1IQAA

Crystal structure of the extracellular domain of mouse rank ligand
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
156
structure length
156
Chain Sequence
AQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cytokine
molecule keywords RECEPTOR ACTIVATOR OF NUCLEAR FACTOR KAPPA B LIGAND
publication title Crystal structure of the extracellular domain of mouse RANK ligand at 2.2-A resolution.
pubmed doi rcsb
source organism Mus musculus
total genus 31
structure length 156
sequence length 156
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1iqaA00
3QD6A 4RSUA 1DG6A 2RJLA 4KGQA 1U5ZA 4QQLA 1D0GA 4N90A 1OQEA 2HEYF 1D2QA 1TNFA 3K51A 2TNFA 1I9RA 4KG8A 2Z5WA 3FC0A 3ME2A 1KD7A 1ALYA 2OIIA 3B9IA 4QQPA 1OQDA 2QDNA 1PK6A 3QBQA 1D4VB 4QQ2A 4KGGA 3TYJA 5KC6A 2AZ5A 4OUSA 1PK6C 2WNUA 4HT1T 2Q1MA 5KC5A 3TWIA 4MXWA 2WNVA 1GR3A 4EN0A 1C28A 4D7YA 3V56A 2RE9A 5TSWA 3B94A 2WNUC 1IQAA 3URFA 1PK6B 4G4FA 4QQHA 2E7AA 4G3YC 3IT8A 2JG9A 4QPYA 5L36A 1RJ8A 2JG8A 1XU2A 4MSVA 2R30A 1TNRA 4NN0A 2WNUB 3ALQA 3LKJA 1XU1A 2JG9C 4MXWB 2RJKA 2O0OA 2WNVB 2KA3A 4QQOA 2ZJCA 2QE3A 2JG8C 2HEVF 3B93A 2X29A 3AB0A 1U5XA 2R6QA 5HBAA 2HEWF 1O91A 2R32A 2WNVC 1WCKA 4DB5A 3MI8A 2JG9B 1U5YA 1A8MA 1S55A 4TSVA 1DU3D 4E4SA 1C3HA 2JG8B 4GIQA 3L9JT 4TWTA 1RJ7A 3WD5A 4J6GA 1KXGA 4DOUA 5KWRA 4MXVA 3K48A 4E4DX 4F3JA 5BNQA 2TUNA 1JH5A 2ZPXA 1JTZX 4OUMA 2Q8OA 4OULA 5CIRA 5L19A 1OSGA
chains in the Genus database with same CATH superfamily
2E7QA 3POWA 2HYKA 4WVMA 2PHDA 2SBAA 2GMMA 4X8NA 3VBUB 1WW5A 4QHZA 2EXKA 1D2QA 3ZXFA 2JDYA 2TNFA 3KM5A 2GAUA 3MFAA 1YIFA 3OGGA 1B09A 2Z5WA 3SEEA 3N9OA 5D8AB 2Z2SB 2ZS6B 4YVSC 3RVHA 3ZFFC 2IFWA 1X82A 4MGSA 5F9TA 5H9RA 5CFCC 4I30A 2VO5A 5FZOA 4IEVA 3PLQA 2O14A 2GN3A 5I0UA 3PURA 1V9U2 3WDXA 5GLZA 3DL3A 4KGGA 1JHNA 4TTGA 2YUEA 5LCWL 2ZGQA 4AFBA 1UPSA 1UZVA 1W6NB 5FLJA 2VW2A 4FAGA 3J7MA 2ZAHA 2VBBA 1AR91 4EZHA 3S5QA 5IVYA 2JE9A 4CEWA 3SLIA 2XWJB 1LESA 2PLV3 4ZS2A 5FZHA 5KC5A 1WUVA 4LHSA 4D0QA 5F5QA 1QGLA 3HT1A 5LK7B 2A6WA 3QCWA 4LLOA 1NE4A 4XBLA 2ORXA 1ASJ3 4ES9A 2RHPA 4PDWC 3LDRA 3OB8A 2WNUC 4TLGA 3SISA 1SCSA 5F3CA 3TN92 1MZEA 1NCRC 2YBPA 4BZ4A 2BEOA 3WR0A 3AKPA 2MEV3 4R9DA 1W6PA 2OZJA 1PO11 3I7DA 3AYAA 4GMP0 2AH2A 2HWE3 3NV4A 5D1IA 4BK5A 4LOTA 2QQPA 2R30A 2TBVA 5LA2A 5K8SA 4FI9A 1O5LA 1VBE2 1CN1A 5LRSA 3S5AA 2WFF1 3FLTA 1RUH3 4FFIA 5AC93 2OT7A 2JDKA 4K7JA 4AEJA 1O3TA 5L9BA 2BP6A 1CAWB 2C9KA 2QE3A 2HEVF 1SDWA 3DXUA 4AFMA 5EJ3A 1OLMA 1SFYA 3B00A 1RUI1 3M3OA 5IVVA 4DXRA 2D3SA 3R6SA 1UN1A 2HWD3 2RMU1 4GALA 2X10A 5EJ1B 5IW0A 5A7OA 3BCWA 2DVDA 1W05A 2HWF3 3PIGA 4AL9A 4FOQA 1X8MA 5F39A 1BK1A 3RYRA 4AFCA 1IHMA 3C7HA 3VBSA 1JN2P 3I2DA 4A7KA 5C7GA 2YROA 5DG2A 3I54A 4GIQA 3RNSA 2O1QA 3X29B 2R49A 1MPXA 1RMU1 4Z8BA 1RUG3 2VZPA 1QU0A 4HK8A 4MXVA 4QX3A 1CAVA 4CDUB 4E4DX 4B7EA 4K8FA 3K4DA 4NMIA 2BDRA 5HI0A 1FOD3 2Q30A 4C1XA 1RUNA 4CDXB 4H2AA 4EWAA 1YHFA 1AXYA 5DXDA 3E1F1 4LE4A 1DQ2A 1YFUA 3ZR5A 3S57A 3IIIA 2E53A 1R091 1BEV3 3PVEA 1RINA 3GZAA 5BPXA 2XPJA 1JOJA 1RUD3 2PMWB 4D6QA 2AR6A 5FLIA 1W2AX 1QNWA 2CDOA 4I09A 3DPRA 1Y3TA 3JU9A 5FUIA 1EPZA 1CONA 4LO8A 4AR2A 3C2UA 3KT4A 1I9RA 4NHXA 3USSA 1GMMA 3DGTA 5DABA 3MUY1 3ZFGB 4OQ8A 2FDGA 4N9IA 2DV9A 3J7HA 4QDSA 2CU5A 3I4IA 5CISA 1C8M3 1PK6A 2Y33A 4LKEA 1MS3A 3VZMA 4DRVA 1N1YA 2JX9A 1CGPA 1STMA 4GQ7A 3SNMA 3N9QA 5I0DA 3J8F1 5FXVA 1DZQA 1HB4A 5E8AA 2W92A 4B1MA 5IVBA 3I3EA 1JI6A 4AHYA 5CZKA 1HB3A 1O8SA 4RR3B 4XUQA 1W3XA 2WT1A 3ELNA 1W03A 3RQ0A 4QKFA 4WVMB 4KWLA 1H8VA 1YQ2A 2LS6A 2QJVA 2X05A 4HT1T 2HWC2 3LAGA 2OQ6A 1F9KA 2V72A 1IS3A 3DV8A 4AVAA 4XAEA 4N7IA 3I3MA 3NWKA 1GNYA 1PO13 2IXHA 4Q4Y3 5I8TA 1AYM2 2JIJA 5FYVA 1MEC2 4W6XA 1AHSA 1EY2A 4IEWA 5HCHA 4L97A 1PMJX 2J1EA 3VKFC 2CGPA 3LOIA 4UW5A 4XQ4A 3HBKA 4K1ZA 1WCSA 3O1VA 2WFF3 2XH6A 1NCQA 4UFMA 1V9U1 5FZOB 5CB7A 4A44A 3K2OA 3CJXA 2Y6JA 3USUA 4R4ZA 3TBDA 2XOMA 5LA9A 1LOGA 5F2SA 4P02B 3VDDA 2R1DA 3UKTA 5I93A 2Q5TA 2SLIA 3H7YA 4D8MA 3O1MA 4RFRB 4CEWB 1X8EA 3THCA 3FLRA 3LE0A 3UGGA 2ENRA 4ARXA 2NQYA 2YBKA 2DTYA 3ZYPA 4AI1A 4RGAA 4YG0A 3GYDA 1BVVA 2UU8A 3TN91 3T2TA 3UETA 2AEZA 2R072 2ZX3A 2W1UA 4NO4A 4GWMA 3I2FA 4XBNA 1UKGA 2WNVC 4A4AA 3H8XA 4NRQA 5EIYB 3H7JA 1W6PB 4FT8A 2BOIA 1YFWA 2BW8A 2E9QA 1HKDA 3H0OA 5FZ4A 4ATFA 4E4HA 2ZX2A 1GZCA 2IVIB 2NPIA 2EALA 4DS0A 4OHZA 2VCCA 1MS0A 3FBYA 4YG6A 1VBE1 2J1VA 1LRHA 3JBG2 4YARA 4RA0A 4M00A 1S0IA 2FDHA 2VMCA 1UXXX 2PQQA 5FMOS 1UD1A 3CJIA 3JB8A 3LEGA 2WT0A 3VBUC 4LBMA 1NLQA 2Q4SA 3FX3A 5SV5A 4EJRA 2P17A 2QDRA 4DINB 3NVCA 2JECA 4CCEA 3NJXA 4BQ4A 5JAXA 1W90A 2B9VA 3J7LA 1Y9GA 4KI5M 4RSUA 1XE7A 2FDJA 3C3VA 2Z42A 5FYMA 5FP8A 5I8SA 4XJUA 3VBSB 1SPPA 2ET7A 3ZIWA 4CE8A 1KEXA 3OGVA 1PX3A 5FREA 4OI0A 3NL1A 5F6LB 3DEMA 4BISA 4YM1A 3U11A 5FZ9A 1LJ7A 2Q8DA 4WZCA 1QJX3 3LWCA 2ZACA 1CAVB 4LO5B 1H9PA 1JU4A 1TE1B 1W8NA 2VXJA 4OHYA 5KR7A 2RR12 4IE5A 5FMDA 2V4AA 2ZGTA 4QHOA 4E9KA 2BNNA 1JMUB 4XOGA 4HOOA 3OBZA 3OBTA 4QGLA 4ES8A 3NO8A 1ZRFA 2EIBA 2ARAA 1SQ4A 2A7AA 2H6BA 3HQRA 3EHKA 2GNMA 1FXZA 5B4XA 1XJAA 4K9SA 4XUOA 1SHWB 1HN0A 3R4UA 2DCKA 2FDIA 2WINB 3DPRB 4HMZA 1ZZ8A 2Q1MA 2WBKA 5DUUA 3WF2A 4XABA 2BGCA 1VR3A 1UU6A 5GZEA 3TWIA 3BOPA 4AI3A 5JIUA 5GLTA 4QKDA 5LBBA 1Q43A 1QEXA 3VKNA 2O8QA 3LPGA 4INDA 3BU7A 4A3ZA 2V4VA 4HK9A 4OHVA 4Y20A 1JW6A 1REFA 2XUMA 3CKHA 3D8CA 1PK6B 4CP9A 3DKWA 1P8JA 3B9CA 1UX6A 2OXBA 2JG9A 4DNYA 1QIQA 3IDAA 4KBBA 2D6LX 2BGOA 3PMSA 3S0MA 3WUDA 3SCHA 3ITQA 3E6DA 4P9JA 4QU1A 2ARBA 3OUIA 1G9BA 1RHI3 2QQKA 3BB6A 1OLME 2HWC1 4U36A 4AAPA 1XU1A 1U5IA 1I5PA 3DYOA 1AYM1 4HZFA 1MEC1 5CKQA 4KQ7A 1H2KA 5J98B 1W9YA 3TEXA 3C7GA 4FFHA 3WP4A 2GMEA 2JKXA 1YJKA 4UXAA 1XQNA 4MLOA 4Q0PA 1VBE3 1SBDA 3WDWA 4CDUC 5IAXA 3J4UH 1ODNA 2LTNA 4Q0QA 2ARXA 2XL7A 1NCQB 2C4XA 4XIKA 2BTVC 2J42A 3AMHA 3KV6A 4PI0A 2EAKA 2ZEZA 1LHUA 3MF6A 4CCCA 3K3NA 3USUB 5IK4A 1OF3A 3SCFA 5FYZA 2G4IA 1IOAA 3T2PA 3FE5A 1JZ8A 3VDDB 1O3RA 5SV8A 1QJEA 1SACA 1ZNPA 5FK7A 3SH5A 1GYKA 4ZZ8A 1VAVA 2P34A 1IQDC 2D40A 1DYOA 2TUNA 4ZKTB 3ZIXA 1Q3EA 4M3CA 2GP3A 4YZ1A 2AEYA 2JKBA 2R071 3PL0A 5FXWA 3ZFGC 4NIDA 3ILRA 3C8XA 2UWBA 1J1LA 3QD6A 4LK6A 1ZYBA 2HKXA 1AXKA 4FCAA 5T5OA 1H2LA 5B2GB 1U5ZA 2R042 1W8UA 4YFWA 2HEYF 1S0BA 3FHAA 4KWUA 4LIVA 4EV0A 5IFTA 1O7FA 3AZXA 1JYTA 3JBG1 1S2EA 3DN7A 4N9HA 1AJKA 4QXHA 4XJWA 3BYWA 4RR3C 1J3QA 2X5IA 3RJ2X 4A3XA 1WLTA 1ALYA 3WW1A 1O4TA 3B9IA 5LBFA 1LECA 3CJIB 5EXOA 4R8HA 1W9SA 4B1LA 3OG2A 2W47A 2OS2A 5JXGA 5IK8A 4B29A 2YV8A 2V73A 4YW1A 1JXNA 1RC6A 2WN3A 4TN7A 2H0BA 1UY2A 4QB1A 4D7TA 2QQWA 3E6CC 1ENXA 4ARYA 1F31A 1URXA 1ZX5A 2CTVA 2VW0A 3ACIA 3AM2A 3N7KA 3N9NA 5A1FA 1SPPB 5FPXA 3ZO0B 3OGSA 4ATEA 4XFAA 1R1ZA 1W2UA 1C28A 4UBGA 2RR11 2RDQA 4YGCA 4FXGB 2HWC3 1H1AA 5FP9A 1AUYA 2XLAA 2ZMNA 3PUHA 3LQCA 5FKBA 2DUOA 4CEWC 2BVBA 4WM7A 1KQRA 1VIWB 4MZUA 1MEC3 1GV9A 4OUEA 4G3YC 3WV6A 2DCYA 1RVF2 1JZ4A 3C7OA 2DBIA 5E89A 4FP2A 2PLV2 3Q8BA 2JIGA 3M2MA 4UW6A 4AGVA 1DGWA 5C8WA 3BUCA 4C1WA 1LOBA 3NNMA 2P3KA 2WO1A 4CP1A 4E2QA 1ULEA 1TNRA 2B9UA 1W04A 4WBBA 1N3OA 3PDQA 5FZ1A 3U0ZA 5IVFA 4CVUA 5FK8A 4MUVA 1G8WA 4YW6A 2VY0A 2ZGKA 1H4HA 2D6NA 1J1TA 2EICA 3NNGA 4XETA 2W1WA 1S2BA 5BNNA 3CHXA 2MEV2 4OHWA 4CRQA 1WCDJ 4IEPA 5LATA 2K0GA 3AZZA 1DYPA 3VUOA 2WAAA 4Y20B 1PVC3 2B7YA 3ZSJA 2AYHA 1ACCA 4LIUA 4CP9B 2VMFA 1XC6A 2J22A 3IIAA 3MYXA 3OGRA 4D69A 1ZBA3 4BCUA 2VL4A 1HX6A 1REDA 3HWJA 4AHXA 1NG0A 4COUA 2BWCA 3ROUA 1DGRN 2JG9B 2G19A 2YMZA 3WCSA 3GF6A 3KMHA 3RFRA 1MZFA 1RUH2 5AC92 2C0ZA 4JV4A 1F35A 4ZU4A 1NQDA 4BOWA 5DAWA 1PNFA 5KWRA 4OZXA 4LO7A 3ZLIA 4ET7A 5BY5A 2CGNA 3AZWA 3ASIA 4NHKA 3PJYA 4XUPA 4PQ9A 5HV4A 1DDLA 2C6SA 2QUOA 3LA3A 4F3JA 4I2OA 3WP3A 2HWD2 3LDKA 1QJY3 1YQ6A 2NYYA 4EQVA 2JDAA 3DF0A 2XONA 3VBSC 4AEMA 1QOTA 2WWSA 2W52A 2VNRA 4YG3A 4JGYC 4FTBA 1FYUA 1MS1A 3JCIA 3UJQA 1O4YA 3AK0A 3KVBA 2ZHLA 3WXPA 4PIXA 5K7PA 1AXZA 3M8LA 4ASKA 4B8EA 3BN6A 4HPKA 1RUG2 2ES3A 2QQIA 1W6OA 4IQPA 4Y3OA 2IXKA 2B39A 1D0GA 1V0AA 4HSJA 1BCXA 2ZMLA 1G6NA 2QFEA 1PVXA 1FOD2 2XR4A 1K5JA 4JHTA 3LOBA 5A6QA 1ULPA 3I3QA 3POFA 3I2OA 3QACA 4A7ZA 4CU8A 4A41A 1JS9A 2VOWA 3D6EA 3ME2A 2PHRA 4LUKA 3ZXAC 2WWJA 4W65A 4XPVA 3B69A 4LKFA 1BEV2 2C9AA 2RM23 4Q29A 4UFHA 4AI9A 1S0EA 1OUSA 3UNPA 1MQTA 1HRI2 1RUD2 2QDNA 3DPRC 5EWSA 4BU2A 3QBQA 2PHUA 4OZOA 2HH9A 2ZGPA 1D4VB 4M3CB 5FP4A 1EUUA 5KHIA 3BKZA 5D2AA 2D6KA 2VNGA 3LZZA 2OVUA 2VVDA 4PLOA 2RR13 5FWEA 5FZMA 1Y43B 3U10A 3GBGA 1X7NA 5GZCA 3GBWA 5KC6A 4JZRA 2QQVA 1CZVA 1CZSA 4YFZA 2DCZA 2R041 5FY8A 3CQOA 5DUVA 3KF3A 1PK6C 2WFPA 1HB1A 1GOHA 1OPMA 2DURA 2BERA 1W2NA 2AUYA 3FUQA 1JYNA 5CG8A 2GMPA 2R063 1ODMA 4IL7A 1C8M2 2VULA 4K6BA 1WD4A 5J7MA 2X5IB 1WGPA 4K1YA 4CPBD 1GKBA 4YYOA 5CKMA 1X9TA 3ACHA 2BNMA 1VRBA 4YGDA 1TG7A 1FNYA 3ST7A 4GWNA 4QQHA 1QMJA 4KU8A 4LBKA 3IT8A 1G9AA 4UF0A 2G9FA 4MHRA 4RGKA 5DG1A 2G1MA 3I59A 4AEKA 5HV0A 5L36A 3H1MA 4QXKA 4Q4Y2 1BKZA 5FUNA 5H9PA 5FY5A 4DUXA 2YDEA 4Y1XA 1S0JA 4W6YA 5AVPA 3FHIB 5CBLA 1DGRA 3JUUA 1OC1A 4FQZA 1CIWA 1OXCA 2MHFA 3A21A 4FFGA 1WA4A 4QKBA 5DN2A 4A2UA 4LHLA 2GALA 2EIEA 1SCRA 1ULFA 1S0DA 2B46X 2BVVA 2LALA 4YZ3A 5FRAA 3IDBB 1G9DA 3WNPA 4F83A 3AKRA 5GZGA 1FAYA 4BHPA 3B3QE 1NE6A 2R1BA 3MW2A 4OYUA 4WM7B 2YG0A 4AQ2A 3PHMA 1KFUL 4LBOA 1RVF1 2VJXA 1CJPA 1WW6A 2XUEA 1IPSA 3FMGA 1BBT2 2PLV1 2ADEA 5F3IA 1YJLA 1GP6A 4XYXA 2IUWA 2DBNA 4MG2A 3AZVA 4AG4A 4NHLA 1H8TA 1C3HA 3AYEA 3MV11 2VE1A 2P6CA 2VQAA 2ZX4A 1OA3A 4GD4A 4SBVA 4M3CE 2ET1A 5GLVA 1KXGA 2B8MA 5C8CA 2W2IA 3WG3A 1RYYA 3GM8A 1W0NA 2VZSA 3D4KA 2FMDA 4FPOB 3I8TA 3ATGA 1MS9A 3ACGA 2MEV1 2GC0A 1ZVFA 1JTZX 5BNNB 3SITA 2DUPA 1GNZA 2QQLA 3CEWA 3VZNA 2VVEA 5FPZA 5CEHA 3RMYA 1VLNA 1VBA3 2YY1A 5F37A 2QTWB 3TRSB 1LHWA 4UFIA 4RYDA 4AVTA 1CAUA 4P9XA 3KVAA 4XQWA 5FFOC 2ZXQA 4D94A 5KXDA 3OGJA 5DUXA 3V0BA 2RJLA 1RUH1 5AC91 4E8DA 5GJ6A 1ZA4A 2EVXA 1PX4A 4BMEA 1E5RA 4XFHA 2JE7A 1TZOA 3HN1A 2WZR3 5ABJA 4UYBA 1FT9A 4XTPA 3CDZB 2RDSA 2XVGA 3D0JA 5JR7B 2HWD1 4I0AA 1L7QA 3JZVA 2QVSB 4IEYA 3T1LA 2EIDA 1Z78A 2ID4A 4IEUA 2OUHA 2ZX0A 5FO8B 1Y9MA 2QQOA 5ACA2 4UFLA 4E2GA 1HRV3 2XJSA 3KB5A 3W9AA 2HWB3 2BFUL 1RUG1 4PQQA 1LENA 2FZ2A 1DQ4A 1GU3A 3LB9A 4HXCA 1ZRDA 4H14A 4HPKB 1DF0A 2AZ5A 1K45A 1QJX2 5F5IA 1W6OB 1CZTA 5F5AA 3H8RA 4HKLA 1FOD1 2XG3A 4FFFA 2GC3A 1AVBA 4CU6A 3MLJA 3HD8B 1LGNA 4NRPA 1WLCA 1H30A 4AVSA 4MOAA 5A3PA 2ZZJA 3U14A 3TAYA 1BEV1 5BNOA 1R1A2 2XHNA 4GKXA 3OUHA 1W9WA 3ES4A 4GKYA 1HRI1 1RUD1 2Q1ZB 2OW4A 3KV9A 1OFNA 1MQTB 2PAMA 3URFA 1O4ZA 3LEIA 2WNEA 3EMRA 4IEZA 3BTYA 4RN5A 4IV1A 3CIHA 5L7OA 3PUSA 4JRAA 4E2SA 2F4PA 2WR9A 5JPNB 4FSJA 4IV3A 4YW4A 1UOGA 4MSVA 3AP6A 3VBHC 4UW4A 3ZVXA 5C3PA 1O3SA 2FZ1A 1RVF3 1C8M1 3RGBA 4AF9A 2IZWA 3M7AA 2JG9C 1WZXA 3IMMA 3NW4A 4CTEA 1A3KA 4O61A 1YO8A 4Q4X2 1RGSA 4BK4A 3H8OA 1AR82 4A7YA 4GJZA 1K5MA 4LBJA 4JGZA 4NIAA 1S0FA 3VZJA 1ZZ9A 4I0WB 1RHI2 3KSCA 2JJ6A 4DB5A 1K42A 5IAVA 4MGIE 4UF0B 4AFDA 5DAXA 2VOVA 2VCAA 4GJYA 3O1PA 3I59B 4Q4Y1 3ZFEA 2DF7A 5A1AA 3WG4A 4B4QA 2VOTA 4PBOA 4TWTA 1G86A 1Y9QA 1BMV2 1A6CA 3PUAA 5T5LA 3K3OA 4COYA 1UF2C 3IB3A 4FOVA 4IEXA 3RRDA 3ZXJA 4B4PA 5A1LA 1ZRRA 3KGLA 4G9SB 4PJYA 5FYSA 1XYNA 1APNA 1F4HA 2XMLA 1WBLA 5C70A 4N43A 5A7WA 5F7UA 1L7RA 1H1MA 1T2XA 1PGL2 2UURA 1NQJA 4MO3M 3NNFA 5L19A 1VBD2 3G6JB 1DQ1A 2XJTA 4J1WA 1Q8VA 1C57A 1BBT1 2XQXA 4JQRA 4LHNA 5H9QA 1YXWA 2P37A 4C91A 4KWJA 4CDQA 1WLDA 4HFSA 1GOFA 3UESA 2GC1A 1US2A 3GCXA 1HN1A 1XNKA 1UMIA 1H8TB 4MX3A 4XURA 4AEDA 5C8CB 5FXXA 3LFMA 4XFCA 4CCLA 1C5IA 3O1TA 3QH7A 1H9WA 3M70A 4YGEA 2YPJA 1QXPA 2E51A 4UWDA 3GALA 4JDOA 3ZSKA 5FOBB 3VL9A 3RG0A 4XE9A 1UZYA 2UYBA 3AP9A 3AVRA 3EBRA 1CD3G 5FJHA 1EAH2 2GU9A 3VBOA 1GSLA 2X5IC 2GNBA 4QQ2A 4HETA 5E88A 5JI9A 1WKYA 4CXYA 3CZUA 1CAUB 1NT0A 1ULCA 4R9BA 3NAPA 1HRI3 2JD9A 4AW7A 4ITCA 1V6LA 3V0BB 1FV2A 4AHWA 1JZ7A 4LKSA 5AVAA 1DCSA 2OPKA 2YU1A 1ND3A 2E6VA 4YLZA 4NPRA 4HVQA 4AXOA 2CYFA 1PM7A 4MXWA 3MEPA 4QB2A 1TME3 4QM9A 2W5FA 5ABJB 4YGBA 2XJRA 4YZ5A 3AP4A 3RZLA 3H1YA 2WA3A 3ZKYA 2Y60A 3B94A 1PZ7A 3SEPA 3WW3A 2WSVA 3ZMNA 1ZZ7A 4R52A 4BIOA 4BJ0A 3EB7A 3O1OA 5ACA1 2IWGB 4XF0A 2KM2A 4G4FA 4BQ5A 1L7LA 2QQUA 1QH6A 4EN9B 4XHXA 2YC0A 5DZGA 3RPQA 1RJ8A 1AYN3 1Z7S2 1QJX1 5C4WA 1N1TA 2PHTA 3ZYJB 2P3YA 4CP0A 2JB4A 5F6KA 3HOBA 2N7GA 4WM7C 2WNOA 3MW4A 4OMDA 5DMYA 2XJPA 5E1RA 3VBRC 1LEMA 5LWBA 2KA3A 2MPFA 3LFIA 2VBDA 3HMYA 1R1A1 5CA6A 3MIBA 3ZOIA 4FPJA 4Y26A 2P3JA 2Z4FA 1VBC3 3MO4A 1CVNA 3SQOA 3OD0A 4CDWC 4U2AA 4R9CA 2R0HA 4FOWA 4M0HA 3U07A 5JDBA 3IMNA 4MGTA 3R4DB 3B02A 1W39A 3VBFA 1OI6A 1O59A 4IV1B 5BNNC 5L7OB 4J1XA 1S55A 1XNTA 3HN3A 4TSVA 2VXRA 4Y22A 1H6XA 2E31A 3BVCA 4Q8LA 4ZS3A 3Q9OA 4IV3B 3WF1A 2HYXA 4AAXA 2YFZA 1NLRA 4Q4W2 2BYVE 2A3XA 4L9BA 1JZ3A 1BBT3 1WMEA 1YQ5A 3K48A 5IJRA 3VD3A 1IG0A 3C7FA 4OQ9A 3ZXEA 1PVC2 2F4LA 4O65A 4N53A 4QGNA 5FZ0A 4CPBA 4FPKA 4XXAA 5IVJA 3AKTA 3PU8A 4Q4X1 4LPLA 1GP4A 1US3A 1XNAA 2FCTA 3IBMA 1W8TA 1ZBA2 4M4RA 4S2DA 5FKCA 4CCOA 2V09A 3MF9A 1ND2A 3WG1A 5KBFA 4W4ZA 3DCQA 2EIGA 2K46A 5FPLA 5IK7A 1AJOA 1K5MB 2VM9A 4JGZB 3T4HB 1RHI1 3NRUA 2ERFA 2E33A 4M01A 1JYXA 1KDKA 1IZ3A 2C1FA 1FI2A 4QB6A 1RITA 4YM0A 1HLCA 1B35C 1QF3A 1ZRIA 2CV6A 4TLFA 1NX9A 2XKPA 3NQHA 1R64A 3ZFEB 1QJY2 1ULOA 2FCUA 3E97A 1UYYA 3LF7A 1BMV1 4NVPA 4L11A 3BGAA 3WLUA 2FHRA 1IS4A 1GZWA 2B45X 2W0XA 1JYCA 4JRLA 1NYWA 5A3WA 5KXEA 3V65A 5EFUA 3RSJA 3T08A 5LZ6A 2QKDA 1UZZA 2ZA9A 3UJOA 5JLVA 2IXIA 1VB4A 3TNPB 4EWEA 1RUF3 3ZSMA 4K3UA 5CU1A 4BH9A 3LPFA 1J84A 5FBJA 4IGQA 4ZY9A 4Q0UA 3WNOA 2VNOA 1D4M3 2RG4A 2VTXJ 1SLLA 4N43B 5A7WB 1QJU3 3WEZA 1VBD1 3GBFA 4RQPA 3M4FA 2PYTA 3WP5A 2JICA 5D8AC 4GMP3 2JDZA 4QPIA 5H9SA 2IFRA 3ON7A 1PMIA 3VD5A 1LU2A 4FVVA 2EAAA 5ACA3 1E5SA 3S30A 1A8DA 1UPIA 2GNDA 5HXVA 2RM22 2OKXA 2ZHMA 4HKOA 2WYSA 3DECA 2WS93 4AEDB 5F3EA 1R083 2WUHA 1GR3A 2VU9A 2WDBA 5T55A 1L3JA 1YI7A 2F6BA 3I2HA 4H7MA 4IERA 3EXUA 4KH9A 3OEAA 1OUXA 3T0AA 5CVRA 2ARCA 4BIFA 1OPOA 3BOWA 1EAH1 2XXZA 3HNBM 3M3QA 4OI1A 2GH2A 4DRRA 1UZWA 3MIGA 1R1A3 3VBOB 4X8PA 4BLJA 1XSQA 5F2WA 2R062 2OPWA 4NIIA 2ZCWA 5KHGA 3NAPB 2WO7A 5FYCA 1DQ5A 5FR3A 1YI9A 3FWEA 5BNPA 1ZRCA 4PLNA 2AACA 1LOFC 1DBNA 4P9GA 1ND3B 1ST8A 5FYTA 2WYFA 4MXWB 3SH3A 2Y6KA 4P00B 2VZQA 3ACLA 2VC9A 4QX0A 3B93A 1W99A 4GAZA 2VVFA 3ZPYA 5KHJA 1JYVA 3HPNA 3ILNA 2W9XA 1I6XA 4WZFA 5J48A 1TQ5A 2CSGA 4Q4X3 1QDOA 3BI3A 1UIKA 5LA0A 1LKNA 1Z7S1 2CDPA 1W6QA 1W0OA 1XYOA 3ZFFA 4V2VA 1AR83 1UCXA 1O8PA 5CFCA 5C4WB 4TXWA 5HXMA 4HN0A 4ZU5A 3WD5A 2Q1FA 2TEPA 3H42B 1OLQA 3VZOA 4Z2AA 4MVTA 1F15A 1H4GA 2ZHNA 2ATFA 3NSTA 1TEIA 3CMGA 4IESA 2FDKA 4QAWA 2VMGA 4CXXA 3AJZA 2XLFA 4A42A 2PA7A 3T1MA 3JQWA 3O1SA 3ZYGA 3Q8FA 5I0SA 1H8TC 4PT6A 4XFFA 1J3RA 3UL2A 3AMNA 1LOAA 3E5UA 2EF6A 1DZRA 3E5XA 2DWRA 2QQNA 3PU3A 1TVGA 2E26A 3KZ4C 1DG6A 1WD3A 2ZABA 4CDXC 3QOPA 2RS52 3VBFB 5JMOA 1NUKA 1SMVA 4UT5A 4Y22B 1RL3A 5I0RA 2ZGOA 5J37A 1VBD3 5HCFA 4Q4W1 2WZEA 4AQ6A 4BQ2A 1RXGA 5DAVA 3AP7A 3FLPA 3A0NA 3P6BA 5IWFA 4Z82A 1PVC1 1VBA2 4FOYA 4Y33A 4FQ4A 1QXRA 3THDA 3NMBA 4N53B 1ULGA 3OCPA 2DYCA 5FYYA 3FFZA 1ZBA1 3H3ZA 1PZ9A 1XNCA 5E6HA 1ND2B 3R4SA 4AVCA 4EWDA 5ABJC 4DXTA 3POJA 1HDKA 2A71A 1Q5OA 1OFSA 3TYJA 1UY0A 5JOWA 5DZEA 4PF5A 4BMBA 2WZR2 3W5MA 1EAH3 4IETA 4AGRA 1HJGA 1MVEA 1YYNA 1QJY1 3DXTA 3RZGA 2DVAA 1AL23 2HJIA 2PHXA 3O5SA 4XILA 3U75A 3ZYFA 4Z1VA 3CZJA 3TEZA 1WMDA 1J59A 2NZ9A 1QXJA 3WDUA 4XJ9A 1GZWB 3AJYA 3KT7A 4B3NA 4EN0A 2QZ3A 4MGQA 2VZTA 1HRV2 3FBMA 1PGSA 5LRRA 2HWB2 1W3VA 2X53S 2NMNA 2WAOA 4M3CF 3BTAA 2ZX1A 4GWJA 3S7EA 5I8YA 3VDBA 1H2NA 4BQ1A 4LJHA 3ZXLA 4QPIB 3FFQA 1AZDA 4NJ4A 1YQ8A 2WA4A 4PHZA 3ZYRA 2KXLA 4HN1A 4R4XA 1HQNA 2RM21 4YW2A 2XBO3 3SMHA 4YZ2A 1UWWA 1Z7S3 4IV1C 4UAPA 3D3AA 5L7OC 2O0OA 2AENA 4QQOA 1ENQA 2QZ2A 5GM0A 4E4ZA 3JB4C 5JSPA 1XB9A 3VDAA 4LE3A 4IV3C 5IATA 3N4MA 1GOGA 1XXNA 1NZCA 1RIRA 5FPBA 2D6MA 4Z07A 2WRAA 2ZGLA 3ZM8A 1POV1 1EUTA 2XVLA 2D44A 3AXEA 3O0XA 4KL1A 1VE0A 1GWMA 4JKKA 4L0PA 1GQHA 1HQWA 3AXDA 3IAQA 4Q8KA 2VUJA 3GDBA 3IAPA 2FCVA 2R061 1U5YA 2BV4A 3G7DA 3OJBA 4HVRA 1V6IA 2Z79A 3VN4A 1J83A 4MH0E 1Q8OA 5FQ0A 3D5OA 5BNPB 4B4RA 1K5MC 1XPWA 1VRH2 3OOXA 3SCGA 2W08A 3C7EA 3POYA 5FZEA 3ZN5A 3L2YA 4PLMA 5APAA 1BLZA 2YGLA 5A6XA 2YXSA 4Z92B 4DEVA 3ILFA 3ZFEC 1WCQA 4Q4W3 3BU0A 5BYNA 3CLPA 1O5UA 4NIHA 3ZPOA 3D0SA 2BUKA 2A6XA 1VMFA 1EPWA 1QKQA 3NNJA 3T2OA 1JZ5A 5J1XA 3VZKA 1NXMA 4DO0A 4COWA 1IG3A 1E57A 5ERLA 4CUAA 2FDFA 1W6QB 2PHFA 5BUVA 1TNFA 5CFCB 4N43C 3AKSA 1UU5A 4QX2A 4OMCA 1X9PA 5L73A 5C3QA 2PHLA 2PN5A 3AYDA 4V1PA 4FPLA 5JVVA 3WDYA 4F8AA 3EO6A 1RXFA 2XWBB 3KCXA 1DYKA 3GHMA 3ZX7A 1VMHA 3AL6A 5ISLA 1C1LA 4Y5TA 1JYIA 5FO9B 1GANA 1KITA 3RDIA 1TMF3 5FJKA 4AEDC 3OUJA 3HQXA 3MHZA 2W3JA 3MIHA 1RUJ2 1ZBE2 3FN9A 4META 1OVPA 3I2KA 2RS51 3SKVA 4AHZA 5DAQA 5JZGA 5C33A 5C5TA 1UMZA 2D6OX 5LK5A 4ISRA 1YWKA 1Q56A 3T30A 4AGGA 5J09A 4ZHNA 4S2HA 3U1XA 4OHXA 4AI0A 1QHDA 3O1UA 3WW2A 2WNVA 3B7MA 1DIWA 1VBA1 4BQWA 5CKNA 4V2WA 4MGZE 1NZIA 2Y6FA 3NAPC 3J7NA 5DQ0A 4CCNA 5C5UA 3B01A 2ZBJA 5CAZA 2RE9A 1PIV3 1G7YA 2UY9A 2W39A 4ZONA 5JOXA 2BBVA 4JDMA 1DFQA 1ND3C 1XE8A 2VZUA 3AMQA 5HCBA 1OA2A 1XNBA 2RVAA 3P1IA 3B5LB 1UOFA 4CU7A 3RZMA 5A3MA 5JSRA 3GCWA 2WZR1 2A3WA 2J7MA 3H8UA 3OD4A 1QWRA 1TME2 4QX1A 1POV3 3SKJE 3JXSA 5JPMB 5LY2A 4LULA 1GZ9A 4K40A 3TB0A 2YYOA 5GZFA 4FPGA 5JI7A 1A34A 3P3PA 2PFWA 5LEKA 4FPHA 3ORJA 1HRV1 1LGCA 4BA6A 2VOKA 4RD7A 5A3OA 5C4WC 2I74A 3FJSA 1X36A 2AREA 4N8MA 2HWB1 4ASLA 5CYYA 1LHOA 2X29A 3HNYM 5A7NA 1AYN2 1U5XA 4P9LA 2QQJA 3HR9A 3WUCA 3WVJA 4AZZA 4CUCA 5EYXA 4DIQA 2R32A 4XVHA 5F8PA 2XJVA 1V00A 2WN2A 5GZDA 2YHJA 3D82A 1W0PA 3TOJA 4P08A 4AK3A 1N1VA 4IEQA 5DAPA 4E4SA 3MFCA 5JXJA 1FPN3 3BODA 3UYJA 4BE3A 5IVEA 3AKQA 3T0DA 1NCQC 2OA2A 1BJQA 1VBC2 4Y4YA 3VBFC 2DVGA 1N1SA 5AFEA 2ZPXA 2DTWA 1DLLA 3HBZA 3IPVA 4OUMA 4OI4A 2A6VA 3VDDC 4I3PA 2Q8OA 1LEDA 5LA1A 1OURA 2VQUA 1IS5A 4JAAA 1GQPA 4HONA 4LLFA 1JOBA 2DU1A 2VUAA 2WIIB 4N53C 1CQ9A 1C8NA 1PMHX 1CESA 2XDVA 3BIWE 1JZ6A 4BLIA 1VBB3 1GFF2 2GC2A 3K4AA 1LOEA 3WQBA 1SBFA 4FO9A 5ANNA 1UYXA 1ND2C 5M0TA 2DFBA 2BWAA 5FZAA 1V6NA 1UIJA 5FQ0B 2DFCA 3JQXA 4CCJA 5FYBA 1UW8A 2VG9A 2A73B 2RS53 2YFUA 5A70A 3U37A 4QWNA 4RGGA 2ZEXA 3MIDA 1RUE2 2XB6C 1CIYA 1W9TA 2BU9A 4K21A 4AI2A 5IT6A 1ULDA 2GSYA 2YGMA 1AX1A 2PXJA 1LULA 3TEYA 1VPHA 3VB9A 4QX5A 4XDPA 3A7QA 4BB3A 4D3WA 3WSOA 4M4PA 3I2IA 4QKNA 3W5NA 2Y38A 2FBEA 1LB2A 3VD7A 3H9AA 4HSLA 2C24A 1H6YA 1V6MA 3CJIC 3WP6A 4C0HA 4CEYA 2JDUA 4EE2A 1C4RA 2JDMA 2A6YA 4OUSA 4PIZA 4C8DA 2LUWA 3WINE 4QU2A 4CDUA 2PTMA 1W2TA 4PIYA 4JQTA 5K0UA 4XFBA 3M3EA 1RUF2 3VZLA 4QGMA 4WV8A 3POEA 2B5HA 1OQ1A 4QPIC 1U0AA 1QQP3 1D4M2 3NJVA 2YB7A 1UY3A 1QJU2 5G04L 1COV2 3PVOA 4CZSA 3OY8A 3OTFA 5IUQA 4WVWA 4XIOA 2OX0A 1KFXL 1OKOA 2BBAA 3W20A 1RUC3 1RUJ1 1ZBE1 2VMHA 3QH6A 4FBFA 3ZXKA 2JDHA 2WS92 3GXUA 3W58A 2CWMA 1OVSA 1R082 1FX5A 4CCDA 5JZGB 2P3IA 1UY4A 4NN0A 2W1QA 1ENSA 5GLWA 2XQRA 3PUIA 3VDCA 3LKJA 4ZPIA 3DUIA 4GH4A 4AE2A 3S6PA 2RJKA 1YEWA 2WNVB 5FDBA 1AX0A 2VW1A 1D0HA 5EQUA 1QY4A 1H1IA 1AR73 4HBNA 4KNCA 1KJLA 4RL7A 1LTEA 3NNLA 3LIGA 1LCLA 1AR62 1G9FA 4NUBA 2UY8A 1ENRA 3M1HA 1UOBA 2CY6A 2E63A 5FMOL 2J1UA 1CPMA 2VMDA 5C9AA 2JE8A 5A3LA 4Y1ZA 4FPFA 3WQ7A 1KRIA 1A8MA 1TME1 2YPDA 2BPA2 1DU3D 1LOCA 4BXSV 1GQGA 1UX7A 1VAMA 2RDRA 4LNVA 3ZSEA 4EN6B 5FZBA 1HXS2 1UKRA 2JB8A 2E7TA 3FZ3A 2QNKA 4B7KA 1PGL1 2J1SA 4HLTA 1BQPA 3K4ZA 5FY9A 2DVFA 1W8OA 4JC1A 5AFBA 5JUVA 3O0WA 1VRH3 1XE0A 1GZTA 2XVKA 3VGIA 2A1XA 3ZXGA 1AYN1 4QDRA 4EN8B 3IZOA 5CIRA 1LR5A 2WT2A 3WG2A 2KR2A 4NPMA 3GNEA 3BPSA 5L9VA 3A22A 1CJDA 3TEWA 4KWKA 1W8ZA 2Y6HA 3H3UA 5JSOA 3CO2A 1UOJA 1S4CA 4UBHA 2Y6LA 4QQLA 1RUOA 4CA9A 4Q0VA 4FTEA 2FD8A 2VQTA 4I01A 4M0NA 1QOSA 3VHRA 3OEBA 4BPZA 4NWVA 2JXAA 3ZMOA 3RZZA 2DCTA 1YLLA 4D7SA 4GULA 1AL0G 3UV9A 1VBC1 1KD7A 2BQPA 1V70A 2Y64A 2RS12 4L99A 4AQTA 1UQXA 2C26A 4W50A 4L92A 1K12A 1WBFA 2HBUA 1FMD3 3AMMA 4Q1RA 4XEZA 5J96B 3I49A 3ECQA 3IPVB 3SH4A 3RZHA 3Q8CA 5A3UA 2VAUA 2J1RA 4P14A 4RS5A 2GNTA 5EHDA 3FUOA 2VTFA 2VMEA 5JCTA 4MGKE 4XUNA 2D3RA 2I2SA 1PNGA 1FNZA 3VL8A 5G05L 5IYYA 5JXHA 4KMQA 3WDTA 3CU7A 1CWPA 3PVNA 4BQXA 1RUJ3 1ZBE3 4LUMA 4AVVA 5F1RA 2HBTA 3KCCA 5F3GA 1NAEA 1Y4WA 3PIJA 4IXLA 2ZOEB 1RUE1 4LITA 4JHZA 3WF3A 4UW3A 2FMYA 4CCKA 1CR7A 4DXSA 4DUWA 2H0VA 1JUIA 4LTAA 5FOJB 3MPBA 1OT5A 3SC7X 2V5DA 1H0BA 3WF4A 5CNAA 5FY1A 2YC4A 4NWWA 1AL22 3WF0A 5JOZA 4NAMA 1MZ6A 2R16A 2QBXA 2WO2A 5FY4A 3RJRA 3WOGA 4CEYB 2BJSA 4FPYA 1I3HA 4JGYA 5JIAA 2W91A 3TNQA 4EN7B 3LDBA 1LHNA 3A0KA 1OOPA 2ETEA 3APBA 1RUF1 5K0UB 5JR2A 4QX7A 2Y0OA 4Q2FA 1NA1A 1GICA 4XXPA 1GWKA 1W6MA 3KV5A 3DYMA 1D4M1 3KV4A 2J1TA 1QJU1 1Y7BA 2MNGA 2ZJCA 1COV1 2ADDA 1LGBA 5KHHA 4C0BA 3M3CA 4GMP1 4WM8A 2VTXA 2J1AA 2R6QA 4AFAA 1OBNA 1ZREA 3OY8B 3HIFA 5CFDA 4AWDA 3ENRA 3Q8AA 1V6OA 3EJKA 1CAXA 4Q0SA 4BDVB 5B4NA 4JKLA 1LNSA 2JD4A 1W8HA 3HT2A 1SLTA 3MI8A 2VGDA 2XBO2 4NIGA 3AX4A 2WS91 1A78A 1R081 1DQ6A 1BYHA 1CPNA 1HJFA 3VD9A 3LGRA 2VCBA 3I2JA 2ILMA 4GXLA 3P5BA 3L2HA 1WW4A 4RHV2 2WWUA 1DP0A 2ZGSA 1HIXA 4GH4B 3UK9A 1AR93 5T5JA 1YQCA 3PUQA 4YVWA 4J25A 3RYKA 1YFXA 5A7QA 2CAVA 4PBPA 3VHNA 3ZKUA 5BNOB 1AR61 3PTYA 4P9IA 2ZGNA 3AC0A 1SZBA 3KT1A 2A75A 5FCCA 4QX8A 4QXBA 4COZA 1JBCA 5C9AB 3N9LA 4XFIA 2NP0A 1HV1A 3T4VA 1Q8PA 2CHHA 4KG0A 4LQRA 2PQSA 4N90A 4Q1PA 3P3NA 3H1WA 4LXLA 3GZUC 2PAKA 1HXS1 2D3PA 2GN7A 2ZGRA 4KG8A 3RWKX 3KF5A 1HV0A 3FC0A 3GJBA 4DPNA 3KLSA 4I02A 1UY1A 3ZN4A 3M3IA 4XW3A 5DDJ2 1XYPA 2UYAA 3WNLA 1HQLA 3R0RA 2ZEYA 3NKTA 1QJZA 1SLCA 4LEJA 5KXCA 1AR81 4YW7A 5L9RA 3VHPA 1RUE3 4DMIA 1IGOA 4LMFA 4IDZA 3AL5A 2WL1A 2WZPP 1JZ2A 2KD7A 4F7ZA 1UYZA 1RUI3 3Q8EA 3VD4A 2RMU3 4CUGA 1LAJA 2W46A 5F32A 1QH7A 2UWCA 4BYYA 1CX4A 4GWIA 4ZXKA 1GBGA 3U4XA 1C1FA 3F95A 1XNDA 4HKWA 1KGYA 5F5CA 2BRTA 1F5FA 1ZA7A 1ZZCA 1OD3A 4I0BA 2RS11 4LBNA 2IXCA 1TMF2 2NM1A 4QD2A 2BFUS 4MHUA 4Y1VA 2B42B 1RMU3 5FIXA 5JZGC 3WNNA 2WLQA 2ZZQA 1EV12 3CL1A 4NROA 5GKAC 2JDPA 4UFKA 4CCMA 4UOJA 3LSDA 3MBWA 4QDQA 1JHJA 3HJRA 3KS7A 5FYIA 3WY6A 1GLHA 2E7AA 1GWLA 4QPWA 1MS8A 1YCIA 2BNOA 5E16A 1COV3 4IE4A 1BHGA 4OI2A 4RS5B 1UXZA 3O14A 3W21A 3E5QA 4QHBA 2K9ZA 2L9LA 3IDEA 3J9SA 2JG8A 3WW4A 2WO3A 1R093 1MQTC 3ABZA 4LA3A 5FPAA 4BXFA 1BK0A 1U12A 5EPAA 4CDQB 4GZ9A 2Z69A 4IUGA 3WQ1A 1N3QA 2W95A 1PIV2 5A3TA 4XDQA 4JX0A 4AVBA 5FBZA 4XBQA 3V0AA 1M4WA 2H6CA 5T5PA 2XJUA 3MLKA 2JDNA 4XZUG 2XHKA 1REEA 5LY1A 4URAA 1I5ZA 3WDVA 3F2ZA 1QDCA 4IE7A 1IPKA 1XBFA 3AB0A 3IN9A 4DQAA 1WCUA 1FATA 4AQSA 4XTMA 3WQ0A 4YW3A 2VUDA 2C5DA 1WCKA 4IW3A 5FZ3A 3WHTA 1AL21 5IFPA 5FY7A 4QPGA 3MICA 2A70A 2XGXA 4O9EA 1AR63 3J8F3 3WNXA 3ZYHA 1UMHA 5C6CA 5FUPA 4JGYB 2PELA 4O9GA 4J6GA 4W8JA 5JOYA 1I1EA 1AF9A 2YU2A 1RB8G 1YRZA 1OOPB 4QT6A 5IVCA 3VKOA 1KDMA 3SXWA 1E5IA 2JENA 3POGA 5FZKA 2RS32 3CF6E 4LBQA 1FV3A 5BNQA 1G9CA 1NA1B 5K9YA 1W6MB 2JWPA 3LSEA 2Q8CA 2XLGA 4FPEA 3HQUA 1X33A 4FAHA 1HXS3 4XF9A 2OZ6A 4OULA 1XSRA 4WM8B 4A6OA 5JWPA 3UKVA 3ZYIB 4JTOA 4PCRA 5D21A 3NV1A 5CFDB 4Q4V2 3T09A 4R9AA 4AYUA 1CAXB 3ES1A 1SBEA 1FPN2 2HLEA 3FHQA 3JD72 3MW3A 1VALA 2XBO1 3PVBB 2CL2A 4BQ3A 2P4EA 4P5YA 2DU0A 3DKQA 3HEIA 4Y5Z0 3RS6A 4YVSA 4XQDA 1V9U3 1OQEA 4COVA 4ASMB 3K51A 2Q8EA 3RZJA 1KS4A 1LODA 2W94A 2VZ1A 1F5JA 3K75B 2YZ4A 1ZZ6A 2DVBA 1V6JA 4Y24A 1NOVA 4RHV1 2A3YA 2IC1A 1UU4A 5EJZB 4S2FA 2QCSB 3N7LA 4UI9L 5K4LA 2X09A 2VZOA 3MIEA 4YVWB 4TZDA 4Z2WA 2WQ4A 3H50A 5T52A 3VBHA 3IDCB 3OPTA 1POQA 4CP2A 5A6ZA 3MPPG 1VBB2 2WJSA 2RS13 5C8CC 3K46A 1SLAA 3KHBA 5FLHA 4FXKB 5BXXA 5LW9A 2WABA 3S7IA 1D7PM 2IXJA 3TN93 5A7SA 1HW5A 2CAUA 1T6BX 4Q27A 5CADA 3OBRA 4PDWA 2GZWA 2WQZC 2W87A 4GB32 2WNUA 4MGYE 2B4KA 2GH8A 3N3HA 1NCRA 3U4SA 1LU1A 4LORA 4CEYC 2G9ZA 2RV9A 2ZGUA 5DDJ1 1PO22 2UWAA 5A6YA 4HVOA 2NLRA 3KQ4B 1W28A 3ACFA 2VQ0A 1BVP1 2GDFA 2OUJA 1MR5A 4KU7A 4S2GA 5FMCA 3VLBB 5K0UC 3IWZA 3BTZA 3NJYA 3RWNA 5T54A 4E27A 1UAIA 2LW8A 2E32A 3N35A 3POSA 4YPJA 3A4UA 1OA4A 1E5HA 1XOYA 2X8KA 4GA9A 1OLRA 1XU2A 3ZR6A 4YM3A 1POV0 1QQP2 1WLWA 5LBCA 2WSUA 3VKLA 1WWYA 4AOCA 4XHBA 1UO9A 3VKMA 5LASA 3MGUA 1WA6X 3KD4A 5LBEA 3OYWA 4D6RA 1TMF1 2O8OA 3MUZ1 1SLIA 1RUC2 4A6SA 2A5ZA 3BALA 4XFGA 1EV11 4XUTA 4MYEA 4XACA 2FQPA 3RI9A 3POBA 1H2MA 5DPNA 1DZTA 1O91A 5FZIA 5A33A 4K20A 1JU3A 4GH4C 4IGOA 3T3YA 1O3QA 5FWJA 1S1AA 3ETQA 2JEMA 4RQPB 1Q8QA 5FTTC 5JXIA 3LEKA 2VNVA 5BNOC 4ZZ5A 5HPOA 5T50A 3AP5A 2JG8B 4LOSA 1HB2A 4XF3A 4HL0A 2BOJA 5EV7A 4DXZA 1PIV1 1W8FA 4BWOA 4D6SA 1ZZBA 3WZ1A 1AR72 3HAGA 5C9AC 5FZFA 3V0AB 5T3NA 2CNAA 3RYPA 2WZ8A 4LO6B 4YZ4A 4HANA 5C3OA 3N9PA 4TYSA 4JTNA 2VUCA 3LEMA 1OH4A 2R7EB 4OVEA 3ZYBA 4RHV3 1GP5A 2VZRA 3MV01 5FZ7A 2WLPA 2LROA 3UT0A 1RTVA 3BIEA 1DGLA 4IGPA 3H3LA 3LA2A 5C3SA 3LIHA 4KGQA 4IEOA 4QPGB 1O6UA 4XF4A 4Y4RA 4XDOA 2Q0AA 3OSDA 2P5BA 5HCAA 2EXJA 2ZKLA 4H3WA 3MZHA 3DYPA 1NY72 4JGZC 3NV3A 4JKMA 2K2SA 2DCJA 2V5YA 1KS5A 4YNIA 5FP7A 1X50A 5FV3A 1SEFA 2RS31 2G9GA 3RI8A 3VHOA 1NLSA 2OIIA 2P6HA 3I3BA 4QXCA 4LBQB 5DZFA 3UGFA 1W9FA 1CX1A 4NR1A 3IM0A 1DGWX 2ZAAA 5A80A 2W1SA 4WVVA 4XC9A 1VP6A 3GHNA 1F4AA 1ONAA 1AYM3 1DQ0A 1MS5A 1MZ5A 3RMXA 5FPUA 2D6PA 4O7XA 5DDJ3 4Q4V1 4DEQA 3VBRA 3FL7A 3JD71 4LKDA 1FPN1 2I07B 3ZN6A 2WKKA 4QMAA 4XMAA 5FPVA 4CU9A 5J3UA 4EROA 2ZTNA 1YUDA 4EZ4A 4YVSB 1ASJ2 4Y1UA 3IKWA 3ZFFB 1JUHA 4CUBA 2A6ZA 5FYUA 1S0CA 4CDWA 4E8CA 1FMD2 5FZLA 4RS5C 5A32A 1OH3A 2EXHA 4LO4B 3WX5A 2DDUA 1VMJA 5A7PA 1S2KA 2RJ2A 3AMPA 2GP5A 4NAOA 3V56A 3W59A 1BXHA 4CDQC 4C90A 1IQAA 3AVSA 3HVDA 3PMEA 2HWE2 4FTSA 3VBHB 1VBB1 2DUQA 3I2GA 5GLUA 4YWAA 3KWVA 3GJAA 4HG6B 1EV13 2VZVA 3BPZA 4Q5OA 3RZKA 2NN8A 2VECA 2D5HA 2R073 4OCTA 5J36A 3WHUA 4CSWA 3PJQA 4GB31 4H7LA 1W06A 5LB6A 5FP3A 4XCBA 4LHKA 2Y8KA 4PDWB 5EZWA 2D43A 3HNMA 2WNUB 3ALQA 2XKOA 2VCMA 2WC2A 3VBOC 1NCRB 2D93A 1VAKA 2VMIA 2HWF2 2EXIA 5FZCA 1PO21 4NE9A 2OQ7A 4YSFA 5A3NA 1B35A 1MACA 4Y5SA 3N7JA 3WNMA 3JBG3 2D7FA 2EA7A 4LK7A 1PGW2 2AGSA 2VZ3A 1OOPC 4NHMA 4BQYA 5HBAA 3WNKA 3OBAA 5CG9A 2Y26A 4A45A 1NA1C 4RFT0 1DHKB 1NXD1 2CWSA 3ZDVA 3KCYA 1LHVA 1EYBA 2RDNA 3O12A 3VBUA 1OHFA 3N7MA 3NV2A 3OPWA 3BTXA 4NRMA 3KHCA 4DUVA 1GUIA 3O1RA 5IK5A 4WM8C 3CBNA 1QQP1 2P2KA 4Y1YA 1RJ7A 1Z0HA 1OF4A 5CFDC 1IS6A 2Y34A 4DOUA 4LT5A 2ZHKA 3MLLA 3LA7A 4NOTA 2VBPA 4L8QA 5ANQA 2AC1A 5D8AA 3KQRA 1UL9A 4KBZA 4XJZA 3ZDSA 5BV6A 2I45A 1YNAA 3OYWB 1RUC1 1JH5A 3O7OA 3O0VA 1IPJA 1N3PA 4X6QB 5FZGA 3QLQA 4IE6A 5LEJA 1QOOA 2IXLA 2RS33 3R05A 3UKNA 2ORZA 3U78A 5A33B 1WW7A 1W6NA 4XAAA 4CXWA 2ZKNA 4XZPA 4YVWC 1M06G 1NKGA 3ETPA 3AYCA 2ZEWA 3T2QA 4FPCA 1SLBA 4L2NA 1AR92 3INAA 3KGZA 3PNAA 1OKQA 1PHMA 2LM3A 4Q4V3 4X6RB 4XCAA 3JD73 4DZGA 1AR71 2VOXA 1KJRA 4ISQA 1C5HA 4EYUA 4LR4A 2CGOA 1K3IA 5FZ8A 2YBSA 4QQPA 1OQDA 1F2NA 1WMFA 1YIPA 3AFKA 4NPLA 2ZGMA 4FP3A 5FMBA 3MIFA 1J58A 1LOFA 3UGHA 4P9WA 4YW5A 1ZM1A 2VH9A 4XMIA 5DUWA 1YC61 2WQ8A 1IKPA 3EYPA 3N36A 3VV1A 3GZTB 4JDNA 1QJFA 1JOPA 4ZU7A 1MVQA 1PO12 5EYYA 5FZ6A 4MV2A 5FZDA 5C3RA 1AX2A 4DY5A 4UFJA 4BM8A 4DY3A 4I3GA 1NY71 1VRH1 5KHKA 3NJZA 3LCPA 1DLCA 2WFF2 2BZDA 2VD7A 1CAWA 2D97A 4H55A 5I91A 5JMCA 1JODA 1Q8SA 4GB33 4NHYA 4OFGA 4P9YA 4D7YA 1T6GC 5I0TA 5FYHA 4JCKA 3I3DA 3GZEA 5TSWA 3LD8A 4P5HA 1RUI2 4ORFA 2PHWA 2VR4A 3OPZA 3THTA 3WT3A 4AI8A 2PAEA 2RMU2 1BZWA 2VPVA 3ZSLA 2IVJA 1W8WA 1PO23 4YM2A 1D2SA 1MS4A 5FO7B 5IHRA 1EP0A 1UYPA 4URTA 4QPYA 3VBRB 3THPA 5C71A 1PM4A 3ZN6B 2D5FA 2QQMA 2R0FA 4QM8A 5FXZA 2F17A 5KXBA 2P1BA 3GGLA 1ASJ1 3OF1A 3T0BA 3NKGA 4Q26A 1YFYA 5GALA 1RMU2 2OYZA 1FMD1 1N47A 1VJ2A 2LRPA 4CDWB 4CYDA 1XRUA 4RQPC 4MADA 4XJAA 3POIA 4LA2A 5FAXA 5A32B 4CDXA 1JYWA 1PZ8A 2D98A 2JG8C 3AZYA 4JVAA 4LBQD 1S0GA 3E6BA 4WVZA 2Y6GA 3PTRB 4XJ8A 1SDDB 2HWE1 3A23A 3SHRA 2HEWF 3WCRA 2ZMKA 4DFSA 1R092 5FY0A 4PI2A 1GNHA 4YRDA 1SG3A 1W2OA 1QNYA 4N7UA 3MDPA 4XF1A 2W68A 1OD5A 1J3PA 3K77A 4W6WA 3V64A 3J26N 3L9JT 4ONUA 2BGPA 1F8VA 4OLLA 1OMIA 3AFGA 1UZ0A 4K8RB 3ZFGA 4SLIA 1SFNA 2R043 2YC2A 4PF1A 3EQEA 2HWF1 1UNBA 4QPGC 3ZXDA 3CNAA 2NMOA 2XL9A 1SFPA 3N9MA 1B35B 5BNPC 1IKQA 1PGW1 1V6KA 1VB2A 2Y0IA 4IE0A 2XJQA 4ZXEA 4LBLA 3J8F2 3I97A 5EP9A 1OSGA 4RR3A 1WMXA
chains in the Genus database with same CATH topology
2E7QA 3POWA 2HYKA 4WVMA 2PHDA 2SBAA 2GMMA 4X8NA 3VBUB 1WW5A 2EXKA 1D2QA 3ZXFA 2TNFA 3KM5A 2GAUA 3MFAA 1YIFA 3OGGA 1B09A 2Z5WA 5D8AB 2Z2SB 2ZS6B 4YVSC 3ZFFC 2IFWA 1X82A 5F9TA 5H9RA 5CFCC 4I30A 4IEVA 3PLQA 2GN3A 5I0UA 1V9U2 3WDXA 5GLZA 3DL3A 4KGGA 1JHNA 2YUEA 2ZGQA 4AFBA 1UPSA 1W6NB 5FLJA 2VW2A 4FAGA 2ZAHA 1AR91 2JE9A 4CEWA 3SLIA 2XWJB 1LESA 2PLV3 5KC5A 1WUVA 5F5QA 1QGLA 3HT1A 5LK7B 2A6WA 3QCWA 4LLOA 1NE4A 4XBLA 1ASJ3 4ES9A 2RHPA 4PDWC 3SISA 2WNUC 1SCSA 3TN92 1MZEA 1NCRC 4BZ4A 2BEOA 3WR0A 3AKPA 2MEV3 4R9DA 1W6PA 2OZJA 1PO11 3I7DA 3AYAA 4GMP0 2AH2A 2HWE3 3NV4A 5D1IA 2QQPA 2R30A 2TBVA 5K8SA 1O5LA 1VBE2 1CN1A 2WFF1 3FLTA 1RUH3 5AC93 4K7JA 4AEJA 1O3TA 1CAWB 2QE3A 2HEVF 1SDWA 4AFMA 5EJ3A 1SFYA 3B00A 1RUI1 3M3OA 2D3SA 3R6SA 1UN1A 2HWD3 2RMU1 4GALA 5LRSA 3BCWA 2DVDA 2HWF3 4FOQA 1X8MA 1BK1A 3RYRA 4AFCA 1IHMA 3VBSA 1JN2P 3I2DA 4A7KA 2YROA 5DG2A 3I54A 4GIQA 3RNSA 2O1QA 3X29B 2R49A 1RMU1 4Z8BA 1RUG3 4HK8A 1QU0A 4MXVA 4E4DX 1CAVA 4CDUB 4B7EA 4K8FA 5HI0A 1FOD3 2Q30A 4C1XA 1RUNA 4CDXB 4EWAA 1YHFA 1AXYA 5DXDA 4LE4A 1DQ2A 1YFUA 2E53A 1R091 1BEV3 3PVEA 1RINA 3GZAA 5BPXA 2XPJA 1JOJA 1RUD3 2AR6A 5FLIA 1QNWA 4I09A 3DPRA 1Y3TA 3JU9A 1EPZA 1CONA 4LO8A 3C2UA 3KT4A 1I9RA 3USSA 3DGTA 3ZFGB 4N9IA 2DV9A 3I4IA 1C8M3 1PK6A 3VZMA 1MS3A 4DRVA 1N1YA 2JX9A 1CGPA 4GQ7A 3SNMA 3J8F1 1DZQA 5E8AA 4AHYA 4RR3B 2WT1A 3ELNA 3RQ0A 4WVMB 4KWLA 1H8VA 2QJVA 4HT1T 2HWC2 3LAGA 1F9KA 1IS3A 3DV8A 4AVAA 4N7IA 3NWKA 1PO13 5I8TA 2IXHA 4Q4Y3 1AYM2 1MEC2 4W6XA 1AHSA 1EY2A 4IEWA 4L97A 3VKFC 2CGPA 3LOIA 4UW5A 4XQ4A 4K1ZA 1WCSA 2WFF3 2XH6A 1NCQA 1V9U1 5CB7A 3CJXA 3USUA 4R4ZA 3TBDA 1LOGA 3VDDA 2R1DA 3UKTA 5I93A 2Q5TA 2SLIA 3H7YA 4CEWB 1X8EA 3FLRA 2ENRA 2NQYA 4AI1A 2DTYA 3ZYPA 4RGAA 4YG0A 3GYDA 1BVVA 2UU8A 3TN91 3T2TA 2R072 2ZX3A 4NO4A 4GWMA 4XBNA 1UKGA 2WNVC 3H7JA 1W6PB 4FT8A 1YFWA 2BW8A 2E9QA 1HKDA 3H0OA 4ATFA 2ZX2A 1GZCA 2NPIA 2EALA 4DS0A 4OHZA 1MS0A 3FBYA 4YG6A 1VBE1 3JBG2 1LRHA 4YARA 4RA0A 4M00A 1S0IA 2PQQA 5FMOS 1UD1A 3CJIA 3JB8A 2WT0A 3VBUC 4LBMA 2Q4SA 5SV5A 4EJRA 2P17A 2QDRA 4DINB 3NVCA 2JECA 5JAXA 4RSUA 1XE7A 3C3VA 2Z42A 5I8SA 4XJUA 3VBSB 2ET7A 3ZIWA 5FREA 4OI0A 3NL1A 5F6LB 4YM1A 3U11A 1LJ7A 4WZCA 1QJX3 3LWCA 2ZACA 1CAVB 4LO5B 1H9PA 1TE1B 4OHYA 2RR12 4E9KA 2ZGTA 2BNNA 4XOGA 3OBTA 4QGLA 4ES8A 3NO8A 1ZRFA 1SQ4A 2A7AA 2H6BA 3EHKA 2GNMA 1FXZA 4K9SA 3R4UA 2DCKA 2WINB 3DPRB 4HMZA 1ZZ8A 2Q1MA 5DUUA 3TWIA 2BGCA 1VR3A 1UU6A 5GZEA 4AI3A 3BOPA 5JIUA 5GLTA 1Q43A 3VKNA 2O8QA 4INDA 3BU7A 4HK9A 4OHVA 4Y20A 1JW6A 1REFA 2XUMA 3D8CA 1PK6B 3DKWA 3B9CA 1UX6A 2JG9A 4DNYA 4KBBA 2D6LX 3PMSA 3S0MA 3WUDA 3SCHA 3E6DA 4P9JA 2ARBA 1G9BA 1RHI3 3BB6A 2HWC1 4U36A 1XU1A 1U5IA 1AYM1 4HZFA 1MEC1 4KQ7A 1H2KA 5J98B 3WP4A 2GMEA 1YJKA 4UXAA 1XQNA 4MLOA 4Q0PA 1VBE3 1SBDA 3WDWA 4CDUC 3J4UH 2LTNA 4Q0QA 2ARXA 2XL7A 1NCQB 4XIKA 2BTVC 3AMHA 2EAKA 1LHUA 3MF6A 3USUB 5IK4A 3SCFA 2G4IA 1IOAA 3FE5A 1O3RA 3VDDB 5SV8A 1SACA 1ZNPA 3SH5A 1GYKA 1VAVA 2P34A 2D40A 2TUNA 4ZKTB 3ZIXA 1Q3EA 4M3CA 4YZ1A 2JKBA 2R071 3ZFGC 3ILRA 2UWBA 1J1LA 3QD6A 1ZYBA 2HKXA 1AXKA 4FCAA 5T5OA 1H2LA 5B2GB 1U5ZA 2R042 4YFWA 2HEYF 1S0BA 4EV0A 1O7FA 3AZXA 3JBG1 4N9HA 3DN7A 4XJWA 1AJKA 4A3XA 4RR3C 2X5IA 1J3QA 3RJ2X 1WLTA 1ALYA 3WW1A 1O4TA 3B9IA 1LECA 3CJIB 5EXOA 4R8HA 5IK8A 4B29A 2YV8A 2V73A 4YW1A 1JXNA 1RC6A 2H0BA 4D7TA 3E6CC 1ENXA 1F31A 1URXA 1ZX5A 2CTVA 2VW0A 3AM2A 3N7KA 5FPXA 3ZO0B 4ATEA 4XFAA 1R1ZA 1W2UA 1C28A 4UBGA 2RR11 4YGCA 4FXGB 2HWC3 1H1AA 1AUYA 2XLAA 2ZMNA 2DUOA 4CEWC 2BVBA 4WM7A 1KQRA 1VIWB 4MZUA 1MEC3 1GV9A 4G3YC 3WV6A 2DCYA 1RVF2 5E89A 4FP2A 2PLV2 3M2MA 4UW6A 4AGVA 1DGWA 5C8WA 4C1WA 1LOBA 4CP1A 2P3KA 4E2QA 1ULEA 1TNRA 2B9UA 4WBBA 1N3OA 3U0ZA 4MUVA 1G8WA 2VY0A 2ZGKA 1H4HA 2D6NA 1J1TA 4XETA 5BNNA 1S2BA 4OHWA 2MEV2 4CRQA 1WCDJ 4IEPA 2K0GA 3AZZA 1DYPA 3VUOA 4Y20B 1PVC3 2B7YA 3ZSJA 2AYHA 3MYXA 3IIAA 4D69A 1ZBA3 4BCUA 1HX6A 1REDA 3HWJA 4AHXA 1NG0A 4COUA 2BWCA 3ROUA 2YMZA 1DGRN 2JG9B 3WCSA 3GF6A 3KMHA 1MZFA 1RUH2 5AC92 2C0ZA 4JV4A 4ZU4A 1NQDA 4BOWA 1PNFA 5KWRA 4OZXA 4LO7A 5BY5A 2CGNA 3AZWA 3ASIA 4NHKA 3PJYA 1DDLA 4PQ9A 2QUOA 3LA3A 4I2OA 4F3JA 3WP3A 2HWD2 1QJY3 2NYYA 4AEMA 3DF0A 3VBSC 1QOTA 2WWSA 2W52A 2VNRA 4YG3A 4JGYC 4FTBA 1FYUA 1MS1A 3JCIA 3UJQA 1O4YA 3AK0A 2ZHLA 3WXPA 4PIXA 5K7PA 1AXZA 3M8LA 4B8EA 4HPKA 1RUG2 2ES3A 1W6OA 4IQPA 2IXKA 2B39A 1D0GA 4HSJA 1BCXA 2ZMLA 1G6NA 2QFEA 1PVXA 1FOD2 3LOBA 3QACA 4A7ZA 2VOWA 3D6EA 3ME2A 2PHRA 4LUKA 3ZXAC 4W65A 4XPVA 3B69A 4Q29A 1BEV2 2C9AA 2RM23 1S0EA 1MQTA 1HRI2 1RUD2 2QDNA 3DPRC 5EWSA 3QBQA 2PHUA 2ZGPA 1D4VB 4M3CB 5KHIA 2D6KA 2VNGA 3LZZA 2OVUA 2VVDA 4PLOA 2RR13 3U10A 1Y43B 3GBGA 1X7NA 5GZCA 3GBWA 5KC6A 4YFZA 2DCZA 2R041 5DUVA 1PK6C 2WFPA 1OPMA 2DURA 2AUYA 3FUQA 5CG8A 2GMPA 2R063 4IL7A 1C8M2 2VULA 4K6BA 1WD4A 5J7MA 2X5IB 1WGPA 4K1YA 1GKBA 4YYOA 2BNMA 4YGDA 1FNYA 3ST7A 4GWNA 4QQHA 1QMJA 4KU8A 4LBKA 3IT8A 1G9AA 2G9FA 5DG1A 5L36A 3I59A 4AEKA 3H1MA 4QXKA 4Q4Y2 1BKZA 5H9PA 2YDEA 4Y1XA 1S0JA 4W6YA 5AVPA 3FHIB 5CBLA 1DGRA 3JUUA 4FQZA 1CIWA 2MHFA 1WA4A 4A2UA 4LHLA 2GALA 1SCRA 1ULFA 1S0DA 2B46X 2BVVA 2LALA 4YZ3A 5FRAA 3IDBB 1G9DA 4F83A 3AKRA 5GZGA 1FAYA 4BHPA 3B3QE 1NE6A 2R1BA 3MW2A 4WM7B 4AQ2A 3PHMA 1KFUL 4LBOA 1RVF1 3FX3A 1CJPA 1WW6A 3FMGA 1BBT2 2PLV1 1YJLA 4XYXA 3AZVA 4AG4A 4NHLA 1H8TA 1C3HA 3AYEA 4SBVA 2VQAA 2ZX4A 4C0HA 1OA3A 4M3CE 2ET1A 5GLVA 1KXGA 2B8MA 5C8CA 3WG3A 3D4KA 2FMDA 4FPOB 3I8TA 3ATGA 1MS9A 2MEV1 2GC0A 1ZVFA 1JTZX 5BNNB 3SITA 2DUPA 1GNZA 3CEWA 3VZNA 2VVEA 5FPZA 3RMYA 1VLNA 1VBA3 2YY1A 3TRSB 1LHWA 4AVTA 1CAUA 4P9XA 4XQWA 5FFOC 4D94A 5KXDA 3OGJA 5DUXA 3V0BA 2RJLA 1RUH1 5AC91 5GJ6A 1ZA4A 2EVXA 4BMEA 4XFHA 2JE7A 3HN1A 2WZR3 5ABJA 1FT9A 4XTPA 2XVGA 3D0JA 5JR7B 2HWD1 4I0AA 3JZVA 2QVSB 4IEYA 3T1LA 1Z78A 4IEUA 2OUHA 2ZX0A 5FO8B 5ACA2 4E2GA 1HRV3 2XJSA 3KB5A 3W9AA 2HWB3 2BFUL 1RUG1 2FZ2A 1LENA 1DQ4A 3LB9A 1ZRDA 4H14A 4HPKB 1DF0A 2AZ5A 1QJX2 1W6OB 4HKLA 1FOD1 2XG3A 2GC3A 1AVBA 3MLJA 3HD8B 1LGNA 1WLCA 1H30A 2ZZJA 3TAYA 1BEV1 5BNOA 1R1A2 4GKXA 3ES4A 4GKYA 1HRI1 1RUD1 2Q1ZB 2OW4A 1OFNA 1MQTB 2PAMA 3URFA 1O4ZA 2WNEA 4IEZA 4IV1A 5L7OA 4JRAA 4E2SA 2F4PA 5JPNB 4FSJA 4IV3A 4YW4A 4MSVA 3AP6A 3VBHC 4UW4A 3ZVXA 1O3SA 2FZ1A 1RVF3 1C8M1 4AF9A 2IZWA 3M7AA 2JG9C 3NW4A 4CTEA 1A3KA 1YO8A 4Q4X2 1RGSA 1AR82 4A7YA 4LBJA 1K5MA 4JGZA 1S0FA 3VZJA 1ZZ9A 4I0WB 1RHI2 3KSCA 2JJ6A 4DB5A 4MGIE 4AFDA 2VOVA 3I59B 4Q4Y1 3ZFEA 2DF7A 3WG4A 4B4QA 4PBOA 4TWTA 1G86A 1Y9QA 1BMV2 1A6CA 5T5LA 4COYA 1UF2C 4FOVA 4IEXA 3RRDA 3ZXJA 4B4PA 1ZRRA 3KGLA 4G9SB 4PJYA 1XYNA 1APNA 1WBLA 4N43A 1H1MA 1PGL2 2UURA 1NQJA 5L19A 1VBD2 3G6JB 1DQ1A 2XJTA 4J1WA 1Q8VA 1C57A 1BBT1 4JQRA 4LHNA 5H9QA 4C91A 1YXWA 2P37A 4KWJA 4CDQA 1WLDA 4HFSA 2GC1A 1XNKA 1H8TB 4MX3A 4AEDA 5C8CB 4XFCA 1C5IA 3QH7A 1H9WA 3M70A 4YGEA 2YPJA 1QXPA 2E51A 3GALA 4JDOA 3ZSKA 5FOBB 3VL9A 3RG0A 4XE9A 1UZYA 2UYBA 3AP9A 3EBRA 1CD3G 1EAH2 2GU9A 3VBOA 1GSLA 2X5IC 2GNBA 4QQ2A 4HETA 5E88A 5JI9A 1CAUB 4R9BA 1ULCA 3NAPA 1HRI3 4AW7A 4ITCA 1V6LA 3V0BB 1FV2A 4AHWA 5AVAA 2OPKA 1ND3A 2E6VA 4YLZA 4NPRA 4HVQA 4AXOA 2CYFA 1PM7A 4MXWA 3MEPA 4QM9A 1TME3 5ABJB 4YGBA 2XJRA 4YZ5A 3AP4A 3H1YA 2WA3A 3B94A 1PZ7A 3WW3A 3ZMNA 2WSVA 4BIOA 1ZZ7A 4R52A 5ACA1 2IWGB 4XF0A 2KM2A 4G4FA 1QH6A 4EN9B 4XHXA 2YC0A 5DZGA 3RPQA 1RJ8A 1AYN3 1Z7S2 1QJX1 5C4WA 1N1TA 2PHTA 3ZYJB 4CP0A 5F6KA 2N7GA 4WM7C 3MW4A 2XJPA 5E1RA 3VBRC 1LEMA 2KA3A 2MPFA 3HMYA 1R1A1 5CA6A 3MIBA 4FPJA 4Y26A 2P3JA 1VBC3 1CVNA 3OD0A 4CDWC 4U2AA 4R9CA 2R0HA 4FOWA 4M0HA 3U07A 5JDBA 3IMNA 3R4DB 3B02A 1W39A 3VBFA 1OI6A 4IV1B 5BNNC 5L7OB 4J1XA 1S55A 4Y22A 4TSVA 2VXRA 4Q8LA 3Q9OA 4IV3B 1NLRA 4Q4W2 2BYVE 2A3XA 4L9BA 1BBT3 1WMEA 3K48A 3ZXEA 1PVC2 4QGNA 4N53A 4FPKA 4XXAA 3AKTA 4Q4X1 5IK5A 3IBMA 1ZBA2 2V09A 3MF9A 1ND2A 3WG1A 5KBFA 2EIGA 5IK7A 1AJOA 1K5MB 4JGZB 1RHI1 2ERFA 4M01A 1KDKA 1IZ3A 2C1FA 1FI2A 4YM0A 1RITA 1HLCA 1B35C 1QF3A 2CV6A 4TLFA 2XKPA 3ZFEB 1QJY2 3E97A 1BMV1 4NVPA 4L11A 3WLUA 2FHRA 1IS4A 1GZWA 2B45X 2W0XA 1JYCA 4JRLA 1NYWA 5KXEA 3V65A 5EFUA 3RSJA 2QKDA 1UZZA 2ZA9A 3UJOA 5JLVA 2IXIA 1VB4A 3TNPB 4EWEA 1RUF3 3ZSMA 4K3UA 5CU1A 4BH9A 4Q0UA 2VNOA 1D4M3 4AVSA 4N43B 1SLLA 5F1RA 1PGL1 1QJU3 1VBD1 3GBFA 4RQPA 3M4FA 2PYTA 3WP5A 2JICA 5D8AC 4GMP3 2JDZA 4QPIA 5H9SA 2IFRA 1PMIA 1LU2A 4FVVA 2EAAA 5ACA3 3S30A 1A8DA 1UPIA 2GNDA 5HXVA 2RM22 2ZHMA 4HKOA 2WS93 4AEDB 1R083 1GR3A 2VU9A 5T55A 1L3JA 1YI7A 2F6BA 4IERA 4H7MA 4KH9A 3EXUA 5CVRA 4BIFA 1OPOA 3BOWA 1EAH1 3M3QA 4OI1A 2GH2A 4DRRA 3MIGA 1R1A3 3VBOB 4X8PA 4BLJA 2R062 2ZCWA 5KHGA 3NAPB 1DQ5A 1YI9A 3FWEA 5BNPA 1ZRCA 4PLNA 1LOFC 1DBNA 4P9GA 1ND3B 4MXWB 3SH3A 3ACLA 3B93A 2VVFA 3ZPYA 5KHJA 3ILNA 1I6XA 4WZFA 5J48A 1TQ5A 4Q4X3 1QDOA 1UIKA 1LKNA 1Z7S1 1W6QA 1W0OA 1XYOA 3ZFFA 1AR83 1UCXA 5CFCA 5C4WB 4HN0A 4ZU5A 3WD5A 2TEPA 1OLQA 3VZOA 4MVTA 1H4GA 2ZHNA 2ATFA 3NSTA 1TEIA 4IESA 2VMGA 3AJZA 2XLFA 2PA7A 3T1MA 3JQWA 3ZYGA 5I0SA 1H8TC 4XFFA 1J3RA 3UL2A 3AMNA 1LOAA 3E5UA 2EF6A 1DZRA 3E5XA 2DWRA 3KZ4C 1DG6A 1WD3A 2ZABA 4CDXC 3QOPA 2RS52 3VBFB 1SMVA 4Y22B 1RL3A 5I0RA 2ZGOA 5J37A 1VBD3 5HCFA 4Q4W1 4AQ6A 3AP7A 3FLPA 3A0NA 4Z82A 1PVC1 1VBA2 4FOYA 4FQ4A 1QXRA 4N53B 1ULGA 3OCPA 2DYCA 3FFZA 1ZBA1 3H3ZA 1PZ9A 1XNCA 1ND2B 3R4SA 4AVCA 4EWDA 5ABJC 1HDKA 2A71A 1Q5OA 1OFSA 3TYJA 5JOWA 5DZEA 4PF5A 4BMBA 2WZR2 1EAH3 4IETA 4AGRA 1MVEA 1YYNA 1QJY1 2DVAA 1AL23 2HJIA 2PHXA 3O5SA 4XILA 4Z1VA 2BBVA 1WMDA 1J59A 2NZ9A 1QXJA 3WDUA 4XJ9A 1GZWB 3AJYA 3KT7A 4B3NA 4EN0A 2QZ3A 3FBMA 1HRV2 1PGSA 5LRRA 2HWB2 2X53S 2NMNA 4M3CF 3BTAA 2ZX1A 3S7EA 5I8YA 1H2NA 4BQ1A 3ZXLA 4QPIB 3FFQA 1AZDA 2WA4A 3ZYRA 2KXLA 4HN1A 4R4XA 1HQNA 2RM21 4YW2A 2XBO3 3SMHA 4YZ2A 1Z7S3 4IV1C 5L7OC 2O0OA 2AENA 4QQOA 1ENQA 2QZ2A 5GM0A 4E4ZA 3JB4C 5JSPA 4LE3A 4IV3C 3N4MA 1XXNA 1NZCA 1RIRA 2D6MA 4Z07A 2ZGLA 1POV1 2XVLA 2D44A 3AXEA 3O0XA 4KL1A 1GQHA 1HQWA 3AXDA 4Q8KA 2VUJA 3OJBA 2R061 1U5YA 3G7DA 4HVRA 1V6IA 2Z79A 3VN4A 4MH0E 1Q8OA 5FQ0A 3D5OA 5BNPB 4B4RA 1K5MC 1VRH2 3SCGA 2W08A 3POYA 3ZN5A 3L2YA 4PLMA 2YGLA 2YXSA 4Z92B 3ILFA 3ZFEC 4Q4W3 5BYNA 3CLPA 1O5UA 3D0SA 2BUKA 2A6XA 1EPWA 1QKQA 3VZKA 1NXMA 4COWA 1E57A 1W6QB 2PHFA 5BUVA 1TNFA 5CFCB 4N43C 3AKSA 1UU5A 5L73A 2PHLA 2PN5A 3AYDA 4V1PA 4FPLA 5JVVA 3WDYA 4F8AA 3EO6A 2XWBB 3KCXA 1DYKA 3GHMA 3ZX7A 1C1LA 1JYIA 5FO9B 1GANA 1KITA 3RDIA 1TMF3 4AEDC 3HQXA 3MIHA 1RUJ2 1ZBE2 4META 2RS51 4AHZA 5JZGA 5C33A 1UMZA 2D6OX 5LK5A 4ISRA 1YWKA 1Q56A 4AGGA 5J09A 4S2HA 4OHXA 4AI0A 1QHDA 3WW2A 2WNVA 3B7MA 1DIWA 1VBA1 4MGZE 3NAPC 3B01A 2ZBJA 5CAZA 2RE9A 1PIV3 1G7YA 2UY9A 2W39A 5JOXA 4JDMA 1DFQA 1ND3C 1XE8A 3AMQA 5HCBA 1OA2A 1XNBA 3B5LB 5A3MA 5JSRA 3OD4A 2WZR1 2A3WA 3H8UA 1QWRA 1TME2 1POV3 5JPMB 4LULA 1GZ9A 4K40A 3TB0A 2YYOA 5GZFA 4FPGA 5JI7A 3P3PA 2PFWA 5LEKA 4FPHA 1HRV1 1LGCA 4BA6A 2VOKA 4RD7A 5C4WC 2I74A 3FJSA 1X36A 2AREA 2HWB1 4ASLA 1LHOA 2X29A 3WVJA 1AYN2 1U5XA 4P9LA 3HR9A 3WUCA 5EYXA 2R32A 2XJVA 1V00A 5GZDA 2YHJA 3D82A 1W0PA 3TOJA 4AK3A 1N1VA 4IEQA 4E4SA 3MFCA 1FPN3 3BODA 4BE3A 3AKQA 1NCQC 2OA2A 1BJQA 1VBC2 4Y4YA 3VBFC 2DVGA 1N1SA 5AFEA 2ZPXA 2DTWA 1DLLA 3HBZA 3IPVA 4OUMA 4OI4A 2A6VA 3VDDC 4I3PA 2Q8OA 1LEDA 1IS5A 4JAAA 4LLFA 2DU1A 2VUAA 2WIIB 4N53C 1CQ9A 1C8NA 1CESA 3BIWE 4BLIA 1VBB3 1GFF2 2GC2A 1LOEA 1SBFA 4FO9A 1ND2C 2BWAA 2DFBA 1V6NA 1UIJA 5FQ0B 2DFCA 3JQXA 1UW8A 2VG9A 2A73B 2RS53 4RGGA 3MIDA 1RUE2 2XB6C 4K21A 4AI2A 5IT6A 1ULDA 2GSYA 2YGMA 1AX1A 1LULA 4QX5A 4D3WA 2Y38A 2FBEA 1LB2A 3H9AA 4HSLA 1V6MA 3CJIC 3WP6A 4CEYA 1C4RA 2A6YA 4OUSA 4PIZA 2LUWA 3WINE 4QU2A 4CDUA 2PTMA 4PIYA 5K0UA 4XFBA 3M3EA 1RUF2 3VZLA 4QGMA 4WV8A 2B5HA 1OQ1A 4QPIC 1U0AA 1QQP3 1D4M2 1QJU2 1COV2 3PVOA 4CZSA 3OY8A 3OTFA 5IUQA 4WVWA 4XIOA 1KFXL 1RUC3 1RUJ1 1ZBE1 2VMHA 3QH6A 4FBFA 3ZXKA 2WS92 3W58A 2CWMA 1R082 1FX5A 5JZGB 2P3IA 4NN0A 1ENSA 5GLWA 3LKJA 3DUIA 4GH4A 4AE2A 3S6PA 2WNVB 2RJKA 5FDBA 1AX0A 2VW1A 1D0HA 1QY4A 1H1IA 1AR73 4HBNA 4KNCA 1KJLA 4RL7A 1LTEA 1LCLA 1AR62 1G9FA 2UY8A 1ENRA 3M1HA 2CY6A 2E63A 5FMOL 1CPMA 5C9AA 5A3LA 4Y1ZA 4FPFA 3WQ7A 1KRIA 1A8MA 1TME1 2BPA2 1DU3D 1LOCA 1GQGA 1VAMA 4LNVA 3ZSEA 4EN6B 1HXS2 1UKRA 3FZ3A 2E7TA 2QNKA 4B7KA 4HLTA 1BQPA 2DVFA 4JC1A 5AFBA 3O0WA 1VRH3 2XVKA 3VGIA 3ZXGA 1AYN1 4EN8B 5CIRA 1LR5A 2WT2A 3WG2A 3GNEA 1CJDA 4KWKA 3H3UA 5JSOA 3CO2A 4UBHA 4QQLA 1RUOA 4Q0VA 4FTEA 4I01A 4M0NA 1QOSA 3VHRA 4BPZA 4NWVA 2JXAA 3ZMOA 3RZZA 2DCTA 1YLLA 4D7SA 4GULA 1AL0G 3UV9A 1VBC1 1KD7A 2BQPA 1V70A 2RS12 4L99A 4AQTA 4L92A 1WBFA 5J96B 3AMMA 1FMD3 4XEZA 4Q1RA 3ECQA 3IPVB 3SH4A 4P14A 4RS5A 2GNTA 3FUOA 5JCTA 4MGKE 2D3RA 2I2SA 1PNGA 1FNZA 3VL8A 3WDTA 3CU7A 3PVNA 1RUJ3 1ZBE3 4LUMA 4AVVA 3KCCA 4IXLA 2ZOEB 1RUE1 4UW3A 2FMYA 1CR7A 2H0VA 1JUIA 4LTAA 3MPBA 1H0BA 5CNAA 4NWWA 1AL22 5JOZA 1MZ6A 2R16A 3RJRA 3WOGA 4CEYB 4FPYA 5JIAA 1I3HA 4JGYA 3TNQA 4EN7B 1LHNA 3A0KA 1OOPA 2ETEA 3APBA 1RUF1 5K0UB 2Y0OA 4Q2FA 1NA1A 1GICA 4XXPA 1W6MA 1D4M1 2MNGA 1QJU1 1Y7BA 2ZJCA 4C0BA 1COV1 5KHHA 1LGBA 3M3CA 4GMP1 4WM8A 2R6QA 4AFAA 1ZREA 3OY8B 3HIFA 5CFDA 4AWDA 3ENRA 4Q0SA 1V6OA 3EJKA 1CAXA 2JD4A 3HT2A 1SLTA 3MI8A 2VGDA 2XBO2 3AX4A 2WS91 1A78A 1R081 1DQ6A 1BYHA 1CPNA 3LGRA 2ILMA 4GXLA 3L2HA 1WW4A 4RHV2 2ZGSA 1HIXA 4GH4B 3UK9A 1AR93 5T5JA 4YVWA 3RYKA 1YFXA 2CAVA 4PBPA 3VHNA 5BNOB 1AR61 3PTYA 4P9IA 2ZGNA