1NA1B

The structure of hrv14 when complexed with pleconaril
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
255
structure length
255
Chain Sequence
b'GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coat protein VP1
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
molecule tags Virus
total genus 51
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1na1B00
3CJIB 1ND2A 2RM23 1CD3G 4QPGA 1VBE3 4SBVA 1TME3 1V9U2 1VAKA 5CFDA 2RS52 1R091 1RUF1 1C8NA 1B35A 4FTBA 4WM8B 1Z7S2 5ABJB 5DDJ3 4GB33 1VBE1 1R083 1TME1 4IV3B 2HWE3 4WM7A 4JGZB 1BBT3 1PO22 3DPRC 1RUH2 5DDJ1 4GB31 4Y4YA 1NY71 1VBA2 1EV13 1PO12 1R081 1VBB3 5K0UB 2HWB2 1BMV1 4CDWC 2GSYA 4CEYA 1OOPC 2ZTNA 1EV11 1FPN3 1VBB1 1X33A 2DF7A 1BEV3 3HAGA 5C8CB 1MEC2 1AR83 4AEDA 4PDWB 4JGYA 5BNPB 4IV1C 1ND3A 1AR81 1ZBA3 5AC93 5FOJB 1RUC2 1NCQB 1AYM1 4CDQC 1F2NA 1AL23 5FMOL 1EAH2 3ZFGC 1PIV2 3ZFFA 1ASJ2 4Q4Y3 1AL21 2R043 3J8F2 1RMU3 1V9U3 4NWWA 3VBRC 4Q4Y1 4CDUA 1K5MC 5K0UA 2R041 4Q4W2 1OHFA 3VDDC 4N43C 1RMU1 5A33B 4RQPB 1RHI2 1AYN2 2R062 1AUYA 2FZ1A 1RUH3 1QJY3 4CEWC 1FOD2 1R1A2 3VBRB 1ND2C 1RUI2 3JBG3 1NCRB 1PGW2 2RR12 4Z92B 2RMU2 1QJX2 2HWB3 5CFDC 3TN92 5BNPA 1RUH1 1QJY1 1VBD2 3JBG1 2HWD3 2WFF2 4N53A 3ZFEC 1PVC2 3ZXAC 3JB8A 5BNNA 3JD73 5J96B 4WM7C 1MEC3 1AR92 5A32B 5L7OB 5D8AB 2HWD1 1AR72 4QPIB 1VBC3 3JD71 1PGL1 2BFUS 1IHMA 1HRV2 1NOVA 1HRI2 1VBC1 1RUJ2 1C8M2 3S6PA 4GH4A 1EAH3 1H8TB 1RUG1 2Y26A 2MEV1 4Q4X1 2RS33 4YVWA 1ASJ3 4JGYC 5CFCC 1ND3C 2RS31 1D4M2 4RR3B 1ASJ1 2RS12 2RM21 5C4WB 5C9AB 1F8VA 2R073 4YVSA 4CDXC 1RHI3 1SMVA 3VBHA 1AYN3 2R063 3VBOA 3ZFFC 1RVF2 3NAPA 1ZBE2 2R071 1QJU2 5BNOA 2HWE1 1BBT1 1AL0G 1AR63 4QPIA 4RFT0 1VBD3 3VBUA 4CDXB 1NA1C 5JZGA 2ZZQA 3DPRB 2WFF3 1MQTA 2X5IC 1TMF2 1DDLA 1AR61 1AR93 1FPN1 4CDWB 2WFF1 1H8TA 1BEV1 1OOPB 1RUD2 1VRH3 1NA1B 4RS5A 3VBSC 2WS92 4Y5Z0 1AR91 3CJIA 1HRV3 2PLV2 5ACA2 1VRH1 1ZBA1 4WM8A 5ABJA 5AC91 2HWF2 4RHV3 4IV1B 1COV3 4Q4V2 2WZR2 2TBVA 4IV3A 2ZAHA 3VBFC 2XBO2 4JGZA 5GKAC 4CDQB 4RHV1 1COV1 2RS53 1D4M3 3M8LA 3ZFGB 2HWC2 1Z7S3 2FZ2A 3LOBA 4GH4C 1V9U1 3VBFB 2RS51 1D4M1 1QQP2 1R092 1PO23 4YVWC 1Z7S1 1RVF3 1VBA3 1K5MB 5C8CA 1HQNA 1PO13 2QQPA 1VB2A 1ZBE3 4PDWA 1VBE2 1QJU3 4N43B 4QPGC 3VDDB 2GH8A 4CDWA 1PO21 4LLFA 1B35C 1VBA1 1PO11 4GB32 1NY72 1POV0 4CEWB 2HWB1 1HXS2 1NCQA 1ND2B 4YVSC 1GFF2 3VBHC 1BMV2 4QPGB 4EJRA 5CFDB 1EV12 3NAPC 1VBB2 1B35B 1RUD3 1MEC1 3ZFEB 2WS93 4CEYC 1RUC3 4WM7B 4CDQA 1M06G 5JZGC 1MQTC 1AR82 1QJZA 1RUC1 2HWF3 4AEDC 1PIV3 4Q4V3 2WZR3 5A33A 4RQPA 1AYM2 3J8F3 1EAH1 4RS5C 1PIV1 3FBMA 3VBRA 4Q4V1 2WZR1 1K5MA 1NCRA 2HWC3 4N43A 4Q4W3 2BBVA 3J8F1 1A6CA 5FMOS 4FTEA 4JGYB 2XPJA 1QQP3 5CFCB 1R093 1ND3B 4Q4Y2 4Q4W1 2R042 1FOD3 1R1A3 1RUI3 4IV3C 2RR13 4JGZC 1RMU2 2RMU3 1QJX3 5A32A 1RHI1 4BCUA 5L7OA 5D8AA 1QQP1 1AYN1 2R061 3TN93 4CDUC 1FOD1 1R1A1 5K0UC 1RUI1 3ZFEA 1PGW1 2RR11 3ZFFB 2RMU1 1QJX1 1PVC3 1HXS3 3TN91 1E57A 1VBD1 1QJY2 1AR73 1PVC1 3JBG2 4CDUB 5C8CC 1HXS1 3IDEA 2BUKA 4PDWC 2X5IB 5BNPC 2BFUL 1AR71 2HWD2 1HRI3 4FTSA 1RUE2 4N53C 1RUJ3 1C8M3 4RR3A 3JD72 5LK7B 1NCQC 2WWSA 1WCDJ 5BNNC 1PGL2 3VBSB 5C4WA 1HRV1 5C9AA 1HRI1 1RUJ1 1C8M1 1AYM3 1NG0A 1VBC2 5CFCA 1CJDA 1RUG2 4N53B 1RB8G 2MEV2 4Q4X2 1FMD2 2RS13 5BNNB 1W39A 4CDXA 2WLPA 2RS11 2RS32 1RUF2 3DPRA 2IZWA 1OPOA 4RQPC 2RM22 5J98B 1TME2 2BPA2 1OOPA 4GH4B 4NWVA 1NCRC 1NA1A 1RVF1 5DDJ2 1ZBE1 4YVWB 1QJU1 1R082 2X5IA 2R072 2HWE2 1TMF3 1BBT2 3VBOC 3JB4C 4IV1A 4GMP0 3VBSA 5L7OC 1TMF1 5BNOC 5D8AC 1HX6A 1AR62 4QPIC 4YVSB 3VBUC 3VBHB 1VB4A 1FPN2 1RUD1 2PLV3 3VBOB 1BEV2 5ACA3 1RUE3 1POV3 2WS91 3ZFGA 3NAPB 2VQ0A 5BNOB 4FSJA 1X36A 2PLV1 4CEYB 5ACA1 1RUE1 1H8TC 1POV1 3VBFA 1VRH2 2XBO3 3VBUB 4GMP3 5JZGB 2HWF1 1ZBA2 1MQTB 1RUG3 3CJIC 5AC92 2MEV3 4Q4X3 1FMD3 3VDDA 4AEDB 1AL22 2XBO1 4GMP1 4RR3C 4WM8C 4RHV2 5ABJC 1FMD1 1COV2 4RS5B 1RUF3 5C4WC 2HWC1 4CEWA 5C9AC
chains in the Genus database with same CATH superfamily
2OIIA 1S0BA 4ARXA 3CJIB 2UWAA 1OC1A 4B7KA 4OZXA 4DNYA 4E4DX 4EE2A 2QBXA 1ULFA 4PIXA 3D3AA 4QPGA 3WQBA 1S2KA 1V9U2 4XUQA 3I97A 2Q1MA 4R52A 1C8NA 3VN4A 2JG9A 3RPQA 2CU5A 3I2IA 4HK8A 4QGNA 4RGAA 1O5LA 5ABJB 5DDJ3 5IUQA 3GDBA 4R9AA 1H30A 2NYYA 4LKFA 2VQTA 2AACA 1TME1 1U0AA 2X05A 5KBFA 4IV3B 2QQKA 2HWE3 2F4LA 4AFAA 1QOSA 2VH9A 4FFIA 3DPRC 1ZNPA 4DS0A 4QX3A 2GC2A 1F4AA 1VBA2 5B2GB 5HBAA 4AEJA 1PO12 3GM8A 1HV1A 4JTOA 4CCMA 5LY2A 5L73A 5K0UB 3MI8A 2HWB2 3AMPA 2BV4A 3M1HA 4A42A 4RGKA 4XFAA 4RN5A 1AXYA 1XSQA 2ZTNA 2VVEA 3OY8A 3R05A 5IVBA 2X10A 4JZRA 1S4CA 1O5UA 1X33A 1ODMA 4JHTA 3CU7A 1YQ2A 3HAGA 2QVSB 3POEA 4YNIA 4AEDA 3R4UA 4EWAA 3O1RA 2YDEA 4PDWB 2JDKA 1SFYA 2WUHA 1U5ZA 1H1IA 5JMCA 4F8AA 5J09A 1ND3A 4H3WA 1AR81 5CU1A 4BXFA 2AC1A 5FPZA 1RUC2 4IEUA 3VZKA 2FCUA 4LOSA 3EO6A 3I7DA 2RG4A 2XL9A 3FUQA 4XHXA 4QHZA 2VXJA 5IK7A 3VZNA 2ZEZA 3A21A 3DYPA 1EAH2 1DGRA 3MZHA 4FVVA 5APAA 4D6RA 2GC3A 1IKQA 2Y6KA 5FZKA 4LO8A 4EWDA 3RZHA 3SQOA 1C5HA 1QDCA 1AL21 2OZ6A 1WLDA 3T1LA 4CYDA 2IVJA 3S57A 3QOPA 2ZGLA 5LB6A 2HEYF 2VJXA 2BQPA 4W50A 4UT5A 4DFSA 4NWWA 1KRIA 5FPBA 3SHRA 4NIHA 1MS4A 4X6RB 1YWKA 2WIIB 4IEWA 1H2MA 2ZHNA 4XFGA 1AXZA 1OHFA 1PMIA 3POIA 5F3EA 4XF0A 2YMZA 5T5JA 4R9CA 4BH9A 3DXUA 1VIWB 1W6PA 1PM4A 4FPKA 4G3YC 1RHI2 2CDOA 2E7TA 5AFEA 2CNAA 1ZVFA 2Y6JA 1LGCA 3H3ZA 3IBMA 2TUNA 3N9LA 4C1WA 1XE8A 1W8HA 5F39A 1QJY3 1QGLA 1FOD2 1ULCA 1PX4A 1ND2C 3VBRB 3JBG3 4XVHA 3RVHA 3AFGA 3UNPA 4AXOA 4B29A 4ZU4A 1ZZCA 3ZM8A 4XFIA 3O1TA 1F35A 1UOGA 2A6YA 2VQAA 4G4FA 4LLOA 4XC9A 3OGGA 5F8PA 3ZKUA 4BMBA 4C8DA 4QX1A 4FPOB 4XXPA 1YJKA 4KL1A 3ST7A 1EYBA 1PVC2 4GWJA 1S0CA 4XUNA 2OA2A 4NRQA 2ZGOA 4CP9A 4HVOA 1NAEA 4RD7A 2EXHA 5F3IA 4N7UA 3UKTA 4HN1A 4DUXA 2P4EA 3WP5A 4ZZ8A 1AR92 1JH5A 4AVVA 5L7OB 1DCSA 1CAXA 3HMYA 3VHPA 2G4IA 5FYMA 1N47A 1Y9QA 3B00A 4YRDA 4P9YA 4YZ3A 1PK6A 1CPMA 1GKBA 4AZZA 3JQXA 1NOVA 3UGGA 1VBC1 1RUJ2 4XW3A 1YUDA 1CAUA 2VBBA 5CISA 2GMMA 3N9OA 5EQUA 1H8TB 2Y26A 1REEA 4XDQA 2MEV1 4WVVA 5GZEA 1H2NA 3POFA 1J3RA 3ON7A 4EYUA 2UY8A 2W91A 3GGLA 4ATFA 5DZGA 3HN1A 1G9CA 2P3IA 2ZHLA 1Q8QA 2VUAA 3H7YA 1BVVA 5E89A 1UZZA 3NV2A 1GZTA 3HQRA 2DTYA 1CN1A 4KBZA 1JXNA 4WZFA 4YGCA 4E4SA 3HT2A 1WLWA 4RR3B 1ASJ1 4IE0A 4DMIA 4D69A 1IZ3A 2IXHA 1H1MA 3BIWE 4FQ4A 4NHMA 5LZ6A 1KJRA 2C1FA 2OPWA 3EB7A 3O7OA 4RA0A 3IKWA 4TWTA 1VP6A 1FV2A 3WF3A 2XQRA 4BQYA 1TG7A 3KHBA 5A7QA 1AYN3 1YJLA 3U4XA 1AF9A 1SFNA 2ARAA 3MW3A 5E1RA 3IDAA 3LB9A 3EJKA 2BVBA 4EN7B 3NAPA 4PQQA 1GP5A 5A6ZA 3GYDA 3AK0A 2R071 1XNBA 1N1TA 3BPSA 2HWE1 3K3OA 3RYKA 1FAYA 5BNOA 4NRPA 1LR5A 1W8UA 4CE8A 1DFQA 1SQ4A 2FBEA 4QPIA 2O0OA 1DQ4A 1S2BA 1QEXA 4PBOA 2WWJA 2WFF3 1XC6A 1MQTA 1I9RA 1YFWA 4IE6A 2CGPA 2X5IC 4YARA 1DQ5A 2KR2A 3O0VA 4XF9A 1RUNA 1Y43B 1CESA 4ISRA 5T5PA 1A34A 2WA3A 5IVYA 5F5CA 5T3NA 2I45A 1BKZA 4YW5A 4QXCA 5FP4A 1LB2A 1TZOA 2EIBA 3JCIA 4GQ7A 1ZZ8A 4R4XA 5CKMA 1ZA7A 5FZIA 1XYOA 2ID4A 2TEPA 4ET7A 5IVJA 1HRV3 5LBCA 2QQVA 1VRH1 4CXWA 2FHRA 3LQCA 1NUKA 3BOWA 3GBFA 4QXBA 3UETA 3H42B 4YM2A 5FLJA 5FXVA 3LF7A 5EV7A 4P9GA 4ITCA 1JYTA 4PLMA 4XUOA 3SISA 3TYJA 1AVBA 2W1QA 3HBZA 3CQOA 3VBFC 4JGZA 5GKAC 3LDKA 2VBPA 1W6QB 2WQ8A 2RS53 4KWUA 3M8LA 5JSPA 5M0TA 3K48A 5FZBA 3SCHA 3SLIA 5FUNA 2FZ2A 2ILMA 4KMQA 5EWSA 1W06A 1SPPA 4HG6B 2V5YA 4FFGA 2W47A 1YQ8A 1XQNA 1UCXA 2LS6A 4BQ5A 1JYWA 1RUOA 1W90A 1QQP2 2YB7A 3N3HA 1OD3A 1R092 2NQYA 4GWMA 4YVWC 1Z7S1 2P3YA 4FOWA 3TAYA 2WNUC 5FYSA 2OQ7A 4HANA 4P9XA 4AHYA 5FTTC 3THCA 1K5MB 1ULOA 1HQNA 3MLKA 4JDNA 5IYYA 4AHZA 1IPSA 3I2FA 5SV5A 1QJU3 4QPGC 1FATA 3LEMA 5FZ9A 5LRRA 3EYPA 4KWKA 1PO21 2WYFA 3FFZA 1XE7A 2D40A 5T5LA 2JG9C 3THPA 2PQSA 3N7MA 4I09A 3CO2A 3ETPA 2WO7A 4RGGA 4FCAA 2JWPA 4XBLA 2ZKLA 3NSTA 5FRAA 5BY5A 3H8OA 2VQUA 2LW8A 3VBHC 2VPVA 1HQLA 4V2WA 3ILFA 2VCBA 4EQVA 2ZOEB 3OUIA 4EJRA 1NXD1 1B09A 4ZZ5A 1J84A 3P3NA 3MGUA 1XU2A 1WGPA 3MYXA 4KWLA 4A6SA 2VZTA 3C7FA 5HXMA 3MEPA 2VMGA 3ZFEB 2WS93 3KSCA 2GNMA 1D0GA 3MUZ1 1GOHA 4MGYE 4DINB 2GN7A 4Z2AA 4YW4A 4N9HA 3ELNA 1IS5A 4XF1A 4W8JA 4WM7B 4Q0PA 4MXWB 4PIZA 3OD4A 4CP1A 2XVGA 1DYKA 2P2KA 1LJ7A 4INDA 4LPLA 2HWF3 3B94A 3UJOA 4AEDC 2XXZA 5A3MA 1NYWA 2OT7A 2WZR3 5A7WA 1OVSA 4PQ9A 1HB1A 1AYM2 2AREA 4Y20B 4RS5C 4DO0A 1JZ2A 3N4MA 1OH3A 2GC1A 2XWBB 4HPKB 5FZOA 2Y64A 2ATFA 2BBVA 5FY9A 1O4TA 1OVPA 4JGYB 4I0BA 5JI9A 2XPJA 1AX0A 2I07B 3S5QA 4YSFA 1GUIA 1QKQA 2Q8DA 1HKDA 1Q56A 4Q4W1 4MXVA 4JKKA 1NLSA 2GP3A 1RUI3 2PFWA 1W6OA 2NPIA 5LEKA 2RR13 4JKLA 1REDA 3NRUA 4Q0QA 4CCNA 3OGJA 1AYN1 2ZHMA 3LDBA 5A3PA 4CP0A 5I0DA 1A3KA 1KS4A 4MGQA 4Q5OA 2QQIA 4HLTA 2W0XA 1QMJA 1R1A1 1UYYA 1YI9A 2R7EB 1GQGA 3AFKA 3NJXA 4LBQA 3ZYIB 5A3LA 3OGRA 4BLJA 5J36A 1DQ2A 1PZ8A 2OQ6A 2WQ4A 1UZ0A 3WP6A 4XZUG 4QM9A 4EN8B 5FO9B 1UKGA 1DHKB 3TN91 4D7SA 3OUHA 1F5JA 2AR6A 4NHLA 5LCWL 1QH7A 1P8JA 3U0ZA 1QJY2 2DVGA 4J25A 4W6WA 3UGFA 4UF0B 4LBQD 2PQQA 3W59A 3ZSJA 1AR73 3JBG2 4MO3M 3OPZA 3V0AA 4AVSA 5A6YA 3HD8B 2BUKA 3VV1A 2Z4FA 3NO8A 3WG4A 2HH9A 4Q8LA 2VE1A 3KF3A 4E2SA 3O14A 3RZLA 4YG3A 1HRI3 2A73B 4JV4A 2D5HA 1W0OA 1C8M3 3VDAA 2IFWA 3P5BA 5LK7B 1NCQC 1HB3A 2WZPP 4K6BA 3DEMA 2FMDA 1MZFA 4EROA 3PIJA 2Z5WA 3ACIA 1MACA 1HRV1 3MF6A 4MGZE 2GMEA 4CCOA 4LBJA 3RYPA 3M3QA 4UFLA 3ZIWA 4WVMB 5CIRA 5CFCA 3NNMA 1SLLA 1GZCA 2MPFA 4FPGA 1JZ8A 1YRZA 4CXYA 1SDDB 2VOWA 1FMD2 2ZCWA 2RS13 4D94A 2JG8A 4XOGA 5DAXA 4UAPA 1Y3TA 4KQ7A 1KFUL 1V6NA 5FFOC 4CDXA 1K45A 1LRHA 3VD7A 3HBKA 1OFSA 5FY0A 3DPRA 2J22A 2YROA 1OPOA 1UOJA 2BRTA 2RJ2A 2WLQA 4RQPC 4Y1XA 1OI6A 5JOZA 3P3PA 1UPSA 1NE4A 3GZEA 4UFHA 4O9EA 5I8TA 1KS5A 5JDBA 2ADEA 4M3CE 3AKTA 2O1QA 3DL3A 2BPA2 3FFQA 3WQ1A 2JDMA 3PVOA 4XABA 2DCKA 4FFFA 2FQPA 4EN9B 1O3TA 3TEWA 1JYVA 2YPJA 2ERFA 3BCWA 5F32A 4M3CF 2JIGA 2VXRA 3W20A 1QJU1 1R082 2X8KA 1I5ZA 2VZ1A 3QH7A 2PHRA 5GZFA 3ACGA 3POJA 5A1LA 1WMFA 1PM7A 1BBT2 4HVQA 5KHGA 2JENA 3KMHA 3RZKA 1QXJA 3PTRB 5A1FA 3WCRA 2ARXA 3ZIXA 1TMF1 5BNOC 5D8AC 4NO4A 2Q4SA 5E6HA 3P6BA 4QPIC 4YVSB 4EZHA 3B69A 1FPN2 1XU1A 2ZACA 4JQRA 3RRDA 3M70A 3VBOB 1K42A 1EPWA 4CUAA 2WS91 2W5FA 1LTEA 4GD4A 5FZLA 4IE7A 1W2AX 2VQ0A 5BV6A 1X36A 3L2YA 1OKQA 2PLV1 2DDUA 2E6VA 4CEYB 1RUE1 2W1WA 1LEDA 2ZX0A 4P02B 4DEQA 4YW7A 4S2FA 1QHDA 5I93A 4ORFA 1AJOA 2HWF1 1ZBA2 5LA9A 1RUG3 5F2SA 4L11A 3INAA 5LBFA 4Q4X3 5FZ1A 4O61A 4B4QA 2ZPXA 3ZN6B 1CVNA 1RXFA 2EA7A 3OGVA 5LA2A 3LEKA 3R6SA 5I0SA 2XBO1 4DRVA 3OB8A 4DUVA 3S0MA 3RYRA 2AUYA 1Y4WA 4ONUA 5J1XA 2EAAA 1IS4A 1JU4A 1UO9A 1MS1A 4K8RB 5C4WC 3VD3A 3BKZA 1ND2A 2D6LX 1WW7A 2Y6FA 1O4YA 1OLRA 1QIQA 2D93A 3EXUA 4IW3A 1GZWB 3CF6E 3O1MA 1JBCA 3I3EA 1TME3 2RS52 3I59A 3VL9A 4QPWA 1ENQA 3ZOIA 4M3CA 1B35A 4UXAA 3H0OA 4H7LA 3KT7A 1LHNA 3IAPA 3KGZA 3H8UA 4XILA 2KA3A 2OZJA 3E5QA 1G7YA 4QDRA 3ZVXA 2FDHA 5AFBA 1VBE1 4QQLA 3I3QA 5FOBB 3VHNA 5K7PA 4LO6B 3O5SA 1FXZA 1R64A 1GP6A 4NIGA 1GLHA 1GNHA 1RUH2 3RQ0A 4GB31 1NY71 3IDCB 1WUVA 4YM0A 2VUDA 5FY7A 3PVNA 3DXTA 1KD7A 4PF1A 5CADA 3BTXA 1BMV1 2BNMA 2XB6C 2DCTA 4Y1VA 3SKJE 3WW4A 3HNYM 2VY0A 2Y0IA 2G19A 5F6LB 1CJPA 1CX4A 1SEFA 3J9SA 4BISA 1VBB1 3BTAA 3PMSA 1QJFA 2B9VA 2E51A 3M4FA 4LQRA 2CWMA 3T30A 2KM2A 2VZPA 5C8CB 1AR83 3HR9A 2EALA 4TLGA 3PURA 3N7LA 2Q8CA 3MPBA 3TNQA 4X6QB 2RE9A 3GHMA 1NQJA 5C8WA 4P08A 3ZR5A 2RHPA 3WW2A 5BNPB 2VAUA 4NIIA 5B4NA 2NMNA 1FNYA 1ULDA 1WLCA 4QHOA 2XJTA 4J1WA 3WF0A 5AC93 5FOJB 4DPNA 3BGAA 2OUHA 4MLOA 4UFJA 2B46X 1EP0A 1AL23 5JVVA 4XFFA 1LOFA 5T52A 1YFXA 1ENXA 1UPIA 3ECQA 3ZFGC 2W52A 2VOKA 3CL1A 2BJSA 4LIVA 2W92A 4Q0VA 4LKDA 5FZCA 3B9CA 4BK4A 4XJZA 4FAGA 4NIAA 4RYDA 4ASKA 5C3RA 3DYOA 4XDOA 2P5BA 3HVDA 2CGOA 1W28A 2P3JA 2UYAA 5D21A 5DUUA 2D97A 3GHNA 3KM5A 2P6HA 5K0UA 1QOTA 2R041 3WZ1A 2AENA 3LOIA 4AFDA 2WNVB 3KV4A 4B4PA 2WT0A 3NJVA 3WUCA 4AEMA 5F2WA 1IG0A 1RMU1 4BZ4A 4C91A 3VGIA 5A33B 4MOAA 1HN1A 2JEMA 4YG6A 3SKVA 3MV01 1CAWA 4LBOA 1AUYA 1LODA 2FZ1A 2DWRA 3AKSA 4ZY9A 4CEWC 4DXTA 1RUI2 5C71A 1NCRB 1PGW2 2RR12 2YBPA 2ZBJA 2K2SA 4LEJA 4QKDA 4FPJA 1ENRA 3FLPA 4RSUA 4BIOA 5CFDC 4EN0A 1OF3A 3W21A 2A71A 1PMHX 3PUIA 4NJ4A 1VBD2 4Z82A 1LU1A 5JOWA 1LGNA 1O3QA 2DCJA 2VULA 5CA6A 1LKNA 3KQRA 1V6LA 3TBDA 3AJZA 5BNNA 5J96B 1H9PA 3KWVA 4PLOA 4LE3A 2E26A 5D2AA 1MEC3 1XSRA 1W9YA 2XWJB 4UI9L 2GU9A 2HWD1 1WW4A 3KCCA 1WMXA 2WNOA 1AR72 2QNKA 5FK7A 3AKPA 1VBC3 3JD71 1BJQA 5T50A 1QY4A 2Y8KA 2Z2SB 1YIPA 2VMCA 4QQ2A 1X8MA 3T0BA 3AYEA 1JW6A 5DAPA 2QDRA 3T08A 5JI7A 1U5YA 2WT1A 3AP7A 4BQXA 4AI0A 3M3OA 1A78A 1HRI2 4B4RA 2HLEA 1YC61 2YZ4A 4PBPA 3RJ2X 3ZYPA 1C8M2 1DLCA 2VW0A 1W8ZA 4GALA 3J7LA 1RUG1 2DFBA 5L7OA 4Q4X1 4YVWA 4CCCA 4YPJA 1ASJ3 2WNUA 5I8YA 3NQHA 3GBWA 5FZ7A 3ZSKA 2AEYA 2O14A 1V6KA 4AE2A 3ORJA 4JAAA 2JKXA 2UY9A 5CFCC 1WZXA 4JRAA 1TNRA 5LY1A 2RS31 3D6EA 3BTYA 1D4M2 3AX4A 2P37A 2RS12 5DG2A 3T2PA 2YC0A 4XCAA 3K77A 4O9GA 2JG8C 1TE1B 2A6VA 1SLBA 4OI4A 2AGSA 5C9AB 1L7RA 3IMMA 2PELA 4AOCA 2A70A 1V6IA 2R073 4K21A 4B8EA 3PHMA 4CDXC 1SMVA 3VBHA 1NT0A 1W8OA 2R063 3K4AA 5CZKA 1OQ1A 3B3QE 3BPZA 3ZFFC 1UU5A 1Q8PA 3TEYA 4UFKA 5FQ0A 4LNVA 4AAPA 1ZBE2 3UYJA 5FKCA 4YM1A 4IL7A 3LIHA 2WABA 3SEEA 4OQ8A 1AL0G 4E2GA 4PT6A 4AI3A 2XDVA 2B9UA 1GQHA 3D5OA 4RFT0 3VBUA 4F3JA 2H0BA 5JUVA 1W6MA 2ZZQA 2WO3A 1W99A 4JVAA 3HEIA 2QQNA 4U2AA 5DUVA 3ZSMA 3B01A 3GF6A 2D6PA 5GLZA 4WZCA 1DDLA 1AR61 3WQ0A 2P34A 3E6BA 2OKXA 1EUTA 4CDWB 4UW3A 1H8TA 1OOPB 2OXBA 3APBA 5FYYA 1RYYA 4CCJA 2X53S 4BMEA 1VRH3 1ZZ7A 4RS5A 1PGSA 1GWMA 4K7JA 4HKLA 4Y5TA 4Y5Z0 1AR91 5FZGA 4QD2A 5FBJA 4MUVA 3HNBM 4AL9A 2A1XA 4Z2WA 1UU4A 2QQOA 1GICA 3KV9A 3E6CC 5LW9A 3V0BA 1HLCA 4M0NA 1QXPA 2XKPA 3WW1A 1RITA 4UFMA 1UD1A 3KQ4B 3V64A 4LK6A 5ISLA 3OEAA 4CU9A 3AMMA 4QDQA 5J37A 3C7OA 4WM8A 5AC91 4NOTA 4I01A 4IV1B 2YUEA 4UW6A 4Q4V2 2IXIA 3U75A 4EZ4A 3IB3A 4FXGB 4M4RA 4Y33A 4SLIA 4XQWA 2B39A 2TBVA 4PI0A 3PUAA 2DYCA 3CIHA 4Q8KA 3WF4A 4X8PA 3N9NA 3A7QA 5FO8B 5IK4A 3USUB 4XETA 4CDQB 1SBFA 1W3XA 3CZUA 4M00A 2YU2A 3KHCA 4KI5M 4GJZA 2EICA 1Z7S3 2RV9A 3WLUA 4IDZA 1EY2A 2A7AA 1PZ7A 4GH4C 3RFRA 3ZXEA 3VBFB 4MGSA 4DEVA 1PO23 4D0QA 3ASIA 1GOFA 3HPNA 4MGTA 1UNBA 3MFAA 2D6NA 1XE0A 1RVF3 3CMGA 1SLAA 2QQUA 1OFNA 2QQPA 1VB2A 1SZBA 3VDDB 4N43B 1TNFA 2GH8A 3MV11 4IEZA 2CTVA 2JE8A 4CA9A 4AQSA 2QTWB 1B35C 4UYBA 1GANA 2D3RA 1D7PM 3RZGA 3J7NA 5HCHA 4XFCA 1HXS2 1NCQA 1OH4A 3K75B 1MZEA 3WOGA 1GFF2 3LA2A 1OQEA 4LIUA 1UY0A 5KHJA 5GLWA 4QPGB 2IWGB 2XLGA 5GZCA 4PF5A 4E8CA 2ZEWA 3R4SA 3WT3A 5DUXA 3AB0A 1RUD3 1IQDC 3BN6A 4OUEA 5EZWA 3ABZA 1MEC1 4OUMA 4DUWA 1C1LA 4WBBA 4MX3A 4CU6A 2I74A 1LOCA 1ZA4A 4FOQA 2AH2A 5FY8A 5FZMA 1N3OA 3G6JB 4EWEA 2WZEA 3EBRA 5C6CA 4XUTA 5JZGC 1N1VA 4DRRA 1UY4A 4UW5A 3TOJA 4CTEA 1XRUA 1AR82 5FJKA 5A7SA 3WNNA 4E4ZA 1CAVA 2VW2A 4YFZA 5EYXA 1JZ4A 4QAWA 4RQPA 1XOYA 4XIKA 2MHFA 2WQZC 1WD3A 2P1BA 5A6XA 1XNCA 3FE5A 3FLRA 1LEMA 1UMIA 3OY8B 2O8OA 4IGOA 3LFMA 4Q1RA 4CSWA 1ZYBA 2VZOA 1PIV1 2WT2A 3ROUA 4AVAA 5BXXA 5JR2A 2A5ZA 4DXSA 2DVDA 4IESA 1K5MA 4MGKE 3RI9A 3H7JA 4LUMA 4HMZA 4OI0A 3GALA 4QU1A 4I0WB 2HWC3 4Q4W3 5FYCA 3V56A 1ACCA 3J8F1 2PHWA 3POGA 4J6GA 1NKGA 1IKPA 1LOFC 4XQDA 3ZXDA 2CHHA 4A3ZA 2LTNA 3VLBB 4OCTA 4FFHA 2EXJA 5GLTA 1ND3B 4P9IA 1D0HA 4H14A 4KBBA 2ZGQA 4IEOA 1R1A3 4IV3C 1CIWA 2YBSA 4C1XA 1UKRA 5A32A 4QX7A 2JD9A 5D8AA 1QQP1 3VKOA 1LHUA 2R061 2K46A 3WQ7A 4S2HA 4BM8A 5FCCA 3TN93 4Y22A 1L7QA 1WMDA 5K0UC 2CY6A 4FP3A 3ZFEA 4NR1A 1HIXA 2RMU1 1QJX1 5EHDA 4BK5A 4FPHA 1MS9A 3MHZA 1XNKA 5FYZA 1E57A 2QQMA 5IK5A 2W39A 3FLTA 4S2GA 5F3CA 5EIYB 1JHJA 4PDWC 2VZ3A 2R30A 1JYNA 2FD8A 1W6PB 2A75A 2BFUL 4XURA 3T2OA 1HB4A 4LHKA 3W58A 3AYDA 2DCZA 4GJYA 3VZJA 4S2DA 4HOOA 4NPRA 4WVWA 4XJ8A 3VB9A 5FIXA 1NZCA 2ORXA 5FPUA 3OF1A 5BNNC 1EPZA 1JS9A 1AXKA 4YWAA 5HXVA 3H8XA 3AMHA 3IWZA 3VBSB 5C4WA 2ZEXA 2RDQA 5FYBA 1V00A 1J1LA 1JZ5A 3DUIA 1YHFA 2QDNA 1FT9A 4IGQA 4CXXA 2ZJCA 1VBC2 3OPWA 4XF3A 2XHKA 4BJ0A 5I0RA 3H3UA 4RFRB 5IJRA 2Y6HA 2H0VA 5JMOA 1F5FA 1UMHA 3SC7X 2MEV2 2VMDA 5HCBA 2W95A 1ALYA 1KGYA 3AP6A 4CP9B 1FI2A 2W68A 5LBBA 1ZRRA 3QLQA 1MVEA 1Y9GA 1W39A 1YO8A 2D7FA 1T2XA 4FOVA 3MICA 1CAXB 2IVIB 5KXEA 4AGGA 1DGWX 2WLPA 4ASMB 2B5HA 3URFA 1JN2P 4E2QA 5L19A 1RUF2 3PIGA 5C5TA 3SEPA 1PK6B 1SACA 3AP4A 4K1YA 3ZXKA 4XJAA 1D2SA 1H6XA 2RDRA 3PVBB 2UWCA 4QM8A 5J98B 3THDA 1WMEA 4A4AA 4DB5A 4TTGA 5CNAA 4URTA 4V1PA 1CAUB 1HN0A 3J7MA 2LUWA 4FT8A 3O1SA 1NA1A 1RVF1 2J1SA 3FL7A 5DDJ2 2E53A 3RS6A 3W9AA 4LBLA 2PHXA 5DN2A 5IAVA 4DQAA 4OMCA 2R072 2HWE2 1GYKA 2XQXA 1TMF3 2XJUA 2VOVA 5FWEA 4L9BA 3KV6A 1JZ3A 1W9TA 4I0AA 3DV8A 4LO4B 1AX2A 3JB4C 3LZZA 5L7OC 4YYOA 5J48A 2FDIA 3S7EA 2CSGA 1E5HA 1HX6A 1STMA 2WR9A 3H1WA 3OBRA 4XAAA 5AVPA 4IXLA 5DUWA 1ZZ9A 5FPVA 3SNMA 1DGLA 4K40A 3VBUC 3ZX7A 1VB4A 3FHIB 3GCXA 2XUMA 1RUD1 1YIFA 2GNDA 2PLV3 3AMQA 3IPVA 1RUE3 4Y3OA 2W9XA 3ZFGA 1ENSA 3NAPB 3HQXA 3FHQA 3VZLA 4QU2A 4HVRA 1OA2A 2VCAA 4YW6A 5L9BA 3BI3A 2BP6A 3PUSA 5BNOB 1URXA 3IDBB 5ACA1 5FP8A 1H8TC 4HSLA 1C1FA 2VMIA 4H2AA 4ZPIA 1VRH2 2BNOA 2XBO3 3M2MA 5FYIA 4ES9A 1VMFA 2R0HA 3WSOA 3VKMA 4OZOA 1MQTB 5CG8A 3BODA 2JDPA 2CAUA 4KH9A 4FXKB 3GJAA 1GWLA 3CKHA 4GMP1 4XUPA 3DN7A 1W9SA 4RR3C 4QDSA 1JODA 4LTAA 2OW4A 4IEQA 2Y38A 4P9JA 4WM8C 2Q0AA 1FMD1 1YCIA 5LASA 2DURA 2HWC1 2H6BA 1OLME 4CEWA 2NP0A 3RMXA 1V6JA 3LWCA 3T2QA 2DU1A 2BVVA 2RM23 1VBE3 4Z07A 1O6UA 3H1YA 5CFDA 5IT6A 2Q8EA 4F7ZA 5IAXA 4Z8BA 4LOTA 2XHNA 1HJGA 2BDRA 3ALQA 3N9MA 3CDZB 3POSA 1Z7S2 3U4SA 2H6CA 3NJZA 2ZGNA 3I49A 4GB33 1W8NA 3NV1A 3K4DA 3BU0A 3QACA 5FPAA 1JYCA 2ZHKA 4CRQA 1S0FA 3NVCA 1ST8A 4JGZB 5FPXA 4M0HA 1UY3A 1PO22 3WHTA 5FZDA 2VMFA 3O1PA 1W2NA 3PJYA 5BPXA 3SCGA 4DOUA 1E5SA 1JOPA 4Y4YA 4YM3A 2PAMA 4D7TA 1YI7A 1R081 2HEVF 1G9FA 1VBB3 1XB9A 2BYVE 1AHSA 4JC1A 2UURA 5C3OA 1XBFA 1SCRA 4LHSA 1C5IA 3O1UA 2ET1A 4CEYA 1SPPB 4CCEA 5A3TA 5JPMB 3A4UA 1Q43A 4XDPA 2EF6A 5IK8A 1DQ6A 1X82A 2FCVA 1EV11 4NIDA 3A0NA 4A7ZA 1BEV3 2V72A 1GMMA 4K3UA 4NUBA 2ZZJA 1A8DA 5SV8A 2VTXJ 4QB1A 2WRAA 2JE7A 3MIDA 2IXCA 1WCUA 1ZX5A 2QKDA 2K0GA 3IIIA 4D6QA 5BYNA 1O8SA 3VKFC 3P1IA 4LA2A 4Q26A 2WAOA 4IERA 5JXHA 3NNFA 5FPLA 2JDHA 4C0BA 5HV4A 2UU8A 4IEVA 4B3NA 3WY6A 5FDBA 5HV0A 2V73A 1GZWA 4QKFA 4LO7A 1UOFA 3C2UA 5I0UA 3O12A 4AI1A 4LUKA 1FX5A 4FP2A 4QGLA 5IVFA 4CUCA 3U37A 3ZFFA 2OS2A 2R043 2BNNA 1OLMA 1JZ7A 2J1EA 2XLFA 1RMU3 4HKWA 3K51A 3I2HA 4CVUA 1V9U3 2A6ZA 4AK3A 1H8VA 3LSDA 4Q4Y1 4CDUA 4EV0A 4NHYA 1K5MC 1CX1A 4Q4W2 4CPBA 1SFPA 3MO4A 3JU9A 4DXRA 2ZKNA 3WG1A 1NE6A 2WJSA 4YG0A 5JLVA 2W3JA 3ETQA 4UWDA 3GZUC 5A7WB 3MF9A 1AYN2 1BHGA 4HBNA 2BZDA 4PCRA 3C3VA 5EFUA 4Y1YA 1OKOA 5FZAA 1X9TA 4CPBD 1R1A2 1UL9A 4IUGA 1IG3A 1OPMA 4Z92B 4TYSA 4C90A 5A3UA 2ZX4A 4META 3X29B 2HWB3 1OF4A 4L8QA 4MHUA 5FYTA 1WCSA 3T0DA 4WVZA 3TN92 3M7AA 5BNPA 1RUH1 5IFPA 1JOJA 3KB5A 2JKBA 5FK8A 1W6NA 3AYCA 2ZS6B 1YXWA 2HWD3 4LULA 5FJHA 2BGOA 2BW8A 2WFF2 4MGIE 4N53A 3WNPA 4PJYA 4I3GA 3ZFEC 4BB3A 4NRMA 2LM3A 3JB8A 4GKXA 3RG0A 3JD73 3ES1A 4FQZA 2C26A 4L2NA 1W6OB 4Q2FA 4WM7C 4DY3A 4TN7A 1LULA 2RDNA 2VZQA 4DIQA 1W9WA 4COZA 1OA3A 3WVJA 3RWKX 1JUHA 3UGHA 3VUOA 3ACHA 3USSA 4YZ2A 3WEZA 1NQDA 4YW1A 1PGL1 4N9IA 2OYZA 2D6KA 4CU8A 2D6OX 1JYXA 5A3NA 1XNDA 2BFUS 3WDWA 3TNPB 3MLJA 4HETA 4OI1A 1HRV2 1TQ5A 4LA3A 4CCKA 3ZLIA 1O3SA 4P5YA 3AZXA 3KCXA 3T1MA 5BNQA 5HCAA 4NAMA 4GH4A 1DGRN 4GULA 4L0PA 1EAH3 1K12A 2ZGRA 3VKNA 3V0AB 5DPNA 2BGCA 2XONA 5JPNB 4MV2A 2RS33 2DVBA 1G86A 4URAA 3OYWA 4JGYC 3WR0A 2C6SA 5GALA 1UMZA 2WNEA 3I3DA 1QF3A 3O1VA 2R0FA 2VVDA 2Q8OA 3AKRA 3MW4A 2FDKA 1CR7A 4BHPA 1JI6A 4P14A 5KHHA 2QZ2A 4BIFA 2PXJA 4OUSA 5FZ8A 5A7PA 2RM21 1UF2C 2J1VA 4XMAA 1XYNA 3KD4A 3TEZA 1F8VA 2DVAA 5A3OA 4JQTA 5FYVA 2HJIA 1RHI3 5A6QA 3DKWA 5DQ0A 3C8XA 1GWKA 3J26N 1CONA 1HB2A 1QXRA 1TVGA 3OGSA 3J4UH 3S30A 3O1OA 1S0EA 3AP9A 3SH5A 2QUOA 1QJU2 4BA6A 2JG8B 3KVBA 4LK7A 4NE9A 3SH3A 2D5FA 3ZXGA 3WDYA 2UWBA 3KT4A 4KG0A 4Q29A 1AR63 4OULA 4E8DA 2UYBA 3O0WA 4CDXB 4R8HA 4KU8A 3BU7A 1NA1C 4AG4A 5JZGA 1I3HA 5FREA 1DZRA 3AC0A 3DPRB 4Y5SA 3GCWA 5K4LA 3PMEA 4B1MA 2Y60A 2ZGPA 1TMF2 3E6DA 2VG9A 2XJRA 1AR93 4PLNA 3WUDA 3ZDVA 3ES4A 1KDKA 1Y7BA 3I2KA 2XJQA 1BEV1 4LE4A 4UOJA 3WP3A 3WF1A 2TNFA 2MNGA 2HBTA 4YW2A 2IC1A 1J1TA 2WS92 4IEXA 4OYUA 3CJIA 3DCQA 4FPLA 5D1IA 1SBDA 1O59A 1RJ8A 4XJ9A 2ES3A 4YGEA 1EUUA 2I2SA 1AX1A 3E5UA 3AL5A 5DG1A 3BALA 2BEOA 2PLV2 1ULPA 5A80A 1K3IA 1FV3A 1YQ6A 3L9JT 5ABJA 2KD7A 2HWF2 1KFXL 4NPMA 1DF0A 2WFPA 3T09A 2WZR2 3LEIA 3UV9A 5F9TA 2A6XA 2NMOA 1Y9MA 2HKXA 3K2OA 3NW4A 3POWA 5H9PA 4W65A 5EYYA 1DG6A 4IV3A 3LE0A 2ZAHA 2WBKA 2GZWA 2XBO2 3O0XA 4XIOA 1MR5A 3TWIA 4RHV1 4ZHNA 1UOBA 1COV1 2ZGMA 3CZJA 2EIDA 3ZXJA 5G04L 3AVRA 4KGGA 2YU1A 5FZ6A 1GP4A 2ZX1A 3LOBA 1UYZA 3B93A 4KNCA 3FX3A 4XXAA 5BUVA 2BTVC 1G9DA 2VNVA 1F15A 1V9U1 4TZDA 1D4M1 4BOWA 3BOPA 5FMDA 2DCYA 4OHVA 4O65A 5A3WA 3WNXA 3N7JA 3RJRA 4XE9A 1KQRA 5F5QA 2YBKA 5KWRA 1S2EA 5CAZA 1JUIA 1VBE2 4PDWA 4IQPA 4XJUA 1UXXX 3N7KA 4CDWA 3FBYA 5FMCA 3OG2A 3V65A 3T3YA 3WX5A 4BQ3A 5F7UA 1VBA1 1YFYA 3SXWA 2GNBA 1PO11 4GB32 1NY72 1POV0 2YGMA 2HWB1 1NX9A 1KDMA 3KV5A 5H9QA 1ND2B 4QX5A 4YVSC 2GP5A 4AFCA 1BMV2 2JXAA 4QKNA 4QPYA 5FLHA 3ZN4A 4AFMA 2V4VA 2E7QA 1BZWA 1YLLA 2WYSA 4UBHA 5AVAA 1HDKA 3I59B 3ILNA 1KJLA 2GN3A 1GV9A 1V0AA 1VBB2 4LBKA 1B35B 2VD7A 3GZTB 4M3CB 4WV8A 4V2VA 1CIYA 4TLFA 1FYUA 1VRBA 2E63A 4QKBA 5C3SA 2C4XA 3MIGA 4RL7A 2NLRA 2RVAA 1YQCA 2PHTA 4CEYC 5DABA 1NLRA 4QX2A 5FYUA 4CDQA 3GJBA 4COYA 4QXHA 3OBTA 3VHOA 1VALA 4LHNA 4GXLA 1QJZA 1RUC1 1WKYA 3FHAA 3ZDSA 1PIV3 4HFSA 1S0DA 2JDNA 3UL2A 1UYXA 4KWJA 4CCLA 4COWA 2WA4A 4GA9A 3ZPOA 1JMUB 5I0TA 4JTNA 3G7DA 3J8F3 3ZPYA 1EAH1 2R32A 3N9PA 4XMIA 3I2OA 3AL6A 3NV4A 5GJ6A 1VPHA 3VBRA 4Q4V1 3ZYRA 2ZGUA 5JCTA 1X8EA 4N43A 4EN6B 1V70A 2ZXQA 1J83A 1LOEA 2PYTA 4FTEA 3N35A 4YGDA 4QGMA 1PNFA 1W0NA 3PLQA 3H1MA 1OMIA 4QT6A 4ZONA 4BYYA 1QQP3 3A22A 4XBQA 2VZUA 3Q8AA 1R093 4BWOA 2PHDA 2V09A 1R1ZA 4D8MA 1UZWA 2R042 3IN9A 2XUEA 5HPOA 4LKEA 2GH2A 1RMU2 2RMU3 1QJX3 2EXIA 1RHI1 1U12A 5E16A 4ZXKA 4BCUA 3AZVA 2YY1A 3ILRA 4IETA 1LU2A 1HJFA 3Q8EA 1HW5A 5F5AA 4CDUC 1BLZA 3LKJA 4YW3A 1LENA 2XH6A 4NROA 1FOD1 3OCPA 1I6XA 1U5XA 4FPFA 4R4ZA 4LORA 1G8WA 3OEBA 1X7NA 1IS3A 3QH6A 4HN0A 4IE4A 4AQ2A 3S5AA 1VMJA 1W8TA 4E27A 2A3WA 3VZMA 1PVC1 4N8MA 4QB6A 5C8CC 2W1SA 1HXS1 3IDEA 3RZZA 2XLAA 3WHUA 3LFIA 3BIEA 3U07A 2X5IB 4BDVB 3CHXA 4TXWA 1MS8A 2VOTA 5T55A 5BNPC 5DAQA 4OMDA 2IFRA 3AXEA 2HWD2 1O91A 2J1UA 1CAWB 2AEZA 4L99A 5EJ3A 3DYMA 5GM0A 4N53C 3PL0A 3T4HB 4FTSA 4RR3A 4F83A 3JD72 4TSVA 1WCDJ 3FUOA 4QQHA 5FZ0A 3ZYBA 4BQWA 5DAVA 1PX3A 2AYHA 3OBAA 1US3A 1IQAA 2VTXA 5LBEA 1T6GC 1APNA 1J59A 4BQ1A 1RUJ1 1WCQA 1AYM3 2WN2A 2D44A 2JB4A 2Y6LA 4BQ2A 3HN3A 1DYPA 3LA3A 3AZWA 1RUG2 2NZ9A 3EHKA 4XYXA 3B5LB 1YNAA 1UWWA 2YFUA 4Q4X2 3WDXA 5BNNB 1O8PA 1TEIA 5HCFA 3VD5A 1VAMA 3WF2A 2Z69A 5GZDA 3TB0A 1OUXA 2GC0A 3I8TA 2V4AA 1UU6A 1SHWB 1X9PA 2XVKA 2RS32 2WNVC 3RSJA 2IZWA 2B8MA 1OD5A 2QQLA 2R1BA 3OD0A 5E8AA 1QDOA 3GXUA 1TME2 2P3KA 2VUCA 2JICA 5FUIA 2EXKA 4A41A 5JSRA 2LROA 2W94A 1NCRC 4FI9A 2F4PA 1VMHA 4JDOA 2JJ6A 4MSVA 2P6CA 4I3PA 1WBFA 4YVWB 3ZN5A 2WNUB 4J1XA 3JQWA 1ODNA 1GU3A 2EIEA 4BXSV 3ACFA 3T0AA 2QZ3A 4XCBA 1W0PA 4DZGA 1W8WA 1GSLA 3FJSA 2WKKA 1BCXA 3W5NA 4OHXA 2VMEA 5JXIA 1PZ9A 3RZJA 2JG9B 5IVEA 2QQJA 2RJLA 2VBDA 4QB2A 3BB6A 4GMP0 5F5IA 3VBSA 1JHNA 2G9ZA 1JZ6A 4GAZA 2JECA 3BVCA 1E5RA 4AQ6A 4YZ4A 1QNYA 1A8MA 1YEWA 4GZ9A 4K9SA 3E5XA 1AR62 2XVLA 2G9FA 3VBHB 2WC2A 3W5MA 3U10A 3MIFA 5ACA3 1UZYA 1W6QA 2F6BA 1RXGA 4BQ4A 5FQ0B 4B7EA 1RJ7A 2ARBA 2Q1ZB 1C57A 2HYXA 1C3HA 1SLTA 3ENRA 2IUWA 4D3WA 1POV1 2ETEA 3H3LA 1MZ5A 3T2TA 2C24A 2R16A 2ZX3A 3FN9A 4W6XA 4GMP3 3VBUB 1W6MB 3KGLA 5AC92 3CJIC 1OBNA 2EVXA 1DZTA 3CBNA 1UAIA 2CDPA 1FMD3 4K1ZA 1SDWA 2FDFA 1US2A 2E32A 1S0IA 4CP2A 4AEDB 2L9LA 1AL22 2N7GA 4P9LA 1C4RA 2QCSB 5CKQA 5I91A 1IOAA 4W6YA 5FZHA 2DU0A 4ARYA 2D3PA 5ABJC 1UN1A 2A3YA 1DBNA 4RS5B 3D82A 2R1DA 2ADDA 4FPYA 4Z1VA 1GNZA 2JD4A 5C9AC 3TRSB 1W2UA 4AHXA 1BXHA 1CD3G 4AEKA 2XL7A 3V0BB 2VM9A 4JKMA 2O8QA 2P17A 4SBVA 1VAKA 2CYFA 1R091 1RUF1 5T54A 1DP0A 4FTBA 4YLZA 4WM8B 5JOXA 5FAXA 4AHWA 4AI2A 3FC0A 1Q5OA 4XTPA 4MZUA 4Y1ZA 2PAEA 3LCPA 3OOXA 1R083 4BLIA 5FWJA 2OVUA 4XEZA 4FOYA 4WM7A 3UK9A 1OQDA 3MPPG 1BBT3 4NPLA 3RDIA 2XOMA 4COVA 4MXWA 5DDJ1 5LA0A 3PNAA 4AI8A 3ACLA 1O7FA 1CZTA 1W8FA 2A3XA 5DAWA 4ASLA 1EV13 4QX8A 1UIKA 3TEXA 1ZZBA 2WZ8A 1LESA 3H8RA 4YZ1A 4FAHA 1YYNA 3LDRA 2GSYA 4CDWC 1KXGA 3ITQA 4E4HA 1LAJA 1OOPC 1ZRDA 2BWCA 4IEYA 3PDQA 4Y20A 3S7IA 1FPN3 1D2QA 2OUJA 2DF7A 2QQWA 4D6SA 3D4KA 1UIJA 4HPKA 3KF5A 2J1TA 1MEC2 3RMYA 3UT0A 5IFTA 4HK9A 4UBGA 1DQ1A 4A45A 3POYA 3Q9OA 4UW4A 5KC5A 4JGYA 1JU3A 1CWPA 2ZMLA 5FY5A 4XQ4A 5L9VA 2VVFA 3FZ3A 4BE3A 5FXWA 1MZ6A 1DIWA 4IV1C 3F95A 4P00B 1ZBA3 2BWAA 3IMNA 4GIQA 2FMYA 5I8SA 2ZAAA 1WW5A 1NCQB 1DYOA 2WL1A 2WSVA 3AJYA 2B45X 2PMWB 2R6QA 4ZKTB 5FUPA 1AYM1 2ZGSA 3SITA 3MW2A 1Q8OA 1F2NA 2VUJA 5FMOL 5A7NA 4CDQC 5J7MA 2VZRA 1QNWA 2IXLA 5K9YA 1PIV2 2C9KA 4MG2A 3OUJA 5A70A 1ASJ2 3C7EA 4Q4Y3 5LATA 3IM0A 4AFBA 5CVRA 4MHRA 3ZMOA 5EP9A 3J8F2 5H9RA 1IS6A 1UXZA 3ZYHA 3RWNA 4A7YA 3AZZA 4UF0A 1UW8A 4ZXEA 2FDGA 3VBRC 1IPJA 1CQ9A 2CWSA 2EIGA 3SCFA 2J7MA 3VDDC 4N43C 1CAVB 2BBAA 4N7IA 4L97A 4RQPB 3CEWA 1H1AA 1QOOA 3K4ZA 3ZXLA 1RL3A 1ZRIA 2R062 2XJVA 5CBLA 4QQPA 2LRPA 3R0RA 4Q1PA 2D3SA 1RUH3 3WP4A 2E9QA 1F31A 3EMRA 3AKQA 3UESA 2B7YA 2DUPA 2RMU2 1QJX2 1J58A 1MS3A 1WCKA 2G1MA 1FNZA 3OJBA 5JIUA 5JSOA 1LGBA 4CUBA 5IVVA 3WNMA 5IATA 3NNLA 1QJY1 1GOGA 4DY5A 4WVMA 1REFA 1ULGA 2OPKA 1M4WA 1OURA 2VMHA 3JBG1 4M01A 1LNSA 4BPZA 2JDZA 5F1RA 3ZXAC 1QU0A 4QXKA 1W9FA 2WO2A 2DTWA 1QWRA 4FPCA 3ZXFA 2FDJA 1JOBA 1GR3A 1HV0A 3U14A 1RIRA 5A32B 2C5DA 5D8AB 1GBGA 4NVPA 3KCYA 4ES8A 1N1SA 1WA6X 2QJVA 4Y22B 4Y4RA 2SLIA 4QPIB 1XPWA 4OHZA 2WWUA 3I3MA 2W1UA 4FBFA 5EPAA 1XNTA 3AYAA 1CPNA 1VAVA 2WSUA 3M3CA 1DQ0A 4P9WA 1Q3EA 2Q1FA 1UYPA 4LBNA 3K3NA 1S0GA 2E7AA 2Z42A 1IHMA 5F3GA 2PHLA 4XAEA 2IXJA 5E88A 2CL2A 4YFWA 4L92A 4NAOA 1F9KA 2HBUA 3S6PA 2HYKA 2C9AA 2XJPA 3VDBA 4JCKA 5ANNA 3WG2A 1E5IA 3B02A 3LIGA 3H50A 3WNKA 1U5IA 3ZMNA 5C33A 5B4XA 5G05L 1K5JA 4HSJA 3MUY1 4O7XA 1CZVA 1N3QA 4QMAA 3ZSEA 2B4KA 2VW1A 2K9ZA 2DV9A 2NM1A 2WDBA 3A0KA 5JIAA 4A2UA 4MVTA 1J3QA 2B42B 2HEWF 3LAGA 1ND3C 3GBGA 4KU7A 3IAQA 2KXLA 3I2DA 3BTZA 1GZ9A 4NHXA 3Q8CA 4QX0A 2WINB 4AQTA 1XYPA 2ZA9A 5FP9A 5IW0A 4B1LA 1CGPA 2Y34A 3CLPA 4OHYA 3RZMA 3ZYFA 2ORZA 4OHWA 1YFUA 5C4WB 4R9BA 3DGTA 1ZZ6A 3VL8A 1W3VA 3HIFA 2W46A 4YVSA 1S0JA 2YPDA 2JDUA 3I2GA 4LO5B 2PA7A 3VBOA 2DBIA 3AMNA 1OT5A 4HL0A 1RVF2 2JIJA 2GAUA 2LALA 5FR3A 2ZGKA 4JX0A 1KITA 3M3EA 1BBT1 1G9AA 3ZO0B 4QHBA 1RTVA 4CZSA 4ZS2A 1VBD3 2Q30A 2ZGTA 4HT1T 5GZGA 1G9BA 2VR4A 3FWEA 3I3BA 4NN0A 2VZVA 4KG8A 3WCSA 2GALA 4GWIA 4AI9A 1SLCA 1JYIA 3ZN6A 5LWBA 5JOYA 2VU9A 2Z79A 4U36A 5CG9A 3UKNA 4GWNA 2E31A 1FPN1 4A7KA 2WFF1 3NMBA 2J42A 4FPEA 1Q8VA 1RUD2 1UQXA 1SCSA 2W2IA 3PJQA 5FY1A 1NA1B 4YGBA 3VBSC 3WNOA 5C70A 3L2HA 3PU8A 2PTMA 4XFBA 3THTA 1WD4A 1L7LA 1S55A 3AXDA 4FO9A 1RINA 2YGLA 3QD6A 4XACA 5EXOA 4X8NA 2YHJA 2NN8A 5JR7B 5ACA2 3KS7A 2YC4A 2WO1A 4H7MA 1ZBA1 4AF9A 3N9QA 5A7OA 2PAKA 3OPTA 4RHV3 1COV3 1C28A 2PHFA 1OXCA 1POQA 3AM2A 1LOBA 5FYHA 3RI8A 4HXCA 2ZEYA 3LPFA 3Q8FA 4P5HA 3IPVB 1RGSA 2R49A 1PK6C 2YV8A 1Z78A 4Q0SA 1D4M3 1VR3A 3ZFGB 1NXMA 2HWC2 1PMJX 5CB7A 1IPKA 2DBNA 3HQUA 4XZPA 4AVTA 5KC6A 2ZABA 4W4ZA 2D98A 3U78A 3NKGA 4Q27A 3AVSA 2RS51 1SLIA 3NNJA 5GLVA 3F2ZA 3MIBA 1LOGA 3GZAA 4D7YA 4JRLA 2W08A 3IIAA 1VBA3 4YZ5A 5C8CA 4XJWA 1PO13 1D4VB 2XR4A 1ZBE3 5FZOB 3EQEA 3LSEA 5DZFA 5GLUA 3QCWA 3HWJA 1N1YA 3ME2A 5ANQA 5C3PA 5L36A 2VGDA 4LLFA 3D0SA 3GNEA 4HKOA 3I2JA 3OBZA 4NMIA 3AP5A 4Q0UA 2VZSA 5FO7B 4CEWB 5CKNA 4ISQA 5KR7A 3MBWA 3NKTA 1MS5A 4Y24A 3POBA 1UX7A 2X29A 2SBAA 1LHOA 5CFDB 5FZFA 1EV12 3NAPC 4XPVA 3ZSLA 3HNMA 1G6NA 4LBQB 3NWKA 1XNAA 2VCCA 1WLTA 5JWPA 3ATGA 2YG0A 1UY2A 1VE0A 2ARCA 1RUC3 1MVQA 3ZYJB 3JXSA 3D0JA 4LKSA 1ZREA 1IGOA 1M06G 1W2TA 1WW6A 1MQTC 4Y26A 3E1F1 1AJKA 3OSDA 3WW3A 1GQPA 1JTZX 4GKYA 4PI2A 5F37A 2XMLA 2YFZA 1RC6A 5EJZB 2E33A 4XHBA 2WNVA 4M4PA 5FZEA 3KT1A 4Q4V3 1W03A 5A33A 4JDMA 5KXBA 1HQWA 1XXNA 3B9IA 2BOIA 5EJ1B 5JXGA 1DGWA 1AZDA 5H9SA 2QFEA 2Y0OA 3BUCA 1F4HA 1KEXA 1V6OA 3MDPA 4XTMA 3FBMA 3JZVA 2XGXA 3H9AA 4NHKA 1S1AA 2WZR1 4K8FA 1BK0A 2VNRA 1NCRA 3MFCA 5FBZA 2XKOA 3NNGA 4DXZA 2GNTA 4JHZA 2DVFA 3DECA 3HJRA 1VLNA 4N90A 1A6CA 4K20A 5FMOS 2QE3A 5JAXA 1XJAA 4IGPA 5CFCB 2ET7A 3HT1A 2VO5A 4Q4Y2 1T6BX 4I2OA 4IE5A 1DU3D 3ZKYA 5DXDA 5A1AA 1OLQA 1FOD3 5LA1A 1UY1A 1Q8SA 1V6MA 4JGZC 5KHIA 2JX9A 3KLSA 4PHZA 3RNSA 4A3XA 4IEPA 2X09A 1W2OA 3CJXA 2YC2A 1PVXA 3BYWA 4LBMA 3LGRA 3LA7A 1RUI1 1PNGA 2PHUA 4MH0E 1PGW1 1ONAA 2RR11 3ZFFB 1PVC3 4OQ9A 5FY4A 1HXS3 2VNOA 3M3IA 4COUA 2J1RA 3PVEA 5FMBA 3RGBA 5FP3A 1VBD1 4HONA 2YYOA 4PIYA 4AVCA 2AZ5A 1QJEA 1OA4A 3OTFA 4A44A 4I30A 4OI2A 4CDUB 2ZX2A 5ERLA 2BERA 1BVP1 2VTFA 3WDTA 3E97A 1W05A 3B7MA 2BGPA 3MIHA 4BU2A 4A6OA 4LMFA 1MPXA 2WN3A 4E9KA 2VECA 1AR71 5J3UA 3FMGA 4R9DA 1RUE2 1RUJ3 2FCTA 5F6KA 3A23A 4ZS3A 5FLIA 2F17A 2WWSA 1PGL2 3IZOA 1H4HA 2Q5TA 3UKVA 3KZ4C 3D8CA 1CZSA 4MADA 4AGRA 4LJHA 2CGNA 1SG3A 3LD8A 3LPGA 1HRI1 4ZU7A 5C9AA 3C7GA 3ZYGA 5IVCA 5IHRA 1C8M1 5FZ4A 4OLLA 1NG0A 1LECA 2OX0A 3N36A 1OUSA 4AW7A 1W6NB 3DF0A 1CJDA 1WWYA 2BOJA 2VL4A 1NZIA 4LITA 4N53B 1RB8G 1ZRFA 4Y1UA 4AAXA 3VD4A 5FXXA 2YXSA 4XFHA 1L3JA 3R4DB 2DFCA 1UX6A 1WA4A 1QH6A 2VOXA 3UJQA 1UZVA 4XBNA 5KXDA 1H4GA 5CEHA 2D43A 5IWFA 3ZR6A 1I1EA 3WDVA 1Z0HA 2RS11 2V5DA 4C0HA 1N3PA 2WAAA 3PU3A 1SBEA 2BU9A 3VKLA 5C3QA 5C5UA 3VD9A 3SH4A 1O4ZA 1LHVA 1BQPA 2RM22 5KXCA 3WD5A 4UFIA 1LOAA 2VCMA 3LEGA 3JUUA 5HI0A 1OOPA 2JDYA 4GH4B 3T4VA 4NWVA 2XG3A 2PN5A 4AWDA 1OSGA 2ZMNA 5K8SA 3WDUA 3I4IA 3WV6A 5DZEA 5DMYA 3I54A 3WNLA 1LHWA 5FV3A 1ZBE1 3J7HA 2JDAA 5KHKA 2X5IA 3OYWB 1YQ5A 5JXJA 5LEJA 5C7GA 4ZU5A 4LR4A 2ZMKA 5TSWA 5FKBA 4OVEA 1ZRCA 1DLLA 4LXLA 5L9RA 3VBOC 4H55A 2DUOA 4QWNA 3VHRA 3WXPA 1H2KA 3VDCA 3PTYA 4IV1A 4LHLA 1BYHA 2JB8A 1ZM1A 3QBQA 2G9GA 2ENRA 1I5PA 3PUHA 2C0ZA 5CYYA 3IT8A 1DZQA 2JE9A 5FZ3A 3U11A 4CU7A 4AR2A 1X50A 3USUA 1BEV2 2IXKA 3U1XA 1J3PA 1POV3 3MIEA 4CUGA 2GMPA 3WG3A 4XF4A 1H0BA 3WINE 1WBLA 2Y6GA 2D6MA 2W87A 3HOBA 4AGVA 3DKQA 3Q8BA 2RJKA 4FSJA 1VJ2A 1O3RA 2CV6A 3VBFA 2VC9A 4G9SB 5LRSA 4KGQA 4ATEA 1W04A 3AZYA 5JZGB 2J1AA 1BK1A 3SMHA 3NL1A 3NV3A 4MYEA 4QQOA 4CCDA 2MEV3 2VNGA 1MS0A 1PHMA 3NJYA 1LCLA 1H6YA 3PUQA 5FP7A 5FXZA 4AVBA 2CAVA 3C7HA 3CNAA 3VDDA 1NLQA 4OFGA 2GDFA 4LT5A 2EAKA 2Y33A 2XJSA 1H2LA 3K46A 3MLLA 4I02A 3VZOA 1GNYA 1H9WA 5LK5A 3KVAA 4RHV2 2DUQA 1COV2 1ULEA 2RDSA 1RUF3 5T5OA 4AYUA 4HZFA 2A6WA
chains in the Genus database with same CATH topology
2OIIA 1S0BA 4DNYA 3CJIB 2UWAA 4B7KA 4E4DX 4OZXA 1ULFA 4PIXA 4QPGA 1S2KA 1V9U2 2Q1MA 4R52A 1C8NA 3VN4A 2JG9A 3RPQA 4HK8A 4QGNA 4RGAA 1O5LA 5ABJB 5DDJ3 5IUQA 4R9AA 1H30A 2NYYA 1TME1 1U0AA 5KBFA 4IV3B 2HWE3 4AFAA 1QOSA 2VH9A 3DPRC 1ZNPA 4DS0A 2GC2A 1VBA2 5B2GB 5HBAA 4AEJA 1PO12 1HV1A 4JTOA 5K0UB 5L73A 3MI8A 2HWB2 3AMPA 3M1HA 4XFAA 1AXYA 2ZTNA 3OY8A 2VVEA 3R05A 1O5UA 1X33A 3CU7A 3HAGA 2QVSB 4YNIA 4AEDA 3R4UA 4EWAA 2YDEA 4PDWB 1SFYA 1U5ZA 1H1IA 5JMCA 4F8AA 5J09A 1ND3A 4H3WA 1AR81 5CU1A 5FPZA 1RUC2 4IEUA 3VZKA 3EO6A 3I7DA 2XL9A 3FUQA 4XHXA 5IK7A 3VZNA 3MZHA 1EAH2 1DGRA 4FVVA 2GC3A 1IKQA 4LO8A 4EWDA 1C5HA 1QDCA 1AL21 2OZ6A 1WLDA 3T1LA 4CYDA 3QOPA 2ZGLA 2HEYF 2BQPA 4DFSA 1KRIA 4NWWA 3SHRA 1MS4A 4X6RB 1YWKA 2WIIB 4IEWA 1H2MA 2ZHNA 4XFGA 1AXZA 1OHFA 1PMIA 4XF0A 2YMZA 5T5JA 4R9CA 4BH9A 1VIWB 1W6PA 4FPKA 4G3YC 1RHI2 2E7TA 5AFEA 2CNAA 1ZVFA 1LGCA 3H3ZA 3IBMA 2TUNA 4C1WA 1XE8A 1QJY3 1QGLA 1FOD2 1ULCA 3VBRB 1ND2C 3JBG3 3AFGA 4AXOA 4B29A 4ZU4A 1ZZCA 4XFIA 2A6YA 2VQAA 4G4FA 4LLOA 3OGGA 4BMBA 4FPOB 4XXPA 1YJKA 4KL1A 3ST7A 1EYBA 1PVC2 1S0CA 2OA2A 2ZGOA 4HVOA 4RD7A 2EXHA 4N7UA 3UKTA 4HN1A 3WP5A 1AR92 1JH5A 4AVVA 5L7OB 1CAXA 3HMYA 3VHPA 2G4IA 1N47A 1Y9QA 3B00A 4YRDA 4P9YA 4YZ3A 1PK6A 1CPMA 1GKBA 3JQXA 1NOVA 1VBC1 1RUJ2 4XW3A 1YUDA 1CAUA 2GMMA 1H8TB 2Y26A 1REEA 4XDQA 2MEV1 4WVVA 5GZEA 1H2NA 1J3RA 2UY8A 4ATFA 1G9CA 5DZGA 3HN1A 2P3IA 2ZHLA 1Q8QA 2VUAA 3H7YA 1BVVA 5E89A 1UZZA 3NV2A 2DTYA 1CN1A 1JXNA 4WZFA 4YGCA 4E4SA 3HT2A 1WLWA 4RR3B 1ASJ1 4DMIA 4D69A 1IZ3A 2IXHA 1H1MA 3BIWE 4FQ4A 4NHMA 1KJRA 2C1FA 3O7OA 4RA0A 3IKWA 4TWTA 1VP6A 1FV2A 1AYN3 1YJLA 3U4XA 1AF9A 1SFNA 3MW3A 5E1RA 3LB9A 3EJKA 2BVBA 4EN7B 3NAPA 3GYDA 3AK0A 2R071 1XNBA 1N1TA 5BNOA 2HWE1 3RYKA 1FAYA 1LR5A 1DFQA 1SQ4A 2FBEA 4QPIA 2O0OA 1DQ4A 1S2BA 4PBOA 2WFF3 1MQTA 1I9RA 1YFWA 2CGPA 2X5IC 4YARA 1DQ5A 3O0VA 4XF9A 1RUNA 1Y43B 1CESA 4ISRA 5T5PA 2WA3A 5T3NA 2I45A 1BKZA 4YW5A 1LB2A 3JCIA 4GQ7A 1ZZ8A 4R4XA 1XYOA 2TEPA 1HRV3 1VRH1 2FHRA 3BOWA 3GBFA 4YM2A 5FLJA 5EV7A 4P9GA 4ITCA 4PLMA 3SISA 3TYJA 1AVBA 3HBZA 3VBFC 4JGZA 5GKAC 1W6QB 2RS53 3M8LA 5JSPA 3K48A 3SCHA 3SLIA 2FZ2A 2ILMA 5EWSA 2V5YA 1XQNA 1UCXA 1RUOA 1QQP2 3N3HA 1R092 2NQYA 4GWMA 4YVWC 1Z7S1 3TAYA 4FOWA 2WNUC 4AHYA 4HANA 4P9XA 5FTTC 1K5MB 3MLKA 1HQNA 4JDNA 4AHZA 5SV5A 1QJU3 4QPGC 1FATA 5LRRA 4KWKA 1PO21 3FFZA 1XE7A 2D40A 5T5LA 2JG9C 3THPA 3N7MA 4I09A 3CO2A 4RGGA 4FCAA 4XBLA 2ZKLA 3NSTA 5FRAA 5BY5A 3VBHC 2VPVA 1HQLA 3ILFA 2ZOEB 4EJRA 1NXD1 1B09A 3P3NA 3MGUA 1XU2A 1WGPA 3MYXA 4KWLA 3MEPA 2VMGA 3ZFEB 2WS93 3KSCA 1D0GA 2GNMA 4MGYE 4DINB 2GN7A 4YW4A 4N9HA 3ELNA 1IS5A 4XF1A 4WM7B 4Q0PA 4MXWB 4PIZA 3OD4A 4CP1A 2XVGA 1DYKA 2P2KA 1LJ7A 4INDA 3UJOA 2HWF3 3B94A 4AEDC 5A3MA 1NYWA 2WZR3 4PQ9A 1AYM2 2AREA 4Y20B 4RS5C 3N4MA 2GC1A 2XWBB 4HPKB 2ATFA 2BBVA 1O4TA 4JGYB 4I0BA 5JI9A 2XPJA 1AX0A 2I07B 4YSFA 1QKQA 1HKDA 1Q56A 4Q4W1 4MXVA 1NLSA 1RUI3 2PFWA 1W6OA 2NPIA 5LEKA 2RR13 4Q0QA 1REDA 3OGJA 1AYN1 2ZHMA 4CP0A 1A3KA 1KS4A 4HLTA 2W0XA 1QMJA 1R1A1 1YI9A 4LBQA 3ZYIB 1GQGA 3AFKA 5A3LA 5J36A 4BLJA 1DQ2A 1PZ8A 3WP6A 2WQ4A 5FO9B 4QM9A 4EN8B 1UKGA 1DHKB 3TN91 4D7SA 1F5JA 2AR6A 4NHLA 1QH7A 3U0ZA 1QJY2 2DVGA 4W6WA 3ZSJA 4LBQD 2PQQA 3W59A 1AR73 3JBG2 3OPZA 3V0AA 4AVSA 3HD8B 2BUKA 3VV1A 3NO8A 3WG4A 4Q8LA 4E2SA 3O14A 4YG3A 1HRI3 2A73B 4JV4A 2D5HA 1W0OA 1C8M3 2IFWA 5LK7B 1NCQC 2WZPP 4K6BA 2FMDA 1MZFA 4EROA 2Z5WA 1MACA 1HRV1 3MF6A 4MGZE 2GMEA 4LBJA 3RYPA 3M3QA 3ZIWA 4WVMB 5CIRA 5CFCA 1SLLA 1GZCA 2MPFA 4FPGA 1YRZA 2VOWA 1FMD2 2ZCWA 2RS13 4D94A 2JG8A 4XOGA 1Y3TA 4KQ7A 1KFUL 1V6NA 5FFOC 4CDXA 1LRHA 1OFSA 3DPRA 2YROA 1OPOA 2WLQA 4RQPC 4Y1XA 1OI6A 5JOZA 3P3PA 1UPSA 1NE4A 4O9EA 5I8TA 1KS5A 5JDBA 4M3CE 3AKTA 2O1QA 3DL3A 2BPA2 3FFQA 3WQ1A 3PVOA 2DCKA 2FQPA 4EN9B 1O3TA 2YPJA 2ERFA 3BCWA 4M3CF 2VXRA 1QJU1 1R082 2X8KA 1I5ZA 3QH7A 2PHRA 5GZFA 1WMFA 1PM7A 1BBT2 4HVQA 5KHGA 2JENA 3KMHA 1QXJA 3WCRA 2ARXA 3ZIXA 1TMF1 5BNOC 5D8AC 4NO4A 2Q4SA 4QPIC 4YVSB 3B69A 1FPN2 1XU1A 2ZACA 4JQRA 3RRDA 3M70A 3VBOB 1EPWA 2WS91 1LTEA 2VQ0A 5BV6A 1X36A 3L2YA 1OKQA 2PLV1 2E6VA 4CEYB 1RUE1 1LEDA 2ZX0A 4S2FA 1QHDA 5I93A 4ORFA 1AJOA 2HWF1 1ZBA2 1RUG3 4L11A 3INAA 4Q4X3 4B4QA 2ZPXA 3ZN6B 1CVNA 2EA7A 3R6SA 5I0SA 2XBO1 4DRVA 3S0MA 3RYRA 2AUYA 4ONUA 2EAAA 1IS4A 5C4WC 1MS1A 1ND2A 2D6LX 1WW7A 1O4YA 1OLRA 3EXUA 2D93A 1GZWB 3CF6E 1JBCA 1TME3 2RS52 3I59A 3VL9A 1ENQA 4M3CA 1B35A 4UXAA 3H0OA 4H7LA 3KT7A 1LHNA 3KGZA 3H8UA 4XILA 2KA3A 2OZJA 3E5QA 1G7YA 3ZVXA 5AFBA 1VBE1 4QQLA 5FOBB 3VHNA 5K7PA 4LO6B 3O5SA 1FXZA 1GLHA 1GNHA 1RUH2 3RQ0A 4GB31 1NY71 3IDCB 1WUVA 4YM0A 3PVNA 1KD7A 5CADA 1BMV1 2BNMA 2XB6C 2DCTA 4Y1VA 3WW4A 2VY0A 2Y0IA 5F6LB 1CJPA 1CX4A 1SEFA 3J9SA 1VBB1 3BTAA 3PMSA 2E51A 3M4FA 2CWMA 2KM2A 5C8CB 1AR83 3HR9A 2EALA 3N7LA 3MPBA 3TNQA 4X6QB 2RE9A 3GHMA 1NQJA 5C8WA 5BNPB 2RHPA 3WW2A 2NMNA 1FNYA 1ULDA 1WLCA 2XJTA 4J1WA 5AC93 5FOJB 4DPNA 2OUHA 4MLOA 2B46X 1EP0A 1AL23 5JVVA 4XFFA 1LOFA 5T52A 1YFXA 1ENXA 1UPIA 3ECQA 3ZFGC 2W52A 2VOKA 3CL1A 4Q0VA 3B9CA 4XJZA 4FAGA 2CGOA 2P3JA 2UYAA 5DUUA 2D97A 3GHNA 3KM5A 5K0UA 1QOTA 2R041 3WZ1A 2AENA 3LOIA 4AFDA 2WNVB 4B4PA 2WT0A 3WUCA 4AEMA 4C91A 5JOWA 1RMU1 4BZ4A 5A33B 3VGIA 4YG6A 2JEMA 1CAWA 4LBOA 1AUYA 1LODA 2FZ1A 2DWRA 3AKSA 4CEWC 1RUI2 1NCRB 1PGW2 2RR12 2ZBJA 2K2SA 4LEJA 4FPJA 1ENRA 3FLPA 4RSUA 4BIOA 5CFDC 4EN0A 2A71A 1VBD2 4Z82A 1LU1A 1LGNA 1O3QA 2DCJA 2VULA 5CA6A 1LKNA 3KQRA 1V6LA 3TBDA 3AJZA 5BNNA 5J96B 1H9PA 4PLOA 4LE3A 1MEC3 2XWJB 2GU9A 2HWD1 1WW4A 3KCCA 1AR72 2QNKA 3AKPA 1VBC3 3JD71 1BJQA 5T50A 1QY4A 2Z2SB 1YIPA 4QQ2A 1X8MA 3AYEA 1JW6A 2QDRA 5JI7A 1U5YA 2WT1A 3AP7A 4AI0A 3M3OA 1A78A 1HRI2 4B4RA 3RJ2X 2YZ4A 4PBPA 3ZYPA 1C8M2 2VW0A 4GALA 1RUG1 2DFBA 5L7OA 4Q4X1 4YVWA 1ASJ3 2WNUA 5I8YA 3GBWA 3ZSKA 1V6KA 4AE2A 4JAAA 2UY9A 5CFCC 4JRAA 1TNRA 2RS31 3D6EA 1D4M2 3AX4A 2P37A 2RS12 5DG2A 2YC0A 4O9GA 2JG8C 1TE1B 2A6VA 1SLBA 4OI4A 2AGSA 5C9AB 2PELA 2A70A 1V6IA 2R073 4K21A 4B8EA 3PHMA 4CDXC 1SMVA 3VBHA 2R063 1OQ1A 3B3QE 3BPZA 3ZFFC 1UU5A 1Q8PA 5FQ0A 4LNVA 1ZBE2 4YM1A 4IL7A 1AL0G 4E2GA 4AI3A 2B9UA 1GQHA 3D5OA 4RFT0 3VBUA 4F3JA 2H0BA 1W6MA 2ZZQA 4JVAA 5DUVA 4U2AA 3ZSMA 3B01A 3GF6A 2D6PA 5GLZA 4WZCA 1DDLA 1AR61 3WQ0A 2P34A 3E6BA 4CDWB 4UW3A 1H8TA 1OOPB 3APBA 2X53S 4BMEA 1VRH3 1ZZ7A 4RS5A 1PGSA 4K7JA 4HKLA 4Y5Z0 1AR91 4QD2A 4Z2WA 4MUVA 1UU4A 1GICA 3E6CC 3V0BA 1HLCA 4M0NA 1QXPA 2XKPA 3WW1A 1RITA 1UD1A 3V64A 3AMMA 5J37A 4WM8A 5AC91 4NOTA 4I01A 4IV1B 2YUEA 4UW6A 4Q4V2 2IXIA 4FXGB 4SLIA 4XQWA 2B39A 2TBVA 4Q8KA 2DYCA 4X8PA 5FO8B 5IK4A 3USUB 4XETA 4CDQB 1SBFA 4M00A 1Z7S3 3WLUA 1EY2A 2A7AA 1PZ7A 4GH4C 3ZXEA 3VBFB 1PO23 3ASIA 3MFAA 2D6NA 1RVF3 1SLAA 1OFNA 2QQPA 1VB2A 3VDDB 4N43B 1TNFA 2GH8A 4IEZA 2CTVA 4AQSA 1B35C 1GANA 2D3RA 4XFCA 1HXS2 1NCQA 1MZEA 3WOGA 1GFF2 3LA2A 1OQEA 5KHJA 5GLWA 4QPGB 2IWGB 2XLGA 5GZCA 4PF5A 3R4SA 3WT3A 5DUXA 3AB0A 1RUD3 5EZWA 1MEC1 4OUMA 1C1LA 4WBBA 4MX3A 2I74A 1LOCA 1ZA4A 4FOQA 2AH2A 1N3OA 3G6JB 4EWEA 3EBRA 5C6CA 5JZGC 1N1VA 4DRRA 4UW5A 3TOJA 4CTEA 1XRUA 1AR82 4E4ZA 1CAVA 2VW2A 4YFZA 5EYXA 4RQPA 4XIKA 2MHFA 2WQZC 1WD3A 1XNCA 3FE5A 3FLRA 1LEMA 3OY8B 2O8OA 4Q1RA 1ZYBA 1PIV1 2WT2A 3ROUA 4AVAA 5BXXA 2A5ZA 2DVDA 4IESA 1K5MA 4MGKE 3RI9A 3H7JA 4LUMA 4HMZA 4OI0A 3GALA 4I0WB 2HWC3 4Q4W3 3V56A 3J8F1 2PHWA 4J6GA 1IKPA 1LOFC 4XQDA 3ZXDA 2LTNA 3VLBB 2EXJA 5GLTA 1ND3B 4P9IA 1D0HA 4H14A 4KBBA 2ZGQA 4IEOA 1R1A3 4IV3C 1CIWA 4C1XA 1UKRA 5A32A 5D8AA 1QQP1 3VKOA 1LHUA 2R061 3WQ7A 4S2HA 4BM8A 5FCCA 3TN93 4Y22A 1WMDA 5K0UC 2CY6A 4FP3A 3ZFEA 4NR1A 1HIXA 2RMU1 1QJX1 4FPHA 1MS9A 1XNKA 1E57A 5IK5A 2W39A 3FLTA 4S2GA 4PDWC 2R30A 1W6PB 2A75A 2BFUL 4LHKA 3W58A 3AYDA 2DCZA 3VZJA 4S2DA 4NPRA 4WVWA 4XJ8A 1NZCA 3OF1A 5BNNC 1EPZA 1AXKA 5HXVA 3AMHA 3IWZA 3VBSB 5C4WA 1V00A 1J1LA 3DUIA 1YHFA 2QDNA 1FT9A 2ZJCA 1VBC2 4XF3A 2XHKA 5I0RA 3H3UA 2H0VA 1F5FA 2MEV2 5HCBA 1ALYA 3AP6A 1FI2A 2W68A 1ZRRA 3QLQA 1MVEA 1W39A 1YO8A 2D7FA 4FOVA 3MICA 1CAXB 5KXEA 4AGGA 1DGWX 2WLPA 4ASMB 2B5HA 3URFA 1JN2P 4E2QA 5L19A 1RUF2 1PK6B 1SACA 3AP4A 4K1YA 3ZXKA 4XJAA 1D2SA 3PVBB 4QM8A 2UWCA 5J98B 1WMEA 4DB5A 5CNAA 4URTA 4V1PA 1CAUB 2LUWA 4FT8A 1NA1A 1RVF1 5DDJ2 2E53A 3RS6A 3W9AA 4LBLA 2PHXA 4DQAA 2R072 2HWE2 1GYKA 1TMF3 2XJUA 2VOVA 4L9BA 4I0AA 3DV8A 4LO4B 1AX2A 3JB4C 3LZZA 5L7OC 4YYOA 5J48A 3S7EA 1HX6A 3H1WA 3OBRA 5AVPA 4IXLA 5DUWA 1ZZ9A 3SNMA 1DGLA 4K40A 3VBUC 3ZX7A 1VB4A 3FHIB 2XUMA 1RUD1 1YIFA 2GNDA 2PLV3 3AMQA 3IPVA 1RUE3 3ZFGA 1ENSA 3NAPB 3HQXA 3VZLA 4QU2A 4HVRA 1OA2A 5BNOB 1URXA 3IDBB 5ACA1 1H8TC 4HSLA 1C1FA 2VMIA 1VRH2 2BNOA 2XBO3 3M2MA 4ES9A 2R0HA 3VKMA 1MQTB 5CG8A 3BODA 2CAUA 4KH9A 4FXKB 4GMP1 3DN7A 4RR3C 4LTAA 2OW4A 4IEQA 2Y38A 4P9JA 4WM8C 2Q0AA 1FMD1 1YCIA 2DURA 2HWC1 2H6BA 4CEWA 2NP0A 3RMXA 1V6JA 3LWCA 2DU1A 2BVVA 2RM23 1VBE3 4Z07A 3H1YA 5CFDA 4F7ZA 4Z8BA 3ALQA 3POSA 1Z7S2 2H6CA 3NJZA 2ZGNA 4GB33 3NV1A 3QACA 1JYCA 2ZHKA 4CRQA 1S0FA 3NVCA 4JGZB 5FPXA 4M0HA 1PO22 3WHTA 3PJYA 5BPXA 3SCGA 4DOUA 4Y4YA 4YM3A 2PAMA 4D7TA 1YI7A 1R081 2HEVF 1G9FA 1VBB3 2BYVE 1AHSA 4JC1A 2UURA 1SCRA 1C5IA 2ET1A 4CEYA 5JPMB 3A4UA 1Q43A 2EF6A 5IK8A 1DQ6A 1X82A 1EV11 3A0NA 4A7ZA 1BEV3 4K3UA 2ZZJA 1A8DA 5SV8A 2JE7A 3MIDA 2IXCA 1ZX5A 2QKDA 2K0GA 5BYNA 3VKFC 4LA2A 4Q26A 4IERA 4C0BA 2UU8A 4IEVA 4B3NA 3WY6A 5FDBA 2V73A 1GZWA 4LO7A 3C2UA 5I0UA 3O12A 4AI1A 4LUKA 1FX5A 4FP2A 4QGLA 3ZFFA 2R043 2BNNA 2XLFA 1RMU3 4HKWA 3K51A 1V9U3 2A6ZA 4AK3A 1H8VA 3LSDA 4Q4Y1 4CDUA 4EV0A 1K5MC 4Q4W2 3JU9A 2ZKNA 3WG1A 1NE6A 2WJSA 4YG0A 5JLVA 3ETQA 3GZUC 3MF9A 1AYN2 4HBNA 4PCRA 3C3VA 5EFUA 4Y1YA 1R1A2 1UL9A 1OPMA 4Z92B 4TYSA 4C90A 2ZX4A 4META 3X29B 2HWB3 4L8QA 1WCSA 4WVZA 3TN92 3M7AA 5BNPA 1RUH1 1JOJA 3KB5A 2JKBA 1W6NA 3AYCA 2ZS6B 1YXWA 2HWD3 4LULA 5IT6A 2BW8A 2WFF2 4N53A 4MGIE 3ZFEC 4PJYA 4I3GA 2LM3A 3JB8A 4GKXA 3RG0A 3JD73 3ES1A 4FQZA 4L2NA 1W6OB 4Q2FA 4WM7C 4DY3A 1LULA 4COZA 1OA3A 3WVJA 1JUHA 3VUOA 3USSA 4YZ2A 1NQDA 4YW1A 1PGL1 4N9IA 2OYZA 2D6KA 2D6OX 1XNDA 2BFUS 3WDWA 3TNPB 3MLJA 4HETA 4OI1A 1HRV2 1TQ5A 4LA3A 1O3SA 3AZXA 3KCXA 3T1MA 5BNQA 5HCAA 4GH4A 1DGRN 4GULA 1EAH3 3VKNA 2ZGRA 3V0AB 2BGCA 5JPNB 4MV2A 2RS33 2DVBA 1G86A 3OYWA 4JGYC 3WR0A 5GALA 1UMZA 2WNEA 1QF3A 2R0FA 2VVDA 2Q8OA 3AKRA 3MW4A 1CR7A 4BHPA 4P14A 5KHHA 2QZ2A 4BIFA 4OUSA 2RM21 1UF2C 4XMAA 1XYNA 3KD4A 1F8VA 2DVAA 2HJIA 1RHI3 3DKWA 3J26N 1CONA 1QXRA 3S30A 3J4UH 1S0EA 3AP9A 3SH5A 2QUOA 1QJU2 4BA6A 2JG8B 3SH3A 3ZXGA 2D5FA 3WDYA 2UWBA 3KT4A 4KG0A 4Q29A 1AR63 4OULA 2UYBA 3O0WA