2R072

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r07200
4RQPA 1PVC1 4CDUC 1NA1B 4IV3A 2RS53 2BBVA 1PIV2 1RUF2 1ND2C 1HX6A 2WLPA 5J98B 4QPIA 5LK7B 1B35C 5ACA2 3ZFFA 5AC92 3VBUA 1ZBE3 5ABJB 3VBRC 4N53C 1FOD3 5CFCB 2HWB1 2Y26A 3IDEA 1VBC1 4FTEA 1ASJ2 1F8VA 2WFF3 3VBOA 4GB31 4YVSC 1HRV1 4PDWB 2HWB2 5JZGA 1AR81 1RVF3 1AYN1 1TME3 4Z92B 4GB32 4WM8C 3VBRA 4CDWC 1POV3 1AYM1 5A33A 1RUF1 2HWC3 1HRI1 1QJY3 1ND3A 1FMD3 1H8TC 4CEYC 1D4M2 1PO11 1AR92 1X33A 4IV3C 4GMP0 1VBC3 5BNNB 1RUJ2 2X5IA 1IHMA 2GSYA 1ZBA3 2R072 4Q4V1 5DDJ3 4Q4Y2 1Z7S2 4QPGB 1R1A1 4N43B 1FOD2 1R083 2FZ1A 1VRH3 1V9U1 4PDWA 1HXS2 1R1A3 1BBT1 3JBG3 5C9AB 5JZGB 2R071 2RR11 2BFUS 3FBMA 1RUC2 4YVSB 1B35B 1TME1 2RM22 3ZFFB 1QJX1 4GH4C 5BNPA 5FOJB 1RUI3 3VBHA 2R061 1PO12 5D8AB 4AEDA 5ABJC 2HWE2 4Q4X3 4CDQA 2RS33 2R063 2HWF2 2R062 4GH4A 1AYM3 5C8CA 1NCQC 2HWD3 3TN93 5FMOS 4Q4W3 1ASJ3 1RUC1 1X36A 1AL22 1EAH2 1BBT3 4JGYA 1BBT2 4NWWA 3VDDB 3ZXAC 1WCDJ 1NA1A 4IV3B 4WM7A 3JD71 5ACA3 1VAKA 2RS11 2RMU2 4Q4Y1 1AL21 1C8NA 1ZBA2 5DDJ2 1RUE2 1MEC1 3CJIA 5BNOC 5C8CC 1ASJ1 2HWB3 4CDXB 1AR61 1RMU1 4YVWA 1PO13 1H8TB 4CEWC 1AUYA 2MEV2 4CDUB 1QJU1 3J8F3 1NA1C 3JD73 5CFDC 1COV2 2WZR2 2R043 1ND3B 3VBFA 3ZFEA 2HWF1 1VBB2 2HWC2 4FTBA 4N43C 1VBA3 1OOPA 3ZFGB 2X5IB 1FPN1 1AR62 1BEV1 1RB8G 1AR73 1AR82 3VBRB 4N53B 1RUE1 1VBE2 4Q4X1 1HQNA 1C8M1 2FZ2A 2RMU1 4Q4V2 4WM7B 1VBE1 4Q4X2 4QPIC 5K0UC 1PO22 4RS5A 1VBB1 1QJX3 5C4WA 1HRV2 3NAPC 2RR13 5L7OA 4CDXA 5AC93 5BNNA 2RS13 1NCQB 1NY72 3DPRB 3VBSA 1TMF2 2PLV3 5ACA1 5BNOB 5J96B 1RMU2 1COV1 1TMF1 1K5MC 1AL0G 1OPOA 1HRV3 1TME2 5AC91 2RS52 1PGW1 1GFF2 1PO23 4RQPC 1OHFA 4CEWA 5C9AA 4FSJA 4BCUA 5CFDB 1QJZA 1RUJ3 4JGZA 1ND3C 1FMD1 1EV11 3VBSC 1FMD2 4YVWC 1RUE3 2X5IC 1RUD3 5ABJA 1V9U2 1K5MA 1BEV2 2XBO1 1RMU3 1H8TA 1Z7S1 5D8AA 4AEDB 1VBA2 1R092 4CDQB 4SBVA 4WM7C 3TN91 5C9AC 5JZGC 2XBO3 4CDUA 1R081 1NY71 2RS31 4Q4W2 4RR3B 3TN92 4EJRA 4WM8A 1QJU3 5K0UA 4Q4V3 3VBFB 3ZFEB 4JGYB 5L7OC 3VDDA 1A6CA 3VBHC 2RM21 1PO21 2WS93 1RUG2 1RUD1 1RHI3 5CFDA 5C4WB 1PGL1 1EAH3 2BFUL 2QQPA 1TMF3 4GH4B 1ND2A 2R042 1R1A2 2DF7A 4IV1A 1NCRC 3VBUC 2RS51 2HWE1 2MEV3 1Z7S3 3DPRA 3VBSB 2RS32 4Q4W1 5A32B 1BMV2 1VRH1 1OOPB 1MQTA 3ZFGA 1VBE3 3JB4C 3CJIC 1QJU2 1W39A 4NWVA 1R091 1RUH1 2WFF2 5BNOA 1C8M3 1NOVA 1HRI2 1RUH2 2WFF1 3JB8A 4CEWB 4Y4YA 2XBO2 4YVWB 1MEC3 1AL23 4JGZB 3S6PA 2XPJA 1EV12 1QJY1 3JBG1 1RUH3 3JD72 4CDXC 1V9U3 5L7OB 4AEDC 3HAGA 5CFCC 1EAH1 1ND2B 1CD3G 1D4M3 1F2NA 5CFCA 2WWSA 2HWD1 2WZR1 5K0UB 4RR3A 1AR72 1AR83 1RVF1 1NG0A 3VBOC 2GH8A 1VBD3 1QQP2 3NAPB 2PLV2 1PVC2 1VRH2 1R082 3DPRC 2IZWA 2WS92 4LLFA 4CDWA 4PDWC 2RR12 4QPIB 1K5MB 1C8M2 2R073 5BNPC 3J8F2 4IV1C 1VB2A 1PIV3 1B35A 2HWF3 1NCRB 3VBUB 1VBC2 1RUI2 1QJY2 1EV13 1MQTC 1PGL2 1RUI1 3LOBA 1CJDA 1ZBE2 1OOPC 1RUJ1 1RUG1 5GKAC 1AR63 1POV0 1VBB3 4N53A 3JBG2 1VBD2 4CEYB 2VQ0A 1PGW2 1RHI2 4RQPB 4GMP1 1QQP1 1VBD1 1COV3 4RHV3 4RS5B 1QJX2 1AR71 1RVF2 2PLV1 2HWD2 1PIV1 1VB4A 1BMV1 4QPGC 1SMVA 1ZBA1 5DDJ1 4RR3C 5D8AC 2HWE3 2MEV1 1AYN2 1AR93 3VBFC 3ZFEC 1E57A 4RHV2 2R041 5FMOL 1DDLA 4RHV1 3VBHB 2RMU3 1MEC2 4FTSA 4CDQC 1R093 2TBVA 3ZFFC 2RS12 2BPA2 2ZAHA 2WS91 2WZR3 1BEV3 3VBOB 3VDDC 1AR91 4QPGA 1D4M1 4RFT0 1RUG3 1FPN2 4Q4Y3 4JGYC 1AYN3 4YVSA 1AYM2 2HWC1 3NAPA 4GMP3 5A33B 4CDWB 5BNPB 4IV1B 1POV1 5C4WC 1RHI1 1FPN3 1NCRA 1RUC3 1M06G 1VBA1 3CJIB 5A32A 2RM23 1PVC3 1FOD1 4Y5Z0 4RS5C 1HXS3 1ZBE1 1MQTB 5BNNC 1QQP3 4WM8B 5C8CB 3J8F1 4GB33 1HRI3 1NCQA 2ZTNA 3ZFGC 1RUD2 2BUKA 2ZZQA 1RUF3 4JGZC 4N43A 4CEYA 1HXS1 3M8LA
chains in the Genus database with same CATH superfamily
3DXTA 1W05A 2P6HA 4XJZA 4XCAA 1UPSA 1PVC1 3DYMA 3AYEA 4E2QA 4OMDA 4O9EA 4HK9A 1ODNA 2GP3A 3T3YA 4CUBA 4AAXA 1NA1B 3FFQA 1H0BA 5EZWA 4NROA 1PIV2 2WA4A 3V65A 2KXLA 1ND2C 4DY5A 3I4IA 2D6PA 5FP8A 3NQHA 5FPAA 4AR2A 2VPVA 4Y1VA 5CU1A 1NLSA 4ES9A 1UKRA 2XB6C 3OGSA 5ACA2 5FO8B 3WF1A 2V4AA 4HL0A 3PUQA 3VBUA 1LHNA 2XUEA 2JDPA 3P6BA 4M3CF 1MVQA 2A5ZA 4NPMA 5ABJB 5FDBA 1SLIA 2WC2A 1PK6B 4OHZA 4AI0A 1FOD3 5CADA 2BNNA 1UOBA 3IDEA 3NV3A 1VBC1 4GWNA 2FHRA 1IS6A 3RWNA 3ZSKA 3POJA 1AXZA 1W6QB 3GZUC 3DV8A 2DBNA 4META 1DIWA 1E5HA 2BWCA 4ZS2A 1XE0A 3D0SA 4BMEA 4GB31 3H8RA 1GQPA 4UW6A 2YUEA 4CU8A 3S57A 4PQQA 3EJKA 1CAUB 2B8MA 1RYYA 2HWB2 4XFAA 1AR81 2ZMKA 2KA3A 5L73A 4KGQA 4COUA 4CYDA 1Q43A 1OVSA 3NKTA 1HIXA 1TME3 4LO8A 5A1LA 2R6QA 2OZ6A 2VQUA 3AP4A 3FUOA 3CHXA 1ODMA 3HEIA 3NMBA 3FL7A 4H2AA 2JG8C 4XMAA 1POV3 5FUNA 5FUPA 4MV2A 5C8WA 4XF4A 3AMHA 3PHMA 4ASKA 4P5YA 4Q26A 1AYM1 5A33A 4XFBA 1RUF1 4XF0A 3USUB 2R1BA 3W58A 3JQXA 1JS9A 2HWC3 1HRI1 4XIOA 1G8WA 1AJKA 2ZS6B 4AW7A 5JLVA 2KD7A 4IERA 3IDAA 2B9VA 4K3UA 5IVJA 3HN1A 2EXKA 1MZEA 3BIWE 4O65A 2PXJA 3DL3A 5BNNB 2BJSA 1RUJ2 1S2KA 1UAIA 1IHMA 2LALA 2XKOA 5G04L 1VIWB 2VVDA 1D2QA 1ZRCA 1XE7A 4C8DA 3H1YA 5C70A 2WWJA 1S4CA 5FZ4A 3ZR6A 2EXHA 4ZKTB 4LBQB 4CVUA 4Y20A 4XURA 1V9U1 1KDKA 4PDWA 2ZX3A 5IVVA 2FDFA 3S7EA 1EPZA 1TZOA 1JUHA 1BBT1 2OIIA 5DN2A 5CZKA 2I45A 4PBOA 5JOWA 4YFWA 1X50A 5JZGB 5J09A 4PHZA 4I09A 2RR11 3FBMA 5A3LA 5HXVA 1YQ2A 1B35B 2NPIA 3MI8A 1S0FA 4BQWA 2Y60A 3AP9A 3K46A 2VMCA 3RYKA 3SISA 4YW5A 3X29B 4P9GA 4AHZA 2BW8A 5FOJB 1GOGA 3VBHA 2R061 1I3HA 4FQZA 3ALQA 5ABJC 1ONAA 4AHWA 4KWKA 3LSEA 2R063 5HXMA 4XBLA 3HQRA 4IEXA 1SFNA 2YV8A 2BV4A 4QQHA 5I0DA 3QH7A 3B9IA 3GDBA 1NCQC 4QGLA 4Z07A 5C8CA 1AVBA 2BOIA 1SLTA 1H1AA 1RUC1 1UYXA 3CDZB 1OA3A 5JXJA 2PHUA 4OVEA 3RZZA 1GZWB 4XYXA 4CCLA 2E32A 3RZHA 4NWWA 2GZWA 3VDDB 2IFWA 1FT9A 1UOFA 2ORZA 5I0SA 3T0DA 2YC2A 2D6LX 4WM7A 1U5XA 4XETA 5HCFA 3SITA 5ACA3 1O3TA 2HYXA 4MLOA 4A7KA 2CU5A 2MPFA 1CAVA 2FDJA 4R4ZA 4Q4Y1 1AL21 5FZKA 4AFMA 1RUE2 4FFIA 2VJXA 1DYOA 1L7LA 4GWJA 3OPZA 3BU0A 1ASJ1 4BLIA 2LW8A 1OFNA 1UU4A 4XOGA 3V0BA 1RMU1 2FDGA 4LUKA 1CESA 2D98A 4CEWC 1CAWA 4ORFA 1TQ5A 2BWAA 1DQ6A 3KWVA 4BIFA 2VO5A 5DUXA 5M0TA 2UYAA 5DQ0A 5FP3A 1W9YA 1IKPA 2A73B 1Q8SA 2WN2A 3OBRA 5H9SA 5CFDC 5E6HA 1YNAA 4MGQA 2PHWA 4XF3A 3VBFA 3GALA 2HWF1 2ZKNA 3MLJA 4W6WA 1GOFA 3RMXA 1SQ4A 4XFIA 4XDOA 5F2WA 2QDRA 1GMMA 4LLOA 1CQ9A 1EP0A 4N43C 4W8JA 4XAEA 5JOZA 2FQPA 3H1WA 1FPN1 4YWAA 5CISA 3UNPA 3EXUA 2EXJA 1XBFA 2QQWA 4UBHA 4QKNA 5FCCA 3T2OA 1BEV1 1K42A 4GWIA 1QJFA 3WCSA 3WP3A 3NJVA 4K21A 3UGFA 3VBRB 5C5UA 4WZCA 5IVFA 3WQ7A 1VBE2 3KV6A 4LBQA 1N3OA 2A3WA 2J1EA 5IUQA 4Q4X2 2VH9A 3R05A 3SMHA 3D4KA 1PO22 4INDA 5E89A 4UW4A 3B7MA 3PMSA 4IEYA 4JZRA 1T6BX 2VC9A 4P9JA 2ZHKA 4AQTA 2NMNA 2ZEWA 4EN8B 4J25A 3C3VA 1OD3A 4LBLA 1GANA 5LWBA 3KS7A 1ZZ8A 2OPKA 3IM0A 5EJ1B 1NCQB 4FPLA 3LWCA 4Q8LA 5FLIA 3KQ4B 5BNOB 5IHRA 5J96B 3H1MA 1TMF1 1UMHA 1ST8A 1OPOA 2E53A 4IEVA 4XHXA 5GZGA 4DXSA 5AC91 2NMOA 1GUIA 1E5IA 1HQWA 1GFF2 5IK5A 3VKMA 5A6YA 4FSJA 1BQPA 1CAVB 1MS4A 1JI6A 1QGLA 1YJLA 1N1YA 1XC6A 2YFZA 2B46X 4I3GA 2DTYA 3ZVXA 4LBMA 2ZGRA 4OZXA 3WW1A 2UWBA 1PZ8A 3MIBA 3VBSC 1FMD2 2K0GA 4CP9B 2XXZA 5IVYA 1RUE3 3AYCA 3RZLA 2ENRA 3MIHA 4YGBA 1RUD3 2FCTA 2ZGTA 1V9U2 1KQRA 5ABJA 5J3UA 3OPTA 2XBO1 1LR5A 4NN0A 5EJ3A 4S2DA 3VL8A 3O0XA 2WO7A 2HKXA 2ZACA 4WVZA 1SFPA 4KU7A 4JTOA 1WZXA 5A7NA 3V0BB 5I8YA 3J7MA 1MS3A 5C9AC 1UIJA 2HEVF 4R9AA 2ZJCA 3WY6A 1F5FA 4LKFA 3TEYA 2C1FA 3WF0A 1CJPA 1R081 2VTXA 3ZO0B 1B09A 1VMHA 3DN7A 3VD3A 3AZVA 3FMGA 4MH0E 4XXPA 1D0GA 1LEDA 2JDAA 4LORA 4ISRA 4K1ZA 4Q4V3 3VBFB 3RNSA 3O1RA 2GN3A 2Y0OA 4CUAA 5FQ0B 3RJRA 4JGYB 4FOYA 3QOPA 2YPDA 3GBGA 1A6CA 2V5DA 4QQOA 4FVVA 3RWKX 3VZJA 2Y33A 2WS93 3UJOA 1WCSA 3GCXA 1BZWA 3USUA 1RUG2 1UMIA 1LB2A 1O5LA 2P3JA 3FLTA 4O9GA 3NO8A 1PGL1 1LNSA 2P1BA 4LO4B 4Q0VA 3SXWA 2BFUL 2D3PA 2RE9A 2XDVA 3ZYBA 2OT7A 4N7IA 3BTAA 3IKWA 1O7FA 5FY4A 5BPXA 2WRAA 4B7KA 4PCRA 3FUQA 5IJRA 2DF7A 3PLQA 4IV1A 3OBAA 1MZ5A 4KQ7A 1ZYBA 5JMOA 4OHWA 4QHZA 2HWE1 5AVPA 2BU9A 2XOMA 2E7AA 1CX1A 4JC1A 3P5BA 3ST7A 3PVOA 1JODA 4YW4A 2RS32 5A32B 3R6SA 3LKJA 5JUVA 1BMV2 4AXOA 4PF5A 1ZA4A 2P4EA 3NNGA 1MQTA 5A3PA 1X82A 3E97A 1UOJA 1VBE3 5K8SA 4NRPA 2ZAAA 1QJU2 3CJIC 4P02B 3BVCA 5GZEA 1RUH1 5BNOA 3N7JA 3WDYA 1NOVA 1FNYA 4HN1A 2VMIA 5LASA 4AVTA 1JHJA 4CEWB 3WV6A 3WW2A 4Y4YA 3BYWA 2AENA 3PVEA 3W9AA 4D7TA 2IWGB 4TSVA 5SV5A 2ZGLA 3MIEA 1LAJA 1G9DA 3H50A 4U2AA 2UWCA 3S6PA 3AB0A 4EWDA 3QD6A 5EJZB 3JBG1 1FX5A 1IGOA 1XNCA 1RUH3 3JD72 3LIHA 1HB1A 3VD7A 5JSOA 3TEZA 1OD5A 4YPJA 1RGSA 4KGGA 4QD2A 2C24A 4DRVA 4JKLA 4GD4A 4BYYA 4LJHA 3OGJA 4CPBD 1N1TA 1R1ZA 1S0EA 4IW3A 5L9BA 1H6YA 2QVSB 4LXLA 5FPLA 2JXAA 2GC1A 4EZ4A 1GQGA 4ISQA 4XFFA 3VL9A 5CFCA 1K45A 2HWD1 1AR83 4URTA 4NIDA 2D6KA 1NG0A 4MGTA 4OCTA 1ALYA 3VBOC 2RHPA 5FPZA 1RUNA 4QX7A 1YXWA 3J7HA 1SBEA 4YW7A 4CCMA 3JZVA 4HVRA 1NE4A 3MFCA 5K4LA 1S1AA 1MS1A 4HKOA 3J7NA 1O8PA 2VZTA 4B3NA 3WUDA 4JTNA 2HYKA 5FXZA 2BVVA 2IZWA 1DGRA 3AFGA 3OY8B 3POIA 4CDWA 4F7ZA 3PIJA 2Z2SB 1K5MB 5FAXA 4NPRA 2WNUA 3J8F2 4AL9A 4IV1C 4RSUA 1CZTA 1VB2A 1DZRA 3MGUA 4HSJA 2FMYA 3VDAA 4A7YA 5FZFA 4Y1UA 5F37A 3VBUB 5FOBB 3AC0A 3U4XA 1JZ6A 5FY0A 1E5RA 3OSDA 2XJUA 4RGKA 4B1MA 1RUI2 1J3QA 1UY0A 5LA2A 3IWZA 1BXHA 2DVDA 4QX5A 5EP9A 2WDBA 5LK5A 1GQHA 2A3YA 3ORJA 2XVGA 4BQ1A 2B45X 5C71A 1V0AA 3TNQA 3MV01 2W1WA 2C9AA 5HCAA 2PTMA 2FCUA 2CSGA 1VBD2 2R1DA 4PIXA 4CEYB 3ZXDA 1TE1B 4YG6A 4LPLA 4GZ9A 2QQLA 3ETPA 2WO3A 3WUCA 5A3UA 5KHGA 5FYTA 3O12A 5D1IA 1J84A 2BTVC 2XJTA 3W5MA 1QJX2 4CA9A 3OBTA 3JQWA 1QKQA 3LE0A 2ATFA 3LPGA 3RMYA 5I0TA 3RRDA 4C0BA 1UZYA 1WUVA 4FXKB 1OFSA 5JSPA 3C7HA 4OQ8A 1BMV1 2F4LA 1OI6A 4A2UA 3LEMA 4RR3C 1YQ6A 2HWE3 4DMIA 2ADEA 2ZX0A 2ORXA 2E9QA 1UZZA 1Y7BA 4EWEA 1AYN2 1JYWA 3ZFEC 3J26N 1WW7A 4RHV2 5KHHA 4LT5A 2A6YA 2K9ZA 4FI9A 2B42B 1ZRIA 3CKHA 1DDLA 2WUHA 2VBBA 2A3XA 2VCCA 3LF7A 2P3YA 4LOSA 5FIXA 2AYHA 5T5PA 2RS12 1N47A 4YW2A 2ZAHA 5L36A 2WS91 2YGLA 4D3WA 1APNA 5J36A 4G4FA 1QXRA 1WWYA 3A4UA 4JKMA 1JYXA 1GZ9A 3CZUA 5JMCA 4IUGA 2VZRA 1D4M1 3N9LA 2PFWA 5DUWA 5CB7A 4RFRB 5LA1A 1ZVFA 1G9BA 3EMRA 2HEYF 4Q4Y3 2DUOA 2OXBA 4JGYC 3OD0A 5A1AA 3LA2A 3M3CA 3D3AA 1H2NA 2AC1A 3ZM8A 4YARA 1UW8A 3MDPA 4OQ9A 1YQ8A 3O1TA 4LHNA 5BXXA 1RJ7A 5A33B 1OC1A 1XNTA 2J7MA 2Z4FA 5C33A 4R9CA 1RHI1 5K9YA 4Z2WA 1NXMA 2WFPA 1H6XA 3QLQA 5JPNB 2HEWF 2OX0A 2Z79A 3CJIB 1IZ3A 1GNZA 1XE8A 1ZZ9A 4Q8KA 4HK8A 3KHBA 5H9RA 1UF2C 4QB6A 5LA9A 5LA0A 3R4SA 2WABA 2D6NA 3JUUA 4AF9A 2XMLA 4XQ4A 4H7LA 5JOYA 3VUOA 1QQP3 5C8CB 1SACA 5E88A 2ZTNA 1WCUA 3ABZA 4ZU7A 2C0ZA 3ZFGC 2BUKA 1JYTA 4K8FA 1RUF3 1WKYA 1H2LA 1J1TA 1HXS1 3WP6A 3EQEA 4CEYA 3PNAA 4N8MA 4L97A 5IW0A 3EBRA 1GZWA 5LW9A 4OFGA 1VJ2A 2Y34A 4XJ8A 4BLJA 3HPNA 4CDUC 3AZXA 2QQOA 2IXIA 1QWRA 1HB4A 3G7DA 4JKKA 4QDSA 2Y38A 4B4QA 1J3RA 2AH2A 1RUF2 2KM2A 4QXHA 1HX6A 2GNMA 3VB9A 2W3JA 2WLPA 2QJVA 5A7SA 1UN1A 1NKGA 5LK7B 3K2OA 4AQ6A 1O3RA 1DU3D 3A0KA 1YJKA 3ZFFA 3ILFA 2CYFA 4XJAA 2TNFA 3FN9A 3PVNA 1ZBE3 3WNPA 4BB3A 1J1LA 2DCZA 5FYCA 2TUNA 2HWB1 4FFGA 4JDMA 2EICA 3WF2A 5L9RA 5LBCA 4FTEA 3AFKA 3S30A 2EAAA 1UY2A 4GALA 5B2GB 1XSRA 5FZOB 3S7IA 3IDCB 3CQOA 2QDNA 1LHWA 1UPIA 1GWLA 2Y6LA 3FX3A 4YVSC 1S0GA 5FKBA 5CEHA 2B39A 3N35A 4LQRA 4R9DA 1QNWA 4G9SB 4IEPA 4JHTA 1BCXA 1IS5A 4UYBA 2CGPA 1AYN1 1FV3A 4GKYA 1A8DA 3E5UA 1KJLA 4CCJA 1I5ZA 4AI1A 3ZYJB 4GB32 4WM8C 3VBRA 1NUKA 4ZXEA 1E5SA 5CIRA 2ZGOA 3V64A 4AVBA 3N36A 4CDWC 1LHVA 4CCCA 1Y4WA 5IVBA 3LOIA 3NNJA 1OF3A 4GQ7A 4UW5A 2PHLA 2VECA 4BXFA 3LGRA 3BN6A 2B5HA 2YBSA 3O5SA 3P3PA 4KU8A 1FMD3 4AVAA 4D6RA 4CEYC 2W91A 1D4M2 2W92A 1PO11 2YDEA 3A0NA 4S2FA 1AR92 3OGGA 3H8UA 4IV3C 2GMMA 5C5TA 2WNVB 2W0XA 1CVNA 4MO3M 2JJ6A 4XUTA 3INAA 4AGGA 2EVXA 2CNAA 2GSYA 2PAKA 4FT8A 1YFYA 3T2PA 3I59A 2R072 4Q4V1 1F5JA 1JU4A 3I3EA 5DDJ3 4CU9A 1Z7S2 3K51A 4QPGB 4BQ2A 1DZQA 3WINE 1R1A1 3RFRA 3IDBB 4M3CE 5JVVA 3MFAA 4GAZA 1R083 2D3RA 1VRH3 1YFUA 3I97A 4XQDA 2PYTA 1R1A3 1C1LA 1LU1A 1V00A 4IESA 4XDPA 5F3GA 5A80A 3ZIWA 3L2HA 2XVLA 5F6LB 3ZMNA 2W95A 1LODA 4YYOA 1RUC2 2BVBA 1UD1A 4Q2FA 2JKBA 2RM22 4DXTA 3KB5A 2QZ2A 1QJX1 1HB3A 4M4PA 3ZFFB 1S0JA 5FZIA 1US3A 5BNPA 1HDKA 1UKGA 1RUI3 5D8AB 4AEDA 1PK6C 2HWE2 3ZOIA 4Q4X3 2HWF2 3T1LA 3OEAA 4GH4A 5DZGA 2OPWA 5CG9A 3PURA 4QGMA 3V0AB 1LHUA 4IGOA 4DRRA 1DQ1A 4Q4W3 1ASJ3 1YQCA 2GP5A 1SLAA 4Q1RA 3WNLA 2XWJB 1YO8A 3THCA 1AL22 1GU3A 3N7LA 5D2AA 2LTNA 1EAH2 1O8SA 5FXXA 4YW3A 3WW4A 1BBT2 3CO2A 3WR0A 3AYAA 4K8RB 3EB7A 1H4GA 3HQUA 1OQEA 4NR1A 4XHBA 1W8UA 3PDQA 1Z0HA 4IGPA 4Y20B 4E4ZA 1EYBA 3URFA 1G86A 4QX2A 3C2UA 5FYZA 5A3TA 1OQDA 5C8CC 4BM8A 3CJXA 4EN0A 2VW1A 2HWB3 2W5FA 3MICA 1WA6X 4CDXB 5JCTA 3ZPYA 4ES8A 2P37A 4COZA 3UETA 5EQUA 3KSCA 2PHDA 1AUYA 1ZZCA 2J1AA 2MEV2 1OKOA 2C26A 2WNVA 5T54A 5H9QA 3IMMA 1ENXA 2VXJA 3VHPA 4YSFA 1NA1C 1Q8VA 3JD73 4RYDA 2F4PA 2R043 1ULDA 5C3PA 2GALA 5FLHA 2WJSA 3WF3A 2IFRA 1JBCA 1WD4A 2D93A 4YGCA 4ARYA 3B5LB 3U75A 5A6XA 1JTZX 1ZRFA 2OQ7A 4GJYA 1LOFA 2X05A 1BK0A 1I9RA 5F5CA 4Y22A 5FQ0A 2ZXQA 2E6VA 3HOBA 2VZPA 3DF0A 3I59B 3KD4A 4OULA 1W2AX 2JE9A 1AR73 4QKDA 1S2EA 3Q8FA 1RUE1 2WNEA 1YCIA 1C8M1 2Z5WA 4P9XA 4AGVA 4JQTA 2RMU1 5F5QA 4WM7B 5FV3A 4TZDA 1LOEA 2VNRA 1FV2A 2XLGA 1RXFA 4XCBA 4BDVB 5I8TA 4RS5A 1ACCA 2PELA 1H30A 4LMFA 2SBAA 1VBB1 5FZCA 3ZXLA 3MPBA 4OUEA 2HJIA 4IEZA 3TB0A 4TXWA 4DEVA 3NAPC 2WSVA 3GCWA 5C7GA 2DVBA 2RR13 4I0AA 4TYSA 5A7QA 3K75B 5AC93 5KXCA 1XQNA 1YQ5A 4R52A 4YM3A 1CAWB 1PMJX 3SHRA 4NAMA 2JG8B 1TME2 3M3OA 3FHAA 3I3MA 4MADA 4DXZA 2WIIB 1YFXA 2Z69A 4CUCA 1VALA 2YC4A 4GIQA 3WDVA 3IB3A 1JYNA 2CTVA 4RQPC 1OHFA 4CEWA 3PIGA 2OW4A 3WHUA 2WT0A 5FTTC 5GLZA 5CFDB 1QJZA 1RUJ3 1CR7A 4JGZA 4QM8A 5F1RA 1ND3C 2WNVC 1FMD1 1OPMA 2ID4A 5DG2A 2ZGPA 4QKBA 5FZ7A 4HOOA 1NQJA 2J1UA 5F7UA 5JXIA 4ET7A 1K5MA 1IS4A 1DQ4A 4XF9A 1RMU3 3HBKA 4KL1A 1NX9A 2PMWB 1ENRA 4BQ3A 2GC2A 1H8TA 3ZN6B 4DUWA 5DAWA 5FK8A 4FPYA 3S5QA 2WZPP 1NZIA 2P34A 1MR5A 3M70A 4CDQB 1ZREA 4MX3A 4PT6A 5T5JA 5JZGC 2DCTA 1SG3A 2WSUA 4GJZA 4CDUA 2GMEA 1JU3A 1R64A 1W3VA 2QE3A 5B4XA 3TN92 3VKOA 4IEOA 5JR7B 2VVFA 4NIHA 4XTMA 5CKQA 4W65A 2VCBA 4E2SA 4QKFA 3VBHC 5FBZA 4DUVA 4RN5A 4ZZ8A 1CWPA 4P00B 4CP0A 1PO21 1Q8QA 3HT2A 5A3OA 1C3HA 1WMFA 1RHI3 5FZ0A 1OH4A 2OA2A 5ERLA 1IPSA 3GZTB 5KBFA 2CGOA 3PJQA 4C90A 2QQPA 2DVFA 4QX8A 5F9TA 5FJHA 1QXPA 3FHIB 4Q0PA 1N1VA 3ZKYA 3BIEA 1WD3A 5LCWL 1SBDA 3I2OA 2VG9A 1C57A 4JAAA 1DZTA 1U5IA 1V6NA 4KI5M 3I3QA 3A7QA 4J6GA 1JZ4A 4W4ZA 3DPRA 2RG4A 3VBSB 4Q4W1 1X7NA 2EALA 4YZ3A 2XJQA 3WXPA 4LBJA 1X9TA 1LOFC 4HMZA 5I0UA 3BGAA 3M3EA 3ZFGA 1GP5A 3OGRA 1SDWA 5GJ6A 3JB4C 2QQIA 1W39A 3MF6A 3N7KA 1R091 2WFF2 4NWVA 3ELNA 1C8M3 2GMPA 4UI9L 5FZBA 3SQOA 4YLZA 5LBFA 2JG8A 2XJVA 5FKCA 4XABA 4QXCA 1AHSA 3K4DA 4WVMB 5GALA 1L7RA 1D4VB 3KHCA 2BGPA 5FBJA 1G6NA 4NIAA 4UFHA 4GWMA 1TVGA 3AP6A 3CEWA 4JGZB 4FAGA 3KGLA 2P2KA 4UBGA 4XJUA 4AZZA 3J7LA 3KVAA 4IETA 1D0HA 2J1SA 5LRSA 2TEPA 5F6KA 4J1WA 1UZVA 1X8MA 5L7OB 3ME2A 1W28A 3D82A 2O1QA 2JKXA 3HAGA 3LSDA 5FZ6A 5CFCC 3VD5A 4NIGA 1EAH1 2D43A 3IBMA 3UKNA 3GYDA 3VKLA 4FXGB 2E31A 2ZMNA 5FJKA 2OYZA 1UYYA 5F3CA 1W90A 3AKQA 5F2SA 1W6NA 1IS3A 3AVRA 1UMZA 1WLCA 2WWSA 2ZPXA 1KS5A 1XYPA 2WZR1 1AR72 2O0OA 3VKFC 2UURA 3CNAA 3RYRA 1BKZA 4Y1XA 5FK7A 5A7WA 2YB7A 1QY4A 4NIIA 1QQP2 1SCSA 3IN9A 2OUHA 4Q0QA 3DUIA 5FO7B 4RD7A 4A42A 4AI2A 5FZGA 5T52A 1N1SA 3G6JB 3K3NA 2R0HA 1SBFA 3ATGA 3K77A 4LLFA 3GZAA 2Q8OA 2D5FA 4M0HA 4PDWC 3BOPA 1VMJA 1Y43B 2XLAA 4A45A 4Z8BA 5BNPC 3S5AA 1RINA 2VOTA 4DY3A 2R7EB 5FREA 4XUNA 4AI3A 1PK6A 4XUOA 2ZGNA 1GBGA 5L19A 1VBC2 4JDOA 1PX4A 3WG4A 4BOWA 3AKRA 3FE5A 4OI2A 4AVSA 3FWEA 4IEWA 1C4RA 3RSJA 3I49A 4QX3A 1UYPA 4OMCA 2W52A 1QJY2 4L92A 1EV13 1MQTC 4LHKA 5F32A 1MS0A 1RUI1 4E9KA 5A6QA 2Y6JA 3LOBA 4QU1A 1XNBA 1RUJ1 2ZZJA 3WNMA 3WG2A 1AR63 4LIUA 2LUWA 3AM2A 2VMDA 3SKJE 1HV0A 3AMPA 4RGGA 1WLDA 4CE8A 5LEKA 3LDRA 2WNOA 2VNGA 1OLMA 1I6XA 1WW6A 3OUJA 4XJ9A 1A34A 2VQ0A 2XKPA 4FPGA 3D0JA 4JCKA 4UXAA 4NHXA 4B4RA 1PGW2 4XF1A 3BI3A 3AK0A 2JDYA 4RQPB 1GOHA 3HQXA 4DO0A 2QQNA 2A6ZA 3VZNA 1COV3 4DB5A 4RHV3 4RS5B 3HIFA 4MGSA 1RVF2 5IK4A 2PLV1 2A75A 1IKQA 2OS2A 5T3NA 1VMFA 2AACA 2YHJA 4Q0UA 5JXHA 3I2FA 1VB4A 4HFSA 4Y5TA 2Y6FA 5DDJ1 4MVTA 4AEKA 2FDKA 2BZDA 4KWUA 1YEWA 3ETQA 3VV1A 2X09A 3MLKA 3O0VA 3KLSA 5FPXA 4XW3A 3VBFC 3E1F1 5APAA 2VAUA 3M3IA 4KNCA 2WO1A 1LHOA 5CBLA 3N3HA 1OF4A 3OB8A 4RHV1 3WT3A 1VP6A 4WZFA 1D7PM 1MEC2 4NRQA 4CDQC 2YZ4A 1R093 2LROA 2TBVA 3KGZA 4FO9A 1J59A 1STMA 3NRUA 3CZJA 1OBNA 5FYBA 5IATA 1BEV3 3VBOB 3WF4A 3HT1A 4FPJA 4ASLA 3N4MA 1NE6A 4QPGA 4K20A 1W6OA 4RFT0 1RUG3 2O8QA 1YI9A 5C3QA 4EWAA 1Q3EA 2ZGSA 2V09A 2BBAA 5A70A 1F15A 2A6WA 4YM2A 2Q8CA 3UESA 3AYDA 1AYM2 2HWC1 1Q8OA 2WT2A 3MUZ1 1RITA 1UYZA 2JDMA 4DQAA 4GMP3 5JIUA 2NZ9A 2JDNA 4IV1B 1POV1 5KXDA 1LESA 1W9FA 4W6XA 2EF6A 4KH9A 4PF1A 4YM1A 1I1EA 1FPN3 1SEFA 5GLTA 4V1PA 2WAOA 3POYA 3CU7A 3HD8B 1F4AA 1UQXA 2YFUA 1FATA 2RM23 5A32A 3WG3A 4YZ2A 1PM4A 1FOD1 2D44A 2H0BA 4PLMA 1W2OA 1PM7A 1HJFA 1HXS3 1VRBA 1ZBE1 4UF0A 4UFIA 1MQTB 4CUGA 5AFEA 4XILA 5A3WA 4JHZA 5CG8A 3W21A 3B94A 5FYVA 4EN7B 1SHWB 4GB33 1HRI3 2OVUA 4QM9A 1RUD2 3LEKA 1S0DA 2VQAA 2ZZQA 1W04A 4JGZC 3WSOA 5TSWA 3TRSB 1OURA 1OSGA 5A3MA 2WWUA 5IFPA 4RQPA 3POSA 2X29A 4Y1YA 4YZ4A 2ET7A 3MEPA 5BV6A 4D0QA 3RZGA 4GKXA 3O1PA 2VUJA 1YLLA 2RS53 4XACA 3K4ZA 3CLPA 1TG7A 2DCJA 4XMIA 2P3KA 4E4DX 2O14A 4K40A 1VLNA 4UOJA 5FPVA 3H9AA 5J98B 1OVPA 4QPIA 4XPVA 2JEMA 4AYUA 4BPZA 5J48A 1ZZ6A 1W6PB 4L8QA 3KF3A 5FZEA 2XQRA 1WBLA 3I3DA 2VCAA 1G7YA 2WL1A 4NMIA 4LULA 1CPMA 1H9PA 3HN3A 4OUMA 3WG1A 4N53C 3ACLA 5CFCB 2XL9A 2ZBJA 2QQKA 2I07B 3ILNA 4MSVA 1SLLA 2YYOA 3EYPA 3V0AA 1F8VA 2EAKA 3TNPB 4U36A 3BTXA 3ZXEA 4FAHA 2WFF3 5F3IA 4MOAA 4QAWA 4XVHA 3SNMA 3VBOA 5BY5A 1LOAA 3WHTA 1CAXB 1U12A 1QOSA 1LGBA 2WZ8A 3T0BA 4BIOA 2AGSA 1ZRDA 2ARCA 4ZY9A 1CIYA 3I2GA 3KT4A 5D21A 1OKQA 2JENA 4GXLA 4OYUA 5IT6A 4PIYA 1KRIA 3O0WA 3L2YA 4BH9A 1O3SA 3KM5A 4OI4A 1GZTA 3PU8A 3AZYA 5FY5A 5BYNA 4YW6A 3THTA 2W08A 4E4HA 2BYVE 3ASIA 2XHNA 3ZYPA 4AOCA 5C3RA 1HN1A 2VTXJ 4E4SA 5LBEA 5BNQA 4NAOA 1JOPA 2B7YA 3GJAA 3B00A 3LA7A 3HNBM 4ZZ5A 2X10A 3BKZA 1O5UA 4TWTA 1QJY3 2ZA9A 1XOYA 3SCHA 3MO4A 1H8TC 3U07A 2YBKA 3OPWA 3PUAA 1X33A 1W8TA 1HJGA 2UU8A 3LEIA 4OZOA 4Y3OA 5FWEA 1VBC3 2WINB 4L9BA 4P5HA 4OI1A 2ZX4A 2X5IA 3RDIA 1PVXA 2V72A 2ZX1A 1ZBA3 5F5AA 5EIYB 4FPCA 4Q4Y2 1HLCA 1LCLA 1QOTA 3GXUA 1LEMA 1LULA 1W2UA 4XFCA 3U14A 3VZOA 4CU6A 5F39A 1HV1A 2V5YA 3ILRA 1FOD2 4HETA 3GBFA 2FZ1A 2QFEA 2BQPA 4L0PA 5KC6A 3T4VA 2Y64A 1CZVA 2XLFA 4MGIE 3IIAA 1QHDA 5GLVA 3ZSJA 4E27A 2J1RA 2R071 2BFUS 2R30A 1A3KA 2Y6KA 1MS5A 5IK7A 3SCFA 4YVSB 3LFMA 2R0FA 4OHXA 3AL5A 2D40A 1GICA 4FFFA 4GH4C 4N9IA 2P3IA 4MZUA 4R4XA 4WBBA 3IIIA 1XSQA 4AFCA 3H0OA 5LY1A 4I2OA 4EV0A 1PO12 4EN9B 1ZRRA 2H0VA 3DECA 4QXBA 3ECQA 4Q29A 2C9KA 1SFYA 4COYA 1HQLA 2RS33 1W2NA 2R062 3RS6A 2UY9A 4Z1VA 2WKKA 1AYM3 4AQ2A 1JMUB 3FJSA 3DCQA 2QQUA 3RZMA 2HWD3 2MHFA 3TN93 4HKLA 2ZHNA 2VOVA 2D97A 4P14A 2H6BA 1OUSA 2NYYA 3NV2A 1LTEA 3ZMOA 4AI9A 2R32A 4EYUA 3LEGA 2DUPA 2JG9B 3U11A 4JGYA 2BGCA 4NHYA 3GBWA 3UL2A 3IPVB 1W0PA 1WCDJ 1QH6A 4IV3B 1ULEA 3JD71 4ASMB 2JDKA 3SCGA 1VAKA 3C8XA 1DLLA 3VDCA 4JV4A 4CZSA 3MIDA 4KG8A 3RZJA 3UKVA 1C8NA 1ZBA2 2EIGA 1WBFA 4AK3A 1MEC1 3CJIA 5BNOC 4TTGA 1DGWA 4PQ9A 4XZPA 3J9SA 2ARBA 1ENSA 4LTAA 4YVWA 2E33A 1C1FA 1DHKB 1H8TB 2OZJA 2VZVA 3E5XA 3M1HA 3WP5A 4EN6B 2QZ3A 1QJU1 2JECA 3J8F3 4LHLA 2QUOA 4M00A 3Q8EA 3DYPA 5FYMA 4AE2A 2WNUC 2PHRA 1US2A 1Y9GA 4C1XA 4YZ1A 3NNLA 1COV2 1S0CA 3Q8CA 4BQYA 5HPOA 1YI7A 2C5DA 4PIZA 5FP4A 1VBB2 3ZSLA 3POEA 1PNFA 1W6OB 2HWC2 1VAMA 2VNVA 3RZKA 4M01A 1AXYA 4FTBA 5C3SA 3ZYIB 1VBA3 1X9PA 1XJAA 1NT0A 5KHIA 3ZFGB 3O1SA 1W6MA 2X5IB 1W06A 5FMBA 4A6SA 3BTZA 5JXGA 4KG0A 1AR62 5HCHA 2XGXA 4YM0A 1BLZA 3LCPA 1RB8G 1AR82 2ARXA 2DVGA 1NZCA 3AMNA 4FQ4A 3GHNA 4AHXA 2RJ2A 1F4HA 1NLRA 3KT7A 5K7PA 3AL6A 4QPIC 5K0UC 5ISLA 3OG2A 2A70A 4PI0A 4WV8A 2IC1A 3GNEA 5FP9A 5T5OA 3LPFA 1AX1A 5DZFA 1QJX3 5C4WA 1OH3A 3ACFA 3T0AA 4M3CA 2GC3A 2VOWA 1ZX5A 4I3PA 4LKSA 1WLWA 2R16A 5L7OA 3ZXFA 4CDXA 1GP4A 4CCNA 1PZ9A 2NQYA 3MLLA 4MGYE 3ZYGA 2W1UA 1CX4A 2RS13 3BU7A 2DFBA 3A21A 3DPRB 3VBSA 1JZ2A 3WX5A 3NW4A 5ACA1 1V70A 3HWJA 1IOAA 2GNTA 2IXHA 1RMU2 1COV1 2H6CA 1AL0G 1YC61 1WLTA 1J58A 5HV0A 3RYPA 4LBKA 4N90A 2VD7A 3SH4A 4BJ0A 3CIHA 4LEJA 5FRAA 1OLQA 3WNNA 3VD4A 2RS52 5F8PA 5FPUA 1J83A 5GZCA 1PGW1 3WQBA 1PO23 1A8MA 4IXLA 1UCXA 3ES4A 5C9AA 1GP6A 4XDQA 4BCUA 2G9ZA 2JB8A 1RUOA 2ZEYA 2VW0A 3TOJA 4BK4A 3FHQA 1EV11 5LZ6A 2QTWB 2RVAA 1HB2A 4AEJA 1W8FA 1YUDA 1UOGA 4MUVA 4YVWC 1H4HA 2W39A 1VPHA 3H7JA 1XPWA 2XVKA 3GJBA 3T30A 1WMDA 3QBQA 3OYWB 1LKNA 4Y5SA 4BMBA 1RIRA 3N9OA 5DG1A 3NJYA 4Y26A 3DYOA 2JB4A 2WR9A 3FC0A 1REDA 1POQA 4YGDA 5EYYA 3O7OA 4YNIA 3TEWA 3H8OA 3ZLIA 3T1MA 4CU7A 1LRHA 4SBVA 4WM7C 5KXEA 2VMGA 4JX0A 1YRZA 1OLRA 3WVJA 2EA7A 2P6CA 2PAEA 3PTYA 3ZDSA 5DPNA 4YW1A 4Y4RA 1NY71 4Q4W2 4P08A 4MGZE 3HR9A 2ARAA 2YY1A 2SLIA 4PLOA 4WM8A 3QACA 5K0UA 2VBPA 4NO4A 2VR4A 4DEQA 1JHNA 2UY8A 4I02A 3VDDA 3N9NA 3O1UA 1Y9QA 2ZHLA 5I8SA 2RM21 1H9WA 5EPAA 5ANNA 2FDIA 2XR4A 2JDHA 4FPFA 1ZZ7A 4QB1A 1V6LA 2GDFA 5CFDA 4C1WA 5C4WB 2DUQA 1EAH3 1JW6A 1TEIA 1TMF3 3J4UH 4GH4B 3ZX7A 2UYBA 3OUIA 1ND2A 2R042 2WYFA 3MIGA 1D2SA 2D3SA 3V56A 1LENA 4BHPA 4P9WA 2MEV3 5B4NA 5IVCA 4XC9A 4LUMA 1Z7S3 5GM0A 3IZOA 1PX3A 1RL3A 4EQVA 1H8VA 1AXKA 1GNHA 1OOPB 1DQ2A 2GN7A 3OGVA 3ES1A 5CAZA 1S2BA 3RJ2X 2CV6A 4HANA 3ZXGA 3ZN4A 4CRQA 4FPOB 2DTWA 2BDRA 1JYVA 2WFF1 2Y8KA 4DFSA 5EV7A 1MS9A 1H2MA 3PUHA 3AJZA 5FYHA 1CPNA 5JI7A 3JCIA 2Y6GA 1MEC3 4NHMA 4AI8A 3AJYA 3OYWA 4UAPA 4DIQA 3A23A 1NYWA 1EV12 1LOCA 3K4AA 3MW3A 1BVP1 4LK6A 5CNAA 3ZXJA 4Z2AA 4UT5A 1L7QA 1XNDA 1JOJA 3O14A 1ZA7A 4CDXC 1V9U3 1AJOA 4XIKA 2A6VA 3NJXA 1XB9A 2VXRA 4OUSA 1ULFA 2Q30A 2RDQA 1UL9A 1W9SA 1ZNPA 2JWPA 3I2JA 3AKSA 1UZWA 4UF0B 2VW2A 4DZGA 2ADDA 2BOJA 2LM3A 4AG4A 4CP2A 1D4M3 1M4WA 1F2NA 2JG9A 4JRAA 5FZLA 4UW3A 5DAXA 3UKTA 3MYXA 5K0UB 1AZDA 3AP7A 3U0ZA 3Q9OA 4RR3A 2E7TA 3T2TA 4E8DA 1W6QA 3FLRA 4CCOA 4NHLA 5J7MA 1V6KA 2ILMA 4LIVA 5JSRA 1LJ7A 1VR3A 3K48A 3NAPB 1JXNA 4DUXA 5EXOA 4Q0SA 1GWKA 1V6JA 4HSLA 5LBBA 1UIKA 3B69A 1DF0A 1R082 4C91A 4QDQA 4NUBA 1KITA 2WS92 5KHKA 3ZYHA 2W2IA 1RXGA 2RR12 3JXSA 5CKMA 1JZ8A 4QPIB 4GULA 4B8EA 1OUXA 4CP9A 5KC5A 4P9IA 2O8OA 3H7YA 2QQVA 1Q5OA 2CHHA 4QB2A 4ZU5A 3DGTA 5FZ9A 3WCRA 5J37A 1QF3A 2VMHA 1KFXL 4MXWB 3ZSEA 4FPHA 3USSA 3PUIA 4HG6B 2PAMA 2Q0AA 1GNYA 2JD4A 5CKNA 4Y33A 1KD7A 2C6SA 1BK1A 4YGEA 1JYCA 3B01A 3E6BA 5GZFA 3VGIA 3SEPA 3D5OA 1PGL2 2GH2A 3ACHA 2VZQA 1ZBE2 1OOPC 3WEZA 1RUG1 4CDUB 1KJRA 5T55A 1TNFA 4E2GA 4LE3A 5EYXA 3AZZA 1UY3A 1POV0 3M7AA 1W0NA 3C7FA 3JBG2 5CVRA 3MPPG 4I01A 1OA4A 4AWDA 1RHI2 2P17A 1WMEA 2DVAA 3BALA 3TBDA 5FYSA 4GMP1 1QQP1 1VBD1 4CPBA 2ZGQA 2CDPA 5LB6A 1QMJA 1DQ0A 4NPLA 3ZN5A 3IT8A 2Q4SA 1Q56A 2OKXA 2ZX2A 3M2MA 4JQRA 3N9QA 1PIV1 3IAPA 4QPWA 1ZBA1 4ATFA 4EE2A 3OEBA 2MEV1 5FPBA 2VE1A 3PU3A 3VHNA 4LKEA 3H42B 2YBPA 1G9AA 3AKTA 1E57A 2VUCA 1BVVA 2X8KA 3PJYA 5SV8A 3NVCA 1IG0A 3KVBA 2R041 5FMOL 2ZKLA 2B9UA 3B02A 3OF1A 4B7EA 3VBHB 4B1LA 4GA9A 5FO9B 4CCEA 3LA3A 5FUIA 1DQ5A 1QOOA 5A1FA 2VZOA 5FY8A 3U1XA 1CAXA 1WW4A 4QDRA 2WZR3 3DEMA 3H8XA 4H3WA 3VDDC 1GZCA 4CCKA 3R4UA 1XXNA 1UX7A 4OLLA 2VZ1A 3SEEA 4AEMA 1ZM1A 2A71A 1FPN2 4HT1T 4PI2A 1CN1A 2PN5A 1AYN3 1SCRA 1RJ8A 4CXXA 2GNDA 2VMEA 3IMNA 1DGLA 4QHOA 4YRDA 1LECA 3U78A 3VHOA 3FBYA 3WDWA 2RJLA 2G9GA 2WYSA 3NAPA 2VTFA 2NP0A 4D6QA 5BNPB 1O4ZA 2WLQA 5KWRA 5GLUA 4V2VA 2VULA 4QQ2A 1PMIA 2FMDA 5EHDA 1RTVA 1U5YA 1M06G 1VBA1 3LZZA 3RGBA 2KR2A 1O59A 2YG0A 4FPEA 4Q27A 3WDUA 2AEYA 2YGMA 4LBOA 4Y5Z0 3KV5A 1OLME 2E51A 2N7GA 1JZ7A 2VQTA 3I8TA 2E63A 2WBKA 5BNNC 2DCYA 4WM8B 4MXWA 2I2SA 2RV9A 3FLPA 3J8F1 5IVEA 4ZHNA 3UGGA 4XXAA 5FMDA 4COWA 2Q8EA 4FFHA 1J3PA 1PHMA 1DG6A 2RDNA 4H14A 3KMHA 2CAVA 4K9SA 2FD8A 1KEXA 2VOXA 5J1XA 2QQMA 4TLFA 2F6BA 4I0BA 4FOQA 2CL2A 4IV3A 2V4VA 4JDNA 1OMIA 5LATA 2Z42A 4PLNA 3UK9A 2BBVA 1P8JA 2EIDA 4CXYA 5JOXA 2YXSA 4A6OA 4CTEA 2BNMA 1B35C 2VGDA 2AZ5A 3ZDVA 4AHYA 5E1RA 5DAVA 1UNBA 5EWSA 2FCVA 2HLEA 5AC92 2DCKA 3THPA 2K46A 2B4KA 2YPJA 3BPSA 4F3JA 3VBRC 3AKPA 5CA6A 4HPKB 2Y26A 2ZCWA 4Q5OA 5KHJA 2Y6HA 5IAVA 2XONA 3KZ4C 1ASJ2 3KCXA 2Y0IA 1T2XA 5A7WB 1DGWX 1PMHX 3ACGA 1ULPA 2ZHMA 4K6BA 4XJWA 1UY1A 2D6OX 1HRV1 4PDWB 3HNYM 1V6OA 4EROA 4KMQA 3P3NA 1O91A 4WVVA 2XHKA 4NVPA 1RVF3 5JZGA 4HVOA 2K2SA 1IPKA 2G1MA 3MW2A 1A78A 1MPXA 3W59A 1NXD1 3ZPOA 5G05L 4Z92B 3WZ1A 1W9WA 2YROA 3QCWA 2WAAA 3OCPA 4WVWA 1XNKA 2MNGA 3RG0A 2LRPA 3WLUA 2ZEXA 1GWMA 3U10A 3UGHA 2ZOEB 1XU1A 4M3CB 4A7ZA 1O4TA 1CZSA 5FZ3A 1ND3A 4DNYA 1K3IA 1W2TA 2GAUA 5JR2A 2RDSA 2VY0A 2XJSA 3R4DB 4GMP0 5T5LA 3BTYA 3ZSMA 3MW4A 2EXIA 2ZMLA 3TAYA 5FZ8A 4IE6A 5IWFA 4YG0A 3ZXKA 5HV4A 4IE0A 1DGRN 3E6CC 4P9LA 4AVVA 2WN3A 4IQPA 1LOBA 3UJQA 4BXSV 3K3OA 4QX1A 2VZ3A 1ENQA 4N43B 3H3LA 1DFQA 3ROUA 3B9CA 1Z78A 3HJRA 4RL7A 2DWRA 1HXS2 3JBG3 3IAQA 3QH6A 5C9AB 2IXLA 2QBXA 2WT1A 1BJQA 4MYEA 4BZ4A 3WNXA 4LE4A 1GKBA 1TME1 4W6YA 3D8CA 1SZBA 3NJZA 3B93A 1ULCA 5DAQA 5FZ1A 1G9CA 2ERFA 1YHFA 5C3OA 1O6UA 4DXRA 1LU2A 2XUMA 3O1VA 5FYIA 4CDQA 4N7UA 1U0AA 2PQSA 2VL4A 1N3PA 3AVSA 5HCBA 3VLBB 3H3UA 2NM1A 3MBWA 5IYYA 2G19A 5FMOS 4JVAA 4V2WA 3U37A 3NV1A 5F3EA 4LBNA 1X36A 4DINB 1EY2A 1JZ3A 4TN7A 4BE3A 1KFUL 1BBT3 1NLQA 4X8NA 4ZONA 3AXEA 3UT0A 4DOUA 1QJEA 2P5BA 3WDXA 3ZXAC 1FI2A 1NA1A 4AAPA 2IUWA 4QWNA 2ET1A 3WP4A 2RS11 2RMU2 3WOGA 5AVAA 2E26A 5DDJ2 1F9KA 5JI9A 1HN0A 4BQ5A 4OI0A 2LS6A 4AGRA 4HXCA 4DS0A 1WCQA 4O7XA 4CXWA 1CGPA 3WW3A 1AR61 4FCAA 3NSTA 4B29A 4L2NA 5LEJA 1IQAA 3MF9A 5T50A 1PO13 1RC6A 5DMYA 3PTRB 4HZFA 2VCMA 1GYKA 4Y24A 2JDZA 4A3ZA 1YFWA 4XTPA 1EUUA 2CWMA 5EFUA 3RPQA 3RQ0A 1K12A 4XFGA 4OHYA 3SLIA 2WZR2 5E8AA 3PMEA 3WNKA 5AFBA 4H7MA 1XYOA 1URXA 2VZSA 4A3XA 1ND3B 1EPWA 3ZFEA 2AREA 3PVBB 3MIFA 1QEXA 1KDMA 1PZ7A 2YC0A 4LA3A 5FZOA 4XBNA 4QGNA 3W20A 3E6DA 2EIBA 2BNOA 3T08A 1OOPA 3AMQA 4IE4A 1JYIA 1GV9A 4M4RA 2UWAA 2CY6A 4COVA 1CONA 1W8ZA 4AFBA 2PQQA 2J42A 1W0OA 2Q1MA 3LQCA 3POFA 4X6QB 1NQDA 3PL0A 1GLHA 4ARXA 1S0BA 4LHSA 3RVHA 4YFZA 4N53B 5DZEA 5FZHA 2DU1A 2D6MA 4Q4X1 5FR3A 2JIJA 1HQNA 2D7FA 3IPVA 3LD8A 1OXCA 1SLBA 2FZ2A 4Q4V2 4D69A 1VBE1 4URAA 4AFDA 4SLIA 4MHUA 5ANQA 2IXKA 4AQSA 1WCKA 4LOTA 4MG2A 1CIWA 4KBZA 1AX0A 2CWSA 2G4IA 3VZKA 4ZS3A 3N9MA 2CAUA 2DFCA 1HRV2 2ZGKA 1BHGA 3OD4A 3GGLA 4ITCA 2I74A 2CDOA 3POBA 4LBQD 4QX0A 5BNNA 3S0MA 1MS8A 2BP6A 3BPZA 2VMFA 1YWKA 1NY72 3GM8A 1TMF2 2PLV3 3EO6A 2PA7A 4HONA 5FYUA 1UZ0A 2VVEA 2QQJA 1O3QA 4Q1PA 2EIEA 1K5MC 3CF6E 1HRV3 2A1XA 2X53S 2VM9A 1KXGA 2ZGUA 3LAGA 4N9HA 4LA2A 4FOVA 1DP0A 4ZPIA 5FLJA 5I0RA 1HKDA 3NWKA 4XBQA 5I91A 3NKGA 3VDBA 2VZUA 3DKWA 4BK5A 4D7YA 4FP3A 5JWPA 2DURA 2AUYA 3ENRA 2AEZA 4K1YA 1FNZA 1S55A 3AP5A 1V6MA 4W50A 3ZYRA 1UU6A 1IPJA 3AMMA 4TLGA 2WO2A 4AFAA 2WZEA 4HKWA 5IFTA 1VE0A 4H55A 4QHBA 1W8WA 2RDRA 3THDA 5JAXA 4YG3A 3C7GA 2HBUA 1W9TA 2W87A 1PNGA 2JE7A 2WQ8A 2X5IC 2XQXA 5FZMA 4C0HA 4JRLA 1JZ5A 1W8NA 3A22A 1BEV2 4D8MA 1O4YA 1FXZA 1N3QA 2BRTA 3CL1A 5A6ZA 5C6CA 1Z7S1 4G3YC 4L99A 5D8AA 4AEDB 4D7SA 3SH5A 3M4FA 5FY1A 1QH7A 3C7EA 1VBA2 1K5JA 1WMXA 1R092 3T4HB 4ONUA 3TN91 2RJKA 5FYYA 2XBO3 4IDZA 5GZDA 5KR7A 2NLRA 2V73A 2W46A 4D94A 4IEQA 1T6GC 3WQ0A 4IGQA 1JUIA 2RS31 4RR3B 3ZKUA 3Q8AA 3WDTA 1WW5A 2DBIA 4EJRA 3NV4A 1REEA 1QJU3 2W1SA 3OUHA 4ZXKA 3NNMA 3TYJA 2OUJA 1SPPA 3ZFEB 1BYHA 3JU9A 4QU2A 4YZ5A 2IVJA 5L7OC 2F17A 2ZGMA 3ON7A 4PBPA 4QPYA 2J1TA 3I2DA 2Q1FA 5CYYA 4MGKE 4KWLA 2A6XA 1QIQA 4UFLA 3I7DA 1RUD1 3ZIXA 5JPMB 1S0IA 5DUUA 5GLWA 5A7PA 3LDKA 4X6RB 3DKQA 1JOBA 4P9YA 1MZFA 1QDCA 3VKNA 4K7JA 1C5IA 3I2HA 3AXDA 1R1A2 3FFZA 5E16A 4LITA 4ATEA 3HMYA 2W9XA 1NCRC 3WD5A 3VBUC 2RS51 2FBEA 3GZEA 3I2IA 1IG3A 4FP2A 2IVIB 2AR6A 3ZYFA 1ULOA 1W8HA 2BERA 4F83A 1HW5A 1UXXX 5FP7A 3R0RA 3VZLA 3I54A 2W68A 1VRH1 4O61A 2GU9A 1XU2A 1H1IA 3NL1A 4RA0A 3GF6A 3O1MA 3DXUA 2JG9C 5FMCA 1HRI2 1REFA 2VUDA 1GR3A 1RUH2 2W47A 3BODA 3JB8A 4RGAA 1ULGA 3OBZA 2CGNA 4Y22B 3E5QA 3T2QA 1DLCA 2XBO2 3TWIA 4CP1A 2BEOA 2WNUB 4E8CA 5IK8A 4BWOA 4HN0A 4YVWB 4AVCA 3N7MA 3ZR5A 1AL23 2PHFA 4LNVA 1MZ6A 2XPJA 1SLCA 1DYKA 1QJY1 4DPNA 2QKDA 3BOWA 2ZABA 5JIAA 3LB9A 5FY7A 4MHRA 1UO9A 1UU5A 3OTFA 3SKVA 4AEDC 2VOKA 3BCWA 4XFHA 1YIFA 3SH3A 1KGYA 3LDBA 1MVEA 2ETEA 5HBAA 3MZHA 4QQLA 1EUTA 1ND2B 2ES3A 3BB6A 1CD3G 2QNKA 1H2KA 1W6MB 2G9FA 2JD9A 1QU0A 1I5PA 3CMGA 3OJBA 3UYJA 4UFMA 3VHRA 2GNBA 4B4PA 2VBDA 1RVF1 1L3JA 2YU2A 3VN4A 2HBTA 4S2GA 2GH8A 1VBD3 5H9PA 1YYNA 2WQ4A 2Q1ZB 1OQ1A 1UXZA 2Q8DA 5FZDA 4A44A 5FWJA 3F2ZA 4CCDA 2J22A 3EHKA 4ZU4A 2Q5TA 4HLTA 4FOWA 3WQ1A 3LFIA 4BA6A 2XL7A 2PLV2 5HI0A 1PVC2 5JDBA 2HH9A 2J1VA 1SPPB 1VRH2 1AX2A 1V6IA 3MV11 4I0WB 3DPRC 5IAXA 3WNOA 4PJYA 4LO5B 1W6PA 2YMZA 3ITQA 1GSLA 4UWDA 4OHVA 3KV9A 4Y1ZA 2R073 1C8M2 1UWWA 2XJPA 4XAAA 4FPKA 5DXDA 4HVQA 2BGOA 1PIV3 1B35A 1JH5A 3CBNA 2HWF3 2IXJA 2L9LA 3Q8BA 3SC7X 1OT5A 1NCRB 1G9FA 5DAPA 5FFOC 3APBA 2W1QA 3H3ZA 4FBFA 5I93A 3ZN6A 1JN2P 4BISA 3C7OA 4BU2A 1NAEA 4HPKA 2JDUA 2OQ6A 4IE7A 4LK7A 2A7AA 1QDOA 2JIGA 1IQDC 1ZZBA 3GHMA 1CJDA 3POGA 5GKAC 5L9VA 1F35A 4NJ4A 4S2HA 2XJRA 4QMAA 2IXCA 1DBNA 4R9BA 3T09A 1VBB3 3I2KA 2NN8A 2DU0A 2JE8A 5A7OA 3D6EA 4N53A 3KCCA 4LO7A 2XWBB 1XRUA 3FZ3A 2R49A 3ACIA 3LIGA 1DCSA 3BUCA 4HBNA 4M0NA 3RI9A 4QT6A 3B3QE 1LGCA 1W99A 3KV4A 1XNAA 1SDDB 1AR71 4X8PA 1KS4A 1UX6A 2HWD2 2VU9A 2E7QA 4NRMA 1XYNA 4NOTA 4QPGC 1SMVA 2FDHA 2ZEZA 3PUSA 4IEUA 5D8AC 4XEZA 2JICA 3I3BA 1AR93 2PHXA 4F8AA 4KBBA 2VNOA 1U5ZA 2WQZC 1VAVA 2QCSB 2RMU3 3KCYA 4KWJA 4FTSA 2PHTA 1CAUA 4XUQA 1WA4A 3ZFFC 2JX9A 3MUY1 2BPA2 1Y3TA 4IE5A 4IL7A 2XH6A 4LR4A 5FY9A 4CSWA 1AR91 4Z82A 3KT1A 5BUVA 2D5HA 5FZAA 3KF5A 2GC0A 3HVDA 3MHZA 1W03A 3O1OA 1F31A 1QNYA 3F95A 3AZWA 4XUPA 4XQWA 1TNRA 4WVMA 5FXWA 4YVSA 3TEXA 2DYCA 3U4SA 4I30A 4MXVA 4XE9A 1C5HA 4BQXA 2DV9A 4EZHA 5KXBA 3W5NA 5F5IA 1MACA 3OY8A 4CDWB 4D6SA 4L11A 2DDUA 4LKDA 4XZUG 3UV9A 1LOGA 5C4WC 2XG3A 5DUVA 4LO6B 2YU1A 3KQRA 5A3NA 1NCRA 1PGSA 1RUC3 3RI8A 4A4AA 1W8OA 3HNMA 2VUAA 1H1MA 4QQPA 5LRRA 4NE9A 1QXJA 1DYPA 1PVC3 1FAYA 4R8HA 4RS5C 3L9JT 3P1IA 1WGPA 5FXVA 3VZMA 4A41A 1YIPA 1AF9A 3VD9A 1LGNA 3AX4A 1OA2A 4UFKA 2W94A 1UY4A 3POWA 5DABA 1Y9MA 3NNFA 3OOXA 5LY2A 1C28A 1W3XA 1Q8PA 1FYUA 1NCQA 1X8EA 4QXKA 1W6NB 3HBZA 4NHKA 3M3QA 4J1XA 4N43A 4BQ4A 4UFJA 2C4XA 3N9PA 3M8LA 2WA3A
chains in the Genus database with same CATH topology
4XJZA 1UPSA 1PVC1 3AYEA 4E2QA 4O9EA 4HK9A 1NA1B 3FFQA 1H0BA 5EZWA 1PIV2 2WA4A 3V65A 2KXLA 1ND2C 4DY5A 3I4IA 2D6PA 2VPVA 4Y1VA 5CU1A 1NLSA 4ES9A 1UKRA 2XB6C 5ACA2 5FO8B 4HL0A 3VBUA 1LHNA 4M3CF 1MVQA 2A5ZA 5ABJB 5FDBA 1SLIA 2WC2A 1PK6B 4OHZA 4AI0A 1FOD3 5CADA 2BNNA 3IDEA 3NV3A 1VBC1 4GWNA 2FHRA 1IS6A 3RWNA 3ZSKA 1AXZA 1W6QB 3GZUC 3DV8A 4META 1DIWA 2BWCA 4BMEA 3D0SA 4GB31 4UW6A 2YUEA 3EJKA 1CAUB 2B8MA 2HWB2 4XFAA 5L73A 1AR81 2ZMKA 2KA3A 5I91A 4KGQA 4COUA 4CYDA 1Q43A 3NKTA 1HIXA 1TME3 4LO8A 2R6QA 2OZ6A 3AP4A 3FUOA 2JG8C 4XMAA 1POV3 5C8WA 4MV2A 4XF4A 3AMHA 3PHMA 4Q26A 1AYM1 5A33A 4XFBA 1RUF1 4XF0A 3USUB 2R1BA 3W58A 3JQXA 2HWC3 1HRI1 4XIOA 1G8WA 1AJKA 2ZS6B 4AW7A 5JLVA 4IERA 4K3UA 3HN1A 2EXKA 1MZEA 3BIWE 3DL3A 5BNNB 1RUJ2 1S2KA 1UAIA 1IHMA 2LALA 2XKOA 1VIWB 2VVDA 1D2QA 1ZRCA 1XE7A 3H1YA 2EXHA 4ZKTB 4LBQB 4Y20A 1V9U1 1KDKA 4PDWA 2ZX3A 3S7EA 1EPZA 5JOWA 1JUHA 1BBT1 2OIIA 2I45A 4PBOA 4YFWA 1X50A 5JZGB 5J09A 4I09A 2RR11 3FBMA 5A3LA 5HXVA 1B35B 2NPIA 3MI8A 1S0FA 3AP9A 3RYKA 3X29B 3SISA 4YW5A 4AHZA 2BW8A 5FOJB 3VBHA 2R061 1I3HA 4FQZA 3ALQA 5ABJC 1ONAA 4AHWA 4KWKA 3LSEA 2R063 4XBLA 4IEXA 1SFNA 2YV8A 4QQHA 3QH7A 3B9IA 4Z07A 1NCQC 4QGLA 5C8CA 1AVBA 1SLTA 1H1AA 1RUC1 1OA3A 2PHUA 4OVEA 3RZZA 1GZWB 4XYXA 4NWWA 2GZWA 3VDDB 2IFWA 1FT9A 5I0SA 2D6LX 4WM7A 1U5XA 4XETA 5HCFA 3SITA 5ACA3 1O3TA 4MLOA 2MPFA 1CAVA 4R4ZA 4Q4Y1 1AL21 4AFMA 1RUE2 3OPZA 1ASJ1 4BLIA 1OFNA 1UU4A 4XOGA 3V0BA 1RMU1 4LUKA 1CESA 2D98A 4CEWC 1CAWA 4ORFA 1TQ5A 2BWAA 1DQ6A 4BIFA 5DUXA 2UYAA 1IKPA 2A73B 1Q8SA 3OBRA 5H9SA 5CFDC 1YNAA 2PHWA 4XF3A 3VBFA 3GALA 2HWF1 2ZKNA 3MLJA 4W6WA 3RMXA 1SQ4A 4XFIA 2QDRA 4LLOA 1CQ9A 1EP0A 4N43C 5JOZA 2FQPA 3H1WA 1FPN1 3EXUA 2EXJA 5FCCA 4UBHA 1BEV1 3WP3A 3WCSA 4K21A 3VBRB 4WZCA 3WQ7A 1VBE2 4LBQA 1N3OA 2A3WA 5IUQA 4Q4X2 2VH9A 3R05A 3SMHA 3D4KA 1PO22 4INDA 5E89A 4UW4A 3B7MA 3PMSA 4IEYA 4P9JA 4AQTA 2ZHKA 4EN8B 2NMNA 3C3VA 4LBLA 1GANA 3KS7A 1ZZ8A 2OPKA 3IM0A 1NCQB 4FPLA 3LWCA 4Q8LA 5FLIA 5BNOB 5J96B 3H1MA 1TMF1 1OPOA 2E53A 4IEVA 4XHXA 5GZGA 5AC91 2NMOA 1HQWA 1GFF2 5IK5A 3VKMA 4FSJA 1BQPA 1CAVB 1MS4A 4I3GA 1QGLA 1YJLA 1N1YA 2B46X 3ZVXA 2DTYA 4LBMA 2ZGRA 4OZXA 3WW1A 2UWBA 1PZ8A 3MIBA 3VBSC 1FMD2 2K0GA 1RUE3 3AYCA 2ENRA 3MIHA 4YGBA 1RUD3 2ZGTA 5ABJA 1V9U2 1KQRA 5J3UA 2XBO1 1LR5A 4NN0A 5EJ3A 4S2DA 3VL8A 3O0XA 2HKXA 2ZACA 4WVZA 4KU7A 4JTOA 3V0BB 5I8YA 1MS3A 5C9AC 1UIJA 2HEVF 4R9AA 2ZJCA 3WY6A 1F5FA 2C1FA 1CJPA 1R081 3ZO0B 1B09A 3DN7A 3AZVA 3FMGA 4MH0E 4XXPA 1D0GA 1LEDA 4ISRA 4K1ZA 4Q4V3 3VBFB 3RNSA 2GN3A 2Y0OA 5FQ0B 3RJRA 4JGYB 4FOYA 3QOPA 3GBGA 1A6CA 4QQOA 4FVVA 3VZJA 2WS93 3UJOA 1WCSA 3USUA 1BZWA 1RUG2 1LB2A 1O5LA 2P3JA 3FLTA 4O9GA 3NO8A 1PGL1 4LO4B 4Q0VA 3SXWA 2BFUL 2D3PA 2RE9A 4N7IA 3BTAA 3IKWA 1O7FA 5BPXA 4B7KA 4PCRA 3FUQA 2DF7A 3PLQA 4IV1A 4KQ7A 1MZ5A 1ZYBA 4OHWA 2HWE1 5AVPA 2E7AA 4JC1A 3ST7A 3PVOA 4YW4A 2RS32 5A32B 3R6SA 3LKJA 1BMV2 4AXOA 4PF5A 1ZA4A 1MQTA 1X82A 3E97A 1VBE3 5K8SA 2ZAAA 1QJU2 3CJIC 5BNOA 5GZEA 1RUH1 3N7JA 3WDYA 1NOVA 1FNYA 4HN1A 2VMIA 4AVTA 4CEWB 3WV6A 3WW2A 4Y4YA 2AENA 3PVEA 3W9AA 4D7TA 2IWGB 4TSVA 5SV5A 2ZGLA 3MIEA 1G9DA 3H50A 4U2AA 2UWCA 3S6PA 3AB0A 4EWDA 3QD6A 3JBG1 1FX5A 1IGOA 1XNCA 1RUH3 3JD72 5JSOA 1OD5A 1RGSA 4KGGA 4QD2A 4DRVA 4BYYA 3OGJA 1N1TA 1R1ZA 1S0EA 2QVSB 2JXAA 2GC1A 1GQGA 4ISQA 4XFFA 3VL9A 5CFCA 2HWD1 1AR83 4URTA 2D6KA 1NG0A 1ALYA 3VBOC 2RHPA 5FPZA 1RUNA 1YXWA 1SBEA 3JZVA 4HVRA 1NE4A 3MFCA 1S1AA 1MS1A 4HKOA 4B3NA 3WUDA 4JTNA 2HYKA 4F7ZA 2BVVA 2IZWA 1DGRA 3AFGA 3OY8B 4CDWA 2Z2SB 1K5MB 5FAXA 4NPRA 2WNUA 3J8F2 4IV1C 4RSUA 1VB2A 1DZRA 3MGUA 4HSJA 2FMYA 5FOBB 4A7YA 4Y1UA 3VBUB 3U4XA 2XJUA 1RUI2 1J3QA 3IWZA 1BXHA 2DVDA 4QX5A 5LK5A 1GQHA 2A3YA 2XVGA 4BQ1A 2B45X 3TNQA 2C9AA 5HCAA 2PTMA 1VBD2 2R1DA 4PIXA 4CEYB 3ZXDA 1TE1B 4YG6A 3WUCA 5KHGA 3O12A 5D1IA 2BTVC 2XJTA 1QJX2 3OBTA 3JQWA 1QKQA 2ATFA 3RMYA 5I0TA 3RRDA 4C0BA 1UZYA 1WUVA 4FXKB 1OFSA 5JSPA 1BMV1 1OI6A 4A2UA 4RR3C 2HWE3 4DMIA 2ZX0A 2E9QA 1UZZA 1Y7BA 4EWEA 1AYN2 3ZFEC 3J26N 1WW7A 4RHV2 5KHHA 4LT5A 2A6YA 2K9ZA 2B42B 1DDLA 2A3XA 2AYHA 5T5PA 2RS12 1N47A 4YW2A 2ZAHA 5L36A 2WS91 2YGLA 4D3WA 1APNA 5J36A 4G4FA 1QXRA 3A4UA 1GZ9A 5JMCA 1D4M1 2PFWA 5DUWA 5CB7A 1ZVFA 1G9BA 2HEYF 4Q4Y3 2DUOA 4JGYC 3OD0A 3LA2A 3M3CA 1H2NA 4YARA 1UW8A 3MDPA 4LHNA 5BXXA 1RJ7A 5A33B 5C33A 4R9CA 1RHI1 5K9YA 4Z2WA 1NXMA 2WFPA 3QLQA 5JPNB 2HEWF 2Z79A 3CJIB 1IZ3A 1GNZA 1XE8A 1ZZ9A 4Q8KA 4HK8A 5H9RA 1UF2C 3R4SA 2D6NA 3JUUA 4AF9A 4XQ4A 5JOYA 4H7LA 3VUOA 1QQP3 5C8CB 1SACA 5E88A 2ZTNA 4ZU7A 2C0ZA 3ZFGC 2BUKA 4K8FA 1RUF3 1H2LA 1J1TA 1HXS1 3WP6A 3EQEA 4CEYA 3PNAA 4L97A 3EBRA 1GZWA 4OFGA 1VJ2A 4XJ8A 4BLJA 4CDUC 3AZXA 2IXIA 1QWRA 3G7DA 4B4QA 2Y38A 1J3RA 2AH2A 1RUF2 2KM2A 1HX6A 2GNMA 2WLPA 2QJVA 1UN1A 5LK7B 4AQ6A 1O3RA 1DU3D 3A0KA 1YJKA 3ZFFA 3ILFA 2CYFA 4XJAA 2TNFA 3PVNA 1ZBE3 1J1LA 2DCZA 2TUNA 2HWB1 4JDMA 4FTEA 3AFKA 3S30A 2EAAA 4GALA 5B2GB 3S7IA 3IDCB 2QDNA 1LHWA 1UPIA 3FX3A 4YVSC 1S0GA 2B39A 3N35A 4R9DA 1QNWA 4G9SB 4IEPA 1BCXA 1IS5A 2CGPA 1AYN1 1FV3A 4GKYA 1A8DA 3E5UA 1KJLA 1I5ZA 4AI1A 3ZYJB 4GB32 4WM8C 3VBRA 5CIRA 2ZGOA 3V64A 4AVBA 3N36A 4CDWC 1LHVA 3LOIA 4GQ7A 4UW5A 2PHLA 2VECA 3LGRA 3O5SA 2B5HA 3P3PA 4AVAA 4KU8A 1FMD3 4CEYC 1D4M2 4S2FA 1PO11 2YDEA 3A0NA 1AR92 3OGGA 3H8UA 4IV3C 2GMMA 2WNVB 2W0XA 1CVNA 2JJ6A 3INAA 4AGGA 2EVXA 2CNAA 2GSYA 2PAKA 4FT8A 1YFYA 3I59A 2R072 4Q4V1 1F5JA 5DDJ3 1Z7S2 3K51A 4QPGB 1DZQA 3WINE 1R1A1 3IDBB 4M3CE 5JVVA 3MFAA 1R083 2D3RA 1VRH3 1YFUA 4XQDA 2PYTA 1R1A3 1C1LA 1LU1A 1V00A 4IESA 3ZIWA 3L2HA 2XVLA 5F6LB 3ZMNA 1LODA 4YYOA 1RUC2 2BVBA 1UD1A 4Q2FA 2JKBA 2RM22 3KB5A 2QZ2A 1QJX1 3ZFFB 1S0JA 5BNPA 1HDKA 1UKGA 1RUI3 5D8AB 4AEDA 1PK6C 2HWE2 4Q4X3 2HWF2 3T1LA 5DZGA 4GH4A 5CG9A 4QGMA 3V0AB 1LHUA 4DRRA 1DQ1A 4Q4W3 1ASJ3 1SLAA 4Q1RA 2XWJB 1YO8A 1AL22 3N7LA 2LTNA 1EAH2 3WW4A 1BBT2 3CO2A 3WR0A 3AYAA 1H4GA 1OQEA 4NR1A 4XHBA 1Z0HA 4Y20B 4E4ZA 1EYBA 3URFA 1G86A 3C2UA 5C8CC 1OQDA 4BM8A 3CJXA 4EN0A 2VW1A 2HWB3 3MICA 4CDXB 5JCTA 3ZPYA 4ES8A 2P37A 4COZA 3KSCA 2PHDA 1AUYA 1ZZCA 2WNVA 2MEV2 4CDUB 5T54A 5H9QA 1ENXA 3VHPA 4YSFA 1NA1C 1Q8VA 3JD73 2F4PA 2R043 1ULDA 2GALA 5FLHA 2WJSA 2IFRA 1JBCA 1WD4A 2D93A 4YGCA 3B5LB 1JTZX 1ZRFA 1LOFA 1I9RA 5FQ0A 4Y22A 2E6VA 4YW3A 3DF0A 3I59B 3KD4A 4OULA 2JE9A 1AR73 1RUE1 2WNEA 1YCIA 1C8M1 2Z5WA 4P9XA 4AGVA 5F5QA 2RMU1 4WM7B 4TZDA 1LOEA 2VNRA 1FV2A 2XLGA 5I8TA 4RS5A 2PELA 1H30A 2SBAA 1VBB1 3ZXLA 3MPBA 2HJIA 4IEZA 3TB0A 3NAPC 2WSVA 2DVBA 2RR13 4I0AA 4TYSA 5AC93 5KXCA 1XQNA 4R52A 4YM3A 1CAWB 3SHRA 2JG8B 1TME2 3M3OA 4DXZA 2WIIB 1YFXA 2Z69A 1VALA 4GIQA 3WDVA 2CTVA 4RQPC 1OHFA 4CEWA 2OW4A 3WHUA 2WT0A 5FTTC 5GLZA 5CFDB 1QJZA 1RUJ3 1CR7A 4JGZA 4QM8A 5F1RA 1ND3C 2WNVC 1FMD1 1OPMA 5DG2A 2ZGPA 1NQJA 1K5MA 1IS4A 1DQ4A 4XF9A 1RMU3 4KL1A 1ENRA 2GC2A 1H8TA 3ZN6B 4FPYA 2WZPP 2P34A 1MR5A 3M70A 4CDQB 1ZREA 4MX3A 5T5JA 5JZGC 2DCTA 2WSUA 4CDUA 2GMEA 2QE3A 3TN92 3VKOA 4IEOA 5JR7B 2VVFA 4XTMA 4W65A 4E2SA 3VBHC 5FBZA 4CP0A 1PO21 1Q8QA 3HT2A 1C3HA 1WMFA 1RHI3 2OA2A 3GZTB 5KBFA 2CGOA 3PJQA 4C90A 2QQPA 2DVFA 5F9TA 1QXPA 3FHIB 4Q0PA 1N1VA 1WD3A 1SBDA 2VG9A 1C57A 4JAAA 1DZTA 1U5IA 1V6NA 4J6GA 3DPRA 3VBSB 4Q4W1 1X7NA 2EALA 4YZ3A 2XJQA 3WXPA 4LBJA 1LOFC 4HMZA 5I0UA 3ZFGA 3M3EA 5GJ6A 1SDWA 3JB4C 3MF6A 1W39A 3N7KA 4NWVA 1R091 2WFF2 4P9GA 3ELNA 1C8M3 2GMPA 4YLZA 2JG8A 2XJVA 1AHSA 4WVMB 5GALA 1D4VB 1G6NA 4GWMA 3AP6A 3CEWA 4JGZB 4FAGA 3KGLA 2P2KA 4UBGA 4XJUA 4IETA 1D0HA 5LRSA 2TEPA 5F6KA 4J1WA 1X8MA 5L7OB 3ME2A 3D82A 2O1QA 3HAGA 3LSDA 5CFCC 1EAH1 2D43A 3IBMA 3UKNA 3GYDA 3VKLA 4FXGB 2ZMNA 2OYZA 3AKQA 1W6NA 1IS3A 1UMZA 1WLCA 2WWSA 2ZPXA 1KS5A 1XYPA 2WZR1 1AR72 2O0OA 3VKFC 2UURA 3CNAA 3RYRA 1BKZA 4Y1XA 1QY4A 1QQP2 1SCSA 3IN9A 2OUHA 4Q0QA 3DUIA 5FO7B 4RD7A 4AI2A 5T52A 1N1SA 3G6JB 2R0HA 3ATGA 1SBFA 4LLFA 3GZAA 2Q8OA 2D5FA 4M0HA 4PDWC 3BOPA 1Y43B 2XLAA 4Z8BA 5BNPC 1RINA 4DY3A 5FREA 4AI3A 1PK6A 2ZGNA 1GBGA 5L19A 1VBC2 4JDOA 4BOWA 3WG4A 3AKRA 3FE5A 4OI2A 4AVSA 3FWEA 4IEWA 1C4RA 3RSJA 2W52A 1QJY2 4L92A 1EV13 1MQTC 4LHKA 4E9KA 1MS0A 1RUI1 3LOBA 1XNBA 1RUJ1 2ZZJA 3WG2A 1AR63 2LUWA 3AM2A 1HV0A 3AMPA 4RGGA 1WLDA 5LEKA 2VNGA 1I6XA 1WW6A 4XJ9A 2VQ0A 2XKPA 4FPGA 3D0JA 4JCKA 4UXAA 4B4RA 1PGW2 4XF1A 3AK0A 4RQPB 3HQXA 2A6ZA 3VZNA 1COV3 4DB5A 4RHV3 4RS5B 3HIFA 1RVF2 5IK4A 2PLV1 2A75A 1IKQA 5T3NA 2YHJA 4Q0UA 1VB4A 4HFSA 5DDJ1 4MVTA 3ETQA 3VV1A 3MLKA 3O0VA 3KLSA 5FPXA 4XW3A 3VBFC 3M3IA 4KNCA 1LHOA 5CBLA 3N3HA 4RHV1 3WT3A 1VP6A 4WZFA 1MEC2 4CDQC 2YZ4A 1R093 2TBVA 3KGZA 4FO9A 1J59A 1BEV3 3VBOB 4ASLA 3HT1A 4FPJA 3N4MA 1NE6A 4QPGA 4K20A 1W6OA 4RFT0 1RUG3 2O8QA 1YI9A 4EWAA 1Q3EA 2ZGSA 2V09A 2A6WA 4YM2A 3AYDA 1AYM2 2HWC1 1Q8OA 2WT2A 1RITA 4DQAA 4GMP3 5JIUA 2NZ9A 4IV1B 1POV1 5KXDA 1LESA 4W6XA 2EF6A 4KH9A 4YM1A 1I1EA 1FPN3 1SEFA 5GLTA 4V1PA 3POYA 3CU7A 3HD8B 1FATA 2RM23 5A32A 3WG3A 4YZ2A 2D44A 1FOD1 2H0BA 4PLMA 1PM7A 1HXS3 5AFEA 1ZBE1 1MQTB 4XILA 5CG8A 3B94A 4EN7B 4GB33 1HRI3 2OVUA 4QM9A 1RUD2 1S0DA 2VQAA 2ZZQA 4JGZC 5TSWA 3TRSB 1OSGA 5A3MA 4RQPA 3POSA 2X29A 4Y1YA 4YZ4A 2ET7A 3MEPA 5BV6A 4GKXA 2VUJA 1YLLA 2RS53 3CLPA 2DCJA 4XMIA 2P3KA 4K40A 1VLNA 3H9AA 5J98B 4QPIA 4XPVA 4AYUA 2JEMA 4BPZA 5J48A 1ZZ6A 1W6PB 4L8QA 1WBLA 1G7YA 2WL1A 4LULA 1CPMA 1H9PA 4OUMA 3WG1A 4N53C 3ACLA 5CFCB 2XL9A 2ZBJA 2I07B 3ILNA 4MSVA 1SLLA 2YYOA 3V0AA 1F8VA 2EAKA 3TNPB 4U36A 3ZXEA 4FAHA 2WFF3 3SNMA 3VBOA 5BY5A 1LOAA 3WHTA 1CAXB 1U12A 1QOSA 1LGBA 4BIOA 2AGSA 1ZRDA 3KT4A 1OKQA 2JENA 4GXLA 5IT6A 1KRIA 4PIYA 3O0WA 3L2YA 4BH9A 1O3SA 3KM5A 4OI4A 3AZYA 5BYNA 3THTA 2W08A 2BYVE 3ASIA 3ZYPA 4E4SA 5BNQA 2B7YA 3B00A 3LA7A 1O5UA 4TWTA 1QJY3 2ZA9A 3SCHA 3U07A 1H8TC 1X33A 2UU8A 4OI1A 1VBC3 2WINB 4L9BA 4P5HA 2ZX4A 2X5IA 3RDIA 1PVXA 2ZX1A 1ZBA3 4FPCA 4Q4Y2 1HLCA 1LCLA 1QOTA 4XFCA 1LEMA 1LULA 1W2UA 3VZOA 1HV1A 2V5YA 3ILRA 1FOD2 4HETA 3GBFA 2FZ1A 2QFEA 2BQPA 5KC6A 4E27A 2XLFA 4MGIE 5GLVA 3IIAA 1QHDA 3ZSJA 2R071 2BFUS 2R30A 1A3KA 5IK7A 1MS5A 3SCFA 4YVSB 2R0FA 4OHXA 2D40A 1GICA 4R4XA 4GH4C 4N9IA 2P3IA 4MZUA 4WBBA 4AFCA 3H0OA 4I2OA 4EV0A 1PO12 4EN9B 1ZRRA 2H0VA 3ECQA 4Q29A 1SFYA 4COYA 1HQLA 2RS33 2R062 3RS6A 4Z1VA 2UY9A 2WKKA 1AYM3 4AQ2A 3FJSA 2HWD3 2MHFA 3TN93 4HKLA 2ZHNA 2VOVA 2D97A 4P14A 2H6BA 2NYYA 3NV2A 1LTEA 3ZMOA 2R32A 2DUPA 2JG9B 3U11A 4JGYA 2BGCA 3GBWA 3UL2A 3IPVB 1W0PA 1WCDJ 1QH6A 4IV3B 1ULEA 3JD71 4ASMB 3SCGA 1VAKA 1DLLA 4JV4A 4CZSA 3MIDA 4KG8A 3UKVA 1C8NA 1ZBA2 2EIGA 1WBFA 4AK3A 1MEC1 3CJIA 5BNOC 1DGWA 4PQ9A 4XZPA