1C8M1

Refined crystal structure of human rhinovirus 16 complexed with vp63843 (pleconaril), an anti-picornaviral drug currently in clinical trials
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
285
structure length
285
Chain Sequence
NPVERYVDEVLNEVLVVPNINQSHPTTSNAAPVLDAAETGHTNKIQPEDTIETRYVQSSQTLDEMSVESFLGRSGCIHESVLDIVDNYNDQSFTKWNINLQEMAQIRRKFEMFTYARFDSEITMVPSVAAKDGHIGHIVMQYMYVPPGAPIPTTRDDYAWQSGTNASVFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDTYKSRYGTVVTNDMGTLCSRIVTSEQLHKVKVVTRIYHKAKHTKAWCPRPPRAVQYSHTHTTNYKLSSEVHNDVAIRPRTNLTTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title THE REFINED STRUCTURE OF A PICORNAVIRUS INHIBITOR CURRENTLY IN CLINICAL TRIALS, WHEN COMPLEXED WITH HUMAN RHINOVIRUS 16
rcsb
molecule tags Virus
total genus 60
structure length 285
sequence length 285
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2000-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c8m100
4YVWA 1POV3 1POV0 1X33A 5BNPC 5ABJB 1AUYA 5CFDC 1VBE2 4GMP3 5DDJ2 5ACA3 5JZGA 1V9U2 4GMP0 1D4M3 3JD72 4IV1B 1COV2 4CDQA 1RUJ3 1RUG3 1B35B 1RUF2 4AEDA 3VBHC 1AR71 5D8AB 1VBA3 1F2NA 2PLV3 1ZBE2 1QJY2 2X5IC 1Z7S2 5C4WA 4WM7B 5AC91 2RR13 4Q4Y2 1K5MB 1AYN1 1ND2A 1EV11 1RUH1 1RUC1 1TME1 2HWF1 4CEYB 4RS5C 1A6CA 1EAH2 3JB4C 2WS93 1NY71 4CEWC 1H8TA 4FTBA 1QJU2 5CFCC 2RMU2 3JB8A 4Q4X1 1HQNA 2RS12 2PLV2 1RUE1 1AL23 4RFT0 5L7OB 2R043 1FPN2 2RM23 4GB33 2TBVA 3TN91 2XBO1 1OPOA 1F8VA 1TME2 2MEV1 5A32A 1FOD2 3VBSA 2XPJA 1NY72 2VQ0A 3ZFFB 4CDXC 2HWD3 4IV3A 4BCUA 2ZAHA 4WM8B 4GH4B 1VRH3 1ZBA2 2R061 1GFF2 1FMD3 4RQPB 2XBO2 1AL22 1RVF1 4CDUA 4JGYA 4SBVA 4Q4V3 3ZFGB 1MQTA 1R092 1PVC1 2BFUS 4CDWC 1CJDA 3VBOC 2WFF1 4Q4W2 1ND3A 4JGZB 1C8M2 2ZZQA 4YVWB 1HRI2 2WZR1 1NCRC 2FZ1A 4RHV3 1AR83 4PDWC 5JZGB 4N43A 1MEC3 5ABJC 1PO13 4FTEA 1R083 4CDQB 1R1A3 1RUI1 4AEDB 5K0UA 2RS53 1ASJ1 1E57A 3NAPA 1QJX1 5C4WB 1VB4A 1RB8G 1TMF1 2WLPA 4QPGC 1HRV3 1HXS2 3J8F2 1VBD1 1ND2B 1OOPA 1PIV1 1BBT3 4WM7C 1M06G 5BNPA 1CD3G 1H8TB 1VBE1 5CFDA 5DDJ1 1V9U1 3JD71 1COV1 2HWB2 5BNOC 1RUF1 1RMU3 2HWE3 3VBHA 3JBG3 1BEV2 1ZBE1 1QJY1 5A32B 2X5IA 3VBSB 1Z7S1 4N53C 1AR93 4Q4Y1 3DPRB 4IV3B 5C9AC 4EJRA 4RS5A 1EAH1 2Y26A 4GMP1 1AYM3 4CEWA 4WM8C 1QJU1 3VDDB 2RMU1 5CFCA 1AR62 5C8CC 2HWE2 2RS11 2PLV1 4QPIC 4YVSC 4CDUB 4JGYB 2WWSA 4RQPC 1FPN1 1MQTB 2RS33 1RHI3 1FOD1 1AR73 5ACA2 3M8LA 1D4M2 4CDXA 1RUJ2 1RUG2 3VBRC 1AYM2 1VBA2 4JGZC 5AC93 1ZBA1 4N43B 1AYN3 4RR3C 1RUH3 1RUC3 2HWF3 1AL21 2BPA2 1PO23 2RR12 4FSJA 1VBC3 5K0UB 2RS32 1RHI2 2QQPA 4Q4X3 1R091 1RUD3 1RUE3 2WS92 4CDWA 3VBOA 4Q4W1 3TN93 5FMOS 3CJIC 1C8M1 1AL0G 1HRI1 1NCQC 2MEV3 5BNNC 3VBFC 3VBUC 5BNPB 1NCRA 2R042 2RM22 4GB32 5CFDB 4NWVA 4PDWA 1NOVA 5ABJA 1PO22 1NA1B 1VBC2 2HWC3 2BBVA 1BMV1 2HWD2 1RVF3 3ZFEC 1QQP3 4Y4YA 1VRH2 1HXS1 4QPGA 1SMVA 1FMD2 3J8F1 1PVC3 2BFUL 4WM7A 4Y5Z0 4Z92B 4RHV1 4RS5B 3DPRC 4Q4V2 2WFF3 4IV1C 4CEWB 3S6PA 1PGL2 1BMV2 1B35C 5D8AC 2HWB1 2WZR3 2HWC2 5BNOA 3VDDC 1QJZA 5A33A 1BEV1 1QQP2 1RUI3 4RHV2 1AR82 1K5MC 4N53A 1MEC2 2GSYA 1PO12 4CEYC 4CDXB 1ASJ3 1R082 1R1A2 5C9AA 1VBB3 1TMF3 1VBD3 2R073 2RS52 4WM8A 1PIV3 1AR61 2HWE1 5C8CA 5J98B 5L7OC 4QPIA 1HRV2 4YVSA 1VBE3 5DDJ3 1V9U3 4RQPA 3JD73 1COV3 1BBT2 1OHFA 1POV1 5LK7B 4CDWB 3ZFFC 5ACA1 1PGW2 1D4M1 1IHMA 1ZBE3 1QJY3 4GH4C 1VBB2 1RUJ1 1RUG1 1RMU2 1Z7S3 1AYM1 1VBA1 3VBRA 1NCRB 2R072 3JBG2 4JGZA 4Q4Y3 4PDWB 4RR3A 1EAH3 1AR92 2RR11 3ZFGC 1NA1C 1QJU3 3ZXAC 2RS31 1ND3B 1RHI1 2RMU3 1HX6A 3FBMA 2RS13 2WS91 1FPN3 4QPGB 4YVWC 3CJIA 1EV13 1TME3 2GH8A 1FOD3 1NCQA 5BNNA 5JZGC 3VBFA 3VBUA 2FZ2A 2R041 2RM21 4GB31 4NWWA 4CDQC 4AEDC 1PO21 3NAPB 1AR72 1VBC1 2BUKA 5BNOB 1ZBA3 1W39A 5GKAC 5A33B 3LOBA 2HWD1 1RUD1 5C4WC 1X36A 2XBO3 1OOPB 3ZFEA 5AC92 1VRH1 1AYN2 1ND2C 4N53B 1EV12 1RUH2 1FMD1 1RUC2 2HWF2 1R093 5C9AB 1DDLA 1H8TC 1NG0A 3DPRA 2IZWA 4Q4V1 2ZTNA 4Q4W3 3VBHB 4IV1A 5FMOL 4Q4X2 1PGL1 1C8M3 2R063 1HRI3 1RUD2 1B35A 1RUE2 5J96B 5C8CB 5D8AA 2HWC1 2X5IB 4QPIB 4YVSB 1VAKA 3TN92 3VDDA 3VBSC 2MEV2 1QQP1 1AR81 1K5MA 4IV3C 1MEC1 1PO11 4CEYA 4LLFA 1VB2A 1R081 1R1A1 5CFCB 3VBRB 1HXS3 2R062 3J8F3 2RS51 2DF7A 4RR3B 1RVF2 4CDUC 4JGYC 5L7OA 1HRV1 1MQTC 1PVC2 1BBT1 2HWB3 1QJX3 2WFF2 1ND3C 3ZFFA 5FOJB 1BEV3 1PGW1 3CJIB 1VBB1 4GH4A 2WZR2 1NCQB 5BNNB 1RMU1 4N43C 3VBFB 3VBUB 1C8NA 2R071 3JBG1 3HAGA 1RUI2 1WCDJ 4FTSA 5K0UC 1RUF3 1AR91 3ZFGA 3NAPC 1NA1A 1ASJ2 3VBOB 1QJX2 1AR63 1TMF2 3ZFEB 1VBD2 1OOPC 1PIV2 3IDEA
chains in the Genus database with same CATH superfamily
2VTXJ 4YVWA 5A7WB 1O3QA 5ABJB 5BNPC 5CKNA 3PU3A 5FZ3A 3LA3A 1UPSA 4SLIA 4M01A 5CFDC 5KXCA 3BODA 3I2GA 2P34A 4S2DA 4XTPA 4C91A 5HPOA 1D4M3 3GXUA 3I54A 4FPYA 4IV1B 1COV2 4CUGA 3RWKX 4F3JA 2EXKA 1N1TA 1SBDA 4RSUA 3N7KA 1B35B 5GLWA 3AJZA 2XL7A 5FZIA 2ZGTA 3ACHA 2J1VA 3GALA 2W1SA 2G9GA 3IB3A 4FFHA 4NHMA 4NHLA 1DQ4A 3H3ZA 4GKXA 3ZMNA 4CRQA 2X8KA 4P9IA 2VBBA 1V00A 1YWKA 4IEQA 2UWBA 3SKVA 3GGLA 1K5MB 2HEYF 4XABA 2AENA 1ND2A 5I0RA 1EV11 1RUH1 2DYCA 3PDQA 1SQ4A 2HWF1 4BM8A 4QU2A 2PHFA 5IVEA 3O1SA 1IZ3A 1UXXX 3AXEA 3JB4C 2QQNA 3NL1A 4DY3A 1VPHA 1FX5A 4XACA 4CEWC 1YLLA 3B69A 5FZDA 2IVJA 1W6QB 1TVGA 2WT1A 3I59A 2ZEXA 2IXCA 1HQNA 2RS12 2PLV2 1RUE1 4XTMA 5HCBA 5LK5A 3M7AA 4KU7A 1AL23 5A1FA 2VNGA 4RA0A 4MADA 1D2SA 4CXYA 5JI9A 2R043 2TBVA 5E16A 1D0HA 2BTVC 3B00A 3B3QE 3N9LA 5C3RA 2NMOA 4FFGA 4AEKA 4GD4A 3U75A 2MEV1 3VBSA 5A3OA 1GNHA 4Q1PA 2RV9A 4AQ6A 3K2OA 2UYBA 1DZRA 1ENRA 1D4VB 4ARXA 4CDXC 3DGTA 1WMFA 2ORXA 3APBA 5G05L 3QLQA 4MH0E 4AI1A 2WN3A 1OQEA 5EQUA 1QIQA 4HVQA 4K6BA 1YO8A 4E4HA 2C26A 3ABZA 4CU9A 4P00B 4LBOA 2ADEA 1ZBA2 1WW5A 3VDCA 1NXD1 3M70A 1A8DA 3CJXA 2XBO2 3NJXA 1REEA 4FPOB 2DFCA 2V72A 3VDDA 3WHTA 4XJ9A 4SBVA 5GZFA 2QQWA 3MLJA 2J1SA 5LY1A 3WT3A 3NV4A 3VZNA 2FDGA 4BK5A 1PVC1 1C5IA 1CAWB 3FLPA 4D94A 3FFZA 2P6CA 2VZ3A 2I2SA 1OFSA 3H8RA 2B8MA 2VY0A 2WFF1 5F6KA 3HOBA 5ISLA 4YSFA 4LO8A 1I3HA 1LHVA 4FPFA 3VDAA 3GJBA 1AR83 1V0AA 3A22A 3KB5A 4MV2A 1XB9A 1MEC3 2VO5A 2BVVA 3M3EA 5HI0A 5H9QA 4YM1A 2C5DA 3OPZA 1LOAA 5FZEA 3SLIA 1BHGA 4M00A 4BQ5A 4NIIA 3ZDVA 3BOPA 2C9AA 4YGCA 3WDYA 1EPZA 3H8UA 1WLTA 4AQTA 4BE3A 2XWBB 4XZPA 3FMGA 2ID4A 2QQUA 3GCXA 1ASJ1 1E57A 4X8NA 5E89A 2GALA 1LAJA 1YEWA 4M3CA 1IPKA 4AHWA 1VB4A 1TMF1 3OBRA 4DO0A 3HR9A 4OHWA 4QPGC 4DZGA 2YC4A 5L36A 3LOIA 2BNOA 1PMJX 3L2YA 1VBD1 1I9RA 2WZEA 1LOFC 1YHFA 2G1MA 3GNEA 4NAMA 4WM7C 4E4DX 1M06G 4LKFA 3PUSA 2XUEA 4BISA 4NIAA 1H8TB 2VOTA 4P14A 4Q1RA 4XFHA 5FWJA 5JMCA 4QGNA 2XVGA 1BXHA 2VZPA 3N3HA 4NVPA 2QDNA 3ZYGA 1COV1 4CP1A 3CIHA 2PAMA 2GMMA 3ZXKA 1JI6A 4AK3A 3VBHA 2K0GA 5JSPA 3I2FA 2DVBA 1BEV2 2VNOA 4FP3A 4CXXA 3EYPA 2LW8A 3WW3A 5LCWL 3UT0A 3IWZA 2X5IA 4JQRA 3WW2A 4C1WA 1VLNA 4G9SB 5FMBA 3RPQA 1H4HA 3T1MA 4FAGA 1URXA 4QDRA 2PTMA 3LE0A 4N90A 1QGLA 3DPRB 2GN3A 3M3OA 5IK8A 1W6OB 4RS5A 4Q29A 1LCLA 2XKPA 3MV11 4LBLA 1PZ8A 2WSUA 5ERLA 3NV3A 3HPNA 3FFQA 1RXFA 3JU9A 1Z0HA 2VCCA 4NPLA 4KQ7A 2RS11 3AKQA 4BJ0A 2PLV1 4QX3A 5FZBA 5GLTA 3TBDA 4YVSC 1BCXA 3BALA 3MPPG 3IAQA 3A7QA 5BXXA 2NQYA 3AYEA 3ZXFA 5EJZB 2B9UA 2RJ2A 3FL7A 1NLQA 4MX3A 4X6QB 4W8JA 3IPVA 3PIJA 3KGLA 1E5HA 4QPYA 2RS33 2B45X 2J1UA 3KQRA 2R32A 3RJ2X 1LHOA 5T5JA 4J1XA 5F3GA 1SLBA 3WDWA 5ACA2 1ALYA 5F1RA 4LUMA 1HIXA 1OI6A 3LFIA 2ZGPA 4JTNA 2BGPA 1ZRDA 2QQOA 4XUNA 1EY2A 1MACA 4QT6A 5TSWA 3OY8A 1KJRA 1AYM2 1SZBA 2ZEZA 4BOWA 1OLMA 1ZBA1 5JR7B 3WQBA 5AFBA 3ALQA 4XETA 1RUH3 2FDHA 2HWF3 3J7LA 1HDKA 4XDOA 4XUPA 4HETA 1QU0A 2RDSA 5C8WA 2BPA2 3FZ3A 1ULFA 4AAPA 3E5XA 3A0NA 2ETEA 3K4DA 4EWEA 4MO3M 5FZOB 1JTZX 5DUVA 1RUE3 2WYSA 5FZ6A 5LW9A 3P3PA 4AWDA 3OTFA 2JDNA 5DABA 4QWNA 2X29A 3VBOA 3UGGA 4EN7B 1H9PA 4IEZA 4OQ9A 5BNNC 2MEV3 4OHYA 2VZOA 2Y60A 3I3QA 3VBFC 3ZR5A 3VBUC 1WBLA 3USSA 2B39A 2VMGA 2RM22 3GZEA 2KM2A 4CP0A 4PDWA 4COUA 3OBTA 3ITQA 5ABJA 4LNVA 4XQDA 2ET7A 3GZAA 1LHUA 5FREA 3N4MA 3G6JB 1F35A 2NMNA 2OQ7A 3H7JA 2WYFA 1NAEA 2BBVA 1BMV1 4EROA 3O0WA 4QDQA 2HWD2 5C3OA 4XC9A 1GZ9A 3NJYA 3WDTA 4E8DA 2OXBA 3UGHA 5FPXA 1HB4A 5KWRA 1VRH2 1KDMA 1PVXA 5JOYA 2VUCA 3RSJA 1SMVA 1FMD2 3N35A 3N9QA 2GNBA 1PVC3 3UGFA 2OZ6A 1OURA 2WC2A 4XHBA 4D0QA 4COVA 3O5SA 4RHV1 1HN1A 2DURA 3GJAA 2WFF3 1RUOA 2W1UA 4YGDA 2O0OA 1RUNA 5FZGA 1DGLA 3FUQA 1UX7A 2BEOA 4HT1T 3I2IA 5LASA 4KL1A 1CAVA 3AP6A 1SLLA 5BNOA 4P9GA 1OA2A 1YIPA 1BEV1 4NN0A 1AVBA 1YJKA 1V6IA 2CGNA 2JG8C 1QQP2 4R9CA 3AYAA 2OUJA 2YDEA 3MUZ1 1W8TA 3OGRA 2WT0A 3H3UA 3O1PA 1GWKA 3WG1A 3USUA 3AKSA 1PO12 4CEYC 1QDOA 1ASJ3 2X09A 3FC0A 4XJUA 2JX9A 3U10A 1TMF3 2W39A 4NAOA 5FK8A 1Q8SA 1GV9A 3O1OA 3I8TA 1W0PA 4XJAA 1VBD3 5FDBA 5F2SA 2WT2A 4GWNA 5GALA 4CYDA 4Q0QA 1IGOA 3ZXDA 4YM3A 1HRV2 1NX9A 4NRPA 2D6PA 3DCQA 4XHXA 2JB4A 1WCQA 2WNOA 1IG0A 1COV3 1UW8A 2CGPA 3ZYIB 4O7XA 1POV1 1N1YA 1YFWA 2QNKA 4FI9A 4H7LA 4DUVA 3ZKYA 2DCYA 3IT8A 4CSWA 3FLTA 4QXHA 1XE8A 3S5QA 5ACA1 1C1LA 4FPGA 5GZEA 4MZUA 4HXCA 3H8OA 5FMCA 5KHHA 4GH4C 1FT9A 1VBB2 1OQ1A 4PI0A 3SHRA 3NRUA 1QJEA 5FP3A 1HW5A 4QM9A 1AYM1 4GA9A 5GZGA 3RZHA 1NCRB 2OUHA 1TG7A 1W2TA 4MUVA 1G9AA 3UV9A 3PVNA 2IXIA 4HONA 4IGPA 3EQEA 1HV1A 3V0BA 1CJPA 1KITA 1AR92 1QNYA 1AXKA 1OF3A 3GF6A 3NMBA 3ZFGC 3ORJA 1NA1C 5HCHA 4HFSA 4QKBA 2B5HA 4XFFA 2RJKA 1ND3B 1XPWA 2JE7A 1BKZA 3H1YA 3JCIA 5FP9A 3M3CA 2RS13 5FY1A 1SLAA 3K3OA 5JDBA 4LHLA 3DF0A 3AKPA 4ZONA 4Y1ZA 4YVWC 2OZJA 4XFBA 3CJIA 3MHZA 5FYMA 4DB5A 4MGSA 4YW6A 5CAZA 2GH8A 3MIHA 4LORA 4WBBA 4XCBA 4GWMA 4AE2A 4QX5A 2Y0OA 5JAXA 3RMXA 4IERA 2RM21 4TTGA 2DCKA 2BQPA 3CF6E 1SEFA 2VQAA 2DCZA 3S30A 5JXJA 4JV4A 3VZLA 1W04A 2VMDA 3MIBA 3NAPB 4D7SA 2Y34A 2VZTA 3AFGA 3POFA 4MHRA 1ZBA3 3SKJE 4IDZA 2R1BA 4LO7A 4N7UA 2WNVB 2HWD1 4CUAA 2Y6FA 3P5BA 2Q1MA 2XBO3 1OOPB 3AL6A 4FOYA 3AKTA 4XBQA 5HXVA 3OEBA 5A3MA 5AC92 1FNYA 1WLDA 4LLOA 1VRH1 1ND2C 4BIOA 1ZZ8A 3LB9A 4JCKA 4PIZA 1FMD1 1RUC2 4DUXA 5JXIA 3FLRA 4M0NA 3FUOA 1WW4A 1XRUA 3VLBB 5FIXA 5C9AB 2DCJA 2ZGUA 3OSDA 3I3BA 4XVHA 5EXOA 2D3PA 2R0HA 1OMIA 4ASMB 2XJQA 3DPRA 2FMYA 1MS4A 3U14A 1XXNA 3IKWA 1GQGA 4M4PA 1I5PA 4Q4X2 3ZKUA 1W6OA 2RHPA 1JZ2A 1RUD2 4JHTA 4OYUA 1D0GA 4FOWA 2ZX3A 5C8CB 2OA2A 2VPVA 5D8AA 5L9BA 3F2ZA 4Y3OA 4QPIB 5F5AA 1Y43B 2XL9A 1W6PA 1XNBA 1VAKA 2ZEWA 3CZJA 1WA4A 5F6LB 4M3CF 1AX1A 2PHTA 3UKVA 1O59A 4YARA 2VMCA 3VBSC 4R4ZA 1QQP1 5DAPA 4XPVA 3AZZA 4A44A 5E6HA 2JG9B 5F2WA 1PO11 2VXRA 2W1QA 4FPKA 4UFKA 2O8OA 3DYPA 4H14A 5FOBB 3E5UA 1UY2A 4QQHA 3LKJA 1W9YA 5EZWA 4A6OA 1OVSA 3PTRB 1UL9A 1RL3A 2R062 2CNAA 4LBQD 1V6OA 4IGQA 1YUDA 4RR3B 1RVF2 2VW2A 4AHZA 2R7EB 1QH7A 2YBPA 2EF6A 1BQPA 1GUIA 4YZ3A 4NHXA 1HRV1 3HNMA 4LA2A 2W94A 1VMJA 4KH9A 2ET1A 4DMIA 1N3PA 1JYWA 1G9BA 1J58A 2OPWA 1CX1A 1O4TA 4OUEA 5A7QA 1QJX3 1YXWA 2YV8A 1BLZA 2OT7A 5DAWA 3MF9A 3HIFA 1BEV3 1DGWA 1K45A 5HV0A 4QQPA 1U5IA 1RITA 4OULA 2PAKA 1DQ6A 4R4XA 1AZDA 4YW3A 1VBB1 4URAA 3KLSA 4JZRA 1NCQB 4V2VA 1GICA 1C8NA 1WZXA 2VNVA 2YB7A 4OI1A 2Y6LA 4KBZA 5JVVA 2VTXA 1P8JA 2UURA 3OG2A 3I2HA 1UKRA 3LSDA 4LPLA 4EN6B 3PUHA 2QDRA 1WCDJ 5FO7B 4B4PA 3OCPA 1RUF3 1AR91 1PM7A 4OZXA 1ENXA 2GAUA 1GNYA 1W8NA 2WZ8A 5J36A 2P6HA 3NNGA 2G9ZA 1W0NA 3UKNA 1NT0A 5DZFA 5FXZA 2H6CA 4Y1XA 4A3XA 3OGSA 4XF4A 1HN0A 4BMEA 1L3JA 4OUSA 5BUVA 5CKMA 5I93A 1PIV2 3O0XA 1POV3 2FQPA 4XOGA 1AUYA 3FX3A 2ZGMA 1Y7BA 4GJZA 1VMFA 4GMP3 5DDJ2 5ACA3 1V9U2 2P5BA 3O7OA 2ZMLA 2K46A 1OSGA 3RZZA 2QZ2A 1I1EA 3ZDSA 4CDQA 3W9AA 2ATFA 3OEAA 2JJ6A 1ZZ6A 4AEDA 3VBHC 3V0AA 3U07A 4ISRA 4YM2A 1DF0A 1WMDA 4C1XA 4DRRA 4XDQA 1KQRA 3AP5A 2X5IC 4KMQA 3CMGA 1Z7S2 1BVP1 1F5FA 4HG6B 3UNPA 3WXPA 3O1RA 3O14A 4IESA 4AZZA 2W87A 5AC91 4CCLA 4ZU7A 1G7YA 2GZWA 4XILA 1SFPA 3ZN6A 1RUC1 5EIYB 4RS5C 4ES8A 3OPTA 1EAH2 3KS7A 4L0PA 4HK8A 4BQ2A 4Y1YA 2XLFA 3UKTA 4NROA 2O1QA 4UFIA 2RMU2 1DGRA 1V6MA 4Q4X1 1GZWA 1UY0A 1U5YA 4PQ9A 2ZBJA 1Q8OA 5FBJA 3DKQA 3DL3A 4AL9A 3T4VA 5L7OB 1DYKA 1FPN2 2RM23 1F4HA 2IFRA 1PK6A 4XCAA 4I01A 3BU0A 1OUSA 1KXGA 1XNKA 3GHNA 5A32A 1KDKA 1FI2A 2D98A 3VD5A 3T0DA 1YYNA 4A41A 3LF7A 2F4PA 5DXDA 3ZFFB 2HWD3 2CDPA 4L9BA 4V1PA 2ZAHA 3MBWA 4WM8B 4CCDA 4XF1A 3VB9A 1VRH3 4D6SA 4L2NA 2P17A 2R061 1FMD3 3NNJA 4AHYA 4UFMA 2XJVA 4FVVA 4RQPB 4YW5A 4Q0VA 3DKWA 1RVF1 3OBAA 4UW3A 5AVPA 2ARCA 4JGYA 1YQ5A 3OPWA 3RDIA 2DTYA 1SLCA 2FCVA 4LBJA 3VHRA 2BU9A 4P08A 2BV4A 1GLHA 1ENSA 2W2IA 3J7HA 3T4HB 3VBOC 5I8TA 3WNLA 4G4FA 1OKQA 1UOGA 4ITCA 1ND3A 3MW3A 3RZGA 2JWPA 4ZKTB 1C8M2 4XBNA 4U36A 4DEQA 5EJ1B 2F6BA 3POEA 3WF4A 1VP6A 4K40A 4URTA 4WVMA 1UYPA 5JR2A 4W6YA 4PDWC 1ZRCA 5FLIA 1IQDC 2Y6JA 3KSCA 3M3QA 4DXRA 5JZGB 5ABJC 3PHMA 3WNMA 1PO13 5D21A 3IZOA 2VQTA 1QY4A 3MFCA 1YJLA 3A23A 4K1ZA 2BERA 3C7HA 3OGJA 3ZR6A 1DQ0A 3RMYA 2AUYA 5BPXA 5HCAA 1HB3A 2GH2A 4BK4A 3NAPA 5DAVA 4QPWA 2XH6A 2CU5A 5C4WB 1RGSA 5FZHA 2WLPA 3W5MA 4JKKA 1QNWA 1HRV3 2J1TA 4YFWA 2VZRA 1S0BA 3O0VA 1OOPA 1PIV1 3N7LA 1JYVA 3JQXA 5LRRA 4MGIE 3SISA 4Y22B 5IATA 1DCSA 5DDJ1 1V9U1 4IE6A 1AXZA 3ILFA 3NJZA 4RGAA 5A1AA 2ORZA 3QCWA 5BNOC 3ES4A 1EUTA 2GNDA 3RI8A 3WF3A 4ES9A 4JDOA 4D7TA 2Y64A 4FQZA 1HQWA 4XYXA 2Q30A 3VKOA 3S57A 1Z7S1 5EYYA 1AR93 1Q8VA 1W3VA 2EXJA 2VW0A 4HKLA 4OMDA 4Z07A 5IJRA 1KFUL 2XHNA 3KCCA 1RYYA 3VZMA 4AFAA 2D40A 2VXJA 5JIAA 1DGRN 2VJXA 4IV3B 3WINE 5K8SA 5J37A 1CWPA 3BTXA 1YRZA 1EAH1 1GMMA 3AVRA 2E51A 1S0IA 2GNMA 4LBQB 3WSOA 4BXSV 4R9AA 2JDKA 4W4ZA 2WA3A 3ZVXA 3O1TA 1W6MA 3ZMOA 4AXOA 1OC1A 2RMU1 5APAA 1AR62 5JPMB 2HWE2 1CONA 2KA3A 5IVCA 3GCWA 4B8EA 1J3RA 4BXFA 4ZU4A 4CDUB 5FP8A 4EWDA 1FPN1 2AEZA 5CNAA 2XGXA 2DUPA 3SEEA 4AVCA 4A2UA 1MQTB 3UJOA 4Q0SA 5KXBA 4BLIA 2P3KA 3LEIA 4GAZA 4XMAA 4A7KA 4KBBA 3D8CA 4UF0B 3GYDA 2D6NA 2FMDA 3T2PA 2ZAAA 3M8LA 5F37A 1YQCA 3ZN4A 3NNMA 3LEMA 3EXUA 2Q4SA 3U78A 2E7TA 3Q8CA 4R52A 1VBA2 2GMPA 1EYBA 2UU8A 4LXLA 4M3CE 2DVFA 3LAGA 2JE8A 1H2KA 4AOCA 2DTWA 4N43B 5AC93 2VCAA 1RUC3 2RVAA 3RQ0A 2VZSA 2ZOEB 1STMA 5IAXA 2NYYA 3EBRA 4RL7A 1Y3TA 4AEJA 1XJAA 1UMHA 2YGMA 1VBC3 2PN5A 3WCSA 5K0UB 1X9PA 5A3WA 5FO9B 1S2BA 1UOJA 1RHI2 2QQPA 4QKNA 1JYCA 4Q4X3 3W21A 5T3NA 4A42A 4E2SA 1RUD3 2EVXA 2W91A 2WS92 4FQ4A 2C0ZA 4CDWA 1MZFA 2VMIA 2VAUA 3HNBM 1CAXB 1J3QA 1KEXA 2VGDA 4MGKE 1UYZA 4FFFA 5FMOS 2R16A 3CJIC 4QX1A 5A7PA 1C8M1 2WO3A 4CTEA 1AL0G 3WLUA 1K12A 5FFOC 2D97A 3ZSEA 2VCBA 1OUXA 5BNPB 3EB7A 5F5QA 4GB32 4BU2A 5CFDB 3SCFA 2QUOA 2ZGSA 3PMSA 2ES3A 2WNUA 3POWA 1BVVA 3JZVA 3T3YA 2J42A 1CAUB 1PO22 3RYKA 5FQ0A 1Q43A 1ZM1A 3TEZA 2WQ4A 4NO4A 2Z69A 3K75B 4YPJA 3RI9A 2HWC3 3VL8A 4CUBA 4XJ8A 1XNCA 1U5ZA 3LPFA 1GZTA 3K46A 2PQSA 1RVF3 1HKDA 2VU9A 3A0KA 2WKKA 1DU3D 3MICA 1ULDA 4Y4YA 4AQSA 2YPJA 4D69A 4L97A 1N1VA 1JMUB 4EZ4A 5DZEA 1OF4A 5JIUA 4EQVA 3H1WA 3HQRA 3POGA 5A6QA 1LECA 4LKSA 5F9TA 3OGGA 4QB6A 4MG2A 2AZ5A 2EAAA 3DPRC 4Q4V2 1S2KA 4N7IA 3WDVA 2BP6A 3IBMA 1DHKB 4TLGA 4FXGB 1AJKA 1GP6A 1S2EA 3HQUA 3X29B 4CEWB 5JXHA 1BMV2 2ZHNA 4YG0A 5FY9A 5FZCA 4XQ4A 5D8AC 3WUDA 5KHJA 2BOIA 4PCRA 4LEJA 3C7GA 2VMEA 4L11A 5A33A 4ZS2A 1DQ2A 5JSOA 1OLME 4CU8A 5F3CA 3LZZA 5FYVA 2VOKA 4Z8BA 1YC61 2H0VA 3T30A 2B7YA 1LEMA 2IXHA 5EHDA 1CR7A 4RHV2 4HPKA 2B46X 4N53A 2GSYA 4CDXB 1R082 1R1A2 1XNDA 1AX2A 1RC6A 5KR7A 5GZCA 2C1FA 5DUXA 2VBPA 4AGVA 3N7MA 5A7NA 3UESA 3ASIA 2R073 2RS52 4WM8A 1PIV3 5BV6A 3BU7A 4TWTA 1ZZ7A 1AR61 1OVPA 5KHGA 1EP0A 2FHRA 2HWE1 5J98B 4BQYA 5HBAA 2IWGB 2X05A 5DDJ3 5FKCA 1V9U3 1Q5OA 1V6KA 4RQPA 3MI8A 4A45A 4MXWB 1BBT2 1LODA 1MPXA 2VOVA 4K3UA 4DPNA 1ODNA 1WBFA 2JENA 4IEOA 2XJPA 1QKQA 2D6OX 1UNBA 4NE9A 4CCKA 3I3MA 5C7GA 1PGW2 1SCSA 5I91A 1IHMA 5C33A 4GJYA 1NE4A 4COWA 1WWYA 3I2OA 3WNKA 1Z7S3 3C2UA 1W9FA 3D0SA 4NRMA 1VBA1 4LO4B 3VBRA 3DEMA 2R49A 1R64A 5IK5A 3B02A 3O12A 3VD4A 4X6RB 1SPPB 1LU1A 1H8VA 1ZRRA 5FRAA 1EAH3 3LWCA 1ST8A 5I8YA 5FR3A 4QM8A 2QBXA 3KVAA 2DWRA 2XG3A 3ZXAC 5F3EA 5FLJA 3D5OA 4GIQA 1N47A 1RHI1 2RMU3 4NMIA 4TXWA 2OIIA 3RZLA 3POBA 1K5JA 5IT6A 3KD4A 1FAYA 2WS91 4HMZA 4AFBA 1OLRA 1YFUA 3WVJA 1O3SA 1FPN3 4QPGB 4K7JA 1GBGA 1U12A 1DZQA 1V6JA 4NRQA 4K8RB 4QXKA 1EV13 3VKLA 2GC1A 1JOPA 2AYHA 4OUMA 4OZOA 2J1EA 2P3IA 2XR4A 5AFEA 2FZ2A 1G9CA 1APNA 4GB31 5LWBA 5M0TA 4NWWA 1AF9A 1PZ9A 2WL1A 3B9IA 4CDQC 1U5XA 1VRBA 4AEDC 3DXUA 1PO21 3KT4A 4BH9A 3UK9A 4JRAA 2LM3A 4NUBA 4I3PA 4Y26A 3OUHA 4WVZA 2FDFA 3HEIA 4Y5TA 1NUKA 1O3TA 5IFTA 4FXKB 5CBLA 1GR3A 4B7EA 2WJSA 3ZFEA 5IYYA 1AYN2 1WW6A 1BJQA 2W46A 4DEVA 5JSRA 1LENA 5A7WA 4G3YC 4Q8LA 4BB3A 3E97A 4N9IA 2E6VA 5BNQA 4OQ8A 3MPBA 4ZXKA 1NG0A 4Q4V1 2IZWA 3IIAA 3KT7A 4HN0A 5LEJA 1LOBA 1UYYA 2EAKA 4IV1A 5FMOL 5T5OA 3WEZA 1C8M3 3I2JA 1VAMA 1T2XA 4OHVA 1B35A 4MGTA 1UY3A 1YFXA 4LBQA 4PBPA 4NIDA 1HV0A 1CZSA 4YVSB 1PK6C 2CWMA 1MZ5A 3LD8A 1JU4A 1AJOA 1ACCA 5FZAA 1DLCA 3FHIB 5FZ8A 5E88A 4LIUA 1F31A 4FOQA 2HKXA 2ADDA 1H2LA 4IW3A 5EPAA 3ST7A 2QQMA 1K5MA 1ZYBA 5DG2A 1MZ6A 2JDHA 4Q27A 4LKDA 5FPZA 3AB0A 1W2OA 1VB2A 4X8PA 1R081 4D6RA 1R1A1 4UF0A 5GM0A 4I2OA 3POIA 3Q8FA 5CFCB 5C3QA 4B29A 3THTA 3HT1A 3W5NA 4I3GA 1PNFA 3VDBA 1W6QA 2CYFA 2QJVA 4E8CA 5SV8A 2R6QA 2RS51 4CCNA 3MF6A 4F83A 4BQ4A 4JGYC 5DG1A 3ELNA 4O65A 1ULGA 2E7QA 5LB6A 3ZX7A 1XE7A 2UYAA 2FCTA 1PX3A 4D8MA 4Y20B 1XSRA 4DRVA 5JPNB 1BBT1 4MVTA 4QQOA 4LMFA 3HN3A 1YI9A 1MR5A 2W95A 4UWDA 1SCRA 1W8WA 1ND3C 4D7YA 3S7IA 2G19A 3AK0A 1PGW1 4ZS3A 4XURA 4P02B 2OQ6A 5FYHA 4RGKA 1O6UA 2WSVA 4ZZ8A 1GYKA 2WZR2 4Y1UA 5FJKA 5A1LA 1VE0A 5BNNB 1DYPA 4K8FA 4XFGA 3VBFB 3VBUB 4FPJA 1X50A 4GQ7A 4P5HA 3IDBB 2ERFA 2PFWA 2VUJA 3HAGA 4QB1A 1SBEA 1WKYA 2AC1A 3FHQA 1ZX5A 1W9WA 2JICA 1YIFA 5CVRA 3TEXA 1LGNA 1IPSA 4Q5OA 2ZKLA 3NVCA 2YU1A 2RJLA 2ZMNA 4GALA 5A3LA 4R8HA 4BQ1A 3BKZA 2PHXA 2EIDA 3NAPC 4HK9A 1BK1A 4OMCA 1VMHA 1W06A 1AR63 1CAWA 1I6XA 3WP6A 2FBEA 2VBDA 1FNZA 4W50A 3LIGA 2E31A 2EIEA 3FJSA 4C90A 3LDKA 1S0GA 1TE1B 1KJLA 2AREA 3FHAA 5DMYA 2VL4A 1UYXA 2EIGA 1OOPC 1CIWA 1LJ7A 2WAAA 2VZUA 5FTTC 2IXJA 4EN9B 2JDZA 1MS8A 3WR0A 1POV0 1X33A 4L8QA 2AEYA 1IKQA 4YM0A 3KCXA 3AZYA 1ZA7A 2QKDA 5K9YA 1XQNA 3LFMA 4KNCA 5KHIA 2CGOA 4GMP0 4AGGA 2ZX1A 3JD72 1UN1A 3LCPA 4AFMA 4XJWA 1MS0A 5I0DA 1W8ZA 4JVAA 3MFAA 1OKOA 3RGBA 1SFNA 1VBA3 2PLV3 1WMXA 1CZVA 4NPMA 1GQPA 4FBFA 5K7PA 1ZBE2 4ET7A 1RINA 2JDPA 1UWWA 4MGZE 5CEHA 2A1XA 2P4EA 2JG8B 2ZX2A 3PMEA 4LR4A 3U11A 4ASKA 1GANA 1AX0A 4Q4Y2 1AYN1 3U37A 3CBNA 1ZZ9A 2V73A 1TME1 2WBKA 3HN1A 3NQHA 3OB8A 2XJTA 3ZPOA 4CEYB 3QOPA 2XQRA 1JXNA 2WS93 1NY71 2Y8KA 1N3QA 3D6EA 3S5AA 5IVYA 4YW4A 3RZJA 1H8TA 1A34A 4AFDA 3Q8BA 4DXZA 4FTBA 3B7MA 1QJU2 3GM8A 3SMHA 1VJ2A 1X7NA 4O9EA 1O8SA 2B4KA 2GNTA 1ULEA 3KWVA 5I0TA 3U0ZA 2P2KA 4OHXA 3HQXA 4RFT0 3J26N 3AFKA 4FPEA 4GB33 1OH4A 1W99A 5BYNA 2QQIA 1DZTA 1R1ZA 1CPNA 1OD5A 2ZMKA 4BA6A 1F8VA 1LOEA 2KXLA 2A7AA 3AX4A 4Q2FA 4Z2AA 3PTYA 4AR2A 1LHWA 5FZ4A 2CWSA 1UAIA 1RTVA 2VQ0A 1JU3A 2WA4A 3AMHA 2IFWA 1F15A 2I45A 2A70A 2E53A 1JW6A 2HEVF 2PHWA 2W9XA 3LA7A 2RG4A 1C3HA 4MXWA 4I09A 4UBHA 1KRIA 4BCUA 4F7ZA 2VUAA 3NV2A 1JHJA 2GU9A 4KWLA 4GH4B 3WG4A 3K48A 1C1FA 1XU2A 5GJ6A 1ULOA 4PIXA 1JN2P 3N9PA 3RS6A 2YBSA 2YC2A 2Q8EA 1OA3A 3Q9OA 4ZU5A 1PZ7A 1JUIA 1AL22 3M3IA 5FYBA 4B1LA 5A80A 1I5ZA 4PJYA 1JZ5A 5T54A 4Q4V3 3TNQA 3TYJA 1SPPA 5LA0A 1QHDA 2ZXQA 3ZFGB 4D6QA 1NXMA 3EJKA 5C5TA 4AQ2A 2A6VA 3VZJA 2VVEA 2BFUS 4BWOA 3GBFA 4CDWC 4E4ZA 2RDRA 3RJRA 1DBNA 3VV1A 2IXLA 3H8XA 1AXYA 1LOCA 2YUEA 2W5FA 4Q4W2 1W05A 2H6BA 2XJRA 4JGZB 3WDUA 2B42B 2ZZQA 4YVWB 1HRI2 1ZNPA 2DU0A 2Q5TA 2WZR1 3SXWA 3R4SA 5JZGC 3GZUC 4RHV3 2WNUC 5GZDA 3ACLA 1JS9A 2YU2A 1MS5A 2WDBA 4INDA 3ZYFA 1R083 3O1VA 1R1A3 3QACA 2Z5WA 3WV6A 4AI0A 2WN2A 1J83A 3ON7A 5G04L 2PXJA 2GDFA 2VR4A 3AP4A 2RS53 2FCUA 5FPUA 4CVUA 5FZOA 1LTEA 5CYYA 2DBIA 5GLZA 1X8EA 1JZ8A 4COYA 2V09A 5KC5A 5JXGA 1OPMA 3T0BA 1ZRFA 4XZUG 3ETQA 2Y0IA 3LA2A 5LY2A 1HXS2 2XUMA 1UZ0A 1ND2B 2YROA 4ZZ5A 1FV2A 1BBT3 2W1WA 4LHNA 3TB0A 1M4WA 1ONAA 1LB2A 3BTAA 3PUAA 1IS4A 1H4GA 3ILRA 2P1BA 3WZ1A 3PNAA 2BNMA 2KD7A 3I59B 1Z78A 3JD71 1XU1A 3IAPA 4QX7A 4CUCA 2DV9A 2D43A 2HWB2 2QFEA 3MO4A 2Y6HA 2XDVA 1PMIA 2A3YA 4LE4A 2LTNA 4BHPA 2F17A 4QX0A 3WW4A 2DUOA 2J1AA 2V5YA 4S2FA 1Y9GA 2BBAA 5H9PA 4UOJA 1ZBE1 4XUOA 2FDKA 1O5LA 1Q8PA 1WA6X 2E32A 5F39A 2A73B 3C3VA 1W2UA 3VBSB 1A3KA 4N53C 1OBNA 3D0JA 4UT5A 4Q4Y1 1S0JA 1L7QA 1UZZA 2WWUA 5F3IA 1JYTA 4KWJA 4NHYA 3M2MA 1QDCA 4EJRA 4JQTA 2VCMA 1GNZA 4H7MA 3V65A 2VUDA 4CZSA 2HYXA 4EE2A 3ZYJB 3AMPA 3T1LA 2D5FA 2WO1A 1AYM3 1EUUA 2JKBA 4WM8C 4QD2A 1QJU1 5AVAA 3VDDB 2HH9A 1UF2C 2W47A 3SH3A 5CFCA 1JZ7A 2G9FA 3BTZA 5C71A 1CZTA 2WWSA 4RQPC 4L99A 1LGCA 3U4SA 4FCAA 2Z42A 3B93A 3PUIA 2CAVA 4QMAA 3WUCA 2CHHA 5JMOA 3THCA 4YWAA 2W92A 4JKLA 3R4UA 3R6SA 4Y20A 2XVKA 3MYXA 4HSJA 3C7OA 4QKDA 1RUJ2 3MLKA 1RUG2 4MLOA 4H55A 2D44A 1TNFA 3VBRC 2NN8A 4AI9A 4J1WA 1PX4A 2JB8A 1AYN3 4BIFA 1K42A 2GP5A 2G4IA 2IVIB 3ZPYA 1CQ9A 1GQHA 3IMMA 3HT2A 1AL21 5ANNA 2MNGA 3KZ4C 5CIRA 2BJSA 1MS1A 2E63A 3WDXA 4PLOA 1GWLA 2RR12 1PM4A 4AG4A 2RS32 2NLRA 3WG2A 4AEMA 1J84A 4UXAA 3LIHA 1CVNA 4M3CB 5SV5A 5CG8A 2HYKA 1JHNA 3ZYHA 3EO6A 3PIGA 1HQLA 3B94A 4ONUA 2BDRA 4PT6A 4FFIA 2W68A 4Q4W1 4XAEA 4Q26A 1HRI1 2V4VA 1GP5A 2DU1A 4XXAA 3BB6A 3NJVA 5IK7A 2AH2A 1NCRA 3DUIA 4NWVA 4I0AA 5CADA 2C4XA 4UW6A 1QH6A 1NOVA 2X10A 3OJBA 3T0AA 5BY5A 1YQ6A 5FY0A 1H6YA 1RXGA 3NW4A 5FYCA 3H3LA 4KWUA 4Z82A 3WNNA 5C3PA 1DG6A 3P3NA 4E9KA 2O14A 2VZ1A 4AGRA 2EXHA 2E33A 3OUJA 3ETPA 4E2QA 3HVDA 4GWJA 4LJHA 3ZO0B 3ZFEC 1QQP3 1OFNA 1OLQA 2BYVE 1HXS1 1S0EA 2PYTA 5F5IA 2QZ3A 2JE9A 1H0BA 5CU1A 2BFUL 5I0UA 3ZSKA 2UY9A 1JODA 4I02A 1NZCA 3KV6A 4JDMA 3RVHA 4RS5B 4CCOA 4Z92B 1US2A 2OS2A 4IV1C 5FY4A 3S6PA 2WO2A 2JDMA 2YY1A 3KMHA 1B35C 1ZZCA 1Y9MA 4L92A 4A7YA 2D7FA 2HWB1 2PQQA 2WZR3 2Y33A 4BDVB 2ENRA 5JUVA 4EN8B 3VL9A 2Z2SB 5JLVA 4AYUA 1QJZA 2QTWB 4H3WA 4K1YA 3URFA 1IG3A 5FPAA 1Y9QA 2CTVA 5EYXA 3IPVB 2WNVA 3HBKA 3SQOA 3NV1A 4AVVA 4CA9A 3VKMA 3INAA 5FZ7A 4IGOA 1K5MC 5T50A 5FYIA 1ZZBA 3RZMA 2W3JA 4KG0A 5DUUA 3CEWA 1ZVFA 3DYMA 3RWNA 2ZHLA 5C9AA 3BPZA 1MVEA 2A6WA 1VBB3 3WF1A 3ZYPA 3I49A 3OY8B 2JIJA 1V70A 3DYOA 5LA2A 3LDRA 4IQPA 3UL2A 3NO8A 3J7NA 2RDNA 2WAOA 3ATGA 3G7DA 1O7FA 3W59A 2BZDA 2DVAA 5FYYA 5C8CA 1X9TA 5DZGA 3KM5A 4N9HA 4LHKA 1UMZA 2BWAA 5FZFA 4QPIA 5T5LA 1JYNA 5L19A 4QDSA 3WW1A 5FXWA 3JD73 2VG9A 4CP9B 2ZACA 5FYZA 5IFPA 4D3WA 2LALA 2VZQA 2PHLA 1QXJA 4HVOA 4J6GA 3VKFC 3PU8A 3SC7X 3WP5A 4LIVA 4TSVA 2JG9A 2CY6A 1ZBE3 4YGEA 5FWEA 3I7DA 1RUJ1 2OX0A 4QKFA 1RUG1 5DN2A 1RMU2 3VKNA 1W9TA 4S2HA 3H7YA 5LRSA 4HLTA 4JGZA 3JBG2 3IN9A 3BIEA 4Q8KA 1WLCA 2XLGA 4PDWB 4Q4Y3 1SG3A 2HLEA 5KXEA 4TLFA 4Y4RA 3EMRA 5HV4A 3HD8B 4FO9A 4RR3A 1XNTA 3NWKA 5FYTA 3WX5A 1N1SA 1T6GC 1T6BX 2SBAA 2DVGA 5GLVA 4HL0A 2YBKA 4M4RA 4LK6A 1O4ZA 2RR11 1QJU3 2RS31 2OYZA 2CV6A 3VGIA 3THDA 1HX6A 1D7PM 2Z79A 1HJFA 5LZ6A 3K3NA 1YQ8A 4JDNA 4F8AA 2SLIA 2ZGKA 4LUKA 2Q8DA 1TNRA 1NQDA 3WOGA 2WR9A 2DBNA 1S0DA 4B1MA 1IQAA 3WQ7A 1UOFA 3H42B 4META 2XXZA 4I0BA 3HMYA 4PLMA 1ZA4A 3LEKA 4CCCA 1YQ2A 3RZKA 1NCQA 4BQWA 1QOTA 2HJIA 3NKTA 2GC3A 4OI4A 5FCCA 4FPHA 2ZEYA 1O5UA 2LROA 4UAPA 5I0SA 4AW7A 4LITA 4O9GA 1K3IA 1AR72 3ACGA 3P1IA 4QHZA 2BUKA 1CAVB 4WVVA 5BNOB 1LHNA 1W39A 2QQKA 3UJQA 5GKAC 2PHUA 3HJRA 2XONA 1E5IA 1LEDA 4KU8A 2ZX4A 2BNNA 1X36A 3WD5A 3ZM8A 4OFGA 4TYSA 3FN9A 4IE0A 4OCTA 1NYWA 4RN5A 4YLZA 2O8QA 4IL7A 4GWIA 4NOTA 3PVBB 3USUB 1S4CA 5FZ1A 4HOOA 3ZXLA 2N7GA 1WW7A 1Q3EA 4PIYA 4CPBD 1DDLA 4BQXA 5IK4A 1H8TC 4WV8A 5LBEA 2YFUA 1HLCA 1MS9A 3PVOA 5FPVA 5CISA 5A6YA 4Q4W3 2ZJCA 5D2AA 3ZYRA 1IPJA 2VULA 3E5QA 4XMIA 4DQAA 2R063 1HRI3 5FXVA 1KS5A 4H2AA 3BI3A 3PL0A 1ZRIA 2VE1A 4HVRA 4FP2A 1WCSA 3E1F1 1H30A 3GBWA 3N9MA 4YZ1A 4LTAA 3L2HA 4OVEA 4O61A 4XIOA 2A6XA 2W52A 1SLIA 5IAVA 1SFYA 3TN92 1QWRA 2IUWA 4ZPIA 4DS0A 1FXZA 5DUWA 3THPA 1J1TA 4KWKA 4XFCA 3E6DA 1CPMA 2XMLA 1MS3A 2EIBA 4FPLA 4HKWA 3FBYA 3PUQA 4LLFA 2NM1A 3AZVA 4DIQA 1W8HA 1WGPA 2RDQA 2ZX0A 4LBMA 4QU1A 3V64A 4MOAA 5T5PA 2ARXA 5LATA 2WIIB 1HXS3 2ZKNA 4I30A 1YFYA 4C0BA 4IEXA 2DF7A 1FATA 1VR3A 2R1DA 1GOFA 1XOYA 3V0BB 5T55A 2C6SA 1DQ1A 4HZFA 5L7OA 1LESA 2P37A 1J1LA 3VHNA 1SLTA 4XFIA 5CG9A 3MW2A 4AFCA 3POJA 3CLPA 2HWB3 2BOJA 5HCFA 2TNFA 1O4YA 5A7OA 5A6ZA 3ZOIA 4XBLA 3CNAA 5EFUA 3RNSA 3ZFFA 2JIGA 2CDOA 5FOJB 4DOUA 2JEMA 1IS3A 2JDAA 5E1RA 3WHUA 3CJIB 4ZXEA 3SCGA 2B9VA 2EXIA 4AI8A 3TOJA 2KR2A 5GLUA 3SITA 3D4KA 1RMU1 1LGBA 2YZ4A 3AYCA 3D3AA 3LSEA 3OF1A 1N3OA 5A7SA 3T2QA 3VD3A 5JOWA 3JBG1 1UU5A 4IE4A 1JZ3A 4DXTA 2I07B 2QQJA 2Y38A 4JAAA 3LGRA 1HJGA 5FV3A 2ZS6B 1US3A 5FUIA 1RUI2 3ENRA 2H0BA 1LULA 1CN1A 2XLAA 5FLHA 4ZY9A 1F9KA 4FTSA 1UKGA 3ES1A 5LBBA 4V2WA 3D82A 5C6CA 5JOZA 4RD7A 4BLJA 1UZYA 3B5LB 5B2GB 1QJX2 3MUY1 1XC6A 2YXSA 1W90A 5EWSA 3TNPB 3OUIA 1JH5A 4AVTA 1LU2A 3O1UA 3C7EA 1RJ7A 3N9OA 3QH6A 3N9NA 4A6SA 3LDBA 3WG3A 3ZXEA 4KI5M 4XQWA 3SH4A 3WY6A 2Y6GA 1GWMA 1VBE2 3QH7A 4MSVA 5JZGA 3PURA 2XOMA 3IIIA 5FZMA 3VHPA 4COZA 1XYNA 2GC0A 2E26A 1G8WA 4QGLA 3AC0A 4YYOA 5J48A 1RUJ3 3AMNA 1RUG3 4AVSA 1RUF2 1TQ5A 4XIKA 5FK7A 5LEKA 2AR6A 1AR71 1OXCA 5D8AB 1F2NA 2R0FA 1W6PB 1QJY2 3BCWA 1W8FA 1ULPA 1C28A 4PF1A 1J3PA 1A8MA 3MLLA 2ARAA 4NJ4A 5H9RA 3JQWA 4WM7B 5C4WA 1DP0A 2UY8A 2C9KA 2Q0AA 2RR13 4AHXA 4QQ2A 4RYDA 1W2AX 4PI2A 5FZLA 3KGZA 4A3ZA 1REDA 1A6CA 1FYUA 2D6KA 2JD9A 3MDPA 2WABA 3ZSJA 4Y22A 3J9SA 2WINB 5A70A 2XJUA 3ME2A 4BQ3A 1NLRA 2PMWB 3ACIA 3KF3A 3RG0A 5CFCC 3JB8A 1UO9A 2DVDA 1O3RA 3KV5A 4WZCA 2BVBA 1SBFA 4ASLA 4YGBA 1QMJA 5FP7A 2IXKA 2VOXA 3TN91 2XBO1 1OPOA 3VHOA 4HANA 4NR1A 2CAUA 3H50A 1TME2 1FOD2 3GBGA 5KBFA 4GULA 1UX6A 4LA3A 2XPJA 1NY72 1UD1A 5C3SA 4LQRA 4CP9A 1UZWA 3BTYA 4IV3A 2YHJA 3S0MA 3NSTA 1ENQA 3ZN5A 2A6ZA 1HB1A 1CIYA 3TEWA 1DYOA 1UQXA 2EA7A 1LRHA 1GFF2 1JZ6A 4ISQA 2PHDA 5FUNA 4AI2A 5FO8B 3I2KA 2GMEA 3A21A 1W2NA 3KT1A 1JYIA 3B01A 3CZUA 3KHCA 4CDUA 5FJHA 3WP4A 4UI9L 5FAXA 1XE0A 1ODMA 1JOBA 5F5CA 4HN1A 3ZLIA 5IWFA 1MQTA 1R092 1WCUA 3Q8AA 1CJDA 1S0FA 4S2GA 4E27A 3AMQA 1SDDB 3Q8EA 4LBKA 1WCKA 4JX0A 1IKPA 3R05A 3V56A 4CE8A 4HKOA 3MIDA 5LBCA 2JDUA 1QF3A 4R9BA 4IE5A 4XE9A 3ILNA 4NIGA 2D3SA 2VC9A 3RYPA 4TZDA 4RFRB 2BGOA 2XWJB 1NCRC 4CP2A 2FZ1A 3AKRA 4IEVA 3KCYA 3NNFA 3TAYA 3H0OA 1O8PA 4N43A 5A3PA 5IVJA 2Q8CA 3ZXGA 3GZTB 4QX8A 3E6BA 4ATEA 4FTEA 3K77A 5T52A 4BMBA 1L7LA 3CKHA 2YC0A 4CDQB 2FDJA 1RUI1 4HSLA 2W0XA 4AEDB 1XNAA 4IETA 2Y6KA 3T2TA 2ZZJA 5FMDA 3V0AB 4BZ4A 2A75A 5K0UA 2WZPP 3WF2A 3WNOA 4XDPA 3LPGA 2OKXA 3K51A 3T08A 2JXAA 3IM0A 4Y33A 4HBNA 1NQJA 3AM2A 3PLQA 1QJX1 3N7JA 2HEWF 1RB8G 2YG0A 3HWJA 1CAXA 4CCEA 1Q56A 1W03A 3J8F2 3AYDA 3POYA 3ZN6B 5IVFA 2VMHA 1VIWB 5ANQA 3AJYA 5JWPA 5BNPA 1CD3G 1GP4A 4XF0A 3SNMA 1VBE1 2HBTA 5CFDA 5E8AA 4B3NA 4Z2WA 3VZOA 1CAUA 1GZWB 1LKNA 1H1AA 4IXLA 1RUF1 1RMU3 4QAWA 4XW3A 2HWE3 4YW7A 1JYXA 3CL1A 5CKQA 3JBG3 2K9ZA 2WNVC 2C24A 3WNPA 2WUHA 4GXLA 3OD0A 1PK6B 4P9XA 1QJY1 1V6LA 2EALA 2D3RA 3PVEA 4UW4A 3P6BA 5A32B 1QEXA 1ZREA 5DAQA 1DLLA 5FZ0A 2XB6C 4Y24A 1UXZA 3TRSB 1FV3A 2GC2A 2ZA9A 3H1MA 1DFQA 4CU6A 5C9AC 1UU6A 3C8XA 3U1XA 2Y26A 2TUNA 3R4DB 4GMP1 3WCRA 4Q0UA 1C57A 4CEWA 3C7FA 5KHKA 3MZHA 4YZ2A 4NPRA 2VMFA 2ZABA 2VVDA 3OD4A 2BRTA 5C8CC 1UOBA 2A3XA 1Y4WA 1VALA 2QCSB 4QPIC 3E6CC 4JGYB 5D1IA 4DXSA 2E9QA 3LEGA 5LA1A 1H9WA 4QX2A 1SHWB 5C70A 4LT5A 3UYJA 3DECA 2OPKA 4K20A 1RHI3 2VVFA 4XAAA 1EPWA 3ROUA 3OYWB 1FOD1 3W58A 1AR73 1W8OA 2JG9C 4Y1VA 3T2OA 4LULA 1D4M2 3DXTA 3ZSMA 1IOAA 4LOTA 5EV7A 4CDXA 3VUOA 4OLLA 3KV9A 3OGVA 4DINB 1GKBA 1REFA 4JGZC 4WVMB 4XF3A 4IUGA 4XFAA 1JOJA 4E4SA 3IDCB 4RR3C 3W20A 2ZGNA 4JTOA 1OT5A 3FE5A 1YNAA 2R30A 4MGYE 1UPIA 1BK0A 1F5JA 1PO23 2WNEA 2VQUA 5FPLA 1WUVA 1WD4A 1S1AA 2LRPA 4YZ4A 3VZKA 1UIJA 3WQ1A 4EYUA 4FSJA 3ZYBA 3SH5A 4EWAA 3VN4A 1Q8QA 3HNYM 2P3YA 4CCJA 1R091 2GN7A 2LS6A 3OOXA 2FD8A 1GU3A 1C4RA 1OH3A 1LNSA 1UCXA 2YMZA 5IUQA 4YG3A 2BW8A 2ARBA 4ARYA 3TN93 3MIFA 2L9LA 5KC6A 3B9CA 3ZXJA 1KFXL 1NCQC 2D6MA 3KVBA 4UW5A 1GOHA 1QJFA 5FYSA 5IHRA 2YGLA 5FZ9A 4E2GA 2R042 1NKGA 3PJYA 2BGCA 3AZWA 1G9DA 1QXRA 1W6NB 4JRLA 1LOGA 1KD7A 2CL2A 2AACA 5FKBA 1NA1B 2A5ZA 5HXMA 1UY4A 3I2DA 1VBC2 1G6NA 4UFJA 2CSGA 3AXDA 2ZGRA 5JOXA 2WQZC 3EHKA 5FBZA 2PELA 4RGGA 4LOSA 3MGUA 2XVLA 2XJSA 5LBFA 1RIRA 4J25A 4YZ5A 2D5HA 1PNGA 4BPZA 1H2NA 3MIEA 4I0WB 1H6XA 5J3UA 4QPGA 2WRAA 2DDUA 3J8F1 2ZHMA 4PBOA 4QXBA 4WM7A 1SACA 1LOFA 4Y5Z0 1XYOA 1UZVA 5J1XA 4ATFA 1E5SA 4PLNA 1QXPA 2X53S 4IE7A 5A3UA 3I3EA 3NKGA 4DY5A 2WLQA 4C0HA 1QOSA 1PMHX 1PGL2 1W6MB 1GZCA 4JKMA 3BUCA 2GP3A 1OA4A 2HWC2 4XF9A 5A3TA 1L7RA 3BIWE 2WFPA 3VDDC 2VH9A 3WF0A 1RUI3 2RE9A 3R0RA 4DUWA 3K4AA 5FY8A 3U4XA 1AR82 1W9SA 4AF9A 4JC1A 3M1HA 3VD9A 3BYWA 1MEC2 2VW1A 3MEPA 4KGQA 5EJ3A 5IW0A 3ECQA 2TEPA 5C5UA 2Q1ZB 3NNLA 4C8DA 1WMEA 5JCTA 1NZIA 5I8SA 4NIHA 3N36A 2JECA 4B4QA 3AP7A 2JDYA 4MHUA 4MYEA 1PHMA 5FYUA 3LQCA 4EZHA 1TEIA 4AAXA 4P9YA 5CB7A 2D6LX 2J7MA 4OI2A 5L9VA 5EP9A 5L7OC 2WWJA 1MVQA 4YVSA 1VBE3 1UU4A 4BYYA 2MPFA 1MZEA 2QE3A 3GHMA 1OHFA 1VAVA 3BGAA 1UMIA 4OHZA 3RFRA 3AMMA 4YFZA 5LK7B 4CDWB 1JZ4A 4OI0A 1D2QA 4AVBA 4B7KA 4QXCA 5L73A 3ZFFC 1DGWX 2ILMA 2Z4FA 1D4M1 1QJY3 3J7MA 2ZCWA 3ZSLA 2DUQA 2E7AA 4DFSA 2XQXA 2IC1A 4CU7A 3MV01 1X8MA 3K4ZA 4QHOA 2R072 3CHXA 4UBGA 2FDIA 3BN6A 1S0CA 4MXVA 2WNUB 2VZVA 2QVSB 4QGMA 1W0OA 4XXPA 1A78A 5FQ0B 3L9JT 4PQQA 1KS4A 4GZ9A 3AL5A 2W08A 4A7ZA 4ZHNA 4Q0PA 3AVSA 1DIWA 1G9FA 2MHFA 2WO7A 1ULCA 5FXXA 3DV8A 1GSLA 3FBMA 1O91A 4PHZA 4LKEA 4FPCA 4QB2A 2JD4A 1S55A 3MIGA 3TEYA 4UFHA 5F8PA 2NZ9A 2VECA 3ZIXA 3CU7A 2V4AA 1CX4A 4P9JA 5FP4A 3TWIA 5L9RA 3O1MA 3JXSA 3ACFA 1TME3 1JUHA 3BOWA 1FOD3 5BNNA 2YFZA 1W3XA 1YI7A 2NPIA 2UWCA 1OD3A 4LHSA 4QHBA 4W65A 3VBUA 3VBFA 2R041 4CPBA 4XEZA 5DPNA 2ZHKA 4NHKA 4YG6A 4P9WA 1HB2A 1WD3A 2J22A 5CA6A 1C5HA 2VM9A 4K21A 4EN0A 1VBC1 2DFBA 2OW4A 5DAXA 2VNRA 1LR5A 1G86A 3KHBA 3I3DA 3LOBA 5A33B 5FY7A 1AHSA 1RUD1 4DNYA 5IVBA 2D93A 5C4WC 5J7MA 1NLSA 3BVCA 1TZOA 3MW4A 3VD7A 5A3NA 5H9SA 1E5RA 1W28A 4PF5A 2PHRA 2VD7A 4YW1A 2DCTA 2UWAA 3FWEA 3CQOA 4HPKB 4LO6B 3RYRA 4N53B 1XBFA 4XJZA 3BPSA 5CZKA 2NP0A 1EV12 1RUH2 1W8UA 2HWF2 3UETA 4CCMA 1B09A 2XHKA 1R093 4KG8A 3HBZA 4WZFA 5K4LA 5KXDA 1J59A 2BWCA 3F95A 4LO5B 4QQLA 4W6XA 5FZKA 2ZTNA 1CGPA 3CO2A 3VBHB 4LK7A 5FY5A 2YPDA 1PGL1 1RUE2 5J96B 3CDZB 2HWC1 1CESA 2X5IB 1IS5A 2F4LA 1POQA 4B4RA 1BZWA 1XSQA 3I4IA 2OVUA 2ZGLA 4GKYA 1F4AA 4WVWA 2LUWA 2MEV2 2JG8A 4W6WA 2Q8OA 3ZIWA 2I74A 1YCIA 4YW2A 1AR81 1V6NA 3KQ4B 4IV3C 1MEC1 3A4UA 2HBUA 4KGGA 4CEYA 1H2MA 3OYWA 4K9SA 4YRDA 4AI3A 4FAHA 4CXWA 4FT8A 3QD6A 4U2AA 5A6XA 1IS6A 3S7EA 2ZPXA 3VBRB 2ZGQA 1PGSA 4AVAA 1U0AA 2AGSA 3J8F3 4ORFA 3WP3A 2VTFA 3GDBA 5B4NA 1X82A 2QQVA 3AP9A 4CDUC 1RJ8A 2A6YA 3I97A 1OQDA 4P9LA 4MGQA 2J1RA 1KGYA 3DN7A 3SCHA 2K2SA 3QBQA 1H1MA 3SEPA 1MQTC 4FOVA 2VOWA 5F32A 1PVC2 3T09A 3POSA 2WQ8A 1WLWA 4LBNA 3IDAA 2A3WA 1H1IA 5B4XA 3PJQA 4UFLA 4EV0A 2WFF2 1XYPA 1QOOA 1BYHA 3M4FA 3J4UH 2ZGOA 3IMNA 4Y5SA 5J09A 4M0HA 4IEWA 2PA7A 2PAEA 4P5YA 3OBZA 4GH4A 5DQ0A 4YNIA 4UYBA 4N43C 3H9AA 5JI7A 2R071 5F7UA 4JHZA 3WNXA 3KV4A 2EICA 2XKOA 4IEPA 4IEYA 1DQ5A 2P3JA 4LE3A 4A4AA 3AZXA 1SDWA 4IEUA 1JBCA 5K0UC 1W6NA 3WQ0A 1NE6A 2Q1FA 4TN7A 3ZFGA 4XUTA 1NA1A 1ASJ2 5LA9A 3VBOB 2JKXA 2V5DA 3RRDA 1TMF2 2YYOA 4R9DA 5FPBA 3KF5A 2A71A 1GOGA 1UY1A 2QQLA 3JUUA 4XUQA 3ZFEB 5IVVA 4N8MA 1VBD2 4Z1VA 5FUPA 1UIKA 3IDEA
chains in the Genus database with same CATH topology
4YVWA 1O3QA 5ABJB 5BNPC 3LA3A 1UPSA 4SLIA 4M01A 5CFDC 5KXCA 3BODA 4XTPA 2P34A 4S2DA 4C91A 1D4M3 4FPYA 3I54A 4IV1B 1COV2 4F3JA 2EXKA 1N1TA 1SBDA 4RSUA 3N7KA 1B35B 5GLWA 3AJZA 2XL7A 2ZGTA 3GALA 2G9GA 4NHMA 4NHLA 1DQ4A 3H3ZA 4GKXA 3ZMNA 4CRQA 2X8KA 4P9IA 1V00A 1YWKA 4IEQA 2UWBA 1K5MB 2HEYF 2AENA 1ND2A 5I0RA 1EV11 1RUH1 2DYCA 4BM8A 1SQ4A 2HWF1 4QU2A 2PHFA 1IZ3A 3AXEA 3NL1A 3JB4C 4DY3A 1FX5A 4CEWC 1YLLA 3B69A 1W6QB 2WT1A 3I59A 2IXCA 1HQNA 2RS12 2PLV2 1RUE1 4XTMA 5HCBA 5LK5A 3M7AA 4KU7A 1AL23 2VNGA 4RA0A 1D2SA 5JI9A 2R043 2TBVA 5E16A 1D0HA 2BTVC 3B00A 3B3QE 2NMOA 4AEKA 2MEV1 3VBSA 1GNHA 4Q1PA 4AQ6A 2UYBA 1DZRA 1ENRA 1D4VB 4CDXC 3DGTA 1WMFA 3APBA 3QLQA 4MH0E 4AI1A 1OQEA 4HVQA 4K6BA 1YO8A 4LBOA 1ZBA2 1WW5A 1NXD1 3M70A 1A8DA 3CJXA 2XBO2 1REEA 4FPOB 2DFCA 3WHTA 4XJ9A 4SBVA 5GZFA 3MLJA 3WT3A 3NV4A 3VZNA 1PVC1 1C5IA 1CAWB 3FLPA 4D94A 3FFZA 2I2SA 1OFSA 2B8MA 2VY0A 2WFF1 5F6KA 4YSFA 4LO8A 1I3HA 1LHVA 4FPFA 1AR83 3KB5A 4MV2A 1MEC3 3M3EA 2BVVA 5HI0A 5H9QA 4YM1A 2C5DA 3OPZA 1LOAA 3SLIA 4M00A 3BOPA 2C9AA 4YGCA 3WDYA 1EPZA 3H8UA 1WLTA 4AQTA 4BE3A 2XWBB 4XZPA 3FMGA 4X8NA 5E89A 1ASJ1 1E57A 2GALA 4M3CA 1IPKA 4AHWA 1VB4A 1TMF1 3OBRA 3HR9A 4OHWA 4QPGC 4DZGA 5L36A 3LOIA 2BNOA 3L2YA 1VBD1 1I9RA 4WM7C 1LOFC 1YHFA 3GNEA 1M06G 4E4DX 1H8TB 4P14A 4Q1RA 4XFHA 5JMCA 4QGNA 2XVGA 1BXHA 3N3HA 4NVPA 3ZYGA 2QDNA 4CP1A 1COV1 2PAMA 2GMMA 3ZXKA 4AK3A 3VBHA 2K0GA 5JSPA 2DVBA 1BEV2 2VNOA 4FP3A 3WW3A 3IWZA 2X5IA 4JQRA 3WW2A 4C1WA 1VLNA 4G9SB 3RPQA 1H4HA 3T1MA 4FAGA 1URXA 2PTMA 4N90A 1QGLA 3DPRB 2GN3A 3M3OA 1W6OB 4RS5A 4Q29A 1LCLA 2XKPA 4LBLA 1PZ8A 2WSUA 3NV3A 3FFQA 3JU9A 1Z0HA 4KQ7A 2RS11 3AKQA 2PLV1 5GLTA 5IK8A 3TBDA 4YVSC 1BCXA 3BALA 3MPPG 3ZXFA 5BXXA 2NQYA 3AYEA 2B9UA 4MX3A 4X6QB 3IPVA 3KGLA 4QPYA 2RS33 2B45X 3KQRA 2R32A 3RJ2X 1LHOA 5T5JA 4J1XA 1SLBA 3WDWA 5ACA2 1ALYA 5F1RA 4LUMA 1HIXA 1OI6A 2ZGPA 4JTNA 1ZRDA 1EY2A 1MACA 4QT6A 5TSWA 3OY8A 1KJRA 1AYM2 4BOWA 1ZBA1 5JR7B 5AFBA 3ALQA 4XETA 1RUH3 2HWF3 1HDKA 4HETA 1QU0A 5C8WA 2BPA2 3FZ3A 1ULFA 3E5XA 3A0NA 2ETEA 4EWEA 1JTZX 5DUVA 1RUE3 3P3PA 4AWDA 3OTFA 3VBOA 2X29A 4EN7B 1H9PA 4IEZA 5BNNC 2MEV3 4OHYA 3VBFC 3VBUC 1WBLA 3USSA 2B39A 2VMGA 2RM22 4CP0A 2KM2A 4PDWA 4COUA 3OBTA 5ABJA 4LNVA 4XQDA 2ET7A 3GZAA 1LHUA 5FREA 3N4MA 3G6JB 2NMNA 3H7JA 2BBVA 1BMV1 4EROA 3O0WA 2HWD2 1GZ9A 3WDTA 5FPXA 5KWRA 1VRH2 1KDMA 1PVXA 5JOYA 3RSJA 1SMVA 1FMD2 3N35A 2GNBA 1PVC3 2OZ6A 2WC2A 4XHBA 4COVA 3O5SA 4RHV1 2DURA 2WFF3 1RUOA 4YGDA 2O0OA 1RUNA 1DGLA 3FUQA 2BEOA 4HT1T 4KL1A 1CAVA 3AP6A 1SLLA 5BNOA 4P9GA 1OA2A 1YIPA 1BEV1 4NN0A 1AVBA 1YJKA 1V6IA 2CGNA 2JG8C 1QQP2 4R9CA 3AYAA 2OUJA 2YDEA 2WT0A 3H3UA 3WG1A 3USUA 3AKSA 1PO12 4CEYC 1QDOA 1ASJ3 3FC0A 4XJUA 2JX9A 3U10A 1TMF3 2W39A 1Q8SA 1GV9A 3I8TA 1W0PA 4XJAA 1VBD3 5FDBA 2WT2A 4GWNA 5GALA 4CYDA 4Q0QA 1IGOA 3ZXDA 4YM3A 1HRV2 4XHXA 2D6PA 1UW8A 1COV3 2CGPA 3ZYIB 2QNKA 1N1YA 1POV1 1YFWA 4H7LA 2DCYA 3IT8A 3FLTA 1XE8A 5ACA1 1C1LA 4FPGA 5GZEA 4MZUA 5KHHA 4GH4C 1FT9A 1VBB2 1OQ1A 3SHRA 1HW5A 4QM9A 1AYM1 4GA9A 5GZGA 1NCRB 2OUHA 4MUVA 1G9AA 3UV9A 3PVNA 2IXIA 3EQEA 1HV1A 3V0BA 1CJPA 1KITA 1AR92 1QNYA 1AXKA 3GF6A 3ZFGC 1NA1C 4HFSA 2B5HA 4XFFA 2RJKA 1ND3B 3H1YA 2JE7A 1BKZA 3JCIA 3M3CA 2RS13 1SLAA 5JDBA 4LHLA 3DF0A 3AKPA 4Y1ZA 4YVWC 2OZJA 4XFBA 3CJIA 4DB5A 5CAZA 2GH8A 3MIHA 4WBBA 4GWMA 4AE2A 4QX5A 2Y0OA 5JAXA 3RMXA 4IERA 2RM21 2DCKA 2BQPA 3CF6E 1SEFA 2VQAA 2DCZA 3S30A 4JV4A 3VZLA 3NAPB 3MIBA 4D7SA 3AFGA 1ZBA3 2R1BA 4LO7A 4N7UA 2WNVB 2HWD1 2Q1MA 2XBO3 1OOPB 4FOYA 3AKTA 4XBQA 5HXVA 5AC92 5A3MA 1FNYA 1WLDA 4LLOA 1VRH1 1ND2C 4BIOA 1ZZ8A 3LB9A 4JCKA 4PIZA 1FMD1 1RUC2 3FLRA 4M0NA 3FUOA 1WW4A 1XRUA 3VLBB 5C9AB 2DCJA 2ZGUA 5EXOA 2D3PA 2R0HA 1OMIA 4ASMB 2XJQA 3DPRA 2FMYA 1MS4A 1XXNA 3IKWA 1GQGA 4Q4X2 1W6OA 2RHPA 1RUD2 1D0GA 4FOWA 2ZX3A 5C8CB 2OA2A 2VPVA 5D8AA 4QPIB 2XL9A 1Y43B 1W6PA 1XNBA 1VAKA 5F6LB 1WA4A 4M3CF 1AX1A 2PHTA 3UKVA 4YARA 3VBSC 4R4ZA 1QQP1 4XPVA 3AZZA 2JG9B 1PO11 2VXRA 4FPKA 2O8OA 4H14A 5FOBB 3E5UA 4QQHA 3LKJA 5EZWA 1UL9A 1RL3A 2R062 2CNAA 4LBQD 1V6OA 1YUDA 4RR3B 1RVF2 2VW2A 4AHZA 1QH7A 2EF6A 1BQPA 4YZ3A 1HRV1 4LA2A 4KH9A 2ET1A 4DMIA 1N3PA 1G9BA 1J58A 1O4TA 1QJX3 1YXWA 2YV8A 3MF9A 3HIFA 1BEV3 1DGWA 4QQPA 1U5IA 1RITA 4OULA 2PAKA 1DQ6A 4R4XA 1AZDA 4YW3A 1VBB1 3KLSA 1NCQB 1GICA 1C8NA 4OI1A 5JVVA 4EN6B 2UURA 3LSDA 1UKRA 2QDRA 1WCDJ 5FO7B 4B4PA 3OCPA 1RUF3 1AR91 1PM7A 4OZXA 1ENXA 2GAUA 5J36A 3UKNA 5DZFA 2H6CA 4Y1XA 4A3XA 4XF4A 4BMEA 1L3JA 4OUSA 5BUVA 5I93A 1PIV2 3O0XA 1POV3 2FQPA 4XOGA 1AUYA 3FX3A 2ZGMA 1Y7BA 4GMP3 5DDJ2 5ACA3 1V9U2 3O7OA 2ZMLA 3RZZA 1OSGA 2QZ2A 1I1EA 3ZDSA 4CDQA 3W9AA 2ATFA 2JJ6A 1ZZ6A 4AEDA 3VBHC 3V0AA 3U07A 4ISRA 4YM2A 1DF0A 1WMDA 4C1XA 4DRRA 4XDQA 1KQRA 3AP5A 2X5IC 1Z7S2 1BVP1 1F5FA 3WXPA 3O14A 4IESA 5AC91 4ZU7A 1G7YA 2GZWA 4XILA 3ZN6A 1RUC1 4RS5C 4ES8A 1EAH2 3KS7A 4HK8A 4Y1YA 2XLFA 3UKTA 2O1QA 2RMU2 1DGRA 1V6MA 4Q4X1 1GZWA 1U5YA 4PQ9A 2ZBJA 1Q8OA 3DL3A 5L7OB 1DYKA 1FPN2 2RM23 2IFRA 1PK6A 4I01A 1KXGA 1XNKA 3GHNA 5A32A 1KDKA 1FI2A 2D98A 1YYNA 2F4PA 5DXDA 3ZFFB 2HWD3 4L9BA 4V1PA 2ZAHA 4WM8B 4XF1A 1VRH3 4L2NA 2P17A 2R061 1FMD3 4AHYA 2XJVA 4FVVA 4RQPB 4YW5A 4Q0VA 3DKWA 1RVF1 4UW3A 5AVPA 4JGYA 3RDIA 2DTYA 1SLCA 4LBJA 3VHRA 1GLHA 1ENSA 3VBOC 5I8TA 4G4FA 1OKQA 4ITCA 1ND3A 3MW3A 4ZKTB 1C8M2 4XBNA 4U36A 2F6BA 1VP6A 4K40A 4URTA 4WVMA 1ZRCA 4W6YA 4PDWC 5FLIA 3M3QA 3KSCA 5JZGB 5ABJC 3PHMA 1PO13 1QY4A 3MFCA 1YJLA 4K1ZA 3OGJA 1DQ0A 3RMYA 2AUYA 5BPXA 5HCAA 2GH2A 3NAPA 2XH6A 5C4WB 1RGSA 2WLPA 1QNWA 1HRV3 4YFWA 1S0BA 3O0VA 1OOPA 1PIV1 3N7LA 3JQXA 5LRRA 4MGIE 3SISA 4Y22B 5DDJ1 1V9U1 1AXZA 3ILFA 3NJZA 4RGAA 3QCWA 5BNOC 3ES4A 2GNDA 3RI8A 4ES9A 4JDOA 4D7TA 4FQZA 1HQWA 4XYXA 2Q30A 3VKOA 1Z7S1 5EYYA 1AR93 1Q8VA 2EXJA 2VW0A 4Z07A 4HKLA 3ZSKA 4AFAA 1KFUL 3KCCA 3VZMA 2D40A 5JIAA 1DGRN 3WINE 4IV3B 5J37A 5K8SA 1YRZA 1EAH1 2E51A 1S0IA 2GNMA 4LBQB 4R9AA 2WA3A 3ZVXA 1W6MA 3ZMOA 4AXOA 2RMU1 1AR62 5JPMB 2HWE2 1CONA 2KA3A 4B8EA 1J3RA 4CDUB 4ZU4A 4EWDA 1FPN1 5CNAA 2XGXA 2DUPA 4AVCA 4A2UA 1MQTB 3UJOA 4Q0SA 5KXBA 4BLIA 2P3KA 4XMAA 4A7KA 4KBBA 3D8CA 3GYDA 2D6NA 2FMDA 2ZAAA 3M8LA 3ZN4A 3EXUA 2Q4SA 2E7TA 4R52A 1VBA2 2GMPA 1EYBA 2UU8A 4M3CE 5AC93 2DVFA 3LAGA 1H2KA 2DTWA 4N43B 1RUC3 3RQ0A 2ZOEB 2NYYA 3EBRA 4RL7A 1Y3TA 4AEJA 2YGMA 1VBC3 2PN5A 3WCSA 5K0UB 5FO9B 1S2BA 1RHI2 2QQPA 1JYCA 4Q4X3 4E2SA 5T3NA 1RUD3 2EVXA 2WS92 4FQ4A 2C0ZA 4CDWA 1MZFA 2VMIA 1CAXB 1J3QA 2VGDA 4MGKE 5FMOS 2R16A 3CJIC 1C8M1 4CTEA 1AL0G 3WLUA 5FFOC 2D97A 3ZSEA 5BNPB 5F5QA 4GB32 5CFDB 3SCFA 2QUOA 2ZGSA 3PMSA 2ES3A 2WNUA 3POWA 1BVVA 3JZVA 1CAUB 1PO22 3RYKA 5FQ0A 1Q43A 1ZM1A 2WQ4A 4NO4A 2Z69A 3RI9A 2HWC3 3VL8A 4XJ8A 1XNCA 1U5ZA 1RVF3 1HKDA 2VU9A 3A0KA 2WKKA 1DU3D 3MICA 1ULDA 4Y4YA 4AQSA 2YPJA 4D69A 4L97A 1N1VA 5DZEA 5JIUA 3H1WA 1LECA 5F9TA 3OGGA 2AZ5A 2EAAA 3DPRC 4Q4V2 1S2KA 4N7IA 3WDVA 3IBMA 1DHKB 3X29B 4FXGB 1AJKA 4CEWB 1BMV2 2ZHNA 4YG0A 4XQ4A 5D8AC 3WUDA 5KHJA 4PCRA 4LEJA 4L11A 5A33A 1DQ2A 5JSOA 3LZZA 2VOKA 4Z8BA 2H0VA 2B7YA 1LEMA 2IXHA 1CR7A 4RHV2 4HPKA 2B46X 4N53A 2GSYA 4CDXB 1R082 1R1A2 1XNDA 1AX2A 1RC6A 5GZCA 2C1FA 5DUXA 4AGVA 3N7MA 3ASIA 2R073 2RS52 4WM8A 1PIV3 5BV6A 3BU7A 4TWTA 1ZZ7A 1AR61 5KHGA 1EP0A 2FHRA 2HWE1 5J98B 5HBAA 2IWGB 5DDJ3 1V9U3 1Q5OA 1V6KA 4RQPA 3MI8A 4MXWB 1BBT2 1LODA 2VOVA 4K3UA 4DPNA 1WBFA 2JENA 4IEOA 2XJPA 1QKQA 2D6OX 1PGW2 1SCSA 5I91A 1IHMA 5C33A 1NE4A 4COWA 1Z7S3 3C2UA 3D0SA 1VBA1 4LO4B 3VBRA 2R49A 5IK5A 3B02A 3O12A 4X6RB 1LU1A 1H8VA 1ZRRA 5FRAA 1EAH3 3LWCA 5I8YA 4QM8A 2DWRA 2XG3A 3ZXAC 5FLJA 3D5OA 4GIQA 2RMU3 1N47A 1RHI1 2OIIA 5IT6A 3KD4A 1FAYA 2WS91 4HMZA 4AFBA 1OLRA 1YFUA 3WVJA 1O3SA 1FPN3 4QPGB 4K7JA 1GBGA 1U12A 1DZQA 1V6JA 4QXKA 1EV13 3VKLA 2GC1A 2AYHA 4OUMA 2P3IA 5AFEA 2FZ2A 1G9CA 1APNA 4GB31 4NWWA 1AF9A 1PZ9A 2WL1A 3B9IA 4CDQC 1U5XA 4AEDC 1PO21 3KT4A 4BH9A 3UK9A 4JRAA 2LM3A 4I3PA 4Y26A 4WVZA 1O3TA 4FXKB 5CBLA 1GR3A 4B7EA 2WJSA 3ZFEA 1AYN2 1WW6A 1BJQA 5JSRA 1LENA 4G3YC 4Q8LA 3E97A 4N9IA 2E6VA 5BNQA 3MPBA 4ZXKA 1NG0A 4Q4V1 2IZWA 3IIAA 3KT7A 4HN0A 5LEJA 1LOBA 2EAKA 4IV1A 5FMOL 5T5OA 1C8M3 1VAMA 4OHVA 1B35A 1YFXA 4LBQA 4PBPA 1HV0A 4YVSB 1PK6C 2CWMA 1MZ5A 1AJOA 3FHIB 5E88A 1F31A 4FOQA 2HKXA 1H2LA 3ST7A 1K5MA 1ZYBA 5DG2A 1MZ6A 4Q27A 5FPZA 3AB0A 4X8PA 1VB2A 1R081 1R1A1 5GM0A 4I2OA 5CFCB 4B29A 3THTA 3HT1A 4I3GA 1PNFA 1W6QA 2CYFA 2QJVA 5SV8A 2R6QA 2RS51 3MF6A 4F83A 4JGYC 5DG1A 3ELNA 1ULGA 2E7QA 3ZX7A 1XE7A 2UYAA 4Y20B 5JPNB 4DRVA 1BBT1 4MVTA 4QQOA 1YI9A 1MR5A 1SCRA 4D7YA 1ND3C 3S7IA 3AK0A 1PGW1 2WSVA 1GYKA 2WZR2 4Y1UA 5BNNB 1DYPA 4K8FA 4XFGA 3VBFB 3VBUB 4FPJA 1X50A 4GQ7A 4P5HA 3IDBB 2ERFA 2PFWA 2VUJA 3HAGA 1SBEA 1ZX5A 2JICA 1YIFA 5CVRA 1LGNA 2ZKLA 3NVCA 2ZMNA 2RJLA 4GALA 5A3LA 4R8HA 4BQ1A 2PHXA 3NAPC 4HK9A 1BK1A 1AR63 1CAWA 1I6XA 3WP6A 2FBEA 4C90A 1FNZA 3FJSA 1S0GA 1TE1B 1KJLA 2AREA 2EIGA 1OOPC 1CIWA 1LJ7A 5FTTC 2IXJA 4EN9B 2JDZA 1MS8A 3WR0A 1POV0 1X33A 4L8QA 4YM0A 1IKQA 3KCXA 3AZYA 2QKDA 5K9YA 1XQNA 4KNCA 5KHIA 2CGOA 4GMP0 4AGGA 2ZX1A 3JD72 1UN1A 3LCPA 4AFMA 4XJWA 1MS0A 4JVAA 3MFAA 1SFNA 1VBA3 2PLV3 5K7PA 4FBFA 1ZBE2 1RINA 4MGZE 2JG8B 2ZX2A 3PMEA 4LR4A 3U11A 1GANA 1AX0A 4Q4Y2 1AYN1 1ZZ9A 2V73A 1TME1 3HN1A 4CEYB 2XJTA 3QOPA 1JXNA 2WS93 1NY71 3D6EA 1N3QA 4YW4A 1H8TA 4AFDA 4DXZA 4FTBA 3B7MA 1QJU2 3SMHA 1VJ2A 1X7NA 4O9EA 2GNTA 1ULEA 5I0TA 3U0ZA 2P2KA 4OHXA 3HQXA 4RFT0 3J26N 3AFKA 4FPEA 4GB33 5BYNA 1DZTA 1R1ZA 1CPNA 1OD5A 2ZMKA 4BA6A 1F8VA 1LOEA 2KXLA 2A7AA 3AX4A 4Q2FA 3PTYA 1LHWA 2CWSA 1UAIA 1RTVA 2WA4A 2VQ0A 3AMHA 2IFWA 2PHWA 2I45A 2A70A 2E53A 1JW6A 2HEVF 3LA7A 4MXWA 4UBHA 1C3HA 1KRIA 4I09A 4BCUA 4F7ZA 2VUAA 3NV2A 2GU9A 4KWLA 4GH4B 3WG4A 3K48A 1C1FA 1XU2A 5GJ6A 4PIXA 1JN2P 3RS6A 1OA3A 3Q9OA 4ZU5A 1PZ7A 1JUIA 1AL22 3M3IA 1I5ZA 4PJYA 5T54A 4Q4V3 3TNQA 3TYJA 1QHDA 3ZFGB 1NXMA 3EJKA 4AQ2A 2A6VA 3VZJA 2VVEA 2BFUS 4BWOA 3GBFA 4CDWC 4E4ZA 3RJRA 1DBNA 3VV1A 2IXLA 1AXYA 1LOCA 2YUEA 4Q4W2 2H6BA 2XJRA 4JGZB 3WDUA 2B42B 2ZZQA 4YVWB 1HRI2 1ZNPA 2DU0A 2Q5TA 2WZR1 3SXWA 3R4SA 3GZUC 4RHV3 2WNUC 5GZDA 3ACLA 4INDA 1MS5A 1R083 1R1A3 3QACA 2Z5WA 3WV6A 4AI0A 2GDFA 3AP4A 2RS53 1LTEA 5GLZA 1X8EA 4COYA 2V09A 5KC5A 1ZRFA 1OPMA 3ETQA 2Y0IA 3LA2A 1HXS2 2XUMA 1ND2B 2YROA 1FV2A 1BBT3 4LHNA 3TB0A 1M4WA 1ONAA 1LB2A 3BTAA 1IS4A 1H4GA 3ILRA 3WZ1A 3PNAA 2BNMA 3I59B 3JD71 1Z78A 1XU1A 2DV9A 2D43A 2HWB2 2QFEA 1PMIA 2A3YA 4LE4A 2LTNA 4BHPA 3WW4A 2DUOA 2V5YA 5H9PA 4S2FA 1ZBE1 1O5LA 1Q8PA 2A73B 3C3VA 1W2UA 3VBSB 1A3KA 4N53C 3D0JA 4Q4Y1 1S0JA