4UFLA

Mouse galactocerebrosidase complexed with deoxy-galacto-noeurostegine dgn
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
644
structure length
641
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords GALACTOCEREBROSIDASE
publication title Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
pubmed doi rcsb
source organism Mus musculus
total genus 216
structure length 641
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4uflA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4uflA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uflA01
3ECQA 1S5WA 3WEOA 4AMCA 3R89A 1G5AA 2QCCA 4D6IA 2VR4A 1FCUA 3SW6A 1TR1A 3WUGA 2BHZA 1KM1A 4TMCA 3IGXA 2PB1A 2FHCA 3B0VC 3WQ5A 2AEYA 4AZGA 5AC4A 3WJSA 1OVDA 1WQ5A 4OBSA 3NZ1A 3VD3A 1YDVA 1R87A 4XQ6A 2XYLA 4I7VA 1A50A 5I3HA 2J27A 1OK6A 2EJ1A 2A2IA 4TU1A 1VIWA 3HQ1A 2YA2A 4XBKA 1WE5A 3WY1A 4OBRA 4YXGA 1QNOA 3C6CA 3UWWA 4JKMA 3C0JA 5F1UA 3LPOA 1VEOA 1GVOA 4H4IA 4W85A 2NV2A 3W76A 1OFEA 3N2MA 1UH3A 4LGXA 1OCQA 1B2YA 5BXSA 4WY0B 5BRQA 1AW5A 1R8LA 3L4WA 3N73A 1EIBA 3VILA 1PX4A 4YHGA 4Z2JA 3H55A 3CHVA 5FF4A 1DWIM 1PV8A 5LZLA 3CLWA 1LBFA 1LBMA 3TOPA 1L6SA 5KZ6A 3QW3A 3BCFA 5L9FA 1TA3B 3FHQA 4LVDA 3SFKA 1EPXA 2BFGA 4F9DA 4WK9A 3I3DA 1TMHA 3CUHA 4MADA 2V3DA 4N0RA 2G97A 3S5ZA 3B0PA 3M43A 3AHVA 2E9LA 1TV8A 3INPA 2GQ8A 2DT2A 1V3JA 1XM3A 4GINA 2VQUA 1JYVA 5FK7A 2BSLA 3L5AA 4DO6A 2C8NA 2JE8A 1UYQA 3NJ3A 4U3CA 3NUKA 2AAMA 4DEFA 1E40A 4R33A 4JD4A 3P62A 4UUIA 1V3MA 3L2MA 4J28A 1QOXA 5HDRA 4IX0A 2FB2A 4XZ9A 3WL0A 1TRDA 4CQ8A 2QCLA 2H3BA 4UTHA 1UWQA 5I3JA 2HMCA 1CZ1A 1BWLA 3L4ZA 3PG8A 3C2RA 4DELA 5D2VA 3TSMA 4M6VA 3N17A 4AD0A 3UWYA 2VI0A 2GK1B 4HA4A 5BXTA 1UCWA 3ZR5A 3TA6A 4UOJA 5HR6A 1UWIA 5AYBA 1HKJA 1OYBA 4N6FA 1XC4A 1TVPA 2YDAA 1XKYA 4J3XA 1FCQA 1LLZA 1EA9C 1ZFJA 1AMKA 3WQ8A 2Y85A 3SCWA 4M5PA 2WNWA 1ZBKA 2W6RA 3CM4A 4NRRA 1D3CA 3GYCA 1DBTA 1PX8A 1MQRA 2A3HA 3ARPA 3N12A 3LRKA 3EMQA 1H7NA 3VGBA 4X0NA 5F2MA 4PMXA 3PZGA 2Q8ZA 3VI2A 3BSHA 3KF3A 3DH7A 3IEBA 2CKSA 3W7MA 4GZJA 2PE4A 4C7GA 4O53A 4DF2A 4W8BA 2TSYA 4BI5A 4MLRA 4UQ9A 1LLOA 3FEMA 3LTYA 4R27A 3LHYA 2C15A 2TYSA 2WMJA 1JUEA 2XFRA 3MSDA 3N13A 3TIMA 2D0FA 3LV5A 1UG6A 4MB3A 1Q6CA 2D22A 4S2CA 3G0UA 3NO5A 3WJYA 5LA0A 2CZFA 2I14A 1RVGA 4HNNA 1HVQA 2WMGA 1XUUA 3N3MA 3UG3A 3B4UA 3KVKA 2EPLX 1T96A 3WNMA 2DT1A 2ZTKA 4M1RA 1Y4WA 1C90A 5LNSA 1GOWA 2WW5A 3NPXA 4IUGA 4U4MA 3THCA 4IMGA 4JTHA 3NM3A 1QHOA 1O5KA 2OCZA 4Z1CA 2ZWYA 1AQ0A 5FF2A 1OHLA 5KMYA 2VX4A 1UR2A 3BAIA 1LL7A 4X22A 4GBUA 3LXBA 2WSQA 2PBGA 2WCGA 1TV7A 2VJXA 4XTIA 3B8DA 5D33A 5HMSA 3C61A 1UWTA 1JRBA 2FDMA 2ZA1A 1FBAA 5BRBA 2VZSA 4UQEA 2OXBA 4WUIA 1MW2A 3NSXA 1UR8A 4WIWA 4EAMA 2Z1KA 1GOKA 3ARZA 1B90A 2C1HA 1GQIA 5DXYA 4JTJA 3W1MA 2UWFA 3HG4A 1K8YA 2ABAA 1QNVA 3EX6A 3B05A 3E12A 4RE2A 1HG3A 1R2SA 3HF3A 1VF8A 5CPTA 4K8HA 4HA1A 3AHZA 3NDZA 5A8PA 3NL3A 4FXSA 3M7WA 2C7FA 4A3HA 4V28A 2DSWA 1CXFA 1M7PA 1GHRA 3A23A 1WB0A 1TMQA 4MYXA 5KZEA 2CBIA 4LOCA 2C3ZA 1R86A 1S46A 3IJ8A 2E40A 3THDA 1PHQA 1GQNA 3FYPA 4OWGA 4AEOA 5HR7A 1WPCA 3MS8A 4M7TA 4CD8A 5BWFA 2QQUA 1ZY9A 1QI5A 3N9SA 2Y63A 3SECA 1EUNA 4LW7A 4Z1DA 3E0IA 1UKSA 3ZSTA 2ZX6A 3IAQA 3A6OA 3BGGA 3JS3A 3GYEA 5D04C 2UY3A 1E6QM 5I77A 3SUWA 7TAAA 3O8AA 1IXOA 3W7NA 1MSSA 2BXZA 2CLOA 3EDJA 1JNDA 1BEUA 1ML1A 2Y70A 3G8EA 4FXRA 1BPLB 2WBGA 4W9TA 1VJIA 1E43A 3TAOA 3PR2A 3DBPA 3GIYA 1I1XA 2VT0A 2WVUA 1VLWA 1GYLA 5LNRA 1OFPA 2W5FA 4GO8A 2W67A 3WK0A 1B3WA 1B1YA 2DP3A 5D02A 1H7XA 3A22A 5DY2A 1V0LA 2RH9A 1H60A 2G8ZA 1P0KA 1BQCA 4H8HA 1XHGA 2WC4A 4NXSA 3KRSA 3N34A 1JAEA 4UOQA 4BCEA 2F84A 3TONA 2VKZG 1Q4NX 1QI3A 1NSJA 2YL8A 3W1LA 1UH4A 5BMWA 2C13A 4D71A 3G1AA 3BH4A 2X2GA 4IQLA 3PWAA 3ZFHA 4FNPA 4ADTA 3ABOA 1ME7A 3S5NA 3I3BA 5AY7A 3T7VA 5CSRA 3GAYA 3R8RA 4W7WA 1XC6A 1CLVA 1CWYA 3DGRA 5CZTA 5HINA 1Z32X 4F8XA 1ME8A 9CGTA 2VFHA 2DDXA 5DELA 1QCWA 2DZPA 1EEPA 3TUUA 4A2RA 3NQMA 2NT1A 3B9DA 4GI9A 4AD1A 1XD0A 3R5EA 4JEQA 1HO4A 1CPUA 3S5QA 1JZ5A 4JAWA 1UJPA 3GDKA 5C2XA 1JNEA 2XSBA 4FLRA 4IMFA 1U33A 5M3WA 2I9EA 2WSPA 4AD4A 4IGHA 3RJXA 2ZUTA 1CIUA 3G22A 3F5JA 4FNQA 1VS1A 3W2NA 1ZJIA 3QRHA 4R53A 1QBAA 2Y62A 4MJMA 1KR0A 4AHOA 1ZALA 3VGFA 1FHDA 2BXVA 2ZX7A 1J0JA 1I1WA 5JUVA 6CGTA 5TIMA 2FH6A 1XBVA 5EKYA 4KFOA 3ZM8A 1JJKA 2FTPA 2JGYA 4JGDA 5LHFA 2WVTA 4DUXA 1F73A 3ABQA 2CLIA 1E5JA 1W3NA 3CEUA 2WMIA 4M82A 1EH9A 4J3VA 3RILA 2ZYFA 2WC7A 1VPXA 4WY0F 3NQDA 4LUJA 3P80A 3ZWTA 1KB3A 4GQQA 1DQWA 2Z0IA 1X1OA 1JUKA 3RJYA 4UMAA 2A3CA 2CIPA 1QPNA 1HNYA 3W27A 1RQBA 2PRLA 3KVJA 1OFOA 2BHUA 4FLOA 1W31A 1Q6QA 2R14A 3IIPA 3MUZ1 1VYPX 4UFHA 2QCMA 1WCGA 1PCKA 1T99A 1EHAA 4JL2A 3G0SA 3WJZA 4ACYA 4CD7A 5KEZA 2V0TA 3PUOA 3BG9A 3G1YA 4W87A 1KWKA 3W1UA 3LHWA 1V6UA 2NT0A 1VQTA 2V5DA 4M6PA 3EYPA 1E72M 1OYAA 3NL2A 2Y4SA 4W5ZA 4IPJA 3CPUA 4UR9A 2WO5A 4V27A 3GTNA 4FFGA 2VEIA 1BG4A 1VFMA 1G1YA 4RCXA 4NJJA 1JFHA 1H63A 3IJ7A 1QNRA 2P0OA 4EVZA 1BSIA 4O1CA 1JYWA 2CXGA 3O6CA 2WBKA 3DFQA 4MOZA 5A5WA 4LRSA 3PTQA 4H8VA 1JCXA 1P1XA 3LPPA 4QLKA 1V6VA 5I3GA 3J7HA 4U2ZA 2D24A 3AICA 4AZCB 2ZUUA 2NZLA 3ANYA 3NM1A 3RDKA 1O5XA 1KV8A 4D6JA 1Y9MA 3NEVA 4K68A 5G4WA 4IMCA 4MNLA 1F4AA 2ZXAA 3VMNA 1TTJA 3SZ8A 5A69A 2A7NA 1QHZA 2J75A 4CD5A 3BLIA 1ICQA 2GVJA 4M29A 3U5UA 4EKJA 1TFVA 1IIGA 2BWGA 2Y89A 1E1EA 1W3JA 3VO0A 1UUQA 1ME9A 1OT2A 4UFIA 4UTTA 2C6QA 1C7TA 2VELA 3GKFA 3HGSA 3B9AA 4B3LA 3VNDA 3CH9A 4DBEA 2AEZA 3I3EA 2QDGA 2EPMX 3AYSA 2B4GA 3GR8A 3PBUA 1FP9A 2D23A 2H3DA 3NQ8A 2J8FA 1KGUA 4QQ3A 3AIVA 3POCA 2A3BA 3JR2A 3NQ6A 3V75A 3VKJA 2XFYA 3IV3A 2Q8XA 1TREA 3ZIZA 3HGRA 3PM6A 4O11A 3QH2A 2EXOA 1R2TA 3RM4A 4KWWA 1I75A 3VIOA 4RZ6A 8CGTA 2OSYA 3MV11 1JVNA 3M44A 1N82A 2DIJA 3A47A 1XSIA 5K2ZA 4GZEA 4PMRA 4D6EA 3SI9A 4UTMA 3G6MA 4TTUA 1G4PA 5K4XA 3S5OA 2YYUA 1BKSA 2G3IA 3M41A 5JIPA 3MBFA 3W83A 4D2JA 1Z48A 4WOQA 3YPIA 3BK0A 1KGWA 3BAYA 4GUIA 1PVNA 1LLWA 4IPIA 2LLEA 2CCRA 2A85A 4UQBA 2WHJA 3GNNA 3NL5A 2ZRXA 3GDBA 2ZZ3A 3RPMA 3KFTA 5AYYA 1H2JA 4OT7A 1PX3A 3W7HA 1H3GA 2A7PA 2V2CA 2WNNA 4H6KA 2D73A 2YBUA 1O4UA 3L4YA 3CIXA 2XJ7A 1EWDA 3GBEA 1K9DA 4NZJA 4TX9A 4UTUA 3K1DA 1YDOA 2NWSA 3PBWA 2TPSA 5CLTA 1HJXA 2VR5A 2WMHA 3PB0A 4WY0A 3W6MA 1R46A 2ZCGA 2YSWA 5BROA 1UZ1A 4M19A 1WDSA 2XM2A 1CX9A 1H62A 3AMCA 3I7RA 4NXKA 3KWXA 2D0HA 3DZ1A 3MJYA 4S1FA 5F4XA 2QUUA 1L8NA 2OJPA 4WKHA 3QHNA 5KTLA 2XUCA 5F4SA 2CU0A 2QAFA 1TA3A 4Q7NA 3UR7A 4FIRA 4ADSA 4OUEA 4W88A 5CZKA 2Y8KA 4G1KA 1SO5A 3S6TA 1IXNA 4JIPA 2CESA 1CXHA 3ARQA 2WJZA 3R13A 1RQEA 5EBUA 4X9SA 4A3YA 4BF7A 2QUTA 1F5ZA 2BX7A 4FNUA 2FQIA 1D7FA 2ZX9A 1LYXA 1H61A 2DZXA 1CGYA 2G41A 2YA0A 4GZIA 2F8QA 3GZ3A 4GE8A 5FOOA 1EDTA 2ZZ6A 3C8FA 4LS1A 4LV9A 2WLYA 1UA7A 4P8WA 2F7FA 3AMKA 3ARWA 3TK7A 3OGSA 4MPKA 3HGJA 1GOXA 1KFJA 1S5VA 3KXQA 4BWLA 3CHEA 1QW8A 3WFAA 5CG0A 4A22A 1XGZA 1NOUA 1W54A 4RJEA 1TZ7A 4QP0A 3UGHA 1NVMA 4JHOA 4PEEA 1ISYA 2GK1A 1YTEA 1OBAA 3G1DA 3KRZA 3OG2A 3SCSA 3USBA 3GM8A 1H7OA 1TRIA 2X1IA 1LP6A 3ARXA 5HOSA 4EK7A 5A1AA 3FAXA 3TW7A 1WBHA 5HXMA 3OB8A 4AMAA 4WKFA 1B3YA 1LBLA 3G1SA 1KQYA 2BLEA 1JDDA 3M1ZA 1VEMA 4M80A 2CWNA 2E09A 3RMEA 1XH0A 1LL6A 5EMUA 5HWNA 3L4UA 4JNMA 4PMDA 1N55A 3BPWA 4ZZ9A 2J7BA 3CUIA 1JI1A 3WH7A 5D32A 4BK9A 1GTHA 3LMYA 3LM7A 1OD0A 2E8ZA 2ZUMA 1B0IA 4D6FA 4MY9A 1UKQA 2DZVA 4HSNA 2NXGA 3E1F1 3QHMA 3BLEA 4PUDA 3LBMA 2V9DA 5C71A 1QVBA 3LTPA 3FXYA 1ZL1A 4O28A 1MO0A 1SZGA 4MLJA 1DWAM 4LVBA 3WNOA 3W84A 2CERA 4OOUA 1M01A 2ZUWA 4O57A 4IUOA 4OV4A 1UR9A 2Q8LA 3BO9A 5EYWA 3WH8A 4AHPA 1XV8A 3GNOA 1E4IA 3NQCA 1EQPA 3GNPA 1NF0A 1TQXA 1O6IA 1G7UA 4ZE4A 4RXFA 1BAGA 3LPFA 4PMNA 3QSTA 1HX0A 3VM7A 5DBTA 5ABGA 4K38A 1TPB1 2X1SA 3DFPA 2TMDA 2WLZA 3AMLA 3ARVA 4QLJA 3DYOA 3POHA 3PZMA 3W37A 3BGJA 3T78A 1WZLA 1SU5A 1L6WA 1BYAA 2D20A 2V2HA 2G5WA 5DF0A 1RP8A 5G1TA 2NUXA 1LRQA 1SFJA 1XSKA 1K8XA 4LYQA 1KFLA 4PMYA 2JBMA 2V2DA 1J9YA 1RP9A 4PSPA 4I7WA 2TAAA 4WXZA 3VE7A 1E51A 7TIMA 3VD4A 2GJXB 1UR4A 4D6CA 2OLHA 2ZFAA 1PL9A 1BYBA 2NUWA 4UTKA 5J5RA 2CYGA 4OKDA 3ABSA 4POCA 3W87A 4HSOA 3DHUA 3FYOA 1O94A 1B9BA 2V38A 4UR8A 4UMCA 1HKIA 3GNDA 2WPGA 3OGRA 3DI1A 4KGJA 1TSIA 3S42A 1W5OA 2FHFA 3K4AA 2WK2A 4XZBA 2F61A 2WSKA 2YR1A 4AZZA 4AH7A 1GVSA 3NIYA 3U7BA 2C16A 2E6FA 1GUVA 2GDVA 2QKFA 4O50A 3M46A 3WH9A 1KXQA 2X30A 1C8XA 3WEZA 1QMLA 4P7NA 5I3KA 3FOKA 4O1DA 4N2YA 1H4PA 4PTNA 1GNXA 1SFLA 5G2HA 3NSMA 1WDPA 5GQBA 4XUGA 1W2TA 5U4NA 3KL5A 2V82A 1GZJA 4NX5A 5GVJA 1EUAA 3DYMA 1ONRA 2H8ZA 1S5TA 2H8XA 5CGQA 4MZ1A 2BV9A 3N18A 4MAZA 4RE4A 1OK4A 3VNZA 4JZ5A 1ADOA 1V3HA 3ZS4A 2W92A 4BFAA 4FIQA 2O9TA 5AHEA 3T2PA 2CEQA 3TQVA 3FAWA 1HXJA 1G4SA 1RD6A 2W62A 3ZJ6A 1JCNA 5A6BA 3LRMA 5TQLA 1VLIA 3TC6A 1FA2A 1CW2A 1XCWA 3OA3A 2ZX5A 4QDMA 1VENA 3MO7A 4FLQA 3SURA 1Q6LA 3NPVA 4LS2A 4RXGA 1EHNA 1E15A 5HWMA 2EO7A 4Y6GA 1OFQA 2W61A 1MXDA 5AN7A 1XRVA 3TKFA 3DHFA 1H09A 5FKCA 1QNPA 5A2CA 1K8ZA 4X9YA 4IOTA 2EKCA 3G0XA 5DCEA 2X8RA 2MANA 2VZUA 3L67A 1NEYA 1NOWA 3L68A 3C2OA 2Z6JA 5AHMA 4LC8A 1HIZA 3PB2A 1BWKA 1HJQA 3WDRA 4N9DA 1JFXA 2VX7A 3UEQA 2UV8G 1EOKA 5GNYA 5KITA 1QOPA 1W9VA 4EF9A 3STGA 4AD3A 3ZO9A 1BVZA 4M8UA 2GJNA 4P2VA 3ABRA 4NX0A 3TC7A 2DGAA 4RL3A 3WF1A 2ZZ1A 3VDAA 4LNYA 3NA8A 1X1NA 3W7LA 4B3KA 4F79A 1DOSA 1Q6FA 2CPUA 2ISVA 2VZOA 3TSDA 1DEDA 1IV8A 4HOWA 4L4OA 4RX0A 4A4AA 4PMZA 1EP3A 2ZXDA 1H49A 3WBAA 4E8DA 1U30A 1QBBA 3VPLA 2OWWA 3ZSSA 3EX3A 4JICA 3PZOA 3CWNA 1E73M 1A53A 2HTMA 2BY0A 1K7XA 2D1ZA 1UYPA 1UD5A 3LPGA 1H0IA 2ZA3A 1IF2A 3CHFA 1SZEA 3NQFA 1UKOA 2WV8A 2CITA 1E0WA 3VNYA 2W4XA 1Q45A 1EXPA 3L0GA 5EFDA 1OM0A 4EQVA 1JCMP 1LG2A 4AZBA 4ATDA 3T44A 5IFTA 3DU0A 5DY3A 4PMVA 4CCCA 3OVQA 3KE0A 3W25A 4PEKA 2NWRA 5ECUA 3A4WA 1GCYA 3ZJ7A 3ZT7A 1LQ0A 2DT3A 2WVSA 1C7SA 5CXPA 1M7XA 3P61A 5M5DA 2A5HA 5A8QA 3WUEA 1HL8A 5HBFA 5IHRA 1QI0A 2TRSA 1OFAA 3VVGA 3RWKX 1EP1A 1Z41A 2JKPA 3W7EA 4PTXA 4AY1A 4H04A 2QDHA 4GFSA 5EB8A 2Q3RA 3G3DA 1L2UA 1QO5A 4ICNA 3W7QA 1CYGA 5C70A 2EAWA 5LGZA 1KCLA 1M5WA 1YADA 1BFNA 1UUOA 2G3MA 1VC4A 3TMLA 5A8OA 4GI6A 5M03A 3VCRA 5C55A 1WYIA 1F76A 5TD4A 4LX4A 4HU0A 2NW0A 3I7QA 2GUYA 3FY1A 3P5ZA 2YX0A 1UD3A 3F4VA 3HIJA 3BLKA 1K3UA 3L65A 1UQZA 4H8UA 3AXXA 4DWSA 2FPTA 2X1UA 2R91A 2YYTA 3M9YA 4JX5A 3TNOA 5GPRA 1AQHA 1NFBA 1JD7A 2YPIA 1RPXA 1CNVA 2YL9A 4PUEA 3VIMA 3W07A 3GDMA 2GDUA 1SW7A 5SWUA 3DKLA 4NZFA 4HPJA 4HMEA 4GXMA 4L4LA 1OFDA 2DJXA 5A6BD 5LYRA 4AVFA 4Q22A 3F03K 5A8GA 2Q3OA 3GB6A 1TJRA 2P10A 3FNDA 4TXEA 2YLAA 2X09A 3TE9A 3W23A 4JYEA 1N7KA 1PIIA 3SEPA 3W81A 3LHUA 4AF0B 1C93A 2J7HA 4N42A 1TPH1 4LPCA 3IAPA 3C2FA 3OA5A 2O9PA 2XVKA 5E6YA 4Z08A 3AS1A 3B04A 4EE9A 1M53A 1N8FA 1V3LA 4GQRA 2OYMA 2J7DA 4YN5A 1SSGA 3AIRA 4NSBA 5BMXA 4WD0A 3KEHA 1YDNA 4XKYA 1W91A 1MWOA 2JF7A 3AI0A 1SYTA 4F9JA 2DSZA 1DWFM 3PTKA 3LRLA 3VMOA 4AZ5A 2ZWZA 3VU2A 1W5NA 3AS2A 1VB9A 3TXVA 1F7BA 1V6YA 3L9CA 3NPUA 4N02A 1E0XA 1V6XA 3W26A 3WQ4A 4DM2A 1CXEA 3TH6A 3O1NA 3QOMA 3QSRA 4UFLA 1CECA 1GYNA 1JD9A 1GPFA 3OZPA 4MB4A 3EKZA 3FW6A 5ABHA 1JGIA 1A47A 1BGAA 1KTBA 2WSYA 1VHNA 1XFBA 1GJPA 4TUFA 5JBEA 4FFIA 4B5NA 1YHTA 3W74A 4Z2LA 4MJ4A 4K37A 2IXVA 1T8XA 3CTTA 4JKLA 3WD1A 1V7YA 4N9CA 3G24A 3WNKA 2FH8A 4DO4A 4ML9A 4FO4A 5FK8A 5L6UA 3O63A 4NJIA 4HOXA 1W56A 5AB3A 1I45A 5C54A 1DWJM 5D9OA 5CPSA 3OVRA 4UTWC 1JDCA 4CN1A 4ONVA 1TIMA 3THAA 2UY2A 4ZFMA 3IRDA 3LCXA 1WOBA 1OX4B 3E96A 5DN1A 2GPTA 4AXKA 1JZ6A 3NQ2A 3GZAA 4JYDA 3WK3A 4NU7A 1UHVA 4W7VA 1HO1A 2CNCA 3K8MA 5BNKA 2R94A 3FKKA 1AQMA 3QQ0A 3W2MA 1J11A 5FMBA 4UTJA 1W2PA 2QCFA 4TX8A 1FH9A 1E71M 1ZBCA 1FWNA 3LEMA 3QMSA 1KA9F 4O4WA 4AHQA 3OLIA 4E4PA 4FEZA 3VE9A 3PBGA 3B8SA 3VGHA 3QM3A 4M7SA 4AB4A 3G6LA 3MP5A 2VNCA 5BXRA 2DZTA 1XCXA 5D9MA 1MQPA 1YPIA 5I3DA 3O6YX 3OZOA 3VIGA 1GWJA 3P7YA 4MZ8A 5I6SA 2XIIA 5D9PA 1FWTA 1QDSA 3U57A 4CD6A 2CLKA 3RU6A 1EX5A 3WQ6A 4YMZA 2NXHA 5HJLA 1GQJA 1C8QA 3LHZA 5EY5A 1Y0EA 3LF7A 1ALDA 1Q6OA 1V0MA 5FL1A 1ISXA 3PZQA 1E5NA 1WDWA 3OSDA 3W7CA 1B31A 1MZHA 4QCFA 2OZ0A 3W7RA 3AHTA 3WMBA 2O7SA 3MBDA 2ZRVA 4DWSD 2BS9A 3DFSA 1VCGA 2GJPA 4AISA 1VFUA 4AW7A 4W93A 3A5FA 1ODZA 2Z1BA 5F2IA 4DF0A 2VRKA 1GW1A 4RKAA 1XH1A 4HPHA 6TAAA 2X0YA 1H5VA 3MU7A 4Q32A 2NSXA 1OGBA 2VCBA 1KCKA 2OX1A 1YPFA 4OZOA 4WQ6A 3S6DA 1E9LA 3OG3A 5BOOA 3SIMA 2B0MA 3ALFA 1OIMA 2W0UA 4D6HA 5IXEA 1DV7A 3WNLA 2C0HA 4C1LA 2WMFA 4JTKA 5D37A 2J6XA 3PIGA 5FEXA 2DSUA 3K4DA 3W6LA 1X8FA 1FOBA 5FEWA 2BXYA 4JTGA 1KLYA 5C5YA 3MP3A 2IXUA 1AL8A 5CSUA 3T4CA 3L2LA 3NQGA 2EQDA 2Y61A 4WLCA 2J4GA 4J3SA 3NNTA 1IT0A 2PC4A 3DAQA 1E6RA 3BMWA 4Z2KA 3ARRA 3U6WA 1WBJA 2Y7DA 2ZOXA 3TFXA 5A2AA 2WQPA 3W72A 3B0UX 3DC0A 1VJSA 4ACZB 2J24A 1US3A 1LDCA 4MFEA 3C3NA 3IIXA 4K6AA 2JGQA 2ZA2A 3ARTA 4J3WA 1NM9A 1V6WA 3GXDA 1QPQA 1TG7A 4GNJA 3CEPA 4TVUA 3QMRA 3WF2A 3GLCA 4JIQA 4ORMA 4JCMA 5A94A 1HT6A 2ESCA 3C52A 4JTEA 3NXFA 1H7RA 1UUMA 2H90A 1ITXA 1G67A 1DJQA 1JULA 4CLMA 5IBXC 2CZEA 1HJWA 4IISA 3N1AA 4AWEA 2NXIA 5E1QA 1KFWA 1GT8A 2VEKA 2O9OA 1OF6A 3PY2A 4RK8A 3HJZA 3M5YA 1RD5A 2ZTJA 2YIHA 3PC0A 1VGAA 2FFCA 5FKBA 2GJXA 4C7DA 4ZQMA 3LLDA 3HOJA 2DH2A 1GONA 1VJZA 2DT0A 2QLYA 3A4XA 5A8MA 3GKAA 3VGDA 4FFHA 3MKKA 5E70A 3AXHA 3CUFA 1K9TA 4E2DA 4JR5A 3VDBA 2NX1A 3LV6A 3W7KA 1GG1A 4NNCA 2DZSA 2W66A 1QW9A 3I68A 3EKLA 4BF9A 3CO4A 4WSKA 3EWZA 4ZENA 3CTLA 4HKPA 1JXKA 4PBGA 3ATYA 1A5SA 2WWDA 3C2EA 1DVJA 1LOQA 3LCGA 5K9DA 3W70A 1OX6A 2CBVA 2PWHA 2QPUA 3CGTA 5EMYA 3TFCA 3LERA 4H3DA 3E02A 4O12A 3BV4A 4D1JA 4A2SA 2DU2A 4UFMA 1V0NA 1BTMA 2ATSA 3EEGA 3L21A 4MUZA 1DTUA 1R7AA 4Q33A 4BQ3A 2BY1A 1TVNA 1JYNA 2VCAA 5CQ1A 4JTIA 3VFLA 3C56A 4AWSA 4EOUA 1JZ4A 3MSGA 1Z42A 3W29A 3QYQA 2E5DA 3N19B 4DBDA 1ZU8A 1HKMA 3OVPA 4W7UA 1HTIA 4GC4A 4UXDA 3O05A 3STCA 2XIBA 3JUGA 4U2YA 1Q3NA 5LHEA 1CTNA 1VBRA 2J9ZA 2ALDA 3MP4A 1QNSA 5G2IA 3AOFA 4AAJA 1E6XM 3IIOA 4PMQA 1KFKA 4N4PA 2PWDA 3ZT6A 3F1QA 3FJLA 3W1XA 2XN0A 3THQA 1UR1A 1KBIA 2VRJA 2V8ZA 5D2TA 1J0ZA 2XVNA 1HL2A 3DFNA 1LWJA 2OSXA 4KRTA 3SJ3A 2D2OA 4W84A 4MDOA 4UTLA 5ABTA 2QMKA 3DENA 1KTCA 3S5YA 3WENA 1THFD 1A5BA 3TU9A 1SW3A 4WJXA 3VIJA 1U5JA 2O9RA 1V02A 4S3KA 1DQXA 2BVDA 3ELFA 3PUDA 2YBTA 1U2YA 3IIVA 1JRCA 5D8WA 2VL4A 3L0NA 4TVCA 3LCHA 2NX3A 2CHNA 1TJPA 4MDPA 1TUXA 1YTKA 2VCCA 3HMCA 3E49A 4UNKA 1FH7A 3H53A 5FEPA 3F4WA 4FF5A 4A3UA 4D72A 4B1MA 3HG2A 3P74A 4O1BA 4BR1A 4QLLA 5CJ5A 2FB3A 2WVVB 2G96A 2FPYA 4UZUA 4UNIA 3VTRA 3VX1A 1TCMA 4CKQA 1VYRA 4MYAA 1TO3A 4KFPA 4CU8A 3CWOX 4IJBA 2E6YA 4O15A 4E0CA 1W2VA 3WMSA 4AZIA 4TOQA 1KQZA 3ZJ8A 5KINA 2YDRA 1JR1A 3ARYA 1VYSX 1I2PA 4UCFA 1FX6A 2ZICA 2WC3A 1QFEA 3N14A 3SUSA 4AYSA 4ZVJA 1OFBA 1UWRA 4RE3A 3CZ8A 2D3NA 3W1AA 3W24A 4OV9A 1H41A 5FD0A 2J7GA 3OLDA 3O6DA 4K7VA 1QR7A 3O07A 3TW6A 3EDKA 4HP5A 3AJXA 2A6LA 5DFAA 3WDJA 4Z2GA 3B03A 3P67A 3BCDA 4QAWA 3SUUA 1CDGA 1W1ZA 2GSJA 4AZ7A 5I24A 3PZ9A 5IFPA 4UQAA 3RNDA 1KXTA 1DJNA 2Z1SA 3G18A 4AD5A 4LUIA 4ALDA 1JL8A 4CQ9A 2W91A 4H2CA 4UR7A 4GXPA 4DO5A 5ANNA 2PCQA 3BXWA 4JY8A 2E5BA 5DCBA 1MXSA 1HN1A 4KFNA 3PUEA 5CPNA 3IVUA 5E93A 1RPKA 3MMDA 1V5XA 4W8AA 3T0BA 3VD5A 3W0KA 5A6KA 4H7VA 3SR7A 3KF5A 3AFBA 2WKLA 4U33A 3M5VA 3M5XA 4PMOA 2X1TA 3FS2A 4WX2A 4NUWA 2AOSA 1R47A 5H91A 3NMBA 2Z6IA 3DFTA 1J0KA 3U1XA 4IM4A 2WOQA 2FJKA 3LLFA 2OSWA 4H41A 1VCFA 3VGGA 1FY6A 3GXFA 1GOQA 2WCAA 1PEZA 1E6NA 4UOZA 3PTMA 4AXNA 2RFGA 1R7OA 4B16A 3TR2A 4IMDA 3LCWA 1PIFA 4TVDA 4XTDA 1UBSA 1W5MA 4NT0A 4UCGA 2RDUA 3T55A 3KVLA 1E55A 3SUVA 3WH5A 1JUBA 1DWHM 3U75A 1FDZA 1EOMA 3HB9A 5G1YA 3MUXA 5AYZA 1PE1A 2Y7EA 1OSEA 4P8VA 2VFGA 2YJQA 1ZJBA 4CN4A 3CBWA 1ZB5A 3W1RA 1G9HA 1UH2A 2V3GA 1WZMA 3IANA 3S0CA 2OMAA 4PSRA 1YYAA 1KLZA 2GQAA 3GR7A 4PODA 3H3LA 1FDYA 5EPDA 3P84A 2QPSA 4O18A 1X6NA 1W1VA 2WM0A 5BW6A 1SFSA 1TCDA 4LV4A 1PIGA 5LA1A 1OFRA 4P8UA 3AIEA 3VUPA 4BS0A 5IM51 3NVTA 4B15A 3EXTA 1B3XA 2ZRWA 1PCWA 4NRSA 2J74A 3EB2A 3CC1A 2RKXA 3BAJA 2XN1A 5DBUA 1FCVA 1C8YA 5CKSA 6ALDA 1LZOA 1OB0A 3UXDA 1H0GA 2DSVA 1BGGA 1GPWA 4M6QA 1W9UA 3IGSA 3UWVA 3N11A 3TSBA 4A21A 1WZAA 4GWEA 3UY8A 3BAXA 1E6ZA 2VRQA 3AYRA 3G3MA 2AAAA 3A4AA 5M17A 1RQHA 3PZNA 3EX4A 5DMYA 2W79A 4XB3A 2B7QA 1WAUA 1D2KA 3LCIA 1AW2A 5FMCA 1TPC1 2PI6A 2QJGA 2E3ZA 1GVRA 3SCTA 1KM2A 4JDYA 1ZS2A 2A6NA 1TPDA 3W7PA 4LVFA 4K36A 5F7UA 1CGXA 1OINA 1TPFA 2Z2UA 3KOFA 2ZIDA 5FESA 2PWGA 2WCSA 1C29A 5CGTA 3QPZA 2ZXBA 1QPKA 1WDRA 1YQ2A 5KZDA 2CBJA 1H7PA 4MJZA 3DXIA 4W86A 3BVJA 3QPYA 1RR2A 2BNJA 4Y96A 1TV5A 3EWBX 3KRUA 4JDBA 5D2XA 1BTCA 1E1FA 2ZUNA 3P82A 3PSWA 1KBBA 3DI0A 3G1HA 1CXKA 3WDPP 1OGGA 1KGXA 1W1YA 1LTDA 2Y24A 4MY1A 1KBJA 5K7JA 5F2LA 2V5LA 2VXNA 3IVSA 2WHMA 1E4LA 3W82A 3D3AA 2J78A 3WBEA 2QCDB 5D09A 1GTEA 3MWAA 1Y9GA 1H5YA 5K9XA 5FIPA 3EMZA 4GUFA 1R2RA 4EWND 4HZ6A 2HISA 3AISA 3N9KA 3LDKA 1SO3A 3O15A 3TXZA 1EO7A 1NQ6A 2XVPA 3WSUA 3NR0A 2YXGA 2DPEA 5JIWA 3OHIA 1MQQA 1PJ9A 1OABA 3CHDA 3W2KA 3GBDA 3CQ0A 3EWWA 3IIZA 7A3HA 4JX4A 3WFZA 1Q6EA 3ZR4A 3NOEA 3I65A 2VZTA 5BYWA 4PA8A 1B3ZA 2Y88A 1FFQA 4N4QA 2UY4A 3W7GA 2VENA 1HP5A 4AZHA 1SMAA 1JYXA 3CIWA 1GOOA 2A3EA 1AG1O 2GVGA 2QJHA 5FKYA 1QPOA 5BRPA 3LXCA 5BXPA 1NF7A 2QCHA 2EF9A 4NJGA 5LNVA 2J7EA 3U2OA 1FQ0A 1FWSA 5GNXA 1GORA 1KR1A 3P8JA 2WKJA 3FA5A 3LX9A 1JQVA 4QISA 1MXGA 3MUIA 3PHAA 4TX6A 1KTNA 1J0HA 4PFMA 4HNTA 1JF6A 3IJ9A 3IMMA 3W73A 1P0NA 1AK5A 3K30A 3QF0A 1FHLA 1IGSA 3NYDA 4XV0A 3L0KA 4JTUA 1PAMA 4DPQA 4HMCA 3RLVA 3T2OA 3QQ1A 5C6MA 2QJIA 4N9BA 5HWJA 3UPBA 1UD6A 5LA2A 4CQAA 3SCNA 3VDCA 3WD3A 1CI1A 5D4YA 4ADUA 1V03A 5C8BB 5ABFB 5E0KA 3RFAA 6A3HA 4CVWA 2CLEA 4QHZA 3AIUA 1JZ8A 4AD2A 5DT5A 1JF5A 1B30A 1JCJA 2ZZ2A 4GUGA 4LWWA 1I8JA 3MI3A 1ESWA 2JKEA 1H1YA 4FHAA 1ZJAA 3M0ZA 1QI2A 3AJ7A 4JIEA 2WAGA 3GAKA 4PMUA 4MB5A 4PH6A 2YW4A 3LIGA 2E4TA 4NNBA 3Q58A 4ACZA 1EQCA 3M6DA 3SIZA 3UWQA 1FP8A 4WZHA 2XTKA 3O2LA 5D8ZA 1EA0A 1H1NA 3F5KA 4ZQPA 3VIKA 1EB3A 3EWXA 5AHNA 3APGA 5IDIA 4J27A 1F2JA 5E9AA 1TQJA 3WDIA 2ZRZA 3TROA 1NH6A 1SMDA 1HL9A 4WSJA 1CBGA 2C0AA 4RZ4A 2BY3A 4QFUA 3CIVA 1QAPA 2CFFA 5HQEA 1XDLA 3HO8A 4UQDA 1W8SA 2FGLA 5CPQA 5AHLA 1FWWA 2VC9A 2YOCA 4KGLA 1CGTA 1TB3A 4FNRA 1UD8A 1WO2A 2A3AA 3F5LA 3Q37A 3KAOA 1Q6GA 5A6LA 1VR6A 5AOUA 4AIUA 1C91A 1GG0A 1F05A 2QCEA 1Q6RA 5AC8A 4DUWA 3G8RA 3TDFA 1ZAIA 4E2OA 3MO4A 4CCEA 5EFFA 1FFRA 4RV8A 2WXDM 1FWRA 3FFSA 1HFBA 1VFFA 2E8YA 4GI8A 4MB1A 4JFWA 5E0FA 2PRMA 4O8RA 3KL0A 3UESA 7CGTA 1B4KA 3NQVA 3W2UA 1V3KA 3HPSA 3MMUA 1AVAA 1UB3A 1XD1A 1FCBA 1W5PA 1BF2A 5DLCA 3LIHA 3WDHA 2AGKA 2YFOA 4OE7A 3VX0A 1XCFA 4IX2A 3CUJA 3VIPA 2ZZ4A 2DZUA 3W3OA 1W37A 2ZE0A 1D3HA 4JYFA 4PL1A 3NAVA 1QHPA 1MEWA 3EXRA 4NNAA 1F6PA 1OF8A 3LB0A 4Z0SA 2A7RA 2WHLA 1SR0A 1AMYA 5AHFA 4PTVA 3WL1A 3AO0A 4F66A 4DM1A 1SQ7A 3LTSA 5LKYA 1MEHA 4I7UA 1EWEA 1CGVA 3UETA 4BZYA 1I2QA 3LI0A 3KX6A 3ZWSA 3R2GA 3U5YA 4RLIA 1NWUA 2WWCA 2EPHA 4FX7A 5AYXA 3SC7X 3RLUA 1CENA 3AMGA 2JIEA 4FF7A 1GVYA 4JXCA 3B06A 3GH4A 1VH7A 3QFEA 1I2NA 1C3FA 3IVTA 1JG9A 4AZCA 5AC5A 3W85A 4JN6A 3W38A 4TO8A 1E6PA 4AIEA 5CGMA 1W3IA 3Q2DA 2VQTA 5D05A 1TE1A 2E1DA 4HPGA 1I4NA 2VTFA 2G4FA 4QITA 1XYFA 4ZL1A 1VRXA 4C1KA 3VKKA 3MHUA 3CU2A 4QSHA 1C8VA 3SCRA 3EMCA 1K7FA 3MV01 4PYSA 4Y7EA 3W1PA 2W63A 3II1A 3AMDA 4BQ4A 3KZSA 1ISVA 5D30A 1CGWA 3LDRA 1KFBA 1OGSA 2GVYA 2GJLA 2VOTA 5FF7A 1V08A 2V30A 1ODUA 5GNZA 1UASA 1WXJA 3LCLA 4O10A 2OWXA 4HMDA 3WDQA 4HNVA 2QCNA 1SSDA 3LXAA 2G95A 1UOKA 1I2OA 1NOFA 3A9IA 5BCAA 1B3VA 2V5BA 3HGOA 4P7QA 1IIHA 2WVVA 3BGAA 3P81A 4BQ5A 2A0NA 4AWUA 3V1PA 1WX0A 3ATZA 1NAL1 2CKRA 4U3AA 4Y8FA 1B57A 4DPPA 3AZTA 4LT9A 1JIBA 5EL1A 5AHIA 3HPZA 1HVXA 1O7AA 1XH2A 3G1XA 2DIEA 2DH3A 4UTTC 4ZQNA 1QWGA 3AQUA 5A3HA 3HG5A 3WK2A 1ISZA 2VC6A 5JBFA 4FK9A 1MW3A 1XUZA 2WNZA 1KW1A 8A3HA 3I6RA 3N04A 1TTQA 2VX5A 4O17A 3HJEA 3FLUA 4ATWA 2ZX8A 1KXVA 4Z1AA 3PS7A 1TPVA 3W2JA 1P6WA 3PZVA 5KSWA 1ZBWA 1Z44A 4P7LA 3U8GA 4NVTA 1V02E 3RCNA 1PBGA 1OX5A 2QHAA 4NJKA 5G5IA 4BI6A 2ZXQA 2J7CA 3OIXA 3NCOA 3C2VA 3G1FA 3BW3A 3M47A 4HZ7A 1KM3A 1LORA 1C92A 1E3XA 2WKGA 5FEZA 2J77A 3W88A 1VBUA 1CXLA 3WFLA 3UXAA 1ZAJA 2J9YA 4HT3A 3AS0A 3PAJA 3MW7A 3NG3A 2FLIA 2X05A 3SCPA 4Y9AA 2BVTA 4GPNA 2EBNA 2GOUA 4XWUA 4O16A 3S1XA 2B7NA 3TMQA 4O19A 4UNLA 2HS8A 2J88A 5FF3A 3QC3A 3LHTA 3W75A 2HSAA 2R8WA 1UKTA 2RGLA 4JTTA 5CZ0A 3AIBA 1WV2A 2ZQ0A 5DT7A 2YDSA 4QIUA 1IZJA 1LWHA 1JZ2A 2J47A 4CU7A 4NI3A 1TYGA 3CZEA 5I78A 2YL5A 2PC8A 3EDDA 2NLIA 3STFA 3W2LA 4U31A 2IQTA 3CMJA 1GOIA 4TTGA 3C4UA 1G6CA 5CG7A 1MFUA 4P61A 3WMCA 4HN4A 1O95A 1MVYA 3Q94A 3EWUA 1WNOA 1HKKA 1ST8A 2ADDA 1UQYA 3OBAA 5A6JA 3GXTA 4HTYA 3WD4A 4FNTA 1CXIA 2ZUVA 1DKWA 1JDAA 3MYOA 4MPQA 5F4WA 3CZJA 4JHZA 2C14A 3SUTA 1W9XA 4UFJA 1G7VA 4QJ1A 2GJRA 2FPVA 4LRTA 2QV4A 2QMJA 2RHGA 4JTFA 1LG1A 3AHXA 5LNWA 1BYDA 2VEMA 3SSJA 1E3ZA 4BA0A 1M04A 1W0MA 2PURA 3NDYA 3WJWA 1EIXA 2ISWA 2XPKA 1J0YA 4ML4A 1F74A 3TQ0A 1QOQA 2A21A 3RO8A 3EX1A 4U5IA 4BWLC 4EIVA 3KVMA 1OYCA 3PBVA 3S1VA 1WDQA 1LM1A 4P7OA 1ZCOA 4XZWA 3W86A 1UA3A 1F6KA 3RF9A 1DWGM 1E4NA 1YXDA 1ZBVA 3WKZA 1L6YA 4MFDA 4HA3A 2WPBA 5I2UA 1P5BA 1XYZA 4UIOA 4MTVA 4AEEA 2IUZA 3B9EA 4JFTA 2XVLA 3HBKA 1D9EA 2GUUA 1DHKA 1HP4A 1WKYA 3NQ7A 1J5TA 4O4VA 2V81A 3RM9A 4LTSA 3AXIA 1W32A 3FJ6A 3SGUA 1GVIA 1XBXA 1TPUA 1J10A 3UCQA 3A21A 2WNQA 1NWRA 3CZGA 4ZXLA 2OT0A 2E9MA 3NDOA 4CVUA 1C9DA 1IXPA 4N6EA 2I1OA 3BW4A 5D03A 3L4TA 3VIFA 2VFFA 2WMKA 1DP0A 1WZKA 1VCVA 4IXHA 2D0GA 4MNMA 3WF0A 5HULA 1L0PA 3WD0A 3PSVA 2ADEA 5AC7A 1AW1A 1PZ3A 2HVMA 4OJYA 5KZMA 1OJXA 4JL1A 2GVLA 1NP0A 1WAWA 4HU8A 3PIJA 1E4MM 4MNKA 4ZQOA 2JALA 4J3TA 5EA9A 1ITCA 4ZEPA 4CCDA 5CSSA 3G1VA 1X6UA 4GJ1A 4IXXA 4I9AA 3LFIA 3CB8A 5K4ZA 2DSKA 4Y90A 5A6SA 1FH8A 3UZ5A 4X0VA 1FUYA 3S2CA 1KM5A 3TX9A 1SPQA 3W71A 2X1RA 2V3FA 4AC1X 3HBLA 4UC5A 4BI7A 4OU1A 4LS0A 2D3LA 2ISSA 2OWCA 4O1AA 2QCDA 4PC8A 5T26A 4J3UA 2EEXA 3CUGA 4KKXA 4WF7A 1CLXA 3UERA 4TIMA 5A6AA 2YA1A 4MJ2A 1VHCA 4A29A 3EBVA 1GOMA 3DHDA 1SW0A 2ZBTA 4JX6A 3OEXA 1M03A 1XDMA 2KZHA 4O54A 5HPCA 1WP6A 3EDFA 4P8XA 4YCPA 3N2XA 4E38A 3QJAA 2VX6A 1X1ZA 3PZTA 4KRUA 3CHCA 4E8CA 4B9ZA 1HUVA 2X0HA 4MKNA 3L5MA 1XSJA 1H7WA 4YCOA 1M7OA 2CW6A 5HNNA 3BG5A 3FKRA 3O16A 1W1PA 4HHPA 4PCSA 2DJLA 1V0KA 3ZQ9A 3UG5A 4FLSA 2JKAA 3TTOA 4Q4KA 4V2XA 1GJWA 1PZ2A 2NX9A 4IWWA 3ZR6A 4Z0JA 4KH2A 3W1NA 3IK2A 3L2IA 1UR0A 3PZIA 2EPNA 3FIGA 5E0CA 1ECEA 2C18A 4M24A 2H6RA 3VINA 5DCDA 5DXXA 1XI3A 4GKLA 2BZNA 3WJXA 2PWFA 1O60A 4W89A 3E9AA 2DQXA 3O06A 3ALGA 3L4XA 1AL7A 1TPWA 2OYLA 3T09A 4MVAA 4JFUA 3D0CA 4LY8A 1W5QA 3SCVA 3AHYA 1VAHA 4TR9A 3MYPA 3VM5A 2E6AA 4FB7A 2QUVA 1RH9A 5D9NA 3I7SA 4BQ2A 4XBSA 2ZUSA 2Y7GA 2YZRA 4GIAA 1J12A 2WANA 2Y8VA 1OG0A 3P60A 2GFTA 1W1TA 4QNWA 4LYPA 4XUYA 3CPRA 1BLIA 5ABFA 5A6MA 3A5VA 3W7IA 3BAWA 3HU7A 1UD2A 3S1WA 1LJYA 4AWTA 2CZDA 5I79A 1VFOA 3W22A 4EANA 3T0AA 3LDVA 4Z1BA 4DWSB 1YTDA 2P1FA 1HF6A 2J8GA 4M56A 4QCEA 1PS9A 3A24A 4L4MA 5LSMA 5FMDA 4AEFA 3GK0A 2Y7FA 1G01A 3MHFA 3L4VA 2WYSA 4OGZA 3KL3A 2ZZ7A 4D1IA 2JEPA 4U28A 3VOCA 3LBCA 2JIWA 2X16A 3HMJG 1S3HA 1D3GA 3CLMA 1KXHA 5AFDA 4CUCA 2WB5A 2A4AA 1G0CA 3M7SA 1J18A 4OQVA 5FF0A 4JY9A 1GJUA 4O13A 4MIMA 2XM1A 2XFWA 1E0VA 4JCLA 2O7QA 4WXYA 2CETA 4UTIA 2ZDRA 3UZJA 1P4CA 2RGMA 4K39A 4X3ZA 1KV5A 1F4HA 1KM0A 1ZNNA 3K46A 5A8NA 1U83A 4B9YA 4QNEA 1NWSA 3L5LA 1KM4A 1K7EA 1W9PA 2FGZA 2VFEA 4UZSA 5G4EA 3U7VA 1HJSA 2DORA 3CMGA 3GXIA 4PTWA 5AC6A 3QZEA 4WOZA 5F2GA 4XKYB 2BHYA 3UNDA 1XBZA 4KMQA 3ARUA 3K8KA 3U14A 3UWZA 4MZYA 1G4EA 4YWIA 4C7FA 2J7FA 3WQWA 1EO5A 3W1QA 2QR6A 1PPIA 2WZEA 4URIA 1MYRA 2DZWA 3NSNA 2CLFA 1B9ZA 3QHOA 3PG9A 1BVNP 5CPLA 1PHWA 2XVGA 3RM8A 1KM6A 3W6YA 1T0OA 1LCOA 1JXJA 2WZIA 4IPNB 1X6LA 2YGYA 1JZ3A 3W9ZA 5E09A 2RDWA 4WJEA 3MI2A 2QAPA 4R5EA 5HUOA 3WELA 3DECA 1QO2A 1R30A 1H51A 4UTWA 1OT1A 1KBKA 3R12A 2Y2WA 3O6AA 3AIWA 1FXPA 2YCEA 3P8IA 1CGUA 1IXQA 1ICPA 1ISWA 2V3EA 2VO5A 5CLWA 4D6DA 5U7SA 4LVAA 1B3OA 3CZKA 1VRDA 5I3FA 4YLWA 4K8EA 3OGVA 1NWTA 3RK8A 3ZOAA 3EDEA 5F1VA 1L9WA 2VFDA 4UTFA 4W8LA 4ORIA 4R7JA 4MY8A 2E77A 2EGZA 1VZWA 5FIXA 3EX2A 4FNSA 2WZHA 4JFSA 4OIFA 1B4EA 1TTIA 1VEPA 3TQKA 3BLFA 3FN9A 4PL2A 2WHKA 2AC1A 3CT7A 2CLHA 4YPJA 5CPOA 2XSAA 1J01A 3T0DA 2Y5EA 1UKPA 4PRWA 4W5UA 3VD9A 4WKAA 3W7JA 2XQRA 2JF6A 3WN6A 3GX9A 1DORA 4HXCA 4ATLA 4DWSC 2B7PA 3L66A 4J9JA 1GHSA 4QAIA 3GXMA 5H2ZA 4JS3A 2B7OA 3UY7A 5K3VA 2WSRA 2CBUA 5HUPA 4CNPA 5FL0A 1US2A 3FHAA 4AF0A 4LYRA 1KWGA 1I2RA 1E6SM 2B31A 2FIQA 2XGBA 5DEZA 1OD8A 5D2WA 4GUHA 2GQ9A 2XWEA 3ARSA 3TA9A 3GVGA 2VMFA 1NARA 3H54A 3HPXA 4RZ5A 2G3NA 2XGIA 4JFVA 3UPWA 2YDQA 3WD2A 2XWDA 3RIKA 5TBOA 2XG9A 3BG3A 3HN3A 4LC6A 3K8LA 1RZMA 3WQVA 1K02A 5D2YA 3VMPA 1YXYA 2NV1A 4ZQCA 3CZLA 2A1YA 4DQWA 4JTSA 4EF8A 4N9EA 4ZE5A 4HZ8A 2E68A 4CGTA 3MMWA 3TTYA 3PULA 1GZGA 2J25A 2Y6ZA 3TTQA 1NP2A 3LCFA 3O9NA 2ZRUA 1OWQA 3HG3A 2G3JA 2J62A 5D38A 3AIQA 3BC9A 1SR9A 2VOMA 2BVYA 3OLEA 1K9EA 4NQ1A 5I0DA 3SGZA 1Q6DA 4FX6M 3W7OA 4O0KA 1MFVA 1JCYA 4LU0A 1QPRA 3WEMA 3NL6A 1H1ZA 3M16A 5HNRA 4JQTA 3TJLA 4U5KA 1YXCA 4DXVA 4NJHA 3TTSA 5HPOA 2O92A 2VVNA 3TAKA 2J9XA 1LRNA 1GVQA 4O52A 1UWSA 1WOAA 3W1TA 5FCZA 2QEZA 3BAKA 1TPEA 3WH6A 3SY5A 1ICSA 1UD4A 3MUAA 3GXNA 2QF7A 1JI2A 3UR8A 2VFIA 1GVFA 4CN6A 2E5CA 1XBYA 3MMTA 3MANA 4S2BA 4OBTA 2ZZ5A 4ZQRA 3VGEA 2PF0A 4B1LA 1R85A 3DHPA 2VVSA 1A5AA 8TIMA 1OX4A 5IBXA 1BG9A 4RR4A 4IPLA 4S3JA 2YW3A 4CD4A 1IZKA 1LOSA 3BW2A 3QR3A 3W7DA 3UQNA 2CZ5A 1SZFA 4PN2A 3QW4B 1W3KA 5CZJA 2YL6A 5AYIA 3S9YA 4NZCA 2FDSA 1EDGA 4FMVA 1Y7VA 2EHHA 3DYPA 1MEIA 2PRHA 3MHGA 3TV8A 3MI6A 1W9BM 1CEOA 4GUJA 2PWEA 4HNUA 3A3HA 3EWYA 3NGJA 1QI4A 1K03A 3PZUA 3P5YA 4HPXA 2AQWA 3UYCA 4GRSA 4J7RA 3PVFA 1SUXA 2AMGA 4X2RA 3QGVA 1HJVA 4PCTA 3M5ZA 3M6YA 3LOTA 4O0ZA 1J2WA 4E2BA 2YLLA 4UFKA 1W3LA 2PBOA 2WMIB 3BLPX 3W28A 4YL2A 2QQVA 4LXFA 1UZ4A 5I23A 3VIIA 1GQLA 1A3HA 1X7FA 4MAVA 1XXXA 3TJXA 5A95A 2XHYA 1BHGA 1OIFA 2HS6A 3AZSA 3GDRA 3WF3A 4TMBA 3UGFA 4D6GA 5IHSA 3N15A 4ZMGA 3GH5A 3MUY1 4CU6A 1FDJA 1EGZA 3GNRA 1HJUA 3WNNA 1LROA 5FI8A 4IMEA 3VD7A 3TP4A 2CLLA 2QCGA 3QMTA 2EPOA 1UWUA 1JAKA 4R34A 1EP2A 5JBDA 3AS3A 5A2BA 4FFFA 2E0PA 2OT1A 3ZT5A 1A5CA 3JRKA 2OYKA 5LGXA 1XL9A 2XN2A 3PN8A 4UQCA 3GDTA 1E56A 3PF3A 1GQKA 1G4TA 3T08A 3T40A 1GEQA 4QM1A 4CNOA 1G94A 1JZ7A 1EDQA 1LL4A 2DEPA 5MHBA 4JTLA 3ZMRA 4LVGA 3S1UA 1SO4A 5LNUA 1LOLA 1LF1A 2QF8A 4P7RA 1H11A 2BY2A 4M81A 2RDTA 3UWUA 1J4EA 1ZHAA 2XFFA 2F2HA 3N9RA 4DF1A 2J79A 3F4NA 5CZSA 2E9BA 2VZVA 4GO9A 5CPMA 3NYZA 5G2WA 1RV8A 1SO6A 1W3TA 2C19A 2YFNA 3T2QA 2ZRYA 1H50A 2UY5A 3D5HA 3GH7A 5I3IA 2EPKX 3UD6A 3LGEA 4L4PA 1M6JA 2BTMA 4FX8A 1TTPA 2JFEX 4HOZA 4XX6A 5E6ZA 4DUVA 3S8HA 1W3HA 2X2YA 3SCUA 1E70M 4O14A 3TCEA 2QQWA 2NUYA 3M07A 4UMBA 1FXQA 3BARA 2VURA 3W4RA 3UG4A 3WUBA 3STEA 2CHOA 3EXSA 4AIOA 1MW1A 3OLGA 1K6AA 4K7YA 1K9FA 5CSYA 3AROA 4OHQA 3AZRA 1V3IA 2ABBA 3GDLA 3NPWA 3IGUA 3NQEA 2JK2A 4CNNA 1J0IA 1QNQA 3WIJA 2E6DA 4HIBA 4KWVA 1WA3A 3BMVA 1DHPA 1BYCA 1JQXA 2ATMA 2CLMA 4PCFA 3VIHA 3NQAA 4OOZA 5K9CA 1YLVA 1W9DM 1KFCA 4JKKA 1KFEA 3LHVA 3QEZA 3SCQA 5I5RA 4YHEA 3QOKA 3RMJA 5EBAA 3VDHA 5DO8A 3DKJA 3GXPA 5J5DA 3OBKA 2VUYA 4LQ1A 4KWUA 1LRTA 3W53A 3KHJA 3WUFA 3SCOA 3UGGA 3PBYA 6TIMA 2FHBA 4AZ6A 1ZAHA 3LI1A 3NZRA 3BSGA 5ABEA 1ZENA 4MNJA 4NF7A 1SZNA 1JCLA 1DL3A 1MW0A 3OIHA 3WNPA 1G69A 4Z2IA 2YKKA 4ZXOA 2VEPA 3ZJKA 2JEQA 2V5CA 3WF4A 3WK1A 4PTMA 4Z2HA 3DFOA
chains in the Genus database with same CATH superfamily
1S5WA 2X10A 4D6IA 1G5AA 1EF2A 2XIOA 3ACGA 1FCUA 5E89A 4Q7BA 4TV5A 4TMCA 3IGXA 2OPKA 4ZS3A 4KWSA 3VNKA 3WQ5A 4AZGA 4OBSA 3VD3A 1YDVA 1R87A 4Q4Y2 4AX7A 2J27A 3WZ0E 3ZKYA 4KCWA 4TU1A 1JEZA 5AC92 3VBOA 3WY1A 3GTHA 4LULA 3DERA 3H50A 3C6CA 4XHBA 2WNVC 1YQCA 1RUC3 2NV2A 1H8TA 5LW9A 3MIBA 1UH3A 4KF1A 1B2YA 3RYPA 1IPSA 4HK9A 1AW5A 3O3RA 1FV2A 1EIBA 1F3TA 1PV8A 5LZLA 1LBFA 1L6SA 3BCFA 3WP3A 2VOVA 3FHQA 4QQLA 4LVDA 3SFKA 1TIWA 1Y5XA 2YXSA 2BFGA 4GGHA 3I3DA 4N0RA 3B0PA 4A7YA 1YHFA 3PANA 2KX9A 2ZS6B 3ZIXA 1XM3A 3N6HA 4GINA 4QPIB 2I07B 4BLIA 1ND3A 3NJ3A 1E40A 4R33A 2P53A 2G3FA 4AR2A 3L2MA 2QVHA 3NAPC 2FB2A 1RXOB 4EN7B 2HWGA 3PFMA 1UWQA 4CQ8A 1O8PA 2HMCA 2BV4A 4B4PA 4DJED 3E38A 3PG8A 3C2RA 3N17A 4QROA 3AMPA 4AD0A 3PMSA 3WW3A 2D40A 1UCWA 1ZRRA 4D8LA 4DHGA 4DNMA 4UOJA 5HR6A 1DJZA 2H0BA 1OYBA 4RPQA 3VNIA 3KWVA 4MH0E 4CXYA 1ZBE1 3VABA 1LLZA 3LSDA 3WQ8A 5HCBA 3UPMA 2GGGA 4K8RB 1UQXA 1D3CA 3U4AA 4Y33A 3N12A 4HNCA 3VI2A 2I5IA 2CKSA 4A7ZA 4C7GA 2ERFA 2P3KA 2A6YA 4O53A 4UQ9A 3TYUA 3FEMA 4NJ4A 3UXLA 3ZX7A 4LT5A 4F2BA 3HD8B 4B3NA 1SBFA 3LV5A 2E6VA 4IP4A 1AX2A 1DBNA 1AX1A 1Q6CA 2D22A 4GJYA 4EPKA 2I14A 1HVQA 3KOXA 2DT1A 3MIEA 1Y4WA 1C90A 4QX1A 4IUGA 1GOWA 3THCA 4JTHA 2OCZA 3RPTA 2ACRA 5KMYA 2B9VA 3BAIA 4YVXA 4X22A 3LXBA 2WCGA 1TV7A 3PHMA 3RX4A 3AB0A 3LMZA 2ZHNA 2ZA1A 1FBAA 3G5EA 1MW2A 4BPZA 1X8EA 3VBHA 1XFCA 5JZGB 5KXDA 1GQIA 5DXYA 1RUE3 2HYKA 2OO0A 2Q8OA 1R2SA 2YCLB 3NJYA 4A3HA 1M7PA 4DRVA 3A23A 4U10A 5FYVA 3IJ8A 2CHHA 2E40A 3THDA 1GZ9A 2ET7A 4AHZA 4IIGA 4CD8A 3RZZA 1ZY9A 4JTQA 1QI5A 3N9SA 3NVCA 5BWFA 3SECA 4LW7A 4LCQA 5CB7A 5F2SA 4S3BA 1UKSA 2OFJA 2ZX6A 3UJEA 5D04C 2UY3A 3POJA 7TAAA 3FC0A 1JXNA 3W20A 4NAEA 1BEUA 1ML1A 4R9XA 3G8EA 4LAKA 3KD4A 1E43A 4RUBA 3TAOA 1UP3A 1OFPA 2GSEA 2W67A 4C1NB 1B1YA 2DP3A 1V0LA 5DY2A 2XJSA 2G8ZA 3IIAA 5A70A 3UL2A 1JAEA 3KRSA 3N34A 4FPLA 3FSUA 1IEWA 1O5QA 2X2GA 3VBRA 4IQLA 2VULA 4FI9A 4HK6A 3E2SA 5AY7A 3I3BA 3ABOA 4B5WA 4L5ZA 5CSRA 2PLV3 1NX9A 2VGFA 3LB9A 3GAYA 4W7WA 3R8RA 4IETA 1QJEA 4JIRA 2OYZA 3ZDVA 1Z32X 1V6MA 2VUAA 1V93A 2VFHA 4PB4A 2LALA 4GI9A 3NQMA 4A2RA 1QQP3 1XD0A 3ANUA 3OOQA 4AI8A 4JAWA 5C2XA 5M3WA 2Z4GA 1MEC3 1DGWX 2WZMA 1P6BA 2ZUTA 4NPLA 3W2NA 1FPN3 3BZGA 1KR0A 1E57A 4AFYA 4B8EA 2ZX7A 1J0JA 4QQ2A 2HWC3 3JXSA 2FH6A 1XBVA 4KFOA 1KQRA 3O14A 3THUA 2VBDA 4AG4A 3EA2A 2WVTA 2D6OX 4E3VA 3ABQA 2CLIA 3CEUA 1J6PA 2V5JA 5I09A 2Z2AA 1HW6A 2WC7A 1CX4A 2D2GA 4AGVA 1POV0 5LBEA 4GQQA 1BEV2 1X1OA 3SNMA 5K0UB 2HYXA 4WM7B 2B8MA 1RITA 1QPNA 3A0KA 3MUZ1 4F0KA 1HXS2 4G4FA 4XAEA 4R9OA 1VYPX 4JL2A 6XIMA 3G0SA 2V0TA 3PUOA 3BG9A 2IS7A 4W87A 1V6UA 3CQOA 1W6PA 3ERPA 2V5DA 3EYPA 4M6PA 2XL9A 3ZXLA 2Y4SA 3NL2A 4LHKA 1LHVA 5FZCA 2R32A 1BLZA 2YXOA 1K5MA 2IPFA 3UV9A 1QNRA 4HK8A 1BSIA 4G7EA 4O1CA 3T4HB 3N2TA 1MQTB 4H8VA 4XK2A 2VP8A 1A80A 3KZPA 3S0MA 3LPPA 5A33B 4QLKA 1PK6C 5I3GA 1RUC2 4U2ZA 4JQ3A 4IEUA 2NZLA 5LK7B 2QNKA 1LNSA 1TE1B 3ZFEB 4D6JA 3NEVA 1CPNA 4LPLA 1F4AA 2Y64A 3VMNA 4DB7A 1TTJA 1QHZA 1V9U3 1C5IA 4PHZA 1ICQA 1XYOA 3PTYA 4M29A 3U5UA 3J7NA 3CF6E 1M65A 1OT2A 3IK4A 1W8HA 5BOFA 3CH9A 3I3EA 2EPMX 2J8FA 5F3CA 2A6VA 2C24A 3AIVA 4QQ3A 2W39A 3MPBA 3V75A 2R1DA 4RQPA 2OTDA 3IV3A 3ZIZA 1G8WA 4O11A 4HLTA 4LBOA 2EXOA 4CDWB 1I75A 8CGTA 3A4UA 2NPIA 1MNZA 1PWMA 1N82A 2DIJA 3A47A 3M44A 4PMRA 6REQA 4TTUA 1ASJ1 1OA4A 1G4PA 3N4AA 4Z17A 3OD4A 4K40A 5JIPA 1CZTA 4LFYA 4YG6A 5LCWL 1Z48A 3BK0A 3O1RA 1KGWA 3VBFC 2Y0IA 3BAYA 1Q3EA 4WM7C 4IE4A 3GNNA 2ZRXA 4N9IA 3KFTA 1LOGA 2ACUA 5AYYA 1CJPA 1S0BA 4R9CA 3Q8BA 1O4UA 3ZYBA 3CIXA 1EWDA 3GBEA 1K9DA 4NZJA 3GNEA 1Z9AA 3V18A 1YDOA 3PBWA 1VAVA 1C1LA 5CLTA 3KLKA 1HJXA 1EAH3 2WMHA 3W6MA 2ZCGA 2YSWA 1UZ1A 2HJIA 3I7RA 1IYXA 1AYM3 4WKHA 4IE5A 5DABA 4EZHA 3QZ6A 1MQTC 4OUEA 2B9UA 1AUSL 2V69A 3GHRA 3S6TA 1IXNA 4RNHA 3ARQA 1UPMB 1LOEA 1LOFA 2WJZA 3R13A 4REQA 2DBNA 3ZXAC 2FQIA 5JLVA 3ZFEC 5FZAA 3USZA 2G41A 3GZ3A 4ENLA 2D6LX 1UO9A 4AOCA 4M3CE 3Q8AA 5A6YA 2P76A 4LS1A 4LV9A 3EJKA 2F7FA 3OGSA 3ENLA 4PIXA 3CHEA 1WUVA 5GALA 3H4XA 1XLLA 1W54A 3WLUA 3CYJA 2W3JA 1RUE2 1JH5A 1ISYA 4W6YA 3G1DA 5REQB 2WS93 3OG2A 3SCSA 3USBA 1TRIA 2X1IA 3DGTA 4EK7A 1OF3A 1BXHA 2HXUA 1LBLA 1JDDA 4M80A 2NQZA 3RMEA 5EMUA 5HWNA 2GH8A 3IDAA 2DFAA 3BPWA 3SH5A 1JI1A 3KLLA 4RDWA 5D32A 1GTHA 3VBSB 2ZUMA 4NAFA 2PAKA 3QHMA 2NXGA 3E1F1 1QASA 1NCQA 2A3WA 4RDYA 3CQHA 3LTPA 3FDGA 5CVRA 3APTA 1DWAM 3WNOA 2CERA 1ULGA 2ZUWA 2G4JA 4IUOA 1UYXA 4AYGA 2Q8LA 1DGRN 5EYWA 2WWJA 1NF0A 1O6IA 1QK0A 4ZE4A 3ZXWA 3PBMA 1EJWC 4PMNA 5ABGA 1EC9A 4K38A 1TPB1 3DFPA 3AMLA 4QLJA 3DYOA 1FOD3 2I7GA 2FTWA 3VBUA 4Q4W1 4Y26A 4YVWA 4KIRA 2V2HA 4MYEA 2G5WA 3GS6A 4P00B 5G1TA 1LRQA 1XSKA 4PMYA 3ZFGC 4ARXA 2TAAA 2EXHA 3SN0A 3BODA 1ENQA 4B4FA 1UR4A 3R4IA 2ZFAA 2PLV2 5FLJA 1SEFA 4CDUA 1XIHA 2CYGA 3H7UA 4BMBA 4UTKA 5J5RA 3ABSA 4POCA 3W87A 2Y0OA 4HSOA 3UCCA 4C8DA 1HKIA 1QQP2 2X29A 3AKRA 3ZKUA 2OEKA 5CYYA 3DI1A 3WHTA 3K4AA 1W5OA 2WK2A 3ACFA 5C9AB 2I45A 2P8CA 3QYSA 1MDRA 4XZBA 2D3RA 4PBPA 1VRH1 3U7BA 2C16A 3K2GA 2QKFA 4O50A 4GD4A 2RR13 2CU5A 3AP9A 2W87A 5J98B 1GQGA 2R0FA 4HT1T 2HWC2 4COWA 1OY0A 5GQBA 1VRBA 3PVEA 5F39A 2HXTA 2OO6A 4MAZA 1S5TA 2GWGA 4JZ5A 2X0SA 3QFWA 2W92A 4BFAA 4FIQA 2DUZA 3VNJA 3ME3A 4GQ0A 3MW3A 2W62A 3ZJ6A 3R79A 2HVNA 1GICA 5TQLA 1FA2A 4H7LA 1JCTA 2ZX5A 3OA3A 4IEYA 3VZXA 1VENA 1EYEA 4FLQA 1Q6LA 5DANA 4LS2A 4RXGA 5CAZA 3JZEA 2GSYA 3VBSC 3R05A 2VNRA 4GIRA 3WBWA 4IMAA 3OTRA 3TKFA 1H09A 3DHFA 2GP5A 2EKCA 2MANA 1PGL2 3JW7A 4ITCA 4C6FA 4BHYA 3BVCA 3FL7A 2JG8B 4TYSA 4V2WA 1QOPA 3SLIA 3WQGA 3ZO9A 4M8UA 4XTMA 3NV4A 4B3KA 1DOSA 2OQ7A 2CPUA 2GALA 3ETPA 3TSDA 1IV8A 5I07A 5GJMA 1V9U2 1EP3A 4GYJA 4IV1A 4LUTA 3WBAA 1YRZA 3M3IA 4US5D 3VPLA 1G7YA 3M64A 2D1ZA 1UYPA 4DYEA 3LPGA 3DG3A 1IF2A 5FWJA 3KM8A 3UK9A 4XAAA 2WV8A 2V67A 5GZDA 1OM0A 3RNSA 1JCMP 3H1WA 4AZBA 2W08A 4ZO6A 5F3EA 3KQ4B 1BMV1 6XIAA 3KE0A 3VCNA 4CTEA 5ECUA 2B42B 4DY5A 4IG2B 2UYBA 3GU1A 1VPHA 2ZJCA 4KEZA 2AL1A 3ZJ7A 3ZT7A 4L2NA 2WVSA 4N8MA 1Q8JA 1LRHA 2A5HA 1HL8A 3V64A 1J59A 1XB9A 1Q8OA 3P6LA 3OOXA 1OFAA 3RWKX 3W7EA 2ALRA 4H04A 4IE7A 5EB8A 2QQMA 3W7QA 5C70A 3DL3A 2EAWA 1M5WA 4NWVA 4E2VA 5A6ZA 3I54A 1VC4A 3VCRA 1UX6A 4UAPA 4G5DA 1RUOA 2GUYA 3OZYA 4FXFA 1RUI1 3F4VA 3DEQA 4H8UA 3AXXA 1ZM1A 4K1GA 2FPTA 1EAH2 2X1UA 4WR3A 3T05A 1JHJA 1AQHA 1JD7A 1CNVA 3VIMA 1SFPA 4QDWA 5SWUA 1E9ZB 1AYM2 1SZRA 4L4LA 5A6BD 4JTNA 4P9IA 5LYRA 1A8DA 2JG8C 1XLJA 2Q3OA 1SHWB 1TJRA 2P10A 3FNDA 1QJZA 2HK1A 3W23A 1WMEA 3W81A 1ZBA1 3SEPA 4HPNA 4AF0B 3WW1A 1C93A 4HKOA 1EBHA 4IESA 3IAPA 3OA5A 1LEDA 2AYHA 5FPAA 3GG0A 3C7OA 1SSGA 1DF0A 5IUQA 5FY4A 1C8M3 4JTRA 3QH7A 4KGQA 3V56A 4Z1VA 1W0NA 3KEHA 4HYVA 4WD0A 3S4TA 1REFA 2OX4A 3LA2A 1SYTA 2DSZA 4NIGA 4NROA 4FI4A 5ENLA 3L9CA 3W26A 4RW5A 2WS92 1R3TA 2D2HA 2PDLA 1CECA 5AZ1A 1XLCA 3OZPA 4U2AA 4RZBA 3EKZA 1AR91 1IEQA 1A47A 5EGRA 2WSYA 1GJPA 1WW5A 1YHTA 1UX7A 3W74A 2OQLA 2FVMA 3CTTA 3NNFA 2EXIA 4LUSB 4LF1A 5L6UA 1KGYA 3JD73 2CL2A 1W56A 1DWJM 5TSWA 1I45A 2EG7A 4Z92B 3OVRA 1YBQA 3T07A 3THAA 2K2SA 2WYFA 3H2MA 5DN1A 3NQ2A 3GZAA 3WK3A 4IGQA 4KGGA 1HO1A 5H9PA 5BNKA 3B0YA 2ZABA 1J11A 1DIWA 1ZBCA 4O4WA 3PBGA 3VE9A 3BN6A 4AB4A 1ZCCA 3UVAA 1W8TA 4D6RA 2VNCA 5BXRA 4JGZC 3OZOA 5IWFA 4IFRA 4BU2A 2OLSA 4GWJA 2XIIA 5D9PA 4CD6A 1VBC3 1XR2A 2CLKA 4RPPA 1QJFA 5HJLA 2IC1A 3LF7A 1Q4WA 1V0MA 3RMYA 5LBBA 3NNLA 3OSDA 2PSNA 3W7CA 1NG0A 2OZ0A 2OB3A 3MBDA 2BJSA 2ZCWA 1A4LA 3WV6A 5F2IA 2VRKA 2ZGLA 1H1AA 4WM8B 5B7YA 3ZVHA 4K3ZA 1DJIA 3URQA 3MU7A 2DFCA 1UYYA 3CJIC 1KCKA 2RR12 1QEXA 2ZAAA 4ZXEA 4GJZA 3EB3A 4KNCA 3LZZA 1UWAA 2BVBA 2P0IA 2W0UA 2BB0A 2WMFA 1WMDA 1GYMA 1FOBA 4EROA 5FEWA 2NSOA 4Z82A 1AL8A 5CSUA 2EQDA 2XDFA 3NQGA 3GU2A 3BMWA 4N53B 2PC4A 4Z2KA 2GMMA 3ARRA 2DVXA 4LITA 5J36A 1WBJA 3FCPA 3U6WA 1UIKA 3W72A 1VJSA 1IS6A 1H0BA 1WLCA 4RSUA 5K9YA 1XYNA 3FBMA 4K6AA 2ZA2A 5CFCC 3ARTA 1NY72 1TZZA 2ZZJA 1TG7A 4GNJA 3U78A 1XE0A 3CEPA 3N2CA 3GLCA 1HT6A 2ESCA 4JTEA 4LLOA 1ITXA 1DJQA 5IBXC 4AWEA 2VE1A 3N1AA 1KFWA 2TNFA 1GT8A 5APAA 1XYMA 4CCKA 1AYN3 3M5YA 3DX5A 3GALA 3PC0A 2X5IA 2DH2A 3AYDA 5A3UA 1VJZA 3ZSKA 4HCDA 4FFHA 1RALA 1GZ1A 3AXHA 4GVFA 3TJ4A 1K9TA 4E2DA 1OUXA 1S39A 4YIWA 3W7KA 1GG1A 5FXWA 1V6TA 4HHLA 3ITVA 1W2OA 2E51A 3EWZA 3TEZA 4GX8A 1DVJA 1LOQA 3W70A 4QG6A 2HPIA 4H3DA 5LEKA 4O12A 2PHDA 3GHNA 4IEQA 1DTUA 4AQSA 2RDQA 3L21A 5GLZA 1Q8QA 3WHUA 4Q33A 3WX7A 1JYNA 1RCXB 2FBEA 2PAEA 2OG9A 3MSGA 3TN5A 2YU1A 5IJRA 1OA2A 1HTIA 4RHV2 3BLOA 5LHEA 1CTNA 3E5BA 3MP4A 2ALDA 5G2IA 3VHRA 3RX2A 1BJQA 2PQQA 1KFKA 2PWDA 2NQLA 3LY0A 3ZT6A 3F1QA 3W1XA 1X36A 1KBIA 3T9PA 2V8ZA 4HQVA 1J0ZA 4C6JA 3DFNA 3F95A 1AR61 4KRTA 4MDOA 3H4GA 1I9RA 2XONA 1D0HA 1SW3A 4WJXA 1R3VA 2BVVA 1U5JA 1V02A 1QH6A 4GWIA 2BVDA 3RJRA 1U2YA 3IIVA 4N53C 3IMNA 2BG5A 2NX3A 4BOWA 1YTKA 5T5LA 2KAUC 1FH7A 3V4BA 2Y6JA 1FYUA 4B1MA 3HG2A 3P74A 2GDFA 4UNIA 1TCMA 1TME3 4CKQA 2YGMA 3AXKA 4FR1A 3WMSA 4E0CA 3STPA 3ZJ8A 3UW6A 2W94A 2RS33 1FX6A 1EJTC 4C6OA 5M2FX 1DTNA 2HRWA 1QFEA 3SUSA 3N2OA 3CZ8A 4B7KA 4KCUA 4OV9A 1R38A 1PHMA 4K7VA 2Y6LA 3EDKA 3P2VA 3AJXA 4M4PA 3WDJA 4Z2GA 3ALQA 3P67A 4BJHA 1CIWA 5I24A 3PZ9A 5DAQA 4H9UA 2ZGTA 3M2MA 3VGIA 2W91A 1VFSA 4YARA 1MZ6A 3OQ8A 1JBCA 2VM9A 1DU3D 2PCQA 3H2CA 4JY8A 1OH4A 3H3UA 3BWWA 5F5QA 4C60A 1RPKA 3MMDA 2XKPA 3IVUA 5CPNA 2HWF1 2ZMKA 3RCYA 4WVMA 3W00A 5A6KA 1NY1A 3PJYA 3SHRA 1A5NC 4U33A 3NGFA 4PMOA 3SH4A 1RK6A 1J5SA 1R47A 2AOSA 4NUWA 3P6BA 5H91A 4B2DA 4XSLA 4B5TA 1J2BA 2OSWA 4H41A 2WQZC 1GOQA 2WCAA 1PEZA 2R49A 3HQRA 3N9QA 2NMNA 2ETEA 4ZOEA 5CIRA 1LOBA 3JD72 3LCWA 2QCSB 1PIFA 1DZRA 5MKGB 4X63A 4XTDA 3NQHA 2RDUA 3SUVA 5L9RA 1A8MA 1FDZA 3MUXA 4OI4A 2Y7EA 2BOFX 4P8VA 3WP5A 2RV9A 4CN4A 1ZB5A 3W1RA 2QQPA 2V3GA 1WZMA 4IV3A 1BBT1 3LFMA 2Y5SA 4PSRA 2GQAA 5JDBA 1FDYA 4HN0A 4AQLA 3HJRA 2WJFA 1SFSA 3NO8A 1TCDA 1PUDA 5CBBA 3VUPA 2YCKX 4JRAA 1XIFA 4IIHA 2VPVA 1N3OA 2ZRWA 1KRCC 3BDKA 3BJTA 4Q0QA 2YBPA 5CKSA 5LIWX 3IPVB 4LCRA 1OB0A 1PZ0A 4QSFA 4EYUA 1H0GA 1MEC1 2J6VA 5C3QA 3OPZA 1P48A 1UNBA 5XIMA 3AYRA 2AAAA 4LBSA 1U0AA 1RQHA 1Z7S3 4XB3A 4LHSA 4XFHA 1D2KA 4Z1YA 2PI6A 1GVRA 2YFZA 1KM2A 4JDYA 2A6NA 3SN4A 5F7UA 2PDKA 1YEWA 2PWGA 1C29A 3QPZA 5G04L 4YZ5A 3ZFFB 1GZTA 1FT9A 3DXIA 3BVJA 1BVP1 4Y96A 1TV5A 5D2XA 1VBA1 3WG1A 4JDBA 2XQXA 3QC0A 3DI0A 3WDPP 2W3ZA 3AP4A 5DQ0A 3RHGA 2HROA 1IEIA 3OUHA 2VHLA 5B4XA 3W82A 4XC9A 2QCDB 5D09A 3MYXA 2DV9A 2OPWA 4NR1A 4AI9A 1R2RA 3KOWA 2HISA 2VBBA 4ZS2A 3AISA 1JOBA 1V4YA 5FOBB 3N9KA 3TXZA 4YVPA 3WSUA 5L36A 2YXGA 2DPEA 4PF1A 3VC5A 3GHMA 2GGIA 1XSQA 1EZ2A 5GJPA 3HPAA 3CQ0A 1VR3A 2WQDA 1AYN2 1H4HA 3W9AA 3I65A 3J7LA 1POV1 2Y88A 1BZWA 2UY4A 2NV9A 1OD5A 5FKYA 5BRPA 2HVOA 5BXPA 4NJGA 5LNVA 5DAVA 3FE5A 2I16A 1KFXL 5GNXA 5FPLA 3LX9A 1IPJA 3PHAA 4R85A 4TX6A 3VZZA 3KMHA 2HWD1 3E6BA 3AC0A 4CDQB 1J79A 3W73A 3WYZA 1P0NA 1FHLA 3RG6A 1Q65A 1IGSA 5GJNA 2GC2A 4C0HA 3OGGA 5JOYA 4HMCA 2OA2A 4N9BA 3ELNA 3VDCA 3SCNA 3UPBA 1UP0A 3R8GA 1VBE1 1RAKA 5ABFB 1RTVA 1JZ8A 3IJIA 2PEVA 4QHRA 4C1XA 2POZA 1YX1A 3RN6A 1I8JA 2GC0A 1ESWA 5FY7A 1ZJAA 2GWNA 1JPDX 1QI2A 2XISA 4AVOA 4CP2A 4F3HA 1E5SA 3AM2A 2YW4A 2E4TA 4NNBA 3VZNA 3M6DA 3SIZA 4PIZA 5LB6A 4HVRA 3M0VA 3F5KA 4TSVA 1EB3A 3VOJA 1WDDA 3EAUA 5AHNA 5DDJ1 5G4HC 1F2JA 3WDIA 4J1OA 4HU3A 5K7PA 2Z42A 4AHWA 4WSJA 1CBGA 2C0AA 4CCZA 4RNFA 3CIVA 5HQEA 4BLJA 3S2JA 2FGLA 5AHLA 2OPJA 3RYKA 2YOCA 3NURA 1CGTA 1TB3A 1UD8A 4FNRA 4XSMA 4ZZ5A 1RUJ3 5AOUA 4AIUA 4PB3A 5FXVA 1ODNA 1Q6RA 1XLIA 1GOFA 1TME2 3TDFA 2HE5A 4E2OA 1R3WA 5ABJB 1FWRA 3ITOA 2E8YA 3UESA 4JFWA 4O8RA 3MMUA 3N9MA 2RS32 1AVAA 1RUD1 1XD1A 1W5PA 4FPSA 3VLBB 2PDQA 1WUFA 1PKMA 1Q56A 1FWIC 1B35A 3VX0A 5FUIA 4KL1A 2ZZ4A 2DZUA 4FOKA 1W37A 1QHPA 4JYFA 1EJUC 4M3CA 4P9WA 1OFNA 1JU3A 3TTEA 3WL1A 2Z29A 3IB3A 3LU2A 4I7UA 1O3TA 4BZYA 2WAAA 4CDQC 2RHPA 3ZWSA 2B81A 1DJWA 1LUCB 2EPHA 1NA1A 4PQQA 1CENA 1PKLA 1GVYA 3RR4A 2XIJA 1C3FA 1I2NA 1JG9A 4H8NA 4AZCA 5AC5A 3W38A 4TO8A 2E7AA 3GC2A 4G8TA 2VTFA 5DUUA 4QITA 5LIYX 4OECA 5L9VA 4PGLA 3U9IA 3VKKA 2YBSA 3BTAA 3CU2A 3MHUA 4I0WB 3SCRA 3MV01 4Y7EA 2H9AA 5D21A 3WQ1A 4BQ4A 2E7QA 3KZSA 1OGSA 3BU7A 2VOTA 1V08A 5GNZA 2ZADA 4HMDA 3LCLA 5FCCA 1Q5OA 4MWAB 2QCNA 3WP4A 1SSDA 3VA8A 1I2OA 1HQWA 1NOFA 3NO3A 1IIHA 3BGAA 1A0DA 1PZ8A 1NAL1 4D7YA 1S55A 1FOD1 5F6KA 3N7KA 3SM0A 1XH2A 1HVXA 3RZKA 1LEMA 4UTTC 1QWGA 3MICA 1H6XA 1W06A 5JMUA 4SLIA 1ISZA 3R0UA 5JBFA 1D2SA 1XUZA 4PJYA 4ATWA 4J4KA 3PS7A 3W2JA 5BNNB 5G05L 1P6WA 4P7LA 4DIQA 1SFTA 3RCNA 1OX5A 4NJKA 1SPPA 5G5IA 3LA3A 2PGRA 1E3XA 1IWPA 1SJCA 4A05A 1OFSA 1CXLA 3UXAA 2X05A 1DYSA 4PUUA 4ERGA 2HLEA 2WFF1 4O16A 1A5KC 3TMQA 1NAEA 2JDNA 4UNLA 5FF3A 4QR6A 1Z7S2 3LHTA 2HSAA 2R8WA 3W75A 3S9IA 1VP5A 2EAAA 2MEV1 2YDSA 3GTXA 1TYGA 5I78A 3S6PA 1VBB3 3OGJA 4ZO7A 4AFBA 4HYWA 4GA8A 1GOIA 2ZAHA 4HPKA 4QQUA 4OI1A 5CG7A 3TLQA 5FO7B 4Q0SA 4Q8LA 2R1PA 3WD4A 3UR2A 4JHZA 5F4WA 3KWSA 2C14A 4OHYA 4UFJA 1RUG3 1G7VA 4JNZA 3TNPB 2FPVA 4LRTA 2QV4A 1YQ6A 4JTFA 2PELA 1YPXA 5LNWA 3BOXA 1BYDA 2VEMA 3AVRA 2I17A 4A42A 4BA0A 2A7AA 1JPMA 2PURA 3WJWA 3IWPA 4AY8A 3SRHA 2XPKA 1QWKA 3TQ0A 3RO8A 3EX1A 2R071 4Q1PA 1NXMA 2ZHKA 4CDXB 3PBVA 3S1VA 1LM1A 1ZCOA 1K8CA 1DWGM 3ITLA 1ZBVA 1YRRA 3ACHA 4HA3A 4GJJA 1P5BA 1PMHX 2C6SA 3B9EA 1D9EA 2GUUA 5DUWA 1HP4A 2VMEA 1WKYA 1K1DA 1J5TA 3QV6A 4O4VA 4PBFA 3I2IA 4MXWB 3FJ6A 3SDOA 1WKFA 1OD3A 3A21A 1K70A 4ZXLA 1H2MA 1MVQA 3M0MA 1C9DA 2WNUA 4N6EA 3BW4A 3L4TA 5AKQA 2NQ5A 5FJTA 3DIPA 3B01A 2WMKA 1K12A 1VCVA 2AENA 1LGCA 3W5MA 4OHXA 1LU2A 2DCJA 2PTZA 2ADEA 1CGPA 2YDEA 1OJXA 5KHGA 3CS2A 1EJ7L 4HU8A 2UURA 2JALA 4J3TA 3RGBA 1ITCA 4B5UA 4GYPC 4ZEPA 5CSSA 2DVTA 3LFIA 4Y90A 4H7CA 3CL8A 4J35A 1H2KA 3FEQA 3W71A 5FBJA 5HMFA 2V3FA 4AC1X 4BI7A 5JR7B 4OU1A 5CU1A 2BGQA 3GJAA 2O4QA 1XIJA 1OOPB 5C7VA 4K8FA 3VOIA 2ZZQA 4A29A 4LLFA 3EBVA 4G1NA 3GVQA 1GOMA 1SW0A 2ZBTA 4JX6A 1VFHA 3T0CA 3PZTA 2G50A 3QJAA 1FWBC 4E8CA 2X0HA 1ND2B 1TZ9A 4YCOA 3AP7A 1PKNA 3FKRA 3O16A 3FLRA 1R081 3ZQ9A 1IR1A 2JKAA 3I2FA 4Q4KA 4V2XA 1RUJ2 1V77A 4B3ZA