4BQ4A

Structural analysis of an exo-beta-agarase
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
750
structure length
750
Chain Sequence
GSHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLEVPDSGDVNDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNQKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERLGSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords B-AGARASE
publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
total genus 255
structure length 750
sequence length 750
chains with identical sequence B
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq4A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq4A02
2NT0A 1G9HA 4U2ZA 2D2OA 4AMCA 3GXDA 1Y7VA 1H1NA 4PTMA 1B3VA 5DT5A 4W8AA 2YA1A 1IT0A 1KFWA 4LK6A 2VT0A 3U5YA 3QR3A 3EDEA 1UD5A 4KWUA 1ODZA 3MMUA 4PEEA 2VVNA 3EMQA 5A6LA 4FLRA 1H5VA 3WSUA 2LROA 3BGAA 4EANA 2J7CA 5CGMA 4JAWA 3BMVA 3PTQA 5ABFA 5IHRA 4CPBA 3SCPA 1QHZA 1H0GA 4LYRA 3L2LA 4UQ9A 2UY5A 2OWXA 3ZM8A 2WKLA 2DSZA 4C7FA 4YW7A 1EHAA 4MNKA 3CZJA 1DHKA 1OIFA 1NM9A 2DIJA 1V3MA 2VX5A 3WD0A 1JZ5A 2XIBA 2QLYA 1PEZA 3RDKA 5AY7A 1ZJBA 3BMWA 4B15A 5GNZA 2CERA 3OB8A 2XPKA 3CHEA 2WANA 1QI0A 4UQDA 1BFNA 4NRSA 4XUYA 1L7LA 1WB0A 1WAWA 4W5UA 1XSJA 3VNYA 5CXPA 2DH2A 2G4FA 3VMNA 2W62A 3RMEA 2WMFA 1B3WA 3BSHA 2EO7A 2XTKA 2WK2A 4HTYA 2BHYA 1B9ZA 3BSGA 4MB3A 2J7HA 1X6NA 1H49A 3PZNA 2WWCA 4LQ1A 3AZTA 1XV8A 2DT2A 4PMDA 2WVTA 3CZLA 2GUYA 4TTUA 2CEQA 3WNNA 2Z1KA 1J0ZA 2YL9A 1BHGA 3CPUA 3CBWA 2D0GA 1GQJA 3ARRA 1L0PA 1PPIA 1HKIA 4J7RA 3GH4A 5CG0A 1GJUA 1KXVA 3WF3A 2G3JA 1UHVA 1JAKA 1GJWA 1W9UA 1UR0A 1WZKA 2WYFA 4WIWA 2ZXBA 2EQDA 3I3DA 1CXHA 4LJHA 3VO0A 4AEFA 2BVYA 3PZTA 3SEPA 2D3LA 4WSJA 2WLYA 3WIJA 2PB1A 4MDOA 3VIKA 1C90A 4HZ7A 1LWHA 1BG9A 4LGXA 1V03A 3TTSA 1A3HA 1DWJM 2ZUSA 2J8FA 1R7AA 4PMNA 3TONA 1F4HA 4F9JA 1U33A 1XD1A 4GPNA 2DSUA 1JI1A 3VIMA 4D6JA 3WDQA 3WBAA 4PBGA 3WBEA 3MU7A 2AMGA 1FH7A 1DWFM 2X1IA 1B0IA 1GNXA 2E40A 3M07A 3L4TA 3G6MA 3IJ8A 3T0BA 2X0YA 2J4GA 1CZ1A 1GONA 3W82A 1VF8A 1Q4NX 3UG3A 2DSVA 4CN4A 1V0NA 2Y5EA 2VCAA 2W92A 2WZIA 2ZXAA 3VIIA 1NARA 4TTGA 3T08A 1AMYA 3QOMA 2Y8VA 3OGRA 3B9EA 2WVVB 5M5DA 1P6WA 3MSDA 3UCQA 2XWDA 2WM0A 1XD0A 4Q7NA 4QDMA 3FAWA 3ARXA 2J75A 3WQ5A 1NH6A 4AXNA 3VDAA 3D5HA 2OSYA 4LYQA 4AZBA 4IUGA 2D24A 4PMZA 1XH0A 4HU0A 1E6RA 1HL9A 3WD3A 2JIEA 3VGDA 2QF8A 2UWFA 2VZUA 4UQAA 5BXSA 1SYTA 3GBEA 1ISYA 1J0IA 1W9PA 3BAIA 3SUSA 3VD4A 1WO2A 3PHAA 4PUEA 7A3HA 3A6OA 1UH4A 4JIEA 2J74A 2OYMA 1WP6A 1TUXA 2WCAA 1GHRA 2A3CA 4NZCA 1K6AA 1CGXA 4TX6A 3VD7A 3LMYA 4U5KA 5FKYA 2WZEA 4MTVA 1CXIA 5EMYA 4LKEA 2FHBA 3ZJ7A 3CHCA 3FY1A 2CITA 4LYPA 4AIUA 2CBVA 4JCLA 2XVLA 3QGVA 1EH9A 5CPSA 1EA9C 2E8YA 2E0PA 1CXFA 5KZ6A 2WMJA 4UQBA 2ZOXA 3RM4A 4UFJA 5HOSA 4GI8A 2VCCA 3AJ7A 3ZJ6A 1KGUA 2CKRA 4QLLA 1E0WA 1GQLA 3W27A 3VX0A 5I3DA 1QNOA 1FP9A 4H8UA 1CDGA 3VM5A 4GI9A 1HP5A 1E1EA 2VURA 1UWIA 3ARVA 2AAAA 3WNMA 3GH7A 1ISWA 5C8BB 2YA0A 3EDJA 2G3MA 2YBUA 3N12A 3UG4A 2BY0A 3MV01 4TVUA 6CGTA 1EO7A 2X8RA 1FH8A 3KEHA 4FMVA 1JG9A 3WL1A 1MXDA 3POHA 2XWEA 3UETA 2O9PA 1HKMA 5E9AA 4UFLA 4BF7A 1YHTA 4PYSA 3OLGA 1PZ2A 3CUJA 1LWJA 2ZX6A 5JIWA 1GOMA 2WVVA 3O2LA 1W3KA 5D21A 3BAYA 5A2AA 2C8NA 3WNOA 1WCUA 5GNYA 1HJVA 4GQRA 1HNYA 1JL8A 4EE9A 2DH3A 2VCBA 1UOKA 4W86A 2GFTA 1W32A 1JXJA 2G3NA 3VUPA 4B9YA 4LX4A 1WNOA 2VZSA 3UEQA 1YQ2A 3VIPA 1CLXA 5TD4A 4B9ZA 1BG4A 3G6LA 1WZLA 3UESA 4D1IA 4RL3A 1H11A 4GZJA 5LA0A 4W7WA 5E6ZA 4P8VA 4D6CA 1KWKA 2JE8A 2UY3A 4K68A 1VFFA 4UR9A 2CETA 3WDPP 4D1JA 1MW1A 1D7FA 2F8QA 1PAMA 3W6MA 3CIVA 2ZWZA 3L4UA 2O14A 2GJRA 3GYCA 5LA1A 3WMBA 4PCSA 4HMDA 2VOTA 2NT1A 2BV9A 1EDGA 3GNOA 4JKMA 3VU2A 5EFFA 1BLIA 4Z2GA 3K8MA 4AW7A 1HJUA 1VFMA 2FHFA 1B2YA 1MW0A 1ISVA 1KQZA 4OUEA 5HXMA 4P8XA 1KGWA 1NOWA 3ZQ9A 3WY1A 4D6FA 1GQIA 3AICA 2VQTA 4JHOA 2FGZA 1GQKA 1Q6GA 1XYZA 2J8GA 2WNWA 1VAHA 4CD6A 3L4ZA 2XFFA 1EHNA 2G41A 3A3HA 1ZBKA 5BCAA 4JFWA 3VINA 3UERA 4Z2IA 3OA5A 2WSKA 3PZIA 4GO8A 3VNZA 4ZXLA 1R87A 3CUFA 4N42A 2W5FA 4W87A 8CGTA 4MAZA 1GW1A 2K46A 3AS1A 1E72M 1EDTA 4AD3A 2JF6A 1MWOA 1J0KA 4P7NA 4UCFA 4UFMA 2EXOA 4JFVA 2EPOA 2VJXA 2V5CA 3N11A 4RE3A 1LQ0A 4QP0A 5D4YA 3AFBA 1J0JA 3AS3A 3TA9A 1E6NA 1GUVA 4WLCA 4TVDA 4J3WA 3CMGA 4TOQA 1G0CA 5I23A 3ZT5A 4CD4A 4PTWA 3W25A 2XVKA 5IFPA 2ZX8A 3ZSSA 4GO9A 2XG9A 4Y7EA 4HMEA 2Y24A 4HOXA 4CCCA 3ZMRA 2V3DA 4MJ4A 1CENA 4RE4A 5FOOA 1EXPA 3WUGA 2JIWA 1B3ZA 1ECEA 1US2A 2XSBA 4J27A 3FN9A 3U7VA 2CHNA 3AHYA 2FH8A 5D8ZA 1UH2A 1QW8A 1UZ4A 2VO5A 3BAJA 2WXDM 3SCNA 5I5RA 1ZBWA 3WFLA 4AZGA 2YL8A 1E6XM 1CYGA 5M03A 1NQ6A 4ZE5A 3NDZA 3UT0A 3W81A 1VJZA 3PZQA 2FHCA 1PBGA 2BS9A 1QHPA 4N0RA 1W9DM 5D8WA 3VIHA 3WH6A 2EPLX 3GBDA 3KE0A 3FHQA 2OSWA 4W8BA 1OKOA 1W9VA 4M80A 3WQ6A 1CXLA 1UD3A 4YHGA 1W3HA 4J3SA 1E43A 4WSKA 2WBKA 3ZR5A 3K46A 3ECQA 5GPRA 3RPMA 1NWRA 1UWRA 1JDCA 1UKSA 1ZBVA 2WYSA 1IV8A 3VD5A 1UOJA 4MNJA 3WENA 2PBOA 1CGVA 2XGBA 1H2JA 1KCLA 4WF7A 4PN2A 4P8UA 2CYGA 2WKGA 3NSMA 4J3VA 4B3LA 5A8QA 3PN8A 1EIBA 2C0HA 4PMRA 4C7GA 3ZYBA 3CO4A 1H41A 3AIQA 2J77A 5ECUA 1E6PA 1BGAA 1FA2A 2CBJA 3WF0A 1WZXA 1GOQA 2YL6A 1NP0A 4X9YA 5A6SA 4CD8A 1PIGA 3I3EA 4E4PA 1LL4A 5BXTA 4CU7A 9CGTA 1Z32X 1XCWA 2V3FA 3CUHA 2PI6A 4JHZA 3T2QA 2DT3A 5HBFA 4QCEA 4GKLA 1UYQA 3AI0A 4X0VA 1RP8A 3MUAA 4HOZA 2XVGA 4PTXA 4AZHA 1BYDA 1ZJAA 4P7QA 4QFUA 3SCVA 4HA3A 3OG2A 1V3LA 3EBVA 4B16A 2WHJA 2E8ZA 1UD2A 1JD7A 1OT2A 3VDBA 3SUWA 1RPKA 1HIZA 4PMUA 2JF7A 1ODUA 3FHAA 4ML4A 1TMQA 1GCYA 2J7BA 1JF6A 1OGGA 1W2VA 4OJYA 2VQUA 3WEZA 4UOQA 2EBNA 3ZOAA 2EPKX 3EDKA 5A69A 3N15A 2BHUA 1TA3B 5AC5A 1US3A 2Y2WA 4W7UA 3A4XA 3ARZA 1FOBA 3MO4A 2A3EA 5AC4A 2GSJA 2VC9A 4UTFA 4UOZA 1KBBA 4OKDA 1C8YA 2YA2A 3NYDA 1KB3A 1DP0A 2EEXA 1UD8A 3F5KA 8A3HA 2VZTA 1CGTA 1FHDA 2DT0A 5CSYA 4HOWA 3OGSA 5A2BA 4CGTA 2FH6A 1HL8A 4CVWA 2KR2A 4KH2A 1VFUA 4AZCB 5CQ1A 4WKHA 1E4MM 4P7LA 2J79A 2J7DA 2WB5A 3VIFA 1R7OA 4M24A 2O92A 4AZ7A 3WEMA 1K9TA 3MANA 4M8UA 1BYAA 4Z2HA 3LPGA 3EMZA 5DMYA 1QI4A 4XV0A 1E55A 1E0VA 1QNSA 1EOMA 4L4OA 4WKFA 1W8UA 3MUY1 2XYLA 5IFTA 1UUQA 3AMDA 3MS8A 2PWDA 4OIFA 3VM7A 4GIAA 1XH1A 3THDA 4DWSD 3ZIZA 1UQYA 5CGTA 1W9FA 1E4NA 5I6SA 3L2MA 2WZHA 3WL0A 5HNNA 1KXQA 3AROA 3TTYA 1CGWA 5GQBA 2ZUMA 1HT6A 1GVYA 4EAMA 1J11A 1V0MA 1WCGA 4AD0A 3FNDA 2CIPA 4H41A 1C3FA 1BVNP 2F61A 1JZ7A 1WZMA 1I1XA 4OZOA 3WUEA 4CVUA 1ITXA 3GZAA 4EK7A 2UY4A 4UOJA 1WE5A 1KR0A 2E3ZA 2DSKA 2UY2A 2WVUA 1SR0A 3AHVA 3OGVA 4H2CA 1VEMA 1GWKA 1PX8A 1OH3A 4AD2A 1JFHA 1TCMA 3AQUA 5A3HA 3ARQA 1JZ8A 3RCNA 2W4XA 1OGSA 5I2UA 2E9BA 1ZS2A 1W1TA 3WUFA 1J18A 1ESWA 1E5NA 1LL6A 5E09A 1EO5A 4L4PA 2OYKA 2ZUWA 1NOUA 3KZSA 3WQ4A 1V0KA 1CXEA 1TA3A 1GZJA 3B9DA 4YHEA 5JBFA 1VRXA 4ATLA 1B3YA 3CZEA 1ZU8A 5FD0A 1W1VA 4AIEA 4AD1A 1HP4A 4PSRA 1BYBA 2YDQA 3DYPA 3O9NA 1HX0A 5M17A 2QMJA 3WH9A 4JKKA 3PTKA 1QNRA 4S3JA 4H7VA 3BLPX 1KXHA 2EJ1A 2A3AA 3AMLA 1OIMA 4CUCA 2RGMA 3T09A 4AIOA 1CLVA 5A6KA 4PMVA 4AC1X 4ZE4A 3RO8A 3RM8A 4E2OA 3B8SA 4UQEA 3ZJ8A 4AZCA 2G8ZA 1UA3A 4DWSB 3N1AA 3VMPA 4CD7A 5BYWA 1VJSA 3VOCA 5E70A 4GXPA 2DDXA 1PX4A 1OWQA 2VI0A 3GXMA 2G3IA 4U3AA 1U2YA 2XJ7A 4AZ6A 3W53A 1UQZA 4UFKA 4XZBA 1BQCA 1V02E 2EPNA 3RIKA 2E4TA 2V3EA 2CBIA 4IISA 1HKJA 3E1F1 1K9DA 3WQ8A 4WJXA 3NSXA 5AYBA 2WHMA 1VBUA 1UR9A 1CWYA 1GOOA 4YN5A 3WNKA 2XFRA 1E70M 1EQPA 1GHSA 3I3BA 1LF1A 4AZ5A 1EGZA 2BXYA 3VVGA 1JDAA 2FGLA 4HP5A 4U31A 1RP9A 5A6JA 2GVYA 1LJYA 1QW9A 4V27A 5IHSA 3OLEA 3BH4A 2OLHA 3T0DA 2JALA 3ARWA 1BGGA 1C93A 4LPCA 4DUWA 4QLJA 5A6MA 1NWSA 3AXXA 5LA2A 2WSPA 1I1WA 3N18A 2X2YA 4W84A 3RILA 1GVIA 2NSXA 3B9AA 4W93A 2VNCA 3VX1A 4MPKA 1HVQA 4KRTA 1Q6DA 1XC6A 3W24A 3DHUA 2D0HA 3CHDA 2XGIA 3WF1A 3M7SA 1UWQA 4LXFA 2D0FA 4W88A 1TFVA 1E6SM 3AIWA 5IDIA 3BAXA 1E56A 4PUDA 3DECA 3VGBA 4FF5A 5BRQA 4BQ5A 3DYMA 1BVZA 4MNMA 2WPGA 4HZ8A 3QHMA 3SCTA 4CN6A 2BVDA 3WQWA 3MUIA 1B31A 4BCEA 3RJYA 2HISA 1G94A 1OT1A 2A3HA 5A1AA 2WVSA 2VZVA 1JZ2A 1N82A 5I0DA 1W1YA 2VL4A 1I75A 3AIEA 1WKYA 3W28A 1VEOA 3SCOA 3EMCA 1M03A 3VGGA 3L4VA 4HMCA 2VX7A 4TX8A 4S3KA 3PZ9A 5ABHA 1CXKA 4DWSA 1QVBA 2CXGA 2W61A 4QCFA 1UH3A 3MUZ1 1LG1A 1BTCA 1FP8A 1QI2A 4AWEA 5C71A 3VDCA 1JGIA 4Z2LA 2ZX7A 2WC7A 2YKKA 3GTNA 5DFAA 3AYSA 3PZGA 2WMGA 3GNPA 4UFIA 3L4WA 3BXWA 1NP2A 3VGFA 3WDHA 2XHYA 4UQCA 1WZAA 3IK2A 4AL9A 4AYSA 3II1A 1M04A 5CSUA 3BAKA 1J12A 3ZSTA 3AMKA 1GWMA 2F2HA 5CPTA 1JYVA 1UWSA 1MYRA 2J7GA 3SCUA 1WMXA 4MJ2A 4HPGA 3SCQA 1C7SA 4CU6A 3LPPA 4MAVA 4W85A 4MB4A 4KRUA 1BAGA 2E9MA 2WLZA 4HU8A 2BY2A 2D22A 1V6YA 4AEEA 1D3CA 4FLQA 3AZSA 3DC0A 1GOIA 4J3XA 3EDDA 1MW3A 1R85A 5DEZA 3M6DA 3SUUA 3WH7A 1ISXA 1UR1A 2D23A 1W9BM 5BROA 2VX4A 4CU8A 3UR8A 3NIYA 5A8OA 4D6IA 3ALGA 4JL2A 2CCRA 3ZO9A 7CGTA 1V0AA 3ZT7A 4V2XA 1K9EA 1FFQA 1E5JA 1XSKA 4E8DA 1WPCA 1XRVA 5CZKA 3BC9A 1CGUA 2QMKA 5IXEA 1OM0A 2BFGA 3AMGA 2C24A 2W66A 4CN1A 3ARTA 3CGTA 1H4PA 4FLOA 2QHAA 2J62A 1CNVA 3T0AA 1V3IA 3IJ7A 4UZUA 3VKKA 4GZIA 7TAAA 1E0XA 3F4VA 5A8MA 2A3BA 1J0HA 4R5EA 1E15A 1W3LA 1TVNA 1KBKA 3ZT6A 1QBAA 3T2PA 3T2OA 4FK9A 3AIUA 1GPFA 1V08A 3WH8A 3NDYA 1B90A 1E3XA 2OYLA 3JUGA 1X1NA 1DWAM 3KL3A 3U57A 1MVYA 1O7AA 2XM1A 4D6GA 1E40A 1UKTA 5C70A 5D9MA 5FCZA 5I79A 1O6IA 2DGAA 4H8HA 1EDQA 3PBGA 3VIGA 3WDRA 4HPHA 4OOZA 4BQ2A 1UR2A 3HU7A 3NUKA 1HJQA 4KGJA 3SCWA 1QNQA 1ZL1A 2VRKA 1CTNA 4CP9B 4PRWA 2J7EA 3IJ9A 1KGXA 5CLTA 3ARUA 2XVNA 1H3GA 3F5JA 4IPNB 5I78A 1MW2A 1IZJA 2LRPA 2Q8XA 3M46A 2E9LA 1XSIA 4C7DA 1BSIA 2ZWYA 2ZXDA 1C91A 3GXFA 2D20A 2O9TA 4Z2JA 2W63A 4ACZB 4JFSA 3BLKA 4AY1A 5E6YA 3WF4A 3SIMA 3K1DA 2VZOA 4HZ6A 2VR5A 2X09A 4PSPA 1JIBA 4W5ZA 1FH9A 3N9KA 1HN0A 2J47A 1AQ0A 4TXEA 1V02A 3D3AA 4P7RA 3L4XA 1R86A 3MMWA 1OSEA 4OBRA 4MB1A 1V6UA 1UG6A 3AHZA 3ZYFA 2PWHA 2ZX5A 4J28A 1GOWA 1DWGM 2IUZA 3KL0A 4W89A 1Q6FA 3AYRA 3RJXA 1V6XA 4JZ5A 1Q6CA 3UR7A 4GINA 2PF0A 2VRJA 3VIOA 3AHXA 2V3GA 2WAGA 1OCQA 2OWCA 2TAAA 2B31A 1W8ZA 3SUVA 2Y8KA 4WK9A 4P7OA 1CEOA 4U5IA 1EOKA 3N04A 3VDHA 5HPOA 1AVAA 5CPQA 3W0KA 4BQ3A 1WDSA 3J7HA 1MFVA 2AOSA 2ZICA 4GI6A 3TP4A 1H09A 3WF2A 1JI2A 3W38A 1JYWA 1HJWA 2QPSA 5JBEA 3OIHA 4KGLA 3TTOA 3GXIA 2XSAA 3A47A 2GDUA 5A2CA 3AIBA 4M29A 4UFHA 1TR1A 4ZENA 5CLWA 3WQVA 5I77A 4W7VA 4YPJA 1VIWA 2BHZA 1DEDA 2OWWA 1QHOA 1XH2A 4AD4A 3QHNA 1AQMA 2WHLA 1W3JA 2X05A 3W29A 3WDJA 3TTQA 1U30A 1V0LA 4MB5A 2O9OA 2CNCA 5F7UA 4E8CA 1NOFA 1W91A 3GH5A 2VTFA 3WNLA 4XB3A 2XVPA 3RM9A 2ZUVA 1J01A 1J10A 3VMOA 1H0IA 4BZYA 1JFXA 4CP9A 4D72A 1G1YA 4V28A 2YDSA 2WHKA 3U7BA 1G5AA 5HDRA 4TUFA 3MV11 1JD9A 4MADA 4ZEPA 2OSXA 3OLIA 4OOUA 1JNEA 2IXUA 3WELA 2YDRA 3VGHA 4QAWA 1LLOA 1JZ3A 1Q6EA 3WH5A 2XFYA 2ZUNA 3AIVA 2GJXB 1JXKA 3MKKA 4ACZA 1HKKA 1E3ZA 4Q22A 3PTMA 1WDPA 2D1ZA 1PJ9A 1SFSA 3ARPA 2Z1SA 2WMIB 2VX6A 3KL5A 1M01A 2WW5A 5DO8A 4CCEA 1C7TA 5KEZA 1QI3A 3EYPA 1E73M 4UZSA 4D6EA 5DF0A 3VTRA 4F79A 2W91A 2PC8A 4PTVA 4ZFMA 1V3JA 4IPLA 2YBTA 1G01A 3VD3A 2ESCA 3ALFA 1WDQA 2O9RA 3L4YA 4JCMA 3AXIA 4AISA 2DEPA 1A47A 4Z2KA 3CZ8A 5E0FA 1JDDA 1M7XA 4XX6A 3SCRA 3UG5A 4BA0A 4UNIA 1FHLA 5FL0A 1UZ1A 2VR4A 4RE2A 3WKZA 2DSWA 5ABEA 2BY3A 2NW0A 4EKJA 5AYIA 1B3XA 5D9OA 1XYFA 2YJQA 3VGEA 3MSGA 3OZPA 2Y4SA 2PWEA 2Q1FA 1L8NA 3QOKA 3THCA 1QOXA 1OINA 4BQ4A 3FW6A 3S6TA 1KQYA 1OBAA 4DUVA 3BAWA 4TVCA 2V38A 4F9DA 4QLKA 2JFEX 3NSNA 3S2CA 5BRPA 3N17A 2CKSA 1R8LA 4CCDA 1V6WA 1DWHM 3CUGA 1TE1A 3CMJA 3VPLA 3CLWA 3IAPA 3OLDA 3F5LA 5JIPA 1MQPA 2V5DA 1NWUA 3SCSA 3AOFA 2ZE0A 4F8XA 2YIHA 3N13A 1UR4A 1K9FA 3ORJA 3WFZA 1LG2A 5A6AA 1VEPA 1XCXA 4PMOA 5JUVA 4DM1A 1C8XA 1M53A 4OBSA 5A8NA 1V3HA 4M1RA 3VIJA 1GOKA 1ZBCA 1S46A 2W67A 1E6ZA 1C8QA 3CH9A 3GM8A 3DHPA 1W8TA 1OD0A 3CZGA 2GJXA 5GNXA 2EPMX 4U2YA 1V3KA 3AMCA 4FLSA 3MMDA 2WCGA 4P8WA 1BYCA 4IM4A 4BS0A 2WMIA 1MQRA 4ATDA 4ZXOA 2VRQA 3K4AA 2XM2A 3IANA 3BCDA 3VILA 5A6BD 3A4WA 1HN1A 2GK1B 3AXHA 3WDIA 3BCFA 1E71M 3AS0A 3CHFA 3AHTA 4M56A 5BWFA 1QBBA 2WCSA 4PCTA 4J3UA 2BXZA 2WMHA 3LPFA 1MXGA 2CESA 4JFUA 1DTUA 1IZKA 4H04A 2ZX9A 1UD6A 2GJPA 3W26A 1C92A 2VXJA 2CHOA 1NWTA 4A3YA 5I24A 1CECA 2WC3A 5D9NA 4YWAA 5HPCA 1HVXA 3PZVA 1V6VA 3KWXA 3WMSA 4LKDA 3WD1A 2DIEA 5BXPA 4MDPA 5A94A 2YOCA 4DWSC 3HN3A 1W90A 2FDMA 1B30A 1W8WA 3OZOA 4NF7A 4A6SA 1CIUA 1TZ7A 4HA1A 3AIRA 3F95A 4JFTA 1B1YA 1F4AA 2PBGA 1AQHA 4PMYA 1CGYA 2YLLA 5BXRA 1XHGA 3IAQA 1ITCA 4B3KA 1XGZA 5E0CA 1OB0A 2DQXA 3AZRA 4KMQA 3EDFA 2MANA 4A4AA 4CPBD 5EFDA 1ISZA 1JNDA 4XZWA 2ZUTA 3FXYA 1SMAA 1CPUA 2C7FA 3WNPA 4M81A 4D71A 1WDRA 4CD5A 1VENA 1W9XA 5JBDA 3ZYHA 2J25A 5EBAA 1W1PA 1E4IA 2CPUA 2RGLA 3OBAA 3W4RA 3SURA 3ARYA 3TOPA 1KCKA 3K4DA 1CBGA 5LYRA 1HJXA 3ZR6A 3ARSA 2ZXQA 1J0YA 2VVSA 3VD9A 3WUBA 2JEQA 3CZKA 5ABGA 3HJEA 2WBGA 1X6LA 3O6AA 1BF2A 3A4AA 1QPKA 4JKLA 5M3WA 3WN6A 4PMXA 3W37A 1DWIM 6TAAA 1VB9A 1W2PA 1E4LA 4F66A 3K8LA 1RD6A 4U3CA 5FIPA 2QPUA 2DPEA 2YLAA 3NJ3A 1GWLA 1ZB5A 6A3HA 3U5UA 1JYXA 2BNJA 1KXTA 2GK1A 1PX3A 3DYOA 4PMQA 4DM2A 3HMCA 4J3TA 4NSBA 1EQCA 1E1FA 1UKOA 4ATWA 3AS2A 4NRRA 4YW6A 5ABFB 1QI5A 1VFOA 1JF5A 4HA4A 1JZ4A 2WMKA 1KR1A 2HVMA 4DUXA 3FAXA 1RH9A 1MFUA 1J9YA 4URIA 3PZMA 3CUIA 2ZIDA 2JEPA 2J7FA 1UWTA 5A95A 2YL5A 4AD5A 3POCA 1JZ6A 1UKQA 1UR8A 2IXVA 1JAEA 4NI3A 3QHOA 3SUTA 1BPLB 3WMCA 1FFRA 2WWDA 3APGA 1E6QM 4LK7A 3PZUA 4AZIA 4WKAA 1TG7A 2X0HA 4GZEA 3WD2A 3NCOA 1PIFA 1HF6A 2PWGA 2XUCA 2BVTA 1KWGA 4W8LA 1OGBA 4CKQA 5CJ5A 4MNLA 3ZJKA 3WEOA 2ZUUA 5D9PA 1MQQA 3LPOA 4R27A 1LL7A 2WC4A 5A8PA 2DT1A 1E9LA 4LKFA 2VMFA 3WD4A 2PWFA 2CBUA 1JYNA 3AISA 2VUYA 1UWUA 2GDVA 1SMDA 5A6BA 1OD8A 3GDBA 4JL1A 5EB8A 4U33A 1UD4A 2XIIA 4X0NA 3CTTA 2BY1A 4A3HA 2D3NA 4ACYA 2QV4A 4D6DA 1GORA 2J78A 1UKPA 1HXJA 4M82A 1TVPA 3PZOA 5FL1A 4GQQA 2JWPA 1QNPA 5DT7A 4H8VA 1VBRA 1HJSA 3W6LA 4D6HA 3K8KA 1PZ3A 1D2KA 3GNRA 1UA7A
chains in the Genus database with same CATH superfamily
2NT0A 3UWEA 4V1PA 4JCKA 1KO0A 2XWBB 3OEXA 2D2OA 4AMCA 4YVVA 1H1NA 3FHIB 1OKQA 5C9AC 5JPNB 4W8AA 1RGSA 1QT1A 3U0HA 2XJRA 1LESA 3M8LA 5L9BA 4LK6A 1IT0A 3TWAA 3U5YA 4IEVA 5CSSA 1KM4A 3KS5A 2G1MA 1PGW2 4QPYA 1ODZA 1HB1A 2E26A 3QLDA 2PU1A 1SQ4A 3ANUA 4FLRA 3CYVA 4JOMA 3M16A 3WSUA 1QQP3 4E4HA 2LROA 3BGAA 2R82A 4EANA 3LEIA 1G4SA 4QAIA 4LA2A 4DVOA 3GUWA 3EWCA 3K4ZA 4CPBA 4Q4Y2 2FPVA 4X2PA 3VYLA 1QHZA 3I97A 5H9PA 2JDAA 4YFWA 1ITQA 3WINE 2OWXA 1X1OA 2Q71A 3N73A 1ND3B 3UNTA 3AVRA 3WP3A 5C4WA 2DSZA 2IPFA 4YW7A 5EJ1B 2J9YA 4RZBA 3UY7A 3VNDA 3QGAC 3B8UA 5LIYX 4CXXA 1W6NA 1QGLA 2OZJA 4XDPA 4Q0UA 1RCXB 3B93A 3EKGA 3BMWA 4B15A 3MHZA 4MSVA 2XPKA 3AALA 4DBSA 3GVQA 4OI4A 1IXNA 4CP0A 2I5QA 4UQDA 4LUTB 4FO9A 3VZZA 2DF7A 1DL3A 2E32A 3GIQA 3ZFGB 4YVXA 2EICA 4QB6A 5CXPA 2DH2A 2PDMA 4L9XA 2V9DA 3VMNA 3W2LA 4NIDA 2WMFA 3BSHA 4K38A 4HTYA 1EP1A 3BIWE 3V64A 1B9ZA 5JMOA 3A7QA 5REQB 3CLPA 4JZRA 3GLCA 2X7WA 2E1WA 3WLIA 3N9OA 3EB3A 1FMD1 4RV3A 1ND2C 2R24A 4NU7A 4TTUA 4OQ8A 2E7QA 2CEQA 2Z1KA 3G77A 2YL9A 8RUCA 3CBWA 5F5IA 3C52A 3S5YA 1RUE3 1KW1A 2J9ZA 1GQJA 4B91A 3LYEA 1XW8A 3U3HA 4I2OA 2PN5A 3UWQA 2B8MA 3SH5A 3B06A 3DG6A 4GY1A 4K7VA 2ZFAA 1UY2A 4C6NA 3LQCA 3GH4A 1GJUA 1NAEA 3EWYA 5CG0A 5CC3A 3KV6A 2G3JA 1HXS2 2TYSA 4UI9L 4I9TA 4HYVA 3S2JA 2PEVA 1V6JA 3NDOA 4ZZ9A 1W9UA 4DXVA 2NQZA 3H2FA 2WYFA 1S1AA 3H7RA 3W07A 1UP3A 1RLCL 3W3OA 1LOCA 3QC3A 4IMGA 2BVYA 4P00B 2D3LA 1A3KA 2ZQ0A 4LULA 3JQWA 4MDOA 3VIKA 5CG8A 4Q8NA 1I5PA 5C2XA 3M1HA 1BG9A 1A3HA 2JGQA 4MYAA 3LHYA 4OHXA 4L9BA 4LAZA 1EJVC 4D8AA 3IGUA 1XLIA 1UOBA 3TMLA 1QIQA 3VIMA 4D6JA 2Y6HA 4JNZA 1NVMA 5FLJA 4PBGA 1GT8A 2ID4A 1P0BA 2ZYFA 2XHKA 1FH7A 3PTDA 1CAVB 3BOPA 4JY8A 3IJ8A 3T0BA 3OF1A 1XISA 2JKPA 4XAFA 1CZ1A 1GONA 1OZQA 4ZL1A 1W6MB 3PU3A 2X42A 2GZXA 2P0IA 3EB7A 1XSQA 3M0YA 3H8AA 3NGFA 3FVMA 2I07B 2FGBA 3IIAA 5J09A 2Y85A 4GFIA 1NARA 4KWLA 1VBB1 3CIXA 1ND3A 2IZWA 4C6PA 2FMDA 3OGRA 2Y8VA 1WBLA 4FIQA 3R11A 1WLDA 5M5DA 1P6WA 1MS5A 2OZ3A 5T8GA 4EWND 4R34A 1V6NA 3ZSEA 1Z78A 5L9RA 2W3JA 3LV5A 1R1A3 4S39A 3VDAA 2VZQA 1UROA 2OSYA 3NVDA 5FAJA 1IS5A 3PJWA 4QDQA 4LUTA 1XH0A 3TQVA 4NIAA 3ZFGA 2VZUA 4FPEA 2XSXA 2HWC1 4EACA 1SYTA 1ZP4A 1QF3A 1KD0A 4HYRA 1LGCA 5E6HA 4PUEA 3W73A 3A6OA 3DPRB 4B2DA 4JIEA 3ZVIA 2J74A 3V7PA 5REQA 3KCJA 3A9BA 4A8LA 2WWUA 4NZCA 5AHIA 4W4QA 1HFBA 5KHHA 6XIMA 1C8M1 2WZTA 3DL3A 4O61A 5TAOA 3K4WA 4IQDA 3VD7A 2VM8A 4DZIA 3N19B 1BK1A 4XW3A 3PFMA 4X8PA 3ZLIA 2HBTA 3CEWA 4N53C 3DZ1A 3ZJ7A 4TIMA 4IE4A 3CHCA 1CLKA 3AKQA 3ZSMA 1BKSA 4JCLA 4DI9A 4DWDA 1EH9A 1WKDA 5HXVA 2RS32 5FZ4A 2HSAA 2E0PA 4AVNA 1CXFA 2EHHA 3LU2A 1JU4A 1BSLA 5CB7A 4UQBA 1F2JA 1Z89A 4U4MA 4GIYA 4ZODA 2GH8A 3Q2DA 3V65A 5HOSA 4NXSA 1IEXA 2VCCA 3AJ7A 2F38A 3I7SA 1P0DA 3PP7A 1KDKA 4QJ3B 1XCFA 3D6EA 1KGUA 4GI4A 4QLLA 3VX0A 3AFGA 3KVLA 3F4DA 4QMAA 1CZVA 1LOAA 1NCRC 2E9QA 3AZWA 3W2KA 1CAVA 3D4KA 3WW4A 3FA5A 1MEIA 1J2WA 3AL5A 2Q8EA 2YA0A 3QSTA 1Z48A 3DF0A 3WCSA 4XHXA 1BWVA 4DYJA 3FBMA 4L9ZA 3G1XA 2WPBA 4Y1XA 2BY0A 3UWUA 1W6MA 2D6NA 2PAMA 2X8RA 3WL1A 1MXDA 3NQDA 3ILNA 2O9PA 5E9AA 4UFLA 2C16A 3TEWA 1YHTA 3UWVA 1JYTA 1GVRA 3VZMA 3OYWB 3AKTA 4YFZA 4AWUA 3CUJA 1R082 2ZX6A 4YS1A 5JIWA 2X16A 5C2GA 4UW5A 5A2AA 3ZSLA 5FKCA 2HWGA 1WCUA 1I45A 4CYDA 5A32B 1SJBA 3PBMA 2VCBA 4KU7A 4O1DA 4HETA 4QU1A 1ZHAA 1JXJA 3UZJA 5FSEC 1PIV2 1MSSA 2VZSA 3KP0A 1QJY2 1BBT3 1FWFC 1BG4A 2HE5A 4D1IA 1LHVA 2QQNA 1N1YA 5EPAA 3ZFEC 4PIYA 4C6JA 5LA0A 2VZ3A 2FZBA 3S5ZA 4BJHA 3D0SA 4D6CA 2ZCWA 1QWKA 3V16A 3DPRA 2ZMNA 3CL7A 1HIXA 2CETA 3WDPP 1SM9A 2GSEA 4FPOB 1TVLA 4HVXA 2CLHA 1OK4A 3QW3A 1BEV2 1J79A 5IM51 1D7FA 5B7ZA 3S2MA 3CIVA 4L8QA 1X82A 1AR93 3L4UA 4FR1A 3MTWA 4PCSA 3P1IA 3RGTA 3GNOA 5DMMA 1F76A 2C6QA 4AW7A 1JUEA 4DY5A 4MHUA 2FHFA 5IW0A 1MW0A 4S2BA 2XDVA 2VAUA 2E6VA 2XXZA 4EP8C 1SO5A 2PHDA 3QD6A 4IUOA 3M0IA 1XNAA 3KTSA 4JICA 3W86A 1FPN1 1LHWA 5AYYA 3WY1A 4IIEA 3ZQ9A 4D6FA 3FYOA 3J8F1 4JC1A 2FBEA 4JVAA 2QCSB 3AICA 3L5MA 1VB4A 1Q6GA 1XYZA 2WNWA 2RDRA 2QJMA 4Y5SA 4PRTA 2XKOA 2OQHA 2RH9A 3I6TA 5BCAA 5FESA 2X53S 3VINA 5FEXA 3OA5A 2X10A 1VLIA 2YZRA 3RYKA 4UW4A 3MIDA 2X41A 3VNZA 3HQNA 4GKYA 3C2OA 4N42A 4WBBA 1K6WA 1O5UA 3GNDA 4ROQA 2K46A 4IE5A 2ZVRA 5K2ZA 4DZGA 1E72M 3LGRA 4AI3A 4AD3A 3DBNA 1J0KA 4UCFA 3NAVA 4UFMA 3OYZA 3B05A 4ORFA 4ZB0A 4QP0A 4RQPB 3AS3A 3OYWA 3L0NA 1H5YA 4WLCA 4EE2A 2LALA 3PSVA 2P37A 4NPRA 3C7GA 4IGNA 2Y34A 2OT7A 1I4NA 4MZ1A 1MEWA 3VXGA 5A32A 3VKOA 2HK0A 2PP0A 2A6XA 2XGXA 3R4DB 2QQOA 2AKMA 4O18A 2XIJA 2Z6JA 4GO9A 3VBHA 4QGCA 4NY2A 2Y24A 1H6YA 4CCCA 4NZJA 2CNAA 3VHRA 3M64A 2V3DA 4MJ4A 3G1DA 3KBSA 4AH7A 4JQAA 1CENA 2DCKA 2Z1BA 4Z0JA 4YVWC 1P7TB 3NQHA 2JIWA 3G1YA 2ZHNA 4K37A 5HV4A 1HO4A 1FWAC 2ZTKA 1R091 4J27A 3I6RA 3GFYA 3R6IA 3BUCA 4YG6A 4LUMA 2CHNA 2FPYA 4FOKA 5D8ZA 2A1YA 2E5CA 4O9EA 2FFIA 1QDCA 3SCNA 5I5RA 4CU9A 2KX9A 5M03A 1XR2A 1NQ6A 1COV1 3C86A 3W9ZA 4QT6A 2OR2A 3UT0A 3W81A 1LLWA 2CLFA 1KM3A 2OEKA 3G2GA 4A2UA 1QHPA 2YBKA 3UA4A 4GNVA 2P1FA 5D8WA 3CH0A 2R072 4UIOA 1QJX1 2V4AA 4PL2A 1MVEA 4O65A 1JHNA 2PMWB 2EPLX 2QS8A 3GBDA 1FWSA 1DJHA 5DUUA 1OKOA 1W9VA 4A42A 3WQ6A 1O4ZA 4YHGA 5C55A 2Y8UA 1RHI2 5FKBA 1E43A 1U5HA 3SECA 1I8JA 2WT2A 3NQ8A 3ECQA 4AHPA 1OA2A 5D2VA 1I0DA 1W2UA 2R7EB 5CYYA 5I02A 5CH9A 5CAHA 2BWAA 3KLLA 4CUGA 1LRHA 2NXIA 1J5SA 3H23A 5C5TA 2RMU3 3QH2A 3WENA 1GPWA 2W0XA 3KXQA 1VBD3 2XGBA 1F7BA 4X3ZA 3RZGA 2CYGA 3NSMA 5A8QA 5GJ6A 2C0HA 1TTJA 5C4WC 3FJLA 3EBRA 1UZWA 4GCAA 3CL8A 3AIQA 3ZKUA 1H60A 5LK7B 1BGAA 4ARXA 1ADSA 4JTCA 1WZXA 2YL6A 1W3XA 4UWMA 3I3EA 1YQCA 1LENA 2HBUA 4QHZA 1HRV2 2C91A 5BXTA 1MUCA 4JTRA 4LS1A 4GVIA 3O12A 2NN8A 2CLMA 1RUJ3 4YZ5A 2IPGA 1IE7C 2WKJA 1P6BA 1CT5A 3AI0A 3DGTA 5FZCA 4RQPA 4X0VA 4LLOA 2K9ZA 4HNVA 5EV7A 2XN0A 3SY8A 3PR2A 1QMLA 1R3VA 3BPSA 3KVJA 1A6CA 1TJ0A 3HG4A 1PO22 2QTWB 4NHKA 1NFGA 4HA3A 3BTYA 4IP4A 2AMXA 2RM21 5LHEA 3EBVA 3R0UA 1B9BA 4KCWA 1UD2A 2WNOA 1B5TA 1SEFA 1JD7A 2PGRA 1OT2A 3KDNA 3U07A 1RPKA 3LCXA 3CIHA 3STCA 2P2KA 2B7YA 3TW7A 1P7TA 3U4AA 5JSOA 4LWWA 1XLMA 1JJKA 4AAPA 4DXKA 5CAKA 1OGGA 3TWBA 3D47A 3ZXEA 2ZHMA 3SCGA 1HZYA 3SY5A 3S0CA 2KD7A 2EBNA 2QW5A 4PJYA 3EDKA 4PBFA 1TA3B 1G69A 3ZXJA 4LXLA 3B97A 4H9UA 2VYOA 4Z08A 4MKSA 1US3A 1I2RA 2Y2WA 1XNKA 1D9EA 1RUD2 3UXDA 3K30A 1FOBA 4PGLA 4QHBA 3T0TA 1GP6A 3MO4A 1M7JA 4EYUA 1B54A 2VC9A 1RBAA 3LX9A 1KBBA 2IC1A 4Q8OA 3U4FA 1PZ1A 5FPVA 3EA2A 1DP0A 4EV0A 3V36A 4F2UA 1EPXA 3VZJA 8A3HA 3RZZA 3GTHA 3LD8A 1CGTA 3BCJA 2DT0A 3SFKA 4HOWA 3R4UA 2ONEA 1DJWA 1W31A 4JTEA 1NX9A 2QUUA 1ZALA 4NILA 4AZCB 4Q4W2 3ACFA 1OC5A 1QJWA 3IUIA 5CQ1A 5HA7A 3M41A 5FK7A 2D2HA 3TYZA 5E9XA 1LHNA 4MGQA 3KVKA 2C14A 4LFYA 3VIFA 1GKQA 1R7OA 2ZBTA 4XUOA 4AZ7A 2CY6A 3A9IA 1K9TA 2OT0A 1S2KA 3BGGA 2EF9A 1ND3C 1BYAA 2H8XA 1TWDA 1GTEA 5GLZA 2V6AA 4UTWA 1VH7A 4XVDA 5DMYA 2VFDA 2FQIA 1QI4A 4XV0A 1E55A 4WKFA 5ACA2 3KUMA 3TX9A 5FXZA 4N2YA 4S38A 3EQEA 1V9U1 1QOOA 1RINA 2BYVE 3WSOA 1KA9F 1IZ3A 2HWD1 4DB5A 3IDAA 1EXBA 4QROA 5AN7A 3P3BA 1UF2C 2DCYA 3TVAA 3H8RA 1GEHA 3RCYA 1XH1A 1E5HA 4L1XA 1UQYA 3P3NA 5I6SA 5HNNA 3E02A 3AROA 3RSJA 3TTYA 1CGWA 2QQLA 2RR13 1PDZA 1WOAA 5GQBA 1I2NA 1HT6A 1GVYA 3P5YA 2ACSA 4EAMA 4HK7A 1OLQA 4NI8A 4QHOA 3EA1A 2JDHA 2BTMA 1J5TA 2ZRUA 2MEV2 4AY7A 3LNMA 1G7YA 1C3FA 1YCIA 3OBEA 5T55A 5LEKA 4NJGA 4AXKA 4G6CA 2D44A 5DN1A 1F05A 1Y5WA 1D3GA 9XIMA 3GZAA 1RBLA 4A3UA 2DSKA 3QGKC 1SR0A 5DUWA 3AHVA 4H2CA 4ADSA 1S2AA 1VEMA 2XH2A 1AA1B 1OH3A 1MQTC 4JDBA 4X2RA 1EJWC 2WQDA 3I65A 1TMLA 1WBJA 2WO3A 3WUFA 3D3FA 5BNOB 1JCLA 2X8KA 1EO5A 5LNUA 4L4PA 4H14A 3G1FA 5BNQA 2A6YA 1NOUA 3FLPA 4US5A 3IWPA 2ZKNA 2NVCA 1V0KA 3N6QA 1OQFA 1TA3A 4KI5M 1GZJA 1DU3D 5H9QA 2ISFA 5FY0A 2PLCA 3CZEA 2W1SA 1ZU8A 3GZEA 3LDKA 4I3GA 1QO5A 1W1VA 4XKYA 4AIEA 3W1TA 3S2NA 2PCQA 1TIWA 3EPNA 4UMAA 3USSA 1M65A 2QMJA 3PUEA 2X1TA 3HF3A 3Q58A 4S3JA 1OEPA 3S9YA 2QQUA 1O95A 1CIYA 1KXHA 2Y0OA 4W4ZA 2EJ1A 4GB31 3AWOA 5CPNA 4AFYA 5G1TA 5DUXA 1KITA 2RGMA 2FTPA 3RU6A 1LWIA 4AC1X 3WLOA 2JIGA 1Z9AA 5FREA 3P8IA 4PF1A 1XQKA 4AZCA 2DCTA 1LNSA 2G8ZA 1UA3A 2H9AB 4AK3A 4DWSB 3NAPB 1J1LA 3VMPA 2DU2A 4X60A 3CAQA 3CV1A 1DYPA 1DYSA 5BYWA 1TPC1 4NPLA 3LBOA 1W8SA 1HRI2 2E6DA 2DDXA 3D82A 4AEJA 4U3AA 2XJ7A 1YPXA 2RDTA 2C9AA 4HK5A 5DUVA 1FRBA 3GDLA 4UFKA 4L97A 2C3ZA 3IPWA 4FOYA 4JHMA 2HWE3 1R2TA 2EPNA 2H90A 1H30A 2E4TA 1W6TA 1AQFA 3PAOA 4IISA 1NG0A 3VHPA 1K9DA 3N3TA 4HPKA 2EXIA 1ENSA 3RX3A 1YKWA 1EZ2A 3E0WA 2Q4SA 4QQ3A 4Q0PA 1QATA 1OQ1A 5GLTA 4UTMA 4NRPA 3P8JA 3TJXA 2NZLA 4PRRA 1XC4A 5F3EA 1IEVA 5LIXX 1HW5A 3LGDA 5I3GA 3BLIA 1GHSA 4GMP1 5E16A 4DEVA 2Z26A 3G7DA 2PUZA 3TE9A 4JTNA 5EHDA 3S6OA 5TF0A 3OGGA 4SLIA 3SFWA 2Y7GA 5IRPA 1GQPA 4DLFA 5IHSA 3NYZA 4FEZA 3H24A 3GZUC 1RLDA 3DPRC 5AFBA 2JALA 3NQAA 3QMSA 2O55A 4LPCA 3P5BA 4XMAA 3WXPA 4IEZA 4QLJA 3S4TA 3AXXA 2PP3A 3MHFA 2PU0A 1F31A 3ALQA 3MSYA 3BSMA 3AP9A 4LUSB 5F2GA 1PL9A 3JBG3 3TRSB 1RUI1 2RS51 3SQMA 4E4ZA 5GVJA 3WK1A 1JCMP 1DBTA 4LVAA 1URXA 5CA6A 1Q6DA 4KWOA 4OTKA 3VZYA 4KWSA 4B7KA 4AWSA 1GQGA 5BOEA 3CHDA 3GVVA 1J58A 3WF1A 5FYCA 3M7SA 5BNOA 4FS9A 1ULPA 3IVSA 3VB9A 5I0SA 1E6SM 2PPGA 2JG9B 3AIWA 4IXXA 1WMFA 3NQFA 1BRLB 2G9FA 1SBDA 3BAXA 1ODNA 1WCSA 3KBNA 5FYZA 1E56A 4PUDA 3DECA 3ZKYA 3DH7A 3TA6A 4BQ5A 1BVZA 4IMFA 4U10A 4JX0A 4DO7A 2RS11 1T41A 3E6DA 1LT8A 3MUIA 2B9UA 4RPPA 4AIBA 3OD4A 1XIEA 1AL0G 1WD4A 4G7FA 3OPSA 4Y3OA 5A1AA 2NMNA 3I3MA 4MVAA 4LHKA 3IIPA 5I0DA 1J93A 1J83A 2VL4A 4B4PA 3BZGA 1I75A 5G4WA 3AIEA 2OQ7A 4E27A 3NL2A 2LS6A 4TX8A 1Q3NA 4DWSA 2H9AA 3NAPA 1L6WA 1QK2A 3DEQA 1W56A 3MUZ1 4XEZA 1QAPA 3WZ0E 5AFDA 1QJZA 1BTCA 4IEQA 4GH4B 1QO2A 1XIMA 5BPXA 4EIVA 2R0HA 2ZX7A 2YKKA 3IIZA 3HB9A 3AYSA 3GNPA 2RDUA 5HMSA 2DWRA 1H1AA 3ITLA 2V69A 5LXXA 3BXWA 2RJGA 5LRRA 4D7TA 3ZXAC 5D2AA 4QISA 1NP2A 3NNMA 1PO11 3I54A 3WDHA 4QGLA 5E1RA 3QC0A 4AL9A 3NZPA 1J84A 2PLV2 4GXMA 3R94A 1J12A 3H2OA 3V0AB 4L6OA 3AMKA 1GWMA 1VFTA 1JYVA 1UWSA 1F61A 3S83A 5IK4A 1REEA 1SFNA 1YJKA 1RSCA 4HHPA 4XTDA 5DCEA 2PTYA 1LORA 3IGSA 1RMU2 4MAVA 3LIHA 1ENRA 1X38A 5EJ3A 4KRUA 2GGGA 1BAGA 2PHRA 3D0JA 4AX6A 2D22A 4DEFA 1V6YA 2JKEA 3SI9A 2C15A 4IIFA 2INFA 3AZSA 3DC0A 3PTYA 3GAYA 4PF5A 4PI0A 1VPYA 2JK2A 1GNZA 2W9XA 1R85A 3CJPA 2DZBA 4C5YA 2WO2A 1BEUA 3M6DA 4HU4A 3SUUA 3MMTA 4IV3B 4JQRA 4MLJA 1BVVA 3HQ1A 3UR8A 4AQLA 3C56A 5FACA 5A6TC 3BLFA 5JXJA 2PF8A 3TK7A 5JIUA 3B0VC 2XB6C 3C7EA 1LROA 3QSRA 2VTXJ 3MF9A 3ZO9A 3AYAA 3ZT7A 1G7UA 1DGLA 1FFQA 5ANNA 1XSKA 2J1EA 1VBC1 2QMKA 4EN9B 2XN2A 2QULA 2BNOA 1TZ9A 2BFGA 3UGGA 4QJ4B 2C24A 1L8PA 1W0MA 2W66A 4ZSUA 3C2RA 4FPKA 5C9WA 4BWLA 4N02A 3IT8A 2JG9A 1BRLA 2A0NA 3WG1A 2QCHA 3T0AA 2YGMA 4UZUA 1AL22 3VKKA 1Y9GA 2Y6JA 4GZIA 2OVLA 4GUIA 3F4VA 4H9TA 2IXJA 2FZNA 5A8MA 2O8QA 5J8LA 3U37A 5KXCA 2IXCA 2ZJCA 3NNFA 1TVNA 1DJYA 1MUMA 2QPXA 5H8UA 1GPFA 3S42A 2Y5SA 2DURA 2D69A 3H4WA 5KSWA 1E3XA 1I2QA 5C0QA 1B4KA 3IRSA 2OYLA 2AH2A 1DWAM 4JNMA 5EP9A 4UTJA 3J7NA 3KL3A 1GYNA 1MVYA 1O7AA 4OE7A 1MS8A 1PZ7A 3I8TA 4E2DA 4LVDA 3TJIA 4GVFA 3SRHA 2Z29A 5ISLA 2AL1A 4Q8UA 2QAFA 4HMZA 1KTCA 2LW8A 1JQVA 4GH4A 4OOZA 1GVOA 1OYBA 4LS2A 1S4CA 5DABA 4BOWA 4BB3A 4BQ2A 4QNEA 3H7YA 1QCWA 3NKTA 1DJQA 1YPIA 1LCOA 3TR9A 2ORXA 4PRWA 4RQPC 4MG2A 1T6GC 5CLTA 2ZZ3A 3ARUA 2J27A 3TN92 1TJ2A 3MIHA 3RLUA 2LRPA 2JDUA 4ZXEA 4HCHA 4LBMA 5TSWA 2E9LA 5HBAA 1H61A 3V0AA 1S0DA 3PPGA 3QY8A 1Q2SA 3GTFA 4LAOA 5KXEA 1NXMA 1SJCA 1X7NA 4L92A 2NXHA 3UKNA 3KBVA 3PIGA 4Z1CA 5FYUA 5FI8A 3KT4A 1C8NA 4MLOA 4AY1A 3AXEA 3NMBA 4LO4B 4P9YA 1KGYA 3E2VA 3U2EA 3I59A 3BLLA 3QMTA 4FSAA 5C9XA 3QR1A 5FYVA 4IE0A 1DLCA 1FH9A 1S2CA 1J6PA 1SW3A 3N9KA 3QM3A 3QV9A 1VHNA 1RVKA 1YW1A 3APYA 4IV3A 1FOD2 2OKTA 3ES4A 4LY8A 3BL3A 1R86A 2EAWA 1MZFA 4H55A 3MLJA 4O8RA 3KOZA 3GG1A 1Y8BA 4FIRA 1W03A 4QBXA 4MB1A 1CJPA 4IOTA 2R32A 1OFRA 2AUYA 1O5LA 4KESA 2VU9A 1GOWA 5AC93 1IQDC 3W20A 5LWBA 4LBSA 4IQEA 3RJXA 4HCLA 1DIWA 3EEZA 1O5QA 3G8EA 4O9GA 3ABRA 4ONVA 2PCEA 4AVOA 4XAPA 3FCPA 5LASA 2PF0A 2VRJA 4I02A 4TO8A 3VIOA 3B3QE 2V3GA 4AY8A 4ZZ8A 1GVQA 1L7QA 1O1ZA 2TAAA 1RUC1 1H2NA 2Y8KA 3HV8A 4P7OA 1EOKA 1AVAA 3W0KA 4HNOA 4AOCA 1AD4A 1WDSA 3NO5A 3D8CA 2D2JA 3OSDA 3EPOA 2P3JA 1H09A 2HYXA 1GR3A 3FEQA 5DCBA 1OA3A 4UTWC 4XAAA 2PQQA 2XSAA 5A2CA 4H9VA 5CLWA 4GWMA 1TR1A 5I77A 4YPJA 3NPWA 1PO9A 1RTVA 1QHOA 1FWCC 2XUMA 4AD4A 3QHNA 1TPFA 3L21A 4AGGA 3NV3A 3ON7A 3H2AA 1IPKA 1G6NA 3VI2A 2X05A 3GG8A 3DCPA 5KINA 4QQPA 1U30A 2AZ5A 1KCXA 3POFA 4KG8A 2CNCA 3S2LA 1F5FA 4FF7A 4MY8A 1NOFA 1S2UA 2ZX0A 2VZPA 2VM9A 3IIVA 4AHXA 2VTFA 1Q6OA 3B8TA 3LTSA 4P9JA 2XVPA 3PY2A 2GC0A 3BG5A 1J10A 3QOPA 3R25A 1JFXA 3N9RA 5LA9A 4V28A 3WJYA 2YDSA 3U7BA 1G5AA 2OIIA 3VC6A 3W22A 4MADA 1JD9A 4ZEPA 3NJXA 1TELA 1QOSA 2WZPP 1LLOA 1JW6A 3LD5A 1JZ3A 2QV5A 1YIPA 4A3ZA 4JDOA 4GQGA 2OEMA 2QVNA 1UBPC 2FDJA 4DS0A 1IXPA 1YE6A 1QOTA 1NOVA 4LUKA 3BN6A 3SR7A 4Y1UA 1FWBC 2HWC3 3GNEA 4KETA 4Q22A 3NR0A 5K7JA 3N6HA 2D1ZA 5J48A 3KW3A 7ODCA 2Z1SA 5D30A 2VX6A 1U1JA 4I5UA 2WA4A 4LBRA 3DFHA 2WW5A 1T99A 1F8MA 3C2FA 1IG0A 2ZGOA 3S5OA 4CNTA 3CEPA 2R16A 2DZVA 3E5XA 3BVJA 1QI3A 3L2YA 2A5ZA 4NJIA 4D6EA 5A7SA 2WZ8A 3THQA 4F79A 4WVMB 2W91A 1ZRCA 3O15A 1Q5OA 2YUEA 1UO9A 1V3JA 4FX8A 2BWGA 1CN1A 1G01A 1B3OA 5F5AA 2DP3A 1S0BA 4S3BA 2O9RA 3BIEA 1TB3A 4JCMA 4V1XA 5FPAA 4Z2KA 2WZR1 1RJPA 3BJSA 4RNJA 2RS31 4O54A 3SCRA 4OI0A 5GZDA 4Q8TA 1UZ1A 2VR4A 3WKZA 5ABEA 1FWHC 2ZRWA 2A6WA 1VBA2 4IDZA 1XYFA 3OODA 3W7GA 1WW5A 2PWEA 4PUUA 1ASJ2 4QSFA 4YJ5A 4DY1A 1ALDA 3THCA 1PB0A 3B02A 2HS8A 4Q8VA 3O1RA 2FFCA 2XN1A 4XD5A 4CQAA 4DUVA 3OVPA 3BAWA 2OUHA 3FJ4A 2J13A 2DU0A 2IMRA 1AR63 4M1BA 3B40A 2JFEX 1HJFA 1XG4A 2DW6A 4QJ1A 1R3SA 2YPIA 1DE5A 4NKCA 2X5IB 2Z7KA 4H7ZA 5A3UA 4EXQA 4M6UA 4WVVA 3M3CA 1OC7A 4CCDA 1GK8A 1U22A 1DWHM 2NYYA 1PHMA 1UIOA 3VPLA 3W70A 1QJU1 4MG4A 4NRMA 4ZMGA 1JOJA 1T8XA 1RJRA 4Q8PA 5F4XA 2ZVIA 3DKJA 1GZ9A 3AOFA 1ZBE2 4Q27A 4F2TA 1TPH1 4BDVB 1R081 2XLGA 1O91A 3IJ6A 5A6AA 1U5IA 4HXCA 4XBJA 4R9AA 2XBO3 4XJAA 1VEPA 2O0TA 1PZ8A 1MS3A 1KCZA 1JYCA 4DM1A 4IMEA 4M1RA 1D3HA 1XF0A 1ZBCA 3QEZA 2PHFA 2PDCA 4EZ4A 1W8TA 2BXVA 1IZCA 3CZGA 4GJYA 4U2YA 2BGPA 1V3KA 1PIV1 5LK5A 2XJPA 4FLSA 4QKNA 3VBFA 3FV9A 4PHZA 3TH6A 2Y62A 5LBEA 3GF6A 1PK6B 2EG8A 4P8WA 4XKMA 3UYCA 4IM4A 2YU1A 4PDWB 5KHKA 1IGSA 4ZXOA 2Y0FA 3L68A 4DELA 4EZHA 2YZ4A 4OT7A 2XM2A 5BZAA 5FYMA 5BNOC 4SBVA 4D3WA 1V4YA 5A6BD 3A4WA 4IQJA 2J22A 1CB7B 1MDRA 3N9NA 3CBNA 2BLEA 2XFWA 4WVMA 3M0JA 5BWFA 4PCTA 3ES8A 4J3UA 5FZ7A 2BXZA 2WMHA 3MDWA 1JPMA 4GQ7A 2MUCA 2XPJA 4F40A 1GNYA 4J1OA 1KFCA 5XIAA 4WVWA 3FUOA 2ZHKA 1DTUA 5ABTA 1BQGA 1IZKA 4H04A 1TMF1 3W26A 3H7VA 3U4XA 1HQTA 4GRSA 4YNIA 3WJZA 4FXJA 4HPXA 5I24A 2WC3A 4XTIA 4H9MA 3VBRA 4PTNA 1YFUA 1W1IE 4A22A 1V6VA 3WUCA 3KWXA 1IR1A 3WMSA 1RUH1 1YRRA 4RS5B 5BXPA 1TE6A 2XIQA 4DWSC 4F3JA 3NAPC 4NF7A 4XBKA 3J8F3 1A4MA 2V30A 4XXAA 3MBDA 1U12A 2RJ2A 4TU1A 5AB3A 2ZHLA 1LAJA 2ACQA 4FP3A 5FBJA 4GGBA 3P93A 2PBGA 4PMYA 3MYXA 3KOFA 4HK6A 2GWNA 3R58A 2VVFA 3WX5A 4B3KA 3S7IA 1XGZA 1P48A 5E0CA 1S38A 4KMQA 1NLRA 2MANA 4JXCA 4A4AA 3ZN4A 1XXNA 2ZUTA 1VJ2A 1H1IA 3FXYA 1LTEA 4MPQA 2Z42A 2NX3A 2X5IA 3T4CA 4KFPA 4M81A 2P8BA 4F4RA 2R1DA 3DXUA 1JUHA 2GPTA 1XOYA 1ME7A 2GQ8A 1UQXA 1VENA 3DU0A 1XIHA 4DXZA 1W1PA 4JN7A 2CPUA 2YC2A 1FNZA 2BGNE 3MW7A 3FA3A 5A6ZA 4HPNA 1CBGA 2V82A 4PLMA 4F0RA 3OVQA 3QKEA 5JOXA 2ZXQA 3ARSA 3IJIA 1RQEA 4GUGA 5CBLA 1TWWA 3E9AA 5DQPA 5L73A 1AJKA 5HWJA 1Z7S2 4GJJA 4G7EB 1WXZA 3BODA 3FS2A 2XINA 2WBGA 3B01A 4MF4A 3ATGA 4DO4A 1X6LA 4QE5A 3RMJA 3VZXA 3ROUA 1RIRA 4JKLA 1X8CA 3HPFA 5D02A 3MHGA 3WW3A 5CJNA 3C3VA 3GWQA 1VB9A 2BGOA 1W2PA 1R093 1UCXA 3HV9A 1CVNA 1PK6A 1OFNA 3TSBA 2GUUA 5HMFA 1SDDB 4PDWA 3H50A 3K8LA 4U3CA 5A6QA 1QDOA 4YM2A 1F8VA 3GB6A 4YYFA 1EGVA 4LUYA 3QKZA 3H1WA 4BWLC 3VUOA 2JG9C 1ML1A 1PX3A 1CB2A 3DYOA 2ZGKA 3ACIA 2FZ1A 4RGGA 1COV3 2OGJA 3LGGA 2ADAA 3CASA 1BLZA 3VNKA 2ZA2A 3A13A 1YFWA 2OXNA 3HTWA 4LT9A 2OO6A 4CP1A 1M4WA 1QJX3 2TUNA 5JR2A 1THFD 2R071 5FOBB 3FLRA 4Q4V1 3OVGA 3TLLA 4FCAA 3O5SA 5T54A 1UZHA 3O05A 1AR72 4HK8A 2IXIA 1KR1A 2TPSA 4OUIA 1NY72 2HVMA 3IS4A 2A7PA 1RH9A 5FLIA 2V4VA 2DZXA 3S46A 1DHKB 4ASLA 4I9AA 4RS5A 4K21A 4QPIB 5FJRA 1LOEA 2WO7A 4NAOA 2NP0A 2DVUA 3GU2A 4URIA 3CUIA 3F2BA 3ZFFB 2W27A 2WSRA 3IPVB 5FJHA 2LM3A 3CPGA 4GH4C 1OJXA 5J37A 2YL5A 4AD5A 1EAH3 5AHMA 3B0PA 1ELSA 3RNDA 1UKQA 1UR8A 2IXVA 3GD6A 1OPOA 4AVFA 2GJNA 5BRBA 4NX0A 3SUTA 3APGA 2WWDA 4FNUA 1E6QM 4LK7A 2V8ZA 5EU9A 2ZX1A 1T5AA 3PZUA 4O17A 4O0ZA 1KLYA 3KTCA 1MEC2 5A5WA 1OHFA 1XM3A 3NCOA 4HSOA 4CKQA 3A4JA 1PWLA 3TV8A 3P0WA 5CJ5A 5I07A 4MNLA 1HRV1 2ZUUA 2D73A 2HVNA 4Q4QA 5D9PA 3ACGA 2JQXA 3W84A 1KFLA 4R27A 3IIXA 4M0NA 3OOQA 1AL8A 5TQLA 3G18A 4CCOA 3OGJA 2VMFA 4LKFA 3C7HA 1REDA 3EWWA 3WD4A 2X1UA 5FBZA 4I0BA 1OFEA 2J24A 2Z4GA 1VR6A 1S2EA 2WJFA 1H1YA 3GDBA 1OD8A 1T6MA 1A5OC 4GHRA 3H54A 4U33A 4HVOA 1AYM2 3CTTA 3CQJA 5BOOA 3QQWA 1UIPA 4D6DA 2QV4A 2RM23 4IV3C 1PO21 1D4VB 2J78A 3KLSA 1HXJA 1GKBA 4PCRA 1ZBA1 4M82A 5HQLA 1B35B 3PZOA 4RW5A 3WQDA 3GXUA 3H1MA 4Y20B 4RDWA 2JWPA 1XBVA 4ZZ5A 4H8VA 5MKGB 3PVEA 4LNCA 4GY0A 1Q8VA 1JUIA 1CX4A 2GN3A 3AYDA 3S1XA 3PUSA 1G9HA 3N4AA 4U2ZA 1RBOB 5DX7A 4MGSA 1DOSA 3OOXA 3L65A 4PTMA 2XJVA 2GJLA 2RDWA 4YG3A 1BTMA 3W6YA 3S6PA 2YA1A 1KFWA 2PTWA 4HMNA 3QR3A 4IL7A 5D37A 1UD5A 4O19A 3MMUA 1SFYA 3KHCA 3EMQA 2YBPA 3AKPA 5C2CA 3UNPA 1F73A 5BNPB 1V51A 1XYMA 1NY1A 3PDQA 3ZLFA 3WX7A 5AHNA 3AYVA 4IL0A 4QJ5B 4C6FA 2XG3A 1UPPA 1ZAJA 1HQNA 4LYRA 2FZDA 1LB2A 4UQ9A 4DJFC 4J5NA 2UY5A 3ZM8A 4NZ1A 4ZGYA 3CKHA 1EHAA 3NQBA 4MNKA 3CJXA 4B90A 1BQPA 3NV4A 1DHKA 1ULOA 1OLRA 2HNHA 4R9CA 1NM9A 4QPIA 1OCBA 2HZGA 2VX5A 4R33A 3I2GA 1JZ5A 2XIBA 2QLYA 4UW3A 5JZGB 3RDKA 5DAVA 1V5XA 3ZFFA 1ZJBA 3L0KA 3M5ZA 1RZMA 1H6XA 1BMV1 3WLMA 1RUG3 5GNZA 2CERA 3IPVA 3OB8A 3VZKA 2ZZ7A 5H8PA 3CHEA 3H70A 3AXMA 3AUOA 1QI0A 3U78A 1BFNA 5C9UA 3NPXA 3N36A 3S30A 2PWUA 1WAWA 1GFF2 2UU8A 2GUBA 2YV8A 3TNBA 1A3XA 1LBLA 3DCQA 4DFSA 2TNFA 3RMEA 4RZ4A 3W88A 2DIKA 1B3WA 5FUNA 1YQ6A 2O4MA 3WQPA 5LB6A 2PZ0A 2DZSA 4DQAA 2BHYA 3BSGA 2J7HA 5CZJA 2HWD3 2AACA 1X6NA 1XYCA 2BP1A 1H49A 3MSRA 3PZNA 3QH7A 3VDDB 1QWGA 5C9RA 1PVC3 1XV8A 2DT2A 4K7JA 2ORZA 4L64A 4PMDA 2WVTA 3H21A 2QQIA 2GUYA 3CZLA 3BICA 1FUYA 3BW4A 3EPMA 3EWDA 2F6UA 2ZS6B 1G4TA 1L0PA 3RI8A 1WA6X 5D04C 4LUJA 4J7RA 1KXVA 2X40A 2CW6A 1UHVA 5H8MA 4YGCA 2OQYA 3MKVA 4YVPA 4K1YA 1UR0A 1WZKA 4ZTYA 3WQEA 5CCZA 1B35A 3LG3A 2ZXBA 4FP2A 4LJHA 4Y20A 1QFEA 2JENA 3ETQA 1J3PA 2WLYA 2PHTA 4JTUA 5MKGA 2DDUA 4EXAA 1FT9A 4NASA 4RNIA 3VA8A 1LWHA 1BXHA 3G22A 3TTSA 1XU2A 1V03A 3T1GA 1DWJM 3HPZA 4JV4A 1R7AA 3TONA 3VOFA 4CA9A 3ZPYA 4FNPA 1OQDA 3WBAA 1KM1A 3FX3A 3MU7A 4Q6JA 4BISA 1B0IA 4BZ4A 4BEQA 3SCHA 1Y9QA 3L4TA 1VRH3 4H6KA 3PPHA 3NXLA 1UPSA 4DPPA 3PVOA 2J4GA 4JX5A 4XAZA 3W82A 2YROA 5BNPA 2ASHA 1C29A 3KS6A 1UXXX 3UG3A 4BU2A 3HPSA 2P3YA 1SFLA 1XP3A 2Y5EA 2VCAA 2W92A 2R063 2QCFA 1LKNA 2WZIA 3N35A 3V5CA 2E53A 4TTGA 1WDDA 3T08A 3NQ2A 4FPHA 2R94A 3QOMA 1QHDA 3B9EA 3UF9A 2WVVB 2C26A 3PB2A 4UW6A 3UCQA 3T30A 3BTZA 5JR7B 1S2WA 2J1TA 2XWDA 5DRCA 1M68A 2OT1A 5CBIA 1JHJA 1HRI1 2OA2A 4JQTA 1XLHA 2IVJA 3D5HA 4EPKA 3LXCA 1NQDA 2CFFA 4AZBA 4IUGA 3S8HA 2VBBA 2Y70A 1GOHA 1NTHA 3KVMA 4UR8A 1E6RA 3WD3A 5FY8A 5HWMA 3GIPA 2JIEA 3LEGA 2QF8A 3LCPA 5FAXA 4UQAA 3W9AA 5BXSA 4H1ZA 3GBEA 1J0IA 3SUSA 4GJZA 3V4BA 2QZ2A 3H6OA 4BI6A 1ZRFA 1SHWB 4NJKA 7A3HA 1R6WA 3CU2A 1WUFA 1TUXA 3GO2A 2NQ9A 4XTMA 5FO7B 1YXCA 5JWPA 4Q26A 4GMP3 4KIEA 1RUF1 4LV9A 5F1VA 3O14A 4XFAA 4N7IA 3CXOA 1SZRA 5BY5A 1K6AA 3N6JA 1W1A1 1DPMA 1G4EA 2BU9A 3LDRA 3SXWA 2WZEA 1ONWA 1TPDA 3N2XA 2O7SA 1W9YA 1W8HA 4LKEA 1KNWA 2VEPA 4LRTA 2FHBA 1VBB2 5G1YA 1O3SA 4XFCA 4BLJA 3UPBA 1QUMA 2CITA 4AIUA 2CBVA 2W68A 4XZPA 3QGVA 2BNNA 2VGFA 4A35A 3WW1A 1WLCA 5I91A 1EA9C 2E8YA 1K45A 1G9DA 4ZQRA 3ZXKA 2RS53 5EMKA 2D6LX 4UFJA 5FPXA 2A21A 2J6VA 5FF7A 4YTQA 1ZAHA 1O4UA 2QDHA 1GQLA 3VHNA 5BU6A 3FFSA 4ZHNA 1W2OA 1QNOA 1FP9A 3E0IA 4H8UA 1XRTA 1W39A 3VM5A 5I00A 1O1HA 2Y0IA 3CYJA 1U5YA 3MLKA 2FDSA 4JYFA 4RYDA 3AMNA 1NFPA 1PM4A 3WBXA 1EJXC 2IFRA 2VOWA 5CJMA 2TODA 3EDJA 2RS13 3TQKA 3N12A 1C8M2 3UG4A 2YPDA 3BV4A 3WQ1A 4K8RB 3P5ZA 2ZZ4A 3F4CA 3IUDA 6CGTA 1QXPA 1FH8A 4FMVA 2HKXA 1JG9A 3AXKA 3DGBA 2P6CA 3ACHA 5DN2A 1HKMA 1D8WA 3R0KA 3OLGA 5CZTA 4P5HA 1LWJA 2X5IC 2WVVA 3O2LA 1OZMA 4RKAA 3BAYA 5LNVA 1UB3A 1XU1A 3T3YA 2OX4A 5GNYA 1HJVA 4XFHA 2DH3A 1UYPA 4IJCA 1UOKA 4OQ9A 4LVFA 2Z2BA 4W86A 3UZZA 1XLEA 1Z41A 3ELNA 1TNRA 3QZ6A 3OTFA 3VBUA 1SSGA 1UYZA 4LX4A 1KFJA 3PBWA 1FX5A 4IEOA 4Q7BA 1PO13 3C8FA 4B9ZA 5KHGA 3GALA 5J36A 3JZVA 3UESA 4RL3A 3HIJA 1W6PB 1W1B1 1VFFA 5FRAA 4UR9A 3DFTA 5K9CA 2BB0A 3URNA 3V1PA 4A2RA 4Z07A 3IRDA 5EMUA 1UNBA 1GLHA 3OD0A 1YIXA 3AP7A 2GJRA 4EROA 3WMBA 3QV8A 1PK6C 2D6OX 2F6KA 4HMDA 2VOTA 3I10A 4PDWC 4JKMA 4IW3A 5EFFA 5HCAA 1EEPA 4FI9A 4TV6A 4S23A 3K8MA 2ACRA 1HJUA 3OCPA 3B0UX 2DJXA 2RDQA 1B2YA 2ZGTA 1ISVA 1EF2A 1SGJA 2ATMA 1JVNA 1JI6A 3NZGA 4ROPA 5HXMA 4LO8A 1OX4B 4CUAA 3AMPA 4YWSA 4OV4A 1HB4A 2ZACA 3GHRA 4OV9A 1EC9A 1G4PA 1VBC3 5E88A 4QSHA 4PIXA 5B2GB 4JHOA 2FGZA 1C4RA 1GQKA 5GJMA 4JQ2A 1F07A 2RHGA 3IZOA 4BF9A 3SSZA 3L4ZA 4QX8A 1W2NA 2XFFA 4LBNA 1K1DA 5DAQA 3PJYA 3A3HA 1ZBKA 4RS5C 5FO8B 3NL3A 2WSKA 2UYAA 4Q3MA 2VWTA 4ZXLA 3R7MA 4L11A 3CUFA 4W87A 5DXXA 5MF5A 4I9JA 3VOHA 3B00A 3ANYA 3R43A 3LWCA 1EDTA 1KRBC 2JF6A 1MWOA 4P7NA 5FF2A 3PJTA 2EPOA 4C1LA 3N11A 3TWIA 1LQ0A 3AFBA 3TA9A 4RGKA 4XIOA 1GUVA 2YXGA 1NELA 2PDHA 4TVDA 4J3WA 4QQUA 5T91A 3GVGA 2CWNA 3LCLA 4P2VA 1G0CA 3TW6A 4GH3A 4CD4A 2REQB 2PAEA 4DY3A 2W0UA 1F3EA 2Q3OA 5M1TA 4Q4Y3 3ZLHA 2ZX8A 4HNNA 1FPN2 2RDSA 3POJA 4A7YA 3ZSSA 3IDCB 1XYBA 1E9ZB 3SJ3A 3QF0A 4LC6A 4RE4A 3OA3A 3OEAA 1EXPA 3M0XA 1XYNA 1KS5A 3VNIA 1US2A 2A6LA 2YGYA 4IJBA 2Z6IA 5FZ9A 2VMIA 2OKXA 1YDVA 2HWB1 1DZQA 2FH8A 2D43A 2JIJA 1W6PA 1UZ4A 4RDZA 1M3UA 3BAJA 3WD5A 3ZYIB 1UOFA 4D2JA 2JG8B 3ABZA 1ZBWA 1IWPA 2C6SA 1H7NA 1W5OA 3PF3A 1CYGA 1GZCA 3CF6E 5G4HC 4C6MA 3Q8FA 4A05A 2F6BA 5FZIA 4WUIA 3NDZA 1IR2A 1TV7A 5DDJ1 5GJPA 1D0GA 4NVTA 2FHCA 4BLIA 2AGKA 1ZM1A 5JLVA 3E0LA 4N0RA 3WHTA 4F0KA 2KAUC 3PK7A 5BW6A 3WH6A 3AJYA 3BK0A 3IK4A 2VULA 1YXDA 2XGZA 4GFSA 4W8BA 3SQSA 1VIWB 4M80A 1XJBA 2ARCA 4URAA 3DI1A 3PUQA 4QG9A 4WSKA 3ZR5A 2FDGA 3K46A 5GPRA 4Q5OA 2PHLA 3EWZA 1JDCA 1UKSA 1SLLA 1OX4A 4K40A 3GHMA 5CZ0A 4O0QA 1RCOB 4EWJA 2NLRA 3VD5A 1UOJA 3ITYA 4AB4A 2XDFA 2ZC1A 1HXS3 2WKGA 2BV4A 5K0UB 2H0BA 1QEXA 2R1MA 1POV0 4TLGA 3ZYBA 3VABA 3CO4A 2ZA9A 3ZVHA 5A80A 3F2ZA 4PB3A 2VEIA 2J77A 1E6PA 4QPIC 2VUDA 1EJUC 5CC7A 4TXWA 4WDXA 1LUCB 9RUBA 2CBJA 3VKDA 1OI6A 1DQ6A 4X9YA 3XISA 3ZFFC 2GGIA 4JIQA 4AE2A 4CD8A 1H0BA 1LM1A 1WLTA 3MPBA 4DF0A 3H3ZA 2C4XA 3NQEA 1EPVA 1XCWA 3T2QA 1LLZA 5CKMA 2DT3A 2NUWA 3HVDA 1UU6A 2ZMKA 3HZ3A 3X29B 3TNPB 2FTYA 4MUZA 4HOZA 4I7VA 2XVGA 1A3WA 2ZGLA 3IDEA 3V1HA 2MHFA 3RWKX 5FP7A 2HJIA 3W58A 1AR81 1UP0A 4GUHA 4N6EA 2C18A 4OECA 5I09A 4UXAA 3EB2A 4AVSA 4GIRA 4MHBA 3PAJA 4UMCA 2DU1A 3IMMA 4B16A 3UNDA 3AAMA 2YFUA 4RFRB 2OO0A 2WHJA 3KZ4C 4CNSA 4D94A 3K75B 3U1XA 1UY4A 4FOVA 3TKFA 3VDBA 4RR3B 1UMIA 3SUWA 1HIZA 5LNWA 5I93A 3QLLA 4CE8A 3TEXA 1HDKA 4DYEA 1PSCA 1ODUA 4X6QB 4KH9A 4Q8LA 3LCFA 5AC6A 3UCCA 3FGCB 5BV6A 1IGOA 2B4KA 2XZ9A 4F83A 1XIDA 3AYEA 3WEZA 4UOQA 2JG8A 4RK8A 4RUBA 4BK5A 1B35C 3Q67A 5FYYA 5G2IA 5DMNA 4H01A 3U2OA 5A70A 5AC5A 3E2SA 2Y6ZA 4XJ8A 2IKIA 1RR2A 2ZGUA 3FLUA 3CV7A 4YGBA 3W1RA 2UZ9A 3K13A 3O1OA 5DRIA 4XPVA 2A3EA 2B42B 2GSJA 2Q8DA 4UTFA 4UOZA 3K3OA 3LDBA 1HW6A 4Y9NA 2J1RA 4OKDA 4KWWA 2YA2A 3NYDA 5IUQA 2A7NA 1V79A 1CWPA 5EYYA 1W54A 1S2TA 4WY0B 1ZAIA 1FHDA 3OGSA 2CHRA 3RJ2X 2VVDA 5A2BA 1HL8A 4CVWA 1JEZA 3GZ3A 1VFUA 4TX9A 1HO1A 1IT8A 3QYSA 2WS92 3HIFA 4WKHA 3PLQA 4PH6A 4YIWA 2ZKMX 5BNPC 1PUDA 1LP6A 4P7LA 1F5JA 4GC3A 2J79A 2J7DA 2WB5A 3SRKA 3WBWA 3LHTA 2EXKA 2O92A 2QDEA 3WEMA 1O3QA 2NXGA 5K0UA 3MI6A 2HTMA 1E5SA 4HN4A 2RS33 3LPGA 4YZ1A 3OBKA 4GISA 1A0DA 1NF7A 3NEVA 3RX2A 4N9BA 3MJYA 1EOMA 4L4OA 1EFZA 4JRAA 1LUCA 1U5XA 5JZGC 3R79A 3Q9OA 3UPMA 5DZGA 1UUQA 2PWDA 4CCKA 4OIFA 3THDA 4RZ6A 3FJ6A 5M2FX 2E51A 3L2MA 2YXOA 2WZHA 3O1PA 1KXQA 3W72A 5FQ0B 4DBUA 1FWJC 1PTAA 2ZGPA 2O56A 3QN3A 3TEVA 4IH3A 3DFPA 2W08A 3M3QA 2ZOEB 2K2SA 1J11A 1V0MA 2OS2A 4KWKA 2FVKA 1WCGA 4NNBA 1WW4A 4XABA 3VDDC 2CIPA 2A6NA 4AHWA 1JZ7A 1DF0A 4Y33A 1WZMA 2Y88A 2OOFA 1H2KA 4IXHA 1I1XA 4OZOA 3LTYA 3QYQA 4XF1A 1DORA 3PVNA 1LEMA 1ZBE1 4H9ZA 1WE5A 3GR4A 1XE0A 4RR3A 2UY9A 1R083 2FHRA 3OGVA 5D33A 6REQB 1VMJA 2WNUB 1K8CA 1PKMA 2UYBA 3BJTA 4HCDA 4O15A 1W0PA 1K03A 5G04L 4LNVA 5D05A 1TCMA 3O06A 3ARQA 1TX0A 1CX1A 2J1SA 1EBGA 4YYOA 4B4QA 3LQGA 3FGCA 2QCMA 5E09A 4JGYB 2OYKA 2P6HA 2QQWA 1V9U2 5HCBA 2CZDA 1POV3 3KZSA 3MIBA 1XGDA 1RVGA 4FX6M 2FZMA 2AYHA 1PIV3 2GC1A 4IFOA 2CYFA 1DQUA 1VRXA 3LEPA 1QJY3 1Z7AA 5FD0A 3CK5A 3WG3A 1HP4A 2RUSA 4C6OA 1Q2RA 2F4PA 3DYPA 1BYBA 3VBSA 3O1NA 1HX0A 1XDJA 5M17A 4JKKA 2PURA 4JD4A 1QNRA 4H7VA 1WW6A 3BLPX 4QQHA 3CMFA 3DDMA 5JOZA 4WY0A 3AMLA 3CWHA 4CUCA 1BEV3 3T09A 1CLVA 2EPHA 2I5IA 4PMVA 1TYGA 3RO8A 3W5MA 1WYIA 2SFPA 4XIAA 3A5VA 1ENQA 5CPLA 4D6RA 3N1AA 1QOPA 3EOSA 5HR7A 1TTPA 2PMQA 3LSBA 3H26A 1R3YA 2VW2A 4NJHA 3LZ3A 4XUQA 1IIGA 1OWQA 3GXMA 2V67A 5A6YA 1ZNNA 3GTXA 2G3IA 1M1BA 1UMZA 4C1WA 4GIEA 4ZU4A 1QK0A 3K1GA 5EYXA 1PCWA 4TMBA 4XZBA 5T9BG 3LFIA 2DVTA 3LHWA 3E2QA 3WQFA 3TB0A 3WQBA 2Z1XA 5DQ0A 2V3EA 2K0GA 1HKJA 2W94A 4QD2A 3O16A 1NQKA 1KEXA 3PUIA 2EIBA 3PM6A 2WJSA 4PUJA 3MW2A 4WJXA 2ZRVA 1PTDA 1I3HA 4A7ZA 5AYBA 5C5UA 2WHMA 3HGJA 4H6QA 4QR6A 3SKJE 4PC8A 1P1XA 5FZBA 1RJ7A 1CWYA 5HATA 4DBDA 1VYPX 3PUGA 4LO7A 3NVTA 2G4IA 3CHVA 3KQRA 2QDGA 1DZRA 1G8WA 2XFRA 4XQDA 1E70M 1EQPA 2TEPA 2Y38A 5FOJB 3MUCA 1NXD1 1WW7A 3B7MA 3NNJA 1PHWA 1PKNA 4AZ5A 3IACA 4M3CF 4Q8WA 2GC2A 2FGLA 2J88A 5FQ0A 4U31A 1Q66A 2ACUA 4AFMA 1F9KA 5IVJA 2GVYA 1LJYA 2HPIA 1P8JA 3B0YA 3ME2A 4V27A 4GB32 2X1SA 4JTTA 3BH4A 4EPBC 2E7AA 1KKOA 3T0DA 3FKKA 1LTDA 1UUMA 1BGGA 2VY0A 3UGHA 4HA0A 3VCNA 4FTSA 1UW9A 2Y1HA 2OQLA 3MDUA 2NV1A 1NWSA 4ZKTB 4TWTA 1J8VA 4DHGA 1W8FA 3TUUA 3N18A 2X2YA 4YLWA 2CWXA 2YMZA 4LOSA 4AU0A 3B9AA 5DXDA 2X1RA 4W93A 2WNUA 6REQA 1XYLA 4QXHA 4O14A 1AODA 3BARA 2A7AA 1EC8A 5LY2A 1TQJA 3W24A 3DHUA 1AW2A 2PDKA 3FKRA 3UKVA 2XGIA 2RJHA 2D0FA 3QW4B 4W88A 4JGYA 1TFVA 3KHDA 4E3TA 4OHQA 4RV8A 5L9VA 3H8OA 2QVSB 4ZQPA 4AEDA 4PUWA 2UY8A 1EZWA 2WR9A 3VGBA 3A4UA 4X9SA 2WPGA 2DVFA 2IQ0A 4HZ8A 1A53A 3QHMA 1WBHA 2G3FA 4ITCA 3WQ0A 4Y5Z0 4EF8A 4G8TA 2A3HA 3ITOA 2ODOA 2Y7FA 3R13A 2ADEA 4LHLA 4ZO7A 3ZO0B 4MUVA 1TCDA 1EUUA 1K7XA 2POTA 3IN9A 3WDTA 3EMCA 1M03A 4B5SA 1KBIA 3L4VA 4HMCA 4YCOA 2VDHA 1T96A 1EYWA 4S3KA 1SCRA 3PZ9A 1KC7A 3ITVA 5ABHA 1CXKA 2W61A 2R073 2DVXA 4BH9A 3WP6A 3W7CA 4FOJA 3PPFA 3N2MA 2IFWA 1FP8A 1RUI2 2XIMA 4EOUA 3EX4A 3VDCA 2ZEWA 2WC7A 3UVIA 1AR71 2CZEA 1RHI3 1UY1A 4MGYE 3L4WA 3GDMA 4UBPC 4NL1A 3SN0A 1X96A 4Q29A 3VGFA 4A3RA 4UF0B 4QXBA 3IK2A 1W37A 2PE4A 4AYSA 1UD1A 4LV4A 1J59A 1DE6A 1XLDA 1XLCA 2GSHA 3ZSTA 3ZMOA 4LA3A 2EALA 3NKGA 3RF9A 5G2HA 1P0EA 4O57A 1RVF1 3TYDA 4QDWA 4JX6A 3SCUA 1J3RA 3J4UH 4HPGA 3SCQA 4CU6A 1C7SA 2GMMA 3VBOC 1EV12 3A64A 4MB4A 4G1KA 3WLHA 1D8CA 2BY2A 4LF2A 1TPEA 3DFYA 3IIOA 3ZX7A 4K9SA 4LOCA 1W9TA 1RUOA 1GOIA 4J3XA 3EDDA 3L66A 3BB6A 1HRV3 4WM8B 1JCXA 4B8EA 1W9BM 2WO5A 3G0SA 2YXSA 1ZQ5A 1N3QA 3UJSA 4YZ3A 3KQ4B 1J3QA 4FOWA 3W83A 5JMCA 1B57A 5A8OA 1Q85A 5CZSA 1XLGA 3JW7A 4BQWA 3ALGA 3I7RA 4JL2A 4JPGA 7CGTA 1V6MA 2QJGA 1GTHA 1V0AA 1G7VA 4KCUA 4RX0A 4D9PA 1E5JA 4E8DA 3R8HA 1WPCA 2YCKX 1XRVA 2J1UA 3BC9A 1CGUA 1EP2A 4IIDA 2YB4A 4UYBA 1S3TC 1AYM1 2RG4A 3GIYA 4LIUA 3R10A 2NLYA 1PO23