2R072

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r07200
2HWC1 5ABJC 2R042 3JD71 4BCUA 1WCDJ 1RUI2 1RUD3 1V9U3 1TMF2 1C8M1 5C9AA 1K5MB 4N43C 5FMOL 4YVSA 4Q4X2 1TME1 1QQP1 1EAH3 1AL23 4EJRA 1R1A3 5AC93 1ZBA2 1FMD3 1R083 4NWWA 5K0UA 3JBG1 4IV1C 1R093 4IV1B 5C4WC 5C4WB 4RQPC 4RQPB 1RUG1 5L7OC 5L7OB 1QJY3 5C9AC 5C9AB 2WWSA 1QJU3 4YVSB 5BNPA 1AR91 1COV1 1Z7S3 4FTSA 5J96B 2ZTNA 5FOJB 5K0UC 4LLFA 5K0UB 1BBT1 3JD72 1FOD1 2R061 1VBB1 1AYM1 2HWC3 1OOPC 1OOPB 2HWD1 3VBFA 1C8M2 2RS31 1CJDA 1PIV1 1TME2 1QQP2 1AR71 4Q4W3 4YVWA 4FTEA 1AL0G 4GB31 3VBOC 3NAPC 3NAPB 2WFF1 1RUG2 4CDXC 5ACA1 3VBFB 3JBG3 5C8CC 4JGZC 1VBD1 1AR92 1COV2 1GFF2 4Q4V3 1HXS1 5DDJ3 2WZR2 4YVWB 1ND3C 1HX6A 1BBT2 1FOD2 2R062 5A33A 1VBB2 1AYM2 3ZFFA 1RMU1 3VBHA 1MEC1 2HWD2 1RUE1 1ZBE1 2RS33 1PIV3 4PDWA 4QPGA 5A33B 4CDWC 4CDWB 4CDQC 1RUH1 4GB32 3ZFFB 1AR73 3VBRC 1NCQC 5CFDB 5CFDC 5ACA2 5BNOC 1RUF3 2RS11 2WFF3 4JGYC 1VBD2 1NOVA 1RUC1 1HXS2 1TMF1 4PDWB 4QPGB 5BNNA 1AR61 2GH8A 1C8NA 1VBA2 3S6PA 2MEV2 2R072 4Y4YA 1RMU3 1RUE2 1MEC3 4QPIC 4RS5A 1B35A 1ZBE2 1FPN3 4CEWA 4CDUA 1ASJ3 2GSYA 1RUH3 1RB8G 3LOBA 2RS12 2HWB1 4RS5B 1B35C 1B35B 2R043 1RUC2 1RUI3 1K5MC 4CEWB 4CEWC 1AR62 1TMF3 1H8TA 4Q4Y2 2RMU1 3HAGA 4Q4X3 1CD3G 1ZBA3 1VB2A 2BFUL 2HWE1 1AR82 1RHI1 1ND2A 4NWVA 4YVSC 1H8TC 1EV11 1H8TB 3TN92 2WZR1 1MQTA 2RS51 2BUKA 2Y26A 3J8F1 3VDDA 2HWB2 3JB8A 3JD73 1OHFA 2WS92 4RHV1 4GH4A 5BNPC 5BNPB 1NA1A 3FBMA 3VBUA 1F2NA 1C8M3 1MQTB 2RMU2 1HRI1 1TME3 1PO21 1QQP3 3VDDB 3IDEA 3CJIA 2RM21 3VBFC 2HWE2 1RHI2 1BEV1 5JZGA 1RUG3 1D4M1 1VBC2 2XBO1 1EV12 1BMV1 4GMP0 1RHI3 1X33A 4RR3A 1PVC1 1NCRA 4YVWC 1F8VA 1POV0 2HWF2 1VBA1 1AR93 1COV3 2RS52 3M8LA 3CJIB 2WZR3 2MEV1 3J8F2 4WM8A 2R071 1QJX1 1RVF1 1BBT3 1FOD3 2R063 5JZGB 4RHV2 1VBB3 1AYM3 4Z92B 1PO12 1OPOA 2HWD3 2X5IA 1NCRB 1VRH1 3JB4C 3ZFEA 1HRI2 4N53A 2XPJA 1PO22 1VBE1 3ZFFC 3VBHC 3VBHB 4FTBA 4WM8B 2RM22 4GMP1 4GB33 2ZZQA 1BEV2 1AYN2 2PLV2 1POV1 1D4M2 1HRV2 2XBO2 5ACA3 1BMV2 1PVC2 1NG0A 4PDWC 4QPGC 3ZFEB 3VBSA 2RR12 1D4M3 1VBD3 4N53B 1HXS3 1NY71 4Q4Y1 1VBA3 1QJX2 1RVF2 1RUJ2 2MEV3 1RUD1 5D8AA 2DF7A 2R073 3ZFGA 1AR81 5BNNC 5BNNB 5A32A 3VBSC 3VBSB 1VRH2 1RUE3 3TN91 3DPRA 1VBE2 1ZBE3 1AL21 5AC91 1R1A1 5CFCA 5ABJA 4RS5C 1QJY1 4GMP3 5A32B 2RS13 2WS91 1X36A 3DPRC 3DPRB 1VAKA 1RUC3 1NY72 4CDUC 4CDUB 1AR63 4N43A 1RUD2 1V9U2 2WLPA 4Q4Y3 5LK7B 4SBVA 5ABJB 4IV1A 5C4WA 4RQPA 1VBC1 5L7OA 1AR83 1EAH2 1AL22 5AC92 1R1A2 4N43B 4Q4W1 1FMD2 1R082 2HWF1 3TN93 1R092 1W39A 1PGL2 1ND2C 1ND2B 1QJY2 1QJU2 2VQ0A 2HWB3 1OOPA 1PO11 1Z7S2 1VB4A 4Q4V1 5DDJ1 2WS93 1MQTC 2FZ2A 3VDDC 2HWC2 2RMU3 5GKAC 3VBOA 3NAPA 4GH4B 4GH4C 1AYN1 2PLV1 4CDXA 1NA1C 1NA1B 3VBUB 3VBUC 1HRV1 4RFT0 5C8CA 2HWE3 4Q4W2 2RR11 1VBC3 4JGZA 1EV13 2TBVA 1E57A 1QJZA 2BPA2 3CJIC 1ND3A 2HWF3 3JBG2 2RS53 3VBOB 1RUF1 1RUJ1 5JZGC 4CDXB 3J8F3 5C8CB 4RR3C 4RR3B 4Q4V2 5DDJ2 1NCRC 1AUYA 4RHV3 4JGZB 1PO13 4AEDA 1ND3B 4WM8C 1HRI3 1IHMA 3ZXAC 1PO23 4CDWA 4CDQA 3VBRA 1NCQA 2RM23 5CFDA 1M06G 2QQPA 2X5IC 2X5IB 5BNOA 2RS32 1PIV2 1BEV3 1AYN3 2PLV3 3ZFEC 5FMOS 4JGYA 1FPN1 4IV3A 4N53C 1HRV3 2XBO3 1PGW1 4AEDB 4AEDC 4FSJA 1PVC3 1AR72 1ASJ1 2RR13 5J98B 2BBVA 4WM7A 4CDQB 1RUF2 2FZ1A 3VBRB 2WFF2 1NCQB 1V9U1 4Y5Z0 2R041 5BNOB 1QJX3 1RVF3 2BFUS 1A6CA 1DDLA 1RUJ3 1RUI1 2IZWA 4IV3C 4IV3B 4JGYB 4QPIA 1EAH1 1VRH3 4WM7C 4WM7B 4Q4X1 1FMD1 1HQNA 1R081 1R091 1VBE3 4CEYA 5D8AC 5D8AB 1RMU2 1MEC2 1SMVA 1ZBA1 3ZFGC 3ZFGB 1PGL1 2ZAHA 1QJU1 1POV3 4QPIB 1FPN2 1PGW2 1Z7S1 1ASJ2 1K5MA 5CFCC 5CFCB 1RUH2 4CEYC 4CEYB
chains in the Genus database with same CATH superfamily
3CZUA 4OHXA 3ROUA 2EAKA 2R042 1WCDJ 4S2GA 4XVHA 3JQWA 4QHZA 4QKNA 2EXJA 1V9U3 5HI0A 3B3QE 5LY1A 4AL9A 2ZX0A 1XNCA 1LHVA 3CNAA 3GBFA 1K5MB 4N43C 4Q0PA 1FNYA 1MZEA 2G1MA 5C9AA 3KT4A 3AZVA 4Q4X2 3EBRA 1QQP1 3H3LA 1EAH3 2VZPA 3RSJA 4EJRA 5A1AA 3LF7A 5C8WA 3SITA 1R083 2EAAA 4R9DA 4E4SA 1LCLA 5T3NA 4FP2A 2P3JA 5EJZB 2OKXA 4CP1A 4ZZ5A 3K75B 3BPZA 3P3NA 1UMZA 5C9AC 1S1AA 3KV6A 2B9VA 2QDNA 3TNPB 4YVSB 2C9AA 1UY2A 1YXWA 3TYJA 5BNPA 1PM4A 1JYXA 5F2SA 2RJKA 4INDA 1Z7S3 4M01A 5JMOA 2FDKA 4NVPA 1XYPA 4HXCA 5J96B 2ZTNA 3I2IA 4PF5A 5FYCA 5K0UB 4LLFA 5GZFA 4PHZA 1BBT1 1ENQA 4QU2A 1YCIA 1G6NA 3FZ3A 3N7JA 1KEXA 2VMIA 2HWC3 4AI1A 5I0TA 1QOTA 4XUOA 5JMCA 1OOPB 3WDUA 4FPEA 2XL9A 5F2WA 2XUEA 3MF9A 1C8M2 3SEEA 1XNAA 1JZ4A 4GWMA 2ENRA 2WZEA 3ES4A 4QX2A 5A3LA 1W6OA 4MHUA 4Y1XA 1D4VB 2IFWA 1S55A 4OFGA 3CHXA 4YVWA 4HKLA 2VVEA 4J1XA 4JTNA 1JYWA 1UPSA 2WFPA 5BNQA 1QIQA 4GD4A 4WVMA 4XE9A 3VBOC 4XXAA 3WSOA 1REFA 2DBNA 5LA9A 5EPAA 2D6KA 4CDXC 5JR2A 1H2KA 1U5YA 4D8MA 3A21A 5ACA1 5D2AA 3VBFB 4YPJA 1JU4A 4D3WA 2EXKA 3FX3A 1QKQA 2Y34A 4KU8A 1Q5OA 1GWLA 1VBD1 1WA4A 1COV2 5CU1A 5H9PA 1Y43B 1IPKA 1GFF2 4UW3A 1OI6A 1JOBA 2JD9A 4L92A 1DGWA 1HXS1 4Y1VA 5F3IA 3THCA 5IFPA 3MW4A 1J58A 5K8SA 2ZGMA 3H1MA 3RGBA 2VBBA 3GDBA 2JG9A 3DGTA 4FPHA 2XVLA 4Q0QA 4BE3A 1AYM2 3ZX7A 3PVEA 4M0NA 1RMU1 1UX7A 4Q5OA 4DB5A 1OUSA 5FK7A 5F3CA 5CVRA 2AR6A 3WQ7A 4KI5M 5GZDA 1DQ2A 3IM0A 2WQZC 1GYKA 3I3DA 4DQAA 1ZBE1 1W9SA 5DUWA 1PIV3 4HVRA 4YG3A 5F1RA 3LEGA 5KWRA 4L8QA 4LBKA 3A22A 5FWJA 1RUH1 3E5XA 2EXIA 2Q8OA 2ZKNA 3ZFFB 1UPIA 4BJ0A 1WW4A 2XWBB 4YGBA 4PF1A 1CAWB 2ZHNA 3A4UA 5BNOC 3E6CC 1RUF3 4FFFA 2OYZA 5LW9A 4C90A 3WHUA 1DZRA 3RZKA 3BN6A 1ZA4A 4DNYA 1J3RA 4XIOA 3LIGA 1W8FA 4XFBA 2ES3A 2NZ9A 4DUVA 2F6BA 3S6PA 3SNMA 3O12A 3D8CA 3NVCA 1N1VA 4NO4A 2JDMA 4AVTA 1W8WA 2CYFA 3PNAA 4OCTA 4YZ3A 4HKOA 2R072 5T54A 1I1EA 1LAJA 4JQRA 2H6BA 2XOMA 3J26N 4BB3A 1CESA 1GZWA 1RUE2 3OYWB 4QPIC 2I74A 5ISLA 2VM9A 4G4FA 4MXVA 5HV4A 1ZM1A 1ZYBA 3HEIA 1RL3A 2ARXA 3KF5A 5APAA 2G4IA 4R9AA 1SLBA 2Q8CA 1QF3A 4CU7A 2PHDA 1DGLA 5FZDA 1UD1A 4CEWA 1UYPA 3QACA 3T3YA 5CBLA 2P17A 4CDUA 1I3HA 2A71A 3KCCA 4UFMA 5J48A 2EICA 5F32A 4CTEA 1JZ2A 2QTWB 5T55A 1NYWA 2VMFA 1RB8G 2EIDA 3U10A 1GU3A 5K9YA 4RS5B 1N47A 2R043 2JE8A 1OD3A 4D7YA 1KRIA 1RUC2 5FKCA 5FWEA 3RS6A 4AI2A 1YHFA 2VZSA 1C3HA 4OUEA 4NIIA 4FPKA 4CEWC 3MW2A 5FDBA 2D6MA 1DYPA 3ABZA 5JUVA 1SQ4A 4NE9A 2ZGPA 2GN7A 4TLFA 1W99A 2YGLA 5B2GB 3WLUA 2CHHA 4Q4X3 1GV9A 5GJ6A 1CD3G 1Y9MA 4ZONA 4QGLA 1SZBA 1HJGA 4EWEA 4FPGA 4TLGA 2ADDA 3ZYIB 5JIUA 1GOGA 1A78A 4IGOA 1AXZA 1YQ8A 4OHWA 4XYXA 3H7YA 5H9SA 1RHI1 4B7KA 2VBPA 3VD7A 1GLHA 2LW8A 4NWVA 3TEZA 1GOFA 4GAZA 1FAYA 1V6MA 5IK7A 1ZZ8A 3Q8EA 3JCIA 3WQ0A 4COYA 4P9XA 5FZIA 1MS0A 5LK5A 4I01A 2P34A 4JV4A 5DG1A 1OKQA 5A3TA 3MUY1 4QXBA 5FZ0A 3VD4A 3NSTA 4K40A 4L97A 5FP3A 2ZHMA 5LA1A 1OHFA 2CGOA 1UZYA 4DO0A 2B4KA 2O8OA 4IW3A 4EN7B 4GH4A 5BNPB 1JW6A 5IJRA 5A3WA 2KD7A 3VBUA 1TZOA 1V6LA 1F2NA 3ECQA 1C8M3 1MQTB 4QXKA 4JKLA 1JZ6A 2NPIA 1PO21 2VAUA 1UXZA 3CBNA 2PFWA 4EZ4A 3LKJA 3VDDB 4LR4A 1D7PM 5LRRA 1JI6A 4D0QA 3PMEA 3KHCA 2VE1A 5FIXA 3D0JA 1JHNA 5JZGA 2XONA 4NHLA 3OUHA 2FMDA 1W04A 1W6OB 1EV12 3P3PA 1XNDA 2XHKA 4KWJA 1PVC1 1NCRA 2HWF2 2K9ZA 1COV3 2RS52 4UW6A 4WVMB 3DECA 4MVTA 1UZZA 3NKGA 1KDMA 5EJ1B 2ERFA 3CJIB 4LA2A 3J8F2 3JXSA 4OLLA 3VD5A 1JODA 1TEIA 3U4SA 1RVF1 2JDHA 4R8HA 2DUPA 3M4FA 4C0HA 3AM2A 2TUNA 1AYM3 4I0WB 1J3QA 4EQVA 3LGRA 3FHAA 1HDKA 2A70A 2A6WA 1YEWA 3WG3A 3M1HA 1GZ9A 1OLMA 2DTWA 4Q1PA 1WCUA 3ZFEA 2GMEA 5K4LA 1M4WA 4B29A 1NLRA 3GNEA 3VBHC 1G9FA 2RM22 2ZGUA 4BQYA 1ODNA 2CDOA 2UWAA 3HWJA 4B7EA 2ZZQA 1H6XA 4NHXA 2J1VA 5DZEA 4BLIA 2V73A 4H7MA 2V5YA 1SCRA 2XBO2 1G8WA 4A44A 4ZZ8A 1LESA 3Q8FA 2JICA 4P9GA 1NG0A 4QPGC 2GMMA 4OQ8A 4KG0A 2JB8A 3MIEA 4QM8A 2MNGA 4KG8A 3FHIB 2WNVA 4I2OA 2Q0AA 2QQNA 4Q4Y1 4UF0A 3J7HA 2JDKA 5FZHA 4DPNA 4XETA 5I0RA 1S0EA 2RVAA 3OTFA 3ZN6B 4W65A 3MF6A 3RQ0A 2EF6A 3MLKA 2VNRA 2A3YA 2R073 1EUTA 2XMLA 4LULA 3PMSA 4FCAA 3ZSLA 4CP9A 1O5LA 2GALA 3NNGA 2XLAA 3VBSB 1W6NB 1VRH2 1RUE3 2OA2A 5E16A 2WQ8A 3TN91 2WNVC 5FZEA 1VBE2 2RHPA 3P6BA 3V0AA 3K4AA 3I8TA 4KBBA 1XE8A 4KL1A 4NMIA 2HEYF 5CFCA 4ES8A 3WNPA 5EJ3A 4FPJA 1GZWB 2EIEA 4K21A 3ETPA 1K5JA 1LOGA 5ABJA 4QKFA 2XHNA 2BNNA 2PHXA 4IEZA 5A32B 4IEUA 4YW3A 2WS91 1FT9A 4S2DA 1OQDA 3NWKA 3I3QA 5LATA 1X36A 3DPRB 4UFJA 2DTYA 3POWA 4J1WA 1RUC3 1NY72 1WW5A 1ZZCA 2BNOA 4IEYA 4A6OA 3BI3A 4CDUB 4GULA 4S2FA 4XQDA 4KGGA 4YM3A 1W6QA 2QKDA 3AFGA 2DWRA 3HT1A 3BALA 1B09A 4MGSA 2UU8A 3ZVXA 4MUVA 3I3MA 5A7WA 5FZMA 3AVSA 1EPZA 4O9GA 1POQA 4Q1RA 5SV5A 1OVSA 1OSGA 4HONA 5C4WA 4JKKA 3WW3A 4XIKA 4CZSA 4QDQA 4YGEA 4R4ZA 1HIXA 1R1A2 5C6CA 1AHSA 2AZ5A 5GZCA 4KBZA 5GLTA 4PIXA 1ULCA 3H9AA 5M0TA 4QT6A 2V4AA 5FMBA 3LEMA 1PGL2 4IE5A 1KJRA 4FXKB 3I2HA 4R52A 1QJU2 1W8NA 4UYBA 1X82A 2WNOA 4CCOA 3RZGA 1J3PA 3T0DA 1UL9A 3N7LA 4IEPA 3C7HA 2LTNA 1LOFA 3U78A 1UF2C 4CCMA 5C7GA 1XXNA 3BOWA 3PVBB 3POGA 3K48A 2W3JA 3U75A 4Y33A 1GUIA 1PZ7A 1RITA 2Z4FA 4FOYA 4ARYA 5F6KA 1QWRA 4RA0A 3GZUC 3I2DA 4GH4B 1S0CA 4LBQA 2Q8EA 3VBUB 1QDOA 2P3IA 4NUBA 2VPVA 5I91A 2K0GA 3PUQA 4D7SA 2R1DA 1YQ5A 3RJRA 1J1TA 1ZRFA 4Q4W2 2JENA 4B1LA 4E4DX 4K1YA 2RR11 4MGYE 5K7PA 3MPPG 2BBAA 3ST7A 1EV13 3HBKA 3R6SA 4PIZA 2VZUA 2BW8A 3WP3A 1LHWA 2D6OX 3B00A 4HN1A 5I0SA 2HWF3 2RS53 2WBKA 1RUNA 3MO4A 1RUF1 4AW7A 1RUJ1 2SLIA 2ZMKA 3J8F3 3O1UA 3LPFA 2R1BA 1V6JA 3AL6A 4Y1UA 4CPBD 3ACGA 1J84A 1D0GA 1PNGA 4HN0A 2ET7A 4Q4V2 3SH3A 3UGFA 4JGZB 4MX3A 4Q26A 2ZGOA 2QQWA 3OG2A 3BKZA 2D6PA 4PLMA 4AFAA 3RZZA 5FQ0B 1JZ7A 4WM8C 4BQ2A 3IAQA 4XTMA 5I0UA 1W9WA 1ENSA 1SPPB 1CX1A 1W9TA 4ARXA 4CDWA 2JIJA 5FUPA 4CDQA 5DMYA 3PVNA 4GJZA 3VBRA 3CZJA 2RM23 2ARCA 5GLVA 4NIAA 5I8TA 4MGKE 5FZ4A 1BXHA 2BDRA 3H42B 5T50A 3WF4A 5JI9A 1W6MB 5ANNA 3THDA 4MLOA 1VAVA 2VU9A 4JGYA 1KQRA 4JCKA 4N53C 2XBO3 2UWBA 4LITA 3SMHA 2JEMA 3WNXA 3WP6A 4YW1A 1AR72 3PTYA 5BYNA 2VZTA 5IVCA 1GMMA 3J9SA 1HJFA 4NPRA 3NV3A 4EYUA 2VUAA 5FP8A 2FZ1A 2ZA9A 1LOEA 5CB7A 2PQQA 2UYAA 1SFNA 2R041 2CY6A 2XWJB 1V6OA 2JE9A 2RJLA 4NHMA 5ERLA 1DDLA 2IZWA 5LA0A 4WV8A 4LPLA 4IV3B 4GALA 5JXJA 1G9CA 1S2KA 2IWGB 1YYNA 5HXVA 3ZO0B 5T5LA 1NZIA 4UFIA 3N35A 3ZM8A 1VRH3 4N7UA 4Q4X1 1CPMA 3WZ1A 1DU3D 1R091 3JU9A 1VBE3 4HBNA 5CADA 2UURA 1MEC2 2P4EA 3PIJA 1PK6A 4AR2A 1XPWA 4EN0A 1TQ5A 1I5ZA 5T5PA 4IEQA 2ZAHA 3N9LA 4M3CB 5CNAA 3TNQA 4CP9B 1O4TA 2WNEA 1LGBA 1X9PA 4KWKA 1CJPA 1UOBA 1FPN2 3B93A 3OEAA 4E2GA 1UKRA 4V2WA 1K12A 5FZ3A 1ASJ2 1K5MA 2Q1FA 5CFCB 3IZOA 2BU9A 2JKBA 2O0OA 2WNUA 4P5HA 3B01A 5C70A 4FBFA 2YZ4A 1NAEA 4XF3A 1NLQA 4FAGA 1YI7A 5LBFA 4BCUA 4W4ZA 3ZIXA 4XABA 4Z82A 2VCBA 1KGYA 1UOFA 5G04L 3WV6A 3HQRA 4M3CE 1JMUB 2VMCA 5FO7B 1C8M1 3ZPYA 2VNVA 5JXHA 5FMOL 4YVSA 2I45A 4JTOA 4IE7A 2Y38A 1W0PA 1OUXA 1JH5A 4XTPA 3POBA 2WR9A 1QGLA 4ASKA 1R1A3 5FO9B 5FY9A 4K20A 2O14A 4PI2A 4UFKA 3AXDA 4J6GA 5L9VA 4FPCA 2Y6FA 4NWWA 3JBG1 1SFPA 5K0UA 1PM7A 4YRDA 3VLBB 3IB3A 1DQ0A 5C4WB 5L9RA 1OFNA 4I30A 5DXDA 2XGXA 3N3HA 5IVFA 4FFHA 1MPXA 2OUHA 3GCWA 4P00B 5SV8A 1QJU3 5E6HA 2Z69A 2WA3A 4PIYA 5C5TA 5KXDA 1COV1 5FYHA 4YM2A 4XBLA 5FY5A 4Z2WA 1QXRA 2A6XA 1F4AA 1JUHA 5A3PA 1KFUL 5FYTA 1HB3A 1UWWA 5FOJB 5K0UC 2ZGSA 3VD9A 1UXXX 2D93A 4AVBA 4BU2A 3TEWA 1AYM1 3H7JA 2ID4A 5F5CA 1JZ8A 1OOPC 1HV0A 3KB5A 3VBFA 5DUUA 2JG8B 1PVXA 2RS31 1CJDA 4OZXA 3EYPA 5ANQA 4XFCA 2AENA 2WC2A 4Q4W3 2FBEA 2WZ8A 4TWTA 1A8DA 1IOAA 3ELNA 2WFF1 1RUG2 3I2OA 1JYNA 1IS6A 4IEOA 1CR7A 1OH3A 5C8CC 5FXWA 3WP4A 1LODA 4WVZA 3IN9A 1GSLA 3PHMA 4A4AA 2DVBA 2HJIA 4H55A 1ZNPA 2D97A 2ATFA 4Q4V3 1CAUA 2WZR2 1DZQA 1YNAA 2QQJA 2DCTA 1BQPA 1ND3C 2VR4A 1JU3A 3GF6A 1HX6A 2ZOEB 3AMHA 4RFRB 5FY0A 1XYOA 4B8EA 3TOJA 4LHNA 4CXYA 1F5JA 3C8XA 3S5QA 3ZFFA 4BA6A 2FDGA 1W2NA 4NIGA 2XKPA 1CIWA 3S7EA 4XUQA 3CJXA 4A3XA 2GNTA 1CAWA 1YUDA 2QUOA 2VMHA 3KM5A 3WINE 4BIOA 1DFQA 4XFFA 2Z2SB 1RUE1 3AP6A 4L99A 3WF0A 4BK5A 4EROA 5HCHA 2DBIA 3ZMOA 4B4QA 4XUNA 3WDXA 2A3WA 4QGNA 1QEXA 3DXTA 3HBZA 4CUAA 5IK5A 2WN2A 1PZ9A 5FRAA 5KC6A 5E8AA 4NR1A 3GYDA 4CDWB 5A33B 1AR73 3ZXJA 1NT0A 5DAVA 1NCQC 2WO7A 1WUVA 5JVVA 3ZXLA 1XQNA 1LGCA 1WMFA 1MR5A 2VZ1A 3F2ZA 2D6LX 1YFUA 5FZLA 1G86A 4CUBA 5IAXA 3AK0A 5GLZA 1RUOA 4Q0SA 3OYWA 2XJQA 4KWUA 2BNMA 1NOVA 4YM1A 3UT0A 5EWSA 1RUC1 1TMF1 5FREA 3J4UH 4XDQA 2DVFA 4PDWB 5FYZA 5BNNA 1N1TA 1VP6A 5KBFA 2J1TA 1VBA2 1SHWB 2WYSA 1G7YA 1SG3A 1UAIA 3H3ZA 1N3QA 1YIPA 4JC1A 4NRQA 4QM9A 1DYKA 4QX3A 3AP4A 1W8UA 1H1AA 4CSWA 4O61A 1BVVA 2QQKA 1K45A 5JCTA 3POYA 1GP5A 1KJLA 2V4VA 1K3IA 3VZKA 1JYIA 2VG9A 1EP0A 1W06A 3U4XA 2EIGA 1HLCA 1MEC3 4MXWB 2GP3A 2W91A 3JQXA 4UBHA 3WR0A 5C3SA 3ES1A 3I4IA 4Z2AA 4AK3A 4RS5A 3T4VA 4UXAA 2X53S 2DV9A 3NNFA 3RG0A 4PQQA 5GLWA 2LROA 1FPN3 3SCHA 3KLSA 1NZCA 1HV1A 4IESA 4XOGA 3I7DA 3RJ2X 4ISQA 2A5ZA 3WF2A 1ASJ3 1MZ6A 2DU1A 3LFMA 4OI4A 1VMFA 5IFTA 5JDBA 2CAUA 4OHYA 1W2AX 2JD4A 2OX0A 2RS12 2Y6KA 5HXMA 1A8MA 4K6BA 3RVHA 4OUSA 4FAHA 1E5RA 4B3NA 4AQ2A 1LHNA 1JN2P 1B35B 2ILMA 5HCFA 3VKLA 3RWNA 1REDA 2VMDA 2WNUB 3BIEA 4C91A 2B9UA 4EV0A 3AVRA 3LIHA 1OLQA 3MUZ1 4UW5A 5EXOA 5F37A 4LT5A 1V00A 3B02A 4XJUA 2D3SA 3ZXEA 2ZX1A 3VN4A 1UOJA 1H4HA 3RNSA 5F5IA 5C3QA 1GNHA 4NAOA 2VTXA 4FPLA 1WZXA 1OKOA 4BWOA 3NV1A 1NE4A 3O1RA 4QXCA 3WDTA 1EV11 3L2HA 4YZ4A 3OGGA 5CEHA 1O3SA 5H9QA 1P8JA 4A41A 4XZPA 1MQTA 1V0AA 3LD8A 2VL4A 2RS51 4NIHA 4LJHA 1BCXA 3J8F1 3V64A 3VDDA 1WLTA 2B39A 2HWB2 3D6EA 3W58A 1KXGA 3JB8A 1MS3A 2JDUA 3ON7A 5FYUA 1VIWB 4QX1A 1O4ZA 3B5LB 3HOBA 3SEPA 1OURA 2WABA 4LO6B 1N3OA 1S0IA 3OB8A 5BNPC 1ULGA 5BV6A 3E6DA 3POFA 5EFUA 2FCUA 3N9NA 4MGTA 2RMU2 3QH7A 1IS3A 3K46A 3MIBA 1W3VA 1CQ9A 4MSVA 5EZWA 4NN0A 3CMGA 2JJ6A 4XHXA 3WW4A 4CU8A 2MPFA 3CJIA 3I59B 2ZS6B 1U5XA 1S2BA 1ST8A 2O8QA 2RM21 3OY8B 3RZMA 4ZKTB 3ZR6A 2HWE2 2PXJA 1Q8OA 5F39A 5IT6A 2G9FA 2JDNA 2VNOA 1RUG3 5IWFA 1CVNA 1JZ5A 1W0NA 2XBO1 4QDSA 1ZZBA 3KD4A 2Q30A 4GMP0 1X33A 3KF3A 5KHIA 3LFIA 4I3GA 4YVWC 3RRDA 4AG4A 1ZRCA 4YW4A 3GZAA 1JYVA 2DYCA 2MEV1 2WZR3 1QH6A 4JX0A 3ENRA 4KH9A 5AVAA 1BZWA 3KZ4C 4RHV2 1SFYA 3FLPA 4L2NA 1PO12 1QXPA 1GBGA 1W6PB 4XDPA 5T5JA 1CAUB 3CU7A 5A6QA 4S2HA 4BOWA 3LEKA 2X10A 4IE4A 1VRH1 3QBQA 2IXHA 5LBEA 2RDQA 4MGQA 2GC3A 2JG9C 1VBE1 3POSA 1WBLA 3I2GA 3W9AA 2Y6JA 2VZOA 2BOJA 4F3JA 4TZDA 1FNZA 3J7MA 5CZKA 4GMP1 3MI8A 3ZN6A 4BQWA 5EIYB 4QX0A 4A2UA 1RJ7A 1AYN2 5HBAA 1HQWA 4PCRA 4XURA 2W9XA 2C6SA 1HRV2 4IQPA 4OUMA 2ZMLA 2Y60A 1BMV2 2WN3A 5JSOA 2FD8A 1HN0A 3UESA 4GZ9A 2WLQA 2W1QA 2VNGA 5FMDA 1ZZ6A 1L7RA 1W6NA 4G3YC 1D4M3 1U0AA 1XOYA 2VUDA 3H3UA 5DAQA 3VBSA 1LB2A 1WMXA 3KT7A 4AGVA 3OCPA 1NY71 3KS7A 3LZZA 5CIRA 2Y8KA 4YZ5A 1CIYA 3MIDA 2YPDA 4LHKA 1HN1A 1VBA3 5DABA 3VL9A 5FTTC 4AXOA 1QJX2 2VW2A 4E27A 2NQYA 1OT5A 4CUCA 4YFZA 3NL1A 3LE0A 3NNLA 4NPMA 5D8AA 3T1LA 2VOTA 4PLNA 3VZOA 2DF7A 5D1IA 5FZ7A 3FUOA 4Q27A 3VDAA 1W2TA 3ZFGA 1AR81 5BNNB 5A32A 3VBSC 4YLZA 5KHJA 4MOAA 5JI7A 2VMEA 2VY0A 3DPRA 3I97A 2VC9A 3L9JT 3VHRA 4AQSA 1R1A1 3GZTB 2WT0A 4QPYA 1NX9A 4HL0A 2VQTA 5BY5A 3PUIA 1XJAA 5DG2A 3VUOA 3WG4A 1YQ2A 3POJA 4RYDA 4DMIA 1JHJA 4I02A 1WKYA 2R0HA 1RJ8A 2RS13 4QMAA 3LCPA 5F7UA 3MYXA 3BVCA 4AEKA 3DPRC 2W68A 3NQHA 2F4LA 3IMNA 4CCLA 4GIQA 2MHFA 5FK8A 3TRSB 4CDUC 5FPAA 3IT8A 4Y24A 2ARAA 2NMNA 3AXEA 4PLOA 2XQXA 5LCWL 3LWCA 3S0MA 3HN1A 1RUD2 4RGKA 3OUJA 5LK7B 4SBVA 2GAUA 3VKFC 2QCSB 4QB1A 5LY2A 4AZZA 3FMGA 4R9CA 5EQUA 2GH2A 4IV1A 4CP0A 5KXBA 2WAAA 3B9IA 4RL7A 3WX5A 4RQPA 2VOWA 3GJAA 4MO3M 4LEJA 1VBC1 5B4XA 5L7OA 2IXKA 2XJPA 1ODMA 3ZOIA 2YU2A 1AL22 2OUJA 5JAXA 5AC92 3U0ZA 2Q4SA 4N43B 4Q4W1 3VHPA 1FMD2 3OGJA 3SISA 3SKJE 3ZMNA 2HYKA 4QKBA 3DYOA 5KHHA 3WNLA 3E1F1 5JOZA 3UKVA 2PHFA 2VOKA 1NUKA 5JIAA 3INAA 1QJY2 3AJZA 2IXCA 4FFIA 4QHBA 3T2OA 1TE1B 3MHZA 4E4HA 3O1TA 2HWB3 1LULA 1UYXA 1HKDA 2JX9A 4J25A 1JOPA 4Q4V1 1VALA 2WWUA 4MHRA 2WO3A 4FQ4A 4U36A 1Q8QA 5C33A 5GALA 3T2TA 4QXHA 1QY4A 4RN5A 1I6XA 3CF6E 2QQIA 3I3EA 4TSVA 3K4DA 1FX5A 2P1BA 4M3CF 4IL7A 4A7KA 1JXNA 2RMU3 1CAXB 4D6QA 2IUWA 2P3YA 4XAAA 1LECA 5FYVA 4JDNA 1JYTA 4YW6A 4H3WA 3NAPA 1O91A 1OFSA 2ZABA 4GH4C 2PLV1 3LPGA 1JZ3A 1IQDC 3VBUC 2HWE3 1AX0A 4UFLA 4UI9L 1UOGA 2Z79A 1XU2A 1L3JA 3OBRA 3EJKA 3M70A 1NE6A 4JGZA 4DXRA 2ZHLA 1ZX5A 1E57A 1WCSA 3BB6A 4CA9A 5DQ0A 3BPSA 3LA7A 2BPA2 1RINA 1Q8PA 4CCJA 1OPMA 3Q8AA 5FQ0A 4K8RB 1SLIA 2W0XA 5FZ8A 3VBOB 1GR3A 4COWA 1SPPA 2RDSA 3UETA 5JZGC 1RXGA 3M3CA 1QH7A 3H0OA 4AFCA 4CDXB 2OZ6A 3GXUA 4LO7A 1A3KA 2JXAA 4XFHA 3WUCA 4YGCA 5DDJ2 1NCRC 1STMA 2XVGA 4QX8A 1UU5A 1IZ3A 1W6MA 4RHV3 2ZPXA 2QZ3A 4XFIA 1V70A 5J3UA 1PO13 2Y6GA 1XE0A 2BOIA 5CKQA 2VQUA 2XR4A 4QB2A 2HH9A 1LR5A 3O0VA 3THPA 2P2KA 3MIFA 1IHMA 1OA3A 1UU6A 3KQRA 4L0PA 3WNKA 4D7TA 2VW0A 2PYTA 4OHVA 2FQPA 1V6KA 1DYOA 5CFDA 1WA6X 3R0RA 3BTXA 1O6UA 1UNBA 4M4PA 2W46A 4AFMA 1AYN3 3ZFEC 1FPN1 4IV3A 1HRV3 1UIKA 1LEMA 2ORZA 2YGMA 3OPTA 2Q8DA 4DRRA 4LK7A 2PELA 4XEZA 2CNAA 3USSA 3ZYHA 5FZCA 1ASJ1 1RTVA 4ITCA 2BBVA 3LDRA 4JDOA 2J1RA 1SLLA 1PZ8A 1V9U1 4HPKB 4XXPA 4FOVA 2ZHKA 4Y5Z0 3SXWA 4AAXA 5A1LA 3ZR5A 4XILA 3I2FA 1QJX3 5BNOB 4M3CA 4IV3C 1GKBA 4QDRA 3ZSJA 1G9AA 4CCNA 4A3ZA 2Y6LA 2GNMA 2XVKA 2XG3A 1EAH1 2AYHA 4XCBA 2E7QA 4Y3OA 4D69A 3ZSKA 2VTXJ 1W9FA 3PLQA 2ZEXA 2XDVA 3E6BA 1HQNA 1R081 3HJRA 3WP5A 2HBUA 2R32A 1L7QA 1RMU2 5D8AB 3O1PA 2VULA 3MV01 4M0HA 1D2SA 3ZFGB 3N7MA 3T1MA 5F8PA 1XU1A 4OYUA 4LIUA 5A7NA 5BXXA 3RDIA 4QPIB 1EUUA 3KMHA 2EIBA 3MEPA 1PGW2 2OZJA 1Z7S1 2XXZA 4HVQA 3IDCB 1APNA 1ULOA 2ZGNA 5CFCC 3AKRA 1RUH2 4MZUA 4CEYB 1DGRN 1H6YA 5HV0A 5IVJA 3BTYA 1W3XA 2YU1A 1GNZA 2HWC1 5ABJC 2WT2A 1CAVB 3RZJA 5FY8A 1DQ1A 4AHWA 1RUD3 3IPVB 4M00A 3ZYRA 1E5IA 5FY4A 2XJVA 4IEXA 3ZKUA 3QOPA 1QDCA 1W8TA 3R4SA 4Z07A 3CKHA 3ZXGA 4BDVB 3B7MA 5FXXA 5FY7A 5F5AA 2FDIA 3AP5A 1LJ7A 3PJQA 5BUVA 4P02B 1AL23 3PUSA 4BZ4A 4URAA 5AC93 2V5DA 4ISRA 1FMD3 5G05L 4MG2A 3LA3A 1V6IA 2Y33A 4CVUA 4IV1B 4GJYA 1UYYA 2UWCA 2V09A 5C4WC 1YC61 5F3GA 1F9KA 2OW4A 3OGVA 4RQPB 1RUG1 5A3OA 2ORXA 2DCZA 4JKMA 5L7OB 3ZKYA 4A45A 2Y0IA 1QJY3 2JE7A 3CO2A 1Q8VA 4P9WA 1SDDB 2WWSA 3AP9A 2JG8A 2YY1A 1SLAA 4F7ZA 1X8EA 3O5SA 5JSRA 4ZU7A 3B9CA 5E89A 4ATFA 3T2PA 3BCWA 5FZOB 3FBYA 2WDBA 5H9RA 5A6ZA 1G9BA 3JD72 4YFWA 5A6XA 5CG8A 1YO8A 3KT1A 4UT5A 2QQMA 5A7SA 1QMJA 2PMWB 4XW3A 4IEVA 2ET1A 2JG8C 2E32A 5A3NA 3IAPA 1LOFC 3WG1A 1PIV1 4AVAA 4BXSV 3UJQA 3RFRA 1SEFA 1TME2 2E7TA 3ACLA 3MICA 5EHDA 2BVBA 5JOYA 5LZ6A 5GM0A 3AMMA 3UV9A 4F83A 4FTEA 1AZDA 3ORJA 5FXZA 2QQVA 1ZA7A 1W8OA 3S5AA 2X29A 4K7JA 1H8VA 4LA3A 1BHGA 3NAPB 4PBPA 5A3UA 1FYUA 3MPBA 1GANA 1C57A 4W6WA 4K8FA 2DURA 1SBFA 1S0BA 2W47A 1AR92 2WUHA 4QHOA 5DDJ3 2J1AA 1O5UA 2PHRA 2Q5TA 1CWPA 3K4ZA 2AEYA 1Q43A 2RDRA 2UY9A 1JYCA 3EO6A 3Q8CA 4OMDA 1FOD2 2R062 5A33A 4DRVA 1VBB2 4FPYA 5FLHA 4H2AA 3PDQA 5A80A 3O0WA 5FYYA 2GU9A 4IERA 2XJUA 2HWD2 3A23A 4NPLA 4NIDA 2KM2A 2IC1A 2LM3A 4LUKA 2DUOA 4O65A 5FZKA 4GWNA 4DUXA 1O7FA 1OVPA 4QQPA 5FFOC 4LKDA 4HSJA 4PDWA 4XF0A 2CGPA 4YGDA 2R0FA 4CDWC 4CDQC 2I07B 4GB32 3TEXA 3IBMA 4CUGA 4XPVA 3VBRC 4EZHA 3ZYBA 5CFDB 2ZX2A 5LBCA 4C1WA 2A6YA 4BQ1A 3AMQA 3WG2A 3AKTA 2E53A 2RS11 1UU4A 3C7EA 4UOJA 5FP7A 3URFA 5EYYA 3W20A 4JGYC 1WLWA 3O1OA 4MXWA 3OPWA 3FE5A 4QX7A 4QPGB 1HQLA 2D3PA 4ZXKA 2YDEA 4CCCA 1DIWA 1C8NA 1MVQA 1WW7A 1LHUA 2WO1A 1GOHA 1UZVA 2J42A 2N7GA 2BP6A 2ZKLA 2VCCA 2ZXQA 1DGWX 1DLCA 1UYZA 1YRZA 3D82A 1U5ZA 1CGPA 3M3IA 4XFAA 2WAOA 1VMJA 1IKPA 5JOXA 2UY8A 5FPLA 4CCDA 5HCAA 1TNRA 1RMU3 2J1EA 1RC6A 3ATGA 3O14A 4NHKA 4OQ9A 2PHUA 1B35A 3WHTA 4AE2A 2VXRA 1S0GA 1EY2A 3I49A 4W8JA 3AYAA 4NJ4A 2UYBA 3R4DB 1PK6C 1N1SA 5FZGA 2GSYA 2C24A 3RYRA 2HYXA 2WSUA 1PHMA 1RUH3 2SBAA 2J1UA 4DS0A 2BZDA 3T0BA 2HWB1 4CCKA 2ZAAA 3VV1A 3N7KA 3RI9A 4AI3A 1B35C 3M2MA 5LEKA 2FDFA 4MYEA 3CQOA 4G9SB 1K5MC 1AR62 4RSUA 1VLNA 5FZ9A 2WNUC 4JHTA 2ZGRA 1VRBA 2BGOA 1Y7BA 1KS4A 4JDMA 4Q4Y2 2GC1A 2RMU1 1XSQA 3HAGA 4R4XA 4YG0A 5FUNA 2Z42A 4CRQA 3LOIA 5LRSA 4FO9A 4BISA 5FPVA 2YXSA 1YWKA 1VB2A 2HWE1 2JDZA 2YYOA 1T2XA 1HB4A 1ND2A 3HQXA 2WO2A 1SBDA 4QU1A 1AXKA 4XDOA 4YVSC 2LALA 3Q8BA 1H8TB 3TN92 3AB0A 4AHXA 4IXLA 1GICA 4LK6A 1S2EA 3GCXA 4LHSA 3ZXKA 3MLLA 5IVYA 1IKQA 4HVOA 1DBNA 1XNTA 3WOGA 2BUKA 2AACA 4UW4A 4BM8A 1DQ5A 4QGMA 1ZREA 2Z5WA 2ZACA 3PVOA 3I59A 2K2SA 1ULPA 2YPJA 3JD73 3OY8A 2R6QA 2WS92 1X9TA 2OQ6A 4RHV1 4ASMB 3SLIA 3OGRA 2JDYA 2G19A 3FFZA 3WVJA 3VZLA 1NA1A 3FBMA 1DQ4A 2VZ3A 2PQSA 5IVEA 2OPWA 4FFGA 2JDPA 3LAGA 4P9IA 3VD3A 4COVA 1TME3 4YM0A 4E8DA 2DVDA 1WCQA 2OS2A 3IDEA 1CX4A 3RMXA 4V2VA 3WNOA 4CXWA 1DP0A 3VBFC 1MZFA 2FCVA 2CWSA 4R9BA 4TN7A 1W90A 4Y20A 5C3PA 1Y9GA 1ZZ9A 2W2IA 1RXFA 3DUIA 3LSEA 4PBOA 1J59A 3D4KA 4BMBA 3KQ4B 4NRPA 1BMV1 1W6PA 1RHI3 4RR3A 1TNFA 2R49A 1H2MA 3IWZA 3H1YA 1F8VA 2DU0A 3HR9A 1AR93 1ULFA 4BPZA 2FMYA 2RE9A 3M8LA 1XB9A 2XH6A 4A6SA 4YARA 1N3PA 2R071 1QJX1 2PN5A 1FOD3 4XUTA 2R063 1VBB3 3N9MA 1YJLA 4AWDA 4Y22B 2QQLA 1UIJA 4Z92B 2VO5A 1OPOA 2HWD3 2X5IA 4XFGA 4K9SA 4YW5A 2IXLA 3S57A 2W52A 3JB4C 3C7GA 4HG6B 2X05A 1HRI2 1H1IA 2ETEA 4QX5A 3OF1A 1JBCA 3G7DA 2GP5A 1UMHA 2ZEYA 1ONAA 3W59A 2FHRA 1PMJX 3KV4A 3ZFFC 4WM8B 3WDYA 3MV11 4ZS2A 2H0BA 3PL0A 4BIFA 3UKNA 4GB33 1ENXA 1BEV2 1W03A 2TEPA 4N9IA 1UKGA 1D4M2 5CISA 5CKMA 4QPWA 4XJZA 4WVWA 4XUPA 4YW2A 1UW8A 1JUIA 2GZWA 2RR12 3DF0A 4N53B 1W05A 3IDAA 5LBBA 3RZHA 3E5QA 5LASA 3BGAA 3GGLA 1PMHX 5LA2A 2R7EB 3DKWA 2VBDA 1OF4A 1RUJ2 3GM8A 3WNNA 1RUD1 2AGSA 2VUCA 1EPWA 1WD3A 3D0SA 1W2UA 4CYDA 3I3BA 2GNDA 5FYIA 3K51A 5BNNC 2A1XA 4XJWA 3UK9A 1UZ0A 3OBTA 2NP0A 1ZRDA 3HMYA 4W6XA 2WINB 3A0NA 3OD4A 4GA9A 5L36A 4HT1T 4KU7A 1AL21 5AC91 1H9WA 4E9KA 2W08A 4CP2A 2YB7A 2C9KA 3DYMA 3TAYA 2W92A 1OA2A 1XC6A 3H1WA 2YG0A 1U12A 4GWIA 1O59A 2NLRA 4RS5C 3D5OA 3AP7A 1QJY1 3AZWA 5JR7B 2BV4A 3IMMA 4RGAA 3QD6A 2QQUA 3DKQA 4KGQA 1KD7A 1VAKA 2W95A 5FY1A 2DFCA 3ZXFA 2AUYA 4AEMA 3HPNA 2BEOA 3M3OA 3N4MA 1AR63 4N43A 3WDVA 1S4CA 2BYVE 2EALA 2DVGA 2A3XA 4M4RA 5CAZA 1CZSA 3M3QA 4FQZA 5IAVA 1LENA 4E4ZA 4Q4Y3 1FV3A 4LOTA 1REEA 4IGPA 4LKEA 2WQ4A 3MW3A 2A73B 1AXYA 3DV8A 4OZOA 4LBQD 3WD5A 5FCCA 5J1XA 4BH9A 2ZGKA 3ZYGA 3NJXA 4ATEA 2VMGA 4JHZA 4LMFA 3MIHA 2E7AA 2HWF1 4LBOA 1GWKA 1R092 3TN93 3A0KA 3OOXA 4BQ4A 4COZA 2V72A 2HBTA 3S7IA 3VHNA 5D21A 1Q3EA 2LRPA 2BQPA 1CAXA 3BIWE 1ND2B 1XE7A 2RDNA 3AJYA 3EMRA 5DDJ1 2W39A 2WS93 1H9PA 1MQTC 4YG6A 4A42A 5L19A 4LE4A 1AX1A 4FVVA 3QH6A 4L11A 3APBA 5HCBA 3WCSA 4MV2A 3H8OA 3J7NA 1Z78A 4OULA 3VDDC 2A7AA 3BU7A 3SKVA 4QKDA 2EXHA 3LEIA 5GKAC 3VBOA 5C3OA 3SC7X 5IVVA 1GNYA 3NKTA 3Q9OA 4CDXA 3OGSA 1NA1B 4HETA 4Y1YA 1Q8SA 5A6YA 2XKOA 4LO4B 3E5UA 4RFT0 5KXCA 3HQUA 4K3UA 2JECA 2VCMA 4DOUA 3C7FA 3SHRA 3VDBA 5FAXA 1Y9QA 3CJIC 5JLVA 1HB2A 5CG9A 2D6NA 3KGLA 4LKFA 3JBG2 3S30A 4LHLA 1LU1A 3ZPOA 4Y20B 1DF0A 4JQTA 1UY0A 1GQGA 2XJTA 3N9PA 4ZU5A 3OEBA 5KC5A 3AC0A 5C8CB 1MS4A 4XBQA 4RR3B 5I93A 1U5IA 4I0BA 1AUYA 4LOSA 4WZFA 3N36A 3HIFA 3ZSEA 4URTA 3UGHA 4AF9A 2XJSA 1VE0A 2DCKA 2E26A 3V0BB 3H8XA 3AYDA 4TYSA 3FLTA 5FLJA 3EB7A 4BK4A 1ND3B 5E88A 2E63A 1LGNA 2HKXA 4HZFA 2XLGA 4GWJA 4AFDA 1C5IA 1HRI3 3BU0A 2A6ZA 1QJFA 2IXJA 3NV4A 2QVSB 2VW1A 1CN1A 2VJXA 5T52A 3R05A 2VQAA 2WRAA 4HPKA 2ZZJA 1M06G 1UQXA 2X5IB 1BLZA 5FR3A 5BNOA 1WD4A 2RS32 3UKTA 1BEV3 3U07A 1V6NA 5IK8A 5FMOS 4ONUA 5FYBA 3DYPA 1PGW1 4AEDB 4OMCA 5HPOA 3ITQA 3SCGA 4FSJA 1SLTA 1H1MA 3ALQA 1D2QA 1LOCA 2RR13 5J98B 2GDFA 1X7NA 2W1WA 2WJSA 4QQHA 1GWMA 2WFF2 1NCQB 2W5FA 2ZJCA 4OVEA 4DZGA 3AMPA 4BMEA 3ZYPA 3GHMA 4CPBA 1K42A 1FATA 1XNKA 1XRUA 1MZ5A 4LIVA 1EYBA 1RUJ3 3NRUA 5DAXA 5FP4A 3K3NA 1IS4A 1BYHA 4QPIA 5CA6A 5A7QA 1US2A 1LKNA 3HT2A 3T2QA 2D44A 2DCJA 5DUXA 4WM7B 5I8SA 4X8NA 1VJ2A 2IFRA 4HOOA 4LXLA 1O8PA 2VECA 5D8AC 4ZU4A 3W21A 4CEYA 1T6BX 3KV9A 4DY5A 3ZFGC 1PGL1 1CAVA 1WW6A 3PIGA 4ZXEA 3LDKA 1QJU1 4LBNA 5FV3A 2KXLA 1POV3 3IPVA 4NOTA 1J83A 4K1ZA 1NXD1 4PJYA 4XJ8A 4U2AA 3KSCA 1O8SA 1VR3A 2VOXA 3KV5A 3KVAA 5FOBB 2VTFA 4P5YA 5FZFA 4O7XA 3JZVA 4FI9A 4CEYC 3K77A 2ZBJA 4OI2A 1SDWA 2X8KA 3FJSA 3BTAA 3JD71 3NJVA 4H14A 4UBGA 1MVEA 4XMAA 5FPUA 1RUI2 4AFBA 2YBSA 1LTEA 1VAMA 2IVJA 2D5HA 5DZFA 4DXZA 1W9YA 3I2JA 4B4RA 4O9EA 1FI2A 1TMF2 1E5SA 3G6JB 4EN8B 1NXMA 1QXJA 1SLCA 3OUIA 4C0BA 2DFBA 1TME1 1YJKA 2Q1MA 3PUAA 2BWAA 5KXEA 1BVP1 1ZBA2 1DQ6A 1H4GA 2J1SA 1D0HA 3M7AA 4QQ2A 5FZOA 2QFEA 3SH5A 3VHOA 3O1VA 3ILRA 4IV1C 1R093 4BQ5A 4AQTA 3FFQA 2DCYA 4RQPC 4UAPA 1XBFA 4BQXA 1C1LA 4C8DA 5F9TA 1YQ6A 2G9ZA 3T0AA 3ME2A 5L7OC 1DZTA 1QNYA 3ZXDA 5C9AB 2FCTA 4QWNA 1R64A 1AR91 1WLCA 2QZ2A 1UY1A 1R1ZA 2L9LA 3N9OA 4DFSA 3K3OA 3T08A 3VZJA 4QD2A 3W5NA 4FTSA 1Y4WA 3TWIA 4KQ7A 4DINB 2OPKA 3W5MA 2AH2A 2D43A 4EN6B 3WQ1A 1FOD1 3AL5A 2R061 3RZLA 3USUA 1GP4A 1VBB1 2I2SA 2TNFA 2OIIA 1LU2A 2QNKA 3H8UA 4N7IA 2HWD1 1KFXL 1IPJA 2JKXA 3AYCA 3ILFA 4LQRA 4F8AA 2J7MA 3LB9A 4FPOB 2BJSA 3POEA 1F31A 3THTA 1CPNA 3U14A 4LTAA 3ZLIA 3O1MA 1QQP2 3IDBB 2WT1A 4YZ2A 1AR71 1DCSA 3LSDA 4JAAA 4EE2A 3MGUA 1AL0G 3VKMA 4GB31 4LO5B 4L9BA 4PI0A 3RPQA 3NAPC 5FBZA 4NHYA 2P6HA 4CE8A 4HK8A 3JBG3 2P5BA 4BXFA 3DN7A 4IE6A 1X8MA 2FDJA 2NMOA 4XC9A 3POIA 4ZHNA 2YUEA 3MFCA 2WKKA 4JGZC 2OXBA 1QNWA 4COUA 2WA4A 1AF9A 1Z0HA 4IE0A 4YVWB 1WCKA 4JZRA 4IUGA 4H7LA 2H0VA 1IS5A 3IIAA 1PX4A 2PAKA 3U1XA 1BBT2 2YMZA 3CLPA 1UO9A 2C26A 1H30A 2ZEZA 4IDZA 5FXVA 4AYUA 3VBHA 1MEC1 4W50A 4A7ZA 3AMNA 5TSWA 4LE3A 4D6RA 1RYYA 2OQ7A 4XCAA 4LKSA 3FN9A 2IXIA 4XMIA 1E5HA 1WWYA 3F95A 5IHRA 4P9LA 3B94A 4FP3A 1OQ1A 2RS33 4QAWA 3MLJA 1UY4A 3AX4A 4AGRA 1IQAA 4QPGA 2JG9B 1GZTA 1O4YA 1UY3A 1ZRRA 2D98A 4PQ9A 5J09A 1Y3TA 2O1QA 5CFDC 4N90A 2QDRA 3TB0A 4DXTA 3O7OA 4ES9A 3D3AA 4AQ6A 4Z8BA 5ACA2 1YIFA 3BUCA 3WDWA 4XAEA 2YC0A 3OBZA 2WFF3 3H50A 1ZZ7A 1VBD2 1QJEA 5KHKA 3JUUA 3TEYA 5J37A 2R16A 1HXS2 2NYYA 4X6QB 4ZS3A 5FLIA 1AR61 2GH8A 2ZGTA 2BERA 3ZYFA 4NRMA 3GALA 4PT6A 4XF9A 1DG6A 3NJZA 3VZMA 1OH4A 1QHDA 2MEV2 3VDCA 5JOWA 4AVCA 4YNIA 4KNCA 3RYPA 1VMHA 2AEZA 3KCXA 3HNMA 2GC2A 4AEJA 1ULEA 1YQCA 4AGGA 4Y4YA 3VB9A 2PAEA 3MDPA 5FP9A 5FPZA 2CTVA 3MIGA 5CYYA 1KS5A 4AHYA 3ASIA 2WIIB 3T30A 1ZBE2 4GQ7A 2PA7A 4DUWA 2BTVC 5JPMB 4BHPA 3OJBA 3ZDSA 4Q8KA 4GXLA 4Q0UA 1VPHA 5KHGA 1OA4A 3C3VA 2ZCWA 5J7MA 4Y5SA 2ZX4A 3NNMA 1BJQA 2LS6A 1FXZA 2RV9A 4HMZA 3RI8A 5J36A 3LOBA 1NLSA 4A7YA 3HD8B 1MS1A 3R4UA 4ZY9A 2BVVA 1YI9A 1S0DA 2A6VA 3ETQA 3AZYA 4HKWA 5FKBA 2XJRA 4YW7A 5FYSA 1RUI3 4CEWB 1UMIA 1TMF3 1H8TA 2YFUA 5JSPA 3WXPA 3AKPA 3NJYA 2BRTA 3FC0A 3WW1A 4ET7A 1S0FA 5GLUA 3WCRA 3WNMA 4P9JA 4QB6A 1WGPA 3CIHA 4DXSA 1WMDA 3WF3A 1ZBA3 5C3RA 3V65A 4Y5TA 2BFUL 4LNVA 1AR82 1AVBA 2XLFA 2XUMA 3L2YA 2QQOA 3UNPA 3ZN5A 3U37A 1J1LA 2GMPA 4DY3A 2VZRA 4Y4RA 1H8TC 3WW2A 4TTGA 2YHJA 3A7QA 4LORA 4KWLA 1RGSA 2PAMA 2D5FA 1QOOA 2B45X 4JVAA 4Q2FA 2WZR1 4YWAA 3MZHA 3I2KA 3T4HB 1ZRIA 3RYKA 2GC0A 1JOJA 2F17A 3ZSMA 4LO8A 4ASLA 4DEQA 3P1IA 1F4HA 2Y26A 1DLLA 2IVIB 4CU6A 1O3RA 1KDKA 3O0XA 1I5PA 3PU8A 1JTZX 3RWKX 1TVGA 3GJBA 2CWMA 4XBNA 3AZZA 4Y1ZA 5DZGA 1FV2A 4AVSA 3BYWA 1W8HA 2VVFA 3ACIA 4LBMA 4UFHA 2JWPA 5IATA 2P6CA 2PHLA 5DPNA 2GNBA 3LDBA 4Q29A 1HRI1 5F5QA 4Y26A 1OBNA 1QQP3 2Q1ZB 3USUB 4XJAA 5EYXA 5FPBA 4ORFA 2LUWA 4E8CA 4WVVA 1XYNA 1GZCA 3ILNA 2B46X 2PHWA 4JRAA 1RHI2 4XQ4A 3AYEA 3NW4A 2XB6C 1BEV1 5AVPA 5FJHA 1LOBA 2E51A 1C1FA 2C1FA 1D4M1 1VBC2 4XACA 4Y22A 1QOSA 5FZAA 2WZPP 2VXJA 2YROA 4HSLA 1ENRA 3GHNA 1POV0 3NNJA 4MH0E 2AREA 4MGZE 4LBJA 5JXIA 1VBA1 2E31A 1CONA 3FWEA 4P14A 1OD5A 3CEWA 2OVUA 2QBXA 4WM8A 1MS8A 4HK9A 1BBT3 1ULDA 2HEWF 3IIIA 4BYYA 4RD7A 5JZGB 5DN2A 1GQHA 4N9HA 3M3EA 4OHZA 4HLTA 3PURA 2BWCA 1W0OA 4NROA 1NKGA 4EN9B 1NCRB 3VZNA 4LBLA 3AKSA 2K46A 4IEWA 5EP9A 3TBDA 1YFXA 3GZEA 1OXCA 2NM1A 2ZMNA 3C2UA 1NQJA 3FLRA 5A7OA 3AFKA 2C5DA 4N53A 5JXGA 1PGSA 1PO22 2XPJA 3I54A 1LRHA 4FTBA 5FJKA 3VBHB 1C28A 1MACA 1C4RA 3FUQA 1UCXA 1G9DA 2B42B 4P9YA 2PLV2 1POV1 1F35A 5A3MA 5ACA3 1MS5A 5LB6A 1H2LA 1PVC2 2EA7A 2ZX3A 4PDWC 3ZFEB 1O3QA 2GN3A 2WL1A 5DAPA 5IK4A 1VBD3 3DEMA 3N9QA 5GZEA 1PNFA 4FOQA 3X29B 5IVBA 1HXS3 2D3RA 3MFAA 2PHTA 3H8RA 4GKYA 1CZTA 4LUMA 2HLEA 2YC4A 4W6YA 2W1SA 1RVF2 4QQOA 1W8ZA 2JDAA 1X50A 5A70A 3SH4A 3K2OA 2MEV3 5FMCA 1US3A 1IPSA 4DIQA 3HNBM 4D94A 2VOVA 4XQWA 4XJ9A 5IW0A 2CSGA 5FZ6A 4YZ1A 3LA2A 5FZ1A 1URXA 2XL7A 1OLME 1YFYA 2WNVB 3CDZB 1ZBE3 4CU9A 4UF0B 4EWAA 2DUQA 2C4XA 5E1RA 3ZDVA 3CL1A 4TXWA 1JS9A 1QU0A 3KCYA 3C7OA 2Y6HA 4QQLA 1OLRA 4I3PA 5A7PA 2Y64A 3BODA 4META 4BLJA 2OT7A 4OI1A 1XSRA 2VGDA 2FDHA 4GMP3 1PX3A 2EVXA 3VL8A 4AOCA 5FZBA 2R30A 1YFWA 2RG4A 3ZN4A 2ADEA 5AFEA 3V0AB 2KA3A 1UZWA 3PUHA 1IGOA 1GP6A 2YBKA 3BTZA 5I8YA 1PMIA 2E33A 1BK0A 1F15A 1ZVFA 2NN8A 3FL7A 4NAMA 2PTMA 2A75A 2QE3A 1V9U2 2WLPA 4UWDA 2ZGQA 4GKXA 2KR2A 5ABJB 4IETA 2WSVA 3HVDA 2B8MA 3OPZA 4Z1VA 5LWBA 5IUQA 4AI9A 2WWJA 1WLDA 4P08A 4AI8A 2CGNA 3WF1A 3J7LA 3OD0A 4Q0VA 4AVVA 1AR83 1EAH2 4V1PA 3UJOA 4D6SA 5FO8B 1UN1A 3WT3A 5EV7A 1R082 1W6QB 3GBWA 3PJYA 3V56A 3LQCA 1W39A 2E9QA 4X8PA 5A7WB 1OQEA 5BPXA 1MS9A 5L9BA 1XNBA 4EWDA 3T09A 4OI0A 1HB1A 1ND2C 1SBEA 3VKOA 2VQ0A 1WBFA 3UGGA 5JPNB 3NV2A 4XF1A 1OOPA 1PO11 3IKWA 2CDPA 1VB4A 1Z7S2 2HEVF 1LNSA 2YC2A 4N8MA 2QJVA 2ZGLA 3WY6A 3PTRB 1F5FA 2C0ZA 2X09A 5A1FA 2FZ2A 1T6GC 5FUIA 2H6CA 1DGRA 2CL2A 4I0AA 4C1XA 1C5HA 2HWC2 3QCWA 4JRLA 1I9RA 2W1UA 4XHBA 3VGIA 2YFZA 5DAWA 3MBWA 1AYN1 5L73A 1NA1C 4DEVA 5GZGA 1HRV1 2BGCA 5C8CA 3HNYM 3NMBA 5I0DA 1GQPA 3OBAA 4AI0A 3KWVA 4X6RB 4HFSA 3EXUA 1VBC3 2TBVA 3DL3A 1QJZA 1LEDA 3KHBA 3V0BA 3KGZA 1Q56A 1ND3A 4FT8A 4AHZA 2XQRA 3GBGA 4YSFA 4RGGA 2G9GA 2D40A 4LBQB 3UL2A 2ZEWA 3ZIWA 1HW5A 3HN3A 2D7FA 4RR3C 1YLLA 5JWPA 1S0JA 2VCAA 3NO8A 5IYYA 4SLIA 4E2QA 5C5UA 1NQDA 3EQEA 4AEDA 2CU5A 4CXXA 1W2OA 4MGIE 2F4PA 2YBPA 4KMQA 2JIGA 4B1MA 2P3KA 3ZXAC 1PO23 2W87A 1KITA 5C71A 3EHKA 3WQBA 4B4PA 1NCQA 4AAPA 2YV8A 2QQPA 1BKZA 2X5IC 1A34A 4CCEA 3OSDA 3DXUA 1OC1A 2P37A 3DCQA 1PIV2 2BGPA 2WYFA 4FXGB 2PLV3 2DDUA 4AEDC 3SCFA 1L7LA 1AJOA 1PVC3 1IG0A 1OF3A 3WUDA 4I09A 3RMYA 3AZXA 2CV6A 2VD7A 4WM7A 4CDQB 2RJ2A 2AC1A 1RUF2 4ZPIA 1DHKB 5F6LB 3E97A 3VBRB 5F3EA 2VVDA 4BQ3A 1CZVA 5FPXA 4MADA 2JB4A 3FHQA 1RVF3 2BFUS 1N1YA 1AJKA 1ACCA 1A6CA 1RUI1 4Q8LA 4WBBA 5DUVA 3WEZA 5B4NA 4JGYB 3PU3A 1IG3A 1UX6A 4XZUG 1LOAA 2B5HA 2W94A 3P5BA 1RIRA 3BOPA 2CAVA 1H2NA 3ZYJB 3ACFA 4E2SA 4LLOA 4WM7C 2VUJA 3U11A 1FMD1 2ARBA 3AKQA 4WZCA 3ACHA 2DVAA 4HANA 1TG7A 5KR7A 1W28A 3B69A 2B7YA 1SCSA 1SMVA 1ZBA1 3KVBA 3VKNA 4IGQA 2VZVA 4XF4A 4FOWA 3O1SA 2E6VA 1OMIA 1H0BA 1SACA 1O3TA 3QLQA 3UYJA 2Y0OA 2VH9A 4YYOA 5AFBA 1WMEA 2J22A 1ALYA 5T5OA 5LEJA 5FYMA 5FBJA 1LHOA 5CKNA 3SQOA 2VZQA 1AX2A 4FPFA 1BK1A 1PK6B
chains in the Genus database with same CATH topology
4OHXA 3ROUA 2EAKA 2R042 1WCDJ 4S2GA 3JQWA 2EXJA 1V9U3 5HI0A 3B3QE 2ZX0A 1XNCA 1LHVA 3CNAA 3GBFA 1K5MB 4N43C 4Q0PA 1FNYA 1MZEA 5C9AA 3KT4A 3AZVA 4Q4X2 3EBRA 1QQP1 1EAH3 3RSJA 4EJRA 5C8WA 3SITA 1R083 2EAAA 4R9DA 4E4SA 1LCLA 5T3NA 4FP2A 2P3JA 4CP1A 3BPZA 3P3NA 1UMZA 5C9AC 1S1AA 2QDNA 3TNPB 4YVSB 2C9AA 1YXWA 3TYJA 5BNPA 2RJKA 4INDA 1Z7S3 4M01A 4NVPA 1XYPA 5J96B 2ZTNA 4PF5A 5K0UB 4LLFA 5GZFA 1BBT1 1ENQA 4QU2A 1YCIA 1G6NA 3FZ3A 3N7JA 2VMIA 2HWC3 4AI1A 5I0TA 1QOTA 5JMCA 1OOPB 3WDUA 4FPEA 2XL9A 3MF9A 1C8M2 4GWMA 2ENRA 3ES4A 5A3LA 1W6OA 4Y1XA 1D4VB 2IFWA 1S55A 4OFGA 4YVWA 4HKLA 2VVEA 4J1XA 4JTNA 1UPSA 2WFPA 5BNQA 4WVMA 3VBOC 4XE9A 4XXAA 1REFA 2D6KA 4CDXC 1H2KA 1U5YA 5ACA1 3VBFB 4D3WA 2EXKA 3FX3A 1QKQA 4KU8A 1Q5OA 1VBD1 1WA4A 5CU1A 1COV2 5H9PA 4BE3A 1Y43B 1IPKA 1GFF2 4UW3A 1OI6A 3S0MA 4L92A 4Y1VA 1DGWA 1HXS1 5K8SA 3MW4A 1J58A 2ZGMA 3H1MA 2JG9A 3DGTA 4FPHA 2XVLA 4Q0QA 1AYM2 3ZX7A 3PVEA 4M0NA 1RMU1 4DB5A 5CVRA 2AR6A 3WQ7A 5GZDA 1DQ2A 3IM0A 2WQZC 1GYKA 4DQAA 1ZBE1 5DUWA 1PIV3 4HVRA 4YG3A 5F1RA 5KWRA 4L8QA 4LBKA 1RUH1 3E5XA 2EXIA 2Q8OA 2ZKNA 3ZFFB 1UPIA 1WW4A 2XWBB 4YGBA 1CAWB 2ZHNA 3A4UA 5BNOC 3E6CC 1RUF3 2OYZA 4C90A 3WHUA 1DZRA 1ZA4A 4DNYA 1J3RA 4XIOA 4XFBA 2ES3A 2NZ9A 2F6BA 3S6PA 3SNMA 3O12A 3D8CA 3NVCA 1N1VA 4NO4A 4AVTA 2CYFA 3PNAA 5T54A 4YZ3A 4HKOA 2R072 1I1EA 4JQRA 2H6BA 3J26N 1CESA 1GZWA 1RUE2 3OYWB 4QPIC 2I74A 4G4FA 4MXVA 1ZM1A 1ZYBA 1RL3A 2ARXA 2G4IA 4R9AA 1SLBA 1QF3A 2PHDA 1DGLA 4CEWA 1UD1A 3QACA 5CBLA 2P17A 4CDUA 1I3HA 2A71A 3KCCA 5J48A 4CTEA 5T55A 1NYWA 1RB8G 3U10A 5K9YA 4RS5B 1N47A 2R043 4D7YA 1KRIA 1RUC2 3RS6A 4AI2A 1YHFA 1C3HA 4FPKA 4CEWC 3MW2A 5FDBA 2D6MA 1DYPA 1SQ4A 2ZGPA 2GN7A 4TLFA 2YGLA 5B2GB 3WLUA 4Q4X3 1GV9A 5GJ6A 1CD3G 4QGLA 4EWEA 4FPGA 5JIUA 3ZYIB 1A78A 1AXZA 4OHWA 4XYXA 3H7YA 5H9SA 1RHI1 4B7KA 1GLHA 4NWVA 1FAYA 1V6MA 5IK7A 1ZZ8A 3JCIA 3WQ0A 4COYA 4P9XA 5LK5A 1MS0A 4I01A 2P34A 4JV4A 5DG1A 1OKQA 3NSTA 4K40A 4L97A 2ZHMA 1OHFA 2CGOA 1UZYA 2O8OA 4EN7B 4GH4A 5BNPB 1JW6A 3VBUA 1V6LA 1F2NA 3ECQA 1C8M3 1MQTB 4QXKA 2NPIA 1PO21 2PFWA 3LKJA 3VDDB 4LR4A 5LRRA 3PMEA 3D0JA 1JHNA 5JZGA 4NHLA 2FMDA 1W6OB 1EV12 3P3PA 1XNDA 2XHKA 4KWJA 1PVC1 1NCRA 2HWF2 2K9ZA 1COV3 2RS52 4UW6A 4WVMB 4MVTA 1UZZA 3NKGA 1KDMA 2ERFA 3CJIB 4LA2A 3J8F2 4OLLA 1TEIA 1RVF1 4R8HA 2DUPA 3M4FA 4C0HA 3AM2A 2TUNA 1AYM3 4I0WB 1J3QA 3LGRA 1HDKA 2A70A 2A6WA 3WG3A 3M1HA 1GZ9A 2DTWA 4Q1PA 3ZFEA 2GMEA 1M4WA 4B29A 1NLRA 3GNEA 3VBHC 1G9FA 2RM22 2ZGUA 4B7EA 2UWAA 3HWJA 2ZZQA 5DZEA 4BLIA 2V73A 4H7MA 2V5YA 1SCRA 2XBO2 1G8WA 1LESA 2JICA 4P9GA 1NG0A 4QPGC 2GMMA 4KG0A 3MIEA 4QM8A 2MNGA 4KG8A 3FHIB 2WNVA 4I2OA 2Q0AA 4Q4Y1 5I0RA 4DPNA 4XETA 1S0EA 3OTFA 3ZN6B 4W65A 3MF6A 3RQ0A 2EF6A 3MLKA 2VNRA 2A3YA 2R073 3ZSLA 4LULA 3PMSA 4FCAA 1O5LA 2GALA 2XLAA 3VBSB 1W6NB 1VRH2 1RUE3 2OA2A 5E16A 3TN91 2WNVC 1VBE2 2RHPA 3V0AA 3I8TA 4KBBA 1XE8A 4KL1A 2HEYF 5CFCA 4ES8A 5EJ3A 4FPJA 1GZWB 4K21A 1LOGA 5ABJA 2BNNA 2PHXA 4IEZA 5A32B 4IEUA 4YW3A 2WS91 1FT9A 4S2DA 1OQDA 3NWKA 1X36A 3DPRB 2DTYA 3POWA 4J1WA 1RUC3 1NY72 1WW5A 1ZZCA 2BNOA 4IEYA 4CDUB 4GULA 4S2FA 4XQDA 4KGGA 4YM3A 1W6QA 2QKDA 3AFGA 2DWRA 3HT1A 3BALA 1B09A 2UU8A 3ZVXA 4MUVA 1EPZA 4O9GA 5SV5A 4Q1RA 5C4WA 1OSGA 3WW3A 4CZSA 4XIKA 4YGEA 4R4ZA 1HIXA 1R1A2 5C6CA 1AHSA 2AZ5A 5GZCA 5GLTA 4PIXA 1ULCA 3H9AA 4QT6A 1PGL2 1KJRA 4FXKB 4R52A 1QJU2 1X82A 1J3PA 1UL9A 3N7LA 4IEPA 2LTNA 1LOFA 1UF2C 1XXNA 3BOWA 3PVBB 3K48A 1PZ7A 1RITA 4FOYA 5F6KA 1QWRA 4RA0A 3GZUC 3I2DA 4GH4B 1S0CA 4LBQA 3VBUB 1QDOA 2P3IA 2VPVA 5I91A 2K0GA 4D7SA 2R1DA 3RJRA 1ZRFA 1J1TA 4Q4W2 2JENA 4E4DX 4K1YA 2RR11 4MGYE 5K7PA 3MPPG 3ST7A 1EV13 3R6SA 4PIZA 2BW8A 3WP3A 1LHWA 2D6OX 3B00A 4HN1A 5I0SA 2HWF3 2RS53 1RUNA 1RUF1 4AW7A 1RUJ1 2SLIA 2ZMKA 3J8F3 2R1BA 1V6JA 4Y1UA 1PNGA 1D0GA 4HN0A 4Q4V2 2ET7A 3SH3A 4JGZB 4MX3A 4Q26A 2ZGOA 2D6PA 4PLMA 4AFAA 3RZZA 5FQ0B 4WM8C 4XTMA 5I0UA 1ENSA 4CDWA 4CDQA 3PVNA 3VBRA 5GLVA 2RM23 5I8TA 4MGKE 5T50A 1BXHA 5JI9A 1W6MB 4MLOA 1VAVA 2VU9A 4JGYA 1KQRA 4JCKA 4N53C 2XBO3 2UWBA 3SMHA 2JEMA 3WNXA 3WP6A 4YW1A 1AR72 3PTYA 5BYNA 3J9SA 3NV3A 2VUAA 2FZ1A 2ZA9A 1LOEA 5CB7A 2PQQA 2UYAA 1SFNA 2R041 2CY6A 2XWJB 2JE9A 1V6OA 2RJLA 4NHMA 1DDLA 2IZWA 4WV8A 4IV3B 4GALA 1G9CA 1S2KA 2IWGB 1YYNA 5HXVA 3ZO0B 5T5LA 3N35A 1VRH3 4N7UA 4Q4X1 1CPMA 3WZ1A 1DU3D 1R091 3JU9A 1VBE3 4HBNA 5CADA 2UURA 1MEC2 4EN0A 1PK6A 1TQ5A 1I5ZA 5T5PA 4IEQA 2ZAHA 5CNAA 4M3CB 3TNQA 1O4TA 2WNEA 1LGBA 4KWKA 1CJPA 1FPN2 3B93A 4E2GA 1UKRA 1ASJ2 1K5MA 5CFCB 2O0OA 2JKBA 2WNUA 4P5HA 3B01A 4FBFA 2YZ4A 4XF3A 4FAGA 1YI7A 4BCUA 3ZIXA 4Z82A 3WV6A 4M3CE 5FO7B 1C8M1 3ZPYA 5FMOL 4YVSA 2I45A 4JTOA 2Y38A 1W0PA 4XTPA 1JH5A 1QGLA 1R1A3 5FO9B 4K20A 3AXDA 4J6GA 4FPCA 4NWWA 5K0UA 3JBG1 1PM7A 4YRDA 3VLBB 1DQ0A 5C4WB 1OFNA 4I30A 5DXDA 2XGXA 3N3HA 2OUHA 5SV8A 1QJU3 2Z69A 2WA3A 4PIYA 5KXDA 1COV1 4YM2A 4XBLA 4Z2WA 1QXRA 2A6XA 1JUHA 1KFUL 5FOJB 5K0UC 2ZGSA 2D93A 4AVBA 1AYM1 3H7JA 1OOPC 1HV0A 3KB5A 3VBFA 5DUUA 2JG8B 1PVXA 2RS31 1CJDA 4OZXA 4XFCA 2AENA 2WC2A 4Q4W3 2FBEA 4TWTA 1A8DA 1IOAA 3ELNA 2WFF1 1RUG2 1IS6A 4IEOA 1CR7A 5C8CC 3WP4A 1LODA 4WVZA 3IN9A 1GSLA 3PHMA 2DVBA 2HJIA 4H55A 1ZNPA 2D97A 2ATFA 4Q4V3 1CAUA 2WZR2 1DZQA 1YNAA 3GF6A 2DCTA 1BQPA 1ND3C 3VN4A 1HX6A 2ZOEB 3AMHA 1XYOA 4B8EA 3TOJA 4LHNA 1F5JA 3ZFFA 4BA6A 2XKPA 1CIWA 3S7EA 3CJXA 4A3XA 2GNTA 1CAWA 1YUDA 2QUOA 2VMHA 3KM5A 3WINE 4BIOA 1DFQA 4XFFA 2Z2SB 1RUE1 3AP6A 4L99A 4EROA 3ZMOA 4B4QA 3WDXA 2A3WA 4QGNA 3HBZA 5IK5A 1PZ9A 5FRAA 5KC6A 5E8AA 4NR1A 3GYDA 4CDWB 5A33B 1AR73 3ZXJA 1NCQC 1WUVA 5JVVA 3ZXLA 1XQNA 1LGCA 1WMFA 1MR5A 2D6LX 1YFUA 1G86A 3AK0A 5GLZA 1RUOA 4Q0SA 3OYWA 2XJQA 2BNMA 1NOVA 4YM1A 5EWSA 1RUC1 1TMF1 5FREA 3J4UH 4XDQA 2DVFA 4PDWB 5BNNA 1N1TA 1VP6A 5KBFA 1VBA2 1G7YA 1UAIA 3H3ZA 1N3QA 1YIPA 4JC1A 4QM9A 1DYKA 3AP4A 1H1AA 1BVVA 5JCTA 3POYA 1KJLA 3VZKA 1JYIA 2VG9A 1EP0A 3U4XA 2EIGA 1HLCA 1MEC3 4MXWB 3JQXA 4UBHA 3WR0A 3ES1A 3I4IA 4AK3A 4RS5A 4UXAA 2X53S 2DV9A 3RG0A 5GLWA 1FPN3 3SCHA 3KLSA 1NZCA 1HV1A 4IESA 4XOGA 3I7DA 3RJ2X 4ISQA 2A5ZA 1ASJ3 1MZ6A 2DU1A 4OI4A 5JDBA 4OHYA 2CAUA 2JD4A 2RS12 1A8MA 4K6BA 4OUSA 4FAHA 4B3NA 4AQ2A 1LHNA 1JN2P 1B35B 2ILMA 5HCFA 3VKLA 3RWNA 1REDA 2WNUB 4C91A 2B9UA 4EV0A 5EXOA 1OLQA 4UW5A 4LT5A 1V00A 3B02A 4XJUA 2D3SA 3ZXEA 2ZX1A 1H4HA 3RNSA 1GNHA 4FPLA 4BWOA 3NV1A 1NE4A 3WDTA 1EV11 3L2HA 4YZ4A 3OGGA 1O3SA 5H9QA 4XZPA 1MQTA 2RS51 1BCXA 3J8F1 3V64A 3VDDA 1WLTA 2B39A 2HWB2 3D6EA 3W58A 1KXGA 3JB8A 1MS3A 1VIWB 1O4ZA 3B5LB 4LO6B 1N3OA 1S0IA 5BNPC 1ULGA 5BV6A 3E6DA 5EFUA 2RMU2 3QH7A 1IS3A 3MIBA 1CQ9A 4MSVA 5EZWA 4NN0A 2JJ6A 4XHXA 3WW4A 2MPFA 3CJIA 3I59B 2ZS6B 1U5XA 1S2BA 2RM21 2O8QA 3OY8B 4ZKTB 2HWE2 1Q8OA 5IT6A 2G9FA 2VNOA 1RUG3 1CVNA 2XBO1 1ZZBA 3KD4A 2Q30A 4GMP0 1X33A 5KHIA 4I3GA 4YVWC 3RRDA 4AG4A 1ZRCA 4YW4A 3GZAA 2DYCA 2MEV1 2WZR3 1QH6A 3ENRA 4KH9A 5AVAA 1BZWA 3KZ4C 4RHV2 1SFYA 3FLPA 4L2NA 1PO12 1QXPA 1GBGA 1W6PB 5T5JA 1CAUB 3CU7A 4S2HA 4BOWA 1VRH1 3QBQA 2IXHA 2GC3A 2JG9C 1VBE1 3POSA 1WBLA 3W9AA 4F3JA 4TZDA 1FNZA 4GMP1 3MI8A 3ZN6A 4A2UA 1RJ7A 1AYN2 5HBAA 1HQWA 4PCRA 1HRV2 4IQPA 4OUMA 2ZMLA 1BMV2 5JSOA 2WLQA 2VNGA 1ZZ6A 3VBSA 1W6NA 4G3YC 1D4M3 1U0AA 3H3UA 1LB2A 3KT7A 4AGVA 3OCPA 1NY71 3KS7A 3LZZA 5CIRA 4YZ5A 3MIDA 4LHKA 3VL9A 4AXOA 1VBA3 4C1WA 4E27A 5FTTC 1QJX2 2VW2A 2NQYA 4YFZA 3NL1A 5D8AA 3T1LA 4PLNA 3VZOA 2DF7A 5D1IA 3FUOA 4Q27A 3ZFGA 1AR81 5BNNB 5A32A 3VBSC 4YLZA 5KHJA 5JI7A 2VY0A 3DPRA 3L9JT 3VHRA 4AQSA 1R1A1 3GZTB 2WT0A 4QPYA 4HL0A 5BY5A 5DG2A 3VUOA 3WG4A 4DMIA 4I02A 2R0HA 1RJ8A 2RS13 4QMAA 3LCPA 3MYXA 4AEKA 3DPRC 2W68A 3IMNA 4GIQA 2MHFA 4CDUC 3TRSB 3IT8A 4Y24A 2NMNA 3AXEA 4PLOA 3LWCA 3HN1A 1RUD2 5LK7B 4SBVA 2GAUA 3VKFC 2QCSB 3FMGA 4R9CA 4CP0A 2GH2A 4IV1A 5KXBA 3B9IA 4RL7A 3WX5A 4RQPA 2VOWA 4LEJA 1VBC1 5L7OA 2IXKA 2XJPA 5JAXA 1AL22 2OUJA 5AC92 3U0ZA 2Q4SA 4N43B 4Q4W1 3VHPA 1FMD2 3OGJA 3SISA 3ZMNA 2HYKA 5KHHA 5JOZA 3UKVA 2PHFA 2VOKA 5JIAA 3INAA 1QJY2 3AJZA 2IXCA 4QHBA 1TE1B 2HWB3 1LULA 1HKDA 2JX9A 4Q4V1 1VALA 4FQ4A 4U36A 1Q8QA 5C33A 5GALA 1QY4A 1I6XA 3CF6E 4TSVA 1FX5A 4M3CF 4IL7A 4A7KA 1JXNA 2RMU3 1CAXB 1LECA 4JDNA 4H3WA 3NAPA 1O91A 1OFSA 2ZABA 4GH4C 2PLV1 3VBUC 2HWE3 1AX0A 2Z79A 1XU2A 1L3JA 3OBRA 3EJKA 3M70A 1NE6A 4JGZA 2ZHLA 1ZX5A 1E57A 1WCSA 3BB6A 3LA7A 2BPA2 1RINA 1Q8PA 1OPMA 5FQ0A 1SLIA 2W0XA 3VBOB 1GR3A 4COWA 5JZGC 3M3CA 1QH7A 3H0OA 4AFCA 4CDXB 2OZ6A 4LO7A 1A3KA 2JXAA 4XFHA 3WUCA 4YGCA 5DDJ2 1NCRC 2XVGA 1UU5A 1IZ3A 1W6MA 4RHV3 2ZPXA 2QZ3A 4XFIA 1V70A 5J3UA 1PO13 3THPA 1LR5A 3O0VA 2P2KA 3MIFA 1IHMA 1OA3A 1UU6A 3KQRA 4D7TA 2VW0A 2PYTA 4OHVA 2FQPA 1V6KA 5CFDA 3R0RA 4AFMA 1AYN3 3ZFEC 1FPN1 4IV3A 1HRV3 1UIKA 1LEMA 2YGMA 4DRRA 2PELA 4XEZA 2CNAA 3USSA 1ASJ1 1RTVA 4ITCA 2BBVA 4JDOA 1SLLA 1PZ8A 1V9U1 4HPKB 4XXPA 4FOVA 2ZHKA 4Y5Z0 3SXWA 4XILA 5BNOB 1QJX3 4M3CA 4IV3C 1GKBA 3ZSJA 1G9AA 2GNMA 2XVKA 2XG3A 1EAH1 2AYHA 2E7QA 4D69A 3ZSKA 3PLQA 3E6BA 1HQNA 1R081 3WP5A 2R32A 5D8AB 1RMU2 2VULA 4M0HA 1D2SA 3ZFGB 3N7MA 3T1MA 1XU1A 5BXXA 3RDIA 4QPIB 3KMHA 3MEPA 1PGW2 2OZJA 1Z7S1 4HVQA 3IDCB 1APNA 2ZGNA 5CFCC 3AKRA 1RUH2 4MZUA 4CEYB 1DGRN 1GNZA 2HWC1 5ABJC 2WT2A 1CAVB 1DQ1A 4AHWA 1RUD3 3IPVB 4M00A 3ZYRA 2XJVA 4IEXA 3QOPA 1QDCA 3R4SA 4Z07A 3ZXGA 3B7MA 3AP5A 1LJ7A 3PJQA 5BUVA 1AL23 4BZ4A 5AC93 4ISRA 1FMD3 3LA3A 1V6IA 4IV1B 5C4WC 2UWCA 2V09A 1F9KA 2OW4A 4RQPB 1RUG1 2DCZA 5L7OB 2Y0IA 1QJY3 2JE7A 3CO2A 1Q8VA 4P9WA 2WWSA 3AP9A 2JG8A 2YY1A 1SLAA 4F7ZA 1X8EA 3O5SA 5JSRA 4ZU7A 3B9CA 5E89A 4ATFA 3BCWA 3FBYA 5H9RA 1G9BA 3JD72 4YFWA 5CG8A 1YO8A 3KT1A 1QMJA 4XW3A 4IEVA 2ET1A 2JG8C 3WG1A 1LOFC 1PIV1 4AVAA 3UJQA 1SEFA 1TME2 2E7TA 3ACLA 3MICA 2BVBA 5JOYA 5GM0A 3AMMA 3UV9A 4F83A 4FTEA 1AZDA 2X29A 4K7JA 1H8VA 4LA3A 3NAPB 4PBPA 1FYUA 3MPBA 1GANA 1C57A 4W6WA 4K8FA 2DURA 1SBFA 1S0BA 1AR92 5DDJ3 2Q5TA 2PHRA 1O5UA 2UY9A 1Q43A 3EO6A 1JYCA 1FOD2 2R062 5A33A 4DRVA 1VBB2 4FPYA 5FLHA 3O0WA 2GU9A 4IERA 2XJUA 2HWD2 2KM2A 2IC1A 2LM3A 4LUKA 2DUOA 4GWNA 1O7FA 4QQPA 5FFOC 4HSJA 4PDWA 4XF0A 2CGPA 4YGDA 2R0FA 4CDWC 4CDQC 2I07B 4GB32 3IBMA 4XPVA 3VBRC 5CFDB 2ZX2A 2A6YA 4BQ1A 3AMQA 3WG2A 3AKTA 2E53A 2RS11 1UU4A 3URFA 5EYYA 4JGYC 1WLWA 4MXWA 3FE5A 4QPGB 1HQLA 2D3PA 4ZXKA 2YDEA 1DIWA 1C8NA 1MVQA 1WW7A 1LHUA 4NPRA 2N7GA 3D82A 2ZKLA 1DGWX 1YRZA 1U5ZA 1CGPA 3M3IA 4XFAA 1IKPA 5JOXA 2UY8A 5HCAA 1TNRA 1RMU3 1RC6A 3ATGA 3O14A 4NHKA 2PHUA 1B35A 3WHTA 4AE2A 2VXRA 1S0GA 1EY2A 3AYAA 2UYBA 3R4DB 1PK6C 1N1SA 2GSYA 3RYRA 2WSUA 1PHMA 1RUH3 2SBAA 4DS0A