4BQ4A

Structural analysis of an exo-beta-agarase
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
750
structure length
750
Chain Sequence
GSHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLEVPDSGDVNDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNQKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERLGSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords B-AGARASE
publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
total genus 255
structure length 750
sequence length 750
chains with identical sequence B
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq4A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq4A02
2JWPA 1AMYA 1VRXA 4AIOA 4DWSC 5FD0A 1MYRA 5DF0A 1G9HA 2YDSA 5D4YA 3WL1A 1MWOA 1UOJA 1E4LA 1LQ0A 4AL9A 1UR9A 3AICA 3ZT7A 4GI9A 3WIJA 4AISA 4J3WA 3VGGA 4TVUA 1SMAA 5BRPA 2VMFA 2ZX5A 2J7CA 4OJYA 4LQ1A 4UQDA 4PMRA 3QHOA 1CGWA 3VDCA 3ZT6A 4C7GA 4DM2A 1QHOA 5ABFB 1SR0A 4W7VA 1WZKA 4YWAA 2VZSA 4UNIA 1QVBA 1SYTA 3K46A 4MB3A 3VIIA 4H2CA 1G5AA 1JF6A 3I3BA 1EOKA 4UQ9A 1E55A 1BYCA 3GH4A 1GONA 2F61A 1V6YA 5AYBA 4PTWA 2BNJA 4RE2A 2BS9A 3VKKA 4GQQA 4LYPA 3AOFA 1JZ7A 4ATLA 3AIEA 2YDQA 2DSZA 2OSXA 3M46A 3N11A 4PEEA 1OINA 3BAKA 1E4MM 1Y7VA 3VPLA 3RDKA 5A6MA 1JYXA 2ZICA 6A3HA 2ZWZA 5E09A 1OIFA 3J7HA 2BHZA 1BQCA 3VGHA 3VX0A 3MUZ1 3K8KA 1OD0A 3ZSSA 4WJXA 2VZUA 4AIEA 1DWIM 4QDMA 4S3JA 4UFHA 4U5IA 3N18A 1NARA 1ISZA 3IJ8A 1UD5A 2FGZA 1E0XA 1IZKA 3RO8A 2EPNA 5HDRA 1E6XM 4UQBA 4YW7A 3WDQA 1JL8A 4GKLA 1GOQA 2XM1A 3W53A 5M17A 1QI0A 4FMVA 3AHYA 2PWHA 3EYPA 4NRRA 2QF8A 1JZ8A 1VEOA 2D23A 2WMIB 2CBIA 4TTGA 3AS2A 2Z1KA 2WMHA 4IPNB 3CZ8A 1FHLA 3MV11 1QBAA 1QHZA 1J9YA 3SUUA 4BQ4A 3DYPA 4PTXA 1XYZA 2A3AA 1DWHM 2CEQA 2E8YA 2GDVA 4GZJA 3I3EA 4QLJA 4Z2LA 3T09A 5D9NA 2VX4A 3BLKA 1C92A 2OSYA 1XH1A 2PI6A 2XFFA 3VD5A 3F5JA 1LWHA 4Q22A 4YPJA 2V3FA 5M3WA 4WKFA 5CPQA 1DWAM 5GQBA 3BH4A 4YHGA 3VX1A 1BAGA 3U7VA 4JKKA 1NOUA 2ZUWA 4Z2IA 4EAMA 2E0PA 2YA1A 4F79A 2WZIA 1OIMA 1GQKA 3VIMA 1GQJA 1QNSA 4B3LA 5BCAA 2Y24A 3WUEA 4D6JA 4CN4A 4OOUA 2VZVA 1R8LA 1PAMA 1HIZA 2DQXA 4F66A 1W2VA 1W3JA 1GWKA 2C8NA 1BVNP 5A6KA 4D71A 2AOSA 3AHXA 3L4XA 1R7AA 2XJ7A 4UQEA 2HVMA 3WF2A 3DECA 1KCKA 1CGXA 2E8ZA 1W1TA 1B9ZA 4KGLA 1B31A 4MDPA 2Y2WA 1WZXA 2Q8XA 1LLOA 3WNOA 3WMBA 2VZOA 3SCPA 1UH2A 3PZIA 4UOJA 1VJZA 4W8BA 5A6JA 2YLLA 4PUEA 3W28A 3NIYA 5ABHA 1WZMA 1QW9A 3S6TA 1H4PA 1W1VA 4FLOA 1DTUA 4D6IA 1GJWA 4P8XA 2J8GA 2W66A 3E1F1 5E9AA 3CZJA 3IJ7A 3ARSA 3VILA 6CGTA 3PZNA 5C71A 2WAGA 3WQVA 4TOQA 2EO7A 2X09A 4MDOA 1XRVA 3HJEA 2VRQA 1JF5A 2WBKA 1JD9A 2XVNA 2WCAA 3WDPP 4J3XA 4AEFA 1JD7A 4L4PA 3BCFA 2OYMA 4LXFA 1AQHA 4LK7A 1OBAA 2EXOA 3B9AA 1E5NA 4H41A 1C8QA 4HZ8A 4HMCA 3ARRA 1UUQA 1GUVA 5KEZA 4CUCA 4U33A 3VIKA 4Q7NA 1X6NA 4A3YA 1OGBA 4W7WA 4W93A 2VCAA 3PZOA 5HNNA 5I6SA 1MVYA 4H04A 1U33A 1W3KA 1IV8A 4HZ6A 1UD3A 4QAWA 1XH2A 1O7AA 3ZOAA 3CMJA 3K4DA 2WYFA 4KH2A 4MAZA 1VEMA 4N0RA 4F9JA 5M03A 3M07A 4YW6A 4YHEA 1Q6DA 1KB3A 2XG9A 4AD1A 3AS1A 3CHDA 1S46A 2CERA 4RE4A 3ZO9A 2E9LA 2OYLA 5IFTA 4P7QA 2WM0A 1F4HA 1GQLA 4LKDA 3VD7A 1KFWA 1OCQA 1WDQA 2GJRA 5D9MA 3BCDA 2VNCA 3VM7A 3AXHA 4W85A 3QHNA 3PZMA 3CMGA 1WZAA 3MO4A 2FGLA 4CN1A 2VRKA 3WEZA 3ZM8A 1K9TA 5CPSA 1JZ6A 1CEOA 5F7UA 5FL1A 3CUFA 3ZQ9A 3TOPA 1V0NA 1HN1A 2WHLA 2OWWA 4MNLA 3EDEA 4MADA 3GH5A 3N9KA 4XX6A 4WKAA 3AZTA 1UR2A 4J3SA 2VI0A 1L7LA 3N1AA 3GNRA 1JZ3A 4PMNA 1UD2A 1XCWA 2VURA 3AFBA 2CPUA 1QI2A 5D8ZA 3L4VA 4CD5A 2WMGA 2GJXB 3ARPA 4J3TA 4AZ6A 4DM1A 5EB8A 2BY1A 4U2ZA 5AY7A 2BHYA 1E1FA 1A47A 3L4YA 1E15A 2WC4A 3W26A 2YA2A 3W29A 1OWQA 4P7LA 5FCZA 1NWSA 1MW3A 3MMUA 1MW2A 1PPIA 4HPHA 3FN9A 4JFTA 4PMQA 4H8UA 4W84A 1UH3A 1HNYA 1SFSA 1VF8A 3T0AA 3WDHA 4CN6A 3BAYA 2JIEA 2VR4A 5IDIA 1HF6A 3GBDA 4CKQA 4PMYA 3SCOA 1ZBCA 1W8UA 1CGVA 1ISXA 1BPLB 1GZJA 3OLIA 3GXIA 4YN5A 5IHRA 1E1EA 1ODZA 5I3DA 4BQ3A 2WZHA 1EHNA 2G3IA 2WHMA 5E6ZA 2BHUA 1HJSA 4CPBA 2GDUA 1FH7A 3VGFA 3PTMA 4N42A 2WC7A 3TP4A 3ZT5A 3BAJA 3CGTA 2DIEA 2YA0A 4WLCA 3EDDA 4M29A 1CLVA 4OUEA 7CGTA 5IXEA 4OOZA 3AHZA 1VEPA 1C8YA 3L4UA 1V02E 1XGZA 2D22A 3PZ9A 1LL4A 5EFDA 4AZHA 4D6DA 1OSEA 4TVDA 3CHEA 3POCA 2J47A 2D2OA 2PBOA 4HZ7A 4LYRA 3VM5A 1TR1A 5I5RA 1K6AA 1J0ZA 2CBVA 1NOWA 3AMCA 2YL9A 3JUGA 4C7FA 3MKKA 1UWSA 1J11A 2LRPA 4KRUA 4V27A 3WEOA 5E0FA 1XSKA 3MANA 5CLWA 3AMKA 3W27A 3OGVA 3TTSA 3VDAA 3MSDA 2A3BA 3LMYA 1UWRA 2ZX7A 2QHAA 4IUGA 3UT0A 2OWCA 1ISWA 2IXVA 2ZXQA 1LL7A 1V3IA 4UOQA 5CJ5A 1D3CA 4QLKA 3M6DA 4ZXOA 3AROA 4URIA 3EMCA 3WUGA 3FW6A 1CTNA 1BHGA 4MNMA 1GWMA 3NSXA 4B15A 5IHSA 1JG9A 4DWSA 2FHCA 1V3HA 2WWDA 4OKDA 1WKYA 2VXJA 4NZCA 3PTQA 2G4FA 3SCUA 4L4OA 2BV9A 5DT7A 2G3MA 4NI3A 2XFYA 3D3AA 4P7OA 1HKJA 1UR4A 4WSJA 1WCGA 1XV8A 4XZBA 3T2OA 4X0VA 4ZFMA 2EQDA 1GORA 2XIIA 1E6PA 2DIJA 1NP2A 4M24A 2DSWA 1ZBWA 4J7RA 5A8OA 5CGMA 2VUYA 4PCTA 5LA0A 2EEXA 2C0HA 2FH6A 4ZXLA 1TMQA 1V3MA 1CXIA 3BAXA 4V28A 2BY3A 4AY1A 3B9DA 3IAQA 3N15A 1WCUA 4D1JA 3GNOA 3WQ6A 3MMDA 4MNKA 2V3GA 4GZEA 3U7BA 1Z32X 2WVVA 4AZCB 1CXLA 2QMKA 4CP9A 2ZUUA 1KR0A 1FP9A 3ALGA 5FOOA 4CD6A 1KXHA 3ZMRA 4D6GA 3T0BA 2PWDA 4HMDA 5DMYA 2ZXAA 4ACZB 1MQPA 1OM0A 1M03A 3WD1A 2AAAA 1LG2A 2E40A 3II1A 1HVXA 1PX3A 1HXJA 2D1ZA 3QR3A 4DUVA 3ZJKA 4B16A 1CYGA 4P7RA 3PZVA 1UR1A 1GHSA 1E40A 1W9FA 2QLYA 1CECA 3K8LA 1PJ9A 1LG1A 3WD0A 3GBEA 4PSRA 1Q4NX 2D3LA 2PWGA 3F4VA 1ITXA 3DYOA 4EKJA 2WC3A 4KGJA 2X2YA 5LA2A 3B8SA 3AIQA 1NP0A 2ZWYA 1KXTA 2J7DA 2NT0A 2ZUVA 2G41A 3SURA 4W5ZA 3AIVA 3AMDA 2BVTA 3FY1A 2GJPA 3VD3A 4PBGA 2GFTA 2ZOXA 1QNPA 3UG3A 1W9PA 1FH8A 5BXSA 2BFGA 3L4TA 3VVGA 5A8MA 4ACYA 1Q6CA 3VIFA 3HU7A 2YDRA 1N82A 1RP8A 3L2MA 4W89A 2ZIDA 1V6WA 1X6LA 1L8NA 3LPPA 3AISA 3VMOA 1EQPA 1HJXA 2O9TA 4GPNA 4AC1X 3KL5A 2XGBA 1VFFA 4GINA 4H8HA 3ZSTA 1JFXA 3VUPA 2X05A 4Z2KA 3KE0A 5AC5A 1JYVA 1MQQA 4LKEA 1TCMA 3N17A 4LYQA 4FLSA 5LA1A 5LYRA 2GVYA 2DSVA 2WSPA 2DSUA 1LL6A 4HOXA 4C7DA 1V0MA 2XUCA 5E6YA 2V3DA 2WMJA 1PEZA 2RGMA 1E4IA 5ABEA 5EBAA 5JBEA 3AZSA 3TA9A 3WMSA 2CESA 1ZBVA 5ECUA 4D6FA 2EPKX 3EBVA 4JIEA 2G3JA 3KZSA 2X1IA 1GOWA 1E56A 4BF7A 2J7EA 3AQUA 1JDAA 3MUY1 4W86A 3RM4A 3WF3A 1TA3B 4HOWA 1KXVA 1UR0A 2TAAA 4HOZA 5A95A 4U3CA 5E70A 3OLGA 1UA7A 2DEPA 1BLIA 1CWYA 2DT3A 2HISA 4HA3A 4CCEA 1R86A 3I3DA 4GI8A 2JEPA 4TXEA 1WO2A 2DSKA 2JE8A 1H0IA 3QOKA 2E3ZA 4W7UA 3ZR6A 1OD8A 3N04A 4ZEPA 4DUWA 4AWEA 1VFMA 3DHUA 3SCTA 4UTFA 3VNYA 1HKKA 3BMWA 1HJQA 1SMDA 1ZBKA 5HXMA 3F5LA 2VJXA 1L0PA 1R85A 3W0KA 3N13A 2XIBA 1E73M 3OGSA 3VMPA 4KWUA 4CCDA 2D20A 4FLRA 3ARQA 2VVSA 3AXIA 3UEQA 4PMDA 3B9EA 2ZXBA 2DGAA 1JZ2A 3AHVA 3IAPA 1JZ4A 3BAWA 3F5KA 1RPKA 4W5UA 1UKQA 2XFRA 5DO8A 2IUZA 1FP8A 3MV01 2WB5A 1E0VA 4AD2A 2O9RA 1US3A 3A4WA 4W88A 3OBAA 3AMLA 5ABFA 3WDJA 2J7FA 2D24A 5BROA 2CITA 3CH9A 4PUDA 1TE1A 3GM8A 3PHAA 5FKYA 3FAWA 1HP5A 2XPKA 4F9DA 1WAWA 4NRSA 2PB1A 4AZ7A 4AXNA 4U5KA 2RGLA 1BYAA 1ODUA 1PX8A 2Y8VA 3W38A 1V3JA 2WMKA 3OLDA 3EDKA 4JFSA 1JNDA 4JCLA 1JIBA 3CTTA 2GUYA 4LX4A 2FHBA 3UESA 4PMVA 2O9PA 3WBAA 4J27A 2YL6A 5CQ1A 1BGGA 3VDHA 3UERA 8CGTA 2WSKA 4EK7A 3W6MA 2WLZA 2E9BA 3KWXA 3AIWA 3SEPA 2J75A 2QPSA 3GZAA 2CXGA 4V2XA 2ZE0A 1JAEA 3NSNA 1FOBA 1QPKA 3WNKA 1VFUA 3ARXA 2J77A 4H7VA 1O6IA 3UG5A 2GK1B 4Z2JA 1KGUA 2VRJA 1JZ5A 2O92A 2UY2A 3EDJA 3BMVA 3U5YA 4GQRA 1ESWA 3EMQA 1H3GA 1UOKA 1X1NA 1WDRA 5AYIA 3ORJA 1M04A 1XHGA 1YHTA 4JKMA 2WMIA 2XTKA 3HMCA 1FHDA 1KBKA 4PRWA 4D1IA 7TAAA 1P6WA 5D9PA 1V03A 4MNJA 5CXPA 5A8NA 3GXDA 3CUIA 3A4AA 4D6EA 1B0IA 5GNXA 1C90A 1UA3A 3WENA 2DT1A 1J0KA 5CSYA 5A94A 4LPCA 2BVDA 2F8QA 4BQ2A 2WVUA 1GW1A 3WFZA 3AS0A 1E72M 1W9UA 1B3XA 1MXDA 2ZUMA 3WN6A 1EQCA 4JFWA 1GNXA 3NCOA 2C7FA 1MXGA 4UFKA 4PCSA 3RM8A 7A3HA 2WVSA 1W1YA 1JGIA 8A3HA 1WMXA 3ARWA 2C24A 3ARYA 4D6HA 1H2JA 4RE3A 4OIFA 4MB5A 4PSPA 4NF7A 3VDBA 5DFAA 3RIKA 3ARVA 1GJUA 4JKLA 3L2LA 2QMJA 3RJYA 1MW0A 1OT1A 4PYSA 5A2BA 4X0NA 2WMFA 1RD6A 3W6LA 3WFLA 5DT5A 1UWTA 4P8WA 1UD6A 2K46A 1C7SA 1XD1A 1XSJA 3WDRA 4CGTA 3K4AA 2YIHA 3L4ZA 2Y4SA 1JYWA 1EO5A 4PMXA 3RMEA 2W4XA 4PMZA 5FL0A 1B3WA 1OGSA 3CZGA 4AZ5A 1GOKA 4MJ2A 1OB0A 2J7HA 3QHMA 3ARZA 3PZQA 1H0GA 4ATDA 5A6AA 4TTUA 4FLQA 2X0HA 3VINA 3WL0A 2PBGA 4BZYA 5JIPA 3VIJA 1GOOA 3A4XA 4PN2A 3WD3A 4QCFA 5A6SA 4Z2GA 1ECEA 3CZLA 1V08A 4AD4A 2CIPA 5I23A 2CHNA 2V5CA 3FHQA 3WD2A 2W63A 3FNDA 2VT0A 3SUVA 5CG0A 1G0CA 4UCFA 2ZUTA 1CBGA 4K68A 1ISYA 1G94A 1WP6A 2E4TA 2XVKA 3FHAA 5A6LA 1CGYA 1UH4A 5BXTA 1WPCA 4JL1A 4QLLA 5GNYA 3VGDA 3ECQA 5I0DA 2CYGA 1DEDA 4UOZA 1XD0A 1EIBA 1HN0A 4QCEA 4UFLA 5A2CA 3T08A 3MUIA 1HJWA 2Y8KA 1JFHA 3KL3A 1UKTA 1MQRA 2CHOA 1E9LA 2PF0A 3WQ4A 3HN3A 1VAHA 3NJ3A 4PTMA 2VX5A 3OA5A 3MU7A 3ZYFA 4MPKA 1KQZA 1UKOA 4UZSA 1VJSA 5BXRA 1QI5A 1E70M 1WNOA 1R87A 4RL3A 1K9FA 2WPGA 2VCBA 1ZJBA 5HOSA 3BSHA 2WW5A 3BXWA 3DHPA 3WMCA 1I1WA 4CU6A 2NW0A 1V3KA 1V6UA 2W92A 1BTCA 4AZIA 5IFPA 1B3VA 4PMUA 3UG4A 2VL4A 1OGGA 3VIHA 5A69A 3WELA 1MFVA 4GO8A 3A47A 4F8XA 1B90A 1NH6A 5TD4A 1EA9C 1KGXA 4WKHA 2Q1FA 4A6SA 3WKZA 2O14A 4UQCA 2KR2A 3NYDA 4LGXA 1CDGA 4UFJA 2UY5A 4M56A 2GSJA 4ZENA 3WQ8A 3WY1A 5BXPA 2EPLX 2WVTA 3AS3A 2WKGA 1NOFA 3MS8A 3NUKA 2QPUA 4Y7EA 1K9DA 4TVCA 3SCWA 4HU8A 4J28A 3WQ5A 3CPUA 4B3KA 1C3FA 1UQZA 3QGVA 4HPGA 4BCEA 2VQUA 2CBJA 3WNMA 3MSGA 2EBNA 1QHPA 3GTNA 4M8UA 4HU0A 3CBWA 2WWCA 5JBDA 4JCMA 1JNEA 1W9BM 2XVPA 2J62A 2XSBA 2J4GA 1EHAA 2GJXA 2O9OA 3OZPA 2YBUA 4D72A 4BQ5A 2WXDM 1J12A 1CGUA 1E6RA 1TVPA 1GVIA 2G3NA 3AZRA 4JZ5A 1KBBA 1GHRA 3GYCA 2FDMA 1W8WA 3ZR5A 3IANA 1B30A 3VNZA 3MMWA 2WK2A 1I75A 1XC6A 1F4AA 5DEZA 5GPRA 1J10A 3VIGA 4XB3A 1J0YA 1OKOA 2DH2A 3WH9A 1HP4A 4R27A 5AC4A 4KMQA 3OG2A 1J0HA 2A3EA 1VBRA 3G6MA 1EXPA 1EDGA 1UG6A 5D9OA 3S2CA 2X0YA 3EMZA 3ZJ6A 1GOIA 5C8BB 1UWQA 2B31A 2D0FA 1JI1A 1WZLA 1W3HA 1HKMA 2JEQA 1J0JA 3SUSA 3VTRA 1E6QM 1MW1A 1RP9A 4JFVA 4M1RA 3WF1A 4P8UA 2DDXA 3WQWA 5A6BA 2VTFA 2BVYA 2J8FA 5E0CA 3W4RA 5A8QA 1D7FA 1UWIA 1J18A 2Y5EA 5CSUA 4GO9A 3CZKA 2W5FA 4AMCA 3VOCA 1EH9A 4CU8A 1UKSA 2A3HA 3WF4A 1HVQA 1IZJA 3O6AA 3SCQA 2WHKA 1KR1A 1UYQA 2FHFA 4GXPA 4H8VA 4JHZA 1ISVA 5JBFA 9CGTA 4IPLA 2WKLA 4AW7A 1PIFA 1B1YA 1ITCA 1WE5A 3GNPA 3KL0A 2J78A 2WBGA 3SUTA 1E3XA 1W9XA 2EPOA 3CIVA 3D5HA 3WNNA 1BFNA 2VO5A 1Q6FA 1R7OA 2BXZA 3LPOA 1V0LA 1XYFA 6TAAA 2V38A 1MFUA 3GXMA 2YJQA 4UZUA 4E2OA 2BY0A 2JALA 3ARTA 1TFVA 2WCSA 2VCCA 3WH7A 5BYWA 1TUXA 1W9DM 1UQYA 3FXYA 4FF5A 2WANA 1PZ2A 3G6LA 1CIUA 5CGTA 2D0GA 1ZJAA 3CO4A 1EOMA 1US2A 1WDPA 3DC0A 4AIUA 4UFIA 1HX0A 3AYSA 3AYRA 3VGEA 1E6ZA 3WUBA 4KRTA 3ZJ7A 1IT0A 2F2HA 3WUFA 5CLTA 1LF1A 1VB9A 1H49A 4CCCA 3CUGA 1VIWA 2DPEA 3TTQA 4U31A 4AYSA 3PN8A 4GI6A 3CHCA 5I78A 3O2LA 3WDIA 4GIAA 1CXHA 3LPGA 3OZOA 1HL9A 4HP5A 2OLHA 1UZ4A 1B2YA 5FIPA 3A6OA 4IISA 1W3LA 4FK9A 1H11A 1Q6GA 3VIOA 3TTYA 2YL5A 1C8XA 1HJVA 3A3HA 2ZXDA 2J25A 1HT6A 4S3KA 1UHVA 3M7SA 1BG9A 2OSWA 4AZCA 5A1AA 1W8ZA 5EFFA 2EJ1A 2LROA 3TONA 4MAVA 4WSKA 2ZUSA 3L4WA 2Z1SA 2WNWA 1W32A 2OYKA 1V6XA 3W37A 4CD8A 4CPBD 4M81A 5BWFA 1CZ1A 1AQMA 3W25A 5I77A 1DWJM 3AIBA 3RCNA 4MB1A 2XGIA 4ACZA 4NSBA 4OZOA 1ZU8A 2DH3A 2J7BA 4AD5A 5HBFA 1GPFA 3WF0A 4WF7A 3GH7A 1E6NA 1FFRA 3DYMA 3RJXA 5I24A 1BG4A 4Z2HA 3IK2A 2JIWA 1OH3A 1AVAA 2D3NA 5EMYA 4B9ZA 3BSGA 1NWUA 3CUJA 2X8RA 1WB0A 1UKPA 2AMGA 1PX4A 1FA2A 3AMGA 3BLPX 3WH6A 4ATWA 1BYDA 4CD4A 3CUHA 1C91A 2XYLA 4M80A 2XHYA 5JIWA 2VR5A 2VOTA 4HMEA 1WDSA 2VZTA 3U57A 4UQAA 3PBGA 5I2UA 5HPCA 4LJHA 4EANA 3APGA 3OLEA 3THCA 1V02A 2BY2A 4AD0A 1J01A 3WNPA 4J3UA 4DWSD 1W90A 4A3HA 3OB8A 3VMNA 1I1XA 2VVNA 1H41A 1QNQA 2J7GA 3ALFA 2W91A 1J0IA 2ZUNA 2VQTA 1W91A 1CGTA 2PWFA 4QP0A 2YLAA 4TUFA 2VC9A 3AIRA 1NWRA 2UWFA 3W82A 1GOMA 5A2AA 1W9VA 2QV4A 1E71M 2E9MA 1EDQA 4WIWA 4LK6A 4R5EA 3K1DA 1JDDA 3NDYA 3OIHA 4BS0A 3AXXA 4JHOA 3RILA 3GDBA 3AJ7A 4MJ4A 2XVGA 1B3ZA 1W8TA 1DP0A 1U30A 2DT2A 2A3CA 4TX8A 3SCVA 5KZ6A 1CXFA 1QBBA 4JFUA 3RM9A 1GCYA 3VGBA 1JDCA 4DWSB 1HJUA 2V5DA 1FH9A 3OGRA 1TA3A 3WH8A 2ZX6A 3WBEA 2PWEA 4EE9A 1QW8A 1ZB5A 2DT0A 4XZWA 2JFEX 1BVZA 3TTOA 3VIPA 3VD4A 5HPOA 5JUVA 3ZYBA 1E3ZA 4E8CA 2EPMX 4HTYA 1E5JA 3AI0A 2OWXA 2WZEA 3GXFA 3BC9A 1PBGA 1QNOA 1NWTA 4E8DA 2WYSA 1CPUA 4CVUA 4W87A 3WSUA 1CLXA 4U3AA 4AD3A 1VBUA 3BAIA 4JAWA 2CBUA 3T2QA 1V3LA 1TVNA 1JAKA 1UR8A 2WVVB 3VU2A 4P7NA 4A4AA 4CVWA 3W81A 3NDZA 4CP9B 2VX6A 4JL2A 4WK9A 1FFQA 1K9EA 4IM4A 5A6BD 1BGAA 1BF2A 1EDTA 4ZE4A 1M53A 1QI3A 4PMOA 3K8MA 4MTVA 4TX6A 1HL8A 1KWKA 1D2KA 2VX7A 4OBRA 2JF6A 3O9NA 5I79A 2WLYA 3IJ9A 1C93A 2JF7A 3VD9A 4XV0A 1PIGA 5C70A 5ABGA 1JXJA 4QFUA 2XWDA 3T2PA 1A3HA 2YKKA 2CCRA 4U2YA 1PZ3A 3AHTA 1RH9A 1EO7A 4UR9A 1UD4A 4W8AA 3WD4A 2NT1A 1AQ0A 4D6CA 1W1PA 3ZIZA 2XWEA 1M01A 3QOMA 3KEHA 3SCRA 3N12A 3CHFA 1OT2A 2CKRA 4DUXA 3PZTA 4XUYA 1XSIA 3SCNA 2BXYA 2YBTA 3AIUA 1ZL1A 3RPMA 4OBSA 2V3EA 2ZX9A 2MANA 2NSXA 1C7TA 3CZEA 2CETA 2IXUA 2G8ZA 3ZYHA 4CU7A 4UFMA 1YQ2A 3W24A 3UETA 4AZBA 1QNRA 1EGZA 1CXKA 2GK1A 1B3YA 2WHJA 1V6VA 1GWLA 3BGAA 1DHKA 1E43A 1UWUA 2J79A 1H09A 3PTKA 4P8VA 2D0HA 1E0WA 4AZGA 2WCGA 5D21A 4PTVA 2XVLA 1VFOA 1KGWA 2UY4A 1KCLA 3WEMA 3EDFA 1V0AA 4W8LA 2ESCA 4CD7A 3WH5A 1M7XA 2YL8A 5GNZA 3POHA 1LJYA 4ML4A 3SCSA 1JYNA 1BSIA 1BYBA 1NQ6A 2UY3A 4MB4A 4GZIA 4X9YA 2XM2A 1QOXA 3PZUA 3WNLA 1CNVA 1KQYA 4BA0A 4LKFA 1JI2A 3PZGA 1UZ1A 1H5VA 1W2PA 3UCQA 1XH0A 1TG7A 3U5UA 3NSMA 1ZS2A 1KXQA 3T0DA 3UR7A 3MUAA 1DWGM 4ZE5A 4HA4A 1Q6EA 3VO0A 4B9YA 1HKIA 4HA1A 5M5DA 1VENA 1TZ7A 2CKSA 1U2YA 1NM9A 3SIMA 2XSAA 1V0KA 1E6SM 2FH8A 2W61A 1DWFM 3F95A 5CPTA 3ARUA 1CXEA 2CNCA 1CENA 3UR8A 2ZX8A 1LWJA 4M82A 1XCXA 1UD8A 5CZKA 4J3VA 3FAXA 4AEEA 5A3HA 1G01A 2W67A 5D8WA 3ZJ8A 1G1YA 3LPFA 5BRQA 4E4PA 3CLWA 5A8PA 1GQIA 1JXKA 3THDA 1E4NA 1H1NA 1QI4A 2W62A 1KWGA 1GVYA 2PC8A 2J74A 3SUWA 2YOCA
chains in the Genus database with same CATH superfamily
4FXFA 3DFTA 4XAEA 4ZQOA 5D37A 4AIOA 2POZA 5DF0A 2LLEA 1BK1A 1XLIA 5T5LA 2A3WA 3TLQA 1OYBA 3UFYA 3BALA 4AQ2A 1WAUA 1W6NB 1SW7A 1TPVA 3LRMA 3HIFA 1UR9A 5JVLA 1ZBA3 4GI9A 2I45A 1U5HA 2NUWA 3WIJA 5C7GA 4NZ4A 4GYPA 2WFF1 1SMAA 1V6MA 4TVUA 2OB3A 2VMFA 4OJYA 2E9QA 1VAKA 1V6TA 4LLOA 1LOFC 1DORA 1XLGA 4C7GA 1UJPA 1ZLPA 2YB4A 3N6JA 1QHOA 5ABFB 3AYVA 3VE7A 1WZKA 3LDRA 4EF9A 1L3JA 5HMDA 2RS12 1SO4A 1ST8A 4Z8BA 3NNLA 2EA7A 3RZKA 1XIDA 4NJ4A 4I9MA 1KITA 4C6KA 2BV4A 3OA3A 4H7LA 3UG8A 4H2CA 1JF6A 2CGPA 1CPNA 1R1A3 3BUCA 1EOKA 4Z0JA 3GALA 3E12A 4PT6A 4DNHA 3KFTA 4QKNA 2F61A 4NO4A 3TYJA 5A3OA 1DYKA 4FOWA 4WM8B 3RZJA 3BVJA 4XFCA 2FPTA 5A6QA 4Y9MA 1L6GA 4ATLA 4Y4RA 1BWLA 4XYXA 1ZCCA 1OFSA 2WT2A 3M46A 5FK8A 1OINA 3BAKA 4PCNA 5FFOC 4KWJA 3HV8A 1D2QA 1QJEA 1Y7VA 4ZMGA 5A6MA 4JTOA 5FKCA 4YM1A 3NL6A 3N19B 1XOYA 2TUNA 4RYDA 1J84A 2JENA 1DE6A 2WO5A 1S39A 5G4HC 1AUSL 3ZSSA 4WJXA 1GUIA 5AFEA 1X7NA 4YG3A 1PHWA 4PQQA 1VIZA 4AIEA 1H8TC 5F37A 3I2IA 3I6EA 5I3JA 3ZXDA 1ND2A 2P76A 3N18A 4U5IA 1ISZA 1E0XA 3K4WA 4B5SA 3HN1A 2EPNA 2TNFA 1QKQA 4P5UA 2EKCA 1E6XM 1EAH2 1O5XA 4F8AA 3WDQA 2PDUA 3ITCA 1WCQA 3B8IA 4PFHA 3FK4A 3T1LA 4NP7A 1QQP3 4KKXA 3AHYA 2PWHA 1PMJX 2VMEA 2QF8A 3NQ8A 4NRRA 4IV1C 2B9UA 2HROA 1K45A 4XIOA 2C1IA 3W7IA 2WSRA 1BWVA 3U2ZA 3HVDA 1EJXC 1IS6A 4RGAA 2Q02A 1VMHA 2HWD2 3MV11 5LKYA 4UTUA 4Q26A 5GZCA 3ME2A 5A3WA 3JS3A 4CEUC 3OP2A 5BNQA 4H6QA 3TE9A 3TKFA 1PK6A 1XYZA 1DWHM 2GDVA 4GZJA 4QLJA 3OEAA 4FR1A 4Y1YA 5EQUA 3T09A 5D9NA 1VBE1 3UA3A 2OSYA 1UZYA 1PWLA 1QR7A 5FEZA 2CGNA 1PYFA 3FGCA 4CQ9A 2V3FA 5M3WA 2INEA 2PHWA 4WKFA 4K2SA 5CPQA 5GQBA 4YHGA 2QJGA 3MZNA 2ZA1A 3I4IA 2VE1A 5M1TA 4XETA 2IKIA 2AENA 1UMIA 4Q1RA 1X1OA 1MACA 3T81A 3S42A 5I8SA 3O1NA 3M5YA 4N43A 5BNNA 1OIMA 2G4IA 4K1YA 4KEZA 4ORMA 3DDMA 4TIMA 3VIMA 5BCAA 5DAVA 1ADOA 3HOBA 1V6LA 2PHDA 4EN8B 3IUDA 1R8LA 4LU0A 2CWNA 2ORXA 2DQXA 2WSVA 1FWDC 1GWKA 2QW5A 3CMFA 2W0XA 5IVFA 2AOSA 3DFYA 1RLCL 1WA6X 3N9NA 1BZWA 1G69A 3GGLA 1R7AA 3Q8EA 5KINA 4GJ1A 2I5GA 1YMYA 1OA2A 5I93A 3HGJA 2NMOA 2HVMA 3LHYA 4O28A 1KCKA 2E8ZA 2DUQA 1W1TA 4GXMA 4WDXA 3QV8A 4WCJA 1ULFA 1B31A 2Y2WA 2Q8XA 1RUH1 3WNOA 1PNFA 2PYTA 1FY6A 4CEWA 5IAVA 4G1KA 4AH7A 3B03A 4W8BA 2ABBA 2YLLA 4C6BA 3W28A 4CZSA 5ABHA 3GJBA 5E5CA 2A75A 3UKTA 1YFXA 2A73B 4FLOA 3VBOC 4D6IA 1PZ7A 4LUJA 2TODA 1XBFA 1HO4A 4UWDA 3E1F1 2J8GA 2REQA 3HGSA 3C5QA 1M7OA 3VILA 4M3CB 1W5OA 4GGBA 2Q8DA 4AHZA 2QCGA 2B5HA 2R14A 2WAGA 4G56A 4MHBA 2X09A 4MDOA 1XRVA 5FZGA 3HJEA 4IFKB 4J4KA 3UQNA 3LFIA 3LHTA 4RE0A 3TJXA 1J3RA 2WBKA 2JICA 3LCWA 7ENLA 1TTIA 3LSEA 1JD7A 1F2JA 1DLLA 4FO9A 3T1GA 1JYCA 2Z4GA 1LR5A 2P17A 1AQHA 4LK7A 5EMLA 5FLHA 4E2VA 4N4QA 1H1IA 1E5NA 4ZL1A 2PPGA 4BB3A 4QX8A 4NMIA 1C8QA 2VGDA 4HZ8A 2D2HA 4EN9B 5HNUA 3UJQA 3PWIA 3DEMA 5F3EA 3EB4A 4GGHA 4HMCA 5I03A 3O63A 4MGKE 1AL23 1RJPA 4TO8A 1RHI1 5GM0A 2OT7A 1OCBA 1OGBA 2H6RA 2XIJA 5FYBA 2QIWA 1SPPA 2GDQA 3B0VC 3WX7A 5FZCA 4B91A 1F07A 4YL2A 3VCNA 1DXIA 1RXGA 2ZEXA 1MVYA 1HQWA 2VH9A 3H4XA 2GU9A 2BGSA 3CAQA 1DQ2A 3LLXA 2WFF3 1P8JA 1CLKA 1UD3A 4DJFA 2ZRWA 3QPEA 1EPXA 3VOIA 1WMFA 4QQHA 1U1HA 5KHGA 4C6FA 4P02B 3CMJA 5FY8A 5ABJC 4AX7A 4N0RA 1XE7A 1CONA 4I5RA 4JTSA 3WINE 1F5FA 4YHEA 2QDHA 4FB7A 2XG9A 2PSNA 3NAPA 2VDIA 5AC7A 4E4HA 1K7EA 3TXVA 1UU6A 2CAUA 4L9ZA 2JG8C 4INFA 2OYLA 4Z1AA 2OQYA 3VL9A 1GQLA 4EN6B 3WLJA 3VD7A 5FZ4A 1OCQA 3G2GA 3VDDB 3CJPA 1WCKA 2QQLA 2GJRA 3DENA 3TN92 2C6SA 3PZMA 2ZGUA 1K4GA 4NUBA 1Q6OA 1JPIA 3TNBA 4LO6B 4PB3A 3KD4A 4CN1A 3U9IA 3BVCA 3ZM8A 1HXS1 3LEMA 1K9TA 3ZLFA 3IGXA 3CUFA 1NCQC 2GQAA 3ENRA 4ZTYA 2PA6A 1FDZA 2NZLA 2WHLA 1PVNA 1WMEA 4L65A 4L6OA 1JRCA 3AP9A 3ILFA 1XYBA 4MNLA 4MADA 5LIYX 3EX6A 3TXZA 4ZONA 4H1ZA 3ZXFA 1A5MC 2XN2A 4UYBA 3FVMA 1OVSA 1L7LA 2VTXJ 5K8SA 5IK5A 3IJDA 1W39A 1RY8A 3LQGA 1C29A 2QUOA 2YYUA 1XCWA 5LXEA 1EP0A 4DO7A 4HJWA 5HJXA 4F3HA 1YC61 1G9AA 4MPQA 2QF7A 4CD5A 3VE9A 1WD4A 2QQWA 2IWGB 1AHSA 2WMGA 2GJXB 3NM1A 5CYYA 5DQ0A 4GX8A 3OHMB 1VBA2 1S1AA 2RDWA 1KA9F 2BHYA 3GDRA 3INPA 4PUNA 4A2UA 1Q4WA 3RGTA 3F4DA 4YGEA 1E15A 3VXGA 4IF2A 3W26A 2YA2A 4O4WA 3W29A 4YS1A 2BGPA 5FCZA 3LXBA 2XUMA 2O4QA 4JFTA 4YJ5A 3UYCA 4GUHA 2JIEA 2VR4A 1GSLA 4YFWA 5IK8A 1Q66A 1VBE3 5CBIA 3QY8A 5AC92 4PMYA 5GLVA 1QXLA 5IVBA 1ISXA 5D2WA 3USZA 1W8NA 4LHLA 4Z82A 3WG4A 4DO0A 3B97A 3QV9A 4ZOAA 2H9AB 1GV9A 2NQHA 4RR3C 4C65A 4JX6A 3WQDA 1TME2 4WX2A 1EHNA 2WHMA 2QZ3A 1OF8A 4C5YA 3GBGA 1JODA 2BZNA 2GDUA 2BFUL 2K9ZA 1L6YA 5DQPA 4N42A 1TQ5A 1TPUA 3TP4A 3AMPA 3IVUA 3ZT5A 3WBYA 2YA0A 4UTHA 5A1FA 4LNCA 3EDDA 1CLVA 1EEPA 4DX3A 3DKQA 4WVWA 7CGTA 1UY1A 4EX4A 4IMCA 4KI5M 1P4CA 5DUXA 3MBWA 4E4FA 4AZHA 4D6DA 2ZHNA 1OSEA 3CHEA 3WT3A 4WVXA 1XE8A 2J47A 4UMBA 3FLTA 1PO21 2L5HA 4LO5B 5SWUA 4O18A 1TR1A 4NWVA 1K6AA 1PE1A 4F2TA 2DCZA 4LPLA 1NOWA 1N1YA 5J1XA 3AMCA 2YL9A 3JUGA 4C7FA 4US5D 1DXEA 3MKKA 2XN1A 1RUH3 4HYWA 5MKGB 4D6SA 1O95A 5FRAA 1I9RA 3P6BA 4LEJA 4IGMA 4NPLA 3SISA 3KW3A 2XH2A 2SBAA 3WHTA 1PSCA 1XSKA 3L23A 3D0CA 3MANA 1VYSX 3LOBA 4QEHA 2BQPA 3ZYIB 3HT2A 4FNTA 3SRHA 5C9AB 1XU1A 5CH9A 3TTSA 3WQ1A 3L5AA 5HULA 4WDWA 1IKPA 2BFUS 4MOAA 4LH8A 2BLEA 1XRUA 2ZX7A 3NV4A 2PHTA 3IGUA 1MPXA 1SFPA 3WDTA 1LL7A 4UOQA 4PC8A 1TV2A 1JUKA 4MZYA 4AVFA 1G9FA 4AI1A 4J2PA 3M64A 4CCMA 2YFNA 2E6AA 2DVDA 4D94A 3WUGA 2B81A 4FIRA 3ZVIA 2E7QA 1GWMA 1JG9A 5AOUA 1HB1A 4DWSA 1W37A 2WWDA 4DLMA 1TKKA 4MJZA 1ZAIA 4KIRA 2ZOEB 2YBSA 4Q4X1 3SCUA 4CNTA 1EUUA 4M7TA 5DT7A 2NLYA 2G3MA 3EKZA 2XFYA 3TV8A 4P7OA 1HKJA 3T2OA 4PBPA 2WSYA 4GWIA 3CUZA 4QRNA 4C6CA 2ABAA 2VYOA 4IICA 1EWEA 2EQDA 4ZFMA 4L1WA 2XIIA 2DUZA 3NL3A 2DIJA 5C9XA 4YWIA 4JTCA 1RHI3 4N9BA 5A8OA 5CGMA 2R1KA 4LNVA 5GZDA 3BARA 4NIHA 1LJ7A 2CLEA 3OQ8A 4IEPA 3LQCA 1V3MA 1I6XA 4O13A 3TWIA 3IAQA 3B9DA 4HNTA 1D0HA 3UGGA 2R1DA 5C5YA 3W1RA 2P3JA 1UQXA 1JULA 3MMDA 3NNTA 4GZEA 1HUVA 1NU5A 1Z32X 3KTSA 5IUQA 4NILA 1TZ9A 3ZXKA 2ZC8A 4AVVA 1BMV1 4SLIA 3QBQA 1DL3A 1AUYA 4OFGA 1GMMA 4FEZA 1EJSC 3C86A 5I3GA 2NXIA 1BLZA 1KXHA 1O66A 3ZMRA 4D6GA 2VEGA 4S3EA 3SR7A 1AR73 4RNIA 1XGEA 4HMDA 3A5FA 5DMYA 1SFYA 3LQLA 4I0BA 4EPKA 5AECA 4UUIA 2Y6GA 4QHBA 5G2WA 2V72A 1CYGA 1YNYA 3ITXA 1F61A 3PZVA 4QNWA 1K7FA 4XQDA 2E6FA 2QLYA 1HXS3 4BDVB 1PJ9A 3B9IA 1LG1A 4DBEA 5K9DA 3WD0A 1FX6A 4IW3A 1CAVB 3CIXA 1TJ1A 4Q8OA 3MFAA 1L7QA 4XCBA 3C0SA 3AXDA 1OY0A 2PWGA 1UWAA 3F4VA 4WQ6A 3UWVA 2O0OA 5K0UC 4K8EA 3APBA 3OUHA 4K7JA 2EAWA 3LFMA 5AHEA 4LCSA 2ZWYA 1KXTA 1PZ1A 2HWE2 1SFLA 3WLQA 3H26A 1Y5VA 3AIVA 3BANA 4OQ8A 3MUXA 4IJCA 4A8LA 4PODA 2Z42A 2JE9A 1QNPA 2X7VA 3LM3A 5XIMA 1ZREA 3S5AA 3UG3A 1W9PA 2ACSA 1LOQA 4B90A 1RUD1 3S0MA 5BXSA 4XMAA 3L4TA 3QMSA 4X2RA 5A8MA 1XE0A 3UYJA 2A79A 4JTUA 4FNRA 2F38A 1N82A 5L7OB 1PGW1 3RRDA 3MT1A 2W3ZA 4YYCA 1IT7A 3N2TA 2Y89A 4LWWA 2D6KA 5C9ZA 3LPPA 1POV0 3WLRA 2XBO2 2PTXA 3VMOA 1EC8A 1R9YA 1RGSA 3H9AA 1HJXA 4RR4A 2W08A 5JZGA 1T0OA 2XDVA 2Y5JA 3GVRA 1VFFA 5F9TA 5AHIA 3HBZA 4Q0SA 4NAOA 4ZOCA 3F2DA 5IVJA 3HT1A 1G7YA 1JFXA 4QQPA 3YPIA 4A2SA 2NQZA 4Q8WA 2WT0A 5LBBA 1KFUL 5FZHA 1FWWA 4IGPA 3NSTA 2OJPA 5AC5A 3S9YA 2W3JA 3ABZA 5FSDC 1TPEA 1SUXA 1UOZA 3THPA 4ZO6A 4R7WA 4IV3B 5A7NA 2E77A 2Z2SB 1LL6A 2XUCA 4NJHA 5I06A 1KV8A 3GU1A 2QIIA 4YVVA 3RPDA 4GVGA 2JDUA 3G5EA 2E7FA 4O7XA 1UASA 3QW4B 4GVFA 1V6NA 3NZPA 4EQVA 3WMSA 5J09A 1VLNA 1DG6A 3DX5A 1ZBVA 2ZEWA 2ZA3A 4C6QA 1VD6A 2VC6A 2BWAA 3KLKA 3NJXA 2W79A 4JYFA 4D69A 1VBB3 4DPNA 3VAVA 3RF9A 3CC1A 3DL3A 3MUY1 1O8SA 3DUGA 1TA3B 2P34A 3IIPA 3MWAA 4DEFA 4HOZA 5E70A 5DRIA 3QQ0A 4N9DA 4EACA 5D1IA 4COYA 2X16A 4N7IA 3M0ZA 2JEPA 3SJ3A 4L9YA 3ABSA 1WXZA 5HI0A 1OD8A 3N04A 3UWZA 2AKZA 1MS3A 1GJPA 3M44A 4C60A 2RG4A 3M0YA 2RDTA 1A0DA 3USSA 1VFMA 3DHUA 4XBKA 1R3TA 3W1NA 4QPGA 5XIAA 4B1LA 2UWBA 1HKKA 5DMLA 3LCGA 1XRTA 5A3TA 2XHKA 5FZ3A 5LATA 1B35C 1JS9A 3ZFFA 3N13A 4AXKA 1P0DA 4R7JA 1FXZA 3CH0A 4ORFA 1C57A 2C26A 1ZYBA 4N90A 2OZ3A 3OYWA 3NM3A 1WLDA 4RGGA 2O1QA 3NYZA 1GP6A 4UBGA 3AHVA 2GGIA 1HGWA 1RPKA 1AFSA 2OXNA 4W5UA 1RXOB 5B4NA 5T5PA 3KCOA 3QZEA 3UJSA 2ICSA 2WJSA 3W74A 1HV0A 1E0VA 1CQ9A 4CCJA 3C3VA 4A42A 4JX0A 3N4MA 2O9RA 3A4JA 3WQFA 4AEOA 5DUVA 3OBAA 2VEFA 3HM7A 2QAFA 2ZRVA 5H9RA 4UNLA 1BF6A 4LVAA 3WDJA 4COWA 3AJZA 4PR4A 4S2HA 2GWGA 1R9XA 2TMDA 4Q4X3 2CITA 1UCXA 1VBGA 2P10A 4KS0A 1IS4A 3LTSA 1XIMA 3TQ0A 5T54A 4BE3A 1VB4A 2HWF1 1AW2A 2PB1A 4AXNA 4U5KA 3ZO0B 1OFQA 1M3UA 3ST7A 2AQWA 4LF1A 5C8CC 1XISA 1PX8A 2Z1XA 2ORZA 3TEZA 2WO1A 3GHMA 1H5YA 1HG3A 4QNEA 2UY9A 2DUOA 5ACA1 1QH7A 1ZRFA 2WMKA 3SQLA 2NVAA 2KD7A 4IE4A 1V00A 2PTWA 4LJ3A 1F5ZA 4WVMA 1W5NA 4JTRA 1FCUA 2Z7GA 4K1WA 4IEYA 2YL6A 3U07A 5CQ1A 2QCFA 1H60A 5CFCA 3VHNA 2JG9B 4CNPA 1MUWA 3HQUA 2E9BA 3KWXA 3AIWA 1F15A 1UZWA 2QPSA 3GZAA 1VBJA 3MW4A 1HRI1 5I0TA 5JMOA 1VFUA 4GCAA 5LBCA 1XIEA 4NT0A 2YZ4A 2POTA 4H7VA 4WZCA 4KT2A 1N1SA 3L0NA 1DHKB 2Q1MA 3N9PA 3R79A 2VRJA 5F32A 4IXHA 7ODCA 1F74A 1JZ5A 3N36A 2O92A 3UZ5A 2SLIA 4Y8EA 1I5PA 3EXTA 4HXCA 3GZEA 4AF0B 1COV1 4L1XA 1OZQA 4Q4RA 1Z6KA 1IKQA 2WT1A 3ZSLA 1XGDA 3QYSA 3PFMA 4FP1A 3R6SA 4N8MA 2VGGA 2NVCA 5JXJA 2WMIA 3DI1A 2XTKA 4WXZA 3HMCA 3HQ1A 4PRWA 2X53S 4NAMA 1HKVA 3LMZA 3GR7A 3VZZA 2AQVA 3GXDA 3WW4A 2ZA2A 1QCWA 2C71A 5CJMA 3MUCA 1W1B1 2D43A 1WLWA 2FZ8A 3T55A 1J0KA 4M4RA 2CDPA 4RA0A 5CSYA 5A94A 3N9MA 4UR8A 2BVDA 5H1WA 2DCYA 2YPJA 1XLKA 5LIUX 5AVAA 3WFZA 5FI8A 1RUD3 4DO5A 1E9ZB 1MXDA 3EX2A 1OYAA 2ZUMA 3WN6A 5J5DA 4LSBA 2E63A 4R33A 2PE4A 3T40A 4MGSA 3HURA 5M2FX 3NZ1A 4LBUA 3PBWA 2WNQA 1JGIA 2P1FA 4KGQA 3SGZA 3ARWA 3N14A 5HV4A 3ARYA 3K2GA 1VFSA 2WNUA 1ITUA 4OIFA 4QITA 3WMLA 4LE4A 4NF7A 1NVMA 2P6HA 4NOTA 5C9WA 2P3EA 3HBLA 1DLCA 1FMD2 1V7AA 5FP4A 4XVDA 3LD8A 3B0YA 1MW0A 4KWOA 4PYSA 4X0NA 5LBEA 4QXIA 4IGOA 3EWZA 4DVOA 4TYSA 3C0LA 1HRV2 3ACHA 4LAOA 4X9SA 1XD1A 5AFDA 4S2DA 3ZDVA 1GTEA 2PHRA 2QQVA 5IDZA 4UTIA 3WLLA 4IXXA 2D6MA 3ONCA 1OGSA 2J24A 2YXOA 1C1FA 1A5LC 3LGGA 3KVAA 1XLEA 3DFPA 4NVTA 4BY3A 4QGLA 1KM3A 1RY0A 2I9EA 3PZQA 2PTZA 4ATDA 1A78A 5DUUA 3BZJA 4QPIC 3APTA 4MWAA 1YFYA 2X0HA 3IWZA 3G1RA 5E1QA 2HS6A 3AXKA 5LW9A 4ZXEA 1LUCA 3BLFA 3IIZA 5I7GA 5CAHA 5JIPA 2VFFA 1X9PA 4PMJA 5A6SA 1RVKA 2QCMA 2QCDA 2DZTA 5FF2A 4QROA 1XLAA 4XBJA 5AC8A 5I23A 1H7WA 2CHNA 1HV1A 3CB3A 5HCFA 1H2LA 1FI2A 3QACA 4M7SA 4Z1CA 1MS9A 3E2VA 3OBZA 4UB9A 1QO5A 4UCFA 3T9PA 1NE4A 3E6CC 4K68A 5FZOA 1WP6A 1GYNA 1UH4A 2OVUA 3UWWA 3SNMA 3P5ZA 5FZLA 2FB2A 4OYUA 5KXEA 4QLLA 3H12A 5GNYA 3CZUA 3MIGA 4DI8A 3UF9A 2FQIA 3A0NA 2VVFA 4A7ZA 2JDZA 3AYDA 3GXNA 1R3YA 4IIHA 1VPHA 1B4KA 5L19A 3IB3A 5T9CE 2KXLA 1AZ1A 1MUCA 3MUIA 4GUJA 3FX4A 2AEYA 1PVXA 1YQCA 4CUGA 4WGHA 4LB4A 3S1WA 1JPDX 1MQRA 2QT3A 4U2AA 4Q8NA 2H0VA 3VOJA 3NJ3A 4E2QA 2O4MA 1Z42A 3OA5A 1FWGC 3WSOA 1KQZA 4RLIA 5U7SA 3EPMA 4V33A 3H2EA 4LBOA 1ZBE1 1ENXA 4XHBA 1AJOA 2JKPA 1L2UA 2ZABA 4RK8A 3P2VA 1S38A 4JGZA 2WPGA 1RUSA 3R8HA 2NX1A 1JW6A 1GQNA 4A44A 3C2OA 1A3KA 3U4SA 1I1WA 3HPSA 3NQVA 3MLJA 3S2JA 5IFPA 2IQ0A 4AZIA 1XLCA 4B2DA 2ZBTA 2WOQA 1EB3A 5C4WA 3UG4A 1JUHA 2VL4A 3D4KA 2OLSA 2NUXA 2HWF3 1OGGA 5F5AA 3WLPA 2Y0IA 2GGGA 4KWLA 1JVNA 1NH6A 5ACA3 1QWGA 3SGGA 1XNBA 2ZX4A 3T44A 2Q1FA 3ANYA 3WKZA 3W2LA 2CLKA 2ZFAA 4ZENA 3WQ8A 2EPLX 2IQDA 3QY6A 4OWGA 3HQRA 2PTMA 4HSLA 3AS3A 8XIMA 3ZPYA 3MS8A 2WWJA 5G5IA 3AXMA 3W7LA 4PUKA 3Q2DA 3SCWA 1P0BA 5KTLA 3VI2A 4UTTA 1W1ZA 4JDNA 1RJ7A 1F05A 3F03K 1HRI3 2VQUA 3WNMA 2R6OA 5DXYA 5C9UA 3FKKA 2PWVA 2HPIA 2VBBA 3AALA 4HU0A 2WWCA 4JCMA 1JNEA 2OT1A 3STFA 4KBXA 4E4SA 2XVPA 3GWQA 2FVKA 2G5WA 4ERIA 3WLHA 2J4GA 1EHAA 3O6CA 2YBUA 1RVF2 3E6BA 4L5ZA 1COV3 2R91A 2WXDM 1V70A 1WDWA 3GHNA 1TVPA 2WNEA 1XICA 3R8RA 2RS32 3QSRA 1E5RA 3C8NA 1DF0A 2Z2BA 1M1BA 4HZMA 1GHRA 1XIFA 2AQOA 3V36A 3S1XA 4O9EA 4GI4A 4IGSA 1DKWA 2VECA 4K39A 4K20A 3FJNA 1XC6A 3H7YA 3R5EA 2A2IA 5EP9A 2BWGA 3WQCA 1J10A 1YTDA 1F6YA 1I4NA 4LORA 3PJTA 1UYYA 4XB3A 2QQPA 3WH9A 2DBIA 2E28A 1SEFA 4R27A 3RPTA 2DUAA 2A3EA 3G6MA 1TPH1 1RALA 2GZXA 1J8VA 1OCNA 5CBBA 3ZJ6A 4S3AA 1W3VA 3G3DA 2OODA 1L6FA 5LZ6A 1VE0A 1XWYA 3O0XA 4UAPA 1E6QM 2DTWA 1MW1A 1RP9A 4GVHA 2DDXA 4MH0E 4IP7A 1DXFA 2VTFA 2PLV3 5GJ6A 4ZQPA 4C6OA 6ENLA 2J1SA 4AI9A 5CSUA 1Z0HA 3BU0A 1AMKA 1ZVFA 4GO9A 3CZKA 2W5FA 3O7OA 4HA0A 2Y7DA 1EH9A 3QN3A 4YCPA 3P84A 1GOXA 1OA3A 4CDXA 4GYPC 4R4ZA 1IZJA 3NTYA 2E68A 2IXKA 4JQRA 4H00A 1KR1A 4GXPA 3EWBX 3JZUA 4O16A 3BG3A 8RUCA 2XJUA 9CGTA 1RUOA 2XU2A 4ZOEA 4MLJA 1WE5A 3GNPA 5JOYA 3KL0A 4DELA 2BGOA 4LQRA 3LI0A 3I97A 1PIV3 3D5HA 1D7KA 3I3QA 4W6YA 1BFNA 2VO5A 4S23A 3IKWA 3VBFA 3V0BA 1DJWA 1EJRC 3VBSC 3RI9A 2PELA 1YIPA 3GCXA 3ZZ1A 2JEMA 3LPOA 4F0MA 3RG6A 3M3EA 1DQ5A 3EPNA 5KZDA 4KG0A 5ENLA 2OQ7A 1J1TA 4NNCA 1O5UA 2CY6A 2YY1A 3AJYA 1FTXA 3IBMA 3ARTA 1RUG3 2DFCA 1RMU3 4AQTA 2WCSA 3NMBA 2IPJA 3VNKA 3PB0A 4A8RA 2WIIB 2PDHA 2W9XA 4LO7A 2ZGOA 4D7SA 4BKNA 3FXYA 2IKJA 4RQPC 5JXHA 3PIGA 1EL3A 1PKYA 3M1ZA 1OADA 2D0GA 2GGJA 4FNSA 4LLFA 4N53C 5BNOA 3ZXJA 1V7YA 1HX0A 5F4WA 4DZIA 3GK0A 3AYRA 3M47A 5DUWA 5LGZA 4DJDD 3LHZA 3VGEA 5FPXA 1IR1A 2VXNA 4QDQA 5FDBA 4O10A 4KWWA 2F2HA 2AGSA 1I60A 4MYXA 1L2QA 3LRLA 1ND2C 2QDDA 4MSSA 1LF1A 1Z78A 4HPKB 3I2FA 4XVHA 3P7YA 4AQ6A 5A6XA 1XIHA 4V1XA 1SJDA 2J8TA 2D3SA 4YVWA 2P5NA 5I78A 1ND3B 1OPMA 1HZYA 3NO1A 3OJGA 1ZJHA 1PVC1 2OEKA 1RYYA 1DZRA 4FPOB 2PGWA 3CV1A 5CJNA 1B5TA 1OQ1A 5FIPA 3SQOA 4IISA 1W3LA 1H11A 2HDJA 3VIOA 1HLCA 2NZ9A 1A5SA 1K42A 2B7OA 4FO4A 3I2DA 2ZXDA 3BTXA 4WDTA 2A21A 2J25A 1UHVA 3M7SA 3C7FA 1QT1A 5TIMA 3WQ0A 5A1AA 1RUI2 3W7HA 1ZQ5A 3WHUA 1KM1A 3POYA 2DCTA 2ZUSA 1PK6C 2WNWA 1W32A 2PDPA 5FZ8A 1V6XA 3EQEA 1G4PA 4OI1A 5BWFA 2O8QA 1CZ1A 1FWAC 5I77A 2G0WA 5FIXA 1EC9A 1BQPA 3RCNA 1F8VA 4OGZA 4ACZA 3XINA 4NSBA 1FWBC 2A6VA 1K02A 1OVPA 5FK7A 3WP5A 4I0WB 2Y6FA 2FJUB 1Q5OA 2BASA 4AD5A 5HBFA 2PS2A 6REQB 4XPVA 1GPFA 2PC4A 3BW3A 3HPFA 4YVXA 3WF0A 3EWDA 3E49A 4GXLA 1CX1A 1FFRA 4OU1A 3ZSMA 3MZHA 4N43C 5BNNC 3OPZA 1GVQA 5D04C 1OKQA 1OH3A 2D3NA 1ODMA 1E1CA 3NV1A 3QYQA 4CDWB 2FZ1A 3CBNA 1JPHA 4B9ZA 4M6QA 4H2AA 1WB0A 3MIHA 3ZOIA 1UKPA 4BK5A 3UY7A 2GC3A 4PDWA 4AR2A 2HZGA 1TZOA 2CHHA 3BLPX 4ATWA 3M16A 2RHGA 1JCLA 4I9TA 4EWND 1CJPA 3KBSA 3UZYA 4ICNA 3J26N 4GKYA 3OOQA 1DGRN 2VOTA 3HV9A 3NOEA 5FAJA 3B00A 3COTA 4QD2A 3D6NA 4CEWC 2QQ6A 4KL1A 1UP3A 3PBGA 1NZIA 1ZA7A 2WQPA 4F40A 1AR63 1UW9A 2WSUA 2O0TA 3APGA 3QH2A 3WR0A 1K8YA 2XWBB 1VP5A 1M7JA 2GP3A 3WNPA 3W1UA 2ZGRA 5A33A 5CVRA 2DZVA 1ONRA 1P6CA 4DWSD 2D73A 5KSWA 3C2UA 3VMNA 2PHFA 1UYPA 3AP4A 3LEKA 1H41A 4ZS2A 2WNVA 3ISIX 5J7MA 1RUC1 1D9EA 1W2AX 2VQTA 3CAWA 5FQ0B 4O19A 1Z89A 2WS91 2QZ2A 3CJIA 4QEEA 4JQTA 3QM3A 4HFSA 3SCGA 1Y65A 3QY7A 4CNUA 2F84A 3ABOA 1G9CA 1VBC2 1E71M 4QSFA 4M6UA 3GU9A 3G1DA 3K1GA 3N9LA 4R5EA 3K1DA 3PPCA 2C1HA 5K7JA 3NDYA 3OIHA 3WQEA 3S0CA 1WA3A 3GDBA 5G4WA 2WDBA 2VFEA 2JXAA 5HCHA 1FNZA 3QGKC 2BERA 5GVJA 1RSCA 3CT2A 1CXFA 1QBBA 1APNA 4JHMA 3FUOA 1CIYA 4PUUA 3STGA 4JFUA 1RV8A 3DPRB 2R071 4EWAA 1HJUA 4Y20B 2VVEA 4K9SA 2V2CA 4XTIA 2JB8A 5LRSA 2ZX6A 3I7SA 3T42A 5A3UA 4LB3A 3N7MA 3BKZA 2A7PA 4DJFC 5T52A 2JFEX 3GFXA 3TTOA 3VIPA 1KM6A 5HPOA 1Q8PA 1TUFA 4GCXA 4H6RA 3NNJA 1ZZ8A 1E3ZA 3HMYA 2ZCWA 4WM7A 1QJY2 4FOKA 3LTYA 2C0ZA 3NAPC 5K4ZA 1SMVA 1QNOA 2WYSA 3I7QA 4O1DA 3BU7A 4CVUA 4YYOA 3WSUA 2EXJA 4ZU7A 1N3QA 2WZR1 1S0IA 1V3LA 3DGRA 4O0ZA 4IMDA 4PLOA 1JAKA 1UR8A 1DIKA 3POBA 3PURA 3PU3A 4GWMA 3C3UA 5DANA 4A4AA 4P7NA 4CVWA 5E9XA 3SRFA 3PR2A 3G1YA 2VWSA 3TEYA 1RUJ2 3GVVA 2CWSA 1EF2A 2MEV1 4MGIE 1NF7A 1G6CA 1S0FA 1UUOA 5FO9B 1FFQA 4L8QA 1ME9A 2I07B 5EWSA 4FAHA 4U4MA 3S2LA 2Y62A 3JQWA 4EPBC 1S2KA 1SCSA 1BF2A 1EDTA 2GVEA 4AB4A 1GEHA 2Y7GA 4BIOA 4PMOA 3NVCA 3VKDA 3JD71 4Q4W1 1LNSA 1DJQA 4PUJA 4IFOA 3HFYA 1V9U2 4OHXA 3T4VA 1D2KA 1ZNPA 3KCJA 3BTYA 3CXOA 4IPIA 4NIRA 3JU9A 4YCOA 2ZMKA 2OQLA 3O9NA 3IJ9A 3AYAA 1GEQA 3P80A 2IMRA 1H8TB 3JB4C 2FDHA 3GF6A 5FP9A 2Y5SA 1LHNA 5FZFA 4U2YA 4MV2A 4AYGA 4RN5A 3AHTA 1RH9A 4I2OA 1H7PA 4UR9A 3G1HA 3GNXA 4GIEA 1AQ0A 4CDQA 2JDPA 4D6CA 3DHFA 1PVC3 4DJDC 1LT7A 3QTPA 1ONAA 2ZZJA 1J93A 2VENA 4XZHA 1RBAA 2VWTA 3KEHA 4YARA 4WR3A 1CZSA 2ET7A 4K21A 1ICPA 5FTTC 2CKRA 5JQ9A 1H6XA 3PZTA 3FYOA 4IV1B 2O55A 2XDFA 4WEVX 1HW5A 1VHNA 3P60A 4P14A 4X6QB 2R0FA 4PB4A 1MZFA 3SCNA 2IZWA 3AIUA 2AYHA 1P48A 1ZL1A 2FCTA 4OBSA 4PBFA 4L9XA 4EN0A 3TSDA 3RJ2X 4QG9A 2P0OA 2WQ8A 1A5CA 2EAKA 4K8HA 4FNPA 3T3YA 3FE5A 4XUGA 4ASMB 2WJFA 1K12A 2VP8A 1KRBC 3KVLA 2C4XA 4MY9A 2BODX 4AZBA 4DXTA 1LHOA 3USBA 2GK1A 5I0SA 2YC2A 1V6VA 3NZRA 3NV2A 2W1WA 1E43A 3NVTA 1UWUA 1W6MB 2WLQA 3PTKA 4P8VA 1AL8A 2JDYA 2D0HA 1Z7S2 1ZRQA 4XFIA 3TX9A 5FYHA 1MS1A 4FFIA 3K2OA 4HG6B 4HHHA 2OU4A 4C1LA 3OUJA 1AA1B 3N4EA 2HXTA 1KGWA 2UY4A 3E96A 3QC3A 3UCDA 3EDFA 4LT5A 4W8LA 2BG5A 1JQVA 4LEFA 4LTAA 2RS11 4XBQA 4YW5A 1M7XA 1NY1A 4JDMA 5GNZA 2ZHLA 3NVDA 1X33A 1BYBA 3HB9A 4Y26A 2UY3A 2ZX2A 2YDAA 3IN9A 4PA8A 4XAZA 3KOXA 4GZIA 4X9YA 2VZPA 3SC7X 3IDAA 3PZUA 2FQPA 4NASA 4IE5A 4BA0A 1L8PA 3NW4A 3PZGA 5AHNA 2ZZ7A 3UCQA 1XH0A 3UP8A 1LLZA 4YM2A 2IXJA 1ZS2A 4L4LA 2DVAA 1KXQA 2VGBA 4UTMA 4I0AA 3U37A 4ZE5A 3DPRA 4HA4A 3VO0A 1HKIA 5L9BA 2HBUA 1S1PA 4NROA 2FCUA 4GB32 2CKSA 4S3BA 4JQ4A 2VC5A 1V0KA 1E6SM 1JQXA 3VZNA 4FS9A 5CPTA 3ARUA 3W87A 1AK5A 1JH5A 1GZWB 3H8UA 2ZX8A 3VBOB 1XCXA 1UD8A 5CZKA 3FAXA 2W67A 5CG9A 4OHYA 4ZODA 5F5IA 1G1YA 3I59A 3LPFA 3OIXA 3CJXA 1EAH1 5KXDA 5E8AA 1RUC3 5A8PA 5BZAA 1QI4A 4NX0A 3AWNA 4OMCA 3ZIWA 2J74A 2DUXA 4MM1A 1TPFA 1V5XA 2ZQ0A 1KM5A 1H0BA 4ES8A 4RFT0 1W0NA 4DXZA 4DWSC 1MYRA 4F0RA 3LK6A 3CEWA 1G9HA 3TN5A 4O4VA 1CAWB 2Q8OA 5KHHA 4GMP1 3U10A 4MWAE 1X97A 1UOJA 1O59A 2ZBJA 3RQ0A 1E4LA 2WNNA 5FF0A 1F9KA 2D6NA 3PUAA 4AL9A 1LQ0A 5EMUA 3ZT7A 4IMFA 2RJGA 4ALDA 2HWD1 3VKCA 3VGGA 3FS2A 3UKNA 3KVMA 4G7EA 2W1SA 4CRQA 1GGOA 4RNJA 3LDVA 3LGRA 4PMRA 1S2UA 3ATGA 3QHOA 1EFZA 3VDCA 5D2VA 4ZKTB 5B4XA 3O1UA 2FVLA 4DM2A 1ZZBA 3M70A 5A32B 1R3QA 4W7VA 2GQ9A 2PODA 4YWAA 2VZSA 4CP1A 2BXVA 1YI7A 3K46A 4MB3A 2QQJA 2RUSA 1SLTA 2P8CA 3I3BA 3VBUA 5LIXX 3GH4A 5AYBA 4KWSA 2BNJA 2Y6LA 2H6BA 2PCEA 5ABJB 1GPWA 4IG2A 2BS9A 3PSVA 4HT3A 3KRZA 4GQQA 1OI6A 3MBFA 2B9VA 1TO3A 1VRBA 3AIEA 3TWBA 4O52A 2GMMA 1NELA 2OQ6A 2DSZA 3TC6A 3OGGA 2WZR3 3RDKA 4QX2A 1O4YA 1JYXA 1IQAA 4KFOA 4E38A 3KQRA 3CL6A 4XFGA 3IJLA 2ZWZA 4OUSA 3P0WA 4XF1A 3J7HA 1BQCA 1U1UA 5JCTA 5JIUA 3B8DA 3VGHA 3N6HA 3K8KA 1OLRA 3VX0A 2MEV3 1OD0A 1RJQA 1T5AA 4MKSA 3EA2A 1UY0A 1LM1A 2GQ3A 4UFHA 1H63A 4QU1A 4GQ0A 4RHV2 3SSZA 1G6NA 2WC2A 1UD5A 1QJX1 3JD73 4Q4W3 1NCQB 3RO8A 3RJRA 1DZTA 3O6DA 3W59A 4Y22A 3POIA 3K3OA 2C9KA 2YSWA 2VQ0A 3TZNA 3BLEA 1S5MA 2XM1A 3MPGA 4NQ1A 3IIOA 4LUIA 1RCQA 3POWA 4IEQA 4CE8A 2IPFA 4NRPA 4Q8QA 1Z41A 3EYPA 1JZ8A 3PVFA 2D23A 1RBLA 1FWNA 4CNOA 3IVSA 4GWEA 2CBIA 4HPJA 2A6ZA 3CU7A 2WMHA 1DU3D 1KFXL 4HJFA 1YW1A 3O0WA 5FEXA 4XD6A 1AJ0A 3V0TA 2RS52 3SUUA 3O1VA 1EUTA 3ZXAC 1H1YA 3QFEA 1WW5A 4Z2LA 4QISA 5JZGC 2BOEX 3LCFA 5JVVA 2VX4A 1XH1A 4ADUA 2OPJA 3P82A 4B7KA 1NFBA 4YZ4A 1EBGA 2X10A 2ZGQA 4GH1A 3LGDA 4I30A 1GWJA 1KS4A 1VALA 3DFQA 1VCGA 2QDEA 4AI2A 1K4HA 3NGFA 4K38A 4K3UA 2NM1A 3IARA 2Q71A 2AH2A 4Z2IA 5D8AA 1G67A 4EAMA 5C2GA 1YPFA 4FIQA 1NLSA 3GLCA 3P5BA 1J6OA 2YA1A 4F79A 3EWWA 1YDOA 3NZQA 4GYFA 1EZWA 1KGYA 1GZWA 1GQKA 3EXUA 1GQJA 1LORA 4B3LA 3GHTA 5CKSA 1EKOA 1IF2A 1ZUAX 1J2BA 1UIJA 4OOUA 1RPXA 3B40A 2VZVA 1PAMA 4RR3B 3CDZB 1HIZA 3N34A 4F66A 1MS4A 3MIBA 2DFBA 3ZX7A 1BVNP 5FUPA 4P9IA 5CC5A 2MUCA 2RS13 3AHXA 2A71A 3W07A 4XG1A 3L4XA 2J1RA 5FZMA 5FZAA 5EZWA 5T55A 2XJ7A 1O5RA 2I5IA 2DU2A 3WF2A 1B4EA 5CPNA 1Q3EA 3AJXA 4DY5A 4IP5A 2VY0A 4TR9A 3LV5A 3TVAA 5ANNA 4RZBA 2VFGA 2VGIA 1X98A 3PZIA 3U6WA 1VJZA 3QRHA 3WDWA 4I7WA 4TQTA 4PQ9A 3KCXA 5A6JA 5DRCA 3TN91 1J1LA 2Y70A 2OYZA 3NIYA 1QW9A 5C33A 1BWKA 1H4PA 1Z3NA 5BOOA 4ZQRA 5AHMA 4LULA 4G7FA 3CLPA 2QQKA 2XFWA 3RFAA 4GISA 3DBNA 4QPGC 5E9AA 3IJ7A 2D69A 3ARSA 1BVVA 2IVIB 6CGTA 3PZNA 4ZZ9A 2XLAA 4TOQA 2QNKA 3KTCA 3V0AB 1XNTA 3EKGA 3ZFFC 4BU2A 3NL5A 4Q4SA 2VRQA 1NAEA 3B7MA 2VFDA 4AVOA 1F5JA 1JD9A 2XVNA 2WCAA 4AEFA 2KAUC 3BCFA 5JLVA 2OYMA 3C0QA 4LXFA 1SZEA 3T8QA 3Q8AA 3B9AA 4ZGYA 1XG4A 4EXQA 3N73A 4IQJA 1EAH3 3BOPA 3N2OA 3U4AA 4BJHA 5FXZA 4JQAA 4HCHA 2QUMA 4FPKA 1OBNA 3N2BA 4RDYA 4TV5A 3VN4A 1F76A 3BLLA 3WYZA 1VBA1 3MF9A 2YCKX 4C6LA 3DIPA 1KFKA 1R3VA 1SLLA 3BSMA 1XG3A 4E2GA 1G8WA 3MEPA 4GMP3 1TE6A 4W93A 5LNVA 2X1RA 2ADAA 2GLKA 5GZGA 2YPDA 2DU1A 2GVLA 4H8NA 1FV3A 1U33A 2ZZ4A 4LAMA 3ZYRA 3KAOA 2HWD3 1IV8A 4HZ6A 4PZVA 1F8MA 1QFEA 1VRH2 3LEGA 3QFWA 4W4ZA 2Y33A 2J13A 1I9CB 3VBHA 5SV5A 3S2NA 3ZOAA 2VGFA 2YCLA 3K4DA 2FDIA 2WYFA 1YYNA 4GWJA 4KH2A 4MAZA 1AODA 5AC91 2YBVA 3EAUA 1IGSA 3A3WA 3WLNA 1KB3A 1N1VA 4AD1A 5FZDA 3CHDA 1S46A 1XX1A 1SCRA 4GJJA 1CESA 1OPOA 1MMFA 1KTNA 1ZZ9A 4RE4A 2FTYA 4GLEA 1VAMA 3AL6A 3ZO9A 5CFCC 3R8GA 1TME1 5IFTA 4P7QA 1VBD2 1ONWA 2WM0A 4X8NA 4XO6A 1CAUB 3BCDA 3VM7A 5FV3A 4W85A 3H70A 3B4YA 3CMGA 2WZMA 2WINB 2RFGA 2FCVA 2HE5A 3MDWA 1AX0A 4MLOA 4NPRA 3NL1A 4JXCA 1FPN2 1AYM1 5FPAA 1GVEA 5BW6A 3ZN6A 1CEOA 5FL1A 3ZQ9A 3OOXA 4GJYA 1AD1A 2A4AA 5JWPA 2OWWA 1POKA 2Q8EA 4IWWA 1NYWA 3P1IA 3GH5A 1UROA 3V65A 4XX6A 4WKAA 5FLJA 3AZTA 1QJFA 1UOBA 1UR2A 3HWJA 3K51A 4FPCA 4FTEA 1QWRA 2NLIA 2VI0A 3N1AA 2XJTA 3JZVA 1JZ3A 1E5HA 3ITLA 3LAGA 3VZYA 4IV3C 1UD2A 1QJX3 2QPXA 2P3YA 3LA2A 4XUPA 5C6CA 5FJUA 1G86A 3IWPA 3IIIA 4J3TA 4DFSA 2GDFA 1FHVA 4DM1A 3KM8A 5EB8A 1SZGA 4KU8A 2BY1A 2OT0A 3PG8A 4WOQA 4OBTA 2ZEZA 3WFAA 1CZVA 4DBDA 1RUF2 3CWOX 3C7EA 1DPMA 4PULA 4JOMA 4LYKA 2B8MA 3ZDSA 1QIQA 4GJZA 2GYIA 4P7LA 1NWSA 2XONA 3MMUA 1SFNA 4DO6A 3L0GA 3WG3A 2W9MA 4W6XA 5BPXA 1E0UA 4PMQA 4H8UA 2HBVA 2VMDA 3NOYA 4K6AA 3U2OA 1PS9A 3RWNA 2OPKA 4W9TA 1VJIA 1ME7A 1S2WA 3V56A 1RVGA 1EJ7L 2WNUC 1ZX5A 4I02A 2PHLA 4AI8A 3E0LA 3HIJA 5CIRA 5IDIA 2F6BA 2Y88A 2GSYA 1WOAA 1B09A 1WOBA 3ETPA 4CKQA 1W8UA 2ZX1A 4TLGA 4OMDA 2YHJA 4LIUA 5IHRA 1E1EA 1ODZA 3AUOA 4L80A 3KCYA 4BQ3A 4V2VA 2YR1A 1JUBA 5FJTA 2RJLA 1S0CA 3NXLA 4FTBA 2BHUA 4IGHA 4LV4A 4YWSA 1AG1O 1K03A 5HA7A 3G8RA 3RUBL 1TJ0A 3PTMA 4DS0A 3GR4A 4GY0A 3STCA 2BUKA 3RLGA 1OX6A 4B3NA 2L9LA 3VFLA 4OUEA 5FOBB 4IEVA 4NXSA 3UXKA 5IXEA 3M41A 4LVDA 1YFWA 3WLIA 1XGZA 2D22A 5EFDA 4Y4YA 2OZ0A 1UR3M 4YM3A 3G1VA 3ACGA 5BY5A 4O12A 4LBQA 2PBOA 1XYAA 4RDZA 5E89A 2A6LA 4NHMA 3VM5A 1TPWA 4JIHA 1LENA 3DG6A 1QAPA 4XOGA 3AMHA 3HJZA 3MWCA 1BRLA 2Y34A 4M5PA 3ABXA 4B5VA 2ALDA 3QLDA 5E0FA 4K40A 3LCIA 1OC1A 1W6PB 2R1BA 3R12A 2DVFA 3OGVA 1RA0A 3VDAA 4IZGA 4AI0A 2EXIA 1I45A 1JOBA 3MSDA 2W95A 1U5VA 2F9RA 4ZB0A 1UWRA 1DJYA 1V6JA 4E3VA 2DWRA 3UT0A 5C54A 1ISWA 1X7FA 3BG9A 4XIKA 2IXVA 1EGVA 3MDUA 1V3IA 5CJ5A 4JN8A 4ROQA 4DI9A 2D6LX 1W54A 3TSBA 1QY4A 1UKGA 1B35B 2HWE1 1A5OC 1U22A 3IRDA 2WL1A 2JG9C 1CTNA 3KZPA 3LLDA 5A5WA 1QQP2 1YNAA 3SMHA 1R082 1KM0A 4JVAA 1S2VA 1FCQA 2XB6C 2P5BA 3PTQA 4QB1A 1J6PA 2ACUA 3I49A 4NI3A 1SG3A 3XISA 1EJUC 1H51A 4XZBA 1UR4A 3ACIA 4WSJA 1XV8A 2EGZA 3IM0A 1UPSA 4V15A 4GA9A 1ZHAA 1NXD1 2YBKA 1RL3A 4M24A 2XBO1 2PDWA 3I4KA 4JGZC 3B9CA 2J7MA 1XUUA 2VUYA 1WV2A 1BD0A 5LA0A 1T6BX 4ZXLA 3TR2A 1OCJA 3T4WA 4KETA 4GZ9A 3M9YA 1CXIA 1JHJA 5C4WC 1KFCA 3N15A 2RVAA 5C55A 4O53A 3QPYA 4D1JA 5D38A 4MNKA 2P3ZA 4O17A 4M4PA 4Q5OA 3DN5A 2OX4A 5AYXA 5C8CB 3J8F2 4C6NA 3R10A 4LUTB 4CP9A 3ZXLA 2LALA 1FP9A 3ALGA 1C5HA 4LTSA 4QQLA 5FOOA 3BWWA 4L6DA 5JR2A 3KRUA 2PWDA 4B5NA 1Y7BA 1EXBA 4YZ1A 4O0KA 5DXXA 1IEWA 1PTAA 1TME3 1OM0A 1M03A 3WD1A 3R4IA 3TJLA 1R3RA 5FO7B 5KXBA 1YKWA 3ATYA 4UTTC 2D1ZA 3QR3A 3ZJKA 4B16A 3ZN4A 4J3ZA 3NQCA 5T5OA 1PGSA 1CAXB 7REQA 3B8TA 1TE1B 1UR1A 3ZLHA 2NYYA 1GHSA 2CZVA 2ANUA 2SFPA 1W9FA 1JU4A 1CECA 3AFKA 1AYM3 3LF7A 3KT1A 1NKGA 4PSRA 2KX9A 4I7UA 1KLZA 3AWOA 1K3UA 4NRMA 1Q4NX 2D3LA 1M7PA 3CQHA 4AEDA 1A6CA 3CAVA 4EKJA 4A21A 2NT0A 4XHXA 3AMDA 4PTNA 2BVTA 4Y8FA 3FY1A 2B46X 5BV6A 4Q7IA 3VOGA 4GNVA 5HWJA 5FXWA 5C6MA 3WLOA 4C6JA 4D8LA 2ZOXA 3AO0A 1Q8AA 2Q8ZA 3NJVA 1OH4A 1MR5A 2ARXA 1A0EA 1OQFA 1UP2A 4BOWA 4OVXA 3ZSEA 5FYIA 2ZAHA 3PTRB 1UWWA 3LBCA 3ZSJA 3VIFA 3HU7A 3B5LB 3PUIA 2Q3OA 3U3HA 1RP8A 2Z1BA 3QQ1A 3CL1A 1EIXA 1V6WA 4PLNA 4BFAA 1L8NA 3SH5A 5GZFA 3ENLA 1KRCC 4NIIA 3C2FA 2XWJB 1EQPA 3QZAA 4JN6A 4KEVA 5LHEA 4FOYA 2XGBA 1XNCA 1KO0A 3LCPA 3VBRB 1C9WA 1O4UA 4LCQA 3PBVA 4GINA 3TJIA 4ONVA 1XU2A 1KRIA 4H8HA 3ZSTA 4K8FA 4LFYA 4PF1A 1AL0G 1ADDA 3POJA 1KV5A 2RDQA 1MEC2 4M00A 1XLBA 4TX9A 1YIXA 5F1VA 4QDWA 2HEWF 4FLSA 3KV5A 1WWYA 2GVYA 1NA1A 3NNGA 4GQGA 2DSUA 4I6KA 4BWOA 5EJZB 1V0MA 2VOKA 4O0QA 4Q8MA 4WJEA 1IZ3A 2R16A 4FOQA 5E6YA 1FX5A 2WMJA 4ECLA 2PDJA 4D8AA 3WD5A 2RGMA 4JICA 5FJKA 3TA9A 4XZLX 3W7MA 2CESA 2H3DA 3EBVA 2GAUA 3U14A 4CXWA 2C18A 4L4MA 3ETQA 1VPQA 5FYCA 3H24A 1CX4A 3BMXA 2PZNA 2RJHA 4DXKA 4BF7A 4IQDA 4WY0B 3LA7A 3WF3A 1KXVA 3UXLA 2TAAA 3W1QA 3GXUA 3N35A 2XH7A 1WW6A 5A95A 2E67A 3HQOA 5F3IA 3VBFC 1CT5A 1UA7A 3ILRA 3OTRA 2DT3A 1CWYA 4LBJA 4HIBA 4X3ZA 2WQDA 2BTVC 3UXDA 4QPIB 1MDLA 5FOJB 2DSKA 4QHRA 1NG0A 1H0IA 2JDHA 4W7UA 1TRDA 4ZEPA 3P6LA 4US6A 4DUWA 3LHVA 3ZLIA 4DIAA 1DIDA 3ES4A 1YJKA 1IWPA 3BMWA 2VOWA 5HXMA 2IFRA 1GVRA 1YBQA 4GK8A 2IVJA 4YGBA 1FQ0A 2V4AA 4U36A 2ARAA 3W0KA 4LBNA 2ZRZA 1X82A 1E73M 2A1XA 4JTHA 5BNOC 4KWUA 2VVSA 4QR6A 4XFAA 5HAOA 1I5ZA 3C7OA 5L9VA 3AU6A 1EC7A 5L6UA 1JZ4A 2CZDA 1OOPB 3F5KA 3ZR4A 2FKPA 1HX6A 3B0XA 5DO8A 4Q4MA 1XYPA 3MV01 1L6WA 2BW8A 1RTVA 3JZEA 2KZHA 4YGDA 4S1FA 2A6WA 4ZO9A 4YVWC 1D8CA 5F6LB 4RZ6A 4W88A 3AUJA 1WCSA 4QKFA 2OZTA 2QDGA 2XLGA 1EF3A 1DCSA 3O8AA 1P0NA 4UXDA 2BTMA 3GM8A 1TE1A 3MFCA 5FKYA 2VBDA 3LHUA 4NAEB 4KFPA 3FAWA 1UB3A 2XPKA 4NRSA 2PLCA 4MF4A 1PHQA 2UU8A 4AZ7A 3KCLA 1SLBA 3POGA 1A5AA 2XBO3 3OBRA 1UU4A 2GVJA 4NJIA 5LXXA 1I0DA 2W68A 4ARXA 5FF7A 1V3JA 4OHVA 3OLDA 1WW7A 5EHDA 2VEMA 1LT8A 5G05L 2AKMA 1XCFA 1JNDA 3H1WA 4NAFB 2AR6A 1FMD1 2CC0A 1YLLA 1S2TA 4G4FA 2G50A 5J48A 3VDHA 3UERA 8CGTA 1DQ6A 4NZ3A 2HQAA 2JGQA 3R58A 3RR1A 1PNGA 1HRV1 3FDGA 2WLZA 4REQB 3QVQA 3SEPA 4ASLA 3FLRA 2ZRXA 2R1NA 2ZE0A 3THTA 4YLZA 3UJFA 4Q4V2 3TYCA 3DKWA 4A3XA 2V73A 2J77A 1C3HA 3ID7A 3Q8FA 4XIMA 2PQQA 3UG5A 2J1EA 5FSEC 2QQUA 3OBKA 4BEQA 4CUAA 3WO8A 1LODA 1HJFA 4JV4A 3R13A 3GTIA 3ITVA 4LC8A 4PFMA 1MVEA 2HKXA 1LP6A 2WZ8A 3EDJA 3BMVA 1PIIA 4TMBA 1ESWA 2Q01A 1QDSA 2DV0A 1Y5XA 1SLCA 4QJ1A 1GT8A 1H3GA 2OQHA 5FMCA 4LS1A 1UOKA 1WDRA 3LA3A 4FPSA 4PDWC 2IQTA 1LU2A 3KS5A 3OCPA 4QHZA 2LS6A 1XHGA 3Q65A 4JEJA 3W83A 2VC7A 1W06A 4JKMA 1IYXA 4RNHA 2VW1A 5L36A 4D9PA 2LM3A 4D1IA 1Y0EA 3OGJA 5CXPA 5A8NA 5KXCA 2B4GA 2BYVE 3KXQA 4XZIA 4MGTA 5LK7B 1MO0A 4RPQA 3SITA 4YZ5A 2DT1A 4C6EA 3TA6A 5G1MA 2J27A 1UXZA 3C3NA 4X2PA 1YQ5A 1GW1A 2WJEA 5H9PA 1JCTA 4N9HA 1LCLA 1VPYA 2IPGA 4LHKA 4NG3A 4I7VA 1W9UA 1VP6A 4JFWA 2WNVC 3KBWA 4WVVA 1M6JA 1QH6A 4UFKA 1MXGA 3RM8A 7A3HA 1RUNA 4PIXA 4LITA 1R093 2WVSA 3V1PA 3NWKA 3S5NA 4XKYB 3I2OA 1W1YA 5T9BG 3JXSA 2XJPA 3CJIC 5CEWA 1BSLA 1T6GC 4HL0A 5TBOA 2WA4A 1H2JA 1JRBA 4EWDA 3DI0A 3GBFA 1KFLA 4AVTA 3BURA 4PSPA 3PUHA 3ES7A 1GVFA 1XDJA 2PD5A 5DFAA 1X50A 3RIKA 2GNDA 3D0SA 1SLAA 4LO8A 4JKLA 4FTSA 4LCRA 1XM3A 3RJYA 4M01A 1A5BA 3NO8A 4GIRA 1RD6A 4JX5A 5LZLA 3GG7A 1UD6A 3QEZA 1C7SA 1Y5WA 1XSJA 3PPFA 2DCJA 4GHRA 2WRAA 1B54A 4U28A 3KHDA 2HEJA 3L4ZA 2PP0A 2J1VA 2Y4SA 2W87A 1EO5A 4PMXA 3NQ2A 1ONXA 3NXFA 1C8M3 1B3WA 3CZGA 1OOPA 1DQXA 4FSJA 5FJOA 1OB0A 2J7HA 1P43A 1UD1A 2DUPA 4K8RB 1JEZA 3U1XA 1H0GA 5A6AA 4TTUA 5FPVA 3GNEA 3QV7A 3KF5A 3UJRA 1TV8A 3BLIA 1HB2A 5EYYA 1UXXX 3KV6A 4H14A 4OV9A 4L2NA 4UR7A 4MX3A 3VINA 4WM7C 2PAKA 1NQKA 2PBGA 1RUE2 5IJRA 1RHCA 2NV2A 4CQCA 4Z2AA 2WV8A 2NQ9A 1AR72 4JTTA 2Y64A 4BYYA 1H1ZA 3E02A 4GYJA 5C7HA 3KVJA 5LRRA 3UWEA 4AD4A 2CIPA 1A34A 4DYJA 1IIGA 4HBKA 1W5MA 4HSNA 3ZS4A 3RVHA 3FNDA 1OFNA 2PD9A 1ASJ2 4GH4B 2EPHA 2OEMA 3MI3A