4BQ4A

Structural analysis of an exo-beta-agarase
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
750
structure length
750
Chain Sequence
GSHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLEVPDSGDVNDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNQKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERLGSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords B-AGARASE
publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
total genus 255
structure length 750
sequence length 750
chains with identical sequence B
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq4A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq4A02
4B3LA 4UOQA 5TD4A 1BVNP 5CLWA 2KR2A 2GJXB 3WH6A 3AS2A 3M7SA 2J78A 1OGSA 2GJPA 1UD2A 1E71M 3WDRA 4PMVA 1WDSA 1G1YA 3W0KA 4X9YA 1ESWA 1B3VA 2VXJA 3LPPA 3VOCA 5M03A 1R7OA 2BXZA 4F9JA 6TAAA 2AOSA 4GXPA 2D2OA 3AS3A 2V5DA 4HTYA 3FAXA 3VIJA 3CHCA 1R7AA 1WDQA 4X0NA 4MADA 2E4TA 2WAGA 2XGBA 1CGUA 3BSGA 2E9BA 2FHFA 2XIIA 1E55A 4BCEA 1L8NA 3ECQA 1VBUA 2V3DA 5A69A 1F4HA 3ZT6A 4W87A 3SCNA 1MYRA 1J0KA 2WHLA 2X8RA 3T09A 4AEEA 1EOKA 2WHJA 2ZUSA 3MO4A 2IXVA 4PTWA 2WK2A 1H11A 3L4WA 1JL8A 2UWFA 5ABGA 3W4RA 1V6YA 1M53A 4QLJA 1BVZA 1V3LA 4AYSA 1JXJA 1V6WA 4J3XA 1XGZA 1EHAA 2J47A 3ZJKA 1MFVA 2PWFA 1AMYA 3SUTA 3U57A 1ZBVA 2PWGA 2V3EA 4H8VA 3W24A 4UCFA 1QI4A 4AC1X 3L4TA 2JALA 1HL9A 3EDEA 5IFTA 5I78A 4M8UA 1H5VA 2QMKA 4GI6A 4R27A 1DWJM 2BNJA 2ZUUA 2WWDA 2O9PA 1KGWA 1VJSA 4U31A 1E4NA 4H8HA 1UQYA 2V3GA 4N0RA 1EA9C 1J18A 1BGAA 1HT6A 4W7UA 1EQCA 1EGZA 5IHSA 3G6LA 4UFKA 1CLVA 2JEPA 4TUFA 1C7SA 1UWRA 4XZBA 1GQLA 2FHCA 3APGA 3QHOA 2ZXQA 4GZEA 2BXYA 2WVSA 2F2HA 4D71A 2G3MA 5CG0A 2XG9A 3KL3A 4YPJA 2DSZA 4N42A 4WKFA 1ZBKA 2G4FA 1GWMA 3AIVA 4M29A 1HKKA 1V3JA 4OIFA 3L4ZA 3AHTA 4PUDA 1XYFA 3VMNA 4NRRA 1X6LA 2A3HA 4QP0A 1NARA 1AQHA 2GFTA 5C70A 3WUBA 5KZ6A 2WMJA 3L4YA 1UR8A 4PMZA 1QNOA 3IANA 1EXPA 4PMDA 1XSKA 4OJYA 1GOMA 4FLSA 2JE8A 3QR3A 2CCRA 1GQKA 3AZRA 3ALFA 2ZXBA 1E4IA 5LYRA 4NI3A 2VUYA 2GUYA 3B8SA 4W89A 3OBAA 3RM8A 4UQ9A 4PTVA 1HJWA 4TX8A 1MQRA 1B30A 5M5DA 3SCWA 1LWJA 1KQYA 3ZJ7A 1HX0A 4JCMA 1QI5A 2VZOA 4UQAA 2FGLA 2AAAA 5D8ZA 4ACYA 3UG4A 4GZIA 1UR4A 5ECUA 4GQRA 1PZ3A 3N11A 2D1ZA 3CZ8A 1IV8A 2J8GA 2YJQA 1RPKA 1WZLA 2C0HA 1ITXA 1Z32X 2J4GA 1FFQA 3F95A 1DWIM 1V3HA 4B9YA 4J3UA 2J7DA 1W8UA 3IAPA 4DM1A 1EO5A 4P7QA 1KBBA 2WSPA 3AHZA 4E2OA 1V3IA 3NYDA 1ZL1A 1MQPA 1UZ4A 3AJ7A 3ARXA 2VQTA 1GUVA 2WMHA 3T08A 1HKMA 4JZ5A 3BCDA 4BQ2A 1KCLA 3ZT5A 3II1A 3PTKA 4RE4A 4BQ3A 1XV8A 1EOMA 1C8XA 1WNOA 4PRWA 4V2XA 5ABHA 4LXFA 3BLPX 5DFAA 1Q6CA 4W8BA 1SFSA 1GOOA 1ODUA 4UFMA 3RMEA 4B15A 3UCQA 3VIPA 2BS9A 3B9EA 4PYSA 5CJ5A 1XSIA 3GH4A 3T0DA 1KFWA 1EIBA 1C3FA 3FY1A 5I2UA 4RL3A 2A3BA 4CD6A 2E0PA 1JZ6A 1E6ZA 3WL1A 1JAKA 2RGLA 3QGVA 1WB0A 2G8ZA 2ZX8A 4IPLA 5F7UA 2ZXDA 4QCFA 1V0AA 4OUEA 3EDJA 3N15A 1ZJAA 4XZWA 5A2CA 1FHLA 2EPNA 2UY3A 4HP5A 3KEHA 4DUVA 1E43A 2J79A 3WMBA 4QAWA 4JL1A 2X0HA 2XFFA 3WDQA 4H8UA 5JUVA 2OSXA 3QHMA 4AD3A 2WBKA 1HN1A 3OLEA 1HN0A 3WMCA 1W9UA 1EQPA 2E40A 4XX6A 3L4UA 3RCNA 4AD2A 1IT0A 1VFMA 4AD1A 3CIVA 1CGXA 1E6NA 3KL5A 1CXHA 3AXIA 1TVNA 2J75A 3VPLA 4F9DA 4LYPA 2XJ7A 4ATWA 2CIPA 3CZLA 1NWUA 2F61A 2WMKA 4ZXOA 3W29A 1KXTA 1SMAA 1FFRA 4LKEA 3TTQA 3SUSA 1OINA 2WVUA 3RDKA 1W90A 5LA2A 1PPIA 5CSYA 5A2BA 3WBEA 3SCQA 4AZ6A 2XYLA 5E9AA 4YWAA 3W6MA 4CU8A 2EPLX 4AZCA 1C92A 1HVXA 4IPNB 3F4VA 2XWDA 4D72A 2AMGA 2XVLA 4H7VA 4KGJA 1W8ZA 1Q4NX 1WE5A 4M1RA 3W37A 1DHKA 2Y5EA 4BA0A 1VAHA 3VIKA 5I24A 1UR1A 1BG9A 1HL8A 2EXOA 1E9LA 3TTOA 1DP0A 2XSBA 1UWUA 1BTCA 3VGEA 4TOQA 3J7HA 3VDBA 4W7WA 4CGTA 3L4VA 3PZTA 1HP5A 2J7CA 1HJUA 4LJHA 4XUYA 5BCAA 2V38A 3N12A 2FH8A 5IDIA 1JZ2A 2D0HA 2ZX7A 3EYPA 3PZ9A 3UG3A 4PMUA 3WQVA 4GPNA 1C93A 4HMDA 1J0JA 1VEMA 2WCSA 3TOPA 3SIMA 3LPFA 3U7VA 1G9HA 1V3MA 2W66A 1DWHM 5A94A 5E6ZA 2OSYA 2JEQA 2YLLA 3VDAA 4LGXA 2DSUA 4QDMA 1E73M 4AISA 4HPHA 4U5KA 2BV9A 1EO7A 3WMSA 5CGTA 5HXMA 1V6VA 3WN6A 5DEZA 1QI3A 1PBGA 4ZE5A 4D6JA 1E0WA 4BF7A 1CGYA 3HU7A 4WK9A 1BG4A 5E0FA 3VD3A 2YIHA 4UQDA 2O9OA 3RILA 3VDHA 1U33A 3UG5A 1W9DM 1E15A 3VO0A 3WQ5A 3SUVA 2FH6A 4LPCA 3SCUA 3AYRA 2YL9A 4HU0A 4B16A 3KE0A 2YL6A 3GBDA 3ARQA 3UR7A 1QHOA 3WNMA 5I23A 4UFLA 4D6FA 1GNXA 1PIGA 4HA4A 1LG1A 4D6GA 2EQDA 1HXJA 3I3BA 1QHZA 2YOCA 4GINA 1ZBWA 3SURA 3BC9A 4W93A 3WNPA 5GNZA 4MPKA 5DF0A 1BYDA 2VCCA 2WXDM 2O9RA 3VGDA 2WZHA 2YL8A 1OWQA 4AXNA 1CBGA 3DYPA 1JZ8A 3MUZ1 1GPFA 3NSXA 2QHAA 1DTUA 1VB9A 4AZHA 3QHNA 2NT0A 5EB8A 3OA5A 3GH7A 3AOFA 3WQ8A 3GM8A 1JYVA 4JKLA 3VX1A 5IFPA 1OKOA 5A6SA 4GKLA 4W5UA 3RJYA 1UD6A 4DUWA 1VEOA 1R87A 3UETA 2BVYA 1LLOA 2G41A 2CKRA 1TCMA 1MVYA 4GIAA 2QPUA 1SYTA 3AIRA 1UR9A 3IK2A 4PN2A 3E1F1 3VVGA 4YW7A 5CQ1A 3WDPP 3ZJ6A 3W82A 1OT2A 1HJXA 1D7FA 5FD0A 2XVPA 2BHYA 2C24A 4WJXA 1QW9A 3BGAA 4UQCA 1JAEA 3W81A 4PMOA 2WZIA 1MW3A 2Y2WA 1SMDA 2Y4SA 4ZEPA 3RM4A 2VC9A 3GBEA 3VIGA 1NQ6A 2E3ZA 3PZOA 4BZYA 2F8QA 3OGRA 4OZOA 3WH7A 5A2AA 4LX4A 3ZYBA 5A95A 1GQJA 1J0ZA 3GTNA 4P8WA 1E4MM 3EMQA 1UH4A 1G01A 5E09A 1BGGA 4KRTA 4BQ4A 3ARSA 1K6AA 4GQQA 1E4LA 4LK6A 2CERA 4D6HA 1PJ9A 1M7XA 1US2A 2PB1A 3W38A 2XSAA 3K1DA 4HMEA 3N17A 1VFFA 1E40A 1TVPA 1OD0A 5I77A 3CGTA 4P8VA 2D3NA 1RH9A 3LPGA 4J3TA 1WZAA 3OB8A 3ZJ8A 2ZWZA 3AS1A 3VIHA 4BS0A 4ATDA 1W9VA 4FK9A 1J11A 3G6MA 1NOFA 1W9PA 4J27A 5A8QA 3PZQA 1UD3A 5CGMA 2VOTA 5FKYA 1C8QA 4CD4A 4PSPA 3WD2A 1XCXA 4TX6A 3NIYA 1E0XA 1FOBA 2ESCA 4FLRA 4P7NA 4CPBA 1H49A 4HA1A 1JXKA 3AXXA 1ZBCA 2Q1FA 4ATLA 1QPKA 2PBGA 4TTUA 1CGVA 1O6IA 3ZMRA 3HMCA 3EMZA 4F66A 1B2YA 1RD6A 4P7RA 1GHRA 4CVUA 5BXSA 4D1JA 3EDFA 1GZJA 1QBBA 3DECA 4PBGA 1E6RA 5D9OA 3AMGA 3PZIA 2W92A 3AZSA 4M81A 4Z2KA 5A8OA 4AD4A 1QNQA 3WDJA 1HP4A 2BFGA 3CH9A 1JF6A 2XHYA 1E3ZA 3WDIA 1FH9A 1J10A 1K9DA 3KWXA 2NW0A 5BRQA 4WLCA 1WZMA 5FCZA 2WVVA 4A3HA 4UFIA 5A8MA 2G3NA 4IM4A 2VR4A 4EAMA 3GXIA 4W7VA 5A6LA 3ORJA 2EPOA 1GW1A 2J7GA 1W9BM 4HU8A 1A47A 1KGUA 2VRQA 3WFZA 1JGIA 6CGTA 3SCPA 2XM1A 4GO8A 3MMDA 1HIZA 3VIMA 2WYFA 5JIPA 3VU2A 5I5RA 1ITCA 3VD9A 2DSKA 1UWSA 3FAWA 1ODZA 1W8WA 1QVBA 3SUWA 3ARVA 1E5JA 4S3JA 5D9NA 1E0VA 1BF2A 1YHTA 2WLYA 2PWHA 1GWKA 3GXFA 4XV0A 1GVYA 4M82A 3RO8A 1KR1A 1I1WA 5DT5A 1CXEA 1KR0A 3CZKA 5CLTA 1JIBA 1BFNA 1EDGA 2CBVA 3ZQ9A 3AS0A 3TP4A 2WNWA 3WEZA 3ZR6A 2OYKA 1BPLB 4ACZB 1UKTA 3EMCA 4HOWA 1G94A 5JBFA 1MXDA 3BAWA 3VIFA 4E8DA 2VR5A 4K68A 1UKSA 1E70M 1UKQA 1XYZA 2DT1A 2QPSA 2XWEA 3AIEA 3K8MA 3BAIA 3PTQA 1NM9A 1JF5A 1FHDA 1UOJA 2HVMA 2WHKA 2XVNA 3VGBA 2WYSA 3ARWA 4J28A 2JFEX 5I0DA 3AIBA 3K46A 3ZYFA 2VJXA 2VZVA 3WD1A 5BROA 3B9DA 1OH3A 4F8XA 2VMFA 4H41A 2NT1A 1W2PA 9CGTA 1UUQA 4U3AA 2J25A 5AY7A 4HPGA 5I79A 1UD4A 1UR0A 2E8ZA 1LL6A 1AVAA 4EK7A 1OIFA 2WVVB 1TMQA 4M80A 5A6BA 1TZ7A 5FIPA 5GPRA 2WSKA 4LYQA 1UR2A 4DUXA 2YA2A 1TFVA 4KMQA 2VX5A 3AQUA 1JYXA 1B9ZA 1V0MA 3OG2A 4JCLA 2J7BA 5HPOA 2ZXAA 3CZEA 4YW6A 4CP9A 3AXHA 1V6UA 2ZX9A 1HNYA 3VM7A 4TVUA 5C8BB 4UR9A 3MKKA 5DO8A 3WFLA 3K4DA 1HKJA 2DSVA 5FOOA 4CD7A 3MSDA 1WAWA 2GJRA 3WQ4A 5HBFA 1E1EA 5A3HA 4PMYA 2YDRA 3GXDA 3D5HA 5FL0A 1H2JA 4NZCA 4DWSD 5IXEA 3VIIA 2EPMX 3N18A 3ARYA 4WKHA 4URIA 1R86A 4WSJA 4B9ZA 4EE9A 2WVTA 1MW2A 1E6SM 1ISXA 1XH2A 3KZSA 3AIUA 2CXGA 3THDA 3O2LA 4P7OA 4DM2A 2WMGA 5A8PA 1GHSA 5EFFA 3BAYA 2WM0A 3ZIZA 1HF6A 2UY5A 4A4AA 1PX3A 5D9PA 1MW1A 1ZS2A 1HVQA 2VQUA 2YDQA 5EMYA 4QCEA 4MAZA 5I3DA 4PMXA 4DWSC 1C8YA 1JI2A 1HJVA 2DPEA 1BQCA 2LROA 1VFOA 2VURA 6A3HA 1QNSA 2J77A 2EJ1A 2V3FA 3WH8A 1PEZA 1US3A 4YN5A 1OCQA 4Q22A 1JNEA 1MXGA 1EH9A 3GZAA 1LF1A 2OWWA 4QLLA 2WMFA 4UOZA 4J3SA 1E5NA 4W88A 1DWFM 4M56A 2QMJA 4AW7A 3WNLA 4AMCA 4MTVA 3WY1A 4JHZA 5ABFB 3OLDA 3A4WA 1KGXA 3KL0A 2O92A 2DEPA 1C90A 1H41A 4CPBD 1CXIA 2BY3A 1JYWA 3VD5A 4MB5A 1CZ1A 2JF7A 1KXVA 2JIWA 3AFBA 4E8CA 4J3VA 2YDSA 4KH2A 3CMJA 5KEZA 3OGVA 2W63A 3DC0A 3FNDA 4QFUA 1OD8A 3CHDA 3MV11 5D21A 3GNPA 1GJWA 3W28A 4PSRA 4HZ6A 1UD8A 4AWEA 3WEMA 1PZ2A 1JZ4A 4CP9B 1K9FA 1QI0A 2GDUA 2VCBA 5BXPA 1B3XA 4AEFA 7TAAA 2FDMA 4UZUA 3W26A 4ZFMA 3QOKA 4TXEA 3BH4A 1V02A 4TVDA 1OT1A 2CESA 1W9FA 1OSEA 1W8TA 1ISWA 1F4AA 3PN8A 1NOUA 3WNKA 3UESA 1JFHA 1I1XA 3OLIA 3OIHA 4FMVA 3CUFA 1OM0A 4HOZA 4PMRA 3NCOA 3ARRA 3UERA 4EANA 4AZBA 1J12A 1NWSA 3N1AA 4Y7EA 1VFUA 1Q6EA 2JF6A 5JBDA 4B3KA 1Q6GA 4V28A 1OB0A 3WEOA 4FLQA 3WF0A 2VZUA 4UOJA 1VJZA 3MMWA 4AY1A 4CN4A 4PTXA 2A3AA 2ZUMA 5CZKA 5AYBA 1Q6FA 3GNOA 2BY2A 1GWLA 5A6KA 4AD0A 2W62A 1GOWA 2W61A 1FP9A 2BVDA 3MU7A 2WZEA 3M6DA 3AMLA 2J74A 4W5ZA 4F79A 2ZE0A 1XSJA 3VDCA 2WC3A 2XGIA 1B3WA 3DYMA 3IJ7A 1CIUA 5A6JA 3NSMA 2O14A 2WANA 3BAXA 3CZJA 4UTFA 1Y7VA 1B0IA 1UA7A 2CBIA 3WBAA 3IAQA 4TTGA 4UFHA 4MDPA 4U2ZA 1BYBA 2YA0A 5M17A 3WNOA 3CTTA 3MUY1 1E6XM 1BSIA 2XVKA 4C7DA 1CENA 3O9NA 3GNRA 2D3LA 4Z2IA 1V0NA 2BY0A 2Q8XA 3PTMA 1B3YA 2ZICA 1BAGA 3VGFA 3TTYA 2VX6A 4A3YA 1XD1A 4PMNA 3VD4A 4W8LA 5CSUA 3MMUA 1RP9A 1L0PA 1ISZA 7A3HA 2DT3A 1GORA 2EEXA 4W84A 3AZTA 1ZU8A 1JI1A 2PWDA 4W86A 3OZPA 3EDDA 3WKZA 3VNZA 3LPOA 4U2YA 1CWYA 2DSWA 3WF2A 4X0VA 3FN9A 3ZYHA 1GVIA 1M03A 2QV4A 4ZE4A 1QNPA 2WCGA 2DIJA 4AZIA 5GNYA 4AZGA 3VM5A 2BHZA 2TAAA 2VX7A 2CETA 3O6AA 4OBRA 1XC6A 2OYLA 4CU7A 4RE3A 3UEQA 4WF7A 5A6MA 5CPTA 2OLHA 5BXTA 1WDRA 4BQ5A 2WKLA 3N9KA 2IUZA 3ZSSA 4LYRA 1QI2A 2VO5A 1JDCA 1GJUA 2B31A 1QW8A 2QF8A 5DMYA 4W8AA 3TONA 1JD9A 1W3HA 4AZ7A 2VNCA 4E4PA 4JKMA 2IXUA 3CO4A 1I75A 3PZMA 1WCUA 3BLKA 3VNYA 4WKAA 1Q6DA 3DHPA 3NJ3A 2YA1A 4MDOA 1EDTA 4JFVA 4P8UA 1UQZA 1UG6A 1WPCA 3WNNA 5AYIA 4CVWA 3WUFA 3WF4A 3SEPA 1NH6A 1UKPA 3WUGA 1UD5A 2QLYA 2VT0A 1X6NA 2ZX6A 4ZXLA 1J0HA 1W1YA 5CXPA 1FH7A 1YQ2A 4CKQA 1ISVA 3M07A 8A3HA 1V03A 1H1NA 2CPUA 5LA1A 3MS8A 1W1TA 5EFDA 1HJQA 3THCA 2XVGA 2D24A 3MUIA 2WKGA 1KCKA 1UH2A 4JFSA 5HDRA 4ACZA 1TA3B 2J8FA 4HA3A 3NDZA 3CLWA 1WKYA 1NP0A 1S46A 1OIMA 3AICA 3CZGA 1CNVA 1H09A 2D0FA 2X2YA 2ZUNA 3CHFA 1VF8A 4U3CA 1FP8A 4R5EA 4LK7A 2BHUA 3A6OA 1H0GA 1WCGA 3ARZA 3AYSA 1E3XA 1VBRA 2WMIB 4HOXA 1XRVA 4A6SA 3D3AA 3A4XA 4PCTA 2BVTA 1VEPA 1VIWA 1HKIA 1G5AA 1OGBA 5BWFA 2W4XA 2YLAA 1BYAA 1IZJA 2X09A 3L4XA 4H2CA 2WLZA 2DH3A 4MNLA 3JUGA 5CPQA 4LKFA 4CCDA 1NWRA 2WC7A 2DT2A 3MANA 1UHVA 3BAKA 3GXMA 3VGGA 4GI9A 1W3KA 4MJ4A 1TE1A 1H0IA 4CD8A 4MB3A 2GK1A 1KXHA 2GSJA 1WDPA 4M24A 1DWGM 4DWSB 1PX8A 4D6EA 2PBOA 2J7FA 3PBGA 4Z2HA 1WMXA 2OYMA 2ZOXA 4OBSA 3S2CA 3ALGA 3CUJA 2XIBA 1V0LA 3WQ6A 1E72M 3FXYA 3RJXA 5BRPA 2VRKA 3AIQA 2XFRA 5I6SA 2DQXA 5D4YA 3IJ9A 1VENA 5ABEA 3VD7A 3RPMA 2GDVA 4KWUA 3CUGA 3CMGA 1ZJBA 2Y8VA 5IHRA 1W91A 5D8WA 4NRSA 1QHPA 4AD5A 1OGGA 3BXWA 4J7RA 1KXQA 3WD4A 4JAWA 2PI6A 3AROA 3GDBA 1L7LA 2VVSA 3PZUA 5EBAA 4MNKA 4Z2JA 2W67A 4KRUA 3DHUA 4TVCA 3AI0A 4ML4A 4W85A 3SCOA 3GYCA 4LQ1A 1JNDA 4MNMA 3NSNA 4RE2A 3RIKA 1WZKA 3SUUA 2CHOA 1V6XA 2XTKA 2VL4A 1E56A 1W32A 4Z2GA 1JYNA 5D9MA 1LL4A 4ZENA 2DT0A 1CDGA 3WELA 2YBTA 1LQ0A 2PC8A 3CBWA 2VX4A 4WSKA 5FL1A 1TUXA 1V0KA 4P7LA 1CTNA 2X0YA 4NF7A 1C7TA 2OWXA 4C7GA 2NSXA 4PTMA 1W3JA 3L2MA 2J62A 1D3CA 5ABFA 3SCSA 2A3CA 3VINA 5AC5A 1J0YA 5GNXA 1XH1A 2VTFA 3WENA 1V3KA 2XPKA 3EBVA 1HJSA 1V02E 2G3JA 3AMKA 1UYQA 5E70A 4YHGA 3I3DA 1W3LA 4IISA 5HPCA 1CYGA 1W1VA 1RP8A 2GK1B 2VCAA 1B31A 3FHQA 1KB3A 3PZNA 3WQWA 2DIEA 1NWTA 2D20A 1CECA 3T2OA 2Z1SA 1CXFA 1V08A 4D1IA 3VMOA 3A3HA 1ZB5A 1R85A 1U30A 5A6AA 2O9TA 4JFWA 5GQBA 1PAMA 1TG7A 2WWCA 3W53A 2ZUVA 3AHVA 5JIWA 2UY2A 4S3KA 4D6DA 2JWPA 4JL2A 3FW6A 4U33A 5BXRA 2VVNA 1W1PA 1LJYA 2ZUTA 3I3EA 2PWEA 3WH5A 4EKJA 2A3EA 1WO2A 1PX4A 1CXLA 2RGMA 2Y8KA 2Z1KA 1PIFA 1MW0A 1K9TA 1MWOA 3K8LA 3K4AA 3ZO9A 4CCEA 1DWAM 2K46A 3L2LA 1IZKA 4LKDA 2JIEA 2D0GA 4MAVA 5E6YA 2VRJA 3U7BA 1NP2A 1B1YA 1SR0A 2OSWA 1GQIA 1UZ1A 2C8NA 3T0AA 4V27A 1ISYA 1QNRA 3ZSTA 1JG9A 3WUEA 4UZSA 1N82A 3BSHA 1C91A 5DT7A 1H4PA 4PMQA 2OWCA 1E1FA 4HMCA 2ZUWA 3UT0A 3SCVA 5AC4A 3MV01 1CXKA 3U5UA 3U5YA 3POCA 4MB1A 3VTRA 4QLKA 1XCWA 1VRXA 3EDKA 1GONA 2XUCA 2CYGA 1KWGA 3ZOAA 4MJ2A 3AMCA 1M04A 4AL9A 3W27A 4MNJA 1CEOA 3UR8A 3ZM8A 1UKOA 4UQBA 4JKKA 3PHAA 3NUKA 4JFTA 1XD0A 4AIEA 2HISA 3OZOA 2FHBA 3HN3A 3AHYA 3VMPA 2W91A 2X05A 2DGAA 4HZ8A 3T2QA 1AQ0A 4FF5A 1FA2A 3VIOA 4PCSA 1R8LA 3F5LA 2EBNA 2WCAA 4P8XA 2GVYA 2VZSA 3WIJA 4CD5A 3POHA 5CPSA 1FH8A 1ECEA 5HNNA 4CU6A 2WC4A 2YBUA 1CGWA 2DDXA 2W5FA 2EPKX 4CCCA 1KQZA 4CN1A 4UFJA 3WD0A 4IUGA 1A3HA 3BCFA 3ARPA 5C71A 1E6QM 2YKKA 2EO7A 4CUCA 3VUPA 1GOQA 4FLOA 1EHNA 3HJEA 1XH0A 1UWIA 2LRPA 1B3ZA 3BMVA 1K9EA 4NSBA 4JIEA 3A4AA 3ARTA 2CHNA 1P6WA 1XHGA 5LA0A 3N04A 3CUIA 2CITA 3F5KA 4H04A 2E9LA 4L4OA 3WL0A 2CBJA 1UWQA 3ARUA 4WIWA 3FHAA 3WDHA 3PZGA 3MSGA 2G3IA 2ZWYA 1JZ7A 4MB4A 2XM2A 1JDDA 1J9YA 2WW5A 3LMYA 3M46A 3N13A 4U5IA 1DEDA 3K8KA 1CPUA 1H3GA 4J3WA 4Z2LA 1UWTA 1W9XA 3VILA 4OKDA 3DYOA 3ZT7A 2CBUA 1GOIA 4GZJA 3CPUA 3ZR5A 1CLXA 2GJXA 1JZ3A 3OGSA 3T0BA 2DH2A 2CNCA 3AMDA 5M3WA 1AQMA 5BYWA 2X1IA 3S6TA 1D2KA 1JFXA 1BYCA 2YL5A 1BHGA 8CGTA 3WH9A 1KBKA 3TTSA 1LWHA 3B9AA 1OBAA 2D23A 3WSUA 3T2PA 4GO9A 1TR1A 1KWKA 1CGTA 1WZXA 4D6IA 2J7HA 4PUEA 2E9MA 1NOWA 3F5JA 1TA3A 4AZCB 4AIOA 4JHOA 5A1AA 3WD3A 3MUAA 2ZX5A 1GOKA 3PZVA 3OLGA 3IJ8A 4OOUA 1MQQA 2Y24A 3AISA 1UOKA 3BAJA 4UQEA 4L4PA 2WHMA 3A47A 5A8NA 2WMIA 3BMWA 1W2VA 2MANA 2VZTA 2CEQA 3SCRA 4XB3A 1BLIA 1X1NA 4AIUA 2E8YA 3GH5A 1QBAA 3SCTA 3QOMA 3WF3A 2J7EA 4OOZA 4UNIA 3CUHA 3AIWA 3VKKA 1J01A 2FGZA 3W6LA 1LL7A 3TA9A 4AZ5A 3RM9A 1QOXA 5A6BD 4JFUA 3WF1A 1UA3A 4GI8A 2D22A 5E0CA 5JBEA 2BY1A 4Q7NA 2WBGA 2XFYA 1JZ5A 2WB5A 7CGTA 1WP6A 1E6PA 2C7FA 1EDQA 3CHEA 4YHEA 1B90A 1UH3A 5HOSA 3VX0A 4HZ7A 2UY4A 1GCYA 4D6CA 4PEEA 3W25A 1G0CA 1J0IA 1MFUA 3NDYA 1JD7A 1LG2A 2WPGA 1M01A 3VGHA 4C7FA 1O7AA 2CKSA 2ZIDA 2PF0A 3AHXA 4DWSA 4KGLA 2VI0A 2V5CA 1JDAA 4CN6A 1U2YA
chains in the Genus database with same CATH superfamily
1AR93 3DIPA 3BYWA 3FDKA 1YNPA 5TD4A 2WZR3 4LE4A 2Q8EA 3VK5A 1GYNA 4MUVA 3CT7A 4QT6A 3EOEA 3WH6A 3AFKA 4C1WA 2Q6ZA 3M7SA 6XIAA 2GSHA 3GCWA 4Q7BA 4B7EA 1KRBC 3KUMA 2V2DA 4PMVA 2HWE1 1EC8A 1EKOA 1G1YA 4OI4A 1AXKA 4FX6M 4JIIX 5EPDA 3W0KA 5CG8A 4DRSA 3EA3A 2Y6JA 1FWTA 1M6JA 1R091 3L2YA 2A2IA 5EBUA 4AY8A 1G4PA 1EAH2 1RUF3 1UY4A 4F9JA 6TAAA 1VBD3 4NT0A 4L1XA 4ZGYA 4G2DA 3S0MA 4GXPA 2CLEA 3AS3A 1KS5A 4IE5A 1TPVA 3VIJA 3CHCA 4X0NA 4EXBA 2Y85A 3PAJA 4MADA 1VBB2 3RGBA 2OZTA 3EX6A 2XGBA 3R43A 5HQLA 5LRRA 2ISWA 5L73A 4FX7A 4S39A 4S3BA 1E55A 4B4QA 1L8NA 1E5RA 3LLFA 1I6NA 1V00A 1VBUA 3CQIA 5HR7A 1F4HA 1F2JA 2HWGA 3I59B 4S3FA 4YW3A 3TW9A 4AK3A 4PI0A 2C19A 5CKNA 3AYCA 1OC1A 4NUWA 1ODMA 4LSBA 1OFDA 3F2BA 3T09A 3AZYA 1IG3A 1EOKA 4KEMA 1O5XA 3R79A 4X2RA 4EXAA 1H11A 1JL8A 2BNNA 4V1XA 2BGQA 3W4RA 3O12A 4YFWA 1M53A 1W0PA 3IIPA 2Z0IA 4AYSA 4M6VA 4CEUC 1XGZA 2YB1A 3GDMA 1TQXA 4AGRA 3TNOA 4DZAA 5CEWA 3M4HA 1YDYA 1PL9A 3QV9A 1CJPA 5FJKA 4C60A 5FOJB 4UCFA 5D05A 4LY4A 3OEXA 1RC6A 2ZAHA 5KC5A 3EDEA 3LM3A 4M8UA 1H5VA 1H7NA 2QMKA 1YJLA 4R27A 1ULEA 3MKVA 1BSLA 2E6FA 4V15A 2WWDA 3U3HA 4LUJA 1VJSA 4U31A 1RCQA 1E4NA 1WA4A 2XMLA 4H8HA 3THUA 3EPOA 1UQYA 2ZGQA 1GZTA 1EA9C 1J18A 4WY0A 1BJQA 1W17A 3KLSA 1SLIA 4H9XA 3EMRA 5L9RA 3H53A 4RV3A 1GQLA 3WW4A 2FHCA 1WW5A 4KWKA 2YCEA 2PTYA 1FPN3 2Y6ZA 2BXYA 3ACHA 3E5UA 1QJEA 3MJYA 2FHRA 5JR2A 4EPKA 3KL3A 4BJ0A 3H55A 2QJHA 4RNFA 5T5OA 4RLIA 5GZFA 4JTKA 1ZBKA 4AYGA 4N53A 2VMIA 2KX9A 3AIVA 4NPLA 1V3JA 4OIFA 3VB9A 3SQMA 3L4ZA 3OPTA 1YFUA 1A0EA 1EC7A 1VAKA 3ORWA 3VMNA 5C6MA 3J9SA 3H7UA 1S55A 1X6LA 4QP0A 2BOEX 3STPA 1CLKA 3GYDA 1DIOA 1GZ1A 2Y26A 3ILFA 1OCNA 2WMJA 3S0CA 4YM3A 1QPNA 3OBKA 4YYCA 4O16A 1Z7S2 2AMXA 3OJGA 3IWZA 4Z0JA 1EXPA 2C6QA 4CQAA 4BIOA 2GQ3A 4WVMA 4OJYA 3QR3A 4L9YA 1U5YA 1XIHA 1IPKA 3ALFA 3KTCA 3EPNA 5ACA3 1YE6A 2PDMA 2F4LA 2VD7A 2GUYA 4L4LA 3OUIA 5K9CA 2XUEA 4OE7A 3B8SA 1VBC1 1V7YA 3QC0A 5C0QA 3EX1A 3ES7A 3IVTA 2QQLA 4UMCA 2CAVA 4UTKA 2YB7A 1UZZA 4M19A 4TX8A 5I00A 1P0DA 1SO4A 5JXQA 5FBJA 1HX0A 3ID7A 2VZOA 4M01A 4W8JA 1IQ8A 4JCMA 3TE9A 4XMAA 1O4ZA 1R9XA 1LYXA 4A3QA 3GHUA 3SAZA 1AH3A 3EWUA 1NY1A 3UG4A 1GOGA 2XFWA 3BPWA 1ZAIA 4UMBA 4L64A 2W95A 1WLTA 1V79A 1KFEA 2D1ZA 1IV8A 1CAVA 4J9JA 3B4UA 4PBOA 4NHVA 5FYSA 2REQA 5DZEA 2C0HA 2FMDA 2X10A 1A5BA 1ITXA 2ON3A 1JPMA 4HT1T 1B35A 3F95A 3NM3A 1P7TA 1DWIM 2XLGA 3DF0A 5FZ8A 3EBRA 4J3UA 1H2KA 3MVIA 1DJNA 1W3TA 1WV2A 3HPNA 3P82A 3ZMOA 3HQUA 2FCVA 5T52A 5ISLA 3KOFA 4K36A 4MGTA 3K51A 4E2OA 1VCVA 2BV4A 3M8LA 3OQ8A 3RVHA 1NOVA 3N4MA 1GUVA 3N9SA 3T08A 1JUIA 3BCDA 4BQ2A 5T50A 2ZHNA 1EUNA 4LCRA 3II1A 1H60A 3NNMA 3G7DA 3GG8A 1SZGA 1WNOA 1C8XA 5ABHA 3C61A 1TSIA 5FLHA 1X36A 3W5MA 3KTSA 2R061 3U07A 4QHRA 2R49A 2ZEZA 1U22A 5L9FA 4O13A 4UFMA 5GLVA 2Y7GA 2ZGOA 3B9EA 3H54A 3PUDA 4LYKA 4ZPIA 4LULA 4R8HA 6XIMA 3W7PA 1EIBA 3LA4A 3KMHA 3HVDA 5I2UA 1JYTA 3BV4A 2W46A 1Z44A 5FBZA 4YG3A 1JZ6A 1S2UA 3WL1A 1VCFA 5F7UA 2G8ZA 4IPLA 4Y5Z0 1IIHA 1KITA 2WN3A 1CJDA 3EDJA 3APTA 3A24A 3GZUC 3WV6A 1YQ5A 5I0TA 2Y1HA 5A2CA 2VR2A 4M3CB 3E6DA 1STMA 4S2DA 5EMKA 3TYZA 3UG8A 3WMBA 2X0HA 1W2NA 2Q01A 5GALA 3PU8A 4RE0A 3F03K 1C28A 5H2ZA 3FL7A 4JQRA 1K5MC 4CRQA 2TEPA 5JUVA 4X63A 1Z78A 1GQGA 1QDOA 3WMCA 1AMKA 4XX6A 1IR2A 2CNAA 2O56A 3CIVA 1CGXA 3O5SA 3KL5A 3KDOA 1I5PA 3LA3A 2ZC1A 2J88A 4LYPA 2XJ7A 4MWAC 3RZMA 2CIPA 2FVMA 3CZLA 4L99A 5K9YA 3EGJA 4XURA 1MQTB 3RDKA 4MLRA 2WQDA 2CAUA 1W90A 3W1AA 2WFF1 1P7TB 4DUOA 5LATA 2CU5A 3LDBA 1RHI2 1AVBA 3SCQA 2JDAA 1OD5A 2WLPA 5FYZA 2AL2A 1H7PA 1DZRA 1FCUA 5TIMA 2AQVA 3JBG3 3MW4A 3Q37A 4LB3A 4JDNA 5BPXA 1R38A 4GABA 4D72A 1GWJA 5D2AA 1ELSA 2I9EA 3BDKA 5AECA 3GLCA 3WDWA 4M1RA 4Q26A 5DUXA 3CPGA 2J13A 3W37A 2Y5EA 3WVJA 1YQ6A 1VAHA 5I24A 3ZFEA 4RCXA 4EWAA 1VFSA 1BG9A 2EXOA 4LT5A 1S2KA 2XSBA 4PL2A 3VGEA 1BTCA 2J1RA 3FEQA 3O1PA 1UP2A 4W7WA 2PODA 4FPGA 1GP5A 5CKQA 2PCQA 4XJ9A 2PWVA 4KBBA 2GUBA 4CGTA 4ZU5A 1HP5A 3REQA 4XUYA 4X61A 1EGVA 2Z6IA 2WO7A 4YVWC 2V38A 2WZR2 1XIBA 3G2GA 4R7OA 4CUGA 2ZX7A 3AYTA 5IDIA 2OZ8A 3PU3A 2HZGA 2NUYA 3M47A 1ZBA3 1AW1A 1HG3A 4KQNA 3AUOA 1SQ7A 4UW6A 3OYXA 4Y1VA 3TYUA 1PO23 1UAIA 2NM1A 2P2KA 2ZYFA 3TOPA 4O8RA 3C7HA 5ABJC 2GNDA 5CFDA 2Q02A 5G2HA 4PUWA 1YCIA 4BQXA 2D6MA 3AO0A 1ZA4A 5APAA 3KV4A 5K3VA 1ITQA 1KD0A 2V5BA 1YI9A 1V3MA 4JTFA 1RUF2 3FGCA 2CYFA 4JDMA 4QGNA 3ENLA 5G05L 1VBD2 2JEQA 1DBNA 5LWBA 4LGXA 2XJTA 3KD4A 3O0KA 3G0UA 4YGEA 3P93A 2DUOA 2CDOA 2R9RA 5A3OA 2LM3A 4HPHA 5HCFA 1EO7A 5CAZA 5CGTA 1XKYA 4HTBA 1UY2A 1YX1A 3BCWA 1GKQA 1SZNA 1QI3A 3I97A 2GVEA 1E0WA 3WDTA 4GA9A 4WK9A 1BG4A 2QKFA 3VD3A 2H6RA 4Q8VA 2YIHA 4K2SA 2Y7FA 1JOBA 3SW6A 3OOXA 1V6KA 4Y4YA 3EWYA 1CCWB 3TJ4A 4I9AA 2FH6A 3NQ8A 2YL9A 4HU0A 3KE0A 2ZMKA 3GBDA 3UR7A 1W6MA 5FP4A 1LOGA 4EF8A 3KV6A 1PIGA 4HA4A 1FBAA 4J1WA 1XIFA 2WT1A 2FMOA 4D6SA 4F3HA 4JICA 1HXJA 1ZBWA 3SISA 3VKFC 4XDPA 3BC9A 1W6PB 3KZPA 2FDGA 5GNZA 4MPKA 4BB3A 4URAA 4V1YA 4XXAA 1E57A 5HXVA 3S47A 3STGA 5CZJA 2WAAA 2YB4A 2XWJB 3GY1A 4E5TA 1WBHA 5FUIA 3ZFEB 3P3BA 1KV8A 4Q4X3 3RX2A 4G5DA 5FPVA 3MUZ1 2QHAA 2ZDRA 5IBXA 1SZEA 5LCWL 1QJX3 1NDWA 4AZHA 3QHNA 2NT0A 3NMBA 3OA5A 2X8KA 4E3VA 3FLRA 1W6TA 1JYVA 4JKLA 3VX1A 1RGSA 1PK6A 4B8EA 1ND2B 1OKOA 3SSZA 1F07A 1GK8A 1CX4A 4W5UA 2K9ZA 4E9KA 3RJYA 1UD6A 4RPQA 2DZVA 4DUWA 1VEOA 1R87A 1LLOA 4IV1C 3ZXGA 3IKWA 4AGGA 3B97A 4LA3A 4XG1A 1R2SA 5FO9B 2QPUA 1LRTA 3IK2A 2A73B 4OVEA 5CBJA 3VNJA 2OQHA 1PZ1A 3BJTA 4I30A 3BALA 3QH6A 2BXVA 4H6QA 5T55A 1IS3A 2NQJA 3RJRA 5F2GA 2WS91 1PVNA 1XLBA 4BKNA 1HJXA 2IUWA 1R3YA 4KESA 3B94A 4G1NA 4C1NB 1D2QA 4WJXA 1FXZA 2PDKA 3QXBA 1GVEA 4GH1A 3RZHA 1R092 3W81A 1WGPA 3C8FA 3EOUA 1EXBA 2QIIA 4N2YA 1T8QA 4OI2A 3JQXA 1TRIA 4ML9A 3WHUA 5HMDA 2VC9A 5KHHA 3VIGA 1NQ6A 3PZOA 5ACA2 2X29A 3CQJA 2VECA 4CCMA 3LHUA 4PFHA 1SFLA 4AQSA 1TPH1 1NQKA 1JYIA 1J0ZA 1JULA 2CHHA 1HRV1 2DU1A 2WQZC 1UH4A 1LTEA 4OFGA 4GY7A 4YTTA 3N4AA 3NPXA 1NZIA 3WDYA 2V82A 5FY9A 3W7LA 1LU1A 4Q8LA 1PWLA 4C65A 3VZMA 1XYNA 3I2HA 1US2A 1BEV1 1M7XA 2VCMA 2PB1A 1QJY1 3J8F3 2P1FA 3P14A 3R12A 4D9PA 2F6KA 3TA6A 1KM2A 2DUXA 4LBLA 5D8AB 5D38A 5FZGA 1OEPA 4PLOA 3D0JA 1RH9A 5I77A 5JXGA 1UZHA 4J3TA 1WZAA 3N3HA 3PVFA 1EV11 4JS3A 1DQWA 2HWC3 3ILNA 4GH3A 3ABZA 1RMU3 3L23A 3TWIA 2X16A 3H3ZA 1X39A 2CL2A 2FCUA 4ATDA 1TWIA 3WK1A 2B5HA 1G6CA 5FYYA 1G4EA 2UWAA 3H2AA 3VDDA 3PZQA 2RDXA 3O0WA 4K8FA 2HBXA 1C8QA 4CD4A 4W50A 1PK6B 5IDZA 2ESCA 3WLOA 4FLRA 3UWYA 4YNIA 2UYBA 1H49A 3BGGA 3LGGA 3RFAA 3MW3A 1KC7A 2H0VA 3H6OA 1H7WA 1QQP1 3LDVA 4Y96A 1UMZA 2DCJA 1DQ2A 1S3HA 4JQ3A 4M7TA 4RR3C 3HMCA 2PHDA 4F66A 4IICA 4H6EA 1GHRA 5IAVA 1KGYA 1R1A1 5BXSA 3VV1A 1GZJA 3DECA 2Z00A 3FKRA 4MHUA 2L9LA 5D9OA 2H8XA 4FOUA 4HVOA 4M0HA 4IGPA 4M81A 5A8OA 2VPVA 2AKMA 1ME7A 4M5PA 5F1UA 1HP4A 3CV7A 1JF6A 1JGMA 3P6BA 1E3ZA 3ZR4A 3WDIA 2P1BA 1J10A 3CV1A 3KWXA 2G4IA 4TN7A 3EQEA 3WCZA 1WUVA 4ZQCA 1A49A 2Z25A 4DEFA 4HNUA 5FCZA 2WVVA 2YGMA 1XXXA 2AGSA 2GH8A 3R1ZA 3JQWA 2E31A 1R3VA 5A8MA 2G3NA 3E2SA 4MGYE 4MM1A 2VR4A 3UVAA 1DPMA 1W05A 3M70A 2P76A 4BMEA 3B03A 3ORJA 4LBQD 5CFCA 2EF9A 1GW1A 3ITOA 2WZTA 1W9BM 3H2OA 4M1BA 3LMZA 2WT0A 3P80A 1XLJA 5I0RA 4C6EA 1DLLA 4E4UA 3EWDA 4HKPA 1FQ0A 2UV8G 1BCXA 2XM1A 4GO8A 1KKOA 3TQ0A 5BWAA 3MMDA 4REQB 3VIMA 3WDVA 4EE2A 4HNCA 5JIPA 5SV8A 5A1FA 3GC5A 3NNGA 1UWSA 3A5VA 3FAWA 1DQ4A 1XBZA 1N3PA 3I6EA 1PGW1 2IXHA 3ARVA 3ST7A 2PLCA 2WWSA 3H8OA 2H0BA 1YHTA 1GWKA 4O0QA 2JE7A 3BJFA 1GVYA 3GXFA 2GVLA 2W68A 3I2JA 4KRZA 4M82A 4XZPA 1W56A 3JU9A 3L9JT 1BXBA 3CZKA 3SY1A 1LHOA 1EP3A 3CJIA 3VZOA 2VUCA 3ZR6A 1PMHX 1Z42A 3DN5A 3JBG2 4RK8A 1BPLB 3ZOIA 3H2FA 3PB2A 1K8ZA 5JSPA 3EMCA 2X30A 2ZVRA 4H4IA 3VIFA 2AREA 4WUIA 4XISA 2VR5A 4DINB 3AZVA 2NVAA 3CLMA 1UKSA 1BK1A 1XYZA 3WQEA 1RLCL 1VPHA 3KV9A 4AI3A 3VLBB 3U4FA 1Q56A 1H2NA 2J24A 1UOJA 3TROA 2WHKA 1PO9A 3VGBA 2R062 3UD6A 2WYSA 4C8DA 3ARWA 2V67A 1RUJ3 4IQLA 5C5TA 4ES9A 3TU9A 2VJXA 5LY2A 2A6VA 4K1ZA 2VMFA 3A0NA 2NT1A 3POWA 1W2PA 5F2IA 4U3AA 9CGTA 3TQKA 4IHCA 3LS9A 1UD4A 1LL6A 1LT7A 1H7RA 4HSLA 1MS4A 5J09A 4P9WA 1EP0A 4XF3A 5BNOB 5I8YA 1TMQA 2WVVB 4JEJA 3KP1A 1X82A 5FIPA 5FMBA 1NFBA 2WSKA 4FI4A 2FZMA 1UR2A 5GPRA 1QAPA 4DUXA 4YWSA 5K7JA 2YA2A 3JRKA 3L2IA 1NUKA 4MHRA 1X6UA 1X50A 3TN93 2J7BA 3ACGA 3V5CA 2QUVA 3MPPG 2VEIA 3CZEA 1TPB1 3C7GA 4AFDA 4YW6A 4CP9A 2ZRUA 1XIJA 2ZX9A 1HNYA 2GDFA 4YVPA 4TVUA 4WM7A 2YBVA 3X29B 4J1XA 1HKJA 3NOEA 1DJQA 1NDYA 1WAWA 2GJRA 1LQAA 3GJBA 1E1EA 5HBFA 1REFA 5CAHA 2ZZ4A 3UWUA 2YDRA 3D5HA 1EX5A 4MLOA 5K4ZA 1H2JA 4NZCA 1JCYA 5IXEA 3VIIA 3VKNA 1P4CA 3MGUA 1C1FA 3ZXDA 4B9ZA 4EE9A 1JPKA 2YXGA 2BNOA 2FZ1A 2EKGA 4EZ4A 2WFF2 3M3QA 4ZZ8A 3KZSA 2P3ZA 3THDA 3ATZA 3GDTA 1OF4A 1SPPB 1JQVA 4CXXA 4KI5M 3BMXA 4IT1A 4JIHA 2PDBA 1ZYBA 3VBUC 3ONBA 1AG1O 3HT1A 4BI6A 3G1FA 1SZBA 3ZIZA 5FXWA 1HF6A 1SCSA 3VHRA 4AR2A 4HLTA 4Q4X2 1BXCA 1MW1A 5MF5A 4DPQA 1YC61 1ZS2A 2GJNA 3SR7A 7TIMA 1Q6LA 2XLFA 3I10A 2W94A 4GX9A 4EP8C 1O5RA 4EN8B 4R7JA 1Y8BA 1BQCA 3B5LB 4BWOA 1QNSA 4LLOA 2BSLA 2EJ1A 5GLTA 4ASTA 1ZAHA 3UGGA 2ZX4A 1EH9A 4AVSA 3UP8A 3LCLA 2YCJA 1VRH3 4QLLA 2G1MA 2WMFA 4QM8A 4HMZA 3H21A 4UOZA 4F48A 2QUOA 3BOWA 4GUFA 5CH9A 1VYPX 4M56A 2AENA 3WNLA 4AW7A 5KXCA 2GWNA 2QYGA 1UYPA 2QBXA 1I9RA 2HEVF 2ZZJA 3FIGA 4D6QA 4E2QA 5ABFB 2KXLA 3OLDA 4KH9A 1WDDA 3DPRB 2EG8A 4JTEA 4FSAA 1VBA3 4XETA 4BZ4A 1RY8A 5L7OB 2ZRYA 5F5AA 3FVMA 3T0CA 1AF9A 1XI3A 3WINE 2GQ8A 4DI9A 4FT8A 4NZ5A 3ON7A 2ADEA 2PTXA 3G8RA 2Z7GA 1O1HA 2JIWA 4HYRA 1IS4A 5ECVA 3CMJA 1W1ZA 4O4WA 4IXLA 1OK4A 3FNDA 5HMSA 2GPTA 3N9LA 2WNVC 3VFCA 4QGMA 4PBPA 4UW5A 1GJWA 1D4VB 1RALA 3W7GA 4AWEA 4CP9B 3GHRA 4O1AA 1FVPA 4DZIA 3D6EA 3PUQA 3VOHA 1B3XA 5A33B 1GP6A 3EB3A 7TAAA 2FDMA 2YCKX 2NLRA 1ZP4A 5AVPA 1VMFA 3SGZA 2VC5A 3FHIB 3GU2A 1SQ4A 1FI2A 5F9TA 4TXEA 1GT8A 3GZTB 1R46A 5I0UA 3BH4A 5FACA 2ZZQA 2PHTA 3I54A 3PFMA 4JQTA 3HPXA 1TV4A 1XLHA 1VFTA 2OGJA 3L7RA 3PN8A 3PWGA 2VXNA 2ZX2A 1JCJA 3LSDA 1Z9AA 3UESA 2DDUA 1EF2A 4LTAA 1I1XA 2P6HA 3UYCA 2B39A 2P53A 3AKQA 3KBWA 3CQKA 3BZJA 5FYUA 4XVEA 3OY8A 3IWPA 2PTZA 1LECA 3AB0A 1HKVA 4OZXA 1AL23 1CAUA 4DJDA 4MZYA 1RV8A 1ZRQA 1NWSA 2HWC2 1VFUA 2QCMA 4B3KA 1Q6GA 5A7WB 3MKCA 3WEOA 3Q58A 4FLQA 3FSTA 3W59A 1MNZA 4FXJA 4PTXA 4YGBA 5I7GA 4IFKA 4WXZA 4OULA 2P3IA 1GWLA 3MQTA 2WJSA 4AD0A 2GOKA 1SO5A 1DU3D 4O18A 3NQBA 4TYSA 4XF4A 2AQOA 2BVDA 3OGJA 2QV5A 3I2FA 1RVF3 5F8PA 1QOPA 1Y65A 5PTDA 1W5OA 3GU9A 3FUQA 2OX1A 4N53C 1YFWA 4W65A 4L9ZA 4Z17A 5C9ZA 4FPJA 2BGNE 1XSJA 3VDCA 5BRBA 2ENRA 5A6TC 3IJ7A 5A6JA 4B5UA 1NEYA 3CAQA 1LGBA 1AR61 5D2TA 4DYEA 4A22A 3GXPA 3BAXA 3CZJA 3LRMA 3RPTA 1UY0A 5AC91 2CBIA 3WBAA 3T05A 1C1LA 2F4PA 2E53A 1S5WA 4MDPA 1A53A 2WS92 4FOJA 3LFMA 4FZIA 3QQWA 2YV8A 2RJKA 3K30A 1U5IA 3WP4A 4XJUA 2ZFAA 1LGCA 1M7PA 3NQEA 3UWZA 4DN1A 2J9ZA 4UMAA 4QXBA 1FXPA 1VRDA 1PS9A 1VP6A 4EN6B 1S2AA 3LBCA 2ILMA 3RS6A 2B7OA 1UPPA 3QR0A 3F1QA 2D3LA 4Z1YA 1V0NA 3PTMA 3BSMA 4GMP3 2ZICA 3VKJA 2YDAA 2VX6A 3ZPOA 1EIXA 2XHNA 1W8SA 4A2UA 1AH0A 3IMNA 1BRLB 1SACA 3EHKA 4LUKA 3N2XA 1RY0A 1ISZA 3NNTA 3QCWA 3G1HA 1ZU8A 1JI1A 4W86A 3W70A 1YYNA 2NXGA 1GYKA 4RFRB 3NGJA 4U2YA 4N90A 1WX0A 3FK4A 4NWVA 1V6LA 5JPMB 2FZBA 3FFQA 1S1RA 3ZYHA 2Q1ZB 5I8TA 3C7EA 4R9AA 3NQGA 2YR1A 4ZE4A 1QNPA 2WCGA 2DIJA 1D8CA 4JTLA 4AZGA 3OG3A 4PCRA 4AE2A 1DHPA 3VM5A 4YZ4A 2BHZA 2TAAA 1ME8A 2C14A 4OBRA 1AZ2A 4CU7A 3AKTA 4AVOA 5A6MA 5CPTA 3NZPA 3S83A 2HWD1 5C3QA 3BWWA 1YDVA 3IIIA 4NZ4A 4HIBA 5AYXA 3W7NA 3CASA 2Y6KA 1XLGA 4BIFA 2IUZA 1F6KA 2ETEA 4M3CE 4LVAA 4FPSA 1DXFA 5A3WA 1LEDA 4CQ8A 3MIBA 1W3HA 2QFEA 2VNCA 4AZ7A 1YXYA 2DCKA 3BLLA 2IXUA 5FP9A 1CQ9A 5FZ3A 3USSA 2RS11 1RA5A 4LALA 1XINA 1TB3A 1ULGA 1WCUA 4GUJA 5FZ6A 1LEMA 4WKAA 2XH7A 3PUHA 1QQP2 2EPHA 4MDOA 3MFCA 3QMRA 1IWAA 2YXXA 4EYUA 1UQZA 1WPCA 3HQRA 5AYIA 4CEWB 2ACSA 4Q32A 2NQYA 3WUGA 5DUVA 2Y64A 4JNYA 2ZHLA 4H01A 1X6NA 4K1WA 3URQA 4B5SA 4ZXLA 1J0HA 1W1YA 5CXPA 1RD5A 3QR1A 1IEVA 4A6OA 2ATSA 1ISVA 3M07A 8A3HA 1EEXA 1V03A 1H1NA 2J1EA 3WX5A 2R82A 2D5FA 4C6FA 1CD3G 3CEUA 1S0GA 5LEKA 1W1TA 4YTSA 1ADDA 2ID4A 2MEV1 2D24A 1KJRA 2QUNA 2WKGA 2Y38A 3H24A 2J8FA 4HA3A 1B4KA 3NQ2A 4H9VA 2ORZA 2A71A 1OD3A 5LNWA 1UU5A 4GD4A 1SJBA 4RD7A 2WZPP 4U3CA 2BGOA 2MHFA 3MYOA 4ICCX 5F6KA 1WCGA 1XU2A 2W1WA 1VR6A 3SGUA 4Y1UA 2XIQA 2YUEA 4S38A 2X5IC 1YRZA 5GJMA 2PDLA 4A41A 3WG1A 2RE9A 5JOWA 1SZFA 2DVBA 2ZA1A 3D3AA 1UW9A 1SFYA 3S7IA 5FY1A 1LNSA 1JUKA 3SZ8A 4CDXB 2WDBA 1OF3A 1OGBA 5BWFA 4U36A 3R6IA 2IKIA 4LIVA 2Y0IA 4H2CA 3LM7A 1VD6A 4NAOA 4BEUA 2DH3A 5CC3A 1Q85A 2BGCA 2OA2A 4MNLA 3WJWA 3JUGA 5CPQA 4J2MA 3EXTA 3TXZA 2WC7A 3V36A 1YLLA 3GXMA 1PGW2 1OG0A 4F0MA 3VGGA 3KOWA 4Z92B 3WUCA 5A6YA 1MEC3 4L61A 3BG5A 1FWBC 4N43C 2XN0A 4FXFA 1W3KA 3HGSA 2MNGA 5AZ1A 1TE1A 1H0IA 3LCXA 4PTNA 3Q8EA 1XIDA 3GD6A 3SECA 1SFNA 4ICNA 4LTSA 1UOZA 1DORA 2C91A 4RHV1 2GK1A 3ZFFC 3CS2A 3D3FA 2BDRA 1S38A 2ZRXA 1DWGM 1DQXA 4DWSB 3DUIA 3VFLA 4D6EA 1OFSA 2D97A 2OYZA 2PBOA 1RAKA 4Z2HA 1WMXA 3I2KA 3L5AA 4G7FA 1DIDA 4S3AA 1XDMA 3FXYA 2ZRWA 3TBDA 2XFRA 5I6SA 3LB0A 3NRUA 5D4YA 3ANVA 2XJPA 3IJ9A 1D4M3 1MS1A 2DYCA 5ABEA 3RI8A 1CAXA 2B45X 3DBNA 4FO9A 4EPEC 4LLFA 4KWUA 2GDVA 5BOOA 2IPJA 5CZSA 1UP3A 1VRH2 2J8TA 2ZGPA 4UXAA 3IEBA 3A0KA 2H90A 1S0CA 3NAPA 1CW2A 1OGGA 5EXOA 4IJCA 3ZVXA 3QQ1A 2ZADA 5E1QA 4JAWA 1YQCA 4XTIA 3AALA 2PE4A 1YJKA 1L7LA 3DL3A 1U83A 3PZUA 4AH7A 3UJQA 3V0BB 1VBA2 4KRUA 4TVCA 3C86A 3PTYA 3GHSA 3SCOA 3M1HA 1JNDA 4CDWB 3V0TA 4DI8A 1SW0A 1WZKA 1V6XA 3S2LA 3NVCA 3LBOA 4LE3A 4MZ1A 3MYPA 4LUTB 2DT0A 5G4EA 2X2GA 1FWIC 1UBSA 5J5DA 4V33A 5IW0A 1G9DA 4GNVA 3OJBA 3WG4A 1TPC1 4CUBA 3GAKA 4XFCA 1I4NA 3PVEA 4Q4SA 3IVUA 3I3QA 3TN4A 3QVQA 1K4GA 1PKYA 4C7GA 2NSXA 3NOYA 1ZZMA 4Q8KA 2I5IA 1FWEC 4DXKA 1XJAA 2FTYA 2JG8B 5J5RA 1GVOA 4R33A 3RZLA 2VUAA 4I90A 4P5YA 1XE7A 1SM9A 1HJSA 3PIGA 3SRHA 2B9UA 4CDUC 5IUQA 1ZRCA 2NUXA 2XJSA 2OFJA 2Y60A 1S0JA 4LPLA 5FZ1A 1TPUA 5AFDA 3CIHA 1HV1A 1UYQA 5I3HA 1TE1B 2RMU3 2WOQA 3P1IA 4GWEA 4IH3A 4LB4A 1KM3A 1W3LA 1P0BA 3M44A 4IISA 3B4YA 1VLNA 2FKPA 3LERA 2J1UA 5C9AA 2GK1B 2JB8A 3QPEA 1AYM1 1XR2A 5HATA 3T2OA 1Q8JA 3HO8A 3BLIA 2BOFX 4XUGA 3GIPA 4P08A 1GR3A 3VMOA 1A5OC 3IN9A 3LTSA 4Y1YA 5DZGA 3VBFA 1N8FA 3PUGA 5A6AA 5A3UA 2Y70A 5KITA 3W53A 2UY8A 1LT8A 2VZRA 4IWWA 1HXS1 5DLCA 2JWPA 1GOHA 2PAKA 1VMHA 2RS53 2K0GA 3FOKA 3ZWSA 2DZUA 1OXCA 3BLOA 2PWEA 4JN8A 4B5TA 2A3EA 2Z79A 2GQAA 3M7WA 3FX3A 2E6VA 4IJRA 4YTUA 2EXIA 2RGMA 3HG3A 4H1ZA 2Z1KA 1H62A 3I65A 1F8MA 3HQNA 1S2VA 3W02A 1LODA 4DEVA 4FOKA 2A6YA 1DWAM 3GBWA 2K46A 2PDGA 1IZKA 1OKQA 3MDWA 1W8HA 4IOTA 2VP8A 3AMPA 1OHFA 3DHFA 1QO5A 3SC7X 1GQIA 2ZMLA 2ORXA 3ZYZA 4AWDA 1TJ1A 4YLZA 3BE7A 3W71A 5F6LB 4ECLA 4AHOA 3G22A 3HM7A 1RUG3 4D7YA 4LVDA 4NASA 4UZSA 4ZB5A 1F5ZA 1C91A 5DT7A 3OBEA 5A3TA 5DZFA 2OWCA 1YEYA 3KVKA 1EZ2A 3ITQA 2ONEA 3MV01 3W1QA 2ZGTA 4NJJA 4AEDB 2CU0A 3DKJA 4PQQA 4D0QA 1CZVA 2FB2A 2OG9A 1OC6A 3TYJA 4QLKA 3VZJA 3EDKA 3VUSA 1W1B1 1GONA 4H14A 3TNQA 4QNWA 2XUCA 1PIV1 4NR1A 2QQKA 4COUA 3GFZA 4O15A 4MJ2A 3AMCA 4AL9A 4Q4W3 2YHJA 4RR4A 2OIIA 5TF0A 2TMDA 5F39A 1WA6X 1KFCA 3DCPA 4Y22A 3AL6A 4AIEA 3ICJA 1RIRA 5IVEA 2FHBA 4XHXA 2XGZA 3E2RA 3VZYA 5DAWA 4QPGC 2X05A 1RYYA 4CTEA 2DGAA 4HZ8A 1OURA 3T2QA 1LOBA 4FF5A 4O0KA 3KFTA 3LRLA 1X98A 2WZMA 4Q0VA 4KGQA 2Y5SA 3S2MA 4YZ1A 2EBNA 3UA3A 4B5NA 2GVYA 3WIJA 1I9CB 4NAEA 1QMLA 3POHA 1JRBA 5IRPA 1GYMA 1FH8A 1ECEA 4CU6A 2IXLA 1A0CA 1J93A 2HVOA 3FYPA 3MIFA 4HSJA 2EPKX 5T5JA 1KQZA 4IETA 2DZTA 4CN1A 3S6OA 1O8SA 3LZ5A 4BISA 4IUGA 2W27A 1QU4A 1ZCCA 2WT2A 1ONWA 1N55A 5C71A 2EO7A 2NV2A 1Q6QA 5FYHA 3M5YA 5FYCA 4F0HA 3SDOA 1GOQA 2OX4A 1HV0A 3HJEA 5LSMA 5FZOB 1B3ZA 1RINA 3ASIA 3M0HA 3H1YA 1K9EA 3V5OA 4JIEA 3A4AA 1TE6A 5FPUA 4IG2A 4C90A 2HCVA 3HIJA 3S1UA 4YZ5A 4OU1A 1VBE1 2Z27A 3F5KA 4H04A 5LBBA 4HHMA 4O9GA 5CKSA 4L4OA 5LZLA 3TZFA 1EWEA 2OUJA 4UC5A 2QQUA 4JR5A 1X9TA 3PZGA 3UFYA 4DPNA 2W1QA 4ZU4A 3ZFGC 3MSRA 5A3MA 2WW5A 4E4DX 3TC3A 1GZCA 2BWGA 3N9PA 1J96A 3N13A 3ZVHB 3S1VA 4Z1AA 1H8TB 1H3GA 1V6OA 1PKNA 4PODA 1UWTA 2VD9A 3VILA 4RW3A 5FF4A 3VBRA 3VL8A 3MIEA 1SGJA 5EA9A 3ZR5A 3L0KA 1S2WA 2D40A 1XKJA 4JX6A 3U1XA 2GJXA 5CFCC 5REQB 4C6MA 2VZ3A 3QZEA 1XBXA 2DUPA 4Y20A 5T54A 4HHPA 4JX0A 4R9XA 3S2NA 1AQMA 2PHLA 4LVFA 3UZ5A 2PP0A 2YCLB 1RTVA 3S6TA 3W7MA 1XBFA 3VZXA 1W5NA 1GEQA 1OA4A 5IK8A 3W7QA 4EWJA 8CGTA 3RYPA 3TTSA 3CWNA 2SBAA 3LA2A 3A7QA 3O0VA 1EGMA 2VD8A 2D6PA 1WZXA 1IXNA 4PUEA 4JTOA 1ZA7A 1NOWA 5FYIA 4AZCB 5EKYA 4AIOA 3WO8A 3WD3A 2FQIA 2ZX5A 2INZA 2G37A 3IVSA 3ITTA 1P0NA 2YFZA 4HK8A 3GU1A 5CA6A 1ZZ7A 2YGYA 1MEC2 3CJIC 3E9AA 4Z82A 3L66A 2NMNA 2QJVA 4IGSA 3W23A 1WMDA 3DUGA 2RM23 1C8M3 2Z2AA 1L6WA 1TNRA 3IGUA 3LD8A 4NJGA 2NPIA 3DBPA 3OVRA 4LFYA 5A8NA 1IQAA 3SNMA 4X22A 3TYAA 4JIQA 2YCIX 1BLIA 4AIUA 1A5LC 4Z8BA 1JDEA 3H2EA 4NHKA 2LS6A 3SCTA 3QOMA 3MHUA 2FPVA 4UNIA 3AKSA 1D3GA 2IPGA 1IPSA 2OKXA 2HYXA 4GULA 3WF1A 4AB4A 1FCBA 4GH4B 4GI8A 2RS12 4QX1A 5DN2A 3CIXA 4KBZA 4FNPA 1Q5MA 4Q7NA 1F3EA 5AHEA 4NPMA 1IXPA 3N36A 4NKCA 2C7FA 1MDLA 5U4NA 1EDQA 4YHEA 1WKFA 2NXHA 1LHVA 1UH3A 1JU4A 1EJXC 3NV4A 2IQTA 3VX0A 4PZVA 3GG0A 4D6CA 1GCYA 3PS7A 3AYDA 4PEEA 1O5LA 3W25A 1MFUA 1XQLA 2QJNA 3O06A 4ZO7A 4PLMA 3C8NA 2UWBA 4HCDA 3PDQA 2WPGA 4TWTA 3MFAA 3VGHA 2JECA 4G9SB 4A3ZA 4HONA 1O7AA 4C6NA 2PF0A 4KT2A 1SSDA 4E3TA 2V5CA 3HR9A 4RDWA 3I68A 4PC8A 1RJPA 4CDQA 4I9JA 1N1TA 4LO4B 4PL1A 4Y4RA 4OYUA 1NCRC 1PHMA 1AR73 4IEWA 4PDWA 1XW8A 5T26A 2KR2A 2GJXB 3AS2A 4AVVA 4H9MA 2J78A 2JKEA 2QQMA 4O57A 4Y20B 2NYYA 4WM7C 2VFHA 3QMSA 4KWWA 2ZZ1A 1XRFA 1LHUA 1CGPA 1QIQA 3VOJA 1R7OA 5HANA 1HQNA 1VBHA 3CV6A 2LTNA 4CEYC 2G3FA 2QCEA 4Q4OA 2PLMA 4HTYA 2D2OA 4JTDA 3LBMA 1S0DA 2FMNA 1R7AA 1WDQA 2E5BA 3TXVA 4MSVA 3BSGA 4XAGA 3DI1A 4GGBA 4RZ6A 1M9HA 2XG3A 1GFF2 1SO3A 3KGLA 4RS5A 5IVCA 4RX0A 1FV3A 5CZ0A 2Z6JA 1QJU3 3FCPA 3SCNA 3TK7A 4IEUA 1LTDA 1QOQA 2X8RA 3P2VA 1AX2A 2WHJA 4BCUA 2ZUSA 3H4GA 4JOMA 4ZHNA 1MZ5A 1KLZA 4QQ3A 2IXKA 4ONUA 5DRCA 3DKQA 4DNMA 1V6WA 1RCXB 2DVAA 1U5HA 3SXWA 1EHAA 2J47A 2GYIA 3DOPA 1EPZA 1LUCB 3ZJKA 1DJYA 4RSUA 4NNCA 3U57A 2OOGA 3N7MA 4R9BA 3TN6A 2HWB3 3ANUA 4XZLX 1M65A 3MI2A 1OQFA 3W24A 1ME9A 2ODOA 3KT1A 4QXHA 3T0TA 1BEUA 4GG9A 5C33A 1QI4A 4AC1X 2PD9A 4G56A 1YTEA 4LANA 5A7NA 1D2SA 4XF9A 5IFTA 1QPQA 1QF3A 4GI6A 3GIQA 1DWJM 4SBVA 2RS52 2BNJA 2ZUUA 4B4PA 1KGWA 1QWGA 3RAOA 1A5KC 3PPCA 4JY9A 1H7OA 2V3GA 4JNMA 4WX2A 3KQRA 1XP3A 1HT6A 2R043 4W7UA 1FOD3 4ALDA 5BNKA 1EGZA 5I07A 3G6LA 5IHSA 1MMFA 1CLVA 4XZBA 3IBMA 1KA9F 2ZXQA 1H1YA 2XZ9A 1I0DA 1QEXA 3MIDA 5KR7A 2WVSA 4QHBA 2F2HA 4D71A 2G3MA 2ZHMA 3A9BA 4BI5A 4Q4V1 1VAVA 3LD5A 2XG9A 1I2RA 4JYFA 2CW6A 1XBVA 4PDWB 3P67A 1O8PA 3QGKC 1AODA 4C6QA 3KW3A 3QF0A 4JTNA 2G4FA 2OEJA 1RUG2 1ZP3A 4RPPA 3WLKX 3C3VA 3R2GA 3WD5A 3LWCA 3V1PA 1N3QA 4FNUA 1AQHA 2GFTA 5JR7B 4L6OA 3L4YA 3TNPB 1ZY9A 1HB3A 1OCBA 1XRUA 3FBYA 1OYAA 2FDIA 1QNOA 5E88A 4FFHA 3Q8CA 5DX7A 1HB2A 4YMZA 3ISIX 1RJ8A 3TR9A 3RZZA 4FLSA 2ZZ7A 1DL3A 4QRNA 1VYRA 5G4HC 2YPIA 2QQ6A 4Q4W2 2VUYA 5EMJA 2R1LA 5FEXA 1AFSA 4YFZA 3OBAA 3RM8A 3MCOA 2C9KA 4PTVA 3P61A 4XIAA 4ZO6A 2DW7A 3AKPA 2VUNA 1G67A 4JGYB 1Q7QA 4WZCA 5M5DA 1O3SA 1F9CA 3GE7A 3VBOA 3I7RA 1KQYA 4DJDC 1G86A 4KCWA 1H30A 1Q8OA 1QI5A 4LY8A 2I5QA 2D3PA 2A21A 2FGLA 5D8ZA 4IPIA 4GZIA 1IWPA 1HQLA 1AYM2 2BJSA 5K4LA 2E67A 3ZX7A 3QKEA 2BBFA 4I9MA 3K5XA 2P0IA 4NWWA 2J8GA 4JX5A 1JPDX 2YJQA 3UZXA 1I6XA 1WZLA 2X1TA 2E33A 2P34A 4E6MA 2XKOA 1XE8A 2N7GA 1XJBA 1H6XA 3C2FA 4L2NA 8TIMA 2PFWA 1AJKA 3HOBA 2FZ9A 1I0BA 2BDQA 3K3OA 4DM1A 1MVEA 3G3DA 3W58A 2PDPA 3P62A 3T4HB 3AHZA 3VN4A 4XBNA 1UOBA 5FA5A 4O1EA 3WLHA 3VE7A 1W5MA 1C8VA 3KVAA 1MQPA 1UZ4A 3LXAA 1HKMA 4JZ5A 4PUUA 1K70A 4QM1A 1NLSA 1TYGA 1A50A 2XH6A 4IX2A 4BQ3A 2R0FA 4PRWA 1TQJA 3CC1A 3E0LA 5JH1A 4H2AA 4AX7A 4Q4KA 2ZRZA 3EXSA 4UAPA 5DFAA 1IZCA 2XH2A 3SKJE 2J22A 4QU2A 3QLQA 4LOCA 1SFSA 5E16A 3V0AA 4QM9A 3RMEA 3ZN5A 4B15A 4X3ZA 5LIUX 5DRIA 4UTJA 1HKDA 3LF7A 3GH4A 1JQXA 3T0DA 4J25A 3ES4A 3UZJA 1C3FA 2NZ9A 5CBBA 4YM1A 2ZS6B 4CD6A 1NXD1 2E0PA 2DJLA 4JQ1A 1VAMA 3NL5A 1DIWA 5EQUA 1MR5A 2ZX8A 3QGVA 3T07A 3PJQA 4IE4A 3LEKA 4GYKA 3O1UA 1V0AA 1NFPA 2GNBA 1XYOA 1GU3A 2QKDA 2I1OA 2PELA 1RCOB 3UCDA 1OFAA 3EOLA 3JVAA 1IEIA 4JDOA 4DUVA 1F3TA 4QAWA 2P8BA 4JL1A 2I14A 3FE5A 2XFFA 1OI6A 2I74A 1ICQA 2QQWA 4OI1A 4GACA 4KFOA 3VBOB 1K7EA 4H8UA 4G4FA 2OSXA 1R9ZA 1DG6A 1IGSA 1HN0A 2DU0A 4XFHA 2O0TA 3KBJA 3NQDA 5CKMA 4YRDA 4AD2A 3L4UA 3RCNA 1SR9A 1IT0A 1VFMA 3LI0A 5FZLA 4AD1A 1XUUA 2H6CA 1CXHA 1WBFA 1VZWA 2XJQA 4HFSA 2VFIA 4R88A 5E9XA 2VHLA 1QXLA 1OX4A 3DKLA 5FKCA 1C8M2 4ATWA 3CB8A 4OCTA 5KXDA 1O3QA 1TEIA 4DAIA 3CNYA 4X8PA 1RR2A 1SMAA 1FFRA 3BJSA 3Q8AA 4E2BA 3K3NA 2WVUA 3ZN6B 4MOZA 5HI0A 3LDKA 1G69A 2FZ8A 2ET1A 1JHJA 1E51A 3FXGA 3WBEA 5TNVA 5LNRA 2C0AA 3WK2A 4ORMA 4UW4A 2FGBA 3B00A 4FALA 1LOSA 2EPLX 2DTYA 1HVXA 4IPNB 3U2CA 2Q8CA 4R53A 1RSCA 4AY7A 2A6WA 3DZ1A 4YVVA 1WE5A 2JE9A 2QJGA 4KPLA 1P6CA 3G8EA 3WX7A 4MF4A 1KM0A 1UR1A 1GQNA 1E9LA 3E5QA 1EJUC 1DP0A 3STFA 4US5D 4HA0A 6REQB 1V70A 5LASA 4GQBA 3J7HA 3KT7A 4GIEA 2C18A 2VM8A 3FA4A 2J6XA 3VNLA 3WBYA 1P8JA 4ZBCA 4BQWA 3BI3A 4RQPC 1K7XA 3PZTA 4QEEA 4H7LA 1HJUA 3URFA 2ZGSA 3S3GA 3VC6A 1UPMB 3UGRA 3NQAA 4E0CA 4AQ2A 5KC6A 3M41A 1PMJX 2FH8A 1JZ2A 3HG2A 2RDSA 4AGVA 3S8HA 1QR7A 2W0XA 5FV3A 3ZKYA 3EYPA 4F83A 1UUMA 4LKSA 1GKBA 3WQVA 1C93A 5FUPA 5CIRA 4HMDA 1BZWA 1J0JA 4W6WA 1VEMA 2ZX0A 3SIMA 4CXYA 3TIMA 3LPFA 1H2LA 4FR6A 2RV9A 3LV5A 4JHMA 1F5JA 2CWSA 4FTBA 2AAMA 4TLFA 3QV7A 2R32A 3UF9A 1DWHM 5E6ZA 2R1BA 3VDAA 1POV1 1DKWA 2EICA 2DSUA 4QDMA 2OQYA 3FJLA 3O0FA 2FTWA 3F4WA 1YPIA 4FNQA 1LOAA 2HWF3 1J3RA 3IIXA 4F3JA 4AZZA 1GQHA 5DEZA 4BF7A 3RMJA 3E2QA 1QJU2 2WAOA 4FPHA 5F2WA 3L2HA 1LRNA 4QHZA 4XUPA 3RILA 3CK5A 1U33A 5I3JA 5ANNA 5U7SA 3VO0A 3WQ5A 2CFFA 1TV3A 4LPCA 3SCUA 4CQCA 3CIWA 3TSDA 4UTTA 5IK5A 3WQFA 3W20A 3WNMA 2PGWA 4JHTA 4D6FA 4D6GA 3QN3A 3VNIA 3SH3A 4XBKA 4DLMA 1WD4A 4PB5A 1EJTC 4M7SA 2EQDA 3I3BA 3V7PA 1Z48A 5FDBA 4CSWA 3SURA 4JVAA 2NP0A 4K9SA 2PDFA 1ASJ3 5AHNA 1NQDA 4PHZA 2YGLA 2VEMA 5E93A 1BYDA 5BU9A 2WXDM 3SO7A 4IV3A 7ODCA 2DFCA 1WAUA 2WZHA 3RO6A 1XISA 2GQ9A 3NAPC 1UW8A 4L6HA 1GZWA 1ONEA 1OPMA 5I93A 4LVGA 2Q4SA 3UJEA 1VB9A 2XONA 1FWAC 2WFPA 5EB8A 3AOFA 2R042 3I4IA 2NLYA 3M0XA 5IFPA 2FQPA 2QCGA 1HRI1 4FXSA 3HNYM 1PYMA 4RGAA 4COWA 3VBHA 1HW5A 3LNMA 1OOPA 4AHWA 2GGEA 3N4FA 3N9OA 5FY7A 3UETA 2A79A 2BVYA 3W87A 5KTLA 1MDRA 1DCSA 1X8CA 4M6UA 2ZGRA 4GWJA 2DUAA 4PN2A 1AYN3 2HNEA 4A8IA 3E1F1 2F6UA 4AF0B 4YW7A 5CQ1A 5DELA 5DCDA 3VGIA 5CJNA 4BJHA 4EAYA 1Y5XA 5LIXX 2QVHA 4QEHA 3ZJ6A 3W82A 1S1PA 5FD0A 3GGLA 2BHYA 3F4NA 4IEPA 3CH0A 1NY71 3RQ0A 5FZFA 3KM8A 2WQ4A 3H2CA 3VHPA 1XICA 3MI6A 1DQUA 1RLDA 2WZIA 4HSHA 2TNFA 1Y9QA 1SMDA 4AU0A 4HKLA 4ZEPA 3RM4A 3SCHA 4DO6A 3GBEA 3C4UA 4GQ0A 5HK4A 1A4LA 4J40A 3NNLA 3UPWA 3LLDA 1K5MA 4QGCA 1RZMA 2F8QA 1QXPA 4Y9NA 2DZWA 3JR2A 3WH7A 4JD4A 5A95A 1GQJA 1QNYA 1RUC3 4NU7A 4XVDA 3L67A 3GTNA 3K2OA 1E4MM 1POV0 1G01A 3MPGA 1PVC1 3NXLA 1YTKA 4H00A 3LEMA 4L80A 3D5OA 4BQ4A 1I2NA 2QPXA 1K6AA 1ULOA 1J1TA 1YWKA 3WLLA 3ES1A 3VBFC 2PMWB 4H7CA 3E6BA 3WP3A 4ENLA 4YU1A 2CERA 4D6HA 5H8UA 1A4MA 4IQJA 1NKGA 3W38A 3K1DA 1XLKA 2QJJA 1VFFA 3MIGA 3BVJA 4LO5B 4IP4A 2JG9B 2Y8UA 5XINA 1R2TA 3U75A 1TJ0A 3KOYA 4PGLA 3MB9A 4OFCA 2HV5A 3FS2A 2FZNA 3R8RA 1R5YA 5L36A 1TME3 2QDHA 2PTWA 4BS0A 2GALA 4XFFA 3O7OA 4O1CA 4O65A 2OT1A 1LWIA 3N9NA 3G6MA 2NQ5A 1JN2P 3O14A 1W9PA 2QQIA 3EOSA 4MG4A 1LAJA 3A21A 1KJLA 4YJ5A 1A0DA 2O1QA 2VOTA 3TAYA 1DTNA 4JTJA 5CGMA 2VEKA 4PSPA 4DY5A 2RDTA 3WD2A 2QNKA 1XCXA 4GA8A 1X33A 1E0XA 3LN3A 4HA1A 3OUJA 3QSTA 1DIEA 3G1VA 4P5UA 4GKYA 2WNNA 5F5IA 3GTHA 4ATLA 2PBGA 4TTUA 2RJLA 4YVWA 3ZMRA 4R7WA 1M06G 3EMZA 4IIFA 2B7NA 3HMYA 3KLKA 4D1JA 3EDFA 1EAH1 2IZWA 4PBGA 1E6RA 3AMGA 2F7FA 3AZSA 3A4JA 4AD4A 3LTYA 4NIGA 4LUSA 5DCEA 3WDJA 1MEWA 2Z24A 2BFGA 3PJXA 3NQ7A 5LNSA 4LF2A 3LCIA 1MS5A 2CWXA 4LQRA 4CNPA 3NGFA 3UY8A 4Q0SA 1MUCA 1Y9GA 4NIAA 2CGOA 5C5UA 5BRQA 3IJLA 1AUYA 3OGGA 1DJWA 2WA3A 2P5NA 4LT9A 1H51A 3B0XA 4UFIA 1UOFA 4AEJA 4IM4A 1NE6A 3IJ6A 5FOBB 3HMJG 3GXIA 2XBO3 2V5KA 3HQXA 4WVZA 1UKRA 3N25A 2EPOA 4XF1A 4BPZA 3SN0A 1KGUA 3WFZA 4MWAB 1JGIA 3DHDA 3SCPA 1K7FA 3S1XA 3M0VA 1KD7A 2E6AA 5DBUA 2YZRA 2VELA 1R30A 4GBDA 1HIZA 3RGTA 5BOFA 2ZTJA 1P0KA 4WY0F 4UWMA 3OBTA 1GANA 3BOFA 2ACRA 3B0UX 4N9HA 4E38A 1CAWB 3H50A 2GLKA 4TMCA 2B7QA 4XEZA 2ARXA 5H9PA 1E0VA 2X53S 3UJFA 3VKOA 1KCZA 2D6NA 2WLYA 2YC0A 2PWHA 2P3JA 5IVYA 5FO7B 1V9U1 5AZ0A 5G4WA 3CHVA 5F2MA 5DT5A 3V5FA 1YYAA 4Z0SA 4C0BA 1JIBA 3PF3A 3HJRA 3JZEA 4NG3A 2CBVA 3ZQ9A 3AS0A 3WEZA 4D8LA 1IYXA 4Q1PA 4GISA 4KEVA 5FXVA 3W2NA 4J35A 1G94A 3BAWA 2Z69A 5K0UC 4E8DA 5DMNA 4DPPA 1E70M 1UKQA 1ULPA 4UTHA 2BP1A 4UR8A 3NO8A 4MYAA 3XISA 2AEZA 4YYOA 1Q43A 3TC7A 3PTQA 1GKRA 3ZYGA 1NM9A 5FZ0A 1MRAA 2Z5WA 4IV1A 1FDYA 4YVWB 1JF5A 4MFEA 3WJZA 5HCHA 3VBRC 1ZENA 4MGQA 3GVGA 2BGPA 4DXTA 4R3UA 3LOBA 1GNYA 2D6KA 3RLGA 4GB33 4IGOA 2W0UA 3MC5A 1AW2A 3E0WA 3DXTA 3TQPA 5CISA 5ABJB 5E5CA 4LUSB 4N8MA 3V3WA 1U1HA 4I0BA 3WD1A 3BICA 5BROA 3B9DA 5TQLA 4PQ9A 4F8XA 2OPWA 4Q8TA 2POZA 1J2BA 1R3SA 2E25A 5HR6A 5AY7A 4HPGA 1MZRA 4AXOA 1UR0A 4C6KA 2E8ZA 2AR6A 4IW3A 4A7KA 1AVAA 2D6OX 5K7PA 1OIFA 1SFJA 5LRSA 3PVNA 1VIZA 1W9TA 2RJ2A 4BK5A 3WQOA 3U4AA 2ZTNA 1CN1A 4DBUA 5DMMA 1DQ1A 3RWNA 4QDWA 4MZUA 4Y5TA 3AQUA 2OZ6A 5BNPA 2CZFA 3N2MA 4JCLA 1RA0A 3GTXA 4GYPA 3OPSA 2PFHA 4BU2A 2C15A 3PANA 2R24A 1H1ZA 1RHCA 5FLJA 4XZNX 3WK3A 1V6UA 3BLDA 3VM7A 5C8BB 1S3TC 5DO8A 4Y26A 5DQPA 3UJSA 2GP5A 3WXPA 1W6OA 2DSVA 2VC7A 2RUSA 3O16A 4C1LA 4J2PA 3WQ4A 3E96A 1RUE3 5A3HA 2BASA 4J1OA 4CA9A 4E2VA 4DWSD 1W03A 2B0MA 3Q8BA 1IEQA 4LS0A 3ARYA 4CNNA 3KHBA 2GVGA 4H3DA 3EA2A 4I3PA 5CPMA 1XH2A 3C2RA 2G5WA 2CXGA 1H1MA 1G9BA 2IWGB 4AOCA 1FKXA 3F7JA 1COV3 4IGHA 4DO5A 1UMYA 2FCTA 2RVAA 3P8JA 3SQSA 1BBT1 4HANA 1RJRA 5EFFA 3XINA 3MUCA 4Y3OA 2DVDA 4GFIA 4ATFA 2HPIA 1RUOA 4A4AA 4FPCA 1PX3A 5FF7A 1AR81 4BH9A 1TVGA 4IIEA 4YWIA 5D9PA 2Z2BA 2FFCA 2YFNA 1W2AX 2VQUA 5EMYA 1EYWA 4QCEA 4WZFA 4R4ZA 3ELNA 4MAZA 5I3DA 1REQA 5IK7A 4A2SA 1HJVA 4FAHA 2JDHA 2LROA 4OHZA 4IV1B 4CDQC 5J96B 4OV9A 3MLJA 1HL2A 2V3FA 3WH8A 2J9XA 4BR1A 3FFSA 1OCQA 1W2UA 3W7CA 3TEVA 3BARA 4HK7A 1Q3EA 4CCNA 1O68A 3QYSA 1DWFM 1OZMA 2QMJA 3A3XA 3ITLA 4B2DD 4HKOA 3EKGA 5KINA 1XC4A 1AYN2 4HVQA 3BU0A 4NHXA 3A9IA 3S5NA 2YPDA 2ZGLA 1C90A 3OPZA 3T30A 4I02A 4V1PA 1H41A 3E5BA 3VD5A 4XUOA 1VPXA 1CZ1A 4MB5A 1ND3C 4NZJA 2NQLA 3AFBA 3P3NA 1VH7A 1B4EA 2ATFA 5KEZA 5FF2A 3GR7A 4HBNA 1X7NA 4RS5C 3RZKA 4GD0A 4QFUA 3UJOA 4UXDA 5HWJA 1OD8A 4B5VA 1NZCA 5FZHA 3FVDA 4NAFA 2D6LX 5GJPA 4HXCA 1BD0A 1RUI1 1TVLA 4HZ6A 1I8JA 1CIWA 4ASKA 2C13A 2QQVA 3RUBL 1VR3A 3HPFA 4EF9A 4QX4A 1JODA 5BXPA 3NM1A 4MGIE 2H8ZA 2QIWA 1W6OB 4ZQRA 1SLBA 1QASA 1XXNA 4FO4A 1RK6A 4UTIA 4NROA 1XS2A 3QOKA 4S3CA 1I5ZA 4GJZA 1FDJA 1VPQA 4TVDA 3ITGA 3MBDA 4MG2A 4HK6A 1OT1A 2V9DA 3PFRA 1GJPA 1OSEA 3KLLA 1XLDA 1W8TA 1ONRA 1ISWA 1O7FA 1NDZA 1NOUA 5HA7A 4H83A 2WKJA 2JD9A 1JFHA 1IKPA 4AYUA 3ANYA 4FMVA 4WZHA 4NXKA 1R3RA 4YXGA 4HOZA 1QT1A 4QG6A 3KOXA 4GKXA 4PMRA 3EWZA 4ZXKA 4BYYA 3UERA 4AZBA 1DFQA 4QPIC 2BWAA 3PC0A 2F9RA 2ZGUA 2JF6A 3VKCA 1K3UA 4LAZA 4V28A 2PD5A 2IFWA 3ALQA 4NJKA 3SN4A 2PCEA 2QULA 4AY1A 3W1PA 4EJRA 3B0YA 1OA3A 3IDBB 2BBVA 1MRQA 4EPDC 1AR91 1Q45A 3EWWA 2WZR1 3NJZA 5J37A 4RR3B 5A6KA 2BFUS 2IKHA 2VDIA 1RUSA 2VFGA 1GOWA 1FP9A 3MU7A 4LS1A 2JKAA 3H70A 3M6DA 5B4XA 3AMLA 2J74A 1TPFA 4K6BA 4W5ZA 1XL9A 2ZE0A 3W7KA 2XGIA 3DYMA 1CIUA 5K9DA 4DO0A 2ZTKA 2JEMA 3BLEA 2O14A 2HLEA 3OZMA 2Y6GA 2JXAA 2QE3A 5J7MA 4ZQMA 5CC5A 4UTLA