4BQ4A

Structural analysis of an exo-beta-agarase
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
750
structure length
750
Chain Sequence
GSHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLEVPDSGDVNDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNQKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERLGSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
molecule keywords B-AGARASE
total genus 255
structure length 750
sequence length 750
chains with identical sequence B
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq4A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq4A02
1E6ZA 1VFUA 4URIA 2Y2WA 1BF2A 3WF2A 3K46A 4BZYA 3WNLA 5GQBA 2YBTA 2VZOA 3LPGA 3QGVA 1RP9A 3L4UA 4NI3A 4M24A 3T0DA 4QCEA 3A4AA 2CETA 2VR5A 3ZSTA 1UWIA 2VX5A 4PRWA 4MNMA 3W6LA 1CXLA 3RDKA 4WSKA 2E8ZA 3WDRA 4JKKA 3MUAA 1H4PA 3MMUA 1W90A 4AISA 4B3LA 1D3CA 1XSKA 3PZUA 5AC5A 5D8WA 2WVSA 1UG6A 5M17A 5EMYA 3AIBA 4W5ZA 1J0JA 1X6LA 3SURA 4IM4A 5JBDA 1GJUA 2OWXA 3VUPA 2ZUMA 3G6MA 1OIMA 1B3VA 2JF7A 4E2OA 2JF6A 1QI2A 1FH7A 1QBBA 4PMOA 3GH4A 5JBFA 3CBWA 3SUWA 3POHA 1CXIA 1J12A 4LKDA 1GCYA 1G01A 2JEPA 4UCFA 3O2LA 4HPGA 1GONA 3GXMA 4JHZA 3AXHA 2E9MA 1CXHA 2PBGA 2J74A 3QOKA 3GZAA 2VCAA 2VR4A 2WHMA 1V02E 3KL0A 1OCQA 3BMVA 3OBAA 1R7OA 2NT0A 4TTUA 2E3ZA 3ZYFA 1EOKA 2XVLA 2VOTA 4J3UA 4HA1A 4H2CA 3AHYA 4CUCA 1BLIA 1TVNA 3ECQA 1V3JA 2G3JA 2V3EA 3ZQ9A 4E4PA 5IXEA 3VIMA 4UQEA 4JCLA 1UKSA 1W3LA 2EXOA 4AD4A 3VMNA 4HMEA 3WD2A 1V0AA 4UFIA 1JD7A 1MW1A 1H0IA 3VDBA 1D2KA 3KWXA 4GKLA 1QBAA 1HKJA 4MTVA 4K68A 1MQPA 1SR0A 1J0ZA 2J25A 1V3LA 4J3TA 3MV11 2VTFA 1JAKA 1Y7VA 1KR1A 3WSUA 4ATWA 5M5DA 1R85A 4ZEPA 2NSXA 4HTYA 3ARUA 2J47A 3OLDA 2W5FA 3AIUA 2X09A 4WKHA 3POCA 3OA5A 3CUGA 2V3FA 4J7RA 3VTRA 4W8AA 3AMCA 1EOMA 1ZB5A 4TVUA 3CZEA 2GJPA 4FMVA 2NT1A 4B15A 3O6AA 2C0HA 2CHOA 4S3KA 1CEOA 4D72A 3IJ9A 2GK1B 5AC4A 3TTYA 4HOWA 4MNKA 3SCWA 2WYFA 4CKQA 1B3XA 3I3DA 3ARVA 1JFHA 4F79A 3GYCA 5EBAA 4PUEA 1M53A 1JZ6A 2EPNA 1W32A 1JNEA 3PZVA 4WIWA 2WVUA 4AIUA 2YIHA 3EDJA 1HX0A 1E4MM 3W4RA 1BG4A 1JZ2A 4PN2A 3KL5A 4UFKA 1UOJA 4J3XA 5FL0A 2ZXBA 1KR0A 2EPLX 4B9ZA 1EHNA 4CN6A 3VU2A 3GNRA 3A3HA 1QNPA 1TFVA 1OGGA 1L7LA 1HJQA 2XIIA 1D7FA 2E9BA 1E3ZA 2QHAA 4H8VA 1HVXA 1EDTA 4AMCA 1U30A 1G9HA 2DDXA 1OD0A 5KZ6A 2PB1A 1QNRA 3WUEA 3CUHA 5EFDA 1F4HA 3MKKA 3N12A 5A8QA 4CCDA 3RO8A 1JZ3A 1W9PA 4HMDA 1GJWA 1VEPA 4KGLA 4ZENA 4A4AA 1UZ4A 2IXUA 3BMWA 1JXJA 3GXFA 3SCQA 2FGZA 5GNYA 2YBUA 4F9DA 2AAAA 4ZXLA 1PPIA 4M8UA 3DHPA 1V6XA 3T2OA 2CCRA 1B90A 3VIKA 1E6NA 1FHDA 1WZMA 4JFWA 4UNIA 3ZIZA 1GW1A 3IAPA 4D6DA 1HN0A 2Y4SA 2O9RA 4GI6A 4GXPA 3FY1A 3GTNA 1NP2A 3PZ9A 4PMZA 4OZOA 4D6EA 3PZTA 2WHKA 4DWSD 2V3DA 2W92A 3OLIA 3GXDA 4FK9A 1JFXA 1E56A 4XV0A 2W62A 4W84A 1A3HA 1ZL1A 3WUBA 4XX6A 4AWEA 5C8BB 1FA2A 2QPUA 4CU6A 4H8UA 3GH5A 2ZE0A 4WK9A 3WBAA 4PTVA 1J0KA 2WC3A 2WK2A 1UWQA 3K8KA 2J7FA 4P7RA 2VC9A 3DYOA 3PTQA 2Z1KA 1NOWA 3VINA 2VJXA 5JUVA 1TR1A 1BYBA 1ZBVA 2WB5A 3TONA 3SCNA 2XFFA 3GM8A 3SCPA 4Z2HA 1LL4A 3BLPX 3VNZA 2ZUUA 3UR8A 4AYSA 2ZICA 5BCAA 5M3WA 1UWUA 1W1VA 4W7UA 2XWEA 3MU7A 3WQ4A 1GWLA 4HP5A 3IAQA 1XSJA 3SCSA 5HPOA 1LQ0A 1KFWA 2D23A 1NWUA 1E4LA 5HPCA 3L4WA 1V3IA 2D0GA 4OIFA 4A6SA 2EPMX 3ARTA 5FD0A 1ISXA 2ZX5A 3WH7A 1RD6A 1TA3A 2A3HA 3NSMA 5FIPA 4AEFA 3S6TA 2QLYA 1B3ZA 4LYQA 3HMCA 4HMCA 3RM4A 1KWKA 4LGXA 5DO8A 2W63A 3IANA 1KBKA 1J10A 3AHTA 1JZ5A 1B1YA 3VGHA 4X0NA 3VO0A 1C91A 4M29A 2XVPA 4GQRA 1C8XA 5HXMA 4AY1A 2VT0A 2C7FA 2WM0A 4R27A 1WP6A 3DECA 3F5LA 4UZSA 3ARYA 4HZ6A 3D3AA 3WUFA 4W89A 1VIWA 1KCKA 2WCSA 3WNPA 4U2YA 2WZHA 2W91A 2BVTA 1GNXA 3JUGA 2V5CA 1W8WA 3M07A 2WSKA 2JFEX 2YDSA 4PMVA 2VL4A 3ARPA 1WZAA 3AMGA 1LG1A 1VB9A 3THDA 1UKTA 1KGXA 2CIPA 1M04A 4B3KA 3AICA 1UH3A 1IT0A 4AD1A 3RM9A 3F5KA 1V6VA 2WCGA 1E4IA 2WMHA 2XUCA 4F9JA 1HP4A 4PMYA 1GQIA 3OG2A 3KL3A 4KMQA 4GINA 4FF5A 1WAWA 4AZBA 4V28A 4W86A 3WF1A 2A3EA 1CLXA 3AYSA 4JFSA 3ZM8A 1E55A 4MB5A 3SCOA 4UZUA 2ZUNA 5JIWA 1HKIA 2XSBA 3UEQA 4KGJA 2VRJA 2X05A 2RGMA 4JCMA 3SCUA 2FHFA 3A4XA 4KH2A 4M56A 2BHUA 3WY1A 4CU7A 4N42A 1XH1A 3L4XA 1XCXA 4Z2LA 1UR9A 4PMXA 3T2QA 2WVVA 3GBEA 5BXPA 4J27A 5GPRA 3UG5A 1H3GA 4TTGA 2WKGA 3W28A 1EDGA 2EO7A 4YW7A 5E6ZA 3B9AA 1MW0A 5A6BA 4D1JA 3WNOA 2W4XA 4CCEA 4JHOA 1OWQA 3CZ8A 4W8LA 3AIWA 3SUSA 1UH2A 2E4TA 2WMFA 1C90A 1NOFA 1CIUA 5ABEA 1OB0A 3PHAA 5D8ZA 4KRUA 3U7VA 1NWTA 7TAAA 2ZXQA 1W9XA 2HVMA 2WC7A 1EA9C 1ZBKA 2PBOA 1CXKA 5CPQA 1AMYA 3FN9A 3F5JA 2WVTA 3NSXA 5DFAA 5CSUA 2D0HA 1WKYA 4PYSA 2BY2A 5A6AA 4AW7A 4PCSA 1GHSA 3NSNA 5HDRA 1TE1A 1H49A 1YHTA 5A69A 1TMQA 1UZ1A 2OLHA 1US3A 1CLVA 2A3BA 4AXNA 1OKOA 1W3HA 2J7GA 3UT0A 3T2PA 3WIJA 4OOUA 1MFVA 2ESCA 1HJVA 3WFLA 3PZNA 3BCFA 5IFTA 3OZOA 2DEPA 4V2XA 4PBGA 1B0IA 3L2LA 4ZE5A 3AI0A 1W9FA 1W9BM 4DUWA 1QOXA 1OD8A 4MAVA 2XYLA 5I79A 2OWWA 1F4AA 5FL1A 3WF4A 4GQQA 1PX3A 3WKZA 1XV8A 4EANA 2GUYA 1JL8A 3W0KA 2O9PA 4XZBA 4W85A 1KWGA 1QVBA 1QI3A 5CLWA 4UFJA 1DEDA 4WKFA 4EK7A 2AOSA 2GK1A 4PCTA 2G8ZA 5BRPA 2UY5A 4ATLA 2J7BA 3ZJKA 4M80A 4YHGA 5D9NA 2DSWA 2E40A 5JBEA 1XH2A 5BYWA 2BHZA 4HA4A 2XJ7A 2D1ZA 4L4PA 1GVYA 3EMZA 3CMJA 1WZKA 4LK7A 2CBVA 5CZKA 2XM2A 3BCDA 1E0WA 3WUGA 7A3HA 1Q4NX 2CBJA 3B9DA 3A6OA 3OLEA 3RPMA 2GJXB 3ALGA 3W27A 5CLTA 1UH4A 4M1RA 2F8QA 3WMCA 2VCCA 4LXFA 3T0AA 5HNNA 2G3NA 4DWSC 3ZO9A 4U3CA 2OSYA 5M03A 5DT7A 1I75A 4AD3A 2XG9A 1H0GA 2CITA 1EQPA 5BXRA 3WNNA 4XB3A 1HJWA 4JKLA 5FCZA 2YL5A 2J7DA 3CZLA 1AQHA 1W3KA 5D21A 2GDVA 3FW6A 4RE3A 3U57A 1W8UA 3N13A 1XC6A 3ARZA 5I23A 1EIBA 1CZ1A 4CVUA 3CIVA 1JF6A 4MDOA 3UESA 4PUDA 1GOMA 1E6PA 1PJ9A 3ARWA 4W88A 5JIPA 3DYPA 2CBIA 3WNMA 3M7SA 1JAEA 1TVPA 2YA2A 3AYRA 4PTMA 3AROA 4PSPA 4JFVA 1BYDA 5BXSA 1UQYA 2YDQA 4MDPA 1J0HA 4DUVA 4IPLA 1UWRA 3L4ZA 2WAGA 1VRXA 1YQ2A 2BHYA 1WMXA 1TCMA 4B9YA 1BG9A 1ISVA 1H5VA 2G41A 4BA0A 3CUJA 4U2ZA 1UD5A 1XSIA 3O9NA 3WQ6A 3W26A 2CNCA 1E5JA 1PEZA 1VFOA 1SFSA 2ZUWA 3WMSA 3NIYA 3GDBA 1HT6A 3W38A 1CXFA 5ABHA 2WMIB 1NH6A 1W2PA 4FLOA 3VIIA 2JIEA 4OBSA 3VM5A 3VVGA 2XGIA 2ZXDA 3MSGA 2X2YA 1XRVA 6A3HA 4PMUA 4H7VA 4PMNA 4U5IA 1HJUA 3WDPP 1WPCA 1XYFA 2FHCA 1WDPA 2WVVB 3PBGA 1ODUA 2XVNA 3T09A 2QPSA 3BLKA 3ZJ8A 1GOKA 4ACYA 1FH8A 5BRQA 3N04A 3OLGA 2WHLA 2XSAA 2Y8VA 4Q7NA 1GORA 2IXVA 2YOCA 4CPBA 3VDAA 1QI0A 5LYRA 5FKYA 2FH6A 3TOPA 2D3NA 1JDDA 3E1F1 2BXZA 4OUEA 3VGFA 1CBGA 3PTMA 1VEOA 4QLKA 1E3XA 3WH9A 1GUVA 3HN3A 4LX4A 1UD6A 3BXWA 2ZWYA 5A8NA 1X6NA 3MUY1 4YW6A 1UA3A 1J0YA 2W61A 2DSZA 4OKDA 2J8GA 4P8XA 3VIGA 4P7QA 1FP8A 1LWJA 3K4AA 4WKAA 3IJ7A 3AS0A 1G5AA 2VZSA 5CXPA 2IUZA 3TTOA 5E9AA 1DWFM 2E8YA 2GFTA 1V03A 2YKKA 2DT0A 4MB1A 3WENA 4CU8A 3FHQA 2VQTA 4PMRA 1SYTA 4PSRA 3AISA 2JE8A 4MAZA 5I0DA 1V02A 4CD4A 4CD5A 3AMDA 1MXGA 3RCNA 5EFFA 1B31A 3CHDA 4DM2A 1OBAA 2J4GA 2JIWA 5HBFA 3TTQA 4D6FA 1KB3A 7CGTA 2VCBA 1GPFA 4CD8A 2Y8KA 3MSDA 1WCGA 2ZX6A 2XHYA 4AZCB 1PZ3A 1KCLA 4XZWA 3CTTA 2VNCA 2VVNA 2ZUVA 5ECUA 3GXIA 2PWFA 4J3VA 1E73M 3WELA 1PIGA 2XGBA 3WD0A 3BC9A 1HJSA 1H1NA 1ISZA 4AZCA 1LLOA 3EDFA 3MV01 4U33A 5E09A 1KXHA 1MW3A 3WBEA 4GI9A 4AEEA 2J8FA 2UY4A 1QNOA 2DIJA 4UOJA 3WD1A 2WANA 4H8HA 4QP0A 2WNWA 3CZJA 1QI4A 1HF6A 3NJ3A 3U5YA 3MUZ1 4AD0A 4QAWA 4LYRA 4ML4A 5TD4A 1B2YA 3EMCA 3AXIA 1RH9A 4J3WA 1MVYA 1CNVA 2MANA 3WN6A 3AQUA 1CGVA 2FGLA 3BGAA 1TG7A 2ZX7A 3OGSA 1LJYA 1JYWA 2VRQA 1Z32X 1JNDA 2WKLA 1TA3B 1W2VA 5LA2A 3QHNA 4R5EA 4P8VA 3PZGA 5CPTA 2EJ1A 1ZJAA 4TX6A 8A3HA 3AIEA 1UHVA 2OWCA 5IFPA 1QHOA 2WWDA 3ORJA 5A8MA 5C71A 1L0PA 3QR3A 2DQXA 1CTNA 3B9EA 1UD2A 4QDMA 3WL0A 3BSHA 2XVKA 2BNJA 2X0HA 3VD7A 4GO8A 2Q1FA 2NW0A 1HL9A 4D6IA 3ARSA 1O6IA 2CEQA 3PZOA 2VVSA 3L4VA 3LMYA 2BY3A 1V0NA 4HU8A 3GNPA 4MJ4A 8CGTA 5F7UA 4D6CA 4L4OA 4CVWA 3RJXA 4IISA 1KGWA 2EPKX 2PWGA 4CP9A 5A3HA 3NYDA 2YL9A 4W87A 2QMKA 1NWRA 3A47A 1MQRA 4MB4A 4WLCA 4TUFA 5DF0A 3BAWA 1BPLB 1V6UA 3ZT6A 4Q22A 1ECEA 2VZUA 4V27A 5BROA 1E71M 1BVNP 1B3YA 1N82A 4AD2A 2WMIA 3AHXA 3AZTA 3W6MA 1XYZA 1CPUA 1SMDA 5I24A 4PMDA 2Y5EA 4UQ9A 2BS9A 3BAKA 4HZ7A 1UOKA 2YA1A 2D2OA 3D5HA 3PN8A 3WMBA 1E43A 4UFMA 4CD7A 4HU0A 3AZRA 2VO5A 4Y7EA 1VF8A 3EDEA 2XVGA 4BQ2A 2PWHA 2VMFA 2WPGA 1ZJBA 1G1YA 3K8LA 1W9UA 4ACZA 4JAWA 2CPUA 3ALFA 1XD0A 1P6WA 4NF7A 3QOMA 3ZT7A 5KEZA 2W66A 1JI2A 3VIPA 1B30A 1ITCA 2UWFA 4W8BA 1JGIA 3AS3A 4EE9A 3BSGA 1QHPA 1ZBCA 3W25A 3WH5A 4KRTA 2EEXA 1TUXA 3ZR6A 1E4NA 4AZ5A 4ACZB 2WW5A 4WSJA 1HKMA 3N15A 3LPFA 1OINA 3QHOA 3EMQA 1VEMA 6TAAA 1DHKA 4S3JA 3BH4A 5I78A 2VRKA 1HJXA 1WNOA 4ZFMA 4J3SA 2ZUTA 3VD4A 3VMOA 3ZJ7A 3PZQA 3VX1A 2ZWZA 1BYAA 1V3HA 4D6HA 3WQWA 4TOQA 4P8UA 3CHEA 3VD5A 2WC4A 4W93A 2V3GA 1R86A 1W1TA 4TVCA 1OSEA 4EKJA 4BQ5A 3HU7A 1OIFA 4JIEA 4LKEA 1ZU8A 5D9OA 3VIOA 2XFRA 1XGZA 4JFTA 1JF5A 1JZ8A 3K8MA 4UR9A 3GH7A 3WEZA 1GOQA 1KQZA 1UD8A 3AMLA 1QNSA 1NARA 2DIEA 2VQUA 1GQLA 1CYGA 3AHZA 3NDZA 2YLAA 1HN1A 3OZPA 3N9KA 2XWDA 1GWMA 2WYSA 1UUQA 1GZJA 1JYNA 5I77A 3UG3A 3W24A 2XM1A 1KXQA 5I5RA 3CUFA 4BS0A 4LQ1A 1ESWA 1XH0A 4EAMA 3WD3A 2O92A 3CO4A 3BAXA 2C8NA 1E1FA 2YL8A 3AXXA 3N1AA 1S46A 3WH8A 4CCCA 3NDYA 1MXDA 2OSXA 2VZVA 3F4VA 4WF7A 4DM1A 1PZ2A 2LROA 1UKQA 4ZE4A 1U33A 2WSPA 3EBVA 2Z1SA 1VAHA 1K9EA 2DSKA 5LA1A 1EXPA 4HZ8A 2G4FA 5HOSA 1FH9A 1EO7A 1NWSA 1V0KA 4C7GA 1MWOA 2EQDA 1G0CA 4AZ6A 1VFFA 1W9DM 1ITXA 1JDAA 2DSVA 4Z2JA 4FLRA 1HKKA 1UWSA 5GNXA 2X0YA 1CGWA 5GNZA 1C8QA 1E5NA 4QLJA 5AYIA 2J7HA 4PTWA 4UOZA 2WWCA 3KE0A 3LPOA 4ZXOA 2DH3A 1W3JA 5A6JA 3W53A 1E6SM 1U2YA 1JG9A 3RM8A 3EDKA 4F66A 2D3LA 2CXGA 1SMAA 3IJ8A 1LL6A 3SUVA 1K6AA 2YJQA 1IV8A 2XTKA 1WCUA 4H41A 5A1AA 3AZSA 2X1IA 4LKFA 2J75A 5D4YA 1PBGA 3OIHA 2LRPA 3RMEA 2DGAA 2BVYA 3NUKA 1NOUA 2CKRA 1MW2A 2B31A 1DWAM 4NRSA 4GO9A 1QNQA 1C93A 2BXYA 5E6YA 1JYVA 1E0XA 6CGTA 2WBGA 2UY3A 3KEHA 2DT1A 2HISA 4LYPA 3W37A 3BAYA 3AOFA 4C7DA 3J7HA 1US2A 1CGXA 1V6WA 3VGBA 4QLLA 1H2JA 3VD3A 2F61A 4FLQA 2QMJA 1K9DA 2WCAA 1UWTA 1UKPA 1Q6EA 2JALA 1UR8A 3SCRA 3S2CA 5ABFB 1WDQA 3DC0A 5E70A 1LWHA 3L4YA 2FDMA 3WQ5A 4MADA 4UQAA 4GZJA 1LF1A 1JZ4A 4QFUA 4P7NA 4TVDA 3M46A 3AFBA 5A6BD 3N17A 2G3IA 1EHAA 1FFRA 2D24A 1KGUA 4PMQA 2XPKA 3CMGA 3FAWA 3MANA 3WDJA 2XFYA 1BGAA 1E0VA 5A8PA 2WZEA 2F2HA 3ZR5A 4LJHA 1H11A 3UETA 2QF8A 4YWAA 1C8YA 4MNJA 2CKSA 2BVDA 3L4TA 1AQMA 3SUUA 4DWSB 1HNYA 1LL7A 3ZYBA 1RP8A 1W91A 2CBUA 3VM7A 1WO2A 4TXEA 2AMGA 1BQCA 1R7AA 1UR1A 4BQ3A 1VJSA 1CGUA 2WMJA 3WQVA 1L8NA 1E6XM 4AC1X 2GSJA 9CGTA 2DH2A 4JL2A 5AY7A 3ZMRA 3DYMA 4JFUA 1GWKA 3VPLA 3VX0A 4KWUA 3CHFA 1JYXA 1UD4A 2WHJA 4TX8A 3THCA 4A3YA 1DWGM 2Q8XA 3W81A 3AS2A 3MUIA 5A2CA 3PZIA 3RJYA 5E0FA 5CPSA 3HJEA 3W29A 2YDRA 3CUIA 5ABFA 4Z2GA 1VBRA 2ZXAA 4U3AA 1GOWA 5CSYA 2X8RA 1AVAA 1PX8A 3CZKA 2GJRA 1TZ7A 1OH3A 4YHEA 2KR2A 4NSBA 1BGGA 1C7TA 1HXJA 3LPPA 1E40A 3AHVA 4P7LA 5D9PA 1BSIA 1M03A 2ZX8A 1UR0A 4C7FA 1MYRA 1UQZA 4PEEA 1WDSA 4MPKA 2E0PA 5DT5A 5C70A 2TAAA 2CHNA 4J28A 2A3CA 2VX6A 4BF7A 1UKOA 2DT2A 1I1XA 3TA9A 4B16A 2EBNA 1J9YA 1KXTA 1J18A 5A6MA 1QW8A 1CGYA 1GQJA 4CN4A 2D20A 4W7WA 1BVZA 3UG4A 3VOCA 4AZHA 1RPKA 1BFNA 3PZMA 1MFUA 1W9VA 3VKKA 1GHRA 1Q6GA 3FAXA 1WB0A 3WFZA 3OGRA 4GZEA 3VNYA 4M81A 1QW9A 4IUGA 2DT3A 2J7CA 4XUYA 3WDQA 2O9TA 1EH9A 3OGVA 3VIHA 1BYCA 2CESA 1CWYA 2D0FA 3M6DA 2FHBA 2WXDM 2O9OA 1V0MA 1QI5A 3VGGA 1E9LA 3CPUA 5CQ1A 3WF0A 2E9LA 3AIQA 4IPNB 2YL6A 4OBRA 3VILA 2YLLA 1B9ZA 4OOZA 1G94A 2CYGA 1E6RA 1E1EA 3OB8A 4AIEA 4M82A 3SCTA 5IHRA 2WZIA 1GOIA 4UQBA 4D1IA 4UQCA 5CJ5A 2WBKA 5I3DA 4AL9A 1DWJM 5LA0A 5A6LA 3VGEA 2W67A 3ZT5A 3K4DA 5CGMA 4GI8A 1BTCA 1JI1A 4BQ4A 1LG2A 2G3MA 2OYMA 3UR7A 2RGLA 4MB3A 1CGTA 2PF0A 1WZXA 3ZJ6A 1VFMA 2ZIDA 4UOQA 2WMGA 1NQ6A 1EQCA 3FNDA 3I3EA 3K1DA 2VI0A 2J78A 1PAMA 3ARQA 1JZ7A 1OT1A 3QHMA 1KXVA 1Q6DA 3CH9A 1DTUA 3SCVA 3L2MA 1K9FA 1IZKA 4JKMA 3CLWA 1ISWA 1HIZA 4YPJA 1UA7A 2A3AA 1X1NA 2BV9A 1GVIA 4HOXA 4X0VA 4JZ5A 3MMWA 3EDDA 2ZUSA 1UD3A 3GNOA 5EB8A 4UFLA 3ZSSA 2GDUA 3WEMA 1OGBA 1ODZA 1C3FA 4E8CA 5CG0A 3AMKA 1CDGA 1Q6FA 2J7EA 4Z2KA 1R8LA 5BXTA 3ARXA 1J01A 1K9TA 4MJ2A 5IDIA 3UERA 2XIBA 2PWDA 4GIAA 3II1A 4ATDA 5A2BA 1JXKA 2OYKA 3WH6A 1UYQA 5DEZA 1BHGA 1UR2A 3KZSA 4YN5A 1DWHM 1OM0A 4FLSA 2DPEA 1OT2A 1GQKA 2EPOA 4CGTA 1DWIM 3SEPA 1XCWA 4DUXA 4D71A 4QCFA 3WDHA 1DP0A 2GJXA 4JL1A 2J79A 2VZTA 2PI6A 4NRRA 1EO5A 2WLZA 4WJXA 5AYBA 2CERA 5I2UA 1J11A 4D6GA 1C92A 1EGZA 1M7XA 5FOOA 3VD9A 2PWEA 2DSUA 1WDRA 3N18A 5ABGA 1WE5A 3DHUA 1V3MA 2V38A 5A6KA 1W1PA 4AZGA 3WQ8A 1V6YA 4RE2A 5A8OA 1E6QM 1H09A 1FP9A 3BAIA 1CECA 4AD5A 1WZLA 1XHGA 3VMPA 4MNLA 1W8TA 3IK2A 3VDCA 3WD4A 3APGA 1O7AA 4U31A 1A47A 3T08A 1AQ0A 4E8DA 3BAJA 3VIFA 1KQYA 4UFHA 2WLYA 2OSWA 3AS1A 1QPKA 1R87A 3FXYA 3WL1A 2JEQA 3ZOAA 3VDHA 1VJZA 3MS8A 3WNKA 2VUYA 2C24A 5CGTA 4CPBD 4CN1A 4U5KA 4A3HA 2J62A 1ZBWA 2BY0A 2WMKA 1BAGA 3VIJA 3G6LA 3TP4A 4W5UA 1IZJA 5A95A 2O14A 2ZOXA 2JWPA 3VGDA 1HL8A 4AZ7A 1C7SA 2GVYA 4PTXA 1OGSA 4AIOA 4Z2IA 4H04A 1HP5A 5A2AA 1VBUA 3T0BA 1E70M 3AIRA 1ZS2A 1QHZA 1B3WA 1HVQA 1JIBA 3I3BA 3W82A 3EYPA 1NM9A 3FHAA 4D6JA 1NP0A 4GPNA 4HOZA 3F95A 1PIFA 1GOOA 4LPCA 2VX7A 4P7OA 4DWSA 1W1YA 3B8SA 5IHSA 4RE4A 1PX4A 1H41A 1I1WA 3U5UA 4HPHA 3AJ7A 1FFQA 4BCEA 5DMYA 1JDCA 4AZIA 3N11A 3SUTA 3WEOA 1JD9A 2V5DA 2ZX9A 5A94A 1XD1A 2VURA 5I6SA 1M01A 1FHLA 3A4WA 3ZYHA 4OJYA 4LK6A 2K46A 4UQDA 4N0RA 4F8XA 4UTFA 1CENA 5BWFA 1UR4A 3CZGA 1MQQA 4CD6A 2BY1A 2VXJA 3CGTA 5D9MA 1E15A 2J77A 4RL3A 3TTSA 4W7VA 2OYLA 1V3KA 3GBDA 1VENA 1CXEA 1EDQA 1J0IA 2PC8A 3WF3A 5A6SA 3NCOA 3WDIA 3MO4A 4X9YA 4CP9B 2QV4A 2VX4A 3AIVA 1V0LA 3PTKA 4NZCA 4HA3A 1E72M 1ISYA 3RILA 1FOBA 3MMDA 4GZIA 2UY2A 1V08A 1W8ZA 2YA0A 3SIMA 3ARRA 3UCQA 3RIKA 3U7BA 2D22A 2BFGA 5E0CA 4P8WA 2Y24A 2FH8A 1Q6CA 3CHCA 1KBBA
chains in the Genus database with same CATH superfamily
4URIA 3BYWA 1TPEA 4JTAA 3C7OA 5ABJA 3CUXA 4PBEA 3VDGA 3WF2A 4KCTA 1GANA 2P2KA 4MV2A 4Z07A 4DYEA 4N9HA 1H2KA 1UIJA 5FP3A 3POBA 2X30A 5MKGB 2VZOA 5JH2A 5FSDC 3CAVA 4AFBA 1RP9A 1VYRA 1XLAA 1FX6A 4NI3A 1VAMA 2V82A 3ZSTA 1U5IA 3A13A 3W2LA 4A2SA 4HQVA 3KVAA 5JAXA 3TB0A 1MRAA 3RDKA 5GJPA 1GZ9A 1K7XA 2Q8CA 1J2WA 3RK8A 3FHIB 1RPXA 3BW2A 2IXJA 1D3CA 4FS9A 3GX9A 3UYIA 4SLIA 2WO7A 1VBJA 4ZS3A 5C7GA 1DJGA 3PANA 4P9IA 1ZRDA 3VC6A 5CISA 1YI9A 4Z8BA 5E88A 2ZGQA 3H24A 4DN1A 1HGYA 3M0JA 4E38A 5BNQA 3THUA 4GK8A 3CHVA 3G6MA 1NZCA 1QDOA 2RS31 3BV7A 1TE1B 4P9YA 4DPPA 1VBA2 3GSMA 3IDAA 1XBFA 1SLTA 4OMCA 4PMOA 3UKVA 1LJ7A 2PDMA 4LBRA 3ZLGA 3U9IA 4MHUA 4YZ5A 4CUAA 4LO7A 2VMIA 3GS6A 3GC2A 2YB7A 4JTRA 2JEPA 3O2LA 3HO8A 4JHZA 3WDTA 3AXHA 2WWJA 5DAVA 1E0UA 2YX0A 2J74A 4IPJA 4IIEA 3GD6A 4RS5C 4QX7A 2J1AA 3OPTA 1OCQA 5FYYA 1EJSC 1R7OA 2NT0A 1NQKA 2BNMA 1GBGA 3GFZA 5T5OA 1DXEA 3EOOA 3Q4DA 1EJWC 2GAUA 4YVSB 1EOKA 3AKTA 2HVOA 1VQTA 3L9JT 2E25A 1K5MB 4LV4A 3CBNA 2GMMA 3LD8A 4PI2A 4EXQA 4Q4W2 2XWJB 1RLCL 4E4PA 1FWAC 1HJGA 4HFSA 1H1IA 1DIDA 1GMMA 1K70A 3BG9A 3BIWE 3QRHA 1XBYA 2EXOA 4AD4A 4RL7A 1F74A 1NCRB 3W2MA 3TDFA 3TROA 1E51A 4EX4A 1JD7A 5FOBB 3I97A 1FWIC 1H0IA 4K2SA 4GKLA 1M3UA 1QBAA 4JRAA 4GLEA 4NVPA 3PUGA 3GFYA 1JRCA 4PLMA 1SR0A 1J8VA 3T30A 4F0SA 5LZ6A 1Y7VA 3H2MA 3AP5A 2FFIA 4IFOA 4ZEPA 1NSJA 3ES1A 3FJNA 4Y1VA 3HM7A 3WXPA 2I9UA 2HH9A 2J47A 3OLDA 2F17A 3QZ6A 1GT8A 3POCA 3OA5A 1YMYA 1W31A 1UYYA 5D30A 4FPLA 3ZN6A 3ZFGB 1JOBA 5JXJA 1YLVA 3LTSA 4B15A 1YEWA 2RR12 3MMTA 2VMGA 1UZWA 3UPMA 3K48A 3WQPA 3WQ7A 4D72A 2GK1B 3TTYA 4HOWA 2DIKA 3QR1A 4NAEB 1QH6A 3V56A 1LGCA 2E68A 4G1KA 4DZIA 3SCWA 2A75A 5FJKA 4CKQA 3CJIA 5C3OA 3WG1A 1MQTA 3FJ4A 2E77A 2NZ9A 3ZYZA 4Z17A 1KNWA 3S9ZA 3EWXA 3GYCA 2Z26A 4JGZA 4PUEA 3P1IA 2RJLA 2EPNA 3LGEA 2JD9A 1F7BA 3RPTA 5DAPA 1IWPA 2WVUA 1V6KA 2B42B 5CC7A 1XPGA 2IKIA 3LHTA 4PN2A 1UZVA 1YQCA 1XYAA 4J3XA 4O18A 4XZNX 4B5UA 2EPLX 2JG9A 1COV1 4LCQA 3MA8A 4DZ5A 5C9WA 3PVFA 2BNNA 1J79A 2VY0A 3OVGA 5JXIA 4EACA 4YG0A 3OA3A 3ZKYA 5DDJ2 2D2HA 3WG4A 2QIIA 1U30A 3O05A 2ZZQA 1OD0A 3WUEA 5KZ6A 1VIZA 4GX9A 1F4HA 3MKKA 2CSGA 4LA2A 2D3RA 4MLOA 1JZ3A 4C6FA 4C6BA 1VS1A 4LY8A 1LGNA 1RMU3 1XISA 4A4AA 2O0OA 3VKLA 1UZ4A 3BMWA 2RG4A 4CEUC 3SCQA 3RZMA 4B1MA 2C5DA 2MNGA 4JV4A 2FGZA 5GNYA 2YBUA 1W2AX 4F9DA 2Z1BA 1Y7BA 1TQ5A 4XHBA 2CZEA 5FY8A 1V6XA 3T2OA 1EJRC 3LD5A 4LBMA 3W59A 1RJ7A 3T40A 1E6NA 4OHWA 1IGOA 1WZMA 4JFWA 4US5A 4UNIA 3U6WA 1R1ZA 3XISA 2RS33 4LIVA 4D6DA 2Y4SA 4MHBA 1Q7QA 4P5YA 2TRSA 4ZOBA 4GXPA 4YG3A 3BU7A 3PZ9A 4PMZA 4OZOA 4B5SA 4GMEA 4L80A 3PZTA 4IMEA 5FA5A 2WHKA 2W79A 3E38A 2WINB 5JXHA 3M9YA 5HQMA 1C8NA 3VKFC 3WZ1A 4W84A 2V72A 1ZL1A 4QG8A 1BLZA 3WUBA 3QV7A 3QYSA 4AWEA 3GXTA 2VEIA 5C8BB 2PLV2 5FXZA 4E2BA 3ZXWA 1OLQA 4LF1A 5FK8A 3WHUA 3H7YA 2ZE0A 3OQEA 3WBAA 2DW7A 1J0KA 2OVLA 2PE4A 3HFTA 2WC3A 3QGKC 3PWGA 4WJEA 2J7FA 2BB0A 3P14A 4YWSA 5JUVA 3VHRA 1AR73 1W6NB 1TR1A 1O4UA 1DXFA 2ZJCA 2WB5A 4LAUA 3M5XA 5T5LA 2XFFA 2PUZA 3BLPX 3TXVA 2VMHA 1HGWA 4AYSA 2CU5A 2ZICA 4CEYC 3EB2A 3RLVA 3HMJG 2DUPA 4CDXA 5BCAA 2RV9A 5DUWA 2VVDA 1W5NA 4IQEA 4IERA 4IP5A 3IVSA 4WV8A 1LQ0A 2PLJA 3ANVA 1CX1A 4XD6A 3RAOA 4DO6A 4NZJA 1E4LA 3L4WA 3OD4A 2D0GA 2NX1A 2V68A 3H50A 4D8MA 4BCUA 5CFCC 2VW0A 2IUWA 5SWUA 1XJBA 2QDEA 5FEXA 4HZMA 3WH7A 1RD6A 3NSMA 4D9PA 3DFQA 2HLEA 4XZHA 4LYQA 2P8CA 3V65A 1JPIA 3VBSB 2IXHA 3MICA 3Q8CA 2W63A 2YG0A 3MVTA 4GUHA 4LBSA 1S2KA 1I9RA 2NLRA 2WABA 3O63A 4L1WA 4YS1A 3VO0A 1FT9A 3OVQA 1RUD1 3LXAA 3S5AA 4OQ8A 1C8XA 4FB7A 3A7QA 2C7FA 2C14A 3SKJE 3ZXAC 3IIAA 3ARYA 3UZZA 4FTBA 4HZ6A 4W89A 1VIWA 5A7PA 3WNPA 4H9MA 3T4WA 1LOLA 2J1SA 4O10A 3RXZA 3VL9A 2BGQA 3B3QE 2RM22 2JFEX 4OHZA 2EAKA 3HNMA 1KXGA 2VL4A 3KF3A 3ARPA 5HJXA 3SRFA 3ZX7A 1UKTA 3GBGA 4C6EA 1UH3A 4URTA 4RUBA 1PGSA 3RM9A 3O07A 3F5KA 1V6VA 1RUF3 1SPPA 3OYWA 4JNZA 2R1PA 2XUCA 5CYYA 2QT3A 5FMOL 5I3KA 4YW3A 4F9JA 3ITGA 4RKAA 4YU1A 3PMEA 1GQIA 3MWAA 2AEZA 1X82A 4FF5A 1EBGA 4B7KA 1CONA 1BSLA 5CA6A 1DQ4A 3HPZA 1IS5A 1CLXA 1H2NA 1KRMA 2POZA 5GZGA 3FIGA 3ZM8A 3KWVA 2VOVA 2RS13 3E02A 3SCOA 4GY7A 2RDUA 3VZMA 1FPN1 4S2BA 3MUCA 2DFAA 2ZUNA 1HKIA 2XSBA 3UEQA 3UF9A 4MWAA 4CA9A 2DUXA 5GLTA 2VRJA 5CGQA 3R10A 3WJZA 1RVF1 2LW8A 3A4XA 2BBFA 4Z1YA 1HB1A 1S2TA 5AFDA 2P10A 3IBMA 4M56A 1QWKA 5TBOA 5GKAC 4BEUA 4Z1AA 4YW5A 4KCWA 4QBXA 4GYFA 4JAAA 3WLMA 3I4IA 3VBFC 4PMXA 4IZGA 5BXPA 1OFNA 1BVP1 1SPPB 3PFMA 3Q65A 3UG5A 4C8DA 3N34A 5AHFA 5EMUA 2P88A 3TW9A 2DUQA 3E2QA 4CDWC 3CO8A 4NAFA 4XBJA 4E0CA 2VXNA 4HPJA 2P5BA 2Z28A 1OWQA 3CZ8A 3M3IA 3AIWA 3EMRA 1HXS3 2CWSA 2E4TA 2WMFA 2CC0A 1C90A 1ZSXA 1NOFA 4LY4A 1Q63A 2JE9A 5JCTA 3AZWA 4D7TA 1WQ5A 4KRUA 5D8ZA 2ZRWA 3WMLA 1Q66A 5FXWA 1YBQA 2Y70A 3GO2A 5FY4A 1NWTA 3FK4A 3GKFA 3CL8A 4QDRA 2HVMA 3Q8BA 4DEQA 3FZ3A 3SW6A 4DBUA 4IHCA 1CXKA 1H7XA 4CDWB 3S5ZA 1ND3B 1AMYA 3BVCA 1EPXA 2WVTA 4EXBA 5DFAA 4AUBA 2O4MA 2IS7A 4EPBC 1WKYA 2VWSA 2PF8A 4RQPC 1QT1A 5A6AA 4OUSA 1DE5A 1YXDA 4AW7A 4PCSA 2OPJA 3NSNA 2Q71A 3TMQA 1POJA 1DQXA 3ATZA 4MUVA 3N9LA 8TIMA 1XCFA 5DDJ3 5BNPC 1JCLA 2Y6ZA 1UZ1A 5FYVA 5ABJC 3FDKA 3QPZA 4QDPA 4NJHA 1CLVA 3GDRA 4AXNA 1V79A 2J7GA 3AL6A 4GCAA 1YPFA 4ICNA 4FOJA 1GTHA 1J1TA 4B92A 4I3PA 3PZNA 1OSGA 4P9WA 3TQPA 3UGHA 3BALA 1TE6A 4V2XA 3VDDA 3STGA 1W1ZA 3STEA 2A85A 4BWLA 4CDXB 3R8RA 1Y9MA 4K8EA 4B90A 3AI0A 1W9FA 5CB7A 1W9BM 2XKPA 2ZX2A 4NIIA 2HK0A 2RH9A 4JQ2A 2OA2A 5IOBA 4ZTXA 1CAUA 5GLZA 1P4CA 3TE9A 4AFAA 5LBEA 1PX3A 2VNGA 4XUPA 1RMU2 5D37A 5A32A 1LOAA 2FMYA 3W0KA 2O9PA 1TUFA 4IX0A 4JTGA 2VHLA 4O0QA 3F2ZA 1KWGA 1I6XA 4MPQA 2DJLA 1BMV1 4DIQA 4WKFA 2AOSA 4EK7A 4KWSA 1ZBA3 2WSQA 3N4FA 4PCTA 1F5FA 3M2MA 5ACA3 2J7BA 3Q8FA 4M80A 5D9NA 2VH9A 2DSWA 3WDUA 4EXAA 5JBEA 1WOBA 1BK1A 2BHZA 4ZU7A 3KDOA 4L4PA 3EMZA 3CMJA 4XBNA 2Z0IA 2CBVA 2YCEA 4JIQA 1LQAA 3IVUA 1R1A1 1CIYA 2INFA 4J40A 2W39A 3W1LA 2FZ8A 3WW4A 4FO9A 3A6OA 4MFEA 4W9TA 3RPMA 3TR9A 3USZA 1UH4A 4M1RA 1I5ZA 2R043 4ZHNA 2F8QA 3C2YA 3GE7A 2R1NA 4GXMA 2XUMA 3T0AA 2IKHA 3DBPA 4K8FA 2I2SA 4N43A 5K9DA 3V1HA 5M03A 5BNKA 2RDSA 1VBGA 1SEFA 1W2TA 1Q43A 4H6EA 1UASA 2X0SA 4PGLA 1ZZ9A 1H0GA 1JTZX 2VTXA 1ADOA 3FFSA 5IW0A 3WW2A 5EJ3A 3JR2A 4JKLA 1XE7A 2J7DA 4XAEA 1ECQA 5FLJA 3G1FA 2DW6A 2GMPA 5F2GA 3MPBA 4YM1A 2WO5A 5I23A 1EIBA 3VNIA 5F32A 4DO5A 2WSUA 1T6MA 5FZGA 4GB32 3IKWA 2BXVA 1MUWA 1XIGA 2ICSA 1XJAA 4S2HA 4PUDA 3QKZA 3OYWB 4GX8A 2JK2A 4YYOA 2NVCA 4IICA 3DYPA 2GJNA 1PIV1 2BFUL 5C8CC 3BOPA 2PDWA 3WLPA 4H83A 2D98A 4GIRA 5FY0A 3QD6A 1TVPA 4Q4MA 2ZQ0A 1V6TA 3A24A 3MBDA 5BXSA 1UQYA 3B9NA 3UA3A 2YHJA 4MDPA 4LE3A 4AVVA 1NJJA 2EIEA 2FCUA 2WAGA 5LHEA 1YQ2A 4LKSA 1U5JA 4KI5M 3WUCA 1WMXA 5B80A 2HWB1 1BKHA 4GHRA 2G19A 3CUJA 4DB5A 3Q45A 2WJFA 4U2ZA 1WLCA 2PRLA 1PZ1A 4ENLA 4O53A 4MJMA 1XSIA 5AC91 2Y7FA 2CNCA 1SFSA 3RYPA 1A5UA 5EV7A 2ZUWA 1KFUL 3PFRA 5SV8A 1W04A 3W00A 2ADDA 3WMSA 5AVHA 2WFF1 2P3JA 4EN0A 2WMIB 4UBGA 1NH6A 1W2PA 2HE5A 3NL1A 1JR1A 2E09A 1QEXA 1UZ0A 3P6LA 4OVXA 4AHYA 2OLAA 4OBSA 3KHCA 1XRVA 2BOFX 1URXA 1LP6A 4U5IA 1VBA1 3QY7A 1IPSA 1MZ5A 2QS8A 1H1AA 2Y6JA 4D0QA 1DHPA 1QMLA 4MWAC 1UU6A 5LXEA 1X9PA 1OURA 4ADUA 4WY0F 1MPXA 3T09A 2QQPA 2R30A 3BLKA 4CDQC 1NUKA 1E5HA 5FKCA 1GOKA 3IJDA 3CS2A 1HRI1 3UY7A 3W7NA 4FIQA 1O8PA 4OUIA 3T05A 1YE6A 5C7HA 4HKLA 4QRNA 5LEKA 2YOCA 3VDAA 1KFEA 4FNSA 2FCVA 5FYHA 5LZLA 4JY8A 1EGMA 2FH6A 3WK0A 1EGVA 2C79A 3NEHA 2GC0A 1H63A 2RHPA 5BMWA 3E1F1 5TIMA 2JGYA 1VEOA 4ES9A 3GAYA 2F4LA 5L9BA 4AI8A 1VPYA 1KRCC 4LX4A 5FMBA 3FA4A 3BICA 3NM1A 3GFXA 3PNAA 1EF3A 3R05A 2ATFA 2PHFA 3D4KA 4PUMA 4QE4A 5DZGA 2V2HA 4RS5A 2IXKA 4YW6A 1UXXX 4MZYA 3CMFA 1PO12 2WJZA 4BI6A 2J8GA 3V5CA 4P7QA 3RZLA 1FP8A 1LWJA 3NO1A 3EX6A 3PAJA 4O1DA 3AC0A 2QDGA 3KF5A 4Y26A 4RZ5A 4XUGA 4FXFA 3TYUA 4GJYA 5LHFA 1PXGA 1X1OA 1DWFM 4Q1PA 1YTDA 4E2DA 2GFTA 1V03A 2FMNA 3EKLA 3FHQA 1X7FA 1IEVA 4FEZA 3O1MA 4PUJA 5KZMA 5FWJA 2VQTA 4PMRA 4XKMA 1U5ZA 1YNQA 2HVNA 4AVAA 5JSOA 2ES3A 2JE8A 1V02A 4O8AA 3UJRA 1MXGA 2QQUA 4NNBA 1TTJA 3BPZA 4Y9MA 3ZYGA 3WLSA 2I5GA 3NZQA 3HQPA 1B31A 3CHDA 5K0UC 2JIWA 1QJWA 4D6FA 1PZ7A 2ZA1A 1GPFA 2VM9A 3IGUA 3AMMA 2ZX6A 2XHYA 5DUVA 3MLLA 2O8OA 2V0TA 3WCSA 2OX1A 3L68A 4NJGA 2DZBA 3GBWA 3A0NA 4Y6GA 2VNCA 2VVNA 2ZUVA 4QJ3B 3KQRA 3KM8A 2PDJA 4ZVJA 4OHYA 2O7SA 3CT2A 4Z0JA 1O59A 1N8WA 1W8FA 2PTYA 4N53A 4Q8WA 3KV4A 4RDYA 3C3UA 1PIGA 3IGXA 1LGBA 5CNAA 3CIWA 4XJ9A 1ZA4A 2JG9B 2QQMA 1POV3 1XRFA 1NCQA 4RR4A 4FOQA 4XC9A 2TSYA 4MG2A 2A7PA 3P7YA 2E53A 4GI9A 3P5ZA 3PURA 2GSYA 1JMUB 1BWVA 3ZXLA 4AB4A 2R072 4ZU5A 1AYM3 3UA4A 3INAA 5JOYA 1HF6A 1KO0A 4AD0A 3L9CA 4RCXA 4QAWA 2OXNA 3LHVA 4LYRA 5TD4A 3NJZA 4NZ4A 1G8WA 1B2YA 1F73A 1IGSA 1FDZA 3O1NA 1TREA 2HE8A 1XINA 1UBPC 1RH9A 2QCCA 4J3WA 2CAVA 3W7DA 3ZVIA 1CNVA 3N6QA 3UXAA 4DJDD 5DG1A 2FGLA 1O91A 4FQZA 1TG7A 2YDAA 2ZZ6A 2ZX7A 1R64A 3FYOA 3OGSA 1A5MC 3AALA 4Q3MA 1JYWA 2X53S 2VRQA 3I7RA 2ID4A 1XR2A 4ML9A 3O6CA 5I0UA 3LXBA 4CSWA 3S1XA 4O4WA 1NDWA 2XLFA 4M19A 5CPTA 1ZALA 3S2LA 4LNCA 4IXHA 3VZYA 4KRZA 4JIRA 2OEMA 4HBKA 1SFLA 1EC9A 2OLSA 5FZLA 2WWDA 3C8XA 2WWSA 4YW1A 5A8MA 5C71A 3S6PA 3MCOA 3R7MA 3TNBA 1SCSA 4HL0A 2JKAA 1DJWA 4KEZA 4N6FA 1RV8A 2WT1A 3VN4A 3NG3A 3BSHA 4LNYA 3WL0A 2ZA9A 1UU5A 2XVKA 4O16A 5J7MA 1HL9A 2DVXA 4C1NA 3QMRA 5A7WA 3ARSA 3V18A 4FOVA 2Q1ZB 2CEQA 1QPOA 1LWIA 1V0NA 4HU8A 1ZZBA 3H21A 4NAFB 8CGTA 1Q8VA 3RJXA 3O14A 4XTMA 3ONCA 1R081 2WQPA 1RUJ2 1X39A 3LHUA 4CP9A 4DX3A 1OVPA 3JBG3 3RMXA 3B3DA 4H9XA 2BGPA 3NYDA 2YL9A 5F1RA 2XONA 3A47A 3TYCA 2OPWA 4B4HA 4ERIA 4AXOA 4BXFA 1BPLB 4NP7A 5HUPA 1QXLA 1D8CA 1H51A 1V6UA 1W6MB 1H4HA 2XSXA 4N02A 3ZN5A 1Q85A 3BLEA 1ECEA 3KVKA 2VZUA 1AR61 1RVGA 5G2IA 3LEIA 3I7DA 1N82A 4AD2A 4FTEA 4HTBA 2X10A 4R8HA 2WMIA 2VNOA 1VC4A 5I24A 4C6CA 1N8IA 3ACIA 5FJHA 4UQ9A 5D33A 1W6PB 1XG4A 3V0AA 1ITUA 2RDTA 1EWDA 3SEEA 3UPBA 3CAQA 2J7MA 4IL7A 1PS9A 2XGZA 4BOWA 1O3TA 2D2OA 4XILA 1OFBA 1SLBA 4HU0A 4DJFD 2YV8A 1OA4A 4Y7EA 5I3IA 4J1WA 2NV9A 1Q65A 1VF8A 4FPYA 2OEJA 4M7SA 4BQ2A 2PWHA 1JCNA 4CXWA 1XD0A 1P6WA 4NF7A 5KEZA 2HWE3 1PO22 3LHYA 4I9MA 3VIPA 3BN6A 3E3HA 1W03A 3K5XA 1WCDJ 2ZGKA 4KG0A 4GVIA 3UWWA 2R061 4IUOA 1JGIA 2GC2A 1S0BA 4WR3A 3FBYA 3NAPC 5C4WC 3WH5A 2Z7GA 3ZR6A 4PBOA 1DQ6A 1K6WA 1RHCA 4AZ5A 4ACZB 2WW5A 4KFOA 1AR72 1ZVFA 1KJRA 1ZGDA 4A8NA 1OQFA 1UMZA 1Z6KA 3LPFA 3MFAA 3QHOA 5KSWA 2BUKA 1RUI2 1QR7A 3DAQA 1KCXA 4RR3C 4S3JA 3ELNA 5JVVA 4HK9A 1P0KA 1MVEA 4HG6B 1HJXA 4M01A 2G95A 4ZFMA 2A79A 2EAAA 2PZ0A 4JX4A 1BYAA 1LORA 1J96A 2DURA 4JTNA 2J6VA 3EAUA 5J8LA 3ES7A 3WINE 3C2VA 2W95A 5F3CA 1W1B1 3FKRA 2Y38A 2QGHA 4X2PA 2B8MA 1VD6A 1FXPA 1OSEA 3ACHA 5KHIA 3GZEA 5K3VA 4BQ5A 1V6NA 3HU7A 4JIEA 4XIMA 2B4KA 4Q4X1 2E1DA 3VIOA 1X38A 1TPWA 4JFTA 3WEZA 3AMLA 2ZZ7A 2PDBA 1BEV1 3BLLA 2DIEA 1VR3A 1PVC1 3FDGA 1H7OA 1YX1A 3P6BA 3GRIA 1EP2A 4F2TA 4BB3A 1J3RA 4AI0A 3MZHA 2XWDA 2Y89A 1GWMA 2WYSA 3UK9A 2MHFA 3PS7A 4LC8A 1DGWX 4PF1A 3DIPA 1BKZA 3SNMA 1V6OA 3DPRB 1J4EA 4LQ1A 3QMSA 4JZRA 4R33A 3CO4A 3WP5A 5DZFA 4B4FA 1XFCA 2V30A 3GHUA 5LGZA 3ABOA 1MEC2 1SW3A 1HRV1 1ZRIA 1PZ2A 1ZCCA 4FT8A 4X6RB 3S2NA 2ZA2A 2AEYA 3EBVA 4PL2A 4TZDA 1K9EA 2DSKA 3SRKA 5KETA 3LA3A 3QCWA 4HZ8A 2PMQA 1NWSA 4K40A 3ANUA 3A23A 5A3UA 5KWRA 4NUWA 3H8AA 1G0CA 2ACUA 4IGOA 1VFFA 1W9DM 4US6A 4FLRA 1HKKA 4QJ5B 3ZYJB 5FF0A 2YXOA 1CGWA 5GNZA 2XPJA 3MJMA 1C8QA 3PVNA 1E5NA 2PGWA 2J7HA 3QEZA 4PTWA 4KWWA 1MQTB 4HXCA 3HBKA 1W9SA 4DS0A 2REQB 1QJY3 4P5HA 4AR2A 3VKOA 4ERGA 1F07A 3BWWA 4F66A 4RD7A 1VBD2 4LPLA 3QTGA 4QDQA 1FOD3 1LL6A 4WBBA 1X97A 1ZENA 3NQ7A 3PTRB 3FVDA 4PT6A 4ZS2A 3K4ZA 3AAMA 3MJYA 1QGLA 4H41A 4F2BA 3NNJA 1W8NA 1O4YA 1FBAA 1AR83 3AZSA 4UCGA 4J6GA 5D4YA 3R43A 5FYMA 3OIHA 3S57A 1XYPA 3ZVXA 3CWOX 3NTYA 3OBEA 3W2NA 4IFKB 2JDAA 4X8NA 1NOUA 3IEBA 4UMCA 3DHDA 2YMZA 5FUIA 4LBQA 1W6MA 3BQ6A 1UX6A 1QNQA 3PAOA 2BXYA 3M43A 2H3DA 2YYUA 2WBGA 2UY3A 4OFCA 1HZYA 1QPRA 1DYOA 2UWBA 3AP7A 5KC5A 4Q4Y1 2BMBA 3BAYA 3H7RA 3LUTA 1JU3A 4A29A 3F4CA 1CGXA 3PPCA 2MNRA 1W3NA 3MVIA 4O12A 2X16A 2YBVA 3KBWA 4L1XA 1YI7A 2BW8A 4EPEC 1GYNA 1UPIA 4QU1A 2WZR1 1UKPA 1NA1B 1F9KA 2XLGA 1UR8A 4LALA 4HYWA 3S2CA 3TTEA 2JDKA 3LCPA 3H2OA 2PS2A 5GJMA 5ABFB 1XYMA 4P9XA 3DZ1A 1XLCA 4HNTA 3TNOA 4KU8A 5LCWL 2JG8C 2JG9C 4BDVB 5EPDA 4QHBA 1GNYA 2HEYF 4UTWC 1QTWA 1KFLA 1PO21 1IIGA 3PNZA 3N17A 3V0UA 3PUIA 4NQ1A 2W87A 4D6QA 4O15A 1KGUA 4DNYA 4FOKA 3B8UA 5HWMA 3CMGA 1XXXA 1FATA 3G0UA 2XFYA 4BJHA 2AENA 3TSMA 1DPMA 5L9VA 3MUXA 2VUNA 3MCMA 2PAEA 1A34A 5FPAA 4QNWA 2OPKA 4C65A 4S2CA 1OVSA 2FDFA 2QGYA 4IGMA 1AQMA 4MKSA 2WA4A 1HNYA 1A49A 1W91A 2CBUA 3VM7A 3LBCA 2QJJA 2AMGA 4MG4A 1OZQA 2V09A 4LUYA 4DOUA 1SLIA 1UR1A 2VZQA 4QQPA 3N7LA 2OB3A 4ZZ5A 4BQ3A 1KCZA 1VJSA 5D32A 4Y9AA 3GDTA 1E6XM 3L7RA 5I3JA 2GSJA 1OT5A 4ZQPA 3G1VA 1QJU3 2J1UA 1VBC3 2GNBA 1MR5A 2QZRA 1F3XA 4Q0UA 4K6AA 3CHFA 1UD4A 4IV1A 1WCKA 3UYJA 1D4M3 4TX8A 4RQPA 3THCA 3AMQA 2VUCA 3CYJA 1FQ0A 4A3YA 1DWGM 3N9RA 3AS2A 3PZIA 1HDKA 5A6TC 2R1MA 3L0KA 2YDRA 3DXTA 5ACA2 3O1SA 3CUIA 4R52A 4P08A 2XFWA 4Z2GA 2W68A 4U3AA 1S1PA 5CSYA 2X8RA 3RCMA 4ARXA 1AVAA 2HS6A 1IQDC 1PX8A 1S3HA 3H54A 5BY5A 2GJRA 3X29B 1OH3A 4DNMA 4DY1A 1UO9A 4YHEA 5A3MA 2PHRA 1BGGA 1C7TA 1HXJA 1NKGA 1AJ2A 3I59A 4GFSA 2OR2A 4GNJA 4RDZA 1C1FA 5A33B 1E40A 3QQWA 1M5WA 2HWE2 3E97A 1BSIA 1MYRA 4P2VA 4PEEA 3PF3A 1JPDX 4MPKA 5FZ3A 5BYNA 5C70A 4P02B 2CHNA 3HG4A 1F2JA 4PFMA 1SFPA 2A6NA 3ITXA 2PHWA 3AZYA 1H50A 3N2XA 1JPHA 3UL2A 5FPXA 2EBNA 4MLJA 2HXUA 1LHUA 5ANQA 1J9YA 4LA3A 2WKJA 4DJEA 3WBYA 4Q5OA 2YU2A 1CGYA 5FRAA 5T5PA 4W7WA 3N35A 1BVZA 3CNAA 4H9ZA 4OHQA 4XTDA 3NOEA 1FRBA 4AFCA 4QHZA 1OPMA 4IGNA 1W9VA 1GEHA 3RQ0A 5IVEA 4Q8OA 4XAFA 1GHRA 4H2HA 5L6UA 3JQWA 1KS4A 2PAKA 4PIYA 5DN2A 4C6IA 1KD0A 4AG0A 3WDQA 3NV1A 2ZEWA 2O9TA 3KFTA 1S2AA 1CPNA 5HR6A 4IOTA 4S2FA 2A70A 3RRDA 5CKNA 4H1ZA 3M6DA 1TR9A 3N36A 3WJWA 3TN5A 1E9LA 3T0TA 5G1MA 5T9BG 1S2EA 3RZJA 4OOZA 1VE0A 1BEV2 2C1IA 4AIEA 2ZABA 4A3ZA 4LANA 3SCTA 2HBVA 1XE0A 5D1IA 3IUIA 3SMHA 5HANA 4Z2AA 2WZIA 1GOIA 2HMCA 2DORA 1SFYA 1Q8AA 4D1IA 1OC1A 4I90A 3W5NA 1DWJM 5CSSA 1TSIA 3ZT5A 3QR0A 1FDJA 2PRMA 3R0KA 2V6AA 4BQ4A 3LHWA 2G3MA 4ORFA 4IGHA 4GWNA 4MB3A 1CGTA 2PF0A 3B97A 3EWYA 1EAH1 3RFAA 4L9ZA 2ZIDA 4UOQA 4JCKA 5GZFA 1NQ6A 4EWEA 2D97A 2WT0A 4LQRA 3U07A 1KBIA 3UZJA 5CJNA 4E4UA 4OTKA 3D0JA 1JZ7A 4F48A 2FDKA 5F3IA 3VOFA 3FS2A 1OXCA 4QGLA 3GB6A 1GJPA 4Y96A 3MTWA 3QGAC 2F84A 3N9PA 5H1WA 3NQVA 2A5ZA 5T26A 3ALQA 2BV9A 1HG3A 4UWMA 5EMJA 4HOXA 2ZVRA 4GFIA 2LS6A 2FHRA 4DIAA 4BMEA 4H3DA 3LGDA 4R53A 3EB4A 1Q6QA 4WXZA 4NJ4A 1ASJ2 1DGWA 4A6OA 4HGXA 1UD3A 3EPOA 5EB8A 4UMBA 4C1KA 4AEOA 1ELSA 3W84A 3QXBA 2WZPP 4IJCA 1ODZA 1IWAA 1EUTA 4QAIA 1TV2A 1UCWA 4YTRA 2ARCA 3UJFA 4L9BA 4Z2KA 5BXTA 1J01A 3KB5A 2PWDA 3II1A 3QLDA 2YBPA 1LESA 2FB3A 2OYKA 2RS53 2J6XA 3WH6A 3QV9A 2XLAA 1HO4A 3LRMA 3NEVA 4LUJA 1Q8JA 3R1ZA 3H1YA 1DWHM 1OM0A 3VKNA 2DPEA 3LDVA 4OZXA 2EPOA 3ROUA 4A8IA 3KRZA 4ZGYA 3ZXFA 1DYSA 4D71A 4QCFA 2WL1A 3ZXKA 4WSHA 2QCLA 5L9FA 3VBHB 3QBUA 2VZTA 4Q4Y3 3LK6A 1F9CA 3K4WA 5AYBA 4JNMA 5I2UA 4X9SA 3S6OA 1J11A 3MQTA 3RX3A 5LNUA 3VD9A 4MF4A 2PWEA 3NVTA 1OMIA 3BTXA 3N18A 1K3IA 5ABGA 2Q30A 1UX7A 1WE5A 4TMBA 2BASA 2KA3A 3OODA 1AR81 3W1AA 1VCVA 3E5PA 2ZX0A 4WVVA 4NAMA 3P3NA 2Z69A 3BO9A 3BZGA 1W8TA 3I2OA 1TYGA 1TPDA 4CDUC 3D47A 1O5QA 5CC5A 3LA4A 3ZR4A 1TWDA 3KS7A 1GG0A 4RPPA 1N3OA 2BYVE 2E28A 2G3FA 4U31A 5FF3A 5C0QA 5BNNB 5GJNA 2E33A 2P0OA 1A50A 2VECA 1ZP3A 3A64A 1BYHA 1ND2A 1KQYA 3EWZA 4RA0A 3SH4A 4EJRA 2GWNA 1QPKA 3WL1A 2PDYA 1ADSA 3MFCA 1AA1B 3VDHA 4ZO7A 1ONEA 2VUYA 4CCKA 1QH7A 2AQOA 3UR5A 2EXKA 4MY1A 2GVEA 4CN1A 4A3HA 1ZBWA 2QUMA 5CC3A 2DVDA 1MZ6A 1HV1A 1W8HA 4M4PA 3OCPA 3OP2A 2DVTA 3I2JA 4MO3M 1AYM1 5ERLA 3TEYA 4S3GA 1BAGA 3VIJA 2L9LA 3TP4A 3M6YA 2HYXA 3SFWA 1TPH1 4O0KA 3O16A 2O14A 2JWPA 3HWJA 4WM7B 4HNVA 1D0HA 3C7HA 2EHHA 4META 3EZ4A 3TYEA 4Q2FA 1LCOA 3TEZA 4AZ7A 2AREA 3H3ZA 4Q8KA 4MJZA 4PTXA 4GKYA 2ZGTA 1P7TA 5A2AA 3HOBA 1E70M 2A6VA 1BVWA 3HT1A 3EGJA 1D4M2 1W6TA 2CHHA 4LVBA 1HVQA 5CBJA 5CZJA 2RMU1 3I3BA 1JIBA 2VELA 3VNLA 5IVFA 4UTLA 1NM9A 5A1LA 1NP0A 3HFYA 2YB4A 4F3HA 5T50A 2DZAA 4OULA 4HOZA 4YTTA 1K12A 4P7OA 1M1BA 1GZTA 2QCMA 3U5UA 4HPHA 3AJ7A 1FFQA 1REEA 2A73B 4F0MA 4AZIA 2I57A 3N11A 3WQGA 3IUHA 1WXYA 1DJNA 2QYGA 1FHLA 1W8GA 3A4WA 3ZYHA 4GY1A 3TNPB 4LK6A 4KIEA 4U10A 4WVXA 2JBMA 2TNFA 5BWFA 1NDZA 2ETEA 2W52A 2HEVF 5C9AB 1R46A 3CGTA 1RVKA 4XIAA 5FZ1A 1E15A 2J77A 1V3KA 5B2GB 4YVSC 5DXXA 1EDQA 1DQUA 3BVJA 1MZHA 3LS9A 1BMV2 4JTHA 3DESA 4YVVA 3NCOA 4XOGA 2LM3A 1PYMA 2CL2A 5C5TA 3NQDA 1FWFC 5DQPA 1MNZA 5KZDA 4DXZA 4QB1A 4XZMX 4HA3A 4YVPA 2OZJA 2ZCGA 3RILA 1QXPA 4C60A 1PZ0A 4GZIA 4OQVA 1V08A 3CPGA 1AJKA 2BG5A 1W8ZA 2YA0A 4JNYA 2OZ3A 1DIWA 3IACA 1RVF2 3UCQA 1ZX5A 1PK6C 4H6RA 3U7BA 2BFGA 4K1ZA 4P8WA 2VQAA 1Q6CA 2H90A 3QFWA 3CHCA 1BXNA 3DHPA 4GNKB 1E6ZA 3A5VA 1VFUA 4QE1A 1AX0A 1EEXA 5D8AA 4DXXA 2A6ZA 3K46A 2QEZA 2OVUA 1M68A 1WUVA 5GZDA 1AUSL 5GQBA 2WIIB 2OZ8A 3ISIX 4DO7A 5T5JA 1SO5A 3QGVA 1UPMB 3LQLA 3WFAA 1W5QA 2PTMA 1OHLA 4Z92B 2XH2A 4L8QA 3R5EA 2O7QA 2VFIA 1UY2A 3JU2A 4MNMA 3L2IA 1I8JA 3W6LA 4WSKA 2SFPA 3FYPA 4A3RA 5LATA 1H4PA 1W90A 2A7AA 3AJYA 4AISA 4B3LA 3A21A 3AFKA 1IQ8A 3PZUA 2WM1A 3HT2A 1MXSA 3BW4A 5D8WA 3IPVA 1UG6A 3JD73 2XIMA 5M17A 5EMYA 1F6PA 1J0JA 3M4HA 1ENXA 5FZ0A 1AJ0A 4N9CA 4IM4A 3KTSA 1EKOA 1RQEA 2FDJA 4H7MA 1T41A 1FWTA 4FPOB 2ZUMA 4JXCA 3FFZA 1BXCA 2JF7A 1G9FA 1RHI2 5D2AA 3HF3A 1RUI3 4ZOCA 3TC6A 4CQ9A 1ZPTA 5CPMA 2ALDA 5FIXA 4RZ6A 3OUJA 1R083 4Z1VA 3POHA 3SN0A 3QF0A 1K77A 2CXEA 3LCWA 2HWB3 1J12A 4ZSTA 4ZXEA 1FDYA 2BPA2 3SECA 4GBUA 1GCYA 2NX3A 4AHOA 1EAH3 4LEFA 1G01A 4GQ7A 5DELA 3WLQA 3FFQA 3HG2A 3BL3A 4IIFA 2GU9A 2VCAA 1UOZA 3EOSA 3G0SA 2BJSA 5JOXA 2MUCA 3KL0A 3K30A 4HNUA 1OA2A 3L5AA 2QCSB 2VZPA 2FYMA 2FZ2A 4AFDA 2VE1A 1DJHA 3GHRA 1DQ5A 1KBJA 5A6QA 2VEGA 4QX1A 4H2CA 4URAA 4CUCA 3CWNA 1BLIA 5FZ7A 3ECQA 3NR0A 2V3EA 5AKQA 4HB7A 3VIMA 1W8SA 2AQVA 2C71A 4UQEA 3NJVA 3PTYA 1PNGA 2C0ZA 2EJAA 3KOFA 4JCLA 2E7TA 2B7PA 1LRTA 4DNHA 4YW4A 2BRTA 4C6MA 2OOGA 2WQZC 3VMNA 2DVBA 3HURA 1V0AA 4UFIA 1RA0A 2JIJA 4PZVA 2Z7KA 3TYAA 4CCMA 1VBE2 4FPGA 3DERA 3HIFA 2UWAA 2P8BA 5CFDB 4ZXKA 3A3XA 1XDLA 1XIMA 2VKZG 1V3LA 2QCFA 3E2VA 1XQNA 3O1RA 3PUQA 4JBRA 3MV11 3G6JB 2R041 4R85A 2VTFA 2GZWA 1Q45A 1CAXA 1KR1A 3WK1A 4ATWA 2ILMA 5KXDA 1QNYA 5T54A 4IL2A 2VM8A 7PTDA 4G5DA 4C1LA 1VFTA 1ICSA 4TV5A 1RAKA 4CQAA 5JSRA 2QDHA 4COVA 1VIWB 2W5FA 5FPVA 5C9AA 2X09A 3JXSA 4WKHA 3F7JA 1IT8A 2FPYA 3CUGA 2PHDA 4EZHA 4JTLA 1HFBA 3NO8A 2V3FA 4J7RA 3VTRA 2PRHA 1IXOA 4W8AA 3S0CA 3IJLA 1H8TC 1T6BX 4ZONA 3FYYA 1RUC2 2VFHA 4YM2A 1XGDA 3N19B 1OD3A 2GJPA 2IFRA 5ACA1 2NT1A 2JDHA 3NQFA 4Q4X3 1P8JA 5K0UB 3O6AA 2C0HA 4H7LA 2CAUA 1QU4A 1TX2A 1SG3A 1LZOA 1TV3A 5HXVA 4KCUA 5JMUA 4HANA 3K2OA 1YTEA 2WYFA 1LNSA 3NV4A 1B3XA 4FCAA 3WV6A 1FCQA 5FEPA 3I3DA 2DZXA 5EBAA 4N2YA 2ZRVA 1W32A 4ECLA 2PPGA 1RUJ3 2QQ6A 1JNEA 4FNUA 2ZGLA 1FYUA 1W06A 2RS12 3VBHC 1TPB1 3R4IA 3BV4A 4AIUA 2YIHA 1PCWA 1E4MM 1P0DA 3W4RA 1ZJHA 5I00A 3VFCA 1E57A 1D4M1 3AU6A 5G4EA 1RUF2 1VMFA 1ZYBA 3NV3A 1DE6A 4AX6A 2XL9A 2E5DA 1UOJA 5FL0A 2ZXBA 1XLIA 4DQAA 3ZLHA 2XN0A 5G4WA 2Q1MA 2D2GA 3VKAA 4TN7A 4CN6A 3A3HA 3C0LA 4NZ1A 1QNPA 1I2OA 1CB7B 3HJZA 1PHQA 3U14A 2BSLA 1QOQA 3D6NA 3SXWA 1HJQA 1H2MA 1RY8A 4H8VA 4OE7A 4QQ3A 2PXJA 2Y7DA 4CCLA 3AFGA 1QNRA 4LV9A 5EFDA 3DEMA 4YGBA 3N12A 4PBPA 4I7UA 2W94A 4CCDA 4HKPA 2KD7A 2YCLB 4OCTA 4HMDA 1WBJA 1F5ZA 1VEPA 4G56A 1S0EA 4E3VA 3GXFA 3BE7A 3GYEA 5A3LA 1YDVA 4BM8A 2CCRA 1B90A 4RYDA 1FHDA 1N3QA 1JUHA 2NVDA 1GW1A 2VPVA 2NM1A 4M00A 3MIEA 3VBRA 4Q8MA 1HRI3 1QATA 2I5QA 2O9RA 3FCPA 1AW5A 3GUGA 2DCTA 2H0BA 1TQXA 1FWHC 4M0HA 4QEHA 2YXXA 3EPMA 5EFUA 2PDFA 1L9WA 4DWSD 3OLIA 3ABQA 3TYDA 1RYYA 3MGUA 4ZB5A 2PDHA 4XV0A 3NQAA 3RYKA 5L19A 5HAOA 4Z2WA 1FKWA 4L97A 1TNFA 4AVBA 3RJRA 1RC6A 3KBSA 3UZ5A 1VZWA 4XKYA 3I2HA 3PJXA 3A4UA 1RBAA 3BK0A 3PBMA 3E6DA 1OQEA 3ZVHA 1TZZA 1XNAA 2J42A 2DCYA 4HCHA 5FZDA 3I2KA 3KOYA 2FZ1A 2WAAA 4KGQA 4PTVA 1XE8A 2WAOA 1U1JA 3P0XA 1UWQA 1SPQA 2P17A 3LERA 4DWDA 2YZRA 2Z1KA 2MEV2 5JZGA 3HG5A 5K7JA 4ZQMA 4Y8FA 3W9ZA 3TONA 3GM8A 3H55A 3E5QA 4QU2A 4A41A 1LL4A 4C6LA 1THFD 3VNZA 2Z1VA 2ZUUA 2Q01A 4CQCA 4C6JA 3K3NA 1IS3A 5K2ZA 3OGJA 3HPFA 5M3WA 4W7UA 3AO0A 3KBJA 4XO6A 1ZREA 1RJQA 4FP3A 1GWLA 2B5HA 3JCIA 3DFHA 3OEBA 5CEHA 1FXQA 1FUYA 2XIQA 3CZUA 1U22A 1V3IA 1VBB1 4NT0A 2EPMX 3FKKA 3VBUC 1XGEA 5FD0A 1ISXA 2PQQA 3EOUA 5C8CA 3RI9A 5FJUA 1CESA 3KAOA 2A3HA 1H1YA 2PHLA 1XKYA 4MGYE 1BK0A 2UYAA 4Q4SA 1B3ZA 3HMCA 5F2WA 4LGXA 3H42B 1KDKA 4DJFC 4KESA 1TME2 4TX9A 4AF0A 1ZY9A 3A4JA 3VGHA 3DKLA 4X0NA 1PM7A 1OKQA 4E2VA 3URNA 3UG8A 4N7UA 3STFA 2VDGA 4JC1A 3TSBA 1WP6A 1C5HA 3F5LA 1REQA 1XBZA 3D3AA 1WBLA 4OT7A 3VKJA 3O1UA 4Q7IA 1B9BA 1WBHA 4N7IA 3LQCA 4XE9A 4AVFA 1ZBA2 1S1RA 1ZAIA 4XBLA 3M07A 4LE4A 4ZL1A 2WO1A 4O9EA 3CL6A 1L7QA 2A0NA 4GMP3 4BIFA 1WZAA 1EAH2 4GB31 2XDVA 1KGXA 1M04A 4OHVA 3GHTA 4EN8B 1P48A 1UY3A 1IT0A 4Q4X2 4D2JA 2O56A 2PTWA 1E4IA 2WMHA 4KKXA 4Q0VA 3E0WA 4JTIA 1BEV3 3FA3A 4CCJA 4GINA 3NKTA 4BYYA 4LAKA 2A3EA 1OZMA 5KR7A 2SLIA 4JFSA 4GG9A 2W9MA 4PTDA 2J66A 3T3YA 4XABA 4TLGA 4CTEA 4XD5A 3PJQA 3QH6A 4QKNA 4MYEA 1H60A 5FBJA 2JKEA 4IP7A 2AZ5A 5EHDA 2X05A 1J58A 3SIZA 2D2JA 3R25A 5C5YA 4WOQA 2FHFA 3BTNA 4AAPA 4YVWC 4RGGA 3POIA 4IEXA 5FO9B 3ACGA 4DZHA 3WY1A 2IW0A 5FMDA 1JCXA 1SW7A 3OHIA 4PUKA 5LRRA 4ZQCA 2WSRA 3T2QA 2OX4A 2WVVA 5H2ZA 4QPWA 5GPRA 1H3GA 3N6JA 5F39A 2WKGA 4GUIA 3W28A 3TYJA 2DP3A 3SC7X 2EO7A 1ML1A 5KC6A 2I7GA 4KG8A 2UYBA 4J2PA 3XIMA 4D1JA 3WNOA 4GXWA 3GALA 2F6XA 4B2DD 2NZLA 3UZYA 1MS1A 3TJLA 3DFOA 3VZZA 1YWKA 3QW4B 4H00A 2PU1A 3B8IA 3O0WA 1K7FA 3LYEA 1CIUA 1OB0A 4INDA 3PTDA 4NVTA 3MP3A 2BWCA 3H0OA 5EMKA 4KL1A 4GGBA 1M41A 1QO2A 2A6WA 2I14A 3FN9A 4K8GA 5CPQA 1NA1A 3QH2A 1TTQA 4QMAA 3IWPA 3BIEA 3W71A 2D0HA 3PVOA 4FXJA 4RLIA 1A3KA 3EWWA 2PSNA 2BY2A 1O5LA 1B4EA 3GK0A 2VNVA 3IM0A 3KS6A 3BURA 2OQYA 3DKQA 5A3PA 3HQXA 1W9YA 4XF3A 2XISA 5A69A 4MGIE 1TMQA 3N2OA 3RJ2X 4EROA 4BK4A 2UV8G 1QJU2 5HV4A 2Y6KA 5D03A 1IHIA 3ABSA 3PPHA 4F0KA 3PBYA 1OC7A 3ERPA 4LC6A 2Y60A 5CPOA 3WIJA 1VP6A 2D3SA 4OOUA 4ASTA 1MFVA 3V16A 3HZ3A 2ESCA 5FZOA 4JYFA 4TLFA 3BCFA 2UBPC 3OZOA 4I2OA 2A6YA 4HU3A 3UGGA 1HB2A 3L2LA 3R0UA 3GC5A 3R0DA 4JTTA 4ARYA 1O5XA 4DUWA 1UWAA 1QOXA 3GNEA 3BMXA 2QJHA 2XYLA 1LROA 3DBNA 2OWWA 5FL1A 1JH5A 3EB7A 4QPGB 2ZFAA 4O1CA 3VE9A 4GQQA 4JN7A 3FJ6A 3GVWA 4UNLA 4IDZA 3WKZA 4EANA 3UCCA 2GUYA 1H6YA 3AYTA 4LHNA 3OJGA 2WSVA 1N1SA 1UF2C 4IGSA 1BKSA 3VC5A 1QVBA 2RS11 4R9OA 2A6XA 4HK8A 4CZSA 4LBKA 3T8QA 1WKFA 1WUEA 4KGGA 3SQOA 5JVLA 1XH2A 5BYWA 5E6HA 1QWGA 3PPFA 2XJ7A 5AFEA 1NCQB 4EN6B 1OHFA 1BJQA 5BMXA 2XM2A 4M0XA 4ZZ8A 3WUGA 1DIOA 4OGZA 3VCRA 5GLVA 5IAVA 2G4JA 4FPHA 3OLEA 3H2EA 2GJXB 4NOTA 3ALGA 1W1A1 3W27A 3OPZA 1YUDA 3GZTB 3IRSA 3WMCA 4LRSA 5HNNA 3GAKA 4R9BA 3LSEA 3TVAA 3ZO9A 3KQ4B 2OSYA 2IXLA 1STMA 1LUCA 3ILNA 3SCHA 3ILRA 1I75A 2ALRA 1DU3D 1A4MA 3UWEA 2PWVA 3LY0A 4OI1A 5AVPA 4HJWA 1F6YA 3LKJA 1AQHA 4DRVA 3OEXA 1X8FA 4QKFA 2VENA 3TWBA 4MM1A 4QB2A 4KWJA 3FW6A 4RE3A 1W8UA 1UP0A 1JUKA 5TSWA 1Y5VA 4G2DA 4XQDA 4FFFA 3PUAA 3W7PA 1LCLA 5DCEA 4HCDA 4CVUA 3UGFA 1CZ1A 3CIVA 4DYKA 3ES4A 3CEPA 1IR1A 3G1HA 5E9XA 4HYVA 2Q6ZA 4QQUA 1QUMA 1NFGA 2REQA 4QIUA 1RCXB 4BIOA 4JGYC 4GNVA 2JDNA 1TJ0A 3NMBA 3BU0A 4KQNA 1Q3NA 4QNEA 1PJ9A 1EUNA 4UTTA 2XL7A 1W17A 3UBPC 3K2GA 3F4DA 3P3PA 3BTYA 3CK5A 3C56A 4P9JA 3TYBA 3ZFFB 1LHNA 4JGZC 4MXVA 2Q02A 4JYEA 2YA2A 3AROA 2WNEA 2YCLA 4FPFA 4JFVA 4JYDA 4HPXA 3MDPA 4DUVA 2VBDA 2VD9A 4C5YA 1RXFA 1W6NA 3L4ZA 1GOXA 3MHFA 1TCMA 1FWCC 5DMNA 1AH3A 3I2FA 3QC3A 3T1MA 2RDNA 2FPTA 3PC0A 1H0BA 1RA5A 1Q5OA 4XXAA 4K21A 5CVRA 1UD5A 3WQ6A 3M5ZA 1U83A 1E5JA 3W01A 2Z00A 2XJQA 3TAOA 2XR4A 1D7KA 1SJBA 4DB7A 3GDBA 1MEC1 5ABHA 4BI5A 3LRLA 1W39A 4LBOA 2G96A 1NLSA 1IT7A 2CLPA 2DVFA 4EF8A 3V64A 2QCDB 3VM5A 3VVGA 3FUOA 3MSGA 1H7NA 3PK7A 2W1UA 4PMUA 3AYCA 4PA8A 4BWLC 3AKQA 4ONVA 1XOYA 1XYFA 2UY9A 4IGQA 2QCHA 1KTCA 3IV3A 4CNNA 3USUB 2WVVB 3PBGA 1ODUA 2GNMA 4GC4A 1YFWA 5BOEA 1X36A 2W3JA 4NO4A 1SR9A 3CC1A 5FZ8A 4ZQOA 4XAAA 2I56A 2FCTA 1OOPB 1XNKA 3FX4A 1S38A 4S3BA 1N8FA 2YCKX 1PGW1 2DWRA 4QHRA 5BRQA 2VDHA 3G2GA 3BG5A 2XSAA 3P74A 4Q7NA 1GORA 1R47A 5FZOB 4JPGA 2RFGA 3C2UA 2E31A 1R6WA 3N4AA 1YQ8A 3GC4A 2FDHA 3NV2A 1WD3A 1UMYA 3NAPB 2BXZA 1CBGA 5C2XA 1W0NA 1S5MA 5D8AC 3WH9A 4RNJA 3N3MA 2QJGA 1ND3C 1UD6A 5T3NA 4ZZ9A 3BXWA 2ZWYA 1J59A 4HK7A 5A8NA 5T52A 1IOAA 1H62A 1LT8A 4AHQA 2VFDA 3FX3A 4JGDA 2DV0A 5IAXA 1CZSA 1VBA3 5C2CA 3AKPA 1QJX2 1PHWA 4L7ZA 4LAZA 2DSZA 1RUH2 1ASJ1 1FHUA 3KLKA 3NPUA 1PGL1 3OTFA 3MKVA 4WKAA 3IJ7A 3TBDA 5I3FA 2VZSA 5DZEA 4I02A 2IUZA 2PEVA 1COV3 3B06A 2YFZA 3TTOA 3RYSA 5E9AA 4KWVA 1W56A 5H9PA 2OS2A 1UMLA 1U12A 2DT0A 3Q9OA 2YKKA 3BLOA 4Q4V1 5D05A 1SJAA 1SYTA 3WJSA 2R062 3ZXGA 3AMDA 4BQ1A 3OYXA 4Q8LA 3RG6A 3OZMA 3RCNA 4QQHA 4DJFA 1ST8A 1S0DA 2VTXJ 4EWDA 3H1MA 1F2NA 2QAPA 4DM2A 1L8PA 1OBAA 4RNHA 1GUIA 1PDYA 2J4GA 1WX0A 1KB3A 4COYA 4AGGA 2VCBA 1K45A 4CD8A 2QVHA 3W1MA 1JHNA 1XNTA 4AQTA 3URFA 1A4LA 1ZZ8A 1KCLA 2AMXA 4E6MA 1PIV3 3LCXA 5EWSA 2WNQA 2GP3A 4O1FA 5A3NA 5FMCA 4AFMA 4XVEA 3UD6A 4GXLA 1JCYA 2C3ZA 4LSBA 4XFGA 1TVGA 5ECUA 2X7WA 1L2QA 1CD3G 4KNCA 4XZUG 1HW5A 3QLLA 3U0ZA 1SBFA 3WD0A 1PWMA 4IQPA 5HK4A 1ISZA 1ME7A 4AZCA 3JD72 1XUZA 2IFWA 5FQ0B 4U33A 1YFXA 5A1FA 4OYUA 5C3RA 3FGCA 4ZQRA 4O4VA 5FZFA 2DJXA 4CNUA 2RMU2 2JX9A 1QNOA 1W0OA 4UOJA 3KBNA 4LLOA 1BF6A 3CJPA 2OMAA 3TN3A 1NCRA 2WANA 2RDWA 3WD1A 3OBTA 2VR2A 4H8HA 1IGWA 4QP0A 1AVBA 2QVSB 3MUZ1 3OTRA 4FVVA 3AM2A 5K9YA 1XYLA 3EMCA 4PCNA 1JJKA 3OQ8A 5D02A 4JR5A 1MVYA 3IRDA 5FOJB 3IB3A 1SLLA 3LCIA 1QQP2 1GEQA 3GTXA 2FKPA 1POQA 1ZHAA 4ZB2A 1RB8G 3BGAA 3PLQA 4B3ZA 3E0IA 4LUIA 1RALA 2ET1A 4X63A 2R0HA 4IFRA 4JDMA 2VW2A 3B69A 1UZZA 2Y7EA 3R2GA 1ZJAA 2YPJA 4TX6A 3JW7A 3BQ5A 3GIQA 1QHOA 1KTNA 3ORJA 3GVGA 5F4XA 3FWEA 1B35B 3B4YA 3ELFA 2XIOA 1XSRA 5IK7A 4IETA 3QR3A 5F6KA 1ITQA 4GRSA 5JLVA 1B35A 4QDMA 3VOJA 2BNJA 2X0HA 3M41A 2Q1FA 2NW0A 5E5CA 5KMYA 5C9XA 2DCJA 2R16A 1O6IA 3PZOA 2B39A 2DZWA 2VVSA 1QQP1 3G0XA 2PTZA 2Z2BA 3NZPA 2FTPA 5F7UA 3DL3A 1EF2A 4L4OA 1SLAA 4RSUA 1U5HA 4IISA 2GVJA 1E9ZB 2I07B 4Q4W1 1XC4A 4LU0A 2PWGA 4FP1A 5A3HA 3VOHA 5FI8A 1D9EA 2UZ9A 2VZ1A 1UW9A 5EXOA 4NKCA 1KRAC 2ZAAA 4YGCA 1NWRA 1MQRA 4TUFA 3W1PA 5DF0A 3BAWA 3UXDA 3TC7A 1BXHA 1O8SA 5BNOB 1EJUC 2FQIA 4Q22A 3E0FA 2OT7A 1ZRQA 4V27A 5DDJ1 1WLDA 4QM9A 1NZIA 5BROA 3P62A 1A5BA 1B3YA 5AC7A 2OIIA 2QVNA 3WG2A 2VFEA 2PAJA 3C2OA 5EMLA 1OX4A 5MKGA 1SMDA 4UAPA 2Y5EA 3M0LA 5LWBA 2GQ3A 3UNTA 1VRDA 3H7VA 1TZOA 2RR13 4OVEA 3BAKA 4HZ7A 4ATEA 3ZLFA 2YA1A 1LECA 4Q4W3 1FTXA 5DY2A 3W7IA 4NRQA 3BLDA 1DBNA 4UFMA 4CNOA 4E4HA 3UU0A 3I68A 4C1WA 3PWAA 2W46A 4HOOA 1RXOB 5C3PA 3ZIWA 3ZIXA 1WA3A 4NZFA 2WPGA 3M64A 4EYUA 3IARA 2CPUA 4XDOA 3VHNA 5AC92 3ALFA 3ZT7A 1O4ZA 2W66A 4U2AA 3ITLA 2QQIA 3R12A 4Y22A 2FD8A 4H01A 4PE8A 4A3QA 3PHMA 4OI2A 3M3OA 2UWFA 1YXYA 4GWEA 1QWRA 3WD5A 1F3EA 2YSWA 3BSGA 3PUDA 3W25A 2D93A 4UT5A 2AKZA 2EEXA 3SGGA 5FJTA 5KZEA 5IDZA 1K1DA 1A80A 1XP3A 3MHGA 3CAWA 4IMCA 2BBVA 5FZIA 3N15A 6TAAA 2V5KA 3HPNA 1AYN3 2FTYA 3T1LA 1WNOA 1FXZA 1R092 1QJX1 5CADA 2DTWA 3VD4A 3VMOA 4L9XA 3VX1A 2ZWZA 3CV7A 7ODCA 1DG6A 2B46X 2WS93 1KFBA 1R3SA 2OODA 4M3CF 2ZC1A 2GZXA 4TOQA 4ADTA 3QSRA 4P8UA 3VD5A 4CDXC 5F8PA 3J9SA 2WC4A 2PGEA 4CCNA 3SJ3A 5BNNA 4RDVA 3WLHA 2Z27A 3KVJA 3FE5A 4CXXA 3B04A 5J3UA 4LKEA 5D9OA 3EB3A 3NW4A 1XGZA 4PR4A 5J04A 1REFA 2PCQA 4K37A 1JN2P 3K8MA 4I9TA 3GH7A 1GOQA 1PGW2 3CJIB 1UD8A 1AODA