4BQ4A

Structural analysis of an exo-beta-agarase
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
750
structure length
750
Chain Sequence
GSHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLEVPDSGDVNDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNQKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERLGSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
molecule keywords B-AGARASE
total genus 255
structure length 750
sequence length 750
chains with identical sequence B
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq4A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq4A02
1AMYA 4AZ6A 3AHXA 4X9YA 4ZE5A 3QR3A 3VGHA 1B9ZA 3ARTA 3VOCA 1BGGA 3W27A 2W66A 3UERA 3F4VA 2JIEA 4MNLA 3B9EA 2RGLA 2BVDA 4PMDA 1JNDA 4JFSA 3WQ4A 3TTQA 3BAXA 2DEPA 2VQTA 3N15A 4LKEA 2FHBA 3GNPA 2XVNA 1UYQA 3ARPA 3W26A 1BGAA 4P8WA 1PZ2A 1W8ZA 4W87A 1TR1A 1A3HA 2WW5A 1DWFM 2PWEA 2F61A 5CXPA 8CGTA 3M7SA 1VBUA 2WHMA 4UOJA 3UG3A 1WE5A 4TTGA 2QHAA 2WSKA 3WNOA 3ARQA 1CGUA 3W37A 3FXYA 4GQQA 2UY5A 4ACZB 1VIWA 4HMCA 5IHRA 3DHUA 4AD0A 2XIIA 4X0VA 2OYKA 5A6AA 5A6KA 3IANA 4MB4A 4OOZA 2VZSA 1UKPA 3AIUA 4UFKA 3WDJA 1PZ3A 3I3DA 4PMVA 1JAEA 5A8QA 2ZXAA 4JIEA 3SUWA 2XSAA 2E40A 3ZIZA 4AIOA 2DGAA 5TD4A 3VD5A 4BF7A 3EBVA 2VUYA 1DWAM 1W1PA 1HXJA 4ZE4A 4MB5A 3WH6A 1W2VA 1H41A 4FK9A 1UKTA 3BCDA 1G9HA 1ZBCA 4QFUA 3SCUA 3ARWA 4GXPA 1OD8A 4HOZA 3QGVA 3LMYA 2DIEA 1KBKA 3ARSA 3ZM8A 3MMUA 1U33A 3N12A 3VILA 4UQCA 1CZ1A 2E0PA 2GJXA 1JAKA 2VZUA 3WDHA 1V6UA 1RP9A 5HBFA 3QHNA 1VEOA 1UR2A 2PBOA 1OIFA 5GPRA 2EXOA 2A3BA 4B3KA 2J79A 4LKFA 5LA2A 3VGBA 4K68A 3ALFA 3NYDA 1EQPA 3VNZA 4ZENA 3PZMA 2CITA 3AICA 2WMIB 4AIEA 5CJ5A 3SCPA 7TAAA 2QV4A 2XWDA 3ZT6A 1TA3A 4P7QA 1IZJA 2CYGA 2X0YA 1AQMA 3VIKA 4Z2HA 1TG7A 3PZOA 3SCVA 5IFTA 1B2YA 3VGGA 1NM9A 2DSVA 2G3JA 4AWEA 1EOKA 1JI2A 2G3NA 1J0KA 1NWSA 4XX6A 4CVWA 1B0IA 3EMZA 4GZIA 3N18A 1KWKA 5A6LA 1B3YA 1H09A 2ZXQA 4XZBA 4PSRA 3L2MA 2BV9A 2O14A 1I1XA 1W91A 4D6IA 1W90A 5ABFB 3BC9A 5I77A 2C24A 1C93A 2D3NA 1BAGA 4L4PA 2OYLA 4AYSA 5M3WA 4UZSA 3ARYA 5JBEA 1UHVA 2J75A 5I2UA 3OB8A 5A6BA 1R85A 5I6SA 3MKKA 3OG2A 5CPSA 3WQ5A 4PTXA 1W8UA 3MSDA 4CD4A 4MADA 3QOKA 2WVSA 3VTRA 2VX4A 1DP0A 3PZ9A 5HOSA 3MUZ1 3UETA 3W6LA 1XD0A 1UR0A 3DHPA 2IXUA 4QLKA 2A3HA 1FH7A 1M04A 2WKGA 3FAXA 1E72M 3THCA 4W5UA 1V3IA 3CUIA 1QHPA 3BH4A 2JEPA 4H41A 5C8BB 4M8UA 1ISXA 1BFNA 4H7VA 1Q6GA 2W4XA 1A47A 2NT1A 2PWGA 3IAQA 3AMDA 2GJPA 2J25A 4UNIA 5I23A 2ZWYA 2OLHA 1H3GA 2WM0A 2WSPA 4AY1A 4D6EA 4GKLA 4TTUA 2ZX9A 2WPGA 1JL8A 2XVLA 3L2LA 2X1IA 1QBAA 2DSZA 1GJUA 3PZQA 1UWQA 2VNCA 4PSPA 1JYXA 3CHDA 2WBKA 3B9DA 1ZBVA 3SCSA 4CVUA 2VJXA 4TOQA 1WO2A 3EMCA 1ISZA 1UWUA 4WKAA 3WUGA 2NSXA 3LPFA 4LX4A 5AY7A 5A6MA 1WZKA 4HZ6A 1KR0A 3BXWA 4J27A 1TVNA 1J18A 2D0HA 1KXTA 3SURA 1W9BM 2X05A 3NJ3A 3AMGA 3ZT5A 1OB0A 3W38A 4M29A 5D9NA 2VXJA 1V0MA 2CBUA 2UY2A 3MS8A 3VIFA 4JZ5A 1M01A 1NOUA 4Z2GA 3KZSA 4OZOA 1KBBA 5I24A 5D9PA 1ZBWA 2ZUWA 1UH3A 3IJ8A 2YL9A 3LPPA 1GQKA 1OT1A 1M7XA 1UH2A 3VX1A 3G6LA 3K8LA 4J3XA 5BYWA 2XWEA 1PJ9A 1V3LA 2VZTA 3GXDA 2G4FA 4JL2A 1MYRA 4AZ7A 4GIAA 2E9BA 4RE4A 3TOPA 3VM7A 3AHZA 3GM8A 1E56A 1R86A 1XGZA 2VCBA 5F7UA 4L4OA 1RH9A 1HJXA 5FOOA 3WF3A 3VDCA 2GVYA 5M17A 3T2QA 3NDZA 5JBFA 3AXXA 3L4VA 5A95A 1UKOA 1V0KA 4P8XA 4LKDA 3BAWA 1H0IA 1D2KA 1C90A 2V3DA 4W8AA 3CLWA 4JKLA 4J3UA 2NW0A 4R5EA 1J12A 3DYOA 4H8VA 3ZJ7A 2X8RA 3CZJA 3W24A 1UR9A 4U31A 2YLLA 3UCQA 4AL9A 1Q6DA 1UWSA 3KL0A 4MPKA 4KH2A 4CD5A 4ATWA 4JFVA 4B3LA 2CHNA 4KWUA 2EPKX 2WXDM 3SCRA 1CLVA 1JG9A 4LK6A 3ARXA 1W9PA 4OBSA 3M46A 4WSKA 2YBTA 2QF8A 3L4UA 3CMJA 1B30A 1EDTA 1NWRA 2BY2A 2WZIA 1QNSA 2E9LA 4E8DA 4FLSA 1UR8A 3QHOA 3MV11 5CPTA 3TTSA 3BLKA 2BVYA 1B90A 2VCAA 2WMHA 1GVIA 2DT2A 4NRSA 1RP8A 2VVSA 1YHTA 3AMKA 4BQ3A 1VFMA 4MNKA 4BQ2A 4UFHA 1E6RA 1CXIA 1KB3A 3CTTA 1HL9A 2OWCA 4HU8A 3L4XA 3OA5A 2VZVA 1GNXA 4WKHA 4HU0A 1JZ3A 5ABHA 2V3FA 5A1AA 1JD9A 1HJUA 4P8VA 1L0PA 4QLJA 4AZBA 1UWRA 3M6DA 1EHAA 1XHGA 2GSJA 1CEOA 4D6CA 1RPKA 4BCEA 4GI9A 1J01A 3RIKA 1KXQA 3WF4A 4NRRA 3ARVA 2WHKA 4OBRA 2FH8A 3NSXA 1MQPA 5EMYA 1CPUA 4W5ZA 2WCAA 2DT0A 1XCXA 4PMZA 1JD7A 1W8WA 1H5VA 3OLGA 1LL4A 1JZ4A 2D3LA 4TVCA 1G01A 2D0FA 2J4GA 2XVGA 2WLZA 1WZAA 1V6VA 3ZYFA 1H11A 4M24A 4LYRA 2XVKA 3WKZA 1E70M 2EEXA 3K46A 2CHOA 2EPLX 1NQ6A 3S2CA 2QLYA 4A6SA 4M82A 2W63A 2E8ZA 4FLOA 5BXTA 4MNMA 1K9FA 4TUFA 2ZE0A 3TONA 1TVPA 4UQAA 3GBDA 1HKKA 3VIOA 1LWHA 1JF6A 4ACZA 3NUKA 4HP5A 1Q6FA 3T0AA 4PTVA 3WF1A 2DQXA 1OINA 3FW6A 4U2ZA 4AC1X 1VFOA 1F4AA 3WD1A 1E6XM 1GVYA 3WNPA 1JFHA 2BFGA 1UD2A 2OYMA 4PMNA 2WBGA 3VKKA 3ARRA 1CXKA 4F66A 3ZYHA 4LGXA 1U30A 4KGLA 2W67A 2W62A 1MW2A 2D1ZA 3WD4A 3RILA 1SR0A 2JWPA 1CECA 4W8LA 4UOQA 1VENA 3ALGA 1JFXA 1V02E 2AAAA 3AS1A 1V03A 2E4TA 1JYVA 1E6ZA 1GONA 3BCFA 4PTWA 1S46A 4CN6A 2BS9A 2WC7A 3HJEA 2ZX6A 3DC0A 3MANA 2WWCA 2CPUA 2TAAA 2Z1SA 3GXMA 5BXSA 2D20A 3A4XA 1TE1A 2E8YA 1BHGA 4PUEA 1KWGA 1KR1A 4PMOA 1U2YA 3VX0A 4DM1A 3E1F1 1ZB5A 2PC8A 4U5IA 2VURA 1GPFA 3VDAA 1OH3A 2A3AA 3WNNA 1EDQA 4D71A 4DWSD 3T0DA 2X09A 4HZ8A 1CXLA 3HU7A 4PEEA 3WFZA 2G41A 4AIUA 4WSJA 5A2AA 3M07A 3ZO9A 2VZOA 4BA0A 1VF8A 3AYRA 4PYSA 5GNZA 2WZEA 3T2PA 3PZVA 2ESCA 2D0GA 1EO5A 2YA0A 1UD6A 1C8XA 2BHZA 3VVGA 5A69A 3U57A 2HVMA 2G3MA 1B3VA 1BYDA 3CZ8A 4QDMA 3ORJA 3WQ6A 3VIGA 3L4TA 3LPGA 2XIBA 3WL0A 3AIVA 1PIGA 2CKRA 2PWDA 2MANA 3CHCA 2B31A 4M80A 3N04A 1Q4NX 1MXDA 4ATLA 4P7RA 3SUUA 1ITCA 1CNVA 1V0AA 3VU2A 2DSKA 2LRPA 2FH6A 2EBNA 2WVVA 5LYRA 4NSBA 8A3HA 2GK1A 3PZIA 4CCDA 1V6WA 2WMIA 4XUYA 1OM0A 2DH2A 2DPEA 2ZXBA 1WDPA 2Y8VA 2J7EA 1CWYA 4TVUA 5HXMA 3EDJA 4P8UA 3L4YA 1UZ1A 3I3EA 2JF7A 2J62A 4V27A 1OIMA 3AHVA 4NI3A 1E1FA 1N82A 5HPOA 1B3XA 4UR9A 1HVQA 2VTFA 3W29A 4ATDA 4F9DA 4AD5A 1E5JA 3WBAA 1TA3B 4F9JA 3W25A 5A2CA 3VGDA 1C7TA 4MDOA 3AIBA 2ZUTA 1KQZA 4JKKA 4AISA 4RL3A 2BXZA 2WMGA 2J7FA 4YHEA 3T08A 2BVTA 2WAGA 1CENA 1J0JA 4W8BA 4W7WA 3I3BA 1JXKA 4CP9B 3AIEA 4WIWA 4BQ5A 2XYLA 3HMCA 2WCSA 4AW7A 2G3IA 4CPBA 1CYGA 5D4YA 2E9MA 3FAWA 4M1RA 1JIBA 4CCCA 3AROA 1WP6A 3PZUA 3CPUA 1UUQA 3TA9A 2AOSA 5HNNA 1O7AA 5CSYA 1XD1A 1XH2A 1DEDA 1AVAA 5DEZA 1EDGA 1JZ2A 4ZXLA 1NWTA 4OUEA 5DF0A 2XG9A 2YDRA 3U5YA 5AC4A 1JDAA 2Q8XA 2VX6A 3AYSA 3W81A 3WH9A 4FF5A 4CU7A 1UA3A 1ISVA 3VIMA 1GQJA 2XM1A 4HMEA 3ZJ8A 4CUCA 1K9TA 4J28A 3CO4A 2D23A 3APGA 2CESA 3U7BA 4FLRA 4YHGA 3KL5A 1XH1A 5E70A 3TTOA 2W92A 3OZPA 1E4NA 1GWKA 2GJXB 3VPLA 2J8FA 1E4LA 4UZUA 2YOCA 3WNKA 5CG0A 4Z2JA 1PPIA 3AZTA 4PUDA 4GPNA 3ZQ9A 4UTFA 1V3KA 4B9YA 1AQ0A 1QI3A 1ITXA 3AIRA 3VGFA 3VD4A 1Q6CA 1DTUA 1UR1A 3RJYA 2VR5A 4D6JA 2ZWZA 6A3HA 1H2JA 1MW0A 4MAZA 4QLLA 1XSJA 1GQLA 3O6AA 6CGTA 4D1JA 4U2YA 1C7SA 2WYSA 2ZICA 1HN0A 1R8LA 3POHA 4V28A 2Y5EA 1XRVA 5BRQA 5FL0A 5EFFA 3AFBA 2FDMA 3W53A 3K8MA 3RCNA 4YW6A 3WD3A 1PBGA 3BMWA 3K4DA 1V02A 1UD4A 3BLPX 3CHFA 1VJSA 2WMFA 1LG1A 1VJZA 3T0BA 1UOKA 1W9XA 3GXFA 3K1DA 2DT3A 2RGMA 2XGBA 1KGXA 2CETA 4LJHA 5M03A 2YKKA 1ISYA 2D24A 1G94A 1JZ5A 2XFYA 3ZJKA 1EIBA 4NZCA 4XB3A 1FFRA 3SCQA 4KMQA 4QAWA 2C7FA 1C8QA 4JFTA 4C7DA 3CGTA 2J77A 5BWFA 2OSYA 3F5KA 3BAJA 2VO5A 3WNMA 3AI0A 5BXRA 1E3XA 1GCYA 4R27A 1TZ7A 1W1YA 4PMUA 4A3YA 4AEFA 2GFTA 4CN4A 5D8ZA 3ZYBA 4TVDA 4UFLA 1UD5A 1XCWA 4MB1A 4PRWA 5D8WA 4D6GA 2AMGA 1TCMA 4IISA 3NSNA 3EDKA 1HVXA 1JDCA 2W91A 2J7GA 3WL1A 5E6ZA 1X1NA 4LPCA 4TX8A 1HP5A 3ARUA 2CBVA 2FHCA 4E4PA 1OCQA 2ZX8A 3AMLA 3PZGA 3VDBA 2IUZA 1YQ2A 3SCOA 3WDIA 1GW1A 2Y4SA 5E09A 1H0GA 3AZRA 1GOOA 3D3AA 3MU7A 2QMKA 5D21A 4D72A 4DWSC 5GNXA 1HT6A 1V6XA 1QVBA 1FP9A 1HJWA 5BROA 1L7LA 4JHOA 1MFUA 3WD2A 3CH9A 1UKSA 3L4WA 2QMJA 2CNCA 3WUEA 4JHZA 1LL6A 4AZGA 2WVUA 1GHSA 1IT0A 5E0FA 4AZIA 1OWQA 3B8SA 2C0HA 3NSMA 3SCNA 4HTYA 1JNEA 1BLIA 3WDRA 3II1A 5FKYA 3AIQA 4M81A 3RPMA 3BSHA 1LJYA 3CUJA 4IUGA 2G8ZA 5GQBA 2VQUA 2WVVB 3PHAA 2FHFA 4E8CA 1PAMA 1E6SM 3GYCA 3KWXA 1E0WA 1GORA 3WEMA 1L8NA 1E71M 3WUBA 2WC4A 5CLTA 1E55A 1LL7A 4BZYA 1QI0A 4A4AA 2UY4A 1E15A 5DMYA 1GJWA 1W3HA 1HKMA 4JFWA 4J3WA 4MJ2A 5CPQA 1QOXA 5CGTA 2DH3A 3U5UA 1I75A 1ISWA 4CU6A 4XZWA 1BYCA 1GHRA 4RE2A 3W28A 3B9AA 1E6NA 3WDQA 5AYIA 1B3ZA 5LA1A 4WK9A 1H49A 3F95A 3VUPA 4GO8A 3AHTA 1GQIA 3N11A 3VDHA 2BHYA 3MMWA 1NP2A 5I79A 1MXGA 3DYPA 3MMDA 5EFDA 5DO8A 5A6JA 4CN1A 1EH9A 1MQQA 1FH8A 1W3LA 5ECUA 1BYAA 1PEZA 4GO9A 1EGZA 1NWUA 3WNLA 3CUFA 4P7OA 1KGUA 2EJ1A 1Z32X 1WDSA 2O9PA 1US2A 2XGIA 1WDQA 1PX3A 4A3HA 3SCWA 5A8PA 3F5LA 2ZX7A 5ABFA 1JYNA 1MVYA 4XV0A 2VR4A 5IFPA 3JUGA 3N17A 5A8NA 3VD7A 2A3EA 3WY1A 1C91A 2FGLA 2GDVA 2VCCA 2EQDA 2JIWA 4UQBA 3UT0A 3S6TA 3WFLA 3WF0A 2V3GA 4LXFA 3KL3A 3VIIA 1OD0A 1LWJA 1Y7VA 4CD6A 1BVZA 3WMCA 2JE8A 1QPKA 1TMQA 1MW1A 2VX5A 3ECQA 4YW7A 1LQ0A 4CPBD 2OSXA 3VIHA 5JIPA 3OZOA 5LA0A 5BXPA 4QP0A 1J10A 1SMDA 1JZ6A 2J47A 5HDRA 1QNRA 1ODZA 5A6BD 1GOKA 4AD3A 3EMQA 4W89A 4U3AA 4JKMA 3A6OA 3CZGA 1QW9A 2JEQA 1EHNA 4PCTA 1VRXA 1HKIA 5KZ6A 4DM2A 4D1IA 4JCLA 3GH4A 3UR8A 2XM2A 3TP4A 4JL1A 5DT5A 3MV01 2J7DA 2WYFA 2KR2A 1GOIA 2PBGA 2WB5A 2YL5A 3VD9A 2W5FA 3WH7A 2J8GA 4QCEA 2WC3A 2NT0A 3MUAA 1SFSA 3FHAA 5E6YA 1US3A 3RJXA 2CERA 4HOXA 1EOMA 2YLAA 2VC9A 3EDFA 2EO7A 4P7NA 3CZLA 2CIPA 3SIMA 1BPLB 4MNJA 2YBUA 2IXVA 1WMXA 2V5CA 3OLEA 1W1VA 2YL8A 3AISA 4TXEA 1CXHA 3O9NA 3N1AA 3GZAA 2EPOA 3WELA 1E40A 1OKOA 1R7AA 3GH5A 4IPNB 4D6HA 5IHSA 5EB8A 1EA9C 2Z1KA 4JAWA 1ZJAA 3EYPA 3NDYA 2HISA 1VBRA 1JI1A 1NOFA 3ZSTA 4AXNA 1W9VA 3GBEA 2WZHA 1GWMA 1JDDA 1UD8A 3N9KA 5M5DA 4ZXOA 1UA7A 4FLQA 2YDSA 5FD0A 4GZJA 1ZS2A 4Q7NA 1EO7A 4P7LA 1OGBA 4AZHA 2ZUUA 1JZ8A 1BG4A 1DHKA 4WF7A 4WJXA 2V38A 2D22A 4MAVA 5ABGA 2WK2A 4M56A 5I5RA 1EXPA 2OSWA 2XUCA 1BG9A 1MFVA 2CKSA 2FGZA 1W9DM 1WPCA 1HKJA 2WMJA 1J9YA 1O6IA 2V3EA 3BAIA 1B1YA 1BYBA 5JBDA 4JCMA 3MUY1 4F79A 4MDPA 3IAPA 2Y24A 3WH8A 3CZEA 2YA1A 4BQ4A 1KFWA 5A8MA 3A47A 1V0NA 4UFMA 1FP8A 4U33A 1ZU8A 3WEZA 3WMBA 4YN5A 4J3SA 1CIUA 2WVTA 4H8UA 4OJYA 3RM8A 3WQ8A 3PN8A 3EDEA 1DWJM 1UWIA 3WIJA 4W84A 1W2PA 5D9MA 2K46A 1E6PA 5CLWA 3W82A 2PWFA 1DWIM 3WEOA 3W4RA 1XYZA 3WMSA 1ZJBA 1AQHA 1RD6A 3UR7A 5ABEA 3BSGA 1KCLA 2WWDA 4EANA 1NH6A 4PMQA 4Z2KA 1IZKA 1X6LA 2V5DA 3SEPA 1KCKA 1OSEA 1FFQA 1JXJA 3ZR6A 1HJSA 2CCRA 1ESWA 3GNOA 4V2XA 3GNRA 2CBJA 4PN2A 1P6WA 1Q6EA 3O2LA 3AS3A 5EBAA 1QHZA 1VAHA 3IK2A 4HPHA 2PF0A 1X6NA 3AXHA 3AS0A 2YDQA 1QI2A 1KXVA 2PWHA 3BAKA 4N42A 1CGTA 1V0LA 4Z2IA 1BVNP 4DUVA 2O92A 3ZSSA 3WUFA 2XJ7A 4QCFA 2Q1FA 3BAYA 4ACYA 1DWGM 1CLXA 1DWHM 1F4HA 3CMGA 2XPKA 3ZOAA 1OT2A 1HX0A 3GH7A 4W7UA 3OGRA 1VEMA 1J11A 1JGIA 1WCGA 4W93A 3VMOA 4B9ZA 1E0VA 4FMVA 1TFVA 2VOTA 1W8TA 3ZT7A 3EDDA 1OGSA 2EPNA 3BMVA 3K4AA 2DIJA 1LF1A 3PZTA 4ZEPA 1D3CA 1GOQA 3AJ7A 1QI5A 1OGGA 3ARZA 4AD4A 4EK7A 2BHUA 1GWLA 6TAAA 4OKDA 4ZFMA 3WQWA 2CEQA 2DT1A 1CBGA 2ZUMA 3QOMA 1CGYA 4JFUA 4PTMA 1UG6A 1VEPA 1FOBA 1BTCA 4IPLA 4UFIA 5I3DA 1WZLA 1XYFA 2ZX5A 3PTQA 3GDBA 4AZCB 7CGTA 2YA2A 3POCA 2JF6A 1V6YA 1G5AA 1XC6A 5FCZA 1E4MM 3FY1A 3AIWA 2VL4A 1E0XA 4J3VA 4HZ7A 1CGVA 1W1TA 4MTVA 2XVPA 1UKQA 4UFJA 2GUYA 2UY3A 2X2YA 1FHDA 2Y2WA 4E2OA 1VFFA 3ZMRA 1CXFA 4H2CA 1GOWA 1WZMA 5CSUA 4KGJA 3CBWA 4EKJA 3OGSA 3MUIA 5CQ1A 1NOWA 5JIWA 1UZ4A 2DDXA 1E1EA 1UWTA 4KRTA 4W86A 1PX4A 2YJQA 4S3JA 1G0CA 2WMKA 3AHYA 1QNPA 2GDUA 3DYMA 2QPUA 4YWAA 2YIHA 4URIA 3FHQA 3NCOA 2XFFA 3PZNA 4PMXA 3J7HA 4UCFA 3W0KA 1ZBKA 3N13A 3D5HA 3MO4A 1J0ZA 4Z2LA 1GZJA 4LK7A 4UQEA 1WDRA 4WLCA 1E4IA 3WENA 4MB3A 2YL6A 3NIYA 1UD3A 1QW8A 1KXHA 3CIVA 2Y8KA 3WH5A 3RDKA 1R7OA 5IDIA 1UOJA 3K8KA 4DWSB 1HP4A 2W61A 1WAWA 2F8QA 1E3ZA 3T2OA 2F2HA 1E9LA 4AEEA 1CGXA 5FL1A 5A2BA 3THDA 5A6SA 4HOWA 4W85A 2O9RA 1B31A 1QHOA 2O9OA 1MWOA 2WLYA 5D9OA 3WSUA 4D6DA 1C8YA 3WDPP 3PTKA 4AD2A 3WQVA 5A3HA 1M03A 4CU8A 1CTNA 5CZKA 4WKFA 2CXGA 4Y7EA 4AD1A 4ML4A 2EPMX 3A4WA 2XTKA 1K6AA 2J7CA 4OOUA 4GQRA 3WF2A 3FN9A 1UQZA 2VVNA 2VT0A 4GI6A 1V3HA 2ZUSA 4UQ9A 2J7HA 3SCTA 3VIJA 1VFUA 2JFEX 5FIPA 5E9AA 4BS0A 1V08A 1JYWA 4NF7A 1CGWA 1IV8A 3A3HA 1W9FA 4AZ5A 1HNYA 3AXIA 2DSUA 1FA2A 2GK1B 4HA1A 4D6FA 3LPOA 1W3KA 4CD7A 1H4PA 1XV8A 1GUVA 2J74A 2XSBA 1SYTA 1BF2A 2ZUNA 4LYQA 3KEHA 1J0IA 2ZOXA 1HN1A 2WNWA 2XFRA 1TUXA 4IM4A 4CD8A 1MW3A 5DFAA 1M53A 1V3MA 4DUWA 1JZ7A 1KGWA 2O9TA 1C3FA 3WBEA 4W7VA 4H8HA 4S3KA 9CGTA 3OIHA 4J7RA 4DUXA 1FH9A 2X0HA 2GJRA 3T09A 1R87A 1J0YA 1XSKA 2ZXDA 1V3JA 3UG4A 1GOMA 4U3CA 5IXEA 3QHMA 1UQYA 3MSGA 4F8XA 3CHEA 5A94A 3KE0A 3G6MA 2ZUVA 3A4AA 1WKYA 3OLIA 5I78A 2D2OA 2WCGA 5KEZA 4GZEA 4N0RA 1PIFA 4C7FA 5AYBA 2PB1A 1ZL1A 5HPCA 1PX8A 5E0CA 1E6QM 4PCSA 5I0DA 4HPGA 2BY1A 3AMCA 3F5JA 2ZIDA 4C7GA 4Q22A 3GXIA 3VINA 3UEQA 1BQCA 5JUVA 4PMYA 1E5NA 1G1YA 2CBIA 4PBGA 4J3TA 2JALA 1FHLA 4PMRA 3OBAA 3L4ZA 4AZCA 3GTNA 3TTYA 2WHJA 3SUVA 3RO8A 3AS2A 1UH4A 5BCAA 1MQRA 3FNDA 5AC5A 3IJ7A 5GNYA 4LQ1A 4HA3A 4B16A 3ZJ6A 1ECEA 4EAMA 4CGTA 3U7VA 1BSIA 5C71A 5BRPA 4UQDA 1WCUA 1WZXA 2WHLA 4H04A 3VGEA 3IJ9A 1I1WA 3VD3A 3RMEA 2BXYA 3VNYA 4LYPA 4U5KA 1KQYA 4RE3A 1XSIA 1D7FA 2VRJA 4OIFA 3WN6A 2E3ZA 2VI0A 4DWSA 2BY0A 2VRKA 4AMCA 1SMAA 1NARA 1NP0A 3PTMA 3UG5A 3WD0A 3PBGA 1K9DA 1K9EA 2A3CA 2VX7A 3VO0A 1CXEA 3UESA 1QBBA 2J78A 1CDGA 1WNOA 2XHYA 3CZKA 1VB9A 7A3HA 3HN3A 4X0NA 1QNOA 2C8NA 1B3WA 3AOFA 3OLDA 5CGMA 1HJQA 2BY3A 1QI4A 4YPJA 4CCEA 3VM5A 3ZR5A 1W32A 3SUTA 4CKQA 1C92A 2WANA 2OWXA 2VRQA 3VIPA 1JF5A 4W88A 1E73M 3AZSA 4KRUA 4EE9A 1H1NA 3RM9A 5A8OA 1OBAA 2QPSA 1EQCA 3DECA 4UOZA 3VMPA 1XH0A 1HF6A 1W9UA 1WB0A 2VMFA 4TX6A 3VMNA 4B15A 3CUHA 2UWFA 4CP9A 2DSWA 4GINA 3BGAA 1HIZA 2J7BA 2WKLA 5DT7A 1LLOA 3SUSA 2OWWA 4HMDA 1ODUA 4GI8A 1LG2A 3W6MA 2BNJA 3RM4A 1J0HA 1QNQA 3CUGA 2PI6A 5C70A 1HJVA 4MJ4A 2LROA 1E43A 1HL8A 1UR4A 3AQUA 4HA4A 3OGVA 1W3JA
chains in the Genus database with same CATH superfamily
1AMYA 2FJKA 2YU1A 3GG1A 3H0OA 4HNUA 9XIAA 4XBNA 4X9YA 1NJJA 4LY4A 4E4FA 3ZXDA 1IQ8A 3Q9OA 4KRZA 3TMQA 4SLIA 2W66A 1XNAA 1POV3 3LNPA 3F4VA 3NZPA 4FPEA 3RLUA 3I2HA 2BVDA 4MUPA 4LOSA 3C2YA 5BOEA 2W1QA 2DEPA 2JDPA 3TEZA 1QNYA 2AZ5A 1O3QA 4Q8QA 2ZZ7A 3OBZA 3ICJA 2WWJA 4OQVA 5A7WA 2FHBA 4QJ4B 3GNPA 3H3ZA 3A22A 1UYQA 2OMAA 3B04A 2AQVA 3G1XA 1BGAA 4P8WA 3ZS4A 4JX6A 1RJ8A 5DCEA 2PHRA 5I09A 5ACA1 1A3HA 1FWHC 2ZA2A 4MFDA 2PWEA 3O1OA 1ZFJA 3RLHA 3DGRA 3W59A 4QTGA 1QNVA 3LAGA 3VE7A 4QPIB 6ENLA 2WHMA 1W5OA 1E5HA 3N35A 3R4DB 4ENLA 2WSKA 5LY2A 4AWDA 3WNOA 3C4UA 4P14A 3G8RA 3A9IA 2QGYA 1HXS1 4ZHNA 1FWWA 1AR62 5LIXX 3C7OA 1UF2C 2WAAA 5F3CA 2CZVA 2V0TA 3W37A 2H6RA 1XI3A 2UY5A 1Q2SA 1XIHA 3TSDA 2HE5A 2Y61A 4M0HA 3DHUA 4AD0A 2BASA 4Y33A 5AC7A 2E6VA 4YLZA 5A6KA 1W9YA 1M7PA 1QDOA 3KD4A 3EGJA 4OOZA 1TPDA 3QSRA 3AIUA 4UFKA 4DB5A 4L11A 1ZGDA 4CEUC 3KZPA 1VLIA 4PMVA 4BI7A 2MNGA 5A8QA 3SQLA 2ZXAA 1B35A 3HBLA 4H9TA 3ZN6B 5TD4A 4BF7A 3SH4A 5G4HC 3TYBA 3WH6A 2Z6IA 3VNMA 4E2SA 2OO0A 4FK9A 1UKTA 4ZSTA 5C33A 3UA3A 1Z9AA 1OD8A 3ZZ1A 4PBFA 2DIEA 1JOPA 3IDBB 4LS0A 2XH6A 2PDIA 2GQAA 4ATEA 1QMJA 4AFYA 4EPKA 2GJXA 4LUTA 2XBO3 4XJ8A 4D8MA 1RP9A 4P5UA 1Z48A 4S3BA 1YBQB 4XUGA 4JGYA 2FZNA 1FX5A 1POKA 1VEOA 2YFNA 4YMZA 4XZIA 3SGGA 5BWAA 4UTTC 5GPRA 1SLCA 4WVVA 2A3BA 4GKXA 3LLXA 5KINA 1TJPA 3IV3A 4XOGA 4YTUA 1OQEA 1BRLA 1TVGA 2GSYA 4HPXA 4RXGA 5A3LA 2PLV3 1X7FA 3A64A 4MLOA 1TJRA 3AICA 4XIMA 3K5XA 3I7DA 2WMIB 3PULA 2ZX2A 1WD4A 3I10A 2HNEA 1UD1A 2XWDA 4V2VA 3M9YA 2VFDA 4Q4V1 4JYFA 4C8DA 4CNNA 4NPMA 4FPGA 3BANA 1ZNNA 4IF2A 3VIKA 2B8MA 3INAA 4I09A 1R38A 1GVOA 4N53A 3KHDA 4Q7BA 4R53A 1T41A 4R33A 4MJMA 5IFTA 1ZJIA 2PLKA 1RLDA 2Z2UA 3DHFA 1NM9A 3PMEA 1G86A 2G3JA 5I02A 4N90A 3WP5A 5EMMA 3PUSA 1RJRA 4ROPA 1VIZA 4UTMA 5JH1A 1NQJA 2CDOA 4L61A 1B0IA 2YCEA 3UGRA 4GB32 1F5JA 4ZQNA 3IKWA 4MZ1A 1HG3A 1FWAC 1OQFA 3ZLHA 1B3YA 1ASJ3 5LK7B 3S7EA 4C0BA 5G2HA 1F9KA 4PSRA 4I0BA 4L9XA 1UBPC 3L2MA 2ZX0A 4Q4X3 4GALA 2W47A 3TOJA 1W91A 3C8FA 4CUAA 3O1PA 5D30A 3BC9A 2VEIA 5G4EA 5FQ0A 2C24A 3IIAA 1J1LA 2VBPA 3P2VA 4MM1A 1IEWA 2QVSB 2EXJA 1C93A 2D3NA 1BAGA 5CNAA 3TNQA 3W2UA 1H2MA 4Q4Y1 3GB6A 2OYLA 3E2SA 4BE3A 4AYSA 3GC5A 3ARYA 3ZFHA 5JBEA 1AYN2 3HNMA 1JPMA 2J75A 5FYSA 1GZCA 1YMYA 1ZUAX 1LHWA 1ULDA 3OB8A 5BOFA 3V35A 5FZMA 3MKKA 3VOFA 3N19B 5DDJ2 2ZZ2A 4LBQB 4NHVA 3OG2A 2Y6KA 1SO3A 3TZFA 4PTXA 4AE2A 1W8UA 4Z1CA 3R7MA 3LYEA 3QOKA 4RXFA 4GULA 4RUBA 1SSDA 4HPKA 4LA3A 5E89A 2VX4A 2WNVA 1Z44A 3B5LB 3UETA 2RKXA 3STFA 4IIDA 4PDWC 3AZXA 3RCYA 2P5BA 1CIYA 3LHZA 5E1RA 4RDVA 7REQA 1J4EA 4GABA 5LASA 3MLJA 1FQ0A 3BPWA 4PE8A 2E1WA 1OVPA 3NQMA 2Z69A 4LA2A 3FAXA 1NDVA 1SLAA 2UURA 3CUIA 4UF0B 4Q4RA 3QQ1A 2CLOA 2FDJA 1XOYA 4UYBA 2VW1A 1JBCA 3W7GA 5EY5A 4KCVA 1ISXA 5A7SA 3UKVA 4NJGA 4YVSB 4QB1A 2JG9B 2PWGA 5FMOS 1YPXA 3SQMA 3GNNA 1I45A 3O1TA 5F1VA 4E38A 3GBFA 5EJ3A 2NQHA 4LC8A 2EF9A 2WSPA 4RD7A 1QW7A 2QDDA 4TXWA 4RK8A 4QEHA 4GQBA 5IW0A 4LBMA 1MDLA 3UKTA 5JMUA 1F61A 1JL8A 3L2LA 3M0YA 1QBAA 1GJUA 2VNCA 1W1B1 4PSPA 1JYXA 5T5JA 5JPMB 2X2GA 4AG0A 4GWIA 3B9DA 1ZBVA 3P3NA 1G4EA 4F48A 3CLPA 4A29A 1AHSA 5A7OA 1XM3A 4AK3A 1V6IA 1VBD2 3L5MA 1A5BA 3GIPA 3WUGA 1G4PA 4NZFA 1JHNA 4QGCA 3VBOA 3PTYA 1BQPA 5A6MA 4DEQA 2PD9A 4S2DA 1W0PA 1RCQA 1MNSA 3KAOA 1V6OA 1TVNA 5LEJA 1VR6A 4HNCA 4KPLA 2UWCA 1W9BM 2X05A 5C9XA 5GZGA 3AMGA 5FY5A 3MDWA 4A7YA 3WCSA 3TKFA 2CBUA 3OW1A 1XX1A 2V2HA 3IUIA 3KZSA 4OZOA 1KRAC 1RUF3 2Y6HA 3H22A 4JGYB 5LIKX 5CCZA 2GP3A 4B4PA 1GQKA 2XMLA 2FTYA 3EA2A 3LPPA 4ET7A 4GNKB 3YPIA 2RS11 2FJUB 1P1XA 2CZFA 2AGTA 1GJPA 3AMPA 4RCXA 3GXDA 1A5KC 2ZKLA 4WEVX 3G77A 3S6DA 1MYRA 3PAJA 3LTSA 2VE1A 2HE8A 2E9BA 3WLJA 1KGYA 2YYUA 1YE4A 3NL3A 3H8OA 1XGZA 1G67A 4AI3A 4YU1A 4L4OA 2OCZA 1S5NA 2DY3A 2F9RA 2WFPA 2GAUA 2HSAA 2ICSA 2XSXA 3AYCA 1S0FA 1KCXA 4QX1A 4RS5C 3UXDA 2X16A 1YYAA 3QEZA 4CP0A 2CNAA 3AXXA 2JDMA 1TWWA 3ZYRA 2FFCA 1BKZA 2BWAA 1R091 3R0KA 5XINA 1CZVA 3FIGA 2INEA 4G3YC 3QKEA 3R8HA 4BXSV 5SV5A 3I4EA 2J1RA 2VW0A 4XF1A 1FX6A 1JYCA 2NZLA 4XF9A 1UIKA 4J3UA 1GT8A 5F4XA 2X8RA 3CZJA 3CQ0A 2OXBA 1W8OA 2YLLA 3ALQA 2VOMA 3M2MA 4MPKA 4HQVA 1YIXA 3C61A 5AHIA 2X7WA 4A3RA 4JFVA 3BTYA 1CR7A 4B3LA 5I91A 3DPRB 3BG5A 3SCRA 4CSWA 3R11A 3ES7A 3WDUA 6TIMA 1HKVA 3ITCA 3ARXA 1HZYA 4EXAA 3O1NA 1O59A 4WSKA 4LITA 1F3XA 4LCSA 5ABJA 3FFQA 3MDPA 2QF8A 5K2ZA 2BTVC 2PPGA 3CMJA 4HVRA 1NFBA 4LUYA 5K7PA 1XIJA 4Z1AA 2OUHA 3ZSJA 1QNSA 1TRIA 4KBBA 3QV9A 4E8DA 4FLSA 3QHOA 2WO5A 3B3DA 1J96A 4HU4A 4MGIE 2VCAA 1W31A 2DV0A 4MZYA 2WMHA 1GVIA 2A71A 4W6WA 2DT2A 3FVDA 1YHTA 4JIQA 1VFMA 1CAWB 2YPDA 1JCMP 4ZU4A 3UJQA 2WS92 3KLLA 5SV8A 3WK0A 1AW1A 5KHGA 1HL9A 4GIQA 2QJNA 5IAVA 2EG6A 1HKWA 1D4M2 2NLRA 3SCHA 5FDBA 4NIDA 4QBXA 2QV5A 3NFUA 4EXBA 3I59A 4Q4V3 1WWYA 3SH3A 2V68A 5FY8A 2V3FA 4GH4A 5DXDA 4LV9A 3SI9A 3UWZA 1OLMA 1L0PA 4QLJA 1UWRA 4BYYA 5I0RA 4PMJA 1FATA 1F15A 2OU4A 1CEOA 2YGLA 5TIMA 4YARA 4GI9A 1UAIA 5D8AA 1J01A 4LO8A 3RIKA 1KXQA 3TJ4A 3M8LA 1Y7BA 4DELA 3SFKA 2NLYA 3KBSA 1SZGA 4OBRA 2PLV1 3QY7A 3LENA 4GX9A 1MQPA 1G6NA 2YX0A 5EMYA 3ZPOA 2ACRA 2WCAA 4GG9A 4M0NA 1W8WA 3OLGA 4I3PA 1JZ4A 2D3LA 5DAWA 5CJNA 2XVGA 2NVAA 4J1XA 2EG8A 4TV6A 3ZYFA 4LYRA 2XVKA 3WKZA 4CCMA 4B1MA 1IR1A 4CNOA 3EMRA 2W63A 2XUEA 2XBO1 1KBJA 2DV9A 3C0JA 4CU9A 2V09A 3UPWA 3C2UA 4LHKA 1FOD2 4UQAA 3STPA 1UY2A 1WCKA 1I4NA 1F2NA 1LWHA 4Q2FA 2WLQA 1JF6A 1W5QA 4PTDA 1BVP1 4Y9AA 4HP5A 1IGWA 2C5DA 1PZ8A 4HONA 3ETPA 3WF1A 4PTVA 4W4QA 2NQ9A 1F31A 2Y62A 5HQMA 4AUBA 4WOZA 2GQ8A 1UD2A 4PMNA 4R4ZA 3CU2A 1QDCA 2ARAA 3ZPYA 3TIMA 2HVOA 3M4FA 1RUF2 1RUF1 4KGLA 4PUKA 1EUNA 4RNFA 1RXGA 3VBFB 4YZ1A 3KMHA 3GZ3A 1K02A 4RS5B 2PU0A 1CECA 4UOQA 1VENA 4RN5A 2VZPA 2AAAA 1H7XA 4HSLA 4AAJA 2E4TA 4IXLA 4JCKA 5I8TA 4CN6A 2O7SA 4O15A 2INFA 2ZX6A 4HU3A 4IMGA 2TAAA 1YX1A 3GXMA 5BXSA 4P9XA 3HGOA 3QLDA 1TE1A 2E8YA 3FSTA 1DG6A 1O7FA 2D6KA 3E1F1 1ZB5A 3PC0A 4ZO8A 3KVBA 2QQNA 4LNVA 4FOWA 2C0ZA 1OH3A 4AVTA 2XHKA 1YPFA 4MOAA 3FXGA 5IRPA 2D6MA 1KBLA 2NQ5A 3UW6A 3RDIA 3HU7A 2H8ZA 2VTXA 4PEEA 2VUCA 1UZ0A 4BMEA 4DI9A 1H8TA 3M07A 3ZO9A 5HULA 3ITLA 1R46A 5E93A 3N9SA 1V6KA 3M0LA 5CPNA 4NE9A 4S2FA 3LA3A 5GNZA 4BI6A 3OPWA 2ZCWA 1C8M1 3GWQA 2D0GA 1E9ZB 1C8XA 2BHZA 2Q71A 3A3XA 1YRZA 1ZZ7A 3SY8A 2I5GA 3W2KA 1JYIA 2P88A 3FLRA 4CLMA 1OFSA 5F37A 5GLUA 2QF7A 4WOQA 2WS91 5L7OB 4EN0A 1GTEA 4G5DA 3C7FA 4EF9A 2ZC8A 3CHCA 1PVC2 1SFTA 2KX9A 4MSVA 4XJ9A 4M80A 3P8JA 4X60A 2ODOA 5JVLA 1PTAA 1KM4A 2UY9A 3V0BA 2ILMA 3HGRA 3PUAA 4ATLA 4P7RA 2RJKA 5FYHA 4Q32A 1A53A 2MNRA 3ITYA 3BU0A 4RSUA 1GZGA 2ACSA 4RHV3 2PDUA 1QF3A 1TMF1 1XJAA 4AAXA 4K1YA 2EBNA 5FBJA 4O4WA 4I5RA 3R0UA 3EWYA 2GK1A 3PZIA 1OXCA 3NQCA 1V6WA 4S2BA 3RPQA 1UZWA 5FR3A 2PS2A 3IPWA 4XUYA 5LHEA 1OM0A 4BWLC 4JEJA 4PEKA 2ZXBA 5I0TA 3AXKA 1WDPA 3O06A 3E0LA 3NKTA 1XWYA 3BLIA 5HXMA 3LXAA 3EDJA 4P8UA 5C3PA 3IJ6A 1VD6A 1GNYA 4HNVA 4RNIA 2DCTA 3QV6A 1GZWB 3QVQA 3AYAA 3W1LA 3BPSA 4KGQA 1OIMA 1SFYA 3B01A 3W5NA 4Q4Y3 3S0MA 5HPOA 3TJIA 3GDTA 5EPDA 3L0KA 1O94A 3IT8A 3OA3A 3TTEA 2VTFA 4LSBA 4MZ8A 4YTTA 3LRMA 2Y70A 5FTTC 1VP6A 4AD5A 4FX7A 4O9GA 1IXPA 1TA3B 3B03A 4F9JA 3W25A 3V64A 5M0TA 4QXCA 2EIBA 2W1WA 4L65A 1CW2A 4XDOA 5FPVA 4JKKA 4YTQA 2P3ZA 5H9QA 3LGDA 1N1YA 1DQ5A 3NNTA 1HB1A 5IWFA 3IDEA 4XWUA 5LWBA 1V51A 2PZNA 4XJZA 3CL7A 3VV1A 1J0JA 1GZ1A 1D7PM 4EPDC 4W8BA 1Z7S3 3OD4A 4W7WA 3GVRA 3SR7A 2QUMA 1JOJA 1SEFA 2NM1A 4BQ5A 2QS8A 4AVBA 1ENUA 2Z24A 2GU9A 4G7EB 2CWSA 2GALA 2XOMA 3OY8A 1G4TA 2WL1A 2G3IA 2BB0A 4Z1YA 1J2WA 4QGLA 4IFKA 5C54A 3PR2A 3FAWA 3EX2A 1TNRA 3MIDA 4M3CE 1SFJA 4CCCA 2BNOA 1UP3A 2DVAA 2ZCGA 2QDEA 1JS9A 3GRIA 4Y4RA 3EOLA 5FZAA 1S3TC 5HNNA 3E2RA 1R6WA 1XH2A 4B4QA 1AVAA 3BOLA 4FPYA 4B5TA 5JOYA 4D9PA 1W39A 3H2CA 5IOBA 1JZ2A 3B05A 2HWF2 3DEQA 3KVKA 1NCRA 1PIV3 2VNVA 1PO12 4E4UA 1S1PA 1WBFA 3U5YA 2F6UA 3ST7A 1JDAA 5AC4A 3WUCA 2WJSA 3PUGA 1GQGA 2PRHA 4IDZA 3OVRA 1W1IE 1W3XA 3W81A 4U10A 3WH9A 4HVOA 4FPSA 1Q7QA 4XUOA 1HRI1 5DZEA 1W54A 2P10A 4IIFA 2ZGTA 4L99A 2XM1A 1ND2C 3KV5A 3FDKA 4IV1B 1X96A 2BLEA 3PNAA 4CUCA 4YL2A 4PB4A 4B4FA 3CO4A 4J28A 4MV2A 2BVWA 3HQNA 4M0XA 5C9UA 4IEQA 2ABBA 4Y20B 2GNTA 4YIWA 1VBGA 2W92A 3AVSA 1E4NA 3BSMA 1GWKA 3NVCA 1VZWA 2DWRA 1UUMA 1A0EA 1A5LC 4F0MA 1GMMA 3EEZA 4DX3A 4Z2JA 2BP1A 3K4ZA 4GVGA 4JGZC 2DCZA 3NA8A 1TX0A 3E02A 3RAOA 2XL9A 3RQ0A 1LOFA 1M7JA 2IQDA 3N73A 3VD4A 3SSZA 1YLLA 4JS3A 3ANYA 1Q6CA 1US0A 1S2WA 1UR1A 1YC61 4BJHA 2QNEA 3HPAA 1E0UA 2EAWA 2BX7A 3LB0A 4XAGA 4MAZA 3AYVA 3FX4A 2I5IA 1XSJA 2AQWA 4Q4KA 4MUVA 4QJ1A 2EF6A 1SW3A 1ULFA 5FPAA 4D1JA 4BQ1A 2WYSA 4DXXA 1R082 3GR4A 5DAXA 5L6UA 3K77A 1R3SA 4NAMA 4QKDA 1B4EA 2Y5EA 1ME8A 3TNBA 4MO3M 1EZ2A 2IS7A 5A3UA 1QO2A 3ZLFA 4AI9A 2OQ6A 1H8TB 1VH7A 2XONA 4ZR8A 4L5ZA 3W53A 1A80A 1RVKA 2PDJA 3K8MA 3V0SA 2GC2A 4YW6A 3WD3A 3LDBA 1QJFA 3BMWA 3N7LA 4AX6A 5FF2A 3CHFA 6ALDA 1LG1A 1LRHA 1XGEA 4FXJA 4UMBA 5ACA3 5GZEA 2DT3A 5BYNA 1WKEA 1KGXA 4LJHA 1S1AA 3G1VA 1DIOA 1JZ5A 1G94A 2YDEA 4DYJA 2XFYA 5FZDA 5I0UA 1C5IA 3FOKA 1EIBA 2YBKA 3VBSA 4IHCA 3SCQA 1W2AX 1MEC3 3A0KA 3M7WA 2QUTA 3W5MA 2XQXA 4JTLA 4H6QA 4OECA 3NNMA 4WZFA 4AQ2A 3BAJA 2DJLA 3CQIA 5MKGA 1NLSA 4JTOA 5DDJ1 1GVQA 3AI0A 4MKSA 5BXRA 2PAJA 4DO0A 1E3XA 4QDWA 2R1DA 4R27A 3OGJA 1K6WA 3WDYA 3WQPA 2R82A 4PMUA 2RJLA 3OPSA 1BRLB 2IQTA 1C29A 2WQDA 1IG3A 2QULA 3FA5A 4M6PA 5HMEA 3H12A 3F2BA 3BTXA 3ZYBA 4TVDA 4MLRA 3JXSA 3VKMA 2HVNA 2CY6A 1LNSA 3CV6A 3CWNA 4K3ZA 4JY8A 3S1XA 2OO6A 2R1MA 3K3OA 5KITA 3COTA 1LJ7A 4UBPC 4BEQA 5I06A 5ABJC 1IF2A 2GWGA 4GHRA 2J7GA 3WL1A 4GYPA 4LPCA 1GP5A 1LCOA 4N8MA 3ARUA 3OO2A 2BV4A 4XMIA 2CBVA 2GN3A 1MS3A 3G3DA 3W70A 2ZX8A 1Q8VA 4COYA 3LQCA 3USZA 2A3XA 1YQ2A 3SCOA 3QJAA 2Y4SA 1JR1A 1FNYA 1XRFA 5FMBA 1AR91 3QFWA 4QS6A 3S5ZA 2WT0A 3EHKA 5JDBA 3AC0A 1GOOA 4C6FA 3QC3A 3MU7A 2BTMA 5D21A 4P61A 3GVVA 4D72A 2C9AA 3M0VA 3HQXA 1BXNA 1AXYA 1QVBA 2QTWB 4I7WA 2NPIA 3R25A 1GVFA 3N2CA 5F2SA 3CH9A 3L4WA 1SMVA 2QMJA 4UB9A 1X6UA 3WUEA 2ZEXA 1RUG3 2OLAA 3GHSA 1IE7C 3M3IA 1LL6A 4AZGA 4KGGA 1RVGA 3NO5A 3HPXA 3KQRA 4AHYA 3STGA 1J3PA 3AVRA 2ID4A 4AZIA 1OWQA 4ZO7A 3SCNA 4PLNA 5FZEA 1JNEA 3H7YA 1BLIA 3MBWA 3ZYIB 2PF8A 4FNPA 3WJYA 4QXKA 2DU1A 5FKYA 1E51A 3CEPA 5C8CA 3LCXA 4MG4A 4QB2A 4JDOA 1W5PA 3UXLA 2VQUA 1Q7ZA 3LEPA 2WVVB 3PHAA 4NAOA 3TA6A 2C16A 3GYCA 3A7QA 2AGKA 1E0WA 5F1UA 1IQDC 3H50A 1E71M 1VJ2A 4QNEA 3WUBA 4WM7C 5I3JA 1YXDA 1LL7A 3HR9A 4AC7C 2ZGSA 4QQUA 1DGLA 3KT4A 1E15A 3KM5A 1GJWA 1OABA 3O7OA 1DGWA 3GZEA 3UU0A 3THTA 4JFWA 4J3WA 4MJ2A 1GP6A 1QOXA 3W72A 2DH3A 5F4SA 8RUCA 4XUPA 5DBTA 1ISWA 1Q85A 4PDWA 3WP4A 1GHRA 3W28A 3B9AA 2PDHA 5LA1A 5AYIA 4Q4SA 2I17A 4FB7A 1XP3A 3HTWA 5FXVA 4EACA 3F95A 1T40A 1DV7A 1GQIA 4IEZA 2XINA 4CQ9A 2BHYA 3MMWA 1NP2A 4N9DA 4IXXA 3DYPA 5FY7A 3MMDA 1RUSA 1VBE1 5DO8A 3KM8A 4CN1A 2PLV2 3P0WA 1HGYA 5JU6A 2DBNA 3BOXA 5HMSA 2G9ZA 1FH8A 3VDDB 2RHGA 4C6EA 3KSCA 4KBZA 3PK7A 1AH3A 2PDNA 4AEMA 1PEZA 1PCKA 4OULA 5CZSA 7PTDA 4AFDA 4L56A 3MPPG 2Q8OA 3LI0A 1Q7MA 1R3YA 4BPZA 1US2A 2PODA 4XFIA 4DYEA 2VGBA 5U7SA 4M51A 4URAA 3FE5A 2XJRA 4WR3A 4N4PA 3K2GA 3FK4A 3JUGA 1FPN1 5A8NA 5D05A 2PDQA 1C91A 4GY0A 1MEC2 4AAPA 1U1UA 3NYZA 4OHVA 1H62A 2JIWA 1B09A 3W87A 5BXXA 3UT0A 2R6OA 3WF0A 1EJXC 1H0BA 4CD6A 2BNNA 3WMCA 4DXZA 2PAKA 4N9IA 2R1LA 4IPIA 1Z7AA 2VX5A 1LQ0A 4OWGA 3KS6A 3ZFFA 5JIPA 5LA0A 3O63A 1J10A 1QXRA 1JZ6A 2J47A 4ZTYA 1ZZ8A 5GLWA 4PTNA 5CGQA 1WMEA 3FKRA 4U3AA 4WXZA 3E0WA 1W04A 1L6YA 4IPJA 4I9TA 5KHJA 1H1YA 4F4RA 2HEYF 2WNUC 3V7PA 3UY8A 1LZOA 4DM2A 4FAGA 4NX5A 4M5PA 3KBWA 4O14A 4D1IA 3ATYA 3GH4A 1AX2A 1GKBA 2XM2A 2RR11 1MI3A 4NRQA 4JL1A 4IX2A 5DT5A 5AVPA 1YDYA 1VPXA 2YL5A 2W5FA 2X1UA 3QZAA 3RRAA 2WC3A 3EX3A 3INPA 4XZLX 1GUIA 1EWEA 3WLIA 5BPXA 3HPFA 5TBOA 3FHAA 3J9SA 3HMJG 3WR0A 4HOXA 3B0XA 2YLAA 3ITGA 2VC9A 5AC8A 3NTYA 3EDFA 2GJLA 1JUHA 5A3PA 2B7YA 3BB6A 3GW3A 3N14A 2IFWA 4P7NA 3CZLA 4L0PA 3H7VA 3CTLA 1BPLB 5ERLA 2RM22 4H7LA 2ZZ6A 4J40A 5FACA 2A6ZA 4FPOB 5EL1A 4Y5TA 3UBPC 1KITA 4OI2A 3O9NA 3N1AA 2RDWA 1PO22 4W8JA 1XNKA 1Y4WA 4RYDA 1OKOA 1XNTA 3UVIA 4JR5A 1R7AA 3GH5A 4HNNA 4IQJA 5IHSA 3T7VA 1VCGA 2RS12 5EB8A 3I2DA 2E6FA 2Z1KA 2DZXA 4ASMB 4Q1RA 4AG4A 4BLIA 1URXA 1AZ2A 5T52A 1ZJAA 3B4UA 4YW2A 3TN6A 5J98B 2C1GA 5LXXA 3ABSA 3O6YX 4URTA 3JU2A 4V1PA 2WZHA 2GMEA 3ZSEA 3W7DA 3PF3A 2WV8A 3W83A 1UD8A 4L4LA 3M0JA 3E0IA 2B7PA 1S0GA 2B4KA 1SJDA 4FXSA 1XYCA 5EYWA 4LHNA 3LF7A 4Q7NA 1EO7A 4AZHA 2ERFA 3R6IA 1GKQA 2ZUUA 2QR6A 1JZ8A 5F1RA 3RITA 1LOSA 1SLIA 3M64A 4WJXA 1RVF3 1F9CA 4AF0B 4MAVA 4CNPA 5ABGA 1TWIA 5JR7B 1WLTA 3SZ8A 1XXNA 1O5LA 5I5RA 1EXPA 2A6NA 2FIQA 2QCDA 3MZHA 4DZ5A 1N1TA 5DZFA 4S3AA 2CKSA 4GUGA 4ARXA 2XH7A 1H30A 3UGHA 3L21A 1PZ7A 1B3OA 3TC3A 3URBA 2ZACA 3FJ6A 2GNMA 1VIWB 4F79A 4DJDC 4GCXA 3CZEA 2PHLA 1KFWA 3N4MA 5IAXA 3P5YA 3QBQA 1OKQA 4NG3A 2WA3A 2ISVA 1V0NA 1QXLA 4K2SA 4U33A 3UA4A 3OZMA 4ONUA 5PTDA 1JUBA 3TBDA 2Q8LA 3S9IA 1CIUA 2V9DA 1SW7A 2HWE3 2LUWA 4OJYA 3EDEA 1S39A 3N9OA 2ON3A 4KCTA 3ITQA 4PT6A 3OYWB 4W84A 2BGSA 9RUBA 1ACCA 2LM3A 4HVQA 1GSLA 3DKQA 1P0KA 5JXQA 4NIIA 3H2AA 4L6DA 3NXFA 3CU7A 1DWIM 4LE3A 2PDLA 2FQPA 5DX7A 2VGIA 2DVBA 1ZJBA 1FDZA 4EJRA 2GH8A 3TW9A 1MS9A 1QTWA 2E1DA 4RV8A 2V4VA 4OFCA 4FNTA 4O18A 2WNUB 4RGKA 5F5QA 2V5DA 4JAAA 4O4VA 1VMFA 1KCKA 1OSEA 3OG3A 1FFQA 1XLBA 2R073 4XF4A 1JXJA 2WSYA 1Z41A 2J9XA 1HJSA 2EAKA 1ESWA 1F3TA 4V2XA 1T99A 2VXRA 1RUC2 1VRH3 2HWC2 1OY0A 2CBJA 1DXEA 1AYN3 3OBRA 1PM4A 1DGRN 5EBAA 3K3NA 3HG3A 4HPHA 2PF0A 1TME3 1HFBA 2NQZA 3O0KA 2YDQA 1QI2A 3GTHA 2PWHA 4RZ6A 1W3VA 1V0LA 1A3XA 2ZDSA 3BGGA 2J22A 3IPVB 4EN9B 1OHLA 4IP7A 3M0MA 1Q4WA 3DG3A 3V0AA 2Z4GA 1GGOA 2C6QA 4KIEA 3RXZA 4DO7A 3CMGA 4AFMA 5LW9A 1SPPA 4W7UA 3MYXA 4A35A 2E25A 3LSBA 1R1A3 3J8F1 3N29A 4W93A 2JDYA 2IPWA 2VOTA 3ZT7A 2GDQA 2PLMA 3AZZA 3C86A 3K30A 4BKNA 2XZ9A 2GWNA 3ZMOA 3I2GA 2R7EB 4O1DA 4N9BA 3UYJA 3WY6A 5BU9A 5L36A 1GOQA 1C9DA 4YGEA 3AJ7A 5FXZA 3DEMA 1QI5A 2OX1A 4YVSA 3UYCA 3PJQA 4HIBA 1M3UA 1QY4A 3VKBA 1BEUA 6TAAA 2W39A 1XE8A 1XIEA 2CEQA 3CK5A 2K0GA 1UX7A 3PVOA 1R3VA 1XPYA 4OUIA 1FWNA 3PSVA 4FOKA 4G7FA 1FOBA 3LY0A 1VBC3 5I3DA 4YYFA 1XYFA 2ZX5A 4AZCB 7CGTA 5IBXA 5C2GA 1JUEA 3LU2A 4Q4V2 4Y1XA 4ZB5A 3M5ZA 1LBLA 4LALA 2VUAA 3VL9A 3A5VA 1A5AA 4ARYA 4OVEA 8XIAA 5FCZA 5CU1A 5BNPC 1ALYA 4PI0A 1A5MC 5FMCA 4NILA 1VB4A 1E0XA 1TV7A 3KDOA 2EAAA 3L2HA 1O4ZA 3FWEA 4K1WA 4BISA 4RW5A 4LLOA 5HCFA 4Q0VA 2QBXA 3CAVA 4Q8KA 4L6OA 4JQRA 1UKQA 1N8FA 3W02A 3LLFA 1FHDA 2Y2WA 4O0ZA 4E2OA 4GC3A 2FD8A 1EJSC 4E9KA 4K8FA 1CXFA 4H2CA 1QPOA 3O0XA 3VUOA 2GGHA 1J8VA 3SITA 3IM0A 4F7ZA 1UPPA 2RS31 5JQ9A 1TQ5A 1IEQA 2FVMA 1R30A 1VBA2 2LLEA 4HA0A 1XL9A 3ZFGA 3MUIA 5CQ1A 1WBLA 3WP3A 1UZ4A 4G9PA 5JIWA 5CZ0A 3TQ0A 4CDQC 3W07A 4KEMA 3W2NA 1W6PB 2NV2A 3U0ZA 2WMKA 1UR3M 2F4LA 3BTAA 2GDUA 1UW8A 4YWAA 3NWKA 4URIA 3NCOA 3PZNA 6REQB 3PB2A 4TWTA 1ZBKA 2TSYA 4Q8TA 4IIHA 3MO4A 2PHUA 3D5HA 5E0KA 3GG7A 1GZJA 2P2KA 4UQEA 1WDRA 3VOIA 3LFIA 1TPC1 4MB3A 2HWD3 2YL6A 1QOOA 4ZA0A 4R3UA 3CIVA 2GGGA 3UGVA 4GH3A 3WH5A 4ORIA 4U36A 1BYHA 5CB7A 1UOJA 1UPMB 3CH0A 2QZ2A 5KC5A 4PQ9A 3JS3A 1E3ZA 4JTSA 5C9WA 4YG6A 2B0MA 4Z0SA 2UWBA 1O3TA 1AXKA 1DBNA 5A2BA 4B5UA 5GALA 2O9RA 1KNWA 1AR61 1MWOA 5JI7A 5L9BA 5D9OA 5AN7A 1OFOA 4D2JA 4K1ZA 3RFAA 4CU8A 3VBSC 4NIGA 3B8WA 2CXGA 4Y7EA 4EV0A 1TZZA 1SPQA 3BW2A 3HIFA 5FZIA 2XTKA 3QBUA 2OZ6A 4GWMA 3WF2A 4GQRA 4G7EA 3JU9A 5FWJA 5HMFA 4RDYA 2VT0A 2JECA 4DB7A 1I1EA 3BWWA 2QJJA 1XLHA 2VEFA 2J7HA 3UXIA 3IIZA 1S0JA 3QZ6A 4IJCA 3VIJA 3D82A 2EXIA 3TYZA 5E9AA 2FDKA 3WP6A 1IV8A 4Z92B 1W9FA 6PTDA 2ZRXA 4D94A 3N4FA 4FNRA 1OC1A 3R05A 1ONXA 1RHI2 1F6PA 3B8VA 1A3WA 5BNPA 4HA1A 4YFZA 4D6FA 1H4PA 4A22A 4RZBA 4LS2A 1AJKA 1MSSA 2ZGKA 2XSBA 1BF2A 1DJGA 3FJ4A 1S1RA 2AENA 5CKNA 4K3UA 5C8CB 4AGVA 2LALA 2IXHA 4Q8NA 3H3LA 2WIIB 3VOJA 1MZFA 2WNWA 5JR2A 3HO8A 1JDFA 1TJ2A 2CSGA 1TUXA 4O57A 3W23A 4LBOA 2E53A 1K12A 4MGGA 1QHDA 4OCTA 2J8TA 1TTJA 1M53A 4FTSA 4DUWA 4EF8A 1WLDA 1EV12 3I4KA 3LQGA 3GHMA 4KW2A 4W7VA 4S3KA 1B9BA 1KDMA 2X0HA 5DLCA 2GJRA 2VWTA 1LLWA 1Y3TA 2JD4A 2TBVA 1FWGC 1J0YA 3TN4A 3UG4A 4ZVJA 1GICA 4C90A 2Z7GA 1COV1 5DMNA 1UQYA 3QHMA 5A94A 1SBDA 4NWWA 1PXGA 4F2UA 1UMHA 4CCLA 2IPFA 3G6MA 3KE0A 3MHZA 1JCTA 5J8LA 3U2OA 2WUHA 4JDNA 1PWLA 2HJPA 4JYEA 3TFCA 1EJ7L 4Q4OA 2WCGA 1XFCA 1SLBA 1GG0A 5KEZA 1RUOA 4GZEA 4N0RA 2X53S 4Y1ZA 3WT3A 1C9WA 3P60A 1K77A 1M1BA 5EJZB 1E6QM 4PCSA 5I0DA 5E0CA 3ABOA 1XC4A 3VAVA 4PIYA 3S8HA 2NV1A 3MLKA 5CAZA 5DN1A 3NO1A 4KWWA 1BQCA 3FLPA 3JZVA 4PMYA 4C6PA 2TYSA 2CBIA 4PBGA 4I7VA 3I2IA 3U14A 1RJPA 5KZEA 3VBFA 3R13A 3L4ZA 4AZCA 3U2EA 3SUVA 3RO8A 4OQ9A 4UWDA 1M06G 1UCWA 1UH4A 2INZA 5BCAA 2BPA2 5FP8A 3HG2A 3H7RA 4ZTXA 2WNVC 5GNYA 4HA3A 5GLVA 3CBNA 3LKJA 3WW4A 2EHHA 1SHWB 1W37A 1G7YA 4UQDA 4OGZA 1TPWA 1WCUA 2R043 1IOAA 4UXDA 3OUIA 4PI2A 1GNHA 5KR7A 4HANA 4ZOAA 2IXJA 4XW3A 3B9OA 3DPRC 3U10A 2RDRA 1KQYA 2D3SA 2AEZA 4RE3A 1MQTA 1XSIA 3V5CA 2QFEA 2G4JA 4R4XA 4OIFA 2ZRYA 3WN6A 2VI0A 4PLOA 4DWSA 3O1UA 4PQQA 5U4NA 4LO5B 3QH7A 2QJMA 2RJHA 4IESA 2V5YA 1T6BX 4AOCA 4PFMA 2I74A 4NNAA 3UJOA 1K9EA 2RMU1 4J2PA 3SY1A 2GNDA 2QJHA 4FO4A 1EPVA 3WLQA 1CAWA 1PO13 2J78A 1WNOA 2BBFA 3IVSA 2HNHA 1KLZA 1B4KA 4R34A 4SBVA 1TMHA 3KT1A 2HZGA 4AEDA 1VE0A 3S47A 3G1AA 2V69A 3ZR5A 3UG8A 3EX4A 3ACHA 5IT6A 5BU6A 3SHRA 1DXIA 1NIUA 3JRKA 2DFBA 2UU8A 1WA3A 4JTQA 2WANA 4QJ3B 2VRQA 1JF5A 2ZAAA 3PBMA 3FBYA 1F3EA 1PK6C 5A8OA 2I1OA 3H2NA 1OBAA 2AL2A 3MJYA 3DECA 5FK8A 1LOGA 4Y90A 2HPMA 1W9UA 2VMFA 4TX6A 3LV6A 2EXHA 4IOTA 3CUHA 5HI0A 2DSWA 5JPNB 1NAEA 3CQJA 1FWCC 2WKLA 4LUSA 1LLOA 3SUSA 3FS2A 3ZN5A 3P67A 4GA9A 4EOUA 4O7XA 1A50A 4QD2A 3WLOA 3W6MA 1LORA 3FGCB 4AX7A 3TEYA 4JGZA 1U1JA 3CUGA 4C6DA 5C70A 1HTIA 2X1RA 4HK6A 3UR5A 3TWAA 2OQLA 1FT9A 1QRQA 4LANA 4Q33A 3VBOB 4JNYA 1ADSA 1E43A 1A5UA 4R9BA 5CZJA 3ZO0B 4HA4A 1EWDA 1VBJA 1CPMA 1M7OA 1YRRA 1BVVA 2P3KA 4YVSC 1BQGA 1FXPA 4AZ6A 4U28A 3AHXA 1ZRDA 3QR3A 5CAKA 1B9ZA 4ZS3A 3V0BB 4O1CA 3THAA 5DN2A 1UYPA 1SZNA 4QEEA 1JRCA 4DEFA 4MNLA 2JIEA 4O8RA 2NSOA 4PMDA 1JNDA 3WQ4A 4I7UA 3WK2A 1MEC1 5F39A 1AX1A 5FEXA 1MUCA 4O50A 3NMBA 2WM1A 5DPNA 3CQHA 3GVWA 1V6LA 3R1ZA 1R3WA 3UR2A 5JXHA 5EHDA 4LBJA 4S3EA 4W87A 1TR1A 1DJNA 2OLSA 1FYUA 2WW5A 3LM3A 3N4AA 3IVTA 4BY3A 4IJRA 3ILFA 4NZ1A 4ITCA 4MGSA 4CEWB 4HMNA 4HBNA 2BOGX 2QHAA 4GQ0A 3GJAA 1JW6A 1K5MA 2FB2A 4HJWA 4IJBA 4LCQA 3WG6A 2GQ3A 4IEXA 2RDTA 3SCGA 4ACZB 1NY72 5B2GB 4XDQA 5DABA 3USBA 2CHHA 5IHRA 2I9UA 2QQ6A 2XIIA 2RH9A 4X0VA 4HL0A 1VBE2 5A6AA 3GIYA 2VZSA 3GCXA 2D44A 3IIVA 3MIHA 4IV3B 2QDGA 2WRAA 5IK4A 1DLCA 5LK5A 2FZ2A 1PZ3A 1S4CA 2W52A 1JAEA 1DORA 1R1A1 4JIEA 2E40A 3VZJA 1QR7A 3EBVA 1XGDA 2HEJA 1OURA 2GPTA 2AL1A 2JG9A 2Y6LA 4E4HA 1GOGA 1W1PA 1XLKA 1Z8AA 3B93A 2PGRA 1H41A 5IYYA 4YGDA 3PJTA 4H9ZA 4MGKE 1ZBCA 3VZYA 3TZNA 1R2RA 1UJQA 2BMBA 3GFYA 4GXPA 1JPDX 5K7JA 2E31A 3LMYA 1JPIA 1AG1O 2CZEA 1OFNA 3SCFA 3ZM8A 3MMUA 1GVEA 4N02A 3R2GA 4X9SA 1CZ1A 4DY1A 2YC2A 1RA0A 3EZ4A 1KS5A 3V65A 2Q5TA 2QUNA 3QHNA 1TPEA 2YC0A 2ZZJA 4XFGA 2PBOA 4LMFA 2EXOA 2GVLA 1LOAA 4NHMA 4I5UA 2DZTA 1QU0A 4QHZA 4JTIA 2I07B 3APYA 2ZHMA 1Z6KA 4QQ2A 3CWHA 2OGJA 1OYCA 5FP9A 2YCIX 1EQPA 1B57A 4J1OA 4K8EA 4I3GA 5D8AC 3VNZA 2VMDA 3EKZA 4ECLA 2CITA 4J5NA 5T55A 3IMNA 4NYUA 5CJ5A 1M6JA 1RALA 4P7QA 3HQ1A 3N36A 1AQMA 2Y6ZA 1ZX5A 2HWE1 3PNUA 1TG7A 4WDTA 1AR92 5A8GA 4AWEA 1EOKA 4A7ZA 1MZ5A 3OPZA 4XFBA 1V00A 1NWSA 1F6YA 1VC4A 3ACFA 3N2XA 2NWSA 2A5ZA 1KWKA 3VKAA 2RVAA 2CU0A 3OUHA 3EAUA 4QX8A 2FLIA 4HTBA 1ZZBA 3MWAA 1F3WA 1SCSA 1O1ZA 4HYVA 2O14A 2R1KA 1I1XA 5FMDA 2QIWA 3FUOA 1W3TA 5GKAC 2IQ0A 2BODX 1HJFA 5CFCA 5CFDC 5I77A 3EXUA 3TFXA 1RMU1 3VKFC 2G96A 3PURA 5C2CA 3NM3A 3UCDA 1SO5A 3U4XA 5G1TA 1VLWA 3VOGA 1W17A 4FFHA 1XLAA 2WJZA 4XAEA 3TSBA 1UHVA 1EGMA 5I2UA 2RE9A 2Q1MA 4I2OA 3OVQA 4B5WA 1YI9A 1POV0 1X9PA 3H21A 5I6SA 2TPSA 3N9QA 4GLEA 2DVUA 3T05A 4K20A 3AK0A 3S1UA 3WQ5A 1Q13A 2WZR3 3MP4A 1D8WA 3SMHA 2Y1HA 4ZOBA 4MADA 3MIBA 3OOQA 1GP4A 1ML1A 2WVSA 4IPPA 2OX4A 5T9CE 5HOSA 2C1FA 4CCJA 3MUZ1 1TMF3 1RUD1 3DXIA 4P9YA 1XD0A 4QPWA 2DURA 1UR0A 2GSEA 4E5TA 4QLKA 4FXFA 5IM51 4IP4A 2E5CA 4YG0A 1IQAA 3MICA 5HAOA 1X8MA 2ZGNA 2WKGA 1E72M 4QGMA 2ABAA 3O1VA 1V3IA 1QHPA 4BH9A 4OV9A 2JEPA 4YM1A 2HCVA 4H41A 3DOPA 5HNRA 3QACA 1EUUA 1N1SA 3BO9A 3DFPA 1BFNA 1ZLPA 4YS1A 1BEV3 5FZOA 4JTUA 2ZYFA 1TEIA 4Q27A 3AMDA 2WLPA 2GJPA 2HS6A 3APBA 5LATA 1XG4A 2OLHA 5IVBA 3W2LA 2QKDA 4XQ4A 2WM0A 5LNRA 1W6OB 5FYYA 2H3BA 4FPJA 2Y6FA 4JOMA 4XSLA 1H8VA 2YBVA 5HWJA 3ZIXA 2QQWA 2CAVA 3ZDSA 2FFIA 1L2UA 2NXHA 4JEQA 4QROA 1ZA7A 2WPGA 2OGYA 3OBTA 2XVLA 3SDOA 5C4WA 5A6TC 2XH2A 4N43C 1YPIA 3CJPA 3RNDA 4QG8A 4F3HA 3E5PA 2G9FA 3A23A 3CHDA 3P93A 1EP0A 2VJXA 4EP8C 1ULPA 3MY9A 3EMCA 3AXEA 3HBKA 3USUA 3NQVA 1A5CA 1KFKA 1ISZA 4XFHA 3ZYGA 4MHUA 3LPFA 4D6RA 4Q8VA 3FFSA 2WSQA 4XD6A 1WZKA 1KV5A 4HZ6A 1KR0A 2PDYA 3BXWA 3P61A 4J27A 4FALA 1RUG2 5CFCC 5FPZA 1J6OA 1OK4A 1WBHA 4C1LA 3ZT5A 3W38A 3GLCA 5D9NA 4KESA 2VXJA 3MS8A 3VIFA 2NMNA 1LOCA 1M01A 1NOUA 3NOYA 3P82A 3RU6A 1FPN3 3TU9A 2ZS6B 3LDVA 4IEYA 3H23A 4AWUA 2YROA 1SJBA 3VC6A 2ZUWA 3EOOA 4HSJA 2I7GA 1O91A 2A7NA 1OT1A 1T6MA 1M7XA 1UH2A 3G6LA 3LA4A 3QPYA 2A79A 4LB3A 4W50A 2XWEA 1PJ9A 1V3LA 3NQDA 2ET1A 2VD8A 1Q5OA 1WDWA 2OZJA 2C3ZA 3EPOA 4Z2AA 3I7RA 4AZ7A 1GZWA 5T50A 3KOFA 2Y6JA 4C6MA 1DGRA 5F2LA 4UNLA 4RE4A 1FWEC 1OX4B 4QR6A 3TOPA 4BM8A 3AHZA 1EAH3 1FOD3 1TV8A 4Y22A 4ORMA 1ENQA 1P7TB 1R86A 5FYBA 2VCBA 1RH9A 3KCJA 4OVXA 5TNVA 2P3YA 5KHHA 4K39A 3J26N 3QXBA 3VDCA 2GVYA 3S2LA 3HAGA 4KEVA 4AZZA 2QQPA 3NDZA 3ACGA 1OFRA 3NAPA 4META 3C2EA 3L4VA 3KBMA 5A95A 1V0KA 4C1KA 3C7EA 1QXJA 3CO2A 1EZWA 1O95A 3W3OA 3ZMNA 4CCKA 4W8AA 3T0TA 2F4PA 4R5EA 2HK0A 5FBZA 2HWB1 3DYOA 3O0FA 1RIRA 3LG3A 4NPRA 3W24A 2XIJA 1ITQA 4WGXA 4U31A 5ANNA 1X36A 2ATFA 3KL0A 3DFTA 4FZIA 1GPWA 4ADSA 3GY1A 4KH2A 3ZFGB 1CX4A 4ATWA 4RDZA 1UL9A 3ZOIA 2EPKX 4E2BA 4C6CA 3LGRA 1XBVA 3OHMB 1CX1A 1BWLA 4L7ZA 4OBSA 4ADUA 2C13A 2MEV3 4HETA 2YBTA 3AMMA 2A6WA 5F32A 1XKJA 2CHRA 5B7ZA 3UZZA 3BUVA 2GSHA 3L4UA 1AZDA 5L19A 3PVEA 1B30A 1IIGA 1NWRA 3V56A 5CBLA 3URAA 3UJ2A 4CEYC 1OC7A 4RFRB 3PSWA 4S38A 2VC7A 3TTSA 2ZZ5A 3BLKA 1RUI2 1B5TA 3W1MA 3RYSA 2ZGQA 1XBXA 1PVC1 4NRSA 1RP8A 2VVSA 1OJXA 4BQ3A 4MNKA 1ULCA 2AH2A 4UFHA 4UMCA 3VBUA 1S5TA 1JUIA 2VVFA 3CTTA 3CNYA 2OWCA 4Z17A 2YGYA 1ULOA 1FDYA 4O9EA 1BBT2 3TCEA 3OA5A 2VZVA 3ISIX 5EXOA 4YTSA 4PIXA 4WM7B 3AP5A 2QUUA 4AFAA 5ABHA 4P8VA 3MSYA 4LAOA 4XEZA 4AZBA 3M6DA 2D6NA 2VZ1A 3WW1A 1M65A 2E5BA 4FQZA 1DVJA 3LXBA 4F0KA 1V79A 1TSIA 2VOVA 1QCWA 4XO6A 4NRRA 4AVOA 5K0UA 2X1SA 3H53A 2WHKA 5GJNA 1CT5A 4XBLA 4LUIA 3RO6A 2FH8A 4FI4A 1YNPA 5A70A 3O6CA 2UYAA 4W5ZA 3THQA 2QIIA 1Y65A 2DT0A 1XCXA 1R093 1JD7A 4JTAA 3MSRA 3N2BA 2YXSA 1A3KA 5IVCA 2J4GA 3BK0A 1RA5A 1JCYA 3T4HB 2JG8C 1O12A 1QOTA 1H1AA 3B69A 4ES8A 1H11A 4M24A 1E70M 2CHOA 2WNNA 5KHKA 1NQ6A 4M82A 5EZWA 3G22A 1KRMA 3I54A 5FJPA 5JOWA 1V5XA 3QH2A 4LJ3A 3UP8A 2Z26A 4KCWA 3CJXA 1TVPA 3BG9A 3ACIA 2HROA 1I8JA 2RM23 2YCLB 3GBDA 1W2NA 3IIPA 4DJED 1H2LA 3OOXA 2WN2A 2QQUA 4KG8A 4DIAA 1EJWC 3BQ5A 1GEHA 1DFQA 3RZJA 3CV7A 4GJIA 3WBYA 1OINA 3CASA 3MPGA 3T4CA 3WD1A 2RS13 2Z42A 3WNPA 2HLEA 1JFHA 3I6RA 3TYJA 1XNCA 3HVDA 2BFGA 4JV4A 2V2DA 2PQQA 4AVVA 3VKKA 5FUPA 1CXKA 1U30A 4GISA 1HRV3 3CDZB 4CQ8A 1UYYA 4M4RA 3QMTA 3VFLA 3ALGA 3VCNA 1JFXA 1KFBA 1V02E 3ZXEA 5FUIA 4GACA 3T1LA 2B7QA 1JODA 1BWKA 4R9CA 1GONA 2FZDA 2PTDA 3BCFA 1Q8JA 1S46A 4K37A 1EY2A 2BS9A 3T2TA 2WC7A 3HJEA 4BB3A 2YZRA 1KM5A 3GNXA 2HBTA 3LHWA 2PE4A 2Z1SA 3P3PA 1RJ7A 1YXYA 3V1PA 5CZTA 4HPKB 4HN0A 2JDZA 3RJRA 1BHGA 3VCRA 3DFHA 2XBO2 1KR1A 4PMOA 1U2YA 3VX0A 3W1TA 4GI4A 4U5IA 1DDLA 2OQYA 1GPFA 2ZX1A 2CLIA 2NX9A 1SVDA 2GUUA 1E5IA 3VDAA 4OUMA 2A3AA 3WNNA 2VQ0A 3I4IA 4DWSD 3LA2A 2VULA 1TR9A 1K5JA 3NQBA 4HZ8A 4UC5A 4QAIA 3PTDA 4XZNX 5A2AA 3MHGA 1QKQA 3N3TA 5AYZA 4V33A 5C3QA 4Y1VA 3CIWA 3BALA 3O07A 1DJXA 1XYBA 4ZL1A 1XNDA 2R16A 5I0SA 1VF8A 4I9MA 4JNMA 3CAWA 4PYSA 1E0TA 2P5NA 2WZEA 2ESCA 2W94A 3MYOA 3SRFA 3K13A 4Q26A 1NA1A 2VAUA 1EXBA 1YTKA 3AJXA 2WAOA 1U22A 4V2WA 4B5SA 5DG1A 3H8AA 3LZ5A 4BHPA 2PFHA 1VRBA 3WQ6A 1XQLA 1EGVA 2PDCA 3KOXA 4K8HA 3L4TA 2XIBA 4EZ4A 4HJFA 2H9AA 2PWDA 2GDFA 1PDZA 2RDSA 1MXSA 3D46A 2XKPA 4BDVB 2JKXA 1Y43B 5IATA 1G6CA 1ASJ2 1MXDA 4RV3A 3SUUA 1ITCA 4D8AA 4QJ5B 3AKRA 4H7CA 2BFUL 3VU2A 4ES4A 1RUI3 2LRPA 2WC2A 4DWDA 4LBUA 2FH6A 3AB0A 1RHCA 5FSDC 5H91A 2WVVA 3KOYA 2FCTA 1IGOA 3THPA 1LUCA 2WMIA 3NQ2A 1CAVA 1O5QA 3ENLA 3AALA 2NV9A 2XHNA 1RUE3 2ZGPA 1RBOB 1UZHA 2JG8B 1CWYA 4ISRA 3N3HA 4TVUA 4XTIA 3H7UA 2ZVRA 3L4YA 4B3ZA 3W71A 3I3EA 1GYLA 1XLIA 2JF7A 3WJSA 2J62A 1Z7S1 4V27A 1HDKA 4M1BA 4NHYA 3B97A 1R1A2 1E1FA 3S83A 2FMYA 4UW5A 1DZTA 2NX1A 3ANUA 3BLFA 3LTPA 1OFBA 3POSA 3W9ZA 1HVQA 2PDFA 2FPVA 4BIFA 3NL2A 1KEXA 2Q02A 4WM8A 3WQBA 4AQ6A 4ATDA 1GK8A 3J7LA 2V81A 3IGHX 1E5JA 3L65A 3WBAA 2D5HA 4R9DA 2JE7A 1VBB1 1I6NA 3BODA 1VBB3 2QNKA 5A2CA 3K2OA 1C7TA 4D8ZA 3RLGA 4AF0A 2IMRA 4S3GA 2ZUTA 1WW7A 2DUOA 3KW3A 4L1GA 4NJKA 3OZYA 4AISA 3H7JA 4WY0F 4US6A 5HWNA 2PN5A 1FI2A 1IPKA 3V36A 4EN7B 4MIMA 1W6QA 5T26A 3T08A 3JZEA 2WAGA 3CQOA 4UF0A 1C5HA 2DZPA 4ZXEA 3UF9A 3I3BA 1GW9A 3AIEA 3PANA 4WIWA 2JXAA 4GKYA 5FYMA 2XYLA 4IMEA 5GLZA 3GGLA 1QJU2 4RS5A 3HMCA 3ERPA 2WCSA 1OCNA 1DQ2A 1W99A 3RMXA 2Y7DA 5FAGA 4CPBA 2VMCA 1CYGA 4WHBA 2G4IA 5D4YA 5K3VA 3UZWA 4M1RA 4DRSA 1JIBA 2DFCA 1UKGA 1WP6A 4PUJA 1A4MA 2ZMLA 3MGUA 1UUQA 3TE9A 3QGKC 3TA9A 3RZHA 3RX3A 4LAUA 1O7AA 3NO3A 5DEZA 1EDGA 1CB7B 3W7EA 1RUI1 4ZXLA 2VW2A 4DS0A 4CDWB 4GVHA 1W0OA 5JMCA 4ADTA 2YDRA 4DBSA 4K1GA 4ZONA 4OI1A 4A3UA 4QQPA 4FF5A 2VUDA 4FNUA 1KM2A 4H01A 4M01A 2PDMA 1VQTA 4HMEA 4AYGA 3UJSA 3O7UA 1HX6A 3IDAA 4WJEA 2FCUA 1BK1A 4AB4A 4NL1A 3HPZA 2OT0A 4GXLA 4S39A 3VZZA 4FCAA 3BTNA 3GZTB 3PJUA 4FLRA 1SQ7A 5DRIA 4B5XA 4EPBC 1XH1A 3H1WA 5FK7A 1MQTB 2BYVE 3NAPC 1YJLA 3EWCA 3N3MA 4RR3A 1OFEA 1J58A 4E6MA 1C8M3 3DV8A 4J2MA 2YOCA 4UZUA 5CG0A 1PKNA 5CBJA 2R042 1PPIA 1OVSA 3AZTA 2OUJA 1F74A 5H8UA 3ATGA 3JD73 4XBQA 3VXGA 3ZQ9A 4WVMB 4B9YA 2BGPA 3N6JA 2UY8A 5RUBA 2HBVA 3RX4A 4CQCA 1LKNA 1ST8A 1DTUA 3ZSLA 4MY8A 1I3HA 1TYGA 2ZWZA 6A3HA 4NRMA 4XAPA 5CFDB 1BXCA 3KB5A 3BW3A 2E6YA 6CGTA 3QV7A 2YHJA 3MF6A 3U37A 4Y3OA 3RSJA 1G9CA 4V28A 3SM0A 5L7OC 3F4NA 1EUTA 2CC0A 3M0HA 1XRVA 1FY6A 1W8SA 1CAUB 1IEVA 2FDMA 3W1XA 5BMXA 1HXS3 2P3EA 3RPTA 2DZBA 4CDUB 3E96A 2VD9A 1LR5A 5BNNB 1PBGA 1V02A 1XQNA 3J7MA 4FPKA 4ORFA 3WQ0A 3W6YA 3P84A 3BLPX 1VJSA 3T0BA 1VJZA 1UOKA 1W9XA 3K1DA 1KDKA 4I6VA 2RGMA 2XGBA 3NJZA 2YKKA 4RDWA 2XJQA 3FFZA 4W9TA 1XDJA 2DU0A 5D04C 4XB3A 1A8DA 4Q4MA 1V77A 4KMQA 4DXTA 1D2QA 1EYBA 4QAWA 1K3UA 1OHFA 3NURA 4O11A 3T9PA 1LT8A 5BRBA 3CGTA 1TPFA 1HW5A 4QE1A 4Y1YA 3F5KA 2ALDA 3WNMA 1RUH1 3WW2A 3HD8B 3AP6A 4JTCA 2XDVA 3AAMA 2GYIA 2YY1A 3MCNA 5KSWA 5CIRA 4DZAA 4GUIA 4DOUA 4A3YA 4M3CF 2E6AA 1AQFA 3LRKA 2JIJA 3LCGA 5D8ZA 4CN4A 4XFFA 5T91A 3UD6A 5IVEA 4PRWA 3A5FA 2OT1A 2NUWA 4LBLA 2PA7A 1YQ8A 5D8WA 4YVPA 3SRHA 2PHWA 2HTMA 1OD3A 3PIGA 1TCMA 3UNDA 3LGEA 1XICA 5D2YA 5DMLA 4IE4A 1WYIA 1JDCA 3AKPA 3ZWSA 4O16A 4GMEA 1O3SA 1YO8A 3QKZA 5E6ZA 5E88A 4PRTA 4A2RA 1XU1A 2BDRA 4HOOA 3RS6A 1Q6QA 3DU0A 1YW1A 2WA4A 1ZBA2 2WNEA 3AMLA 2V5LA 1S2UA 1HB4A 4JIRA 4N6FA 1ZA4A 3CT2A 2D93A 2WKKA 2Z2BA 4WRHA 5C5UA 4JGYC 5E09A 2DCJA 3N34A 4JGDA 1H0GA 3WG3A 1UIPA 2OZTA 3B94A 3E9AA 4BF9A 3PJYA 3WQCA 1XDLA 1COV2 4J1WA 4YZ4A 1CQ9A 4P02B 1HT6A 2PLJA 3QQWA 1FP9A 5BROA 3DFNA 2GL5A 1L7LA 5FSEC 4QISA 3NL1A 3P6LA 3WD2A 4MUZA 1AR83 3A3WA 4YM3A 1Q6LA 4PODA 5F2IA 3BDKA 5I8SA 2GOKA 1L6FA 4HKWA 4LY8A 1MDRA 1GHSA 2I5QA 2XLGA