1NA1B

The structure of hrv14 when complexed with pleconaril
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Coat protein VP1
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
total genus 51
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1na1B00
3VBRC 4Q4X1 5D8AC 1VRH3 2R063 5AC92 4N43C 4NWWA 5C9AA 5AC91 1RMU2 1PVC2 1OOPC 1NA1A 4JGZC 1R1A3 1AYM3 1RMU1 1PVC1 2PLV2 1Z7S2 1AR63 1Z7S1 2XBO2 1VBE2 2XBO1 4CEYC 1VBE1 4RS5C 5FMOS 5JZGB 3ZFFB 3VBFB 1C8NA 4Q4X3 1AL0G 1RUD2 1RUD1 1QJZA 3DPRB 5JZGA 1RMU3 1GFF2 1RUG3 1E57A 3VBFA 4YVWB 5C9AC 2PLV3 3JD71 1RHI2 1NG0A 3ZXAC 1RHI1 3DPRA 1PIV2 4YVWA 1AYN2 2RM22 5FOJB 1PIV1 1AYN1 1RUD3 2RM21 1HXS1 1VB4A 1K5MB 3ZFGB 1ZBA2 1MQTB 2RS51 3VBFC 2R041 3ZFEB 1RHI3 1SMVA 2WWSA 3JB8A 2RS12 1VBB3 1FMD3 1AL23 1BMV1 1PO22 2RS11 1K5MA 1PO21 3DPRC 4Q4W2 4Q4V2 1MQTA 2XPJA 3ZFEA 3VBOB 4Q4W1 1PGW2 4YVWC 1PGW1 2HWE2 2R072 2WZR2 2HWF2 2HWE1 2WZR1 1ZBA3 4Y4YA 2HWF1 4CDXC 3VBOA 1EAH3 1H8TC 4FTSA 1NY72 1PO23 4WM7B 5FMOL 1VB2A 1NY71 1RUH2 4Q4W3 4Q4V3 1RUC1 4CDQB 1K5MC 1FOD2 4AEDA 1AR82 4N53B 1MQTC 4RR3B 3ZFEC 1AR81 5BNPB 2HWE3 2R073 2WZR3 1QJY2 2ZZQA 4WM7A 3NAPA 1QJY1 4GB33 4CDQA 1TME3 1VBC2 4N53A 4RR3A 1COV3 3VBOC 5BNPA 1RVF1 1HX6A 4YVSB 1TMF2 4IV1B 4FSJA 1RUH3 1TMF1 1MEC3 2ZAHA 2HWC1 4GH4C 1FOD3 1AR83 1ZBE2 4RHV3 4AEDC 4YVSA 4IV1A 2WS91 3VBUC 4WM7C 5DDJ2 1NCQB 3NAPC 5K0UB 5DDJ1 1VBC3 4CDQC 1VBD1 3VBHC 4N53C 1HRI2 2MEV3 5BNPC 1D4M2 2FZ2A 1HRI1 4QPIC 1D4M1 1NCQA 4PDWB 5K0UA 4CDWB 3FBMA 2RMU2 1ZBE3 1RUI2 2RMU1 2TBVA 1RUI1 3JBG3 1CJDA 5J96B 4IV1C 1F2NA 4PDWA 4CDWA 1V9U2 1V9U1 5C8CB 2BFUS 5AC93 1X36A 3VBSB 4QPGB 3ZFFA 1PVC3 3JD72 1NCQC 1Z7S3 5A33B 5K0UC 1NA1C 1VAKA 2XBO3 5CFDB 1VBE3 5C8CA 1EV11 3VBSA 4QPGA 2HWD2 1V9U3 1POV1 2HWD1 1WCDJ 5A33A 4PDWC 4CDWC 1HXS2 5CFDA 1DDLA 3HAGA 4LLFA 3CJIB 3JD73 2RS52 2R042 1BEV2 5JZGC 3ZFFC 4FTBA 1BEV1 4NWVA 1BMV2 3CJIA 3JB4C 5C8CC 2RS32 3ZFGA 1PIV3 3VBSC 1QJX2 2RS31 4QPGC 1AYN3 1BBT2 2RM23 1QJX1 1HXS3 2DF7A 1BBT1 4Q4Y2 4Q4Y1 4Y5Z0 4GMP1 2RS53 2R043 1HRV2 2BBVA 5C4WB 1HRV1 1FPN1 1R091 2RS13 1M06G 2RS33 1RUC2 1OHFA 2GSYA 3CJIC 5BNNB 3ZFGC 5C4WA 2BFUL 1CD3G 2HWF3 5BNNA 1NOVA 1ND2B 2RR12 1RVF2 1C8M2 3IDEA 2RR11 3J8F1 1AUYA 1R082 1C8M1 1VBA2 1W39A 1ASJ2 3TN92 1R081 1RUC3 1VBA1 2HWC2 1ASJ1 3TN91 1PO11 1ND2A 5C4WC 2GH8A 2WS92 5CFCB 1QJY3 1OOPB 3VDDB 1ND3B 5BNNC 1RVF3 1VBD2 1QJU1 1VBA3 5CFCA 1VRH2 1RUJ2 1OOPA 1TMF3 2FZ1A 2R062 2HWC3 4RR3C 1VRH1 3VDDA 1AR92 1RUJ1 2R061 1ND3A 5GKAC 5ACA2 1QQP2 1AR91 3M8LA 5ACA1 1QQP1 1R1A1 5BNOB 5A32B 1IHMA 2WS93 4EJRA 2WLPA 5DDJ3 4YVSC 4JGYB 1VBD3 5BNOA 2Y26A 5A32A 1HRI3 1RUJ3 1D4M3 1AR93 5CFCC 5L7OB 5ACA3 1AR72 1QQP3 1RUG2 4JGYA 3VDDC 2RMU3 1AR71 1ND3C 1RUG1 1RUI3 2PLV1 1EV12 5L7OA 4RFT0 2BUKA 1OPOA 5BNOC 1NCRB 1AR73 4CEWB 1HQNA 4JGYC 1POV0 1EV13 1VBB2 1FMD2 1AL22 1NCRA 1VBB1 1POV3 4CDXB 1FMD1 1AL21 2HWD3 5LK7B 1F8VA 4CEWA 1H8TB 5L7OC 4SBVA 2IZWA 2BPA2 2WFF2 1PGL2 4CDXA 5CFDC 4CDUB 4BCUA 2WFF1 1PGL1 1H8TA 1BEV3 1ZBA1 1FPN2 1EAH2 1B35B 1R092 1EAH1 2HWB2 1RB8G 4CDUA 2HWB1 1NCRC 4FTEA 1QJX3 4WM8B 1BBT3 4RQPB 4Q4V1 4GMP0 4CEWC 1B35A 3S6PA 4Q4Y3 5J98B 2WFF3 4GMP3 1RUE2 4GH4B 2R071 1RUE1 4GB32 1RUF2 4RQPA 1A6CA 1HRV3 4GB31 1FPN3 4WM8A 1TME2 4AEDB 1RUF1 1R093 1TME1 1COV2 3J8F2 5ABJB 3VBUB 1COV1 2HWB3 4IV3B 2X5IB 4GH4A 3NAPB 1PO12 1MEC2 4CDUC 1RUH1 1MEC1 3VBHB 3VBRB 1FOD1 5D8AB 5ABJA 4RHV2 2QQPA 4N43B 3VBUA 1B35C 4QPIB 4RHV1 1RUE3 4IV3A 2X5IA 2ZTNA 4JGZB 1RUF3 3VBHA 1QJU2 3VBRA 1X33A 4WM8C 2RR13 3J8F3 4RQPC 5D8AA 4Z92B 1VBC1 1C8M3 4N43A 4QPIA 4CEYB 1R083 4RS5B 2MEV2 1ASJ3 3TN93 4JGZA 1PO13 2MEV1 1R1A2 1AYM2 1AYM1 2VQ0A 1ZBE1 1AR62 4CEYA 1ND2C 3JBG2 4RS5A 1AR61 5ABJC 3JBG1 3LOBA 5C9AB 4IV3C 2X5IC 1NA1B 1QJU3 4Q4X2
chains in the Genus database with same CATH superfamily
2DDUA 2B45X 1JH5A 2GN7A 4TN7A 1YXWA 3IPVB 4XFFA 4MVTA 4XJZA 3EB7A 1LHVA 4CP2A 5IVYA 3H9AA 1MZFA 3LIHA 3RZKA 5AC91 3CHXA 2BGCA 2NQYA 3LWCA 4XUPA 1OOPC 5A1FA 1MS0A 3HNYM 3PLQA 3Q8CA 1JOBA 1GSLA 2PLV2 2VW0A 2ZX3A 3LGRA 2VZPA 1Z7S1 4Q1PA 2BZDA 3MIEA 4FCAA 2WNVB 2Y0OA 4CP0A 2C4XA 1RJ8A 1V00A 2OW4A 1HV1A 2VBDA 3HBKA 3MPBA 4YNIA 3RYRA 3RZZA 3ZFFB 1O8PA 2WNUB 3FLPA 3ZX7A 4DIQA 5C3SA 5LY1A 5LEJA 2XUMA 1IZ3A 1Y7BA 4YFZA 2AZ5A 5EYYA 1UY3A 3MW4A 5FZMA 5EP9A 5ANQA 1RUD1 3VL9A 5H9RA 4OUMA 3ZYFA 4QQOA 2VO5A 5JZGA 2VNGA 3LB9A 1E57A 2ZGNA 1F5JA 3PIGA 4DRVA 4ES8A 2GC0A 5LBEA 2UWCA 2XUEA 3RJ2X 1RHI2 3WQBA 4NHKA 2ZS6B 4P9IA 1NG0A 2JXAA 2YDEA 3CZJA 2HH9A 4I01A 4SLIA 1O3SA 5LEKA 2NMNA 3DPRA 5FUPA 2A70A 3P5BA 1IPKA 1OH4A 3LSDA 4JHTA 1PIV2 1BCXA 2QFEA 1AX2A 3FZ3A 1RINA 3GZEA 4OI0A 1OBNA 3B01A 5CA6A 1LTEA 1RUD3 2A3YA 1VPHA 2RM21 5IT6A 1LOGA 4PF5A 2AH2A 3OYWB 2ET1A 3W5MA 3NNFA 2ARAA 4FPCA 4ZKTB 1RJ7A 5FP4A 4DXSA 1BJQA 4W4ZA 1DQ1A 5FZ4A 4CP1A 1ZBA2 3NV2A 1IQDC 1TE1B 1N1TA 5AFBA 1D2SA 1SBDA 1SCRA 4FXGB 3USSA 3MZHA 4BXFA 1NKGA 2W1SA 4XFAA 5FZOB 4RN5A 1LKNA 3MYXA 1AL23 3PUQA 5T5JA 4CU7A 2AEYA 4E2QA 2CWMA 3U11A 5DUVA 1K5MA 1XQNA 5T5LA 5CKQA 5C3RA 1S0DA 2JB4A 3DPRC 1MQTA 4QU2A 3ACLA 4IUGA 3OSDA 1WCKA 1U5IA 4YZ2A 4XXAA 1PGW1 3I3MA 1DP0A 2F4PA 2Q1MA 3PVNA 4QX5A 2R072 2WZR2 4IQPA 2HWE1 4LA3A 1T2XA 2AREA 2ZEXA 2SLIA 3OG2A 4NAMA 4EWEA 2E51A 2HWF1 5JAXA 3O1VA 2EIBA 2VMGA 4EWDA 1ZA4A 2QKDA 4WVWA 4K8FA 4C91A 2W2IA 3PL0A 1UO9A 1V6IA 1WBLA 3FMGA 4AEJA 3I2HA 5DG1A 2P6CA 3WF3A 3WINE 2QDRA 4X8NA 4FTSA 2RJ2A 3ETPA 1Q8SA 2VMCA 4MUVA 1NLSA 4H7LA 4Q4V3 3NV1A 2ZACA 4KGQA 5IVEA 1K5MC 4LBQB 4BQWA 4XCAA 5IVCA 1AR82 3AYAA 4N53B 1MQTC 2R49A 1CIWA 5BNPB 1SFNA 4GIQA 2W9XA 4MH0E 4JTNA 2EXJA 2HWE3 1QJY2 1G9FA 4WM7A 1ZRIA 5JSPA 4KH9A 3O1TA 2C6SA 4GB33 1OQ1A 5F2WA 4CDQA 2J1VA 3IBMA 4CCJA 4HK9A 1O4ZA 2JECA 5DQ0A 3BGAA 2EIDA 4NPMA 4WZCA 3UGGA 2P34A 1COV3 4LO7A 4P02B 4RR3A 3ALQA 3RWKX 5A1AA 5DAWA 2VQUA 1Y9GA 4BK4A 4FSJA 1TMF1 5HCHA 2ZAHA 3OJBA 3BI3A 3SH3A 4Y22B 4NIAA 4UI9L 1FOD3 1W8HA 1YFXA 5FP8A 1DQ2A 3O5SA 2EXIA 3VDAA 4K9SA 4B7EA 4YZ5A 3AP7A 5JOWA 1X82A 4XFGA 2P3YA 3OBTA 3SITA 3POJA 4R4XA 4WM7C 1NCQB 1C1FA 1TNFA 4AHZA 2B9VA 3U1XA 2W3JA 4CDQC 1Q56A 5C71A 3NNMA 4QX7A 3T0AA 1NXMA 1HRI2 1ZZ7A 2L9LA 2MEV3 2UU8A 4KBZA 4WVVA 1QH7A 5ERLA 3WDXA 3ZIXA 3PTYA 1XU1A 2OX0A 4MYEA 1J1TA 2ZHMA 1RUI1 5CBLA 2G19A 4XF9A 2PHDA 4AI1A 1DGWA 4D7TA 3EXUA 4G9SB 1GNZA 4GWIA 2GNBA 4CDWA 1W6PB 4IDZA 5LA2A 3WZ1A 5JWPA 1F9KA 3HPNA 1C3HA 2VUDA 2J1TA 5C3OA 4CP9B 1H8VA 1SBEA 4PIZA 4K1ZA 5FYVA 3ZPOA 2OT7A 2BFUS 1UIJA 2ZKNA 3GZTB 1RIRA 3VBSB 3OCPA 2G4IA 4CUCA 2VZ3A 5BPXA 2Z5WA 4GWJA 1NA1C 4MADA 3RZHA 1JZ5A 4KI5M 5F6LB 2JG8A 4AXOA 1GQPA 4D6QA 1Q8OA 2E63A 1ULDA 1EV11 3BU7A 4LLOA 5LZ6A 3H3UA 2VCMA 4CCCA 1UZ0A 3BYWA 2WZ8A 2YROA 3BODA 1QHDA 4CUAA 3IT8A 2CU5A 1OVSA 2YU1A 4HSJA 1HXS2 3WNLA 4XF4A 4BB3A 4CDWC 1OLMA 3ILRA 1ZNPA 5CFDA 4YGCA 2IC1A 2W08A 1GZ9A 1S0GA 1W8NA 2OUHA 3CJIB 3D82A 4OQ9A 5FLIA 4F83A 3PTRB 1YYNA 4NMIA 4OLLA 4IEPA 1Q8QA 1WKYA 3JD73 3LCPA 2DFCA 4JDMA 1PNFA 1PX4A 1W2OA 3ORJA 3U14A 5FPAA 1GBGA 2ZHNA 4JRLA 1BEV1 3EO6A 5CIRA 4C0HA 5BY5A 4CCNA 4DUWA 2DUPA 1PNGA 1ZRRA 2JG8C 2OQ6A 3U07A 2RS32 3ZFGA 2F6BA 1PIV3 3AZXA 3QCWA 1K12A 4FVVA 4DXZA 3KF5A 3N9MA 5F3EA 3R4DB 5CEHA 1J3PA 2IXCA 4Q29A 4Q4Y1 4YGEA 1PK6A 3GJBA 1US2A 4P9GA 1GZWA 4HSLA 2R043 2EAAA 4O9EA 1W9SA 1U12A 3MW2A 3ASIA 2ZGOA 3RRDA 3LF7A 5L73A 3VKOA 1YCIA 2ZMNA 4LKDA 4BMEA 1V6NA 2OPWA 4BXSV 4UW5A 4XIOA 1M06G 2QUOA 4RL7A 1OD5A 3USUA 4ATFA 1AF9A 3MFCA 2W1QA 1OHFA 3ZFGC 2QNKA 4HN1A 4DEVA 4DEQA 3AKTA 4XW3A 5EV7A 4YWAA 4D6SA 2BFUL 5B4NA 3AMNA 3ENRA 2VXJA 3WUDA 4MLOA 1QIQA 1WW4A 4AI2A 1LGBA 1QJFA 3WUCA 4YG0A 1PK6C 1XB9A 2QQVA 3MLLA 3UL2A 4JKKA 1ENSA 2IFRA 1RVF2 1I5ZA 3THPA 3D4KA 3H42B 3WQ1A 2RR11 4BISA 1UY4A 2D3SA 1R082 1GV9A 3KT4A 4DOUA 3LEIA 3ZXDA 5JMOA 1WLDA 3SH4A 3TN91 5FZ3A 4FOQA 2XJPA 4DPNA 1R1ZA 1CR7A 3CKHA 4HVQA 4N9IA 1RITA 1PMJX 2A6VA 1YI9A 5DZGA 5BUVA 5CFCB 1QJY3 3ACGA 2VNVA 2JE7A 1OOPB 1JI6A 2PXJA 1J3RA 4NPRA 4KWUA 5K4LA 4E4ZA 5AVAA 1JYTA 1Q8VA 1ND3B 3WD5A 3WOGA 4CPBA 3KGLA 1OF3A 4M3CB 3BALA 4AVCA 4MGTA 5GLVA 1VBD2 3A4UA 1XRUA 4XBNA 4ZS2A 5FY0A 5FJKA 2W5FA 3IAQA 4FFFA 3VD5A 1BVP1 3W9AA 3MUY1 4OHYA 3VDDA 4FPYA 2BGOA 2R061 2WUHA 3P1IA 4UFMA 5GKAC 3SQOA 1N3QA 1UCXA 4E8DA 4DUXA 1I9RA 3PJQA 3E6DA 4HKLA 5ACA1 1QQP1 1R1A1 1W2TA 1W6NB 2HEYF 2Y64A 1OUXA 1PZ9A 4PT6A 3I3DA 4XBLA 4XEZA 5FZ8A 5BNOB 1MACA 1EUTA 1WLCA 3B9CA 2WS93 4EJRA 2ERFA 3NL1A 3I97A 2XONA 4OHXA 3V65A 2E6VA 2ZGUA 1WCSA 1LOAA 2ZGRA 4BWOA 2HJIA 4ZU4A 5C8WA 2VVDA 3NNLA 3T2TA 3TAYA 4L92A 3K48A 3PVOA 4QPWA 3QACA 4AGGA 3RQ0A 4COVA 1HRI3 3ZXGA 2V72A 3TRSB 4Z07A 2HEVF 2UY9A 4NHXA 4YW2A 5ACA3 1QQP3 3VDDC 4TSVA 1C5HA 1DQ6A 5LRSA 4XTPA 1YHFA 4XE9A 1DLCA 4FP3A 2WQZC 4BOWA 2WIIB 3ZMNA 4M0HA 4BLIA 4M3CE 3GBWA 3KV4A 1ZZ6A 4FT8A 5C3PA 1BLZA 2DCZA 3VL8A 5JOYA 3HT1A 2KXLA 3QLQA 4QDRA 2XJTA 2IXHA 3MIBA 1XYOA 2I07B 4FI9A 1Q5OA 3UGFA 2WDBA 4BE3A 5D21A 4DY3A 3N9PA 2DCKA 4QM9A 4RFT0 4JC1A 3UT0A 1RUNA 1YJKA 3MFAA 2OZJA 5FXZA 1NCRB 4V1PA 5FZKA 3IAPA 3VV1A 1JUHA 5JPMB 3T09A 1BZWA 1XE0A 1JBCA 2G9FA 2QVSB 3BB6A 4DXRA 2XLGA 3F95A 1DIWA 5GM0A 3V0BB 3O1PA 3URFA 5C3QA 1YFWA 4CZSA 2A6ZA 3IB3A 2CAUA 2KD7A 1VBB1 5LRRA 1FMD1 5JSOA 4H7MA 5LK7B 3K3NA 5DUUA 1F8VA 5FYCA 4CEWA 5A7NA 2QJVA 1D0HA 3BKZA 2HYKA 4C1WA 1X7NA 1MVQA 4HPKA 5IFPA 1W6QB 3NV3A 1O4TA 1NE4A 4MHUA 2VD7A 1SFYA 4UFLA 1U5XA 4D8MA 4UT5A 4BJ0A 2BPA2 1JYWA 4OYUA 1SLBA 1VJ2A 2DVDA 2VCCA 1J59A 1A8DA 3MV01 2J1EA 2CY6A 2YPDA 4KNCA 4B4PA 2ZZJA 4FO9A 5GLZA 4E4HA 5HPOA 3FUQA 3I2FA 5H9SA 2OZ6A 5EFUA 5DXDA 4PI0A 1EAH1 3AMPA 4HKOA 2HWB2 5CYYA 5FWEA 1RB8G 4CDUA 4XQDA 1OC1A 5FXXA 4ARXA 4ZZ5A 4FTEA 1FV2A 2QZ2A 4AW7A 4CXYA 1D2QA 3BTYA 4CEWC 1EY2A 1DFQA 1WCQA 4QX8A 2OS2A 1WA6X 2V09A 1GP4A 1RTVA 3PUIA 5FZ1A 1ZRCA 2DCYA 1RUE2 1QY4A 5GALA 1IKPA 3M3QA 3M7AA 1JODA 3VUOA 1GANA 2IWGB 1YRZA 1RUF2 4RQPA 4WM8A 3ZIWA 5IFTA 1TME2 4CCOA 4HKWA 3I7DA 3FC0A 1R093 1V6JA 5B2GB 4LO4B 5ABJB 4LITA 3SMHA 3WEZA 5IVVA 5J09A 3FBYA 4DRRA 1H1MA 4IE7A 4OQ8A 1OI6A 3KCCA 3RGBA 3AX4A 4GH4A 3ZXLA 1UOGA 1MEC2 2Y34A 5HCFA 5J36A 3DYPA 4B3NA 4CDUC 1RUH1 2W1UA 2R1BA 4M3CF 1KFXL 3VBRB 3ZXJA 5LBFA 4I3PA 1O7FA 4N43B 3SCFA 3LEGA 3VBUA 2XOMA 2GP3A 4IV3A 4Y1UA 2XL9A 4OI1A 3MF9A 3M70A 3WV6A 3GBGA 3R4SA 2LS6A 4TWTA 3I59A 4ISRA 1JZ2A 3FHQA 2FDKA 4WM8C 4RQPC 5D8AA 3KD4A 1G86A 1VBC1 2E33A 2C26A 4QPIA 1MS4A 1R083 2ES3A 3WX5A 2D6LX 1ZZBA 1APNA 3LDRA 1KJRA 4GZ9A 4JGZA 1PO13 4JRAA 4XZUG 3VZLA 3TBDA 2JE9A 3RMXA 2LW8A 5A7WA 4QX0A 4HK8A 4N9HA 1AXYA 1CIYA 2AGSA 5CKNA 1BYHA 3MI8A 4QQHA 1ZBE1 1G7YA 1WUVA 2BNNA 4LBKA 1SZBA 3V64A 1ND2C 3I3EA 3BUCA 1UIKA 4BDVB 1QDCA 4IV3C 4XQ4A 1NA1B 4NO4A 1REFA 3AP5A 5KXBA 4UW6A 3T1MA 3N9QA 5FO7B 3CMGA 3VHNA 3WW3A 1K5JA 4LQRA 4MGZE 5D8AC 5A3OA 2GC2A 3H7JA 4K40A 5AC92 3FJSA 1UY1A 5C9AA 3KZ4C 4MG2A 4EYUA 3OUIA 1H1AA 2A73B 4JGZC 4B29A 1UZYA 1X50A 4Q1RA 3KGZA 1Z7S2 4TZDA 1KRIA 1HDKA 2QE3A 4QPYA 2GP5A 1WMFA 2R30A 2ZGTA 3J26N 3GHMA 3AYCA 3UKNA 5E1RA 1AZDA 5FMOS 1W6MB 5G04L 2PFWA 1FXZA 2UWAA 3CF6E 4OHZA 3IZOA 2ID4A 4IESA 3TNPB 2CYFA 5A6YA 1UYXA 5J48A 2ZGQA 1AL0G 3AL5A 2VL4A 1RUD2 2WT2A 3ZYBA 5KXEA 4EZ4A 4QD2A 1DGRA 4Y1VA 4XJ8A 2PAKA 1YFYA 4OUSA 1FYUA 5F2SA 4LR4A 1UX7A 3VBFA 5C9AC 2DCJA 1JZ8A 2WN3A 2JG9B 3LOIA 4YG6A 3TEYA 5FYZA 4LKEA 1GNYA 3OY8A 4IEXA 4XHBA 2A7AA 1JYNA 3ZXAC 2Z79A 5AVPA 2IUWA 2DVAA 1XYNA 2VTXJ 3MLJA 3ACIA 3O0VA 4CCMA 1Y9MA 3IM0A 4XFHA 2XHKA 4YVWA 2VZVA 3BTXA 2RM22 3AMQA 3WHTA 5D2AA 3B69A 1UOFA 2A1XA 2J1AA 2XG3A 4NRQA 4Y5TA 4YZ3A 5LA1A 1WWYA 2CTVA 4IEVA 3PURA 2WFPA 2D43A 1VB4A 1H1IA 1QXJA 2MNGA 3GJAA 2V4VA 3GGLA 1POQA 5GLUA 1W9TA 3WDWA 4XFIA 3KV5A 4M4RA 3WNOA 4XJUA 4H3WA 4WVZA 5FY5A 5JXHA 2RS51 5EHDA 3VBFC 4N8MA 3ZFEB 5A6ZA 3MO4A 1OA3A 1TG7A 2VQTA 4LBJA 2FCTA 4AG4A 5HV0A 1BQPA 2X10A 2ZA9A 3M3CA 4AVVA 2WWSA 5IVJA 2YGLA 4KWLA 4CPBD 1H2LA 2RS11 2Q0AA 2GC3A 2JDPA 1PO21 2VC9A 2XJRA 3BPZA 4Q4V2 3KB5A 4M01A 2Q1ZB 2TNFA 4MXWA 4Q4W1 1A3KA 1PGW2 4YVWC 3ZDVA 1W2AX 4H14A 2ZAAA 4QB2A 3S7EA 5F5IA 4AQTA 2HWE2 2HWF2 2WT0A 3RYKA 3WP4A 2O8QA 3I3BA 3B9IA 2A3WA 3SH5A 3T30A 3VBOA 1M4WA 3I2IA 5F7UA 2A75A 4ZXKA 1GWLA 3K46A 3O1SA 5FZAA 5BV6A 2Y38A 2C1FA 2BEOA 2EA7A 1CESA 3TB0A 1PO23 5FMOL 4J1WA 1S2BA 3ZSKA 4HETA 1NY71 4Q4W3 3V0AB 1RUC1 4PI2A 1FOD2 1LHUA 2W92A 3AFKA 1UW8A 4AEDA 3M3EA 2IXLA 4LT5A 5I0RA 4HL0A 4GXLA 3N9LA 1HQLA 3FLTA 1SEFA 5F3GA 4A7YA 3NAPA 5E8AA 3SEEA 4JKMA 5T55A 5APAA 1TME3 3FFQA 3HBZA 3K4AA 4LHSA 2UYAA 2LRPA 3VKLA 3VBOC 3MV11 1BK0A 1HX6A 1TMF2 4IV1B 5JCTA 4COWA 3DCQA 1MEC3 2HWC1 1W0OA 1W6OB 5FQ0A 3POSA 3K4ZA 1UU6A 3ZSMA 5I0TA 1V70A 2NMOA 4QKDA 2R16A 4AEDC 3INAA 4HVOA 2VTXA 4YVSA 3ZKUA 2ILMA 4WBBA 3NAPC 5DDJ1 3OBZA 4QGNA 3NJVA 1XJAA 2ZX1A 1KDKA 4EN9B 2D93A 2HBUA 3RZGA 1W05A 3LEKA 2J1RA 2YXSA 4QM8A 1JZ4A 3WW2A 1D4M1 3ZPYA 2I45A 4B8EA 5K0UA 1H0BA 1V6KA 5FMDA 2FBEA 2XLAA 4QMAA 3IDAA 2WJSA 1RUI2 3RZJA 1E5HA 1OD3A 4OZXA 3VGIA 4W6WA 3CQOA 1VR3A 3KCYA 1FNZA 4META 4CCLA 2WA3A 4JDOA 2WO7A 3O0XA 5I0UA 1IS6A 2CHHA 2Z42A 1WGPA 4PDWA 1XU2A 3S57A 1PM7A 3WG2A 3HMYA 4CSWA 2RDSA 2VECA 4YM3A 2AYHA 2J22A 2BYVE 4C0BA 5FYUA 3SLIA 5AC93 2PYTA 5CADA 2W94A 3HQUA 4QPGB 4PCRA 1WA4A 1XNDA 3FE5A 3JD72 3ST7A 1S4CA 3FWEA 4INDA 1CAVA 1Z7S3 1MZEA 3ZR5A 5A33B 5K0UC 4BIFA 1ULEA 1NZCA 5F37A 1F5FA 5DZFA 4D69A 4NE9A 1DQ5A 3RI9A 2O1QA 5C8CA 1JZ6A 4NOTA 1VALA 2EIGA 2GMPA 2VOWA 3BOPA 3N35A 3HQXA 5F8PA 4NHYA 3RG0A 1MS5A 4PDWC 5FREA 3L9JT 2VAUA 2ZX4A 1UY2A 2R7EB 4ZS3A 4Y33A 3NSTA 1PMHX 2DU1A 5L9RA 2OUJA 3PUSA 1RC6A 3W20A 5FKBA 2JX9A 1UAIA 5BXXA 2VGDA 3SEPA 1JMUB 2R042 1ULPA 1BEV2 1SLAA 2BGPA 3PHMA 4WVMB 2BTVC 5DAVA 5A6QA 4AK3A 5JZGC 4V2WA 4IXLA 2A71A 3NV4A 4YRDA 1I3HA 1BMV2 4QX1A 2QQOA 4YW4A 4W6XA 3WCSA 5C8CC 3UNPA 5FKCA 3DL3A 4P9LA 3I4IA 4P14A 5A3WA 3QH7A 1VAMA 3WQ7A 5LCWL 5IK8A 2RM23 3POYA 2DF7A 1SDWA 1O59A 1BBT1 2WNOA 1TNRA 1UWWA 3ROUA 1UYYA 4Q4Y2 3KHBA 1XPWA 3BTAA 3KVBA 4Y5Z0 2WC2A 1S2KA 2W0XA 4Q8KA 1UX6A 2XL7A 3H8XA 3VZJA 5C4WB 1FPN1 2DURA 4A7KA 1KD7A 3NJZA 4XOGA 5FYBA 1SCSA 2BWCA 3B3QE 4JCKA 5BNNB 1H6YA 3IDBB 4UXAA 2W68A 3G7DA 1E5IA 1LOBA 1HB3A 4GKYA 3H3LA 2K46A 4NRPA 2D3RA 1CD3G 1LAJA 1UXXX 2ZGLA 3LDBA 2HWF3 4LBMA 2PAEA 2GC1A 1LHWA 1JHNA 4E27A 3NRUA 4XF3A 1NOVA 4CXWA 4NROA 2N7GA 5IVFA 3IMMA 2TUNA 1ND2B 2RR12 2Q8CA 1DQ4A 1XBFA 4Y26A 3S5QA 3ZXEA 1ULCA 3SHRA 3J8F1 1AUYA 4D6RA 4QWNA 1C8M1 4TYSA 1DBNA 3TN92 2RDRA 1PZ7A 1SLCA 1DU3D 1DGRN 1ASJ1 2D98A 1NQDA 2Q30A 2VCBA 3N7JA 3C2UA 4OMDA 1G8WA 3ZXKA 5LBCA 2OVUA 2A6YA 1CPMA 3ON7A 2DTYA 3KV9A 5JI7A 2XJVA 2WS92 1QOOA 2JICA 2XKPA 5F5AA 4P9JA 2WAAA 3AXEA 4WV8A 1O3TA 4AHYA 2OKXA 3WW1A 1QJU1 4FOYA 3HR9A 4RR3C 2R062 1TMF3 1VRH1 1RUJ1 5ACA2 5FIXA 1QQP2 1GLHA 1JZ3A 5I93A 1W90A 3M8LA 3T2QA 3ZN6A 4UF0A 2BQPA 1E5SA 5FYHA 1CAUA 3T3YA 5C7GA 5EQUA 1RXGA 3HN3A 1O91A 2WLPA 4XABA 4TXWA 4GULA 3D5OA 2OYZA 1DZRA 2XJUA 3I2OA 3UKVA 2VNOA 3WR0A 2DVFA 2LROA 2GDFA 4XDPA 4XXPA 1SQ4A 3HOBA 5L36A 3DUIA 3PMEA 4LE4A 3VHRA 4DFSA 4CUBA 2QQIA 1RUJ3 3UESA 5A32A 4XC9A 3GALA 1ST8A 5FYSA 4JGYA 1LGCA 1AR71 1RUG1 3IWZA 2YMZA 2E7QA 4CCEA 3I2DA 4MXVA 1RUI3 2PLV1 3RVHA 1LEMA 5JI9A 2D6OX 1OQDA 2AR6A 5L7OA 1J84A 2BP6A 4W6YA 4JHZA 1VIWB 1OF4A 1UMIA 3K75B 4FPOB 5A80A 1L3JA 2H0VA 5F1RA 2YYOA 1UD1A 3LZZA 5FPLA 1XNAA 2ARXA 2E32A 3DYMA 1XYPA 3N9NA 2W46A 1GP5A 4I0AA 1AR73 4FP2A 4MGSA 1HKDA 3QD6A 3WG4A 3AZVA 2VW2A 1CAXA 3KM5A 1Y3TA 1HQNA 3UGHA 4JGYC 4PBPA 1AXKA 1UOJA 2DVBA 2JDAA 1POV0 1LHNA 4J1XA 4LTAA 3AYDA 1EV13 1VBB2 2PHXA 1FMD2 3B93A 2Y0IA 3O7OA 2YBPA 5FFOC 2ZEWA 5TSWA 1SLIA 5HXMA 1W9FA 3GXUA 3M2MA 4XJAA 3LPFA 2ZX2A 4KGGA 1GZCA 5A3LA 5L7OC 2HEWF 1H9WA 4SBVA 5LY2A 3HIFA 3BTZA 1H6XA 3MGUA 1Y43B 5DAQA 5IAXA 5EXOA 1NLQA 2IZWA 4QB1A 1Q3EA 2X09A 3B02A 1DHKB 2RJLA 4CDXA 5GZFA 4GWMA 4QHZA 4BCUA 5CFDC 1PGL1 2GH2A 3APBA 1D0GA 4OUEA 4QT6A 1H8TA 1OKOA 1BEV3 1SHWB 1ZBA1 2VMFA 4NJ4A 4YW1A 3U78A 4C1XA 5FO9B 1EAH2 5LW9A 2PELA 1R092 3R6SA 3A21A 1XNTA 2D6NA 1LNSA 2CAVA 1LOEA 1F31A 4AGVA 1CAWB 1JU4A 4B1LA 1W99A 1W0NA 1D4VB 2QDNA 4HLTA 4LKSA 1VMFA 2ADDA 4GMP0 1B35A 3WDYA 2QQMA 3SKVA 2Q5TA 4Q4Y3 2VZQA 3T1LA 2J42A 4ASLA 1JYCA 2VMEA 1A8MA 1H2KA 3NW4A 5LBBA 4FAHA 2YC4A 3VLBB 3ZN5A 1CGPA 2R071 4L99A 4NRMA 4LO8A 4I3GA 3MHZA 1A6CA 3KQRA 4LORA 4AEDB 1XE7A 2LM3A 3IMNA 4AOCA 1L7RA 4JAAA 1JS9A 3ZLIA 4HXCA 2J1SA 3WG1A 3ACHA 1GOHA 5IK5A 2X5IB 3CZUA 3NAPB 1S0JA 1X8EA 4ZY9A 3IKWA 1PO12 4I0BA 5KBFA 4ASMB 3K51A 3PIJA 4EROA 1A34A 1YC61 4D0QA 4A42A 2P3KA 2K9ZA 3HEIA 5IW0A 2QQPA 2B9UA 3OPZA 1B35C 2JDKA 4JVAA 4RHV1 2XJSA 2W87A 4O61A 4MSVA 1LESA 2ZTNA 2D7FA 4FXKB 3ILNA 2G9ZA 4IEUA 1JU3A 1KITA 3DXTA 5FUIA 5FYIA 1T6GC 3K2OA 1EPWA 3VBHA 1V6OA 3M3OA 2RR13 2VW1A 4Z92B 3M4FA 4JDNA 4ZHNA 4K6BA 3GDBA 4LOTA 1OA2A 2D44A 1FAYA 2UYBA 1S0CA 1YIFA 2WO2A 2PN5A 2HYXA 3TN93 2G9GA 5JVVA 2WQ4A 3L2HA 5K7PA 3TEWA 2YBSA 2VOXA 2XVKA 1TZOA 2VUCA 1SFPA 1MVEA 2AENA 4Q0PA 1N1SA 1S1AA 1AYM1 3AZWA 1ZYBA 2VQ0A 2XVLA 4Z82A 4D7SA 4ES9A 4IW3A 4KQ7A 4OHVA 5SV5A 4CEYA 3N4MA 2ZPXA 3J7NA 2VG9A 4RS5A 5IK7A 5FZEA 1VLNA 5DPNA 3JBG1 3OEBA 3ZYPA 3TNQA 3PU3A 3EYPA 4RGAA 4X6RB 5DUWA 3SISA 4AQ2A 2VULA 1OLRA 1C5IA 4Y5SA 4XF1A 5EJ1B 1DLLA 3LFIA 4HANA 3ACFA 5FLHA 4DO0A 4QQLA 4XIKA 1YQ6A 3CL1A 3ZYGA 2X05A 2R063 3E97A 1NAEA 4IGOA 4XTMA 3AP9A 4NWWA 1GWMA 2WSVA 4I30A 3ZR6A 4BQ3A 2C5DA 2CDOA 4IEQA 5F9TA 1R1A3 1AYM3 5JIUA 1RMU1 1PVC1 4QAWA 2RHPA 5FCCA 4Y1XA 2HBTA 4QHBA 4YGDA 1OLQA 2X53S 5C6CA 2YV8A 4KG8A 3UKTA 3IPVA 5JR2A 2XBO1 4GJYA 1KS4A 3J7MA 4I02A 2CWSA 2P6HA 1HLCA 1VBE1 4CEYC 5JXJA 4RS5C 2RV9A 5JZGB 2GU9A 2X8KA 3DV8A 1C8NA 2BJSA 5JOZA 2GALA 4A2UA 1OFSA 5T5PA 2P3JA 2QQLA 5FMCA 1AX0A 2WNVA 3MLKA 3DPRB 2NZ9A 1RMU3 4FPJA 1JYXA 1O3RA 2A6WA 5FMBA 4M0NA 2WNUA 3CLPA 3BIEA 5FZHA 1AX1A 5KXDA 2EXKA 3AVSA 4QDQA 3H1MA 2CDPA 2D40A 2QQUA 2JWPA 1QKQA 4ITCA 3GCWA 4DUVA 3O0WA 1LODA 3VD7A 1BK1A 3EMRA 5IHRA 2O0OA 3U0ZA 5FUNA 1QMJA 4LXLA 4BM8A 4FFHA 5KWRA 1VAVA 3N9OA 1LENA 4NIGA 1KGYA 1QXRA 1YQ5A 3FUOA 4IE6A 4O7XA 4COZA 1AYN1 4NHLA 2X29A 4MV2A 4XAAA 1HXS1 4B4QA 4YYOA 1IS3A 3GBFA 4LKFA 3ZYHA 1K5MB 2WNVC 1LR5A 2ET7A 4LBLA 1MQTB 4BA6A 4DNYA 4UFHA 5LASA 2R32A 2OQ7A 4G4FA 1WBFA 1SMVA 2FDFA 3OYWA 4RFRB 2RS12 1VBB3 3PMSA 1FMD3 4HT1T 4K8RB 4EN7B 1PO22 3W58A 2CGPA 4QKBA 2JDUA 1SG3A 3JQXA 4Q4W2 5IAVA 1G9BA 2XPJA 4S2FA 1WD4A 1QJEA 3KV6A 3WDTA 3T4HB 2Z4FA 2D6MA 5FK8A 1O5LA 4JV4A 5FZOA 5FZ0A 2BRTA 4Q2FA 4PQQA 4DS0A 2W39A 5LB6A 2XH6A 1GNHA 2WBKA 2Q1FA 3ILFA 3E1F1 3VKNA 4BQ4A 1Y4WA 4QKNA 4UFJA 5T50A 3WY6A 1EAH3 2JDNA 1S55A 4AVSA 1ZRDA 4LUMA 5A6XA 1QOTA 4UW4A 5T3NA 3O1MA 1NY72 1ZZCA 4WM7B 2UURA 4AI9A 2C0ZA 1YWKA 1F4HA 2YFZA 4ORFA 4OCTA 1HIXA 1NZIA 3RNSA 4BZ4A 4CDQB 3VD9A 5CG8A 2E53A 5FXWA 4GD4A 2BWAA 5C33A 4RR3B 2BW8A 4QXKA 3HQRA 2ZZQA 1QU0A 3AZZA 3GZUC 3ZSLA 3LA2A 1CN1A 2Y6JA 4LBQA 4A41A 4IE5A 1JOPA 4AVTA 4BQ5A 4N53A 2YZ4A 4BMBA 4DMIA 5BNPA 1RVF1 1GYKA 3DKQA 5DG2A 5J3UA 4IETA 1XE8A 1RGSA 3JZVA 3SXWA 4EN6B 2NP0A 1RUH3 5FXVA 3WSOA 2VZSA 4GH4C 4CU6A 1K45A 2W95A 3I2JA 1U5ZA 3R05A 4FPFA 3RYPA 2D97A 2P17A 4XDOA 3U75A 1W9WA 5K8SA 3WF0A 2DVGA 3CNAA 3DN7A 4IE0A 4BQ1A 3Q8EA 4GA9A 4Z1VA 3ZKYA 3U4XA 3VBUC 4LNVA 3B7MA 5DDJ2 4Y22A 3ABZA 3CIHA 5JLVA 1VBC3 1W2UA 5FPBA 1CAUB 1GU3A 1VBD1 2GMMA 3AZYA 3Q8AA 4GQ7A 4N53C 1IPJA 4QU1A 1OMIA 1D4M2 4FQ4A 4AEKA 5BNPC 4QPIC 4IGQA 4QXBA 1NCQA 1IKQA 3WT3A 4N7IA 4CDWB 3B00A 1KQRA 1SPPA 3FBMA 1WMDA 1UYPA 1ZBE3 5JXIA 2RMU1 3NQHA 4XUQA 3U10A 4K21A 2TBVA 3MW3A 1JUIA 3VHOA 1B09A 2ZOEB 4BH9A 5H9QA 3ZYJB 1DZTA 2WN2A 3R0RA 1CJDA 5J96B 4PBOA 3VZOA 4LBOA 3MIGA 5GZCA 3HNBM 4R9CA 1UOBA 1UU4A 2PHUA 4BHPA 1V9U1 1BXHA 4FPGA 3MICA 4CYDA 4YARA 4FAGA 3PNAA 5FAXA 4LHNA 2JG8B 2XR4A 4GALA 4LIUA 5FZ7A 3D8CA 2WKKA 5IWFA 5HV4A 1KFUL 1JTZX 1X36A 4YW5A 4A45A 1LB2A 1ZM1A 5FY7A 2XJQA 5A3MA 1W6PA 1LECA 1LRHA 1GOFA 1LU2A 5FBZA 2FDIA 2EAKA 1NCQC 1OFNA 2B42B 3H8OA 1AHSA 2VR4A 5CB7A 3S5AA 3P3PA 1V0AA 1DG6A 4URAA 5FZ6A 3GCXA 4IEZA 5CFDB 4Q27A 2ZMLA 5FY9A 3AJZA 5HXVA 3VBSA 4W50A 2BERA 1UYZA 3U37A 1V9U3 3NWKA 4H55A 1POV1 2HWD1 4XUOA 1HB2A 4P9XA 1JHJA 2WZPP 4S2DA 3ZMOA 1DGLA 1YI7A 2FCUA 4BQXA 3OUJA 2ZABA 4CUGA 2YC2A 3T0BA 3HAGA 2Q8EA 1LU1A 2OA2A 2YGMA 2WO1A 2XWBB 4FOWA 2RDQA 2VUAA 4L0PA 5CU1A 3THTA 3ZSEA 1OH3A 2F17A 4XBQA 1FX5A 1C57A 3F2ZA 3HD8B 2ATFA 3QH6A 3H8RA 3DF0A 3BN6A 5LK5A 4NWVA 2C24A 1ULFA 4NPLA 4IEYA 1N1YA 2YY1A 3K3OA 3CJIA 2EVXA 1PK6B 3KF3A 1YO8A 4YPJA 2FDJA 1GZWB 3VBSC 2Y6KA 1HJFA 1BBT2 4JQTA 2PHRA 1QJX1 3MIDA 4A4AA 1IPSA 4E4DX 5C5TA 5JIAA 1TVGA 5JPNB 1STMA 4DZGA 5EJZB 3I49A 2WRAA 4GMP1 1NT0A 1VP6A 3USUB 2RS53 4FPKA 1K3IA 4O65A 4DXTA 1KXGA 2B39A 1OLME 5FPUA 1ZZ9A 1HRV1 1CQ9A 2PQQA 2EXHA 2JENA 5GLWA 2RS13 3C7EA 3RZLA 1LEDA 2WWUA 1PZ8A 4EQVA 2GSYA 4FFGA 3CJIC 1QH6A 1YQ2A 2FQPA 3AJYA 3H50A 4R4ZA 5IJRA 4Q0QA 2ZEZA 2E7TA 3U4SA 4I09A 5DMYA 4LPLA 3PVEA 3THCA 3H8UA 2R1DA 4XILA 5HI0A 5FZIA 5I91A 2ADEA 4M00A 1C28A 5SV8A 1XXNA 5F3CA 1OURA 4UWDA 3H0OA 3L2YA 1WMXA 5F3IA 1LOFA 1C8M2 4FBFA 4XZPA 1ASJ2 3JXSA 3ETQA 2PA7A 3RPQA 1RUC3 1VBA1 2P5BA 3NNGA 1C4RA 2PMWB 2C9AA 1U5YA 1UN1A 1OSGA 4AHXA 4KU8A 2ETEA 5EIYB 3EHKA 5GJ6A 3DKWA 1ENRA 5F5QA 2PHTA 4L97A 2GNTA 2PTMA 4CTEA 4JZRA 2GH8A 2J1UA 3AM2A 1T6BX 3ES4A 2VJXA 1JYIA 4BQ2A 1MPXA 1W8WA 2PHWA 3VDDB 4HBNA 3I2GA 3WDUA 1W2NA 2CGOA 2V4AA 1Z78A 4U36A 3WNNA 4E9KA 3KS7A 3MBWA 4Z8BA 1SLLA 4MHRA 1H9PA 4PIYA 4N90A 1VBA3 2DBNA 2XMLA 1VRH2 1LOFC 2WLQA 1RUJ2 1OOPA 2B7YA 2XB6C 2DUOA 2HWC3 1GICA 2DYCA 4J6GA 2VU9A 2VNRA 5FPVA 1ND3A 4A44A 5FRAA 1CWPA 4M3CA 1AR91 4NVPA 2EIEA 4XACA 4PJYA 1LGNA 2JEMA 1YIPA 4KBBA 1ODMA 3H7YA 4RSUA 4XUTA 4Q0SA 2Z2SB 2RJKA 3TYJA 3IDCB 5A7SA 4U2AA 5FYYA 5DDJ3 4YVSC 3S30A 3ZXFA 3RSJA 2XQXA 1WW7A 4ASKA 5CG9A 1G9CA 1W6NA 1QNWA 4Y24A 4A7ZA 2Y26A 4DQAA 4Y4RA 5BNOA 4D3WA 1PVXA 2D5HA 1RL3A 3H3ZA 2QQKA 5CFCA 1DZQA 2XHNA 3LD8A 1D4M3 3N36A 5FZGA 5HCBA 2IXIA 1AR93 5CFCC 1BVVA 3S7IA 1AR72 1RUG2 2VOVA 1G9DA 2JJ6A 4P00B 1TEIA 2WZEA 1ND3C 2VQAA 4XF0A 4MO3M 1F35A 2Y33A 4Y3OA 4EE2A 4FPHA 1CVNA 1EV12 4F3JA 1FT9A 3I8TA 2B5HA 4GJZA 5K9YA 1HW5A 1UKGA 2W47A 2XXZA 4MOAA 1JW6A 1UXZA 2BBAA 3FLRA 4PIXA 1UZVA 5BNOC 5L9VA 1Z0HA 3ME2A 4XVHA 1QNYA 5FP9A 1XSRA 3GM8A 2B8MA 4LE3A 3H1WA 3RDIA 4EZHA 3E5QA 4PHZA 4KL1A 3W5NA 4CEWB 5A7QA 2DFBA 4HPKB 3T4VA 3SCHA 3GF6A 2QQJA 3ELNA 1JXNA 2P4EA 4AQSA 3OGVA 1HN1A 1NCRA 4R9AA 2VVEA 1QEXA 1US3A 4LBQD 1WLWA 1AL21 4Q26A 4V2VA 1DYPA 5FYMA 1EP0A 1UNBA 2VE1A 4BLJA 1UZWA 3V0BA 4DB5A 2WL1A 2IFWA 3MF6A 3OBRA 4QX2A 4AFBA 1PGL2 4HONA 5EZWA 5L9BA 4CDUB 5T52A 2DWRA 2WFF1 2ZGSA 4QHOA 4QXCA 4OI4A 3VN4A 3C7FA 3ZN4A 2EALA 2VOTA 3ZYIB 4KMQA 4CVUA 2RG4A 1QXPA 1W6QA 3GHNA 5IYYA 1O3QA 2WNEA 4LK6A 1UMZA 4UAPA 2XKOA 1NYWA 1NX9A 5EWSA 4AE2A 4KG0A 1ENXA 2A6XA 2ZGKA 1MS1A 3JQWA 1QOSA 1NCRC 5KHJA 2JIJA 1REDA 2Y8KA 1BBT3 4RQPB 4WM8B 4JQRA 2OXBA 4Q4V1 5AFEA 2JKBA 2QQNA 5FZBA 1WW5A 1N3PA 1WCUA 3S6PA 1FATA 3WHUA 5KHIA 2WFF3 3KCXA 1OVPA 2D3PA 2KM2A 2OPKA 1UL9A 4GH4B 2GZWA 3UJOA 2VH9A 4YG3A 4BPZA 4GB31 1FPN3 5DABA 2FMYA 3EJKA 3KT1A 4FPEA 3MPPG 1P8JA 1H4HA 3AB0A 1VE0A 1GOGA 3VBUB 4GKXA 1L7QA 1COV1 2G1MA 1SDDB 3DGTA 4NAOA 4UOJA 4IV3B 2DCTA 3Q8FA 4AVAA 5KHHA 2Y6HA 5HBAA 4LEJA 2V5YA 1W0PA 3I59B 2P2KA 3AC0A 4YLZA 3SNMA 3ATGA 4ATEA 1FOD1 1MZ5A 2ORXA 4LK7A 4XDQA 4ZONA 2UWBA 4RHV2 5D8AB 3BPSA 5ABJA 4QPIB 5DN2A 1SLTA 3LPGA 1ZVFA 1D7PM 4JGZB 5G05L 1W28A 1V6MA 1GWKA 1MR5A 2BOJA 4MGKE 5A7WB 5BYNA 3AKRA 3VBRA 3OUHA 1X33A 3SKJE 4NN0A 3J8F3 3MDPA 1C8M3 1NUKA 1GP6A 2A5ZA 4N43A 3ZYRA 4COUA 4RA0A 4R8HA 3OB8A 1ASJ3 4Q0UA 3C7HA 4BIOA 2MEV1 3SC7X 1DYOA 3VD4A 1DCSA 3FHIB 3C7OA 1R1A2 1AYM2 1MS8A 3LQCA 3KVAA 5GZGA 4HMZA 4Q8LA 5EJ3A 2LALA 1UPIA 4D7YA 1UU5A 2VM9A 3POIA 3J9SA 1W04A 3JBG2 3WQ0A 1AR61 4QXHA 1LOCA 1W03A 5FZLA 1X9PA 2Q8DA 1JN2P 5ABJC 3LOBA 5C9AB 2ENRA 2FD8A 2D6KA 1CZSA 2WABA 1SPPB 3WNPA 1QJU3 2YC0A 2K0GA 3OGJA 3OGGA 3A23A 2VCAA 1EUUA 5HCAA 4AAXA 3A0NA 4AFCA 3OPTA 3VBRC 5GLTA 4Q4X1 5DAPA 1CPNA 1KJLA 2LTNA 3ZOIA 5A70A 1VRH3 1X8MA 4YGBA 1XNBA 5IVBA 4UYBA 4N43C 5JR7B 2PHFA 4AFMA 4HG6B 4PQ9A 4R9DA 4OHWA 4AAPA 2JB8A 1RMU2 1PVC2 3LEMA 4R52A 1NA1A 4TLFA 4NIDA 1YFUA 1YEWA 1NLRA 4S2GA 1W9YA 2I74A 4XMAA 1AR63 2XBO2 5E6HA 5CISA 1VBE2 3O1RA 5A3PA 2PAMA 1UPSA 2TEPA 1W8TA 5FLJA 3VBFB 1NQJA 5FDBA 4IEOA 4RD7A 3HT2A 1W8FA 2OIIA 4Q4X3 3AVRA 4LO5B 3IIIA 3OY8B 2FDGA 5GZDA 3CEWA 1R64A 1N47A 1QJZA 1W6MA 3UETA 1GFF2 1RUG3 2ZEYA 5A3TA 2VZUA 4NIIA 2JKXA 3AK0A 4HVRA 4XJ9A 2PLV3 4YVWB 5FP3A 3ZM8A 1HJGA 2YB7A 3C3VA 3JD71 3Q8BA 3AKPA 3GYDA 2NN8A 5IUQA 3BCWA 1O6UA 3T0DA 4URTA 1WZXA 4K20A 5LA0A 4LJHA 2VVFA 1RHI1 4L9BA 2ZKLA 3OD4A 5A7OA 1MS9A 3VB9A 1YJLA 1HN0A 2PHLA 4XETA 4C90A 2ZX0A 3KQ4B 4HN0A 5GZEA 1WLTA 2B46X 2FMDA 1AYN2 2JG9A 2Y6LA 2W52A 3O12A 1PIV1 5FOJB 1TQ5A 5F39A 1LJ7A 2A3XA 4K3UA 4CU8A 4B1MA 4ZU5A 3MIFA 2JDZA 4QGMA 4X8PA 3PUAA 3HN1A 2VBBA 1H2MA 2ZBJA 2P3IA 2R041 4YM2A 1GZTA 3ECQA 4MXWB 4MX3A 4OMCA 4NUBA 4AYUA 4Y20A 2ZJCA 1RHI3 4KWKA 4RYDA 3R4UA 3JB8A 4ZZ8A 2ARCA 3J4UH 3NJYA 1ONAA 3P6BA 3WDVA 1BMV1 2BV4A 3VKFC 3FX3A 3GNEA 3RS6A 3VZKA 3IIAA 4PF1A 1J83A 3ZFEA 3VBOB 1FV3A 3HNMA 4IERA 2JG9C 3CDZB 4GAZA 1ZX5A 5ANNA 1K42A 4LIVA 3KSCA 2Z69A 3WG3A 3O1OA 2WO3A 2AUYA 1S0EA 1ZA7A 4HFSA 4OI2A 4J25A 2WZR1 4M4PA 1ZBA3 4Y4YA 5JSRA 4AR2A 4CDXC 2HLEA 3I2KA 3H1YA 4LUKA 1IGOA 2GNDA 1ACCA 1H8TC 3NKGA 4IEWA 1OQEA 3AMMA 3WP6A 1N3OA 5FY1A 3AKSA 1VB2A 2VZRA 1AJKA 1YQCA 5FP7A 1RUH2 4AGRA 5J37A 3WF4A 1LHOA 3E5UA 4LULA 4F7ZA 2CSGA 4A6OA 5J7MA 2DUQA 1W3XA 1AR81 3ZFEC 1GR3A 1OUSA 2R073 2WZR3 3B94A 4GWNA 5FOBB 4Q0VA 3AXDA 1QJY1 3LFMA 2VTFA 4X6QB 3V0AA 4F8AA 4UFKA 3I54A 4LOSA 3D0JA 3TEXA 1O4YA 5FQ0B 1UMHA 1VBC2 5FV3A 4AHWA 3ZSJA 2PQSA 3RI8A 3VHPA 2VUJA 4YVSB 4P5YA 4LA2A 1H30A 2GMEA 3VZMA 3WLUA 1E5RA 4YZ1A 3OTFA 1PM4A 3HJRA 5A3NA 4OZOA 2ZXQA 1S0BA 1AR83 2W1WA 3KT7A 1OA4A 3NKTA 2ZMKA 1ZBE2 2WYFA 4IE4A 3JCIA 4D94A 1Y9QA 4RHV3 5JOXA 4XQWA 1CX4A 2WQ8A 2LUWA 4MGQA 4CA9A 5CZKA 4IV1A 4IGPA 2WS91 3MUZ1 3DEMA 2YU2A 3QOPA 5K0UB 4ARYA 3AFGA 1W6OA 3AYEA 4IL7A 3UYJA 1PGSA 3X29B 3T2OA 1QF3A 2ZHLA 1OXCA 2ZHKA 3VBHC 2VBPA 2H6BA 1AVBA 2YUEA 2FZ2A 1HRI1 4Y1ZA 5T54A 3S0MA 1SACA 4PDWB 4W8JA 1GKBA 2RMU2 5KHGA 2B4KA 4KWJA 2RDNA 5DZEA 4AEMA 2R0FA 3JBG3 2Y6FA 4CCDA 4EN8B 3ZDSA 4UBGA 4QKFA 5FWJA 4IV1C 1F2NA 1UQXA 3TEZA 4G3YC 1V9U2 4XUNA 1CAVB 2H6CA 4QB6A 3WXPA 2NPIA 3CJXA 5C8CB 4ISQA 3EQEA 4L2NA 3RJRA 5M0TA 2WINB 3LA7A 1PVC3 3ZFFA 4EWAA 1RUOA 3B5LB 5KXCA 3HVDA 4XAEA 4CRQA 2JDYA 3POWA 1IG0A 4AVBA 1VAKA 2XBO3 2YHJA 3DECA 5BNQA 3TWIA 1VMJA 4K1YA 3WF2A 1VBE3 4LHKA 1GUIA 3M1HA 3QBQA 4NHMA 2I2SA 1G9AA 1I1EA 4QPGA 1H4GA 5H9PA 2HWD2 4AI3A 1PHMA 3WCRA 5A1LA 2Q8OA 4YW3A 4AFDA 1WCDJ 2UY8A 5A33A 3V56A 4P08A 4AI8A 4XMIA 1Q8PA 2KR2A 4YZ4A 1C1LA 1DDLA 3LAGA 3GZAA 1N1VA 4LLFA 5FY4A 4C8DA 4MZUA 4O9GA 4E8CA 2RS52 3NJXA 3HWJA 5FZCA 3ZFFC 3I3QA 4A3XA 4FTBA 1G6NA 2WNUC 4I0WB 5F6KA 1IOAA 5E88A 5FK7A 2DTWA 1LCLA 1EPZA 2VZTA 3JB4C 3PVBB 2VMDA 2BU9A 2CL2A 1HQWA 2VZ1A 1ULOA 4WVMA 1QJX2 2RS31 4QPGC 1AYN3 3T2PA 1NE6A 3NMBA 4YFWA 4DINB 1HXS3 2IVJA 1URXA 3KLSA 5E89A 4N7UA 4S2HA 5B4XA 5LWBA 4TLGA 1PMIA 1VRBA 3A22A 2QQWA 3BVCA 1EYBA 2WT1A 2YG0A 1YQ8A 2IXKA 3OOXA 4P5HA 4E4SA 5JXGA 2XDVA 4ZXEA 1HRV2 4B7KA 4H2AA 2BBVA 3POEA 4XCBA 5FO8B 1GQGA 5EPAA 1Q43A 2ZCWA 1R091 1BHGA 3AL6A 4E2GA 2EICA 2WA4A 3N7KA 4BU2A 5EYXA 2XGXA 4LO6B 2NLRA 4FOVA 4FPLA 2RS33 4WZFA 1RUC2 5IATA 2GAUA 4BYYA 3UJQA 2FDHA 3C8XA 1O8SA 2K2SA 3O14A 5C4WA 5FY8A 4OVEA 1S0IA 4CU9A 5CVRA 3C7GA 2Y6GA 3RZMA 1A78A 1I5PA 1O5UA 3LIGA 5DAXA 3KHCA 2R0HA 3OBAA 3W21A 1JYVA 4ET7A 3K77A 3LA3A 2AC1A 3POFA 5BNNA 2V5DA 2W91A 2WR9A 2ARBA 5J1XA 4BK5A 2VZOA 3CBNA 3D3AA 2XQRA 3IDEA 1W8ZA 3NO8A 5T5OA 3LDKA 1W39A 3ITQA 1VBA2 3N7MA 3WVJA 3OGSA 1PX3A 4JTOA 2MHFA 1R081 2HWC2 3JU9A 2YFUA 4JX0A 4AZZA 1PO11 1CZTA 2D6PA 3P3NA 4I2OA 3PDQA 3CU7A 1V6LA 2QTWB 4MGIE 4PLNA 4QGLA 1ND2A 3PU8A 4YW6A 3OGRA 5C4WC 3FHAA 3AKQA 4Z2WA 3TOJA 4OULA 4UFIA 3G6JB 2E7AA 3ZN6B 5BNNC 2AACA 1RVF3 1WMEA 1VMHA 4UF0B 3ZO0B 4CXXA 5E16A 1QWRA 1U0AA 1F4AA 1XNCA 2QZ3A 2WWJA 3AMHA 1RXFA 2FZ1A 5JMCA 5KC6A 1F15A 5FZDA 5JUVA 4ZU7A 1AR92 4UW3A 2JD9A 1J3QA 4BQYA 1AJOA 5IK4A 1JZ7A 3UV9A 3BOWA 4ZPIA 2R6QA 3AP6A 5A7PA 4PLOA 5FJHA 1KDMA 3RWNA 5KR7A 5A32B 1IHMA 5KHKA 1XOYA 2FCVA 4L11A 5D1IA 2VMHA 4P9WA 2JIGA 3FL7A 3OF1A 4AWDA 4E2SA 3BU0A 4JGYB 1YUDA 3AP4A 1VBD3 3OEAA 2GN3A 3PJYA 2BNMA 4EN0A 1W8UA 3CO2A 2QCSB 5CNAA 1FI2A 2IVIB 2JDHA 3OD0A 1OT5A 4QDSA 3WP5A 5L7OB 1XSQA 1DQ0A 1YLLA 2FHRA 3BIWE 2E9QA 4A3ZA 1J1LA 4AQ6A 2RMU3 4LMFA 3WNXA 3E6BA 2D5FA 3WNMA 4CP9A 5ISLA 4XHXA 3KWVA 3FN9A 5FBJA 3J7LA 2DU0A 3JUUA 5FPXA 3LKJA 1IS4A 4QQPA 3M3IA 2AEZA 1WD3A 2WYSA 4P9YA 5I8SA 1QDOA 1HB4A 1CAXB 4Q5OA 2V73A 3THDA 3ZVXA 2BUKA 2JD4A 2WSUA 3IN9A 2O14A 1OPOA 3WF1A 2CGNA 3J7HA 4A6SA 2C9KA 4W65A 3UK9A 1ALYA 4RGGA 1GQHA 1XC6A 2CNAA 2VOKA 3NNJA 1OPMA 5I0SA 4AFAA 1JOJA 2BDRA 4XURA 5FYTA 2E26A 2MPFA 1S2EA 3MIHA 1AL22 4AF9A 4YM0A 2RE9A 3A7QA 5LATA 1POV3 4CDXB 2HWD3 1S0FA 2VMIA 5JDBA 3LE0A 2O8OA 5FZ9A 1H8TB 5FTTC 1QGLA 1YNAA 2Q4SA 2XWJB 3OPWA 4Y20B 4NIHA 4R9BA 2P1BA 5FZFA 1CJPA 3E5XA 1SBFA 3VDBA 2BOIA 3LSEA 2CV6A 2GNMA 3Q9OA 5CKMA 2J7MA 2WFF2 4XFCA 1ENQA 2JDMA 2XVGA 3PUHA 2BVVA 1L7LA 2BNOA 4CCKA 5A3UA 1IQAA 2YBKA 1REEA 2XLFA 4KU7A 1FPN2 5FPZA 1B35B 1KS5A 2Y60A 1RYYA 3ES1A 5F32A 4Z2AA 2HWB1 2QBXA 4DY5A 1IG3A 1ULGA 1LULA 1CONA 1QJX3 1IS5A 2ZGMA 2BVBA 3MEPA 3E6CC 2WAOA 2DV9A 4UBHA 2NYYA 1HB1A 1ZREA 1CZVA 4HZFA 5J98B 1AXZA 4GMP3 5F5CA 3SCGA 1ODNA 2ORZA 2VY0A 3D0SA 4LHLA 3RMYA 4AL9A 1UY0A 1CAWA 1RUE1 2HKXA 4GB32 4YM1A 5LA9A 3RFRA 3T08A 3VDCA 1DGWX 1HRV3 4K7JA 1RUF1 1KEXA 1TME1 3KMHA 1COV2 3J8F2 1UKRA 5I8TA 2HWB3 1W3VA 2P37A 3NVCA 3W59A 5C70A 1MS3A 2DBIA 2E31A 4JKLA 3POGA 2H0BA 4Y1YA 3O1UA 4PLMA 1MEC1 1DF0A 3K4DA 3VBHB 5CAZA 4XJWA 4YW7A 2F4LA 1I6XA 2VPVA 3D6EA 4QX3A 4QQ2A 1MZ6A 1RUE3 3WW4A 3EBRA 3A0KA 2X5IA 3ZFGB 1H2NA 5KC5A 1J58A 1GMMA 4B4RA 1OKQA 3DXUA 3DYOA 1NXD1 1RUF3 5C5UA 1QJU2 1XNKA 4EV0A 5L19A 3WNKA 4L8QA 3POBA 1X9TA 4FQZA 4ONUA 4XYXA 4COYA 1CX1A 1W06A 4CE8A 4CEYB 3VKMA 2NM1A 4RS5B 2MEV2 1DYKA 3FFZA 5I0DA 2VXRA 3VZNA 1ZRFA 3WP3A 4OFGA 5I8YA 4XFBA 3N7LA 2RVAA 2KA3A 2YPJA 2JE8A 1BKZA 4YSFA 4FFIA 1AR62 1W8OA 2EF6A 4XPVA 4RGKA 4LBNA 3VD3A 1WW6A 2SBAA 5FR3A 4HOOA 1FNYA 4AI0A 2X5IC 1ZZ8A 1UZZA 4TTGA 4NR1A 5DUXA 4MGYE 2IXJA 1HV0A 3N3HA 1UF2C 4Q4X2 2ZGPA
chains in the Genus database with same CATH topology
2B45X 1JH5A 2GN7A 1YXWA 3IPVB 4XFFA 4MVTA 4XJZA 1LHVA 4CP2A 3H9AA 1MZFA 5AC91 2BGCA 2NQYA 3LWCA 1OOPC 1MS0A 3PLQA 1GSLA 2PLV2 2VW0A 2ZX3A 3LGRA 1Z7S1 4Q1PA 3MIEA 4FCAA 2WNVB 2Y0OA 4CP0A 1RJ8A 1V00A 2OW4A 1HV1A 3MPBA 3ZFFB 4YNIA 3RYRA 3RZZA 5LEJA 2WNUB 3FLPA 3ZX7A 2XUMA 1IZ3A 1Y7BA 4YFZA 2AZ5A 5EYYA 3MW4A 1RUD1 3VL9A 5H9RA 4OUMA 4QQOA 5JZGA 2VNGA 3LB9A 1E57A 2ZGNA 1F5JA 4ES8A 4DRVA 2GC0A 2UWCA 3RJ2X 1RHI2 4NHKA 2ZS6B 4P9IA 1NG0A 2JXAA 2YDEA 4I01A 1O3SA 4SLIA 5LEKA 2NMNA 3DPRA 2A70A 1IPKA 3LSDA 1PIV2 1BCXA 2QFEA 1AX2A 3FZ3A 1RINA 3B01A 5CA6A 1LTEA 1RUD3 2A3YA 2RM21 1LOGA 4PF5A 2AH2A 3OYWB 2ET1A 4FPCA 4ZKTB 1RJ7A 1BJQA 1DQ1A 4CP1A 1ZBA2 3NV2A 1TE1B 1N1TA 5AFBA 1D2SA 1SBDA 1SCRA 4FXGB 3USSA 3MZHA 4XFAA 1LKNA 3MYXA 1AL23 5T5JA 4E2QA 2CWMA 3U11A 5DUVA 1K5MA 1XQNA 5T5LA 1S0DA 3DPRC 1MQTA 4QU2A 3ACLA 1WCKA 1U5IA 4YZ2A 4XXAA 1PGW1 2Q1MA 2F4PA 3PVNA 4QX5A 2R072 2WZR2 4IQPA 2HWE1 4LA3A 4EWEA 2AREA 2SLIA 5JAXA 2E51A 2HWF1 2VMGA 4EWDA 1ZA4A 2QKDA 4WVWA 4K8FA 4C91A 1V6IA 1WBLA 3FMGA 4AEJA 5DG1A 3WINE 2QDRA 4X8NA 4FTSA 1Q8SA 4MUVA 1NLSA 4H7LA 4Q4V3 3NV1A 2ZACA 4KGQA 1K5MC 4LBQB 1AR82 3AYAA 4N53B 1MQTC 2R49A 1CIWA 5BNPB 1SFNA 4GIQA 4MH0E 4JTNA 2EXJA 2HWE3 1QJY2 1G9FA 4WM7A 5JSPA 4KH9A 4GB33 1OQ1A 4CDQA 3IBMA 4HK9A 1O4ZA 2JECA 4WZCA 2P34A 1COV3 4LO7A 4RR3A 3ALQA 4FSJA 1TMF1 2ZAHA 3OJBA 3SH3A 4Y22B 1FOD3 1YFXA 1DQ2A 3O5SA 2EXIA 4K9SA 4B7EA 4YZ5A 3AP7A 5JOWA 1X82A 4XFGA 3OBTA 3SITA 4R4XA 4WM7C 1NCQB 1C1FA 1TNFA 4AHZA 4CDQC 1Q56A 1NXMA 1HRI2 1ZZ7A 2MEV3 2UU8A 4WVVA 1QH7A 3WDXA 3ZIXA 3PTYA 1XU1A 4MYEA 1J1TA 2ZHMA 1RUI1 5CBLA 4XF9A 2PHDA 4AI1A 1DGWA 4D7TA 3EXUA 4G9SB 1GNZA 2GNBA 4CDWA 1W6PB 3WZ1A 5JWPA 1F9KA 1C3HA 1H8VA 1SBEA 4PIZA 4K1ZA 2BFUS 1UIJA 2ZKNA 3GZTB 1RIRA 3VBSB 3OCPA 2G4IA 5BPXA 2Z5WA 1NA1C 5F6LB 2JG8A 4AXOA 1Q8OA 2E63A 1ULDA 1EV11 3BU7A 4LLOA 3H3UA 2YROA 3BODA 1QHDA 3IT8A 4CDWC 4HSJA 1HXS2 4XF4A 3ILRA 1ZNPA 5CFDA 4YGCA 2IC1A 2W08A 1GZ9A 1S0GA 4F83A 2OUHA 3CJIB 3D82A 5FLIA 4OLLA 1YYNA 4LT5A 4IEPA 1Q8QA 3JD73 3LCPA 4JDMA 2DFCA 1PNFA 1GBGA 2ZHNA 4JRLA 1BEV1 3EO6A 5CIRA 4C0HA 5BY5A 2DUPA 1PNGA 1ZRRA 2JG8C 3U07A 2RS32 3ZFGA 2F6BA 1PIV3 3AZXA 3QCWA 4FVVA 4DXZA 3R4DB 1J3PA 2IXCA 4Q29A 4Q4Y1 4YGEA 1PK6A 4P9GA 1GZWA 4HSLA 2R043 2EAAA 4O9EA 3MW2A 1U12A 3ASIA 2ZGOA 3RRDA 5L73A 3VKOA 1YCIA 2ZMNA 4BMEA 1V6NA 4UW5A 4XIOA 1M06G 2QUOA 4RL7A 1OD5A 3USUA 4ATFA 1AF9A 3MFCA 1OHFA 3ZFGC 2QNKA 4HN1A 3AKTA 4XW3A 5EV7A 2BFUL 3AMNA 3ENRA 4AI2A 3WUDA 4MLOA 1WW4A 1LGBA 3WUCA 4YG0A 1PK6C 3MLLA 3UL2A 1ENSA 2IFRA 1RVF2 1I5ZA 3THPA 3D4KA 3WQ1A 2RR11 2D3SA 1R082 1GV9A 3KT4A 4DOUA 3ZXDA 1WLDA 3SH4A 3TN91 4FOQA 2XJPA 4DPNA 1R1ZA 1CR7A 4HVQA 4N9IA 1RITA 2A6VA 1YI9A 5DZGA 5BUVA 5CFCB 1QJY3 2JE7A 1OOPB 4NPRA 1J3RA 4E4ZA 5AVAA 1Q8VA 1ND3B 3WD5A 3WOGA 3KGLA 4M3CB 3BALA 4AVCA 5GLVA 1VBD2 3A4UA 1XRUA 4XBNA 3W9AA 1BVP1 4OHYA 3VDDA 4FPYA 2R061 5GKAC 4OI0A 1N3QA 1UCXA 1I9RA 3PJQA 3E6DA 4HKLA 5ACA1 1QQP1 1R1A1 2HEYF 1W6NB 5BNOB 1PZ9A 4XEZA 4XBLA 1MACA 1WLCA 3B9CA 2WS93 4EJRA 2ERFA 3NL1A 4OHXA 3V65A 2E6VA 2ZGUA 1WCSA 1LOAA 2ZGRA 4BWOA 2HJIA 4ZU4A 5C8WA 2VVDA 3T2TA 3TAYA 4L92A 3K48A 3PVOA 3QACA 4AGGA 3RQ0A 4COVA 1HRI3 3ZXGA 3TRSB 4Z07A 2HEVF 2UY9A 4YW2A 5ACA3 1QQP3 3VDDC 4TSVA 1C5HA 1DQ6A 5LRSA 4XTPA 1YHFA 4XE9A 4FP3A 2WQZC 4BOWA 2WIIB 3ZMNA 4M0HA 4BLIA 4M3CE 3GBWA 5JOYA 1ZZ6A 4FT8A 2DCZA 3VL8A 3HT1A 2KXLA 3QLQA 2XJTA 2IXHA 3MIBA 1XYOA 2I07B 1Q5OA 4BE3A 4DY3A 4RFT0 2DCKA 4QM9A 4JC1A 1RUNA 1YJKA 3MFAA 2OZJA 1NCRB 4V1PA 3VV1A 1JUHA 5JPMB 1BZWA 3BB6A 1JBCA 2G9FA 2QVSB 5IT6A 2XLGA 3V0BB 1DIWA 5GM0A 3URFA 1YFWA 4CZSA 2A6ZA 2CAUA 5LRRA 1VBB1 1FMD1 5JSOA 4H7MA 5LK7B 5DUUA 1F8VA 4CEWA 2QJVA 1D0HA 2HYKA 4C1WA 1X7NA 1MVQA 4HPKA 1W6QB 3NV3A 1O4TA 1NE4A 1SFYA 1U5XA 2BPA2 1SLBA 1VJ2A 2DVDA 1J59A 1A8DA 2CY6A 4KNCA 4B4PA 2ZZJA 4FO9A 5GLZA 3FUQA 5H9SA 2OZ6A 5EFUA 5DXDA 1EAH1 3AMPA 4HKOA 2HWB2 1RB8G 4CDUA 4XQDA 4FTEA 1FV2A 2QZ2A 4AW7A 1D2QA 4CEWC 1EY2A 1DFQA 1ZRCA 2V09A 1RTVA 2DCYA 1RUE2 1QY4A 5GALA 1IKPA 3M3QA 3M7AA 3VUOA 1GANA 2IWGB 1YRZA 1RUF2 4RQPA 4WM8A 3ZIWA 1TME2 4HKWA 3I7DA 3FC0A 1R093 1V6JA 5B2GB 4LO4B 5ABJB 3SMHA 5J09A 3FBYA 4DRRA 1H1MA 1OI6A 3KCCA 3AX4A 4GH4A 3ZXLA 1MEC2 5J36A 5HCFA 4B3NA 4CDUC 1RUH1 4M3CF 2R1BA 1KFXL 3VBRB 3ZXJA 4I3PA 1O7FA 4N43B 3SCFA 3VBUA 4OI1A 4IV3A 4Y1UA 2XL9A 3MF9A 3M70A 3WV6A 3GBGA 3R4SA 4TWTA 3I59A 4ISRA 4WM8C 4RQPC 5D8AA 3KD4A 1G86A 1VBC1 4QPIA 1MS4A 1R083 2ES3A 3WX5A 2D6LX 1ZZBA 1APNA 1KJRA 4JGZA 4JRAA 1PO13 3VZLA 3TBDA 2JE9A 3RMXA 4HK8A 4N9HA 1AXYA 2AGSA 1BYHA 3MI8A 4QQHA 1ZBE1 1G7YA 1WUVA 2BNNA 4LBKA 3V64A 1ND2C 1UIKA 1QDCA 4IV3C 4XQ4A 1NA1B 4NO4A 1REFA 3AP5A 5KXBA 4UW6A 3T1MA 5FO7B 3VHNA 3WW3A 4MGZE 5D8AC 2GC2A 3H7JA 4K40A 5AC92 3FJSA 5C9AA 3KZ4C 1H1AA 2A73B 4JGZC 4B29A 1UZYA 1X50A 4Q1RA 3KGZA 1Z7S2 4TZDA 1KRIA 1HDKA 2QE3A 4QPYA 1WMFA 2R30A 2ZGTA 3J26N 3GHMA 3AYCA 3UKNA 5E1RA 1AZDA 5FMOS 1W6MB 2PFWA 1FXZA 2UWAA 3CF6E 4OHZA 3TNPB 4IESA 2CYFA 5J48A 2ZGQA 1AL0G 1RUD2 2WT2A 5KXEA 4QD2A 1DGRA 4Y1VA 4XJ8A 2PAKA 1YFYA 4OUSA 1FYUA 4LR4A 3VBFA 5C9AC 2DCJA 2JG9B 3LOIA 4YG6A 4IEXA 3OY8A 4XHBA 2A7AA 3ZXAC 2Z79A 5AVPA 2DVAA 1XYNA 3MLJA 3O0VA 3IM0A 4XFHA 2XHKA 4YVWA 2RM22 3AMQA 3WHTA 3B69A 2XG3A 4YZ3A 2CTVA 4IEVA 2WFPA 2D43A 1VB4A 1H1IA 1QXJA 2MNGA 5GLUA 3ZFGB 5HI0A 3WDWA 4XFIA 4XJUA 4H3WA 4WVZA 2RS51 3VBFC 3ZFEB 1OA3A 4AG4A 4LBJA 1BQPA 3M3CA 2ZA9A 4AVVA 2WWSA 2YGLA 4KWLA 1H2LA 2RS11 2Q0AA 2GC3A 3BPZA 1PO21 2XJRA 4Q4V2 3KB5A 4M01A 2Q1ZB 2TNFA 4MXWA 4Q4W1 1A3KA 1PGW2 4YVWC 4H14A 2ZAAA 3S7EA 4AQTA 2HWE2 2HWF2 2WT0A 3RYKA 3WP4A 2O8QA 3B9IA 2A3WA 3SH5A 3VBOA 1M4WA 2A75A 4ZXKA 5BV6A 2Y38A 2C1FA 2BEOA 2EA7A 1CESA 3TB0A 1PO23 5FMOL 4J1WA 1S2BA 3ZSKA 4HETA 1NY71 4Q4W3 3V0AB 1RUC1 1FOD2 1LHUA 3AFKA 4AEDA 1UW8A 3M3EA 2IXLA 5I0RA 4HL0A 4GXLA 1HQLA 3FLTA 1SEFA 4A7YA 3NAPA 5E8AA 5T55A 1TME3 3FFQA 3HBZA 2UYAA 3VKLA 3VBOC 1HX6A 1TMF2 4IV1B 5JCTA 4COWA 1MEC3 2HWC1 1W0OA 1W6OB 5FQ0A 3POSA 1UU6A 3ZSMA 5I0TA 1V70A 2NMOA 2R16A 4AEDC 3INAA 4HVOA 4YVSA 2ILMA 4WBBA 3NAPC 5DDJ1 4QGNA 2ZX1A 1KDKA 4EN9B 2D93A 2YXSA 4QM8A 3WW2A 1D4M1 3ZPYA 2I45A 4B8EA 5K0UA 1H0BA 1V6KA 2FBEA 2XLAA 4QMAA 2WJSA 1RUI2 4OZXA 3VGIA 4W6WA 1VR3A 3KCYA 1FNZA 4META 2WA3A 4JDOA 5I0UA 3O0XA 1IS6A 2Z42A 1WGPA 4PDWA 1XU2A 1PM7A 3WG2A 3HMYA 2VECA 4YM3A 2AYHA 2BYVE 4C0BA 3SLIA 5AC93 2PYTA 5CADA 4QPGB 4PCRA 1WA4A 1XNDA 3FE5A 3JD72 3ST7A 3FWEA 4INDA 1CAVA 1Z7S3 1MZEA 5A33B 5K0UC 4BIFA 1ULEA 1NZCA 1F5FA 5DZFA 4D69A 1DQ5A 3RI9A 2O1QA 5C8CA 4NOTA 1VALA 2EIGA 2GMPA 2VOWA 3BOPA 3N35A 3HQXA 3RG0A 1MS5A 4PDWC 5FREA 3L9JT 2ZX4A 3NSTA 2DU1A 2OUJA 1RC6A 2JX9A 1UAIA 5BXXA 2VGDA 2R042 4WVMB 1BEV2 1SLAA 3PHMA 5JZGC 2BTVC 4AK3A 4IXLA 2A71A 3NV4A 4YRDA 1I3HA 1BMV2 4YW4A 4W6XA 3WCSA 5C8CC 3DL3A 4P9LA 3I4IA 4P14A 3WQ7A 3QH7A 1VAMA 5IK8A 2RM23 3POYA 2DF7A 1SDWA 1BBT1 1TNRA 3ROUA 4Q4Y2 3BTAA 4Y5Z0 2WC2A 1S2KA 2W0XA 4Q8KA 1UX6A 2XL7A 3VZJA 5C4WB 1FPN1 2DURA 4A7KA 1KD7A 3NJZA 4XOGA 1SCSA 2BWCA 3B3QE 4JCKA 5BNNB 3IDBB 4UXAA 2W68A 3G7DA 1LOBA 4GKYA 2D3RA 1CD3G 2ZGLA 2HWF3 4LBMA 2PAEA 2GC1A 1LHWA 1JHNA 4E27A 4XF3A 1NOVA 2N7GA 2TUNA 1ND2B 2RR12 1DQ4A 4Y26A 3ZXEA 1ULCA 3SHRA 3J8F1 1AUYA 1C8M1 4TYSA 1DBNA 3TN92 1PZ7A 1SLCA 1DU3D 1DGRN 1ASJ1 2D98A 1NQDA 2Q30A 3N7JA 5F5QA 3C2UA 1G8WA 3ZXKA 2OVUA 2A6YA 1CPMA 2DTYA 5JI7A 2XJVA 2WS92 1QOOA 2JICA 2XKPA 4P9JA 3AXEA 4WV8A 1O3TA 4AHYA 3WW1A 1QJU1 4FOYA 3HR9A 4RR3C 2R062 1TMF3 1VRH1 1RUJ1 5ACA2 1QQP2 1GLHA 5I93A 3M8LA 3ZN6A 2BQPA 1CAUA 1O91A 2WLPA 4GULA 3D5OA 2OYZA 1DZRA 2XJUA 3UKVA 2VNOA 3WR0A 2DVFA 4XXPA 2GDFA 1SQ4A 5L36A 3DUIA 3PMEA 4LE4A 3VHRA 4DFSA 5A32A 1RUJ3 3GALA 4JGYA 1LGCA 1AR71 1RUG1 3IWZA 2YMZA 2E7QA 3I2DA 4MXVA 1RUI3 2PLV1 1LEMA 5JI9A 2D6OX 1OQDA 2AR6A 5L7OA 4W6YA 1VIWB 4FPOB 1L3JA 2H0VA 5F1RA 2YYOA 1UD1A 3LZZA 2ARXA 1XYPA 4I0AA 1AR73 4FP2A 1HKDA 3QD6A 3WG4A 3AZVA 2VW2A 1CAXA 3KM5A 1Y3TA 1HQNA 4JGYC 4PBPA 1AXKA 2DVBA 1POV0 1LHNA 4J1XA 4LTAA 3AYDA 1EV13 1VBB2 2PHXA 1FMD2 3B93A 2Y0IA 3O7OA 5FFOC 5TSWA 1SLIA 3M2MA 4XJAA 4KGGA 2ZX2A 5A3LA 1GZCA 5L7OC 2HEWF 1H9WA 4SBVA 3HIFA 3MGUA 1Y43B 5EXOA 2IZWA 1Q3EA 3B02A 1DHKB 2RJLA 4CDXA 5GZFA 4GWMA 5CFDC 4BCUA 1PGL1 2GH2A 3APBA 1D0GA 4QT6A 1H8TA 1BEV3 1ZBA1 4YW1A 4C1XA 5FO9B 1EAH2 2PELA 1R092 3R6SA 2D6NA 2CAVA 1LOEA 1F31A 4AGVA 1CAWB 2QDNA 4HLTA 1D4VB 4GMP0 1B35A 3WDYA 2Q5TA 4Q4Y3 3T1LA 4ASLA 1JYCA 3NW4A 1A8MA 1H2KA 4FAHA 3VLBB 3ZN5A 1CGPA 2R071 4L99A 4LO8A 4I3GA 1A6CA 3KQRA 4AEDB 1XE7A 2LM3A 3IMNA 4JAAA 3WG1A 5IK5A 2X5IB 5KBFA 3NAPB 1S0JA 1X8EA 3IKWA 1PO12 4I0BA 4ASMB 3K51A 4EROA 2P3KA 2K9ZA 2QQPA 2B9UA 3OPZA 1B35C 4JVAA 4RHV1 2XJSA 4MSVA 1LESA 2ZTNA 2D7FA 4FXKB 3ILNA 4IEUA 1KITA 1T6GC 3VBHA 1EPWA 1V6OA 3M3OA 2RR13 2VW1A 4Z92B 3M4FA 4JDNA 4K6BA 2UYBA 1OA2A 2D44A 1FAYA 1S0CA 1YIFA 2PN5A 3TN93 2G9GA 5JVVA 2WQ4A 3L2HA 5K7PA 2VOXA 2XVKA 1MVEA 2AENA 4Q0PA 1N1SA 1S1AA 1AYM1 3AZWA 2VQ0A 1ZYBA 2XVLA 4Z82A 4D7SA 4ES9A 4OHVA 4KQ7A 4CEYA 5SV5A 3N4MA 2ZPXA 4RS5A 2VG9A 5IK7A 1VLNA 3JBG1 3ZYPA 3TNQA 4RGAA 4X6RB 5DUWA 3SISA 4AQ2A 2VULA 1OLRA 1C5IA 4XF1A 5FLHA 1DLLA 4HANA 4QQLA 4XIKA 3CL1A 3ZYGA 2R063 3E97A 4XTMA 3AP9A 4NWWA 2WSVA 4I30A 2C5DA 4IEQA 5F9TA 1R1A3 1AYM3 5JIUA 1RMU1 1PVC1 2RHPA 5FCCA 4Y1XA 4QHBA 4YGDA 1OLQA 2X53S 5C6CA 2YV8A 4KG8A 3UKTA 3IPVA 2XBO1 1KS4A 4I02A 2CWSA 1HLCA 1VBE1 4CEYC 4RS5C 5JZGB 2GU9A 2X8KA 3DV8A 1C8NA 5JOZA 2GALA 4A2UA 1OFSA 5T5PA 2P3JA 1AX0A 2WNVA 3MLKA 3DPRB 2NZ9A 1RMU3 4FPJA 1O3RA 2A6WA 4M0NA 2WNUA 3CLPA 5KXDA 1AX1A 2EXKA 3H1MA 2D40A 1QKQA 4ITCA 3O0WA 1LODA 1BK1A 2O0OA 3U0ZA 1QMJA 4BM8A 5KWRA 1VAVA 1LENA 1QXRA 3FUOA 4COZA 1AYN1 4NHLA 2X29A 4MV2A 1HXS1 4B4QA 4YYOA 1IS3A 3GBFA 1K5MB 2WNVC 1LR5A 2ET7A 4LBLA 1MQTB 4BA6A 4DNYA 2R32A 4G4FA 1WBFA 1SMVA 3OYWA 2RS12 1VBB3 3PMSA 1FMD3 4HT1T 4EN7B 1PO22 3W58A 2CGPA 3JQXA 4Q4W2 1G9BA 2XPJA 4S2FA 1WD4A 3WDTA 2D6MA 1O5LA 4JV4A 4Q2FA 4DS0A 2W39A 2XH6A 1GNHA 3ILFA 3VKNA 5T50A 3WY6A 1EAH3 1S55A 4AVSA 1ZRDA 4LUMA 1QOTA 4UW4A 5T3NA 1NY72 1ZZCA 4WM7B 2UURA 2C0ZA 1YWKA 4ORFA 3RNSA 1HIXA 4BZ4A 4CDQB 5CG8A 2E53A 2BWAA 5C33A 4RR3B 2BW8A 4QXKA 2ZZQA 1QU0A 3AZZA 3GZUC 3ZSLA 3LA2A 1CN1A 4LBQA 4AVTA 4N53A 2YZ4A 4BMBA 4DMIA 5BNPA 1RVF1 1GYKA 5DG2A 5J3UA 4IETA 1XE8A 1RGSA 3JZVA 3SXWA 4EN6B 2NP0A 1RUH3 4GH4C 1U5ZA 3R05A 4FPFA 3RYPA 2D97A 2P17A 5K8SA 2DVGA 3CNAA 3DN7A 4BQ1A 4GA9A 4Z1VA 3U4XA 3VBUC 4LNVA 3B7MA 5DDJ2 4Y22A 5JLVA 1VBC3 1W2UA 1CAUB 1VBD1 2GMMA 3AZYA 4GQ7A 4N53C