1R091 4CDQC 1FOD3 1A6CA 4WM7C 1PIV3 1RUE2 5ACA2 2HWF2 4JGYA 1AR72 4CDUC 3CJIA 1DDLA 1VRH2 4CEWA 1FMD3 3JBG3 5AC92 1Z7S3 3ZFEC 3ZFGB 1RUG1 4Q4V2 1QJU2 2R072 3ZFFC 1NCRB 1F2NA 1IHMA 1W39A 1TMF2 4GH4C 4Z92B 1R082 4SBVA 3VBRB 1PIV2 4JGZC 1VBB1 3VDDB 4FSJA 1TME3 1FMD1 1RUE3 1ASJ3 4Q4W3 4Q4Y3 5BNNC 4GB31 1PO12 2RS51 2WS93 1RMU3 4QPGA 1NCQC 3IDEA 3VBSC 1MQTC 5JZGB 1VBB3 1VBC1 1QJX3 1PGW2 1QJY1 1AR83 1RHI1 2R041 1QJY2 2RS11 2HWD3 4GB33 1VBE2 4RQPA 1ZBA2 2WS91 1QQP3 3VBFC 5ABJB 1HRI1 2VQ0A 4CDQB 1AR61 4GB32 1ND2C 1VAKA 4IV1A 4YVWA 1C8M2 1VBC3 1VBD3 4YVWB 1MEC2 5CFCC 4CEYB 1E57A 4CEWB 5ACA3 3TN91 1QQP1 1R093 1VBB2 1QJZA 3DPRC 1OOPA 2Y26A 4PDWC 1M06G 2GSYA 1B35A 1RUG2 4N43B 4Q4V1 1COV1 1AYM1 5CFCA 5C4WA 1ZBA3 1AYN3 4N53A 4GH4B 1BBT1 2QQPA 4N53B 5K0UA 4JGYB 3JBG1 4CDQA 3ZFGC 3ZFEB 4FTSA 1R1A1 1MEC3 5A32A 4WM8A 5BNOB 1AYM3 1D4M3 1AL21 1ND3C 1PVC2 5BNOC 2HWF1 4WM8B 1F8VA 4IV3C 1RVF3 4QPGC 1H8TC 1BBT3 4JGYC 2MEV1 1R1A2 2PLV1 4Q4W1 1NA1B 1ND3A 1RVF2 4QPIA 1VRH3 4EJRA 1BBT2 4GMP0 1NA1A 1D4M1 1FPN3 3JD72 1NY72 1OHFA 2HWF3 4RS5A 5D8AB 1Z7S2 3VBRC 1VBE3 3JB4C 1RMU1 3J8F2 4AEDB 1QQP2 3VBHB 3DPRB 2X5IA 1RUI2 2RS13 1PGL1 3NAPC 5JZGA 2ZTNA 4RR3B 3NAPB 2XBO2 2HWE2 5J98B 1HXS1 1EAH3 2BPA2 5CFDA 2RS32 1PO13 5DDJ1 2RR13 3M8LA 4CDUA 1FPN2 3JD73 4CDWC 1RHI2 3FBMA 3S6PA 2HWC2 3J8F3 2BUKA 4CDWB 2RS31 1NG0A 3VBUC 3VBHA 4FTBA 1RUJ3 4CDXC 1VBA3 1POV0 5DDJ3 2HWE1 1AR93 5A33B 1FMD2 4RFT0 1VBA2 1PIV1 2RS52 1PGL2 4JGZB 3VDDC 5BNNA 1OOPB 5FMOL 2WFF1 4RQPC 4AEDA 2WZR2 5GKAC 5FMOS 1BEV1 2BFUL 1RVF1 1RUG3 4Q4W2 2R061 1Z7S1 4PDWB 1RUF1 4YVSC 1ZBE2 4PDWA 1X33A 5L7OB 4LLFA 1V9U1 4Q4X1 2RMU2 3CJIB 2WWSA 5J96B 1PVC1 4IV3B 2WLPA 3ZFFA 4CEWC 1PO21 1ZBE3 3CJIC 1R083 4Y4YA 2HWB2 1AR71 1BEV3 1RUD2 1TME1 4CDUB 2R063 1RUE1 1TME2 3JBG2 4Q4X2 4JGZA 5AC93 1RUF3 1WCDJ 1QJU3 2R073 4WM7A 1PO22 1V9U3 2R062 4GH4A 3HAGA 1TMF3 1K5MC 1AYM2 1RHI3 1ZBE1 1B35C 2WZR1 4RHV1 1AR73
chains in the Genus database with same CATH superfamily
2VUDA 4UXAA 5AFBA 1NLRA 3NJZA 2A5ZA 4BE3A 2UWAA 4N43C 5HPOA 1S2KA 1CZVA 4Y4RA 1HW5A 3IMMA 1WMFA 1COV2 3ZMNA 1HRI3 1Q8VA 1W03A 2Z79A 3CF6E 2YU1A 4C0BA 2VZQA 2GMEA 4IV3A 3ZFFB 4TN7A 5LASA 3J7MA 4XJZA 4OYUA 4D6QA 5CVRA 1PVXA 2ZHMA 2N7GA 2ZS6B 1DQ6A 3WNPA 1CAVB 3WW4A 3I3MA 4CCJA 1ND3B 3PMEA 3RYRA 2OW4A 1QHDA 2PHRA 5JAXA 2Q8DA 2A6XA 2JDYA 2QQJA 2XVGA 3VDCA 5JOXA 3BPSA 3E5QA 5FMBA 3U14A 1V6IA 5C5UA 5FDBA 4QQLA 2RHPA 2X09A 4CSWA 1H4GA 4XVHA 1AX0A 5J1XA 2Q8EA 4Q1RA 2E9QA 1J3RA 4DFSA 3T4VA 1FYUA 2WS92 2ZX3A 1WCKA 4CCCA 5JIUA 1TQ5A 1AZDA 4XQWA 3O1RA 3NO8A 1G8WA 4QPIC 3U4XA 2DVFA 4AEJA 4HVRA 5I8TA 1HV1A 1AYN1 1SLAA 1ST8A 4OMDA 4WVVA 1SFPA 3LD8A 2VQTA 2VPVA 2WAOA 4QGMA 1MS0A 4LO7A 2BBVA 1VALA 4XEZA 2YBSA 3I97A 3AP9A 2XHNA 3FLPA 1HLCA 2LTNA 1AL23 2IVJA 4Q4Y1 5LBCA 2Q1FA 3LDBA 3N9PA 4CP9A 5C4WB 4RR3C 5FMCA 5IVBA 2C1FA 4FFIA 3V0BB 1VB2A 1PGSA 3KVBA 4XAEA 5C9AB 3I3QA 1PVC3 2XJSA 2QZ2A 3CKHA 3O0VA 4DINB 3OEAA 2PHUA 1L7RA 4E8DA 4FOWA 1RUI1 2PLV3 5FYYA 1RUC2 2VZSA 4BIFA 5LB6A 3ZFEA 2PHFA 1S0JA 2MEV3 4NO4A 5JDBA 1LHWA 2VW2A 2SBAA 2PLV2 2IWGB 2OUHA 4EROA 4QX5A 4PI2A 5L19A 1D4M2 2WC2A 1XXNA 4GMP3 3UKNA 3ZKUA 1UWWA 3IN9A 4IGPA 4GA9A 3VHOA 4D94A 2JB4A 3LIHA 1TEIA 4BCUA 1EPZA 3BYWA 3VBUA 4GQ7A 3AVRA 2HWB1 3GBWA 4HN0A 1MZEA 2D40A 5DUWA 1LHUA 1XU2A 4EN0A 2AZ5A 1DP0A 1W6QA 2A70A 3AXDA 1UF2C 2A6WA 3B01A 4N53C 1JZ8A 2K46A 5K0UC 1LKNA 2XQXA 4FFGA 3LA7A 2VOVA 4MLOA 3VKFC 1RUF2 3FJSA 1LENA 4QKNA 3ZX7A 4YFZA 4TXWA 4ATEA 2ARBA 2Z4FA 4LK6A 4LBLA 4Q4V3 1WCQA 4XBLA 5IFPA 1O3QA 2DCTA 5F32A 5A6ZA 4H7LA 3OD4A 1ULGA 2GDFA 2HBUA 3U78A 3AK0A 4CCLA 3OB8A 1VMFA 1FNYA 1ULPA 2C4XA 3NRUA 4ES9A 2PHTA 1F4HA 4QKBA 2QDNA 2VJXA 1FI2A 4WVMA 4YVWC 5FYHA 1JBCA 2R6QA 1BMV1 1G9AA 4MO3M 1VBA1 2Y6FA 4HLTA 5FXVA 4CDXA 1QGLA 3ZYJB 1S2BA 2BDRA 1C8M1 2WSVA 1AR91 1YFYA 1H1AA 4XUOA 3PHMA 1RYYA 4NR1A 5BUVA 1AR62 1K5MA 1F5FA 4Y22B 1HRI2 5EFUA 3Q8BA 4F7ZA 4W50A 1HX6A 2W68A 2ZZJA 1RUC3 5FYVA 1OH4A 3M3OA 4FAHA 4TLGA 4HVQA 4FPLA 4W8JA 1VBC2 3UJQA 5A32B 1X9TA 4QXBA 1UAIA 2PHXA 2JDUA 1GYKA 4PBOA 3AMNA 3MZHA 1ASJ1 1JYWA 1EP0A 4D8MA 1O5UA 2BU9A 4FTEA 4XOGA 2G19A 3V0BA 1DZRA 2RM23 1HB3A 3MF9A 4M3CA 5FP7A 1YO8A 4QDRA 2DU0A 4D7YA 3VUOA 1Q8SA 1S0FA 1GZTA 1W6NA 3AJZA 1LRHA 1SLIA 3K51A 1JODA 3G7DA 3W59A 4CU6A 5GZCA 4M3CF 1PO11 2WIIB 4S2GA 1JS9A 4AEDC 1TG7A 2XDVA 3USUB 2RDQA 1KRIA 1OOPC 2W1QA 3I2JA 5B2GB 1YXWA 3FUQA 4MGKE 4XF0A 3A0NA 2R071 2EALA 1H9WA 5EPAA 1APNA 3KM5A 3DN7A 4NHYA 2RMU3 4MXWB 3RZZA 2XWBB 2HWD2 2EIDA 2WRAA 5F3CA 2IXJA 2QQOA 3V0AB 4CYDA 1NCRA 1GNHA 4JCKA 1CD3G 1LR5A 1GQPA 1VP6A 2ADEA 2FHRA 2JENA 3NV2A 4XFCA 3I2GA 2O8OA 4R52A 1CAWB 4ZU4A 4IEXA 5A3PA 4IGOA 4R9CA 4IE4A 3K4ZA 3VZNA 3KV4A 3POIA 1NE4A 1Q5OA 2D6MA 2Y0OA 2WZ8A 2JDNA 2Q30A 1J59A 2HLEA 3E5XA 3BTYA 2CGOA 1HKDA 1RUE2 1RITA 5JXGA 4A6OA 3D8CA 2ZKLA 5FYZA 5LATA 3KCYA 4JGYA 1AR72 2BW8A 3SCGA 2VTXA 3CJIA 4LBNA 3ROUA 3NNGA 4JAAA 5JI7A 3MBWA 4CEWA 3ACGA 3LDRA 1CVNA 1C1LA 2E7AA 3AVSA 2F6BA 3SH4A 1Z7S3 4TZDA 3RYKA 3LCPA 3ECQA 3ZFGB 4AHXA 3WP6A 4C1WA 2W87A 4XBQA 3WG4A 1W6PB 2ES3A 3HEIA 2QQNA 2Q8OA 1IHMA 4XF1A 1LOBA 1OH3A 1UD1A 2VQUA 2Y64A 3CLPA 4YG3A 2D93A 3MIBA 2DBNA 4QHZA 3S7IA 3VBRB 1S1AA 4IGQA 1PIV2 4KNCA 4N8MA 3WF2A 4FSJA 3B3QE 1TME3 1FMD1 2W1UA 5FYSA 2ET1A 5A3OA 3AKQA 1DHKB 2AENA 4AG4A 5AFEA 3UGHA 4QHOA 3MPBA 5IJRA 4UBGA 1OVSA 1SDWA 4XDQA 1PX4A 4LULA 1XB9A 2WS93 4PHZA 3FLTA 4ZXKA 2R1BA 4IERA 3FFQA 5CZKA 3V0AA 1ONAA 1YFUA 1CZTA 1YWKA 3R6SA 3IDEA 4COWA 1YJLA 4Y1VA 1PGW2 3HN3A 4S2HA 3TEXA 2HWD3 3H7YA 1YQ6A 3IT8A 5FYUA 3E1F1 1U5ZA 3POSA 1PZ8A 1ZBA2 3P3PA 4JC1A 2VR4A 2BQPA 1WLTA 4LPLA 3VHPA 5ABJB 4DY3A 2GP3A 4P9GA 1ZX5A 1OA3A 1ZZ6A 1BJQA 2JDMA 3LPGA 2ETEA 3RNSA 5GALA 1VAKA 1GWMA 5EIYB 1SPPA 3AM2A 3T2OA 1VBC3 1Q56A 2WT1A 3AJYA 5FTTC 2J1SA 1IZ3A 4RGKA 1ZZ7A 3I7DA 3DCQA 4NAOA 1MEC2 2JE8A 2CWSA 1OD5A 4BXFA 5CFCC 2DVDA 2JB8A 2WFPA 3IZOA 1S0CA 3H8RA 3L9JT 1ZNPA 2RJKA 3WP4A 5IVFA 3WINE 2WO7A 4GJZA 1OC1A 4BM8A 2LRPA 1XE8A 4LTAA 3SNMA 1VBB2 1QJZA 2Y26A 4NOTA 1M06G 4DO0A 1SDDB 1N47A 3KCXA 3WR0A 2XLAA 2E32A 1UCXA 1E5HA 1ENXA 4A44A 3VZMA 1SBDA 2PFWA 3IAPA 1MZ5A 3MGUA 3MO4A 5C3OA 4JTNA 3M2MA 5G05L 4GH4B 1UKRA 3MLJA 5FZDA 3CHXA 4P02B 1BBT1 3E6BA 3NJVA 5LY2A 3S30A 2Y38A 4V1PA 5K0UA 3BUCA 3JBG1 5FMDA 2EIBA 4ZONA 3ZFEB 5A3TA 2D6KA 1UKGA 2WO2A 3WP5A 4R9AA 2WNVA 4XUQA 3WSOA 1BLZA 4D0QA 2W95A 1AYM3 4FAGA 4JTOA 5JR2A 3D5OA 5BNOC 3RGBA 2JE7A 4GULA 5F5QA 2B46X 2J1VA 2PAEA 2WDBA 1UPSA 1O5LA 2NZ9A 1LNSA 2LUWA 2XQRA 2XVKA 3HIFA 5GJ6A 3I49A 4AI1A 4N9HA 4QKDA 4DUVA 5LA1A 4AW7A 2XVLA 4PLOA 4IEOA 3CZUA 1YQ8A 1VRH3 2BGOA 3LWCA 4V2WA 4EJRA 1BBT2 4GMP0 2P1BA 3D0SA 1CN1A 1NY72 1ULDA 2WT0A 4XILA 2GMPA 4U36A 5F37A 2VXJA 5A7NA 1US3A 3VBRC 4KL1A 2BOJA 4OLLA 5BXXA 4W6XA 1SLTA 3K77A 2WKKA 4K8RB 3LEKA 4LBOA 4Y26A 2VCCA 1QWRA 2P4EA 2J1RA 2VVEA 5EXOA 1D7PM 2VMDA 1Q8OA 2PAMA 2RS13 4K3UA 2WNVB 1QDOA 4BH9A 5EV7A 1YJKA 4W6WA 4N9IA 3NAPB 1EUUA 5DUXA 2Q8CA 1ZREA 4URAA 1Y3TA 4NUBA 1LGCA 1JXNA 3AMMA 3EMRA 4HMZA 2HWE2 4DRRA 3ZXLA 1HXS1 4EN8B 1DLLA 1O4YA 1QXRA 2BPA2 5G04L 2J22A 5C3SA 1MZFA 5IWFA 2D6PA 1NQJA 1YYNA 1NAEA 5FRAA 2CV6A 2RR13 5FCCA 3JD73 1URXA 2UY9A 4CDWC 2V5DA 1RHI2 5GLTA 3SXWA 4JZRA 3N9NA 1EPWA 4PI0A 5FQ0A 3RMXA 4MYEA 1I5PA 2VMEA 2RDSA 1UQXA 3VD9A 1X9PA 2GP5A 2QNKA 4XZPA 1UYXA 4CXWA 4LKSA 4NROA 3BI3A 1NG0A 1OLMA 1POV0 5SV5A 2ZGQA 5DDJ3 5AVPA 3I2IA 2ZMLA 2ZGMA 3OD0A 5J09A 5IK5A 3KGLA 3WQ0A 1Q8QA 2K2SA 4KMQA 1FMD2 1NXD1 1BKZA 4H2AA 3BGAA 2WA3A 4PCRA 5FOBB 1W2TA 3WQBA 1S4CA 5LA2A 5FIXA 1LOFA 3AMQA 4EZ4A 3GALA 1OOPB 4DIQA 1CX1A 3A0KA 1F31A 1WD4A 3FHIB 5FMOL 3Q8CA 4L8QA 2WFF1 5IAVA 3URFA 1XE7A 3C8XA 2DV9A 1MZ6A 2K9ZA 3OSDA 2W0XA 3HBKA 2DUOA 3HPNA 3KWVA 4K20A 4LLOA 5FMOS 4J1XA 3TB0A 4HFSA 1JU3A 4AHZA 4AR2A 1WZXA 4BLJA 5C70A 4PDWB 3RZLA 1RGSA 1GU3A 1RUF1 5EZWA 4RL7A 1TE1B 4UT5A 3WHUA 1N3OA 1X33A 3I2OA 2VW1A 3OYWA 3IIIA 2DCJA 1GQHA 3MDPA 3N3HA 1H1MA 2JG8A 4NPMA 2JG9C 3MIDA 3ZYRA 4IQPA 1HJGA 1PO21 4XABA 2VE1A 1J3QA 4QX1A 4Y4YA 1BEV3 1AR71 3WDYA 4BQ1A 2E31A 2YU2A 3RFRA 4YM3A 4MGYE 1RUD2 3C7FA 1TME1 3DGTA 2R063 2KD7A 1RUE1 1UIKA 1J1LA 1WA4A 4HPKA 1MS5A 3ZPYA 3KHBA 2JG9B 2XUMA 2BWCA 2YC2A 3W58A 5LRRA 1PO22 5CG9A 1VAVA 4MG2A 2XOMA 4OHWA 3HAGA 5FZOB 1TMF3 2VMIA 1UX7A 2I2SA 2WSUA 4OMCA 1AYM2 4GKYA 4MX3A 2ZX4A 1RHI3 2VOKA 1W3XA 1UMHA 4RHV1 4FPOB 4QGNA 1MVQA 2C6SA 2PELA 3B69A 2HWD1 2H0VA 2FZ1A 3NSTA 1Q3EA 2GC1A 3AP7A 3L2HA 2Y34A 4ZZ8A 5JVVA 5C4WC 2WQ4A 2IFWA 1PK6A 4YG0A 1DLCA 2JG8B 3WG1A 4H7MA 2DCYA 4NRPA 3VZOA 5KXEA 1JHNA 3I4IA 1XPWA 2AUYA 3LE0A 4ISRA 1HB2A 2PA7A 4WVWA 5F2WA 4Q29A 1HQWA 3TN92 1GOHA 1T6BX 4WM8C 3C7HA 2GC3A 4FPYA 5FK7A 4LUMA 4QPIB 1AYN2 2D98A 3FLRA 3KQRA 4UFJA 1YI7A 4NPRA 3N9QA 3ILRA 5DG2A 5FXWA 4EWAA 3FE5A 4MSVA 1D0HA 2GU9A 1ASJ2 4CCEA 4YW7A 2P34A 1CJDA 5KHHA 3BCWA 1HN0A 2GMMA 1U12A 2W91A 4RFRB 3AZVA 5JMOA 2ZOEB 4XF9A 3N36A 3VD3A 4CVUA 3KV6A 3PUAA 5FZMA 1A3KA 3MW4A 2ZCWA 4GXLA 3RRDA 2XKOA 2RM22 4LXLA 3M7AA 3BB6A 2E7TA 4XPVA 2A71A 2AH2A 1NCQB 3T4HB 1QEXA 1LTEA 3UJOA 1IKPA 1Y43B 3NKGA 3A21A 4ITCA 1Z0HA 4AI2A 5JMCA 3NJXA 4QX2A 3AP5A 5A33A 4L97A 1RUJ2 1WMDA 4BA6A 3ITQA 1BVVA 4CPBD 2OZJA 2F4LA 5DAQA 2VO5A 1BVP1 3NKTA 4UFKA 4BMEA 4K6BA 3GF6A 2OVUA 3ENRA 4K8FA 1XNDA 2XUEA 5FZ9A 3LFIA 2YROA 5ABJA 1UXZA 1ND2A 1REFA 4JHTA 4R9DA 5A7QA 4AVSA 4XBNA 4B3NA 3IMNA 4D6SA 2PHLA 3H7JA 1IG0A 3LZZA 1ND2B 1QJX1 1OI6A 1Q8PA 3B9CA 2R043 1W2OA 1NY71 1G9FA 4P9YA 2BNNA 2ZBJA 4M0HA 3N4MA 4LOSA 1WA6X 3M4FA 2Q1MA 1UOBA 1NCRC 3VLBB 5C3PA 1J58A 3ZSEA 3ZXJA 2R30A 2W1SA 5FZ7A 3J26N 1VRH1 3ZXAC 4YGBA 5GLVA 5L7OA 1AHSA 2C5DA 2XBO3 3TEWA 2W94A 1XSQA 1LOCA 1EY2A 3BOWA 4PQQA 5JPMB 4ARXA 5HV4A 1KDMA 3TEYA 4XE9A 2L9LA 1U0AA 4EE2A 2QVSB 4AQ2A 5HCFA 3EXUA 5FP3A 1OA4A 1QH7A 1VIWB 2A73B 2YG0A 1AL22 1Y9QA 5EQUA 1YLLA 3ZSLA 3OBZA 1AUYA 2GC0A 1H9PA 2G4IA 2VMHA 1PM4A 3B02A 1R092 3I59B 3LEIA 1POV1 1O59A 4XDPA 5EYYA 1KEXA 2G9GA 2FDKA 4BXSV 4Y5Z0 3EJKA 1D2SA 5E1RA 2G1MA 1DGWX 1SFYA 2RJ2A 5K0UB 2MPFA 2DWRA 1L7LA 2DDUA 3FUOA 4HK8A 1HRV3 1RUH3 5DAPA 1IG3A 1K3IA 3DL3A 1EV11 3C3VA 4R4XA 1JUIA 2X10A 1ZZCA 2TBVA 4H55A 1VBD2 3RMYA 2HWB3 2WO1A 4DXRA 5IATA 1XNBA 2GN7A 3ZXFA 5CAZA 3E6CC 1RUD3 4IW3A 3D3AA 1HRV2 1O7FA 1RUH2 1MQTB 2RR12 3LDKA 3NAPA 3SLIA 1GFF2 5A6XA 1XYNA 4MZUA 5I0TA 4GIQA 1PMJX 4XURA 1US2A 3SMHA 2BZDA 2Q1ZB 3SC7X 2H0BA 1OD3A 3ZSJA 3OJBA 5FZ3A 1OUSA 2HWE3 4KU7A 4OUSA 3ZYHA 1RUC1 1EV13 2QUOA 1MVEA 4LKFA 2P3YA 1AL0G 4RS5C 1RL3A 2AREA 1W6PA 2UY8A 4HVOA 4JRLA 2Y6GA 4Z2WA 5C8CB 1DF0A 1O91A 3FN9A 3ZKYA 3DF0A 2VY0A 4L9BA 3VB9A 3VL8A 3VBFB 3SQOA 4IV1B 5A7WA 3MW3A 1IQDC 4HETA 2PHDA 4JDOA 2X53S 4KH9A 1V6KA 3P1IA 4Y22A 3DKWA 1OLRA 4JKLA 4NHXA 4KGGA 1LAJA 5IVVA 4MUVA 5FJKA 2ZEWA 1SG3A 4AI3A 1ZM1A 4LNVA 2VZRA 1VR3A 3T2QA 4Z8BA 5A3LA 3P3NA 5BNOA 4P08A 5FREA 4NJ4A 2D5FA 2DYCA 1GNYA 5E16A 3POYA 4XQDA 3FX3A 1UXXX 4R9BA 1RUI3 2JIJA 3HT2A 4R8HA 5KWRA 1NYWA 4XF3A 3ZFGA 4DXSA 5BNPA 4XJ8A 2LS6A 3RI9A 4YVSA 4BQXA 2FMYA 3ZN5A 4UF0A 4XETA 5T5OA 5C8CA 1OLQA 1W9SA 1W0PA 1BZWA 3FBYA 4XFFA 3WW1A 2VMCA 1HXS2 4GMP1 4BK4A 1GBGA 4Z2AA 2LALA 5IHRA 4M3CE 2ZGKA 4LA3A 4Y1YA 3OBRA 2XJQA 5BNPC 1CONA 1FV2A 4XUTA 1ODNA 4CTEA 3EO6A 1M4WA 1S2EA 2QKDA 4QDSA 1JU4A 1QJU1 4JVAA 3JD71 5CYYA 5KXDA 1EUTA 5LCWL 2VCAA 3CNAA 2EIGA 1TMF1 3J8F1 2B45X 4QB2A 1QJFA 1DIWA 3O7OA 4YGEA 1DGRN 1XYOA 1W6OB 2W39A 1HQNA 3GJAA 1LB2A 2YUEA 1HRV1 1RUH1 3VDBA 2XKPA 4AVTA 2FCUA 1JHJA 2ZHKA 3AKPA 3SKJE 2MHFA 4N43A 4XCBA 5C3RA 1H6XA 2J7MA 3ZM8A 2OA2A 4PT6A 3VBRA 1EV12 4LKDA 4UW5A 1R091 3T0BA 2B7YA 2FCVA 3M1HA 3AP6A 5CKQA 1PIV3 5KHKA 1XNTA 3Q8EA 1JZ5A 4YW4A 1KDKA 1UZYA 2WUHA 4C8DA 2HWF2 2ZA9A 2IXLA 5FPAA 1HB1A 3AP4A 3H3LA 3MI8A 4OQ8A 2DU1A 4OHYA 1KS5A 2FDJA 3ZYPA 4AVVA 1C3HA 1HQLA 2Z2SB 3UKTA 3WUDA 5DQ0A 3W21A 1VRH2 3OUIA 4A3XA 5L36A 5I91A 2YFZA 3OEBA 3IPVA 4AFBA 4D3WA 1FMD3 4M4RA 3JBG3 2NP0A 5EYXA 4LBJA 4AFMA 3ZFEC 4Y20B 1K42A 2DBIA 2PQQA 1LHVA 2R072 3UL2A 1ZRRA 2EF6A 1NCRB 2NMNA 2XMLA 4IEPA 4S2FA 5CA6A 3B93A 4AQTA 2GC2A 4R4ZA 1BCXA 4GH4C 2J1EA 5F9TA 4LBMA 5JUVA 2V73A 2YV8A 4KI5M 1UY3A 1UNBA 3ZXDA 3E97A 3NWKA 4N7IA 4A45A 1OLME 2ZGUA 1JMUB 3OGJA 4JGZC 2AGSA 4ORFA 1DQ1A 2P3KA 3VDDB 5FPUA 1JYNA 1RUE3 1YQCA 1ASJ3 1W8OA 2DUPA 2G9FA 3ASIA 3NNMA 4FVVA 4GWJA 2VGDA 3GHMA 4Q4W3 4Z82A 4OHZA 4CP0A 4E2QA 5BNNC 4GB31 3POFA 1W0NA 3ZXEA 5CIRA 1GV9A 4O7XA 1CAUA 2E7QA 4COUA 3JZVA 2LROA 4GALA 2RS51 4ZU5A 3W9AA 3THCA 1N1TA 1NLSA 5FK8A 2WAAA 4FPKA 2W3JA 3NL1A 4G4FA 4YLZA 1W6OA 3ATGA 1VAMA 3KV5A 5BPXA 3VL9A 4XF4A 5JZGB 1MS9A 3PVNA 1MQTC 5KC6A 1DZTA 2XJPA 1VBC1 4NIAA 1QJX3 1TZOA 5IFTA 2JDAA 5IK8A 1QJY2 4JX0A 2WNOA 1W8FA 4P00B 2R16A 3V64A 1D4VB 4A4AA 4ZS3A 4GB33 1VBE2 2IXIA 2JX9A 3MIGA 3OG2A 5DAWA 3AL6A 1QQP3 1U5IA 4NIGA 2VBPA 1OPMA 3H8OA 2A7AA 3GGLA 4CDQB 3JU9A 1AR61 5FKCA 4GB32 1UN1A 5JXHA 2GALA 4IV1A 5A7WB 2IXCA 3GBFA 1C8M2 5K9YA 2K0GA 3VGIA 4YVWB 1RJ8A 2XL9A 5K8SA 2JWPA 4C90A 2W52A 3TN91 3NNJA 1LU1A 3T2TA 1R093 2VNVA 2XONA 3O0XA 3A4UA 3QOPA 3R05A 5JOZA 4GJYA 3RVHA 2WN3A 3IIAA 1OOPA 2VBBA 4LK7A 1PK6B 2GSYA 1B35A 2HEVF 3JQXA 4QDQA 4XACA 5E8AA 5GZEA 4EN6B 1W28A 2W9XA 4EN9B 2BYVE 1QOOA 2QQVA 4X6RB 5IVEA 4I3PA 4OI2A 5JSRA 1LEMA 2ZGOA 3ORJA 4OVEA 5H9PA 4FPEA 5FZ6A 1LJ7A 4QB6A 2VZ1A 5A70A 3NV4A 4N53B 4NHMA 1UU5A 3EYPA 4FPHA 5D1IA 1YQ5A 4Q0UA 1RUOA 3ZYGA 1WW7A 2XJUA 5FZGA 4AI0A 3H8UA 3H9AA 3WHTA 4E4ZA 4LJHA 4IESA 3MIHA 4HKLA 2W2IA 1RUNA 5FP8A 2B42B 5C71A 4ZU7A 2XWJB 1PVC2 4PIYA 4AVBA 5LEJA 5FYIA 1O4TA 1RVF3 2NLRA 5F3IA 2ZGRA 3A7QA 3OYWB 3KB5A 3SH5A 4XXPA 1AJKA 4J25A 1WW5A 4JGYC 1JYVA 4O9GA 4XIKA 3GCWA 3K2OA 4IL7A 1NA1B 1H4HA 1ND3A 3GDBA 2FQPA 5CU1A 3U10A 1O3SA 4QPIA 2EIEA 3THTA 1NA1A 2EXIA 1W6MA 2XJRA 3SCHA 3RWNA 2WNVC 2Z69A 3MYXA 3POJA 1VBE3 1Y7BA 4LOTA 2CL2A 1RMU1 5GLWA 1QJEA 4Q8LA 3T1MA 1QQP2 3VBHB 3I3DA 2P17A 3QLQA 4MOAA 4B7KA 4RSUA 4CRQA 3PLQA 3IB3A 1RUI2 1PGL1 2VECA 3I2KA 1NLQA 1H6YA 4IE5A 5FZHA 2UU8A 3F2ZA 1LCLA 1ULFA 2XBO2 3X29B 4YZ5A 3VV1A 2RV9A 1LODA 3DECA 3IPVB 5J98B 3BIEA 1NXMA 4FO9A 3KCCA 1YFWA 5DDJ1 5ANQA 3UT0A 1UMZA 1OMIA 5FQ0B 1H0BA 1AXZA 5FFOC 3M8LA 2YYOA 3H1YA 5A7SA 2WZPP 1FPN2 1GMMA 4V2VA 4CDUA 4HPKB 2AC1A 3FBMA 4LO5B 4M00A 3RSJA 1OBNA 5JI9A 3J8F3 3GXUA 5CKMA 4OI0A 3SITA 3U0ZA 3DV8A 1AVBA 2WABA 4YW2A 3VBUC 4FTBA 3WD5A 1HB4A 1RUJ3 2XLFA 4BU2A 4LIVA 3C2UA 3FL7A 5LK5A 1V00A 3HMYA 3A23A 5JSPA 3WX5A 2OXBA 1NE6A 4XC9A 1K12A 3V65A 5J3UA 3RZHA 3THDA 2RS52 4NVPA 1TVGA 5JR7B 4NIIA 4CU8A 4YNIA 4AYUA 5LBEA 5CG8A 1QIQA 3WUCA 1Y4WA 2WYFA 3WDUA 3LFMA 3T2PA 2QJVA 1UO9A 5GLUA 4WV8A 5FP9A 4RQPC 4OHVA 1JW6A 3PVOA 2ZX1A 4BMBA 1DYOA 4Q5OA 3M3CA 5BNQA 1BEV1 4CU9A 2IUWA 3ACLA 3L2YA 4CUGA 1RUG3 3RI8A 3W5NA 3CEWA 4Q0SA 3RQ0A 2SLIA 3KVAA 3GZEA 3VKNA 4YVSC 5C5TA 3HJRA 4XHXA 5L7OB 1SLCA 3KGZA 1VMJA 4LLFA 3VD5A 4A41A 1WKYA 1VPHA 3CJIB 2KXLA 2XXZA 1MS3A 3QD6A 3CZJA 4UFIA 4B4PA 5CBLA 2VXRA 1XNCA 3DYMA 2OIIA 4PJYA 1LHNA 3U37A 3RZKA 5LWBA 3MIEA 4CDUB 3J7NA 5AC93 4JGZA 1B09A 1JOPA 5I93A 5LW9A 1OFSA 4A2UA 5HI0A 2I74A 2HJIA 2WINB 2OPWA 4YGDA 4DZGA 3RZJA 4E2SA 1YFXA 1V9U3 4TSVA 2PXJA 4XJAA 3TAYA 3WP3A 4GH4A 2ET7A 2JE9A 3I2HA 4FQ4A 3OPWA 1PX3A 5FZAA 5DAXA 3AZZA 1L3JA 5DMYA 1W8UA 5CISA 2QFEA 4HSJA 4AQSA 1V6JA 4KWJA 3WDXA 3P6BA 2FZ2A 4BLIA 1O8SA 1QJX2 2GH2A 2QQUA 4ISQA 1JZ3A 4Y3OA 1H2LA 3RWKX 2GH8A 4NWWA 1FOD2 3MFAA 5GZGA 3LAGA 3SCFA 5FXZA 3ZXKA 2C24A 4AEMA 2B5HA 4XDOA 2YGMA 3OPTA 4FOYA 2ERFA 1UYPA 4L92A 4M01A 4MHRA 5FJHA 1WW6A 1CX4A 2D43A 1I9RA 4AI9A 4CCNA 4H14A 4NN0A 1G9DA 2E53A 1RUJ1 1V6MA 4QPWA 1LU2A 4HKOA 3AZXA 3VKLA 4CP1A 1DYPA 3PTRB 5F8PA 4BQ2A 2VVFA 2XB6C 4FI9A 3O1VA 4LHLA 2CNAA 2B9VA 1O8PA 5LK7B 4F8AA 2V09A 5F5AA 1J3PA 5I0UA 1W2UA 3LPFA 4LBQB 5T50A 3G6JB 2R042 1PGW1 4LT5A 4DUXA 4ASLA 1NQDA 1W2AX 2O14A 5EJ1B 1NOVA 1ZBA1 1OFNA 4RYDA 2X5IB 3LQCA 3ZN4A 2ZHLA 4IXLA 3LB9A 1Y9GA 3NQHA 2RVAA 1XC6A 4XJ9A 4RGGA 3MEPA 1GWKA 5IVCA 1UY4A 1KFXL 5KC5A 3PUSA 1MQTA 1PNGA 3B5LB 3E6DA 1R1A3 2KM2A 2BWAA 5DDJ2 4LO8A 5FKBA 5L7OC 1WGPA 3ELNA 5KHGA 4YVSB 5A3MA 4AEKA 5C8CC 4X8PA 1W9FA 1IPSA 2YZ4A 4CEYC 1QXJA 1OVPA 2FBEA 2XBO1 3AZWA 2J1TA 4KGQA 3JB8A 3HN1A 4IV1C 4MADA 4ONUA 4S2DA 5C3QA 2Y6KA 5D8AC 3OGSA 4AF9A 4QXKA 2OS2A 1DGWA 3AZYA 2OKXA 4ZXEA 4QT6A 4I0BA 1KJLA 4C1XA 3GCXA 4FXGB 1E5IA 1OA2A 3VD7A 2FDGA 3HQUA 4UFMA 3ZSKA 4CEYA 3HOBA 4Z07A 1BK0A 1DGRA 3LA2A 2DVGA 5FY5A 3T09A 1SBEA 2B39A 1QU0A 1C5IA 3KF3A 3WG3A 4FOVA 4I30A 5FZ1A 3O12A 3UESA 3N7LA 3UK9A 2VH9A 1BXHA 1VBD1 2EAKA 4YM1A 2GNTA 3D6EA 1H8TB 3GZAA 3SKVA 3JQWA 5CFCB 4FXKB 2VQAA 3ZYIB 2VOXA 4EQVA 4BJ0A 4YW3A 4CUCA 3LGRA 5T5PA 3VN4A 4Y1UA 1DQ5A 4I3GA 1QF3A 1CAWA 5FZ8A 4IEUA 3MV01 1VRBA 1GLHA 1X36A 2DFBA 3WF3A 2CGPA 2PN5A 1MPXA 1PNFA 1YCIA 5GZDA 1GZCA 4F83A 1IS6A 5J48A 1F5JA 3RYPA 3ETPA 4LITA 3PU3A 5CFDC 1QNWA 3QH6A 1OKQA 2E63A 4KG8A 1I5ZA 4UW6A 2D6LX 2JG8C 2ZKNA 5B4XA 4DB5A 1HIXA 2WYSA 3THPA 3K4DA 1FV3A 1AXKA 1PK6C 3IDCB 2F4PA 4CXXA 5FZIA 1NT0A 4AAPA 4FT8A 1UYZA 2D97A 5H9QA 5FY4A 4HL0A 2GAUA 4JDMA 3VBSB 2ZXQA 4ZHNA 1C8NA 4HOOA 2CDPA 1ZRFA 4JHZA 4AGRA 4QQHA 4RS5B 5D8AA 3DYPA 1OUXA 3N35A 3EB7A 4Y1ZA 4YYOA 1N1VA 4NHLA 4URTA 4AVCA 2YBPA 4TLFA 5CB7A 1UX6A 4ZKTB 4FP2A 3S57A 4MVTA 1CPNA 2JECA 2RM21 4MHUA 4BK5A 2ZABA 1W06A 2OX0A 2W92A 3NNLA 5DUVA 2VZPA 5FO9B 2D3PA 3DEMA 2YGLA 2A3XA 4AZZA 1VJ2A 2JDZA 5T3NA 1PMHX 2AACA 3ZN6A 4CUAA 1OKOA 4AFCA 2CYFA 4JRAA 2GN3A 2YDEA 1LULA 5KHJA 4YPJA 1IGOA 2BEOA 2WNEA 3WNOA 5JOYA 2ZGNA 1VBE1 3C7OA 3DXTA 2VNOA 4QMAA 2ARXA 3VBUB 5K7PA 1S0IA 1OPOA 2RS12 3KV9A 2V4AA 2KR2A 5BNNB 2BP6A 2OUJA 4GWNA 5FY1A 4AHYA 1OXCA 5KXCA 2W08A 3ACFA 2E26A 1SMVA 5FY8A 5F1RA 1DG6A 2A6YA 5DZGA 1NUKA 3LKJA 3HD8B 5BNPB 4AOCA 4BQ5A 5FOJB 3MIFA 2DF7A 2IZWA 4Q27A 2RJLA 4YZ1A 4I01A 5A7PA 1AR92 1GR3A 1DYKA 3A22A 3ON7A 3R4DB 1Q43A 1RC6A 3PJYA 4XFBA 2FMDA 2AEZA 1QOSA 3DPRA 5BV6A 3CJXA 1BMV2 3DYOA 3PVEA 3NV3A 5FPVA 1REDA 3ZIWA 2YFUA 4RHV2 2VU9A 3AYAA 3ES4A 1H8TA 5HCHA 1MS8A 3H42B 4FPFA 1AX1A 1DQ0A 4N7UA 3WNXA 3B7MA 4XXAA 1VB4A 4U2AA 4RHV3 4YZ2A 1RB8G 2RS33 3S0MA 1ULCA 1K45A 1XYPA 1JZ7A 4LORA 3MW2A 5EJZB 1DFQA 1I1EA 3AMPA 4IE0A 2BNOA 4FFFA 4M3CB 3VBFA 3LEGA 4C0HA 4CUBA 1RUD1 2D3RA 2WQ8A 4QX7A 1J84A 4CDQC 4C91A 4QM9A 5FLIA 4OHXA 1FOD3 1H8VA 3RJ2X 1A6CA 4WM7C 3Q9OA 2NPIA 4H3WA 2JJ6A 4A7ZA 1BK1A 1O6UA 5H9RA 3OOXA 3T1LA 4LHNA 3USSA 4L2NA 1FAYA 5ACA2 4YM2A 4YRDA 4Y5SA 1KGYA 2DTWA 5IUQA 3UGGA 4PIXA 5JIAA 5I8YA 3IKWA 4QXHA 3WVJA 1QNYA 1C4RA 1LEDA 4GKXA 3M3QA 4CP2A 1SBFA 2AYHA 4B4RA 4NMIA 1QY4A 4A42A 1A78A 5FWEA 3SHRA 3AB0A 4AAXA 1CWPA 2XJTA 5A80A 1RUG1 5F3EA 5DAVA 1QJU2 1SCSA 1U5YA 2ENRA 2WT2A 5T52A 3ZFFC 4CCMA 5LRSA 1F2NA 1QH6A 1YRZA 3WG2A 5C33A 3IDBB 1W39A 3VKMA 2YXSA 1TMF2 1WMEA 3BPZA 5LBBA 3KT4A 5I0RA 4EWEA 4Z92B 1R082 4JQTA 3ILFA 2EXHA 5LZ6A 1FNZA 4CA9A 3NNFA 3N9MA 4IEWA 3BTAA 1IS3A 1HDKA 3ZDSA 4B8EA 4HT1T 1POQA 2W47A 1I6XA 2RE9A 4E8CA 1UOJA 1Z78A 3APBA 4MH0E 1SEFA 4Q4Y3 4YW1A 1ULEA 5KR7A 4CE8A 3PTYA 2V4VA 3PIGA 4BQ3A 3WQ1A 5DXDA 4OFGA 4XAAA 1LGNA 2VW0A 2BVVA 2Q4SA 3PJQA 2GZWA 3EBRA 4IE7A 5FWJA 4CCOA 1LOAA 1YQ2A 1SFNA 1XQNA 2BVBA 1RHI1 2R041 5D2AA 2ZGLA 3QCWA 1VMHA 3J9SA 2VAUA 4FPJA 2D44A 2OPKA 2R0HA 2R7EB 2DVBA 2P3IA 4RQPA 2D5HA 3WNMA 1UOGA 2WS91 3VBFC 3WY6A 3WF4A 1DBNA 3W20A 5JWPA 2VQ0A 3U1XA 1W6MB 1P8JA 2P37A 3DUIA 4FFHA 5FUIA 4RGAA 3SEEA 4ASMB 3AFKA 4UI9L 1ACCA 1ND2C 2WWJA 5T5JA 2IVIB 3D4KA 1UU4A 1VBD3 2H6CA 2QQKA 3AYEA 4YW6A 1ULOA 5CEHA 2O0OA 3QH7A 2VG9A 3HVDA 1WLDA 3BU7A 5I0DA 4KBBA 2UWCA 3LF7A 5ACA3 2J1AA 4YM0A 2VTFA 1KS4A 2WLQA 2W5FA 4JV4A 4PDWC 2CGNA 3ES1A 1XE0A 4Y24A 1RUG2 4N43B 3ZLIA 1N3PA 1NKGA 2JDPA 3AL5A 1COV1 2UWBA 5FYTA 5CFCA 5JLVA 1W04A 4L0PA 5C4WA 3IDAA 4P9IA 1T6GC 1IQAA 4DQAA 4NIDA 4HK9A 4LEJA 5DZFA 1IPKA 4LE3A 4ET7A 3K3OA 3PDQA 4AK3A 5IVJA 1D0GA 3TYJA 3KSCA 4NAMA 3C7EA 4PBPA 2TNFA 1R1A1 4KWKA 2CWMA 2VZVA 3N9LA 3RG0A 3WT3A 2WO3A 1OSGA 5A32A 4WM8A 3T0DA 5BNOB 3AKRA 4QM8A 4QXCA 1AL21 4LIUA 2DFCA 3S5AA 3CL1A 2HWF1 1GZ9A 4WM8B 4QX8A 3R4UA 2PMWB 2ZX2A 5FPZA 1OF4A 1GWLA 4AFAA 1F8VA 1VE0A 1QXPA 4IV3C 4YARA 3MF6A 3KHCA 1BBT3 3K4AA 4KG0A 4XFIA 3SISA 1H1IA 5T55A 2IXKA 2OZ6A 1R1A2 4COVA 1JUHA 2JKXA 2ZEXA 3ETQA 3MPPG 4W6YA 4Y20A 5E89A 2GNBA 2BJSA 5F5CA 1LOGA 2QDRA 3RDIA 2C9KA 3MUZ1 4ATFA 1E5SA 1FPN3 1OHFA 4K40A 4BHPA 4CPBA 1SHWB 2ARAA 4XFAA 4HKWA 2A1XA 3J8F2 5F3GA 4AEDB 2KA3A 1ZZ9A 3H1WA 1GP5A 1L7QA 5TSWA 1ZRCA 4MGZE 2X5IA 3MLLA 3I54A 4D7SA 1S0GA 5B4NA 3NAPC 1C5HA 1CZSA 4AHWA 3M3EA 4F3JA 4I2OA 5H9SA 3AXEA 2R49A 2OYZA 5DG1A 2LM3A 4DEQA 1UL9A 5A1LA 1UZZA 5FBZA 1SZBA 4BOWA 2P3JA 3OBAA 3TNQA 3N7MA 2VD7A 2ZPXA 1EAH3 3O0WA 1QOTA 3E5UA 2WL1A 4XFGA 2ATFA 5CFDA 3VDAA 4EWDA 3BTZA 1PO13 2HEWF 5IW0A 1SQ4A 1Y9MA 2ZGTA 4BDVB 4LBQD 2UURA 2QZ3A 1ZA7A 2XLGA 3VZJA 2D7FA 3N7KA 5FZKA 2A6ZA 4GAZA 1GNZA 5FY7A 2JKBA 3CMGA 3O14A 4J6GA 4XZUG 5FUNA 3WNKA 1UMIA 4DUWA 3RJRA 2HWC2 2I07B 2BUKA 4TWTA 4B1MA 4QKFA 4XMIA 2RS31 5HBAA 1XOYA 3ZR6A 4CDXC 1VBA3 5IYYA 4OQ9A 4AXOA 2ORXA 3LIGA 4QQOA 4LO4B 3U4SA 4K21A 2E33A 1AR93 2O8QA 2WQZC 2P2KA 1W2NA 4LHKA 5A33B 3T30A 4I09A 1VBA2 2B8MA 1PIV1 2A3YA 4MXWA 4YG6A 4TTGA 5CKNA 1PGL2 5D21A 3HBZA 2VTXJ 1GZWB 2MNGA 3HNBM 5FZ4A 3K48A 2VBDA 3N7JA 5BNNA 3O1UA 2NYYA 4AQ6A 4QPYA 4QB1A 4ZY9A 3INAA 3RZMA 4BQ4A 4PF5A 4WVMB 2BERA 5EJ3A 3CU7A 4AEDA 2WZR2 1S55A 4AGGA 5EHDA 1RVF1 4WBBA 3ZYFA 1AXYA 2WZEA 4UBHA 3CDZB 4N90A 4Q4W2 1CAUB 1PMIA 2R061 2Y0IA 1OQDA 3MV11 4QU2A 1Z7S1 4WZFA 4AE2A 1GOFA 3GZUC 3RZGA 2CSGA 4XJWA 4PDWA 2YB7A 3BTXA 1R64A 1V9U1 4Q4X1 5FR3A 5FYBA 1G9BA 3SH3A 1IS5A 5CNAA 3MICA 4B1LA 5J96B 3O1TA 1PVC1 5FO8B 3KMHA 1KFUL 1X82A 1R083 2HWB2 2JEMA 2QQIA 3H3ZA 1PZ9A 4JKMA 4PLNA 2VZ3A 3TBDA 4AGVA 3T0AA 4XHBA 2B9UA 2YHJA 4XJUA 1TME2 4QU1A 4Q4X2 5JPNB 3ALQA 1RUF3 2HBTA 2CHHA 1D2QA 2YBKA 4FPGA 1GKBA 1WCDJ 3TWIA 5J36A 3IM0A 1QJU3 1RIRA 4OUEA 4CCDA 4WM7A 1ZRIA 2UYAA 5IAXA 1W05A 1SLBA 1S0EA 2JD9A 2R062 4XCAA 1K5MC 3BIWE 4BISA 2D6OX 1UY0A 1X50A 4IE6A 2JDKA 1HJFA 1O3TA 1YEWA 3H0OA 1QMJA 5FZ0A 1B35C 2WZR1 2NQYA 1HV0A 4MGQA 4COYA 1WUVA 4HSLA 4XUNA 4DPNA 4O65A 2VZUA 4LMFA 2XJVA 4RR3A 4GWIA 5FPXA 4G3YC 1YIFA 2F17A 3FFZA 4HONA 5FUPA 3PU8A 1ENRA 2J1UA 1NCQA 3H1MA 2HYXA 3VBSA 2ZMNA 3VBOA 5BY5A 4M0NA 1LGBA 1ENSA 2NMOA 2WFF2 3KT1A 1W8HA 5FP4A 2IXHA 1O3RA 1DQ4A 1CGPA 1AR63 4L99A 2RDRA 3VBHC 4BIOA 1AF9A 2QQWA 4ES8A 4O9EA 1RXFA 2Q0AA 3VHRA 5CFDB 2PYTA 2P5BA 2VOTA 1NZIA 3OGVA 4K1ZA 4YZ3A 2R0FA 2ADDA 5FPBA 5A3WA 5L9RA 2YY1A 4XW3A 4K9SA 4YW5A 3PNAA 1WCUA 2X5IC 1LECA 4D6RA 1K5MB 2WWUA 3WLUA 3OY8A 1CIYA 3I3BA 5L9BA 2HWC1 3O1SA 1UZ0A 3H50A 1KJRA 4CDWA 4DS0A 4DMIA 1W8TA 2ZX0A 1FXZA 5FAXA 3BU0A 1JYTA 3S7EA 3PUQA 4IEZA 3WCSA 1H30A 2H6BA 5J37A 2VZOA 1NA1C 1T2XA 1COV3 3HNMA 1GANA 4YWAA 3UGFA 3GBGA 2ZAHA 1KQRA 1XSRA 3IAQA 4XFHA 5JZGC 3LOIA 4COZA 4Q26A 1N1YA 2HYKA 3BALA 2WJSA 3J7LA 1G86A 4Q1PA 4OZXA 2A6VA 2FDIA 3F95A 3Q8FA 2XL7A 1UU6A 5ANNA 4CU7A 2NN8A 2VOWA 4Y33A 5HCAA 1GQGA 3HR9A 4BQYA 2VUCA 4OI1A 2Y8KA 5LEKA 4Q4X3 5APAA 3OUHA 2RS53 4BWOA 2WN2A 2C0ZA 1CQ9A 3POBA 1STMA 3ME2A 3PL0A 4NPLA 4P5YA 1PO23 2CDOA 1QJY3 1SACA 1FATA 1UY2A 4QX3A 2BFUS 5F5IA 3ZSMA 3ZYBA 2Q5TA 4GWMA 5L73A 5C9AA 2NM1A 1PM7A 4IEYA 3KF5A 4ZZ5A 5A1AA 3VD4A 1F35A 1I3HA 2DUQA 5AC91 2JD4A 5DZEA 2WNUB 3WDVA 1POV3 5FO7B 4NRMA 4K1YA 3N9OA 5BYNA 5HCBA 3VBOC 2LW8A 4MGIE 4NE9A 4ZS2A 3GZTB 3B94A 4LKEA 3BVCA 1B35B 1C57A 2HKXA 2WZR3 2JIGA 2R1DA 2BTVC 4GD4A 2ZEZA 1FT9A 5GM0A 1O4ZA 4CDXB 4YSFA 5JXIA 5HXMA 1SCRA 3TN93 2D6NA 3R0RA 3OBTA 5KBFA 1UY1A 4P9XA 4DY5A 4YFWA 2RMU1 2V5YA 5FV3A 1W6QB 3UETA 3WDWA 4E2GA 1ZA4A 1W3VA 4Q0PA 4Y1XA 3H3UA 4LR4A 4XTPA 1EAH1 2Z42A 2DVAA 5IK7A 2ORZA 1V9U2 1W99A 1BEV2 4WVZA 3WF1A 3POGA 1OT5A 1W90A 3LSDA 3O1PA 3OCPA 2FDFA 4I0AA 1ALYA 3FHAA 4MXVA 1MACA 1GUIA 3AYCA 5E6HA 4PQ9A 2HEYF 2HWC3 4X6QB 2XR4A 1WLCA 2CY6A 2ZJCA 4DEVA 2BV4A 4MGSA 1JYCA 4KU8A 1MEC1 4Q4Y2 1DGLA 4RD7A 1LESA 4ARYA 5I8SA 2PTMA 1KITA 1UYYA 3AMHA 3M70A 5IT6A 2G9ZA 4BYYA 3WZ1A 5ABJC 2XPJA 4K7JA 5C9AC 1SPPB 2EXKA 4DXZA 1PZ7A 1N1SA 1XU1A 4UWDA 1ZZ8A 4QWNA 5AVAA 3CIHA 3VDDA 2WR9A 2WFF3 4Q0VA 3VZLA 5E88A 1WD3A 3WW3A 2X8KA 4PIZA 3LEMA 2W46A 3TOJA 3ZMOA 1ZYBA 2JXAA 1IKQA 3PURA 1U5XA 2A3WA 1KD7A 4QQPA 1C8M3 3VBOB 2B4KA 1FPN1 1N3QA 2VUAA 5JXJA 1DCSA 4INDA 5EWSA 1BQPA 4MV2A 4BB3A 3WEZA 1X8EA 2OQ7A 2E6VA 4KWLA 5T54A 3H8XA 1VLNA 4NWVA 5T5LA 3FZ3A 4FPCA 2I45A 5ERLA 3O1MA 2O1QA 5FZFA 4P14A 4HANA 4JDNA 1A34A 3WW2A 4CZSA 1GP4A 4JQRA 5FYMA 1H2KA 4LHSA 5LA0A 2CU5A 1W6NB 3P5BA 2FCTA 3MFCA 5F39A 5JCTA 4RQPB 2FD8A 3IWZA 4E27A 1YUDA 1KXGA 1SLLA 4FOQA 4LE4A 4QHBA 2AR6A 1R081 1RTVA 1JYIA 2BOIA 2UYBA 1J83A 1UZVA 1H2MA 4TYSA 2IFRA 1RMU2 5C7GA 2A75A 1GICA 3UNPA 4HN1A 2RR11 1MS4A 4G9SB 3ZN6B 2BGCA 1FOD1 1LOFC 1AR82 2PQSA 3LSEA 1WW4A 5DN2A 3UKVA 3LOBA 3ZVXA 5FLHA 2YPJA 3WCRA 4D69A 1GZWA 1TNFA 3GNEA 2QTWB 4NIHA 1WLWA 2MEV2 1EAH2 3HQRA 1R1ZA 3O5SA 4QPGB 1WWYA 5LA9A 1IS4A 4Z1VA 1A8MA 3FWEA 2HH9A 2QE3A 2TEPA 3ZXGA 4EV0A 5ACA1 1RXGA 2E51A 1W8NA 4WM7B 4UFHA 4LBKA 4QGLA 4AFDA 1G7YA 1HN1A 2ZZQA 3J4UH 3UV9A 1CPMA 1V6LA 2V72A 3AX4A 1E5RA 3B9IA 2EICA 3HWJA 4A7YA 3B00A 5FPLA 4PF1A 1CAXA 3T3YA 1V70A 1W8ZA 1YHFA 3POEA 2Y6LA 3W5MA 1LOEA 4META 3USUA 1GSLA 5FZCA 4XIOA 2D3SA 4KQ7A 4CDUC 4LUKA 4Q2FA 1DDLA 1UIJA 3EHKA 5JSOA 3OF1A 1WCSA 5AC92 2OT7A 4IETA 4Q4V2 3IBMA 4UW4A 1XJAA 1JN2P 4CXYA 2YC0A 5CADA 2XH6A 3JCIA 3OUJA 5DUUA 3ZR5A 3I59A 1NZCA 2VMGA 2ZHNA 4SBVA 1REEA 5LBFA 4XQ4A 2GNDA 1VBB1 4WZCA 2XGXA 5HV0A 4J1WA 4HBNA 1DZQA 3V56A 2C9AA 2EVXA 2WBKA 3QBQA 1PO12 4AWDA 4BZ4A 4YZ4A 4DXTA 2DCZA 4GZ9A 3WNNA 5A6QA 2FDHA 1CIWA 1RMU3 4HZFA 2VZTA 3HQXA 1C28A 3HT1A 4QPGA 4ASKA 1JYXA 1RINA 1NCQC 3VBSC 1BYHA 1JOBA 3PIJA 3I2FA 3POWA 1VBB3 1QJY1 1AR83 1JOJA 2P6HA 4O61A 2EXJA 2RS11 2VMFA 3OTFA 5IVYA 4RN5A 3BN6A 5SV8A 2C26A 1QDCA 5HXVA 1H2NA 4CP9B 3I3EA 3DKQA 3WOGA 5L9VA 3ACIA 4MGTA 2QQMA 2OQ6A 1HRI1 1YIPA 2EA7A 1UPIA 2ZGPA 3GM8A 1CJPA 4UOJA 3CO2A 4CCKA 2VC9A 4YVWA 2R32A 3GYDA 4DOUA 2ZGSA 5A1FA 3DXUA 3GJBA 2X29A 2XHKA 2BGPA 1K5JA 4W65A 4CEYB 1E57A 4OZOA 1PHMA 2WNUA 2TUNA 4CEWB 3TEZA 3BKZA 2VVDA 4A6SA 3ACHA 4OCTA 1UW8A 3JXSA 1ENQA 1QQP1 4ZPIA 4HG6B 4EZHA 3NJYA 1EYBA 4KWUA 5F2SA 5FYCA 1V0AA 3DPRC 3C7GA 2RDNA 5F6KA 1LHOA 4FCAA 4Q4V1 4FP3A 4NHKA 2WNUC 1GOGA 1AYM1 3FHQA 1ODMA 3MUY1 1JZ2A 3ZIXA 1ZBA3 5C6CA 3LA3A 1XRUA 3VHNA 1AYN3 1JH5A 1OQ1A 1YC61 4N53A 3RS6A 3U07A 4L11A 3ST7A 2Y60A 4P5HA 3RPQA 2QQPA 2Y6JA 5I0SA 4JGYB 1JZ4A 1QKQA 4CDQA 3ZFGC 2ZAAA 1F15A 4LO6B 4FTSA 5FBJA 4XYXA 4DNYA 4RA0A 1MEC3 4B7EA 1S0BA 4OULA 1D4M3 2ZACA 3TRSB 3QACA 1OQEA 1ND3C 2PHWA 3OGRA 5M0TA 3AFGA 4NRQA 3NW4A 3MLKA 1BHGA 4M4PA 4QQ2A 4A7KA 3O1OA 4QPGC 1H8TC 4P9LA 3WDTA 4BQWA 2Y6HA 3TNPB 1W9YA 2MEV1 2PLV1 4Q4W1 4UF0B 4AL9A 4FBFA 5FXXA 1IOAA 1RVF2 2Z5WA 5F7UA 3NVCA 4QD2A 4DRVA 1D4M1 3KT7A 3JD72 1UZWA 3CBNA 3ZDVA 5K4LA 2HWF3 4RS5A 4LA2A 1Z7S2 5D8AB 5A7OA 5KXBA 3JB4C 2BBAA 1MR5A 3WQ7A 1WMXA 4D7TA 4KBZA 3WF0A 2J42A 2VUJA 1ZRDA 5A6YA 3DPRB 4UYBA 2CAUA 4B29A 4E4HA 1YNAA 1XNKA 4PLMA 4XMAA 2VCBA 1FX5A 5EP9A 1C1FA 3VKOA 3U11A 2DTYA 1YI9A 1UOFA 3D82A 2YMZA 1F9KA 1V6OA 4X8NA 2ZTNA 3PUHA 5JZGA 4RR3B 3ZPOA 2YPDA 3ABZA 3FMGA 2JDHA 2XG3A 5FZEA 5GZFA 4XTMA 4BPZA 3EQEA 3K3NA 4I02A 4Y5TA 1GP6A 5JOWA 2VM9A 4E9KA 3K46A 2RS32 1CAVA 2ID4A 1JZ6A 2YC4A 3Q8AA 3I8TA 3NMBA 4SLIA 1JI6A 2VCMA 1DQ2A 3I2DA 3AKSA 4AI8A 1ZVFA 4IUGA 4E4DX 1CAXB 1NX9A 3T08A 3WNLA 2ZMKA 3S6PA 3WXPA 3SEPA 1AX2A 4LBQA 3BOPA 4CDWB 2IC1A 1OF3A 1WBFA 1X7NA 2EAAA 5C8WA 3ZO0B 3VBHA 1WBLA 3AKTA 5DPNA 5LY1A 1XNAA 2VNGA 1MS1A 2HWE1 2CAVA 5ISLA 4OI4A 2DCKA 3AC0A 4UW3A 2PAKA 2ZEYA 5DABA 3HNYM 4P9WA 4A3ZA 1XBFA 2WA4A 4RFT0 1S0DA 3ILNA 3CQOA 2RG4A 2ILMA 3KZ4C 2BRTA 4JGZB 3KD4A 3AYDA 3VDDC 3UYJA 3S5QA 2JG9A 1W9TA 3JUUA 3NV1A 3M3IA 2VNRA 3ZOIA 4Q8KA 3VZKA 4Q0QA 5KHIA 3R4SA 5FZBA 3PUIA 3WV6A 3PMSA 5IK4A 3OGGA 4B4QA 2QQLA 2JICA 2VL4A 2CTVA 1RJ7A 4JKKA 5GKAC 1DU3D 1W0OA 2BFUL 4XUPA 3U75A 4YGCA 4EYUA 1AJOA 1A8DA 3OY8B 4UFLA 4HXCA 4IEVA 1G9CA 1JTZX 3MHZA 1TNRA 1ZZBA 2ARCA 2VULA 3K75B 4OUMA 1ZBE2 4QX0A 3PVBB 1W9WA 3KS7A 3KLSA 1J1TA 2QBXA 2RMU2 1G6NA 2WWSA 5FZLA 1CR7A 4IV3B 2WLPA 3ZFFA 4CEWC 1IPJA 3BODA 3OPZA 4QAWA 3KQ4B 5GLZA 1F4AA 1ZBE3 3CJIC 4LQRA 2GNMA 5F6LB 3FC0A 2P6CA 4IDZA 4UAPA 5A3UA 4IEQA 2AEYA 2W1WA 3JBG2 1V6NA 2QCSB 2Y33A 4P9JA 4W4ZA 5FY0A 4EN7B 1CESA 2R073 4E4SA 3GHNA 5J7MA 2X05A 3J7HA 4I0WB 2BNMA 5FLJA 4FQZA 1W8WA 2DURA 5A3NA 5FY9A 1OURA 4AVAA 1X8MA 3D0JA 1AR81 1ZBE1 5FZOA 1HXS3 1AR73
chains in the Genus database with same CATH topology
4UXAA 5AFBA 1NLRA 3NJZA 2A5ZA 4BE3A 2UWAA 4N43C 1S2KA 1HW5A 1WMFA 1COV2 3ZMNA 1HRI3 1Q8VA 2Z79A 3CF6E 4C0BA 2GMEA 4IV3A 3ZFFB 4XJZA 5CVRA 1PVXA 2ZHMA 2N7GA 2ZS6B 1DQ6A 1CAVB 3WW4A 1ND3B 3PMEA 3RYRA 2OW4A 1QHDA 2PHRA 5JAXA 2A6XA 2XVGA 5JOXA 3E5QA 1V6IA 5FDBA 4QQLA 2RHPA 1H4GA 1AX0A 4DFSA 4Q1RA 2E9QA 1J3RA 1FYUA 2WS92 2ZX3A 1WCKA 5JIUA 1TQ5A 1AZDA 4XQWA 3NO8A 1G8WA 4QPIC 3U4XA 2DVFA 4AEJA 4HVRA 5I8TA 1HV1A 1AYN1 1SLAA 4WVVA 2VPVA 4QGMA 1MS0A 4LO7A 2BBVA 1VALA 4XEZA 3AP9A 3FLPA 1HLCA 2LTNA 1AL23 4Q4Y1 5C4WB 4RR3C 2C1FA 3V0BB 1VB2A 1PGSA 5C9AB 1PVC3 2XJSA 2QZ2A 3O0VA 4DINB 2PHUA 4FOWA 1RUI1 2PLV3 1RUC2 4BIFA 3ZFEA 2PHFA 1S0JA 2MEV3 4NO4A 5JDBA 1LHWA 2VW2A 2SBAA 2PLV2 2IWGB 2OUHA 4EROA 4QX5A 5L19A 1D4M2 2WC2A 1XXNA 4GMP3 3UKNA 3IN9A 4D94A 4GA9A 3VHOA 1TEIA 4BCUA 1EPZA 3VBUA 4GQ7A 3GBWA 2HWB1 4HN0A 5DUWA 1MZEA 2D40A 2FZ2A 1LHUA 1XU2A 4EN0A 2AZ5A 1W6QA 2A70A 3AXDA 1UF2C 2A6WA 3B01A 4N53C 5K0UC 1LKNA 3LA7A 2VOVA 4MLOA 3VKFC 1RUF2 3FJSA 1LENA 3ZX7A 4YFZA 4ATEA 2ARBA 4LBLA 4Q4V3 4XBLA 1O3QA 2DCTA 4H7LA 3OD4A 1ULGA 2GDFA 3AK0A 1FNYA 4ES9A 2PHTA 4WVMA 2QDNA 1FI2A 4YVWC 1JBCA 2R6QA 1BMV1 1G9AA 1VBA1 4HLTA 4CDXA 1QGLA 3ZYJB 1S2BA 1C8M1 2WSVA 1AR91 1YFYA 1H1AA 3PHMA 4NR1A 5BUVA 1AR62 1K5MA 1F5FA 4Y22B 1HRI2 5EFUA 4F7ZA 1HX6A 2W68A 2ZZJA 1RUC3 3M3OA 4FAHA 4HVQA 4FPLA 1VBC2 3UJQA 5A32B 1UAIA 2PHXA 1GYKA 4PBOA 3AMNA 3MZHA 1ASJ1 1EP0A 1O5UA 4FTEA 4XOGA 3V0BA 1DZRA 2RM23 3MF9A 4M3CA 1YO8A 4D7YA 2DU0A 3VUOA 1Q8SA 1S0FA 1W6NA 3AJZA 1LRHA 1SLIA 3K51A 3G7DA 3W59A 5GZCA 4M3CF 1PO11 2WIIB 4S2GA 4AEDC 3USUB 1KRIA 1OOPC 5B2GB 1YXWA 3FUQA 4MGKE 4XF0A 3A0NA 2R071 2EALA 1H9WA 1APNA 3KM5A 3DN7A 2RMU3 4MXWB 3RZZA 2XWBB 2HWD2 2IXJA 3V0AB 4CYDA 1NCRA 1GNHA 4JCKA 1CD3G 1LR5A 1VP6A 2FHRA 2JENA 3NV2A 4XFCA 2O8OA 4R52A 1CAWB 4ZU4A 4IEXA 4R9CA 3VZNA 1NE4A 1Q5OA 2D6MA 2Y0OA 2Q30A 1J59A 3E5XA 2CGOA 1HKDA 1RUE2 1RITA 3D8CA 2ZKLA 3KCYA 4JGYA 1AR72 2BW8A 3SCGA 3CJIA 4LBNA 3ROUA 4JAAA 5JI7A 4CEWA 1CVNA 1C1LA 2E7AA 2F6BA 3SH4A 1Z7S3 4TZDA 3RYKA 3LCPA 3ECQA 3ZFGB 4AHXA 3WP6A 4C1WA 4XBQA 3WG4A 1W6PB 2ES3A 2Q8OA 1IHMA 4XF1A 1LOBA 1UD1A 3CLPA 4YG3A 2D93A 3MIBA 3S7IA 3VBRB 1S1AA 1PIV2 4KNCA 4FSJA 3B3QE 1TME3 1FMD1 2ET1A 3AKQA 1DHKB 2AENA 4AG4A 5AFEA 3MPBA 4UBGA 1SDWA 4XDQA 4LULA 2WS93 3FLTA 4ZXKA 2R1BA 4IERA 3FFQA 3V0AA 1ONAA 1YFUA 1YWKA 3R6SA 3IDEA 4COWA 1YJLA 4Y1VA 1PGW2 4S2HA 2HWD3 3H7YA 3IT8A 1U5ZA 3POSA 1PZ8A 1ZBA2 3P3PA 4JC1A 2BQPA 1WLTA 3VHPA 5ABJB 4DY3A 4P9GA 1ZX5A 1OA3A 1ZZ6A 1BJQA 2ETEA 3RNSA 5GALA 1VAKA 3AM2A 1VBC3 1Q56A 2WT1A 3AJYA 5FTTC 1IZ3A 1ZZ7A 3I7DA 1MEC2 5CFCC 2CWSA 1OD5A 2DVDA 2WFPA 1S0CA 3L9JT 1ZNPA 2RJKA 3WP4A 3WINE 4BM8A 3SNMA 1XE8A 4LTAA 1VBB2 1QJZA 2Y26A 4NOTA 1M06G 1N47A 3KCXA 3WR0A 2XLAA 1UCXA 1ENXA 3VZMA 1SBDA 2PFWA 1MZ5A 3MGUA 4JTNA 3M2MA 4GH4B 1UKRA 3MLJA 1BBT1 3E6BA 3S30A 2Y38A 4V1PA 5K0UA 3JBG1 3ZFEB 2D6KA 1UKGA 3WP5A 4R9AA 2WNVA 1AYM3 4FAGA 4JTOA 3D5OA 5BNOC 2JE7A 4GULA 5F5QA 2B46X 2PAEA 1UPSA 1O5LA 2NZ9A 2LUWA 2XVKA 3HIFA 5GJ6A 4AI1A 4N9HA 4AW7A 2XVLA 4PLOA 4IEOA 1VRH3 3LWCA 4EJRA 1BBT2 4GMP0 3D0SA 1CN1A 1NY72 1ULDA 2WT0A 4XILA 2GMPA 4U36A 3VBRC 4KL1A 4OLLA 5BXXA 4W6XA 1SLTA 2WKKA 4LBOA 4Y26A 1QWRA 2VVEA 5EXOA 1Q8OA 2PAMA 2RS13 4K3UA 2WNVB 1QDOA 4BH9A 5EV7A 1YJKA 4W6WA 4N9IA 3NAPB 5DUXA 1ZREA 1Y3TA 1LGCA 1JXNA 3AMMA 4HMZA 2HWE2 4DRRA 3ZXLA 1HXS1 4EN8B 1DLLA 1O4YA 1QXRA 2BPA2 1MZFA 2D6PA 1NQJA 1YYNA 5FRAA 2CV6A 2RR13 5FCCA 3JD73 1URXA 2UY9A 4CDWC 1RHI2 5GLTA 3SXWA 1EPWA 5FQ0A 3RMXA 4MYEA 2QNKA 4XZPA 1NG0A 1POV0 5SV5A 2ZGQA 5DDJ3 5AVPA 2ZMLA 2ZGMA 3OD0A 5J09A 5IK5A 3KGLA 3WQ0A 1Q8QA 2K2SA 1FMD2 1NXD1 1BKZA 2WA3A 4PCRA 5FOBB 1LOFA 3AMQA 3GALA 1OOPB 3A0KA 1F31A 1WD4A 3FHIB 5FMOL 4L8QA 2WFF1 3URFA 1XE7A 2DV9A 1MZ6A 2K9ZA 2W0XA 2DUOA 4K20A 4LLOA 5FMOS 4J1XA 4HFSA 4AHZA 4BLJA 4PDWB 1RGSA 5EZWA 1RUF1 4RL7A 1TE1B 3WHUA 1N3OA 1X33A 2VW1A 3OYWA 2DCJA 1GQHA 3MDPA 3N3HA 1H1MA 2JG8A 2JG9C 3MIDA 3ZYRA 4IQPA 1PO21 1J3QA 4Y4YA 1BEV3 1AR71 3WDYA 4BQ1A 4YM3A 4MGYE 1RUD2 1TME1 3DGTA 2R063 1RUE1 1UIKA 1J1LA 1WA4A 4HPKA 1MS5A 3ZPYA 2JG9B 2XUMA 2BWCA 3W58A 5LRRA 1PO22 5CG9A 1VAVA 4OHWA 3HAGA 1TMF3 2VMIA 2I2SA 2WSUA 1AYM2 4GKYA 4MX3A 2ZX4A 1RHI3 2VOKA 4RHV1 4FPOB 4QGNA 1MVQA 2PELA 3B69A 2HWD1 2H0VA 2FZ1A 3NSTA 1Q3EA 2GC1A 3AP7A 3L2HA 5C4WC 5JVVA 2WQ4A 2IFWA 1PK6A 4YG0A 2JG8B 3WG1A 4H7MA 2DCYA 3VZOA 5KXEA 1JHNA 3I4IA 2AUYA 4ISRA 2PA7A 4WVWA 3TN92 4Q29A 1HQWA 4WM8C 2GC3A 4FPYA 3TB0A 4LUMA 4QPIB 1AYN2 2D98A 3FLRA 3KQRA 1YI7A 4NPRA 3ILRA 5DG2A 4EWAA 3FE5A 4MSVA 1D0HA 2GU9A 1ASJ2 5KHHA 2P34A 1CJDA 3BCWA 2GMMA 1U12A 3AZVA 2ZOEB 4XF9A 3N36A 1A3KA 3MW4A 2ZCWA 4GXLA 3RRDA 2XKOA 2RM22 3M7AA 3BB6A 2E7TA 4XPVA 2A71A 2AH2A 1NCQB 3UJOA 3VBSB 1LTEA 4B8EA 1IKPA 1Y43B 3NKGA 4ITCA 1Z0HA 4AI2A 5JMCA 5A33A 3AP5A 4L97A 1RUJ2 1WMDA 4BA6A 1BVVA 2OZJA 1BVP1 3NKTA 4BMEA 4K6BA 3GF6A 2OVUA 3ENRA 4K8FA 1XNDA 2YROA 5ABJA 1ND2A 1REFA 4R9DA 4AVSA 4XBNA 4B3NA 3IMNA 2PHLA 3H7JA 3LZZA 1ND2B 1QJX1 1OI6A 1Q8PA 3B9CA 2R043 1NY71 1G9FA 4P9YA 2BNNA 2ZBJA 4M0HA 3N4MA 3M4FA 2Q1MA 3VLBB 1NCRC 1J58A 3ZSEA 3ZXJA 2R30A 3J26N 1VRH1 3ZXAC 4YGBA 5GLVA 5L7OA 1AHSA 2C5DA 2XBO3 5JPMB 1LOCA 1EY2A 3BOWA 1KDMA 4XE9A 1U0AA 2QVSB 4AQ2A 5HCFA 3EXUA 1OA4A 1QH7A 1VIWB 2A73B 1AL22 1Y9QA 1YLLA 3ZSLA 1AUYA 2GC0A 1H9PA 2G4IA 2VMHA 3B02A 3I59B 1R092 1POV1 5EYYA 2G9GA 4Y5Z0 3EJKA 1D2SA 5E1RA 5K0UB 1DGWX 1SFYA 2MPFA 2DWRA 3FUOA 4HK8A 1HRV3 1RUH3 3DL3A 1EV11 3C3VA 4R4XA 1JUIA 1ZZCA 2TBVA 4H55A 1VBD2 3RMYA 2HWB3 3E6CC 1XNBA 2GN7A 3ZXFA 5CAZA 1RUD3 1HRV2 1O7FA 1RUH2 1MQTB 2RR12 3NAPA 3SLIA 1GFF2 1XYNA 4MZUA 5I0TA 4GIQA 3SMHA 2Q1ZB 2H0BA 3ZSJA 3OJBA 2HWE3 4OUSA 4KU7A 1RUC1 1EV13 2QUOA 1MVEA 1AL0G 4RS5C 1RL3A 2AREA 1W6PA 2UY8A 4HVOA 4JRLA 4Z2WA 5C8CB 1DF0A 1O91A 3DF0A 2VY0A 4L9BA 3VL8A 3VBFB 4IV1B 3MW3A 4HETA 2PHDA 4JDOA 2X53S 4KH9A 1V6KA 4Y22A 3DKWA 1OLRA 4KGGA 4MUVA 4AI3A 1ZM1A 4LNVA 1VR3A 5A3LA 4Z8BA 3P3NA 5BNOA 5FREA 2D5FA 2DYCA 5E16A 3POYA 4XQDA 3FX3A 4R9BA 1RUI3 3HT2A 4R8HA 5KWRA 1NYWA 4XF3A 3ZFGA 5BNPA 4XJ8A 3RI9A 4YVSA 2FMYA 3ZN5A 4XETA 5T5OA 5C8CA 1OLQA 1W0PA 1BZWA 3FBYA 4XFFA 3WW1A 1HXS2 4GMP1 1GBGA 2LALA 4M3CE 2ZGKA 4LA3A 4Y1YA 3OBRA 2XJQA 5BNPC 1CONA 1FV2A 4CTEA 3EO6A 1M4WA 2QKDA 5KXDA 1QJU1 4JVAA 3JD71 3CNAA 2EIGA 1TMF1 3J8F1 2B45X 4YGEA 1DIWA 3O7OA 1DGRN 1XYOA 2W39A 1W6OB 1HQNA 1LB2A 2YUEA 1HRV1 1RUH1 2XKPA 4AVTA 2ZHKA 3AKPA 2MHFA 4N43A 2OA2A 3VBRA 1EV12 4UW5A 1R091 2B7YA 3M1HA 3AP6A 1PIV3 5KHKA 4YW4A 1KDKA 1UZYA 2HWF2 2ZA9A 2IXLA 3AP4A 3MI8A 4OHYA 2DU1A 1KS5A 3ZYPA 4AVVA 1C3HA 1HQLA 2Z2SB 3UKTA 3WUDA 4A3XA 1VRH2 5L36A 5I91A 3IPVA 4AFBA 4D3WA 1FMD3 3JBG3 2NP0A 5EYXA 4LBJA 4AFMA 3ZFEC 4Y20B 2PQQA 2R072 1LHVA 3UL2A 1ZRRA 2EF6A 1NCRB 2NMNA 4IEPA 4S2FA 5CA6A 3B93A 2GC2A 4R4ZA 1BCXA 4GH4C 5F9TA 4LBMA 2V73A 2YV8A 3ZXDA 3E97A 3NWKA 4N7IA 2ZGUA 3OGJA 4ORFA 4JGZC 3VDDB 2AGSA 1DQ1A 2P3KA 1RUE3 3ASIA 2DUPA 1ASJ3 2G9FA 4AVAA 4OHZA 4Q4W3 4FVVA 4CP0A 2VGDA 3GHMA 4Z82A 4E2QA 5BNNC 4GB31 3ZXEA 5CIRA 1GV9A 4COUA 1CAUA 2E7QA 3JZVA 3W9AA 4GALA 2RS51 4ZU5A 1N1TA 1NLSA 4FPKA 3NL1A 4G4FA 4YLZA 1W6OA 3ATGA 1VAMA 5BPXA 3VL9A 4XF4A 5JZGB 1MS9A 3PVNA 1MQTC 5KC6A 1DZTA 2XJPA 1VBC1 1QJX3 5IK8A 1QJY2 2R16A 3V64A 1D4VB 4GB33 1VBE2 2IXIA 2JX9A 3MIGA 1QQP3 1U5IA 1OPMA 2A7AA 4CDQB 3JU9A 1AR61 4GB32 1UN1A 2GALA 4IV1A 2IXCA 3GBFA 1C8M2 5K9YA 2K0GA 3VGIA 4YVWB 1RJ8A 2XL9A 5K8SA 4C90A 2W52A 3TN91 1LU1A 3T2TA 1R093 3O0XA 3QOPA 3A4UA 3R05A 5JOZA 3IIAA 1OOPA 1PK6B 2GSYA 1B35A 2HEVF 3JQXA 5E8AA 5GZEA 4EN6B 4EN9B 2BYVE 1QOOA 4X6RB 4I3PA 4OI2A 5JSRA 1LEMA 2ZGOA 4OVEA 5H9PA 4FPEA 1LJ7A 3NV4A 4N53B 4NHMA 1UU5A 4FPHA 5D1IA 4Q0UA 1RUOA 3ZYGA 1WW7A 2XJUA 4AI0A 3H8UA 3H9AA 3WHTA 4E4ZA 4IESA 3MIHA 4HKLA 1RUNA 2B42B 4ZU7A 2XWJB 1PVC2 4PIYA 4AVBA 5LEJA 1O4TA 1RVF3 2NLRA 2ZGRA 3OYWB 3KB5A 3SH5A 4XXPA 1AJKA 4JGYC 1WW5A 4O9GA 4XIKA 4IL7A 1NA1B 1H4HA 1ND3A 2FQPA 5CU1A 3U10A 1O3SA 4QPIA 3THTA 1NA1A 2EXIA 1W6MA 2XJRA 3SCHA 3RWNA 2WNVC 2Z69A 3MYXA 1VBE3 1Y7BA 2CL2A 1RMU1 5GLWA 4Q8LA 3T1MA 1QQP2 3VBHB 2P17A 3QLQA 4B7KA 4RSUA 4CRQA 3PLQA 1RUI2 1PGL1 2VECA 2UU8A 1LCLA 1ULFA 2XBO2 3X29B 4YZ5A 3VV1A 1LODA 3IPVB 5J98B 1NXMA 4FO9A 3KCCA 1YFWA 5DDJ1 1UMZA 1OMIA 1H0BA 1AXZA 5FFOC 3M8LA 2YYOA 3H1YA 2WZPP 4CDUA 1FPN2 4HPKB 3FBMA 4LO5B 4M00A 3RSJA 5JI9A 3J8F3 4OI0A 3SITA 3U0ZA 3DV8A 1AVBA 4YW2A 3VBUC 4FTBA 3WD5A 1RUJ3 2XLFA 3C2UA 5LK5A 1V00A 3HMYA 5JSPA 3WX5A 1NE6A 3V65A 2RS52 4NVPA 5JR7B 4YNIA 4AYUA 5CG8A 3WUCA 3WDUA 2QJVA 5GLUA 4WV8A 4RQPC 4OHVA 1JW6A 3PVOA 2ZX1A 4BMBA 3M3CA 5BNQA 1BEV1 3ACLA 3L2YA 1RUG3 3RI8A 3CEWA 4Q0SA 3RQ0A 2SLIA 3VKNA 4YVSC 4XHXA 5L7OB 1SLCA 3KGZA 4LLFA 3CJIB 2KXLA 1MS3A 3QD6A 4B4PA 5CBLA 2VXRA 1XNCA 2OIIA 4PJYA 1LHNA 3MIEA 4CDUB 5AC93 5I93A 4JGZA 1B09A 1OFSA 4A2UA 5HI0A 2I74A 2HJIA 2WINB 4YGDA 4DZGA 4E2SA 1YFXA 1V9U3 4TSVA 4XJAA 3TAYA 3WP3A 4GH4A 2ET7A 2JE9A 4FQ4A 3AZZA 1L3JA 2QFEA 4HSJA 4AQSA 1V6JA 4KWJA 3WDXA 4BLIA 1QJX2 2GH2A 4ISQA 1H2LA 2GH8A 4NWWA 1FOD2 3MFAA 5GZGA 3LAGA 3SCFA 3ZXKA 4AEMA 2B5HA 2YGMA 4FOYA 2ERFA 4M01A 4L92A 1WW6A 1CX4A 2D43A 1I9RA 1G9DA 4H14A 4NN0A 2E53A 1RUJ1 1V6MA 1LU2A 4HKOA 3AZXA 3VKLA 4CP1A 1DYPA 2VVFA 2XB6C 4LHLA 2CNAA 5LK7B 4F8AA 2V09A 1J3PA 5I0UA 1W2UA 4LBQB 5T50A 3G6JB 2R042 1PGW1 4LT5A 4ASLA 1NQDA 1NOVA 1ZBA1 1OFNA 2X5IB 3ZN4A 2ZHLA 4IXLA 3LB9A 4XJ9A 4RGGA 3MEPA 1KFXL 5KC5A 1MQTA 1PNGA 3B5LB 3E6DA 1R1A3 2KM2A 2BWAA 5DDJ2 4LO8A 5L7OC 1WGPA 3ELNA 5KHGA 4YVSB 5A3MA 4AEKA 5C8CC 4X8PA 2YZ4A 4CEYC 1QXJA 2XBO1 2FBEA 3AZWA 4KGQA 4ONUA 4S2DA 3JB8A 3HN1A 4IV1C 5J3UA 5D8AC 4AF9A 4QXKA 1DGWA 3AZYA 4QT6A 4I0BA 1KJLA 4C1XA 4FXGB 1OA2A 4CEYA 3ZSKA 4Z07A 1DGRA 3LA2A 2DVGA 1SBEA 2B39A 1QU0A 1C5IA 3WG3A 4FOVA 4I30A 3O12A 3UK9A 3N7LA 2VH9A 1BXHA 1VBD1 2EAKA 4YM1A 2GNTA 3D6EA 1H8TB 3GZAA 3JQWA 5CFCB 4FXKB 2VQAA 3ZYIB 2VOXA 4YW3A 3LGRA 5T5PA 3VN4A 4Y1UA 1DQ5A 4I3GA 1QF3A 1CAWA 4IEUA 1GLHA 1X36A 2DFBA 2CGPA 2PN5A 4F83A 1PNFA 1YCIA 5GZDA 1GZCA 5J48A 1IS6A 1F5JA 3RYPA 5CFDC 1QNWA 3QH6A 1OKQA 2E63A 4KG8A 1I5ZA 4UW6A 2D6LX 2JG8C 2ZKNA 4DB5A 1HIXA 3THPA 1FV3A 1AXKA 1PK6C 3IDCB 2F4PA 4FT8A 2D97A 5H9QA 4HL0A 2GAUA 4JDMA 1C8NA 1ZRFA 4AGRA 4QQHA 4RS5B 5D8AA 3N35A 4Y1ZA 4YYOA 1N1VA 4NHLA 4URTA 4AVCA 4TLFA 5CB7A 1UX6A 4ZKTB 4FP2A 4MVTA 1CPNA 2JECA 2RM21 2ZABA 5DUVA 5FO9B 2D3PA 2YGLA 2A3XA 1VJ2A 2JDZA 5T3NA 3ZN6A 4AFCA 2CYFA 4JRAA 2GN3A 2YDEA 1LULA 5KHJA 1IGOA 2BEOA 2WNEA 5JOYA 2ZGNA 1VBE1 2VNOA 4QMAA 2ARXA 3VBUB