1NA1B

The structure of hrv14 when complexed with pleconaril
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coat protein VP1
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
molecule tags Virus
total genus 51
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1na1B00
5J96B 2ZAHA 2BFUL 1VBB1 3NAPB 4CEWA 1V9U2 5D8AB 1HRI1 1PGW2 1OOPA 1HQNA 2WS92 1AR81 4GMP1 5FMOS 5CFCA 5ABJB 5L7OA 1EAH2 4CDXC 1COV1 4QPGA 4WM8C 4YVSA 1VBA1 2RS11 4RQPB 3ZFFB 4IV3A 1X36A 1CJDA 4RR3A 1AYN3 1C8M2 2PLV2 1MEC1 1AYM2 1ASJ2 3JB4C 2RS31 4PDWC 1R092 1QJX3 1VBC1 1IHMA 5JZGC 4N43C 2RS53 1BBT3 2TBVA 4CDXA 3VBRC 1TME3 5BNNC 4WM8A 2HWB1 2RM23 1AR92 2HWE2 5BNOC 1VBD1 2ZTNA 1VRH2 5GKAC 5JZGB 1PIV3 2IZWA 2RR12 4PDWA 2R041 3LOBA 3DPRB 5BNPB 2R071 2X5IB 1TMF1 5C9AC 3JB8A 1B35A 4LLFA 4IV1C 2WZR2 4N43A 1VBB3 1ND2B 4RS5C 3VBRA 5BNNA 1AR73 2RMU2 5K0UC 5BNOA 1GFF2 4CDWC 3FBMA 4GMP3 4Q4X1 1COV3 5C8CB 1K5MC 4WM7B 5CFDC 2HWC1 2RS13 5C4WC 1AR61 1VB4A 4RS5B 4QPIC 3JBG2 5A32B 3VBOB 1POV0 1RUF2 2XBO2 5C9AA 4YVWB 3TN93 1F2NA 1HXS2 4IV1A 1ND3C 2WLPA 2FZ1A 2RS33 4CEYB 4GB33 1FOD2 1RUC1 1FPN3 5K0UA 1RB8G 3ZFGC 1RUG1 1VBE2 3J8F1 1PGL1 4CDWA 1QJX1 5ACA2 5DDJ1 1NY72 2WFF3 1K5MA 5CFDA 5C4WA 1BBT1 1H8TC 1QQP2 2PLV1 4QPIA 1PO13 1TME1 2MEV3 4JGZB 1VBD3 3VDDB 1RUH3 4RHV2 4Q4V2 1ND3A 1RUD2 3VBUC 2BPA2 3NAPC 2R043 2VQ0A 5D8AC 1PIV1 3ZFGA 1H8TB 1FMD1 2R073 1TMF3 4FTBA 1RHI2 1RUJ2 2BFUS 1E57A 1RMU2 4Y4YA 5ABJC 1ZBE2 4RQPC 3VBUB 3ZFFC 4Q4W2 1PO21 1ZBA3 1AR71 3CJIB 1RVF2 2GSYA 4Q4X3 4CDUB 2HWC3 4GH4B 1AR63 3NAPA 1RUE1 1BEV2 5D8AA 3VBSC 1QJY2 1R1A1 1QJU2 3VBFB 3TN91 1HX6A 1RUC3 4RQPA 3ZFFA 1AYN2 1EAH3 1RUG3 4GB31 3J8F3 2DF7A 1FPN1 3VBSB 2QQPA 5DDJ3 2R061 2HWF2 1MQTB 2WFF1 2PLV3 1AYM3 1ASJ3 3DPRC 1BMV1 5BNPC 4Q4Y2 2X5IC 2RS52 3JD72 5AC91 1AL21 1PO11 1FOD1 1R093 4CDQB 2MEV1 1D4M2 1NA1B 1RUH1 1Z7S2 3ZFEB 1PVC1 1ND2C 4BCUA 1NY71 1FMD3 1M06G 1RUI2 5JZGA 1HRV1 5C8CC 2BUKA 4WM7C 1VAKA 1PO23 3VBOC 3DPRA 5BNPA 2RR13 1SMVA 2X5IA 4GMP0 1QJZA 4YVWC 1ZBA1 1EV11 1HRI2 3VBHB 4CEYC 1RUE3 1ND2A 4JGYB 2WZR3 2HWD1 1R081 1AR82 5LK7B 1R1A3 4Y5Z0 2RMU3 1COV2 1V9U1 1VBA2 2RS12 2WWSA 5FOJB 1NCRB 1PGW1 2WS91 4FTEA 1NCQB 4RS5A 5A32A 3VBOA 4JGZC 1MEC2 3VDDC 1EAH1 2R063 4YVWA 2RS32 4NWWA 1NG0A 2XBO3 1AL0G 4CEYA 1VBC2 5A33B 1C8M1 1VB2A 4FTSA 5AC93 1AYM1 1AL23 1FOD3 1ASJ1 4N53B 1POV3 1PVC3 1R091 2HWB2 5ACA3 1VBD2 4JGZA 3VDDA 4AEDB 4Z92B 3CJIC 4CDUC 1HRV3 2R042 4GH4C 1AR91 2HWE1 4Q4V3 1TMF2 1D4M1 5J98B 1H8TA 1VRH1 1WCDJ 1EV13 3VBFC 2RR11 1RUI1 5L7OC 1RUJ3 1OPOA 2HWD3 1R083 1RMU3 3VBUA 1ZBE3 4CEWB 2WZR1 1F8VA 3M8LA 4Q4X2 1DDLA 2HWC2 1V9U3 3CJIA 1OOPB 1AR62 4CDUA 2RMU1 1MQTC 4GH4A 2WS93 5ABJA 1RVF3 5CFCB 5L7OB 4QPGB 4YVSB 1BEV3 1X33A 4IV3B 4CDQC 3VBFA 4RR3B 1NA1C 1RUC2 1QJY3 3JBG1 3ZFEC 1QJU3 1RUG2 1RUF1 2XBO1 3IDEA 3J8F2 1PGL2 1C8M3 1QJX2 5FMOL 2XPJA 1HXS1 5DDJ2 3VBSA 1BBT2 1MQTA 1TME2 1POV1 1VBE1 2HWF3 2RM22 4CDXB 5ACA1 4WM8B 4CDQA 1B35C 4Q4Y3 1NA1A 1AR93 1QQP1 2HWE3 3JD73 1PIV2 3VBHC 3ZFEA 1FMD2 4JGYC 1D4M3 3S6PA 3HAGA 1VRH3 1Z7S3 4RHV1 4PDWB 4Q4V1 1RUD1 2ZZQA 1RUI3 1VBB2 1W39A 1B35B 1PO22 1AUYA 1NCRC 4N43B 1AR72 1RHI1 1NCQC 1RUJ1 3VBRB 5BNNB 1RMU1 5BNOB 1ZBE1 1RUE2 1NOVA 4Q4W1 3VBHA 4JGYA 5C8CA 4WM7A 1HRI3 1R1A2 1RVF1 2Y26A 1AR83 1OHFA 3TN92 4N53C 1BEV1 5C9AB 3JBG3 1RUF3 4GB32 1NCRA 4IV1B 1VBA3 1FPN2 1QJY1 1NCQA 1HXS3 1QJU1 2R062 4AEDC 5K0UB 2WFF2 2FZ2A 1MEC3 4CDWB 1CD3G 1AYN1 1VBE3 1BMV2 1A6CA 5A33A 1C8NA 5AC92 1AL22 1K5MB 1PO12 5CFDB 2MEV2 1VBC3 5C4WB 1RUH2 2HWF1 2BBVA 4QPIB 1PVC2 4N53A 1QQP3 4NWVA 4Q4Y1 1ND3B 2RS51 3JD71 2HWB3 2R072 4RHV3 4CEWC 1RUD3 4AEDA 1HRV2 4FSJA 1Z7S1 3ZFGB 2RM21 1OOPC 1RHI3 5CFCC 2GH8A 1ZBA2 1EV12 4QPGC 4YVSC 3ZXAC 4RFT0 4EJRA 4IV3C 4SBVA 4RR3C 2HWD2 4Q4W3 1R082
chains in the Genus database with same CATH superfamily
5J96B 1V6OA 1ZZ9A 5HV4A 5A7WB 2VR4A 1UYZA 2ZAHA 4LO4B 4XDOA 3SLIA 4DXTA 1Q8PA 3UYJA 5E8AA 3VKLA 5F6LB 3WG2A 4UI9L 5F39A 1S2EA 1K3IA 5TSWA 1LKNA 3WQ0A 1H4GA 4W8JA 4M01A 1AJKA 1HQNA 3N9LA 3PUAA 2YU1A 3AMMA 4KWLA 5FO7B 2R1BA 4E4ZA 4FOVA 5FMOS 2GDFA 5C6CA 1URXA 1MR5A 2GMMA 1EAH2 1OURA 3CZUA 5H9RA 2ZGLA 4WM8C 3O5SA 4YVSA 2RS11 5FY7A 3TOJA 4FBFA 4IV3A 4XHXA 4JQTA 1AYN3 2WA3A 1UX7A 1WLDA 1WGPA 2CAVA 2EAKA 2QQLA 3PHMA 4QT6A 1Q8QA 2VPVA 3O1MA 1W8ZA 4QQOA 5EFUA 1ASJ2 3AZWA 3CU7A 3HIFA 3PMSA 4HETA 4KWUA 1Z78A 5I93A 1GZWA 1N47A 2TUNA 1R092 4BB3A 1QJX3 3Q8EA 2R49A 3JQWA 5LK5A 3P6BA 4XJWA 1HB4A 4YFWA 1GWMA 4QDRA 2WRAA 4AI3A 1JZ4A 1JYNA 2YG0A 3W20A 3H8RA 1FX5A 4MSVA 5FPUA 1X9PA 4N43C 4FQ4A 2TBVA 4UFMA 4OHVA 5FPVA 4PBOA 4XFGA 3MO4A 3VBRC 4O7XA 2H6BA 3BB6A 5DABA 5F9TA 1IPSA 4EN6B 2HWE2 2CY6A 3LFIA 4MGZE 2W0XA 1QIQA 3ZSKA 2WNOA 3BTZA 3S5AA 2P6HA 4QU2A 4WBBA 1VRH2 4LOSA 4ET7A 3ILRA 1YC61 5GKAC 3MUZ1 4QM9A 5B4XA 1PIV3 3NV4A 4FT8A 4MXWB 2RDRA 4I02A 2RR12 4P08A 4PDWA 3ORJA 4AQ2A 5FWJA 4KG0A 5HPOA 1GICA 1C1FA 2ZABA 2X5IB 3I2OA 1TMF1 3KGLA 4K40A 2VQUA 3JB8A 5I0RA 2QKDA 4Q8LA 4D0QA 4F7ZA 4IV1C 3JXSA 1VBB3 1VRBA 2P6CA 1ENSA 4QXHA 2E31A 1LHUA 1ND2B 4CUCA 2B7YA 5DUVA 5BNOA 2WZEA 4K3UA 1NZIA 1JYCA 2Q8CA 2VVDA 3FBMA 4KWKA 4Q2FA 1ULPA 1L7QA 3LSDA 4C1XA 2J1UA 5HV0A 3C2UA 3WSOA 3OY8B 2D44A 4XVHA 5IVJA 1AF9A 3GJAA 4XIOA 4QGMA 3JBG2 5I0UA 5IVVA 3VBOB 2XBO2 1SFNA 4F8AA 3VGIA 5C9AA 4AGRA 1F2NA 1QHDA 4I01A 3VZKA 1D2SA 2WAAA 4EROA 4JHTA 4V1PA 5IVFA 4GZ9A 3UL2A 4CEYB 5KC6A 2HBUA 3D0SA 1WCUA 1W8WA 1O3TA 3KT4A 1QU0A 2GNMA 5C71A 3KV4A 4JV4A 1H6YA 3PTYA 5L9RA 2VMDA 1UU4A 1JZ8A 1U5ZA 5DDJ1 1TE1B 2RJLA 3MV11 2ZGUA 2XUEA 2GP5A 2ARXA 1K5MA 3AMNA 2YYOA 2V73A 4IGOA 1H8TC 3N3HA 2QQOA 1W03A 2PLV1 2Y6HA 3KQ4B 4O61A 1PO13 3V65A 2ZHMA 4AHYA 1WBFA 4NHLA 2Q4SA 4BA6A 1F4AA 1J3RA 2JG8A 3RZZA 5DUXA 5F3GA 4QX1A 5FPXA 2MNGA 5C3QA 4RHV2 1VR3A 5C3OA 1G9CA 1IS4A 1IQAA 2A73B 3AKQA 3NNJA 5IW0A 1XRUA 3GJBA 5EYYA 3WQ1A 3N9QA 4HVOA 2RDQA 5B4NA 3WD5A 5DAWA 3ZFGA 1E5IA 3FN9A 2PHTA 4K20A 1O3QA 3ZYBA 4NIGA 1RUJ2 4P00B 4U2AA 2VTXA 2W47A 1E57A 1RMU2 3E6BA 4Y22A 4AHXA 1WW6A 4CUAA 4WZCA 2VOTA 1ZBE2 2QQNA 2VO5A 3MHZA 3IIAA 3K3NA 3I3BA 4FPHA 1LOFA 2VZQA 4ORFA 2SBAA 4OUMA 2A6WA 2WQZC 5FPBA 3M7AA 2B9UA 3M2MA 2GSYA 2ID4A 3KMHA 4E2QA 4TTGA 1J1LA 1DGRA 2HWC3 4GH4B 4A41A 4K9SA 2DDUA 4XQWA 1C5IA 2OUHA 5E16A 1AX2A 4DUVA 4DZGA 4FP2A 2Y6JA 5LBCA 2QDRA 5JPMB 2ZGMA 3J7HA 4JRLA 4LKDA 1WCKA 1R1A1 2CSGA 3U1XA 1QJU2 5KBFA 2JE9A 3WG1A 4UFKA 4RGAA 1F5FA 4CCEA 5JR2A 4JKMA 2V09A 1CIWA 1GZCA 2A5ZA 4XJ8A 2WLQA 2P17A 2NQYA 2XB6C 1EAH3 4QQ2A 1RUG3 4GB31 4C90A 3CL1A 1PK6C 3OUHA 3SH3A 3VBSB 4MOAA 3AMQA 3AC0A 2BOJA 3FE5A 2PHFA 1C5HA 3GZAA 5DQ0A 3KV9A 2ORZA 3N9MA 2E7QA 1S1AA 2XWBB 3NJXA 4AEMA 3ON7A 3NNFA 3LEGA 4K1ZA 1ASJ3 2DWRA 3I3DA 3H8XA 5I8SA 4ZS2A 1JZ6A 3DPRC 4Q4Y2 3VD5A 1AL21 4LBKA 1FOD1 1R093 4LHSA 5FBZA 4COZA 5GZGA 3VD4A 2CU5A 2QQJA 1U12A 2K9ZA 1PVXA 2WWUA 1LHVA 1AX1A 5GZCA 3BOWA 2PMWB 3EYPA 5A6XA 3P1IA 5LEJA 4YG3A 3NW4A 1I5PA 3JCIA 4B1MA 4L0PA 4W65A 1OC1A 5LWBA 2IFRA 1HRV1 1L7LA 2BUKA 2WINB 4HK9A 4N8MA 4MXWA 3A21A 4O9GA 4A3XA 1DGLA 4GJYA 1YO8A 5LBFA 4INDA 3POIA 2YHJA 3M70A 3NSTA 3U11A 4UT5A 2RR13 1JOJA 1DQ0A 1EY2A 2X5IA 2VH9A 2BRTA 1VMJA 2ZGSA 1QJZA 2H0VA 4M3CB 4YVWC 1ZBA1 4QX5A 5FKCA 3RJ2X 3VBHB 2D7FA 4CRQA 1ND2A 2BWCA 2ZGNA 5FYSA 5BXXA 3RZLA 1J84A 2HWD1 3ETPA 3GZTB 4IE4A 5KR7A 3POGA 2Q1MA 3MYXA 4XUQA 5CISA 4UFLA 5LK7B 3T0BA 1YYNA 1IS6A 2VU9A 3LD8A 4Y5Z0 5FWEA 5T5JA 3UKTA 5GZDA 3E97A 3ZIWA 2RS12 1SHWB 4BXFA 3N4MA 2ZEXA 3AVRA 1O5LA 5FOJB 3OY8A 2NPIA 1PGW1 2WS91 4XYXA 4OLLA 1IQDC 4XCAA 1ACCA 1FV3A 1ZREA 1YEWA 1G9DA 3B93A 5GLWA 3VBOA 1NYWA 1W6MB 1ZRRA 2A75A 2WFPA 5FYZA 2ZPXA 2DYCA 4NWWA 4LO8A 1NG0A 2P2KA 2VZPA 2XBO3 2WIIB 1VLNA 2R1DA 1W05A 3R0RA 4KU8A 3TB0A 1NT0A 5JI9A 3SQOA 3RVHA 4CEYA 3HQXA 3OEBA 2P3KA 4M0NA 4PI0A 3HT2A 2ZGPA 2JDAA 4BLIA 4D6QA 5FZ7A 2YC4A 4IEVA 1G6NA 1C28A 3B02A 2TNFA 4Y20A 4B8EA 5KXDA 4QM8A 5FKBA 3EHKA 2YZ4A 4HPKB 3WNKA 2VZRA 1LENA 2YPJA 3QACA 5AFBA 4LBMA 3IIIA 5C9AC 2J1AA 3M3EA 5T55A 5CBLA 1ZRIA 2XUMA 1PMHX 4Z92B 3AP6A 3N9NA 3I4IA 3TAYA 1QXJA 3VDBA 1TMF2 1JTZX 4YARA 1UY3A 1SCSA 4QXBA 1OXCA 1SEFA 4Y1XA 5FZDA 2Z4FA 2CGOA 3ZSJA 5FYVA 3SITA 5H9SA 1BK1A 2CNAA 4LR4A 4XFBA 4CP0A 3PIJA 5CKQA 5L7OC 1RUJ3 2Q0AA 4CCDA 1R083 5CKNA 1RMU3 5SV5A 1YWKA 2D40A 2W3JA 1ZBE3 3EMRA 1MPXA 1WCQA 2DVBA 2WDBA 4EWAA 2ZX0A 2XLFA 3A0NA 3TNQA 1V9U3 2Q8EA 4BQ2A 1OOPB 3G7DA 4GH4A 2WUHA 3FUQA 5ABJA 2XDVA 2C26A 4WVWA 3ABZA 4XAEA 4NPRA 4QPGB 2VCMA 2R32A 4QKFA 3WW2A 4ES9A 1D0GA 2BNMA 4NIDA 2L9LA 4H7MA 4QDSA 3HWJA 4FXGB 3RFRA 1Q56A 1QJU3 3WVJA 4I0BA 4XETA 1OQEA 1RUF1 1JOPA 3DV8A 4LHNA 4LBQB 3BI3A 1HXS1 4LJHA 5DDJ2 3L2YA 5CNAA 3ZXKA 3VBSA 1NAEA 2W91A 4GWIA 3AJZA 3ST7A 1JZ2A 3B7MA 4YNIA 2DBIA 4X8PA 3WDXA 2ZZJA 4PIZA 1EUTA 3QBQA 4FVVA 1KS4A 1BKZA 1A8DA 3F95A 4MGKE 3J26N 4CUBA 1VBE1 4BIFA 1O6UA 3B00A 3CZJA 4HANA 3H8UA 5ACA1 2WO1A 4WM8B 4ZU4A 4MO3M 4AI2A 3GYDA 3H8OA 1B09A 1GP6A 2EIDA 1VIWB 2KR2A 3IBMA 4Q4Y3 4R9AA 1AR93 1QQP1 2J1TA 1Y4WA 1Y9GA 4XILA 5DN2A 5FRAA 4CCKA 3DYPA 1CWPA 2P4EA 3O0XA 4BYYA 3AYAA 2VMIA 3VD7A 1AHSA 3AYEA 3JQXA 2FHRA 3UKNA 1CR7A 1UIJA 3LDBA 4BWOA 1O8SA 4Q4V1 2Q5TA 4Z82A 1H6XA 1APNA 3MBWA 1RUD1 1V6KA 4D8MA 3OBZA 1VALA 1DGWX 4RN5A 3K46A 5FYUA 1W9SA 5CG9A 2VMCA 1JODA 4QU1A 4YW4A 1B35B 2WAOA 3T2PA 1UYYA 3K4DA 4N43B 2QNKA 2D97A 1YLLA 5FY9A 1NCQC 3SCHA 3B69A 3OBRA 2RV9A 3VBRB 3W58A 1IS5A 4M3CA 5KWRA 1PMIA 3VHOA 4Z2WA 1UZZA 1IOAA 4GKYA 3OUIA 1UOFA 2OZJA 2J1RA 4Q4W1 4RYDA 3E5XA 3VBHA 1ZRDA 3N7LA 2I07B 1FXZA 5C8CA 1UU5A 4WM7A 4D3WA 1W04A 1JW6A 1R1A2 1W6QB 1SLTA 1UOJA 2F17A 2ZJCA 1BVVA 2ADDA 4PCRA 3OG2A 4LBOA 1GSLA 2VW0A 1W99A 4Y33A 4QPYA 2Z69A 4GB32 2Y6GA 4IV1B 1MS0A 3D82A 3SKVA 1R64A 2DU0A 4QXCA 4MX3A 3KV5A 4LBNA 3HMYA 1W6MA 4KWJA 3MPPG 2VMEA 1W3XA 1XQNA 4AEDC 1KDMA 1SLIA 2IXLA 3KT1A 2JDYA 3ZPYA 1UYPA 1QJEA 3LGRA 2PHRA 3VDAA 4LEJA 4AXOA 1CD3G 1C1LA 1GOGA 5GZEA 1UY0A 4AVAA 1KQRA 2PHDA 4CP9B 5IK5A 3E5UA 4EZHA 2D5FA 1AL22 3SC7X 2QBXA 4C8DA 2V72A 4R9CA 5FLHA 3FHAA 2BERA 4YGCA 3ME2A 4KQ7A 3AKPA 1DGRN 5DXDA 3ZN4A 1E5HA 1D7PM 4UAPA 4Q1RA 4DRVA 3E1F1 1FYUA 4NPMA 3ZSEA 4HPKA 1UCXA 2RS51 4ISRA 5A3TA 5JLVA 1ZRFA 3U78A 2R072 1A3KA 4J1WA 1UW8A 4BU2A 3I2JA 3W5NA 2X09A 4XJAA 2NZ9A 2Y34A 1HRV2 3O7OA 4RGGA 4BISA 4FSJA 2DVDA 3V0AA 2RM21 3OB8A 4UFJA 3CJXA 5CG8A 3RGBA 4HBNA 2VY0A 2VJXA 4ASLA 2UY9A 3LQCA 1K45A 1FV2A 4L9BA 5CFCC 2GH8A 3IMMA 1ZZ6A 1DFQA 1ZBA2 5CIRA 1SLLA 1OH3A 3KVBA 2JKBA 2AR6A 5APAA 1S0EA 2WSUA 1MZEA 4RFT0 3C8XA 1BJQA 3RI8A 5BNQA 2CGPA 2JD9A 2ENRA 3ZYIB 3ZYRA 2HWD2 2QDNA 5M0TA 1IKQA 4QD2A 4DQAA 2ZHKA 4Q0VA 1WW5A 1LGBA 3UJQA 3WDVA 4YZ4A 5SV8A 3I3QA 3K4AA 3WCSA 3FLRA 5T54A 1W6NB 1HIXA 1ULEA 1HB3A 1PGW2 1OOPA 2WS92 3MPBA 3QLQA 2NMNA 3NV3A 5FYIA 3TYJA 2ZX1A 3RZJA 2A3YA 5FP7A 3ZR5A 5J3UA 4CDXC 2Z79A 1Q3EA 4QPGA 3U37A 2JJ6A 3OEAA 3M4FA 5FZHA 4E8DA 3THPA 1JZ7A 1S2BA 4P9WA 2E26A 3NJZA 4Y4RA 1BHGA 1CZVA 3D0JA 3H1YA 2BGPA 1XSQA 1MEC1 2WO2A 5T5OA 4LBQA 2UWCA 3IKWA 1W2OA 4YZ2A 2W1WA 4CU9A 1DU3D 3OD4A 4Z07A 1IHMA 1WLCA 3AB0A 1ZVFA 4DY3A 2VZVA 5JZGC 2QQIA 3WP3A 2ZOEB 4BQXA 4BQ5A 4MV2A 2RDSA 2C0ZA 3VKOA 1O4ZA 2YBKA 2XVGA 4WM8A 2LALA 2ORXA 3WW4A 4B3NA 4E8CA 4UOJA 2QQWA 2JWPA 3KS7A 1PK6B 1TEIA 1VBD1 2AEYA 4AEJA 4AEKA 4XEZA 4MUVA 3RQ0A 2PHWA 3MLLA 1IPJA 1OD3A 4IEQA 4BK4A 5FY1A 4CU8A 1ULFA 2F4PA 4IE6A 4AK3A 5FZ0A 2XJRA 5A7QA 2Y33A 2XHNA 5HXVA 1SPPB 3LIGA 4JZRA 5GALA 3DPRB 2VCAA 3WNNA 3HN3A 3LZZA 4EYUA 4UW5A 4XUNA 1B35A 1N3PA 2HJIA 3I59B 1W6PA 5A3LA 2VXRA 4N43A 3WQ7A 2JIJA 3HJRA 5IVYA 4QGLA 4FPJA 3QCWA 4LOTA 3VBRA 5FO9B 4LQRA 3TEYA 2WQ8A 1JZ3A 2ET1A 2PFWA 1ZYBA 3GDBA 2B5HA 3WW3A 3U4SA 1YFYA 4HKOA 2UWAA 4GMP3 4UFHA 4ZS3A 4CCOA 5HCAA 1AXZA 1XC6A 2ZMKA 4Y3OA 5JIAA 1COV3 3F2ZA 3MIGA 4CU6A 2Y6LA 1RJ7A 5CFDC 5F7UA 1V70A 4EZ4A 5C4WC 3EJKA 1AR61 2G9FA 3INAA 5JDBA 3TEZA 1VB4A 4RS5B 4AOCA 4QPIC 4ZZ8A 4YG6A 4LO5B 1POV0 1RUF2 2BQPA 5GLTA 1W6OA 4GQ7A 1H30A 5FP9A 3BUCA 4YVWB 4AAPA 5AFEA 1HXS2 3DUIA 4IV1A 1J59A 4UFIA 1LEDA 4B4RA 1ND3C 2WLPA 2FZ1A 2RS33 3B01A 3M3CA 3VKFC 3GZUC 4GB33 1SDDB 2ZGQA 1RUC1 1SFPA 5A3MA 1W2AX 1SDWA 3SKJE 3WNOA 5JPNB 3R4UA 1VBE2 2QE3A 3QH7A 4OHWA 1XYOA 3NMBA 3ZKUA 4K7JA 5ACA2 4P9LA 4CP9A 4CA9A 3KQRA 2Q1ZB 1OVPA 3FMGA 4P9XA 2VZUA 4O65A 3ZYJB 3RZGA 1TVGA 4G9SB 5K7PA 2Y6KA 4JTNA 3BODA 3T0DA 2Y60A 3G6JB 2QQUA 1QQP2 1W0OA 3OYWB 2P3IA 3ZN6B 5A1AA 4XF9A 2IXJA 1WLTA 4LMFA 1RGSA 4W6WA 1WLWA 1UY2A 4Q4V2 5CA6A 3O1PA 3QOPA 3B9CA 1RUD2 4QHBA 2E6VA 2H0BA 2VQTA 1QF3A 3BOPA 3NAPC 4XTMA 1GQPA 2R043 5BV6A 2XLGA 2E9QA 5CAZA 1JUHA 1GR3A 2QQMA 1NZCA 2R073 1FMD1 2PTMA 4FPCA 2YXSA 4CU7A 4FTBA 1LR5A 1ONAA 1GWLA 2F4LA 4JX0A 1REDA 4DUXA 1UMZA 4QQPA 2EVXA 2OXBA 4B1LA 4EN0A 4GWJA 4XF3A 3POSA 3LA7A 4M3CF 4RQPC 3VBUB 3NNMA 1V6IA 3K2OA 4Q4W2 1PO21 1H8VA 2CDPA 1ZBA3 2IXHA 5DAQA 2D6OX 4XMIA 1AR71 1JYVA 2AACA 3LFMA 2OPKA 3KHBA 1LRHA 1XBFA 4Q4X3 4FQZA 5C5UA 2VUAA 5FZOB 5I0TA 3I8TA 3S5QA 5LY1A 1ZX5A 1W6NA 1WMFA 1ZM1A 4V2WA 3SH4A 4KI5M 4YZ1A 5IFTA 2OKXA 4ZONA 3T09A 4PQ9A 2VW1A 3KM5A 4XFAA 4LA3A 3A0KA 4BHPA 1GNZA 5LATA 2ATFA 1LEMA 4Q29A 1LAJA 3Q8BA 5GZFA 1JH5A 1WBLA 4XFFA 3SNMA 2FDFA 1OKOA 1PMJX 3J8F3 4FP3A 4XXAA 3BTXA 3K51A 2FMYA 2P5BA 4COWA 2R061 1YFWA 4FXKB 3PUIA 1WMEA 5LA0A 1H2KA 3FJSA 4H2AA 5BPXA 3HR9A 3HQUA 3D3AA 3POJA 3Q8AA 1WUVA 3ACIA 2JKXA 5FDBA 4NIIA 3T4VA 3LDKA 5BNPC 5CADA 3PUSA 2RS52 5F5AA 2KXLA 1ENQA 2ZA9A 4IE0A 4ARYA 1UOGA 1D4M2 3MW4A 3M3OA 2ET7A 4ONUA 1RUH1 3FX3A 3ELNA 4IESA 5JXJA 2JB8A 1PVC1 4WZFA 1EUUA 4KMQA 4E9KA 1S0DA 5T3NA 1OI6A 4RSUA 1HQLA 1NY71 2MPFA 3VZLA 2J42A 2ZGRA 1PK6A 3FC0A 2PQSA 3WF3A 5C3RA 3P5BA 1LHOA 2B39A 4R9BA 1JUIA 2HEYF 2ZEWA 4I3GA 3H7JA 4BZ4A 1VAKA 4JTOA 4PIYA 4WVZA 4NIHA 4N9IA 1SPPA 2DTWA 5IATA 1YI7A 2IXIA 3DPRA 4YSFA 1SMVA 3KV6A 4GMP0 1SLCA 3T08A 4CXYA 1EV11 3I59A 5C5TA 1ULOA 3PUHA 1W28A 1KGYA 5EJ3A 3RYRA 2G4IA 1RUE3 4C0BA 2VULA 1XB9A 2NLRA 2VOXA 5F8PA 4COVA 5A70A 1ULCA 4QAWA 1J3QA 2VCCA 3AYCA 2BBAA 3LPGA 4NHKA 1LJ7A 4JDMA 1F31A 3PURA 4C1WA 1PZ7A 3WDYA 1OA3A 4MHRA 4N9HA 5DZFA 2RJKA 2Y6FA 1DZRA 2WWSA 2W5FA 4JQRA 4C91A 3AXDA 1QXPA 1GYKA 5AVAA 4QB2A 1MVQA 3EXUA 2FCVA 4NAMA 3PU8A 1VJ2A 1GWKA 1UIKA 1NCQB 4RS5A 5J1XA 1RIRA 1Y9QA 3KF3A 1MEC2 3ZVXA 3DXTA 2DTYA 5JUVA 5JWPA 3GNEA 2A7AA 4YVWA 1E5SA 1D0HA 1W9TA 2R6QA 5T52A 1QH6A 4XQDA 2YFZA 1AL0G 3I97A 4OI4A 4XCBA 2PAKA 4A6SA 5HCHA 5A33B 3AXEA 5FYYA 3UKVA 5DAXA 2YC0A 1C8M1 1VB2A 1UMHA 2PAMA 4FTSA 3ILNA 4XDPA 2G9ZA 1AYM1 1OLMA 4UXAA 5AC93 2WZ8A 4CP1A 3MLKA 1N3OA 4ES8A 4GALA 5LBBA 3B5LB 3VD9A 2E32A 2JDUA 1CIYA 2Q8DA 2I2SA 5ACA3 4MGSA 1OPMA 2WKKA 1VBD2 4Y1YA 3OYWA 4D7SA 1LHWA 1LOGA 3ZN6A 1NE6A 4PI2A 3UJOA 1LGCA 5DG2A 2XQXA 4AEDB 4RL7A 1UO9A 4BQ3A 4FPGA 5FZMA 3MW3A 4JKKA 5J7MA 4CDUC 2D93A 5I91A 1TG7A 4IEZA 3RYKA 1ZZ7A 1HDKA 2ZGTA 4Q4V3 4XAAA 5EZWA 3RMYA 5J98B 4FFHA 1LOCA 1RUOA 1WCDJ 5FXXA 1DQ2A 3ZXJA 2AGSA 4DRRA 4FPLA 3VBFC 4BXSV 4NHYA 3AJYA 1RUI1 4MVTA 5A7WA 1UMIA 1NX9A 3Q8FA 5F37A 1OPOA 2Y0OA 3HNBM 3APBA 3VBUA 5FPAA 2QJVA 2AREA 5I0SA 1W90A 4COUA 2WZR1 1F8VA 5KHKA 2IC1A 2WNVC 5FK8A 3SXWA 3C7HA 2ERFA 1LODA 4W4ZA 2ZEZA 5CEHA 1AR62 5A7PA 5I8TA 2RMU1 1TZOA 1MQTC 5FZOA 5FYBA 3U10A 2VCBA 3VZJA 2P1BA 3AKRA 5CFCB 3GALA 4MGQA 3MZHA 1HJFA 1MS1A 2QCSB 1OLRA 2K46A 3ZXEA 4P9IA 5G05L 4L99A 3WHTA 1QNYA 4R52A 4XW3A 4DXZA 2W87A 1RUC2 3ACHA 2PHXA 3PVEA 4ZXEA 3ZFEC 4CUGA 2VTFA 1MACA 3A4UA 3KCXA 1Y3TA 3O1OA 1LOBA 4HKWA 5EYXA 2D43A 2VZ3A 2NYYA 2JDPA 2VOWA 5A3OA 1NKGA 1JU3A 1KS5A 2XJSA 2PN5A 3BGAA 1CAUB 3C7EA 5HBAA 1XYNA 4OI2A 5F5CA 2FDHA 5C7GA 1LOAA 3ZM8A 4CDXB 4TYSA 1YCIA 5CZKA 2JDZA 2YB7A 1XNBA 2Y38A 1PX4A 2LRPA 1V6LA 4QB1A 2HWE3 5FUPA 4QMAA 3SCFA 3BIEA 4KBZA 1W06A 1FMD2 3D6EA 4JGYC 2FDIA 2CTVA 1D4M3 4R8HA 4Q0SA 4I09A 3DXUA 5J37A 1VRH3 3W9AA 3BCWA 4QPWA 4B7KA 1EYBA 1UD1A 2C4XA 4YGDA 5FYMA 1YJLA 2W1UA 1GU3A 1L7RA 5AVPA 4A2UA 4LUKA 5A6QA 1W39A 1DQ1A 3ZSMA 1H2LA 1PO22 2VBDA 1AUYA 3H7YA 3HEIA 5EV7A 5A7NA 4D7YA 3ZKYA 1AR72 1RHI1 1VP6A 2VNGA 1OFSA 4FFFA 3VZMA 3ZMOA 1S0IA 4AWDA 2FD8A 2VUDA 1CPNA 3LF7A 4JHZA 1DZQA 3GCXA 1NOVA 1DYPA 1YQ8A 1MZFA 1ULGA 1JHJA 1YRZA 2BTVC 4I3PA 4OUSA 2WC2A 2RVAA 3HQRA 4V2VA 5GLZA 3WNPA 1J83A 4HKLA 1CONA 2YBSA 3MUY1 3RWNA 1RVF1 2Y26A 2NMOA 4COYA 1XNCA 4NUBA 4AI8A 3JU9A 1YFUA 1BZWA 2E33A 2JXAA 1I6XA 3W21A 1BEV1 3GBFA 5GLUA 3JBG3 4OFGA 3ZDVA 4TZDA 1N3QA 4DFSA 2XLAA 3RPQA 5IK7A 4GULA 4H3WA 1UU6A 1QJY1 1GLHA 1NCQA 1OKQA 1PM4A 2PQQA 3D4KA 2E63A 3DKQA 2R062 4P9GA 3BPSA 1JZ5A 3DL3A 1NE4A 3POBA 4URTA 1V0AA 2WBKA 4LKSA 2VNVA 3KCCA 2WJSA 3AL5A 2JG8C 4CCCA 2YBPA 5FUNA 5KHHA 3RSJA 2AUYA 1MEC3 3UNPA 1AYN1 4I30A 1REFA 3WCRA 4TXWA 4OI1A 1WW4A 1A6CA 1FNZA 1XYPA 3EO6A 4YGBA 5A33A 4WVMB 5CFDB 1GQHA 5T50A 5C4WB 1HN0A 1SCRA 5T5PA 1J3PA 1RUH2 2HWF1 2DV9A 3A23A 4QPIB 3RS6A 4YLZA 1PVC2 1W2NA 1S0FA 2DUQA 1OFNA 4CCJA 1S4CA 2XHKA 1QH7A 5LA9A 1W8NA 3H1MA 4NWVA 3CEWA 5FY8A 3O14A 3W59A 4FFIA 4LPLA 4AFMA 1ND3B 3JD71 4EN7B 5IFPA 2AENA 4KGGA 4RHV3 2J7MA 2YPDA 3D5OA 3LAGA 4CEWC 1TQ5A 1OD5A 1LOFC 3ZIXA 4K8FA 2GNTA 4AF9A 5IWFA 4AEDA 4OUEA 1HKDA 2BP6A 2BNNA 2GMEA 3GF6A 1UZYA 2VE1A 1OF3A 4ZXKA 2VZTA 3ROUA 3J7NA 5EQUA 2H6CA 1JS9A 1G8WA 2LS6A 1F35A 2UYAA 1UY4A 3NVCA 1EV12 2W1SA 2D5HA 2E7TA 3ZXAC 1HLCA 5FK7A 2GN7A 2GP3A 4SBVA 3ZYPA 5B2GB 3CO2A 1E5RA 1J58A 3VUOA 3OF1A 4RR3C 5FREA 3TBDA 1Q8OA 1UN1A 4BQWA 3FLPA 1RC6A 4BIOA 2BFUL 4HZFA 4CSWA 1VBB1 5EJ1B 2DVFA 2UURA 3NAPB 1UKGA 4OHYA 3THCA 1T2XA 2CYFA 2O8OA 4QB6A 3WQBA 4UBGA 1QWRA 2VOKA 2BYVE 4A3ZA 4KBBA 1YHFA 2VECA 2Y64A 3W5MA 3U14A 1SQ4A 5CFCA 2A6VA 5FY4A 4PLMA 3UETA 4K1YA 1VBA1 4RQPB 1KFUL 1QKQA 3FL7A 1WCSA 1X36A 1CJDA 2D6LX 1LU1A 2VMHA 1HV1A 4AVCA 1ZZBA 3LE0A 1HV0A 1JHNA 4DINB 2B42B 3OD0A 5H9QA 4JDNA 4YM0A 1O59A 1C8M2 5C3SA 2J1SA 2PLV2 2BDRA 4TLGA 1AYM2 1LECA 2B46X 2JD4A 5FP8A 3OBAA 2JENA 5F3CA 3JB4C 3LSEA 4NAOA 2E51A 4D69A 1X82A 2ZGKA 5IAXA 4GXLA 5FZ6A 2EIGA 1UKRA 3LEMA 1STMA 1VBC1 3R6SA 1CAUA 4KL1A 5JSPA 5I0DA 3GZEA 2YFUA 5F2WA 4P02B 1CESA 3PIGA 4AZZA 5FCCA 4CDXA 4A7KA 3BU7A 5BNNC 3SISA 4XXPA 2HLEA 2HWB1 1JMUB 3IPVB 1SBEA 4J25A 5IHRA 3VHRA 1SACA 1KJRA 3WP5A 4YW6A 4ZKTB 2ZTNA 3WDWA 1UZ0A 3O0VA 3H3ZA 3FWEA 3WF2A 1XNDA 3JUUA 4AR2A 1IPKA 2IXKA 2YGLA 4MXVA 2IZWA 1Q5OA 3AP4A 5JR7B 2JDNA 3WV6A 2OPWA 4MZUA 4BE3A 3LOBA 3FHQA 3GM8A 2PELA 1TNRA 1X8MA 5BNPB 1JOBA 3NL1A 1NQDA 4K6BA 5A6ZA 2SLIA 4CVUA 2CDOA 4OQ8A 4I0WB 3J9SA 3SMHA 4MYEA 2WZR2 3OBTA 3ZLIA 1RTVA 1T6BX 1ULDA 3WF0A 1DLCA 1FNYA 1NQJA 2VBBA 4SLIA 4MADA 2BWAA 4YW1A 1AR73 5DUWA 2RMU2 3HVDA 5C8WA 3ZPOA 5K0UC 4MGTA 1GFF2 2WABA 4YG0A 1XSRA 2YV8A 4Q5OA 4CDWC 4LITA 4OMDA 4OYUA 1NLRA 2B8MA 2OUJA 5FYTA 3IWZA 1WWYA 5CYYA 4D94A 4NRPA 2HWC1 4IEUA 2OW4A 5L19A 2RS13 3CBNA 5A7OA 4IE7A 1DQ6A 2RG4A 5DMYA 1PZ9A 2YC2A 1GNHA 1BLZA 2N7GA 5A32B 1QOOA 1N1TA 1MS4A 2AEZA 3AFGA 3WXPA 4DY5A 2W2IA 5FY5A 2HEWF 1C57A 3ASIA 1XU1A 2P3YA 1YQCA 4LK6A 1FOD2 3EB7A 1RB8G 1CQ9A 1RUG1 4RGKA 3LKJA 3PDQA 1PGL1 1QEXA 5L36A 3FUOA 4XMAA 4AVVA 2ZGOA 4HG6B 4HVQA 1REEA 1U5XA 4R4ZA 4Y1ZA 3FBYA 4FPEA 2D98A 4WVMA 5FQ0B 5CFDA 5C4WA 1HN1A 1BBT1 4YPJA 1CAWB 3P3NA 4L8QA 4QPIA 1XE0A 2OVUA 1TME1 1GANA 2X10A 1CZSA 5H9PA 2AC1A 2XJPA 4OULA 5D1IA 1RUH3 2BGCA 4XQ4A 4Y1VA 2HYKA 4GAZA 4FO9A 1LCLA 3MIEA 2LUWA 4QX7A 4JDOA 2A6YA 5LASA 1ND3A 3J4UH 2QUOA 2BPA2 2FMDA 1CPMA 2VQ0A 3MDPA 4S2FA 5D8AC 2KA3A 4OMCA 1H8TB 2YGMA 1TMF3 1HJGA 4YW7A 4A42A 1RHI2 3MFCA 1KRIA 4GD4A 2CWSA 3CDZB 1YQ5A 1XNTA 3PVNA 2BFUS 5FZFA 4HN1A 4E4HA 3FFQA 5ABJC 5FYHA 2BGOA 5FYCA 2WO7A 5EPAA 3ZFFC 3UGFA 4EN9B 1VPHA 1N1SA 1O7FA 3BALA 5LB6A 4AGGA 2W08A 4LKEA 5ERLA 3TEWA 1BXHA 3PJYA 3WP4A 2GC1A 1RVF2 1G9BA 4CDUB 4B7EA 4C0HA 5KHIA 1W3VA 3ZYHA 3NAPA 1BEV2 1UNBA 4QKBA 1BQPA 3VBSC 1WZXA 4AHZA 1BYHA 2A3XA 2FCUA 1NXD1 1EPZA 1QJY2 1PHMA 3VBFB 3WUCA 3WF4A 3AMHA 1LESA 1VMFA 3MIHA 4FCAA 3TN91 3N7MA 5A80A 3BYWA 5J48A 4IERA 4RQPA 1RXGA 5FMBA 2BV4A 2CL2A 3PVBB 1AYN2 4NR1A 4TWTA 2VZ1A 4RFRB 4UYBA 2VNRA 4IW3A 4IL7A 4UW4A 1FPN1 2D3PA 2WNVB 1T6GC 5HCFA 2QQPA 1Y9MA 2BJSA 3GBGA 4GWNA 5DDJ3 2CV6A 1WA6X 2DCTA 2FDKA 2D6MA 2GC0A 2HWF2 1MQTB 2WN2A 3NV2A 3BKZA 1K42A 5KC5A 2WFF1 3T1MA 2PLV3 4W6YA 3WEZA 1AYM3 5FTTC 3VL9A 1D4VB 2UY8A 5EXOA 2A6ZA 1BMV1 1V6NA 1LULA 1GQGA 3JD72 2MEV1 1GOHA 4QHOA 3NQHA 2VXJA 3ZFEB 3H9AA 4BCUA 1QY4A 4DO0A 3RNSA 4HMZA 4YYOA 1GUIA 3I2GA 3IPVA 1M06G 1O91A 2WN3A 4PT6A 4XFCA 4CXXA 3H50A 5JXHA 2NP0A 4EN8B 3NRUA 5FV3A 3O1TA 2ARCA 2C24A 2PYTA 3AFKA 3PMEA 3IN9A 4WM7C 4YM1A 2DCYA 4LORA 4YZ5A 5C8CC 5JOYA 1N1YA 4LXLA 4NRQA 2XJTA 5D2AA 3T4HB 3USSA 3SEEA 4HSJA 4TLFA 2ZX2A 3N9OA 5EWSA 5BNPA 5IK4A 3O1RA 1WMXA 3I2HA 2GALA 1N1VA 1O8PA 5HXMA 2VC9A 1KJLA 3MI8A 4BJ0A 4JGYB 5A3NA 1UF2C 2WZR3 1UQXA 2K2SA 1R081 1W6QA 1OT5A 3MICA 5FMCA 4D6RA 3N7JA 4MG2A 1FAYA 1H4HA 1R1A3 4LBQD 2RMU3 4OZXA 4Y1UA 5JI7A 1GKBA 5IUQA 3VZOA 1LNSA 4AE2A 1V9U1 1DYOA 1VBA2 3K75B 5CVRA 3UESA 3VD3A 4YM3A 2XJQA 1OVSA 4LNVA 3VV1A 1UZVA 3GHNA 4IEXA 5A32A 2TEPA 4JGZC 4AGVA 5LEKA 3I3MA 3VDDC 4PF1A 1YNAA 2R16A 1UYXA 2OQ6A 2XONA 5K4LA 4GWMA 4OCTA 3UT0A 1VBC2 2JX9A 2ZS6B 1WMDA 3AKSA 1MS3A 1SBFA 1MS9A 2W1QA 1V00A 4ASKA 3LPFA 5G04L 1AL23 2OQ7A 1FOD3 1W9FA 2VMFA 3NWKA 1AXYA 1QDOA 4S2HA 3VB9A 4CYDA 1W0NA 5E88A 4AVTA 5FBJA 2HWB2 3SH5A 5FQ0A 2C1FA 2ZKLA 3KD4A 2G9GA 1D2QA 1CAWA 3H42B 5A3PA 2QQKA 2VGDA 4AFBA 2K0GA 3DN7A 4XF4A 4N7IA 4JVAA 3TEXA 5IYYA 5LA1A 2JG8B 2EICA 2LTNA 3CJIC 1H1MA 2EALA 4JC1A 2BW8A 1HRV3 4LHLA 1YQ6A 2VOVA 3KLSA 4OVEA 3ES4A 4XJ9A 4Y24A 1AR91 1V6JA 1PZ8A 2W68A 3VKNA 4FPYA 3ZMNA 3NKGA 3ILFA 4E4DX 1NLQA 3AYDA 5IVEA 1CAVB 1H8TA 2R30A 4M0HA 3FLTA 3BTYA 3AZZA 4HT1T 4D7TA 1NXMA 4PLNA 5T5LA 2JE8A 3WUDA 3K48A 5LY2A 4PJYA 1SBDA 2HWD3 4AQTA 1LU2A 1H9PA 3V56A 2EIBA 3UV9A 2C9KA 5K9YA 4CEWB 4P9JA 2ZMLA 3M8LA 4LHKA 3CF6E 3N36A 3TNPB 5KHGA 3KWVA 2HWC2 1H2MA 3RDIA 4L97A 4CPBD 2PA7A 2BNOA 4CDUA 3VLBB 2OZ6A 5GLVA 2XVLA 1I9RA 2JE7A 2WS93 4QX2A 4DS0A 3ETQA 1RVF3 2VVFA 5L7OB 1VE0A 2WNEA 3BIWE 4UF0B 4LE4A 3GXUA 1XE8A 2CHHA 3WOGA 2DUPA 4BQYA 3OPTA 4J6GA 2ZAAA 4DMIA 4QX3A 1BEV3 1X33A 3U75A 2ZX3A 2EF6A 3HNMA 4CDQC 1LB2A 4PHZA 3VBFA 4B4PA 4RR3B 2VBPA 1NA1C 1XU2A 1ENRA 4FOWA 1QJY3 4YGEA 5LA2A 1JXNA 3MGUA 5LW9A 1RUG2 5HI0A 2XQRA 5LRRA 4E2SA 2GH2A 2OT7A 1PGL2 4OQ9A 1Z0HA 5FFOC 5JMCA 3U0ZA 1YXWA 3VHNA 1UWWA 4XF0A 2VUJA 5FPZA 2WNVA 4XF1A 2GZWA 3LDRA 4QWNA 5C70A 1BBT2 2EIEA 2JB4A 4Y5SA 5FLIA 2FCTA 1MQTA 3DCQA 1CAXB 1TME2 3ACGA 1POV1 2AH2A 3CNAA 3ZXDA 1HQWA 5IK8A 2W52A 2HWF3 2RM22 4WVVA 3UGHA 4PLOA 3GBWA 4EV0A 2CWMA 1K5JA 1RJ8A 4GKXA 3O1VA 1SLAA 1B35C 4XHBA 3X29B 3JD73 2EXIA 3ZFEA 2JG9C 5KXEA 1PNFA 5FJKA 2A1XA 5HCBA 4NROA 4QX0A 3S6PA 3ZN5A 4TN7A 5ISLA 3M1HA 1DIWA 2BOIA 4HL0A 5F32A 4CE8A 4F83A 4W6XA 3THDA 2ILMA 4H14A 3RRDA 2VVEA 3ZDSA 4AFDA 4LIUA 3I2DA 3HD8B 3NJVA 4K21A 4CCMA 3ZYGA 4UWDA 1NCRC 3WW1A 4YM2A 2HH9A 4QKNA 4U36A 4LBJA 4XZPA 1UXXX 5BNNB 2EAAA 2PAEA 3R4DB 4ZU5A 2LW8A 5FZ8A 5GJ6A 4IEOA 1W9YA 3E5QA 5L73A 4ATFA 2W92A 5FUIA 1EP0A 4QDQA 4EE2A 1V6MA 3POWA 4XJUA 4JGYA 1DQ5A 5FZBA 5A3WA 1GV9A 3LEIA 3WT3A 5F6KA 3ATGA 3CQOA 2XGXA 4ASMB 2C6SA 5IT6A 4QQLA 2XG3A 2MHFA 5FP4A 4ZPIA 1RXFA 2GAUA 2WNUC 2HEVF 4JRAA 3TN92 3LWCA 5KXBA 5KHJA 4N53C 1F5JA 2XJUA 4HN0A 2XKOA 5CB7A 5DAPA 4AYUA 1RINA 3WNLA 1A34A 1Q43A 3WZ1A 1RUF3 3H1WA 4P9YA 1VBA3 1FPN2 3NJYA 1HXS3 4NHXA 1AXKA 2GN3A 1FATA 3ZOIA 4A4AA 2GNDA 2W95A 4FPOB 1YIPA 4QXKA 3USUB 3WNXA 5K0UB 2GU9A 1KEXA 2WFF2 4M3CE 4AL9A 1X7NA 3THTA 4CDWB 2XWJB 3OCPA 5LBEA 1H2NA 1VBE3 3PNAA 3QH6A 1BMV2 1C8NA 2W9XA 4XTPA 4AG4A 3URFA 2CGNA 2MEV2 3C3VA 3T0AA 3FHIB 1F4HA 1VBC3 4FAGA 5F2SA 2VZOA 4AFCA 2BBVA 2JDHA 1H1IA 4EWEA 4Q8KA 3HN1A 1QQP3 2VTXJ 4LULA 3MEPA 4X8NA 4Y20B 5IVBA 1I3HA 4S2DA 4H55A 1RUNA 5FAXA 4L2NA 4YZ3A 2HWB3 2P34A 4QX8A 3HNYM 3T2OA 1WW7A 2DCZA 3K3OA 2YY1A 3K4ZA 3LCPA 1RUD3 3CHXA 2FQPA 1S2KA 4BDVB 4N7UA 2R0FA 4Z8BA 5BUVA 1Z7S1 1W2TA 2ZXQA 4XBQA 4Y5TA 3ZXGA 5A1LA 3MIBA 1XNKA 2PHUA 3I2FA 1KDKA 1KXGA 2V4AA 3AKTA 4BOWA 3KZ4C 2Y0IA 4IQPA 2D3SA 1CAVA 4CXWA 5EP9A 1NLSA 1VAVA 4CCNA 1QXRA 4YVSC 2WT1A 1FT9A 4EJRA 3M3QA 4IV3C 4L92A 2ADEA 1K12A 1PGSA 4AW7A 4M00A 4Q4W3 1R082 3KVAA 3DKWA 1J1TA 4M4PA 5FOBB 3BPZA 1ODMA 3TWIA 3BN6A 2WYSA 3BU0A 3IMNA 5DAVA 1R1ZA 2HYXA 4CEWA 4Q0QA 3L9JT 1V9U2 5J09A 4LT5A 5D8AB 1HRI1 4P5HA 4P5YA 4DOUA 5KXCA 1OQDA 1UAIA 4JKLA 4ARXA 1AR81 4XUTA 3O1UA 3WX5A 3O1SA 2XVKA 4XOGA 4WV8A 1OMIA 2DVAA 4GMP1 4OZOA 3RJRA 3UGGA 5ABJB 5L7OA 4M4RA 4UF0A 1COV1 2CAUA 4XUPA 1IZ3A 4NJ4A 1WD3A 5A3UA 3KB5A 3ZFFB 2W94A 1PNGA 1GZ9A 4RR3A 4Z2AA 1P8JA 1SFYA 5FZ4A 2Z2SB 4KU7A 2GMPA 2Q8OA 3NV1A 3OPZA 4XZUG 1G9FA 2IVIB 1DP0A 2YDEA 2RS31 4RA0A 3DECA 4PDWC 1HB2A 3IAPA 1ZNPA 1W0PA 3OGGA 3OTFA 1IGOA 1U0AA 1OUSA 1IG0A 1KFXL 4QGNA 2DBNA 4XBNA 4E2GA 2VL4A 5L9BA 1O3RA 1CAXA 4BMBA 5JSRA 5FIXA 2DFBA 1OQ1A 1VMHA 2Q30A 2I74A 1BBT3 2B4KA 1JBCA 2RS53 4NOTA 4IUGA 4FFGA 3J7MA 1ODNA 3VDCA 1DF0A 2XJVA 1TME3 2OA2A 5DZGA 2D3RA 4NE9A 4ATEA 1ZA7A 2RM23 1AR92 5BNOC 2YROA 3IZOA 4Q0PA 2D6KA 2VNOA 4KNCA 2OYZA 2P3JA 2OS2A 2Q1FA 3AK0A 1X50A 5JOZA 2E7AA 1JU4A 2J1EA 1AJOA 3AP9A 5JZGB 3C7GA 4QQHA 4LBLA 4Q27A 2A6XA 3HT1A 1S0CA 2R041 4W50A 4URAA 3S0MA 4LIVA 4X6RB 2R071 3ACLA 5F3IA 3UK9A 1LHNA 1MZ6A 2VZSA 5FZIA 1Y43B 3LA3A 3SCGA 1DYKA 2VD7A 4LLFA 2ETEA 1WD4A 5E1RA 5DZEA 3OJBA 4LA2A 3MF9A 4BMEA 4AQ6A 2A71A 3PUQA 3WY6A 1AVBA 1HB1A 4RS5C 4XDQA 5ANQA 5BNNA 4G4FA 3AP7A 5EHDA 3B94A 2E53A 3AZYA 5FZ3A 5A1FA 4ZU7A 2DU1A 3MFAA 1H0BA 1QOTA 3WLUA 3PVOA 3U4XA 4X6QB 5C3PA 4CCLA 4Q4X1 4R4XA 5C8CB 1K5MC 4WM7B 2D6PA 2EXJA 3DYOA 2WT0A 4AI1A 5FY0A 4NMIA 1IS3A 3T3YA 3MIDA 3VL8A 4I0AA 1JN2P 2BZDA 5EJZB 1HW5A 1O4TA 2GNBA 3LB9A 3TN93 2V5YA 4IE5A 2F6BA 4P14A 3LIHA 4BH9A 3VHPA 3NO8A 2ZKNA 1O4YA 4MLOA 4NRMA 5JMOA 5F5IA 5F5QA 4XUOA 1FPN3 2R7EB 5K0UA 3USUA 3ZFGC 4XE9A 5DG1A 5BYNA 5LZ6A 3J8F1 4IEYA 4CDWA 1QJX1 1QOSA 1XNAA 2AYHA 1DLLA 1PX3A 2FDGA 1NY72 2WFF3 2WR9A 3BTAA 5FO8B 1WA4A 3FZ3A 4S2GA 1G9AA 1QMJA 1L3JA 4LK7A 3WF1A 2G1MA 5A7SA 2MEV3 1W8UA 5CKMA 4JGZB 1VBD3 3K77A 4KH9A 1EPWA 3VDDB 2KM2A 4R9DA 5FZ1A 2W39A 1AX0A 2ARAA 4B4QA 4CTEA 4AAXA 4GJZA 5L9VA 3GCWA 4XJZA 3VBUC 5EIYB 1OUXA 2O14A 5JOWA 1PIV1 1Y7BA 1YFXA 2WSVA 3OSDA 5LCWL 1MZ5A 3V0AB 3WHUA 1NUKA 3KHCA 1BVP1 3PU3A 4KGQA 1XPWA 1CVNA 3CMGA 3R4SA 4Y4YA 5IJRA 2QTWB 1W8TA 1VAMA 1UXZA 4XBLA 2KD7A 3ACFA 2B9VA 3KF5A 4FI9A 1X9TA 1UY1A 4HOOA 4IEPA 1Q8SA 3RG0A 3OPWA 2X8KA 1SG3A 2ES3A 3CJIB 3H0OA 4CZSA 3S57A 3V0BB 5FPLA 2NM1A 5JXGA 2BU9A 5FMDA 3N35A 1AR63 1W9WA 2ZBJA 1RUE1 4NO4A 3PL0A 5D8AA 1I5ZA 2VG9A 3MF6A 3RZHA 1ALYA 4HXCA 3AM2A 4XFIA 4LO7A 4AFAA 1GNYA 4HLTA 4BLJA 1CJPA 1HX6A 1RUC3 4XURA 2D6NA 5JIUA 3IB3A 2PXJA 5FJHA 3WG3A 3ZFFA 5FXZA 3C7OA 2Y8KA 1JYXA 4AVBA 2UWBA 3CKHA 2DF7A 5FR3A 2I45A 2VM9A 1G7YA 2B45X 3IDBB 1YJKA 1XE7A 1ST8A 3DGTA 3IT8A 3RYPA 3MIFA 4IDZA 1O5UA 5JCTA 4LLOA 2X5IC 3POFA 1C3HA 2OX0A 1X8EA 4DUWA 5AC91 1PO11 4XACA 1IG3A 4CDQB 4JCKA 3IDAA 1DBNA 2A70A 3WG4A 1NA1B 3ES1A 1Z7S2 1ND2C 1YUDA 1OBNA 1FMD3 1RYYA 5LRSA 3IAQA 1RUI2 2O0OA 1ZA4A 3RMXA 5DPNA 1U5YA 5JVVA 4FOYA 2DURA 1DGWA 1GOFA 5C33A 5JZGA 1H1AA 2VMGA 3LEKA 1PO23 2XOMA 4QHZA 3VBOC 4ISQA 2X53S 3IM0A 3I49A 2UU8A 3EBRA 2PHLA 1DG6A 5J36A 1O3SA 4XFHA 1M4WA 5IAVA 2O1QA 2Z42A 1W6PB 2JIGA 1HRI2 5FZAA 2C5DA 4CEYC 2HKXA 2JG9B 2XH6A 4DXSA 3VZNA 1ENXA 1AR82 3OOXA 4YFZA 5K8SA 3RZKA 3OGJA 4JAAA 2QQVA 1DQ4A 3I2KA 3PJQA 3ZR6A 3QD6A 5I8YA 1QDCA 1ZRCA 1COV2 4I2OA 1US3A 2FDJA 1KD7A 2J22A 3ZSLA 3ZXFA 3B3QE 1GBGA 2P37A 3Q9OA 1NCRB 2XR4A 1S0GA 4AHWA 3AX4A 4FTEA 4YW3A 3LA2A 4GIQA 4FOQA 1MS5A 4DPNA 3C7FA 2WA4A 4EWDA 1LOEA 1EAH1 2R063 3N9PA 3CLPA 1W6OB 2RS32 4AI9A 4Y26A 3KCYA 4BK5A 2RE9A 1A78A 3HPNA 1CN1A 1YI9A 3R05A 2IXCA 4PF5A 3MV01 1UPIA 3E6DA 1RITA 2ZMNA 3I7DA 1GMMA 1W8FA 2XL7A 4ZY9A 5GM0A 1U5IA 3I54A 3WDTA 2WNUB 2GC3A 1ASJ1 1MS8A 4MHUA 1DCSA 4N53B 4XABA 1POV3 1C4RA 4DIQA 1UOBA 2WO3A 3ZO0B 1PVC3 1QNWA 1R091 4XC9A 3T2TA 2Z5WA 3ZXLA 4META 1XJAA 2ARBA 4DEQA 1YIFA 3S7EA 3WP6A 2JEMA 5JSOA 4JGZA 1ZZ8A 1UX6A 3I3EA 1FI2A 3VDDA 1TNFA 3U07A 2QVSB 1JYIA 4GA9A 2R042 4AI0A 4YW2A 4GH4C 2HWE1 4F3JA 5CU1A 2JDKA 1OSGA 3AVSA 2WT2A 3A22A 2ZCWA 3DEMA 3VKMA 2J1VA 4A45A 1D4M1 4XPVA 1VRH1 2IFWA 3H3LA 3AMPA 2IUWA 2EXKA 1EV13 3KGZA 2EA7A 2XKPA 1OLME 2RR11 3HBZA 4L11A 4XIKA 2QZ3A 2QZ2A 5D21A 2ZHNA 5JOXA 5FP3A 1SZBA 1LTEA 4LO6B 1BCXA 2WQ4A 3ALQA 4LUMA 5FZLA 1QJFA 3PLQA 3WNMA 4Q26A 4DEVA 4Q4X2 1DDLA 2DVGA 3HBKA 3NNLA 4BQ1A 2YU2A 2NN8A 3HOBA 2BVBA 3CJIA 4MH0E 3OUJA 1H9WA 1POQA 3V0BA 4Q0UA 4YRDA 4LKFA 5FXWA 1UZWA 2DCJA 3ZX7A 4LTAA 2ZACA 5FZEA 3WDUA 4YVSB 2DFCA 4IXLA 3AL6A 3AZVA 4HK8A 4IV3B 2X05A 3E6CC 2DUOA 1MVEA 1A8MA 2YMZA 1JYTA 3NNGA 3AZXA 3JZVA 2G19A 3JBG1 4OI0A 1DZTA 2XBO1 1XOYA 3IDEA 4IETA 3J8F2 4ZZ5A 5JAXA 3POEA 1C8M3 1QJX2 4NHMA 5FMOL 2XPJA 2JDMA 1YQ2A 2OIIA 4YW5A 5FXVA 1GZWB 2ZX4A 3N7KA 2WWJA 5IVCA 2O8QA 2XMLA 5FLJA 5FZCA 4FPKA 3T30A 3NKTA 1GZTA 1UPSA 3RWKX 1S0JA 4NVPA 4IGQA 4ITCA 3LOIA 3Q8CA 4NIAA 3O12A 4CDQA 3IDCB 1CX1A 2A3WA 1US2A 2VW2A 1NA1A 2XL9A 3ECQA 3OGVA 2V5DA 2AZ5A 3KT7A 1PIV2 3VBHC 4K8RB 1G86A 4UBHA 5DUUA 3M3IA 3T1LA 3ENRA 1CGPA 3HAGA 3DYMA 3EQEA 1Z7S3 1F15A 4DNYA 2WYFA 4RHV1 1GP5A 4PDWB 1UL9A 2UYBA 3I2IA 3B9IA 2JECA 3S7IA 4AQSA 3OGRA 5JXIA 2ZZQA 2WZPP 1RUI3 1VBB2 3S30A 3VN4A 2VUCA 1GP4A 5BY5A 2EXHA 3KSCA 3ITQA 4H7LA 1KITA 1RUJ1 4Q1PA 2LM3A 3CIHA 1RMU1 1ZZCA 3AP5A 3RI9A 4A6OA 4DXRA 4A7ZA 3MLJA 5BNOB 1ZBE1 5A6YA 2IVJA 1RUE2 3SHRA 2BVVA 4AVSA 3O0WA 1F9KA 3PTRB 3TRSB 2C9AA 2JG9A 2ZEYA 1W2UA 3OGSA 4G3YC 1HRI3 1WKYA 1OA4A 2BEOA 3V64A 5FZKA 5E6HA 1OLQA 1AR83 1OHFA 4EQVA 3RZMA 3ZYFA 1W8OA 3DF0A 3MW2A 4OHXA 4MGYE 3POYA 2LROA 3P3PA 3SEPA 5C9AB 1W8HA 4RD7A 1NCRA 1CX4A 1JI6A 4UW6A 4HVRA 4HFSA 3WR0A 1QJU1 3GGLA 4IEWA 4TSVA 2YUEA 4HSLA 5E89A 5FZGA 1PM7A 4J1XA 4PIXA 1LGNA 4BM8A 4BQ4A 4DB5A 2FZ2A 4QKDA 1AZDA 3WINE 4Z1VA 1CZTA 2XXZA 2X29A 2QFEA 4NN0A 5AC92 4O9EA 1PO12 1K5MB 3FFZA 4CPBA 3T2QA 2WNUA 1RL3A 1I1EA 2ZHLA 1XXNA 1DHKB 2DCKA 4CP2A 4N53A 2WL1A 4ZHNA 4UW3A 1Q8VA 4BPZA 1OH4A 2FBEA 2IWGB 2R0HA 3H3UA 4PBPA 4Q4Y1 4N90A 4E27A 5FZ9A 4A44A 3D8CA 4YWAA 4PQQA 2VQAA 4FPFA 3J7LA 2V4VA 3L2HA 4HONA 4IGPA 1SLBA 5F1RA 3A7QA 1S55A 4E4SA 2W46A 3ZFGB 4OHZA 1OOPC 4B29A 4Y22B 1RHI3 1QGLA 2HBTA 1BK0A 1S0BA 4KG8A 4FAHA 5ANNA 5F3EA 1OA2A 4LE3A 1IKPA 4NPLA 4A7YA 4QPGC 2VAUA 2RDNA 2RHPA 2JICA 3GHMA 2RJ2A 4MGIE 2GC2A 4D6SA 1JYWA 1OF4A 3BVCA
chains in the Genus database with same CATH topology
5J96B 1V6OA 1ZZ9A 2ZAHA 4LO4B 3SLIA 1Q8PA 5E8AA 3VKLA 5F6LB 3WG2A 5TSWA 1LKNA 3WQ0A 1H4GA 4M01A 1AJKA 1HQNA 3AMMA 4KWLA 5FO7B 2R1BA 4E4ZA 4FOVA 5FMOS 2GDFA 5C6CA 1URXA 1MR5A 2GMMA 1EAH2 5H9RA 2ZGLA 4WM8C 3O5SA 4YVSA 2RS11 3TOJA 4FBFA 4IV3A 4XHXA 1AYN3 2WA3A 1WLDA 2CAVA 1WGPA 2EAKA 3PHMA 4QT6A 1Q8QA 2VPVA 4QQOA 5EFUA 1ASJ2 3AZWA 3CU7A 3HIFA 3PMSA 4HETA 1Z78A 5I93A 1GZWA 1N47A 2TUNA 1R092 1QJX3 2R49A 3JQWA 5LK5A 4XJWA 4YFWA 4AI3A 1FX5A 4MSVA 4N43C 4FQ4A 2TBVA 4OHVA 4PBOA 4XFGA 3VBRC 2H6BA 3BB6A 5F9TA 4EN6B 2HWE2 2CY6A 4MGZE 2W0XA 3ZSKA 4QU2A 4WBBA 1VRH2 3ILRA 5GKAC 4QM9A 1PIV3 3NV4A 4FT8A 4MXWB 4I02A 4AQ2A 2RR12 4PDWA 4KG0A 1GICA 1C1FA 2ZABA 2X5IB 1TMF1 3KGLA 4K40A 3JB8A 5I0RA 2QKDA 4Q8LA 4F7ZA 4IV1C 1VBB3 1ENSA 1LHUA 1ND2B 2B7YA 5DUVA 5BNOA 4K3UA 1JYCA 2VVDA 3FBMA 4KWKA 4Q2FA 3LSDA 4C1XA 3C2UA 3OY8B 2D44A 1AF9A 4XIOA 4QGMA 3JBG2 5I0UA 3VBOB 2XBO2 1SFNA 4F8AA 3VGIA 5C9AA 4AGRA 1F2NA 1QHDA 4I01A 3VZKA 1D2SA 4EROA 4V1PA 3UL2A 4CEYB 5KC6A 3D0SA 1O3TA 3KT4A 1QU0A 2GNMA 4JV4A 3PTYA 1UU4A 1U5ZA 5DDJ1 1TE1B 2RJLA 2ZGUA 2ARXA 1K5MA 3AMNA 2YYOA 2V73A 1H8TC 3N3HA 3V65A 2PLV1 1PO13 2ZHMA 4AHYA 1WBFA 4NHLA 2Q4SA 4BA6A 1J3RA 2JG8A 3RZZA 5DUXA 5FPXA 2MNGA 4RHV2 1VR3A 1G9CA 1IS4A 1IQAA 2A73B 3AKQA 1XRUA 5EYYA 3WQ1A 4HVOA 3WD5A 3ZFGA 2PHTA 4K20A 1O3QA 1RUJ2 4U2AA 3E6BA 4Y22A 1E57A 1RMU2 4AHXA 1WW6A 4WZCA 1ZBE2 3IIAA 4FPHA 1LOFA 4ORFA 2SBAA 4OUMA 2A6WA 2WQZC 3M7AA 2B9UA 3M2MA 2GSYA 3KMHA 4E2QA 1J1LA 1DGRA 2HWC3 4GH4B 4XQWA 1C5IA 2OUHA 5E16A 1AX2A 4DZGA 4FP2A 2QDRA 5JPMB 2ZGMA 4JRLA 1WCKA 1R1A1 1QJU2 5KBFA 2JE9A 3WG1A 4RGAA 1F5FA 2V09A 1CIWA 1GZCA 2A5ZA 4XJ8A 2WLQA 2P17A 2NQYA 2XB6C 1EAH3 4QQ2A 1RUG3 4GB31 4C90A 3CL1A 1PK6C 3SH3A 3VBSB 3AMQA 3FE5A 2PHFA 1C5HA 3GZAA 2E7QA 1S1AA 2XWBB 4AEMA 4K1ZA 1ASJ3 2DWRA 5I8SA 3DPRC 4Q4Y2 1AL21 4LBKA 1FOD1 1R093 5FBZA 4COZA 5GZGA 1U12A 2K9ZA 1PVXA 1LHVA 1AX1A 5GZCA 3BOWA 5LEJA 4YG3A 3NW4A 3JCIA 4W65A 2WINB 1HRV1 2IFRA 2BUKA 4HK9A 4MXWA 4O9GA 4A3XA 1DGLA 1YO8A 4INDA 2YHJA 3M70A 3NSTA 3U11A 3ZXLA 2RR13 2X5IA 1JOJA 1DQ0A 1EY2A 2VH9A 2ZGSA 4K9SA 4M3CB 1QJZA 2H0VA 4YVWC 5F5QA 1ZBA1 4QX5A 3RJ2X 3VBHB 2D7FA 4CRQA 1ND2A 2BWCA 2ZGNA 5BXXA 2HWD1 3GZTB 2Q1MA 3MYXA 5LK7B 1YYNA 1IS6A 2VU9A 5T5JA 4Y5Z0 3UKTA 5GZDA 3E97A 3ZIWA 2RS12 3N4MA 1O5LA 5FOJB 3OY8A 2NPIA 1PGW1 2WS91 4XYXA 4OLLA 1FV3A 1ZREA 1G9DA 3B93A 5GLWA 3VBOA 1NYWA 1W6MB 1ZRRA 2A75A 2WFPA 2ZPXA 2DYCA 4NWWA 4LO8A 1NG0A 2P2KA 2XBO3 4ES9A 2WIIB 1VLNA 2R1DA 3R0RA 4KU8A 3TB0A 5JI9A 4CEYA 3HQXA 2P3KA 4M0NA 3HT2A 2ZGPA 4BLIA 4IEVA 1G6NA 1C28A 3B02A 2TNFA 4Y20A 4B8EA 5KXDA 4QM8A 3EHKA 2YZ4A 4HPKB 1LENA 2YPJA 3QACA 5AFBA 4LBMA 5CBLA 3M3EA 5T55A 2XUMA 4Z92B 3AP6A 3I4IA 3TAYA 1QXJA 1TMF2 1JTZX 4YARA 1SCSA 1SEFA 4Y1XA 2CGOA 3ZSJA 3SITA 5H9SA 1BK1A 2CNAA 4LR4A 4XFBA 4CP0A 5L7OC 1RUJ3 2Q0AA 1R083 1RMU3 5SV5A 1YWKA 2D40A 1ZBE3 2DVBA 4EWAA 2ZX0A 2XLFA 3A0NA 3TNQA 1V9U3 1OOPB 3G7DA 4GH4A 3FUQA 5ABJA 4WVWA 4NPRA 4QPGB 2R32A 3WW2A 1D0GA 2BNMA 4H7MA 3HWJA 4FXGB 1Q56A 1QJU3 3WVJA 4I0BA 4XETA 1OQEA 1RUF1 3DV8A 4LHNA 4LBQB 1HXS1 5DDJ2 3L2YA 5CNAA 3ZXKA 3VBSA 3AJZA 3ST7A 3B7MA 4YNIA 4X8PA 3WDXA 2ZZJA 4PIZA 3QBQA 4FVVA 1KS4A 1BKZA 1A8DA 4MGKE 3J26N 1VBE1 4BIFA 3B00A 4HANA 3H8UA 5ACA1 4WM8B 4ZU4A 4AI2A 3GYDA 1B09A 3IBMA 1VIWB 4R9AA 4Q4Y3 1AR93 1QQP1 5FRAA 4XILA 3O0XA 4BYYA 3AYAA 2VMIA 1AHSA 3AYEA 3JQXA 2FHRA 3UKNA 1CR7A 1UIJA 4BWOA 4Q4V1 2Q5TA 4Z82A 1APNA 1RUD1 1V6KA 1VALA 1DGWX 5CG9A 4YW4A 1B35B 4N43B 2QNKA 2D97A 1YLLA 1NCQC 3SCHA 3B69A 3OBRA 3VBRB 3W58A 1IS5A 4M3CA 5KWRA 1PMIA 3VHOA 4Z2WA 1UZZA 1IOAA 4GKYA 2OZJA 4Q4W1 3VBHA 3E5XA 1ZRDA 3N7LA 2I07B 1FXZA 5C8CA 1UU5A 4WM7A 4D3WA 1JW6A 1R1A2 1W6QB 1SLTA 2ZJCA 1BVVA 4PCRA 4LBOA 1GSLA 2VW0A 4QPYA 2Z69A 4GB32 4IV1B 1MS0A 3D82A 2DU0A 4MX3A 4LBNA 3HMYA 1W6MA 4KWJA 3MPPG 4AEDC 1XQNA 1KDMA 1SLIA 2IXLA 3KT1A 3ZPYA 3LGRA 4AXOA 2PHRA 4LEJA 1CD3G 1C1LA 5GZEA 4AVAA 1KQRA 2PHDA 5IK5A 3E5UA 2D5FA 1AL22 4R9CA 5FLHA 4YGCA 3ME2A 4KQ7A 3AKPA 1DGRN 5DXDA 3ZN4A 4Q1RA 4DRVA 1FYUA 3ZSEA 4HPKA 1UCXA 2RS51 4ISRA 5JLVA 1ZRFA 2R072 1A3KA 4J1WA 1UW8A 4XJAA 2NZ9A 1HRV2 3O7OA 4RGGA 4FSJA 2DVDA 3V0AA 2RM21 3CJXA 5CG8A 4HBNA 2VY0A 4ASLA 2UY9A 5CFCC 1FV2A 4L9BA 2GH8A 1DFQA 1ZZ6A 1ZBA2 5CIRA 1SLLA 2JKBA 2AR6A 1S0EA 2WSUA 1MZEA 4RFT0 5BNQA 1BJQA 3RI8A 2CGPA 2ENRA 3ZYIB 3ZYRA 2HWD2 2QDNA 1IKQA 4QD2A 4DQAA 2ZHKA 4Q0VA 1WW5A 1LGBA 3UJQA 3WDVA 4YZ4A 5SV8A 3WCSA 3FLRA 5T54A 1W6NB 1HIXA 1ULEA 1PGW2 1OOPA 2WS92 3MPBA 3QLQA 2NMNA 3NV3A 3TYJA 2ZX1A 2A3YA 5J3UA 4CDXC 2Z79A 1Q3EA 4QPGA 2JJ6A 3M4FA 3THPA 1S2BA 4P9WA 3NJZA 3D0JA 3H1YA 1MEC1 5T5OA 4LBQA 2UWCA 3IKWA 4YZ2A 1DU3D 3OD4A 4Z07A 1IHMA 1WLCA 3AB0A 1ZVFA 4DY3A 5JZGC 3WP3A 2ZOEB 4MV2A 2C0ZA 3VKOA 1O4ZA 2XVGA 4WM8A 2LALA 3WW4A 4B3NA 3KS7A 1PK6B 1TEIA 1VBD1 4AEJA 4AEKA 4XEZA 4MUVA 3RQ0A 2PHWA 3MLLA 1IPJA 4IEQA 1ULFA 2F4PA 4AK3A 2XJRA 5HXVA 5GALA 3DPRB 3LZZA 4UW5A 1B35A 1N3PA 2HJIA 3I59B 1W6PA 5A3LA 2VXRA 4N43A 3WQ7A 4QGLA 4FPJA 3QCWA 3VBRA 5FO9B 2ET1A 2PFWA 1ZYBA 2B5HA 3WW3A 1YFYA 4HKOA 2UWAA 4GMP3 5HCAA 1AXZA 2ZMKA 5JIAA 1COV3 3MIGA 1RJ7A 5CFDC 1V70A 5C4WC 3EJKA 1AR61 2G9FA 3INAA 5JDBA 1VB4A 4RS5B 4QPIC 4YG6A 4LO5B 1POV0 1RUF2 2BQPA 5GLTA 1W6OA 4GQ7A 1H30A 4YVWB 5AFEA 1HXS2 3DUIA 4IV1A 1J59A 1LEDA 4B4RA 1ND3C 2WLPA 2FZ1A 2RS33 3B01A 3M3CA 3VKFC 3GZUC 4GB33 2ZGQA 1RUC1 5A3MA 1SDWA 5JPNB 3R4UA 1VBE2 2QE3A 3QH7A 4OHWA 1XYOA 4K7JA 5ACA2 4P9LA 3KQRA 2Q1ZB 3FMGA 4P9XA 3ZYJB 4G9SB 5K7PA 4JTNA 3BODA 3G6JB 1QQP2 1W0OA 3OYWB 2P3IA 3ZN6B 4XF9A 2IXJA 1WLTA 1RGSA 4W6WA 1WLWA 4Q4V2 5CA6A 3QOPA 3B9CA 1RUD2 4QHBA 2E6VA 2H0BA 3BOPA 1QF3A 3NAPC 4XTMA 5BV6A 2R043 2XLGA 2E9QA 5CAZA 1JUHA 1GR3A 1NZCA 2R073 1FMD1 2PTMA 4FPCA 2YXSA 4FTBA 1LR5A 1ONAA 1REDA 1UMZA 4QQPA 2EVXA 4EN0A 4XF3A 3POSA 3LA7A 4M3CF 4RQPC 3VBUB 1V6IA 4Q4W2 1PO21 1H8VA 1ZBA3 2IXHA 2D6OX 4XMIA 1AR71 2OPKA 1LRHA 4Q4X3 4FQZA 2VUAA 5I0TA 3I8TA 1ZX5A 1W6NA 1WMFA 1ZM1A 3SH4A 4YZ1A 4PQ9A 2VW1A 3KM5A 4XFAA 4LA3A 3A0KA 4BHPA 1GNZA 2ATFA 1LEMA 4Q29A 5GZFA 1JH5A 1WBLA 4XFFA 3SNMA 4FP3A 3J8F3 4XXAA 3K51A 2FMYA 4COWA 2R061 1YFWA 4FXKB 1WMEA 1H2KA 3FJSA 5BPXA 3HR9A 1WUVA 5FDBA 5CADA 5BNPC 2RS52 2KXLA 1ENQA 2ZA9A 1D4M2 3MW4A 3M3OA 2ET7A 4ONUA 1RUH1 3FX3A 3ELNA 4IESA 1PVC1 4WZFA 4E9KA 1S0DA 5T3NA 1OI6A 1HQLA 1NY71 2MPFA 3VZLA 2ZGRA 1PK6A 3FC0A 1LHOA 2B39A 4R9BA 1JUIA 2HEYF 4I3GA 3H7JA 4BZ4A 1VAKA 4JTOA 4PIYA 4WVZA 4N9IA 2DTWA 1YI7A 2IXIA 3DPRA 4YSFA 1SMVA 4GMP0 1SLCA 1EV11 3I59A 5EJ3A 3RYRA 2G4IA 1RUE3 4C0BA 2VULA 2NLRA 2VOXA 4COVA 1ULCA 1J3QA 3AYCA 4NHKA 1LJ7A 4JDMA 1F31A 4C1WA 1PZ7A 3WDYA 1OA3A 5DZFA 4N9HA 2RJKA 4JQRA 1DZRA 2WWSA 4C91A 3AXDA 1QXPA 1GYKA 5AVAA 1MVQA 3EXUA 1VJ2A 1UIKA 1NCQB 4RS5A 1RIRA 1Y9QA 1MEC2 3ZVXA 2DTYA 5JWPA 3GNEA 2A7AA 4YVWA 1D0HA 2R6QA 5T52A 1QH6A 4XQDA 1AL0G 4OI4A 2PAKA 5A33B 3AXEA 3UKVA 2YC0A 1C8M1 1VB2A 2PAMA 4FTSA 3ILNA 5AC93 1AYM1 4UXAA 4CP1A 3MLKA 1N3OA 4ES8A 4GALA 3B5LB 2I2SA 5ACA3 1OPMA 2WKKA 1VBD2 4Y1YA 3OYWA 4D7SA 1LHWA 1LOGA 3ZN6A 1NE6A 3UJOA 1LGCA 5DG2A 4AEDB 4RL7A 4FPGA 3MW3A 5J7MA 4CDUC 2D93A 5I91A 4IEZA 3RYKA 1ZZ7A 1HDKA 2ZGTA 4Q4V3 5EZWA 3RMYA 5J98B 1LOCA 1RUOA 1WCDJ 1DQ2A 3ZXJA 2AGSA 4DRRA 4FPLA 3VBFC 3AJYA 1RUI1 4MVTA 1OPOA 2Y0OA 3APBA 3VBUA 2QJVA 2AREA 5I0SA 4COUA 2WZR1 1F8VA 5KHKA 2IC1A 2WNVC 3SXWA 2ERFA 1LODA 1AR62 5I8TA 2RMU1 1MQTC 3U10A 3VZJA 3AKRA 5CFCB 3GALA 3MZHA 1MS1A 2QCSB 1OLRA 3ZXEA 4P9IA 4L99A 3WHTA 1QNYA 4R52A 4XW3A 1RUC2 2PHXA 3PVEA 3ZFEC 1MACA 3A4UA 3KCXA 1Y3TA 1LOBA 4HKWA 5EYXA 2D43A 2NYYA 2VOWA 1KS5A 2XJSA 2PN5A 1CAUB 5HBAA 1XYNA 4OI2A 1LOAA 4CDXB 4TYSA 1YCIA 2JDZA 1XNBA 2Y38A 1V6LA 2HWE3 4QMAA 3SCFA 1FMD2 3D6EA 4JGYC 2CTVA 1D4M3 4R8HA 4Q0SA 4I09A 5J37A 1VRH3 3W9AA 3BCWA 4B7KA 1EYBA 1UD1A 4YGDA 1YJLA 5AVPA 4A2UA 4LUKA 1W39A 1DQ1A 3ZSMA 1H2LA 1PO22 3H7YA 1AUYA 5EV7A 4D7YA 1AR72 1RHI1 1VP6A 2VNGA 1OFSA 3VZMA 4AWDA 3ZMOA 1S0IA 1CPNA 1DZQA 1NOVA 1DYPA 1MZFA 1ULGA 1YRZA 2BTVC 4I3PA 4OUSA 2WC2A 5GLZA 4HKLA 1CONA 3RWNA 1RVF1 2Y26A 2NMOA 1XNCA 4AI8A 3JU9A 1YFUA 1BZWA 2JXAA 1I6XA 1BEV1 3GBFA 5GLUA 3JBG3 4OFGA 4TZDA 1N3QA 4DFSA 2XLAA 3RPQA 5IK7A 4GULA 4H3WA 1UU6A 1QJY1 1GLHA 1NCQA 1OKQA 2PQQA 3D4KA 4P9GA 2E63A 2R062 3DL3A 1NE4A 4URTA 3KCCA 2WJSA 2JG8C 5KHHA 3RSJA 2AUYA 1MEC3 1AYN1 4I30A 1REFA 3WCRA 4OI1A 1WW4A 1A6CA 1FNZA 1XYPA 3EO6A 4YGBA 5A33A 4WVMB 5CFDB 1GQHA 5T50A 5C4WB 1SCRA 5T5PA 1J3PA 1RUH2 2HWF1 2DV9A 4QPIB 3RS6A 4YLZA 1PVC2 1S0FA 2DUQA 4DXZA 1OFNA 2XHKA 1QH7A 3H1MA 4NWVA 3CEWA 3O14A 3W59A 4AFMA 1ND3B 3JD71 4EN7B 2AENA 4KGGA 4RHV3 4CEWC 3D5OA 3LAGA 1TQ5A 1OD5A 1LOFC 3ZIXA 4K8FA 2GNTA 4AF9A 4AEDA 4CZSA 1HKDA 2BNNA 2GMEA 3GF6A 1UZYA 4ZXKA 3ROUA 2H6CA 1G8WA 2UYAA 3NVCA 1EV12 2D5HA 2E7TA 3ZXAC 1HLCA 2GN7A 4SBVA 3ZYPA 5B2GB 3CO2A 1J58A 3VUOA 3OF1A 4RR3C 5FREA 3TBDA 1Q8OA 1UN1A 3FLPA 1RC6A 4BIOA 2BFUL 4HZFA 1VBB1 2DVFA 2UURA 3NAPB 1UKGA 4OHYA 2CYFA 2O8OA 4UBGA 1QWRA 2VOKA 2BYVE 4KBBA 1YHFA 2VECA 1SQ4A 5CFCA 2A6VA 4PLMA 4K1YA 1VBA1 4RQPB 1KFUL 1QKQA 1WCSA 1X36A 1CJDA 2D6LX 1LU1A 2VMHA 1HV1A 4AVCA 1ZZBA 4DINB 1HV0A 1JHNA 2B42B 3OD0A 5H9QA 4JDNA 4YM0A 1C8M2 2PLV2 1AYM2 1LECA 2B46X 2JD4A 2JENA 3JB4C 3LSEA 2E51A 4D69A 1X82A 2ZGKA 4GXLA 2EIGA 1UKRA 1VBC1 3R6SA 1CAUA 4KL1A 5JSPA 1CESA 5FCCA 4CDXA 4A7KA 3BU7A 5BNNC 3SISA 4XXPA 2HWB1 3IPVB 1SBEA 3VHRA 1SACA 1KJRA 3WP5A 4ZKTB 2ZTNA 3WDWA 3O0VA 3H3ZA 3FWEA 1XNDA 3JUUA 1IPKA 2IXKA 2YGLA 4MXVA 2IZWA 1Q5OA 3AP4A 5JR7B 3WV6A 4MZUA 4BE3A 3LOBA 2PELA 1TNRA 1X8MA 5BNPB 3NL1A 1NQDA 4K6BA 2SLIA 4I0WB 3J9SA 3SMHA 4MYEA 2WZR2 3OBTA 1RTVA 1ULDA 1FNYA 1NQJA 4SLIA 2BWAA 4YW1A 1AR73 5DUWA 2RMU2 5C8WA 5K0UC 1GFF2 4YG0A 2YV8A 4CDWC 1NLRA 2B8MA 2OUJA 3IWZA 4D94A 2HWC1 4IEUA 2OW4A 5L19A 2RS13 1DQ6A 1PZ9A 1GNHA 2N7GA 5A32B 1QOOA 1N1TA 1MS4A 3AFGA 3WXPA 4DY5A 2HEWF 1C57A 3ASIA 1XU1A 1FOD2 1RB8G 1CQ9A 1RUG1 3LKJA 1PGL1 5L36A 3FUOA 4XMAA 4AVVA 2ZGOA 4HVQA 1REEA 1U5XA 4R4ZA 4Y1ZA 3FBYA 4FPEA 2D98A 4WVMA 5FQ0B 5CFDA 5C4WA 1BBT1 1CAWB 3P3NA 4L8QA 4QPIA 2OVUA 1TME1 1GANA 5H9PA 2XJPA 4OULA 5D1IA 1RUH3 2BGCA 4XQ4A 4Y1VA 2HYKA 4FO9A 1LCLA 3MIEA 2LUWA 4JDOA 2A6YA 1ND3A 3J4UH 2QUOA 2BPA2 2FMDA 1CPMA 2VQ0A 3MDPA 4S2FA 5D8AC 2KA3A 1H8TB 2YGMA 1TMF3 1KRIA 1RHI2 3MFCA 2CWSA 3PVNA 2BFUS 4HN1A 3FFQA 5ABJC 3ZFFC 4EN9B 1N1SA 1O7FA 3BALA 4AGGA 2W08A 1BXHA 3PJYA 3WP4A 2GC1A 1RVF2 1G9BA 4CDUB 4B7EA 4C0HA 5KHIA 3NAPA 1BEV2 1BQPA 3VBSC 4AHZA 1BYHA 2A3XA 1NXD1 1EPZA 1QJY2 1PHMA 3VBFB 3WUCA 3AMHA