4BQ4A

Structural analysis of an exo-beta-agarase
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
750
structure length
750
Chain Sequence
b'GSHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLEVPDSGDVNDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNQKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERLGSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords B-AGARASE
publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
total genus 255
structure length 750
sequence length 750
chains with identical sequence B
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq4A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq4A02
4B9ZA 3JUGA 1BF2A 1GONA 1EQPA 2WWDA 5BYWA 2CPUA 3AXXA 3WUFA 1JYVA 1QOXA 1E1EA 1TE1A 2X09A 5IFPA 2PWFA 1LL6A 1KGUA 3FHQA 3BAYA 1HL9A 4UFJA 3F5JA 1J12A 2X2YA 1UA7A 3BLPX 5E6ZA 4CGTA 4CUCA 1V02A 4LKEA 4GPNA 3VIHA 1K9DA 3N11A 1W1PA 5BXRA 2XFFA 3VGGA 4CD4A 1Q6CA 1HKKA 5LYRA 1QVBA 2VJXA 2CBJA 3AIVA 3WDJA 2BVTA 3VTRA 3VIKA 1K9FA 3HJEA 1E4IA 1E9LA 4MJ4A 2WVUA 2BFGA 2CCRA 4IISA 4CD8A 2XVLA 2E9MA 2OWCA 3GH4A 4AWEA 3BSGA 3T2QA 2XFRA 4Z2JA 3VD4A 3VMOA 4FLQA 1JF5A 5CQ1A 3WQ8A 3OLEA 3M07A 1FH9A 4JL1A 3VILA 2C0HA 2YDRA 3GYCA 5BCAA 1SYTA 4DM2A 5D8WA 5AYBA 3T2PA 1NOUA 1OH3A 2WCAA 4X0NA 1OGGA 4OBRA 2JF7A 1PPIA 5FCZA 3VX1A 2YBTA 2J7EA 1E6SM 3ZJ6A 4N42A 3SCPA 3CLWA 3IK2A 3ZSSA 1UWTA 2V38A 4TUFA 3AISA 3EDKA 5BROA 4CCDA 3VINA 4A3HA 2BS9A 5DF0A 5GPRA 2VR4A 2WAGA 1GJUA 2GDVA 2YLLA 4W8AA 1W1YA 2VZTA 3VIPA 3PZOA 4R27A 2Y4SA 2QLYA 1E5NA 1XGZA 1CXIA 4DUVA 2YL9A 2DSVA 4JCMA 2YDQA 1BG4A 1WPCA 2BXZA 4NRSA 2J7BA 1LL7A 2WPGA 3CZKA 2WVVA 5M17A 1KXHA 1MW2A 2X1IA 3AI0A 1G01A 2UY2A 3FXYA 4E4PA 4CD6A 1J11A 1UQZA 4AYSA 3AIEA 2XHYA 2YDSA 3VDAA 1WZLA 3GBDA 1VJZA 1VB9A 2DT0A 4UZUA 1W9FA 3K46A 2BY3A 1GVYA 1GWLA 3WSUA 1UOJA 5C70A 3GH5A 3OZOA 1AVAA 4C7GA 5I24A 1XRVA 2WW5A 2CBUA 2CHNA 3DYMA 1JG9A 1G1YA 1W9XA 1JI1A 3VIFA 4J3WA 1HN1A 2FH8A 1XH1A 3PZMA 4BF7A 5AY7A 3VDBA 4Q22A 2X0YA 4L4OA 4D6JA 4W84A 3SEPA 3W28A 2V3GA 1WNOA 4C7FA 4P7QA 1L8NA 2RGLA 1HVXA 1BFNA 3L2MA 3UR8A 1TUXA 3VIGA 3UETA 1EIBA 1W3LA 4OOZA 1GCYA 3WQ6A 1TR1A 1TFVA 2QPSA 3TTOA 1KGXA 4JCLA 1EHAA 3SCRA 5DFAA 1ZL1A 1C90A 1CXKA 2VMFA 2FGZA 2D1ZA 2QMJA 4AEFA 2ZUWA 4CU7A 1UR4A 3QOMA 1WP6A 2ZX7A 2YA1A 3O6AA 4JHOA 5D21A 2WC7A 1XYZA 4CN6A 1KQYA 5E70A 2C24A 4B15A 1Z32X 2WBGA 4D6DA 1W8WA 3ZJKA 1JF6A 5I2UA 1HVQA 3ARZA 3PTKA 5CSYA 1UKSA 1ZBWA 1UG6A 4PCSA 3VDCA 3WDHA 1GQKA 5A94A 1WCGA 2VO5A 4D6HA 4UFKA 6A3HA 1JAKA 3WDRA 4EANA 2TAAA 2WHKA 4MDPA 3CUHA 5CJ5A 3I3BA 1V3IA 3WDPP 3KWXA 4BS0A 2GJXA 3WNPA 1NWTA 4Z2HA 4PUEA 3UESA 4A4AA 1OT2A 1HN0A 2WC3A 1U2YA 3A4XA 3FAWA 2ZXDA 3ARUA 1OGSA 1MXDA 4FK9A 3AIWA 2Y5EA 3ARWA 3CGTA 3AMLA 1KXQA 1HKMA 4XB3A 2W67A 1E72M 4B3KA 1BSIA 3VNYA 1UH2A 2GJRA 1H09A 4GXPA 1CNVA 1Q4NX 3L2LA 3ZR6A 1LG1A 4UTFA 3WUBA 4U2YA 1LWJA 3NJ3A 1I1XA 4UCFA 1R7OA 3UG5A 1ZS2A 3KE0A 1VFOA 2PC8A 5A8OA 1GVIA 3WENA 4MB1A 1FA2A 4PEEA 4ZXOA 2GVYA 3NYDA 4KGJA 1P6WA 1CDGA 3MKKA 1M53A 3AS0A 2ZUNA 4QCFA 1W1VA 4ACZB 4WJXA 4CCCA 2ZICA 4MDOA 1YQ2A 4YW7A 3KL5A 4LGXA 3ZYFA 4W8LA 3WQVA 2WHMA 2PI6A 2WHJA 2ZUVA 1W8TA 4GZJA 3PZNA 3ZJ8A 3ZT6A 3VO0A 2QHAA 1EDTA 3AHZA 1UD3A 3OG2A 1HL8A 4R5EA 1NOFA 2YL6A 4AZCB 3BCDA 2F61A 3VVGA 4MTVA 1V08A 4H2CA 5FD0A 3QGVA 4AY1A 1VEPA 3SCOA 2Q1FA 1X6LA 4RL3A 3LPOA 3WBAA 4EE9A 1H11A 1QNSA 1V0NA 4HPHA 5D9NA 3K4AA 1MWOA 4E2OA 2GSJA 3UERA 1CENA 2JE8A 3AZTA 3ZO9A 5A8PA 1UYQA 3L4WA 4JZ5A 1ISXA 2QPUA 1DP0A 2G41A 1RD6A 2MANA 3MU7A 2G3NA 4XV0A 1UH4A 3CHDA 4W86A 5CSUA 3KL3A 1GNXA 4P7OA 2BVYA 4KH2A 1XH0A 3WEMA 2XVGA 2QMKA 1NWSA 1GORA 3WL1A 3WMBA 1DTUA 4AZ7A 2ZX5A 1E0VA 1VAHA 3WFZA 4AZIA 1JIBA 2CYGA 2PWDA 4LYPA 2X0HA 3D3AA 1E4LA 4WKAA 1XH2A 4UQEA 4M81A 3AZSA 2XSAA 3GNOA 4HA1A 4WKHA 4TVDA 1EOKA 4M80A 1GWKA 1W8UA 2OSWA 5AYIA 1FH8A 3NIYA 3APGA 3FAXA 3ZMRA 1E6NA 2BY0A 4QDMA 3PZVA 1UKPA 1PAMA 3D5HA 3ZM8A 3T09A 3AFBA 5GQBA 1QHOA 2WCGA 1IZJA 1BAGA 2OYLA 3VD9A 3BGAA 2G8ZA 2ZXQA 3WELA 1JZ5A 3M6DA 3VDHA 3PHAA 4UFMA 1B1YA 2XGIA 2OSYA 3AOFA 2C7FA 3UR7A 1SMDA 3CHFA 3ZT7A 3CZGA 4QLKA 4D1IA 3N12A 3PZ9A 2JWPA 5BRPA 1B31A 1B3XA 1GOIA 1UA3A 2CXGA 1GW1A 2WMIA 3S6TA 3WNKA 4AZBA 1VRXA 3W27A 3OGVA 4PCTA 3NUKA 2XWDA 2J7FA 3VMPA 1B2YA 4HOXA 5E09A 3AZRA 1PX3A 1R7AA 3ALFA 4KRUA 4CN1A 1B90A 1E0XA 4UZSA 4AD1A 1V6WA 3MV01 2D20A 5CPSA 2D0HA 2VQUA 3VUPA 4WSJA 4RE3A 1US2A 5ABEA 2J7DA 4QLJA 1O7AA 3CMGA 1H41A 3WMSA 1W32A 4GQRA 7CGTA 3PZIA 4JFTA 4GIAA 5CGTA 4EK7A 5ABFA 1HKJA 4HZ7A 2WC4A 4IUGA 1RP9A 3A6OA 4U33A 2J78A 1W9UA 1HX0A 4J3VA 1UWIA 3OLDA 5FOOA 1QBAA 4FMVA 4PMQA 3WF4A 3RM8A 4YWAA 5C8BB 1OB0A 1E1FA 4OJYA 3WKZA 5CLWA 5E0CA 1H3GA 2Y24A 2WZIA 2WBKA 2VR5A 3ARVA 4GQQA 1ZJAA 1QNOA 5IHSA 1W9DM 1W9PA 5BXPA 2VNCA 2PWEA 1CECA 1E0WA 4UR9A 4ZE4A 2XG9A 1E6QM 1CBGA 2B31A 4OOUA 1ITCA 3SCQA 5AC5A 1UD4A 2VZSA 2ZE0A 4B16A 3FY1A 1JFHA 2ZOXA 1QI5A 4LX4A 4HMEA 4W7UA 1UD2A 2ZX8A 1SR0A 3VU2A 1VFUA 4J3SA 1OIMA 2ZXBA 1V3KA 3POHA 4YHGA 4OZOA 3GDBA 5HDRA 1U33A 4Q7NA 1KQZA 4ZEPA 2O9OA 1HIZA 4PMDA 5CPTA 2J25A 3N9KA 3VIMA 3N17A 1GWMA 2VXJA 4AD5A 2D0GA 1C92A 1W3HA 1LQ0A 2CKRA 3SUSA 4BCEA 3ZSTA 2W4XA 2VX6A 3AHTA 4F66A 5A8QA 1K6AA 2V3EA 3VIJA 4H8VA 4MNJA 4JIEA 4UOJA 3MS8A 1D7FA 3L4TA 2CEQA 2PWHA 4AZ6A 3MMWA 3CO4A 2DGAA 1QI0A 4GINA 4C7DA 1EGZA 2ZIDA 1NWRA 1JXKA 3U7BA 2WMIB 3I3EA 4W87A 1E70M 4MADA 3AIRA 3IANA 5A2CA 5BXTA 1XV8A 2VCBA 4CP9B 1E55A 3WEOA 3VD3A 3CUFA 2Z1KA 4UQDA 3K8KA 3AMDA 4NRRA 3VIOA 5IFTA 3B8SA 4OBSA 5CLTA 2VZOA 3WF1A 1VFMA 4BQ5A 1FP9A 1V0MA 2VZVA 3TA9A 4CU8A 1IV8A 3L4ZA 1EO7A 3GBEA 4J3TA 1E6ZA 2G3MA 3W37A 3OGRA 2XSBA 2A3HA 1F4AA 2JIWA 1XC6A 4YPJA 3ZIZA 2YBUA 3BH4A 4CVWA 5A95A 5ABFB 4ACZA 5GNXA 2YL5A 4XUYA 3K1DA 1C91A 1GOOA 2UY4A 3W25A 2ZWZA 2W91A 3K4DA 1E4NA 1JDDA 1J0ZA 1C8QA 1WZAA 3CZ8A 1V3MA 1V3HA 4BQ2A 2CETA 4AXNA 5DT7A 2CIPA 4GKLA 1BTCA 3VGFA 4URIA 2YL8A 1JZ3A 1JI2A 1MYRA 3SCWA 4P8VA 1E40A 4FLRA 4AZCA 3OB8A 2WMHA 3QOKA 1MQPA 1J10A 2VURA 1ZBCA 2EXOA 5BRQA 1W90A 2W66A 2A3CA 1JZ7A 3ARXA 1HJXA 1JXJA 1GQLA 1WDSA 2DDXA 1V0LA 3AS1A 3ARSA 3VOCA 4NZCA 3AMGA 2O9PA 3AIBA 3BXWA 5DT5A 2Y8KA 1XSJA 3II1A 1ECEA 1Q6EA 2HVMA 4CU6A 3AHXA 2CHOA 3DC0A 4W88A 4AZHA 4M56A 1GJWA 4F9DA 2UY3A 1PJ9A 4OIFA 2UWFA 1JZ8A 2WVSA 3ARRA 4DWSB 4S3JA 1E6PA 5D9MA 1BHGA 3WUGA 1ISZA 4LKDA 1QNQA 1W9BM 4TOQA 1FOBA 1CXEA 1PZ3A 1X6NA 3M7SA 1UKOA 3VIIA 1F4HA 1I75A 2GK1B 2J8GA 4IPNB 1NP0A 4F9JA 2XVNA 5A2AA 1C7TA 3L4VA 3WH9A 1CGVA 3B9EA 1LLOA 4HZ8A 1NOWA 1V6YA 4ACYA 1Q6FA 1YHTA 3A4AA 1KBKA 1UD6A 3GM8A 3SUVA 2DT3A 3EDFA 4J27A 3RMEA 5C71A 1WB0A 2CBVA 3HU7A 1BYBA 4WF7A 5I6SA 1NM9A 5A2BA 3T0AA 1V3JA 1BYCA 4U31A 1UR8A 2J7GA 1HJWA 5A6MA 3DYPA 4D72A 3SUWA 3PZGA 1W3JA 1J0YA 3WH6A 1E71M 2G3IA 1BG9A 3NDYA 1JNEA 2LRPA 2EPMX 2QV4A 5KEZA 1UR1A 1V6VA 1D3CA 1LF1A 2J8FA 1W91A 1E3ZA 1J0IA 1ZJBA 2GFTA 4TVCA 3EMZA 3ZYBA 4KGLA 4TTGA 3MO4A 1QI2A 3L4XA 1HP4A 4KRTA 1GOWA 2AMGA 4MPKA 4H04A 6CGTA 2WLYA 1FP8A 1E73M 4HU8A 2JEQA 3BMWA 3CUIA 2JEPA 2VRQA 1V0AA 1PZ2A 2E8ZA 1Y7VA 1BVNP 3W4RA 1M01A 4AIUA 7A3HA 2D2OA 2CERA 4TXEA 1UWQA 2BNJA 5DMYA 5A6SA 1FFQA 4GI6A 3A3HA 3RM9A 1GQIA 1FH7A 3BSHA 1LL4A 4QFUA 3RILA 1CLXA 2BXYA 1ODUA 3T0BA 1OSEA 2ZX9A 5GNZA 3EDDA 3POCA 4MB4A 1QPKA 3AQUA 2VOTA 1AQMA 1JAEA 2WCSA 3UEQA 1TCMA 3CH9A 2W5FA 5D8ZA 3VM7A 3TTYA 4W93A 3W6MA 2FHFA 4UNIA 2WKLA 3WEZA 1FHDA 3WD2A 1CEOA 2A3BA 3SUTA 3AHVA 4X9YA 4U3AA 2VT0A 1UWRA 4U2ZA 1QHPA 1L7LA 5EFDA 4CKQA 4XZBA 4QCEA 5CPQA 4CVUA 2DEPA 2XIIA 3CMJA 4DWSD 5HXMA 4AISA 1BYAA 4HZ6A 1ISWA 1E4MM 3RJXA 4IM4A 3SUUA 1FFRA 2LROA 1LJYA 1UKTA 4PMRA 2EJ1A 2OYKA 1KWGA 1JFXA 4WIWA 2ZXAA 1U30A 1WZKA 1CWYA 3SCTA 4EKJA 1ZU8A 5ABHA 4ATDA 5JBFA 4LYQA 3DYOA 4AD2A 4TX8A 1OD8A 2VC9A 2XGBA 3BCFA 2E3ZA 3PN8A 3WMCA 3PZTA 2VCAA 3W81A 3ARYA 1W9VA 1KR0A 3T08A 3T0DA 4D1JA 4UFHA 1V03A 5D9PA 4MAVA 1DWHM 2GJPA 3ARQA 1G9HA 1PEZA 1HF6A 2YOCA 5EFFA 3WNOA 4QP0A 1M04A 3TONA 2YJQA 2XM2A 2WZEA 5JBDA 1G94A 3N13A 4JFSA 4PTXA 2GDUA 4LPCA 3OGSA 4W5ZA 3WH5A 2J7HA 1ISVA 3VPLA 2XM1A 3BC9A 1JNDA 3CUGA 1JZ4A 1JGIA 2WK2A 4TVUA 3WF0A 1BVZA 3K8LA 1XSKA 1V3LA 3TP4A 2VRKA 3BMVA 5I79A 3WDIA 3UCQA 4Z2IA 1KCKA 3GH7A 2VL4A 3GXMA 4BQ4A 1C7SA 4UOQA 5I5RA 3CZJA 1EH9A 4OUEA 3WNNA 4AD4A 5HPCA 4M8UA 1HJSA 4J7RA 4ZFMA 4PBGA 3VNZA 5A6BA 3ZJ7A 1PIGA 2DPEA 1GOMA 3OLIA 2G4FA 1WKYA 3WNMA 3OBAA 3AS3A 1S46A 4PTWA 5FL1A 3BAXA 4BZYA 3TTQA 4JHZA 4CPBA 1XSIA 2RGMA 3U7VA 1XD1A 3MUZ1 3MANA 1BPLB 3THDA 2NW0A 4HPGA 3WNLA 2PBOA 1E3XA 3MMDA 4E8CA 4PYSA 2D23A 4RE4A 2PBGA 3MUAA 5JBEA 4MNLA 1DWAM 3KEHA 2VX7A 2WSPA 1PIFA 1TZ7A 1R87A 2CITA 1CXLA 4CP9A 1J0HA 4A3YA 2DH3A 5EBAA 2IXUA 4AZ5A 5CG0A 4P7RA 2OWXA 2CBIA 2W61A 2VCCA 3U57A 2BVDA 3VGBA 3HMCA 2OSXA 3IAQA 1WO2A 2DH2A 3W26A 1UR0A 4JAWA 1W8ZA 1GQJA 1GZJA 1UR9A 1Q6GA 4F8XA 3EDJA 1UKQA 1W3KA 2V5DA 1XCWA 1CPUA 3QHNA 4UFIA 2EPKX 2EPNA 4W7WA 1SFSA 3A47A 1VF8A 3QR3A 1TMQA 2WMFA 3WH7A 2J47A 3WQ4A 5M3WA 4CN4A 1EDQA 2DT1A 2O14A 1Q6DA 4D6CA 1AQHA 1GOKA 4W85A 4JFWA 5HOSA 4HMDA 1TA3B 1H4PA 2FDMA 5JUVA 1FHLA 1JD7A 2EQDA 4EAMA 1VBRA 4V28A 4DWSC 4AZGA 4UQ9A 2JF6A 1OD0A 1WDQA 3IJ9A 4LQ1A 5AC4A 1ODZA 5I0DA 1RH9A 3PTMA 1CIUA 2EEXA 1B30A 1GUVA 1E15A 1PBGA 1AMYA 4LJHA 3WDQA 3DHUA 1AQ0A 1QW9A 1M03A 4J3UA 5CGMA 2X05A 4PMOA 3AIUA 1PX4A 1GPFA 2DSKA 7TAAA 1BQCA 1HKIA 4PMYA 1J18A 4WK9A 3RO8A 5A1AA 2VX5A 1HXJA 3BLKA 2J74A 2F2HA 2CESA 3PBGA 4DWSA 4W7VA 1QI4A 2DSWA 4ZENA 4CD5A 1BYDA 1H1NA 1G5AA 4FLSA 4AMCA 2GK1A 4L4PA 3CIVA 4QLLA 1K9TA 1OWQA 3AROA 4ML4A 1MXGA 4B9YA 1HT6A 2WMJA 2OWWA 5LA2A 3RCNA 1UR2A 1EXPA 5E0FA 5LA1A 2W63A 1KCLA 2WHLA 4AEEA 2DIJA 5CXPA 4H8UA 5HBFA 3AIQA 1JYNA 3GXFA 1LWHA 4XZWA 3BAKA 3WD3A 1UWUA 3GXIA 3L4YA 1N82A 2ZUSA 1UD8A 4N0RA 4X0VA 6TAAA 4MJ2A 3ZYHA 3IAPA 1H0GA 2UY5A 2VVNA 2ZWYA 5A8MA 4P8XA 3RPMA 5E9AA 2YLAA 2E40A 3VM5A 1WMXA 1R8LA 3ORJA 2O9TA 3W53A 3MMUA 1LG2A 1CGTA 2FGLA 3KL0A 1UOKA 3AMKA 2DSUA 4QAWA 4J28A 1WDPA 3VD5A 2J7CA 1R85A 3ZQ9A 4M24A 3EMCA 4MAZA 3U5YA 3N04A 1CGXA 2XWEA 3CHEA 5LA0A 4K68A 2FHCA 4P8WA 3SURA 1WCUA 1UD5A 1JYXA 4AIEA 3VMNA 2VI0A 3F95A 2FH6A 4KWUA 2G3JA 3NSNA 4HA3A 4IPLA 4UQBA 3WN6A 1JL8A 1UZ1A 4M1RA 1HJUA 3VGDA 2JIEA 3BAWA 3TTSA 2PWGA 3PZQA 2VZUA 1R86A 3ALGA 1KB3A 2WKGA 4OKDA 4PMVA 5ECUA 1UH3A 2CNCA 2OLHA 4YN5A 3RIKA 1B0IA 1C3FA 1JDCA 3A4WA 1WZMA 3M46A 1B3WA 3IJ7A 5M03A 2DIEA 1DWGM 3LPFA 4P7NA 4MNKA 1J9YA 2XVKA 2BHYA 1A47A 4D6FA 4WLCA 1W2VA 3FN9A 2WYSA 5I23A 2V3DA 3FW6A 4WSKA 4Y7EA 3VD7A 1PX8A 3EYPA 5JIWA 3UT0A 1CGYA 2D22A 4FLOA 1MW3A 2AAAA 3L4UA 4JFVA 2Q8XA 1JD9A 1CXHA 1JDAA 2E0PA 3LMYA 1C8YA 1MQQA 4UOZA 1A3HA 1I1WA 1V02E 4S3KA 1E43A 1MFVA 1UUQA 4LK7A 1EA9C 1NWUA 2DT2A 2NT1A 1VENA 1VFFA 4PMUA 3ZR5A 8A3HA 2VUYA 3EDEA 3SCUA 3CTTA 3W38A 1W2PA 5I3DA 1GHRA 3CZLA 3SCSA 4PSRA 4E8DA 4LXFA 4H8HA 1HNYA 2ZUUA 2QF8A 2Z1SA 4V2XA 4PN2A 5A6BD 1B9ZA 2KR2A 3FHAA 4HMCA 1E56A 5IDIA 2EPLX 3AMCA 2W92A 1MVYA 4CPBD 2J4GA 4LKFA 1DHKA 2NSXA 1DWJM 1EDGA 5GNYA 2V5CA 2XJ7A 1MW0A 4W5UA 3WH8A 3W24A 4YW6A 2WMGA 3AXHA 3IJ8A 3WFLA 2BV9A 1OBAA 2E8YA 2VQTA 3K8MA 4CD7A 3N1AA 4PTVA 4U5KA 1OGBA 4MB3A 1IZKA 4P8UA 2EO7A 5I77A 3U5UA 5FIPA 1K9EA 4W89A 3PZUA 2WMKA 2E4TA 3B9DA 3EMQA 2WYFA 2E9BA 1NP2A 3WD4A 1HJVA 3SIMA 1QNPA 3VX0A 1MW1A 1D2KA 3UG4A 4AIOA 4HOZA 1TG7A 4PMNA 1EHNA 1CYGA 4NSBA 1WDRA 4NI3A 1O6IA 3SCNA 1B3ZA 3N15A 1NQ6A 2D0FA 1QHZA 3MSGA 1H5VA 1OCQA 4D6IA 2CKSA 2AOSA 3AYSA 5KZ6A 2BHUA 3MSDA 1VBUA 3OA5A 5FKYA 4P7LA 3NSMA 2E9LA 1ZB5A 5BWFA 4JL2A 8CGTA 1GHSA 3KZSA 1EO5A 5IXEA 5A3HA 3THCA 1KXTA 3WF2A 4DUXA 1J0KA 1IT0A 4TTUA 1TVPA 1CXFA 2BY1A 3F5KA 1MFUA 2ZUTA 3ARTA 2XUCA 5FL0A 1TVNA 2DSZA 1OT1A 3G6MA 3VKKA 1CZ1A 3O9NA 5M5DA 2V3FA 4GO9A 2WVVB 5JIPA 2A3EA 3T2OA 2HISA 4NF7A 3AJ7A 5ABGA 5A6LA 1WZXA 5F7UA 1W1TA 4ZXLA 2X8RA 2O9RA 2WM0A 3EBVA 3NSXA 4M29A 4PMXA 5A69A 2C8NA 3GNRA 3S2CA 2F8QA 2OYMA 3F4VA 3WD0A 4AD3A 3F5LA 4AW7A 3OZPA 5I78A 2PB1A 3DHPA 1RPKA 1QW8A 2VTFA 3W0KA 2D3LA 5HNNA 4HA4A 1MQRA 4D6GA 4HP5A 2W62A 3RJYA 1SMAA 3PTQA 4B3LA 1QBBA 1ZBKA 2ZUMA 4Z2GA 1E5JA 2VX4A 1KBBA 1X1NA 5BXSA 1J01A 3NCOA 2YIHA 1VIWA 1WAWA 2DQXA 1ITXA 3MUIA 3UG3A 4GO8A 5D4YA 3GXDA 4PSPA 2D24A 4PRWA 3QHOA 3VGHA 3VGEA 5DO8A 1TA3A 3W82A 3DECA 5A8NA 4KMQA 3CPUA 4YHEA 2ESCA 1JZ6A 1UHVA 2NT0A 4GI9A 3E1F1 3GNPA 2J79A 1B3YA 3RM4A 2WXDM 1JZ2A 2YKKA 4PMZA 2A3AA 2XYLA 2J77A 1BGGA 3CZEA 1UZ4A 3FNDA 1C8XA 1V6UA 1XCXA 2EPOA 1VJSA 2YA2A 3LPPA 1HJQA 2JALA 2WSKA 4ZE5A 2BY2A 2WB5A 3WD1A 5A6AA 4RE2A 1CTNA 4LK6A 4PTMA 1XYFA 3RDKA 4MB5A 2XIBA 1DWIM 1KWKA 1VEMA 2VRJA 2WWCA 2BHZA 4HOWA 4H41A 2VVSA 2D3NA 5D9OA 4MNMA 4DM1A 4JFUA 1ISYA 4DUWA 4LYRA 1ZBVA 3O2LA 4UFLA 2WZHA 4D71A 4F79A 1CLVA 2O92A 3CBWA 1ESWA 1EOMA 2WNWA 3BAIA 3WL0A 4J3XA 4GZIA 1BGAA 2GJXB 5HPOA 1OINA 4JKLA 3G6LA 5TD4A 2GUYA 2XFYA 3AXIA 3I3DA 3SCVA 1V0KA 1JYWA 4UQAA 1XD0A 1M7XA 4PUDA 4AD0A 1DEDA 1H0IA 1OKOA 3HN3A 4JKKA 3W6LA 3MUY1 4H7VA 5DEZA 3GZAA 1H49A 4U5IA 4UQCA 3GTNA 5A6JA 5A6KA 2PF0A 2ZX6A 3ECQA 1CGUA 3CHCA 1UQYA 3WUEA 1B3VA 4BA0A 1E6RA 1HP5A 4XX6A 4ATLA 3WY1A 3CUJA 3AS2A 3N18A 4D6EA 3B9AA 4U3CA 2WVTA 3AICA 4M82A 4JKMA 2IUZA 1H2JA 1RP8A 3AYRA 3J7HA 5IHRA 1UWSA 3TOPA 3LPGA 1L0PA 3OIHA 1G0CA 4TX6A 1QI3A 4WKFA 3QHMA 1KFWA 3WQ5A 3W29A 2Y2WA 1E6XM 2XTKA 4AL9A 5EB8A 2K46A 1OM0A 4AC1X 4A6SA 1KGWA 5E6YA 4W8BA 3ARPA 1US3A 1GOQA 1OIFA 1KXVA 3ZOAA 1C93A 3OLGA 2EBNA 2XPKA 4HU0A 4GI8A 3AHYA 3NDZA 3MV11 1EQCA 2XVPA 4Z2KA 1WE5A 4CCEA 3WQWA 5EMYA 3WBEA 1NH6A 1XHGA 2J75A 4ATWA 3BAJA 4GZEA 1V6XA 1CGWA 3WIJA 5CZKA 2WANA 9CGTA 1VEOA 2Y8VA 1DWFM 2J62A 3ZT5A 4FF5A 1BLIA 1J0JA 2JFEX 2IXVA 4BQ3A 4V27A 4Z2LA 3WF3A 1NARA 4HTYA 2FHBA 2WLZA 2YA0A 1QNRA 1KR1A
chains in the Genus database with same CATH superfamily
2QJIA 3H9AA 3R0RA 1EQPA 2WWDA 1I1EA 1EGMA 1TJ0A 1JMUB 2AUYA 1RVF1 1JCTA 1JYVA 3G3DA 1QOXA 1E1EA 3LCPA 2X09A 2PWFA 3HN1A 4WOQA 3MYOA 3OW1A 3KCJA 3APYA 4QMAA 4XIOA 2P0IA 2ZRUA 4NAEA 2Y7DA 4IGNA 2DCJA 2DYCA 4UFJA 1HL9A 2CLEA 3F5JA 2ZGMA 1RJRA 2VYOA 3IMNA 5E6ZA 4CGTA 2R49A 4LKEA 4GPNA 4PBPA 3RLGA 4TV6A 2Q1MA 3BGGA 3A9BA 5HINA 3IDBB 5FXWA 5LYRA 2NWRA 3R5EA 2VOWA 5GZFA 1OX6A 3C2FA 4C6KA 2PA6A 1EYEA 4DY5A 2BVTA 3VIKA 1K9FA 1K45A 4FNSA 1TWWA 1CVNA 3OY8B 2E6DA 1E9LA 4NT0A 4J1OA 3W1UA 3N3HA 2IXCA 1PDYA 2BFGA 2CCRA 3C2OA 1AL7A 3DOPA 3DI0A 4E3VA 3C4UA 4AWEA 3VAVA 3TEXA 1R64A 4Z2JA 2XFRA 2VTXA 5LKYA 4B4RA 3ZXLA 2REQA 5C7GA 4BR1A 5C9WA 1YC61 1JF5A 3S5YA 1FDJA 4PJYA 3IARA 3WQ8A 3NV4A 1UCWA 1OCBA 5F5AA 4LHLA 3M07A 2AAMA 3SQSA 1WMDA 1EJWC 2PF8A 4PUJA 2C0HA 3IVSA 3EWYA 2BODX 3GYCA 1I5ZA 1SYTA 2EAWA 4DM2A 2YCLA 5C9XA 2YBKA 2RJHA 5D8WA 5AYBA 2YYOA 1LOAA 2ZCWA 1K8XA 4X0NA 4DJFC 4C6QA 1WA6X 5FYMA 4ZU7A 1PPIA 3RPDA 2CWNA 2C1GA 4WOZA 2XH0A 3ZFFA 1OZMA 3LHUA 3WLJA 4N42A 3MBDA 3CLWA 3W88A 4CDQA 3TRSB 2LUWA 4AX6A 2V38A 1TJ2A 4INFA 4JTIA 5AVAA 3EDKA 5BROA 9XIAA 3LQCA 5CAHA 1YLLA 3N7KA 4KKXA 3PPGA 4Q33A 4A3HA 3WBXA 2VR4A 4HPKA 2WAGA 2F4LA 2YLLA 3VZLA 4PQ9A 4W8AA 1ZUAX 4IEVA 3INPA 3WJXA 2ZZ6A 3VIPA 4PLMA 4CRQA 3PZOA 1V8EA 4R27A 1XGZA 1F9CA 5CFDB 1XFBA 4LCSA 1HJFA 4JY8A 1OCJA 3O06A 4OVXA 1SBFA 2W47A 3I7SA 4NZ4A 2DUQA 1W1IE 5FY4A 4YG3A 2DZXA 3HPSA 4JCMA 1UAIA 1BG4A 3RCMA 2KM2A 1WPCA 5BNPC 2BXZA 4M01A 5TBOA 2NXGA 3LSCA 3GDTA 4PC8A 1LL7A 2WPGA 2I2SA 3E0WA 3IIVA 3GF6A 5FWEA 4FNUA 3UJEA 2ZTJA 1WCSA 2QUVA 3DKJA 2X1IA 3V0SA 1S55A 3E5PA 1SSGA 5AYXA 5BMWA 1PO22 2UYBA 1K4GA 3TDFA 3FJ4A 4CD6A 2JG8A 1S0IA 1UQZA 4AYSA 4DRVA 3KB5A 1COV3 1QPNA 3ELNA 3J7MA 4V2WA 3OQ8A 1WZLA 5DX7A 1B3OA 5JMCA 2IZWA 4I7UA 4L9XA 1CX1A 1CONA 3OJBA 2ET7A 3N4AA 2BY3A 3ITXA 1GWLA 5C70A 1UOJA 3QF0A 3T4CA 3GH5A 5CPLA 5GZDA 3HWJA 1AVAA 5JXHA 2MNRA 2JDPA 1NDYA 3H7RA 4HJFA 2B8MA 1WWYA 3L9JT 3DYMA 5FYHA 2CBUA 3U2EA 4NAEB 3MIGA 1JG9A 1ENRA 1W9XA 2E63A 4UC5A 2YYUA 1JI1A 4LBOA 2FH8A 1A3XA 1XH1A 3BTYA 2I5QA 5AY7A 1HXS1 3TNOA 2A3XA 2CHRA 4W84A 3A5VA 3N9OA 1QPRA 5KMYA 1WNOA 4MGZE 3JRKA 4EWEA 1R30A 4A2UA 3TXVA 2RGLA 2ZMNA 1PVNA 4JIHA 2PHXA 3V0BA 3WCZA 3UY8A 3UETA 5C4WB 1EXBA 1W3LA 3IUHA 1RAKA 1S0CA 1DHPA 4AI0A 1KNWA 4KPLA 3JQXA 2GQ8A 4QU1A 2QPSA 3KOFA 4XAAA 2B7OA 4HNVA 5JOZA 1BZWA 2F84A 2REQB 2D6MA 1TQ5A 2VMFA 1CXKA 3AMHA 1XC4A 4R52A 4Q4W1 2XIJA 3TU9A 2D1ZA 2C9AA 4HNTA 4HYVA 2I56A 1HV1A 3P6LA 3S0CA 4AEFA 4I7WA 3RLHA 1XYOA 1UR4A 4HK9A 1WP6A 3MFCA 2PU0A 2OQ7A 2YA1A 2ZX7A 3QOMA 2J9ZA 1KRIA 1O3RA 1Y0EA 3IGHX 4LE3A 1OFDA 2YCLB 5D02A 1PMJX 1S0FA 4UBPC 4JIQA 1W6OA 2C24A 2RKXA 1Z32X 4KFOA 2CNAA 3B9NA 2XH6A 4D6DA 3OHMB 1K12A 2RS53 1JEZA 4E4DX 4MVAA 3IK4A 3UXDA 4IG2A 4KS0A 1IQDC 5CSYA 3ARZA 3TMLA 1UKSA 2I5GA 1ZBWA 4XMAA 1FPN2 4K8GA 1UG6A 3V5OA 1X8FA 2J1RA 3C7GA 4CDXC 2VO5A 3LI0A 1H7NA 4D6HA 4ZXEA 1UPPA 3PUOA 4KEZA 3W1QA 4DXKA 3VOGA 4EANA 1VBGA 1U5ZA 4HPKB 3WNPA 1H7OA 3EX1A 1NWTA 3KOXA 4JX5A 2XU2A 1OT2A 4XZLX 5JXJA 4FR1A 2XDFA 2Z1BA 4MF4A 1OGSA 2QIIA 1A4MA 2FFIA 4D7SA 2OZTA 3AIWA 2Y5EA 3ARWA 5B2GB 1CX9A 2QQVA 4NROA 4NIHA 3ZS4A 1OC7A 2Z00A 2CLPA 3LSBA 4ARXA 1MUMA 1SLBA 1XUZA 4LBLA 2C6SA 1H09A 4BCUA 1LRTA 4XKYA 2P3EA 3AYDA 3E3HA 1W8HA 5FZOA 2P76A 1SUXA 3FZ3A 4U2YA 3JZEA 3GB6A 3U6WA 1VFOA 4DHGA 2TSYA 4IEZA 4G1NA 4MB1A 2ZGNA 1XL9A 4RXFA 2A1XA 3AMPA 1G4EA 5DY3A 5H9SA 5DCDA 3OODA 2JG8B 1OD3A 4KGJA 1ULGA 3N7LA 3MKVA 3DHDA 3MKKA 1M53A 3AS0A 2C1FA 2VZ3A 4LE4A 1RUG3 4WJXA 1G8WA 3RMYA 4RLIA 1UJPA 3KVMA 1RALA 1W9YA 4PLNA 4LMFA 2I9UA 3R0KA 1YQ2A 4RS5C 3KL5A 2HWB2 4OI4A 4ZSTA 2FJUB 3HFTA 3WQVA 2WHMA 4IEYA 1SLCA 4PDWB 3PS7A 3VE9A 4J1WA 1W0OA 3NM3A 4P9WA 4GD4A 3PZNA 4FI4A 3ZJ8A 3VO0A 3O6YX 1FVPA 4KT2A 5BW6A 5BU9A 2ZX3A 4Q6XA 1UF2C 2YMZA 1HTIA 1R3WA 1NOFA 1WCQA 2YL6A 4FPEA 3A24A 4K21A 1SHWB 2DZPA 1DJQA 4QE5A 1PKMA 2QR6A 1ZYBA 3C5QA 2ZZ2A 1C8M2 1RLCL 4GXMA 1OHFA 4I9AA 5C5TA 1H11A 1AX1A 4JGDA 3ILNA 4LALA 4IFKB 1QNSA 4R9DA 2VULA 4DO6A 3V0BB 3E0LA 4B1LA 4ALDA 2Z1XA 4BF9A 3TYEA 3FLRA 5HAOA 5FF3A 1RVF2 4M19A 3H8XA 1SO3A 2PD5A 2JDZA 2AKMA 1F73A 2HROA 4WR3A 3CNYA 4DNYA 1NA1C 4WCJA 4AAPA 1L7QA 2DJLA 4O1AA 5A8PA 3L4WA 5KBFA 4JZ5A 3L2HA 2WNEA 4XCBA 1I9CB 1QDSA 3MSRA 2Y6HA 1S1AA 5J37A 2SBAA 2LS6A 3SH5A 3QGKC 4JYDA 1CAVA 1XG3A 2R042 2GVLA 1WLWA 1LHNA 2GMPA 1SSDA 1R093 1VBB3 1AD1A 1FX5A 3HQOA 4XDOA 1PM7A 1Z7S2 2XHKA 2MANA 1IHIA 1P43A 7REQB 1UY1A 2ZGRA 4W86A 3MW2A 3NSTA 2QUUA 4IP5A 4GQ7A 3QY6A 3NMBA 3WEMA 1W39A 2XVGA 2QMKA 5LZLA 1LYXA 4D69A 1LORA 3UW6A 3WL1A 5FF2A 1O3TA 2VDGA 2PLKA 2WA4A 2CYGA 1G4PA 1TTJA 2I9EA 1KRAC 5IVFA 3VBSA 1B9BA 3DG7A 4JTGA 2ZPXA 3IMMA 2DV9A 3L66A 4M81A 5F3EA 2XSAA 1JPIA 3PBMA 4HA1A 5G5IA 3AP7A 5SV5A 2P8BA 2XSXA 4M80A 4MGKE 1DPMA 1ICPA 1RTVA 3M0KA 1S2CA 2E5DA 3E2RA 1H51A 3NJZA 1PV8A 4M6VA 2EHHA 4FEZA 3APGA 4G3YC 4UW6A 4G4FA 5FBJA 3FAXA 4F0MA 2ICSA 3ZMRA 3TEVA 3BLFA 2BY0A 3CJXA 5E0KA 1H1AA 5DZGA 3LB9A 2EAKA 4Q0QA 1V6IA 3B69A 3S5AA 4HN8A 4I9JA 2WCGA 3HOBA 1TIWA 3BCJA 4L5ZA 3QFEA 3WELA 4O9EA 1AODA 1TPFA 2FZNA 4C6CA 5C7HA 3M6DA 3LQGA 1M7OA 4HKOA 2W52A 3CHFA 3ZT7A 3CZGA 3NQ7A 2FPYA 5F1RA 3PZ9A 1VHCA 1H6YA 1MEHA 3FBMA 3N14A 2CXGA 3S6TA 2FB3A 1EPWA 3V7PA 3PU8A 1MS9A 1JJKA 1R6WA 1LRNA 1VRXA 3UR5A 3U0HA 1N1YA 2J7FA 4M3PA 4HOXA 1SLTA 1PX3A 3R6IA 3DXTA 2OUJA 3EMRA 4QGMA 4YZ5A 3SY8A 3UXKA 1R7AA 3IIXA 2ZC1A 2CTVA 7PTDA 1UX7A 1GG0A 3PVBB 5L7OA 5AVNA 4HFSA 4AD1A 1H2MA 3NQ6A 2MEV2 1G69A 1XM3A 1E9IA 3M5XA 3VUPA 1H60A 3HR9A 3NL6A 3QPZA 4MY1A 1OX5A 4AZZA 1SO6A 1XB9A 4TIMA 4Y9PA 7CGTA 3B05A 4RUBA 5FK8A 3PZIA 4JFTA 3TOJA 2B45X 5EV7A 2XJPA 3KBMA 4FF7A 2PDNA 5KXEA 2Y7EA 5A7OA 1UW8A 4LUTA 3I10A 3LLFA 4JS3A 1KFCA 1SQ7A 1W9WA 2ZGSA 1ADSA 2OT0A 4J3VA 3TROA 3ZLFA 4F3HA 2BTVC 3OLDA 1P7TB 5C4WC 1FNZA 4AAJA 4JX0A 4LVBA 1TV8A 1EJVC 2VPVA 4FMVA 4PMQA 1COV1 2R30A 4GBUA 1HXS2 4WD0A 3J4UH 3QPYA 4OJYA 1POJA 1T96A 4QS5A 4Z0JA 4NI8A 2XBO3 5F8PA 4Q4V2 3LIGA 3W2JA 5LNSA 4GE8A 2VR5A 3OPWA 2ZABA 3QLLA 5A7WA 1ZJAA 1QNOA 4FXRA 5AFBA 2BSLA 5BYNA 2BG5A 5CKMA 5EZWA 2C19A 2PWEA 4UR9A 2B31A 2CLHA 2J27A 4S23A 1HQLA 4DNHA 2Y60A 2ZE0A 3FY1A 2ZGKA 1JFHA 2ZOXA 2Q01A 1QOPA 5FXZA 3TYAA 4J3SA 4YXGA 4UAPA 1V3KA 4YHGA 1O68A 5HDRA 3M0MA 1E0UA 5F4WA 2ISWA 3NKGA 3NQCA 3FYYA 4D6RA 2PQSA 3N9KA 4DYEA 4EXQA 4BK5A 4NHVA 3LA4A 4EF9A 2WJSA 1MS0A 4OYUA 3BSMA 3UY7A 3ZYJB 2OCZA 3VCCA 2JGQA 4QPGB 4AAXA 3VBHA 3PVOA 4GUIA 1UOFA 4H3DA 3RZHA 2W4XA 3AHTA 1FCBA 4L99A 3F4WA 4NMIA 3QW3A 4LEJA 2V3EA 1OFOA 3HPFA 3TE9A 2A4AA 4Z82A 5KHHA 5E16A 3LNPA 3MWCA 2YCJA 4MGYE 4IV1A 1AZ1A 3BG5A 3L4TA 2RS51 3VKMA 1JCLA 4AZ6A 1XIGA 2DGAA 4K8RB 2QCDB 3MI6A 2PDBA 3U7BA 4XD6A 4YZ2A 3EPMA 4W87A 1CT5A 1Q7MA 3JU2A 2ANUA 4C8DA 2NUWA 2CDPA 2HE8A 3MKCA 4OV9A 3IANA 1SPQA 3T7VA 5F4SA 4WXZA 2XWBB 4ZHNA 1E55A 3WEOA 5H9RA 3STEA 3AL6A 4Z0SA 2Z1KA 4JIRA 3K8KA 3PIGA 1QOTA 3MCMA 4NRRA 5L7OB 1XCFA 4OBSA 4PDWC 2VD9A 4PCRA 1LOFA 1OMIA 1R47A 2VZVA 4QM9A 1VB2A 2B81A 3W1XA 4DLMA 2ZHNA 1HLCA 4XZNX 1E6ZA 3NV1A 4L9ZA 2BV4A 3W37A 2EXJA 2HZGA 2WS93 1F4AA 2ABBA 1J93A 4US5D 2JIWA 2JQXA 1PK6A 4JGZA 4NNCA 4YPJA 1SPPB 3BH4A 1QK0A 2PSNA 4XAZA 4QG6A 4CVWA 4LNCA 4V15A 4ACZA 5GNXA 1X96A 1ZRDA 2HCVA 3VOIA 1GFF2 2WSQA 1H0BA 2UY4A 1XS2A 2XJRA 3O0XA 3K4DA 2YX0A 2ADDA 3PFRA 3VBOA 4PCFA 3W1MA 1V3HA 2FDSA 4Z92B 2CETA 4AXNA 5DT7A 4F3JA 2CIPA 4CA9A 1GG1A 1BTCA 4K9SA 4ICNA 4COUA 3TX9A 4AIBA 3CYVA 4URIA 2QUMA 1RUG1 4UXAA 4AEDB 2DORA 3UZ5A 3V75A 3GLCA 2C0ZA 5CVRA 4JDNA 2VURA 4FPOB 1LEDA 3P93A 3HPAA 1W90A 2W66A 2A3CA 5AFEA 4XF9A 3ARXA 1HJXA 5AVHA 3CU7A 4B3NA 2O0OA 1JXJA 3DBPA 4BF5A 2DDXA 1GICA 2HWD3 2P6CA 3UXIA 4WX2A 2B4GA 3AIBA 3BXWA 4XF0A 4Y1XA 3AJXA 4JBRA 2Y8KA 5I0UA 2PAMA 1XSJA 4E4ZA 4Y5SA 2HVMA 2Z4FA 3WK0A 2DF7A 3AHXA 3DC0A 4AZHA 1HQWA 1LLZA 4FOYA 1GJWA 3TSBA 1JDFA 1W2AX 4OIFA 4DZIA 3B0XA 3JVAA 3OSDA 1E6PA 4S3JA 5EXOA 3QW4B 1BHGA 2RDUA 4P9IA 4JQ2A 3WR0A 4DO7A 4U36A 1TPEA 1XYNA 2Z6JA 1D3GA 4MHBA 3WFAA 4GB33 4LA2A 3VIIA 3WG3A 4RPQA 3RYPA 4IPNB 3TOYA 3E49A 4F9JA 5A2AA 1N3QA 3LS9A 2FGBA 1YQ5A 1DQ0A 3LA2A 4AHXA 2G1MA 3OVPA 3B9EA 3PUGA 1STMA 4GGHA 1V6YA 4LBJA 1YHTA 3A4AA 1AXYA 3GM8A 3KHJA 1DQ2A 1EJUC 1JYIA 2DT3A 4J27A 5HMEA 3RLUA 1R091 1PZ0A 1VBB1 1WB0A 2W6RA 2BDQA 4LW7A 4RW5A 2Y34A 4L9BA 4CEYB 5BV6A 3S7IA 3IRDA 3NWRA 4R7OA 2QGHA 2D3SA 3S9IA 3QQ0A 4BPZA 4Q8TA 4HPNA 2JKEA 3GCXA 5H8PA 3PZGA 1W3JA 3MC5A 3F2BA 4XIAA 3WH6A 1E71M 2G3IA 3A64A 1W56A 3NO5A 1D7KA 4C1KA 5FUNA 4LNVA 2J8FA 1V4YA 5CBJA 3CT7A 1ZJBA 1HKWA 1XYBA 4LAOA 2XFWA 5SWUA 4MWAE 2MNGA 3IPWA 1PGW2 2Y88A 4IQJA 3STFA 3WW3A 4AFCA 4QNWA 2P3ZA 4WVMA 1ASJ3 4LKSA 4KRTA 5HULA 3P61A 1GOWA 4OHZA 2VCMA 1FOD2 1UPIA 4HU8A 1FWBC 1PYFA 1F9KA 3S2JA 1V0AA 6XIMA 2QTWB 3GCWA 4UB9A 1DFQA 3KGZA 1MUCA 5FAJA 2BGQA 3W4RA 2CERA 2BNJA 5A6SA 2QF7A 4GI6A 1F3EA 5A3LA 1GQIA 1FH7A 3GTXA 3V64A 3MQTA 4QFUA 2HYXA 3RILA 2BXYA 1PK6B 1ODUA 2AL2B 5GNZA 3M47A 4CNNA 2HYKA 2VOTA 2WSUA 3CYJA 3NR0A 4WUIA 1NSJA 4RDYA 5I03A 3ATYA 4CEWB 5FZCA 2W5FA 5D8ZA 2Q8ZA 4W93A 3VZJA 4FPGA 3UG8A 4C6LA 5CJMA 3QMTA 2EIBA 2IFWA 1KBJA 3WD2A 5K7PA 2Y0FA 2EG8A 1F74A 1AYM3 1IIGA 3AHVA 4FFHA 1OADA 1PWMA 4X9YA 2D69A 3VL8A 2VT0A 2ZBTA 3LSEA 1RJPA 3VLBB 1UWRA 1B5TA 3HQXA 2RDQA 3ST7A 4D6SA 1OLME 4LTAA 5EFDA 3PP7A 1UU6A 1OZQA 5CPQA 4QQOA 5CC6A 4J2MA 5EMJA 2D6OX 3ENRA 3LCIA 5DANA 1L6SA 2WABA 3AJZA 3KVKA 3KT4A 1OPMA 2BWCA 5DELA 4QXCA 3V65A 1LKNA 3SUUA 1UKTA 3RDIA 4PMRA 2Z27A 2OYKA 1KWGA 1K3IA 1YI9A 1JFXA 2ZXAA 2UWBA 3KBSA 4NVTA 5ABHA 1ELSA 1COV2 2OZ0A 2R072 4TX8A 1G9DA 2VC9A 3KLKA 4WM8A 5FRAA 1I5PA 5CSSA 2P3IA 4DJEA 3FS2A 2VCAA 2OZ8A 5LNRA 3IN9A 2QCEA 3T0DA 4FS9A 4BI7A 2ZGQA 5EKYA 2HKXA 3DFTA 3VUSA 2FPVA 4MAVA 1OFBA 1R38A 2GJPA 2V67A 3CAKA 4O0KA 3LD8A 3ARQA 1V6JA 3AL5A 3TVAA 2XOMA 4LWWA 1M04A 3TONA 3LDVA 4NZFA 2J1EA 3M2MA 2I74A 2XM2A 1A6CA 5IBXC 4KBBA 2ZX1A 3GX9A 2WZEA 5JBDA 2IQDA 1W2NA 4FXKB 2XJQA 2XBO1 4RQPA 3WQBA 4D3WA 3M0XA 4PBEA 2GDUA 3CWOX 3T05A 5T8GA 3NJYA 3WQEA 2ZKLA 4QPGC 4ZMGA 4B7KA 4W5ZA 2CAVA 1CQ9A 1QU0A 3DGTA 1X39A 2J7HA 1KBIA 3WV6A 4TWTA 1DOSA 3MWAA 1BXHA 1NIUA 3BLEA 1AR72 3CUGA 4OULA 1JZ4A 1R5YA 2DP3A 7TIMA 5G04L 2NLRA 2ZMKA 3BI3A 1P6BA 5AZ0A 3F2ZA 4EN9B 3K8LA 1V3LA 1S2TA 2VRKA 1A3WA 3UCQA 1XLKA 3BZJA 1MEWA 1KCKA 3IIOA 2RVAA 1OC5A 3Q94A 3RSJA 2G37A 3FFSA 4XC9A 1NQDA 3Q67A 3R12A 5I5RA 1XYMA 1UY0A 3FGCB 3CZJA 1EH9A 1X8MA 4OUEA 2VBBA 5FUPA 4HD5A 4M8UA 1IQ8A 4EWJA 1US0A 4ZFMA 1S3TC 3ZVIA 2RS52 5D33A 2JECA 1PIGA 3S1VA 4XD4A 3H12A 3PJTA 2G4FA 2WFF3 3WNMA 4BDVB 4IIEA 3ZFEB 1HJGA 1NXMA 3BAXA 1IPKA 3LEPA 1XSIA 2VNGA 5FZGA 1JU4A 2R24A 5FYZA 4PBFA 2TRSA 1FCQA 3MANA 2NW0A 1VRDA 4CDWB 3LEMA 4XIKA 4BHYA 3WNLA 3B8IA 4EN7B 4IE0A 1E3XA 2PS2A 3ZSJA 1F3WA 3TQKA 1W03A 3LBOA 1UJQA 3MUAA 1GKRA 4COZA 4BISA 4HETA 2CDOA 4RPPA 3PC0A 3KEHA 2WSPA 3LCGA 1TZ7A 3W00A 1HV0A 4CP9A 4X2PA 4HYWA 3R58A 4Q8MA 2IXUA 1A5KC 4YVVA 3ZSKA 1A5NC 4IGQA 4PF5A 3ATZA 3TNQA 5CG0A 1QWRA 1ITQA 2CBIA 2QQMA 2VCCA 2WQDA 4E38A 3VGBA 4H00A 4PIYA 2W0XA 3N3TA 3W7CA 3JU9A 4QJ5B 4AK3A 1U22A 1XUUA 3GRIA 1ZLPA 3H21A 4AEDC 5EMKA 1CJPA 2Y5SA 4M6UA 1UR0A 4JAWA 3W26A 1J3QA 1GZJA 4IZGA 2Y6JA 3W1AA 2BZDA 2P5NA 3EDJA 1UKQA 1W3KA 1XCWA 3HM7A 5L73A 4IIBA 3ZZ1A 2ILMA 2NYYA 3ZXKA 3V0AA 2WMFA 1MDLA 3AP5A 3N2MA 4GYPA 3WQ4A 1BVP1 3MF6A 4WBBA 5C5UA 3LRMA 1RUG2 3PG8A 1EDQA 4O15A 4JEJA 1Q6DA 2ZZ3A 2WS91 4YGDA 3QEZA 4N02A 4LHSA 3NW4A 2F6UA 1K6WA 3NQGA 4HHMA 4JTOA 3RNDA 3E5UA 3WT3A 4Q7IA 2NZ9A 4HMDA 4XVEA 1GOHA 4NAOA 4GCAA 1JD7A 4EAMA 1VBRA 3QACA 3VUOA 1BRLA 4YCOA 4AEOA 5GZEA 1L2UA 3MIHA 1OD0A 3IJ9A 3URAA 3CK5A 4ORFA 3WG2A 1V6NA 5AC4A 3JZVA 2P10A 5F2IA 1H8TA 4XTIA 1B35B 2FCTA 4RD7A 2XH4A 4Z42C 1MZHA 3J8F3 1IXNA 4LJHA 1D2QA 3WDQA 1XPGA 2WKJA 4GVFA 3BKZA 4Y9OA 4RQPB 3I2KA 4PMOA 1SBDA 3UZWA 3U78A 1HKIA 4Q4X2 4PT6A 3WQFA 4GALA 3AP4A 5LBFA 4JGYC 3H53A 2VX5A 5GJMA 1DZRA 4XAPA 2J74A 5C6MA 4IHCA 5JVVA 5I3IA 4CEYC 3L2IA 4DWSA 4L61A 3GFXA 2HWD1 4U28A 4W7VA 3WLIA 3EOEA 2DSWA 3QQ1A 4ZENA 1UWAA 4CD5A 6XIAA 1I2NA 4Z1YA 1RINA 1ZM1A 2X10A 2GN3A 4AMCA 2GK1A 3BPSA 4LVDA 3WHTA 2WZMA 4L4PA 3CIVA 4RDZA 3RCYA 4LSBA 4C6FA 2WZPP 4I8DA 1KM6A 2V5KA 4UMAA 3R94A 3S46A 1MXGA 3ZFHA 1R092 1EL3A 1HT6A 5LA2A 1UR2A 4MGSA 1EXPA 5FPZA 5E0FA 5GLVA 5LA1A 1LOSA 2QVSB 2HWC3 2WHLA 2RHPA 3E96A 3HGRA 4GB31 1EB3A 5CXPA 5HBFA 2F17A 1VBA3 5T9BG 1SJAA 1T99A 4BEQA 4MWAC 2JICA 1YPIA 2FVLA 2ZUSA 1UD8A 3VV1A 4N0RA 3S4TA 1PWLA 4JDYA 3LNMA 1XE8A 3OUJA 3ZYHA 3IAPA 1RUJ2 1EJXC 2UY5A 5A8MA 3TYJA 3R8RA 4URTA 4P8XA 1I2RA 2EALA 1IE7C 5E9AA 4UI9L 4DPPA 1WMXA 4H2HA 4LBUA 1AXZA 2IPGA 5D2VA 3QKEA 1XLCA 4N2YA 2FGLA 2DSUA 4E4UA 1K7EA 4L6HA 4QAWA 3BIEA 1PZ9A 2VM8A 4B2DD 2J7CA 3QYSA 1GQPA 3G1DA 4QDRA 3U5YA 3U9IA 3UCCA 2ZKNA 4CEWC 5CKSA 1CGXA 2FHCA 3GBFA 2HBVA 3QLDA 3SURA 4M3CA 1Q63A 5F1UA 3IPVA 1JYXA 2GWNA 4KIRA 4AIEA 4N53A 1TV5A 4W6YA 3MI3A 3H3LA 1OSGA 3DHFA 4A7YA 4DI9A 3F95A 5FMDA 2FH6A 4M0XA 4H7MA 2G3JA 1ONAA 2OO6A 4G5DA 1REQB 1TWZA 3KHCA 4Q8QA 5FZMA 5CA6A 3UCDA 1JHNA 2YXXA 5AC6A 1ASJ1 1HJUA 3E74A 1Z9AA 3ZLHA 2UWAA 5EL1A 2D3PA 4GZ7A 3EAUA 1KITA 4DZGA 3UWZA 1JW6A 1WMEA 4P08A 3BTAA 1E9YB 1UH3A 2YV8A 4K7VA 3KW3A 1A3KA 1BJQA 4IGHA 1C3FA 2BGSA 4ZB5A 1AJOA 1KJLA 1A5BA 2RDSA 4S2GA 5DABA 2DIEA 2FIQA 3RNSA 1DWGM 3OF1A 3N3MA 4P7NA 4YM2A 2YZ5A 4MNKA 4J1XA 3C3VA 1RUD3 4AGRA 2BHYA 4F2BA 3KTXA 5F2SA 1QNVA 1A47A 3W2UA 4LULA 1W2VA 3C7FA 1OK6A 3ABSA 4Y7EA 1JI6A 4IV3A 1PX8A 4MG2A 3UT0A 1CGYA 4FLOA 3J7NA 4ATFA 2RDRA 3S6OA 3T6CA 2Q8XA 4MUZA 5FYUA 3PBUA 1AYM1 1CXHA 1JDAA 4HJWA 5I8YA 2UY8A 1MQQA 4UOZA 3KCLA 3QMRA 2OIIA 4A35A 1AR63 3AKSA 3LFMA 3K48A 1TJRA 1ECQA 1LZOA 3HGSA 1VRH3 1E43A 1UUQA 2X1RA 3QQWA 1EA9C 4Y33A 1PTGA 2XGZA 4JTCA 2VUYA 4NWVA 2O7SA 1WXJA 4Y96A 3GG7A 3W38A 1F5FA 2GSEA 3CZLA 5JOXA 1XSRA 1HNYA 1XYCA 4I9MA 5JZGC 1F3XA 1SO5A 5A6BD 3A3WA 3FHAA 2PDYA 3EKZA 4LUSB 5FZFA 1GKBA 2PN5A 4RKAA 3K3NA 3DN7A 3NZ1A 3BQ6A 2J4GA 1GVFA 1DHKA 4XUOA 2NSXA 2OG9A 1EDGA 4IX0A 2BFUS 5A7QA 2UWCA 4O61A 2IKHA 4W5UA 4YW6A 2X1TA 2WMGA 1U1JA 3AXHA 3IJ8A 5J36A 1LCOA 3WFLA 4PTDA 3BALA 2XBO2 2VQTA 3N2OA 4U5KA 1GEQA 3JXSA 2WWUA 1LR5A 2Q02A 4MSVA 1W04A 3B02A 1MI3A 3HG4A 4KL1A 4W89A 2WMKA 1TV4A 2HEYF 2B4KA 4IEXA 4O57A 2JX9A 3O6CA 3NV2A 4YW1A 2C1IA 1KFEA 3LE0A 5CB7A 3EMQA 4XKMA 5EYYA 1OOPB 1TME2 2BVWA 1X8CA 4RNIA 1IHMA 1G86A 3WD4A 3KV9A 5C9AB 1HJVA 1IG3A 3SIMA 3OYWB 3UKNA 1MW1A 1Z7AA 3VHPA 3GTFA 4AIOA 3ZFEC 1RJ8A 1PDZA 4E4FA 2LLEA 1CYGA 3O7UA 1EC7A 2Y0OA 4W8JA 1RPXA 3SCNA 4JIPA 4TV5A 2NUYA 3IJLA 3N15A 1Y9GA 4CDWC 2GVEA 2CLOA 1H5VA 1Q6LA 3BICA 3QH7A 3CTLA 3MSGA 3P8IA 4PUNA 4A8NA 4AHQA 1U5VA 3LEGA 5CPMA 4Z17A 4DEFA 4M3CB 1WA3A 3POJA 4KG0A 4LY8A 3VBFA 4P7LA 3N19B 3H50A 1YDNA 4N53B 1HRV3 4P02B 4AEKA 3R8HA 8CGTA 1S0GA 3AZVA 3UWQA 4GKYA 1J58A 4DI8A 5IXEA 3THCA 4YM0A 1W54A 4LS1A 4XAEA 3N4EA 1GJPA 1Y9MA 3L0KA 4R7JA 3GDRA 4Z8BA 3CHVA 1J0KA 1FKXA 1IT0A 2HQAA 1TVPA 1CXFA 4KETA 2BY1A 5C8CB 5AN7A 1OF8A 3F2CA 2VW1A 1SFLA 4DINB 5BXXA 3WK1A 1B09A 1OT1A 4E27A 1OQ1A 1E1CA 1V51A 3I6RA 3TW9A 2WSRA 1OABA 4K6BA 4GO9A 4O54A 2WFF1 3HT1A 2H8XA 4GJ1A 4HA0A 2VC7A 4ET7A 2JDUA 3EEZA 4L1XA 3MEPA 1PIV3 1ULFA 4LJ3A 4PF1A 3VKBA 3O0VA 2BOJA 1A80A 3EBVA 2O9RA 5A69A 1W05A 1C5HA 1A5MC 3EX4A 3V16A 4XFCA 1CPNA 1I8JA 2V5LA 3GNRA 2CGOA 4XZMX 5D38A 1RXFA 1TUFA 3OVQA 4ZFCA 5DLCA 3E5QA 1J59A 3VKNA 4C5YA 5FPBA 2XWJB 1RPKA 3P7YA 1R1ZA 4F8AA 5LATA 1QW8A 2D3LA 4HA4A 3IDAA 4Q1RA 5ABTA 3IGUA 3LI1A 4F83A 5C9ZA 4NE9A 4B3LA 4WEVX 2AGTA 2OLSA 2ZUMA 2BX7A 4Z2GA 5LEJA 4YTUA 4C5ZA 2VX4A 2WS92 4C1XA 5BXSA 4QXKA 1Y43B 1B35C 3U48A 3KVAA 1AL23 3BURA 3WSOA 3O6DA 4PUMA 1QK2A 4WGHA 1X82A 4X63A 3LKJA 2WQZC 3QBQA 3GXDA 4PSPA 4I0BA 2QBXA 3FKRA 3NZPA 3WUDA 5M2FX 5DO8A 3DEQA 3LDRA 3W82A 2PTYA 3DECA 2GDQA 4E8GA 4YHEA 1DGRA 1XDMA 1JZ6A 1S2AA 2E33A 3MICA 4GI9A 3E1F1 5FAGA 3EA3A 4CUAA 2J79A 5G4EA 1IS6A 5KXDA 1RJ7A 2WR9A 2RJLA 2WXDM 4FAHA 2J77A 1THFD 1XRTA 2NVDA 3FNDA 1C8XA 2VMIA 3ZVXA 1U1HA 1VJSA 4E5TA 3LPPA 1T8XA 4H83A 4HBNA 2BY2A 2IFRA 5A6AA 4ITCA 4PTMA 3S8HA 3P3PA 1XYFA 1QRQA 1AD4A 1FHVA 4EROA 1Z8AA 3PWIA 2DVXA 1K02A 5DUVA 1DWIM 4KCVA 4AFBA 2VRJA 4H41A 4E9KA 2D3NA 3TAKA 1Z69A 1M7PA 3J8F1 4DM1A 4DJFD 4JFUA 1ISYA 1GYMA 3DEMA 4LFYA 2PZ0A 4TMCA 2WZHA 2ZEZA 3I7RA 4XFAA 1XISA 3WLQA 1CLVA 2O92A 3LGGA 5J5RA 1EOMA 1BEUA 2A6VA 2ATFA 1TPB1 2ATMA 3B8TA 2QKFA 1AR93 2B9UA 1OA2A 4EN6B 4GB32 1F2JA 1VKFA 4UYBA 5HV4A 4FTBA 2F6KA 1TWDA 3CAVA 4GZIA 4DBWA 3PLQA 1UMIA 3MLLA 1XNKA 2XFYA 3FYPA 1JYWA 5C2CA 4DJDA 1L6WA 4AD0A 1CR7A 3LERA 1SLIA 3H1MA 3PUEA 1OKOA 1Z78A 1JHJA 2DVUA 3W6LA 3GZAA 1R1A3 5I91A 3PBWA 5A6KA 4ILSA 5CYYA 1ZZ6A 1TELA 2HE5A 2HWC1 3MYPA 5A3MA 2JG9B 3OUIA 1S38A 4NXKA 3CHCA 1E1CB 3E97A 1FWIC 4SBVA 1B3VA 1VBA1 1W9SA 1E6RA 1ODNA 3R11A 5BMXA 4ORIA 1YW1A 3WY1A 5FZ7A 3AS2A 2NM1A 2OT7A 4X6QB 4AFDA 3QXBA 1H2JA 2RS33 3AYRA 4WY0A 3R4DB 3UJRA 1D3HA 1O4ZA 4EPDC 2W95A 5D2WA 3HTWA 3R1ZA 1HO1A 1L0PA 2LW8A 3FLTA 2BXVA 1JYTA 1DKWA 1ASJ2 3PWGA 1RMU2 4WKFA 1DTNA 3ZYIB 1KFWA 3QHMA 3WQ5A 1U83A 3EX3A 1IEXA 4AL9A 4AQTA 1KLZA 1NAL1 2X16A 4XBKA 1BSLA 3BLDA 1OM0A 4AC1X 2HMCA 2Q3OA 2XISA 4AVOA 2XPJA 4AI3A 4W8BA 2GZWA 2Q8EA 2VFHA 2EBNA 1NCQB 3GDLA 3L67A 2Y33A 3SRFA 1NOVA 3NDZA 2OTDA 1JH5A 3TZNA 2ZACA 5FMCA 2D5HA 1WE5A 4CU9A 3A12A 3H7JA 2FZDA 4TSVA 5LBEA 5D37A 2EXHA 4QTGA 2IUWA 2Z79A 1UZWA 5C2GA 5CZKA 3CAWA 9CGTA 4Q8KA 5LA9A 4XCAA 2PWVA 5LIKX 4FF5A 1BLIA 4O1CA 4N9EA 3NQDA 1A53A 4BQ3A 4WVVA 2WJDA 3WBYA 2DZBA 4Z2LA 4O1FA 4RSUA 2XJTA 2WLZA 2UV8G 3JBG3 3WK3A 1UMZA 5IVVA 3CV2A 1DYPA 1UZ0A 1XKYA 5MKGA 1P0EA 4A8LA 4FTSA 4WM7A 2CPUA 3EB4A 3AXXA 5T52A 3HJZA 4FNQA 1RUD1 1TE1A 4NO4A 3LN3A 4MYAA 2MUCA 1LL6A 2P8CA 3PAJA 4OQ9A 1Q8JA 1OUSA 1OCNA 1N47A 3TA6A 4P2VA 1MZ6A 3O14A 2X2YA 3U1XA 4AWUA 3HFYA 1Q8QA 3DESA 1V02A 1G67A 3VN4A 3FYOA 2VVDA 3CJIB 3E5BA 1WXZA 2R1PA 3V0UA 2XFFA 1HL2A 3W7NA 1Q6CA 1HKKA 1QVBA 5DXDA 1NY1A 2HPMA 1AR61 3MUXA 1MVEA 4FO4A 1VRH1 1B4KA 2YDAA 1OOPC 2CBJA 5LK5A 3W73A 4OGZA 4MJ4A 4LNYA 5FYVA 3GHSA 5C9AC 4CD8A 2XVLA 3KT1A 4I3GA 5LCWL 2OWCA 4AX7A 2PTZA 5E6HA 4E2BA 4CP1A 3GXUA 3IWZA 4GJYA 4CNUA 3VD4A 1GW9A 4TX9A 3KXQA 3LFIA 3BLLA 1OX4A 3R7MA 5C3QA 2BGNE 2YFUA 2WN2A 5KWRA 4LAZA 1G7UA 2IXHA 3MTWA 1SW0A 1KBLA 3ZMOA 4D8MA 4MHUA 3W3OA 1U5IA 2XB6C 1LENA 3WCRA 3T2PA 3N2TA 5HK4A 1XBZA 4O16A 4OBRA 3YPIA 1HFBA 3BK0A 5T55A 5FCZA 4BU2A 1E6SM 3ZJ6A 4N7QA 2Y7GA 1YPFA 2AC1A 1IEIA 3VNMA 5HQEA 3FOKA 5C8CC 2BVVA 3LCHA 2CW6A 1XNBA 3SECA 3UWEA 3SLIA 1TWIA 2Z25A 4TUFA 1NTHA 3U07A 2WSYA 5LXEA 1YLVA 4G9SB 4CCDA 2BS9A 3UGRA 5HA7A 5DF0A 4BB3A 3RX3A 3PUDA 1GJUA 4WVZA 2W68A 3K51A 3MA8A 3ZXDA 4DS0A 1NJJA 2QLYA 1E5NA 2GOKA 1MS5A 2W0UA 1DBTA 3V1HA 2CV6A 4K1ZA 1J1LA 2VFIA 2JBMA 4JYEA 4LAUA 5FR3A 2CLFA 3OD0A 4MUPA 5I3HA 2DSVA 4CZSA 4RCXA 2WFF2 5K9XA 1HRV1 1WKEA 4QB1A 4ZA0A 3PJUA 3LIHA 4NRSA 1PHWA 2J7BA 3KWVA 3PUQA 3PM6A 1J8VA 1TEIA 2PA7A 3B8UA 2WVVA 1KXHA 4ADTA 2AR6A 3B3QE 4O8AA 4N7UA 1O8SA 2UY2A 2BBVA 1WLDA 1YMYA 2VBDA 4ADSA 2QUOA 1J11A 1QJU2 5KR7A 1GTEA 1QKQA 1UZZA 2YDSA 5DMLA 1T41A 3U2OA 4DXZA 2XONA 3ME3A 2ZEXA 3OGJA 2QUNA 4FXSA 2QGYA 2BW8A 5CEWA 3K3OA 2PTXA 3UVIA 2DT0A 4IEUA 1W9FA 3RYSA 1EFZA 5IVCA 2FFCA 3WSUA 4WM7B 1PIV1 3LB0A 3SR7A 3AU6A 4Q4Y3 4XG1A 3E2VA 4XQDA 2R16A 1RUE3 1N3PA 1IGOA 2P37A 5FP7A 1UIKA 2EIEA 3KRSA 3XISA 4Q4SA 4PIZA 3OBTA 4J3WA 3B9OA 3IUIA 4LUJA 3WQPA 4BF7A 2BVBA 2VUJA 4Q22A 1UYYA 3SCHA 3KRZA 4JIIX 4M4RA 1TV3A 4PB5A 1UY4A 2NQ5A 1Q65A 4NJKA 3W28A 3S5ZA 4S2DA 1NF0A 1MPXA 1WOAA 3UL2A 1O4TA 1LLWA 4P7QA 1HVXA 3LF7A 1CZVA 2VOXA 3SH3A 1PZ1A 1TUXA 5D04C 4EP8C 3SH4A 4LT5A 3WQ6A 3AZYA 1AL21 1ZZ7A 3DFNA 4OZXA 1TFVA 3TAYA 4PMJA 2XL7A 3TTOA 1OVPA 1V00A 1EHAA 2YG0A 4GRSA 1XLIA 5DFAA 5I06A 1ZL1A 3RI8A 4HCHA 1LBMA 1SVDA 1B54A 2QCFA 2ZEYA 4FAGA 2ZUWA 1LOGA 1HRI3 2PP0A 4JPGA 3RF9A 1PL9A 3V5FA 3EOUA 3POWA 2LTNA 3J8F2 1AXKA 1MZ5A 4HVOA 1S5TA 2WC7A 4AUBA 4RGGA 5B4XA 3WVJA 4JD4A 3QV7A 4HANA 5E70A 4TLFA 3NL3A 2AQWA 2IKJA 3HO8A 4G56A 4WDUA 5FI8A 1TTIA 3IWPA 1W8WA 1Y65A 4N9DA 3KF3A 1TR9A 5I2UA 2A6XA 1DJZA 4YVPA 4ONUA 2K2SA 1EZ2A 5G1TA 4AHZA 1H4HA 5JI7A 3CH0A 4A29A 3LLXA 3LK6A 3DG6A 1AX0A 4XW3A 1OQFA 3LA7A 3WDHA 2Z69A 1GQKA 5A94A 2JG9C 3DPRB 1WCGA 4FNPA 1OH4A 2ARCA 2FZ8A 3ZYRA 1JAKA 2TAAA 2WHKA 1NVMA 2VMDA 5FP8A 3I3BA 5FQ0A 3WLSA 2GJXA 5CZJA 5F5QA 2QEZA 8XIMA 3QH2A 1H9PA 1W6QA 4PUEA 1P48A 3G1XA 4H9TA 3A22A 1HN0A 4LC6A 4RDWA 3O0WA 3O05A 3FAWA 2ZXDA 3TEYA 3ARUA 2HWC2 2B7PA 2INFA 1AR91 1JOJA 3HB9A 1HKMA 2CZDA 2W67A 1UMHA 1E72M 4B3KA 3GWQA 1VBA2 5JR2A 2P17A 3N9QA 1UH2A 5GJNA 5KSWA 4GXPA 3W22A 1U5YA 4IE7A 1Z48A 2E26A 1Q4NX 3ZR6A 3WLOA 1LG1A 2XKPA 2DBIA 3WX7A 3TJXA 4BXFA 3WUBA 1UYXA 1J2WA 4FBFA 1LWJA 2F9RA 4UCFA 3OA3A 4Y1ZA 3UG5A 1ZS2A 4LF1A 3KE0A 3PMSA 4LB3A 1Y4WA 2CXEA 1FYUA 1JDEA 4PEEA 1NCQC 1NEYA 1K5MB 4ZXOA 1R1A1 2RM23 2V2CA 1J96A 2WNUA 2ZDRA 1I0DA 1QJX3 2RV9A 1P6WA 1OT5A 1LOBA 3HVDA 2X40A 1W1VA 1Q8OA 4BEUA 1BEV2 5U4NA 3BUCA 5C54A 3RMXA 2VEFA 2VKZG 4Q1PA 1FDYA 3CQIA 2WN3A 3CQHA 5AC8A 4F0RA 4YW7A 1P0DA 4IMEA 1YIPA 3L23A 4HB7A 3THQA 4L2NA 3ON7A 2WHJA 1H4GA 2W1SA 3A4JA 4GZJA 2RS31 3P6BA 3GNNA 1HO4A 4FXJA 3PG9A 1HL8A 4JTRA 4R5EA 4A44A 4AZCB 3B00A 3QZEA 2R7EB 5JIUA 1KGYA 2F61A 2FTPA 1KC7A 4MTVA 4C6PA 4H2CA 4ENLA 1ZZBA 3QGVA 4IL0A 4AY1A 4LBKA 3LEKA 1VEPA 2PDJA 3SCOA 2Q1FA 2CC0A 3LENA 4RL3A 4EE9A 5FZBA 1XLMA 1Y5WA 4EJRA 4QX0A 1DU3D 3S57A 3SNMA 1H7XA 3HPNA 3K4AA 3CJIC 3OOQA 4EZHA 1OFRA 4XQ4A 3UERA 2JE8A 4OHVA 3GVQA 4N6EA 1RUD2 3NNFA 1CGPA 3ZO9A 1FV2A 1H7PA 5FEZA 1UYQA 4MLRA 1KRCC 3LHVA 1DORA 2WUHA 4B5UA 1UOGA 5D03A 1S0EA 1ISXA 3K75B 2Z42A 4R7WA 1VBC3 4CSWA 2H6RA 4H9VA 1KJRA 2QPUA 3OYXA 5FKCA 2OQHA 1DP0A 1WA4A 4XQ6A 1BKSA 2O4MA 3TW7A 4MV2A 4IUOA 5IVBA 3JBG1 4K2SA 3GDKA 3KL3A 3QV8A 1AR62 3R8GA 1VS1A 1ULEA 2E09A 4P7OA 1VRH2 5FBZA 5AVPA 2OZ3A 1DYKA 4LIUA 3K1GA 2PTWA 2D73A 2EIGA 3OBRA 4XFHA 1VYSX 4PHZA 1F07A 2RG4A 3MI2A 1KKRA 2Q3RA 1DTUA 1VAHA 1GP4A 4DXSA 1JUBA 1JIBA 3WDUA 2F38A 4EN8B 3GNEA 3LSDA 5FYIA 4LYPA 1RK5A 5ECVA 4UTWA 1YADA 4LYKA 3W85A 4YRDA 3NVTA 4XD5A 4B5XA 4QITA 4OI2A 4L4MA 5FSDC 2G9GA 5FXVA 1OF4A 3NVDA 2QDHA 2PRHA 3WDTA 3EWWA 4JTJA 4WKHA 1PTDA 1YYNA 4DBSA 5BNOB 4NIGA 4DY1A 5AYYA 3PVFA 4QE1A 4WSHA 2L9LA 4XE9A 4Q8LA 2OXBA 2CZVA 3BJFA 3UZJA 1FH8A 3NIYA 2VC5A 1M3UA 3MZ2A 2OQLA 2D6PA 1ZBA3 5JSPA 5F3GA 3TN93 3NPVA 3ZM8A 3WQCA 1U5XA 5HCBA 3QGAC 1QHOA 4FOKA 3GAKA 3P84A 2OYLA 2GQ3A 2PUZA 3ITCA 1LBLA 4IEOA 4XZIA 3DFHA 5JI9A 4M51A 1ODMA 2X29A 2PEVA 3G0XA 3UKTA 3MP4A 4ZBCA 2XGIA 2D43A 2W46A 2OSYA 3AOFA 2C7FA 3UR7A 1S2EA 1SMDA 3H4XA 4OWGA 3W70A 2RUSA 2VQAA 3V3WA 1AHSA 1MSSA 1OJXA 1DQ5A 4GG9A 1GW1A 4E2QA 3PNAA 4X22A 3WNKA 3OGVA 4RDVA 3NUKA 4I0WB 1GEHA 3QZAA 3V18A 3VMPA 1SM9A 3PPCA 1DV7A 5E09A 4B4FA 2PD9A 5FZ0A 2HVNA 3NQVA 4QJ4B 3RITA 4NU7A 3CF6E 4UZSA 1W1ZA 2F6XA 2VGBA 3IIPA 2CHHA 3WP4A 4LAMA 3MV01 2D20A 2RHGA 5CPSA 1LGCA 3T4VA 3ILFA 1BKHA 4L7ZA 3BVCA 3H2OA 2DVFA 4RE3A 2GMEA 1AW2A 5C3RA 3VNKA 1O7AA 2ISDA 2QQNA 3CMGA 3ERPA 5CG8A 2F2KA 3BOLA 5CG7A 3GJBA 3LZZA 4R34A 3LA3A 3FHIB 4A3QA 4GIAA 5TNVA 5CGTA 2PPGA 3QM3A 1HG3A 4HZ7A 2WC4A 2FZ1A 3B06A 1PIV2 3RLVA 3NPXA 4E2VA 4BMEA 4LQRA 4N7IA 1RP9A 2VUNA 2GAUA 3DXUA 1G9BA 4Q4OA 4U33A 5KZMA 2DUAA 1WGPA 2J78A 2J24A 1ZVFA 1RBOB 3EB2A 2GSHA 3UGFA 3FJSA 4K7YA 5FOOA 3AP6A 4YU1A 2ZGUA 3ZSLA 1XDJA 2R0HA 5L9BA 4QS6A 2IPJA 3WF4A 4J6GA 4YWAA 1OB0A 3IV8A 5JQ9A 3S9ZA 1YQ8A 3NTYA 1GV9A 1PCKA 4GIQA 2V30A 2BNOA 1LDCA 2ALDA 3WKZA 1KLYA 1FWJC 5IUQA 4XK2A 1AZ2A 5FMBA 3U11A 3IUDA 1UOBA 4FSJA 2A79A 5IHSA 4Q4Y1 1RUE1 1AL22 1W8NA 4YZ4A 3CAQA 3VBRB 3TCEA 4R85A 3I59B 4SLIA 1CECA 1E0WA 4GNVA 1G9AA 2XG9A 3AKRA 4DF1A 4OHQA 5DPNA 4OOUA 4NAFB 3FFQA 1UPSA 1EYBA 3UNDA 4LR4A 3GC4A 4XJAA 1XX1A 5FP9A 3D8CA 2JE7A 3U10A 1Z0HA 3MPPG 3Q8EA 4EN0A 1YFWA 4W7UA 3MB9A 1UD2A 3DPRC 3CPRA 3VU2A 1OIMA 2QJNA 4O13A 2XJUA 3POHA 3KBVA 4Y4RA 3GDBA 1U33A 3CUZA 3VZNA 4Q7NA 4ROPA 3W59A 3MPGA 4E0CA 3UNTA 2J25A 5EJ1B 5T91A 3PNZA 1QOOA 2DU1A 2WIIB 1GWMA 1NLQA 2G4JA 3WW4A 3MCOA 1MDRA 2VXJA 2V68A 4XUTA 2D0GA 2XJSA 2NQYA 3CKHA 1FATA 2CKRA 2GJNA 4DVOA 2DUOA 3R89A 1HRI1 2J1TA 3PDQA 3GSMA 3KOYA 5A8QA 1K6AA 3TNPB 4KGQA 3WHUA 2D2HA 1WXYA 5GLUA 3MJYA 3NPWA 1OF6A 4UOJA 1F7BA 1O4UA 2ASHA 1D7FA 2JKXA 2QCHA 1PZ7A 3SO7A 2VUCA 5DQ0A 2CEQA 2PWHA 3R2GA 4MKSA 5FY9A 4WGXA 1QI0A 2Q30A 4D2JA 1AR92 3I7QA 4NJGA 1QH6A 3CO8A 3MVTA 1JXKA 2LM3A 4B29A 3S6PA 4CTEA 5DRIA 1K5MC 3RQ0A 1R0MA 1E70M 3AXDA 1XQKA 1FBAA 1W5MA 1XPYA 3NO8A 2WOQA 3W7RA 3AIRA 4YNGA 3IS4A 3ZXGA 1JTZX 5LBCA 1EC9A 2WSVA 2I45A 3POIA 1SZNA 2QIWA 1NLRA 2J42A 2XIQA 3AMDA 3FJNA 3TV8A 1R2SA 5IFTA 3K13A 3C3UA 1ENQA 4D8AA 4H3WA 5CLTA 4WRHA 1CPMA 1R1A2 3DCQA 4C0HA 1IKQA 4BQ5A 1FP9A 3N9SA 1GTHA 4FPYA 4DPQA 5CBLA 3KVLA 3IV3A 1KTBA 1YJLA 1JOBA 3L4ZA 4AHPA 3GBEA 3TB0A 3RZGA 1F05A 3W2KA 5FZIA 3AC0A 1AJKA 3OGRA 4C6BA 2BPA2 2A3HA 2C14A 1O1ZA 1J4EA 5FLIA 5T3NA 3HAGA 1ME8A 4RZ4A 3ZIZA 2YBUA 4OUSA 2Y62A 3NFUA 2YXSA 5A95A 4E6MA 3NZGA 1BBT3 1JVNA 2RS32 3MIDA 1O12A 1Y8BA 3VKOA 1J5SA 1J0ZA 1C8QA 3CZ8A 1V3MA 1AA1B 2RM21 5DQPA 3B0UX 5D2XA 2OX1A 3UJQA 3W5MA 1QJX1 3WLKX 2DZAA 3GYDA 2JXAA 3VGFA 2E6FA 1JZ3A 5APAA 1DVJA 2YL8A 3DENA 3SCWA 3GU2A 1D8CA 3OB8A 2NUXA 5RUBA 4R53A 4H9ZA 1CWPA 3XIMA 1ZBCA 1O5LA 1TJ1A 4EF8A 3I65A 2YBPA 4DO0A 1JZ7A 5AKQA 4YFWA 1EYWA 1GQLA 1R3QA 2QDNA 2ZGOA 2ZTKA 4Y24A 2W1QA 4IPPA 1IIHA 3AMGA 5FJRA 3ABZA 1DJYA 2GLKA 4XAYA 5DN1A 5FJKA 1C8VA 2FCUA 4MGIE 3NOEA 3RO6A 1ECEA 1Q6EA 3GXPA 3L0GA 1SU5A 2FQPA 1DJXA 2B5HA 1XU1A 4NIRA 3RRAA 3RYKA 2ZAHA 4R9AA 2PDGA 3W1RA 3S5OA 2ZA2A 1OFEA 3EOOA 5FY7A 2WVSA 4XJ9A 5D9MA 2FLIA 3PFMA 1VCVA 1IQAA 3CB3A 3BTNA 3DFSA 1ND3B 3E2QA 4TOQA 1PZ3A 1CXEA 3OVGA 4JTTA 1UKOA 2J8GA 2HWF3 4IGPA 4K1GA 1C7TA 3I97A 3WH9A 4Q7BA 2WNVC 4NHXA 1KV8A 1XR2A 5C3OA 4GX8A 5HQMA 1C8NA 4C6DA 2J22A 1Q6FA 1N3OA 5BNOC 4QJ3B 4YWSA 1KBKA 3E12A 4QQUA 1VBC1 5FYBA 1UD6A 2VGIA 4ZO8A 4ASTA 2GP5A 3R05A 3MW7A 4AVTA 2ZCGA 5H2ZA 3C2VA 1BYBA 1GKQA 4WF7A 4B4PA 2QXWA 1U1UA 2HEVF 1BYCA 3NAPA 2IQTA 4BI5A 2P3YA 4IMCA 3N9NA 3UWYA 4D9PA 5A6MA 4Q2FA 3DYPA 2VOVA 4D72A 3SUWA 4UTTA 4OVEA 4WQ6A 3TN6A 3SADA 3NDYA 4BI6A 1JNEA 1U12A 4YZ3A 2EPMX 2NVAA 5KEZA 4JC1A 3OCPA 1R3RA 4V2VA 1ZJIA 1SZBA 3UPBA 1PHQA 3GZEA 4H7ZA 2Q0AA 1ZBE3 4MGQA 1A5SA 1GBGA 4KNCA 4TVCA 3ZYBA 4IESA 5JMUA 4TTGA 4XDPA 3L4XA 1H6XA 4UR8A 2GGGA 1IR2A 4OV4A 4JYFA 4QX2A 4MPKA 1RUI3 1GQGA 1JRBA 2WLYA 3SGUA 3GQYA 4AGVA 1ZY9A 4XZHA 4MSSA 3AAMA 4FPHA 3WJWA 5IM51 1M01A 4FOQA 4TXEA 1YE4A 1XU2A 4GIRA 4NVPA 5DMYA 4Z07A 3RM9A 1MQTC 4HL0A 5C2XA 4UCGA 1ZBA1 3TN91 1OSEA 2ZX9A 3POCA 4MB4A 1XINA 2PDIA 1LROA 2A1YA 1MRAA 3VCNA 3CH9A 3FX4A 2WZTA 1TVGA 2FHFA 2IXLA 1P0NA 1P8JA 1HB1A 1XBFA 3L2YA 4S39A 3FV9A 1NCRB 1T40A 1YBQA 2A3BA 1GNHA 1PZ8A 3P1IA 4UBGA 4YM3A 3SSJA 4U3AA 2FDFA 2ZGPA 2OW4A 2PLV2 4K37A 4U2ZA 2GQ9A 3UQNA 1PM4A 3I4IA 2E6YA 3ES1A 3OZYA 1DLCA 4QCEA 3QVQA 2ZRXA 5HXMA 2DEPA 1DIOA 5HCAA 1BYAA 4HZ6A 4TU1A 2EXKA 1E4MM 3URQA 1GU3A 4ZY9A 1Q3EA 4PUUA 3VBUB 5ACA3 4L65A 1GQHA 1PNGA 1WAUA 1QF3A 4WIWA 1WZKA 2EPHA 3SCTA 2NQZA 4XQWA 3GW0A 4LO5B 2E53A 1CCWB 3OD4A 1T6MA 4ATDA 2Y64A 3ZFGA 2W39A 2ZA3A 4HPJA 3VBRC 4PQQA 4FP1A 5KHIA 3GO2A 3A23A 4K39A 3M5VA 1R3YA 1VAKA 4XFGA 1OD8A 4HU3A 3A3XA 2YFZA 5D2YA 3VDGA 1QMLA 4BWLA 4AVCA 2ZDSA 4O14A 1JPHA 1H2LA 4Y1VA 4HK6A 3GHRA 4D1JA 3POGA 4JDBA 2DU0A 4UFHA 1V03A 2GL5A 5D9PA 4MMWA 4US5A 4FP2A 3OPSA 1RUE2 3I2JA 2GUBA 1DWHM 4F0HA 4CLMA 1XJAA 3GVVA 1UO9A 4MFDA 5KZEA 2EVXA 3WNOA 5I7GA 4RR3C 2HXTA 1NELA 2BOIA 4IEWA 2HRWA 2YJQA 1BK1A 3CPGA