4BQ4A

Structural analysis of an exo-beta-agarase
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
750
structure length
750
Chain Sequence
GSHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLEVPDSGDVNDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNQKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERLGSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
molecule keywords B-AGARASE
total genus 255
structure length 750
sequence length 750
chains with identical sequence B
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq4A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq4A02
3GBEA 3NYDA 3WEMA 1AQMA 2D0HA 2RGLA 1LF1A 3OLDA 4WKHA 1V0AA 2W91A 9CGTA 4PEEA 4M29A 3GXDA 3OZPA 4JKLA 2Q8XA 3ZSSA 1KBBA 2CEQA 4AXNA 2WLZA 2D0GA 4P7NA 2CETA 2G41A 4P8XA 4QAWA 4W85A 5KZ6A 4CD8A 1C7TA 1J0HA 4H41A 5A8OA 1M03A 2BY0A 4D6FA 2Z1KA 2AOSA 2W5FA 1LG2A 4MAZA 3ZMRA 1V0LA 2VUYA 4D6HA 5D9NA 4B16A 1FOBA 1VBUA 2PWGA 2BVTA 3VDBA 2Y8KA 3CHFA 3OBAA 1TG7A 1H4PA 4FF5A 1CBGA 2WANA 4UOZA 2PB1A 2E40A 3AROA 3AYSA 3EMCA 1KXTA 3MKKA 4J3SA 2BVDA 3L2MA 3WDQA 4YW7A 3ARZA 1MWOA 1GQKA 1UR1A 1ZBWA 2QMKA 2GJRA 4W86A 2J4GA 3NCOA 1W1TA 1GQIA 4U3CA 3PZMA 5A6LA 2XUCA 1UWRA 5A6KA 1W9DM 4BQ3A 2XM1A 3WELA 3EDFA 1V3MA 3WDHA 3AIWA 3AXHA 6TAAA 1HKIA 4A6SA 2WC3A 5EB8A 4AZ7A 2BV9A 3BC9A 1LWJA 4GI8A 4LQ1A 3W25A 2ZUMA 1GWLA 3II1A 1UOJA 4OOZA 4P7LA 3EBVA 4H8VA 1E43A 1A47A 2W4XA 4V28A 4GPNA 2J8GA 4H8HA 3UEQA 1MYRA 1E0XA 1OT1A 5A6MA 4AC1X 3MMDA 4EAMA 5BRPA 3MS8A 5BXTA 1NQ6A 4P7QA 1JZ7A 4ZXLA 5A2CA 1VIWA 4JFTA 1BYCA 1TA3B 4U5KA 1CGVA 2WBGA 1CEOA 3B9DA 1CXFA 1VF8A 5LA1A 4UCFA 2ZUWA 1B31A 1CTNA 1W3KA 3MUIA 1KGUA 1F4HA 3A6OA 4A4AA 4WSJA 4D6IA 4NSBA 1XV8A 4E4PA 2J62A 1J18A 5E6YA 1QI2A 1EHNA 2ZICA 1CYGA 4MB3A 1XH0A 4F8XA 3ARRA 3UG5A 4PYSA 4ZEPA 1CGUA 2PBGA 1ISXA 3OG2A 1MFUA 2WVUA 2VCBA 3ZM8A 1JIBA 1GOQA 4JL1A 2BHUA 3W6MA 3WQ6A 4D1JA 2VT0A 2J7CA 3AIRA 1XSIA 4UQAA 4W84A 3FY1A 1L8NA 2GJXA 1HJQA 4JL2A 2QHAA 1B3XA 5I2UA 3AHTA 4M81A 4ACYA 4W89A 1UKPA 1JI2A 1E0WA 3AMDA 2PF0A 4CKQA 3ZYBA 5JIPA 4BA0A 1KXVA 1E4LA 2XTKA 1CLXA 4P8WA 5I0DA 3CUIA 4JFUA 1DWAM 3DHPA 2EXOA 2PWFA 1CNVA 4TTGA 2EEXA 4IISA 3NUKA 3GM8A 1JZ3A 1GVIA 3VIOA 3IJ7A 3VIIA 3O9NA 2JEQA 3MU7A 5DF0A 4A3HA 3CZ8A 1MW2A 4PUEA 3WKZA 1U33A 2E0PA 3KZSA 3AMGA 5I77A 2C8NA 3K8MA 1JZ5A 2KR2A 2WMIA 4MNMA 3RDKA 1BSIA 1GZJA 3N18A 4UFIA 1VFFA 4W7VA 3A4AA 5I23A 3ALGA 3TTSA 1QPKA 1BTCA 3VGEA 3AZTA 3W53A 5CGTA 4BQ2A 1JYNA 1WP6A 2CBIA 4J3WA 1JDCA 1OD0A 2XVGA 1BGGA 2G3NA 2V3FA 5CLTA 3QR3A 4CPBA 3WF2A 1ZJAA 3U5UA 1HN1A 2E8ZA 4AD1A 3VD4A 5A94A 5FL1A 3WF0A 4Z2JA 1OKOA 4HPGA 1CXKA 1H1NA 4BS0A 1H2JA 3F4VA 1QNOA 2IXVA 1JNEA 2GFTA 4F79A 3AZRA 5A2BA 1E55A 2DH3A 4AMCA 4GINA 3RPMA 2WMJA 5FKYA 4EKJA 4PMQA 1E1FA 3WSUA 3AS0A 2WC4A 5E6ZA 1ISYA 5E9AA 2XWEA 1IZKA 3S6TA 4JAWA 2O9OA 2WCGA 2YDQA 3W82A 2J78A 2VQUA 3W81A 1XC6A 4LYPA 1NP2A 1V02E 4M24A 1ZJBA 4ACZB 4CCEA 4P8VA 1V6WA 3SUVA 5A69A 1ODZA 3RM4A 1C90A 4DM2A 4OOUA 1GNXA 5AYIA 2JWPA 3DHUA 2DSVA 3E1F1 3UERA 4AISA 1FH7A 5ABFB 3AYRA 2ZWZA 4AZIA 3TA9A 1HF6A 3VO0A 3BAIA 3ZJ6A 1H0IA 1AQ0A 1UH4A 2XVPA 1W9VA 3F95A 1FA2A 1HJXA 5ABGA 3VGHA 2F2HA 1BYBA 1W1PA 4D72A 1GOIA 4YHGA 1C7SA 1C8QA 1HIZA 4UZSA 2QV4A 2J8FA 2JFEX 4UZUA 4YW6A 4J27A 1NWSA 4P7OA 4OIFA 1V0MA 5D8WA 3VVGA 2EPLX 3OGVA 4OJYA 2DGAA 4UFKA 3SCSA 3BLKA 3MANA 3N04A 4B15A 4TVUA 4ML4A 3AS3A 1TCMA 5CPTA 4TX6A 5BXPA 1SFSA 4QP0A 3WD4A 1DEDA 3WMSA 3MSGA 3WY1A 1S46A 1GCYA 2E8YA 1E6NA 1UWTA 4KH2A 2TAAA 3CZJA 2ZX5A 2OSWA 1AQHA 5DMYA 1HJUA 3PZ9A 1ZB5A 2V38A 4GO9A 1OH3A 2DDXA 3VD5A 1H11A 2J7DA 3W24A 3ECQA 3N11A 4LPCA 3CZLA 1TFVA 3AS2A 5DO8A 1IZJA 3K8LA 3O6AA 4FLSA 2XM2A 2G3MA 1XYFA 1UA3A 3VTRA 2W66A 2CHOA 5D4YA 4UFHA 4RL3A 1W3LA 3VIPA 4H04A 5E09A 4AD4A 3KL0A 1K9DA 1BG4A 2XFYA 2BY3A 4LJHA 1QOXA 3RIKA 3ZT7A 3D3AA 4PTWA 1EDGA 2DT3A 5BYWA 1BAGA 3ZT5A 1QI4A 2VVNA 4XZBA 1US2A 4XV0A 3WNMA 1VBRA 1TUXA 1IV8A 3M46A 4Q22A 3GZAA 3A4XA 3VKKA 1PX3A 4OBRA 1HN0A 4MTVA 2WYFA 2CKRA 2WHMA 4EK7A 3GH4A 2LRPA 3ARVA 3LPFA 5IFPA 2FH6A 5I79A 1WE5A 3AI0A 3D5HA 3KE0A 3SEPA 1G1YA 2D20A 4AL9A 1H09A 1TMQA 5HOSA 4ATLA 2YBUA 2AMGA 2EO7A 4U33A 4GO8A 7CGTA 4CPBD 3DYMA 2V5DA 4DM1A 2OWWA 1QNPA 3AXXA 1FHLA 4XB3A 1UQYA 1W9XA 1W9UA 2AAAA 1ZL1A 1HP4A 2VNCA 3QHOA 1XCXA 4GZJA 2UWFA 4LGXA 3BXWA 1JDDA 1HKMA 5A6JA 5ABFA 2YKKA 4UFMA 3GNRA 1UH2A 1TE1A 3WF1A 4CU6A 1UR2A 2EPNA 5KEZA 1WZAA 2BXYA 1NARA 2ZXDA 5E0CA 1D3CA 1JZ6A 1JI1A 1A3HA 3SCWA 2WB5A 2D22A 5A8NA 3VIHA 3L4TA 4QCFA 2VCAA 5FOOA 1OIMA 2XPKA 3EDDA 3A3HA 4PCTA 5D9MA 4Z2HA 3VUPA 3AFBA 3WNOA 3RMEA 4MDPA 1BYAA 4ZE4A 5JBDA 1GOOA 1KR1A 5I5RA 3ZT6A 4LK7A 5I6SA 3W38A 3VMPA 5CZKA 5E70A 2CERA 1OINA 4XX6A 1BFNA 3O2LA 2BHZA 4PRWA 4UOJA 3VMNA 2GJPA 1ODUA 1ZBCA 3CH9A 1J0JA 1VEOA 1W8WA 3PZNA 3VM7A 3BSGA 1K6AA 3VOCA 1UH3A 4W93A 3M6DA 3UETA 3POHA 1TZ7A 1EXPA 4NRRA 3W26A 1V08A 2V3GA 2V3DA 2XVNA 1UKOA 1CPUA 2XJ7A 3VINA 2VRQA 3EMQA 1HJWA 1SR0A 4Z2GA 5FIPA 3KWXA 1H0GA 1SMDA 1VENA 1J0KA 3F5KA 1KQYA 3VX1A 3VGGA 2Y2WA 1B9ZA 4CU8A 2X09A 2WVSA 1FH8A 1Q6DA 1QHPA 4ZE5A 4FK9A 2WM0A 4AZCA 3OLIA 3VPLA 4HZ7A 2W63A 1UG6A 3FNDA 5A8QA 1UZ1A 5M17A 4XUYA 3ARUA 1UKSA 1HL9A 1OGGA 3DYOA 2GVYA 1V03A 4HU8A 1BHGA 1I1WA 2YL5A 4M80A 2D23A 2DIEA 3BAYA 1KWGA 5HDRA 3POCA 1C8YA 2WMKA 1CGYA 3IK2A 4IM4A 2J7FA 2X0HA 6A3HA 2J74A 1QW8A 1VAHA 4LYRA 1Q6GA 1YHTA 2WKLA 4HZ6A 1ZS2A 4W7UA 1E73M 4R5EA 3SUWA 3THCA 3WNKA 4F9DA 1PZ3A 3VGDA 1ZBVA 1UA7A 2WMHA 4X9YA 1TVPA 4EANA 2G3IA 1FFQA 4PTVA 4LKEA 3PBGA 1PIGA 2JF6A 5LA0A 4PMDA 1V6UA 4CVUA 4E8DA 3W27A 4ZXOA 1KGWA 2ZX9A 5A6BA 4JFSA 1W91A 3WUFA 1J0IA 3RM9A 3CUFA 1O7AA 3OLEA 3LMYA 3AIQA 4JCLA 1LWHA 1E4IA 4MB1A 2VX4A 5I3DA 3TTQA 2D24A 4D6CA 4L4PA 2XGBA 1KQZA 7A3HA 4MNKA 1LL4A 1UD8A 1NOUA 2W61A 4GQRA 1YQ2A 2CITA 2E9BA 3JUGA 2X05A 3AIEA 3IJ9A 1GOWA 7TAAA 4W8BA 4LKDA 1M53A 3K4AA 5CLWA 4A3YA 3WH6A 3CBWA 4QLKA 1B3VA 2FHCA 4TUFA 3SUTA 4YN5A 1PJ9A 2VO5A 3CUJA 2V5CA 3BMVA 2J7EA 3W4RA 4KRTA 1V6VA 1XYZA 2VURA 4PN2A 1QNQA 1HJSA 3THDA 5A6BD 2ZUVA 3VILA 1HNYA 3T09A 1QI5A 1MVYA 2YA0A 3VIGA 1V6XA 3ORJA 4Z2KA 3SCPA 4W8AA 4BQ5A 4PMZA 4AD3A 1B90A 5AYBA 1C3FA 3IAPA 1VEMA 1M7XA 2K46A 1QI0A 3MV11 4PMNA 2IUZA 2CYGA 2YDRA 3OGSA 2YJQA 4AY1A 4HTYA 4W7WA 4HA4A 2BXZA 1KBKA 1OSEA 3BCFA 4AZBA 2YBTA 3A4WA 2OYMA 2YA1A 2DIJA 3K8KA 1W8UA 2OYLA 1RPKA 3GTNA 5LA2A 1WDSA 2X8RA 1PEZA 4Z2LA 4CCDA 2A3HA 2ESCA 2UY5A 4JFVA 3L4XA 3N9KA 1HKJA 1L7LA 4NF7A 1J12A 1J11A 1WPCA 1E6RA 1UUQA 3BLPX 6CGTA 1UD5A 3ZR5A 4FLRA 1PAMA 3RILA 4HOXA 2VZTA 1E40A 1NOFA 1J0ZA 4Q7NA 4WKFA 2WKGA 2WCAA 3CIVA 3HN3A 3ARPA 3CMJA 2FGZA 4CVWA 3AISA 4OZOA 3WDRA 3T0DA 2X1IA 3CHEA 4AEFA 4PCSA 2CESA 3DC0A 1Y7VA 1W9PA 2ZUSA 3AHYA 1DWGM 1E71M 4LXFA 2DEPA 2VL4A 3RJYA 5EFDA 4CGTA 1WZKA 4AEEA 2NSXA 2WBKA 3UG3A 3VIKA 3OB8A 4H8UA 3L4VA 1O6IA 4UOQA 2XIIA 1R85A 4H7VA 1WO2A 1X6NA 2D1ZA 4FMVA 1GOMA 1JFXA 3I3DA 1H49A 1DTUA 2UY3A 1V02A 1V3LA 3AICA 1F4AA 4MJ2A 1ITCA 1B3WA 2J75A 4EE9A 4AZCB 4NRSA 3T2QA 3OA5A 2WSKA 2WWDA 1GWKA 4DWSB 1W8TA 1EH9A 1G01A 1V3HA 2J7GA 4CD4A 2WWCA 4GZIA 1OM0A 1R7OA 3L4WA 5LYRA 4YPJA 2GUYA 3A47A 3ALFA 4W87A 1E6SM 4JZ5A 1W1YA 5AY7A 1R8LA 1V3IA 2O9TA 3CMGA 1KWKA 1CGTA 5BROA 1JNDA 3NSMA 3CGTA 1GVYA 3CUHA 3KL5A 1EIBA 1XH1A 1FHDA 3CUGA 5A6AA 3WUGA 2CIPA 4J3UA 3WMBA 1CENA 3AMLA 3VDHA 1JZ8A 2VMFA 2OWXA 2NW0A 3SCNA 1HJVA 3WNLA 2X0YA 4UNIA 1ZU8A 4GZEA 1HVQA 1W3HA 1OT2A 3MUY1 1AVAA 2J7BA 3WL0A 1US3A 2DSUA 4PBGA 1WDRA 3GXMA 2WHKA 1PX4A 4S3JA 3B8SA 3EDJA 2VVSA 3QGVA 2ZOXA 3NIYA 5CSYA 3WD3A 1V0NA 2CXGA 3VD7A 1UWSA 1C92A 3AHZA 2VR5A 3FHAA 2IXUA 4F66A 2E9MA 1D2KA 1EOKA 3FHQA 4ZFMA 4DUVA 1HP5A 5I24A 1HL8A 3ZJ7A 1XSKA 2WVVA 2XG9A 2VCCA 5GNYA 2D3NA 3T2PA 4BCEA 3TTOA 3VNZA 1JD9A 5D9PA 3WH5A 3WH9A 2B31A 1MQPA 5AC4A 3VIJA 1GWMA 4PUDA 3PZUA 1VJZA 2YDSA 4BZYA 2XVKA 3MO4A 1HKKA 2WZHA 1UQZA 4URIA 3RJXA 3VM5A 3WH8A 3VGFA 3U7BA 4B3LA 1VJSA 3AXIA 2GK1A 3K1DA 3W0KA 2BFGA 3ZQ9A 4CD5A 3W37A 3VGBA 4PMUA 3U57A 3WMCA 1MW3A 1Q6FA 3WN6A 3OIHA 1JAKA 5BWFA 4PSPA 4GI6A 2F61A 3FAWA 4CCCA 3L4ZA 4WLCA 3AHVA 4PMOA 2JF7A 4HMEA 1E5JA 3UR8A 3BSHA 4UQEA 2VX5A 5DT7A 1AMYA 4ATWA 1X6LA 1MXDA 2XSAA 1GHSA 1JDAA 1WZMA 4MADA 5E0FA 1J10A 3QOMA 1UR0A 1XD0A 5FCZA 5DFAA 1E5NA 2W62A 4E8CA 2WW5A 3MUAA 4TOQA 1UD3A 2JEPA 3RM8A 2A3BA 2BS9A 3EDEA 2Y4SA 1E4MM 2EPOA 4DWSD 1QNSA 3GDBA 2WMGA 1J0YA 3WD1A 1KR0A 1OD8A 1U2YA 1W2VA 1EDTA 4DWSC 1FP8A 3CTTA 4C7FA 3MMUA 3SCTA 2XHYA 3KEHA 4BF7A 1L0PA 2VR4A 4Z2IA 4P7RA 3APGA 2WMIB 3HJEA 4MNJA 2X2YA 4PTMA 2JIWA 3MSDA 3T08A 1JYVA 1E9LA 1K9TA 2J77A 2ZE0A 3VD9A 3L2LA 2WHJA 1JYXA 3BAJA 4WIWA 2XFRA 3ZYFA 4MB5A 3WD0A 3AS1A 1BVZA 4X0NA 3WUEA 4J3TA 4J7RA 2YOCA 1KCLA 2YLAA 5DT5A 1W8ZA 2WAGA 3VNYA 1VB9A 3AOFA 3NSXA 4JCMA 3VX0A 3SCQA 1UWQA 3SCVA 1CDGA 1W3JA 3ZJKA 3K46A 4CUCA 4AD0A 4GKLA 4LX4A 1GQLA 2BY1A 3NDZA 4M56A 3AHXA 3TONA 1EO5A 2ZUNA 2A3AA 1LL6A 1GQJA 1NP0A 4LKFA 4MJ4A 2FDMA 1Z32X 3MUZ1 2O9RA 3EMZA 3WDPP 5HXMA 3QHMA 1E72M 1G94A 3BGAA 1K9FA 3T2OA 3WQWA 4ATDA 2VZSA 4CN6A 5A1AA 3SURA 2ZIDA 3NDYA 3B9AA 1CGWA 2OLHA 1ISZA 4MB4A 3PTKA 2MANA 1UWIA 1E6XM 4QLLA 4JHZA 1UYQA 2CBJA 1R87A 3N15A 4OUEA 4UFLA 5TD4A 4UR9A 2YL9A 1OGSA 2G3JA 1BG9A 3GYCA 2QPSA 3T0AA 4MPKA 1OIFA 4AZ6A 5JBFA 1BQCA 1VFOA 1XD1A 3PZQA 1N82A 4H2CA 3CLWA 5C70A 2W92A 3CHDA 4IPLA 2HISA 3U5YA 4TVCA 4J3VA 3UR7A 1OWQA 4TXEA 3QHNA 4NI3A 1C93A 3VDCA 1E0VA 4V2XA 1GJWA 1W9FA 4AZ5A 3FN9A 1U30A 5GQBA 1B3ZA 5BXSA 3PHAA 3AIUA 1WNOA 4RE2A 1W1VA 2Y8VA 2ZUTA 8CGTA 1NM9A 1OCQA 4MDOA 1V3KA 1C8XA 2VOTA 4AWEA 4QCEA 3SCUA 4ACZA 2DPEA 1X1NA 1EA9C 2DSZA 5A3HA 1E1EA 1M04A 5JBEA 4K68A 1M01A 4AIUA 1ISVA 2C24A 1JXKA 2GDUA 4AYSA 4U3AA 5C8BB 1JZ2A 3WQ5A 1PIFA 4Y7EA 4PTXA 1B1YA 4HMDA 3SCRA 1UKTA 4JHOA 1E56A 1MFVA 1JGIA 2PWHA 4HP5A 1E70M 1EQPA 4NZCA 2GK1B 2UY2A 3HMCA 4CU7A 4RE3A 3VMOA 2OSXA 2D2OA 3WFLA 5D8ZA 2WMFA 2OYKA 3N13A 3WNNA 4QFUA 1WKYA 4GI9A 1B30A 3WFZA 2DSKA 3BAKA 2GSJA 1XGZA 2WPGA 1DWFM 3DYPA 1GJUA 4CP9A 1EDQA 1IT0A 3WBEA 2PWEA 1WDQA 3NSNA 1QBAA 2ZUUA 4D71A 4GXPA 4W5UA 1MW1A 1E6PA 1B0IA 3FW6A 5CGMA 1TR1A 1UR9A 4L4OA 4YWAA 1W90A 1R7AA 3ARXA 5CSUA 1UR4A 1TVNA 1DWIM 2EJ1A 4QDMA 3HU7A 3TP4A 1DP0A 4F9JA 3UESA 2YL8A 2OWCA 4KRUA 1NOWA 4UQDA 1VEPA 1GW1A 4DUWA 5A2AA 1UOKA 3SUSA 1UKQA 4PMVA 2Y24A 4B9YA 3W29A 3GBDA 1KGXA 1HXJA 2JE8A 4V27A 1HT6A 2BHYA 1UD2A 4GQQA 3PZVA 3CPUA 2G4FA 3GNOA 4U2YA 3WENA 5CXPA 3UT0A 2CKSA 5ABHA 3AIVA 4YHEA 2WSPA 2J7HA 3VIMA 1BGAA 5ECUA 2QLYA 3F5JA 2E4TA 1QHZA 3BMWA 5FD0A 4M1RA 4RE4A 4OBSA 3CZGA 1E3ZA 4C7GA 3U7VA 2XVLA 2A3EA 1E15A 5IDIA 2XFFA 1JD7A 3I3BA 1KXQA 1DHKA 3CZEA 1ECEA 4IUGA 3PTMA 3AMCA 4AIOA 4U31A 4J28A 1CGXA 3GH7A 2Z1SA 1FFRA 1G0CA 3RO8A 4CD7A 4JFWA 4KWUA 4UFJA 4JIEA 5JUVA 1OGBA 1Q4NX 2YLLA 2WXDM 1LG1A 4LK6A 1J01A 4PSRA 3PZTA 5EFFA 3WDJA 3WL1A 5IFTA 5CG0A 4N0RA 2E9LA 2XYLA 5ABEA 5BRQA 3IJ8A 3EDKA 1EOMA 1CXLA 3SCOA 1WCUA 4UQBA 1XCWA 1V6YA 4WKAA 1NWTA 5GNXA 3ARTA 3W6LA 3J7HA 2WK2A 1B3YA 3W28A 4WF7A 3WQ8A 3PN8A 2DT2A 4AIEA 4UQ9A 4D6DA 1E3XA 2EPMX 1JF6A 4LYQA 2WVVB 3WQ4A 4D1IA 1ZBKA 4WJXA 4TVDA 2EPKX 2CNCA 4HA1A 3SIMA 1VRXA 1V3JA 4HU0A 2BNJA 2O14A 2WHLA 4N42A 2V3EA 3L4YA 2ZXQA 3FAXA 4GIAA 4CP9B 2VZUA 5A95A 3WD2A 3GNPA 3BAWA 3OLGA 5M5DA 2GJXB 2UY4A 2ZX6A 4E2OA 4B9ZA 1MXGA 2DT0A 4S3KA 1RP8A 2E3ZA 3QOKA 3TTYA 3WEZA 2WZEA 2VX7A 1UR8A 3DECA 5CJ5A 1WB0A 2ZXAA 1GOKA 2VRJA 1FH9A 3AIBA 1V0KA 2Y5EA 5D21A 3FXYA 3ZYHA 1ISWA 1ITXA 1GPFA 1VFUA 2F8QA 1BLIA 2OSYA 4W8LA 1BPLB 4MAVA 3AZSA 3G6LA 3PZGA 1GONA 2VI0A 3N1AA 3GXFA 4W5ZA 5IXEA 2WZIA 4CN1A 2WNWA 2RGMA 2ZX8A 3PZOA 1I75A 2VXJA 1XHGA 2W67A 4D6JA 3WQVA 3S2CA 1QNRA 3WH7A 5A8PA 5EBAA 3LPPA 3AMKA 4U2ZA 4HOZA 5BXRA 2DT1A 5HPOA 4P8UA 4XZWA 2WCSA 1JZ4A 3WNPA 4OKDA 5HPCA 1I1XA 3OZOA 4QLJA 4UTFA 3LPOA 3WF4A 5CPSA 2YL6A 1XH2A 2DSWA 2PWDA 2VZOA 1K9EA 2ZXBA 4WK9A 1GORA 1MQRA 1LLOA 5HNNA 4M82A 4PMXA 2BVYA 1GUVA 2VRKA 4HA3A 4X0VA 5CQ1A 1PX8A 3BAXA 3EYPA 4M8UA 1BYDA 2Q1FA 1G9HA 1NH6A 4U5IA 3M07A 4ZENA 5DEZA 3OGRA 4AD5A 3AJ7A 3VIFA 3SUUA 1LJYA 3WBAA 1H41A 1CXEA 5A8MA 4J3XA 1QBBA 3IANA 3AQUA 5GPRA 4WSKA 4W88A 3UG4A 1Q6EA 2J47A 5A6SA 1UD4A 5IHSA 3VDAA 4AD2A 3ARQA 1SMAA 1HVXA 4DUXA 2CHNA 1CIUA 3K4DA 1RD6A 2WC7A 3RCNA 3ARSA 2J79A 2YA2A 1FP9A 2HVMA 5C71A 1KB3A 2XGIA 1NWRA 5AC5A 1CWYA 4AZHA 2VC9A 3WEOA 4IPNB 3TOPA 1RH9A 3UCQA 1EO7A 1KCKA 2XWDA 3N12A 4C7DA 5CPQA 1WZLA 2PC8A 2G8ZA 1WMXA 2VQTA 1H3GA 2CPUA 4JKMA 3ARYA 3VD3A 1J9YA 2GDVA 1C91A 1H5VA 3PZIA 2XSBA 4HPHA 1EHAA 2EQDA 3ZIZA 2FH8A 1WZXA 1UZ4A 1RP9A 1MQQA 2QF8A 1UWUA 2VZVA 1D7FA 2D3LA 3GXIA 2ZWYA 4AW7A 4HOWA 3BH4A 3B9EA 1W9BM 4B3KA 1SYTA 4CN4A 2DH2A 2YIHA 3MV01 3I3EA 1E6ZA 5HBFA 2EBNA 1CLVA 1W2PA 1QVBA 3L4UA 1WDPA 1CXIA 3CO4A 4KGJA 1BF2A 5IHRA 5D9OA 1NWUA 1DWJM 1JF5A 3G6MA 5I78A 1OBAA 1DWHM 2C0HA 8A3HA 4FLQA 2WLYA 1WAWA 4FLOA 2FHBA 1UHVA 2PI6A 4JKKA 3WDIA 2ZX7A 3NJ3A 4BQ4A 5M3WA 2FGLA 2VJXA 5M03A 2NT0A 2VTFA 3IAQA 1CECA 2VX6A 1XSJA 1HX0A 2O9PA 2BY2A 2DQXA 2O92A 2C7FA 1XRVA 1E4NA 1KXHA 3WUBA 2PBOA 1JXJA 1EQCA 2CBUA 1PPIA 1QI3A 5BCAA 2QMJA 1MW0A 1EGZA 2NT1A 3M7SA 1QW9A 4HMCA 2LROA 4KMQA 1TA3A 3ZR6A 2XIBA 2WYSA 1G5AA 2FHFA 1CXHA 1KFWA 2A3CA 2D0FA 3ZO9A 1JYWA 1LL7A 3T0BA 4R27A 3GH5A 1LQ0A 1QHOA 5GNZA 3ZOAA 4D6GA 3ARWA 4DWSA 4MNLA 5JIWA 4D6EA 1ESWA 1PBGA 3LPGA 1Q6CA 2WVTA 3PTQA 2JIEA 3WF3A 1OB0A 4PMYA 3N17A 5FL0A 4UQCA 1VFMA 1JAEA 1E6QM 1B2YA 3WIJA 1PZ2A 1P6WA 2J25A 2CCRA 2QPUA 1BVNP 5F7UA 1JL8A 1UD6A 1W32A 3KL3A 2JALA 5EMYA 1WCGA 1JFHA 4PMRA 4KGLA 1R86A 4CD6A 3BCDA 4TTUA 3VU2A 1JG9A 1CZ1A 3MMWA 3CHCA 4AZGA 3CZKA 1GHRA 3ZJ8A 3F5LA 2CBVA 4HZ8A 4TX8A 3ZSTA
chains in the Genus database with same CATH superfamily
3VOHA 3NYDA 4OMCA 5I3JA 3QGAC 4QRNA 5CAHA 3SCGA 1TQ5A 1LEDA 1DE5A 2D0HA 2RGLA 1YNAA 1EWDA 4QB1A 3K1GA 2E51A 3OLDA 3JZVA 5JR2A 1AYM3 3RZGA 2D44A 4TV5A 4WKHA 2NYYA 4XAGA 3W2MA 3M47A 5I3GA 4G6CA 5FY1A 3HR9A 1VFSA 4M29A 4XOGA 2NZ9A 3GXDA 2D6PA 2Q8XA 4XXPA 1YTDA 2VG9A 5LNVA 2WLZA 2D0GA 3D47A 3CLPA 4GMEA 1O4YA 2ZRZA 5T54A 2CETA 4IQDA 4ZQMA 1A4MA 1T96A 3GU9A 4CD8A 4A6GA 3ABRA 5GLUA 3TIMA 2ADAA 1M68A 4QJ3B 1M03A 1AMKA 4N4QA 2Z1KA 4QEEA 3C6CA 1WW4A 1Q8VA 2G9FA 5FY9A 5EFUA 1MS3A 1RUI3 3ZMRA 2R073 4XZNX 4D6HA 4B16A 2PWGA 2BVTA 1JUIA 3URQA 5F4XA 3RWNA 4FF5A 2FZ2A 4POCA 1PKLA 1VP6A 2PB1A 1SUXA 2DU0A 2E40A 4NNAA 1UMHA 4Z1DA 4QB2A 1T2XA 4GYKA 4K8RB 3NZPA 2BVDA 3CUXA 2R071 5FYCA 3WDQA 4R9XA 4B2DA 1ZRCA 1ZBWA 2Y6HA 3KTXA 1W1TA 1RD5A 3SY5A 2FYMA 5A6LA 3KFTA 3P8IA 2G9GA 1UWRA 2X1SA 2R1DA 3A0NA 2RAGA 5F37A 4GA9A 3DFTA 3WELA 2HEVF 3WQDA 4I5UA 4RUBA 5LY2A 3AIWA 2XINA 1ZA4A 6TAAA 1TMF2 5I91A 4OECA 4LQRA 2WN3A 1OC1A 1HQNA 3VDDC 4XVHA 3M5YA 2W08A 4GI8A 5FEXA 4LQ1A 3W25A 1XYPA 1TE6A 1GWLA 1UOJA 5EMJA 4BEUA 1FHVA 4I3GA 3AP7A 1KQRA 2VEPA 1T6BX 4MY8A 4GYPC 1AX1A 3H21A 1W6OA 3MZHA 3MMDA 4BFAA 4BI5A 1UPMB 3C7HA 4PUUA 1DQ2A 3SAZA 3V5FA 6XIAA 1GJPA 1XLIA 3KW3A 1ASJ1 1BYCA 3O1PA 2A3XA 3EEZA 2E7AA 1DIEA 3QM3A 4JV4A 1AX0A 1R1ZA 1VF8A 4UCFA 1NDYA 4K8GA 1F73A 3TCSA 4FI9A 4X3ZA 1GFF2 5IRPA 1IGWA 4JC1A 5IOBA 1WOAA 3GHUA 3DF0A 4PTDA 3AXMA 1F4HA 4C6BA 6REQB 3N19B 4DPNA 1TPB1 1LGCA 4WSJA 3T0CA 5F9TA 5J5DA 3WDXA 4D6IA 1EC7A 4B1MA 4GNJA 2BOEX 1HG3A 4URAA 4QQPA 3BPWA 1IGSA 1QI2A 3F2DA 5EMMA 2WDBA 4S2HA 1GGOA 1CYGA 4FXRA 4RNHA 4CNTA 1RBOB 3I59B 4BQ1A 3GXNA 4JYDA 1MEHA 4L1WA 4XD4A 3TWAA 2RMU3 1IPJA 4Y24A 4PDWC 2VCBA 4NHYA 1UY4A 5JSPA 1GOQA 1FWNA 2BOIA 1MUMA 3WQ6A 2VT0A 2AR6A 1IWAA 3WQFA 2YZ4A 4L65A 2VVDA 3FY1A 3HMJG 1RGSA 3GJAA 4NL1A 4MZ1A 5LW9A 3EHKA 3KM8A 4GY7A 1HJQA 2ZHLA 3A9BA 4JL2A 4S39A 4FNQA 2OA2A 5I2UA 4XBQA 1QXJA 3AU6A 2HCVA 4M81A 3HV8A 4PIYA 4TU1A 2MHFA 4C1NA 3PU8A 4W89A 2Y38A 1UKPA 1YCIA 1E0WA 4LCSA 3MLLA 3VABA 3WJXA 2V5KA 4BA0A 3GZUC 3UA4A 4V15A 4WCJA 2JDNA 4F7ZA 5CNAA 1NFPA 2OT1A 1SJBA 4H7ZA 2VEMA 4LWWA 1DYSA 3KBWA 1CNVA 4MXWB 4G8TA 3NUKA 2AC1A 4AXKA 1S0GA 3WZ0E 1JZ3A 1OA3A 3VBHA 1HRV2 2DZVA 3O9NA 3MU7A 3OUJA 4M6PA 3V65A 1JPIA 1RQHA 2ZRYA 5LEJA 1MW2A 1BQPA 4R85A 1Z89A 3WKZA 4IE5A 3SRDA 2I56A 3AMGA 1LROA 2C8NA 3SBFA 1KS5A 2KR2A 2WMIA 1GZJA 5K4LA 1YXCA 4C6LA 4UFIA 3UJRA 5I23A 3E6DA 1N2VA 2XJSA 3H7UA 4XJAA 1QPKA 2G95A 3OJBA 4XMAA 2BU9A 1O5KA 3VKCA 2Z69A 3M5ZA 2C71A 2A6VA 3NPWA 3G1SA 2OU4A 3W53A 2PSNA 1WP6A 2CBIA 3PWIA 4J3WA 2C15A 1OD0A 3CAVA 3QF0A 1RUC2 1DLLA 2WZTA 1BGGA 2V3FA 1W37A 3QR3A 1QH6A 2IXCA 3USZA 1IGOA 3OUHA 3ZSKA 4HCDA 3WF2A 1TRIA 3TCEA 5G2HA 3VD4A 5BNPC 4EPKA 5A94A 1T6GC 1DQ0A 4XD5A 2WZR2 4FBFA 2IXVA 3KT4A 1GTHA 5A2BA 3ITCA 2HYXA 4WQ6A 4DXTA 1KGYA 2ZZ5A 2WMJA 5JDBA 4EKJA 3WSUA 3I4KA 2O55A 3AS0A 3CMFA 5E9AA 2VEFA 1EJUC 4HVOA 1GEHA 4GD0A 4DB7A 4CDUC 4N02A 1AR73 4HVRA 3S1GA 1TRDA 2ACUA 2O9OA 2YPJA 3DPRC 2ABAA 2J78A 1H30A 1Q2RA 3BN6A 3NPVA 2GNBA 1NP2A 1V02E 1VIWB 4M24A 1ZJBA 2P76A 3HGRA 5GLWA 1D0HA 3IZOA 2HJIA 2JDUA 3BU7A 4XFGA 1C90A 4CDWC 4IXLA 2DU2A 3G7DA 3CWHA 4AI9A 4PMJA 2QNKA 3URFA 3E1F1 1FH7A 2GJLA 5I3FA 2ZRVA 1QWRA 2YFOA 4BQXA 1GT8A 1UR3M 3N9SA 3UU0A 5LGXA 3HZ3A 4PT6A 4YW1A 3LHUA 4Q8UA 3ST7A 3TOYA 3ZJ6A 4MLOA 1E1CB 2R1KA 5K9CA 3K51A 1XLGA 1DQ1A 2HLEA 1K7XA 1YTEA 1LHOA 1ULOA 3L2IA 1OPOA 1REFA 5ABGA 2VFFA 3EOSA 3VGHA 3NL2A 4NXKA 4YHGA 3QSRA 1C8QA 4HSJA 2WKKA 3M8LA 4R7JA 4UZSA 3HPFA 4F0MA 3S30A 2BV4A 1S1PA 3UZZA 4UZUA 4YW6A 1W39A 2ZFAA 4J27A 1NWSA 3IWPA 3QACA 4GALA 4Z08A 4C1WA 3ABXA 4MYXA 2VBDA 3KHJA 3BLKA 1TJ0A 4TIMA 4EXBA 1T99A 2QKFA 3TNOA 2XJTA 1KFKA 4TVUA 2A79A 3OO2A 2PDMA 2FMDA 4TX6A 3STCA 1SFSA 2B7YA 2XFWA 3WD4A 3L0KA 2RHPA 4UF0A 1GCYA 1E6NA 4H9MA 5A70A 3HQOA 3L0GA 2DVTA 3H2AA 4KFOA 4DEFA 3T0TA 1OFNA 3V0AB 1VCVA 3E2VA 4K40A 3DENA 2CLEA 1AQHA 3LYEA 1HJUA 3PZ9A 2G4IA 1PK6C 4NAOA 3CT7A 4FP1A 3IMMA 1UASA 3O7UA 3LA7A 3ZN5A 2Q09A 2PUZA 1FPN2 5CG8A 3LTPA 4C0HA 3EB4A 2Z2SB 4PBEA 2VNRA 4JVAA 1XYFA 3NWRA 4ZQRA 1YDOA 3QH2A 2HPMA 2W66A 1OZQA 1S2UA 4H04A 2P0OA 4MO3M 3COTA 5I3IA 1RQBA 3FYOA 2BQPA 2V8ZA 5FXWA 4JDBA 4LHKA 3LRKA 4YJ5A 1VAVA 3C56A 1ZBA2 1XXNA 3ZVIA 3ZT7A 1W6PA 5FMBA 1BRLB 4LEFA 5CJMA 1ZZ8A 3D3AA 4PTNA 2GMEA 3UKTA 3WW1A 5DXYA 1QJEA 4PTWA 1EDGA 4ASMB 2ZC8A 1LAJA 5D2XA 3ZT5A 3S57A 3C2RA 2AACA 1F05A 1SZBA 2R062 3KMHA 3WNMA 5JXJA 3OYZA 1OYCA 1ENSA 3CJXA 5CZSA 3SH5A 3H24A 3IUDA 4XXAA 2OX0A 4XBJA 3KLSA 3REQB 4QWNA 4MTVA 2WYFA 2YV8A 3ZDVA 3GUGA 4QQUA 3DCQA 2DUOA 4X6RB 3VDGA 2PD5A 1VZWA 3CB8A 3PBMA 3LPFA 3D3FA 5IFPA 2UY9A 1QJZA 3B7MA 1R5YA 4BF9A 4Y9OA 1GMMA 3Q4DA 5CEHA 2UYBA 3AI0A 5A3OA 3SEPA 2A3LA 4D9PA 1GP6A 1PIV3 2PGWA 1KKRA 3K2GA 1NDZA 2E1DA 1LODA 4XZHA 1G1YA 4AL9A 5HMEA 5F8PA 1TMQA 1BLZA 1HXS3 4JDNA 2AMGA 3DAQA 1UW8A 2EO7A 2VMDA 1NY1A 3PFRA 4LF2A 3PAOA 2XB6C 4R88A 3UG8A 4CPBD 3BLOA 5E1RA 1QNPA 1UJPA 3AXXA 4XB3A 1XIHA 2QCMA 3GDMA 3ATZA 4KBBA 1VPHA 3QHOA 4UR8A 4GZJA 4LGXA 5IK5A 4K38A 3I10A 1S0BA 3NG3A 1AUYA 3VBFA 1JOPA 4UFMA 4ZU5A 4GBUA 1TE1A 3WF1A 2RJKA 2FDJA 3CJIA 1UR2A 2EPNA 4K6BA 5FPXA 4JGZA 5KEZA 3EPNA 5FYHA 4RW5A 4SLIA 3AK0A 1JI1A 1YJKA 3SCWA 2WB5A 3VIHA 4QCFA 1ODMA 2VE1A 4QE4A 2XPKA 3W72A 3V1HA 3A3HA 5D9MA 3C0JA 3WNOA 2E5BA 4MDPA 1OX4A 3W1NA 3UYJA 5FQ0B 4ZE4A 1K1DA 4FXFA 4BEQA 4G9SB 3ZN6A 1ZY9A 1FWSA 3LEKA 4PL2A 4AAPA 3W1PA 3VMPA 5HV0A 1W99A 2PEVA 3IRDA 2J24A 3CU2A 4CDWB 3KCXA 3WLHA 1BFNA 1H9WA 2PHTA 2R061 1VBJA 4FR1A 2VGFA 4PRWA 4A3ZA 3U3HA 3S1VA 3QXBA 3GKAA 4KF1A 4JTKA 3ENLA 1P43A 4QXKA 4UMBA 3L2HA 1W8WA 3PUAA 3EO6A 1GQHA 3MW3A 4YW3A 1AODA 1Z41A 1UH3A 3U78A 2VUNA 1KLYA 1WXYA 5L6UA 3UETA 1QPQA 1KBJA 1ONRA 4R52A 2VZRA 3NL1A 3UXIA 4DELA 5D02A 4JTAA 3ZXGA 3W26A 3W70A 3IPVA 2FD8A 1ZZMA 3OBRA 2XJ7A 3VINA 5FY5A 2VRQA 4LBMA 5ISLA 4LNVA 1HJWA 1SR0A 4Z2GA 3OY8B 4NPMA 1Q2SA 1Y43B 1S5NA 1FOD3 4WVXA 5FIPA 1V6IA 1F5ZA 3MSYA 2BRTA 5FO7B 1POV3 1HB4A 1J0KA 1GZCA 3KBMA 3VX1A 2EF6A 2O0OA 1XQKA 1JH5A 2BZDA 4PULA 4QM9A 2V9DA 5LZLA 3EWXA 3I7DA 3QRHA 1H7PA 1CR7A 3KBNA 4JX0A 1Y65A 1RUD2 4LYKA 1FH8A 1PZ1A 3PUEA 4JN6A 2WM0A 2Y6JA 5H9QA 4R9DA 3N9RA 3OLIA 3VPLA 4OQ8A 1UG6A 5A6XA 3ROUA 2OZ8A 1DIDA 1JUEA 1A78A 2Y7DA 4FFHA 4XUYA 3ARUA 5T5OA 3DYOA 1WW6A 4O9EA 5ANNA 3KCYA 2QCFA 4G7FA 4XTDA 1H2NA 1YFUA 1BHGA 4S3DA 4A8NA 2YCLB 2YL5A 4HPKA 1P7TA 3VBSC 5DRIA 1PIIA 5FZDA 5HDRA 4UF0B 2YBVA 5CFDA 4FSAA 1R1A1 4LV9A 1UMLA 5FJTA 3EKGA 3O7OA 3TC7A 5DELA 1ONAA 4JTOA 1QEXA 1X7IA 3NNJA 4IM4A 4XO6A 2J7FA 6A3HA 4D8MA 4LVGA 5G04L 3NO5A 4AWDA 2DCTA 4RFRB 4LYRA 4RHV1 2L9LA 2D2HA 1XGDA 1YHTA 1UAIA 2VY0A 4FO9A 4HZ6A 4W7UA 1XDLA 4L9ZA 4ICCX 5I09A 1W8GA 1AUSL 2ATMA 5CFDC 2V5LA 2C16A 3WNKA 4F9DA 2R042 3OGJA 4XKMA 1A5LC 3JU9A 1NFGA 3VGDA 3WQGA 4XISA 5FAGA 4RHV3 3DI0A 3BODA 5FK8A 2G3IA 4S3BA 1UMYA 4O0QA 4LE4A 3FYPA 3GAKA 4PTVA 3RX2A 5F4WA 2VOMA 4BHPA 2ZTKA 1ICQA 5C9XA 3KRUA 3R2GA 3G6JB 2OX1A 1V6MA 1RUC3 1H6XA 1MS9A 1V6UA 1VMJA 2PHLA 5U7SA 3W27A 1KGWA 4PJYA 5A6BA 1W91A 5FREA 1R9YA 1TSIA 1XYCA 3WUFA 1J0IA 3IIPA 3GK0A 1LJ7A 1O7AA 1QK0A 1YADA 3QJAA 3AIQA 1UKGA 1V6LA 4JCLA 2YDEA 1EEPA 4L99A 3CYVA 3UYCA 5KSWA 2XQXA 3EXSA 3TTQA 2D24A 1V4YA 4IV3B 4LORA 1WX0A 4LBRA 3S7EA 1QNYA 1QJU3 2Q0AA 2XGBA 1JPDX 4JRLA 4A2RA 1RUSA 4MNKA 2OLAA 3DI1A 2AH2A 3EWZA 1YQ2A 4IIEA 3LM7A 3C3VA 3IJ9A 1KRBC 4EPDC 3UJOA 3J4UH 1R47A 4C6CA 4UTTC 1GVRA 2CWSA 2Q71A 4A3YA 1HO4A 2D6MA 4UTKA 4UBHA 3VFCA 4PGLA 2FHCA 4U10A 3PUSA 4YN5A 1S5WA 1IZCA 2ZJCA 1JCLA 3B9CA 3CUJA 4XJWA 5I8YA 3FBMA 3V0BA 1BXNA 4KRTA 3NZQA 4YLZA 4FNUA 1SSGA 2B81A 1A3KA 3S9ZA 4IJBA 1R1A3 3THDA 4G1NA 3TJLA 2IS7A 5F3IA 1FTXA 4Q0QA 3G77A 4YG3A 1S0IA 3WP3A 3M0HA 3MHUA 3I2HA 1V6XA 2RMU1 5FPVA 1JQVA 4NYUA 4FXGB 4XF0A 2HJPA 3SCPA 2R1PA 4EZHA 4LBUA 4W8AA 2DW6A 4AD3A 4PMZA 3PNAA 1IWBA 2A85A 4WVMB 3I4IA 1U1HA 3MP5A 2I9EA 5H9SA 4PMNA 3SC7X 3PUGA 2IUZA 3SB0A 2YDRA 2X53S 5BWAA 1SG3A 4HTYA 2BXZA 3O16A 2OYMA 1ICPA 3NRUA 2GQ9A 1H7WA 1DIWA 1UY2A 2OG9A 4XCAA 2YA1A 3CIWA 3QR0A 3TQPA 4BZ4A 3DKJA 3K8KA 5ERLA 3SXWA 3KUMA 4A8IA 1Z7S1 3GTNA 2W68A 1IIGA 4YG0A 1B57A 2QJIA 4CLMA 3SCFA 5AZ0A 4FPOB 1VQTA 3S5ZA 1PO13 3FK4A 4CCDA 1SHWB 2A3HA 1RMU2 4QHOA 3MZ2A 2B9VA 1ND2C 2B9UA 1BYHA 3N9KA 1JDEA 2VDGA 1VYRA 2P3ZA 2PP3A 1VMHA 4KWKA 4LBKA 2ATSA 1EA0A 3QH6A 4NVPA 1E6RA 3EZ4A 4GH3A 2QDRA 2CXEA 1WLCA 4IFKB 4UCGA 4IJCA 1D7KA 1PHMA 4YVWC 1YQCA 3LZZA 4NHXA 4DY3A 4RR3C 2V82A 4DBSA 1NXMA 3H2NA 2FDSA 3S6DA 2WKGA 3OZMA 3NJYA 2WCAA 2BNMA 3TJIA 3CIVA 3HN3A 4OFGA 1W3NA 1UWWA 4CVWA 3CL8A 5C5YA 1KC7A 4OZOA 1ME7A 4YNGA 5DDJ2 4AEFA 1FQ0A 3G8RA 3DC0A 1Y7VA 1W9PA 3IPVB 3AHYA 3SDOA 1QWKA 2NVAA 3RJYA 3P5BA 1W0PA 5EFDA 1DL3A 1GU3A 2FTWA 4AU0A 1VAKA 3W7DA 3VIKA 3MVTA 1HXS1 3CQOA 1JN2P 2YG0A 3L4VA 4RPPA 1O6IA 2V0TA 1P5BA 4JPGA 1PO23 2PTWA 4WY0A 3J8F3 5FPUA 1X6NA 5FUPA 2B39A 1PZ9A 1K42A 3M0KA 2D1ZA 5FZGA 1FMD1 2ZS6B 1V3LA 1KJRA 3QOPA 1W1ZA 4MJ2A 4A44A 1ITCA 2OO6A 1GQGA 4IDZA 3PVBB 3MIHA 1EPVA 5CADA 4NRSA 3TMLA 4D7YA 3MTWA 2A75A 1P0KA 3WLJA 2WSKA 4K1GA 3ITVA 2WWDA 1LRHA 4QDSA 1J58A 3LGDA 4K1ZA 3E2RA 3SW6A 1SU5A 2P3EA 1U5IA 3RWKX 1TX0A 2PQSA 3A47A 1M41A 4NOTA 1W6TA 4ZFMA 4JN7A 1W1YA 1BEV3 3W1RA 1R8LA 4HXCA 3TEZA 3NFUA 3W5NA 4EN7B 1KWKA 3ZFFC 1M65A 2D3SA 1JNDA 2JDHA 1FHDA 3NPUA 4FAHA 3ON7A 2BODX 2CIPA 1TVLA 4J3UA 2VZ3A 2ABBA 1RUI1 1Y9QA 1XR2A 3UWQA 2A7PA 5KC5A 3SIZA 1BCXA 3GAYA 3IIIA 3NPXA 2VMFA 3T30A 5TIMA 3IM0A 4MHUA 1Q7MA 1HJVA 2GGGA 5FSDC 1QDCA 1SLLA 1ZU8A 4Q4RA 1IEXA 4GZEA 5FYZA 1HVQA 2Y5JA 1TR9A 1P6CA 3BURA 4O7XA 1XRFA 2ES3A 2XJUA 3AKTA 3KB5A 2ZKLA 5DPNA 4YYCA 5BNNA 3KRZA 1EWEA 4GI4A 3PJXA 4IMCA 2WHKA 1GZTA 1XIEA 3EDJA 1L2UA 4WY0F 3NIYA 4NX0A 5C4WB 3KDNA 2DVAA 3AHZA 3OGGA 3FHAA 2FJKA 5EP9A 1UY3A 2E9MA 3SFKA 2G37A 2J6VA 3RZKA 3NQEA 3ZJ7A 2PDKA 1W8FA 4I02A 1IYXA 1XIGA 3M6YA 3B0PA 1H2MA 2ZABA 3VNZA 1JD9A 4FP2A 3HQRA 5J37A 3WH5A 1W1A1 2YPIA 1MQPA 8XIMA 1EGVA 3KSCA 3VIJA 1WLTA 4L0PA 4L6DA 3UVAA 2PP1A 1LRQA 4O54A 4GMP1 5KHJA 3DESA 2HK1A 1RUJ2 1KV8A 3V16A 3C52A 3PSVA 4C6MA 1GV9A 2C6SA 2VCMA 1ZPTA 1HKKA 2FZDA 3TXVA 3P3BA 4HU3A 3NJZA 1ICSA 5E89A 3VGFA 1KM2A 8XIAA 3U7BA 3POSA 4B3LA 1VJSA 2X8KA 4LVBA 5JXHA 4XG1A 3AXIA 1R083 5HBAA 2GK1A 2QJGA 3ZQ9A 2EVXA 5GJPA 2ALRA 1ZTVA 4HK8A 2EA7A 3RLUA 4TLFA 3WN6A 5TF0A 3MUCA 1JAKA 1H62A 1YMYA 3OCPA 5BWFA 4GI6A 5AFBA 3W1MA 2F61A 3KCCA 5FMDA 3K5XA 4A7KA 3V3WA 5AKQA 3LHWA 5HMFA 1AQFA 4H6KA 2MPFA 4L56A 4A45A 5C8CA 3VBUB 3PPCA 1AXYA 1CZTA 2W1QA 4D6RA 2O7SA 1TPH1 4ATWA 1XE0A 4BE3A 3G5EA 2NVCA 2XSAA 1JDAA 4MADA 3CEUA 1E57A 1NLQA 1CIWA 3I65A 3BG5A 3POEA 5F6LB 2W62A 2PLJA 3F2ZA 3MUAA 1XYAA 4IH3A 2KAUC 3RNSA 3DG3A 3C7FA 1XYMA 3WG6A 2WNQA 1PVC3 2A3BA 2Y4SA 3EDEA 1E4MM 2DBNA 1BBT3 1QNSA 3IDBB 2WMGA 4O8AA 1U2YA 4YWIA 2CZEA 2J1EA 1EDTA 2ZEWA 4DWSC 3RZJA 1JCNA 3KEHA 1HO1A 1L0PA 5DCEA 1S2VA 2ISWA 3GGLA 1DYPA 5HJLA 2PC4A 3W23A 1XBYA 3APGA 1XLEA 4IFKA 3LB9A 2XZ9A 2C26A 2R16A 1LOEA 1XKJA 3A64A 4PTMA 1DQ5A 5CBBA 1YIPA 2JIWA 3M0JA 4QPGA 1E9LA 4H1ZA 1K9TA 4C6IA 3WDYA 1VLNA 4AB4A 3VD9A 1XGEA 2VOVA 1CZVA 2JJ6A 3WDVA 2YC4A 4WIWA 4MB5A 2R8WA 3DOPA 3KCOA 3SRHA 2OPWA 2P53A 3WUEA 4PI2A 4PCNA 1ZRIA 4O0KA 5KETA 1KCLA 3P61A 2A4AA 5DT5A 3C0LA 2WAGA 7XIMA 1AJ0A 3AOFA 4JCMA 1L6FA 1UWQA 3SCVA 1QOQA 5H8MA 3UJEA 1QJX2 2HBUA 1ND3A 4QGMA 3ZJKA 4NAMA 3LSCA 4DZHA 1SW0A 3L5AA 5A3TA 2DUPA 1TJ2A 4DJED 1DBNA 3RRDA 1S0DA 2YW4A 2RHGA 3VKDA 1YNQA 1K5MC 4OVEA 4FTEA 4GKLA 4O61A 4Q0PA 4N6EA 4B5XA 2BY1A 3CTLA 3P7YA 3FYYA 2ETEA 2A3AA 1JGMA 2CAVA 1FVPA 1QJU2 4LKFA 1H7OA 1QR7A 3W7QA 5FP8A 4MJ4A 5C3SA 2FMOA 3WDPP 1VBC2 2AKMA 1KBIA 2YCJA 2C18A 1Q43A 5JI9A 1IWPA 5DN1A 4HJWA 2VZSA 1YWKA 3N35A 2JDZA 4K7VA 2YYUA 2EICA 2GPTA 2VGBA 3TQVA 4YMZA 2OLHA 4B4QA 4A35A 3VCCA 2NMOA 5G2WA 3M0LA 3VLBB 2V68A 2WWUA 3LRLA 3VKMA 3OW1A 2ZHMA 4YCPA 3W7GA 5F5CA 4XFFA 1KS4A 4AGRA 4E2VA 1AL21 5JU6A 3MVIA 1ZUAX 4N7UA 3AC0A 5BYNA 1FWTA 3E02A 1OGSA 1QPRA 1WLDA 1ZVFA 4XFIA 4NAEB 3QW4B 3VC6A 3SGUA 5APAA 1NCRA 1I0BA 2V6AA 5JBFA 1N82A 4H2CA 3CLWA 2R0FA 2W92A 1KTCA 3O0KA 2OZTA 5A6YA 3KF5A 1EJVC 4Q6JA 4HN0A 2PWUA 3GBFA 2RFGA 3DPRB 3G8EA 1W2NA 4QM8A 2NQ5A 1C93A 1TWSA 1H1IA 4EN8B 1GJWA 4N43A 5K7PA 5AC92 4UAPA 5JH1A 3CNAA 5F5IA 3FN9A 5H9RA 4PBOA 1HKWA 2LUWA 3P0WA 6TIMA 1KFEA 4JQ3A 1YX1A 3ITTA 2AEZA 4D7TA 4Q4V3 2A3WA 5DZFA 2BZNA 4RE2A 1W1VA 4FAGA 4DLFA 8CGTA 1NM9A 1FMD3 4MGSA 3VZJA 3SISA 2MEV2 3MA8A 2ORXA 3CZUA 3WDTA 4QCEA 4ACZA 1FX6A 2DPEA 2WPBA 3C2UA 1H7NA 3MCOA 5C0QA 2DSZA 3IARA 3WJZA 1E1EA 1FNZA 3MIBA 1XRTA 3A9IA 5HR6A 4N53A 3MSRA 1XQLA 4Y5Z0 4RGGA 5AVAA 2J7MA 4O0ZA 4U3AA 3SR7A 4FFGA 3VZXA 3K3OA 4LE3A 2CFFA 3A0KA 1RVF1 1GP5A 1UIKA 3ZPOA 3W6YA 1NX9A 1WKFA 4HZFA 1PIV2 5L9FA 1UKTA 4YRDA 3BSMA 1SFYA 2GSEA 3U2EA 1QWGA 1S55A 5K4ZA 6XIMA 3RLGA 2NN8A 2OSXA 1Q8OA 5D8ZA 5T5JA 3N13A 1VE0A 2HWB3 4IL2A 1YTKA 1DGWX 2NV2A 4DNYA 3DHDA 3KWVA 1B30A 2DSKA 2GSJA 2B8MA 3N2OA 4KU8A 4B1LA 2KA3A 4IEQA 4CP9A 1F9KA 1EDQA 2PMWB 5A6ZA 1IT0A 5D8AB 3PPGA 1QBAA 1MZHA 5H9PA 1EAH1 4W5UA 2PTMA 3CUZA 4ZOCA 5FKCA 2QCHA 5CGMA 4S1FA 1QOPA 3ZOIA 4YWAA 3EOLA 4X2RA 1VBA1 4LR4A 1R7AA 3ARXA 1SJDA 3U4AA 3MBDA 1XG4A 4QDMA 3TP4A 4HHHA 4P9WA 4K8HA 4F9JA 2YL8A 2OWCA 1YI7A 2A1XA 2PCQA 3HFYA 4KRUA 5LK7B 4BMEA 1CX1A 4UQDA 1VEPA 2CGNA 2NPIA 3LTSA 5FJIA 1UOKA 5K7JA 1UKQA 4AIBA 3W74A 1OXCA 4Q8LA 3WLQA 4B9YA 4QJ5B 1SO6A 2HQAA 3GBDA 2A7AA 1KGXA 3QEZA 3EPOA 5KHIA 4V27A 2BHYA 2YSWA 3ICJA 4QNEA 1TWDA 4CP2A 5J09A 3GFZA 4XYXA 1UD2A 5FKBA 4WBBA 5DZGA 2G4FA 1QDSA 5LHEA 5C3QA 3M41A 4U2YA 1P0EA 1KRCC 3KTSA 2ACQA 2Q5TA 4IX0A 4GKTA 3M44A 2CKSA 4NIAA 3R43A 3DFQA 1Z48A 5JZGC 3MDWA 1G9BA 4AEKA 4D7SA 4D8AA 4OQVA 5ECUA 2QLYA 3F5JA 1G8WA 1A5OC 2E4TA 5EL1A 3BMWA 3EMRA 1ULEA 4YYFA 1PGW2 1YI9A 3I2JA 3BLLA 3PTDA 3WO8A 4RE4A 3KZ4C 1MS0A 3HPZA 3LS9A 5E16A 2FLIA 4QQHA 1U5YA 2GGJA 3U7VA 2XVLA 5E5CA 1PMHX 3LCWA 2XFFA 4IG2A 2BNNA 3QMTA 1ZRDA 4Q33A 3T4WA 3I3BA 2H6CA 5CKSA 2XH7A 1CPMA 1E9YB 2XJQA 4OU1A 3GIQA 3WDUA 5A7OA 1GKRA 4Y5TA 1O59A 2ZA1A 4ZONA 1B3OA 3RO8A 3KVAA 4E3TA 2G50A 4Z1BA 1W6OB 1OGBA 3TE9A 1UIJA 3F7JA 3UWZA 3BALA 5EFFA 2J22A 3KCJA 1VRBA 4MY9A 1P4CA 2BOFX 4Z92B 3ZVXA 5I3KA 4GNKB 1SLCA 1Q63A 2XYLA 1Z0HA 1VBA3 1G69A 1O68A 4JDMA 1EF3A 2GNDA 5LNWA 5CBJA 1LTEA 4EWJA 1WCUA 2GP3A 1Y0EA 1J8VA 4M00A 4S3CA 3ILFA 1NCQA 5CFCA 3H23A 4JTQA 4HKPA 2GMPA 2UWAA 5D03A 2WO1A 4M3CF 3S3GA 5GNXA 4LBQB 3PSWA 3KHBA 1QQP3 2JDYA 4ZA0A 4WD0A 3ARTA 4PZVA 6ENLA 1BK0A 3J7HA 1SO5A 4O1EA 1YPIA 4WZHA 1X39A 4GGHA 4GQ7A 2J42A 1H1YA 1OHLA 2H3BA 2WQ8A 4OI2A 4NJJA 1VRH2 5BOEA 4LXLA 3ZXEA 2QCSB 4M0HA 3PN8A 4BJ0A 5FZBA 4RSUA 2EPMX 4UW4A 1UUMA 4LYQA 3KCLA 4FPSA 2EPKX 3H70A 2CNCA 1SLAA 4RS5C 4HA1A 1V3JA 3WBXA 1XS2A 2R14A 2WHLA 3J9SA 2OQLA 3NO3A 3FEMA 4YFWA 3L4YA 2ZXQA 3FAXA 3GLCA 4IL0A 4C5YA 3B94A 1ZAIA 1O8PA 3WD2A 1Q13A 2QCLA 3Q8AA 4LAMA 2UY4A 5M5DA 3C2OA 4GWJA 4E2OA 3LFMA 4XQ6A 1SFJA 1GNYA 3GIPA 4S3KA 4H4IA 1TX2A 4GX8A 4DX3A 4EVZA 1FX5A 3WEZA 2QQJA 3DECA 2VX7A 2W3JA 3XISA 1WUFA 1S39A 4F0HA 2VENA 2VRJA 1O3SA 3WW3A 2KD7A 1KFLA 2Y5SA 4QQ3A 4UB9A 2FDGA 3GHRA 5MF5A 1BKHA 3J7NA 3RRAA 3ZYHA 1QNVA 2GNTA 5D09A 1ND2A 4HNUA 2VFDA 1GPFA 3AYVA 4JTDA 3M9YA 2A5HA 1C28A 3ZFEA 3DG7A 1GONA 3N1AA 3DDMA 3GXFA 3D6EA 4I6VA 2WLPA 3OVPA 1ZNNA 4QQOA 3PZOA 5FF2A 5K9DA 2DZUA 2VXJA 4DPPA 5LHFA 4PF5A 4I8DA 3LEPA 4JTLA 1EV12 4Q4MA 3PK7A 4A8RA 3ZXDA 1VFTA 4FOWA 4KETA 1TVGA 3WXPA 5LWBA 4P8UA 1IPKA 2J88A 2D97A 5D33A 1JZ4A 1K77A 4OKDA 4M4PA 4P5YA 5HPCA 3URBA 2BTVC 3SFWA 1PNGA 2G0WA 1AR83 5DAVA 1BZWA 3USSA 1NYWA 3T05A 4H3DA 4C1LA 1S38A 1D4M2 3KX6A 1I3HA 4ZPIA 1XH2A 3I2KA 2PWDA 5FEPA 4GVGA 3BJFA 1BKZA 2Z1BA 3ZR4A 4PMXA 2BVYA 4IGNA 4GWMA 3T8LA 3RU8X 3U1XA 4DO6A 5CQ1A 4RW3A 5ABJB 3EYPA 1BXHA 5I06A 4ASLA 1S2KA 1W3VA 1G9HA 5HWMA 4NYYA 5CFDB 3M07A 3CAQA 3B8WA 4O16A 4FPFA 4AD5A 3OODA 3SUUA 2WS91 3FOKA 3N2CA 4UWMA 1P8JA 1FDZA 3TSBA 4PLOA 3IANA 2QQKA 3UGFA 3H2CA 4EQVA 1GP4A 2WA4A 3NAPA 1VBE2 1W6MB 3I54A 1B09A 1Q6EA 2DJXA 3VZYA 1FOD1 1O6UA 3M1HA 4PC8A 2WQ4A 1BWLA 4HLTA 4LBLA 4YNIA 3GF6A 3K4DA 1RD6A 2WC7A 2ZMNA 3G18A 2OYZA 4Q4OA 4DXZA 1UU5A 3D5OA 2QULA 1TPDA 4LEQA 2HWGA 2ZZ2A 1W0MA 1WW5A 5AC5A 1S0EA 2RDTA 4AZHA 1VLWA 4JIQA 2DCYA 2J1UA 1LOQA 4IPNB 5HNTA 3TOPA 4HNCA 1V79A 5CB7A 4HHLA 3AZZA 3PDQA 4GJIA 1WZLA 2ODOA 3QLDA 4M3PA 1UPIA 4Q8VA 2CPUA 3HB9A 2PRLA 1C8M1 3QGKC 3BU0A 4O57A 2HE8A 3FJNA 3VD3A 5ECVA 4MGZE 1VBD3 2YB7A 4O8RA 1TPVA 3EKLA 2PGFA 2EQDA 3IUIA 2FH8A 4QX3A 3RUBL 1V93A 1KM4A 1F3WA 4E27A 4A42A 1RP9A 1H9PA 1UWUA 2VMIA 2A6NA 2SLIA 4HOWA 3SADA 5K9XA 4GHRA 3SN1A 3AYCA 3LLXA 4NIHA 2CV6A 4L9BA 4SBVA 3KD4A 1K8XA 4UBPC 4CN4A 3VKJA 5FZIA 3CS2A 1PVC1 4NHMA 2GMMA 5HBFA 1YQ6A 3Q67A 2BBAA 3LDVA 4FNRA 3TB0A 1QJFA 1BF2A 5IHRA 4K3ZA 3P5YA 4GJJA 1NWUA 1RUI2 2J1SA 5I78A 1SFNA 2YU2A 3MW4A 1DWHM 1O5QA 4AVTA 3NXLA 1ZBE1 8A3HA 3R8GA 3UNDA 1LLZA 5JQ9A 4I30A 4JKKA 3ACFA 3N4MA 4Q8NA 3KWSA 5M3WA 2FGLA 3MICA 2VAUA 3GFYA 3W1QA 2NX1A 4HFSA 3LXAA 4ZSTA 1XSJA 3PP7A 3ZFGC 2O9PA 2BY2A 3R5EA 3LFIA 3B9NA 5T8GA 4WVMA 2EXJA 3OYWB 3BOWA 2C7FA 3WUBA 1JXJA 5FA5A 2YFNA 1PPIA 1QI3A 1ZZ9A 4AY7A 4AI3A 3THUA 2NT1A 3JZUA 1QW7A 1HB1A 3M7SA 1QW9A 4JTRA 4HBKA 2LROA 4MGGA 1UP0A 5AHFA 3T6CA 3S83A 3ZN4A 1EB3A 2OCZA 1CXHA 3ZO9A 5HCAA 4E8GA 4B90A 4R27A 1QO2A 4NHVA 3BDKA 3BARA 3JU2A 3RMXA 1RUE2 2VMEA 1W3TA 4D6EA 3SI9A 5GLTA 1Q6CA 3PTQA 2JIEA 4PMYA 2QAPA 4H55A 2PDJA 5FL0A 1JPKA 4CXXA 4UQCA 1YDVA 4A05A 2RS53 4H9XA 3OBKA 1B2YA 4BWLA 1PZ2A 3TYBA 4GKYA 1OBNA 2CCRA 2J25A 2QPUA 3LG3A 3OTRA 3W20A 3KL3A 5HI0A 1WCGA 2W95A 2OO0A 3BCDA 4U4MA 2Q3RA 2XH0A 3OVRA 2ARAA 3ZFEB 2RDXA 4CYDA 2OKXA 1QJU1 2A6YA 4HZ8A 3U9IA 4FVVA 2WNVB 3GBEA 4R9AA 4LAZA 3WEMA 4QD2A 2I57A 3FA3A 1EBHA 2XHKA 2RM22 3ZWSA 1Q6RA 1MEWA 2FBEA 4XUPA 4YTSA 4QU2A 1EJ7L 4NAFA 1N3QA 4R4XA 3D4KA 1QJY3 3FUQA 2AL2A 2HS6A 2ZGRA 1FDYA 4E3VA 2P1FA 2NWSA 2A6WA 3LA2A 4BIOA 3ZSSA 4IFOA 4H7MA 4JTJA 2XZ7A 1R3QA 3FLRA 1OCBA 4KFPA 2GH8A 4W85A 2ID4A 4F4RA 2OW4A 4OHWA 1C7TA 1J0HA 4H41A 5FPAA 3TX9A 1ZJIA 5F1RA 1MACA 4LKSA 3OVGA 3VBHB 1X98A 2HS8A 1DJNA 2JB8A 1ZCCA 3KXQA 1W8SA 3VDBA 1TG7A 1H4PA 5FLIA 3ES8A 4L97A 4UOZA 1Q5OA 3OPTA 2W79A 1JUHA 3TQ0A 5BPXA 4XVEA 5DLCA 3GZTB 4IE0A 3AKPA 3B02A 3L2MA 4OV4A 3KV4A 1GQKA 1MWOA 3QZEA 2QMKA 3NQGA 3IGSA 3H4GA 3ACGA 3NQCA 4U3CA 2R0HA 2Y70A 4DXVA 2XUCA 4OCTA 5L9RA 4FOQA 5KBFA 1ZM1A 2ARCA 3M7AA 1DDLA 4LT5A 3EDFA 2VH9A 4GWNA 3I3MA 3Q8FA 4HD5A 3WDHA 4COVA 3VN4A 3NEHA 3PNUA 5EB8A 4AZ7A 2BV9A 5IK8A 2Z1VA 4WM8A 4J4KA 3PLQA 4B5SA 2ZUMA 4MLJA 4OOZA 4GXMA 2HBTA 5IWFA 4MVTA 1ITQA 1E43A 3I4EA 4V28A 3N14A 2FHRA 1N8FA 4GPNA 4H8HA 2QYGA 3TN92 4LB4A 3KBSA 1XSQA 4D0QA 4OHQA 1OT1A 2GGHA 5AVNA 2DVBA 1SO4A 5BRPA 2VNVA 1LLWA 4GYJA 4ZXLA 1ZALA 1AJOA 3S5SA 5A2CA 5B7ZA 2P34A 3ZLIA 3QC3A 3U6WA 1CQ9A 2I17A 4V33A 4FXSA 3OHIA 4U5KA 2LS6A 3BTAA 2WBGA 3C2VA 1DGWA 5FAXA 3VC5A 5PTDA 5EZWA 1VBC1 3S2JA 1MRAA 4ZFCA 1G7YA 4DRVA 4G3YC 3VBFC 4UTHA 3OHMB 2VC5A 1CTNA 3MUIA 1OLQA 2PFWA 4WRHA 4FOKA 2VVEA 1TJRA 4R7WA 1KGUA 3FV9A 2QJJA 3VE7A 2NQZA 4UTJA 1ENQA 1KXGA 1X50A 4A4AA 2XN2A 5LGZA 2BWCA 1E1CA 2E6DA 2ZX2A 1XV8A 2H9AB 3L23A 2J62A 1PKNA 5E6YA 1NF0A 1W17A 4ZB2A 3O12A 3SECA 4B2DD 2HEWF 4A41A 2FPTA 5FOBB 2D2JA 2GQ3A 4PYSA 4HK5A 4ZEPA 1MMFA 1CGUA 5L7OB 1RUG1 3OG2A 1RR2A 4KT2A 3VCRA 4XZPA 4XWUA 3GZ3A 2Z27A 3ZM8A 2BHUA 3LERA 3W6MA 2JX9A 2RJHA 3H54A 3C5QA 4NILA 4IPJA 4GCXA 4Q4QA 3H8AA 3MUXA 5C8CB 1B3XA 2QHAA 2BGQA 4O1AA 1XLLA 3AHTA 2OJPA 2OGYA 1RCXB 4ACYA 5IBXC 1SBEA 3HT1A 1LOSA 1UOZA 4DVOA 1Z7S3 2RS33 4Q4X1 3S8HA 4ECLA 4ISQA 1JI2A 3QD6A 1W8NA 1F6KA 3MIDA 1I1EA 3ZYBA 3C8XA 1KDKA 1AZDA 1OH4A 3R6SA 2GLKA 3BGJA 1QCWA 3HGSA 1WGPA 4TWTA 2EXOA 4Z1YA 3NTYA 4MOAA 1IEIA 4TTGA 2EEXA 3VBRB 4IOTA 3P6BA 4Q0VA 1OFAA 4GFIA 5AZ1A 3VIOA 3AZXA 4B3NA 1YPFA 5DF0A 1F35A 1RSCA 4PUEA 1DZRA 2E0PA 3UPWA 1A6CA 4K36A 3KGLA 4AOCA 2K9ZA 1DTNA 1D2QA 4EPBC 3M43A 1CJDA 3BJSA 4ZZ8A 3QPYA 4KEZA 3ALGA 4OMDA 2Q8OA 3TTSA 3R4IA 5D30A 4Y1YA 1BTCA 2YX0A 5H2ZA 2ZZJA 5J04A 3GO2A 1RUF3 2XVGA 2PQQA 2PTYA 3UQNA 5CLTA 5A3NA 1SJAA 1PM7A 4HMZA 1G4TA 1CWPA 3REQA 2J1AA 3HN1A 2QDHA 3AMPA 5FL1A 3WF0A 3ZMOA 1OKOA 1HQTA 1XLJA 1I5PA 1LR5A 1JRBA 1S3HA 2P5BA 1YW1A 1JYCA 2E31A 3PC0A 2YC2A 1JJKA 1JNEA 4F79A 2D3RA 2CLIA 2DH3A 3Q8EA 4AMCA 5J5RA 3L68A 1H1ZA 2POZA 5EYXA 1G7UA 4LHNA 3ABOA 5FCCA 1ISYA 4AFDA 5HCBA 3HBKA 4QQ2A 1TIMA 2Y88A 5F6KA 1W5MA 4ZL1A 2XWEA 2YDQA 2VQUA 3HQ1A 3WHTA 1XC6A 2HZGA 3LTYA 4LYPA 3V0TA 4NO4A 3BOFA 2VEIA 1REEA 3GWQA 1QU0A 5F3CA 1AYN1 4QMAA 2EIBA 1V6WA 1F76A 1PDYA 4NZJA 4P8VA 3SUVA 2RKXA 4XURA 1ODZA 1J6PA 1D0GA 1TKKA 2OXNA 3UGVA 1XDMA 2HWD3 2JWPA 3DHUA 4Q4X2 3TH6A 2Y6GA 3CJPA 5FJHA 5GZCA 1SZFA 4JGYC 3TA9A 3CJIB 5ENLA 1H8TA 1Q4WA 1AQ0A 1RVGA 1RPXA 1UH4A 2NUWA 1UN1A 4XD6A 1W9VA 1A5SA 2F2HA 3R4SA 2W9MA 1IEWA 3VOFA 4XTMA 4IEYA 1W1PA 3ZXAC 4LH8A 4D72A 5LATA 4K39A 1VB2A 2JG9A 2YU1A 3OZYA 4MH0E 1LT8A 1PVC2 3W58A 4BR1A 2IXLA 4E2GA 3G0XA 3CV2A 1TME1 3JD73 4GX9A 1LENA 4GBDA 5G4HC 4F48A 2FZ8A 4P7OA 4RNIA 1V0MA 3HOBA 5K0UA 1Y5VA 2OELA 2G96A 4XDPA 1XUUA 4OJYA 3SCSA 3N04A 3CO8A 5LB6A 1GUIA 9RUBA 2ISSA 2QJVA 2ERFA 1DEDA 1BVP1 1Y5XA 2QE3A 2BB0A 3MSGA 3WMSA 1S46A 2XPJA 4KI5M 3GSMA 3NOYA 4KH2A 3CZJA 4YL2A 3S4TA 5EMUA 1XLAA 1NQDA 5LK5A 4PUMA 3N7MA 4LUTB 3VBOA 2OSWA 1V51A 4UNLA 1EY2A 1OH3A 1F2JA 2ZDSA 5KXEA 4CTEA 2XLGA 3NNMA 4XUTA 2J7DA 2XJVA 1XFBA 2E09A 3N11A 4JTCA 3NV3A 1SCRA 2GSYA 3K8LA 3O6AA 3UL2A 4FLSA 4HHPA 2XM2A 4C6EA 3S5AA 3TXZA 1UA3A 3SKVA 3V75A 4N53B 2CHOA 7REQB 4UFHA 4RL3A 1EUTA 2VNGA 1W3LA 3H3LA 1ZZBA 1DJIA 1R6WA 3MBWA 3KL0A 2PLV2 2B7QA 5BNNC 3E0WA 2QIIA 1PGL2 1YE6A 4JS3A 4AQTA 3MB9A 3O63A 3KS5A 2DT3A 5CVRA 1BAGA 5C54A 2DP3A 5FO8B 1LHVA 2VVNA 1UBPC 4G7EB 4XV0A 3M46A 4Q22A 3LEGA 3VKKA 1PX3A 4Q8TA 3B8UA 1NU5A 3C0QA 4DY1A 2WHMA 4PCRA 2XIOA 3GH4A 1VB4A 5CPOA 1NY71 4DI8A 2H90A 3FUOA 1POQA 3E0IA 5I3HA 1WE5A 4IEXA 4DBDA 1E5IA 4KWOA 4NHLA 2QFEA 2BGSA 2AREA 5FFOC 4YFZA 3GFXA 3BTNA 4BIFA 2JD4A 1X8MA 4H6QA 1JODA 5D32A 4O1CA 5FYBA 2FCVA 7CGTA 1ITUA 3L0NA 4ZO6A 3KGZA 4YZ2A 2ICSA 3CL6A 1VPYA 5CC7A 4S38A 1UQYA 5FZOB 2V5YA 4QDRA 3K13A 1W9UA 1XU2A 3M70A 1AXKA 2VUCA 1JDDA 1JI6A 4N9BA 2EXHA 1R1A2 2I07B 2YKKA 3KVMA 4HNTA 1RUJ1 5ABFA 5KTLA 3AYAA 1UH2A 3AXDA 2DZXA 1I2PA 2KZHA 4Y1ZA 3UK9A 5HV4A 5JIAA 3AJZA 2OEJA 2ZCGA 4PR4A 1WZAA 1RA5A 1VBB3 2ZZ4A 5CSSA 2ZXDA 5E0CA 1D3CA 4DZGA 1JZ6A 3NXFA 2VOWA 2REQB 5D04C 1TEIA 3ITXA 3RITA 1A3XA 1V8EA 3CV1A 3M1ZA 1O3RA 1K3UA 3L4TA 1OIMA 2C14A 3RMYA 3EDDA 2RR13 3SHRA 3BKZA 1BMV1 4LNCA 4Z2HA 1I4NA 1LOGA 1ZBA3 1C8M3 2SFPA 4O17A 2WO7A 3KP0A 1J5SA 3T4CA 1ADOA 2QCDA 4LVDA 5I5RA 3B01A 1BXBA 2CW6A 3W38A 4JTSA 4NX5A 2VFHA 1OT5A 1GG1A 3I6RA 3K30A 2IKHA 2ZMLA 3BICA 4ZQPA 3BTZA 5DDJ3 2VFEA 2G3FA 3QV8A 3UYIA 2C9AA 1VP5A 2OPKA 1ZZ7A 3O2LA 2RJ2A 1PTGA 1MRQA 4Q4Y1 5F5QA 2BHZA 1XBFA 3VMNA 1NELA 2IXIA 4ZKTB 2BDQA 3H4WA 4CDXB 4QJ4B 4CCNA 3V0BB 1NDWA 1TV8A 1OD3A 2J66A 2EIDA 5KINA 1LDCA 3BSGA 1XLKA 3M3EA 1POJA 4W93A 3M6DA 2D7FA 3VHPA 1OABA 3POHA 5CC5A 1TZ7A 4IPPA 2E7TA 2V3DA 2BP1A 4DO4A 3E74A 2DUXA 1RBLA 5G4EA 1SEFA 1V7YA 2I5GA 2DBIA 2RH9A 2C19A 3OOQA 4KIRA 1VENA 4NJGA 4EJRA 1KQYA 4GXLA 4JYFA 5FOJB 2Y2WA 4ITCA 3H7RA 4AQSA 4PCFA 1SJCA 1O1HA 1O7FA 3AMQA 4BU2A 1ENRA 2D93A 4LO5B 1KBLA 3BYWA 4DYKA 5F2SA 2WVSA 1Q6DA 4YW5A 3LQLA 1OFSA 3H1YA 4BHYA 2DFCA 3GC2A 3ZYJB 2DDUA 4AZCA 2YBSA 3BB6A 4DXKA 3RR1A 1D2SA 5A8QA 1UZ1A 5M17A 3X29B 4HCHA 3V5OA 2IKIA 3S46A 5BOFA 4EOUA 3N7KA 5T5PA 4GMP0 4Y9NA 2QS8A 5JZGA 4M80A 5LRSA 1NA1C 2DIEA 1XCFA 2XJPA 3POCA 1C8YA 3H42B 3UXKA 3HO8A 1IT7A 5D8AC 2H3DA 2X0HA 4R7OA 2J74A 4F2UA 5H1WA 3N25A 4CEYA 4ILSA 1AL7A 1LTDA 4O50A 1P1MA 2YFUA 1Q6GA 1NT0A 2QV5A 3B97A 3QYQA 1XE8A 4R5EA 1G6NA 3THTA 1AYN3 5HNUA 2YUEA 1F15A 2HWE2 4IP4A 4WDWA 2PP0A 3D6NA 3NL6A 1PZ0A 4O10A 1A0EA 3WHUA 1O8SA 3HJRA 1S2EA 4B8EA 1ZBVA 5C8CC 4P00B 1NIUA 3PANA 3B3QE 2WMHA 1OSGA 4ARXA 1NTHA 4X9YA 1TVPA 3PUQA 4S2FA 3UNPA 3KBJA 1M7PA 3N9PA 2FPVA 3WX5A 4C1NB 1PIGA 4JHTA 3WDWA 4LO8A 4CVUA 4XZ9A 4XBLA 4HSOA 4E8DA 3WQBA 3V0UA 3A3WA 1F3TA 1R082 2X1UA 4JFSA 2XH6A 3J7MA 4QROA 2W1WA 4ZXKA 2VX4A 1OUXA 4NWWA 5C7VA 3O0VA 4PUWA 3RX4A 5FPLA 2WNOA 2VP8A 1HDKA 2PYTA 4I0BA 4S2DA 3E96A 3T1MA 3MDPA 7A3HA 3HGOA 3TVAA 4M1BA 4N53C 5IBXA 1UD8A 4RK8A 1NOUA 4GQRA 4FPYA 1SGJA 3JUGA 4HPXA 1AVBA 3LA3A 5DG2A 1GOWA 4W8BA 1H50A 3K4AA 3N3HA 3CBWA 3C8NA 2VGIA 3PU3A 3BUCA 1MQTA 1NEYA 5KZEA 2XGXA 3G1FA 2X42A 2V5CA 3BMVA 1RUG3 1LT7A 5LSMA 1TV7A 2VD7A 5FAJA 1XYZA 4HONA 4LVFA 1OQFA 4PN2A 2IXHA 2EXKA 5A6BD 3VILA 1NG0A 2PN5A 3T09A 3MPGA 4UC5A 2YA0A 4AEJA 3ORJA 3RPQA 5BNNB 1WBLA 5FO9B 3KOWA 3QYSA 2ZVRA 4Z2KA 1Y8BA 4AVVA 2PLMA 3ZXKA 4BQ5A 1XKYA 3WLKX 4A2UA 1VEMA 4M4RA 4MOZA 4N6FA 2K46A 2W1SA 4P9JA 3WY6A 3DKLA 3MV11 4F40A 5BOOA 5FF0A 3LENA 1D3GA 4DF2A 2CYGA 5GJMA 3ZO0B 1RUF1 3H22A 3TC3A 3APBA 1S0CA 5FZKA 2ZBTA 1OSEA 3BCFA 5FEWA 1VRDA 4BCUA 3GG1A 3CQJA 5HR7A 1RPKA 3V0SA 3PBWA 3S42A 4OHYA 2X8RA 2FVMA 3LCFA 2QQWA 3WLLA 2DVFA 1MS4A 1VJ2A 4JFVA 3L4XA 1MEC1 4A7YA 1HKJA 1L7LA 2R94A 4D8LA 2PLV3 2WSUA 3BVCA 1C57A 4XW3A 1R093 1PO11 1TQXA 1JVNA 5A3LA 3I2FA 3ZR5A 4AI8A 1CT5A 3RILA 3B0XA 4YGDA 2VZTA 1I0DA 2V30A 2WNNA 3W07A 1RINA 1E40A 4Q7NA 3TRSB 1ODNA 2CZ5A 4PB4A 3IV3A 3OQ8A 4UTMA 2INEA 5FZ7A 5JSRA 3M3OA 4XK2A 3GVRA 1GWJA 4P08A 1EC8A 3B3DA 3CMJA 1IS4A 4CDQC 3MJMA 2FGZA 3F03K 3AISA 1N1VA 3QCWA 1UO9A 1IXOA 2C0ZA 3AYTA 3UJFA 2BFUL 3GTHA 5LXEA 3T0DA 2X1IA 4TLGA 3CHEA 1KFCA 3S5OA 1E71M 4LXFA 3WD5A 2VL4A 3QFWA 2PZNA 4CGTA 5IVYA 1WZKA 1IE7C 3CC1A 2BDRA 4AEEA 1UZWA 4IGQA 4YVSC 2C1GA 1TUFA 2DZBA 1PCKA 3UG3A 3OB8A 2UY8A 1DQUA 3C2YA 3N4EA 4YZ4A 2WT0A 3USUB 1AD4A 2XIIA 1ALDA 3ZKYA 4UWDA 1WO2A 2DVGA 1VYPX 3BGGA 3ZYRA 4FMVA 4H6EA 1W31A 3G2GA 1JFXA 4Z1AA 1XXXA 2QCGA 1DTUA 4UUIA 3UKVA 3PWAA 4NT0A 5BNQA 3BOPA 3DFYA 3C2EA 3ELNA 3TEYA 1W8HA 2J75A 4FQZA 3LEIA 1XPGA 4AZCB 4A22A 1YKWA 4GB31 4B3ZA 3PTRB 4PBPA 3PFMA 4IWWA 1VBE1 2I1OA 2RS32 3DG6A 4IG2B 1V3HA 2CL2A 5E88A 4GZIA 3N2MA 4Y4YA 5LYRA 1VALA 2BUKA 4W87A 4QPGC 3NV1A 5GJ6A 4KCUA 2W3ZA 3UJ2A 3CK5A 3CMGA 1DGRA 3PPFA 3L7RA 1VBB2 1TV3A 3HG5A 4AHOA 5ACA3 1OFEA 1GVYA 3FLPA 1AA1B 4JNZA 3JBG1 5C3OA 1W1B1 3WUGA 5A6AA 3WLTA 3EB7A 3WMBA 1RMU3 4R9BA 3VB9A 2Y0FA 1RJQA 1B5TA 1YUDA 4Z0JA 5C2CA 3W59A 2W9XA 5IDZA 2E9QA 2OWXA 1TPWA 3DEQA 1XIMA 3Q94A 2X0YA 1XLFA 5T55A 4Z0SA 3GHTA 2XXZA 4COZA 1WXJA 4NZ5A 4OE7A 1AVAA 4KCTA 3E5XA 3PTYA 3H3ZA 3IIOA 4ZBCA 4JX4A 2YFZA 2QUOA 5C6CA 1WDRA 2QDEA 1H63A 4NAFB 5CBLA 1N1YA 5HWJA 3PS7A 1EJSC 1Z3NA 5CSYA 2ZVIA 4DNMA 2JKEA 4IERA 3L9CA 3VHOA 1UWSA 3ANYA 3GYEA 3NV4A 2DIKA 2HPIA 3EOEA 2Z24A 1WMFA 4GUJA 3FHQA 1D2KA 2ZCWA 3AKSA 4DUVA 1HP5A 1EOKA 1HL8A 3HPNA 1GKPA 1AYM2 1PSCA 1BK1A 3T2PA 4F8AA 2WL1A 3CQ0A 4Q4W3 5A7QA 4Y96A 4MUZA 4DJDD 1XNDA 4QPIA 3LOIA 1YLVA 3W88A 1VBD2 1NFBA 2OKTA 1UY1A 5IT6A 3SY8A 2P8BA 5KWRA 5HUPA 4D8ZA 1GWMA 2JENA 5I7GA 1JEZA 3PZUA 2QPXA 1VJZA 1YXWA 2TODA 2O4QA 5CU1A 3VBFB 4BZYA 4D94A 1OFOA 3FFQA 5C5TA 2NZLA 1UL9A 3MO4A 2KX9A 1TE1B 3U4XA 1UQZA 3R1ZA 3RJXA 1NA1A 3UCDA 2VQ0A 4ERIA 3ITQA 3RLHA 1HKVA 4JTUA 1PXGA 2D98A 3OEXA 3LGRA 4M3CE 4S2BA 1D3HA 2BFGA 4CD5A 3TOJA 1Q8JA 1M3UA 3A12A 1TREA 4H01A 3IPWA 1KD7A 4RR3A 2J8TA 3EOUA 2BGNE 4M7TA 4F2TA 4QAIA 1RITA 1UD1A 1UMIA 2QQIA 2XKOA 2HDJA 3UWEA 3DPRA 3AHVA 2PGRA 3PUIA 4LB3A 1DCSA 2OTDA 3Q9OA 3EX6A 4FX6M 3OTFA 1QMJA 1X36A 4AF9A 3SNMA 1XBXA 4AVFA 1AMYA 1HW5A 1KM1A 3RAOA 3R79A 1UCWA 3RFAA 1GHSA 2PMQA 5C9AB 1D8CA 4LALA 3LSBA 4NHKA 2BPA2 3G1VA 3B4YA 3Q8CA 3LAGA 4R53A 1GSLA 2WT2A 3UXAA