1NA1B

The structure of hrv14 when complexed with pleconaril
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
molecule tags Virus
molecule keywords Coat protein VP1
total genus 51
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1na1B00
3NAPC 2WZR2 5C4WA 3VBRC 4EJRA 4CDQA 5JZGA 1AL21 1ND3B 1POV0 1QJX1 1EAH3 1VBB2 4LLFA 1AUYA 5BNPB 2HWC1 3VDDA 2RMU1 1K5MA 4SBVA 4JGZC 5J96B 4N43A 1RUC2 2RMU3 1CD3G 1A6CA 1PIV3 1BMV2 2FZ1A 4IV1C 2HWE2 4PDWC 2HWD2 4QPGC 1AL23 3DPRA 5C4WB 4WM8B 4QPGA 1Z7S3 1RUD1 4FTEA 1MEC3 1RVF2 4RHV2 3JBG1 1ASJ1 1VBD3 1AR92 5AC92 5BNOA 1FMD3 1PVC2 1AYM1 1F8VA 2WZR1 3VDDB 2QQPA 1AYM2 3JB4C 2R073 2WS91 1M06G 1RVF1 2RR11 4N53A 1RUD2 5BNNC 5L7OA 5JZGC 1RUJ1 4CDQC 2HWE1 3VBUC 1VBB3 1ZBE1 2FZ2A 1EV12 3DPRC 4CEYC 1AR82 1VRH1 4JGYC 4CEWC 4RQPA 1RUH1 1HRI2 1AR91 1ZBA3 3DPRB 3JBG2 5ACA1 2WFF1 2RMU2 3ZFEB 1NOVA 1PO21 1QJZA 1TME2 1FMD1 2WWSA 1FPN2 1ND3A 1OPOA 4Y5Z0 1PO11 1AL22 5A33A 3VBFB 5K0UB 1VBE3 2BFUL 3VBSA 1MEC2 1R091 4Q4V2 5D8AC 1AYN1 4RS5C 1COV3 4AEDB 3JD72 4N43B 1RUF1 1AR93 4CEWA 1D4M3 1PVC3 1V9U2 2TBVA 4Q4W3 4Q4Y1 2R043 4Q4X2 4WM8C 1QJX2 5ABJA 1RUH3 2BUKA 1RMU1 4RR3B 1VBC2 1VBA1 1BEV1 1VBE1 1ND2A 1R1A3 4AEDC 5K0UA 1K5MB 1PGL2 1E57A 1HX6A 1RUF3 2RM23 1AR83 5FOJB 1QJU2 2HWB1 1HRI3 1ZBA2 1AR71 4Q4Y3 3VBFA 3ZFGC 4BCUA 5A33B 1R093 4N53B 5DDJ3 4GH4B 5L7OB 4GMP3 4YVSB 1TMF1 4WM8A 1ASJ3 1VBD1 1FPN3 1BEV3 4GH4A 2R041 1AL0G 1R082 2BBVA 1MQTB 1B35B 3J8F2 5C8CA 3ZXAC 4CDWC 1COV2 5J98B 1OOPC 2DF7A 5A32B 1NY72 1V9U3 1AYN3 2HWE3 2HWD3 1RUG1 4GMP1 1QJX3 4Q4X3 2HWC3 1VBC3 1RVF3 1RUG2 1VBD2 1PIV1 1RUE3 5AC93 1B35C 1RHI3 1VBC1 1MQTA 3M8LA 3FBMA 4QPIA 2HWB2 3ZFEA 1QJU1 4Q4Y2 3VBUB 5CFDA 3ZFFA 5L7OC 4CDXA 5DDJ2 1R081 1QQP1 5BNOB 1BEV2 1HXS3 3VBOB 3VBOC 1NY71 1HRV3 1NA1B 3VBOA 3VDDC 1FPN1 2HWF3 5C9AA 4RR3C 4GMP0 4CDXC 2ZTNA 1ZBE3 3NAPB 3JD71 1PO13 1QJY2 4CEWB 5C8CC 1AYN2 4IV1A 5C9AC 2RS11 1VBE2 1VBA2 4IV1B 5BNNA 1FOD3 4N43C 4CDUA 2RS31 1RB8G 1RUG3 1ZBA1 4JGZA 4Q4X1 1QQP3 1D4M2 1NA1C 2R063 4Q4W2 5BNOC 2RR12 3VBFC 5ACA2 2R061 1C8M3 2WS92 1RUH2 3ZFFC 5CFDC 3ZFEC 2RS52 1EV11 1R1A2 4CDWA 4PDWA 2MEV3 1MQTC 1RUJ2 1B35A 1H8TB 1HXS2 1V9U1 1H8TA 2WFF2 4YVSC 2HWD1 3VBHC 4GH4C 4CDQB 4Q4V1 1R092 2HWF2 5FMOS 3ZFFB 1X36A 5CFDB 2PLV1 3JB8A 1RUI2 1ZBE2 1ASJ2 1PO12 1RUE1 1R083 3VBRA 1PO22 1TME1 1FOD2 4CDWB 4YVWB 3J8F3 1HRI1 5C9AB 4GB33 1NCQB 1PVC1 4YVSA 2HWF1 1RUC1 5FMOL 5AC91 1SMVA 2RR13 4PDWB 1HQNA 1RHI1 2Y26A 4WM7B 5ACA3 4RHV1 4CDXB 1C8M2 2R071 2WS93 2HWC2 1VB2A 5CFCB 2RS53 3VBUA 1VBB1 2IZWA 2XPJA 2RS32 1RUE2 4RS5A 1R1A1 4JGZB 1RHI2 1RUJ3 5K0UC 1BMV1 1NCRB 2RS51 2PLV2 2HWB3 2WFF3 1ND3C 1NA1A 3CJIB 1FOD1 5CFCC 1RUI3 3TN93 1AR63 1OHFA 1HRV2 1RUI1 1Z7S1 4QPIB 4CEYA 5D8AA 4NWVA 1POV1 4Z92B 2RS12 1NCQC 1EAH1 5D8AB 4RR3A 1NCRA 2X5IA 5BNPA 1HXS1 1D4M1 1F2NA 1QJY3 2XBO2 3LOBA 1WCDJ 1VBA3 4GB31 3IDEA 2WZR3 4CDUC 4FSJA 4JGYA 1QQP2 2R062 2RM21 2X5IC 3VBHB 1GFF2 4QPGB 3NAPA 5ABJB 4Q4W1 1NCQA 1BBT2 1X33A 4N53C 1RUC3 3ZFGB 3S6PA 5CFCA 3J8F1 1PIV2 2MEV2 1W39A 1VB4A 1QJY1 5A32A 3TN92 1AR62 1K5MC 1CJDA 1NCRC 1PGW1 1TMF2 3VBRB 1NG0A 1VAKA 4YVWA 5C4WC 1AYM3 1AR72 4FTBA 4QPIC 4RQPB 2ZZQA 1PGW2 2XBO3 1VRH3 1PO23 1RMU3 4WM7A 5DDJ1 1PGL1 4RS5B 2WLPA 3TN91 5GKAC 2VQ0A 3CJIC 3ZFGA 4GB32 1EV13 2BFUS 5BNPC 1IHMA 1BBT1 1COV1 3JBG3 1OOPA 4IV3B 1BBT3 1ND2C 4IV3A 1TME3 2GSYA 2RS33 3CJIA 4JGYB 1EAH2 1MEC1 5LK7B 4CEYB 2MEV1 1C8NA 4NWWA 5ABJC 2PLV3 4WM7C 2GH8A 3HAGA 3VBHA 4Y4YA 1H8TC 2X5IB 5JZGB 1ND2B 4Q4V3 5BNNB 1TMF3 1POV3 3JD73 4IV3C 4YVWC 4CDUB 1DDLA 1AR61 3VBSC 2R042 1AR73 3VBSB 2ZAHA 4AEDA 1AR81 1VRH2 1Z7S2 1HRV1 2RS13 1RMU2 2BPA2 4FTSA 4RHV3 2XBO1 1OOPB 1FMD2 1C8M1 2R072 4RQPC 1RUF2 2RM22 1QJU3 4RFT0 5C8CB 1RUD3
chains in the Genus database with same CATH superfamily
5A7PA 2ZAAA 2WZR2 1ALYA 2ZGUA 4M3CB 1MS0A 2WNEA 2QZ3A 1MS4A 4EJRA 5JZGA 2YXSA 3I2JA 3OGRA 2PHRA 3OEBA 3ZIWA 1F9KA 1VBB2 1JODA 2R1DA 3USUA 5BNPB 4IDZA 1HN1A 3BTYA 5KXCA 2VOXA 3N36A 3VDDA 2RJKA 2RMU1 2VECA 3D8CA 3WF4A 2JDHA 4JGZC 1SPPB 5J96B 2XLGA 3SMHA 1HV1A 5FCCA 1H9PA 2WYSA 2PHUA 3C7FA 4K40A 2WO3A 1CD3G 4MYEA 2W3JA 4LUKA 4XFAA 1SFNA 4U2AA 4NRQA 4BXFA 2BW8A 1QXRA 3MV01 4PDWC 2HWD2 4QPGC 4RL7A 1LHOA 2EALA 4QPGA 5FZLA 3WW3A 1K5JA 3SNMA 1AXZA 4S2HA 1DZRA 1WW4A 3H8UA 3UL2A 4BWOA 4ZZ5A 3ACHA 2Y6LA 3UKNA 1ASJ1 1VBD3 1OLME 4XXPA 3RYKA 3AP7A 2WNUB 3B3QE 1AYM1 2WZR1 1TE1B 3I3DA 2K0GA 1XYNA 2QQPA 4MGQA 3GM8A 4BU2A 2R073 1OF4A 2WS91 5CU1A 3W20A 2VBDA 2AENA 3N9QA 3VZOA 2B4KA 1M06G 1RVF1 3S5QA 3ZX7A 5JCTA 2NN8A 4LHSA 4N7UA 4P9IA 3WNOA 1JZ8A 5L7OA 1PZ7A 4LEJA 1ZZ9A 1VMFA 3HWJA 2WR9A 3ASIA 3LGRA 1VBB3 1KXGA 3GYDA 1KDMA 3E5UA 5FIXA 4CEYC 4Z1VA 4YW1A 4HANA 4GJZA 4XMIA 1XPWA 4COYA 2QE3A 3HNMA 2VULA 1ZA4A 2XWBB 3KMHA 4BOWA 4G3YC 2RVAA 2BERA 3MLKA 2CSGA 4X6RB 1DQ4A 3B9CA 3ZSKA 1PO21 1QJZA 5E16A 3KT4A 1RUNA 4MHUA 3MUZ1 2HBTA 2C1FA 5FMDA 1JZ4A 1OPOA 2W0XA 5CKNA 1PO11 5A33A 1F5JA 2WIIB 4OVEA 3VBFB 1O3RA 4MZUA 2UYBA 3FZ3A 5C3OA 1DQ5A 2Y8KA 4KGQA 3MLLA 3VBSA 4CUBA 4FPGA 4M3CF 2XR4A 4DQAA 5DUXA 5D8AC 4Q4V2 4QGMA 3VHPA 3WSOA 4AEDB 3AX4A 4DS0A 2JE9A 3H1WA 4CEWA 2TBVA 1OH3A 4GA9A 1W6NB 5EHDA 4PJYA 2R043 1Q8VA 2VZRA 4XPVA 2P6HA 1MR5A 2YB7A 4LULA 2CYFA 1OFNA 5FPBA 5CKMA 3R6SA 5J1XA 2BUKA 3FUOA 1Y3TA 4OI2A 3S5AA 1NLQA 4QMAA 1X8MA 1VBC2 4B4QA 2Y64A 4COZA 4V2WA 1ND2A 2PHLA 5HBAA 3NKGA 3CHXA 3POSA 5K0UA 1K5MB 3AJYA 3CJXA 3HN3A 3W59A 3APBA 5FR3A 3R4UA 4MGKE 1RUF3 2A6XA 2BVBA 1QJU2 3N9NA 5FZMA 1EP0A 1ZBA2 1OPMA 1LU2A 4QGNA 2JJ6A 4IGPA 4FOWA 4BCUA 2EF6A 4OI0A 4Q0PA 4OHXA 1V6OA 5HCBA 2D6KA 2VQAA 4D8MA 3PVNA 3H9AA 4GH4B 3OGGA 1Q56A 3ECQA 4NIIA 3FMGA 1ASJ3 1VBD1 3Q8FA 1BEV3 2ZGOA 2Q4SA 4JZRA 3WUCA 1FX5A 2NPIA 2BDRA 2BBVA 1MVEA 3KHCA 1B35B 4IGQA 2BP6A 5FZEA 5K8SA 2W9XA 3ITQA 2WQ4A 1SG3A 1WKYA 1O4YA 1O8PA 4CDWC 4LK6A 1YFXA 5J98B 5DUVA 2WO7A 1PZ9A 3ILFA 3GXUA 3NJZA 4HETA 3UKTA 3WLUA 1NY72 2ZXQA 4M00A 4W6WA 3VZJA 1W8OA 3I3QA 2HWE3 4CCJA 5BPXA 1EUUA 1FYUA 2B42B 3EQEA 3PIGA 1NE6A 1SBDA 1U5YA 3OYWB 4J1XA 1EYBA 3I2DA 3M70A 3F95A 1H0BA 3JQWA 4AWDA 2WABA 2VOWA 5A3NA 1D7PM 4KQ7A 1B35C 3HT2A 1JUIA 1S0FA 2FBEA 1MQTA 4GXLA 4BH9A 4MV2A 3J4UH 4LE4A 5F37A 1NKGA 4Z82A 5FYMA 4BQ5A 5A3LA 5KHJA 5IJRA 3ZFEA 4BK5A 4OCTA 2W5FA 1W8HA 2VMFA 4LKFA 4LO7A 3HPNA 3KV6A 2ERFA 2RE9A 3RZZA 3T1MA 3B5LB 2QQLA 5KHGA 1WCSA 4NRPA 5HCHA 3VZKA 5JR2A 1NQDA 4LIUA 5F3GA 5BNOB 4C1XA 1HXS3 1VMJA 1UY3A 2KA3A 4OUMA 2CWSA 3VZMA 2MPFA 4H7MA 1NA1B 4BMBA 3HQUA 1GWKA 5IK8A 1UMHA 2XJTA 4J6GA 1RIRA 5C9AA 4BQ2A 3NAPB 1XNKA 1PO13 2A6YA 4BPZA 2XQXA 4CEWB 3KVAA 5C8CC 3CKHA 1LOCA 4CP9A 4RFRB 3FHIB 5C9AC 2QQWA 1VBE2 5EYXA 1HQLA 2XVKA 1VBA2 4XYXA 5J3UA 1FOD3 2HLEA 3LZZA 4Q0SA 3WQ7A 2GN3A 2JDNA 1LULA 3IAPA 4HL0A 4JGZA 1S4CA 2CDOA 3TB0A 1CGPA 1QQP3 2NMOA 3ZYHA 3M2MA 4IQPA 4Q4W2 3UGHA 2GC3A 5JSPA 2DBNA 2IVIB 3VBFC 2B8MA 2R061 4XBQA 4XVHA 1TEIA 2YBKA 4P9YA 2WS92 3SEEA 2J1VA 1RXFA 1ZZCA 3AXEA 2WWJA 3ZFFC 2E7TA 2XONA 5FPVA 4XUPA 5CIRA 3ZFEC 1WMDA 2VUAA 2JE8A 5CAZA 4JQTA 2EVXA 2B46X 3FE5A 5KR7A 1QNWA 2ZHMA 5F2WA 1VPHA 4CDWA 4FVVA 3O0XA 4Y1ZA 5FV3A 1MQTC 3OPTA 4NHKA 1H8TB 1HXS2 2E26A 3J7HA 4QU2A 1AVBA 1SHWB 5EWSA 3DYMA 4SLIA 4YVSC 4A3ZA 2VZUA 4CDQB 3PURA 3ZXGA 3ZIXA 5CB7A 1OKQA 3KM5A 4Q4V1 4HFSA 2RV9A 5FMOS 4XCBA 1X36A 5CFDB 1WA6X 4LBNA 2ID4A 3Q8EA 4ATEA 3ZLIA 4ARXA 4FPOB 3GZEA 5A1AA 3LA2A 1V6MA 1ZBE2 3LA3A 5FZFA 4YM0A 1OVSA 2DV9A 5HCFA 3E6DA 1UIJA 2K46A 2VQUA 3BU7A 2ZX3A 3U37A 1UCXA 3M3IA 1LU1A 1RITA 1O5LA 1FOD2 1UOGA 1UYYA 1FNYA 1LNSA 2WA3A 2OKXA 4MUVA 4BJ0A 4YVWB 3J8F3 4LKDA 3RZJA 1QDOA 3VUOA 3H8XA 5C9AB 1N3OA 3PMEA 5J37A 1CAVB 2L9LA 4AE2A 4COVA 1UL9A 1PMIA 3AZWA 1V6KA 4XMAA 1VE0A 3B94A 3KF3A 3KGLA 3L2HA 5KHKA 1FNZA 2RG4A 2R071 2WS93 2P17A 1OQDA 1Y9GA 4A42A 3H3UA 3SCHA 3ZYBA 1H4HA 3VBUA 2XPJA 1YLLA 3IIAA 1UY4A 2A3XA 1UWWA 4FQ4A 1NCRB 3P1IA 3KQ4B 4JVAA 5LBBA 2X09A 5K0UC 4P9JA 4Y22A 1CPNA 5FY8A 3AYAA 4B1MA 4PQ9A 3WQ1A 4NJ4A 1JBCA 1ND3C 5CVRA 4JC1A 3RG0A 4XCAA 2DBIA 1D4VB 5F6KA 1PK6A 1SACA 5A3PA 3ZYRA 3SQOA 2W47A 3MO4A 1YQ8A 1RUI3 4PBPA 1GNZA 2PAMA 3KLSA 4NAMA 1KQRA 1LOEA 3TN93 2VZOA 3SCGA 5GZFA 1RUI1 3ACGA 4LUMA 3KV5A 2W2IA 4CEYA 5D8AA 4C91A 3FFQA 4Z92B 3T2OA 4YM3A 2D98A 4JKMA 4BMEA 2JWPA 4RR3A 3SH4A 3GZTB 3ZYFA 3KB5A 3OSDA 2KD7A 4IE7A 3BU0A 5BNPA 3FUQA 3LDBA 3BIWE 2ZX0A 1W2NA 1F2NA 4JTOA 2BGPA 4GIQA 1T6BX 1XSRA 3TNQA 4V2VA 4R9AA 1YRZA 2XUEA 4FFFA 1LOGA 1N1VA 2BNNA 1UOJA 2VXJA 4AQTA 3IDEA 3LDRA 1TZOA 3FHAA 3BALA 3V65A 1YCIA 4Z07A 3O1TA 4OMCA 5JXHA 4L9BA 3USSA 1K42A 3AYEA 2R062 4K3UA 1KS4A 2GNBA 2V5YA 3VD5A 2PTMA 5I0SA 4NIHA 4AOCA 2EA7A 1HDKA 3HD8B 3H42B 4WVMB 5LY2A 3NNGA 3LEKA 3GJBA 2VNRA 5AFEA 4XZUG 1BBT2 4AFBA 3BTZA 3ZFGB 1B09A 4URAA 3TEZA 4XTPA 5FP7A 5CFCA 3EB7A 3LDKA 1UKGA 2E33A 2P3YA 3T2PA 3VDBA 4ES8A 3DN7A 5FBJA 4P9WA 3IDCB 5FZKA 1LGCA 5A32A 3TN92 5LW9A 3AVRA 3ZSLA 3B69A 3KWVA 1NLRA 3LFIA 4JKKA 3CZJA 4ASKA 2VZSA 4C90A 1NCRC 1PGW1 2W39A 2B9UA 3VKMA 2Z69A 3TNPB 4HONA 4W6XA 3VBRB 3RYRA 4LKEA 1Q8SA 4YZ3A 1UU4A 4AFCA 2VE1A 2JDYA 2A1XA 2EXIA 3C2UA 5FYZA 1F5FA 3TAYA 5C4WC 3T2TA 2UWCA 2WAOA 4XC9A 1ULPA 2GNDA 1LHVA 2D93A 1W8TA 3Q8CA 4TSVA 1PGW2 4XDPA 2ZKLA 5EFUA 1RYYA 3OF1A 5T5LA 1RMU3 2ADEA 2B5HA 2C24A 4WZFA 1K12A 5D21A 1GWMA 4XFBA 2P34A 3FFZA 3MF9A 2FHRA 5FLJA 2PQSA 5FZ7A 3TN91 3D3AA 4G4FA 2GAUA 4A7YA 4P9GA 3ACFA 1S0BA 2Q0AA 2RDSA 1H6XA 3ZFGA 1AX1A 4EQVA 5C33A 4MH0E 1Q8QA 1DLLA 1QWRA 1SFYA 4IXLA 1BBT1 5A3TA 3DCQA 1QH7A 2XGXA 3AKQA 4L92A 3LSDA 2OQ7A 1QNYA 4CUAA 1OOPA 5A7NA 3TYJA 3U4XA 5C3PA 5K4LA 1SLTA 2R49A 2VOKA 4IV3A 1IPSA 2CU5A 2QKDA 4DXZA 1CAWA 4I0WB 4NHMA 5JIUA 3B00A 3RRDA 1ENSA 3O1RA 1EAH2 3O1SA 3QD6A 5CZKA 4CEYB 2YGLA 4INDA 4L2NA 5LK7B 3UGGA 5FK7A 2PLV3 3UJOA 4AHXA 2LRPA 2PA7A 2W87A 4UBHA 3T0BA 3VBHA 4BZ4A 3VD4A 2C5DA 3BKZA 2X5IB 5FJHA 1PX3A 2D44A 4GQ7A 1UXZA 4HSLA 4QHZA 3QOPA 2UY8A 5DAWA 5EYYA 2ADDA 4IV3C 1W6MA 3SLIA 3CL1A 5FP3A 4YVWC 4CDUB 1YUDA 3DL3A 5FZOB 1WWYA 5KHIA 4YM1A 1DDLA 4XFIA 1DQ6A 4XZPA 2R042 4DZGA 1ZA7A 4EE2A 1NZIA 1ULGA 3WDXA 1DQ1A 3CLPA 4L0PA 4A45A 3USUB 2P5BA 5FYSA 3RDIA 1IPKA 2WO2A 1CAWB 1HRV1 2RS13 4FPYA 2LW8A 4HMZA 4YGEA 3J9SA 1C57A 1XXNA 3NSTA 4AAXA 1GICA 5LB6A 2XBO1 5FQ0A 3MEPA 1OOPB 1O3TA 1FMD2 5JI7A 1W03A 2VW0A 3OG2A 1AJKA 5L9BA 2Y60A 4E4SA 3R4DB 5AFBA 4CU9A 1RUF2 2RM22 3KZ4C 2FQPA 5HCAA 1QJU3 2J1EA 1FXZA 3IN9A 4RFT0 4YM2A 4DXRA 5C8CB 1IS4A 1RUD3 1QDCA 3ETQA 4CEWC 3NAPC 5DABA 2VZTA 2R0HA 2WLQA 5A3WA 5C4WA 3H7JA 4HPKB 1DGLA 1FT9A 3E97A 4Y1YA 3S30A 2GC0A 4IEYA 4BQ3A 2BOJA 2YBSA 2EAAA 3EMRA 4LLFA 5DZEA 5JUVA 3PTRB 2HWC1 4UW6A 3MIGA 4ZS2A 3W21A 3BIEA 1OUXA 1LGNA 3I59B 3N7KA 4NHLA 4XIKA 2DCTA 5T5OA 2AC1A 1RUC2 2Z4FA 1UNBA 2X10A 3LAGA 2XJVA 4KG0A 4CCDA 4JRAA 1ZZ7A 3VL9A 2VVEA 5BXXA 4LBQB 1PIV3 3ZXLA 4R9CA 1LOFA 1S0EA 4UFHA 1YJKA 2BBAA 2FZ1A 2JB4A 3GHNA 4N8MA 5HPOA 1AL23 4O9EA 5LA2A 3W5NA 4WM8B 4CCEA 1Z7S3 4ZU5A 1MEC3 4FTEA 2D97A 4QKDA 5L19A 1RVF2 2EIDA 2O1QA 3I3BA 4UYBA 5FZAA 4R4XA 1AR92 3EXUA 1LHUA 3N7MA 5AC92 1F8VA 1FMD3 2C4XA 1MS1A 2VCCA 1DF0A 1AYM2 1O4ZA 3QH7A 1IG0A 3JB4C 5FY5A 5C5UA 1H6YA 3MYXA 2W46A 1F4HA 2ZGQA 2ORXA 3ZPOA 2PAEA 1RUD2 1W3XA 3P3NA 4XBLA 3R05A 3PVOA 2QQOA 4EYUA 3OJBA 1HKDA 2JIJA 3OGJA 2ET1A 2YDEA 1C4RA 2OVUA 2QNKA 2Y6HA 3GHMA 5EQUA 5A6YA 1LB2A 3OOXA 1SLCA 3ON7A 2AEYA 1DG6A 2FDGA 5KBFA 5H9PA 2TNFA 4AI9A 3LD8A 1VRH1 4ZKTB 4AF9A 1RUH1 1X9PA 1HRI2 3AXDA 2YPDA 4NMIA 4U36A 3VKLA 4UAPA 1ZX5A 1DGRA 2V4AA 2WFF1 2ZABA 3KQRA 1NE4A 1QOTA 4PLMA 4EWEA 4AVAA 1KEXA 1FMD1 1O7FA 2WDBA 2QFEA 4D0QA 4EN7B 1ND3A 2FDHA 1MS5A 3WV6A 4I02A 4LBMA 4F8AA 3U0ZA 5FZOA 5F1RA 1VBE3 1CVNA 3AMNA 3PUHA 3LIGA 3T09A 3DYPA 4MGYE 5LCWL 1MEC2 1UOFA 1R091 2LS6A 4CCNA 4RS5C 3IT8A 1V70A 4LBKA 5E1RA 1JYNA 4D7SA 4XHXA 2ARXA 3LIHA 4NIDA 3AP9A 1MZFA 2WQ8A 2Y6JA 3UETA 1PVC3 1V9U2 1XBFA 2A71A 1H1MA 3PJYA 2ZEXA 2NP0A 2VOVA 2YU1A 3BVCA 3O14A 4WM8C 4D3WA 2DVGA 2FMYA 5ABJA 3H8RA 5A6XA 2D7FA 4AGVA 1AHSA 3FLPA 4XJZA 3WW2A 1JOJA 2RJLA 3TOJA 4RR3B 2XL9A 1JU3A 1VBA1 3KCCA 3LQCA 2X29A 1BEV1 1XYOA 3PLQA 1UIKA 4K21A 1WLCA 5EV7A 4CPBD 4QKFA 1R1A3 4HVOA 3PU3A 1VRBA 5C7GA 1QIQA 1YQ5A 5F32A 5IVFA 1IOAA 4HK8A 4IESA 1DYPA 3B7MA 4XDOA 4XQWA 2BJSA 1UOBA 2ZGNA 5AVAA 3QACA 4UW5A 5FZ8A 1XJAA 1HRI3 2G1MA 4CSWA 4K6BA 4GJYA 2CWMA 1LODA 4N53B 1UN1A 3HN1A 1EPWA 3BODA 1W9FA 4JHTA 4QDQA 4GMP3 4NVPA 5F9TA 3ZSJA 4XOGA 5LBCA 4YFZA 2XH6A 1AL0G 1XU2A 1AJOA 1VR3A 3KCXA 1XQNA 1MQTB 3I8TA 4LLOA 2G4IA 5JAXA 5TSWA 3ZYJB 2ZGPA 4LHNA 1MZ6A 2PXJA 2ZS6B 1YNAA 3J8F2 2BGOA 4LIVA 1COV2 4J25A 1OOPC 1H2KA 5A6ZA 4S2DA 3WDYA 4FPHA 1OF3A 2Z2SB 4I0AA 5L9RA 1V9U3 3T1LA 2WAAA 3WCSA 2CHHA 3K3NA 4UW3A 2R1BA 4AVVA 4CXWA 1WW6A 4Q4X3 5FZ3A 4AHYA 1JYTA 4BQYA 3SHRA 2BYVE 3TRSB 5JR7B 4AI1A 4A4AA 3VZNA 4NRMA 5FP4A 3P6BA 5C6CA 4M0NA 5AVPA 5FY0A 1WBLA 3HQRA 1GQHA 5DG1A 4FXGB 3VV1A 1J58A 5FZBA 1CIWA 5JXJA 2NZ9A 1S55A 4A7ZA 4BXSV 4CXYA 3WCRA 2IXJA 1ENQA 2ZBJA 4YWAA 1JW6A 3TEYA 2A7AA 4KMQA 4Q4Y2 4GD4A 5CFDA 2FDJA 5FUIA 2PELA 2QQMA 5DDJ2 4KG8A 4A2UA 2R6QA 2ZGSA 4YPJA 1IS3A 4I2OA 4Y5SA 3TEXA 4YW2A 4LORA 3ZN4A 5I8YA 1NAEA 4A3XA 1REEA 4QXBA 2VVDA 3C7OA 2AEZA 2W52A 3K48A 3U10A 1CR7A 3VBOA 1ZRFA 3J7NA 3VDDC 1FPN1 4MO3M 2XVGA 4XFFA 2NQYA 2HWF3 4WBBA 1W6OA 3POFA 1WW7A 1PM4A 3KF5A 2QCSB 2J1AA 4HZFA 3JD71 2QQUA 5JI9A 1IGOA 5IVVA 3NJVA 4AFMA 4DPNA 4EWAA 5L73A 4HT1T 1F4AA 4ZXEA 3K51A 4IETA 3AZVA 2QZ2A 5FY1A 1G7YA 5E89A 4N43C 3R4SA 1H2NA 1RUG3 4PIZA 5FBZA 1UW8A 3O7OA 2R063 1MZ5A 4CE8A 1TVGA 1UX6A 3C8XA 1REDA 2WNOA 2AUYA 4XF4A 1S0GA 3LCPA 3ZSMA 2VQTA 5A1LA 4YZ2A 1ZNPA 5JDBA 2O8OA 1CZTA 1LAJA 4E4DX 1DYKA 4D69A 1APNA 4XETA 2PFWA 1ONAA 3G7DA 1UZZA 4LJHA 3OYWA 2IXKA 1X7NA 3I97A 1NXD1 4PDWA 3JU9A 1SBEA 5EP9A 2EXHA 2RDNA 3HR9A 4W4ZA 1JZ6A 4DUVA 2A3WA 4NIGA 2P37A 1V9U1 3C7GA 1AZDA 2PMWB 1DQ2A 2XJRA 3WY6A 4NROA 2XL7A 5FPUA 3NMBA 4HPKA 4Q0QA 2ZHNA 1GP6A 3U1XA 1R092 3MICA 1XNDA 4ISRA 5F39A 3RJ2X 5GLZA 3URFA 4QHBA 2PLV1 1VP6A 1ZRCA 1E5SA 4PI0A 1A8DA 3RI8A 2VZ3A 5HXMA 1ASJ2 1DLCA 2A6ZA 3GGLA 2XLAA 3NQHA 1NUKA 1UU5A 3O1MA 1RUOA 1TNFA 4TXWA 2QQKA 1OLMA 1R083 5C8WA 3U11A 3GJAA 4D6SA 2QJVA 4XF3A 1TME1 3M3EA 2JG9C 2OT7A 4KWLA 1LRHA 2BRTA 2EXKA 2ZJCA 1O4TA 1OLRA 5K9YA 1CAUB 4C1WA 3KVBA 1JU4A 1HRI1 2VGDA 2Q8DA 3ILNA 1NCQB 3AP6A 4QX5A 5FMOL 4K1YA 4Q1PA 4MHRA 2NYYA 2P2KA 1HQNA 2WT2A 4WM7B 3N9LA 3RS6A 2J1SA 5ACA3 1J59A 3UK9A 1CX4A 1C8M2 1CIYA 3UKVA 4IEVA 1QXPA 4B4RA 1LGBA 4DB5A 3PTYA 1SCRA 1H1IA 1V0AA 2IWGB 2J42A 2WN3A 2LROA 4N7IA 3I3MA 2BWAA 2H0VA 4XE9A 5A3OA 2VVFA 4E4HA 2QQVA 1RUE2 1W05A 2C6SA 2JG8A 3AFKA 1R1A1 2ZEYA 4Y5TA 3VL8A 3E6CC 2WBKA 1RUJ3 4LTAA 3EHKA 3T2QA 4FBFA 2A70A 2B7YA 5FWEA 2PLV2 2BNMA 2R0FA 4KL1A 3LFMA 4UBGA 2JDPA 2HWB3 1NQJA 5FP8A 2UURA 1M4WA 1ST8A 1GOFA 3SKVA 1DBNA 4FT8A 4TYSA 3POJA 5C5TA 2HYXA 3FBYA 4P5HA 1QHDA 2CGOA 3WZ1A 4FP2A 1Y43B 1AR63 3DF0A 1OHFA 4AYUA 5FTTC 1S2BA 3WUDA 1CAVA 3KGZA 1NZCA 2VCBA 4GULA 4QX1A 3RVHA 5DXDA 4P9XA 1O3QA 5A7WA 2RS12 4AFAA 4KGGA 1SQ4A 3B02A 4BLIA 5BUVA 2B39A 3W58A 1EAH1 2GH2A 1ULDA 2WQZC 4ES9A 1O59A 5LEKA 3O1UA 3ENRA 4WZCA 5LASA 2BVVA 3H50A 1UMIA 1LHNA 4Q29A 4C8DA 3GZUC 3BPSA 3NVCA 1LJ7A 3AFGA 4QPWA 4MG2A 3FL7A 3N9MA 4B4PA 3LOBA 1SEFA 4UF0B 1WLDA 3H7YA 1IKQA 4AL9A 2WNUC 4MGZE 4A44A 5ISLA 2ZGLA 3WF3A 1QKQA 1AXKA 4CP2A 1WD3A 1EY2A 5J36A 4AHWA 4EN6B 4JGYA 5JXIA 5I8SA 4CRQA 5K7PA 1SCSA 1AF9A 2P6CA 5IVJA 5IVBA 1UY2A 2RM21 2X5IC 1LR5A 2YC0A 3AMMA 5GJ6A 1QJFA 5IK5A 3OTFA 4NN0A 1GFF2 3NAPA 2GC1A 3QLQA 3M7AA 2CNAA 5FWJA 1N1TA 3ME2A 4XAEA 4Q1RA 2XG3A 1HW5A 1LKNA 2HBUA 1ZZBA 4RGAA 4WVMA 4XFCA 5A70A 3BOPA 2JIGA 1X33A 4N53C 1MVQA 2RDRA 1RUC3 3ZO0B 2VH9A 4JTNA 3K46A 1L3JA 4HN0A 3FJSA 5FZ6A 3ES4A 5G05L 2CGPA 1UZWA 2MEV2 2JDAA 5FPXA 3MIBA 1YJLA 2WWUA 3T30A 1URXA 4EV0A 1DGWA 2ZOEB 4K20A 4IEXA 1Y9MA 3NNFA 1ZVFA 1DQ0A 2AGSA 4UT5A 2XQRA 1VAMA 1JZ5A 2EIGA 2YYOA 4PCRA 1G9DA 4ZY9A 2YMZA 4QPYA 1XSQA 1W2OA 4IEUA 3VD3A 1NX9A 4CCLA 1YI7A 5IT6A 3MZHA 2I74A 1AYM3 1AR72 5DZGA 4QPIC 4RQPB 5C70A 5SV8A 5I93A 4ZXKA 4B29A 2JD9A 4Y1VA 2QQNA 1NLSA 4XF9A 4WM7A 1PGL1 1S0CA 2JG8B 3ZSEA 4S2GA 2DFCA 5CADA 2J1RA 4H7LA 3FN9A 2J1TA 2O14A 3WNPA 1RC6A 4Y22B 1SDWA 3CJIC 1XE7A 1EV13 2BFUS 4QXKA 5BNPC 1UYZA 2VC9A 4PBOA 4NUBA 5C71A 5DMYA 4UW4A 4OFGA 1N1YA 1PGSA 4QX8A 5T55A 4CTEA 3UYJA 1H9WA 1DYOA 2ETEA 3BOWA 1GANA 5DAQA 1LECA 1O91A 3D4KA 2Z5WA 4DFSA 4I3PA 4K1ZA 4RGGA 1TME3 2GSYA 3Q8AA 4EN0A 4YW3A 3CJIA 4R4ZA 4XILA 2OYZA 2MEV1 4IE0A 4L11A 3ROUA 4WM7C 4W6YA 3HAGA 2B9VA 5A7OA 5JZGB 1J3RA 2ES3A 3AJZA 5BNNB 1GZ9A 5FYVA 1POV3 3RYPA 3LOIA 3WNKA 2JG9A 1GZTA 2Q1ZB 2PYTA 2QQJA 4XABA 1JMUB 4QQPA 4BHPA 2B45X 3WD5A 5GM0A 5GZCA 3WDWA 1N3QA 4FP3A 1ACCA 5FUNA 4AEDA 1OFSA 2JKBA 5HV0A 1D2QA 2D3SA 3AK0A 3CIHA 3P3PA 5JMOA 1SBFA 4HKOA 2BPA2 2XUMA 1JZ3A 3V56A 1UYXA 2WINB 1C1FA 1UY0A 2VAUA 3U14A 1UYPA 2P3KA 3OPWA 2Q1MA 3ABZA 4IUGA 4QGLA 4ZU4A 3CNAA 5LZ6A 5GZEA 2E31A 4LMFA 4J1WA 4HLTA 4OHVA 5LRSA 1AX0A 4CU8A 1XYPA 3M3OA 2YC2A 2R072 3BB6A 3AMPA 4Q2FA 3DYOA 2A75A 3MFCA 1H1AA 4YG3A 1WMXA 3Q9OA 3RFRA 1Q3EA 3IMNA 3VHOA 3WOGA 2OS2A 3BPZA 3T08A 1NT0A 1BCXA 1PX4A 5DAXA 2E7AA 5A7WB 1YFYA 4CDQA 4IEQA 2HEVF 1AL21 1GQGA 2XXZA 1ND3B 3SITA 3TBDA 1POV0 3D82A 4LITA 5A3UA 1ULCA 5FXWA 1AUYA 2I45A 1G9BA 1N3PA 3WW1A 1HB4A 4DIQA 4XTMA 1K5MA 2PHXA 3LPFA 3WINE 1YYNA 4EZ4A 2GP5A 3RNSA 1J84A 1DZQA 1PZ8A 4YW6A 1K3IA 2JDMA 4XW3A 2W68A 4N43A 2EXJA 4B1LA 1UPSA 1J1LA 4B7EA 1YQCA 1KGYA 2HYKA 2AR6A 2NM1A 3U4SA 1KRIA 1W0OA 4LNVA 2Q8OA 1A6CA 3ZN6A 3OPZA 4IV1C 5FLIA 1CZVA 3E5QA 3AKPA 2HJIA 3ZN6B 2W94A 5IK4A 4LO5B 1XB9A 2JICA 4AEKA 2XMLA 1WLTA 2GMEA 3FC0A 2F17A 1RUD1 2A6VA 1JYVA 4BK4A 3UNPA 3N4MA 4PI2A 1DIWA 2HEWF 4UFJA 1D0GA 1GBGA 4XEZA 3OUJA 3UGFA 3BTXA 4HK9A 4QDRA 4D6RA 5EIYB 3RSJA 5BNOA 5F5AA 3VDDB 1PK6C 2G19A 3HT1A 3V0AB 1Y4WA 4XXAA 5ERLA 2P3IA 5FYBA 1CWPA 1QY4A 3NV4A 2UWAA 4YRDA 2RR11 2Y0OA 2Y34A 3GCXA 2R30A 5M0TA 1P8JA 4NPLA 2A73B 1BYHA 4TZDA 5C3RA 5F3CA 2FCUA 1RUJ1 3THTA 4CDQC 2OQ6A 2HWE1 1ULFA 3VBUC 5L9VA 2YFUA 1XNCA 2FZ2A 3DEMA 3DPRC 4PHZA 1C3HA 4ET7A 1AR82 4LOSA 4MOAA 4UFKA 3ZN5A 5F5IA 4CCOA 3NJXA 3ELNA 4IE4A 1MS8A 1AR91 1C28A 1ZBA3 3AC0A 3DPRB 3JBG2 3GBWA 5ACA1 3VKFC 2ZGMA 4OQ8A 1SZBA 3POWA 3ZFEB 2HKXA 2WNVA 1DHKB 1YO8A 4M3CA 4QB2A 1OH4A 3KV4A 1CN1A 2WWSA 2VBPA 2VPVA 2D6LX 4W50A 2VW2A 3T3YA 1BVP1 3T0AA 2Q30A 1O8SA 2QTWB 1NXMA 4XJUA 3WP6A 5FP9A 2WSUA 1U5IA 4GZ9A 4HG6B 5FFOC 4DEVA 2E6VA 4E2SA 1JI6A 5IVYA 4XUOA 4QT6A 2UWBA 4AI3A 4UFLA 3FWEA 4M4RA 4KWJA 3JD72 4FQZA 1RUF1 4IGOA 4IL7A 2OIIA 2V4VA 3LPGA 3P5BA 3CF6E 4KH9A 1KJRA 1W6QB 5FY9A 2ZGKA 4D94A 4TTGA 1GOHA 4OUEA 1XE0A 4UXAA 1YWKA 1PNGA 1QJX2 1TG7A 1V6LA 2AH2A 2XJUA 4O65A 5C3QA 4YGCA 2DCJA 2QUOA 1OQ1A 1RMU1 1UAIA 2IFWA 1WMEA 1Q5OA 3WDTA 1W8FA 4RGKA 1W04A 1O6UA 5SV5A 3MPPG 4DY5A 3L2YA 5CG9A 1SDDB 5IK7A 3BN6A 1C5HA 2BNOA 2FCVA 4Q0VA 5FMBA 3PIJA 2ZMKA 4E27A 1H4GA 2Q1FA 5CNAA 1PGL2 2Y6FA 5F7UA 3LEIA 1E57A 1U5ZA 3DECA 4E8DA 2RM23 1AR83 4QKBA 4W65A 5FOJB 1WCUA 2F6BA 3A0NA 1ZZ6A 1AR71 3ZFGC 1WLWA 5FO8B 1R093 1UF2C 5A7QA 3ES1A 3BGAA 2O0OA 3AYCA 3WNXA 4LQRA 1QOOA 1UKRA 1S2EA 1W2TA 1GZWA 3MF6A 4GH4A 2R041 1PNFA 2EAKA 2VMDA 1R082 2DCKA 1CPMA 2VUDA 5KHHA 1D0HA 1POQA 1W8ZA 4I3GA 5F8PA 1JTZX 1ODMA 3V0BB 1IS5A 5B4NA 1LESA 4BQWA 3ZXAC 2XDVA 4XUQA 2IUWA 2E32A 2P4EA 4CCCA 3SH3A 2LM3A 1UD1A 2PHTA 3A21A 5FYHA 3ZMOA 5J48A 2OX0A 1AYN3 4PIYA 5F6LB 4BIOA 1DGRN 4P14A 1SLAA 1RUG1 4MXWA 1QJX3 1BZWA 3WQBA 4YW4A 3JUUA 2WNVC 1W6OB 4HBNA 1MPXA 4D7YA 1X9TA 5CG8A 1VBC3 1RVF3 1OSGA 4QX2A 1Y9QA 1GQPA 1GP5A 2ARAA 4YW5A 3VZLA 1GOGA 1PIV1 1RUE3 2ILMA 4IERA 5AC93 2VZVA 1VBC1 3MFAA 4Z8BA 4CUGA 5E8AA 3M8LA 2CL2A 2E63A 3FBMA 2QDNA 1W3VA 1DP0A 2P3JA 2HWB2 4LXLA 1KFUL 3ZKYA 2YROA 1QF3A 2YHJA 3AMQA 5JPMB 4XIOA 4CDXA 4FPKA 5FPAA 3ZYGA 4BQ1A 3VHNA 1IZ3A 1N47A 1QQP1 2W92A 2ORZA 3HJRA 4AEJA 3WVJA 2WNUA 3AZYA 1BEV2 2VCMA 1Q8PA 2IXIA 2JX9A 3VBOB 1NY71 4M4PA 3PVBB 4EROA 2D6MA 4Q5OA 2XLFA 5FYTA 1GSLA 2E51A 5FXXA 3SH5A 4ZS3A 2V09A 3WR0A 2ENRA 4WVWA 2OXBA 1HB2A 3BTAA 4LBJA 3AKTA 4AQ6A 5LBFA 3OBRA 1BLZA 4CDXC 1ZBE3 2OW4A 4PF1A 1XU1A 4B7KA 1GLHA 4QQHA 1CX1A 1QJY2 4XFGA 1AYN2 4IV1A 3HOBA 4TLFA 4XUNA 2BV4A 2RS11 2R16A 5BNNA 4FOVA 1PVXA 4E2GA 5FLHA 4CU7A 3PDQA 4CDUA 4ATFA 2V72A 1W9TA 1ZBA1 4Q4X1 1EPZA 3PUQA 5JPNB 4MADA 1D4M2 1ZM1A 3JXSA 4IEOA 2PHWA 3AKRA 2RR12 3ZKUA 1PHMA 4EN9B 1RUH2 2FCTA 3AP4A 5CFDC 1KITA 1WCKA 1YQ2A 2CGNA 3CQOA 3NWKA 3OBTA 1SPPA 1EV11 1OURA 5KXBA 3ZYPA 2WYFA 4FAGA 1R1A2 1R64A 3MIDA 5IHRA 5A3MA 2MEV3 4FO9A 3K77A 3IAQA 3PVEA 4AAPA 5D2AA 1W6QA 2KM2A 4HKWA 4DUXA 1QOSA 3LEMA 3ORJA 1CESA 4NR1A 1H8TA 1W9WA 2WFF2 5B2GB 2D3PA 2HWD1 3RWNA 4CP0A 4CXXA 1ZREA 4IEWA 4JCKA 2GNTA 2VZ1A 1T2XA 4I01A 2O8QA 1ZRRA 1K45A 3ZFFB 1L7RA 1X50A 1XNAA 1YEWA 2NLRA 2OUJA 2QBXA 2WSVA 2YPJA 1RUI2 3CMGA 3JB8A 1JYIA 3MLJA 2GZWA 1PO12 3FX3A 4QHOA 4XURA 1OVPA 4QM9A 3N7LA 2VU9A 2BGCA 4UFIA 4AGRA 4AI8A 1PO22 1HQWA 5FZ0A 2SLIA 2GDFA 2PN5A 5CYYA 2VR4A 1CAXB 2WL1A 2LTNA 3QH6A 2VW1A 2LUWA 4GWJA 1H2LA 3BYWA 4DUWA 3VD9A 4YSFA 3WP4A 2BU9A 4NHXA 1W0NA 3I2HA 4JAAA 2JEMA 3PUSA 4GB33 4B3NA 3D0SA 4R9DA 1PVC1 4YVSA 2HWF1 1RUC1 1BHGA 4IEZA 1SMVA 2RR13 3AMHA 4PDWB 2Y26A 1RHI1 5AC91 2ARBA 2ZKNA 4RHV1 3OB8A 4TLGA 4CDXB 5I91A 1DZTA 1KS5A 1OA2A 4YARA 3MW3A 2HWC2 1RTVA 3FLRA 3I2IA 5CFCB 1R1ZA 4RA0A 5BY5A 4A6SA 4BIFA 2RS32 2ZZJA 3WEZA 4BQXA 4JGZB 1RHI2 4UF0A 1BMV1 2H6CA 2RS51 5ANNA 5LWBA 1LCLA 4MGIE 2VM9A 2XKOA 2RHPA 4ONUA 2UYAA 2VMCA 2WFF3 2ZMLA 3RMXA 4OULA 4E8CA 3O1VA 4AW7A 3KT1A 4QKNA 2ZHLA 3HMYA 1FOD1 3N35A 2WC2A 3MPBA 3PUAA 4BM8A 2FDIA 3WDVA 5JWPA 1GR3A 1KD7A 5J09A 3MW4A 3WF0A 5CBLA 3S57A 3K4AA 5JLVA 3IDBB 2MNGA 3CZUA 1GNHA 5HV4A 1HRV2 5FXVA 1Z7S1 4LBQD 2ZGTA 4MXVA 1POV1 5H9SA 4CP9B 4IE6A 1NCQC 5LRRA 3W9AA 3MV11 3LKJA 2R32A 2WN2A 4FCAA 3ETPA 4ASMB 1XE8A 2WO1A 1UMZA 3ZXJA 3C7HA 1HXS1 3LE0A 2PHDA 4FPEA 1HJFA 1D4M1 4UWDA 2JG9B 2DU1A 4OI4A 2YUEA 5IW0A 5APAA 2BOIA 2XBO2 1WCDJ 4LA2A 2F4PA 2DTYA 4ZZ8A 1PMHX 3LSEA 3H3LA 1IPJA 5DUUA 1HV0A 2D43A 3AZXA 4GB31 4FFGA 2D5FA 3JQXA 1N1SA 2WZR3 5GLTA 3TWIA 3UJQA 3THCA 3ZR6A 3HQXA 4CYDA 5T3NA 4FSJA 4Y20A 4JHZA 5FZ1A 4QQLA 1CAXA 1W90A 2VTFA 2XVLA 4FXKB 4I0BA 3WP5A 3ZXDA 5CKQA 4CCMA 4AG4A 5F5CA 4XQDA 3VBHB 3HIFA 4DMIA 4Q4W1 3IDAA 1NCQA 4I09A 3O0VA 5FKCA 5HI0A 5FAXA 2YZ4A 2DTWA 4V1PA 2JKXA 1S0DA 1YIPA 3GALA 4YZ5A 1C5IA 3UT0A 2QVSB 3J8F1 4HVRA 2IXLA 4OHWA 4BA6A 3B9IA 1KJLA 1QJY1 4XJWA 1H2MA 4W8JA 3VKOA 1CJPA 1YQ6A 1K5MC 1LOBA 2D6OX 2XJQA 1OT5A 5G04L 5KXDA 3O0WA 2UU8A 3VD7A 4XACA 1OD3A 1FV3A 1I3HA 1W6PB 2VTXJ 1YI9A 5FQ0B 4AGGA 1TMF2 2VUCA 2W1UA 3HVDA 3DKWA 5E6HA 4KBZA 5H9QA 4ASLA 4PLOA 1G8WA 1GYKA 1NG0A 5BNQA 1A3KA 1VAKA 4YVWA 3JCIA 1Z78A 4N90A 5FMCA 2ZEZA 4FOYA 2VUJA 3RZMA 2DURA 3O12A 5KC6A 2OPKA 2X8KA 1GMMA 5FZ4A 2XBO3 3AKSA 3I4IA 1VRH3 3M3QA 5E88A 1YHFA 5FPZA 4BE3A 4JV4A 3N7JA 3MIHA 1W6MB 1OQEA 3NO8A 3NV3A 4YW7A 5JVVA 2WLPA 5GKAC 1G6NA 2VQ0A 3K75B 1JOBA 2DFBA 5FYCA 3WHTA 4Z2AA 3C3VA 2D6PA 2BQPA 4O9GA 2Q8EA 1V6JA 2XB6C 3L9JT 4YG0A 4F3JA 3MDPA 4JKLA 2XHKA 3JBG3 4IV3B 4K9SA 1GKBA 1U5XA 1BBT3 3AL6A 4P02B 4C0BA 1GZCA 1ND2C 3OY8B 1GNYA 2D3RA 3KD4A 1UXXX 1MS9A 4HN1A 4B8EA 2FDFA 4L8QA 4PIXA 2AZ5A 4OZXA 5GLVA 1X82A 1MEC1 1XNBA 2Q5TA 5EXOA 1U0AA 2MHFA 4NWWA 2YU2A 4CVUA 3QCWA 4BISA 4AI0A 1WGPA 5ABJC 1TNRA 4K7JA 2GH8A 3WQ0A 1OUSA 2W91A 4Y4YA 1H8TC 3K3OA 4DOUA 5FZDA 1ND2B 4G9SB 4Q4V3 1TMF3 3ACIA 2V5DA 2VXRA 2WUHA 4X8PA 3JD73 3A0KA 1PMJX 5DPNA 3THPA 4BYYA 5IYYA 5T5PA 2DDUA 2JENA 2YFZA 5GLWA 2ZGRA 4AI2A 5DN2A 1AR61 3OD4A 4HOOA 4H55A 3VBSC 4GALA 1JZ7A 2J7MA 3VBSB 3ZOIA 1QJEA 3EYPA 4CUCA 4FPJA 4QD2A 1ENRA 3OCPA 1VRH2 3ATGA 4R8HA 4XUTA 1G9FA 1Z7S2 3GZAA 3PJQA 2VD7A 2ZEWA 4M01A 4YZ1A 1RMU2 4NOTA 1H30A 5LA1A 2DUPA 2YV8A 2ZACA 3INAA 4RHV3 2E7QA 5CISA 2DUOA 1VIWB 1W6NA 3OEAA 3I2OA 3NNJA 3HNYM 1BXHA 5I0RA 3PMSA 3ILRA 5IVEA 3WP3A 1C8M1 5LBEA 5IFTA 5T54A 4AZZA 4LBQA 5IATA 3PHMA 1T6GC 3ZXFA 2X53S 2VL4A 3POIA 5FZGA 2IXHA 3KCYA 3GNEA 5GZGA 4Z2WA 5EPAA 1NYWA 3VBRC 5JIAA 4E4ZA 3U07A 3SKJE 1QJX1 1MACA 1EAH3 1QXJA 4D6QA 4CP1A 2P1BA 3AYDA 3IMMA 2AREA 5EJZB 4SBVA 4BDVB 5JOWA 2LALA 1FATA 4YNIA 2WRAA 4RN5A 2CV6A 4O61A 3MIEA 3ZR5A 3KT7A 2RMU3 3D6EA 2C9AA 5F2SA 4DO0A 1W6PA 4WV8A 5LA9A 3WF2A 1BMV2 3LB9A 4DRVA 2AACA 1L7QA 4DRRA 3WNMA 2HWE2 3DPRA 4YGDA 3GBGA 1V00A 1JN2P 1W06A 5C4WB 1RGSA 2SBAA 2VG9A 4QQ2A 1LOFC 3DKQA 1XRUA 3ZM8A 3VKNA 5DAPA 4RHV2 3JBG1 3I7DA 1E5HA 5JOZA 2PHFA 4AVBA 3NKTA 1F35A 1PVC2 3I2FA 3POEA 5DAVA 1Q8OA 1RJ7A 1G9AA 2Y6GA 2WNVB 1IQAA 4NPMA 4ZONA 3AM2A 4P5YA 3HBKA 4Y33A 4GWMA 1QU0A 1FAYA 2GMMA 4N53A 4KU8A 3W5MA 1QGLA 5BNNC 5JZGC 2PQQA 4A6OA 4AR2A 4EN8B 4NAOA 1U12A 5J7MA 1ZBE1 3N3HA 3GBFA 1EV12 3AL5A 2GP3A 4LPLA 2DVBA 1JXNA 1US3A 3A22A 3J7LA 4JGYC 5L36A 4RQPA 3O1PA 2FD8A 4OHYA 2ZA9A 4QDSA 4BQ4A 2WKKA 4Q8LA 1S0JA 5HXVA 3VLBB 1ZRDA 2RMU2 1E5IA 4M0HA 1RJ8A 1VJ2A 1Z0HA 1MZEA 1NOVA 1TME2 2GC2A 5LATA 4OQ9A 1JYWA 1QMJA 4HVQA 5A7SA 1FPN2 4Y1UA 3MUY1 3TEWA 4Y5Z0 3IB3A 1AL22 2CTVA 5K0UB 2VMEA 5ANQA 3THDA 2VMIA 2WA4A 4MLOA 2BFUL 3OD0A 2K9ZA 3RJRA 3UESA 2YG0A 2Z79A 4YZ4A 1AYN1 2JG8C 1COV3 1HB3A 4RD7A 4N43B 1XOYA 3DXUA 1AR93 4LBOA 3S7IA 4Q27A 1D4M3 4DINB 5D1IA 5IWFA 5F3IA 4ZPIA 4Q4W3 4ZHNA 2EICA 1OI6A 4Q4Y1 2VMGA 1KFXL 4CA9A 2YY1A 3T4VA 3I54A 4XJ8A 4AVTA 1SFPA 5FREA 4DXSA 4Q4X2 4XFHA 4CCKA 1GZWB 1JUHA 5IAVA 1RUH3 1IKPA 3PU8A 2AYHA 2UY9A 3WT3A 1AX2A 5FJKA 5I0DA 1VBE1 1UU6A 1STMA 2E53A 2RDQA 1RL3A 1FV2A 2G9ZA 1F31A 3ZXEA 4JDNA 3BCWA 3NRUA 4AEDC 4PT6A 4AVCA 3H8OA 1WBFA 3BI3A 1FI2A 1JYXA 1HX6A 4EZHA 4LO6B 5T52A 4DY3A 4Y24A 5IUQA 5FYUA 2HWB1 3KV9A 4Q4Y3 4WVVA 4XJ9A 3VBFA 5A33B 1MS3A 1XNTA 4PLNA 3A7QA 4UOJA 5DDJ3 3I59A 1QH6A 2JDKA 1ODNA 2VJXA 1G86A 1SLIA 2FMDA 4A7KA 2PAKA 5L7OB 1OA4A 4YVSB 4QXHA 1OD5A 3MIFA 1TMF1 4WM8A 5FZCA 1FPN3 4YYOA 4Y3OA 1GWLA 3VN4A 4AFDA 3VB9A 3SISA 3I2KA 1Q43A 1CONA 3K2OA 2XOMA 2RJ2A 4P08A 2A3YA 5JOXA 1S0IA 2N7GA 2EIEA 4OMDA 1O3SA 3LEGA 4LKSA 1BK1A 4Y1XA 5C8CA 1DCSA 2TEPA 4QAWA 3LA7A 4E9KA 5F5QA 2DF7A 1X8EA 3V64A 3H0OA 4XHBA 5A32B 1F15A 4MXWB 2BEOA 1JHNA 1WCQA 2JXAA 2HWD3 3IWZA 2YBPA 4GMP1 2XKPA 5FRAA 3S0MA 3OGVA 5DG2A 3WHUA 1ULEA 2V73A 2VZPA 1PK6B 2HWC3 2WZ8A 3OGSA 3SC7X 4AHZA 2C26A 3HEIA 4JQRA 1RUG2 3POBA 1VBD2 2QDRA 1RHI3 2DVFA 3EBRA 2QQIA 3RZKA 1SLLA 3FHQA 2JD4A 4QPIA 5I8TA 2CAUA 4FPFA 4AXOA 1H8VA 1UPIA 3OUIA 3J7MA 3Q8BA 2E9QA 4HSJA 4KU7A 1LOAA 4YGBA 4CZSA 1QJU1 3VBUB 3ZFFA 2VO5A 3ALQA 5FZ9A 3PL0A 4LOTA 3VDCA 5L7OC 5FY7A 2VNGA 4QX7A 5GZDA 1R081 2VY0A 3ZMNA 1HLCA 4MX3A 3T0DA 3O1OA 1AXYA 3NNLA 4XF1A 4F83A 5I0UA 4TN7A 2DU0A 4XF0A 3VBOC 3NV2A 1HRV3 2VBBA 1IQDC 3ZDSA 3WNLA 4Q26A 2IC1A 2OA2A 3IPVA 4N9IA 3OBAA 3CO2A 3WF1A 2H6BA 3F2ZA 1OKOA 1BQPA 4UFMA 1UQXA 4LO4B 4X6QB 5EZWA 4AK3A 4AQSA 5KXEA 1DU3D 5H9RA 1W28A 4LBLA 1OMIA 4PQQA 4RR3C 3K4ZA 2ET7A 1O5UA 4GMP0 4OYUA 5BV6A 2ZTNA 2VMHA 2GN7A 3EO6A 4O7XA 4XDQA 3EJKA 4CPBA 3DGTA 1OA3A 1RINA 3HNBM 5FKBA 4LK7A 4FFIA 5FO9B 4MVTA 2ZX1A 4LE3A 5T5JA 2BWCA 4LO8A 1LEMA 4GWNA 1W9SA 3NNMA 4IV1B 4FOQA 4XQ4A 1W8NA 3KHBA 2W95A 4FPCA 1PM7A 3NV1A 4QM8A 1OBNA 2RS31 1S1AA 3ZYIB 1RB8G 2DCYA 4R9BA 2D5HA 5JOYA 1NA1C 3PNAA 3H3ZA 3DXTA 1JZ2A 2K2SA 5BNOC 4FPLA 1W99A 4AQ2A 2GNMA 5ACA2 1UO9A 5IFPA 3ACLA 1C8M3 2DVAA 3WW4A 1HIXA 2BTVC 1TQ5A 5IVCA 1I5PA 2VNVA 2GMPA 5DQ0A 2WZPP 2RS52 4QU1A 1JH5A 1BVVA 1WW5A 1W2AX 4S2FA 4TWTA 1VLNA 1BKZA 2DCZA 2VOTA 4KWKA 4M3CE 4NO4A 4RSUA 1RUJ2 2WFPA 3WDUA 4EWDA 2HEYF 1B35A 2KXLA 3AVSA 3N9PA 2WJSA 2Y33A 2VNOA 3U75A 4C0HA 4P9LA 1J83A 4L97A 3VBHC 4GH4C 2GU9A 2ATFA 4I30A 2XJPA 4LR4A 2HWF2 2JB8A 3R0RA 2J1UA 3CBNA 3B93A 3MGUA 5FK8A 3RWKX 2ZHKA 3WG1A 1A34A 4LA3A 4AEMA 1I9RA 1RUE1 3NW4A 3NL1A 2W1QA 2IXCA 4MSVA 3V0AA 3ZDVA 2Y38A 4WVZA 3VBRA 4MGSA 4YFWA 2JECA 3GDBA 4AVSA 2KR2A 5BYNA 2ZX4A 4CDWB 2WT0A 4R52A 1WD4A 1OXCA 4KNCA 3SEPA 4COUA 2XJSA 2H0BA 4JDMA 5I0TA 5A6QA 2JDZA 1CQ9A 1ZZ8A 3ST7A 4DEQA 5LK5A 1J1TA 3IIIA 1CZSA 1I5ZA 5FZHA 3NJYA 2CDPA 4GKXA 3ZVXA 2ZCWA 5EJ3A 1UY1A 1HB1A 1HJGA 2G9FA 3PUIA 5FO7B 1SLBA 3K4DA 2NMNA 4KWUA 5FYIA 4QXCA 2JE7A 3I3EA 3M4FA 4BB3A 3E5XA 4N9HA 5KWRA 1VB2A 3SXWA 2VZQA 3AB0A 2RS53 4XJAA 3V0BA 3IKWA 1I6XA 1VBB1 1ZYBA 2IZWA 1XC6A 4RS5A 2D6NA 2ZMNA 5JXGA 3QBQA 2I2SA 2C0ZA 1UZVA 2XHNA 3IPVB 5DZFA 3RZHA 3M3CA 3IZOA 1W2UA 3IBMA 3N9OA 1JS9A 3OY8A 2WT1A 2VTXA 5GLUA 2GALA 2D40A 1UX7A 1LENA 1NA1A 3CEWA 3CJIB 5GALA 3RZLA 2OUHA 1V6IA 3X29B 4URTA 1US2A 5CFCC 5A1FA 1VALA 4YLZA 2BZDA 3U78A 2YGMA 2IVJA 3AZZA 4GWIA 3GCWA 1JOPA 1YFUA 4QPIB 2OPWA 4XAAA 5LA0A 4NWVA 3LF7A 4K8RB 1ULOA 2W08A 3FLTA 5D8AB 3WX5A 3WNNA 1WA4A 2F4LA 4F7ZA 5JMCA 1NCRA 5FY4A 2X5IA 3C7EA 3OBZA 4E2QA 2Z42A 3ZXKA 3LWCA 3AP5A 1QJY3 1QEXA 4Q8KA 1WZXA 4FI9A 4L99A 4OI1A 1W8UA 3VDAA 1S2KA 1JYCA 2Q8CA 2HH9A 1VBA3 4IW3A 4CU6A 1ZRIA 1BK0A 4Y4RA 4NPRA 3DV8A 1G9CA 4CDUC 4HKLA 2VCAA 3RZGA 3RGBA 1CAUA 1QQP2 3WG3A 2C9KA 4OLLA 1Y7BA 4QQOA 4OHZA 5EJ1B 3JZVA 2W1SA 2OZ6A 1VMHA 3J26N 4QPGB 5ABJB 3GF6A 3ZPYA 5T50A 1WUVA 3SCFA 3RI9A 2JDUA 3OUHA 2DVDA 3WG2A 5KC5A 3HBZA 1LTEA 3I2GA 3MW2A 2ZX2A 1A8MA 3S6PA 2OZJA 3A4UA 1PIV2 1YFWA 4D7TA 2A5ZA 2G9GA 1W39A 1EUTA 4JX0A 3VHRA 1VB4A 5CA6A 1JHJA 5FZIA 1AR62 5FDBA 5CEHA 3DUIA 1OLQA 3H1MA 1LHWA 3B01A 1W9YA 4GAZA 3KSCA 1CJDA 4IEPA 4Y20B 3S7EA 3WG4A 3E6BA 3POYA 3RPQA 1YXWA 4QB6A 1DGWX 4LT5A 1GP4A 3WXPA 5F3EA 4ARYA 3H1YA 4FTBA 1C1LA 2ZZQA 4JRLA 2YC4A 2DUQA 5B4XA 1WMFA 1KDKA 1VAVA 1IS6A 2Y6KA 1IG3A 1BJQA 4UI9L 5A80A 1PO23 2W1WA 5DDJ1 4RS5B 4X8NA 4HXCA 1J3QA 4RYDA 1RXGA 2ARCA 2I07B 3M1HA 4DNYA 4H3WA 4GB32 4NIAA 1HN0A 1IHMA 1DFQA 1COV1 1D2SA 2WZEA 2XWJB 3CDZB 2Y0IA 5LY1A 4ITCA 3RQ0A 2DYCA 3D5OA 4JDOA 4P00B 4Y26A 3MHZA 2TUNA 1W0PA 1UZ0A 4ORFA 2RS33 4NE9A 3O5SA 1REFA 4JGYB 1V6NA 1C8NA 4YG6A 4OUSA 1OC1A 4QB1A 4K8FA 2ZPXA 4ISQA 1E5RA 4IE5A 5FYYA 4FAHA 5LEJA 3KS7A 5DUWA 4PF5A 1GU3A 3I49A 4BLJA 1UZYA 2IFRA 5FXZA 4A41A 5FUPA 3D0JA 4XBNA 4QX0A 5JSRA 2CAVA 1GV9A 2J22A 4KBBA 4LHKA 3MI8A 4QX3A 1ENXA 1AR73 2A6WA 2R7EB 3G6JB 4META 2ZAHA 4NHYA 1W8WA 3E1F1 1AR81 3A23A 4H14A 4H2AA 3CU7A 5C3SA 1I1EA 4QWNA 1YC61 5IAXA 4DXTA 4FTSA 2DWRA 4FFHA 3MBWA 5FPLA 1GUIA 1LEDA 3RMYA 4KI5M 4ZU7A 1YIFA 3BUCA 2EIBA 3POGA 5JSOA 4LHLA 3VGIA 4OZOA 1L7LA 3UV9A 4MGTA 4GKYA 4RQPC 3T4HB 1J3PA 4Q0UA 2CY6A 4COWA 1A78A 2X05A 5FOBB 2FDKA 3IM0A
chains in the Genus database with same CATH topology
2ZAAA 2WZR2 1ALYA 2ZGUA 4M3CB 1MS0A 2WNEA 2QZ3A 1MS4A 4EJRA 5JZGA 2YXSA 2PHRA 3ZIWA 1F9KA 1VBB2 2R1DA 3USUA 5BNPB 5KXCA 2VOXA 3N36A 3VDDA 2RJKA 2RMU1 2VECA 3D8CA 4JGZC 5J96B 2XLGA 3SMHA 1HV1A 5FCCA 1H9PA 2PHUA 4K40A 1CD3G 4MYEA 4LUKA 4XFAA 1SFNA 4U2AA 2BW8A 1QXRA 4PDWC 2HWD2 4QPGC 4RL7A 1LHOA 2EALA 4QPGA 3WW3A 3SNMA 1AXZA 4S2HA 1DZRA 1WW4A 3H8UA 3UL2A 4BWOA 3UKNA 1ASJ1 1VBD3 4XXPA 3RYKA 3AP7A 2WNUB 3B3QE 1AYM1 2WZR1 1TE1B 2K0GA 1XYNA 2QQPA 2R073 2WS91 5CU1A 2AENA 3VZOA 1M06G 1RVF1 3ZX7A 5JCTA 2NN8A 4P9IA 4N7UA 5L7OA 1PZ7A 4LEJA 1ZZ9A 3HWJA 3ASIA 3LGRA 1VBB3 1KXGA 3GYDA 1KDMA 3E5UA 4Z1VA 4CEYC 4YW1A 4HANA 4XMIA 4COYA 2QE3A 2VULA 1ZA4A 2XWBB 3KMHA 4BOWA 4G3YC 3MLKA 4X6RB 1DQ4A 3B9CA 3ZSKA 1PO21 1QJZA 5E16A 3KT4A 1RUNA 2C1FA 1OPOA 2W0XA 1PO11 5A33A 1F5JA 2WIIB 4OVEA 3VBFB 1O3RA 4MZUA 2UYBA 3FZ3A 1DQ5A 4KGQA 3MLLA 3VBSA 4FPGA 4M3CF 4DQAA 5DUXA 5D8AC 4Q4V2 4QGMA 3VHPA 4AEDB 3AX4A 4DS0A 2JE9A 3H1WA 4CEWA 2TBVA 4GA9A 1W6NB 4PJYA 2R043 1Q8VA 4XPVA 1MR5A 4LULA 2CYFA 1OFNA 3R6SA 2BUKA 3FUOA 1Y3TA 4OI2A 4QMAA 1X8MA 1VBC2 4B4QA 4COZA 1ND2A 2PHLA 5HBAA 3NKGA 3POSA 5K0UA 1K5MB 3AJYA 3CJXA 3W59A 3APBA 3R4UA 4MGKE 1RUF3 2A6XA 2BVBA 1QJU2 1EP0A 1ZBA2 1OPMA 1LU2A 4QGNA 2JJ6A 4FOWA 4BCUA 2EF6A 4OI0A 4Q0PA 4OHXA 1V6OA 5HCBA 2D6KA 2VQAA 3PVNA 3H9AA 4GH4B 3OGGA 1Q56A 3ECQA 3FMGA 1ASJ3 1VBD1 1BEV3 2ZGOA 2Q4SA 3WUCA 1FX5A 2NPIA 2BBVA 1MVEA 1B35B 5K8SA 2WQ4A 1O4YA 4CDWC 1YFXA 5J98B 5DUVA 1PZ9A 3ILFA 3NJZA 4HETA 3UKTA 3WLUA 1NY72 4M00A 4W6WA 3VZJA 2HWE3 5BPXA 1FYUA 2B42B 3EQEA 1NE6A 1SBDA 1U5YA 3OYWB 4J1XA 1EYBA 3I2DA 3M70A 1H0BA 3JQWA 4AWDA 2VOWA 4KQ7A 1B35C 3HT2A 1JUIA 1S0FA 2FBEA 1MQTA 4GXLA 4BH9A 4MV2A 3J4UH 4LE4A 4Z82A 5A3LA 5KHJA 3ZFEA 4LO7A 2ERFA 2RE9A 3RZZA 3T1MA 3B5LB 5KHGA 1WCSA 3VZKA 1NQDA 5BNOB 4C1XA 1HXS3 2KA3A 4OUMA 3VZMA 2CWSA 2MPFA 4H7MA 1NA1B 4BMBA 5IK8A 2XJTA 4J6GA 1RIRA 5C9AA 3NAPB 1XNKA 1PO13 2A6YA 4BPZA 4CEWB 5C8CC 1LOCA 3FHIB 5C9AC 1VBE2 5EYXA 1HQLA 2XVKA 1VBA2 4XYXA 5J3UA 1FOD3 3LZZA 4Q0SA 3WQ7A 2GN3A 1LULA 4HL0A 4JGZA 3TB0A 1CGPA 1QQP3 2NMOA 3M2MA 4IQPA 4Q4W2 2GC3A 5JSPA 3VBFC 2B8MA 2R061 4XBQA 1TEIA 4P9YA 2WS92 3AXEA 1ZZCA 3ZFFC 2E7TA 5CIRA 3ZFEC 1WMDA 2VUAA 5CAZA 2EVXA 2B46X 3FE5A 1QNWA 2ZHMA 4CDWA 4FVVA 3O0XA 4Y1ZA 1MQTC 4NHKA 1H8TB 1HXS2 4QU2A 1AVBA 5EWSA 4SLIA 4YVSC 4CDQB 3ZXGA 3ZIXA 5CB7A 1OKQA 3KM5A 4Q4V1 4HFSA 5FMOS 5CFDB 1X36A 4LBNA 4ATEA 4FPOB 3LA2A 1V6MA 1ZBE2 3LA3A 4YM0A 5HCFA 2DV9A 3E6DA 1UIJA 3BU7A 2ZX3A 1UCXA 3M3IA 1LU1A 1RITA 1O5LA 1FOD2 1FNYA 2WA3A 4MUVA 4YVWB 3J8F3 1QDOA 3VUOA 5C9AB 1N3OA 3PMEA 1CAVB 4AE2A 4COVA 1UL9A 1PMIA 3AZWA 1V6KA 4XMAA 3B94A 5KHKA 3KGLA 3L2HA 1FNZA 2WS93 2R071 2P17A 1OQDA 3H3UA 3SCHA 1H4HA 3VBUA 2XPJA 1YLLA 3IIAA 2A3XA 5K0UC 4FQ4A 1NCRB 4JVAA 4P9JA 4Y22A 1CPNA 3AYAA 4PQ9A 3WQ1A 1JBCA 1ND3C 5CVRA 4JC1A 3RG0A 1D4VB 5F6KA 1PK6A 1SACA 3ZYRA 1RUI3 4PBPA 1GNZA 2PAMA 3KLSA 1KQRA 1LOEA 3TN93 3SCGA 5GZFA 1RUI1 4LUMA 4CEYA 5D8AA 4C91A 3FFQA 4Z92B 4YM3A 2D98A 4BMEA 4RR3A 3SH4A 3GZTB 3KB5A 5BNPA 3FUQA 3BIWE 2ZX0A 1F2NA 4JTOA 4GIQA 3TNQA 4R9AA 1YRZA 1LOGA 1N1VA 2BNNA 4AQTA 3IDEA 3BALA 3V65A 1YCIA 4Z07A 4L9BA 3USSA 3AYEA 2R062 4K3UA 1KS4A 2GNBA 2V5YA 5I0SA 2PTMA 2EA7A 1HDKA 3HD8B 4WVMB 2VNRA 5AFEA 1BBT2 4AFBA 3ZFGB 1B09A 4XTPA 5CFCA 1UKGA 4ES8A 3DN7A 4P9WA 3IDCB 1LGCA 5A32A 3TN92 3ZSLA 3B69A 1NLRA 4C90A 2W39A 1NCRC 1PGW1 2B9UA 3VKMA 2Z69A 3TNPB 4W6XA 3VBRB 3RYRA 1Q8SA 4YZ3A 1UU4A 4AFCA 2EXIA 3C2UA 3TAYA 1F5FA 5C4WC 3T2TA 2UWCA 2GNDA 1LHVA 2D93A 4TSVA 1PGW2 2ZKLA 5EFUA 3OF1A 5T5LA 1RMU3 4WZFA 2B5HA 4XFBA 2P34A 3FFZA 3MF9A 2FHRA 5FLJA 3TN91 4G4FA 2GAUA 4A7YA 4P9GA 1S0BA 2Q0AA 3ZFGA 1AX1A 5C33A 4MH0E 1Q8QA 1DLLA 1QWRA 1SFYA 4IXLA 1BBT1 1QH7A 2XGXA 3AKQA 4L92A 3LSDA 1QNYA 1OOPA 3TYJA 3U4XA 1SLTA 2R49A 2VOKA 4IV3A 2QKDA 4DXZA 5JIUA 1CAWA 4I0WB 4NHMA 3B00A 3RRDA 1ENSA 1EAH2 3QD6A 5LK7B 4CEYB 2YGLA 4INDA 4L2NA 2PLV3 3UJOA 4AHXA 2PA7A 4UBHA 5J37A 3VBHA 4BZ4A 2C5DA 2X5IB 2D44A 4HSLA 4GQ7A 3QOPA 2UY8A 5EYYA 4IV3C 1W6MA 3SLIA 3CL1A 4YVWC 4CDUB 1YUDA 3DL3A 5KHIA 4YM1A 1DDLA 4XFIA 1DQ6A 4XZPA 2R042 4DZGA 1ULGA 3WDXA 1DQ1A 3CLPA 3USUB 3RDIA 1IPKA 1CAWB 1HRV1 2RS13 4FPYA 4HMZA 4YGEA 3J9SA 1C57A 1XXNA 3NSTA 1GICA 5FQ0A 2XBO1 3MEPA 1OOPB 1O3TA 1FMD2 5JI7A 2VW0A 1AJKA 4E4SA 3R4DB 5AFBA 1RUF2 2RM22 3KZ4C 2FQPA 5HCAA 1QJU3 3IN9A 1FXZA 4RFT0 4YM2A 5C8CB 1IS4A 1RUD3 1QDCA 3ETQA 4CEWC 3NAPC 5C4WA 2R0HA 2WLQA 3H7JA 4HPKB 1DGLA 1FT9A 3E97A 4Y1YA 3S30A 2GC0A 4IEYA 2EAAA 4LLFA 5DZEA 2HWC1 4UW6A 3MIGA 1LGNA 3I59B 3N7KA 4NHLA 4XIKA 2DCTA 5T5OA 1RUC2 4KG0A 3LAGA 2XJVA 4JRAA 1ZZ7A 3VL9A 2VVEA 5BXXA 4LBQB 1PIV3 3ZXLA 4R9CA 1LOFA 1S0EA 1YJKA 2FZ1A 3GHNA 1AL23 4O9EA 4WM8B 1Z7S3 4ZU5A 1MEC3 4FTEA 2D97A 5L19A 1RVF2 2O1QA 4R4XA 1AR92 3EXUA 1LHUA 3N7MA 5AC92 1F8VA 1FMD3 1MS1A 1DF0A 1AYM2 1O4ZA 3QH7A 3JB4C 3MYXA 2ZGQA 2PAEA 1RUD2 3P3NA 4XBLA 3R05A 3PVOA 3OJBA 1HKDA 3OGJA 2ET1A 2YDEA 1C4RA 2OVUA 2QNKA 3GHMA 1LB2A 1SLCA 1DG6A 5KBFA 5H9PA 2TNFA 1VRH1 4ZKTB 4AF9A 1RUH1 1HRI2 3AXDA 4U36A 3VKLA 1ZX5A 1DGRA 2ZABA 2WFF1 3KQRA 1NE4A 1QOTA 4PLMA 4EWEA 4AVAA 1FMD1 1O7FA 2QFEA 4EN7B 1ND3A 1MS5A 3WV6A 4I02A 4LBMA 4F8AA 3U0ZA 5F1RA 1VBE3 1CVNA 3AMNA 4MGYE 1MEC2 1R091 4RS5C 3IT8A 1V70A 4LBKA 5E1RA 4D7SA 4XHXA 2ARXA 3AP9A 1MZFA 1PVC3 1V9U2 2A71A 1H1MA 3PJYA 2NP0A 2VOVA 3O14A 4WM8C 4D3WA 2DVGA 2FMYA 5ABJA 2D7FA 4AGVA 1AHSA 3FLPA 4XJZA 3WW2A 1JOJA 2RJLA 3TOJA 4RR3B 2XL9A 3PLQA 1VBA1 3KCCA 4K21A 2X29A 1BEV1 1XYOA 1UIKA 5EV7A 1WLCA 1R1A3 4HVOA 1IOAA 4HK8A 4IESA 1DYPA 3B7MA 4XQWA 2ZGNA 5AVAA 3QACA 4UW5A 1HRI3 4K6BA 2CWMA 1LODA 4N53B 1UN1A 3HN1A 1EPWA 3BODA 4GMP3 4NVPA 5F9TA 3ZSJA 4XOGA 4YFZA 2XH6A 1AL0G 1XU2A 1AJOA 1VR3A 3KCXA 1XQNA 1MQTB 3I8TA 4LLOA 2G4IA 5JAXA 5TSWA 3ZYJB 2ZGPA 4LHNA 1MZ6A 2ZS6B 1YNAA 3J8F2 1COV2 1OOPC 1H2KA 4S2DA 3WDYA 4FPHA 2Z2SB 4I0AA 3T1LA 1V9U3 3WCSA 4UW3A 2R1BA 4AVVA 1WW6A 4Q4X3 4AHYA 3SHRA 2BYVE 3TRSB 5JR7B 4AI1A 3VZNA 5C6CA 4M0NA 5AVPA 1WBLA 5DG1A 1GQHA 4FXGB 3VV1A 1J58A 1CIWA 2NZ9A 1S55A 4A7ZA 3WCRA 2IXJA 1ENQA 2ZBJA 1JW6A 2A7AA 4Q4Y2 5CFDA 2PELA 5DDJ2 4KG8A 2R6QA 2ZGSA 1IS3A 4I2OA 4YW2A 3ZN4A 5I8YA 4A3XA 1REEA 2VVDA 3U10A 2W52A 3K48A 1CR7A 3VBOA 1ZRFA 3VDDC 1FPN1 2XVGA 4XFFA 2NQYA 2HWF3 4WBBA 1W6OA 1WW7A 2QCSB 4HZFA 3JD71 5JI9A 1IGOA 4AFMA 4DPNA 4EWAA 5L73A 4HT1T 3K51A 4IETA 3AZVA 2QZ2A 1G7YA 5E89A 4N43C 3R4SA 1H2NA 1RUG3 4PIZA 5FBZA 1UW8A 3O7OA 2R063 1MZ5A 1UX6A 1REDA 2AUYA 4XF4A 1S0GA 3LCPA 3ZSMA 4YZ2A 1ZNPA 5JDBA 2O8OA 4E4DX 1DYKA 4D69A 1APNA 4XETA 2PFWA 1ONAA 3G7DA 1UZZA 3OYWA 2IXKA 1X7NA 1NXD1 4PDWA 3JU9A 1SBEA 2EXHA 3HR9A 2A3WA 2P37A 1V9U1 1AZDA 2XJRA 1DQ2A 3WY6A 2XL7A 4HPKA 4Q0QA 2ZHNA 1R092 3MICA 1XNDA 4ISRA 3RJ2X 5GLZA 3URFA 4QHBA 2PLV1 1VP6A 1ZRCA 1A8DA 3RI8A 1ASJ2 2A6ZA 2XLAA 1UU5A 1RUOA 1TNFA 5C8WA 1R083 3U11A 2QJVA 4XF3A 1TME1 3M3EA 2JG9C 4KWLA 1LRHA 2EXKA 2ZJCA 1O4TA 1OLRA 5K9YA 1CAUB 4C1WA 1HRI1 2VGDA 3ILNA 1NCQB 3AP6A 4QX5A 5FMOL 4K1YA 4Q1PA 2NYYA 2P2KA 1HQNA 2WT2A 4WM7B 3RS6A 1J59A 5ACA3 3UK9A 1CX4A 1C8M2 3UKVA 4IEVA 1QXPA 4B4RA 1LGBA 4DB5A 3PTYA 1SCRA 1H1IA 2IWGB 4N7IA 2BWAA 2H0VA 4XE9A 2VVFA 1RUE2 2JG8A 3AFKA 1R1A1 3VL8A 3E6CC 4LTAA 1RUJ3 3EHKA 4FBFA 2A70A 2B7YA 2PLV2 2BNMA 2R0FA 4KL1A 4UBGA 2HWB3 1NQJA 2UURA 1M4WA 1DBNA 4FT8A 4TYSA 3FBYA 4P5HA 1QHDA 2CGOA 3WZ1A 4FP2A 1Y43B 1AR63 3DF0A 1OHFA 4AYUA 5FTTC 1S2BA 3WUDA 1CAVA 3KGZA 1NZCA 4GULA 1O3QA 5DXDA 4P9XA 2RS12 4AFAA 4KGGA 1SQ4A 3B02A 4BLIA 5BUVA 2B39A 3W58A 1EAH1 2GH2A 1ULDA 2WQZC 4ES9A 5LEKA 3ENRA 2BVVA 3H50A 1LHNA 4Q29A 3GZUC 3NVCA 1LJ7A 3AFGA 4B4PA 3LOBA 1SEFA 1WLDA 3H7YA 1IKQA 2WNUC 4MGZE 2ZGLA 1QKQA 1AXKA 4CP2A 1WD3A 1EY2A 5J36A 4AHWA 4EN6B 4JGYA 5K7PA 5I8SA 4CRQA 1SCSA 1AF9A 2RM21 2X5IC 1LR5A 2YC0A 3AMMA 5GJ6A 5IK5A 3OTFA 4NN0A 1GFF2 3NAPA 2GC1A 3QLQA 3M7AA 2CNAA 1N1TA 3ME2A 4Q1RA 2XG3A 1HW5A 1LKNA 4RGAA 1ZZBA 4WVMA 4XFCA 3BOPA 1X33A 4N53C 1MVQA 1RUC3 3ZO0B 2VH9A 4JTNA 1L3JA 4HN0A 3FJSA 3ES4A 2CGPA 2MEV2 5FPXA 3MIBA 1YJLA 1URXA 4EV0A 1DGWA 2ZOEB 4K20A 4IEXA 1ZVFA 1DQ0A 2AGSA 1VAMA 2EIGA 2YYOA 4PCRA 1G9DA 2YMZA 4QPYA 4IEUA 1YI7A 5IT6A 3MZHA 2I74A 1AYM3 1AR72 5DZGA 4QPIC 4RQPB 5SV8A 5I93A 4ZXKA 4B29A 4Y1VA 1NLSA 4XF9A 4WM7A 1PGL1 1S0CA 2JG8B 3ZSEA 4S2GA 2DFCA 5CADA 4H7LA 1RC6A 4Y22B 1SDWA 3CJIC 1XE7A 1EV13 2BFUS 4QXKA 5BNPC 4PBOA 4UW4A 4OFGA 1N1YA 1PGSA 5T55A 4CTEA 1H9WA 2ETEA 3BOWA 1GANA 1LECA 1O91A 3D4KA 2Z5WA 4DFSA 4I3PA 4K1ZA 4RGGA 1TME3 2GSYA 4EN0A 4YW3A 3CJIA 4R4ZA 4XILA 2OYZA 2MEV1 4L11A 3ROUA 4WM7C 4W6YA 3HAGA 5JZGB 1J3RA 2ES3A 3AJZA 5BNNB 1GZ9A 1POV3 3RYPA 3LOIA 2JG9A 2Q1ZB 2PYTA 4QQPA 4BHPA 2B45X 3WD5A 5GM0A 5GZCA 3WDWA 1N3QA 4FP3A 4AEDA 1OFSA 2JKBA 1D2QA 2D3SA 3AK0A 3P3PA 1SBFA 4HKOA 2BPA2 2XUMA 3V56A 2WINB 1C1FA 2P3KA 4ZU4A 2Q1MA 4QGLA 3CNAA 5GZEA 4J1WA 4HLTA 4OHVA 5LRSA 1AX0A 1XYPA 3M3OA 4Q2FA 2R072 3BB6A 3AMPA 4YG3A 3MFCA 2A75A 1H1AA 3Q9OA 1Q3EA 3IMNA 3VHOA 3WOGA 3BPZA 1BCXA 2E7AA 1YFYA 4CDQA 4IEQA 2HEVF 1AL21 1GQGA 3SITA 1ND3B 3TBDA 1POV0 3D82A 1ULCA 1AUYA 2I45A 1G9BA 1N3PA 3WW1A 4XTMA 1K5MA 2PHXA 3WINE 1YYNA 3RNSA 1DZQA 1PZ8A 4XW3A 2W68A 4N43A 2EXJA 1UPSA 1J1LA 4B7EA 2HYKA 2NM1A 2AR6A 1KRIA 1W0OA 4LNVA 2Q8OA 1A6CA 3ZN6A 3OPZA 4IV1C 5FLIA 3E5QA 3AKPA 2HJIA 3ZN6B 5IK4A 4LO5B 2JICA 4AEKA 1WLTA 2GMEA 3FC0A 1RUD1 2A6VA 3N4MA 1DIWA 2HEWF 1D0GA 1GBGA 4XEZA 4HK9A 3RSJA 5BNOA 3VDDB 1PK6C 3HT1A 3V0AB 4XXAA 2P3IA 1QY4A 3NV4A 2UWAA 4YRDA 2RR11 2Y0OA 2R30A 2A73B 1BYHA 4TZDA 1RUJ1 3THTA 4CDQC 2HWE1 1ULFA 3VBUC 1XNCA 2FZ2A 3DPRC 1C3HA 1AR82 3ZN5A 3ELNA 1MS8A 1AR91 1C28A 1ZBA3 3DPRB 3JBG2 3GBWA 5ACA1 3VKFC 2ZGMA 3POWA 3ZFEB 2HKXA 2WNVA 1DHKB 1YO8A 4M3CA 1CN1A 2WWSA 2VPVA 2D6LX 2VW2A 1BVP1 2Q30A 1NXMA 4XJUA 3WP6A 2WSUA 1U5IA 5FFOC 2E6VA 4E2SA 4QT6A 2UWBA 4AI3A 3FWEA 4WZCA 4KWJA 3JD72 4FQZA 1RUF1 4IL7A 4KH9A 2OIIA 3CF6E 1KJRA 1W6QB 4D94A 2ZGKA 4UXAA 1YWKA 1PNGA 1QJX2 1V6LA 2AH2A 2XJUA 4YGCA 2DCJA 2QUOA 1OQ1A 1RMU1 1UAIA 2IFWA 1WMEA 1Q5OA 3WDTA 5SV5A 3MPPG 4DY5A 3L2YA 5CG9A 5IK7A 1C5HA 2BNOA 4Q0VA 2ZMKA 4E27A 1H4GA 5CNAA 1PGL2 1E57A 1U5ZA 2RM23 1AR83 4W65A 5FOJB 2F6BA 3A0NA 1ZZ6A 1AR71 3ZFGC 1WLWA 5FO8B 1R093 1UF2C 3ES1A 2O0OA 3AYCA 3WNXA 1QOOA 1UKRA 1GZWA 3MF6A 4GH4A 2R041 1PNFA 2EAKA 1R082 2DCKA 1CPMA 5KHHA 1D0HA 4I3GA 1JTZX 3V0BB 1IS5A 1LESA 3ZXAC 3SH3A 2LM3A 1UD1A 2PHTA 3ZMOA 5J48A 1AYN3 4PIYA 5F6LB 4BIOA 1DGRN 4P14A 1SLAA 1RUG1 4MXWA 1QJX3 1BZWA 4YW4A 3JUUA 2WNVC 1W6OB 4HBNA 5CG8A 4D7YA 1VBC3 1RVF3