1IQAA

Crystal structure of the extracellular domain of mouse rank ligand
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
156
structure length
156
Chain Sequence
AQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RECEPTOR ACTIVATOR OF NUCLEAR FACTOR KAPPA B LIGAND
publication title Crystal structure of the extracellular domain of mouse RANK ligand at 2.2-A resolution.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine
total genus 31
structure length 156
sequence length 156
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1iqaA00
2E7AA 2Q1MA 2HEWF 2RE9A 1C28A 4MXWB 3ALQA 2R6QA 3ME2A 2TUNA 3LKJA 4G3YC 4J6GA 2Q8OA 4DOUA 1ALYA 1D0GA 1KD7A 2ZPXA 5KWRA 4OUMA 1RJ8A 4OULA 5BNQA 5CIRA 2ZJCA 4TSVA 5TSWA 3K48A 5HBAA 1RJ7A 2JG9B 1U5XA 1PK6B 2HEYF 3V56A 2JG9C 3B9IA 2X29A 4MXVA 1JH5A 1PK6A 4N90A 1XU2A 2RJKA 1A8MA 4MSVA 3B93A 1OSGA 2AZ5A 4E4SA 2KA3A 1XU1A 1TNFA 3IT8A 1JTZX 2JG8B 3WD5A 1S55A 1IQAA 2Z5WA 4G4FA 4GIQA 4EN0A 3TYJA 1OQEA 4NN0A 2JG8A 1D2QA 3QBQA 4QQ2A 1C3HA 2WNVA 5KC5A 4D7YA 1PK6C 4DB5A 5L19A 4QPYA 1D4VB 1I9RA 2HEVF 4F3JA 2TNFA 3URFA 2WNUA 1O91A 3FC0A 2QDNA 4KGGA 4QQPA 1KXGA 2R32A 3QD6A 3AB0A 4QQHA 4RSUA 3B94A 1WCKA 2WNVB 4E4DX 3L9JT 2JG8C 1U5ZA 2WNVC 1GR3A 3TWIA 2WNUB 3K51A 1TNRA 5KC6A 2WNUC 2RJLA 4MXWA 4TWTA 4KGQA 4QQOA 1DG6A 1DU3D 2O0OA 1OQDA 3MI8A 4OUSA 4HT1T 2OIIA 4KG8A 2R30A 1U5YA 2QE3A 4QQLA 2JG9A 5L36A
chains in the Genus database with same CATH superfamily
4LXLA 3ZSEA 3NJYA 1W6PB 5KBFA 2VUAA 1LTEA 3FHIB 3NL1A 4Y1VA 1LHOA 1CJDA 4MXWB 1HXS1 2VZOA 3U14A 2BBAA 2UWAA 1PM4A 5LWBA 2PFWA 4LHLA 1PMHX 3AZWA 3LQCA 1AR91 2C1FA 5J98B 2MEV3 3N9PA 3UGHA 5IWFA 1W8ZA 4XAAA 2XJSA 3HT2A 2PXJA 3M3QA 4K7JA 4KG0A 2DVGA 2JEMA 2WLQA 2ZX0A 5LK5A 3ZXGA 3ZVXA 4CU8A 1AHSA 3POSA 2EXHA 3SH4A 5C3RA 1POQA 2R042 2WL1A 2G9FA 3AFKA 4WV8A 4Y1YA 5FP7A 4B7EA 3CBNA 3QACA 3TN92 1VRH1 3VKOA 5JPMB 3GNEA 5SV8A 4LKDA 1QJY1 4XUQA 3WP6A 3B5LB 2J1UA 3LA2A 3MLJA 2W91A 4COYA 1SLBA 3M3IA 2GNTA 4MOAA 3U0ZA 3N35A 1RUI1 4I3PA 2PA7A 3WNNA 4Z2WA 3ZYIB 2JE7A 3ZFGA 1VMFA 5L9VA 1FMD1 1CAVB 1YQ2A 3N7LA 3KGZA 4P9WA 3UGFA 1W2UA 1C8NA 2H6BA 2IXHA 3I8TA 3QH7A 1VJ2A 2FDJA 4LBQA 3EQEA 3UV9A 2WT1A 2D6PA 5CFCC 4HVRA 3CL1A 5JUVA 3UNPA 4P5YA 1ND2A 2WINB 3W20A 3WQBA 3ZXDA 1DZTA 3UJQA 1CX1A 1R1A2 2VG9A 2XVGA 3B02A 1FPN2 4QHOA 1PK6C 5ISLA 4CEYC 5A1LA 2I74A 4EYUA 4AEDC 2XUMA 1RUF1 2DTWA 1U0AA 1J59A 1TZOA 1QJEA 3D4KA 3SKVA 2B45X 2PHLA 4P9YA 3RRDA 4IXLA 1K12A 3FC0A 5LRSA 2X8KA 2EALA 1L7RA 2JDUA 2ORZA 1W28A 4BOWA 1W06A 4QPGC 3DUIA 3MIEA 3OUHA 4NRMA 3OGRA 2CHHA 1PGW1 3DXUA 3B94A 1REEA 5FMOS 2Q8DA 1QJU1 2W1WA 5GZDA 3IAQA 4A6OA 1TMF2 3K4ZA 1T2XA 2XLAA 3NJXA 4N9IA 4RGAA 4YW2A 1UOBA 5I8TA 4ISQA 5DAXA 1H30A 4GMP3 4B4PA 4B8EA 3K75B 4NUBA 5IYYA 1UX6A 4WVWA 2WYFA 4Y20B 4GWJA 1JUIA 1V6JA 5BNOC 2J42A 4CDWB 3WNMA 4XQWA 3HBKA 2RDRA 4Y20A 4TTGA 5D8AB 3WEZA 4FCAA 5C3OA 4DXTA 1LOFA 2V73A 3RS6A 1BQPA 1OA3A 1GZWB 2WWUA 3MFCA 3VBHC 3BB6A 5D8AA 3U75A 2BP6A 2E7TA 2QQIA 2Y6FA 4CDUB 1C5IA 3HNMA 2K9ZA 1UL9A 5CG9A 5C8CA 1LCLA 1LENA 1RTVA 1VALA 1WA6X 1MACA 1B35B 2BGCA 2X09A 1AR71 3N36A 4QQLA 4L97A 5D1IA 4QDRA 1JBCA 2VTXJ 5EHDA 4F83A 4CDUA 1JU3A 5JAXA 1UKGA 5FY5A 3VHPA 5C9AB 2D6NA 5CB7A 4A2UA 1JZ5A 2BYVE 1CGPA 5BNPB 4FXKB 4E8CA 4ZY9A 1D0GA 1WCUA 2G9GA 2A1XA 1AR63 2D7FA 3ZXKA 1S0IA 2VTFA 3H0OA 5FYYA 4CUCA 2ID4A 4AFDA 1D4M2 1QF3A 4QDQA 4ZXKA 3VBRB 3VHOA 3JBG1 1EP0A 5JSPA 3GHMA 1S0EA 2HWE2 4QU2A 1BK1A 1H6XA 3Q8AA 5FZGA 4LJHA 3S5QA 4UBHA 4GH4A 3FMGA 2ZGOA 4XJAA 3AKPA 3OJBA 5FKBA 2R072 2CSGA 4D6SA 5C6CA 2OW4A 4BCUA 3TOJA 4JAAA 4IGQA 1FNYA 1BEV2 5A7WA 5FWJA 1W8NA 2WBKA 3WLUA 2CNAA 5KXDA 4KBZA 3B3QE 4Z2AA 5HXVA 2J1RA 4YGBA 2VW2A 3MIHA 3KSCA 2VNGA 1Y4WA 1PO23 3ES4A 2O8OA 1ULDA 3WNPA 5FJKA 1VBA1 4PLOA 3R0RA 5T5LA 5FZHA 3D6EA 5FYHA 4CE8A 2WS92 2WNOA 1QDOA 5DDJ3 3CU7A 3RWKX 4EN8B 1XYOA 3JCIA 1SCSA 4I0AA 4M0HA 3GZUC 2LRPA 4FPYA 4YNIA 5HPOA 4RR3A 5EFUA 1UYXA 2GNMA 3O0XA 1WW6A 4Q4V1 5F32A 1MR5A 1WLWA 2QKDA 2IFWA 3HQUA 2Y34A 3MO4A 3WSOA 3OY8B 3ENRA 5HCBA 4Z8BA 5T54A 2VQAA 2XQXA 3CIHA 4BJ0A 1REDA 3WP4A 1Q5OA 4MGZE 3T2OA 1XNBA 3OY8A 5DAVA 4QHZA 3I2OA 2V4AA 1NXD1 1DYKA 1YQ8A 2JDHA 2ZHLA 1RGSA 5C3SA 3IKWA 2O14A 1XNTA 1XYNA 1AYM1 5GZGA 4AVVA 3TNPB 2F4LA 5B2GB 1QJX2 4LUMA 4YM1A 4QXCA 5A7QA 3VZNA 3UKVA 2HKXA 1DDLA 4UW5A 2W87A 4E2QA 4HLTA 5DPNA 2WNVC 1RUJ3 4V1PA 2YG0A 5IVJA 1UU5A 5KHGA 1ZRFA 2Y26A 2ZS6B 3TNQA 1OT5A 2F4PA 5FY7A 3BGAA 3TEZA 4IDZA 3N9LA 3F2ZA 3K51A 1UYYA 3I3BA 1NA1C 3GZAA 2ZGRA 1IPKA 1NYWA 1SDDB 3RYRA 4ASKA 1E5SA 4MHUA 2VMFA 2BWAA 2EIEA 4AI9A 1VMHA 5FYUA 1BBT2 3MICA 2D3RA 2A75A 4HN0A 2EAAA 1O3RA 2WQ8A 2W47A 3FJSA 2JD4A 3GBWA 4FXGB 4XW3A 3ZSJA 3ZYGA 1C1LA 1OF4A 4OUSA 5EJ3A 4JTNA 3HBZA 3W59A 3ZFFA 4XDPA 1V6LA 5E8AA 3WV6A 4A3XA 3WDUA 2ZXQA 4KI5M 3J8F2 1Q8VA 3H3UA 1IKQA 4ZU5A 4DEQA 4CZSA 5FZ6A 3AYDA 3H8RA 3D5OA 1KDKA 1HLCA 4Q26A 3KHBA 4N53B 3LKJA 4YM0A 2Y6GA 3CMGA 4UFMA 4UT5A 4GKYA 2MPFA 1US2A 1VIWB 3JQXA 1JS9A 4C91A 1KGYA 1QU0A 5KWRA 3O1SA 3BUCA 4LORA 3J4UH 2E9QA 5BNQA 5FPLA 1GZCA 1VLNA 5LW9A 1MVQA 2P2KA 2JG9B 1HB1A 4S2DA 1AL0G 4O61A 1JHJA 4B3NA 5CFDB 1QOSA 3T3YA 4N9HA 4NIAA 1K5MA 3NAPA 3H1MA 1MS4A 4OHYA 3ZYPA 1CAUB 2A3XA 3DXTA 1HRI2 1I5PA 4K9SA 1AJOA 2BU9A 1W8OA 4OZOA 4COVA 1Q43A 2XKOA 4XURA 5IK5A 3ABZA 3PU8A 2FQPA 4HKLA 4MSVA 4XF4A 5FZAA 2HJIA 1W2NA 2JENA 3QCWA 1HXS2 3D82A 1GUIA 3OPTA 1LOAA 3BOPA 3M3EA 1F2NA 3LSEA 3WCRA 2W52A 1EUTA 3O12A 4DFSA 3RGBA 2YC2A 2BUKA 5HCAA 1POV3 4XF0A 3SCGA 3ZXAC 4AVCA 1X36A 4WM7B 3WW4A 4JDNA 2VNRA 4OHZA 2A73B 4YZ5A 3KV4A 1PVC2 2D40A 3ZSMA 2WT2A 4WM7A 2HWC2 4AAPA 2GN3A 2VO5A 5F9TA 3PVEA 2FD8A 1UY4A 2RS32 4RS5B 3WHTA 4JRLA 3AP5A 3U4SA 2XJQA 3ZFGC 5JDBA 5JZGA 1OKOA 3THPA 3VKFC 4CUAA 4XXAA 3SHRA 1PNFA 3LF7A 3QH6A 3DYMA 3LA7A 1V0AA 4XYXA 3AVRA 3HD8B 2RHPA 3OGJA 1EV11 3AZXA 2CAVA 2Z42A 5A6ZA 1FT9A 3SC7X 2CGPA 1NQDA 5JXIA 2CDPA 2SBAA 1DLLA 1ND2C 3VBOA 4AVSA 1GQHA 2WZPP 1O4TA 5E88A 3OUJA 4C1XA 2RR11 1HX6A 1WBLA 4FOWA 4W65A 5T5OA 1UOJA 5DMYA 2XBO2 3RDIA 4Q8KA 4ASMB 1FOD1 1MEC1 4YVSB 4P9GA 3MZHA 2W46A 3WNLA 1S0GA 2AC1A 2YHJA 5A3LA 3O5SA 3VBFB 4N43B 2VD7A 1E57A 4MGIE 4CPBA 4IQPA 2FZ2A 4F8AA 1H2MA 5FZKA 2IXJA 2WWJA 1QHDA 4YW7A 5AVAA 3VBFA 3NV1A 1HRV2 1KS4A 1TVGA 1D2SA 2IC1A 4LHSA 5FYMA 4UI9L 1GKBA 1CD3G 2XONA 2BGPA 2ZAAA 3RI8A 4XF1A 4XQDA 4QKDA 4XQ4A 1EPWA 4IEZA 2HEWF 3ZN6A 2VY0A 4LEJA 4HKWA 4AGVA 5DAWA 4YWAA 1PZ7A 1JUHA 2JECA 4E4HA 1XXNA 1SCRA 4XABA 4OUMA 1RJ8A 1I6XA 1LOFC 1XE7A 4RHV2 4HZFA 4JQTA 1PX3A 2I2SA 2PHWA 2UURA 3K46A 2R041 4TSVA 1ULCA 5D8AC 4CU6A 3LWCA 4L0PA 1CONA 4GD4A 2GMEA 2WZEA 2ET7A 4L92A 4MGTA 5C8CC 1WBFA 2ARXA 4IV1C 3OGGA 3C7FA 3ZYHA 3B9IA 2Z4FA 4J1XA 4C0HA 1NZIA 3LOIA 4CDUC 4WVVA 1GBGA 4MGYE 1XU2A 2W0XA 2XOMA 4A42A 3FUQA 5FXXA 1C8M1 1JZ8A 1PIV3 4PIYA 3L2HA 2J1SA 3PUIA 2W9XA 4M00A 3IT8A 4V2VA 5CFCB 5A33B 3B69A 2J1AA 1HB3A 4XILA 4Y4YA 4D3WA 1EAH1 4W8JA 1ODNA 2A6XA 3DKWA 1V9U2 4MLOA 5FV3A 3N9NA 4AHZA 4NN0A 5IVEA 5CFCA 4GH4C 4FOQA 4D6RA 3BIWE 1LOEA 1JN2P 2RJ2A 4AEDB 3K77A 4FPFA 1HN1A 1R1A1 2Y60A 4KL1A 1RUG2 1FPN1 3C7HA 1ASJ3 4MH0E 4RL7A 2XPJA 4NO4A 4S2FA 1UMHA 3WNXA 2OS2A 3ILRA 4BPZA 1LB2A 4ZZ8A 3ES1A 5FZLA 2WWSA 3WG3A 1O3TA 4QPGB 3PDQA 5H9PA 3URFA 4S2HA 1WW4A 2JJ6A 4WVMB 3A0KA 2ATFA 4A7KA 1W6QB 3VD3A 4QQPA 1OURA 4AI1A 5IAXA 1DGRN 2VZQA 4FPHA 1ZBE3 4O7XA 2E7QA 2ADEA 3AJZA 2WUHA 3LFMA 1LJ7A 3JUUA 1RC6A 4WVMA 3GGLA 5F5IA 1BMV2 2VU9A 2BJSA 1IG0A 1H2KA 1WD4A 1TMF1 3J7NA 3M8LA 4WZFA 3UT0A 1OUXA 1VBA2 3AKTA 2PHTA 1X33A 2EXIA 3M4FA 3OYWA 4FO9A 5GKAC 4Q4X2 3T1LA 3BU0A 1E5RA 3LPGA 4RFT0 1NZCA 1CQ9A 4CCNA 5BNOB 2VC9A 4RR3C 5FBZA 2DVAA 4N8MA 5FFOC 5FCCA 2RVAA 1TME2 2P37A 1QNYA 4K1YA 1S1AA 2AYHA 4Q4V2 5FLIA 3ECQA 4JVAA 5EIYB 1TNRA 2IVIB 5FJHA 5KHIA 5KC6A 3LEKA 3VBHB 2HWD3 3ZO0B 2VOKA 2W94A 5JXGA 1VBE1 2LALA 1Q8QA 2BTVC 1VB4A 2OQ7A 3C2UA 2XJVA 4QDSA 5I0DA 1H4HA 1E5HA 3OBZA 2WYSA 4F7ZA 5FZEA 2W95A 2DCYA 5LBBA 2ZGMA 1O7FA 1KQRA 4PQQA 5FOBB 1N3QA 2BNOA 2BVVA 3THDA 1F4HA 4XBLA 3PVOA 5FP4A 2WA4A 1W2AX 1NLRA 4Q1RA 5CU1A 5EP9A 4CSWA 2X53S 5IATA 1LU1A 1RITA 3E1F1 3QOPA 4AAXA 2D98A 5GLUA 4K20A 2Q5TA 1SHWB 2OPWA 4XIOA 2E6VA 1Y9GA 1AR93 2Y64A 3LSDA 1W6OA 3FHQA 4HONA 1D4M1 4XETA 1GP5A 3GM8A 2HWE1 2KD7A 4QGMA 2WN2A 1AUYA 1PO11 3CZJA 3BN6A 1H0BA 3LEMA 3VN4A 1V70A 4C1WA 1ZBA2 2IWGB 2R071 3ZFFC 5FZ1A 2OQ6A 5K0UA 1VRH3 4UWDA 4EWDA 3I3DA 3NO8A 2VBDA 1XNCA 2YB7A 3Q8EA 4XE9A 3SLIA 1NLSA 1QJY3 4BZ4A 4I02A 3HNYM 1W04A 1G9BA 2CY6A 1Y3TA 3D0SA 1XSQA 3OPZA 4W6YA 1MZ6A 4BQ4A 4HPKB 1RUI3 2RJKA 4EWEA 3DV8A 3RPQA 1R082 4IEXA 1YJLA 1N3OA 5A7PA 1Y9MA 3UETA 3KV5A 1APNA 1UN1A 1VBB2 1FMD3 3ITQA 3GJAA 5I8SA 2JG8B 4GJZA 4BHPA 1IQAA 1GANA 2JKBA 3H1YA 4K8FA 4QM8A 1V6KA 4GIQA 5K9YA 1DFQA 5DG2A 1OQEA 2W68A 2WIIB 1FX5A 2IXKA 1NQJA 3BU7A 4XTPA 2JG8A 3KZ4C 2WLPA 2IXCA 5A3WA 3QBQA 2JB8A 3WDWA 4AL9A 1K5MC 3NAPC 4UW4A 2YU2A 4D7YA 2CYFA 5CKNA 1SLTA 1W90A 3O0VA 4IE4A 2B39A 1QQP1 1RUF3 1O59A 3FLPA 4UFIA 1D4VB 1UIKA 1CIYA 3RI9A 4MZUA 1GNYA 2NP0A 5FYSA 1CIWA 1YO8A 5JPNB 1XOYA 1PNGA 1AL22 4OI4A 4LHKA 1N3PA 2JICA 3WQ7A 1R64A 1ULOA 3UYJA 1SBFA 3POFA 1CZVA 4E2SA 3RZHA 1U12A 1QJX1 2D43A 1WCKA 1P8JA 1QJU3 1ZYBA 2WNVB 5FPZA 4LHNA 2D6OX 2PHRA 2WZ8A 5FTTC 4LBMA 4Y5TA 2AGSA 1LHNA 4QX1A 3EMRA 4CDQA 1G9FA 5JOXA 1VE0A 1AX0A 1S2KA 2VE1A 5H9QA 1NCQA 4UF0B 5ABJB 4WM7C 1XE0A 3ZDSA 3IMNA 4RGGA 3Q8BA 4LE4A 4AHYA 5CKMA 4E27A 2QBXA 1OHFA 3NNGA 3RYKA 5M0TA 3POGA 1XQNA 1BBT1 2EIGA 5ABJA 4KGQA 5JZGC 3WDYA 5L9RA 1H1IA 5A3NA 1YUDA 4JDMA 1DU3D 4YG3A 3OSDA 1O4YA 4BK5A 4EN9B 3V0BB 4IV1A 2P4EA 4Q4Y2 3ROUA 5DZFA 4EROA 3S5AA 4XVHA 1PZ8A 1EV12 3INAA 3W58A 2WFF1 2WZR2 3VBOC 1AR73 1WMFA 5C5TA 2EIBA 1VMJA 4DXSA 5J96B 3N9OA 4Y1UA 5BUVA 5CYYA 3NNMA 4J6GA 3PJQA 4JHTA 4LK6A 2Q8OA 5L7OA 3WR0A 1VBC2 4LIVA 4FFFA 3ZKYA 2GDFA 5ACA1 3BPSA 4IGOA 1FOD2 1WW5A 3PJYA 1GMMA 2NN8A 4XPVA 4HK9A 1HV1A 2VZVA 1UXZA 3JD72 4RN5A 5A32A 4C0BA 3JBG3 5FR3A 1QIQA 4QD2A 5FP3A 3VBFC 3JZVA 3VZJA 4KU8A 2C9AA 4IE0A 3PUAA 1UAIA 1GZTA 4QWNA 4XZUG 4Z1VA 3T4HB 1JYXA 1IS6A 1E5IA 3SCFA 1HRI1 2JIJA 4CVUA 2HWF1 2VPVA 1JH5A 4CEWA 4EZ4A 2VTXA 2I07B 5DG1A 3BIEA 1NE6A 2GC3A 4PIZA 3RZKA 1HQNA 2YFUA 2AEYA 2OUJA 4JDOA 2EF6A 2FDKA 1ZRCA 3AMNA 1H6YA 5CNAA 4FP3A 3FUOA 2CV6A 3AP6A 2YMZA 4AI2A 3WD5A 2A6ZA 1OF3A 5F3IA 3UKNA 4JKMA 1GP4A 1VBA3 5T55A 2BERA 2BOJA 2DU1A 2Y6HA 4O9GA 1S2BA 1Z78A 4YVWA 4H3WA 4AEMA 4ZHNA 1AJKA 1UY2A 3P5BA 1QDCA 5EWSA 1VP6A 1W9FA 5JR7B 3LB9A 3NMBA 4Z92B 2GH8A 1PVC1 3J7HA 1ZX5A 2HWC1 3MPBA 4FSJA 2LROA 1GLHA 4YRDA 3ZFGB 4QKFA 3U10A 2RS31 3B7MA 4LNVA 5LZ6A 1YHFA 3WDXA 3GCXA 4CCMA 2BQPA 3MV11 1IOAA 2DCTA 4FAGA 3LOBA 1FATA 4LBQB 4HVQA 2KXLA 1C8M2 4YW4A 1UYPA 5FZ9A 2H6CA 5GLZA 3LGRA 3LEIA 2VOTA 1JZ3A 1AYM3 1ND2B 5FMDA 3VKNA 2ZTNA 3ZMNA 4D0QA 1IGOA 4GB32 1EAH2 4KWUA 1GWMA 1RUH2 4YW5A 2KM2A 3AXDA 4KMQA 5EYYA 1GICA 2LS6A 3U4XA 5CZKA 2ZMNA 3PL0A 5C8WA 3ZXFA 1IKPA 3TWIA 1IQDC 2QDRA 2XBO1 3ACLA 5DUXA 2EXJA 1CAWA 1QXPA 3CEWA 3JQWA 1FYUA 1QJFA 1W03A 4YM3A 2GC0A 4N7UA 1QOOA 3KCCA 2Q8CA 3OBAA 4D69A 4X6RB 1QOTA 1G9CA 2GALA 2NMNA 2VBPA 3OD0A 2JB4A 2BOIA 3I2FA 5FXVA 3ZIWA 1TEIA 3ETPA 2WDBA 2ZHNA 4YW1A 2HBUA 1HRV1 2K0GA 1FV3A 3POBA 1UOGA 4YFWA 1WZXA 5FXWA 4URTA 4B7KA 4YSFA 1URXA 2GMPA 3LCPA 4KG8A 2N7GA 4LBQD 4SBVA 4JHZA 1JU4A 3U37A 1HB2A 3AZYA 4AQ6A 4BIFA 2CAUA 5L36A 2GN7A 5T3NA 4DY3A 4P9LA 2IUWA 4ASLA 1YQCA 4QMAA 3WY6A 2W39A 2ZHKA 1NT0A 5DAQA 2W5FA 2GNBA 1QGLA 4KBBA 2WFPA 4NPRA 4AYUA 2ZGUA 3A23A 4XUOA 1UCXA 3V0AB 1W6MA 1UY3A 3HT1A 1FV2A 2XG3A 4RHV1 4AZZA 4OULA 2UU8A 3E5UA 1VBE2 3V0AA 3OBTA 2Q8EA 3WDTA 5C8CB 2AENA 3E5XA 2RMU2 1JOPA 3K48A 4KH9A 4IV1B 4L11A 3O14A 1J3PA 2PMWB 2DCJA 5FZ8A 5HBAA 5JWPA 3VBUB 1F35A 1JMUB 2OXBA 1ULGA 1WMDA 2K2SA 2V09A 1RUOA 1W0NA 3A21A 1QH7A 4MGQA 4R4XA 3O1MA 2ZAHA 4N90A 4Q0QA 3FHAA 3VBUA 3LA3A 3C7EA 3PURA 5IJRA 3USUA 2NPIA 4DMIA 1H1MA 4P08A 4NR1A 3T4VA 2DCZA 4P14A 5C4WB 4YARA 2X10A 1DLCA 2QQWA 3HR9A 1HQWA 5FUPA 4AK3A 5FO9B 1RB8G 4D7TA 3FE5A 1BVVA 3NVCA 3I2JA 3VBSA 5I0RA 2C0ZA 3WINE 4EQVA 2VH9A 3OUIA 5C4WA 5IVVA 2YDEA 4GH4B 4U36A 1V9U1 3A22A 1A8DA 1X8MA 5EXOA 3ACGA 4FOYA 3TYJA 3FBMA 3N9QA 2VBBA 1FAYA 1RUG1 1X82A 1PO12 4ATEA 3M2MA 2DFBA 1QEXA 3WNOA 5K0UC 2UWBA 3M1HA 2NZ9A 3R6SA 5A7WB 4AEJA 1Q8SA 3I3MA 2VW1A 1AR82 1H1AA 2ZGTA 3ZYBA 1JZ4A 1MS8A 5F3EA 1RXGA 1MS0A 4UBGA 4IERA 3A4UA 1AXKA 4LBNA 4Y5Z0 2D97A 1TE1B 2EICA 1SEFA 5DXDA 3ZSLA 2WSVA 4KGGA 3UJOA 4A41A 2DURA 4JQRA 4ZU7A 4MX3A 5LBEA 3AC0A 1C1FA 3VZMA 1BMV1 3PMEA 3VDCA 2ZMLA 4BE3A 5FPVA 3BPZA 1MZEA 1GZ9A 1HKDA 1EV13 3KVAA 3DECA 4GAZA 4Q4X1 4Q4W2 4RR3B 1KFUL 2ZKLA 2JG8C 1G6NA 1TQ5A 3MIGA 5FBJA 2GAUA 3DN7A 5A3OA 5K7PA 1TME1 4LPLA 2RR13 3ETQA 4HL0A 5LY2A 1CESA 4ITCA 5FZBA 2CWMA 3EJKA 4WVZA 3WF1A 5FPXA 1FOD3 1MEC3 1PGSA 2Y33A 3A7QA 5C33A 1QQP2 1YJKA 2RJLA 5D21A 4JC1A 1MZ5A 5IK4A 1KDMA 3AM2A 3SITA 3CHXA 2RS51 4J25A 4YFZA 2QQVA 3MI8A 1NE4A 4XDQA 3WT3A 4IEPA 3VL9A 4EWAA 5EZWA 2DBIA 2CWSA 4TLFA 4XFHA 4DNYA 1NCRA 4COWA 1L7LA 3C3VA 2BDRA 2QE3A 2RS12 3FX3A 2FMYA 3S57A 4D7SA 2VNVA 4CP1A 4Q27A 5ERLA 5GLTA 4PJYA 4X8PA 3ZMOA 4QX8A 2Q1MA 4CDQC 3PMSA 4RA0A 5GLWA 1Y43B 1XB9A 4Q2FA 1NCQC 1W9WA 3MF9A 2IXLA 3AYEA 2D5HA 2VQUA 3HVDA 3KV9A 2EIDA 5C71A 3U11A 5IVYA 3T2TA 4LE3A 1LGBA 3O1VA 1YI7A 1KS5A 5ABJC 5FYBA 4K21A 2XJPA 3LE0A 4WM8B 3ZFFB 2ZJCA 5DZGA 3OPWA 2R043 1W8UA 2XH6A 4NAOA 1ZBA1 3POJA 1OBNA 1QH6A 5FWEA 2AACA 3TN93 3U07A 1OOPA 3VGIA 4B1MA 4CP2A 5F8PA 4QB6A 4WM8A 2H0VA 3NJZA 1H9WA 4V2WA 4KU7A 5C7GA 2XVKA 3AYAA 3H3LA 4XUNA 4LO4B 3C8XA 3AP9A 2WFF2 4XFFA 2E53A 2XJUA 4LA3A 2RM22 1R081 2ZGPA 3GBFA 4XF9A 4Y26A 3NKTA 5FPBA 3TAYA 2W3JA 1RMU2 2WNEA 5L7OC 1VBB1 5T52A 3ACIA 3VD5A 1YYNA 2QQKA 3K4DA 5FYTA 3RJ2X 4FTEA 2J1VA 3IMMA 1US3A 2TEPA 3KT7A 5ACA2 5T5JA 2BNMA 3H7YA 3AMHA 2O8QA 4HN1A 2Z5WA 1EAH3 1RUE2 2WABA 2PQSA 2XR4A 2ZZJA 2LUWA 1K5MB 2PYTA 2UWCA 3I54A 3NAPB 2B46X 4H55A 5J36A 3FL7A 2NQYA 2C4XA 4QB2A 2VZ1A 4NPMA 2LM3A 1R1A3 5FKCA 1FPN3 4XHXA 2K46A 3T1MA 4CEWC 1SFYA 1MS5A 1UZVA 4FVVA 2WA3A 3MV01 2HWF2 2B7YA 4HBNA 1F31A 4PDWA 1BKZA 1AL21 2VECA 3WF3A 2AEZA 1IG3A 1SBEA 2E31A 4GULA 5FZCA 4URAA 5LK7B 4FTSA 4FPEA 4KWKA 4DUWA 5JIUA 1QY4A 2RG4A 3GBGA 5EPAA 4B4QA 4ARYA 1GSLA 2ZEXA 4LKEA 4DPNA 2W08A 5BYNA 5J7MA 1TMF3 4XXPA 3WG4A 4YVWC 4NVPA 4X6QB 2B42B 1CZTA 3PHMA 4IEVA 3VD7A 2JXAA 4OFGA 3HN1A 4YG0A 1R092 2G4IA 1RUD2 1AX1A 2P17A 3K4AA 4CRQA 3N4MA 2R061 2JDMA 3KLSA 1C4RA 5JZGB 3ON7A 1DQ2A 3JB4C 1G8WA 4HG6B 5FZDA 1OPMA 4B4RA 5J37A 1EUUA 1H8VA 2ORXA 4FPCA 4XMAA 4QX7A 2BBVA 5JSOA 4FQ4A 1DG6A 3THTA 1ND3A 2VMCA 3IDAA 4PBOA 3PU3A 3M3OA 4Q4Y1 3VBOB 4Y24A 3WF2A 2HLEA 1EY2A 3IDCB 2IXIA 1AX2A 1A6CA 3KM5A 2R30A 2WZR1 2X5IB 3OOXA 1OUSA 4ORFA 5FY1A 5CAZA 1KEXA 1XYPA 5FREA 5CA6A 1OLRA 2X5IA 3VDDA 1YEWA 1EYBA 1VBC1 1O5LA 2E51A 3KT4A 3L2YA 1S0DA 4Q5OA 4COUA 4OQ8A 2ET1A 3WOGA 5KXBA 4BQ2A 1ALYA 3PVNA 2ZX2A 1KD7A 1ZM1A 2LTNA 3DGTA 4MVTA 5AC92 2WT0A 1D4M3 5DN2A 3JD71 5FZ7A 4E2GA 4YYOA 3GZTB 2HWE3 3MUZ1 5FZ0A 3H42B 5F5CA 5FYCA 4AI3A 4MGSA 3BTYA 3VD4A 3RMYA 2CTVA 1DGWX 1J1LA 1OH3A 2R073 2HEYF 3E6BA 4QPIA 4I09A 4BQXA 5LASA 4FPOB 2ZX1A 1RXFA 3X29B 3ZN6B 5HCFA 4AFMA 1BEV3 2FMDA 3S30A 4DXZA 4XJ8A 3I3QA 5F2WA 3KS7A 2MHFA 2Y38A 3O1PA 3KMHA 2P1BA 4LBOA 3WW1A 4IL7A 2ZGQA 4O9EA 2ZACA 2VULA 4ES9A 3LDKA 4KWLA 5F2SA 4NJ4A 2D6KA 4GWNA 1G9DA 4TZDA 1XU1A 5E16A 2PAMA 2FDGA 4DO0A 4H2AA 2XJTA 2WS93 1I3HA 4CPBD 4G4FA 1DF0A 5HCHA 4RYDA 2VUJA 3ACHA 1D2QA 5F1RA 4L2NA 3IDEA 4Y5SA 4A45A 1FI2A 4A4AA 3OCPA 5EV7A 5FYZA 2KR2A 5K8SA 2VVFA 1UPIA 3MDPA 4AI0A 2JX9A 2BNNA 2ZEWA 3VBUC 3U78A 4ZKTB 1UKRA 3BTAA 1XPWA 2LW8A 1K42A 1I9RA 4F3JA 1WCQA 2TNFA 4XDOA 5E1RA 5FZIA 3IIAA 2C24A 2WN3A 2GNDA 3PIGA 3VL8A 1I1EA 1HQLA 2WC2A 3ZN5A 1ZA7A 5LCWL 4MO3M 3SKJE 1S0CA 3VBSC 5C4WC 1SG3A 1QJX3 2NMOA 2UY8A 4GB31 4CXXA 4FFIA 2WAAA 1RUH1 5FRAA 2EXKA 2XQRA 5H9SA 4ET7A 1DQ4A 2VM9A 3RZLA 1UD1A 1U5ZA 2OYZA 1OD5A 2B9VA 4XBNA 4JGYA 2VZTA 4RQPB 2WO7A 5HI0A 3HJRA 4FI9A 4AVTA 4C90A 3RZZA 4NROA 3POWA 4JGZA 3HWJA 3I4IA 3TRSB 4RQPA 5J09A 4FOVA 5ANNA 4LTAA 2DVDA 4NWWA 2RDSA 1BBT3 4YZ3A 4IGPA 4CCKA 1ZRDA 2P3KA 4OUEA 2XJRA 2P34A 5BPXA 2A3YA 3KQRA 1YI9A 1RIRA 2O0OA 3OYWB 4NRPA 4OHXA 5I91A 5JMOA 2YROA 2CGOA 3ACFA 4ZU4A 3ZFEA 5FP8A 1DIWA 1RUC2 1QXJA 5IHRA 2OIIA 5LEKA 1U5YA 3J8F3 1OMIA 1YXWA 2H0BA 1D7PM 4NHXA 3DPRA 2Y0IA 4ZXEA 5G04L 2E7AA 2DUOA 3HEIA 5JCTA 4Q1PA 1S4CA 5F3CA 2O1QA 1SDWA 3NJVA 2XMLA 3IB3A 1LEMA 1DHKB 1BCXA 5J1XA 3ALQA 1COV1 3OTFA 4M4RA 1W9YA 2PN5A 4PLMA 2FBEA 1H8TB 4L9BA 1VR3A 1SMVA 5ACA3 1LECA 2OPKA 4OZXA 3ZYJB 1J3QA 4CCOA 3HQXA 2RMU1 4XC9A 2MEV2 1H8TA 5TSWA 1W0OA 3NSTA 4XACA 4P5HA 2DVFA 5JLVA 1U5XA 4DUXA 4P02B 2A6YA 2RS52 3H50A 1NCRC 5FPUA 1ZZ7A 4I01A 5IW0A 2VUCA 4PHZA 4DS0A 4IE7A 1HRI3 2NM1A 1NLQA 2ZGKA 1PM7A 2XLGA 2FHRA 5E6HA 1VAMA 2QUOA 3LAGA 3HAGA 2ETEA 4HSJA 4C8DA 1ZA4A 3GHNA 1W6OB 1W8HA 3SQOA 1HXS3 2BRTA 4CP0A 4QXHA 1G86A 1VAKA 3I59A 4QAWA 4E4SA 5LY1A 3RWNA 2QJVA 3O1RA 3I49A 3RZJA 3DL3A 4HVOA 2ZBJA 4GJYA 4YZ1A 3Q8FA 1S55A 2WSUA 3MIDA 4BQ5A 1L3JA 2YC0A 4P9JA 2IVJA 4AQSA 5FLJA 5K0UB 4EN0A 3R4DB 1M06G 1GNZA 1TG7A 5FO7B 3THCA 5DQ0A 1OOPC 1PMIA 2J7MA 4WM8C 1V00A 1LESA 4XZPA 3T30A 5LEJA 1AR81 1O8SA 1XC6A 1W9TA 2VMIA 4Q0PA 3RVHA 5CEHA 3CLPA 2XL9A 1PVC3 4K1ZA 4IEQA 4LQRA 4Y3OA 2HWC3 4QHBA 1ZZ6A 4M3CE 5FMOL 4INDA 2RS33 4NAMA 1CPNA 3GJBA 5A7OA 2YFZA 4Y22B 1R1ZA 2WNUA 4QX5A 4BDVB 5C70A 5A1AA 2GSYA 4GALA 3G6JB 4O65A 1MQTA 2Z2SB 4Y22A 2PHUA 5LA9A 4TXWA 4GWIA 5LB6A 1K45A 1C5HA 1GQGA 2D93A 2DWRA 4MGKE 4Q4W1 3OGVA 3WHUA 4JKLA 2JKXA 1DYPA 2XVLA 1FNZA 1HW5A 2D6MA 3E6DA 1PHMA 1UOFA 4YGEA 5FZ4A 1YIPA 2HYKA 5I0TA 3PIJA 5CADA 1UY0A 2R0FA 1UZYA 3ZLIA 3KF3A 3WF4A 3AMMA 5IK8A 2I45A 3VHNA 2AR6A 2Y8KA 1SLCA 4DUVA 2XBO3 3AKRA 3KB5A 1F9KA 4FPLA 5DUUA 1UU6A 4MG2A 1YCIA 2XXZA 4AE2A 4PDWC 1RVF1 5CBLA 5DZEA 5A7NA 3BOWA 3NV3A 1MPXA 2L9LA 1IHMA 3DEMA 1JYVA 4OI2A 2JE9A 4QKNA 4QX0A 2JDKA 3IPVB 1X50A 4CXWA 2OZJA 4CCJA 4Q8LA 2YGMA 1JYNA 3BALA 1FXZA 1HRV3 1SZBA 3MW3A 3SMHA 2Y6KA 1NX9A 3ZXEA 4LITA 4META 3IPVA 2RS11 1OPOA 3AX4A 4CDQB 3MEPA 4E9KA 4NHYA 5F6LB 1NCQB 3RSJA 1POV0 2W2IA 2XUEA 1QMJA 4XF3A 1VBD1 1ENQA 1ULFA 2FDHA 3WG1A 3D3AA 1ZZ8A 1C28A 1H9PA 2DTYA 2R062 2GMMA 3ZYFA 1DCSA 4BQYA 3O0WA 4DOUA 2OT7A 4B1LA 5FP9A 1ZZBA 1JXNA 4I0BA 2VZRA 2ZPXA 3GCWA 5FK7A 4RHV3 5A6QA 4ES8A 3MW2A 5IT6A 1ZZCA 1CPMA 3ILNA 1X9PA 5FZMA 1AR62 5CIRA 1W2OA 5EJZB 1ND3C 1SLAA 4IV3A 3USSA 2RDNA 2ZX3A 2VNOA 5LATA 4UYBA 5D2AA 2DU0A 1NY71 3W21A 1ASJ1 2ZX4A 3V56A 5C3QA 1OH4A 5IVCA 3C7GA 2D3SA 2VXJA 4MYEA 2OX0A 2RM21 2ZOEB 3ZXLA 2WO1A 5L7OB 5GM0A 1RMU1 2X5IC 3VDDC 1IPSA 1HV0A 1UW8A 3ZXJA 1ZZ9A 2VGDA 4BLJA 1V6MA 3MUY1 3B00A 2VL4A 3GZEA 1YIFA 3F95A 5DAPA 1J84A 2AH2A 2ZA9A 3APBA 4OVEA 5A32B 4H14A 4BH9A 3P6BA 4A6SA 1RUE1 4BXFA 3MW4A 5I0UA 1V6NA 1V9U3 1LAJA 5CKQA 3AZVA 5AFBA 3WQ1A 5FZFA 4BU2A 4CEWB 1RUG3 4QPIC 2YU1A 5B4NA 2R1DA 5DDJ2 3O1UA 1XNDA 4QT6A 3CJIB 4XFBA 1HJFA 2VW0A 3FFQA 4FQZA 4A3ZA 2F17A 1UNBA 4QPYA 4R9BA 1LKNA 4NE9A 4ZZ5A 4IE6A 4AF9A 2HEVF 1DGRA 4BLIA 1PVXA 3CJIA 2QQLA 1IZ3A 1GNHA 1WCSA 2HYXA 2HWD1 3WCSA 3VHRA 3IAPA 4YZ2A 1CJPA 4BIOA 1N1TA 4YM2A 1H2NA 4YVWB 2V4VA 3MFAA 1X7NA 3N7KA 4CDXB 4RSUA 1SQ4A 1OXCA 1HIXA 2QVSB 4DIQA 3VUOA 4Q4X3 5FLHA 1WMXA 3P1IA 2BV4A 4CDXA 1R091 3ZYRA 1RUD1 3KD4A 2JDNA 4DRRA 3IBMA 4XFCA 5JI7A 1TME3 3PUSA 1RUJ2 4GQ7A 1BK0A 4Q4V3 2VOWA 1UY1A 1W8WA 5A80A 4AVBA 1S2EA 1W6PA 4YGCA 2W1SA 1CZSA 2DV9A 1N1SA 3JU9A 5FY0A 2VR4A 1GYKA 4MXWA 3AKSA 2X05A 2XHKA 4HFSA 4QQOA 4HSLA 3UKTA 2PQQA 4LKFA 3I7DA 3ZSKA 2ARAA 2RS53 2Y6JA 4MADA 2VZ3A 3D0JA 3DYOA 4HT1T 1JYCA 1RHI1 3EBRA 4LBLA 2ENRA 4LT5A 3HNBM 1XNAA 1SACA 2DCKA 2FCTA 4JV4A 1CAWB 1GQPA 2C9KA 4JGYC 5CG8A 2YY1A 2J22A 1IS5A 4ISRA 5JR2A 2VZUA 4JGZC 2BPA2 2JWPA 2RDQA 3ME2A 1F5JA 4RQPC 5AC91 4NIIA 1JZ2A 2QQPA 3ZR5A 3AL5A 1WUVA 1AZDA 1O6UA 4A7ZA 2V5YA 4WBBA 4DRVA 1HB4A 2HWB1 2JDYA 2Y6LA 2YC4A 3N7JA 4JKKA 3WQ0A 5E89A 5A70A 4XMIA 3WZ1A 1ZBA3 1CAVA 1SPPB 3GXUA 2XL7A 5L9BA 2OZ6A 2YGLA 3ZFEC 3H8XA 1ZRRA 2WR9A 4M3CB 2WQ4A 5DUWA 5F37A 3VDBA 5FQ0B 1HN0A 2W1QA 2JIGA 4PF5A 2P3IA 1ODMA 1Z7S1 3DPRC 3MLLA 1OA2A 1SPPA 2VCAA 1W8FA 3SH3A 1OLME 4MXVA 1A3KA 1MZFA 1ZRIA 4M3CA 5JOWA 1MVEA 1W6MB 3N9MA 1R083 1WW7A 4HMZA 5FQ0A 1AYN1 1PMJX 5KHKA 2GC2A 3AYCA 1GP6A 1HDKA 1VBB3 3WVJA 1LOGA 1COV2 4FBFA 2YBSA 1SLIA 4LLFA 1A78A 4ONUA 3DYPA 4AHXA 3S7EA 3ZIXA 4PBPA 4YZ4A 1H8TC 3ZN4A 4MHRA 1WMEA 3LZZA 4EN6B 5I93A 1JI6A 1Q8OA 4Z07A 3AL6A 3KVBA 1DGLA 4IEUA 3VZLA 5IVBA 4H7MA 5I0SA 2WKKA 3LDBA 2WRAA 1YQ6A 4QQ2A 5G05L 3USUB 3WXPA 3J7LA 3IZOA 1F8VA 5LA2A 2XGXA 3AMPA 4LOTA 4XJ9A 3H1WA 1GFF2 3UGGA 4ARXA 1AL23 1DZQA 1W3XA 4WZCA 2R7EB 3CNAA 1W3VA 3M3CA 4XAEA 1C57A 3AJYA 3VBSB 1O91A 2A6VA 2ILMA 4XFGA 4CDWA 5A1FA 2HH9A 2V72A 3KWVA 3AB0A 3N7MA 4XCBA 4Y1XA 3BCWA 1ULPA 1UWWA 2QQUA 3BTXA 1BXHA 3ZDVA 3NKGA 1GZWA 3RMXA 5GZCA 3SEPA 3WDVA 1F4AA 4FP2A 4DXRA 1GV9A 4XHBA 1N47A 1BHGA 2VCBA 1OVSA 3T0AA 3I2GA 2R063 4PCRA 1ENSA 2PLV1 1B35A 1STMA 4NWVA 3UESA 3VLBB 3WX5A 4DY5A 1JYWA 2D6LX 3ZKUA 1K3IA 4LULA 3H3ZA 2E26A 1JYIA 5C9AA 3PTRB 2WNUC 2VOVA 4Y4RA 4OYUA 2BZDA 1KJRA 3VV1A 2A6WA 4IE5A 1MQTC 5BNPA 3BODA 3FN9A 1QWRA 5A6XA 4XOGA 3IM0A 4NOTA 1RUC1 1AXYA 2ZKNA 1DQ0A 4M3CF 4Q4Y3 5CVRA 4QGLA 1PGL2 1ST8A 2EA7A 1DQ1A 3FFZA 2WZR3 3VBRA 1LOCA 3V64A 5KXEA 1OKQA 3OB8A 1ULEA 4UW6A 5BNNB 4PLNA 1YFYA 2VQTA 1VBC3 3DKQA 1AF9A 1BLZA 2ZZQA 2R6QA 2WJSA 2TUNA 1RYYA 4G3YC 4Q29A 4BA6A 5BNNA 1A34A 4FPKA 4LO6B 2ZGSA 4LO7A 4JZRA 1VPHA 2DUQA 2VAUA 1RVF2 1YFWA 2MEV1 5FMBA 3JD73 3T0BA 2BFUS 4R9DA 3ZOIA 1NCRB 1WWYA 4UXAA 3DF0A 1CAXB 1NAEA 1REFA 2Z79A 1SFNA 3TBDA 5BV6A 1QXRA 3M70A 4IESA 1W99A 1O3SA 2G1MA 4QU1A 1W39A 3KHCA 4LA2A 2YBKA 1QNWA 5FPAA 1LNSA 5F5QA 4HOOA 1CAXA 2EVXA 4W6WA 4FTBA 3CDZB 3RYPA 4COZA 2HBTA 2CU5A 5J48A 3ORJA 2QQMA 3KCXA 5DABA 5FUNA 1LR5A 4Q0SA 1JYTA 3B9CA 1U5IA 1O3QA 1UYZA 1VBD2 2WO3A 4CCEA 3RFRA 1OSGA 2AZ5A 1NUKA 5IVFA 4UFJA 5I8YA 3IWZA 1GWLA 1PIV2 1YFUA 1NOVA 2KA3A 1IS4A 4R4ZA 4BQ3A 3W9AA 1OOPB 1EPZA 1UZWA 4UOJA 1BYHA 2Q0AA 2DF7A 2RV9A 4I2OA 3LIGA 2E63A 4IV3C 3TEXA 3EO6A 4K8RB 3I2IA 1YFXA 2QNKA 4ZONA 2FDIA 3MF6A 2AUYA 3NV2A 4FPJA 2ZGLA 2VOXA 2VZPA 1UZZA 4IEOA 5KC5A 3GDBA 4LO8A 4UAPA 4YG6A 4AQ2A 1NY72 2IZWA 1ASJ2 4Z82A 4RFRB 1DQ6A 4IW3A 1SFPA 2R0HA 3VDAA 1XBFA 5AFEA 2VUDA 1XE8A 1CR7A 4BXSV 4HKOA 2BGOA 4R9CA 1C8M3 4AR2A 4YPJA 4YW6A 2VQ0A 3HIFA 2PHXA 3RZMA 2R32A 5KXCA 2PELA 5A3TA 3W5MA 1MS3A 1B09A 3KV6A 3AP7A 1ZBE2 4GB33 3POIA 1QKQA 1RUH3 4CTEA 3ELNA 2R49A 3RQ0A 3Q8CA 2UY9A 3I2KA 4E8DA 4YLZA 1JW6A 4IUGA 4PDWB 4GMP1 2A71A 3ATGA 3ZM8A 2YZ4A 4XJUA 1WLTA 4FFHA 4R8HA 4AW7A 1DZRA 3CO2A 2B4KA 3CJIC 2W1UA 5FOJB 2FCVA 4K40A 4D6QA 1MS9A 3TB0A 1MS1A 3SCHA 4N7IA 3WG2A 4N53A 4TWTA 2HWD2 4OMDA 3PUQA 4DINB 5FO8B 2ERFA 5T5PA 5LBCA 2VXRA 4H7LA 1ZNPA 3PNAA 1LODA 3ZX7A 2VZSA 1LHVA 4XFIA 3ILFA 4LLOA 3NNJA 1XRUA 1WLDA 3LD8A 3MHZA 4I3GA 4M0NA 2OKXA 4IEWA 1WLCA 1JOBA 1OLMA 4CDXC 1Y7BA 2A5ZA 2JG9A 3IIIA 3UL2A 4CXYA 3BI3A 5JSRA 4OQ9A 1LULA 5CFDA 4EV0A 3HMYA 4ZS2A 3RNSA 4XJZA 1COV3 1CAUA 2ZEZA 1LU2A 3GYDA 3ZPOA 3J7MA 3TEWA 1O8PA 1OFNA 1AR61 1ND3B 4G9SB 4KQ7A 4IETA 1VBE3 2XB6C 3KGLA 3MPPG 3MYXA 1AR92 2RMU3 3A0NA 1BJQA 3OD4A 4R52A 4AG4A 4JX0A 5DUVA 2YYOA 5HXMA 4AHWA 2B8MA 1J1TA 2DBNA 4FT8A 4Q0VA 4ATFA 4LKSA 3CF6E 2ZMKA 5SV5A 1UXXX 4NHLA 2D5FA 4JTOA 3NW4A 1W2TA 4B29A 1YNAA 3VDDB 3NQHA 3OF1A 4QM9A 4XFAA 3K3NA 1RHI2 1VRH2 5JMCA 1IS3A 5AVPA 1F5FA 4CA9A 4K6BA 1XSRA 1YLLA 1QJY2 2PAKA 4KWJA 4L8QA 4S2GA 3J9SA 4RD7A 2P5BA 4CCLA 1A8MA 2ZEYA 1RUI2 2ZHMA 1OC1A 2GU9A 2Q1FA 4L99A 4PIXA 5FZ3A 5ANQA 1W05A 1BZWA 1AVBA 1PO21 1FMD2 4RS5A 4P9XA 4QPIB 1NKGA 1KFXL 2B5HA 2VCMA 3LIHA 5JI9A 1O5UA 1HJGA 2FZ1A 4UFKA 5KR7A 2MNGA 2HWB2 1PO13 4OHVA 5DDJ1 3TEYA 2BEOA 3FBYA 4HETA 2TBVA 3WNKA 3JXSA 2QQNA 3B01A 1AR83 1OD3A 4P9IA 3FLRA 5IAVA 2YBPA 3I97A 4W4ZA 5EQUA 5FMCA 4BMEA 4DZGA 3O7OA 1YC61 1RL3A 3AK0A 5L19A 1Z7S2 1ZREA 4NHKA 1JZ7A 5K4LA 4CUGA 4OI1A 4IEYA 5GZEA 1RUF2 1Q56A 3AVSA 2DVBA 3LEGA 3LDRA 4GKXA 4GMP0 1AYN2 2Z69A 3R05A 3JB8A 2JDPA 4AQTA 2D44A 1UIJA 3VD9A 4NIDA 4YVSA 2XWJB 1D0HA 5FY9A 4AWDA 2VMHA 1F15A 4TLGA 4QQHA 5FUIA 4Q4W3 4XTMA 4N43A 2XWBB 1PGW2 2D3PA 3SISA 1WD3A 4TN7A 3WP3A 3CJXA 1CVNA 1LHWA 1QJU2 2GP5A 3GF6A 2G9ZA 3R4SA 2ZCWA 2P3JA 1RUJ1 1UZ0A 1N1VA 4XJWA 3PVBB 5HV4A 3FLTA 5JOZA 5GLVA 4AEKA 2NYYA 2YV8A 1QQP3 4A44A 1BVP1 5LRRA 3BKZA 1RVF3 2VMDA 5A3UA 3CQOA 1UPSA 3M7AA 4BK4A 1J3RA 4OMCA 4CDWC 4ZS3A 2P3YA 4FPGA 5JVVA 3MBWA 4EZHA 3PTYA 3TN91 4XIKA 4CCDA 5JXHA 4JGYB 5JOYA 2RS13 1S0FA 2Q1ZB 3AP4A 2VMEA 2PAEA 1AXZA 3KT1A 3OBRA 4JRAA 3V65A 5FY8A 3GALA 1GU3A 4QXKA 5GJ6A 4CP9B 5C5UA 3LPFA 4GXLA 1UMIA 4JGZB 2JE8A 5F6KA 1LHUA 2PHDA 2QTWB 1AR72 1VRBA 2BWCA 1V6OA 2QQOA 4CUBA 1VBD3 2RE9A 4UFLA 4CP9A 1B35C 3VKMA 3DCQA 5GALA 3O1OA 2VMGA 2PLV2 3Q9OA 3EYPA 3HQRA 4I30A 2P6HA 4PQ9A 1DBNA 4AI8A 5C9AC 5EYXA 1GWKA 1LOBA 3ZFEB 1GOHA 2J1TA 5BNPC 1XJAA 3KCYA 3POEA 3PLQA 2ARBA 3NRUA 4Y33A 1S0JA 4XUTA 5JIAA 3IN9A 3T2QA 3HOBA 3AFGA 3DPRB 1N1YA 1ZVFA 3G7DA 3KF5A 1ENXA 3JBG2 5A33A 2JD9A 1PK6B 1O4ZA 4KNCA 1YWKA 4YGDA 3T2PA 4AVAA 4CEYB 4EE2A 3ASIA 3VBRC 2G19A 2IFRA 5F3GA 2WFF3 3FZ3A 3J26N 4XBQA 2DYCA 2PTMA 2RM23 2X29A 1PK6A 3BYWA 4CCCA 3ST7A 2R16A 4CEYA 4AEDA 3E5QA 1RMU3 5FDBA 5J3UA 2JDZA 4GZ9A 1OVPA 1ONAA 4HK8A 4PF1A 5LBFA 3S0MA 2YXSA 5BNNC 1RINA 5KHJA 3BTZA 1V6IA 4PT6A 5B4XA 1DYOA 3WW2A 2C26A 4QPGA 1J58A 3WUCA 1IPJA 4J1WA 1TNFA 4CYDA 4BB3A 1RUE3 4LIUA 3S6PA 5FIXA 2GC1A 1KJLA 2OVUA 5GZFA 4BWOA 1W6QA 3D8CA 4LK7A 4W6XA 4MUVA 3VKLA 2SLIA 3U1XA 1POV1 3S7IA 3NNFA 3RJRA 1W9SA 4SLIA 1T6GC 5KHHA 1C3HA 5A6YA 4AFBA 1QJZA 2HWF3 4DB5A 5IK7A 4Y1ZA 1WGPA 5FK8A 3I59B 5A3PA 5BNOA 4AXOA 2VVEA 4LR4A 2UYAA 2ES3A 1Q3EA 2Q30A 1T6BX 3MIBA 4W50A 3KQ4B 4AFAA 2BW8A 2Y0OA 3WP5A 3K3OA 3SEEA 4FFGA 4DEVA 4QGNA 1KXGA 1OLQA 4XUPA 1X9TA 5F5AA 5FY4A 3SNMA 4BYYA 1GOGA 4NMIA 1KRIA 4TYSA 3P3NA 3VBHA 2QFEA 2P6CA 1G7YA 1SBDA 1UQXA 5LA0A 2Q4SA 1PZ9A 2QQJA 2B9UA 4QPWA 4BM8A 2NLRA 4LO5B 3UK9A 1AYM2 5FZOB 4BMBA 3E97A 4NRQA 2DUPA 1R093 5IFTA 1RUD3 5EJ1B 1JZ6A 4CU7A 5L73A 1NXMA 3EXUA 3RG0A 1GR3A 1UMZA 4MV2A 5FZOA 3SXWA 5CISA 2WNUB 5IFPA 1OFSA 1G9AA 1VAVA 2ARCA 5A3MA 3W5NA 1MQTB 4GWMA 2GP3A 2A3WA 4QXBA 2CL2A 3N3HA 1VB2A 3BVCA 4D94A 4UW3A 3EHKA 3P3PA 1JOJA 2BVBA 3OEAA 4OCTA 1OQDA 4BQWA 1PGL1 3POYA 2QZ2A 1WCDJ 1W6NB 2R1BA 1LRHA 1CN1A 1YQ5A 2WAOA 4PI2A 3HN3A 4ZPIA 2UYBA 1RHI3 2VJXA 4LBKA 2EAKA 2ZABA 4OHWA 2WQZC 1BEV1 1W6NA 1W0PA 4EJRA 4NHMA 3I3EA 3NWKA 4U2AA 3I2DA 3AXEA 4A7YA 4M01A 4AOCA 3FWEA 5AC93 1L7QA 1UX7A 2DFCA 3ZR6A 3CKHA 4HPKA 1SLLA 3LFIA 4UFHA 4N53C 3H7JA 1JODA 2OA2A 2WS91 5BXXA 2HWB3 4HXCA 5LA1A 2W92A 4AGRA 1RJ7A 2E32A 4P00B 3SH5A 1XNKA 3PUHA 4K3UA 5BY5A 1OQ1A 3RZGA 3VZKA 1ACCA 1Z7S3 2JG9C 3QLQA 3MLKA 4LMFA 1I5ZA 1GOFA 3HPNA 3OEBA 1ENRA 3WF0A 4LUKA 1DGWA 4GA9A 4YW3A 4D8MA 2XLFA 5CFDC 5FXZA 1RUNA 4I0WB 1AYN3 3VB9A 3NNLA 4LOSA 5FYVA 4E4ZA 3OG2A 5F7UA 4PI0A 3R4UA 4QB1A 3B93A 3MIFA 1PIV1 2CGNA 1LGNA 5FYIA 2QZ3A 5JXJA 4RGKA 4LBJA 1JTZX 4IV3B 2A70A 3AZZA 1OA4A 3O1TA 4Q0UA 3CZUA 1UU4A 1Q8PA 2VCCA 2YPDA 3I2HA 4R9AA 1UF2C 2WNVA 4BQ1A 4NPLA 1NA1B 2WO2A 2C5DA 4AGGA 1LGCA 4XEZA 3T09A 2FDFA 1S0BA 3T0DA 1OI6A 2J1EA 2E33A 1Z0HA 1WKYA 3EB7A 1NA1A 2DDUA 2JDAA 3OGSA 4BISA 3K2OA 2QCSB 4UF0A 4QX3A 2QDNA 4XCAA 1JHNA 2C6SA 4OI0A 3H8OA 2F6BA 5IUQA 1LEDA 4AFCA 4QX2A 1ZBE1 3QD6A 4RS5C 4QKBA 4CU9A 2CDOA 1H4GA 2GH2A 5A7SA 4DQAA 1PO22 3IDBB 5H9RA 5T50A 4X8NA 5HV0A 4E4DX 2V5DA 3J8F1 3L9JT 1KITA 3WUDA 4EN7B 1DP0A 4JCKA 3H8UA 3V0BA 2BFUL 2VVDA 4OLLA 3E6CC 2ZGNA 4NIHA 3H9AA 2XHNA 1CWPA 1DQ5A 1M4WA 2AREA 2PLV3 5FAXA 2RR12 2XKPA 3T08A 2XDVA 1NG0A 1YRZA 3AKQA 3MGUA 1MEC2 1PX4A 2PHFA 2YPJA 1K5JA 3WW3A 4YVSC 2GZWA 1J83A 1H2LA 2OUHA 1WA4A 4NIGA 1RUC3 1Y9QA 5C3PA 2ADDA 2FCUA 5F39A 5APAA 3NV4A 1UO9A 3VZOA 4N43C 4FAHA 3AMQA 3ZPYA 1CX4A 2YUEA 1X8EA 4HANA 4M4PA 1W8TA 3C7OA 2A7AA
chains in the Genus database with same CATH topology
3ZSEA 1W6PB 5KBFA 2VUAA 1LTEA 3FHIB 3NL1A 4Y1VA 1LHOA 1CJDA 4MXWB 1HXS1 2UWAA 2PFWA 4LHLA 3AZWA 1AR91 2C1FA 5J98B 2MEV3 2XJSA 3HT2A 3M3QA 4K7JA 4KG0A 2DVGA 2JEMA 2WLQA 2ZX0A 5LK5A 3ZXGA 3ZVXA 1AHSA 3POSA 2EXHA 3SH4A 2R042 2WL1A 2G9FA 3AFKA 4WV8A 4Y1YA 4B7EA 3QACA 3TN92 1VRH1 3VKOA 5JPMB 3GNEA 5SV8A 1QJY1 3WP6A 3B5LB 3LA2A 3MLJA 4COYA 3U0ZA 1SLBA 3M3IA 2GNTA 3N35A 1RUI1 4I3PA 2PA7A 4Z2WA 3ZYIB 2JE7A 3ZFGA 1FMD1 1CAVB 3N7LA 3KGZA 4P9WA 1W2UA 1C8NA 2H6BA 2IXHA 3I8TA 3QH7A 1VJ2A 4LBQA 3EQEA 3UV9A 2WT1A 2D6PA 5CFCC 4HVRA 3CL1A 1ND2A 2WINB 3ZXDA 1DZTA 3UJQA 1R1A2 2VG9A 2XVGA 3B02A 1FPN2 1PK6C 4CEYC 2I74A 4AEDC 2XUMA 1RUF1 2DTWA 1U0AA 1J59A 3D4KA 2B45X 2PHLA 4P9YA 3RRDA 4IXLA 3FC0A 5LRSA 2X8KA 2EALA 4BOWA 4QPGC 3DUIA 3MIEA 1PGW1 3B94A 1REEA 5FMOS 1QJU1 5GZDA 1TMF2 2XLAA 4N9IA 4RGAA 4YW2A 5I8TA 4ISQA 4B4PA 1H30A 4GMP3 4B8EA 1UX6A 4WVWA 4Y20B 1JUIA 1V6JA 5BNOC 4CDWB 4XQWA 4Y20A 5D8AB 4FCAA 1LOFA 2V73A 3RS6A 1BQPA 1OA3A 1GZWB 3VBHC 3MFCA 3BB6A 5D8AA 2E7TA 4CDUB 1C5IA 2K9ZA 1UL9A 5CG9A 5C8CA 1LCLA 1LENA 1RTVA 1VALA 3N36A 1MACA 1B35B 2BGCA 4IV1A 1AR71 4QQLA 5D1IA 4L97A 1JBCA 4F83A 4CDUA 5JAXA 1UKGA 3VHPA 5C9AB 2D6NA 5CB7A 4A2UA 2BYVE 1CGPA 5BNPB 4FXKB 1D0GA 2G9GA 2D7FA 1AR63 3ZXKA 1S0IA 3H0OA 4AFDA 1D4M2 1QF3A 4ZXKA 3VBRB 3VHOA 3JBG1 1EP0A 5JSPA 3GHMA 1S0EA 2HWE2 4QU2A 1BK1A 4UBHA 4GH4A 3FMGA 2ZGOA 4XJAA 3AKPA 3OJBA 2R072 5C6CA 2OW4A 4BCUA 3TOJA 4JAAA 1FNYA 1BEV2 3WLUA 2CNAA 5KXDA 3B3QE 5HXVA 4YGBA 2VW2A 3MIHA 3KSCA 2VNGA 1PO23 3ES4A 2O8OA 1ULDA 1VBA1 4PLOA 3R0RA 3D6EA 2WS92 1QDOA 5DDJ3 3CU7A 4EN8B 1XYOA 3JCIA 1SCSA 4I0AA 4M0HA 3GZUC 4FPYA 4YNIA 4RR3A 5EFUA 2GNMA 3O0XA 1WW6A 4Q4V1 1MR5A 1WLWA 2QKDA 2IFWA 3OY8B 3ENRA 5HCBA 4Z8BA 5T54A 2VQAA 1REDA 3WP4A 1Q5OA 4MGZE 1XNBA 3OY8A 1NXD1 1DYKA 2ZHLA 1RGSA 3IKWA 1XYNA 1AYM1 5GZGA 4AVVA 3TNPB 5B2GB 1QJX2 4LUMA 4YM1A 3VZNA 3UKVA 2HKXA 1DDLA 4UW5A 4E2QA 4HLTA 2WNVC 1RUJ3 4V1PA 5KHGA 1ZRFA 1UU5A 2Y26A 2ZS6B 3TNQA 2F4PA 3K51A 1NA1C 3GZAA 2ZGRA 1IPKA 1NYWA 3RYRA 2BWAA 1BBT2 3MICA 2D3RA 2A75A 4HN0A 2EAAA 1O3RA 3FJSA 4FXGB 4XW3A 2JD4A 3GBWA 3ZYGA 3ZSJA 1C1LA 5EJ3A 4OUSA 4JTNA 3HBZA 3W59A 3ZFFA 1V6LA 5E8AA 3WV6A 4A3XA 3WDUA 3J8F2 1Q8VA 3H3UA 1IKQA 4ZU5A 4CZSA 3AYDA 3D5OA 1KDKA 1HLCA 4Q26A 4N53B 3LKJA 4YM0A 4GKYA 2MPFA 3JQXA 1VIWB 4C91A 5KWRA 1QU0A 3J4UH 2E9QA 5BNQA 1GZCA 1VLNA 1MVQA 2P2KA 2JG9B 4S2DA 1AL0G 4B3NA 5CFDB 1QOSA 4N9HA 1K5MA 3NAPA 3H1MA 1MS4A 4OHYA 3ZYPA 1CAUB 2A3XA 1HRI2 4K9SA 1AJOA 4COVA 1Q43A 2XKOA 5IK5A 2FQPA 4HKLA 4MSVA 4XF4A 2HJIA 3QCWA 2JENA 1HXS2 3D82A 1LOAA 3BOPA 3M3EA 1F2NA 3LSEA 3WCRA 2W52A 3O12A 4DFSA 2BUKA 5HCAA 1POV3 4XF0A 3SCGA 3ZXAC 4AVCA 1X36A 4WM7B 3WW4A 4JDNA 2VNRA 4OHZA 2A73B 4YZ5A 1PVC2 2D40A 3ZSMA 2WT2A 4WM7A 2HWC2 2GN3A 5F9TA 3PVEA 2RS32 4RS5B 3WHTA 4JRLA 3AP5A 5JZGA 2XJQA 3ZFGC 5JDBA 3THPA 3VKFC 4XXAA 3SHRA 1PNFA 3QH6A 3LA7A 4XYXA 3HD8B 2RHPA 3OGJA 1EV11 3AZXA 2CAVA 2Z42A 1FT9A 2CGPA 1NQDA 2SBAA 1DLLA 1ND2C 3VBOA 4AVSA 1GQHA 2WZPP 1O4TA 5E88A 4C1XA 2RR11 1HX6A 1WBLA 4FOWA 4W65A 5T5OA 2XBO2 3RDIA 4Q8KA 4ASMB 1FOD1 1MEC1 4YVSB 4P9GA 3MZHA 1S0GA 2YHJA 5A3LA 3O5SA 3VBFB 4N43B 4MGIE 1E57A 4IQPA 2FZ2A 4F8AA 1H2MA 2IXJA 1QHDA 5AVAA 3VBFA 3NV1A 1HRV2 1KS4A 1D2SA 2IC1A 1GKBA 1CD3G 2ZAAA 3RI8A 4XF1A 4XQDA 4XQ4A 1EPWA 4IEZA 2HEWF 3ZN6A 2VY0A 4LEJA 4HKWA 4AGVA 1PZ7A 1JUHA 2JECA 1XXNA 1SCRA 4OUMA 1RJ8A 1I6XA 1LOFC 1XE7A 4RHV2 4HZFA 2I2SA 2PHWA 2UURA 4TSVA 2R041 1ULCA 5D8AC 3LWCA 1CONA 2GMEA 2ET7A 4L92A 5C8CC 1WBFA 2ARXA 4IV1C 3OGGA 3B9IA 4J1XA 4C0HA 3LOIA 4CDUC 4WVVA 1GBGA 4MGYE 1XU2A 2W0XA 3FUQA 1C8M1 1PIV3 4PIYA 3L2HA 4M00A 3IT8A 5CFCB 5A33B 3B69A 4XILA 4Y4YA 4D3WA 1EAH1 2A6XA 3DKWA 1V9U2 4MLOA 4AHZA 4NN0A 5CFCA 4GH4C 4FOQA 3BIWE 1LOEA 1JN2P 4AEDB 4FPFA 4KL1A 1R1A1 1RUG2 1FPN1 4MH0E 1ASJ3 4RL7A 2XPJA 4NO4A 4S2FA 3WNXA 3ILRA 4BPZA 1LB2A 3ES1A 2WWSA 3WG3A 1O3TA 4QPGB 5H9PA 3URFA 4S2HA 1WW4A 2JJ6A 4WVMB 3A0KA 2ATFA 4A7KA 1W6QB 4AI1A 4QQPA 1DGRN 4FPHA 1ZBE3 2E7QA 3AJZA 1LJ7A 3JUUA 1RC6A 4WVMA 1BMV2 2VU9A 3M8LA 1WD4A 1H2KA 4WZFA 1TMF1 1VBA2 3AKTA 2PHTA 1X33A 2EXIA 3M4FA 3OYWA 4FO9A 5GKAC 4Q4X2 3T1LA 4RFT0 1NZCA 1CQ9A 5BNOB 5FBZA 4RR3C 2DVAA 5FFOC 5FCCA 1TME2 2P37A 1QNYA 4K1YA 1S1AA 2AYHA 4Q4V2 5FLIA 3ECQA 4JVAA 1TNRA 5KHIA 5KC6A 3ZO0B 3VBHB 2HWD3 2VOKA 1VBE1 2LALA 1Q8QA 2BTVC 1VB4A 3C2UA 2XJVA 1H4HA 4F7ZA 2DCYA 2ZGMA 1O7FA 1KQRA 5FOBB 1N3QA 2BNOA 2BVVA 4XBLA 3PVOA 2WA4A 1NLRA 4Q1RA 5CU1A 2X53S 1LU1A 1RITA 3QOPA 2D98A 5GLUA 4K20A 2Q5TA 4XIOA 2E6VA 1AR93 3LSDA 1W6OA 1D4M1 4XETA 2HWE1 4QGMA 1AUYA 1PO11 1H0BA 3VN4A 1V70A 4C1WA 1ZBA2 2IWGB 2R071 3ZFFC 5K0UA 1VRH3 4EWDA 3NO8A 3SLIA 1XNCA 4XE9A 4BZ4A 1NLSA 1QJY3 1G9BA 4I02A 2CY6A 1Y3TA 3D0SA 3OPZA 4W6YA 1MZ6A 4HPKB 1RUI3 2RJKA 4EWEA 3DV8A 3RPQA 1R082 4IEXA 1YJLA 1N3OA 1APNA 1UN1A 1VBB2 1FMD3 5I8SA 2JG8B 4BHPA 1IQAA 1GANA 2JKBA 3H1YA 4K8FA 4QM8A 1V6KA 4GIQA 5K9YA 1DFQA 5DG2A 1OQEA 2W68A 2WIIB 1FX5A 2IXKA 1NQJA 3BU7A 4XTPA 2JG8A 3KZ4C 2WLPA 2IXCA 3QBQA 3WDWA 1K5MC 3NAPC 4UW4A 4D7YA 2CYFA 1SLTA 3O0VA 2B39A 1QQP1 1RUF3 3FLPA 3RI9A 1ZRDA 1D4VB 1UIKA 4MZUA 2NP0A 1CIWA 1YO8A 5JPNB 1PNGA 1AL22 4OI4A 4LHKA 1N3PA 2JICA 3WQ7A 1SBFA 4E2SA 1U12A 1QJX1 2D43A 1WCKA 1QJU3 1ZYBA 2WNVB 5FPZA 4LHNA 2D6OX 2PHRA 5FTTC 4LBMA 2AGSA 1LHNA 4CDQA 1G9FA 5JOXA 1AX0A 1S2KA 5H9QA 1NCQA 5ABJB 4WM7C 3ZDSA 3IMNA 4RGGA 4LE4A 4AHYA 4E27A 1OHFA 3RYKA 1XQNA 1BBT1 2EIGA 5ABJA 4KGQA 5JZGC 3WDYA 1H1IA 1YUDA 4JDMA 1DU3D 4YG3A 1O4YA 4EN9B 3V0BB 4Q4Y2 3ROUA 5DZFA 4EROA 1PZ8A 1EV12 3INAA 3W58A 2WFF1 2WZR2 3VBOC 1AR73 1WMFA 5J96B 4Y1UA 5BUVA 2Q8OA 4J6GA 3PJQA 5L7OA 3WR0A 1VBC2 2GDFA 5ACA1 1FOD2 1WW5A 3PJYA 2NN8A 4XPVA 4HK9A 1HV1A 3JD72 5A32A 4C0BA 3JBG3 4QD2A 3VBFC 3JZVA 3VZJA 4KU8A 2C9AA 1UAIA 4Z1VA 1IS6A 3SCFA 1HRI1 2HWF1 2VPVA 1JH5A 4CEWA 2I07B 5DG1A 1NE6A 2GC3A 4PIZA 1HQNA 2OUJA 4JDOA 2EF6A 1ZRCA 3AMNA 5CNAA 4FP3A 3FUOA 2CV6A 3AP6A 2YMZA 4AI2A 3WD5A 2A6ZA 3UKNA 1VBA3 5T55A 2DU1A 4O9GA 1S2BA 1Z78A 4YVWA 4H3WA 4AEMA 1AJKA 1QDCA 5EWSA 1VP6A 5JR7B 3LB9A 4Z92B 2GH8A 1PVC1 1ZX5A 2HWC1 3MPBA 4FSJA 1GLHA 4YRDA 3ZFGB 3U10A 2RS31 3B7MA 4LNVA 1YHFA 3WDXA 2BQPA 1IOAA 2DCTA 4FAGA 3LOBA 1FATA 4LBQB 4HVQA 2KXLA 1C8M2 4YW4A 2H6CA 5GLZA 3LGRA 1AYM3 1ND2B 3VKNA 2ZTNA 3ZMNA 1IGOA 4GB32 1EAH2 1RUH2 4YW5A 2KM2A 3AXDA 5EYYA 1GICA 3U4XA 2ZMNA 5C8WA 3ZXFA 1IKPA 3TWIA 2QDRA 2XBO1 5DUXA 3ACLA 2EXJA 1CAWA 1QXPA 3CEWA 3JQWA 1FYUA 4YM3A 2GC0A 4N7UA 1QOOA 3KCCA 4D69A 4X6RB 1QOTA 1G9CA 2GALA 2NMNA 3OD0A 3ZIWA 1TEIA 2ZHNA 4YW1A 1HRV1 2K0GA 1FV3A 4YFWA 4B7KA 4URTA 4YSFA 1URXA 2GMPA 3LCPA 4KG8A 2N7GA 4LBQD 4SBVA 3AZYA 4AQ6A 4BIFA 2CAUA 5L36A 2GN7A 5T3NA 4DY3A 4P9LA 4ASLA 4QMAA 3WY6A 2W39A 2ZHKA 2GNBA 1QGLA 4KBBA 2WFPA 4NPRA 4AYUA 2ZGUA 1UCXA 3V0AB 1W6MA 3HT1A 1FV2A 2XG3A 4RHV1 4OULA 2UU8A 3E5UA 1VBE2 3V0AA 3OBTA 3WDTA 5C8CB 2AENA 3E5XA 2RMU2 3K48A 4KH9A 4L11A 4IV1B 5HBAA 3O14A 1J3PA 2DCJA 5JWPA 3VBUB 1ULGA 1WMDA 2K2SA 2V09A 1RUOA 1QH7A 4R4XA 2ZAHA 4N90A 4Q0QA 3VBUA 3LA3A 3USUA 2NPIA 4DMIA 1H1MA 4NR1A 2DCZA 4P14A 5C4WB 4YARA 3HR9A 1HQWA 4AK3A 5FO9B 1RB8G 4D7TA 3FE5A 1BVVA 3NVCA 3VBSA 5I0RA 2C0ZA 3WINE 2VH9A 5C4WA 2YDEA 4GH4B 4U36A 1V9U1 1A8DA 1X8MA 5EXOA 4FOYA 3TYJA 3FBMA 1FAYA 1RUG1 1X82A 1PO12 4ATEA 3M2MA 2DFBA 5K0UC 2UWBA 3M1HA 2NZ9A 3R6SA 4AEJA 1Q8SA 2VW1A 1AR82 1H1AA 2ZGTA 1MS8A 1MS0A 4UBGA 4IERA 3A4UA 1AXKA 4LBNA 4Y5Z0 2D97A 1TE1B 5DXDA 1SEFA 3ZSLA 2WSVA 4KGGA 3UJOA 2DURA 4JQRA 4ZU7A 4MX3A 1BMV1 1C1FA 3VZMA 3PMEA 2ZMLA 4BE3A 3BPZA 1MZEA 1GZ9A 1HKDA 1EV13 4Q4W2 4Q4X1 4RR3B 4BYYA 1KFUL 2ZKLA 2JG8C 1G6NA 1TQ5A 3MIGA 5K7PA 2GAUA 3DN7A 1TME1 2RR13 3ETQA 4HL0A 1CESA 4ITCA 2CWMA 3EJKA 4WVZA 5FPXA 1FOD3 1MEC3 1PGSA 5C33A 1QQP2 1YJKA 2RJLA 4JC1A 1MZ5A 5IK4A 1KDMA 3AM2A 3SITA 2RS51 4YFZA 3WT3A 3MI8A 1NE4A 4XDQA 4EWAA 4IEPA 3VL9A 5EZWA 2CWSA 4TLFA 4XFHA 4DNYA 1NCRA 4COWA 3C3VA 2QE3A 2RS12 3FX3A 2FMYA 4D7SA 4CP1A 4Q27A 5GLTA 4PJYA 4X8PA 3ZMOA 4CDQC 2Q1MA 3PMSA 4RA0A 5GLWA 1Y43B 4Q2FA 1NCQC 3MF9A 2IXLA 3AYEA 2D5HA 3U11A 3T2TA 4LE3A 1LGBA 1YI7A 1KS5A 5ABJC 4K21A 2XJPA 4WM8B 3ZFFB 2ZJCA 5DZGA 2R043 2XH6A 1ZBA1 1QH6A 3TN93 3VGIA 3U07A 1OOPA 4CP2A 4WM8A 2H0VA 3NJZA 1H9WA 4KU7A 2XVKA 3AYAA 4LO4B 3AP9A 2WFF2 4XFFA 2E53A 2XJUA 4LA3A 2RM22 1R081 2ZGPA 3GBFA 4XF9A 4Y26A 3NKTA 3TAYA 1RMU2 2WNEA 5L7OC 1VBB1 5T52A 1YYNA 4FTEA 3RJ2X 2TEPA 3KT7A 5ACA2 5T5JA 2BNMA 3H7YA 3AMHA 2O8QA 4HN1A 2Z5WA 1EAH3 1RUE2 2ZZJA 2LUWA 1K5MB 2PYTA 2UWCA 3I54A 3NAPB 2B46X 4H55A 5J36A 2NQYA 2LM3A 1R1A3 1FPN3 4XHXA 3T1MA 4CEWC 1SFYA 1MS5A 4FVVA 2WA3A 2HWF2 2B7YA 4HBNA 1F31A 4PDWA 1BKZA 1AL21 2VECA 1SBEA 4GULA 5LK7B 4FTSA 4FPEA 4KWKA 5JIUA 1QY4A 3GBGA 4B4QA 1GSLA 4DPNA 2W08A 5BYNA 5J7MA 1TMF3 4XXPA 3WG4A 4YVWC 4NVPA 4X6QB 2B42B 3PHMA 4IEVA 2JXAA 4OFGA 3HN1A 4YG0A 1R092 2G4IA 1RUD2 1AX1A 2P17A 4CRQA 3N4MA 2R061 3KLSA 1C4RA 5JZGB 1DQ2A 3JB4C 1G8WA 5J37A 1OPMA 4B4RA 1H8VA 4FPCA 4XMAA 2BBVA 5JSOA 4FQ4A 1DG6A 3THTA 1ND3A 4PBOA 4Q4Y1 3M3OA 3VBOB 4Y24A 1EY2A 3IDCB 2IXIA 1AX2A 1A6CA 3KM5A 2R30A 2WZR1 2X5IB 4ORFA 5CAZA 1XYPA 5FREA 5CA6A 1OLRA 2X5IA 3VDDA 1EYBA 1VBC1 1O5LA 2E51A 3KT4A 3L2YA 1S0DA 4COUA 2ET1A 3WOGA 5KXBA 1ALYA 3PVNA 2ZX2A 1KD7A 1ZM1A 2LTNA 3DGTA 4MVTA 5AC92 2WT0A 1D4M3 3JD71 4E2GA 4YYOA 3GZTB 2HWE3 4AI3A 3RMYA 2CTVA 1DGWX 1J1LA 2R073 3E6BA 2HEYF 4QPIA 4I09A 4FPOB 2ZX1A 3X29B 3ZN6B 5HCFA 4AFMA 1BEV3 2FMDA 3S30A 4DXZA 4XJ8A 3KS7A 2MHFA 2Y38A 3KMHA 4LBOA 3WW1A 4IL7A 2ZGQA 4O9EA 2ZACA 2VULA 4ES9A 4KWLA 2D6KA 4GWNA 1G9DA 4TZDA 1XU1A 5E16A 2PAMA 2XJTA 2WS93 1I3HA 4G4FA 1DF0A 2VUJA 1D2QA 5F1RA 4L2NA 3IDEA 1FI2A 3OCPA 5EV7A 5K8SA 2VVFA 1UPIA 3MDPA 4AI0A 2JX9A 2BNNA 3VBUC 4ZKTB 1UKRA 3BTAA 1I9RA 4F3JA 2TNFA 5E1RA 3IIAA 2GNDA 3VL8A 1I1EA 1HQLA 2WC2A 3ZN5A 1S0CA 3VBSC 5C4WC 1QJX3 2NMOA 2UY8A 4GB31 1RUH1 5FRAA 2EXKA 5H9SA 1DQ4A 1UD1A 1U5ZA 2OYZA 1OD5A 4XBNA 4JGYA 4RQPB 5HI0A 4AVTA 4C90A 3RZZA 3POWA 4JGZA 3HWJA 3I4IA 3TRSB 4RQPA 5J09A 4FOVA 4LTAA 2DVDA 4NWWA 1BBT3 4YZ3A 2P3KA 2XJRA 2P34A 5BPXA 2A3YA 3KQRA 1YI9A 1RIRA 2O0OA 3OYWB 4OHXA 2YROA 2CGOA 4ZU4A 3ZFEA 1DIWA 1RUC2 1QXJA 2OIIA 5LEKA 1U5YA 3J8F3 1OMIA 1YXWA 2H0BA 3DPRA 2Y0IA 2E7AA 2DUOA 5JCTA 4Q1PA 2O1QA 1SDWA 1LEMA 1DHKB 1BCXA 3ALQA 1COV1 3OTFA 2PN5A 4PLMA 2FBEA 1H8TB 4L9BA 1VR3A 1SMVA 5ACA3 1LECA 2OPKA 4OZXA 3ZYJB 1J3QA 3HQXA 2RMU1 2MEV2 1H8TA 5TSWA 1W0OA 3NSTA 4P5HA 2DVFA 5JLVA 1U5XA 2A6YA 2RS52 3H50A 1NCRC 1ZZ7A 4I01A 4DS0A 1HRI3 2NM1A 2ZGKA 1PM7A 2XLGA 2FHRA 1VAMA 2QUOA 3LAGA 3HAGA 2ETEA 4HSJA 1ZA4A 3GHNA 1W6OB 1HXS3 4CP0A 1G86A 1VAKA 3I59A 4E4SA 3RWNA 2QJVA 3DL3A 4HVOA 2ZBJA 4YZ1A 1S55A 2WSUA 3MIDA 1L3JA 2YC0A 4P9JA 4AQSA 5FLJA 5K0UB 4EN0A 3R4DB 1M06G 1GNZA 5FO7B 1OOPC 1PMIA 4XZPA 4WM8C 1V00A 1LESA 5LEJA 1AR81 4Q0PA 2VMIA 3CLPA 2XL9A 1PVC3 4K1ZA 4IEQA 2HWC3 4QHBA 1ZZ6A 4M3CE 5FMOL 4INDA 2RS33 1CPNA 4Y22B 1R1ZA 2WNUA 4QX5A 2GSYA 4GALA 3G6JB 1MQTA 2Z2SB 4Y22A 2PHUA 1C5HA 1GQGA 2D93A 2DWRA 4MGKE 4Q4W1 3WHUA 1DYPA 2XVLA 1FNZA 1HW5A 2D6MA 3E6DA 1PHMA 4YGEA 1YIPA 2HYKA 5I0TA 5CADA 2R0FA 1UZYA 3AMMA 5IK8A 2I45A 3VHNA 2AR6A 1SLCA 2XBO3 3AKRA 3KB5A 1F9KA 4FPLA 5DUUA 1UU6A 1YCIA 4AE2A 4PDWC 1RVF1 5CBLA 5DZEA 3BOWA 3NV3A 1IHMA 4OI2A 2JE9A 3IPVB 1X50A 2OZJA 4Q8LA 2YGMA 3BALA 1FXZA 1HRV3 3MW3A 3SMHA 3ZXEA 4META 3IPVA 2RS11 1OPOA 3AX4A 4CDQB 3MEPA 4E9KA 5F6LB 1NCQB 3RSJA 1POV0 1QMJA 4XF3A 1VBD1 1ENQA 1ULFA 3WG1A 1ZZ8A 1C28A 1H9PA 2DTYA 2R062 2GMMA 3O0WA 4DOUA 1ZZBA 1JXNA 4I0BA 2ZPXA 4RHV3 4ES8A 3MW2A 5IT6A 1ZZCA 1CPMA 3ILNA 1AR62 5CIRA 1ND3C 1SLAA 4IV3A 3USSA 2ZX3A 2VNOA 2DU0A 1NY71 1ASJ1 2ZX4A 3V56A 2D3SA 4MYEA 2RM21 2ZOEB 3ZXLA 5L7OB 5GM0A 1RMU1 2X5IC 3VDDC 1HV0A 1UW8A 3ZXJA 1ZZ9A 2VGDA 4BLJA 1V6MA 3B00A 1YIFA 5A32B 2AH2A 2ZA9A 4OVEA 3APBA 4H14A 4BH9A 1RUE1 3MW4A 5I0UA 1V6NA 1V9U3 3AZVA 5AFBA 3WQ1A 4CEWB 1RUG3 4QPIC 2R1DA 5DDJ2 1XNDA 4QT6A 3CJIB 4XFBA 2VW0A 3FFQA 4FQZA 4QPYA 4R9BA 1LKNA 4AF9A 2HEVF 1DGRA 4BLIA 1PVXA 3CJIA 1IZ3A 1GNHA 1WCSA 3WCSA 2HWD1 3VHRA 4YZ2A 1CJPA 4BIOA 1N1TA 4YM2A 1H2NA 4YVWB 3MFAA 1X7NA 3N7KA 4CDXB 4RSUA 1SQ4A 2QVSB 1HIXA 3VUOA 4Q4X3 5FLHA 4CDXA 1R091 3ZYRA 1RUD1 3KD4A 4DRRA 3IBMA 4XFCA 5JI7A 1TME3 1RUJ2 4GQ7A 4Q4V3 2VOWA 4AVBA 1W6PA 4YGCA 2DV9A 1N1SA 3JU9A 1GYKA 4MXWA 3AKSA 2XHKA 4HFSA 4QQOA 4HSLA 3UKTA 2PQQA 3I7DA 3ZSKA 2RS53 3D0JA 4HT1T 1JYCA 1RHI1 3EBRA 4LBLA 2ENRA 4LT5A 1SACA 2DCKA 4JV4A 1CAWB 5CG8A 4JGYC 2YY1A 1IS5A 4ISRA 4JGZC 2BPA2 3ME2A 1F5JA 4RQPC 5AC91 2QQPA 1WUVA 1AZDA 4A7ZA 2V5YA 4WBBA 4DRVA 2HWB1 3N7JA 3WQ0A 5E89A 4XMIA 3WZ1A 1ZBA3 1CAVA 3ZFEC 2XL7A 2OZ6A 2YGLA 1ZRRA 4M3CB 5DUWA 2WQ4A 5FQ0B 4PF5A 2P3IA 1Z7S1 3DPRC 3MLLA 1OA2A 3SH3A 4MXVA 1A3KA 1MZFA 4M3CA 5JOWA 1MVEA 1W6MB 4HMZA 1R083 1WW7A 5FQ0A 5KHKA 1AYN1 2GC2A 3AYCA 3WVJA 1HDKA 1VBB3 1LOGA 1COV2 4FBFA 1SLIA 4LLFA 1A78A 4ONUA 4AHXA 3S7EA 3ZIXA 4PBPA 4YZ4A 1H8TC 3ZN4A 4EN6B 1WMEA 3LZZA 5I93A 1Q8OA 4Z07A 4IEUA 1DGLA 3VZLA 4H7MA 5I0SA 2WKKA 4QQ2A 3USUB 3WXPA 1F8VA 2XGXA 3AMPA 4XJ9A 3H1WA 1GFF2 1AL23 1DZQA 4WZCA 3M3CA 3CNAA 3VBSB 1C57A 3AJYA 1O91A 2A6VA 2ILMA 4XFGA 4CDWA 3AB0A 3N7MA 4Y1XA 3BCWA 1BXHA 3NKGA 1GZWA 3RMXA 5GZCA 3WDVA 4FP2A 1GV9A 4XHBA 1N47A 2R063 4PCRA 1ENSA 2PLV1 1B35A 4NWVA