1C8M1

Refined crystal structure of human rhinovirus 16 complexed with vp63843 (pleconaril), an anti-picornaviral drug currently in clinical trials
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
285
structure length
285
Chain Sequence
NPVERYVDEVLNEVLVVPNINQSHPTTSNAAPVLDAAETGHTNKIQPEDTIETRYVQSSQTLDEMSVESFLGRSGCIHESVLDIVDNYNDQSFTKWNINLQEMAQIRRKFEMFTYARFDSEITMVPSVAAKDGHIGHIVMQYMYVPPGAPIPTTRDDYAWQSGTNASVFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDTYKSRYGTVVTNDMGTLCSRIVTSEQLHKVKVVTRIYHKAKHTKAWCPRPPRAVQYSHTHTTNYKLSSEVHNDVAIRPRTNLTTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title THE REFINED STRUCTURE OF A PICORNAVIRUS INHIBITOR CURRENTLY IN CLINICAL TRIALS, WHEN COMPLEXED WITH HUMAN RHINOVIRUS 16
rcsb
total genus 60
structure length 285
sequence length 285
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2000-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c8m100
3VBSA 1VBA3 1PIV3 1C8M1 1H8TB 2TBVA 1R1A2 2HWD1 2WFF3 4RQPB 1COV1 4Y5Z0 1HXS1 1B35A 4EJRA 4JGYA 2QQPA 1C8M2 1RUG3 1RUI1 1H8TA 2HWD2 3LOBA 1COV2 4QPGB 4WM7C 4GB31 1NA1B 1HXS2 1AL23 1RUD3 4CEWC 5BNPC 5L7OB 3DPRB 1RUI2 5CFDB 4LLFA 4JGYB 1ND3C 3JB8A 4GB32 1IHMA 5FOJB 1DDLA 4FTSA 1WCDJ 4RHV2 3ZFGA 4GMP1 1NA1A 2HWE3 1ASJ1 4PDWB 1BEV3 1RMU3 2Y26A 2RS31 5ABJA 1EV11 5CFCB 1CJDA 3VBHB 1OPOA 4CDQC 2XBO3 5JZGC 1PO23 1ASJ2 1HRV1 1PVC1 2R063 4N43B 5BNPA 1FOD3 2FZ1A 2R073 4FTBA 1QQP1 2RS11 3IDEA 2RS32 1EV12 1ND3A 4AEDA 1F2NA 1RUE3 1RUF3 1HRV2 1PVC2 4CDWB 3VBHA 1VBE1 2MEV1 2R043 1QJY1 1QQP2 2RS12 3VBFB 5FMOL 4YVWA 3NAPB 1RB8G 4JGZB 1HRI3 1VBE2 2MEV2 1BMV1 1AR73 1QJY2 1PO11 4IV3C 1OOPC 5J98B 3VBFA 1BMV2 4Q4W3 1VBB1 1PO12 4CDXB 1AYM3 3JBG1 5GKAC 1ND2C 1K5MC 5BNOB 1HX6A 1VBB2 2HWC1 1EAH1 3JBG2 2VQ0A 1D4M1 1OOPA 2BUKA 2HWB1 4IV3A 3S6PA 1VBD1 2DF7A 1POV0 2RS53 3TN93 2RM21 2WZR3 4IV1B 3VBOB 1TMF3 4CDUB 5BNOA 2HWC2 1EAH2 3ZFEB 1NCQA 3VBSC 1D4M2 2HWB2 1FPN3 1VBD2 2PLV1 1RUJ1 1K5MA 4Q4V3 1NG0A 1QJU1 2RM22 4Q4X1 5K0UC 4RFT0 4Y4YA 4IV1A 1ZBA3 1ZBE1 4JGYC 3ZFEA 2PLV2 1RUJ2 5BNNB 1QJU2 1AYN3 4Q4X2 1BBT1 1H8TC 1TME3 4N53A 1VBA1 4RQPC 1ZBE2 2ZTNA 2WFF1 3CJIB 1BBT2 1RVF3 5K0UA 2RMU3 1VBA2 1RUC3 3JD73 4QPGC 3ZFGC 1RUG1 1NA1C 2GSYA 5A32A 2WFF2 4GMP0 1E57A 5J96B 1X33A 1NCRB 5L7OC 4YVSB 4Z92B 3CJIA 5CFDC 5ABJC 5C8CB 1AL21 1RUD1 4CEYB 4RQPA 1RUG2 1C8NA 1AR83 4RHV1 1MEC3 1SMVA 2BFUS 1AL22 1RUD2 4AEDC 2HWE1 4RR3B 1BEV1 1R083 4QPGA 5CFCC 4CEYA 1RMU1 3VBHC 1V9U3 4N43C 5L7OA 3JB4C 3DPRA 5CFDA 2XBO1 1PO21 3VDDB 2HWE2 2R061 1BEV2 4YVWC 5C4WB 1FOD1 4GH4B 2R071 1QJX3 1Z7S3 1RMU2 4CDWC 4PDWA 1FMD3 5ACA3 1RUE1 2XBO2 1PO22 1RUF1 2RR13 2R062 1QJZA 3VBFC 1FOD2 2R041 2R072 3VDDA 5CFCA 3NAPC 4JGZC 4N43A 1RUE2 1RUF2 1HRI1 2R042 1AR71 1M06G 5A33B 5DDJ3 4CDWA 2BBVA 1AR93 2FZ2A 4CDXC 1HRI2 1AR72 4Q4W1 1NY71 5BNOC 1AYM1 3NAPA 1VRH3 4JGZA 1NCQC 1MQTB 1RUH3 4SBVA 4RS5B 4Q4W2 3VBRB 4Q4Y3 1NY72 1R093 1AYM2 4IV1C 3J8F3 3VBOC 3ZFEC 2RS51 3TN91 4CDXA 5C9AB 2XPJA 2WZR1 1TMF1 2X5IB 4N53C 1FPN1 1W39A 1RHI3 2RS52 4Q4V1 3VBUB 3TN92 2WZR2 5LK7B 1VB4A 1TMF2 2GH8A 5BNNC 1ZBA1 1FPN2 2WS93 4NWWA 3VBOA 4CDUA 4Q4V2 1ND2B 2ZAHA 1AYN1 1VBC3 1TME1 1VB2A 1ZBA2 3CJIC 3ZFFB 1AR63 1PGW1 1PIV1 1AYN2 1RVF1 4FTEA 1TME2 2RMU1 2BFUL 1RUC1 2HWF3 3JD71 5BNNA 3VBSB 1NCRC 4YVSC 4QPIB 1PGW2 1PIV2 5C8CC 1RVF2 4CEYC 2WLPA 5AC93 2RMU2 1RUC2 1POV3 3JD72 5D8AB 3DPRC 4FSJA 1B35B 1AR81 4WM8B 1MEC1 1R1A3 1X36A 4QPIA 4RR3C 4PDWC 1C8M3 1R081 1AR82 5D8AA 1NCRA 4YVSA 1MEC2 2HWD3 5C8CA 1V9U1 3VDDC 1COV3 4WM8A 3ZXAC 5C4WC 2BPA2 1HXS3 4GH4C 1R082 4BCUA 1RUI3 3ZFGB 1QJX1 1Z7S1 2WWSA 1V9U2 4GB33 4RR3A 1FMD1 5ACA1 4RHV3 5ABJB 2RR11 4WM7B 1QJX2 1Z7S2 4CEWB 5BNPB 1CD3G 1FMD2 5ACA2 5C4WA 1OHFA 4GH4A 2RR12 1ND3B 4GMP3 3FBMA 4AEDB 1ASJ3 4WM7A 2RS33 1EV13 5DDJ1 4CEWA 1AR91 1HRV3 1PVC3 4YVWB 4CDQB 1MQTC 1QQP3 2RS13 5JZGB 1PGL1 3HAGA 4RS5C 5DDJ2 1VRH1 3VBRC 1AR92 1RUH1 1F8VA 1VBE3 2MEV3 1QJY3 5A33A 1PGL2 4Q4Y1 1R091 4CDQA 1VRH2 5C9AC 5JZGA 1HQNA 3J8F1 1RUH2 2X5IC 4CDUC 3M8LA 1MQTA 1R092 1PO13 4Q4Y2 3VBUC 4RS5A 3J8F2 4NWVA 3VBRA 1RHI1 4IV3B 1AUYA 1OOPB 1VBB3 5FMOS 3JBG3 5C9AA 2WS91 1NCQB 1RHI2 2X5IA 1A6CA 3ZFFC 1VBC1 2IZWA 1K5MB 2HWC3 1GFF2 1EAH3 1D4M3 3VBUA 2HWB3 1AR61 1VBD3 2WS92 1AL0G 1VBC2 2RM23 4QPIC 2HWF1 4N53B 1ND2A 1AR62 2PLV3 1RUJ3 1VAKA 1NOVA 5D8AC 1QJU3 4Q4X3 3ZFFA 1B35C 5AC91 4WM8C 2HWF2 1POV1 1ZBE3 5K0UB 2ZZQA 1R1A1 1BBT3 5AC92 5A32B
chains in the Genus database with same CATH superfamily
3WF4A 1XE7A 3UJOA 3PUQA 3PDQA 1QHDA 4FT8A 4R52A 1C8M1 5T55A 2JIGA 1DQ6A 1JYCA 2VXRA 2DTWA 2CGNA 2YZ4A 5BPXA 4A6SA 1UCXA 4IERA 1YNAA 2HWD1 3GJBA 3O1TA 4QGLA 3T4VA 4Y26A 1XYNA 2ARAA 1OA3A 2PAMA 2VECA 1FT9A 2VMGA 1B35A 2VY0A 3R0RA 4ZY9A 4ZU7A 1GQPA 3RZGA 4E27A 2ZX1A 1YEWA 2JXAA 1NXD1 2J1SA 5C3OA 5HXVA 4A45A 1RUI1 1OUSA 2OS2A 2WA3A 3D6EA 4XUQA 5I8SA 3LDKA 4HSLA 3LOBA 2R49A 1L3JA 4GB31 2DCYA 1HXS2 3NQHA 2FDFA 2QQWA 1AL23 4LQRA 5HBAA 4FO9A 3RZZA 2DUPA 2WC2A 1LTEA 3H9AA 3GXUA 5CG8A 4YW6A 5HCFA 3P1IA 4CXWA 1XQNA 4LLFA 4XILA 3B9IA 1GQHA 4CU7A 1IHMA 2V4VA 1A3KA 5FOJB 3RZJA 5T5LA 4I2OA 4FTSA 1TQ5A 5FYHA 3SEEA 4DOUA 4BQWA 3FC0A 2HWE3 4UT5A 3M2MA 2ZGUA 2QQKA 1JU4A 2W1QA 4BDVB 2JG9B 2Q1FA 4NE9A 4QB1A 2GH2A 2Y26A 4M01A 1Q43A 3OYWA 4CE8A 4COVA 5ABJA 5J7MA 1OLRA 5FZLA 5CFCB 2PQQA 4D7YA 1W8WA 3MIDA 2ARCA 3WQ7A 2VPVA 3WNLA 2YB7A 3ATGA 1ULGA 2JICA 1ASJ2 1HRV1 1PVC1 1SFPA 1UXXX 2VH9A 4N43B 2A75A 5BNPA 3J9SA 2PHDA 2XJVA 4AFBA 1T6BX 1S2BA 5T52A 2O8OA 4BMBA 1QQP1 3KMHA 3D8CA 2RS32 4UF0B 2JD4A 1DZQA 4OZOA 5JWPA 4NIIA 5JUVA 2Z2SB 1OMIA 1O4ZA 3GCXA 1RUE3 1KGYA 2EA7A 4MVTA 4AVSA 2WN2A 1MVQA 4QX5A 5FREA 2QDRA 4CDWB 2LUWA 4EQVA 4META 2R043 4LBOA 2H0BA 4Y1UA 1QJY1 4ATFA 5KR7A 2RS12 2ZACA 4YW2A 3BPSA 5FTTC 1WW6A 3VBFB 2VNRA 2HEYF 4K8FA 2QVSB 4K20A 4G9SB 5JIUA 4YVWA 4ONUA 1J3PA 3KSCA 3VKNA 1RB8G 4A7ZA 2MEV2 4IDZA 1BMV1 2ZGNA 4TSVA 4DPNA 1V00A 4NJ4A 4XMIA 4ES9A 3RJ2X 2ZMLA 3E5UA 3ON7A 4QB2A 2VMCA 4IV3C 1OOPC 2Z5WA 3VBFA 1IQAA 1XRUA 3AVRA 5FXZA 4D69A 4UWDA 4DFSA 4DNYA 2HBTA 2WNUC 5LY2A 2I2SA 2QFEA 5FPLA 4HN0A 3ZIWA 3GNEA 4P08A 4YW7A 2H0VA 2X53S 2ZKNA 3KT7A 4IESA 4ARXA 3ZX7A 1OD3A 5BNOB 1HX6A 4P5HA 1VBB2 4KWJA 1YQ2A 1SPPA 3POSA 4XUNA 2YFUA 1G6NA 2HWB1 3MLJA 3S6PA 1YFUA 1GANA 3POWA 2IWGB 2SBAA 3TN93 1SLAA 2BQPA 4L97A 4NHMA 4CDUB 5BNOA 5KXEA 4AOCA 1GWLA 2EIDA 3HPNA 4AEKA 5IAXA 1U0AA 1D4M2 3N9LA 1FPN3 4BQ2A 2PLV1 3A0NA 2UURA 2ZOEB 1K5MA 3WF0A 1NG0A 4D6SA 3UT0A 4XJ9A 1OLME 1JOJA 2GAUA 1U12A 2VVDA 3J7HA 4KG0A 2XUMA 4R4ZA 1HN0A 3ECQA 2V09A 1ACCA 5FJHA 4XJZA 1JZ4A 1W8OA 3I3DA 5BNNB 1O6UA 3ACLA 3E6DA 2Z69A 4YG3A 3ZO0B 4HG6B 4UW6A 3DEMA 4UW4A 5FY8A 4E4DX 1TME3 5A3LA 2J7MA 2G9GA 2XJRA 5LASA 2EIGA 4MZUA 1U5IA 1VBA1 2ZGOA 1JZ2A 2I45A 4CP2A 3R4DB 3CDZB 1ZBE2 3AKSA 5F6LB 2WR9A 5EP9A 2CDPA 4IGOA 2ZTNA 3EMRA 2PHFA 4CUGA 5I91A 3M3CA 3OPTA 5GLZA 1TEIA 1XU1A 4AQTA 4M3CF 5C3SA 4P5YA 1OF3A 3IAPA 3ZSMA 1W8ZA 4WV8A 1RUC3 2AGSA 2OW4A 2YFZA 2ZX3A 4P9YA 3LD8A 1BVVA 1RUG1 3H1MA 4XBQA 4LOTA 1W9WA 3R4UA 4BQ3A 3DL3A 4AXOA 5L7OC 1JZ8A 5LRRA 1W6MB 5JDBA 4Z92B 2A71A 5CFDC 5C8CB 1W6NB 1K45A 4IEUA 4I09A 1I9RA 4RQPA 3EQEA 5FP3A 3ZSJA 2D6PA 2YPJA 1SEFA 1MEC3 2IUWA 2YGMA 1VP6A 5FPXA 1V6MA 3KT1A 1REFA 4YM3A 2OZ6A 3BTZA 2BFUS 2X29A 3RWNA 4HZFA 1AL22 4FCAA 1ENRA 1E5SA 1W6MA 2AACA 3QLQA 4YW4A 3W9AA 3ZSEA 3O1RA 3LFIA 2X05A 1W6NA 1QU0A 4B7KA 1RMU1 3KQRA 4IXLA 1CGPA 5FK7A 1LHVA 3THCA 1YCIA 5BYNA 3TRSB 4YSFA 4UFLA 1GYKA 1KS5A 1GZTA 4I3GA 4GWMA 4D6QA 1PO21 4XTMA 2HWE2 2WQ4A 4JX0A 5FY0A 5JVVA 5A70A 3RG0A 4ES8A 1Z7S3 5CKMA 3SH5A 1UX6A 3WW1A 5IK7A 3ES1A 3RYKA 2JE8A 2QCSB 5IATA 5FUIA 5FYIA 2JDPA 3TYJA 4LBLA 3GDBA 5CU1A 4PLNA 3TEYA 3HNMA 2I07B 2WAAA 4EWAA 2ZGQA 3OF1A 1QJZA 3RFRA 2CV6A 1IQDC 2YG0A 4QKFA 4A3ZA 4FBFA 4QDRA 5FMCA 3AYAA 3OGVA 4QM8A 4QQHA 1IPJA 2ADEA 2WNOA 4J25A 4JGZC 4V2WA 2TUNA 4XOGA 4FPKA 2WZPP 1RUE2 3AP6A 4FPJA 5FKCA 4A6OA 1SACA 4XDOA 4MV2A 1HRI1 2R042 1AR71 4IE0A 1A34A 1J83A 2VMIA 3DN7A 3GBFA 2B4KA 2VNGA 4RGGA 5DDJ3 5A33B 4XFIA 5SV8A 3SCGA 1H2KA 1OFNA 2DCTA 5ACA3 1AR93 3U11A 1HIXA 4LLOA 4PJYA 3WR0A 3MIHA 2DYCA 4Q4W1 2W0XA 3AKQA 2H6BA 2XWJB 4K21A 3OEBA 3P3PA 4HK8A 1JI6A 4YZ3A 1BCXA 1WA4A 4HANA 4NHLA 3OD4A 3T2PA 2ZGKA 4SBVA 4BU2A 5L9RA 5F5IA 3SISA 2GC1A 1J58A 2GNBA 1BYHA 1RYYA 1V6KA 2OQ7A 4IETA 2ZX0A 4NRMA 3RPQA 4F8AA 3O1UA 3OBAA 1NY72 1A8DA 5T3NA 4B29A 4QU1A 3MDPA 3NNFA 3CO2A 4NPLA 3ZFEC 2XVLA 1O8SA 1ULEA 4AGGA 5L73A 2XPJA 1PK6C 4AVBA 2BEOA 4ZONA 3GHMA 1TMF1 1BHGA 4PHZA 1WMFA 4XETA 4XQDA 2W3JA 5DAQA 2ZGRA 2W9XA 2YC2A 3VBUB 5A7QA 3TN92 5LK7B 1W06A 1Q8PA 5E1RA 2DTYA 3CBNA 5FZIA 4HVOA 5G05L 3MV11 1FPN2 4C0HA 4UYBA 1YI7A 2WS93 2KM2A 4MGSA 4ARYA 1LGBA 1XNDA 2GN3A 1CAXA 3O12A 1OKOA 3VBOA 4AG4A 5FYMA 1CZSA 1VB2A 3AXDA 3JU9A 2VW0A 3PMEA 4CCMA 2BZDA 3AYEA 3U0ZA 2IXIA 3A22A 1S0IA 3CKHA 3ZYIB 4JV4A 5FZMA 2VMDA 2IXJA 3IN9A 1G7YA 1K42A 1SHWB 1TME2 4RA0A 1UY2A 1LR5A 2RMU1 3IMMA 1GOHA 3POIA 3KF5A 1NCRC 1AX2A 3KHCA 4YM2A 3BODA 1OLQA 3C7HA 3QBQA 1PIV2 1TG7A 4QQ2A 3GBWA 4KNCA 3HT1A 2OA2A 4CEYC 3AKPA 2C1FA 4ZU4A 5AC93 1PX4A 3CHXA 3NNGA 4LE3A 1KRIA 1LKNA 1RUC2 5KHGA 1CIWA 3WQ0A 4FSJA 4MH0E 4DIQA 1H1MA 3RI8A 2R32A 3BB6A 2BW8A 2VTFA 1R1A3 1JW6A 2YU2A 5FZOA 1H0BA 3LEGA 3L9JT 4RR3C 1SFYA 2WO1A 4ITCA 5JR7B 1RXFA 3I49A 1BKZA 4S2GA 4CPBA 4LITA 1W9SA 4I30A 5EWSA 3SLIA 4TTGA 1HN1A 4YVSA 1MEC2 2ZAAA 1ZZ6A 1V9U1 1COV3 1UOFA 4AW7A 2VGDA 4AL9A 4NHKA 1CPMA 4IQPA 3PMSA 4AFDA 4DXSA 4BA6A 2O1QA 1C3HA 1CPNA 3GCWA 1WGPA 3AZVA 3IMNA 2VOKA 1X82A 5DUVA 2Y0OA 4FFFA 1A78A 5FBJA 3ZSKA 3MEPA 2Y6HA 3ZN5A 3BU0A 2JKBA 1H1AA 4RFRB 2VUDA 5C7GA 4BH9A 2RR11 4ZHNA 3T0AA 1JXNA 2VOTA 4B3NA 4W65A 1O3RA 1Z7S2 3AZWA 2PYTA 5CKQA 4CEWB 3TNQA 1CD3G 5FXWA 3MIFA 2QQLA 4YG0A 3PUHA 5DQ0A 2YDEA 1OHFA 1CR7A 1ND3B 1QXRA 1XOYA 2P17A 2VQTA 3VZKA 3PTRB 1JZ6A 2XQRA 2ET7A 3UV9A 4B4QA 2P3YA 2XGXA 1YJLA 2IXHA 1EV13 2NZ9A 2VVEA 5E8AA 4CEWA 2PHXA 3N9OA 3N36A 3WG2A 1LOFA 2WKKA 3ZYRA 1J1TA 2W52A 4IEQA 3S0MA 4OHYA 1V70A 1V6OA 1DQ0A 1PGL1 5FMBA 1ULCA 4LK7A 5FLJA 3VD5A 1O4YA 1PZ7A 5DDJ2 4C8DA 2R16A 2E7AA 2YBKA 4EN8B 2PHLA 1AR92 2ZHKA 4IEXA 1F8VA 2RDQA 4BXFA 4GJZA 4JTOA 3TWIA 4M4PA 2RJ2A 2ERFA 3ZR5A 2VZRA 1NLQA 3MO4A 1DQ5A 3WQ1A 2X5IC 1ZVFA 3VZMA 4EN6B 1YO8A 3IPVB 4LMFA 2Y38A 3ZMNA 1F9KA 3M8LA 3KQ4B 3U75A 1YIFA 1JTZX 1H4HA 2RJKA 1NAEA 1UYXA 2JG8A 4PIYA 3WUDA 1OKQA 2D40A 1IS6A 5A3UA 2VOXA 3Q8CA 5AVPA 2IVJA 2HBUA 3PVEA 1CVNA 4N9IA 1MACA 2CGPA 3U1XA 3JBG3 2W92A 3CU7A 5C9AA 2DWRA 1VAVA 2H6CA 1TNRA 2C9KA 3ZFFC 1VBC1 3OG2A 4EN9B 4BB3A 1W8FA 3W59A 1O4TA 4LBQD 2HWC3 1GFF2 1W0NA 2J1EA 4XUOA 3N9QA 4I0BA 3WV6A 5KHJA 3ZN4A 1JZ5A 1AR61 1VBD3 2WS92 4ZS3A 1F5JA 3B94A 1HLCA 2ATFA 5JLVA 1EPZA 3ELNA 5GZGA 1OT5A 2P3KA 3BTYA 1CAWB 2WWJA 4FXKB 3B01A 3PURA 2HWF1 5C3QA 4CXXA 1AJKA 1O3SA 3ROUA 2RDSA 5FYTA 5A7SA 1N1YA 1GNHA 3ALQA 1NZIA 1J84A 4I3PA 1RUJ3 4DY3A 5EV7A 2OQ6A 3A0KA 2OZJA 3LOIA 4XMAA 1S0EA 4Q4X3 2XB6C 1B35C 1SBEA 2D6MA 5HCBA 3MPBA 3UETA 2QUOA 2JDHA 3BPZA 1D4VB 1CAWA 5K0UB 1LHOA 4D6RA 4XAAA 4EV0A 2VBPA 5DAVA 3JCIA 1XNTA 2D6KA 2WINB 2W47A 2FDJA 5JI9A 5CZKA 2LM3A 1CAVA 1BBT3 2DBNA 4AAPA 4COZA 5AC92 2BGPA 3VBSA 2W94A 4WZCA 3VHPA 5CEHA 3FLTA 4QHOA 3WDYA 1IOAA 1H8TB 3AP4A 3E1F1 3VHNA 3A23A 5LWBA 5EFUA 1R1A2 4NIGA 4XTPA 4W8JA 4AHXA 1W3VA 5IFPA 1DZRA 3AP5A 1W2OA 1MS9A 3BALA 2EIBA 3OGRA 4LNVA 3RSJA 3UJQA 2FBEA 1ENQA 2QQPA 3V0BB 1KDKA 5GZFA 5LA0A 2VCCA 3EBRA 1D0HA 1H8TA 5CKNA 2WNVB 3AYDA 4Q1PA 1COV2 2XG3A 4N8MA 4QPGB 3JUUA 4WM7C 2Q8OA 1NA1B 4DXTA 3MYXA 1ST8A 3AMPA 2WFPA 1XSRA 1MZEA 5FZ4A 1G9AA 5BNPC 1PX3A 2B9VA 4OI2A 2AR6A 1QWRA 5DAPA 4CVUA 3LGRA 3V0BA 4OMCA 4TXWA 5L19A 1AXKA 3A7QA 3HT2A 3FFZA 4YZ2A 1DDLA 2FCUA 5H9RA 2WNVA 4XHXA 3VLBB 2ZS6B 4B4PA 3ZOIA 4RD7A 1WCDJ 4O9EA 3ZFGA 2BNMA 4GMP1 1NA1A 3VBUC 3VZOA 4JQTA 1G9BA 3WHTA 2EAKA 3KV5A 5GLUA 2D3SA 2JKXA 2ZHNA 1LJ7A 2VBBA 2XONA 4LEJA 1LOBA 3KVBA 3VHRA 2K9ZA 1CJDA 4HETA 3VBHB 1S0BA 2Y64A 1UL9A 4CDQC 4PT6A 1XE8A 3FLRA 5FPAA 2NQYA 1FOD3 3D3AA 1YFYA 4IE5A 4FTBA 4S2HA 4JQRA 4XEZA 1BXHA 5F5QA 2JEMA 1EV12 2A3XA 4AEDA 4CU6A 3TOJA 4HKWA 5E89A 2P2KA 1JMUB 3NRUA 1RUF3 1ZZBA 2ORXA 2ARXA 3VBHA 1VBE1 5BNQA 2QDNA 5FWJA 3PJQA 2QTWB 1GICA 1MPXA 2LTNA 3KS7A 5CB7A 1Y9MA 1ZZ8A 2O0OA 1MS4A 4AI2A 5K8SA 1HB2A 5FMOL 1RITA 5HXMA 3UKTA 2B45X 4AHYA 1OF4A 4OI1A 1OI6A 3NAPB 2BOJA 2J22A 2RG4A 1WCQA 1KITA 3LIGA 2ZABA 3AK0A 1PO11 4UBHA 3BN6A 1AJOA 2HJIA 3VD4A 3RZLA 4AEJA 3CF6E 3T1MA 1IG3A 1VMFA 2A70A 3OCPA 4A42A 3WX5A 3IDCB 4CDXB 1IS5A 1IG0A 3B3QE 1AYM3 4NPMA 1F35A 2EF6A 5LATA 3K4DA 3FE5A 3GZAA 2E26A 1ND2C 1K5MC 4YWAA 4CPBD 1IKQA 1XNBA 3MW2A 5FXXA 2QQVA 4QX0A 3K4ZA 4AK3A 3N7JA 4FFIA 3TEZA 1IPKA 1EAH1 2IVIB 3JBG2 2DUQA 2DU0A 3AMHA 3GBGA 4JTNA 3ACFA 4Q8KA 2RS53 2WN3A 2F17A 2V73A 2RM21 1W6OA 1WLWA 3MLLA 2WZR3 4QKNA 4XDQA 3T08A 2VMFA 2HWC2 2VCMA 4M3CB 4MSVA 3ETPA 4FOWA 4YG6A 4KL1A 5CG9A 1UD1A 1XC6A 2JDNA 3HD8B 1VBD2 3E6BA 4I02A 4LHLA 4DINB 2J1UA 4Q4V3 1QJU1 3AKTA 5HCHA 1C28A 2P4EA 2QZ2A 1QXJA 2Q8DA 4MUVA 1LHNA 2E9QA 5CVRA 3AL6A 5A7OA 5IT6A 5BY5A 4Y4YA 1ZBA3 4SLIA 4DZGA 2UYBA 4M3CA 4JGYC 2W39A 5FOBB 1RUJ2 4OLLA 4MO3M 1S2KA 1EY2A 4GALA 3THTA 2GNDA 3AP7A 4Q4X2 3GZEA 2X10A 4J1XA 5EYYA 4N53A 1HJGA 3DV8A 3C2UA 1XNAA 1LOAA 4NOTA 3ZLIA 4C1WA 1H1IA 4RQPC 5T50A 4HK9A 3T2OA 1O91A 3UESA 2FMYA 3ZXJA 2YC0A 5DPNA 2G19A 4JKLA 5FPVA 2WFF1 3FN9A 2GU9A 3H8OA 5FZ1A 4YGEA 1BBT2 1RVF3 2NM1A 4QGNA 1UU5A 3ETQA 3VHOA 4AF9A 3J7MA 2GC3A 4GWJA 4O61A 2DVAA 3TNPB 1SLIA 4OQ8A 4UFHA 1UMZA 3AMQA 3KVAA 4V1PA 5IVJA 1DQ2A 2YYOA 4BE3A 3A21A 3SXWA 4UFKA 5FO8B 1RUD1 3LQCA 2VUJA 2W91A 4YPJA 2YPDA 4D7SA 1D0GA 1QF3A 4RHV1 3HBZA 1ZX5A 2WQZC 4U2AA 1WMDA 1XE0A 4GWIA 2P34A 4UOJA 3PUSA 1YJKA 4D0QA 1UMIA 5LBBA 3LWCA 4JHTA 4DEQA 3K4AA 3POEA 4JRLA 4KI5M 1FNYA 1BEV1 1R083 1DG6A 2B8MA 1QY4A 2OYZA 1NX9A 2G4IA 1NQDA 1WZXA 5IVYA 2RJLA 2WYSA 4AI1A 5KXDA 4CUCA 1QOSA 3JB4C 2XBO1 2JJ6A 2UWAA 3VDDB 3PTYA 4XJ8A 2R061 2OPKA 5C4WB 1C4RA 1AX1A 1UF2C 5EJZB 4GH4B 2R071 2XDVA 1QJX3 4HFSA 1HB1A 1Z78A 4JZRA 3HVDA 1CN1A 1FMD3 2QQUA 1F5FA 2XHKA 3MV01 1KS4A 1ZM1A 2JG9A 2K0GA 2VZSA 3K75B 3WDTA 4LJHA 2MHFA 4LHNA 3ZXEA 2BTVC 1FOD2 3VDDA 5J37A 5F3IA 5CFCA 3ZM8A 1H2NA 2B5HA 4HMZA 4C0BA 2N7GA 1Q8QA 3IB3A 1TVGA 4N43A 4URTA 5A7NA 1RUF2 4CUAA 5F32A 1LAJA 3LPFA 4UF0A 4PLOA 5T5JA 2WIIB 3HNYM 5JAXA 1M06G 2VD7A 3NJXA 5FJKA 2PHRA 3VKMA 3X29B 3GJAA 5FIXA 3O1VA 4IEPA 5I0DA 4CDWA 2K46A 1SG3A 5G04L 2D7FA 4AI9A 4S2FA 1QIQA 4QMAA 5T5PA 4H55A 1S0CA 4OUMA 3V56A 3PL0A 1LOGA 2Y33A 3B5LB 3RWKX 3W58A 5JPNB 1H6XA 1NCQC 1MQTB 4OUSA 1RUH3 3WDXA 2BU9A 2VMEA 4RS5B 4HL0A 5KXBA 5I8YA 2YGLA 3QOPA 4Q0SA 3VKOA 2DDUA 3VBRB 3O1SA 4QX8A 2LRPA 3U10A 1AYM2 3OB8A 4BLIA 3CIHA 3H3UA 4IV1C 1YLLA 3J8F3 3VBOC 1WA6X 2E7TA 1V6JA 2VZ1A 4AYUA 3HMYA 4INDA 1XSQA 3WF2A 1VE0A 1YFXA 1SZBA 3KD4A 4MGKE 5D2AA 2D43A 3URFA 4BHPA 2D5FA 2AC1A 3OPZA 1MS5A 2VBDA 2EIEA 3GZUC 1H4GA 1RHI3 2RS52 2WO2A 2PN5A 1CESA 2CTVA 2WZR2 3N35A 4MGYE 4AI0A 1VB4A 1Q8OA 3FJSA 3AZXA 3DECA 1DF0A 1QH7A 4GXLA 4BLJA 3OEAA 3KV6A 1KDMA 4RGKA 4PF5A 3OY8B 4K1ZA 3ZN6B 1W03A 4FPHA 3AZZA 4NWWA 2DCKA 2E31A 4Q4V2 1ND2B 4CDUA 2ZAHA 1AYN1 4FOQA 4BQ4A 5A3MA 4K1YA 4LIUA 3O1OA 1EUUA 1WUVA 4MXWB 5HCAA 1W6PB 1ZBA2 3CJIC 3EB7A 3PU8A 3K48A 4QT6A 3OTFA 1DZTA 3ACHA 1WMXA 3NJVA 1WKYA 3M70A 4GKYA 4BZ4A 4UBGA 3ZN6A 1OVSA 1XNKA 1ODMA 3AYCA 4NAMA 3GF6A 3JD71 5BNNA 4QXCA 1GMMA 3INAA 4YVSC 4YRDA 1PGW2 4YGDA 4MGIE 4DS0A 4QGMA 4COWA 1RVF2 5CADA 1US2A 5C6CA 2JDAA 1GZCA 1OH4A 5FP7A 2ZGLA 5D8AB 4IW3A 3THPA 3T2QA 3ZYHA 3DPRC 2WRAA 4GQ7A 1YI9A 3U07A 4FAGA 4QU2A 3BVCA 3GZTB 4LKEA 1AR81 3ZXFA 4WM8B 4E8CA 3WDVA 5F1RA 1N3QA 2DVDA 1X36A 2JDYA 4IE7A 2ZX2A 3V64A 2JDMA 2P37A 3J4UH 3K77A 4M0HA 2A6VA 3SH4A 4PDWC 5FUPA 1I1EA 1C8M3 5LCWL 5L36A 5D8AA 2BNNA 4UW5A 4LUMA 2HWD3 1ZYBA 5C8CA 4WM8A 5J3UA 1ZRRA 5EHDA 1X9PA 5FFOC 2JDUA 1UYYA 2VE1A 5FZ6A 3V65A 3WDUA 4FFHA 5F3CA 3MFCA 1NE6A 1R082 2FDGA 3TB0A 1RUI3 5FY4A 2BYVE 5FZKA 4GB33 1H2MA 1VAMA 2UYAA 1LOFC 5A6QA 1AXZA 4FPLA 1DGLA 1H8VA 1YWKA 4RHV3 2G9FA 4AVVA 4KU8A 2D5HA 4YFZA 4YZ5A 1QJX2 2DVBA 3I2HA 3EHKA 2BERA 4XUPA 5A3NA 5JSRA 3LA7A 1FMD2 5ACA2 5IUQA 4KH9A 4L11A 2DFBA 5LZ6A 2CSGA 2JX9A 2SLIA 2YXSA 3UKNA 2Y60A 2HYKA 3VD7A 3PNAA 2A6XA 5CAZA 4OZXA 2VZ3A 1JOBA 4GULA 2PTMA 1QXPA 5ANQA 3VZJA 1DFQA 3HIFA 4HVRA 3FZ3A 3NW4A 4Y22B 4DUXA 3W20A 1HRV3 4W6YA 1PVC3 1QH6A 3VKLA 4BQYA 2BRTA 1PGSA 4DXZA 2L9LA 4O7XA 1QQP3 5JZGB 3MPPG 4YM1A 2Q4SA 5GM0A 2JG8C 3HAGA 1IS3A 1W9YA 2ZZJA 2X09A 2Y6LA 1VRH1 4Y1VA 3NL1A 3UKVA 2WWUA 3J7LA 1OSGA 1RINA 4LOSA 1UZ0A 3M7AA 3ABZA 4IEVA 3FUQA 4QDSA 1QJY3 1Y9QA 3PIGA 4QX1A 5A33A 2O14A 3PHMA 3WNXA 1JYVA 4Q4Y1 1R091 3N9MA 1UMHA 1PM4A 5C9AC 5JZGA 1LGCA 3H0OA 4R8HA 1RUH2 1DBNA 4XBNA 5A3PA 1PMJX 4E4HA 1RUNA 5LBFA 4Y1XA 3HQXA 4IGPA 1FYUA 2BNOA 1GU3A 3MFAA 4FPCA 4HN1A 5IK8A 4QXKA 2Q8EA 4C91A 3J8F2 4XFBA 3EJKA 2OT7A 4PQQA 1JZ3A 2P6CA 4IV3B 1AUYA 1OOPB 1SFNA 2DU1A 2OXBA 3QH6A 5LEKA 4JDMA 1LB2A 5KWRA 1UZWA 3KGZA 2C4XA 2VQAA 2IXCA 3R05A 4M3CE 4N7UA 2VXJA 1UN1A 2WNUB 3WD5A 1QOOA 1HW5A 1NXMA 2ES3A 1NCQB 5FV3A 1RHI2 4XJWA 3C7OA 1BJQA 1W3XA 5GLTA 3LE0A 2IZWA 5I8TA 1CWPA 4NIHA 4HSJA 3ORJA 3NJZA 1CIYA 3HJRA 1UZYA 1CONA 2HWB3 2GMMA 3P5BA 3VBUA 5IVEA 2DV9A 1GR3A 4BIOA 2WNUA 2YU1A 3AC0A 4D3WA 4EE2A 2FDIA 1K5JA 2EAAA 3RMYA 2QZ3A 5JXGA 2W46A 4B7EA 2Y6GA 5FZHA 4F3JA 1WWYA 4QPIC 3NV1A 1F15A 2XQXA 4XACA 5TSWA 4PBPA 3MF9A 2FDKA 2PLV3 1VAKA 1NOVA 2KA3A 3OSDA 2VR4A 4FPYA 4E2QA 1A8MA 2DCZA 4LE4A 1X8MA 2CL2A 5GZDA 3C3VA 5FQ0B 3VDCA 1POV1 3FFQA 4YARA 3KF3A 2JB4A 3S30A 5A80A 1FX5A 2ZZQA 3E5QA 4CXYA 3LA2A 3ZR6A 2XWBB 1J59A 1IZ3A 1LHUA 4XF0A 2X8KA 2Y6KA 5DZEA 5A32B 3ZYPA 4W50A 1VBA3 2W1WA 1DLLA 1W8TA 2FMDA 4IE6A 3N9PA 1Q8VA 3TAYA 5FQ0A 4Y1ZA 3WINE 1X7NA 2BVBA 1OC1A 5C9AB 1NT0A 5F3EA 1S0JA 3FX3A 3NKGA 4CU9A 3T09A 3F2ZA 4CP0A 2V5DA 2CHHA 4Y5SA 1HXS1 4EJRA 5FZFA 1C8M2 1KJRA 1SLCA 1H9PA 3NWKA 2ZGPA 3W5NA 1HB3A 1RUG3 1E5IA 2LROA 4AI3A 5LY1A 1O3TA 4LR4A 1ZREA 2HWD2 2YY1A 3N7KA 1K3IA 1ZNPA 1HQLA 1Y4WA 2J1AA 3SH3A 1AVBA 1LOCA 2BGOA 2ENRA 3ZYGA 1JOPA 3H1YA 4CA9A 1WCKA 2ZKLA 5EJ1B 5L7OB 1QGLA 1W2NA 3DPRB 1RUI2 4P9XA 5CFDB 2A73B 4ZS2A 4PBOA 3JB8A 4XZPA 4QB6A 3P6BA 4GB32 5H9PA 1UZVA 2ET1A 3AJYA 4BM8A 2J1TA 3APBA 3I3QA 2EXIA 4RHV2 5HPOA 2D3RA 3ILRA 2HYXA 4L8QA 4TWTA 1ASJ1 4PDWB 2PHUA 2GMPA 1O3QA 5T54A 1G9DA 1RMU3 2ZGTA 3CQOA 1REDA 2RS31 5D1IA 2C6SA 4FPOB 1JYTA 4FPGA 3IKWA 3USSA 4B1MA 4IEZA 1GUIA 1OPOA 2CNAA 4UAPA 4YW1A 1PO23 4AAXA 5A3TA 1RTVA 4NVPA 5DAWA 3AP9A 4QHBA 3OBTA 5KHKA 4RGAA 1G8WA 3VD9A 4MGTA 1GBGA 5F2SA 2EXHA 2RS11 3IDEA 1NLSA 4P02B 1VALA 4Q2FA 3QD6A 1ND3A 1Y43B 5APAA 4OHWA 2UU8A 1F2NA 1BK1A 2AEYA 4NPRA 4Z82A 4D94A 1HRV2 1OQEA 1PVC2 3CJXA 3WHUA 4AQ6A 2MEV1 3ZXGA 1EUTA 2JDKA 3HQUA 3ILFA 1QQP2 3WCRA 4D7TA 1O7FA 2XL7A 4UI9L 3IIAA 4LO6B 3WT3A 1WLDA 1JYWA 3OGSA 4OI0A 4TYSA 5FKBA 1UXZA 1UYPA 1ZZCA 1IS4A 1YQ8A 4JGZB 4NHYA 4XVHA 4AFMA 1HRI3 4E2SA 3LKJA 5C33A 1W2TA 1YUDA 1AR73 1QJY2 2NMNA 3AJZA 2JIJA 4AGVA 5J1XA 2HLEA 4CUBA 2R6QA 3G7DA 3VL8A 4JDOA 2ZHLA 2Q1ZB 2ZEZA 2WZEA 2A6WA 4MLOA 1O59A 4LO7A 3ZYBA 2ORZA 1GSLA 4M00A 1BMV2 5EZWA 3E97A 4Q4W3 1VBB1 5FZ3A 3KCCA 4URAA 4B1LA 3ZVXA 4QX2A 1H9WA 3IPVA 4L99A 4MYEA 1TE1B 1UIJA 2ZEWA 1NYWA 3MBWA 3LPGA 4XJAA 3NNLA 4W4ZA 2NMOA 3ZMOA 2B42B 4HKOA 1PNFA 5FZ0A 1N1VA 4EZ4A 3UL2A 3BKZA 4HOOA 5CISA 4NO4A 2VQ0A 1D4M1 3HWJA 2BUKA 3AMMA 3Q8BA 4L92A 1KQRA 2DF7A 2PELA 4LK6A 5B4XA 1LU1A 4LXLA 3DYMA 4EWDA 2ZA9A 4JC1A 3AX4A 4OYUA 5F2WA 1HQWA 1NLRA 3PVBB 3KGLA 4A7KA 3LZZA 1TMF3 2Z79A 3ZFEB 4PIZA 3N9NA 3K3OA 4H3WA 5FZ7A 1PK6B 1E5HA 1EP0A 4XZUG 2HWB2 1NZCA 3M1HA 5IVVA 5FBZA 5JXIA 1UY1A 2HEVF 4EZHA 5A7WB 2CY6A 3T4HB 3WP4A 4AI8A 3NV2A 2C9AA 1YFWA 4RFT0 4DMIA 5F39A 2VW2A 1DGWX 4WZFA 1WLCA 3IZOA 3DKWA 1ZBE1 1W99A 1AXYA 5IYYA 3ZFEA 1MVEA 2PLV2 4LA2A 5FLIA 2YBSA 3UNPA 1UPSA 1PK6A 2DVFA 3PVOA 3R6SA 3GALA 3VUOA 2Z4FA 3I2DA 1D2QA 5J48A 3H3ZA 2OPWA 4YLZA 4BOWA 3MW3A 1MS1A 5H9QA 4HPKB 2RVAA 1XXNA 4LKDA 3CEWA 1HB4A 4Q0QA 4A41A 4Q29A 1O5LA 2I74A 5K4LA 4BISA 2A5ZA 2CDOA 1XJAA 5K0UA 2RMU3 1VBA2 4AR2A 2ZJCA 4Q0UA 1ULPA 2PAEA 4A2UA 4O9GA 4BYYA 4LBMA 3PUAA 3WF3A 4Z1VA 3FBYA 5K9YA 3RYRA 2GSYA 1LULA 4XIKA 5I93A 4HPKA 4GMP0 1JYIA 3B93A 1E57A 3LF7A 4TN7A 1X33A 1NCRB 5DABA 5GLVA 4LHKA 5ABJC 3V0AB 1AL21 1GV9A 2D6LX 5FPZA 4CEYB 5IVBA 1OH3A 2XJQA 1RUG2 1B09A 1C8NA 1FXZA 3M3EA 5KC5A 4UW3A 1SMVA 5GALA 3I59B 2HH9A 4LORA 1S55A 2EALA 2JG9C 3H50A 3NSTA 3I97A 4OFGA 4OHZA 1W8NA 5ERLA 2HWE1 3DCQA 5FZDA 4RR3B 4QPGA 3K46A 5CFCC 2Q0AA 3BIEA 1ONAA 3WNNA 4CEYA 5JMOA 1OPMA 1WW7A 2D44A 3RI9A 4AVTA 4COYA 1V9U3 1YHFA 4KWLA 1I3HA 4N43C 2YHJA 4N7IA 3T0DA 5DUUA 1UKGA 2QQMA 2RE9A 1ULFA 4YVWC 4NRPA 2OKXA 1GZ9A 3GHNA 1RMU2 3MIGA 5JZGC 1PMHX 1LCLA 3I2KA 3MGUA 2V5YA 3OD0A 4CDWC 1Y7BA 2ZGMA 2A6ZA 1RUE1 1FATA 1PO22 1QEXA 1U5XA 2RR13 4JVAA 5FYBA 5LA1A 3VBFC 4AQ2A 3L2HA 3I2JA 2R041 5CYYA 1OD5A 3BYWA 3LFMA 4QHZA 2VCBA 4XF9A 2J1VA 3HN1A 3I4IA 1RJ8A 5L9BA 1U5YA 1BQPA 1MR5A 3CZJA 1IPSA 4AGRA 4HXCA 3N7MA 3WEZA 4GKXA 4Y33A 2XXZA 1N47A 4ASLA 4H7LA 3USUB 1E5RA 3DUIA 1PNGA 3W5MA 2JE7A 3POBA 4YFWA 1RJ7A 4KGQA 4DB5A 3D4KA 2FCVA 5C3RA 1HDKA 2VOWA 2FZ2A 1HV0A 1HRI2 1C5HA 4KBZA 4YGCA 1AR72 2AH2A 1Q56A 3I2FA 3VDAA 4K6BA 1NY71 1OURA 1UAIA 5BNOC 3NAPA 4XYXA 2VM9A 2WDBA 1QJEA 4XF4A 1C57A 4Z07A 2YC4A 4A3XA 5CIRA 4Q4W2 1UWWA 3B9CA 4BK4A 1JZ7A 4XXAA 1Z0HA 2AZ5A 2JB8A 3HBKA 5F6KA 3LB9A 3WCSA 3ZKUA 2XJPA 3VV1A 4Y4RA 1DU3D 2Y8KA 5FY9A 3TN91 3AL5A 4CDXA 3POJA 2R7EB 3C7GA 4YM0A 2X5IB 1LOEA 3JZVA 4J6GA 2P1BA 3OOXA 2OUHA 1OVPA 2DFCA 1HJFA 1FPN1 3LEKA 4TLGA 1W39A 2E33A 1BVP1 2E7QA 4LIVA 4R9DA 3AB0A 4A4AA 2UY8A 4ZKTB 3VL9A 1CZVA 3NVCA 1TMF2 3AFKA 4FOYA 5FXVA 5BNNC 4DO0A 4TZDA 1UX7A 2WT0A 2XJTA 3W21A 3WZ1A 1OXCA 2YBPA 2C24A 4KWUA 1L7LA 4OMDA 2JWPA 3KV4A 3I3BA 1DCSA 2WT1A 1VBC3 4OHXA 1TME1 4Z8BA 1XYPA 4YZ1A 4XAEA 4UFJA 1KXGA 1VIWB 3ZFFB 1HKDA 1V0AA 3H8UA 3ZXLA 3N7LA 1F4HA 1T2XA 3ILNA 3E5XA 2IFWA 1AR63 2O8QA 2PAKA 2VC9A 5DN2A 1PIV1 1UY4A 4XW3A 1YYNA 2AENA 2R0HA 4MADA 5I0SA 4FTEA 3I8TA 4XPVA 1QDOA 3RZMA 2BFUL 4FXGB 1RUC1 2HWF3 4RL7A 1C1FA 1VR3A 1UOBA 1DLCA 2WSVA 4P9LA 2ETEA 1CX4A 2NN8A 3H7YA 5C8CC 3WW3A 1FV2A 4IL7A 2WLPA 1XU2A 2Q1MA 2RMU2 3U37A 4QX7A 3UYJA 2D97A 2YROA 3SMHA 4K8RB 1BZWA 4O65A 1B35B 3WF1A 1IGOA 1WBFA 4CP9B 5JMCA 4MHRA 1MEC1 2BVVA 1GP6A 2D6NA 2WQ8A 3RDIA 4BXSV 4I01A 5IVFA 3WDWA 4Y24A 2GN7A 2XLFA 4N9HA 2C5DA 2UWCA 4B4RA 3POYA 5EXOA 1S1AA 3I2IA 1GZWB 2ZMKA 1UQXA 5GLWA 4QQPA 1FI2A 3ZXAC 4CP9A 2BPA2 4ASKA 1MZFA 2B9UA 3PLQA 1JYXA 1JUHA 4FQZA 3FHQA 5EYXA 4MX3A 4KG8A 3DGTA 2Z42A 3NJYA 1YQ6A 2XVKA 3NKTA 5FZGA 3ZYJB 4BCUA 5A3WA 3OGJA 3N4MA 2LS6A 1Z7S1 1WLTA 1W2AX 1GZWA 4MOAA 1Q3EA 1V9U2 4P9GA 2A3WA 1VMJA 4AEMA 2W2IA 3OYWB 1R64A 4H14A 2EXJA 5ABJB 4WM7B 5CBLA 3OGGA 3HNBM 1JODA 2A7AA 2P3IA 2P6HA 1PZ9A 2WUHA 4IE4A 4P9WA 5A6YA 3F95A 5BNPB 1SDWA 3CMGA 3Q9OA 5C4WA 4GH4A 5JIAA 2WABA 2RR12 4GMP3 4X6QB 4V2VA 5DG1A 3IWZA 4N90A 3A4UA 5A1LA 4FAHA 4WM7A 2VL4A 4AQSA 5KXCA 1S0GA 4CZSA 3D0JA 5DDJ1 2P3JA 3UK9A 3M3IA 1AR91 1WCUA 1UKRA 5LK5A 2C26A 4AHWA 3H3LA 5DZGA 4YVWB 1SDDB 4WVWA 1X8EA 2MPFA 4CDQB 1N1TA 3CZUA 3WOGA 1GKBA 2R1DA 5LBEA 3BCWA 2AEZA 4OI4A 1O8PA 3MIBA 5CA6A 2W1UA 3KT4A 5LA9A 3IDBB 2FDHA 5FZCA 1VBE3 4DXRA 4R4XA 4EN7B 1CJPA 2QQOA 3MW4A 1J1LA 4QAWA 1PGL2 1CAUB 2BP6A 5FZ9A 4CDQA 2Q5TA 5FK8A 4EROA 5B4NA 1SBDA 5H9SA 2ZGSA 2R0FA 4R9BA 4E8DA 1S4CA 2AUYA 3ZPYA 5DZFA 2QQIA 3VBOB 3S7IA 1MQTA 1PO13 2W68A 1XB9A 2FQPA 2XMLA 1X9TA 1WW4A 1CAUA 1WW5A 3EYPA 4RS5A 4BQ5A 2ZCWA 1SPPB 4NWVA 3VBRA 1N1SA 4P9IA 1NE4A 1W05A 5T5OA 4ZZ8A 5EQUA 3OBRA 3BTXA 5FMOS 2DURA 4JCKA 5BV6A 2KD7A 2WS91 2OUJA 5A7PA 1A6CA 1W2UA 4H2AA 4LBNA 3BOWA 5GZCA 2EICA 4XQWA 1N3PA 1K5MB 1EAH3 2MNGA 2XLAA 3QH7A 1OUXA 2BWAA 3NNMA 5F37A 2VULA 4NUBA 2B46X 3IBMA 2RDRA 3AVSA 1VLNA 1VBC2 2RM23 4S2DA 3O5SA 4C90A 2V4AA 2TEPA 3DXUA 3OY8A 4RN5A 4XC9A 4XFHA 3AZYA 3HN3A 3AKRA 1ND2A 2VVFA 4CCEA 3H8XA 3T30A 1AR62 1WMEA 3I3MA 4XFGA 2DVGA 2EVXA 4MXWA 1W6PA 4MGQA 5HI0A 3PUIA 1QJU3 5JOWA 4CCLA 4IEYA 5AC91 5C70A 1UU6A 4A7YA 4P00B 2HWF2 5ISLA 2PHWA 2WNEA 4XCBA 5F3GA 3RQ0A 1ZRCA 1PM7A 5IJRA 2XJUA 4BIFA 5F5AA 3WVJA 4XE9A 4Y5TA 4L9BA 4IEOA 2HEWF 4EN0A 1R1A1 1SQ4A 4JGYB 4BQXA 2PXJA 3TEWA 1ZRIA 2CWSA 5FAXA 1QKQA 2QQNA 4UFIA 4ISQA 1W8HA 1PIV3 4H7MA 2TBVA 3DKQA 4FQ4A 1BK0A 1OA4A 3MIEA 2WFF3 1WCSA 4RQPB 1EPWA 1COV1 2BV4A 4Y5Z0 2VZUA 2XVGA 3UGGA 4W6XA 4BWOA 5LA2A 1W0PA 4GA9A 4OQ9A 4CU8A 3I54A 4JGYA 2CWMA 2VQUA 3B02A 3LSEA 1YXWA 4PI0A 2OX0A 4RSUA 1MZ5A 5FUNA 3WG1A 2P5BA 3IT8A 4ET7A 1RC6A 4GWNA 4UXAA 2GNTA 1C5IA 2KXLA 3K51A 3T3YA 4XFAA 3U4SA 4C1XA 3FL7A 4LBQB 3SITA 2WZ8A 4FFGA 1DQ4A 4BK5A 1GWKA 1RUD3 2FCTA 3BIWE 2A1XA 2W5FA 2DCJA 4CEWC 5FY5A 4IUGA 2W95A 2YUEA 3I2OA 3B00A 5FLHA 5FYSA 1GNYA 1ND3C 1YC61 2BGCA 3Q8FA 1VMHA 4QXHA 4NRQA 5F8PA 4FP3A 2WLQA 2GP5A 1UPIA 3GGLA 4LBQA 4LTAA 1BEV3 4Q1RA 1KD7A 4OHVA 3LIHA 3SHRA 1LHWA 1EV11 1H30A 2WO3A 5JXHA 1LESA 2G1MA 3RZKA 1AHSA 1W90A 3TEXA 2JD9A 2WBKA 3WP5A 4PCRA 2XBO3 2E6VA 4AE2A 1GOGA 1Y3TA 2R063 2ZEXA 1LGNA 3HR9A 5EJ3A 3ASIA 5KHHA 4LO8A 4F7ZA 2FZ1A 2OIIA 3MHZA 2R073 4FP2A 4HBNA 1M4WA 4NAOA 3HEIA 4XUTA 3THDA 2DBIA 2ZHMA 3LDBA 3VN4A 1JYNA 4XHBA 4BQ1A 3O1MA 1DHKB 1W28A 2VZQA 4LULA 4MXVA 3D0SA 3RJRA 3BOPA 5DUXA 5FYYA 2QE3A 1G9FA 3JQWA 5GZEA 4Y22A 3FHAA 1XBFA 4D8MA 1UO9A 1L7QA 3H7JA 4ISRA 3KZ4C 2VU9A 1XPWA 1VBE2 4XXPA 4QD2A 4KBBA 1KEXA 1RIRA 3OUHA 5CNAA 4A44A 2VZVA 4ATEA 3S5AA 5D21A 3MF6A 1QNWA 5GJ6A 5LRSA 4CCJA 5KC6A 5J98B 4XCAA 4CCKA 4NR1A 5J36A 1W9TA 3D82A 1XYOA 4ZU5A 5FYVA 1UIKA 5FYUA 4YZ4A 3AM2A 2J1RA 4AWDA 1JUIA 3RGBA 1QJFA 4M4RA 2RV9A 4LKFA 2LALA 1PO12 4YNIA 3ME2A 3DF0A 3KB5A 3JBG1 4WVZA 1UW8A 4RYDA 2XH6A 2XKOA 3O0VA 5GKAC 5AFBA 5SV5A 2JDZA 3WP6A 3WNOA 1ZZ9A 4FPFA 3ZKYA 5HV0A 4HT1T 4PQ9A 2B39A 2HWC1 4G3YC 4OULA 4XIOA 5IFTA 2VJXA 5JOZA 2VNOA 4JHZA 2VW1A 2BOIA 4HVQA 3ACIA 4IV3A 1OOPA 2D3PA 1VBD1 3Q8EA 1YQCA 1Q8SA 2VTXJ 4QWNA 1POV0 4FPEA 4ORFA 3FWEA 5JSPA 3ZIXA 4IV1B 1O5UA 3FHIB 1CAXB 4FVVA 2CU5A 2ADDA 1EAH2 1GOFA 4K7JA 3DXTA 4LA3A 1NCQA 3WXPA 5BXXA 3VBSC 5FPBA 3MICA 4AVCA 1RUOA 1KFXL 4XBLA 1DP0A 5FP4A 2QBXA 1RUJ1 4QPWA 3BTAA 5AVAA 3ENRA 3J26N 5FZ8A 2RM22 2BWCA 4Q4X1 4LKSA 1ZZ7A 5EPAA 5FYZA 5HV4A 5K0UC 4CCCA 3AXEA 2NP0A 1ENSA 3C8XA 4QDQA 2ZEYA 4IV1A 4LHSA 3ZXKA 5JSOA 5JOXA 3OUJA 4QXBA 2WL1A 1F31A 5F5CA 4HONA 3KLSA 4KWKA 2ARBA 1YIPA 2AYHA 3LCPA 1QJU2 1AYN3 3PU3A 1BBT1 1H8TC 3VZNA 5ANNA 5B2GB 4LUKA 1ULOA 1TZOA 2ID4A 2VZPA 3LAGA 3J7NA 3NMBA 3NNJA 2YV8A 4LO5B 4XDPA 2DUOA 2D93A 5FO9B 3C7FA 2A3YA 3FUOA 2XL9A 3GYDA 3CJIB 3FLPA 1UOGA 4COUA 2GP3A 3HOBA 3OBZA 5LB6A 2W87A 1DGWA 2WSUA 1US3A 4LO4B 3WW4A 3I2GA 4Z2WA 1F4AA 1W9FA 5FZOB 2WNVC 1VPHA 3JD73 4Y1YA 2QQJA 4QPGC 3WNMA 3ZFGC 1NA1C 3PIJA 5A32A 3O7OA 4MGZE 2WFF2 4X6RB 2D6OX 5J96B 3O0WA 3SC7X 3VDBA 2ZXQA 4YVSB 3CJIA 2XLGA 4JDNA 3N3HA 2RDNA 1R1ZA 4XFFA 1HV1A 5LBCA 1I5ZA 4ZXEA 1AR83 4K3UA 1SCSA 3VKFC 2PA7A 1YRZA 2GC2A 4R9CA 1DQ1A 1RXGA 1TNFA 4QQOA 4XABA 2VMHA 5E16A 5FZBA 1RUD2 4AEDC 2QJVA 1UZZA 3KCYA 1EYBA 4BMEA 3IM0A 5A6XA 5I0UA 4NIDA 5FWEA 3VBHC 1WBLA 5FZAA 5F9TA 3ES4A 3K3NA 5A1AA 4TLFA 5L7OA 3DPRA 5CFDA 4OUEA 3ITQA 1W04A 2WYFA 4ZZ5A 3SNMA 5IVCA 1BEV2 1FOD1 1FNZA 3LEIA 2YMZA 3K2OA 3B69A 3R4SA 3DYOA 3LSDA 4PDWA 2E32A 4BPZA 2XBO2 3P3NA 2E53A 1RUF1 3WG3A 2R062 3AFGA 2R072 1D2SA 4AFCA 2Y0IA 4NROA 5AFEA 1LECA 3KHBA 4FI9A 1G9CA 3NAPC 2VZTA 4YYOA 4AFAA 3RYPA 1S2EA 2RHPA 4ZXKA 1N3OA 1JN2P 4M0NA 4KMQA 1YQ5A 4NIAA 1LRHA 2VUCA 3CLPA 2F4PA 3KV9A 5FCCA 4X8PA 2EXKA 2PFWA 5JR2A 4JRAA 3WNPA 1AZDA 1H6YA 3KCXA 3KWVA 2NPIA 1KJLA 4WBBA 4Q0PA 2BBVA 4XQ4A 4E4ZA 1DYPA 4CDXC 5FP9A 3QACA 5EIYB 1ENXA 3SKVA 5LEJA 3U78A 1PVXA 5C5UA 3NO8A 2GZWA 4KGGA 1RGSA 1AYM1 1FV3A 1VRH3 4JGZA 2CYFA 5DAXA 3SKJE 3WLUA 2JG8B 5FPUA 4CYDA 1Q5OA 3RRDA 1UY0A 2A6YA 1ALYA 1GNZA 4PF1A 4LT5A 4GIQA 4Q4Y3 1R093 5L9VA 3ST7A 3JQXA 4JAAA 4NMIA 2QKDA 3OJBA 1AX0A 5FMDA 4Q26A 3SQOA 1PZ8A 2XOMA 2RS51 3O1PA 3I7DA 3SCFA 4UFMA 4L2NA 2W08A 2WZR1 1VRBA 4X8NA 2J42A 5FRAA 1S0DA 5FY1A 4BJ0A 3QCWA 4QPYA 4CP1A 4N53C 4HKLA 5DUWA 2R30A 5E88A 2BDRA 4XURA 1W6QB 2W1SA 2VCAA 4Q4V1 3L2YA 3RVHA 5F7UA 4OCTA 1CZTA 1DGRN 2B7YA 3ZDSA 4EYUA 5J09A 2XHNA 3B7MA 2GH8A 1DGRA 5A6ZA 3BGAA 1ZBA1 1MS8A 4NN0A 5DG2A 5I0TA 4DUWA 1OQDA 1WD4A 4J1WA 4ZPIA 3BI3A 3U14A 2VOVA 2XUEA 4I0AA 5DXDA 1W6QA 1KFUL 5FYCA 3WNKA 1K12A 3MUZ1 3S5QA 2GMEA 2XR4A 5A7WA 1LEDA 4Q0VA 3VD3A 3H42B 4GD4A 1JU3A 2CAUA 2WA4A 4U36A 3WSOA 1PGW1 1QNYA 2PMWB 2NYYA 4Z2AA 1AYN2 1RVF1 2Y6FA 3M4FA 5IAVA 4XJUA 1NUKA 4AVAA 1ZRFA 3ZYFA 1GQGA 4GJYA 1CAVB 5I0RA 3O14A 1W0OA 3VBSB 1POQA 2F6BA 3ZXDA 4CRQA 1T6GC 4QPIB 4YW3A 2ZX4A 5C3PA 1REEA 2OVUA 4LBKA 2FHRA 3M3QA 4W6WA 3RNSA 1POV3 3JD72 1OLMA 3C7EA 4QQLA 5IK4A 4QX3A 1UNBA 1JHJA 1LENA 3EXUA 2Q8CA 3MI8A 5KBFA 3VGIA 4E4SA 4E9KA 5FO7B 4DY5A 2K2SA 3IAQA 1G86A 4NHXA 2CGOA 4QPIA 2PHTA 1LU2A 3ZPOA 1I5PA 1R081 2G9ZA 1AR82 2WAOA 1NCRA 3WW2A 1CQ9A 4LPLA 4MHUA 3VZLA 5IWFA 1STMA 3V0AA 3VDDC 3H1WA 2E63A 4G4FA 4DEVA 4P14A 4AZZA 5C4WC 1HXS3 3AMNA 4GH4C 1OFSA 3M3OA 4K9SA 4I0WB 2UWBA 1S0FA 5C8WA 1JHNA 3I59A 3ZFGB 1QJX1 1XNCA 1AF9A 2WWSA 1IKPA 5M0TA 5IK5A 1UU4A 4KQ7A 2R1BA 3T1LA 4ASMB 4RR3A 1JBCA 1FMD1 1QOTA 1OA2A 5ACA1 1WD3A 2TNFA 1GP5A 5C5TA 2WJSA 4WVVA 4CTEA 2IXKA 4IGQA 5E6HA 5K7PA 5C71A 5JOYA 1MS3A 1UYZA 4WVMB 5LW9A 1DYOA 2JE9A 4Q8LA 3POGA 3PJYA 1MS0A 4Y20B 1CX1A 2WO7A 5JCTA 1ZA4A 2WT2A 1OQ1A 3FBMA 1ASJ3 3IIIA 4AEDB 1Y9GA 2GDFA 1JH5A 1NKGA 3NV4A 4QM9A 2BBAA 2RS33 5JI7A 5IHRA 4DUVA 1GWMA 2GNMA 1ULDA 4EWEA 4WVMA 3U4XA 1ZRDA 1UY3A 1URXA 3IDAA 4CCNA 1QMJA 4E2GA 3ZSLA 3E6CC 2ZPXA 4Y20A 4DQAA 4R9AA 4B8EA 2IFRA 2IXLA 3DYPA 1MQTC 2RS13 3FMGA 4XF3A 4RS5C 4Q27A 3RS6A 1LODA 4OVEA 4XF1A 3VBRC 1RUH1 2VUAA 4FOVA 3VB9A 3USUA 1D7PM 3WG4A 1GLHA 2MEV3 3WY6A 4QKDA 4LBJA 1X50A 3UGFA 2VZOA 4GZ9A 2ILMA 1QDCA 1VRH2 4L0PA 1ZA7A 1HQNA 1U5ZA 3MZHA 2VAUA 4CCOA 2GALA 3J8F1 1OBNA 2F4LA 2VO5A 3OPWA 3JXSA 4CDUC 1ODNA 2VTXA 2KR2A 2V72A 1C1LA 2XKPA 4F83A 3POFA 1APNA 3RMXA 4Q4Y2 1R092 4P9JA 3NV3A 4CCDA 4AHZA 2FD8A 2NLRA 4HLTA 2JECA 1I6XA 1RHI1 3EO6A 4PLMA 3D5OA 4MG2A 1PHMA 4XFCA 3H8RA 2VNVA 1J3RA 5IW0A 1SBFA 2E51A 2HKXA 1VBB3 5FP8A 3Q8AA 3S7EA 1L7RA 1H2LA 1SLBA 1W6OB 2CAVA 3CNAA 2ZMNA 3G6JB 3ACGA 3LDRA 4CSWA 4PI2A 4DRRA 1VJ2A 5A1FA 4Y3OA 2GC0A 2JENA 2QNKA 3PVNA 1SLTA 5DMYA 2X5IA 1W8UA 3CL1A 1DYKA 4Q5OA 3BUCA 1GP4A 1JS9A 5BUVA 5JPMB 1DIWA 3RZHA 3BU7A 4KU7A 1MZ6A 5FY7A 3SCHA 2IC1A 3I3EA 4JKMA 1D4M3 5A3OA 3LA3A 4YW5A 2VG9A 3MUY1 4GAZA 1RL3A 1AL0G 1LNSA 1FAYA 1V6NA 2AREA 3TBDA 2BJSA 1BLZA 2UY9A 3WUCA 3WQBA 1SCRA 2LW8A 3T0BA 2Y34A 2ZBJA 1UOJA 3O0XA 4N53B 3GM8A 3T2TA 4IEWA 3UGHA 1V6LA 1V6IA 3KM5A 3OUIA 5D8AC 4PIXA 5FDBA 3ZDVA 3S57A 1P8JA 3WP3A 3ZFFA 1J3QA 1PMIA 2C0ZA 2Q30A 2XJSA 4JKKA 4WM8C 4YGBA 1ZBE3 1NQJA 3HQRA 3LEMA 5FR3A 4K40A 4QKBA 1LEMA 1SLLA 5FZEA 5KHIA 2PQSA 4DRVA 5JXJA 2D98A 3MLKA 3SEPA 2Y6JA
chains in the Genus database with same CATH topology
1XE7A 3UJOA 4FT8A 1QHDA 4R52A 1C8M1 5T55A 1DQ6A 1JYCA 2VXRA 2DTWA 2CGNA 2YZ4A 5BPXA 1UCXA 4IERA 1YNAA 2HWD1 4QGLA 4Y26A 1XYNA 2PAMA 1OA3A 2VECA 2VY0A 1FT9A 2VMGA 1B35A 3R0RA 4ZU7A 4E27A 2ZX1A 2JXAA 1NXD1 5HXVA 1RUI1 5I8SA 2WA3A 3D6EA 4HSLA 3LOBA 2R49A 1L3JA 4GB31 2DCYA 1HXS2 1AL23 5HBAA 4FO9A 3RZZA 2DUPA 2WC2A 1LTEA 3H9AA 5CG8A 5HCFA 1XQNA 4LLFA 4XILA 3B9IA 1GQHA 1IHMA 5FOJB 1A3KA 5T5LA 4I2OA 4FTSA 1TQ5A 4DOUA 3FC0A 2HWE3 3M2MA 2ZGUA 2JG9B 2GH2A 2Y26A 4M01A 1Q43A 3OYWA 4COVA 5ABJA 5J7MA 1OLRA 5CFCB 2PQQA 4D7YA 3MIDA 3WQ7A 2VPVA 5JZGC 3ATGA 1ULGA 2JICA 1ASJ2 1HRV1 2VH9A 1PVC1 4N43B 5BNPA 2A75A 3J9SA 2PHDA 2XJVA 4BMBA 5T52A 1S2BA 2O8OA 1QQP1 3KMHA 3D8CA 2RS32 2JD4A 1DZQA 5JWPA 2Z2SB 1OMIA 1O4ZA 1RUE3 2EA7A 4MVTA 4AVSA 1MVQA 4QX5A 5FREA 2QDRA 4CDWB 2LUWA 4META 2R043 4LBOA 2H0BA 4Y1UA 1QJY1 4ATFA 2RS12 2ZACA 4YW2A 5FTTC 1WW6A 3VBFB 2VNRA 2HEYF 4K8FA 2QVSB 4K20A 4G9SB 5JIUA 4YVWA 4ONUA 1J3PA 3KSCA 3VKNA 1RB8G 4A7ZA 2MEV2 1BMV1 2ZGNA 4TSVA 4DPNA 1V00A 4XMIA 4ES9A 3RJ2X 2ZMLA 3E5UA 4IV3C 1OOPC 2Z5WA 3VBFA 1IQAA 1XRUA 4D69A 4DNYA 4DFSA 2WNUC 2I2SA 2QFEA 4HN0A 3ZIWA 3GNEA 2H0VA 2X53S 2ZKNA 3KT7A 4IESA 3ZX7A 5BNOB 1HX6A 4P5HA 1VBB2 4KWJA 3POSA 1G6NA 2HWB1 3MLJA 3S6PA 1YFUA 1GANA 3POWA 2IWGB 2SBAA 3TN93 1SLAA 2BQPA 4L97A 4NHMA 4CDUB 5BNOA 5KXEA 4AEKA 1U0AA 1D4M2 1FPN3 2PLV1 3A0NA 2UURA 2ZOEB 1K5MA 1NG0A 4XJ9A 2GAUA 1JOJA 1U12A 2VVDA 4KG0A 2XUMA 4R4ZA 3ECQA 2V09A 4XJZA 5BNNB 3E6DA 3ACLA 2Z69A 4YG3A 3ZO0B 4UW6A 4E4DX 4UW4A 5A3LA 1TME3 2G9GA 2XJRA 2EIGA 4MZUA 1U5IA 1VBA1 2ZGOA 2I45A 4CP2A 3R4DB 1ZBE2 3AKSA 5F6LB 2ZTNA 2PHFA 5I91A 3M3CA 5GLZA 1TEIA 1XU1A 4AQTA 4M3CF 3ZSMA 4WV8A 1RUC3 2AGSA 2OW4A 2ZX3A 4P9YA 1BVVA 1RUG1 3H1MA 4XBQA 3R4UA 3DL3A 4AXOA 5L7OC 5LRRA 1W6MB 5JDBA 4Z92B 2A71A 5CFDC 5C8CB 1W6NB 4IEUA 4I09A 1I9RA 4RQPA 3EQEA 3ZSJA 2D6PA 2YPJA 1SEFA 1MEC3 2YGMA 1VP6A 5FPXA 1V6MA 3KT1A 1REFA 4YM3A 2OZ6A 2BFUS 2X29A 3RWNA 4HZFA 1AL22 4FCAA 1ENRA 1W6MA 3QLQA 4YW4A 3ZSEA 3W9AA 1W6NA 1QU0A 4B7KA 1RMU1 3KQRA 4IXLA 1CGPA 1LHVA 1YCIA 5BYNA 3TRSB 4YSFA 1GYKA 1KS5A 4I3GA 4GWMA 1PO21 4XTMA 2HWE2 2WQ4A 5JVVA 3RG0A 4ES8A 1Z7S3 3SH5A 1UX6A 3WW1A 5IK7A 3ES1A 3RYKA 2QCSB 3TYJA 4LBLA 5CU1A 4PLNA 2I07B 4EWAA 2ZGQA 3OF1A 1QJZA 2CV6A 4FBFA 3AYAA 4QM8A 4QQHA 1IPJA 4XOGA 4JGZC 2WZPP 2TUNA 4FPKA 1RUE2 3AP6A 4FPJA 1SACA 4MV2A 1HRI1 2R042 1AR71 2VMIA 3DN7A 3GBFA 2VNGA 4RGGA 5DDJ3 5A33B 4XFIA 5SV8A 3SCGA 1H2KA 1OFNA 2DCTA 1AR93 3U11A 1HIXA 4LLOA 4PJYA 3WR0A 3MIHA 2DYCA 4Q4W1 2W0XA 3AKQA 2H6BA 2XWJB 4K21A 3P3PA 4HK8A 4YZ3A 1BCXA 1WA4A 4HANA 4NHLA 3OD4A 2ZGKA 4SBVA 3SISA 2GC1A 1J58A 2GNBA 1BYHA 4IETA 1V6KA 3RPQA 4COYA 2ZX0A 4F8AA 1NY72 1A8DA 5T3NA 4B29A 3MDPA 3CO2A 3ZFEC 2XVLA 1ULEA 4AGGA 5L73A 2XPJA 1PK6C 4AVBA 2BEOA 3GHMA 1TMF1 1WMFA 4XETA 4XQDA 2ZGRA 3VBUB 3TN92 5LK7B 1Q8PA 5E1RA 2DTYA 4HVOA 1FPN2 4C0HA 1YI7A 2WS93 2KM2A 1LGBA 1XNDA 2GN3A 1CAXA 3O12A 3VBOA 4AG4A 1VB2A 3AXDA 3JU9A 2VW0A 3PMEA 3AYEA 3U0ZA 2IXIA 1S0IA 3ZYIB 4JV4A 2IXJA 3IN9A 1G7YA 1TME2 4RA0A 1LR5A 2RMU1 1NCRC 1AX2A 4YM2A 3BODA 1OLQA 3QBQA 1PIV2 4QQ2A 3GBWA 4KNCA 3HT1A 2OA2A 4CEYC 3AKPA 2C1FA 4ZU4A 5AC93 4LE3A 1KRIA 1LKNA 1RUC2 5KHGA 1CIWA 3WQ0A 4FSJA 4MH0E 1H1MA 3RI8A 2R32A 3BB6A 2BW8A 1R1A3 1JW6A 1H0BA 3L9JT 4RR3C 1SFYA 4ITCA 5JR7B 1BKZA 4S2GA 4I30A 5EWSA 3SLIA 4YVSA 1MEC2 2ZAAA 1ZZ6A 1V9U1 1COV3 4AW7A 2VGDA 4NHKA 1CPMA 4IQPA 3PMSA 4AFDA 4BA6A 2O1QA 1C3HA 1CPNA 1WGPA 3AZVA 3IMNA 2VOKA 1X82A 5DUVA 2Y0OA 1A78A 3ZSKA 3MEPA 3ZN5A 2JKBA 1H1AA 2RR11 1O3RA 1JXNA 4B3NA 4W65A 1Z7S2 3AZWA 2PYTA 4CEWB 3TNQA 1CD3G 3MIFA 4YG0A 2YDEA 1OHFA 1CR7A 1ND3B 1QXRA 2P17A 3VZKA 2ET7A 3UV9A 4B4QA 2XGXA 1YJLA 2IXHA 1EV13 2NZ9A 2VVEA 5E8AA 4CEWA 2PHXA 3N36A 3WG2A 1LOFA 2WKKA 3ZYRA 1J1TA 2W52A 4IEQA 3S0MA 4OHYA 1V70A 1V6OA 1DQ0A 1PGL1 1ULCA 5FLJA 1O4YA 1PZ7A 5DDJ2 2R16A 2E7AA 4EN8B 2PHLA 1AR92 2ZHKA 4IEXA 1F8VA 4JTOA 3TWIA 2ERFA 1DQ5A 3WQ1A 2X5IC 1ZVFA 3VZMA 4EN6B 1YO8A 3IPVB 2Y38A 3ZMNA 1F9KA 3M8LA 1YIFA 1JTZX 1H4HA 2RJKA 2JG8A 4PIYA 3WUDA 1OKQA 2D40A 1IS6A 2VOXA 5AVPA 3PVEA 1CVNA 4N9IA 1MACA 2CGPA 3JBG3 3CU7A 5C9AA 2DWRA 1VAVA 2H6CA 1TNRA 3ZFFC 1VBC1 4EN9B 3W59A 1O4TA 4LBQD 2HWC3 1GFF2 5KHJA 4I0BA 3WV6A 3ZN4A 2WS92 1AR61 1VBD3 1F5JA 3B94A 1HLCA 2ATFA 5JLVA 1EPZA 3ELNA 5GZGA 2P3KA 1CAWB 4FXKB 3B01A 2HWF1 1O3SA 1AJKA 3ROUA 1N1YA 1GNHA 3ALQA 4I3PA 4DY3A 1RUJ3 5EV7A 3A0KA 2OZJA 3LOIA 4XMAA 1S0EA 4Q4X3 2XB6C 1B35C 1SBEA 2D6MA 5HCBA 3MPBA 2QUOA 3BPZA 1D4VB 1CAWA 5K0UB 1LHOA 4EV0A 3JCIA 2WINB 2D6KA 5JI9A 2LM3A 1CAVA 1BBT3 4COZA 5AC92 3VBSA 3VHPA 4WZCA 3FLTA 3WDYA 1IOAA 1H8TB 3AP4A 3VHNA 5EFUA 1R1A2 4XTPA 4AHXA 1DZRA 3AP5A 4LNVA 1MS9A 3BALA 3RSJA 3UJQA 2FBEA 1ENQA 2QQPA 3V0BB 1KDKA 5GZFA 3EBRA 1D0HA 1H8TA 2WNVB 3AYDA 4Q1PA 1COV2 2XG3A 4QPGB 4WM7C 3JUUA 2Q8OA 1NA1B 3MYXA 3AMPA 2WFPA 1MZEA 1G9AA 5BNPC 4OI2A 2AR6A 1QWRA 3LGRA 3V0BA 5L19A 1AXKA 3HT2A 3FFZA 4YZ2A 1DDLA 5H9RA 2WNVA 4XHXA 3VLBB 2ZS6B 4B4PA 4RD7A 1WCDJ 4O9EA 3ZFGA 2BNMA 4GMP1 1NA1A 3VZOA 1G9BA 3WHTA 2EAKA 5GLUA 2D3SA 2ZHNA 1LJ7A 4LEJA 1LOBA 3VHRA 2K9ZA 1CJDA 4HETA 3VBHB 1S0BA 4CDQC 1UL9A 1XE8A 3FLRA 2NQYA 1FOD3 1YFYA 4FTBA 4S2HA 4JQRA 4XEZA 1BXHA 5F5QA 2JEMA 1EV12 2A3XA 4AEDA 3TOJA 4HKWA 5E89A 2P2KA 1RUF3 1ZZBA 2ARXA 3VBHA 1VBE1 5BNQA 2QDNA 3PJQA 1GICA 2LTNA 3KS7A 5CB7A 4AI2A 1ZZ8A 5K8SA 2O0OA 1MS4A 5FMOL 1RITA 3UKTA 2B45X 4AHYA 4OI1A 1OI6A 3NAPB 1KITA 2ZABA 3AK0A 1PO11 4UBHA 1AJOA 2HJIA 4AEJA 3CF6E 3T1MA 2A70A 3OCPA 3WX5A 3IDCB 4CDXB 1IS5A 3B3QE 1AYM3 2EF6A 3FE5A 3GZAA 1ND2C 1K5MC 1IKQA 1XNBA 3MW2A 4AK3A 3N7JA 1IPKA 1EAH1 3JBG2 2DUQA 2DU0A 3AMHA 3GBGA 4JTNA 4Q8KA 2RS53 2V73A 2RM21 1W6OA 1WLWA 3MLLA 2WZR3 4XDQA 4M3CB 2HWC2 4MSVA 5CG9A 4YG6A 4FOWA 4KL1A 1UD1A 3HD8B 1VBD2 3E6BA 4I02A 4LHLA 4DINB 4Q4V3 1QJU1 3AKTA 1C28A 2QZ2A 1QXJA 4MUVA 1LHNA 2E9QA 5CVRA 5IT6A 5BY5A 4Y4YA 1ZBA3 4SLIA 4DZGA 2UYBA 4M3CA 4JGYC 2W39A 5FOBB 1RUJ2 4OLLA 1S2KA 1EY2A 4GALA 3THTA 2GNDA 3AP7A 4Q4X2 4J1XA 5EYYA 4N53A 3DV8A 3C2UA 1LOAA 4NOTA 4C1WA 1H1IA 4RQPC 5T50A 4HK9A 1O91A 2FMYA 3ZXJA 2YC0A 2WFF1 2GU9A 4YGEA 1BBT2 1RVF3 2NM1A 4QGNA 1UU5A 3ETQA 3VHOA 4AF9A 2GC3A 2DVAA 3TNPB 1SLIA 1UMZA 3AMQA 4V1PA 1DQ2A 2YYOA 4BE3A 3SXWA 5FO8B 1RUD1 2VUJA 4D7SA 1D0GA 1QF3A 4RHV1 3HBZA 1ZX5A 2WQZC 4U2AA 1WMDA 2P34A 1YJKA 3LWCA 4JRLA 1FNYA 1BEV1 1R083 1DG6A 2B8MA 1QY4A 2OYZA 2G4IA 1NQDA 2RJLA 4AI1A 5KXDA 1QOSA 3JB4C 2XBO1 2JJ6A 2UWAA 3VDDB 3PTYA 4XJ8A 2R061 2OPKA 5C4WB 1C4RA 1AX1A 1UF2C 4GH4B 2R071 1QJX3 4HFSA 1Z78A 1CN1A 1FMD3 5ACA3 2XHKA 1F5FA 3WDTA 1KS4A 1ZM1A 2JG9A 2K0GA 4BH9A 2MHFA 4LHNA 3ZXEA 2BTVC 1FOD2 3VDDA 5J37A 5CFCA 1H2NA 2B5HA 4HMZA 4C0BA 2N7GA 1Q8QA 4N43A 4URTA 1RUF2 5T5JA 4PLOA 2WIIB 5JAXA 1M06G 2PHRA 3VKMA 3X29B 4IEPA 4CDWA 2D7FA 4S2FA 4QMAA 5T5PA 4H55A 1S0CA 4OUMA 3V56A 1LOGA 3B5LB 3W58A 5JPNB 1NCQC 1MQTB 4OUSA 1RUH3 3WDXA 4RS5B 4HL0A 5KXBA 5I8YA 2YGLA 3QOPA 4Q0SA 3VKOA 3VBRB 3U10A 1AYM2 4BLIA 3H3UA 4IV1C 1YLLA 3J8F3 3VBOC 2E7TA 1V6JA 4AYUA 3HMYA 4INDA 3KD4A 1YFXA 4MGKE 3URFA 2D43A 4BHPA 2D5FA 3OPZA 1MS5A 3GZUC 1H4GA 1RHI3 2RS52 2PN5A 1CESA 2CTVA 2WZR2 3N35A 4MGYE 4AI0A 1VB4A 1Q8OA 3FJSA 3AZXA 4BLJA 1DF0A 1QH7A 4GXLA 1KDMA 4PF5A 3OY8B 4K1ZA 3ZN6B 4FPHA 3AZZA 4NWWA 2DCKA 4CDUA 4Q4V2 1ND2B 5A3MA 2ZAHA 1AYN1 4FOQA 4K1YA 1WUVA 4MXWB 5HCAA 1W6PB 1ZBA2 3CJIC 3K48A 4QT6A 3OTFA 1DZTA 4GKYA 4BZ4A 3M70A 4UBGA 3ZN6A 1XNKA 3AYCA 3GF6A 3JD71 5BNNA 3INAA 4YVSC 4YRDA 1PGW2 4YGDA 4MGIE 4DS0A 4QGMA 4COWA 1RVF2 5CADA 5C6CA 1GZCA 2ZGLA 5D8AB 3THPA 3DPRC 4GQ7A 3U07A 1YI9A 4FAGA 4QU2A 3GZTB 5F1RA 1AR81 3ZXFA 4WM8B 3WDVA 1N3QA 2DVDA 1X36A 2ZX2A 3V64A 2P37A 3J4UH 4M0HA 2A6VA 3SH4A 4PDWC 1I1EA 1C8M3 5L36A 5D8AA 2BNNA 4UW5A 4LUMA 2HWD3 1ZYBA 5C8CA 4WM8A 5J3UA 1ZRRA 3WDUA 5FFOC 3V65A 3MFCA 1NE6A 1R082 3TB0A 1RUI3 2BYVE 4GB33 1H2MA 2UYAA 1VAMA 1LOFC 1AXZA 4FPLA 1DGLA 1H8VA 1YWKA 4RHV3 2G9FA 4AVVA 4KU8A 2D5HA 4YFZA 4YZ5A 1QJX2 2DVBA 3EHKA 5JSRA 3LA7A 1FMD2 5ACA2 5IUQA 4KH9A 4L11A 2DFBA 2JX9A 2SLIA 2YXSA 3UKNA 2HYKA 3PNAA 2A6XA 5CAZA 4OZXA 4GULA 2PTMA 1QXPA 3VZJA 1DFQA 3HIFA 4HVRA 3FZ3A 3NW4A 4Y22B 1HRV3 4W6YA 1PVC3 1QH6A 3VKLA 4DXZA 1PGSA 1QQP3 5JZGB 3MPPG 4YM1A 2Q4SA 5GM0A 2JG8C 3HAGA 1IS3A 2ZZJA 4Y1VA 1VRH1 3NL1A 3UKVA 1OSGA 1RINA 3M7AA 4IEVA 3FUQA 1QJY3 1Y9QA 5A33A 3WNXA 3PHMA 4Q4Y1 1R091 5C9AC 5JZGA 1LGCA 3H0OA 4R8HA 1RUH2 1DBNA 4XBNA 1RUNA 4Y1XA 3HQXA 1FYUA 2BNOA 3MFAA 4FPCA 4HN1A 5IK8A 4QXKA 4C91A 3J8F2 4XFBA 3EJKA 4IV3B 1AUYA 1OOPB 1SFNA 2DU1A 3QH6A 5LEKA 1LB2A 4JDMA 5KWRA 3KGZA 2VQAA 2IXCA 3R05A 4M3CE 4N7UA 1UN1A 2WNUB 3WD5A 1QOOA 1HW5A 1NXMA 2ES3A 1NCQB 1RHI2 4XJWA 1BJQA 5GLTA 2IZWA 5I8TA 4HSJA 3NJZA 3VBUA 1UZYA 1CONA 2HWB3 2GMMA 2DV9A 1GR3A 4BIOA 2WNUA 4D3WA 2EAAA 3RMYA 2QZ3A 4B7EA 4F3JA 4QPIC 3NV1A 5TSWA 4PBPA 3MF9A 2PLV3 1VAKA 1NOVA 2KA3A 4FPYA 4E2QA 1A8MA 2DCZA 4LE4A 1X8MA 2CL2A 5GZDA 3C3VA 5FQ0B 1POV1 3FFQA 4YARA 3S30A 1FX5A 2ZZQA 3E5QA 3LA2A 2XWBB 1J59A 1IZ3A 1LHUA 4XF0A 2X8KA 5A32B 5DZEA 3ZYPA 1VBA3 1DLLA 2FMDA 3TAYA 1Q8VA 5FQ0A 4Y1ZA 3WINE 1X7NA 2BVBA 1S0JA 3FX3A 3NKGA 4CP0A 1HXS1 4EJRA 1C8M2 1KJRA 1SLCA 1H9PA 3NWKA 2ZGPA 1RUG3 4AI3A 1O3TA 1ZREA 4LR4A 2HWD2 2YY1A 3N7KA 1ZNPA 1HQLA 3SH3A 1AVBA 1LOCA 3ZYGA 2ENRA 3H1YA 1WCKA 2ZKLA 5L7OB 1QGLA 4P9XA 3DPRB 1RUI2 5CFDB 2A73B 4PBOA 3JB8A 4XZPA 4GB32 5H9PA 2ET1A 3AJYA 4BM8A 3APBA 2EXIA 4RHV2 2D3RA 3ILRA 4L8QA 4TWTA 1ASJ1 4PDWB 2PHUA 2GMPA 1O3QA 5T54A 1G9DA 1RMU3 2ZGTA 1REDA 2RS31 5D1IA 4FPOB 4FPGA 3IKWA 3USSA 4IEZA 1OPOA 2CNAA 4YW1A 1PO23 1RTVA 4NVPA 3AP9A 4QHBA 3OBTA 5KHKA 4RGAA 1G8WA 1GBGA 2EXHA 2RS11 3IDEA 1NLSA 4Q2FA 1VALA 3QD6A 1ND3A 1Y43B 4OHWA 2UU8A 1F2NA 1BK1A 4NPRA 4Z82A 4D94A 1HRV2 1OQEA 1PVC2 3CJXA 3WHUA 4AQ6A 2MEV1 3ZXGA 3ILFA 1QQP2 3WCRA 4D7TA 1O7FA 2XL7A 3IIAA 4LO6B 3WT3A 1WLDA 4OI0A 4TYSA 1ZZCA 1IS4A 4E2SA 4JGZB 4AFMA 1HRI3 3LKJA 5C33A 1YUDA 1AR73 1QJY2 2NMNA 3AJZA 4AGVA 2R6QA 3G7DA 3VL8A 4JDOA 2ZHLA 2Q1ZB 2A6WA 4MLOA 4LO7A 1GSLA 4M00A 1BMV2 5EZWA 3E97A 4Q4W3 1VBB1 3KCCA 3ZVXA 1H9WA 3IPVA 4L99A 4MYEA 1TE1B 1UIJA 1NYWA 4XJAA 2NMOA 3ZMOA 2B42B 4HKOA 1PNFA 1N1VA 3UL2A 4NO4A 2VQ0A 1D4M1 3HWJA 2BUKA 3AMMA 4L92A 1KQRA 2DF7A 2PELA 1LU1A 4EWDA 2ZA9A 4JC1A 3AX4A 1HQWA 1NLRA 3PVBB 3KGLA 4A7KA 3LZZA 1TMF3 2Z79A 3ZFEB 4PIZA 4H3WA 1PK6B 1EP0A 2HWB2 1NZCA 3M1HA 5FBZA 2HEVF 2CY6A 3WP4A 4AI8A 3NV2A 2C9AA 1YFWA 4RFT0 4DMIA 2VW2A 1DGWX 4WZFA 1WLCA 3DKWA 1ZBE1 1AXYA 3ZFEA 1MVEA 2PLV2 4LA2A 5FLIA 1UPSA 1PK6A 2DVFA 3PVOA 3R6SA