4UFLA

Mouse galactocerebrosidase complexed with deoxy-galacto-noeurostegine dgn
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
644
structure length
641
Chain Sequence
b'GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GALACTOCEREBROSIDASE
publication title Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 216
structure length 641
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4uflA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4uflA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uflA01
4RZ6A 1H1YA 4AD1A 4ACZA 1GJPA 3STEA 1C92A 4U5IA 2D0GA 1J2WA 3LX9A 4UFMA 1FFQA 3WBEA 1DEDA 1ZAIA 1JRCA 5EBAA 4H3DA 2XVGA 3GAYA 5M5DA 3W1RA 1UWQA 4HMDA 2ZXQA 4HTYA 4EF8A 3B9AA 1L2UA 3N2MA 3P80A 4HHPA 2BHZA 1SR9A 2E4TA 1QPQA 4UTIA 2PI6A 3II1A 5C71A 6TAAA 3STCA 1LF1A 1DBTA 3B8DA 3KZSA 4V27A 1TPEA 1NOWA 1MO0A 1Q6QA 4U4MA 2QDHA 3VKKA 4PMZA 4F9JA 5DLCA 1A53A 3KL3A 3B0VC 1PPIA 3NGJA 4WOQA 1GQIA 4B1LA 4CLMA 5DCBA 4B3LA 3W1TA 3DHDA 4GRSA 3MP5A 4N9DA 5AHNA 3L2LA 3OG2A 2UY3A 1OF6A 2DZVA 1IT0A 3VIFA 2HS6A 4OV4A 1W2PA 3GZ3A 3NAVA 4JR5A 1W3KA 4TX6A 3CHDA 1KWGA 4AZ6A 2JEPA 4PTWA 2WSRA 3UWUA 5BRBA 3TKFA 3RWKX 2B7PA 5CZTA 1C9DA 3WNPA 1PIFA 1IGSA 2WLZA 4B15A 4WKAA 3CWOX 5HJLA 3OZOA 3HGJA 3TV8A 2FDSA 5A6LA 3FKKA 4MVAA 2D0HA 1B0IA 4PMRA 3VNDA 2G5WA 3CMJA 1E1EA 1LBLA 1Y4WA 1KR0A 3L65A 2ZZ7A 3EXSA 4EQVA 3LLDA 3NQMA 3S8HA 4JTKA 2YLLA 5HINA 3FHQA 4MJMA 3LRMA 1FHDA 4CNOA 1HVQA 4CNNA 1CLVA 3W7NA 3VDCA 3LM7A 3ZT5A 1GEQA 1W1ZA 4P8XA 1BG4A 1UG6A 3M44A 4ZMGA 3G1FA 3WENA 1QOXA 3GXIA 3KVJA 3PZTA 4TTGA 3T7VA 4DO4A 2A3EA 1OYAA 2TAAA 1GQLA 5ANNA 1PE1A 3CWNA 2J88A 2NXHA 4AZ5A 5LA0A 1FDYA 1I2OA 3NZRA 1JAKA 4L4MA 4Z2JA 3ZSSA 3Q37A 1A5AA 5CZSA 5DXYA 3TH6A 2WPBA 4BWLC 1KR1A 1LWHA 5D8ZA 3GX9A 3W87A 5CPOA 1CNVA 1H5VA 3NQFA 1K8YA 4ZQPA 1UYQA 1B31A 5JBEA 4JHOA 1XFBA 1OK4A 5FMCA 4OE7A 3BCDA 4X9YA 3AZSA 3NQGA 4WY0A 4QITA 3IVTA 1TQXA 3CO4A 3KFTA 5BROA 2ZX6A 3TE9A 3L4VA 4MUZA 5KZMA 5J5RA 3W7KA 2C0HA 5BWFA 5HUOA 3FEMA 1X8FA 4ZQMA 3ZJ6A 3LXCA 1KB3A 3GBDA 4AD5A 1OT2A 4DM2A 3AJXA 1CW2A 3UZ5A 3W7MA 2JK2A 4GO8A 3ZJ8A 4HU8A 1XM3A 2C6QA 1CGTA 1CXHA 1D7FA 1S5TA 2WCAA 2XSAA 4LQ1A 2EPHA 1VHCA 4PUDA 4RE2A 4H8HA 4MB5A 3PZMA 4JKKA 2WXDM 3BMVA 3DFPA 3FA5A 3LERA 3MI3A 2WKGA 4YWIA 2Z1BA 3LMYA 3LCWA 3FW6A 3SGZA 3KE0A 1E5JA 4UOZA 2CLHA 1W5PA 1UD8A 1F4AA 1JJKA 4CVUA 3MUXA 1W32A 2J7HA 4FK9A 1UR8A 1I2PA 2QPSA 3VX0A 3LFIA 2NLIA 3WEZA 3NQ7A 4W7WA 1EO7A 3IJ8A 3VD4A 5CXPA 1TMQA 2ZRVA 3ELFA 2CLIA 3L4YA 5K4ZA 3L4WA 1HL8A 4U5KA 3UQNA 2QQVA 4N9EA 1V6XA 1WDRA 5DT5A 2QUVA 5A2CA 4LS0A 2A1YA 1UWUA 1M04A 1UQZA 1FWWA 1TUXA 2YKKA 4M24A 1OFAA 3DYMA 2Y8VA 3CGTA 2Q3OA 3RJYA 1WDQA 3KXQA 4OIFA 1TJRA 1FWSA 2GK1B 5FEXA 2A6LA 4XWUA 3B05A 4M7SA 3DC0A 3W07A 4M19A 4DELA 5I77A 3LF7A 2ZBTA 1UWTA 3QYQA 5LYRA 2HMCA 4OBTA 3LTYA 1J0KA 3ARRA 3DHPA 4UTHA 3QSRA 1QNRA 4UTLA 4NJIA 2NUWA 1NARA 1W0MA 1QW8A 3C2RA 3IEBA 4S1FA 3W72A 5BNKA 1E6XM 4IMGA 1W9BM 4YCPA 3PN8A 2WYSA 1JFXA 2EO7A 4H8VA 2Y70A 1TV7A 3SJ3A 2EGZA 2VEKA 5K3VA 4AC1X 3PS7A 4UQCA 4A22A 4PA8A 4KFPA 4UCGA 4O1BA 4XBKA 3A21A 3P5YA 4ZVJA 3KOFA 1MW3A 4JAWA 1W1VA 3UEQA 4QNEA 1DV7A 3AXXA 4AIUA 1IIGA 5A8PA 3G24A 4GKLA 4OU1A 3HJZA 5D30A 1KCLA 2J7BA 4OWGA 2Y85A 3ARQA 3T09A 2AGKA 1G5AA 3WNKA 5JBFA 1WCGA 1ICSA 1LRNA 1W1TA 3VX1A 3DZ1A 2CLOA 4NSBA 1GVRA 2FTPA 2WKLA 1M7OA 3NPUA 1PCWA 3CC1A 1GVSA 1EP2A 1H62A 3LLFA 1VBUA 3QGVA 4XV0A 1LWJA 2YL5A 4D6EA 1TV8A 5I79A 4JKLA 3P82A 3UYCA 2X1IA 3VMOA 1XBVA 4FO4A 3TJLA 5ABTA 2WHJA 4RXGA 3AISA 3DI0A 3N14A 1E43A 1J18A 1ECEA 4CU6A 1D3HA 2Y7GA 5G5IA 3G0XA 1GONA 1LBFA 4FLQA 4HPJA 2VVNA 3FHAA 3LEMA 5TD4A 3BLIA 2VNCA 1ME8A 1FXPA 4XUGA 3WK1A 2FHBA 4W8AA 4FLRA 3W6LA 3T44A 2CZ5A 4RKAA 2GQAA 3GBEA 4K8HA 2G3NA 1UWRA 1GJWA 1G4SA 3DFTA 3LCIA 4ZQCA 2EBNA 1NF7A 5BRPA 2WKJA 1J0JA 1B3WA 1C7TA 1Z41A 5D38A 3PSVA 3TXZA 1HKMA 3CU2A 3IRDA 3RILA 3P84A 3VI2A 1W37A 2QDGA 3BLFA 3ABSA 3LV6A 1WOAA 3MW7A 3P74A 3LPPA 1RQEA 4PMNA 3P7YA 1W3TA 1QBBA 1MFVA 3NA8A 2FH6A 1J9YA 2XVKA 5K2ZA 1QHZA 4AHPA 1T8XA 4J9JA 1JIBA 3ZR4A 3RM4A 1SO4A 3C3NA 3HO8A 1H3GA 1QI3A 3AICA 1KFCA 1XCFA 3PBWA 3N3MA 3UNDA 3CTTA 1Q3NA 3QR3A 3UGGA 3MJYA 2X1RA 1R2RA 1B3OA 3EBVA 4K39A 2A7PA 1UB3A 4Z1AA 3TQKA 2OT0A 4HNUA 4MZ8A 2ZTJA 1US3A 1HXJA 1BWLA 1GPFA 2W91A 4CU8A 2E6DA 1V02E 1GVYA 2VI0A 1AQHA 1U33A 4S3JA 2R8WA 1ISZA 3BXWA 3OIHA 2YIHA 1RZMA 5HPOA 1K03A 2YSWA 2PRMA 4MLRA 3INPA 2GK1A 4H8UA 1DL3A 2WMIB 4W8LA 3MSGA 3WNNA 2WLYA 3NL2A 2CLFA 3RO8A 1BVZA 3TC7A 1BG9A 2CYGA 3VD9A 4DM1A 3AHTA 1SFLA 5HNNA 3ZWSA 3ECQA 3OLEA 3ZO9A 3BSGA 1WDSA 3S5ZA 3ARWA 5I5RA 4FFHA 2ZE0A 1E72M 1IXQA 3UG4A 3QRHA 4CNPA 2TPSA 4D71A 4J3WA 5FEZA 1VLWA 1GQNA 3S1UA 2FHFA 1QNPA 3DGRA 4JHZA 2ADEA 2FHCA 2CIPA 1RD5A 3LDVA 1LROA 3CM4A 2ZRUA 3MMWA 4UR8A 1X7FA 4N2YA 1FCVA 2WOQA 3CH9A 4LVDA 1BTCA 1K7EA 1VHNA 2HSAA 4HP5A 2Z1KA 1EQPA 2RGMA 1VJSA 1XC4A 4QISA 4AWSA 4R53A 3BG3A 1O4UA 4O16A 3P81A 1VCVA 5G4WA 5A6BA 1NEYA 3C61A 1L6SA 1OG0A 4P7QA 4M29A 4FNPA 3MMTA 4M6QA 5CZ0A 2EKCA 4HXCA 1Z44A 4NX0A 1KQYA 2DEPA 4TVCA 4MB3A 1F74A 2JIEA 3ATZA 2Z0IA 5HR6A 3MUIA 2F84A 5U4NA 2G96A 5HWJA 1G6CA 3SURA 2VCCA 1MQQA 5BXTA 2ZUWA 3H55A 1SZGA 3QPZA 1B4EA 1LM1A 2J24A 4GO9A 1ZNNA 1TIMA 1J12A 1SSDA 5A2BA 1E6PA 3BW3A 1H5YA 1FWNA 1MW2A 1JNEA 1FCQA 3GDTA 1H7WA 3W85A 2EPKX 1QNVA 3G1VA 1Q6RA 1KGUA 3QHOA 5A8QA 2W5FA 4LVAA 3PTMA 4IISA 3ANYA 2E09A 4CD7A 3CQ0A 3NSXA 3NG3A 2OWXA 1QPKA 1TJPA 3L0GA 3U2OA 4FIQA 1SW0A 4N4QA 5HXMA 3LHVA 1DTUA 4J7RA 4U2YA 3AXIA 3C8FA 2YW4A 4FNTA 3WJZA 4ADSA 4D72A 3GR7A 3ARPA 5FD0A 1SFSA 3S2CA 4QSHA 3Q94A 1LOLA 4LNYA 1C93A 3A5FA 1TFVA 2WVTA 1H61A 4GNJA 4E2OA 1ST8A 1OCQA 2C16A 2WMHA 3AS1A 4WIWA 3PF3A 3TQVA 3UZJA 4NRRA 4HA4A 3AIWA 1KXQA 4HA1A 3FAXA 4HKPA 1ZAHA 5U7SA 2CESA 1HJXA 3KL0A 5DCEA 3TDFA 4W5UA 1KM0A 1PS9A 1TV5A 5IFPA 1S5VA 2CCRA 5G2WA 4JCLA 1EB3A 2UY4A 4LXFA 4LTSA 3PSWA 2YR1A 4PMUA 2CEQA 2PC4A 1GQKA 1I2NA 1XI3A 3N15A 4KRUA 4DBEA 4JFWA 1C8YA 1JG9A 2BVTA 2ADDA 5F2LA 1BYDA 4WOZA 1JULA 1NM9A 5LGZA 3G1DA 2WMIA 1YTDA 2A6NA 2G8ZA 3L0NA 5C5YA 4D1IA 1PZ3A 3WMBA 1JCXA 3ABQA 4PRWA 5EBUA 2ZA3A 3GDBA 4NX5A 1WO2A 2IXUA 2FGLA 1XGZA 2FFCA 1DVJA 3NXFA 4JY9A 3MO7A 3AS0A 2VCBA 1CZ1A 1G7VA 5ABEA 1TVPA 1ICQA 1XCWA 2VRQA 5FESA 5I3DA 5CSRA 3NQ8A 3TC6A 1E4LA 4JEQA 1VIWA 1WKYA 5KITA 3KRSA 4TMCA 1G4PA 3TXVA 3RMEA 3NR0A 3WNLA 4O14A 2YZRA 2YW3A 3NDOA 3CUFA 5I3JA 1KW1A 4P8WA 4CQAA 4JY8A 1TYGA 1PX8A 5E09A 2BY1A 2J9ZA 5D09A 3BAKA 1E73M 5D9NA 2B4GA 4CD5A 1JDAA 1TREA 5LNRA 1G1YA 4O0KA 3PZNA 4V2XA 3EWUA 1AMKA 4UTJA 4JS3A 1OT1A 2GFTA 3FJ6A 3BO9A 2DT0A 1HP5A 3S0CA 2ZA2A 1R30A 3W22A 2VFFA 2WV8A 4QM1A 2XM2A 1FH9A 3UY7A 5F2IA 4AY1A 3SFKA 1N55A 3L0KA 1E6NA 1RPKA 4UXDA 1QAPA 1AL8A 1N7KA 2NX9A 3M0ZA 5KINA 3BAJA 2YX0A 5G2HA 4MLJA 2XSBA 2TYSA 5BOOA 2CLEA 1BVNP 3CLMA 1UKPA 4MADA 1GVOA 3KRZA 3F5JA 2WVVB 2C19A 2FJKA 2O92A 1HTIA 2CKSA 3FKRA 5AYYA 2VFDA 1MYRA 1JCLA 4JZ5A 5D03A 3W70A 4FNUA 1EP1A 1W3JA 4CKQA 3S1XA 1F76A 4DBDA 1E0WA 2QF8A 4F66A 4OUEA 1GNXA 4AVFA 4A3UA 3LCFA 3S5OA 3W7PA 1VFUA 2WANA 3TP4A 3VIOA 4MIMA 1M03A 1UR0A 1HJUA 2VTFA 4QFUA 4BQ5A 1QMLA 3AQUA 4CQ9A 4EOUA 3I3BA 4TVUA 4Q33A 1MQPA 2ALDA 4AZIA 3PHAA 1KV8A 2F61A 2XJ7A 2NSXA 5I2UA 4GI9A 4X2RA 4PN2A 4LU0A 4CCDA 2WK2A 3SCUA 2XFWA 1W2VA 1CYGA 3E1F1 4PEKA 1PL9A 3HG2A 4IPIA 5A8NA 2QEZA 2PBGA 1B1YA 4POCA 4UNLA 5GNYA 1FHLA 4O8RA 5I78A 4LYPA 4LPCA 4ADTA 2OWCA 3AMGA 3IGUA 1XH2A 3P61A 5KZDA 2PB1A 3AHVA 1G94A 5KTLA 1UKSA 4HNVA 1T96A 4BQ4A 4BFAA 4LW7A 3CHEA 3L5LA 1OFEA 4O1AA 1Y9GA 5LNUA 1SFJA 3EWBX 5AHFA 4HZ7A 4LVFA 5C2XA 4MAZA 3A9IA 1W56A 2BY2A 2WAGA 2X2YA 3BLPX 3Q58A 4RR4A 2YA2A 1UA3A 2V3FA 1H49A 3LBCA 3MS8A 1QDSA 3GDRA 1XCXA 4P7OA 4ZXLA 3MKKA 1TTJA 1FP8A 4S2BA 5LGXA 1GG1A 3M46A 2BVYA 3U6WA 4FFFA 3CUHA 1KCKA 1FQ0A 3G0UA 3G8EA 3L4ZA 5BYWA 1QO2A 4O17A 5F1UA 2RKXA 3LXBA 5A6MA 1UR9A 2P10A 3LGEA 3WK0A 4GJ1A 2BHUA 3DECA 2VFGA 6TIMA 3DAQA 3RF9A 1Q6FA 1UD5A 3PTQA 4QDMA 4CU7A 3WKZA 1WV2A 3KL5A 1V5XA 5AC7A 3B9EA 2VQTA 4HT3A 4LX4A 1DWFM 5IDIA 2FB3A 4BI5A 1OGGA 1FY6A 4QLLA 2I9EA 2QJIA 3KHJA 2VX4A 1KM1A 1GOXA 4UQBA 3PR2A 5GVJA 2WNZA 3A24A 5D05A 3IGXA 4IQLA 2R14A 4AWUA 4UTKA 1KBJA 3OEXA 3RNDA 1GCYA 5C54A 1H60A 2Q8ZA 2WSYA 4UNKA 1HL2A 4QAIA 1CGWA 4WZHA 4Y6GA 3THDA 1KTBA 3CTLA 3CUJA 2VRJA 3HJEA 4A3YA 2XQRA 3M7WA 2VX7A 1H0GA 4K8EA 4NVTA 1GUVA 5LA2A 1K9EA 2V3GA 3OA3A 1XH1A 3M1ZA 1OGBA 5I3FA 5DF0A 1H7NA 1HJWA 1VYRA 5AFDA 1FH8A 5I23A 4FEZA 2WZEA 3YPIA 6ALDA 4JL1A 1DHKA 3WF0A 3VKJA 1RD6A 1VEMA 1A50A 2ZYFA 4U3AA 4JYFA 5D2YA 5CGTA 1P5BA 4RZ4A 3W53A 3K4DA 3F4WA 3AIEA 2WVVA 1JCNA 2QPUA 3B9DA 3S6TA 3LBMA 4OQVA 1C29A 1XRVA 3JS3A 1CGYA 1SYTA 3LIGA 1WZKA 2PWFA 2X0YA 5EB8A 3VNZA 1AW2A 5CGQA 3SUTA 4RZ5A 5FKYA 2OYKA 3UXAA 1Z48A 4OJYA 8CGTA 1DOSA 1KM4A 5LKYA 2W61A 4BF7A 2NWRA 4N02A 4S3KA 3C2FA 3GYEA 3OBAA 1TPH1 1JYVA 2BSLA 4JTJA 1KFLA 4EK7A 1V0MA 3VGEA 2E5DA 1E56A 1K9TA 3WIJA 3LB0A 1BYBA 5F1VA 3DFSA 3THAA 2V9DA 2VOMA 3LCGA 4ZE5A 3W86A 1S5WA 1VEOA 4QLKA 1BTMA 1D9EA 3C2VA 1VBRA 2QCMA 1PBGA 2NT0A 1NWUA 1ALDA 3W88A 3PZVA 4NRSA 4WSJA 2CWNA 3NYZA 1HFBA 5KZ6A 4QCEA 1F2JA 4E8CA 3PBGA 3EB2A 3PZQA 3J7HA 2CPUA 1A5SA 1DKWA 1QI0A 4JTFA 1IXNA 3VUPA 2JF6A 2NX3A 1R2SA 3OVRA 3W29A 5E9AA 3NMBA 1OWQA 4DF0A 1JZ7A 3W6YA 3NIYA 2W0UA 5MHBA 1LTDA 2CKRA 1LLWA 2BWGA 1ONRA 2BV9A 2DP3A 3UWQA 1YXYA 3N19B 3DHFA 2XTKA 3FY1A 4LYRA 4P7LA 4B3KA 3GTNA 4WXYA 5FMBA 2P1FA 1NOFA 3WUFA 3M5YA 2XFYA 3AZTA 5CPQA 3UESA 3UG3A 1E15A 3PUEA 2J8FA 2VEIA 3TIMA 3KEHA 5AYIA 4OGZA 4M82A 3OVPA 2V5DA 2ZUVA 4MJ2A 1ITXA 1H1ZA 1U5JA 1L6WA 4URIA 2PWEA 2W79A 3K4AA 5FIXA 5IHRA 4CVWA 1YQ2A 1O6IA 1H09A 1R7AA 4MAVA 5HDRA 4ATDA 1ZFJA 1ZU8A 1VS1A 4GUIA 5K7JA 4FF5A 5E1QA 1TPB1 2YOCA 3EWYA 1KM5A 1CI1A 5EA9A 4PTVA 5C8BB 2FGZA 3P62A 5BMXA 1WPCA 2ZZ2A 3GH4A 1Q6GA 5FF4A 1BKSA 3U8GA 1B4KA 3AFBA 2V2DA 4AZHA 4HOZA 1WBHA 4GIAA 1E6ZA 1V3LA 2YA1A 2RFGA 1THFD 1UKQA 1MWOA 2RDUA 3MBDA 1GOQA 3PB0A 1HUVA 4GE8A 2J62A 1HJSA 3W9ZA 1VC4A 1OINA 1KXVA 3VNYA 1MEWA 1JUBA 3WMCA 4NJGA 2TMDA 4H4IA 1LDCA 1J10A 1UUQA 4DPQA 5CPSA 3SUWA 4EWND 3IV3A 4IMCA 3MUAA 4W87A 4EE9A 3LCXA 4UR7A 5CQ1A 4XKYA 1UBSA 5FEWA 1JDDA 4QCFA 3H53A 3LRLA 1LOQA 1MFUA 4O52A 4K6AA 1D3GA 1UCWA 2ZUTA 2XG9A 1W3NA 4DF1A 1Q6DA 3KWXA 1JZ8A 2ISVA 4JTLA 3UGHA 1LLZA 5A6AA 2DSKA 4TXEA 4U31A 3NJ3A 1CECA 1G01A 4XB3A 3EDDA 2OZ0A 1KFBA 2DSVA 4W5ZA 3WK2A 3VDAA 2ZWZA 1DWIM 3NNTA 2J79A 5J5DA 3UR8A 4WQ6A 5FKBA 1O7AA 5AB3A 2A3HA 2DGAA 3F4NA 4OV9A 1B57A 1E4NA 1OX5A 1R7OA 2OSYA 3NQ2A 3P8JA 4OHQA 1XD0A 3WMSA 3T2OA 3G1YA 1UWIA 4D6IA 1YXDA 4GQRA 2VMFA 5F7UA 4X0NA 1FH7A 1E51A 3EYPA 3STGA 1PV8A 4DO6A 2CU0A 4PL1A 2VJXA 3O15A 2VEMA 1US2A 4U2ZA 4UC5A 4EANA 5M3WA 2AAMA 3AROA 3U75A 3W24A 1KXHA 3UR7A 3MBFA 2BZNA 4ICNA 5D2WA 1PZ2A 1M5WA 3ZJKA 4MY1A 4QP0A 5A8OA 1CPUA 1MXDA 4JFUA 4L4LA 3E49A 1XBZA 3ZT6A 5CKSA 4IJBA 2X2GA 1MXGA 3BV4A 4ML4A 3HG3A 2AAAA 4Y8FA 4N9BA 3VIGA 3LDRA 1SMDA 4TU1A 1Q4NX 4UTWC 4H2CA 3VIIA 3FXYA 4PSRA 3VO0A 1VCFA 1XUZA 3TMLA 4UTMA 2YYTA 3F5LA 3A22A 3CPRA 3DENA 2HS8A 2HVMA 3W7GA 3W23A 2VURA 2VZVA 3LPGA 2QQUA 2V38A 3VGDA 3AYRA 1Y0EA 4UUIA 3C56A 1OSEA 3R13A 4AAJA 1EX5A 3NZ1A 2E8ZA 5G1YA 3T40A 4HSOA 3K8LA 2E9MA 3S42A 3BGJA 3UXDA 2QV4A 4NI3A 2A7RA 2ZZ5A 2QCDA 3NVTA 2PRHA 1V08A 1CEOA 2WWDA 2YFOA 1DWHM 1H51A 1IF2A 2FH8A 3CZLA 4OKDA 1SO5A 5F2MA 3S5YA 3NUKA 2ZQ0A 3O6YX 4UFJA 1WAWA 4GUJA 1FBAA 5AYXA 3SIZA 5CG7A 3PTKA 3NM1A 2V5LA 3AHZA 4TOQA 2F7FA 4D6GA 3RLVA 1FDJA 1WBJA 5CPMA 7TAAA 2R94A 1C91A 5LNSA 4JIPA 1CX9A 1HF6A 1WZAA 1GOMA 2CBIA 4LS1A 3W1UA 4Z0JA 2G3JA 5CPNA 4MJZA 3PZUA 4R5EA 2ZICA 1W5NA 4NXKA 4P7NA 1Q6CA 3AS2A 1W8SA 4H04A 3SUUA 3VOCA 3WF1A 2A85A 2WSPA 4JKMA 4Q22A 3WQ6A 3C52A 1H63A 4AF0B 3MP4A 5FK8A 1J01A 2CBJA 4O18A 3MHUA 5TQLA 2PWDA 1GQJA 2XN2A 4MNMA 4AMCA 5JIWA 3QEZA 4TR9A 3RFAA 3UWWA 5AHLA 3W2KA 4AEEA 8A3HA 3GDLA 4Y96A 3FJLA 1OIMA 1RQHA 1XYFA 4NJKA 4AZ7A 1V3HA 3W84A 4O1CA 1DWAM 4Z08A 1YDOA 1H0IA 1CTNA 2KZHA 2O7QA 4F79A 4UFLA 3EEGA 4QJ1A 5DXXA 3QW3A 3UPBA 5A6BD 1VFOA 3DFOA 4Y90A 4E4PA 3GNRA 4HMCA 2DJXA 3TX9A 3EDFA 4XTDA 1VJIA 4A4AA 2YPIA 1KFEA 3ALGA 1E6SM 3B03A 3SECA 1VYPX 2E3ZA 4MYAA 3T78A 1EP3A 3M16A 2EPNA 3VFLA 2D20A 1A5CA 4OBSA 1B9BA 4MKNA 1G0CA 5DMYA 5L6UA 5C55A 1NWTA 4MFDA 3NQCA 1V03A 2OSXA 1QI5A 3AZRA 5A6SA 3UPWA 2Y89A 2VZTA 1EUAA 5D8WA 5DFAA 1PIIA 3AHYA 3P60A 4DUXA 2ATMA 4BR1A 3STFA 1J5TA 1X1OA 1QO5A 3WEOA 3R8RA 1CLXA 3N13A 2QQWA 1W3HA 4KRTA 4D6JA 2OJPA 1GJUA 1Y7VA 3HF3A 3HQ1A 1HX0A 4UQ9A 3SC7X 4A21A 2WMGA 4CD4A 3MYPA 2BS9A 3PZIA 3VIMA 3W7EA 2CXGA 3KVMA 3ZS4A 6CGTA 2EPMX 4YL2A 1EPXA 3JRKA 1P4CA 1NP0A 2BXZA 1ADOA 2DT1A 4FNRA 1E4IA 3U7VA 5CLWA 1QNOA 2H8XA 1AQMA 2G41A 5AN7A 5ABHA 2LLEA 1FFRA 3MV11 3VINA 1H7PA 3HBKA 2D3NA 2WBKA 1MSSA 3WEMA 3L4UA 3G1XA 3PULA 1HNYA 5EL1A 3IVSA 4K7VA 3T08A 3WJWA 3OLIA 2X0HA 4KH2A 1UUOA 4K7YA 3IVUA 4O19A 4UFHA 2C8NA 3VGGA 2NV1A 1AW1A 4JX4A 7TIMA 5DN1A 3ARTA 1KFKA 5M17A 3U5YA 3MSDA 1E0XA 4IPLA 2NZLA 3WF4A 5KZEA 4PCTA 3HU7A 4IMDA 3SCOA 1F6PA 4PTXA 1JI1A 3A23A 3L5AA 3QZEA 3SUVA 2ZRXA 2WMJA 4W7VA 2CNCA 5AHMA 3TSMA 2QCGA 2OMAA 2BNJA 3I3DA 1W91A 2WWCA 4TO8A 4AF0A 1TCDA 1A5BA 3E12A 1WE5A 4M6PA 1E6QM 3ABRA 3B4UA 1R47A 2VEPA 4KGJA 2D73A 3W6MA 3A6OA 4JL2A 3DKLA 2NUYA 1BHGA 3AIRA 2TRSA 4R7JA 4TMBA 3SCQA 3BW2A 1R46A 3HOJA 1OFRA 4WX2A 1OK6A 4B16A 2Y63A 4NZCA 2VCAA 5FF2A 3ARYA 1ZY9A 5LA1A 4NJHA 5I24A 1FOBA 2VR4A 4AZZA 3ATYA 3PY2A 2WC4A 3D0CA 2ZCGA 2J9XA 3I65A 1VENA 1LG1A 4JYDA 2DJLA 1VFMA 2DZPA 1V3JA 5GNXA 4HPHA 1XDMA 1VAHA 3B0UX 2YXGA 4ORIA 3N2XA 2VZSA 5T26A 4XZ9A 2DSZA 2QKFA 2ZUSA 4PMYA 3QC3A 2VOTA 1RV8A 1EA9C 1GT8A 2CERA 2VVSA 1CDGA 2Y5EA 1KFWA 3UGFA 4PUEA 2OCZA 2BLEA 1FCUA 3BLKA 4AB4A 3E96A 4UOQA 4BQ2A 3U57A 3VE7A 2W67A 1RQBA 1LL4A 4LRSA 5KMYA 5DT7A 3AYSA 4YXGA 1YTKA 4JX5A 1SZEA 3U1XA 4I9AA 2E9LA 3GXPA 2ZUUA 3CHVA 1CXKA 1OFDA 2IUZA 3O06A 1E0VA 4GZEA 1MZHA 2FDMA 1G4TA 2H8ZA 3GIYA 1ZB5A 1WQ5A 1DWGM 5DEZA 3SI9A 2R91A 1GTHA 5A95A 4IX0A 3O2LA 1YADA 1O94A 2EHHA 3K8MA 4KWUA 1G69A 3NQVA 3SCPA 1G7UA 2XM1A 7A3HA 1HIZA 3ARXA 3TW6A 2D0FA 3ARSA 3C6CA 3C0JA 2WPGA 3WDRA 1TRIA 4FX6M 2B7NA 3R89A 2W4XA 1XSKA 4PC8A 1M7PA 2CHNA 3SCTA 3BW4A 4EKJA 4CUCA 3GH7A 4WLCA 3CIWA 1RPXA 2YDRA 1VGAA 4Z0SA 4U33A 3RIKA 3ZMRA 1TPWA 1SO3A 4MY8A 1D2KA 2PURA 2IXVA 3GZAA 4HNNA 1K8ZA 2FIQA 4AXNA 4IX2A 3W38A 1WA3A 4RX0A 3WQVA 1V7YA 2A3BA 3CHFA 1LOSA 3HG5A 2DZTA 1GYLA 2WB5A 3IIVA 4B1MA 2FPVA 3SIMA 4JFVA 3LDKA 4ZENA 2V3DA 3W25A 3FOKA 2BY3A 3W1NA 3W73A 3O63A 1O5XA 3HGOA 4ZXOA 3VIHA 4GUGA 2OX1A 2ZXAA 1JR1A 1TB3A 1GWJA 3EDEA 4OOUA 3LPFA 5A8MA 3WDQA 1QPNA 2GDVA 1BGAA 1VLIA 2H3DA 3MHGA 1RP8A 2NUXA 4GI8A 4AD2A 2G95A 3O05A 5CSYA 4GBUA 3ARVA 1TPFA 3BAIA 3W1QA 5D9PA 1V0NA 3NPXA 3A3HA 4BCEA 5EYWA 1JL8A 4J3TA 1H41A 4R27A 3RPMA 2D24A 1MEHA 2EQDA 2O9PA 4UFKA 1PHQA 2ZTKA 4LV4A 3WUBA 3L68A 4UMCA 3QHMA 5E6YA 4IXXA 4KWVA 1PX3A 3O6AA 3T0BA 5E93A 2D3LA 4Z2GA 4IXHA 2Y7DA 1IXPA 2A7NA 1YPFA 5I3HA 1M01A 4M5PA 3PZOA 2EAWA 1UR4A 4UTUA 3CZ8A 5FOOA 3I68A 1XH0A 2J7EA 1HJQA 3EDKA 1N8FA 5GQBA 3WQ5A 5HULA 3OGRA 2XGIA 4MJ4A 4IMFA 4C1LA 3MMUA 5D33A 1GYNA 1JF6A 2ZUNA 1KM2A 1SO6A 3M5ZA 3TCEA 2A3AA 3SCVA 1X6UA 1UD3A 4CD6A 3DFQA 2WO5A 4MYXA 3GNNA 1S3HA 3W3OA 1DQXA 3MP3A 4GFSA 2YA0A 5A8GA 3G6MA 3MUZ1 1JZ2A 1ISVA 1WOBA 3I7RA 2AEZA 2JKAA 3DHUA 3AMKA 3P5ZA 2VENA 4PMXA 3MUY1 3TMQA 2Y88A 3LOTA 3WJXA 4GXMA 3I7SA 2DZWA 3VIKA 1AW5A 4X22A 2QCLA 3L2IA 4FIRA 4C7GA 3W26A 1TG7A 1ML1A 3F1QA 1J0IA 1AMYA 4O28A 2O9OA 3HIJA 2V5CA 1JZ3A 1ZJIA 1Z42A 2ZZ6A 3TNOA 5D04C 3NSNA 3OGSA 3SCRA 4KKXA 4MFEA 1HO1A 3IMMA 2F2HA 3WUEA 2ESCA 2EEXA 1JUEA 5IBXA 4FFIA 1K9FA 9CGTA 2V2HA 1OD8A 3G8RA 3PBYA 2MANA 3NPWA 1GTEA 1BWKA 1LBMA 3GKFA 1VRXA 2VL4A 5EY5A 3BGAA 1I2QA 2WC3A 1W9DM 4JDBA 4IUGA 1UR2A 4OOZA 1QHOA 3GXFA 1ODUA 3TTQA 3W1XA 5SWUA 3N34A 2ZA1A 3RMJA 4RV8A 3QPYA 3AOFA 3VE9A 1KFJA 1LORA 3HPXA 4O11A 3TSDA 2W63A 2DU2A 1UD6A 2YYUA 4LVGA 3SUSA 1EDTA 1GVQA 1CIUA 3SW6A 1HT6A 3W82A 5FMDA 3NSMA 1I1WA 4IM4A 4AHOA 3IGSA 3AS3A 1UZ1A 3OB8A 3GXMA 5I3KA 5AC8A 3T0DA 3WH7A 4EIVA 1BFNA 3G22A 4JNMA 3BAXA 3WQ8A 3GKAA 4GXPA 4JXCA 1SR0A 3GR8A 4FX7A 3O6DA 1L0PA 3USBA 3HBLA 4JQTA 3E02A 1WB0A 3NQAA 3N11A 2V30A 4GQQA 1QVBA 4W86A 1OF8A 1LRTA 1BSIA 5IFTA 2RGLA 3O07A 4H6KA 1WAUA 4AEFA 1JXKA 4E38A 3GAKA 1F6KA 5ABGA 3AXHA 4A29A 3MMDA 3FIGA 3JR2A 1W1PA 2OWWA 1J0YA 3FS2A 1OBAA 3QMSA 4RJEA 3EX2A 1J0ZA 3A5VA 1LJYA 3W7OA 4MB4A 4PBGA 5EMYA 4LUIA 4N0RA 3SY5A 1GG0A 4ACYA 3WSUA 2DSUA 1WZMA 3PZ9A 1XKYA 4PEEA 2YGYA 3W75A 3LRKA 2YL6A 3WFAA 3W27A 2E6FA 2GVLA 1X1ZA 3BCFA 3DXIA 5AHEA 2WVSA 3W2JA 1X6NA 4JIEA 2J7FA 3RDKA 1XD1A 1SW7A 4NNAA 1KBKA 5HWMA 4DUWA 1KXTA 2XIIA 1KTNA 1AVAA 1I4NA 2DDXA 1OFPA 4LWWA 2I1OA 3LV5A 1BPLB 3SCWA 5AC5A 2VFIA 4FHAA 1ZCOA 4UFIA 5D02A 5EPDA 1VFFA 4B9YA 1QNSA 2XYLA 4OZOA 1EWEA 1GOWA 2QCCA 5CZKA 1OX4B 4KWWA 4DWSC 2VQUA 1HVXA 1BQCA 2V81A 3N17A 3W7DA 2Y24A 3TAKA 2QCFA 3W2MA 1LL7A 3OLDA 3WUGA 8TIMA 4B9ZA 2GJRA 4UZUA 1JCJA 1E70M 2CLMA 1B3ZA 3WELA 3G6LA 2V5BA 1OB0A 3OHIA 1BEUA 1N82A 3ZJ7A 3FAWA 1Q6LA 4J3UA 3VGHA 3P67A 5A1AA 4GUHA 4UTTC 5CG0A 3PIGA 3B0PA 3B8SA 5HWNA 3ZWTA 4IPJA 2CZFA 3E9AA 1W3LA 2GVJA 4AH7A 4ML9A 4PL2A 5GPRA 4CGTA 4MNKA 5EKYA 1UUMA 3QW4B 3N1AA 4NU7A 4XKYB 1JQVA 1OABA 1WX0A 1XUUA 5D37A 5C6MA 2ZRZA 1GOIA 4MTVA 4HIBA 2ZX9A 1H1NA 3M7SA 2ZFAA 1SU5A 1UR1A 4XTIA 2JGYA 2J7GA 1TE1A 1V6VA 3SZ8A 3G3MA 1NWRA 1PIGA 4K36A 4BWLA 3UG5A 4UTWA 5IHSA 1KV5A 1V02A 1VJZA 2WNQA 4WSKA 2QJHA 2XN1A 4M7TA 2X30A 1VF8A 2J4GA 4D2JA 5LSMA 1E55A 1TZ7A 1K9DA 3S1WA 1YLVA 1JVNA 4R34A 1PAMA 3K1DA 2JKEA 2VZOA 2XN0A 1P6WA 4YHGA 3PBUA 2BX7A 3RM9A 1KQZA 4JTHA 2QCNA 3W7LA 2AOSA 4PMVA 3N73A 4P2VA 3ZT7A 4DF2A 3POHA 4CCEA 1L8NA 4RCXA 2JF7A 4WF7A 2WNNA 3TFCA 1PCKA 1W5QA 3BH4A 3WQWA 2YLAA 4A3HA 2VUYA 3NM3A 4AWEA 1LQ0A 1CWYA 3LHYA 1QI2A 5AYBA 3UWVA 2Z2UA 1H11A 5G1TA 1M7XA 3GH5A 3PBVA 1EDQA 2GJPA 1SPQA 4PCSA 4Z2IA 1PVNA 1L6YA 2ABBA 3NQEA 4GINA 3TTSA 3AIVA 3RM8A 1DQWA 3GNOA 1T99A 1HO4A 1SZFA 3VMPA 1NVMA 1W5OA 3VM5A 5LHFA 3PUDA 4PFMA 3SGUA 4BK9A 1DP0A 4HU0A 1FA2A 4GC4A 2QCDB 4N6EA 3N9KA 4AWTA 3W1AA 2D22A 1QWGA 3ZR6A 4JN6A 1O95A 1LZOA 1OX4A 3CT7A 5AYZA 1GZGA 3IAQA 3QQ1A 4AD3A 1EEPA 4JFSA 4MY9A 3EX4A 3IIOA 5I3IA 4PMQA 3GYCA 2VO5A 4CN4A 4ZZ9A 3WL0A 4JTUA 4K38A 1KLZA 4UMAA 1LLOA 4U3CA 2H90A 1X1NA 2A4AA 5D2XA 4M81A 4QNWA 4WJEA 2DIEA 3O1NA 1OFQA 3QFEA 2XWDA 1XYZA 3WH6A 4F9DA 5H91A 4I7WA 2B7OA 3T2PA 5A69A 1WP6A 3EMZA 3GM8A 3KVLA 1CBGA 2WHMA 4O12A 3MV01 3QHNA 5AOUA 2BXYA 3NCOA 3W7JA 1KGWA 4JFTA 1TPVA 2Y6ZA 4O0ZA 4HNTA 2JALA 2EPOA 1I8JA 3OIXA 5JUVA 3GXTA 3MU7A 3SEPA 4LOCA 2CBUA 4XBSA 3BG5A 2DH2A 4MOZA 3WDHA 3ABOA 4JD4A 2XIBA 1Q45A 1GW1A 3QJAA 2X05A 5H2ZA 3W4RA 1TRDA 3WNMA 3VU2A 3MHFA 4H7VA 1ITCA 2J74A 2WZHA 5LZLA 4F8XA 4NF7A 4D6DA 2WVUA 1OHLA 2UY5A 3UERA 4DQWA 1ZBKA 1FWTA 1ZL1A 4HZ6A 1EOMA 1V6YA 4YMZA 1TQJA 3PG8A 3WH8A 5CJ5A 3AMDA 1FCBA 2DORA 1TTIA 4DO5A 2V8ZA 2WW5A 5DO8A 3CLWA 1IXOA 2DPEA 1DORA 4ATLA 3HPSA 3EXRA 5I3GA 4J3SA 5HPCA 5K9DA 3LTSA 4Z2KA 3WY1A 5BXSA 3MANA 1SQ7A 3GNDA 1J4EA 2IQTA 2RH9A 4K37A 4EF9A 1W9UA 1K02A 2DSWA 4C1KA 4TTUA 3VPLA 4AZCB 3ALFA 3GB6A 5EFDA 4KMQA 4M8UA 1XXXA 2YDAA 3EX6A 4CCCA 5EFFA 4CQ8A 3VD3A 4HOWA 3NEVA 2DIJA 2X8RA 3EX1A 4M80A 3T0AA 1H7XA 2YJQA 1GORA 5M03A 1YDVA 1NWSA 3C2OA 5L9FA 1R8LA 4UTFA 1EH9A 2E68A 2NW0A 3SCNA 2I14A 2NV2A 3LIHA 2YBTA 4PTMA 2JGQA 5JBDA 1A47A 1BLIA 4C7FA 3NL3A 4BA0A 3KX6A 5HNRA 1PEZA 4RK8A 3W1LA 2ISSA 2G97A 3M6DA 3DYOA 1RH9A 2DZUA 1C8QA 4RXFA 4GWEA 2A0NA 2QCHA 4NZJA 3W7CA 1H2JA 3MO4A 2XWEA 2J77A 3U14A 2EF9A 1V6UA 1VH7A 2QUTA 3C4UA 2GJXB 2VZUA 3WD2A 3CIXA 1VB9A 4GZJA 1G9HA 2A2IA 3LHUA 5HMSA 2QCEA 1HL9A 1V3IA 1YDNA 2D23A 4X9SA 2UV8G 5A2AA 2VFHA 4V28A 3FNDA 3LXAA 2XHYA 1UH2A 2C15A 2CBVA 1ZAJA 4Z2LA 1QHPA 1E3XA 1TPC1 3PG9A 3CIVA 3I7QA 4BI7A 1CXLA 2ZXBA 5CSSA 3IIZA 1DJNA 4UMBA 1VR6A 1XBYA 4NZFA 1J0HA 5CGMA 2W62A 3LCHA 3NQ6A 1TCMA 1AK5A 2TSYA 5HQEA 3D3AA 1TA3B 1M53A 3S6DA 3EMCA 1WXJA 1PX4A 4UNIA 3PIJA 4QIUA 1TO3A 2JE8A 4LGXA 3CHCA 1WDWA 3W7QA 3QSTA 1QNQA 5G4EA 1TSIA 1GHRA 2A3CA 2EXOA 2WBGA 1BGGA 4L4OA 3QMRA 3QOMA 4E8DA 1B3VA 4HOXA 4J3VA 1UHVA 4IGHA 2Z6IA 4JX6A 1I2RA 4N9CA 5HOSA 3PUOA 2E40A 4HSNA 2EPLX 4O13A 1U30A 1IIHA 2ZRWA 1EIBA 2Q3RA 2OLHA 5HBFA 3ZFHA 3MI2A 4DUVA 1W54A 2GJLA 2AMGA 3WFLA 4JCMA 2Y62A 2QAPA 3F5KA 1JI2A 4M1RA 3CPUA 4LYQA 4D6FA 1P0NA 4Q32A 3TAOA 1KWKA 1UWSA 4O4WA 1RP9A 4PMDA 3LCLA 3G1AA 4G1KA 3B06A 1F7BA 3PZGA 1IZJA 3W37A 1VEPA 3UWZA 1KM3A 1EIXA 3WJYA 4BQ3A 3DYPA 2E6AA 1OGSA 1JNDA 1B2YA 1BYCA 2UWFA 2WHKA 3CUIA 4Q4KA 4HPXA 3IK2A 4MNJA 1WYIA 2ZOXA 2J78A 5D4YA 3TTOA 1UH3A 1QR7A 1JF5A 4AZCA 3TU9A 3W2NA 2YL9A 4Y9AA 3VD5A 1XL9A 1DJQA 4TIMA 2D2OA 3W0KA 4MDPA 4UQDA 3VVGA 1O5KA 2CLLA 2ZZ4A 3MYOA 4MZYA 4AW7A 1ESWA 4XX6A 3S5QA 1JUKA 3WF3A 4O53A 1CGXA 2ZX5A 5FF7A 3VGBA 1A3HA 2FB2A 2QJGA 4EAMA 1MQRA 1GZJA 2PCQA 4ZQRA 2CZDA 4UOJA 2AC1A 1QOPA 1JXJA 3AIUA 2Y61A 1ICPA 4NT0A 2QMJA 1KGXA 1ZJBA 2OT1A 4IOTA 1H7RA 4D6HA 5ABFB 5FL1A 3AO0A 2VFEA 4GPNA 7CGTA 2ZZ1A 1GHSA 4XUYA 1XBXA 4RE3A 1HKJA 5F4SA 5HR7A 2WSKA 5FL0A 2GJXA 4NUWA 5D9MA 3WD4A 4MPKA 3FLUA 5A6KA 3KF3A 4LVBA 1UZ4A 3QOKA 3CZJA 4H41A 5FIPA 4MZ1A 2NXIA 3R12A 5AY7A 4AMAA 5GNZA 4AHQA 3TOPA 4IPNB 3HB9A 1ODZA 3IJ7A 3WBAA 1K7XA 4AISA 2C18A 2ATSA 4M6VA 1ZHAA 2V0TA 2Y2WA 1FDZA 3WH5A 3M6YA 4MDOA 3H54A 5BW6A 1JD9A 2NXGA 4WKHA 4AD0A 1GPWA 2B0MA 2X1TA 3OVQA 5FEPA 2ZZ3A 2E8YA 3EWWA 1FWRA 2O7SA 2X1UA 1UKOA 2G3MA 3D5HA 4DWSD 2JEQA 4GI6A 3GDMA 1TA3A 1JZ5A 4FB7A 3G1SA 1K8XA 4YHEA 4AZBA 1F73A 3W76A 4DEFA 3WD1A 1HN1A 1JGIA 1CXIA 3KVKA 1LL6A 3L21A 3BGGA 2WQPA 4I7VA 4JTSA 5K9CA 2C13A 4BI6A 2VX5A 4DWSB 1B3YA 2NWSA 1OYBA 3THCA 3F4VA 4LRTA 3EDJA 3CZEA 1W31A 2J8GA 2E9BA 2GPTA 1YHTA 3K8KA 3EWZA 3L67A 4LT9A 1I1XA 1DWJM 2BHYA 2BVDA 2PRLA 3IANA 1QCWA 4UZSA 1SUXA 4P7RA 3T2QA 3VDBA 2CHOA 3VIJA 3LI0A 5DY2A 2GDUA 4P8UA 5IXEA 3TTYA 3POCA 3AJ7A 1NP2A 1P1XA 5JIPA 1ZS2A 1TPUA 3NQDA 3K30A 2O9RA 3WDJA 1Y9MA 4A2RA 3N18A 4UQEA 2WCSA 3A4WA 4CN1A 3BPWA 3ZM8A 3CZGA 4XZBA 4D6CA 3VD7A 1NSJA 4FF7A 3TROA 5DY3A 1C3FA 2WNWA 3PVFA 1HKKA 2Z1SA 2ZIDA 2YFNA 3BVJA 2VR5A 3VTRA 2HTMA 3HGRA 3CMGA 3ZR5A 4TVDA 3M07A 1NFBA 4TX8A 3GXNA 2PWHA 2J75A 1W1YA 5FCZA 1VCGA 2J7CA 1Q6OA 2ZX7A 4PMOA 4W9TA 4CD8A 4Y7EA 4WKFA 4ZFMA 3W1MA 3TR2A 1DHPA 2E6YA 3DI1A 5A6JA 4PTNA 1XSIA 2A21A 3BG9A 2DT3A 4KFOA 4WUIA 1V6WA 2GOUA 4W7UA 2DZSA 4PODA 1JYWA 4WK9A 4O1DA 3BAWA 3L5MA 3TONA 1HJVA 3TSBA 3T4CA 4LC8A 5FF3A 1YYAA 1MXSA 3BARA 3VM7A 1QOQA 3DU0A 3WF2A 2CETA 5CPTA 3TK7A 1YPIA 3RK8A 2O9TA 4PSPA 2XVNA 5ABFA 4LC6A 3FYOA 1OFOA 1JQXA 5LHEA 4TUFA 1RVGA 1QBAA 4N6FA 1E4MM 1Z32X 2X16A 3T55A 4LV9A 4AIOA 2V3EA 2WM0A 4W93A 3HPZA 1UOKA 4HA3A 1ZJAA 3BMWA 1YXCA 1SSGA 4UR9A 4QAWA 3JUGA 3TW7A 1CGVA 3HN3A 3RJXA 1ME9A 3U7BA 1KLYA 2Q8LA 2W92A 1W5MA 2RHGA 2DZXA 3CB8A 3EKZA 1NF0A 5CZJA 1MW0A 1MW1A 4W89A 4ZEPA 4ZQOA 3CZKA 3CEUA 2PC8A 2WMKA 2J27A 4XZWA 2ZUMA 1AQ0A 1KM6A 4J3XA 2XUCA 4L4PA 3R2GA 2W6RA 1EXPA 3FFSA 1AL7A 3NPVA 3SR7A 2Q8XA 5E70A 4CN6A 4KFNA 1D3CA 1B30A 4AIEA 1UH4A 1JFHA 5DBTA 2E5BA 2QAFA 1ISXA 1R2TA 1XDLA 2C1HA 1UKTA 3O8AA 3TQ0A 3W1PA 1O60A 2BY0A 3EMQA 3BK0A 4WXZA 3W7RA 2YDQA 3DFNA 3BC9A 3RU6A 1JCYA 4DWSA 5I0DA 2OSWA 3OZPA 4QHZA 1MEIA 4HPGA 1JYNA 2J25A 5ECUA 2VC9A 2RDWA 2QF7A 1EGZA 3S1VA 5A94A 3GVGA 3W7HA 1ISWA 1JYXA 3UD6A 2JKPA 2H3BA 1I45A 4JTTA 2CITA 2WZIA 1W2TA 5FF0A 1I75A 3A4XA 3NL5A 1K7FA 3OA5A 5AC4A 5BCAA 3ARUA 4UTTA 4JTEA 2FQIA 4UIOA 3PB2A 3UY8A 1JDCA 1S46A 1W9XA 2E0PA 3LHWA 4DXVA 3GXDA 5FI8A 1LP6A 1XV8A 2OYMA 2XVLA 4QLJA 3EX3A 2P0OA 2NT1A 4BZYA 3F03K 5F4WA 1EO5A 2G4FA 5C70A 3W7IA 3EKLA 2EJ1A 5CPLA 3I6RA 2GJNA 1C90A 1W3IA 4JTIA 5AC6A 4MB1A 1VZWA 1VYSX 1E71M 1TVNA 2XVPA 4PCFA 3IIXA 1F4HA 2YDSA 4B5NA 4OBRA 1TMHA 4ONVA 5HUPA 3AIQA 5BXPA 3ZQ9A 3N9RA 1OVDA 2GUYA 3SSJA 1E1FA 3S9YA 4J28A 3VIPA 3M41A 3VCRA 1GVFA 3WDPP 3CUGA 2DT2A 3WN6A 3MWAA 4O57A 3BLEA 1C8XA 2QHAA 3UCQA 2Z6JA 3V1PA 1XHGA 3LI1A 1ZALA 4IUOA 1KTCA 2HISA 3PC0A 2WJZA 1G4EA 3THQA 1WZLA 3O16A 4OT7A 1FP9A 1JCMP 2PBOA 4IWWA 3G1HA 1UA7A 3I3EA 4FXSA 4S2CA 3L2MA 1OX6A 1GVIA 1OIFA 2DH3A 4AEOA 1VPXA 2VXNA 2G3IA 4AYSA 3TA6A 1UASA 4AXKA 1G67A 3ZIZA 3VDHA 2C14A 3WD0A 2FPYA 4HZ8A 2XPKA 2CW6A 4W8BA 3LTPA 3PAJA 3NOEA 1EDGA 5K4XA 2Y8KA 3M47A 3GK0A 1W9PA 2B31A 1L9WA 1B3XA 4E2BA 4ALDA 1V3MA 5EMUA 2GVYA 3NDZA 3RLUA 2V82A 2JIWA 3MI6A 3O9NA 2X1SA 3OGVA 1QFEA 1OM0A 2JBMA 1JZ4A 3C2EA 2VX6A 5TIMA 4NNCA 3WJSA 1UQYA 1EHAA 2AEYA 3FYPA 4Z1CA 1UD4A 3A4AA 1F5ZA 4FLSA 2ZXDA 2J9YA 1H7OA 4LUJA 5FK7A 3BSHA 1BF2A 3AMCA 3NL6A 3O6CA 4ZE4A 4YPJA 3HMCA 1ZBWA 1JZ6A 2QLYA 1LRQA 4Z1DA 1UYPA 2WMFA 2GVGA 2XFFA 3G18A 4O4VA 4U28A 2QMKA 4Z1BA 1EQCA 4ZQNA 2E5CA 1EHNA 1M6JA 2PF0A 3WDIA 1NH6A 4O50A 1HP4A 2Y7EA 1MVYA 3AI0A 1E6RA 2E1DA 1UJPA 3M5XA 4NNBA 1LCOA 1PJ9A 1ZENA 2VELA 1W9VA 2YBUA 2Y7FA 3W71A 3ARZA 2X09A 2VRKA 1ME7A 3OBKA 3KF5A 3R5EA 4QQ3A 3W74A 1WNOA 4FMVA 5D2TA 4BF9A 5CSUA 4NJJA 3S5NA 4P8VA 4WJXA 2CFFA 3LHTA 3ZOAA 2ISWA 4DPPA 3N04A 2OYLA 4YLWA 4FNSA 1V0LA 4K68A 2BFGA 1OYCA 4JGDA 3UWYA 2VKZG 6A3HA 3ZSTA 3GLCA 3G0SA 1T0OA 3OG3A 4JYEA 4O15A 1BYAA 4W84A 2QUUA 4YN5A 5I6SA 3A47A 2BXVA 2WCGA 4HMEA 5AHIA 1JD7A 3NDYA 1XSJA 3M43A 1J11A 3W2LA 4JDYA 2WSQA 2VT0A 4XQ6A 2PE4A 2YL8A 4BS0A 1JRBA 2ZDRA 1SZNA 4LS2A 4EVZA 2J7DA 3AIBA 4RLIA 1NQ6A 3E0IA 1KA9F 4D1JA 5LNWA 3GDKA 1F05A 4GZIA 4IMEA 4N42A 1E9LA 3N9SA 4Z2HA 3OSDA 2AQWA 3QMTA 1H4PA 4I7UA 2BTMA 3KAOA 3W83A 1TR1A 2A5HA 1CGUA 3GNPA 3LPOA 3IAPA 3VGFA 4O10A 4UCFA 1SW3A 5F2GA 1VQTA 4JIQA 3VMNA 1X6LA 1KBIA 4YCOA 1NAL1 4KGLA 2FPTA 4ACZB 1ZBVA 2C3ZA 3W28A 1ZBCA 3TUUA 2QR6A 3HGSA 4C7DA 3TJXA 4MNLA 2V2CA 3B04A 1CXEA 3G3DA 3FN9A 3W2UA 3EXTA 2GSJA 1OD0A 3AHXA 4AD4A 3L9CA 4ATWA 4ADUA 1CENA 3U5UA 3NYDA 1PHWA 1R86A 5KSWA 1UD2A 4PYSA 1OJXA 1RR2A 3TA9A 4E0CA 1B90A 1AG1O 1FUYA 5F4XA 3WK3A 1C8VA 2ABAA 4FXRA 5TBOA 3APGA 3KRUA 1WDPA 5E0CA 4UQAA 1EUNA 1TTPA 5LNVA 1NOUA 1TPDA 3WFZA 4JICA 5IM51 3QQ0A 5G2IA 4W88A 5D2VA 5FKCA 2WHLA 1OFBA 3UETA 4FFGA 1Q6EA 1XC6A 4LY8A 2C0AA 2J6XA 1KBBA 1HKIA 1GOOA 1QW9A 1U83A 3PM6A 1V0KA 3WL1A 4WD0A 1LYXA 1CXFA 4J27A 2B7QA 3LHZA 4E2DA 5A3HA 4PH6A 1IV8A 4NQ1A 4MPQA 4X0VA 4FX8A 2FLIA 3K46A 1YTEA 1HG3A 4FNQA 2ZWYA 4GUFA 1B9ZA 3W81A 2RDTA 3OLGA 4P61A 3DKJA 1C7SA 3DH7A 4JTGA 5D32A 3WQ4A 4X3ZA 3L66A 1JAEA 1SMAA 3NO5A 5K9XA 2CLKA 1BAGA 3L4TA 5IBXC 2GQ9A 3H3LA 1TTQA 2GUUA 5CLTA 3CEPA 5E0FA 3SCSA 3AMLA 3IIPA 1EA0A 4Q7NA 2VC6A 1E5NA 3PWAA 3WD3A 4AZGA 1LG2A 1IZKA 1QPRA 2E77A 3HG4A 1ISYA 3BAYA 5DELA 4W85A 5BRQA 1K6AA 1E3ZA 4RL3A 1VRDA 3QH2A 5DBUA 1GOKA 1P0KA 3DBPA 2ZX8A 3WNOA 2JFEX 4O54A 3RCNA 5E0KA 4ZL1A 4R33A 1EWDA 1FXQA 4N4PA 1EOKA 1R85A 2C7FA 1U2YA 2J47A 2Y4SA 3CBWA 3EWXA 2DQXA 2H6RA 1FX6A 4RE4A 2UY2A 3QF0A 1R87A 3M5VA 2PWGA 1V3KA 2WC7A 5KEZA 2GQ8A 3TFXA 3M9YA 4HN4A 2W66A 4M56A 2D1ZA 5E6ZA 3WH9A 2CZEA 1H50A 4A2SA 3N12A 1QI4A 3P8IA 4WY0B 5D9OA 2OXBA 1QPOA 2NX1A 3Q2DA 3HMJG 1K3UA 1E40A 2XFRA 2XGBA 3VILA 4WY0F 5A5WA 2F8QA 4ORMA 3L4XA 5BMWA 3IJ9A 3V75A 2ZRYA 3QM3A 4NXSA 4TX9A 5DCDA 4FLOA 2YCEA 5BXRA
chains in the Genus database with same CATH superfamily
4XJWA 1UIPA 2R071 4AD1A 2Y6KA 2VUJA 3BN6A 2AQOA 3U2EA 1L2UA 3N2MA 4HHPA 1SR9A 3UYJA 5C71A 3II1A 4AG0A 1W6OA 1TPEA 4US6A 1NOWA 1Q6QA 2QDHA 3VKKA 4PMZA 4F9JA 2E51A 5DLCA 3KL3A 5DX7A 2ES3A 3AMQA 1LRHA 1GQIA 1ZM1A 1TR9A 5DCBA 3UFYA 4B3LA 4H14A 4KESA 4NZ1A 3W1TA 2VCMA 5BNOA 3DUGA 3OG2A 3L2LA 3JB4C 2HS6A 4TX6A 1B35C 2ISDA 4WSHA 3CHDA 4PTWA 1LCLA 3WNPA 3UWUA 2B7PA 5CZTA 1C9DA 1PIFA 4CDQC 1IGSA 3MIHA 3UJFA 4B15A 3OZOA 3HGJA 4XUPA 2FDSA 2VM9A 5A6LA 4MVAA 2D0HA 4PMRA 1SVDA 3CMJA 2R041 1RJ8A 4NN0A 1LBLA 1Y4WA 2ZZQA 1YFWA 3L65A 4EQVA 1R091 1DYOA 4DVOA 1HVQA 3FYYA 1CLVA 3C7GA 3W7NA 3VDCA 3POSA 1NY72 3H7YA 4Q0PA 1W1ZA 1AXKA 3M7AA 2E33A 3NZQA 5ECVA 1UG6A 1IEIA 4UBPC 5C7GA 1SBEA 4OVEA 5JIUA 3E0VA 1GQLA 2PP1A 5ANNA 1O5LA 3CWNA 1I2OA 1JAKA 4L4MA 4IDZA 3PPGA 4GBDA 3ZSSA 3PURA 4L61A 2ID4A 4IERA 2A1XA 4GB32 1GKPA 3GX9A 3W87A 4DO7A 2V69A 1UYQA 1B31A 1RB8G 1P7TB 4JHOA 5JBEA 1XFBA 1OK4A 3R11A 1BZWA 2IPJA 1XPWA 2G0WA 3MKCA 4HNCA 4WY0A 2RS33 3HQRA 4PZVA 2ZX6A 4MUZA 2C0HA 1S0JA 4BXFA 3SGGA 4QJ4B 3LXCA 3W7MA 1CW2A 4HU8A 1UCXA 4HANA 2JK2A 1JHJA 3WLMA 2C6QA 2XSAA 4RE2A 3SSZA 4H8HA 3OJGA 3QY7A 1UMLA 1TEIA 1ZZ6A 4LHNA 3MI3A 3LMYA 4DJED 9XIAA 3FW6A 5JMUA 1HXS1 4IJRA 4YVWA 5LIUX 1FPN1 3MY9A 2J7HA 1I2PA 1QXPA 2PDHA 2XJSA 4JGYB 3LB9A 3Q65A 3IJ8A 5FLJA 3UQNA 2PHWA 4CDWC 3AAMA 1L6FA 5FJRA 1XU1A 4XCAA 5A2CA 2A1YA 1M04A 3I2KA 1FWWA 1TUXA 1RUJ2 1UQZA 4J1OA 2Y8VA 1WDQA 4Q8KA 5FEXA 2A6LA 3M3CA 3DC0A 4Y5TA 3H21A 1V70A 4F7ZA 5I77A 1UR3M 5LYRA 3QYQA 1OUSA 3C7OA 3QSRA 2NUWA 4NJIA 1UD6A 3W72A 3CYJA 1W9BM 3PN8A 3IDCB 1JDFA 4PA8A 1MW3A 4JAWA 3AXXA 1S1PA 4GKLA 2V73A 5D30A 1KCLA 2J7BA 2AGKA 3VX1A 4LR4A 1ICSA 1LRNA 4NROA 4NSBA 1JYTA 3RRXA 2FTPA 3TR9A 2D2GA 3CC1A 1H62A 1PK6B 3WCSA 4Z17A 2EG8A 1QJU3 3UYCA 2WNVA 4AD3A 3VBRB 5ABTA 2E6VA 1VRH1 5F3EA 4HVXA 4HVRA 2ZBJA 3T8LA 1V79A 4AOCA 2FHBA 4RNHA 3W6LA 2VVEA 3T44A 2ZVIA 4RKAA 1PTGA 3GC5A 4FPJA 1UWRA 3LCIA 5IOBA 1J0JA 4XD6A 4XD4A 1RA5A 3CU2A 3IRDA 3RILA 2R6QA 3ABSA 3MW7A 4LULA 1RXGA 3P7YA 1RXOB 1FV2A 1W3TA 4LO5B 1QBBA 3RX2A 1BMV1 5FFOC 1IKQA 1T6MA 3RM4A 3ILNA 1ZNPA 3AICA 3FCPA 4KCWA 3QR3A 4IE6A 1QKQA 1UB3A 4HNUA 4MZ8A 1US3A 4YZ2A 1GPFA 4CU8A 4DPNA 2O1QA 1AYM1 3GZTB 1GVYA 3VZOA 5JZGA 4CCZA 1ISZA 2YIHA 4YWSA 1RZMA 1VBHA 4RDZA 3VBUA 1U5YA 2XHNA 3H1WA 2GK1A 4W8LA 3MSGA 2WLYA 2CLFA 2CYGA 3TC7A 3R4DB 1VP5A 4DM1A 3OZYA 5EJZB 2QS8A 4INFA 4IE7A 1WDSA 3C3UA 3S5ZA 3ZYIB 4FFHA 4ZOCA 4HNOA 4D71A 2UU8A 1VLWA 1GQNA 5FEZA 4JHZA 3LDVA 3CH9A 1S5MA 1PVC2 1EQPA 4I9MA 1XC4A 2A73B 4IF2A 2HBVA 1CIYA 4GH4C 3VYLA 1NEYA 5F37A 3C61A 5ACA2 4M29A 1W1IE 3MMTA 2P3EA 2BP6A 1ZRIA 4HXCA 3VZNA 1Z44A 1JHNA 1X98A 2PS2A 4MB3A 1AL22 1LU1A 2JIEA 4Q8UA 4TVCA 1CAUB 2Z0IA 4QM8A 2G96A 4YVXA 2C1FA 3J7LA 1US0A 4ZS2A 4C1XA 1Q8SA 4GWIA 2W0XA 2XHKA 2ZGQA 2J24A 1FI2A 5HV4A 4GO9A 5CB7A 1J93A 1SSDA 4KQNA 1AYN2 1E6PA 3CKHA 1FCQA 5FWEA 1EBGA 3G1VA 1KGUA 3QHOA 5L36A 1STMA 4UAPA 1RA0A 3OEBA 5EFUA 3LSCA 4CD7A 3TJIA 1WMEA 3U2OA 4N4QA 3BDKA 4XF9A 1DTUA 1J3PA 4V1PA 3BIEA 1HRI2 2YW4A 3WJZA 3GR7A 3ARPA 4KIRA 4DN1A 2QYGA 1W39A 4E2OA 1H61A 4GNJA 1ST8A 3AS1A 3M70A 4XXAA 3UK9A 3TQVA 3WLPA 3ACIA 2I5GA 1KXQA 5F9TA 2H9AA 3FAXA 4HKPA 3IUHA 5U7SA 4MVTA 1ONAA 3R4IA 5DCEA 3TDFA 3ILRA 3KZPA 1S5VA 3SCFA 3BODA 2CCRA 1EC7A 4LXFA 1Q85A 2YR1A 2PC4A 1BVVA 3N15A 4KRUA 3S83A 2ZX2A 3AMMA 1JG9A 2ADDA 1NM9A 4IG2B 2YU1A 3DL3A 3GC2A 2G8ZA 2DBIA 3RDIA 4FPKA 2GOKA 4PIZA 3ABQA 4COYA 2IXKA 2ZA3A 4YFZA 3D0SA 3NXFA 5B7YA 3AS0A 5FO9B 4META 1G7VA 1TVPA 5FTTC 2VRQA 2VDIA 1E4LA 4MGKE 3ATGA 3WNLA 1I6XA 1DLLA 2FHRA 4QHOA 1ENSA 2YZRA 3NDOA 5E09A 2BY1A 1XNDA 1UY4A 4OMDA 3MF9A 1QRQA 1RBOB 4AHYA 1G1YA 2DUQA 3E5XA 1AMKA 1OT1A 1OC5A 2GFTA 2P8BA 5M1TA 1NKGA 4YZ5A 3BO9A 3DC8A 2P0IA 2WV8A 4QM1A 2XM2A 3D47A 3IDAA 2AGTA 4AY1A 4XJUA 3LA7A 3IMNA 2ZEWA 3INAA 1QJX2 2VPVA 1PO23 3RMXA 3M0ZA 5KINA 4MLJA 2R062 1RUOA 1RUF3 2CLEA 2P3JA 3T4VA 3AYTA 4AEMA 2Y1HA 4Q4MA 4EN7B 5AYYA 2VFDA 1W6TA 3N2CA 4CKQA 3S1XA 1F76A 4KU7A 3WCZA 2D5HA 2ZKMX 1GNXA 4A3UA 4I30A 3ABXA 3LCFA 3Q4DA 2UYBA 1AZ1A 1MDRA 3W7PA 4CXXA 1HJUA 4QFUA 3O0KA 3AQUA 4CQ9A 2HWB2 4TVUA 3PHAA 1KV8A 2F61A 2NSXA 5I2UA 4BIFA 4DXTA 4LU0A 3L9JT 2YGLA 1XSRA 1W2VA 2XFWA 1CYGA 4RHV1 4IPIA 2R1PA 2QEZA 2PBGA 3S3GA 4LUKA 2OWCA 5FY9A 3BTYA 3NTYA 2I7GA 1T96A 4YSFA 3L12A 4O1AA 1Y9GA 5LNUA 4MZUA 1SFJA 3FSUA 3EWBX 1F3WA 5B7ZA 4C60A 3A9IA 3B3QE 3Q58A 1HB1A 2YA2A 4RR4A 2V3FA 1H49A 1E5RA 3OBEA 4ZXLA 4LBRA 3MKKA 1GLHA 2WAOA 1QATA 2REQB 1OUXA 2RG4A 2BVYA 3CUHA 1FQ0A 2DUXA 1XLCA 3G8EA 3L4ZA 1QO2A 2J1UA 3LGEA 4CCMA 2BHUA 1Q6FA 4FP3A 3DAQA 3PTQA 5A3MA 4QDMA 5IRPA 1V6MA 2WM1A 3H7RA 5AC7A 1V6TA 2VQTA 1DWFM 3H8XA 2I9EA 4EN0A 2VX4A 5DAXA 1BBT1 3ZVIA 2QTWB 3IGXA 4HU4A 1N1SA 2R14A 4UTKA 5FQ0A 1KBJA 3RNDA 3BU7A 3IKWA 1CGWA 2J6VA 3MSRA 3OQEA 4QAIA 2VRJA 3M7WA 1YQ8A 4K8EA 5LA2A 1K9EA 3P5BA 3OA3A 1XQNA 1XH1A 1H2KA 4D8AA 4NIGA 1H7NA 2W95A 4ZBCA 1FH8A 4G1NA 1O8PA 5FPLA 4H19A 4JL1A 6ALDA 1DHKA 3VKJA 3WG1A 1VMJA 1A50A 1X9PA 4COWA 4LUTB 5FJKA 5FY7A 3KDOA 3AIEA 1JCNA 3KOXA 3S6TA 1XRVA 3JS3A 3GGLA 4QQ2A 2PWFA 4ZZ5A 2JDZA 3VNZA 2PTZA 1OXCA 2GGJA 1DOSA 5FZBA 1P1MA 1KM4A 3VBOB 3CAVA 3IIIA 3C2FA 5C9AB 5GJ6A 1DYPA 1RCXB 4R8HA 4EK7A 3VGEA 4Y20B 2E5DA 1SJAA 4JIIX 5H6HA 2E31A 1K9TA 3KT1A 4NL1A 2V9DA 3W86A 1S5WA 2Z1VA 1PO13 5FOJB 5C7VA 3AYAA 4NRSA 4MXWB 1H9WA 3O0VA 4NZ3A 4MUPA 4E8CA 4QCEA 3PZQA 1WCUA 1GOHA 1UOZA 3W29A 5E9AA 1OWQA 1PZ0A 1LTDA 3L2YA 2BGOA 5IVYA 3N19B 4LYRA 4B3KA 3UJSA 2P1FA 1K4GA 5FZMA 4HHLA 5K0UA 1RUD2 4MWAA 1ALYA 1JEZA 2VG9A 3I4IA 3AZTA 3UESA 5CPQA 3UG3A 2J8FA 3PUEA 2WDBA 4OGZA 3AUJA 3MVTA 2IW0A 4MJ2A 1XJBA 3VCNA 3MLLA 2W79A 1HKDA 4GAZA 5IHRA 3S0MA 4CVWA 4PBEA 3BOXA 1OG6A 2JDAA 1VS1A 4TSVA 3A3XA 1TPB1 1ENXA 3EWYA 1QK2A 1KM5A 4PTVA 4PTDA 5BMXA 3I6EA 1UPSA 1B4KA 2CL2A 1P0EA 5KXEA 2VP8A 1E6ZA 2RDNA 3WT3A 2VGIA 3GCWA 1HUVA 4AR2A 3SJNA 4MGYE 2OEMA 3N2TA 3W9ZA 2Z29A 1KXVA 2D6NA 4JGZC 4NJGA 2TMDA 1J10A 4NPLA 3PVBB 4DPQA 5CPSA 4QQOA 1XG4A 2XBO2 2E7QA 4RE0A 4W87A 4EE9A 4XKYA 4XDOA 1UBSA 3WP5A 2POZA 3LRLA 2CAVA 4XZHA 4GKTA 4O52A 4K6AA 1D3GA 2ZUTA 3AZXA 1Q6DA 2Z7KA 1QNYA 2ISVA 4JTLA 4FXKB 4B8EA 1G01A 3VDAA 1JOBA 2DSVA 3NNTA 3JD73 3GBGA 5FBJA 2A3HA 1YFXA 3WV6A 3OUJA 2DGAA 1B57A 4B2DD 4X6QB 1ND2B 2O55A 5DMMA 3QH7A 1XD0A 3U4AA 3VBSA 2Y0FA 3G1YA 1YXDA 4ENLA 3BJFA 5F7UA 1FH7A 2RS11 5T5LA 2VEMA 1PO21 2A79A 4J3ZA 3ZLHA 4DB5A 3VKLA 5JSRA 4A8IA 3U75A 1QDOA 3TWAA 5D2WA 1M5WA 4MY1A 5A8OA 1DGRN 1CPUA 3KTSA 3ZT6A 4AL9A 4F40A 5CKSA 4IJBA 2X2GA 1MXGA 2Q0AA 3LDRA 5CEWA 1Q4NX 4H2CA 1BK1A 4D7YA 4LY4A 1VCFA 3DUIA 1SJDA 4LAZA 3H8OA 2HWD3 3W7GA 2QDNA 3SN1A 5CAKA 1T2XA 2QQUA 2Y6LA 3C56A 1UZVA 3O1OA 2GGIA 4GNKB 4QE5A 3T40A 5HCAA 4YW7A 1S2TA 2QV4A 3VABA 4TQTA 1V51A 3AALA 3NVTA 1CEOA 3D6EA 2YFOA 2DTYA 4OKDA 1XB9A 1WAWA 2W94A 1FBAA 3BTXA 5CG7A 3NM1A 3AHZA 5CPMA 5HJXA 3IM0A 2R94A 1CX9A 4Q2FA 1PSCA 2GNDA 4Q4V3 4HK8A 5CPNA 3KT7A 1DIOA 1Q6CA 3AS2A 1W8SA 3SUUA 3VOCA 2BGQA 2A85A 2WSPA 4HGXA 4LHLA 1HV0A 5TQLA 4RNJA 3W2KA 1DE6A 1UW8A 3GDLA 1XYBA 4Y96A 4ZO9A 1O4TA 1S0BA 4OVXA 2Y26A 3FJLA 1RQHA 1OOPA 1XYFA 4AZ7A 5DAVA 1V3HA 2JB4A 4O1CA 2E53A 2ZGRA 1H0IA 1DIWA 1HW5A 3ZSMA 4Y4RA 3N29A 4F79A 4UFLA 5DXXA 3FZ3A 3UPBA 3H2AA 4UBHA 1G9AA 4LBNA 3NNMA 3GNRA 4HMCA 5A32B 3TX9A 3LOBA 1KFEA 3B03A 1ONXA 2YGMA 3SQOA 3UV9A 4FT8A 1HIXA 4MYAA 3T78A 3M16A 3ICJA 3SQMA 1SZRA 1QK0A 1A5CA 4MKNA 5FJOA 1G0CA 1MZRA 3FE5A 1V7AA 1V03A 1VJ2A 2JXAA 2ILMA 4XAFA 3AHYA 1DXEA 3P60A 1GZTA 1O59A 4BR1A 3UJEA 1QO5A 3HQNA 3C7EA 4KRTA 2OJPA 2OO0A 2FZBA 4P02B 3HWJA 2BS9A 3MYPA 3PZIA 1BK0A 2CXGA 3ZS4A 3Q8CA 3GFYA 2EPMX 5HCFA 3JRKA 4RUBA 1NP0A 6CGTA 2JG9A 4Q8NA 1AQMA 1TZ9A 2G41A 2OTDA 1PO11 3VINA 1H7PA 3HBKA 4CEYB 4IEPA 1HNYA 1NDZA 4K7VA 1CAWA 3MIDA 4AGRA 1Q65A 2X0HA 4KH2A 4LAUA 2Z79A 4GJIA 2TUNA 3NVCA 3IVUA 2NV1A 1AR83 1EJUC 4JX4A 2HBTA 4DZIA 1KFKA 5M17A 4JQ3A 1PGL1 4AY7A 2ZABA 2OPWA 1WXYA 1WUVA 3WF4A 1E0XA 1OZQA 2JECA 4OFCA 4PCTA 4WM7A 3SCOA 2BOJA 4HK6A 2YUEA 5H9SA 3A23A 3AMNA 3NKGA 3L5AA 5J48A 2A3LA 2ZRXA 4QR6A 5C8CC 4UW5A 3TSMA 3ZYHA 3I3DA 2INFA 2VMCA 3LA2A 1A5BA 4F83A 1FWCC 3ABRA 3DEMA 5T5OA 2D73A 4JL2A 1BHGA 4HT1T 3DKLA 3SCQA 3BW2A 3CT2A 3HOJA 5DABA 2Y63A 4WRHA 5LA1A 2VMDA 5FF2A 3M3QA 2WJFA 4C6IA 4D8MA 4AZZA 3ATYA 4EN9B 1SHWB 4NIIA 1RC6A 1UYYA 3GBWA 2WFPA 5FZFA 1V3JA 5GNXA 2VBPA 3F2BA 4HPHA 1XDMA 2CWMA 1K5JA 1XGEA 1XISA 3QC3A 1RV8A 1EA9C 3IACA 1HN0A 1Q8OA 4YVSC 3U4FA 2BLEA 4UOQA 3E96A 3J9SA 4BQ2A 3VE7A 4Z82A 1LL4A 4LRSA 3WDVA 5DT7A 1WLWA 2QQPA 2OOFA 3PVEA 1YTKA 3F4CA 1LJ7A 2ZHMA 5CA6A 3CHVA 4D8LA 5C5UA 1E0VA 1R64A 1MZHA 1ZB5A 1WQ5A 1PZ1A 3SI9A 2X10A 4Y3OA 1D4M2 1GTHA 5IYYA 1EC8A 3K8MA 3AL6A 4LA3A 3G5EA 4KWUA 1WXZA 4OZXA 2XM1A 1V4YA 3UKVA 1AX0A 1PHMA 3TW6A 1RUI2 5E6HA 2W4XA 2CHNA 4PC8A 3SCTA 2VH9A 4WLCA 3CIWA 1RPXA 4JTCA 3B8IA 1VGAA 3ZMRA 1TPWA 3W38A 3WQVA 4RX0A 1WBLA 3UJRA 4DIQA 3SIMA 1RXFA 3W25A 5C33A 4H9XA 3URAA 3W1NA 1DQ0A 3WLSA 1TMF3 1O5XA 5FZEA 3EJKA 1W8FA 2OX1A 2ZXAA 4OHWA 1AVBA 3QGAC 3KP0A 4PUJA 1QPNA 2HWD1 4M1BA 4HLTA 4HVOA 4GI8A 1HW6A 2G95A 5E88A 1V0NA 3NPXA 4ASTA 3K51A 3R8HA 3BTZA 2Y0IA 4IGSA 3FMGA 4J3TA 4R27A 3E38A 1K6WA 3RPMA 4XBLA 6REQA 2O9PA 2ARBA 2ZTKA 3WUBA 2RMU3 3OY8A 3QHMA 4IXXA 3AKQA 4J1XA 5E93A 5FMOS 4J5NA 4XZMX 4DBUA 4I90A 4KBZA 3O12A 1QIQA 3V0AA 5I3HA 4M5PA 3V0UA 3OEAA 3KLSA 5LY1A 2J7EA 5DZGA 4FPLA 1R081 4DEVA 1UP2A 2IKIA 2ZC1A 4KU8A 3MMUA 4L65A 5D33A 4Q4V1 3SCVA 1X6UA 1X38A 3B0XA 1VBB3 2WO5A 3DFQA 4CQCA 3MP3A 3VCCA 1BRLB 3TYUA 1ISVA 2AEZA 3AMKA 5CC3A 1S2CA 3MUY1 3TNPB 3P6LA 3IS4A 4X22A 4C7GA 3SRDA 1JPKA 3W26A 1TG7A 3CQJA 4AIBA 3V0TA 1OC1A 3WQOA 1A78A 5ABJA 4U2AA 2ZZ6A 1RUC2 5D04C 3NSNA 4KKXA 3WUEA 1RHI2 4WGHA 3G8RA 1YRRA 1GTEA 1BWKA 2VL4A 3GKFA 4ZXEA 1BVP1 3UZXA 1I2QA 2WC3A 1OLMA 1AQFA 4E2SA 1AA1B 1DJWA 2GVEA 3W1XA 5SWUA 1TE1B 1KFJA 1LORA 4O11A 3TTEA 3SW6A 4P9YA 4IM4A 5A7WA 3IGSA 1UZ1A 3QZAA 3OB8A 3T0DA 1D4VB 3GXMA 2WKKA 5I3KA 3WH7A 1QQP1 4YNIA 4ES8A 1HRV3 5FRAA 1M3UA 4FX7A 3O6DA 3KTCA 4JQTA 1WB0A 3E02A 5A3PA 3NQAA 2ZHNA 4K9SA 5CFDB 2V30A 3IB3A 1BSIA 3O07A 1NA1C 1U5IA 4IE4A 4BHYA 1Y3TA 4F2TA 5IVBA 3JR2A 3FS2A 3QXBA 4GGBA 3EQEA 4RJEA 3FX3A 4PBGA 3A5VA 4NAFA 2YB7A 1DQUA 2Y64A 4QU1A 4BPZA 4LUIA 3WSUA 2EAKA 3W75A 2YL6A 4HSJA 2JDHA 3TVAA 3RZMA 4JIEA 2J7FA 1NDYA 3THUA 4N9IA 1AR81 5HWMA 2XL7A 3ES4A 1I4NA 4Y22B 1OFPA 2DDXA 4LWWA 3UVIA 2I1OA 2D6MA 3U4XA 1BPLB 4J1WA 4UFIA 3D6NA 1VFFA 5BNQA 1EJVC 4B9YA 1Q8VA 4RQPC 4OZOA 3ES8A 1ZREA 1BQCA 3QTGA 5LZ6A 4B9ZA 4UZUA 3AP9A 2CV6A 5A3OA 2OFJA 3G2GA 2VHLA 3BE7A 1OB0A 4J3UA 1Q6LA 1J2BA 3WOGA 3PBMA 1ZZBA 1QT1A 3B8SA 1LT7A 4QX0A 2CZFA 5JMCA 1W6QA 1UAIA 1S0EA 3NO1A 2F6KA 4NU7A 3P1IA 2ZMNA 4BQWA 2Z2SB 4I0BA 2ZRZA 4HIBA 1DZQA 4LAOA 4NE9A 1J58A 2GN7A 1SU5A 2OO6A 4XTIA 1XIJA 3OTRA 3FVDA 3CNAA 4M6UA 4XF3A 1V6VA 4N43C 3GVVA 1NWRA 3G3MA 1GFF2 3GSMA 3OW1A 1LECA 4UTWA 5IHSA 1KV5A 2BDRA 4L99A 4HZMA 4WSKA 4C5ZA 2XN1A 4LOTA 5REQB 4D2JA 2V5JA 3HAGA 4W50A 1JVNA 1NY71 1UX6A 1AR62 1PAMA 2FMOA 2FJUB 2IKJA 2JKEA 3K1DA 2PA7A 5C9WA 4IIEA 2PDIA 3RM9A 2PN5A 2AUYA 3W7LA 2PWUA 1O4ZA 2VGGA 4DF2A 1XPGA 3FWEA 5D8AA 4RD7A 3WQWA 1MS8A 2XJUA 2YLAA 4P5UA 3GRIA 4A3HA 4GB31 1KS4A 2VC5A 4KCVA 2WWUA 5AYBA 2Z2UA 3UWVA 1POV0 5H9RA 3GFXA 1EDQA 2GJPA 1SPQA 4PCSA 4Z2IA 1PVNA 1L6YA 1NCRC 4MKSA 4R9OA 4L5ZA 1HO4A 2UWCA 4LF1A 3VM5A 1TMF1 5LHFA 4DY5A 4QRNA 4BK9A 4HU0A 3PPFA 4AQLA 4C6BA 4N6EA 4AWTA 3W1AA 4RL7A 2D22A 1QWGA 3ZR6A 4JN6A 1XYAA 1O95A 1G7YA 3CT7A 4DJFC 3QQ1A 5DRIA 3O7OA 2C91A 3APTA 5I91A 1PDYA 4ORFA 4JTUA 1H6XA 3JCIA 4Q3MA 1WW4A 4F2BA 4M81A 1OFQA 2VYOA 1PNGA 2IQDA 2OUHA 3ORJA 2QUMA 4Q4W2 1U0AA 4ZFCA 1EYBA 3A13A 2BXYA 3TYJA 3NCOA 4KH9A 4GKXA 1TPVA 5C3RA 2Y6ZA 3PUAA 3LS9A 1W6MA 3IT8A 1IZ3A 2CGOA 1I8JA 2VY0A 4XOGA 2QIIA 3I4KA 3SADA 2MNGA 3SEPA 2QQIA 1VBB1 4XBSA 1BEV3 3U0ZA 1X96A 3SB0A 2XIBA 4JD4A 1EL3A 3V0BB 1U1HA 2X05A 3THTA 5LIWX 4MKVA 2YPJA 2MNRA 4LUSB 3WY6A 3NZPA 1LEDA 4HJFA 1H6YA 4GIEA 1LTEA 2VAUA 4D6DA 1OT5A 3HTWA 1ZZCA 2GSHA 1FWTA 3WH8A 1V6YA 4FO9A 1IQAA 1FCBA 1TTIA 5BNNC 2WW5A 1IXOA 1FMD2 1DORA 3EXRA 4AAXA 3ZVHA 2VD7A 5K9DA 1QXRA 2IQTA 4EF9A 4C1KA 3MICA 4AZCB 3C8XA 1GVEA 1I9CB 4CQ8A 4M3CF 4OFGA 5C4WC 2DIJA 4WJ8A 5I0RA 5A1LA 4XABA 1GORA 1LB2A 1YDVA 2X5IB 5L9FA 1EJXC 3TOJA 2RR12 2E68A 3SCNA 5FREA 4E3VA 2I14A 2NV2A 3LIHA 4NHXA 2YBTA 3EA3A 3HT2A 3Q67A 1P43A 3SMHA 1A47A 2FVKA 3J7MA 4BA0A 3KX6A 3TN5A 2G97A 3M6DA 1YFYA 5LWBA 2A0NA 2QCHA 4J25A 4S2GA 1UMHA 1VB9A 4GZJA 1RJRA 4UWMA 4FOVA 2YCKX 2QCEA 4CPBD 2D23A 1YDNA 4X9SA 3U4SA 2UV8G 4V28A 1R9XA 3DKWA 3LXAA 2XHYA 1UH2A 2W1QA 1ZX5A 4EX4A 1E3XA 2VW1A 3ES1A 1G86A 1QXJA 3SM0A 1MQTC 4LA2A 4R52A 1J0HA 3LY0A 5CGMA 2W62A 5HQEA 1W04A 3S30A 3WINE 1FRBA 4MXVA 2BMBA 4UNIA 3B02A 4XDPA 1BGGA 4PR4A 1UZWA 3QOMA 3LWCA 1Y43B 4IGHA 4CXWA 3GTIA 2E40A 2EPLX 4HSNA 1UY2A 2Q3RA 5FP8A 1RHCA 1ND3B 2JDMA 2PLCA 4W4ZA 1SACA 1JI2A 1RAKA 3D4KA 1P0NA 4S3AA 2IPWA 3TAOA 1REQA 1RP9A 1A0DA 2FDGA 3G1AA 2Z69A 1F7BA 4L8QA 3PZGA 4DI8A 3UWZA 4AVTA 2XGZA 1QJY3 2P6CA 3KV6A 2HV5A 2BBVA 1CB7B 3O3RA 3FX4A 1PVC1 1B2YA 1BYCA 1XLIA 4HPXA 1WYIA 5IWFA 1UP0A 5T52A 5E16A 5ACA1 3W2NA 2WZR3 1DIDA 4G9SB 5HQMA 2OEJA 1AL21 1PZ7A 2QJJA 3HV9A 4O65A 4MDPA 4ZR8A 3VVGA 4NMIA 2ZZ4A 2CLLA 2GZWA 1FTXA 1YEYA 2GALA 1JUKA 2WZPP 4Q5OA 4EAMA 4JCKA 2PCQA 3HD8B 1AYN1 2AC1A 2Y61A 3ZFGA 2AACA 3TYZA 2LM3A 4YW4A 3NVDA 3OPWA 4LYKA 2ZZ1A 1GHSA 3U07A 3GC4A 2WS92 5FL0A 1UC5A 2W87A 3C0LA 3KF3A 1MS0A 3CZJA 4FZIA 5FZ8A 3C3VA 5AY7A 3GG0A 3WBAA 3IPVB 4AISA 2P2KA 4M6VA 2CY6A 1HRI1 2XB6C 4EROA 2QJNA 4XD3A 2Y2WA 2B0MA 5T9CE 5FEPA 4FXGB 1NQDA 2WNUB 1FWRA 2O7SA 4TV6A 2JDPA 2JEQA 5HAOA 3MPGA 4FB7A 4FBFA 1K8XA 3N4FA 1EPWA 1HN1A 1CXIA 3L21A 5FZDA 3BGGA 4BI6A 2VX5A 3THCA 4GXWA 5C0QA 3EDJA 2J1SA 2J8GA 3O1UA 2HWC2 3SH4A 1T5AA 1YHTA 3UKNA 4OHVA 2CAUA 2XISA 4NZ4A 1DWJM 1UQXA 2R82A 4GZ9A 3CB3A 4FVVA 4GVHA 1SUXA 1ULGA 1NIUA 1JPIA 5IXEA 3TTYA 3POCA 1EV13 2MEV3 3TEZA 1ZS2A