2R072

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r07200
5DDJ3 3VBSC 3ZFEC 1TMF1 1R093 1FPN1 1VB4A 1RUD1 4CDWB 1QJX2 2R061 3ZFGB 1GFF2 4CEYA 1PO12 1EV11 2HWE3 1NCRC 1PVC3 1FPN2 1RUD2 2WWSA 4N53C 2R062 1PO21 4RHV1 1D4M1 4CDUA 4RR3C 3VBHA 5AC91 1COV1 1X36A 4CEYB 4JGYA 4YVSA 1RUG1 1RUI2 1MEC3 1RUH1 4Q4V1 5A33A 1D4M2 2XBO1 3TN93 5AC92 4WM7A 4CDUB 1ZBE2 3VBHB 4PDWC 1RUG2 1RVF2 1RUH2 4JGYB 2XBO2 5CFDA 2HWD3 5K0UC 4FTEA 2GSYA 5C8CC 1QJU3 1MQTA 1OOPC 4WM7B 5BNPA 5C9AA 2WFF3 1FMD3 2HWB3 3JD71 3VDDA 4AEDC 5GKAC 3VBOA 4RQPB 5CFDB 3JD72 4N43A 2WZR1 5D8AB 5BNPB 5C9AB 4Z92B 5JZGC 5BNNA 1RUD3 3VBOB 1TME3 2R063 1QJY1 1RUJ1 2X5IC 4N43B 4QPIC 1W39A 4GH4C 1RUC3 1NCQA 1BEV1 1QQP3 3VBSA 1RUI3 2RS12 1QJY2 4Q4Y3 1AR62 1VBB1 5BNNB 1RUJ2 1RHI2 1NCRA 1ASJ1 2XPJA 1PIV1 1BEV2 1ND2C 1AR82 1ZBE3 2RMU1 1RVF3 4N53A 2BPA2 1NCQB 5C4WB 2XBO3 1VBD3 1VBA1 4RR3A 1NY72 1ASJ2 4RS5C 1PIV2 1RUE1 1IHMA 2RMU2 5ABJC 1BMV1 1NCRB 1F2NA 1VBA2 4N53B 1H8TC 2RS33 1AR71 2ZTNA 1ZBA3 5J98B 5L7OA 4RR3B 4PDWA 1HRV2 1BMV2 3JBG3 4GB32 2MEV3 2R041 4CEWC 4Q4X1 5K0UA 1AR72 5FMOL 5C8CA 4CDQC 3NAPA 1VBE3 1OOPA 1HQNA 1AL22 1HRI1 2HWC1 5L7OB 4PDWB 5CFCB 1R082 1AR91 1BBT3 4AEDA 4Y4YA 3ZFFC 1POV1 3J8F1 1HRI2 1FOD1 1TMF2 5C8CB 1Z7S1 1PGL1 2RS13 3NAPB 1OOPB 1AR63 1AR92 1A6CA 2PLV3 1EV12 1RHI3 1VBC1 3J8F2 2R073 1FOD2 2BFUL 1AR83 1PGL2 1Z7S2 1PO22 4RHV2 2FZ2A 4CDXC 4QPIA 1RUF3 4FTSA 1COV2 1V9U3 4GH4A 4IV3C 3VBUA 4Q4V2 5ACA1 3VBFC 1AYN3 1RMU3 4YVSB 1C8M1 5A33B 1EAH1 2RM23 1HRV3 4GH4B 4GB33 1OPOA 1AYM1 5ACA2 3VBUB 1C8M2 1AUYA 4NWVA 4RS5A 4JGZC 3ZFGC 3VBRA 1E57A 5ABJA 1AL23 1AYM2 1QJX3 1MQTB 1R083 1H8TA 2WS91 1PO13 4RFT0 3VDDB 4GMP1 1HXS1 1TMF3 4RS5B 1FPN3 4CEWA 2WZR2 2HWF1 3VBRB 1AL0G 5ABJB 2WS92 4Q4W1 1EV13 4CDQA 1B35C 5DDJ1 5FOJB 3ZFEA 1R091 4EJRA 1Z7S3 1PO23 2HWF2 4RHV3 1D4M3 4CEWB 3VBHC 3ZFFA 5AC93 2HWE1 5DDJ2 1COV3 3DPRC 1R092 1PVC1 2RR11 1RUG3 4CDQB 1RUH3 1VBB2 4Q4V3 3VBSB 3ZFEB 2WLPA 3ZXAC 2HWE2 1NG0A 2RR12 3ZFFB 2RS51 1M06G 1MEC1 4QPGC 4RQPC 3JB8A 4CDXA 3TN91 5BNOC 1RUE2 1VRH1 4IV3A 2RS52 5D8AC 1MEC2 3JD73 3VBFA 1CD3G 5A32A 4IV1C 1WCDJ 1VRH2 1QJU1 1X33A 2WFF1 2R042 1FMD1 2HWB1 4YVWC 3M8LA 4IV3B 4Q4X2 2WZR3 1POV0 1K5MC 4JGZA 3VBFB 4WM8C 5A32B 3ZFGA 5K0UB 3CJIC 2WFF2 2HWC2 1FMD2 4Y5Z0 1QJY3 1RUJ3 2Y26A 1R1A1 5JZGA 1NCQC 3FBMA 1BEV3 4AEDB 5C4WC 1NA1C 4JGZB 1TME1 5FMOS 1VBB3 2X5IA 1VBC2 3JB4C 1R1A2 1B35A 1ASJ3 1PIV3 1RUC1 1QQP1 1HX6A 2RMU3 2RR13 3HAGA 1TME2 2TBVA 1RUI1 4Q4Y1 5JZGB 4FTBA 1ND3C 1VBA3 4LLFA 3DPRA 1RUC2 1QQP2 1RUE3 1ND2A 1DDLA 1ZBE1 2X5IB 2RS53 1RVF1 4QPIB 1B35B 4Q4Y2 1RB8G 5LK7B 1VBD1 2BFUS 1QJZA 1AR73 1EAH2 1NOVA 1VRH3 4CDWC 2QQPA 5L7OC 5CFCC 3DPRB 2BBVA 2R043 1ND2B 1VBD2 4QPGA 1C8NA 4Q4X3 4RQPA 2RS31 1F8VA 4GMP0 1ZBA1 5BNOA 3NAPC 5D8AA 1HRI3 4NWWA 3JBG1 1SMVA 2HWC3 2IZWA 2MEV1 3S6PA 4IV1A 2RS32 1AR93 4CEYC 1CJDA 1ZBA2 4QPGB 4SBVA 1POV3 3J8F3 2VQ0A 1VBE1 1H8TB 1HXS2 1FOD3 2ZZQA 3JBG2 2MEV2 5BNOB 2FZ1A 4YVWA 1BBT1 1PGW1 4Q4W2 4CDUC 1K5MA 2BUKA 1VBC3 4WM8A 1R1A3 1VB2A 1VBE2 4IV1B 3CJIA 4JGYC 4YVSC 2RS11 1AR61 1BBT2 1PGW2 2PLV1 4YVWB 1RHI1 4WM7C 2R071 3LOBA 5C4WA 1NA1A 1PVC2 1AR81 1K5MB 4WM8B 3VBUC 3CJIB 2PLV2 5ACA3 2ZAHA 5CFDC 1RUF1 1C8M3 1NY71 1VAKA 2R072 1V9U1 1EAH3 1MQTC 1OHFA 5BNPC 5C9AC 1AYM3 1NA1B 1ND3A 1AYN1 1RMU1 2HWD1 3TN92 3VDDC 1RUF2 4FSJA 1V9U2 4BCUA 3VBOC 2RM21 4CDXB 1HRV1 3VBRC 4GB31 4N43C 1AYN2 1RMU2 2DF7A 2HWD2 2WS93 1ND3B 4CDWA 1QJU2 2RM22 5CFCA 4GMP3 3IDEA 1HXS3 5BNNC 1AL21 2GH8A 5J96B 2HWB2 1QJX1 2HWF3 1R081 4Q4W3 1PO11
chains in the Genus database with same CATH superfamily
1HB2A 5LEJA 2FD8A 4IEOA 5GZFA 5BY5A 3GF6A 1PM4A 3NJYA 1FPN1 4IEQA 1RUD1 2HYXA 3IB3A 4JX0A 4LKFA 4N7IA 1GFF2 3T3YA 2C24A 2R7EB 4K7JA 1F35A 2Q1FA 2B42B 3P3PA 4FPYA 5ANQA 3LEMA 4E4SA 2HWE3 1SFYA 4XEZA 5I0DA 3AKPA 1NCRC 3PMEA 3O1VA 5LATA 1TNFA 2WWSA 5FYMA 1GNHA 3ZSLA 1UMZA 2VW0A 3LIGA 4NHLA 5LCWL 1QHDA 4XPVA 4L9BA 4AEMA 4GZ9A 2IXJA 1COV1 1P8JA 3DYPA 5IVYA 2WQ8A 2XLFA 3E97A 4JGYA 3ZLIA 4CEYB 4CP0A 4L99A 5T52A 2PQQA 2Q8CA 5CA6A 1OA3A 4SBVA 1RUH1 5FCCA 4XDQA 4XVHA 2HLEA 3KLSA 5JDBA 3MGUA 3MW4A 1V6JA 4UWDA 2VUCA 1NLRA 2D6MA 4NUBA 4GIQA 5FXVA 5FP9A 1LR5A 5F3IA 1RUG2 4QX8A 3FMGA 5C8WA 1TQ5A 1JYIA 3M3QA 4ZS3A 2XBO2 2VCAA 2VMHA 2HWD3 4IESA 5T54A 4FXKB 4OHXA 4NROA 4XQWA 2PMWB 1MZ6A 5HBAA 1H30A 2OS2A 2P37A 4HSLA 1MQTA 4FO9A 2BQPA 2B9VA 1DZRA 1PM7A 2VW2A 2Z42A 5BNPA 3QACA 5FZDA 4LBQB 5FZOA 1FMD3 4XF0A 3K4ZA 1SBDA 1SLLA 3TBDA 3UKVA 3WSOA 3APBA 2V09A 5A70A 2VZTA 4UW5A 5FZ0A 1BK0A 2VZSA 1HQWA 4RQPB 3VBOA 5CFDB 1UMHA 1IG0A 3HD8B 3MF6A 1ULGA 2WO7A 4GWJA 3SKVA 1PGSA 2BNOA 3JD72 4N43A 2W68A 2EIGA 5FWJA 2WBKA 4UYBA 1O6UA 1FI2A 1O3QA 4D8MA 4Z92B 4R9DA 4NMIA 3ACLA 2W39A 3WP5A 4OHVA 4AQ2A 1V70A 3LDRA 1DQ2A 2A75A 4ASMB 1S0EA 1H1MA 3VDCA 1STMA 1TE1B 2YY1A 2YYOA 3K77A 3MO4A 3ORJA 5FYCA 3K4DA 4LIVA 4CP9B 4LMFA 2ZKNA 3HNYM 4V2VA 3ENRA 2OA2A 5FYIA 1KS5A 3OBTA 1KQRA 3NJXA 1F5JA 1H2LA 1GQHA 1QJY2 4XETA 3I3BA 1AR62 1LEDA 5BNNB 1QU0A 3JUUA 1WCKA 4IE5A 4LUKA 2E6VA 2LRPA 3W9AA 4XFIA 3BN6A 2VBDA 3H3UA 3D3AA 2I45A 4N53A 4MLOA 4KQ7A 5K4LA 2BPA2 2MHFA 1NCQB 2XBO3 3NW4A 4JVAA 3Q8CA 1VBA1 3PIJA 3C7GA 2Y38A 1CZTA 1NY72 1W99A 1PIV2 3PL0A 1AX1A 2RMU2 1OSGA 2J1UA 4I0BA 5FV3A 3HQXA 4XYXA 1NCRB 4AVTA 2D6LX 2P2KA 5DUUA 4RA0A 4J6GA 3T4HB 3THCA 4YW4A 2ZGTA 1HV1A 5CKQA 3N7MA 4EV0A 2CY6A 5HCHA 1AR71 3WQBA 4FQ4A 2CHHA 1XNBA 2GN7A 1GWLA 5IFPA 1GBGA 2ARBA 2IFRA 2J1AA 1Y9GA 3NVCA 5FTTC 4FFGA 1RJ7A 2E9QA 4W8JA 2QQKA 3POBA 4NOTA 4PCRA 2PHXA 3ALQA 2R041 2CTVA 1D0HA 4XURA 3BI3A 1U5XA 3MHZA 5FO7B 2GNDA 2PHRA 2R0FA 3P1IA 3DF0A 5JI7A 4HKLA 3RWKX 5F5QA 2ZABA 4DS0A 1OOPA 2GC1A 1CAUB 1H4GA 5DAQA 1YYNA 5CB7A 4NHXA 1ULFA 5JIAA 2Q8EA 3J7MA 4OUSA 4LO8A 2ZOEB 4XF3A 2YG0A 3TNPB 5CFCB 2BU9A 4AEDA 4A4AA 3A0NA 4ITCA 2VVDA 3GBFA 1WCSA 2EVXA 3J7LA 2NYYA 2CWMA 4IEYA 2JB8A 1FOD1 3AKTA 3UL2A 1W8UA 2W1QA 2YB7A 2JD4A 2ZS6B 3NAPB 3MEPA 1W6MA 1DYPA 1AR63 5T5OA 3WG4A 4FP2A 1VRBA 1A6CA 1AHSA 2PLV3 2D98A 1VBC1 3J8F2 5FZ4A 2QKDA 4PBPA 3SC7X 2W52A 3BU7A 4Y1VA 3ZSJA 1IQAA 4LBOA 3RGBA 2YMZA 2HEYF 1EYBA 1W9YA 2DU0A 1HN1A 3POSA 3RZLA 4XDOA 4I02A 2WO3A 3KCCA 4FTSA 2VOTA 4GH4A 4Y1YA 1O4ZA 4GALA 4WVZA 4BISA 4EN8B 2J42A 5T5LA 1CR7A 4Q4V2 3DECA 2JDMA 1W2UA 2JE8A 3S30A 3D6EA 4UOJA 2PHWA 4MGZE 4RFRB 2AZ5A 1JZ4A 4MYEA 1PMJX 3OPWA 3PMSA 5FY8A 1IGOA 2D6KA 1LJ7A 2K2SA 4QT6A 3TRSB 4BJ0A 4MVTA 3NL1A 5ACA2 3VBUB 1AUYA 1S1AA 4KL1A 4RS5A 1RXGA 5FZFA 4WVWA 2LUWA 3VBRA 5ABJA 5FLHA 5FYSA 5GJ6A 4DXZA 5GZCA 3GDBA 4BWOA 5C3OA 1FX5A 1UX6A 5E89A 1QJX3 3KQRA 5IK8A 3LWCA 1WA6X 4W6WA 5DXDA 5FPLA 5LRRA 2G9GA 5FAXA 2WSVA 3GZUC 5LA2A 4CUCA 4CRQA 1H2MA 4UFKA 3VDDB 4B4PA 1DFQA 1RC6A 1HXS1 5EHDA 3SXWA 2VBBA 4KWUA 2RDQA 2VNVA 3B9IA 2WUHA 1M4WA 4JKKA 4A3XA 2OX0A 1FXZA 2YGLA 5GLWA 5KHJA 3FE5A 2CSGA 2NMOA 1YO8A 2WS92 2DVBA 1GICA 3ELNA 4H7LA 3USUA 4HG6B 2DCYA 3E6DA 4XZUG 5B4XA 2Y8KA 3UGGA 5JXIA 2BOIA 3O0WA 1QNWA 1US2A 1Y4WA 4E4DX 4IEPA 1YFYA 2HWE1 5DDJ2 5DMYA 1MS1A 3DPRC 4EROA 4IE0A 1CAVA 1R092 2VTXJ 5BXXA 4YWAA 1UCXA 1IPJA 4Y26A 5FYTA 4HKOA 4Q4V3 5FY5A 1HLCA 4LBNA 4FOWA 3VBSB 1WWYA 3VHOA 1UKRA 3ZFEB 3ZXAC 4AI8A 3TEZA 4Q0VA 5LA9A 3POYA 1YRZA 5A3TA 2JIGA 3AK0A 2Y6HA 3H3LA 4HT1T 1JYVA 3VKLA 1NG0A 3FLTA 2VMGA 4ES8A 1NXMA 1UIKA 3AMPA 1VE0A 2EXJA 4OHZA 3RVHA 1MZ5A 4MADA 4LOTA 2BZDA 3WDUA 1QDCA 5BNOC 2XONA 1IKPA 3M3EA 4IV3A 5FK8A 3VD9A 3TYJA 3MLJA 2L9LA 3HWJA 2Y6LA 4H2AA 3T2QA 5K9YA 5JMOA 3VBFA 5A32A 4DINB 4DXTA 1XNCA 2WDBA 1VRH2 1XSRA 2X10A 4KMQA 2B4KA 4F8AA 3IDAA 4GQ7A 3RJ2X 4Q1RA 1OF3A 5FY0A 1FMD1 2RDRA 4Q4X2 5EYXA 2DUQA 4QPWA 3BPZA 3H0OA 2J1SA 3VGIA 4YM0A 4XIOA 5K0UB 1Q56A 4CZSA 2WFF2 2Z4FA 3OEBA 1TNRA 3FC0A 4JZRA 4R8HA 2J1RA 4AGVA 4B1LA 5JXHA 4AHZA 4H3WA 1LESA 4MGSA 3ETPA 4L11A 4NR1A 1LAJA 1W6QB 2Q0AA 5IUQA 3HIFA 1BEV3 5F5CA 1BHGA 3UJQA 4A2UA 3SH4A 2JG8B 4IW3A 3QH7A 4P9GA 4UXAA 4XJ8A 3UV9A 4Q26A 4LO7A 1URXA 4J1XA 4A6OA 3A7QA 2JKBA 4MV2A 3BU0A 1OLRA 1YIFA 3BVCA 3E5UA 3U14A 3CKHA 2YDEA 3KHCA 5A7WA 1HX6A 4URTA 3M7AA 4P08A 3H8RA 5JZGB 4FTBA 5EJ1B 2AH2A 1QXPA 3R6SA 1GKBA 5LWBA 1SCRA 4CCCA 5LBFA 5IK7A 2BNMA 1W05A 4XDPA 1DDLA 3AP7A 5FYBA 4EQVA 4QPIB 1LHUA 1V6OA 2VO5A 5D2AA 3WNLA 5CG8A 3WF1A 2TNFA 1GOHA 2E7TA 2F4LA 1QJZA 2P4EA 1O5UA 3IMNA 4F3JA 5LEKA 1HQLA 1ZRCA 4U2AA 1EAH2 1NOVA 1VRH3 3OYWA 3LA2A 3AMQA 1G6NA 4CCKA 1LEMA 4CP1A 3FHQA 2VNRA 5L7OC 3VV1A 3AZXA 4XTPA 1AZDA 1Q43A 2YXSA 3DPRB 3INAA 3OY8B 1PX3A 1W8HA 4URAA 1W6NA 2JG9A 2KXLA 4PLMA 4QPGA 4Q4X3 4YGDA 5EWSA 4EYUA 3Q8EA 3I3MA 2BVVA 4NAOA 4QX0A 2P3IA 1W6OA 4XFGA 5D8AA 4COWA 4NWWA 3K75B 1WW7A 2IZWA 4EWDA 2VZPA 3VLBB 3IKWA 5GZGA 4IV1A 4ORFA 1UOJA 2ET7A 1CJDA 1QXRA 2BEOA 1HKDA 4CPBD 1YI9A 2IXCA 2VQUA 1H8TB 3AFKA 5A3PA 1DLLA 2XJQA 1V6KA 3JBG2 2MEV2 4BOWA 1LGBA 5BNOB 5F3CA 2FZ1A 5HI0A 1S0GA 1YQ6A 4YVWA 3ZYBA 4BIOA 4H55A 1SLCA 4Z8BA 3ZIWA 4QKNA 4YGEA 1BCXA 1DF0A 2BUKA 2JDHA 2PFWA 4B4QA 3OJBA 4WM8A 2JE7A 4OYUA 5JMCA 5FO9B 4JGYC 3HN3A 2VNGA 1ULCA 1W2AX 1WD3A 3OTFA 1AR61 1PGW2 1JU3A 1KD7A 1GZTA 3QOPA 5CZKA 2PLV1 1JI6A 5F5IA 2JE9A 3ZDVA 1GOFA 1CAWB 4JHTA 2I07B 1DG6A 2UY9A 3OEAA 3H3ZA 2GC0A 2QCSB 3AJYA 3IBMA 4NN0A 1NA1A 3HT2A 2SBAA 4P02B 4YW1A 5C4WA 1IS5A 1NE6A 4WZFA 3MV01 3RG0A 4NHMA 3VZOA 1V6MA 5A3OA 4KWJA 1YI7A 4BLJA 3U4XA 5A1LA 4UW3A 2YFUA 3FHIB 1N1VA 3H7JA 4HLTA 5KXEA 1NT0A 1NY71 4TN7A 4AG4A 3GGLA 1EAH3 4YM2A 2WO1A 1MQTC 5FPBA 3CZJA 3Q8BA 4U36A 3LCPA 5BNPC 2AEYA 4TLGA 5DG1A 3WW4A 4P00B 2O14A 2NP0A 1CAXA 1GP4A 1ND3A 2ZEZA 1DBNA 1ZRIA 5IAVA 3TN92 1NZCA 3ZYPA 4BPZA 4IDZA 4JRLA 4LO4B 4LKDA 5FP8A 1V9U2 1HDKA 1QEXA 5F39A 3VBOC 5DUWA 4SLIA 4CDXB 4CUAA 4L8QA 1OLQA 3WV6A 3CZUA 1QY4A 4N43C 1MS4A 3VZLA 1AYN2 2NQYA 5H9PA 3ZR6A 1WLCA 4CDWA 5F3EA 1ZZ7A 3BIWE 5M0TA 4AVSA 4ZS2A 1ZRFA 3UJOA 3HNMA 4TZDA 1VMHA 2DCZA 4E2SA 3B5LB 3T2PA 1QJX1 4M3CA 3ME2A 3B69A 4LHSA 2OKXA 3B9CA 1GU3A 5FDBA 2AENA 1U12A 1C57A 5KHIA 1V6IA 2PA7A 4KWLA 1KRIA 1VB4A 3WNMA 5CEHA 2R061 1LOAA 3ZFGB 1AXZA 3U75A 5FP4A 1T6BX 2CU5A 5ISLA 4ES9A 2XWJB 4JDNA 2QDRA 1CGPA 4QHBA 3MUY1 3AX4A 4EN0A 5A3MA 2ZGKA 3HQRA 4Q0UA 4D94A 3RNSA 4UW4A 5JOZA 1UPSA 3DXUA 3EQEA 3PDQA 4N53C 5SV5A 2VVEA 5FLIA 2RJKA 3BCWA 3DEMA 4YZ2A 5J1XA 3C2UA 1TVGA 2JDPA 4QPYA 1AJKA 4KI5M 2GNTA 4QXKA 1OKQA 3DN7A 4UF0A 1DCSA 3UGHA 3H8OA 3UGFA 1UOFA 3IAPA 4IL7A 2WAOA 3HR9A 3KT7A 4YW7A 4OI1A 4FPJA 5G04L 2HEWF 2VCCA 1Z0HA 1MEC3 4Q4V1 1FAYA 3I2KA 4QHZA 1D4M2 5EFUA 5EIYB 4CCMA 3TN93 1OI6A 5AC92 4NIAA 1S0DA 4XHXA 2Q4SA 4QX2A 1LODA 3GZTB 2ZX2A 1XC6A 1ZBE2 3WNPA 4AHWA 2W92A 1UZYA 1RVF2 4D69A 1BVP1 2RJLA 4CCLA 1A8DA 1Z78A 4JGYB 1L3JA 1DU3D 2H6BA 3AP9A 4NPRA 4YG0A 2YBPA 3DXTA 4OQ9A 4FTEA 1WMFA 2QBXA 4K21A 5IVJA 5JPNB 2Q30A 3SH5A 4BZ4A 3DL3A 1PZ8A 3AKSA 3KQ4B 1J83A 1OOPC 1Q8OA 3BTAA 4HBNA 5EV7A 4YARA 2XQXA 1OLME 4DEVA 4LJHA 1XOYA 2WA3A 3SHRA 2JEMA 4AEDC 3TWIA 4D7SA 3U07A 5GKAC 1GWMA 3LE0A 3WHUA 1DGRN 3KGZA 1WLDA 1XSQA 1JYNA 3MIBA 4MOAA 2QNKA 2E31A 4S2HA 4Y33A 1JTZX 4FAHA 4J25A 4YZ5A 1JUIA 3NO8A 3WCSA 5BNPB 5EPAA 3T2OA 1X7NA 2GH2A 1LENA 2VECA 4KU8A 5EJ3A 5FZOB 1JUHA 3ZYFA 1UL9A 2HBUA 2PHFA 1ODNA 2VY0A 1OVSA 1OC1A 2BGOA 3LEIA 3VBOB 3ZN6A 5DAWA 4GWNA 1TME3 1DZTA 4PJYA 2WYFA 4D6RA 5F37A 2GU9A 1WMEA 3KGLA 4E4HA 1DQ4A 5IVBA 2QZ2A 1QXJA 4N43B 5FWEA 4AI0A 4AFCA 4LBLA 1JOBA 2ZX4A 5FMDA 5H9SA 4GH4C 1RUC3 1D2SA 1BEV1 1QQP3 2QQOA 3OSDA 4P9JA 1G7YA 1UD1A 1JS9A 2JDAA 2EAKA 3I97A 5H9QA 4AOCA 2RS12 4PHZA 1K5JA 5I0TA 2R1DA 5DG2A 1RUJ2 1MACA 3EXUA 1W8OA 4R9AA 1HV0A 1RHI2 2BJSA 2ZZJA 1N3OA 4DFSA 2XPJA 1ND2C 1ZBE3 2JD9A 1RVF3 2WAAA 2FCTA 4CUBA 4X8NA 2Z5WA 4QXBA 5CYYA 1VBD3 4KG8A 1LHWA 3FUQA 4ET7A 4RR3A 1QF3A 4I0AA 1ASJ2 4RS5C 4ZU7A 4MG2A 3PUIA 3RZZA 1VAVA 4P9YA 2ZMNA 5ABJC 5IFTA 3NJZA 3ZYRA 3FLPA 4B4RA 1CPNA 1UW8A 2DBNA 4ZKTB 3AYDA 4YM3A 2Y33A 4NVPA 2FQPA 3OUHA 4N53B 3W5MA 5IW0A 3ZXEA 3W5NA 1ZBA3 4NRPA 3MW3A 2R32A 2A6YA 1S55A 5IHRA 2ZGQA 5L7OA 3S0MA 1BMV2 3RYRA 2EXIA 4M01A 3NNGA 4YW5A 1HJGA 1QIQA 4Q4X1 4IE7A 3HNBM 4AVAA 2QDNA 1O3RA 3ZIXA 3I8TA 2P1BA 2ZGNA 1NUKA 2VMCA 4IEUA 4QQOA 4BK4A 2PHTA 4QXHA 1VBE3 5FUNA 1Y9MA 2WR9A 3LEKA 5IWFA 5FYZA 3MF9A 3U0ZA 2JJ6A 1W3XA 4S2GA 1S0IA 4Y5TA 1J3QA 1BBT3 1RL3A 2AUYA 4Y4YA 2ZX3A 2ZPXA 4DUVA 2QUOA 4NIIA 1IZ3A 2JXAA 2XG3A 3VZJA 4M00A 2OPWA 1LTEA 5LW9A 1HRI2 3U11A 1V00A 4MUVA 2RS13 2VJXA 3M3CA 1IKQA 1OOPB 4MXWA 1AR92 5A6XA 1VMJA 3ACGA 5FQ0B 2WWJA 2LW8A 3T09A 1EV12 1RHI3 3OGJA 1REFA 4BB3A 1J58A 1Y3TA 2VUJA 2G9FA 2YGMA 3MIGA 2QVSB 1Z7S2 4LA3A 1RUOA 1PGL2 3ILNA 4AHXA 3VHRA 4RHV2 1IS3A 3KSCA 2BTVC 3Q9OA 4NIDA 3VB9A 2FZ2A 1RUF3 5A3WA 1W6MB 3D0JA 4OUMA 4XUNA 4QM9A 5FREA 1IPSA 4GJYA 4FPEA 3WNOA 4A6SA 2JX9A 5FO8B 1O59A 1QJEA 3HN1A 4IV3C 2WNVA 4QB1A 4C1WA 1I5ZA 1MS9A 2JENA 3WDVA 3CJXA 3VBFC 3D5OA 3PJYA 1RMU3 1ZNPA 4YVSB 2VR4A 2W5FA 4P14A 1PNGA 3LSDA 5A33B 1EAH1 2WINB 1YFUA 2RM23 2W87A 3PLQA 4L0PA 4ATEA 2ES3A 3KD4A 4GD4A 4GH4B 4LO6B 3WUCA 1S2EA 4XUQA 5FBJA 3LPGA 2Z69A 3NKTA 4LXLA 1C8M2 3UETA 4E27A 1H9WA 2XJVA 2GZWA 2O8OA 4NWVA 4YFWA 3IMMA 1WCUA 2WT2A 2P3YA 1OFSA 4AVVA 4UBHA 2FDHA 5DAPA 2IC1A 1AYM2 3IPVA 3H50A 4MHRA 5CVRA 3SCGA 3U78A 4KWKA 3UNPA 2ZACA 2J7MA 3NNLA 1LB2A 3POEA 2B39A 2PHDA 2LTNA 2PELA 4AYUA 3MPBA 5JOYA 2IXLA 2HKXA 2DVDA 4OI0A 5DZEA 3CBNA 4RS5B 2DFBA 4HMZA 4FQZA 4QDSA 3MV11 1ENQA 1UYZA 2WZR2 3VBRB 3AVRA 1AL0G 5ABJB 3P5BA 2VUAA 4RSUA 1LOCA 1G9CA 2JDKA 1KGYA 3BPSA 4DXRA 1EV13 3MIHA 2E7QA 3ETQA 4LA2A 4HFSA 4EJRA 1Z7S3 4B1MA 3RZGA 3MIDA 2XWBB 3DGTA 2DVGA 2HWF2 5FPZA 4RHV3 4BA6A 2ZX0A 1QWRA 4R4XA 3VBHC 5KC5A 2VMEA 1D7PM 4BE3A 2XVGA 4EE2A 2VBPA 3AMMA 3CIHA 2ZHNA 4DRRA 2RR11 1RUG3 1X9TA 2RDNA 4KBZA 3USUB 1JYWA 4ARYA 2WWUA 1WW6A 4AWDA 1YIPA 3ZOIA 1ULPA 4WVMA 2NMNA 3KF5A 2XXZA 1IG3A 3WW2A 1UIJA 2DYCA 5FJKA 2C5DA 2P34A 4HPKA 5KC6A 2BGPA 2VNOA 1ENRA 2RS51 2OUHA 1M06G 1SLAA 1MEC1 3FWEA 2X29A 1RIRA 1EUTA 2JG9C 4L97A 4O9EA 4QPGC 3JB8A 3P6BA 2X53S 3TN91 5A3UA 3C3VA 4XJWA 3RMXA 4W50A 4R9BA 1RUE2 4DRVA 4P9XA 3RYKA 1H1AA 1Y7BA 5FZBA 2DCJA 5D8AC 3ZR5A 1UOBA 1MPXA 2XJTA 3RS6A 3WW1A 1J3RA 1ZA7A 3JD73 2XLAA 1AX0A 4Q2FA 1C3HA 4IV1C 4E9KA 1EPZA 1KFXL 3PUQA 4LEJA 4XAEA 5FMBA 4B7KA 1W9WA 5EZWA 2G4IA 3MYXA 2EIEA 2I74A 1X33A 3LEGA 3ILRA 4YVWC 4IV3B 5GLZA 4BQ1A 2WZR3 5JAXA 3AZWA 3WX5A 4RL7A 5A80A 3VL8A 5BYNA 5A1AA 3VBFB 1DGRA 4WM8C 4A7ZA 5A32B 1G9BA 2KD7A 2KR2A 3NV2A 1BVVA 2HWC2 3T4VA 4XQ4A 4ATFA 3UKNA 1JZ8A 3VZMA 1QJY3 1YNAA 5KXDA 3W59A 3FZ3A 5CKNA 2A3XA 4O9GA 1S0CA 1XBFA 4LHKA 4NAMA 1E5RA 2OZ6A 3JCIA 3FBMA 5BUVA 1U5YA 5C4WC 1NA1C 4AEJA 4XXPA 4A3ZA 4K6BA 3KV9A 3A21A 1TME1 4XE9A 2ORZA 1X9PA 1XYOA 5A7OA 4ISRA 5FKBA 4HL0A 2UWBA 1DYOA 2XDVA 5T5PA 1R1A2 1B35A 1PIV3 3C7FA 1C5HA 1RUC1 1B09A 1QQP1 2Z79A 3FUOA 1CX4A 3OGVA 2RMU3 3ZO0B 3GBWA 2ZMKA 4Q29A 3OD0A 1ND3C 2EIBA 4W4ZA 3WF4A 5C5UA 5K7PA 4PT6A 1J84A 4ZU4A 2DURA 2E53A 4X6RB 4LLFA 4AQSA 1DGWA 1RUE3 1CZVA 1ND2A 1ZBE1 3N9MA 1DGLA 4IUGA 3U1XA 1RVF1 2H0VA 2V5YA 4GXLA 4Q4Y2 5F7UA 1RB8G 3MLLA 3R4DB 4DO0A 2B45X 1POQA 1OUSA 1VBD1 2D3RA 3I2GA 4FPCA 1G9DA 3H7YA 2ZX1A 1W28A 1X8EA 3NRUA 4LBJA 1CPMA 1VALA 1W6PA 2P6HA 4RGKA 5IJRA 4CDWC 4CCOA 3MICA 4PIYA 2AR6A 2VOWA 4MHUA 4BMEA 4Q5OA 1CQ9A 1NKGA 3U10A 4BQ4A 1ZZ6A 1YLLA 1OLMA 2XJSA 4Q0PA 1C8NA 2DUPA 4RQPA 5AVAA 3WF0A 1IS6A 4ARXA 3WG3A 3PURA 3T08A 3KZ4C 1F8VA 1UYYA 1ZBA1 4JDOA 1ENXA 2W91A 2ZHMA 2BOJA 2J1VA 4EN6B 4CTEA 1CZSA 4IETA 3SKJE 5J36A 1SMVA 2HWC3 3S6PA 3B93A 1DLCA 1Q8VA 3OYWB 1J59A 3VD3A 2AGSA 2W1UA 5FY4A 2WZ8A 2RS32 4XAAA 4AXOA 3PTRB 4LHNA 1W6NB 2JG9B 2VZRA 2XMLA 4QDQA 1POV3 3AFGA 3J8F3 4QDRA 1XU2A 4QPGB 1UY1A 1VBE1 5F32A 5JR7B 3IDBB 3IIIA 5JVVA 4QU2A 1MVEA 4ZXEA 2CAVA 4CP9A 3POGA 3VN4A 1KJLA 5IYYA 5LZ6A 3WNNA 1BBT1 4XUPA 4OVEA 1DZQA 1GLHA 2IWGB 2O1QA 3PU3A 4PI2A 1JZ7A 1JW6A 1R1A3 2B5HA 4IV1B 4BXFA 5KHHA 3KVBA 2A6WA 4AVBA 3WUDA 1LU2A 1L7QA 2LROA 2B46X 3NV1A 1AXYA 4LKSA 2C26A 4AW7A 2NN8A 4MH0E 2RS11 2D6OX 1VJ2A 1DP0A 3J26N 4JV4A 3AYEA 3KT1A 3MFCA 3IWZA 3O1TA 5B4NA 5JSRA 4YVWB 1RHI1 3RFRA 4CE8A 3N9NA 2HH9A 3WP6A 5FOBB 2F4PA 1C5IA 1PVC2 1XYPA 3WG1A 4WM8B 2ARXA 4YW2A 4LK6A 4QD2A 3BGAA 2VW1A 3ACIA 5ACA3 1HN0A 5FRAA 1NAEA 4JTOA 1RUF1 2R16A 1VAKA 1XB9A 1Y9QA 2R072 2ZEYA 5JWPA 4YLZA 1PHMA 3MZHA 3OF1A 3TOJA 4CXXA 1Q8PA 1LOFA 1A3KA 1XE7A 1OHFA 3WXPA 3PVNA 5C33A 1H2KA 3OBZA 4I0WB 1T2XA 2YPJA 3BOPA 2K46A 5T55A 2EF6A 1MZEA 1NA1B 4OI4A 4H14A 1LHOA 1RMU1 2HWD1 2MNGA 2Q1ZB 2XL7A 4D3WA 5DN2A 4I01A 4BCUA 4Y24A 1CX1A 2XL9A 3BIEA 2RM21 2PN5A 5DAXA 5F2WA 5IVEA 3O1PA 1W8WA 4AQ6A 1RINA 1KXGA 1FV2A 2VOXA 5GM0A 4FFHA 2A1XA 1OQ1A 4COVA 3WNKA 3N36A 1NX9A 3ZN5A 2WS93 3HJRA 2DCKA 1ND3B 3Q8AA 4K40A 4TLFA 1QJU2 3ZXDA 4Y22A 2A3YA 5CFCA 2LM3A 1FNZA 1HIXA 3CHXA 3E1F1 1Q8QA 3FL7A 2JIJA 2W1SA 1UY3A 4RN5A 5J96B 3E6CC 1LNSA 2HWB2 1ZREA 4ZXKA 5F9TA 2A7AA 2Y6KA 2VCBA 3A4UA 1UOGA 4XZPA 3GHNA 4DEQA 1BXHA 3LDKA 4YRDA 2VZQA 3T2TA 5A6QA 5FXZA 5KHKA 3IT8A 2VM9A 3HBZA 5DDJ3 4XJAA 4BU2A 4GKXA 4LLOA 4QHOA 4DUXA 2WT1A 5EJZB 1R093 4XABA 1W2TA 2VOKA 4CDWB 3I4IA 3RZMA 1GQPA 3M2MA 5J37A 3N4MA 1PO12 4XBLA 1EV11 4M3CB 4XTMA 2DFCA 1JH5A 3AJZA 5FIXA 4BXSV 1PVC3 1FPN2 2ATFA 1RUD2 5IVVA 5F5AA 1VAMA 4RHV1 2VU9A 3A22A 3LAGA 1I3HA 4R52A 4CDUA 1N3QA 4RR3C 3VBHA 3ZM8A 2QQUA 1WMXA 2ZGMA 1SDWA 3DKQA 4O7XA 4XCAA 1TEIA 2EIDA 1ENSA 4B29A 1DYKA 1RUG1 4LBMA 2JKXA 4L92A 4GULA 3V65A 5LBBA 2XBO1 1H1IA 4G3YC 1WGPA 4YW3A 4FOVA 4WM7A 4P5HA 5I0RA 1GMMA 2WZPP 1SPPB 1GP6A 2WABA 3O1MA 3RMYA 3O12A 3CEWA 2WQ4A 3GHMA 4FOQA 2EAAA 2GN3A 1RUH2 4META 3ZYHA 2H6CA 2W46A 3U37A 5JXJA 4C8DA 5JXGA 4C0BA 5FUIA 1J1LA 2GSYA 2JECA 2QE3A 3DKWA 4FT8A 2D93A 4I09A 4BYYA 1VLNA 1QJU3 4P9WA 3ES4A 3B7MA 4OFGA 5HXVA 5C9AA 4AL9A 1SFNA 4LULA 1RTVA 2WFF3 3ZPYA 5C71A 3BALA 2HWB3 2J1EA 3JD71 1SFPA 2OYZA 3VKOA 4YGCA 3VDDA 4BQYA 1PVXA 4JKMA 5CIRA 4HSJA 4K1YA 2ZCWA 4IEVA 2ENRA 3GJBA 4TYSA 5DABA 5CBLA 1RJ8A 1PZ7A 3E5QA 4EZ4A 2E63A 1GANA 1ZVFA 3ZXGA 2FDJA 1UKGA 2WZR1 5GLUA 2UURA 1S0BA 2C1FA 2DDUA 5CNAA 4XJ9A 3LD8A 5FFOC 3M3OA 3ZPOA 3CNAA 4MGTA 4A7YA 3POIA 5FK7A 1KITA 2A73B 1RUD3 2ZBJA 3ST7A 4PIXA 1QJY1 2RJ2A 2UWAA 1LGNA 3AL6A 4Y20A 2JDNA 1GR3A 2WC2A 1PK6A 4DB5A 2X5IC 4NIHA 4NE9A 4JAAA 1RUNA 4N8MA 3SEEA 3WEZA 3VBSA 3V0BA 4Z1VA 1ULOA 2Q1MA 2RDSA 2WNVC 3P3NA 2YBSA 4QKBA 3RDIA 1RXFA 3J7NA 3ZN6B 1GOGA 3R05A 3CU7A 4EN9B 1PIV1 3LF7A 4HOOA 3PUAA 1AR82 1G9FA 2RMU1 4DOUA 3RJRA 1QKQA 2D6NA 4YG3A 3BKZA 4LTAA 1PMIA 1ZA4A 4V2WA 4QGNA 4ONUA 3B94A 5C3SA 1DQ5A 4YNIA 4Z2WA 5FZ9A 2WNUC 2SLIA 5LRSA 3USSA 3S57A 4XQDA 4IGPA 1A34A 3O1RA 2GALA 3GZEA 5IAXA 4OZXA 2VXJA 5BNQA 1RUE1 1XE8A 5G05L 1IHMA 2E26A 1WUVA 1GSLA 4FPHA 4QXCA 4YPJA 4Z2AA 1C1FA 1LECA 4IEWA 4XJUA 2D40A 4M4PA 4XW3A 1WLTA 1VBA2 2DU1A 3I2IA 5EXOA 1N1SA 5FZ7A 3DV8A 4KNCA 2XVLA 4Q0QA 4QX5A 1WA4A 4UFJA 4YW6A 1CIYA 1NXD1 5J98B 4EWAA 4RR3B 4PDWA 1HRV2 4DXSA 4NIGA 2CL2A 2DV9A 4QKFA 2XUEA 3K3OA 3RPQA 1CESA 2BYVE 3FFQA 3JBG3 1GYKA 2MEV3 2XH6A 3FHAA 3LZZA 4GB32 5HPOA 2X05A 3NNJA 2Q8OA 5FUPA 5K0UA 4ASLA 5KR7A 4CCNA 3J4UH 1AR72 2DTWA 2MPFA 2PAMA 3MFAA 4K8RB 3I59A 5C8CA 2UYBA 1K45A 2D3PA 3B3QE 3MDPA 1F9KA 4ZHNA 5ANNA 1JZ6A 1KFUL 2ID4A 2XKOA 4Q27A 1JZ3A 1AL22 1W06A 2E51A 2HWC1 1ZX5A 5JLVA 5FZGA 1W6QA 5L7OB 1KDKA 4OLLA 1R082 1MS5A 1QH6A 4Y1XA 3I2JA 3F2ZA 4BQXA 4WV8A 4DPNA 1POV1 1OUXA 1UQXA 2JG8A 2VQAA 3J8F1 4M3CF 4XMIA 1OH4A 2OZJA 3WP4A 1TMF2 3OGRA 4AI2A 1WD4A 2KM2A 5FYHA 5FY1A 2R30A 1W04A 5DPNA 5FZ6A 5SV8A 1I5PA 1CN1A 1REEA 2G1MA 4FPOB 4ZONA 1AJOA 1JXNA 5CG9A 1HJFA 1ODMA 3ZSKA 1OT5A 1FOD2 2BFUL 2WJSA 1L7LA 1AR83 3AKRA 3JZVA 3VDAA 4E8CA 2XJRA 1UY0A 5EYYA 3WQ0A 3WF3A 3NQHA 1PO22 3GYDA 1UXZA 1MS8A 5KXCA 3AYAA 1DGWX 1O8SA 1VR3A 2DBIA 3VZNA 4QPIA 5I8SA 3IZOA 1V9U3 4DQAA 2J22A 2GC2A 3NNFA 4P9LA 1RGSA 4GA9A 1YQCA 3ECQA 1GZWA 4H7MA 1YQ8A 2ZXQA 5ACA1 1AYN3 3IIAA 2D7FA 3B01A 3LPFA 3MPPG 2BGCA 4FAGA 1JYCA 3OY8A 1YFWA 4JTNA 1HRV3 3RZKA 1HW5A 2GDFA 4GB33 5IATA 1LOBA 4AGGA 2IXIA 2WN3A 2WNVB 3EO6A 4N9HA 1MS3A 4INDA 4XC9A 2N7GA 1W2NA 2K0GA 2OIIA 1RYYA 3EBRA 4I3GA 1AL23 4W6YA 4XFHA 2YBKA 4LOSA 1YUDA 2D97A 2YZ4A 1MQTB 3POFA 4AI9A 1R083 2YC2A 1H8TA 4FVVA 3ILFA 4LHLA 3VKFC 2WS91 1V6LA 2E7AA 5GZEA 2FDGA 4AFDA 4I30A 4RFT0 3H1MA 1ZYBA 4LT5A 1TMF3 1G86A 4CEWA 1S2BA 5L36A 3SITA 2EXHA 2QTWB 5FYVA 4UBGA 3RI8A 4AHYA 3H8XA 3ZYGA 4MGKE 2ET1A 4CDQA 1B35C 5DDJ1 2VXRA 3EYPA 4CU7A 4GKYA 1R091 1K42A 4YSFA 3F95A 2XGXA 4XUOA 1CAWA 3WG2A 1PO23 2ORXA 2XR4A 5I8YA 4MGQA 1D4M3 3ZFFA 4AEKA 5AC93 2OUJA 4KBBA 2ZAAA 3FBYA 5JSOA 3SH3A 4OHYA 4AI1A 4TSVA 5FZHA 3TEWA 1PVC1 1GWKA 1VMFA 4CU9A 1LULA 3NMBA 5CKMA 2W47A 2BP6A 1V6NA 1VBB2 5FZKA 3GCXA 2GNMA 3SISA 3O1SA 2WLPA 3AZVA 3GCWA 1XE0A 3MIFA 2HWE2 2CYFA 3NNMA 2ILMA 2A70A 3TEXA 4O61A 1QOTA 3SNMA 4K3UA 1U5ZA 3JU9A 2HJIA 3BTYA 4NJ4A 5FPXA 1KEXA 4HVOA 4RQPC 3WR0A 3N7KA 5C3RA 4CDXA 4KGQA 3V0AA 2WSUA 4BK5A 4FPLA 1QH7A 4ASKA 2NPIA 1LU1A 2VTXA 4E4ZA 2QQMA 3OBRA 4Q8LA 1VRH1 5I91A 4WVMB 1OKOA 4XIKA 5D1IA 4HETA 2JDZA 4QMAA 2QQLA 3KMHA 4PF1A 3URFA 5A6YA 1CD3G 4X6QB 4BQ5A 1WCDJ 4Y3OA 1BJQA 4HXCA 5A7PA 1QJU1 3ZYIB 1D2QA 2VQTA 3ABZA 3N9LA 5AFBA 3GZAA 3M70A 2AEZA 2LS6A 2WFF1 3O14A 4OMCA 2HWB1 4XF4A 1F5FA 4E8DA 3M8LA 1SEFA 1YEWA 3T0DA 3N7LA 3C7OA 1POV0 4Y4RA 4HK9A 1UU5A 4FXGB 2V72A 3W58A 3KM5A 4MZUA 1Y43B 4JGZA 4DIQA 4IE6A 1US3A 4IGOA 4FFIA 3ZFGA 3VHNA 2IFWA 5AVPA 4PIZA 1FMD2 4Y5Z0 5HCFA 3BUCA 5CAZA 5E1RA 2UYAA 1RUJ3 2Y26A 3ZMNA 2D6PA 2P3KA 2Y6GA 2ZHLA 3PIGA 3OGSA 2C0ZA 1NCQC 4LIUA 3T0BA 4AEDB 4XF9A 1WBLA 3M3IA 5FMCA 1JOPA 1OH3A 4NPLA 4F83A 1N47A 4C90A 4N7UA 4O65A 1XJAA 1VBB3 3ZN4A 4CU6A 2CDPA 3GM8A 2X5IA 3HT1A 3JB4C 3LGRA 4QX3A 1ASJ3 1UYXA 2VUDA 3WP3A 2EXKA 3K48A 3MW2A 3H8UA 4YGBA 1LOFC 3HAGA 4MSVA 1X82A 4R9CA 3LA3A 1QGLA 4CPBA 4XACA 4DUWA 3OCPA 1XXNA 2QFEA 3LA7A 4NHKA 4QB2A 2C9AA 3GNEA 1YJLA 4KG0A 4A44A 1B35B 5A7SA 3AVSA 4CCJA 2EALA 1E5IA 2WNUA 1YXWA 2BFUS 3X29B 1DIWA 5T50A 1UU4A 5JI9A 1FATA 2ARAA 2QQPA 3LFIA 5CFCC 1OXCA 3PJQA 5DAVA 1DQ0A 1XNKA 2OPKA 4HN1A 1ND2B 1KS4A 1F15A 4PLNA 1UY2A 2YU1A 5FXXA 3UK9A 3JXSA 4M0NA 1X50A 3PHMA 1E5SA 3THPA 3V64A 1JODA 4E2QA 1ZM1A 4KGGA 4EN7B 3BOWA 4OI2A 2OQ6A 2V73A 3NAPC 5DQ0A 3WDTA 1OA2A 2B9UA 5J09A 5L9VA 1H6XA 1HRI3 1F4HA 1W9SA 2W94A 3JBG1 2MEV1 1W6PB 1WW5A 1FV3A 3R4SA 4IERA 1YWKA 1XYNA 1GP5A 3TAYA 1AR93 1S4CA 2W1WA 4TWTA 3I3QA 3AZZA 5FPAA 3W21A 5F2SA 3ZMOA 2VQ0A 2YUEA 3GBGA 1W9FA 2CDOA 2XHNA 2ZZQA 4LUMA 1GNZA 3QD6A 4V1PA 4BDVB 1CWPA 2BV4A 1PGW1 4UFHA 1NLQA 4Q4W2 2PQSA 4CDUC 1K5MA 3O7OA 4XUTA 2VH9A 1TG7A 1VB2A 3R4UA 3CJIA 2W0XA 1W03A 5BPXA 3DUIA 1C4RA 2D5FA 4OUEA 3W20A 5IVCA 3ASIA 1FT9A 3LOIA 1SHWB 1FYUA 4AK3A 4WM7C 3EHKA 5JCTA 2PXJA 1JMUB 2WA4A 2KA3A 3LOBA 2DVAA 1AR81 4FBFA 5CADA 2C6SA 2W9XA 3CMGA 3PVOA 1O4TA 3VBUC 2B7YA 1XPWA 4IEZA 5I0UA 3VZKA 5JPMB 1CAVB 2IVIB 2PLV2 4CUGA 1UPIA 3HOBA 2G9ZA 1PNFA 1ULEA 2ZKLA 1C8M3 5JOWA 5FYYA 4JKLA 2XQRA 1LOEA 2BRTA 1V9U1 4G9SB 1I1EA 2GMMA 4AVCA 1I6XA 5C9AC 3OGGA 3WT3A 4PLOA 1OFNA 4LQRA 1AYM3 5JUVA 5J7MA 1AYN1 2JDYA 3DYMA 3VDDC 4YZ3A 4FSJA 4KU7A 2VVFA 4PF5A 2E32A 1E5HA 1HRV1 4D6QA 4QB6A 4GB31 5FJHA 3PUHA 3OD4A 3VKMA 4BQWA 1GZCA 2WZEA 2DF7A 5L19A 1W8NA 3POJA 1QOSA 2PTMA 4P9IA 1SBFA 5FY7A 1JU4A 3MI8A 1VPHA 5KBFA 1GUIA 4EWEA 3MIEA 2VG9A 4GMP3 5J48A 1AL21 2GH8A 5FZIA 4MGYE 2D43A 2QQJA 4R4ZA 4CSWA 5FZ3A 2VGDA 2VMDA 5L9BA 2HWF3 1R081 2VPVA 1OF4A 3MLKA 1TZOA 4Q4W3 4FPGA 1PK6C 3FLRA 5LK5A 1MS0A 1ALYA 2FBEA 4NO4A 4QU1A 2ZA9A 5C6CA 4LITA 2ZGLA 2CGOA 3VBSC 3ZFEC 1TMF1 3CO2A 5FQ0A 3PUSA 4M3CE 1QJX2 3S5AA 4Y22B 2V4AA 1BK1A 1KJRA 2PAEA 4A42A 2RV9A 1LHNA 1O5LA 1UF2C 5AFEA 1MVQA 4CEYA 4I2OA 2W08A 3KCYA 2XJPA 2A5ZA 1YQ5A 1H0BA 3UYJA 5A3NA 1S0JA 3PVBB 5L9RA 3DCQA 2WRAA 2R062 4XJZA 2YU2A 1PO21 5FBZA 2XLGA 2XKPA 1J3PA 1D4M1 4LK7A 4BLIA 1W2OA 3KT4A 1W90A 3MBWA 1BLZA 3R0RA 4GWMA 5EQUA 5AC91 1YFXA 1X36A 3SCFA 5FKCA 4YYOA 4Z07A 1Q5OA 1G8WA 2HYKA 4YVSA 1RUI2 1S2KA 1W8TA 5C3QA 4QAWA 2GNBA 5H9RA 5J3UA 3OB8A 5A33A 1IPKA 3WY6A 5A6ZA 5A7WB 5IK4A 3ATGA 1GV9A 1K12A 3QBQA 1QJFA 2XB6C 2VZUA 2WO2A 4LBQA 3I2FA 3S7EA 4CDUB 5BV6A 1APNA 1MZFA 4PDWC 3VBHB 4A45A 1EY2A 1LCLA 4IEXA 1W0PA 3KS7A 3AP6A 1LRHA 1NYWA 1YCIA 1C28A 3KF3A 2Y6JA 5CFDA 3WLUA 4NRMA 5K0UC 2VMFA 1UWWA 1VIWB 1N1TA 3NKGA 2R1BA 5C8CC 4BM8A 1T6GC 3KV6A 1J1TA 5FZ1A 1EUUA 1AX2A 3I2HA 2W3JA 4WM7B 2FDIA 3M4FA 4RGGA 1WLWA 3NV4A 3UT0A 4QQPA 5FPUA 3K51A 3D8CA 4CP2A 1OQEA 2Y0OA 4LNVA 3N35A 3N7JA 5DUVA 4UFMA 3HQUA 2JG8C 3RYPA 4Y5SA 4ISQA 4AAXA 2ERFA 2WL1A 5JR2A 2VAUA 3T1LA 5JOXA 1UMIA 4B8EA 1W6OB 3V56A 1HB1A 3AXDA 2PHUA 1ZZBA 5D8AB 5C9AB 3AB0A 3O0XA 1IS4A 4DY3A 2ETEA 3AC0A 3VD4A 1LHVA 4Q8KA 3RWNA 2PAKA 3BODA 2WLQA 4K8FA 5JZGC 4AZZA 4PQ9A 5BNNA 1EP0A 4MGIE 5FR3A 2LALA 4K1ZA 1REDA 2R063 4M0HA 2K9ZA 4EZHA 3THDA 1RUJ1 4S2DA 5FYUA 3EMRA 1BZWA 2VZ3A 2Q8DA 4AE2A 1IQDC 2D44A 3O5SA 4QPIC 1W39A 3AYCA 2AYHA 5HCAA 1NCQA 1QDOA 2VD7A 3VUOA 3ZKYA 1AF9A 4OZOA 1RUI3 1PMHX 4Q4Y3 4RD7A 3UESA 1VBB1 3BYWA 2WQZC 3N9PA 4XBQA 4UW6A 2R6QA 5LY2A 1QNYA 3L2HA 1NCRA 1ASJ1 4Y20B 1BEV2 3S5QA 1YQ2A 1PK6B 4Q0SA 4HKWA 3JQXA 4XF1A 1OQDA 1NZIA 1WMDA 2A3WA 2V5DA 2WN2A 4JCKA 5F6KA 3SEPA 4BIFA 3V0BB 3FX3A 2QQIA 1O8PA 1NLSA 3N9QA 4CXWA 5C4WB 5IT6A 2BBAA 2P6CA 4C1XA 3I2DA 4WZCA 5FZ8A 3POWA 2R0HA 5E16A 2ZMLA 2D3SA 3WDYA 3I2OA 2Y0IA 2JICA 2YROA 3KV5A 4NPMA 2FDFA 1BMV1 2VZ1A 2IUWA 2EA7A 2YC0A 1F2NA 5I93A 1K3IA 4COYA 2HEVF 1H8TC 1F31A 2RS33 5DZGA 1CAUA 4XOGA 4D7TA 2ZTNA 3AM2A 1CAXB 2P5BA 1MR5A 3D0SA 4OQ8A 1KDMA 2DUOA 4YG6A 5FPVA 3SLIA 2FHRA 2GC3A 2A6XA 3MUZ1 4TXWA 4FFFA 1JZ5A 1NE4A 2DWRA 3ZXJA 2GP5A 2X09A 2VE1A 3AKQA 3WF2A 2BWAA 4CEWC 3ZSMA 1LOGA 3D4KA 2IXHA 3AMHA 3CLPA 3N3HA 4HN0A 5LA0A 2VCMA 2VMIA 4JDMA 5FMOL 3KCXA 3LDBA 3NSTA 4AFBA 4CDQC 1WKYA 3AZYA 3IN9A 3NAPA 1JYXA 1HQNA 1XNDA 1HRI1 5FZMA 4BMBA 1F4AA 3LB9A 5KXBA 2ZGOA 4PDWB 1AR91 4AAPA 2XHKA 2WT0A 4AFAA 3WD5A 3ZFFC 3ZVXA 5HXMA 1UYPA 3PNAA 3T30A 1UZ0A 1SLBA 5C8CB 1Z7S1 3I59B 3WINE 3OPTA 4I3PA 3WDXA 1ZRDA 3N9OA 1PGL1 2CAUA 1OPMA 3LFMA 3LIHA 3ZDSA 3OUJA 4TTGA 2C4XA 5HV4A 4BHPA 5T3NA 2R073 3A23A 2UU8A 4HK8A 4OULA 3NJVA 4JHZA 4C91A 4IGQA 4KH9A 3WQ1A 3RZJA 2YHJA 3HEIA 3SQOA 4E2GA 5LB6A 5ERLA 4RGAA 4XILA 5CU1A 4CDXC 5LY1A 1UX7A 2DCTA 2VTFA 4QKDA 1COV2 3RQ0A 3VKNA 1HB3A 1SBEA 4HANA 3VDBA 4UF0B 2ZEXA 2F17A 3HBKA 5GALA 3U4SA 3VBUA 1N1YA 1OBNA 4YZ4A 3HMYA 2RG4A 5T5JA 1ONAA 4FOYA 4CYDA 3J9SA 2BVBA 5IVFA 1C8M1 4QGLA 4AFMA 3TEYA 3FN9A 3L2YA 4IE4A 4IQPA 2P17A 4XXAA 4L2NA 1CVNA 2Q5TA 1OPOA 3ZYJB 1AYM1 1UY4A 3WOGA 2YC4A 4COUA 1C1LA 4CCDA 2CWSA 3M1HA 1S0FA 1GZWB 2VZOA 2NLRA 3OG2A 4LPLA 2YPDA 3G7DA 1JN2P 1QOOA 3WCRA 4JGZC 5FZAA 3UKTA 1CONA 5HV0A 3ZFGC 2AC1A 5F3GA 1E57A 5FY9A 2ZGPA 3H9AA 3I3DA 4F7ZA 1VP6A 4GWIA 1OA4A 3ZX7A 2XUMA 2BWCA 3WQ7A 1DQ6A 4YFZA 2ZHKA 3ZKUA 2VULA 1PO13 3AP4A 4WVVA 4XFBA 1UAIA 3PU8A 1CJPA 4GMP1 3FJSA 3WZ1A 4XFCA 5A1FA 2EICA 5F8PA 1YC61 1FPN3 3E6BA 1H6YA 3H42B 4UI9L 3PVEA 1A78A 2R49A 4MX3A 2QQVA 3ZXKA 2HWF1 4BQ3A 2BW8A 2ZGUA 4Q4W1 5FXWA 2NZ9A 2WIIB 2OW4A 2WYSA 3EJKA 3K46A 2V4VA 5FOJB 3I7DA 1AXKA 3ZFEA 3C7HA 3J7HA 5KWRA 2GMEA 3O0VA 3NV3A 4MO3M 5CISA 2OQ7A 3ZXFA 4CEWB 2I2SA 3C8XA 3VD7A 1COV3 1SLIA 2W95A 2XJUA 3KVAA 1OMIA 1AVBA 1I9RA 4CDQB 1H2NA 1W9TA 3CQOA 3K2OA 4CXYA 3S7IA 1GQGA 1RUH3 3OOXA 1OVPA 2FMDA 2VC9A 3EB7A 5E88A 1IOAA 5JSPA 1YJKA 4JQTA 3OUIA 2XOMA 1WW4A 1NQJA 2IXKA 3I3EA 4NHYA 4W65A 5A7NA 3ROUA 5C7GA 1ZZ9A 1H4HA 3ZFFB 2RR12 4QQHA 4XBNA 3IAQA 3CF6E 2GAUA 2B8MA 4HONA 4NRQA 4P5YA 2X8KA 5IK5A 4PBOA 4HZFA 1O91A 1W0OA 4ZZ5A 2BDRA 3VL9A 3LSEA 4QX7A 3AMNA 3D82A 5FP3A 2RS52 2ADDA 2ARCA 2WFPA 4RYDA 1XQNA 1MEC2 1ZZ8A 3IDCB 3K3NA 4X8PA 3E5XA 2DTYA 1NQDA 1WBFA 1O3TA 3HVDA 1SQ4A 3TB0A 4AQTA 1X8MA 4C0HA 4PQQA 4JRAA 3V0AB 1UZZA 2TEPA 1SZBA 2P3JA 2YV8A 3ACHA 4LBKA 2JWPA 1R64A 2Y6FA 1O4YA 2R042 3Q8FA 3G6JB 2C9KA 2XVKA 2G19A 2RE9A 2Y64A 4GAZA 2ZEWA 1K5MC 2H0BA 1XNTA 1XU1A 3CJIC 3WW3A 4UFLA 4M4RA 4QGMA 4AI3A 5GLTA 4DMIA 4OMDA 3FFZA 2A71A 4Y1ZA 3CL1A 5GLVA 5LBCA 2RHPA 2O8QA 5APAA 1R1A1 3H1YA 1GZ9A 5JZGA 4YZ1A 1D4VB 1SG3A 3RZHA 3GJAA 4JGZB 4OHWA 1UN1A 1UZWA 4Y1UA 5FMOS 3BB6A 4QWNA 4MXVA 4N90A 2OXBA 4S2FA 4AR2A 1VBC2 4K9SA 4MXWB 5KHGA 5D21A 3WNXA 3CDZB 3H1WA 1ULDA 2RR13 2QJVA 1TME2 2TBVA 1PZ9A 1RUI1 2CV6A 4Q4Y1 3RRDA 4QM8A 1SDDB 1SPPA 5FZEA 4D6SA 5L73A 1VBA3 1W0NA 3OPZA 5F1RA 2TUNA 3DPRA 3I54A 1RUC2 1QQP2 1H8VA 3AXEA 1Q3EA 2Y60A 3HPNA 2QQNA 2X5IB 1SACA 3AP5A 2RS53 3KHBA 4Q1PA 1OURA 5LA1A 5HCBA 2YFZA 4B3NA 4CCEA 5E6HA 3ES1A 4D0QA 5C70A 5LK7B 4UT5A 3O1OA 4XFAA 3SCHA 4N9IA 4CA9A 4AGRA 4FP3A 4BQ2A 4DY5A 1AR73 3K4AA 5A7QA 4LR4A 1WCQA 1R1ZA 4A7KA 2GMPA 2A6ZA 3VHPA 5K8SA 2BERA 4IXLA 2BBVA 4CVUA 2JB4A 2R043 1W3VA 4LORA 1VBD2 1PX4A 2WKKA 3TNQA 1RITA 2Y34A 4QQLA 2W2IA 4ZU5A 4AF9A 2RS31 1N3PA 4CU8A 4FI9A 4GMP0 4LE3A 2FCUA 5BNOA 4FPKA 2WNUB 4WBBA 1ST8A 3B02A 1UU6A 2O0OA 4QQ2A 3O1UA 3IM0A 4W6XA 1U5IA 1JBCA 1UZVA 1JOJA 3GALA 4CEYC 1ZBA2 3IPVB 3T0AA 1BYHA 1JZ2A 2HBTA 2AREA 4XCBA 1XNAA 2PYTA 1HXS2 1UO9A 1FOD3 3C7EA 3NWKA 2QZ3A 4XHBA 1OD3A 2OT7A 5C3PA 1U0AA 1LKNA 4DZGA 1D0GA 2VZVA 4JQRA 1O7FA 1ACCA 2VL4A 3KV4A 5DZFA 2DVFA 5LASA 1DQ1A 2QQWA 1VBC3 3ACFA 3THTA 2FCVA 3WDWA 3WVJA 1VBE2 1WZXA 1CIWA 1UXXX 4FCAA 4LBQD 2JDUA 2WNEA 4YVSC 1QMJA 2WNOA 1UNBA 4K20A 5E8AA 5FZCA 1BBT2 5LBEA 2D5HA 2PHLA 1LGCA 3A0KA 3B00A 3L9JT 3BTXA 3BTZA 2R071 1V0AA 1O3SA 1K5MB 4XMAA 3T1MA 2CNAA 4B7EA 3CJIB 1JHJA 4LO5B 1JYTA 1Q8SA 4A41A 2Z2SB 2ZAHA 2ZGSA 5CFDC 2IVJA 5FP7A 1BKZA 2CGPA 2NM1A 1GNYA 4DNYA 1JHNA 1SLTA 5GZDA 4FPFA 5F6LB 3SMHA 1BQPA 5EP9A 1HB4A 1ZRRA 2CGNA 2ZJCA 3JQWA 4D7YA 3LQCA 4ZPIA 1W8FA 2A6VA 2ADEA 4G4FA 3VD5A 4HPKB 3QLQA 1EPWA 3QCWA 4OCTA 4ZY9A 5TSWA 1W8ZA 1XRUA 1RUF2 5FLJA 1G9AA 2BNNA 4JC1A 1DHKB 3KWVA 2FMYA 2VOVA 4YM1A 5I8TA 1ZZCA 5C5TA 2RVAA 3VBRC 5FZLA 5B2GB 4PI0A 3DYOA 3QH6A 4BH9A 5A3LA 2ZGRA 4UAPA 2E33A 4QX1A 2FDKA 4GJZA 3ITQA 4LKEA 1OD5A 1RMU2 2HWD2 3OBAA 2UWCA 2J1TA 3RI9A 4Z82A 4COZA 1FNYA 3AL5A 5DUXA 5I0SA 2AACA 2RM22 3I49A 1SCSA 3PTYA 4HVRA 4J1WA 3WHTA 3IDEA 1HXS3 1A8MA 1L7RA 2UY8A 4XFFA 3ZSEA 4HVQA 5BNNC 1YHFA 4LE4A 3ZXLA 2GP3A 2OVUA 5JIUA 1H9PA 4ZZ8A 4UFIA 3GXUA 3RSJA 3LKJA 3ON7A 3KB5A 1PO11 2F6BA
chains in the Genus database with same CATH topology
5LEJA 4IEOA 5GZFA 5BY5A 3GF6A 1FPN1 4IEQA 1RUD1 4N7IA 1GFF2 4K7JA 2B42B 3P3PA 4FPYA 4E4SA 2HWE3 1SFYA 4XEZA 3AKPA 1NCRC 3PMEA 1TNFA 2WWSA 1GNHA 3ZSLA 1UMZA 2VW0A 4NHLA 1QHDA 4XPVA 4L9BA 4AEMA 2IXJA 1COV1 2XLFA 3E97A 4CEYB 4JGYA 4CP0A 4L99A 5T52A 2PQQA 5CA6A 1OA3A 1RUH1 5FCCA 4XDQA 3KLSA 5JDBA 3MGUA 3MW4A 1V6JA 1NLRA 2D6MA 4GIQA 1LR5A 1JYIA 1RUG2 5C8WA 3FMGA 1TQ5A 3M3QA 2XBO2 2VMHA 2HWD3 4IESA 5T54A 4FXKB 4OHXA 4XQWA 5HBAA 1MZ6A 1H30A 2P37A 4HSLA 1MQTA 4FO9A 2BQPA 2Z42A 1DZRA 1PM7A 2VW2A 5BNPA 3QACA 4LBQB 1FMD3 4XF0A 1SBDA 1SLLA 3TBDA 3UKVA 3APBA 2V09A 4UW5A 1HQWA 4RQPB 3VBOA 5CFDB 3HD8B 3MF6A 1ULGA 1PGSA 2BNOA 3JD72 4N43A 2W68A 2EIGA 1FI2A 1O3QA 4Z92B 4R9DA 3ACLA 2W39A 3WP5A 4OHVA 4AQ2A 1V70A 1DQ2A 2A75A 4ASMB 1S0EA 1H1MA 1TE1B 2YY1A 2YYOA 2ZKNA 3ENRA 2OA2A 1KS5A 3OBTA 1KQRA 1F5JA 1H2LA 1GQHA 1QJY2 4XETA 1AR62 1LEDA 5BNNB 1QU0A 3JUUA 1WCKA 4LUKA 2E6VA 3W9AA 4XFIA 3H3UA 2I45A 4N53A 4MLOA 4KQ7A 2BPA2 2MHFA 1NCQB 2XBO3 3NW4A 4JVAA 1VBA1 2Y38A 1NY72 1PIV2 1AX1A 2RMU2 1OSGA 4I0BA 3HQXA 4XYXA 1NCRB 4AVTA 2D6LX 2P2KA 5DUUA 4RA0A 4J6GA 4YW4A 2ZGTA 1HV1A 4EV0A 3N7MA 2CY6A 1AR71 4FQ4A 1XNBA 2GN7A 1GBGA 2ARBA 2IFRA 3NVCA 5FTTC 1RJ7A 2E9QA 4NOTA 4PCRA 2PHXA 3ALQA 2R041 2CTVA 1D0HA 1U5XA 5FO7B 2GNDA 2PHRA 2R0FA 3DF0A 5JI7A 4HKLA 5F5QA 2ZABA 4DS0A 1OOPA 2GC1A 1CAUB 1H4GA 1YYNA 5CB7A 1ULFA 5JIAA 4OUSA 5CFCB 4LO8A 2ZOEB 4XF3A 3TNPB 4AEDA 3A0NA 4ITCA 2VVDA 3GBFA 1WCSA 2EVXA 2NYYA 2CWMA 4IEYA 1FOD1 3AKTA 3UL2A 2ZS6B 2JD4A 3NAPB 3MEPA 1W6MA 1DYPA 1AR63 5T5OA 3WG4A 4FP2A 1A6CA 1AHSA 2PLV3 2D98A 1VBC1 3J8F2 2QKDA 4PBPA 2W52A 3BU7A 4Y1VA 3ZSJA 1IQAA 4LBOA 2YMZA 2HEYF 1EYBA 2DU0A 3POSA 4I02A 3KCCA 4FTSA 4GH4A 4Y1YA 1O4ZA 4GALA 4WVZA 4EN8B 5T5LA 1CR7A 4Q4V2 1W2UA 3S30A 3D6EA 2PHWA 4MGZE 2AZ5A 4MYEA 3PMSA 1IGOA 2D6KA 1LJ7A 2K2SA 4QT6A 3TRSB 5ACA2 4MVTA 3NL1A 3VBUB 1AUYA 1S1AA 4KL1A 4RS5A 4WVWA 2LUWA 3VBRA 5ABJA 5FLHA 5GJ6A 4DXZA 5GZCA 4BWOA 1FX5A 1UX6A 5E89A 1QJX3 3KQRA 5IK8A 3LWCA 4W6WA 5DXDA 5LRRA 2G9GA 5FAXA 2WSVA 3GZUC 4CRQA 1H2MA 4B4PA 3VDDB 1DFQA 1RC6A 1HXS1 3SXWA 4A3XA 3B9IA 1M4WA 1FXZA 2YGLA 5GLWA 5KHJA 3FE5A 2NMOA 1YO8A 2WS92 2DVBA 1GICA 3ELNA 4H7LA 3USUA 2DCYA 3E6DA 3O0WA 1QNWA 4E4DX 4IEPA 1YFYA 2HWE1 5DDJ2 1MS1A 3DPRC 4EROA 1CAVA 1R092 5BXXA 1UCXA 1IPJA 4Y26A 4HKOA 4Q4V3 1HLCA 4LBNA 4FOWA 3VBSB 3VHOA 3ZFEB 1UKRA 3ZXAC 4AI8A 4Q0VA 3POYA 1YRZA 3AK0A 4HT1T 3VKLA 1NG0A 3FLTA 2VMGA 4ES8A 1NXMA 1UIKA 3AMPA 2EXJA 4OHZA 1MZ5A 3WDUA 1QDCA 5BNOC 1IKPA 3M3EA 4IV3A 3TYJA 3MLJA 3HWJA 5K9YA 3VBFA 5A32A 4DINB 1XNCA 1VRH2 4F8AA 4GQ7A 3RJ2X 4Q1RA 1FMD1 4Q4X2 5EYXA 2DUQA 3BPZA 3H0OA 4YM0A 4XIOA 5K0UB 1Q56A 4CZSA 2WFF2 4AGVA 4R8HA 1TNRA 3FC0A 4AHZA 4H3WA 1LESA 4L11A 4NR1A 1W6QB 2Q0AA 5IUQA 3HIFA 1BEV3 3UJQA 4A2UA 3SH4A 2JG8B 4P9GA 3QH7A 4UXAA 4XJ8A 3UV9A 4Q26A 4LO7A 1URXA 4J1XA 2JKBA 4MV2A 1OLRA 1YIFA 3E5UA 2YDEA 1HX6A 4URTA 3M7AA 5JZGB 4FTBA 2AH2A 1QXPA 3R6SA 1GKBA 1SCRA 5IK7A 2BNMA 1DDLA 3AP7A 4QPIB 1LHUA 1V6OA 5CG8A 2TNFA 2E7TA 1QJZA 1O5UA 3IMNA 4F3JA 5LEKA 1HQLA 1ZRCA 4U2AA 1EAH2 1NOVA 1VRH3 3OYWA 3LA2A 3AMQA 1G6NA 4CP1A 1LEMA 5L7OC 2VNRA 3VV1A 3AZXA 4XTPA 1AZDA 1Q43A 2YXSA 3DPRB 3INAA 3OY8B 1W6NA 2JG9A 2KXLA 4PLMA 4QPGA 4Q4X3 4YGDA 5EWSA 2BVVA 2P3IA 1W6OA 4XFGA 5D8AA 4COWA 4NWWA 1WW7A 2IZWA 4EWDA 3VLBB 3IKWA 5GZGA 4IV1A 4ORFA 2ET7A 1CJDA 1QXRA 2BEOA 1HKDA 1YI9A 2IXCA 1H8TB 3AFKA 1DLLA 2XJQA 1V6KA 3JBG2 2MEV2 4BOWA 1LGBA 5BNOB 2FZ1A 5HI0A 1S0GA 4YVWA 4BIOA 4H55A 1SLCA 4Z8BA 3ZIWA 4YGEA 1BCXA 1DF0A 2BUKA 2PFWA 4B4QA 3OJBA 4WM8A 2JE7A 5JMCA 5FO9B 4JGYC 2VNGA 1ULCA 1WD3A 3OTFA 1AR61 1PGW2 1KD7A 3QOPA 2PLV1 2JE9A 1CAWB 2I07B 1DG6A 2UY9A 3H3ZA 2GC0A 2QCSB 3AJYA 3IBMA 4NN0A 1NA1A 3HT2A 2SBAA 4YW1A 5C4WA 1IS5A 1NE6A 4WZFA 3RG0A 4NHMA 3VZOA 1V6MA 4KWJA 1YI7A 4BLJA 3U4XA 4UW3A 3FHIB 3H7JA 1N1VA 4HLTA 5KXEA 1NY71 4AG4A 1EAH3 4YM2A 1MQTC 4U36A 3LCPA 5BNPC 5DG1A 3WW4A 2NP0A 1CAXA 1ND3A 1DBNA 3TN92 1NZCA 3ZYPA 4BPZA 4JRLA 4LO4B 1V9U2 1HDKA 3VBOC 5DUWA 4SLIA 4CDXB 4L8QA 1OLQA 3WV6A 1QY4A 4N43C 1MS4A 3VZLA 1AYN2 2NQYA 5H9PA 1WLCA 4CDWA 1ZZ7A 3BIWE 1ZRFA 4AVSA 3UJOA 4TZDA 2DCZA 4E2SA 3B5LB 1QJX1 4M3CA 3ME2A 3B69A 3B9CA 5FDBA 2AENA 1U12A 1C57A 5KHIA 1V6IA 2PA7A 4KWLA 1KRIA 1VB4A 2R061 1LOAA 3ZFGB 1AXZA 4ES9A 2XWJB 4JDNA 2QDRA 1CGPA 4QHBA 3AX4A 4EN0A 5A3MA 2ZGKA 4Q0UA 4D94A 3RNSA 4UW4A 1UPSA 3EQEA 4N53C 5SV5A 2VVEA 5FLIA 2RJKA 3BCWA 4YZ2A 3C2UA 4QPYA 3VGIA 1AJKA 2GNTA 4QXKA 1OKQA 3DN7A 4IL7A 3HR9A 3KT7A 4OI1A 4FPJA 2HEWF 1Z0HA 1MEC3 4Q4V1 1FAYA 1D4M2 5EFUA 3TN93 1OI6A 5AC92 1S0DA 4XHXA 2Q4SA 4AHWA 1LODA 3GZTB 2ZX2A 1ZBE2 1UZYA 1RVF2 4D69A 1BVP1 2RJLA 1A8DA 1Z78A 4JGYB 1L3JA 1DU3D 2H6BA 3AP9A 4NPRA 4YG0A 4FTEA 1WMFA 4K21A 5JPNB 2Q30A 3SH5A 4BZ4A 3DL3A 1PZ8A 3AKSA 1OOPC 5EV7A 1Q8OA 3BTAA 4HBNA 4YARA 2WA3A 3SHRA 2JEMA 4AEDC 3TWIA 4D7SA 3U07A 5GKAC 3WHUA 1DGRN 3KGZA 1WLDA 3MIBA 2QNKA 4S2HA 4FAHA 1JTZX 4YZ5A 1JUIA 3NO8A 3WCSA 5BNPB 1X7NA 2GH2A 1LENA 2VECA 4KU8A 5EJ3A 1JUHA 1UL9A 2PHFA 2VY0A 3VBOB 3ZN6A 4GWNA 1TME3 1DZTA 4PJYA 2GU9A 1WMEA 3KGLA 1DQ4A 2QZ2A 1QXJA 4N43B 4AI0A 4AFCA 4LBLA 2ZX4A 5H9SA 4GH4C 1RUC3 1D2SA 1BEV1 1QQP3 4P9JA 1G7YA 1UD1A 5H9QA 2EAKA 2RS12 5I0TA 2R1DA 5DG2A 1RUJ2 1MACA 3EXUA 4R9AA 1HV0A 1RHI2 2ZZJA 4DFSA 1N3OA 2XPJA 1ND2C 1ZBE3 1RVF3 4X8NA 2Z5WA 1VBD3 4KG8A 1LHWA 3FUQA 4RR3A 1QF3A 4I0AA 1ASJ2 4RS5C 4ZU7A 3RZZA 1VAVA 4P9YA 2ZMNA 5ABJC 3NJZA 3ZYRA 3FLPA 4B4RA 1CPNA 1UW8A 4ZKTB 3AYDA 4YM3A 4NVPA 2FQPA 4N53B 1ZBA3 3MW3A 2R32A 2A6YA 1S55A 5L7OA 2ZGQA 3S0MA 1BMV2 3RYRA 2EXIA 4M01A 4YW5A 4Q4X1 4AVAA 2QDNA 1O3RA 3ZIXA 3I8TA 2ZGNA 4IEUA 4QQOA 2PHTA 1VBE3 3MF9A 3U0ZA 2JJ6A 4S2GA 1S0IA 1J3QA 1BBT3 1RL3A 2AUYA 4Y4YA 2ZX3A 2ZPXA 2QUOA 1IZ3A 2JXAA 2XG3A 3VZJA 4M00A 1LTEA 1HRI2 3U11A 1V00A 4MUVA 2RS13 3M3CA 1IKQA 1OOPB 4MXWA 1AR92 5FQ0B 1EV12 1RHI3 3OGJA 1REFA 1J58A 1Y3TA 2VUJA 2G9FA 2YGMA 3MIGA 2QVSB 1Z7S2 4LA3A 1RUOA 1PGL2 3ILNA 4AHXA 3VHRA 4RHV2 1IS3A 3KSCA 2BTVC 3Q9OA 2FZ2A 1RUF3 3ZXEA 1W6MB 3D0JA 4OUMA 5FO8B 4QM9A 5FREA 5JOZA 4FPEA 2JX9A 3HN1A 4IV3C 2WNVA 4C1WA 1I5ZA 1MS9A 2JENA 3CJXA 3VBFC 3D5OA 3PJYA 1RMU3 1ZNPA 4YVSB 4P14A 1PNGA 3LSDA 5A33B 1EAH1 2WINB 1YFUA 2RM23 3PLQA 4ATEA 2ES3A 3KD4A 4GH4B 4LO6B 3WUCA 3NKTA 2Z69A 1C8M2 4E27A 2XJVA 1H9WA 2GZWA 2O8OA 4NWVA 4YFWA 2WT2A 1OFSA 4AVVA 4UBHA 2IC1A 1AYM2 3IPVA 3H50A 5CVRA 3SCGA 4KWKA 2ZACA 1LB2A 2B39A 2PHDA 2LTNA 2PELA 4AYUA 3MPBA 5JOYA 2IXLA 2HKXA 2DVDA 4OI0A 5DZEA 4RS5B 2DFBA 4HMZA 4FQZA 1ENQA 2WZR2 3VBRB 1AL0G 5ABJB 2VUAA 4RSUA 1LOCA 1G9CA 1EV13 3MIHA 2E7QA 3ETQA 4LA2A 4HFSA 4EJRA 1Z7S3 3MIDA 2XWBB 3DGTA 2DVGA 2HWF2 5FPZA 4RHV3 4BA6A 2ZX0A 1QWRA 4R4XA 3VBHC 5KC5A 4BE3A 2XVGA 3AMMA 2ZHNA 4DRRA 2RR11 1RUG3 3USUB 1WW6A 4AWDA 1YIPA 4WVMA 2NMNA 3WW2A 1UIJA 2DYCA 2C5DA 2P34A 4HPKA 5KC6A 2VNOA 1ENRA 2RS51 2OUHA 1M06G 1SLAA 1MEC1 3FWEA 2X29A 1RIRA 4L97A 2JG9C 4O9EA 4QPGC 3JB8A 2X53S 3TN91 3C3VA 4XJWA 3RMXA 4R9BA 1RUE2 4DRVA 4P9XA 3RYKA 1H1AA 1Y7BA 2DCJA 5D8AC 3WW1A 2XJTA 1J3RA 3JD73 2XLAA 1AX0A 4Q2FA 1C3HA 4IV1C 4E9KA 1EPZA 1KFXL 4LEJA 4B7KA 5EZWA 2G4IA 3MYXA 2I74A 1X33A 3ILRA 4YVWC 4IV3B 5GLZA 4BQ1A 2WZR3 5JAXA 3AZWA 3WX5A 4RL7A 3VL8A 5BYNA 3VBFB 1DGRA 4WM8C 4A7ZA 5A32B 1G9BA 3NV2A 1BVVA 2HWC2 4XQ4A 4ATFA 3UKNA 3VZMA 1QJY3 1YNAA 5KXDA 3W59A 3FZ3A 2A3XA 4O9GA 1S0CA 4LHKA 2OZ6A 3JCIA 3FBMA 5BUVA 1U5YA 5C4WC 1NA1C 4AEJA 4XXPA 4K6BA 1TME1 4XE9A 1XYOA 4ISRA 4HL0A 2UWBA 5T5PA 1R1A2 1B35A 1PIV3 1C5HA 1RUC1 1B09A 1QQP1 2Z79A 3FUOA 1CX4A 2RMU3 3ZO0B 3GBWA 2ZMKA 4Q29A 3OD0A 1ND3C 5K7PA 4ZU4A 2DURA 2E53A 4X6RB 4LLFA 4AQSA 1DGWA 1RUE3 1ND2A 1ZBE1 1DGLA 1RVF1 2H0VA 2V5YA 4GXLA 4Q4Y2 1RB8G 3MLLA 3R4DB 2B45X 1VBD1 2D3RA 4FPCA 1G9DA 3H7YA 2ZX1A 1X8EA 4CDWC 4LBJA 1CPMA 1VALA 1W6PA 3MICA 4PIYA 2AR6A 2VOWA 4BMEA 1CQ9A 3U10A 1YLLA 1ZZ6A 2XJSA 4Q0PA 4RQPA 1C8NA 2DUPA 5AVAA 1IS6A 3WG3A 3KZ4C 1F8VA 1ZBA1 4JDOA 1ENXA 2ZHMA 4EN6B 4CTEA 4IETA 5J36A 1SMVA 2HWC3 3S6PA 3B93A 3OYWB 1Q8VA 1J59A 2AGSA 2RS32 4AXOA 4LHNA 1W6NB 2JG9B 4QPGB 4SBVA 1POV3 3AFGA 3J8F3 5JR7B 1XU2A 5JVVA 3WCRA 1VBE1 3IDBB 4QU2A 1MVEA 2CAVA 3VN4A 1KJLA 1BBT1 4OVEA 1DZQA 1GLHA 2IWGB 2O1QA 1JW6A 1R1A3 2B5HA 4IV1B 5KHHA 2A6WA 4AVBA 3WUDA 1LU2A 2B46X 3NV1A 1AXYA 4AW7A 2NN8A 4MH0E 2RS11 2D6OX 1VJ2A 3J26N 4JV4A 3AYEA 3KT1A 3MFCA 3IWZA 5JSRA 4YVWB 1RHI1 3WP6A 5FOBB 2F4PA 1C5IA 1PVC2 1XYPA 3WG1A 4WM8B 2ARXA 4YW2A 4QD2A 2VW1A 5ACA3 5FRAA 4JTOA 1RUF1 2R16A 1VAKA 1Y9QA 2R072 5JWPA 4YLZA 1PHMA 3MZHA 3OF1A 3TOJA 1Q8PA 1LOFA 1A3KA 1XE7A 1OHFA 3WXPA 3PVNA 5C33A 1H2KA 4I0WB 2YPJA 3BOPA 5T55A 2EF6A 1MZEA 1NA1B 4OI4A 4H14A 1LHOA 1RMU1 2HWD1 2MNGA 2Q1ZB 2XL7A 4D3WA 4BCUA 4I01A 4Y24A 2XL9A 2RM21 2PN5A 4AQ6A 1RINA 1KXGA 1FV2A 2VOXA 5GM0A 4COVA 1OQ1A 3N36A 3ZN5A 2WS93 2DCKA 1ND3B 4K40A 4TLFA 1QJU2 3ZXDA 4Y22A 2A3YA 5CFCA 2LM3A 1FNZA 1HIXA 1Q8QA 5J96B 1ZREA 2HWB2 4ZXKA 5F9TA 2A7AA 3A4UA 4XZPA 3GHNA 1BXHA 4YRDA 3T2TA 5KHKA 3IT8A 3HBZA 5DDJ3 4XJAA 4GKXA 4LLOA 2WT1A 1R093 2VOKA 4CDWB 3I4IA 3M2MA 5J37A 3N4MA 1PO12 4XBLA 1EV11 4M3CB 4XTMA 2DFCA 1JH5A 3AJZA 1PVC3 1FPN2 2ATFA 1RUD2 1VAMA 4RHV1 2VU9A 3LAGA 1I3HA 4R52A 4CDUA 1N3QA 4RR3C 3VBHA 2ZGMA 1SDWA 1TEIA 1ENSA 4B29A 1DYKA 1RUG1 4LBMA 4L92A 4GULA 3V65A 2XBO1 1H1IA 4G3YC 1WGPA 4YW3A 4FOVA 4WM7A 4P5HA 5I0RA 2WZPP 3RMYA 3O12A 3CEWA 2WQ4A 3GHMA 4FOQA 2EAAA 2GN3A 1RUH2 4META 2H6CA 4C0BA 1J1LA 2GSYA 2JECA 2QE3A 3DKWA 4FT8A 2D93A 4I09A 4BYYA 1VLNA 1QJU3 4P9WA 3ES4A 3B7MA 4OFGA 5HXVA 5C9AA 1SFNA 4LULA 1RTVA 2WFF3 3ZPYA 3BALA 2HWB3 3JD71 2OYZA 3VKOA 4YGCA 3VDDA 1PVXA 5CIRA 4HSJA 4K1YA 2ZCWA 4IEVA 2ENRA 4TYSA 5CBLA 1RJ8A 1PZ7A 3E5QA 2E63A 1GANA 1ZVFA 3ZXGA 1UKGA 2WZR1 5GLUA 2UURA 1S0BA 2C1FA 5CNAA 4XJ9A 5FFOC 3M3OA 3CNAA 4A7YA 1KITA 2A73B 1RUD3 2ZBJA 3ST7A 4PIXA 1QJY1 2UWAA 1LGNA 4Y20A 1GR3A 2WC2A 1PK6A 4DB5A 2X5IC 4JAAA 1RUNA 3V0BA 3VBSA 4Z1VA 2Q1MA 2WNVC 3P3NA 3RDIA 3ZN6B 3R05A 3CU7A 4EN9B 1PIV1 1AR82 1G9FA 2RMU1 4DOUA 3RJRA 1QKQA 2D6NA 4YG3A 4LTAA 1PMIA 1ZA4A 4QGNA 4ONUA 3B94A 5LRSA 1DQ5A 4YNIA 4Z2WA 2WNUC 2SLIA 3USSA 4XQDA 2GALA 4OZXA 5BNQA 1RUE1 1XE8A 1IHMA 1WUVA 1GSLA 4FPHA 1C1FA 1LECA 4IEWA 4XJUA 2D40A 4XW3A 1WLTA 1VBA2 2DU1A 5EXOA 1N1SA 3DV8A 4KNCA 2XVLA 4Q0QA 4QX5A 1WA4A 1NXD1 5J98B 4EWAA 4RR3B 4PDWA 1HRV2 2CL2A 2DV9A 3RPQA 1CESA 2BYVE 3FFQA 3JBG3 1GYKA 2MEV3 2XH6A 3LZZA 4GB32 2Q8OA 5K0UA 4ASLA 3J4UH 1AR72 2DTWA 2MPFA 2PAMA 3MFAA 5C8CA 3I59A 2UYBA 3B3QE 2D3PA 3MDPA 1F9KA 1KFUL 2XKOA