4UFLA

Mouse galactocerebrosidase complexed with deoxy-galacto-noeurostegine dgn
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
644
structure length
641
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords GALACTOCEREBROSIDASE
total genus 216
structure length 641
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4uflA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4uflA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uflA01
1BEUA 2H8XA 2J7BA 3RNDA 1TPWA 1XC6A 5A8MA 1YDOA 3H53A 1XM3A 3HG5A 4H2CA 1Q6EA 4Z2LA 1GNXA 2Y8VA 5I3KA 1V3KA 1HF6A 3S6TA 3EMZA 1WAUA 2H6RA 3ZWSA 1A5AA 2A2IA 2DZSA 1FWSA 1AW5A 3HPSA 3CU2A 3PR2A 1RD6A 4PMZA 1G67A 2DGAA 4PCSA 2YYUA 2QV4A 4QCEA 1L9WA 3GDLA 4HPJA 2ZZ4A 3STGA 4AISA 4WX2A 3WKZA 3UG3A 1UUQA 5BOOA 1ZBCA 1EEPA 3AIUA 3AIBA 1PX3A 1TV8A 5FKCA 3AMDA 4N6EA 1E43A 5LA2A 4K68A 5CZJA 1VR6A 5G2IA 1F4AA 1UH2A 4MDOA 3WQ6A 3WFZA 2ZA3A 1QMLA 1YXCA 2OLHA 2ZZ2A 1EIBA 1TYGA 1O5KA 1V0KA 3W1QA 3KL0A 3LLDA 3RJYA 2PCQA 3O07A 1Y7VA 4YHGA 2EPHA 6TAAA 3M6YA 3SCRA 1Y4WA 1ISVA 4LU0A 4BCEA 3LM7A 1VBRA 3KZSA 3UPWA 3SR7A 2IXUA 5I3IA 2D3NA 1JCXA 4N2YA 3MI6A 5LGXA 3SGUA 2CETA 1F5ZA 5DF0A 3UY8A 3OLDA 4JYFA 1Y9MA 1DWJM 3AIQA 3OG2A 3TU9A 2BVTA 3SIZA 2XPKA 4M82A 2ZICA 3MWAA 3P84A 4S1FA 2CHNA 1VC4A 5A6LA 5D33A 2OWXA 3A47A 1QFEA 4PN2A 1Q6OA 1QNRA 2RGMA 4WLCA 5GNYA 4IM4A 1O6IA 3GIYA 1EO5A 5AN7A 1E4LA 3NAVA 1BVNP 4HN4A 5K4XA 3LRLA 1KGUA 3UWYA 4GZEA 4XV0A 3NGJA 1TPUA 1KTCA 1CXFA 2XVKA 3UCQA 5DY3A 2D73A 5BRQA 3LTSA 2XWDA 3DFNA 4IGHA 1G0CA 3SY5A 3LCWA 3FKKA 3CEUA 4XUYA 3RM9A 6TIMA 2CKRA 2VUYA 3R12A 3CBWA 4LS1A 3A5FA 1YQ2A 3KWXA 3TTYA 1EPXA 4PH6A 3A5VA 3I68A 5JBEA 1W3IA 4FXSA 3PWAA 5M03A 3VIIA 2DSZA 2WYSA 2VFEA 1JUKA 5EKYA 1OM0A 2NLIA 3MSGA 2CWNA 1LDCA 4MY1A 3VMOA 1FXQA 1OFOA 2C0HA 3BXWA 2VR4A 4NU7A 2IXVA 4NX5A 4MADA 1UUMA 1W3NA 3BLIA 3WNNA 3U5YA 3TC7A 1P1XA 2BV9A 3OGRA 5FD0A 3K4DA 2EEXA 1YDNA 3HF3A 5CZSA 4AMAA 4CD4A 3IVUA 1F05A 1SR9A 2G96A 2WZHA 1HVXA 4MJZA 3L0GA 3QQ0A 5D2WA 1TPEA 3O2LA 4P8UA 1QO2A 2VEPA 3MUZ1 3VD9A 5LNSA 1LOQA 5AC4A 3B8SA 3TW6A 1BHGA 2V3FA 1DHKA 2EKCA 1QNQA 5G4EA 3RCNA 5A8QA 3AIEA 1OK4A 4GBUA 3GDTA 2X1IA 3F4VA 5M3WA 3NO5A 3M9YA 1R30A 4UNIA 4CQ8A 1E6SM 5DCDA 1KBBA 4MNJA 1LF1A 3IMMA 1V02A 3K30A 1TREA 3UZ5A 3HO8A 4JFVA 4FLRA 4Y9AA 3LTYA 5FEPA 1KQZA 1VB9A 1HP5A 4K36A 1PHWA 3WDIA 3LHVA 1JXJA 2CYGA 3S8HA 4R5EA 5E93A 4DF0A 5IBXC 4UTLA 3T4CA 4YLWA 1B3WA 1OF6A 4CNOA 1QW9A 4ZMGA 3GBEA 3QR3A 2VMFA 2AQWA 3MMWA 3WK3A 1FP8A 5IHRA 4CD5A 1XCWA 3CMGA 2Y62A 3QW3A 1MEIA 5A6KA 3N15A 1JYWA 4K8EA 5HBFA 3S1UA 4AH7A 1PX8A 2QCCA 4NJJA 1G4TA 4QNEA 5I3GA 3C56A 1G01A 2PF0A 4U2YA 3AIVA 1H61A 3KX6A 1XSKA 4D6EA 3E1F1 4J7RA 4RL3A 4ZQNA 1H1ZA 2G3JA 1CXIA 3AYSA 3T55A 1W91A 3LXBA 2TPSA 3FY1A 2A6LA 4UR8A 3KL5A 1Q6RA 4PEKA 1TZ7A 3K8LA 1JZ8A 3OVPA 1PAMA 4NT0A 2UY2A 2PWFA 3S1XA 3WJZA 3ZQ9A 2WLZA 5SWUA 2DT2A 2XM2A 1TJRA 2G5WA 5CZ0A 2F2HA 1IXNA 3QYQA 2X2GA 1WDSA 3BH4A 3CLMA 3LDRA 3U14A 3GXDA 3AZSA 2W0UA 1O60A 1TRDA 4AVFA 2GDVA 3DC0A 1FX6A 4CN4A 1ZHAA 4ORMA 1QWGA 4WY0B 1V3JA 3U2OA 1H50A 1E6NA 3CUIA 1B3ZA 4POCA 2WWDA 4F9JA 4W8LA 3W6MA 5I24A 2QQWA 3JRKA 1HJVA 1R8LA 2XN0A 5ABFA 4AD4A 2O7SA 4N4QA 4CN1A 5C54A 2V2DA 1PIGA 2D1ZA 2OSXA 3KF5A 1LTDA 3CHVA 2VURA 5D4YA 3OEXA 1JQVA 1Q6CA 1TCDA 3Q37A 3W86A 3ZR5A 2GPTA 4K6AA 4W93A 4KFNA 5LGZA 1J11A 1BTCA 3TK7A 1VHCA 3SCTA 2WVSA 3QRHA 2FTPA 1GOIA 1DQWA 4W87A 4B3KA 3O9NA 4NF7A 5LNRA 5CSRA 4O1CA 4PL2A 3LGEA 1OGBA 3WD3A 4UTHA 1KLYA 3T2PA 1L6YA 4QM1A 1NWTA 1I2RA 4Y8FA 2A5HA 1KM0A 4YL2A 1NM9A 1V6UA 3EKLA 3NDOA 3W85A 1CGYA 1XHGA 1W3HA 3CUHA 3CZKA 4KGJA 3ARUA 2QJHA 2Y63A 4FFGA 5BXSA 3W9ZA 3CLWA 2AGKA 3P80A 3G22A 1LLOA 3C3NA 5FL0A 4U4MA 1N8FA 3UWWA 2ZX8A 4O13A 3QEZA 3W1PA 2GQ9A 3INPA 1QNPA 3UY7A 2CERA 4DBEA 2E8ZA 2Z6JA 4IISA 4RE2A 2GVLA 2YCEA 3SSJA 1UKTA 3NOEA 4AHPA 1V3HA 4O16A 2D0HA 5L6UA 4OBTA 1QPKA 3BAXA 1H1NA 3CUGA 4AWTA 1LBFA 2RDUA 3QM3A 5LA1A 3MHGA 1US2A 3BPWA 3GLCA 2O9TA 3AMCA 4K37A 4ZFMA 1CXEA 5CG7A 3ZFHA 3N17A 2Y85A 7TIMA 1PCWA 2NUYA 1OBAA 4MYXA 4TU1A 5LNUA 2ZZ5A 1M03A 3UETA 2B7QA 4PUDA 5DY2A 5I3JA 4CU8A 3CIWA 4JYDA 5D9PA 5MHBA 1GZGA 1S5VA 4MLRA 1D7FA 2E6AA 4D1JA 3PBWA 1UKQA 3W29A 4CN6A 4UFJA 2GOUA 3I6RA 1GQIA 1CXHA 5BXTA 3UGGA 4GWEA 5KZ6A 1G69A 2PC4A 3LCHA 4IUOA 1W1YA 4XX6A 4AD0A 3BLKA 3WQ8A 3S6DA 3VD5A 5IFTA 2W91A 1KFLA 1KM5A 4ORIA 1NP2A 1FDYA 1YADA 4UMAA 1KM2A 4ZQPA 1UWTA 3L4WA 5M5DA 3BLEA 4MZ8A 4LV9A 5AYYA 3RM8A 3VCRA 1CXKA 1L8NA 2WMJA 4LX4A 2W92A 2J9XA 1OABA 2OWWA 1DWAM 5E0CA 1BYCA 2GJXB 4BI7A 3MYPA 4TX8A 4IPJA 5K9CA 3TCEA 3A4WA 1HO4A 4V2XA 1VLWA 5FMCA 3L21A 1PIIA 1UH3A 4PRWA 3VTRA 3F03K 3ATYA 4B3LA 4L4MA 1Q6LA 4LUIA 2FHFA 1CGTA 4PMNA 4UMBA 5A6MA 1SW3A 3LPPA 4BQ5A 2X30A 1LQ0A 1H49A 3UEQA 1ZBWA 3POCA 4JD4A 1OSEA 4LTSA 3B8DA 3R8RA 5K7JA 1H4PA 5HXMA 2OSYA 1X8FA 3DAQA 1K8YA 4TIMA 4AWSA 2ZRXA 4MAZA 3VNZA 4E8DA 2QCLA 3WH8A 1BG9A 1MWOA 2ZYFA 3JS3A 2V81A 2CITA 3HOJA 5BRBA 3W1XA 4WF7A 3EWBX 2DT1A 4FIRA 1XD1A 4W85A 4ACZA 4E2OA 1TTQA 4FNUA 2ZTKA 1WZAA 1B4EA 1TTJA 4M19A 1HNYA 1UD5A 3RO8A 5HQEA 3S5ZA 4A22A 1LM1A 4MKNA 3PZ9A 3GNDA 4A2SA 4NVTA 3PZMA 2QHAA 4B15A 3TIMA 1XH2A 4O57A 5DBUA 1CGVA 4S3KA 4R34A 4ZQRA 3TH6A 2EXOA 1H62A 4JTLA 3ALFA 3NJ3A 2DDXA 1AW2A 2DEPA 2Y88A 5D02A 3HGSA 5AB3A 4QP0A 3PSWA 4DF1A 4GUIA 2YA2A 1ICSA 3S42A 1W2TA 3VU2A 4MAVA 4J28A 5F1VA 2VX7A 1HG3A 1SO5A 1LBMA 1ESWA 5AC5A 1X6UA 1MYRA 4FNSA 5EL1A 2YYTA 1KXHA 2GVYA 3WQ4A 3CT7A 5A1AA 2EPOA 1W9VA 4M24A 4AD3A 3TSDA 3SUVA 3WN6A 3VIMA 2WANA 4QITA 3STFA 4AWEA 1H09A 1H11A 2JIWA 1WOBA 4M6PA 4UZUA 1VHNA 4XKYA 1M7XA 4NJHA 2V5LA 5CPMA 1C29A 1P6WA 4PMVA 2QUVA 3M43A 3NUKA 4N02A 1G5AA 4CLMA 1NOFA 1W3TA 1RQEA 2QDHA 4JN6A 1ECEA 1IGSA 1S5WA 4JKKA 2R91A 4LV4A 4FNTA 5JUVA 4FIQA 1W32A 3GYCA 5A8GA 4HA4A 1MZHA 3B06A 1ODZA 3NL6A 3SUSA 2WOQA 2J6XA 4LVGA 4MNLA 1NEYA 2QCNA 4MYAA 4CQAA 2VT0A 3FHAA 4Q7NA 2ZXQA 1JYVA 3PVFA 2WC7A 1KQYA 1B2YA 3WBEA 4LYPA 2NX1A 3VVGA 1AK5A 1E70M 1KM3A 1J0ZA 1GOKA 1YTDA 1JF5A 4YHEA 4TX9A 1UR1A 3UXDA 4Z2HA 1WV2A 3TNOA 3MANA 3S5NA 4JKLA 1QI2A 4ML9A 3THAA 1H1YA 1H2JA 3KHJA 1JZ6A 1G7VA 4E2BA 3POHA 2OT1A 5HNRA 3PB0A 3M7SA 4XUGA 1Z42A 3GAYA 4HTYA 4AB4A 4Q4KA 3AJXA 1O7AA 4B9YA 3AS3A 3MUAA 3PZVA 4ATDA 4HNNA 3PUOA 3IIZA 3QFEA 5I77A 3W73A 3UG4A 2V30A 4V28A 1CZ1A 3WQWA 3JUGA 4UQBA 3HBKA 1LLWA 1KFCA 2DZWA 3LCFA 3N2MA 3W7LA 3LTPA 4CCCA 1W8SA 2WV8A 2J79A 4JX4A 2XHYA 1C7SA 3DBPA 2F61A 3T09A 1RP9A 1N55A 4UTWA 5FEXA 2J75A 1XCFA 3B4UA 1GVYA 5D30A 4O1BA 2VZOA 4PTVA 2Y4SA 5CSUA 4LVBA 3GYEA 5K3VA 2E5CA 3AMKA 3CHFA 3ALGA 1LORA 1LG2A 2J8FA 3W7KA 1XD0A 2ISVA 2EGZA 2XIIA 1PVNA 3M7WA 1SUXA 2E1DA 3GBDA 1E6RA 5FF0A 1OFQA 4JYEA 1E0VA 2GSJA 4DWSC 2BY1A 3I3BA 1JD7A 4UTTC 5CGMA 3C8FA 3VNDA 3WF0A 3CZEA 3KVLA 3L4VA 4A4AA 1K7XA 2GJXA 2VZVA 3WH9A 2ZDRA 5K4ZA 1GVRA 5D2TA 1L6SA 4BWLA 2GQAA 1KGWA 2VC9A 1NARA 1PHQA 1NH6A 2VFHA 3ZS4A 3IRDA 4OV9A 2W66A 1OD0A 1TQXA 1TJPA 2E5DA 3FA5A 1IT0A 1OD8A 2RDWA 5DT5A 2DZTA 2GDUA 2YL6A 3GH5A 3SUWA 2RHGA 1ZENA 2XFYA 3SCWA 3SFKA 4BQ3A 1VAHA 3MMTA 5CZKA 3BGJA 1YTEA 1VS1A 3TJLA 5G1YA 2Y61A 1TUXA 3TONA 2NUXA 3MBDA 4MIMA 1KR0A 1AVAA 2LLEA 4N0RA 2DQXA 1QPNA 1P0NA 3GK0A 3WNMA 2WMIA 2DSUA 1CWYA 5I3FA 4RXFA 2CIPA 3HMJG 3P67A 3GNPA 3VIPA 3AHXA 2FDMA 5FI8A 1KR1A 4YPJA 1Z44A 4IMEA 2DSWA 5C55A 4WJXA 1VBUA 2DPEA 5ABHA 1KW1A 2XIBA 1XDMA 5CG0A 5I23A 1GCYA 5U7SA 3FLUA 2WQPA 4ZENA 1QI3A 2WHKA 1JUBA 4U28A 4QIUA 3RLUA 5D2VA 1J2WA 3WJWA 4W5ZA 4IMCA 3LXAA 3NPVA 4NI3A 1DTUA 1EP2A 5CPQA 3WDHA 4UTKA 4Z2GA 3CTLA 4D2JA 3IGXA 4X2RA 5IXEA 1A5SA 4D6HA 1RQBA 1CPUA 1OT2A 5F4XA 1I2OA 3PZGA 3P74A 2ADDA 2FPYA 3HPXA 5C2XA 1ZBKA 2VZUA 5HULA 4WK9A 3MP3A 2J8GA 3BV4A 1OFRA 3W74A 4X9YA 2A3EA 4B1MA 3HGRA 1ME8A 4GO8A 1CLVA 1B3XA 2WMHA 2EQDA 4LVDA 1QOQA 3TKFA 3PZIA 5HPCA 2Y7DA 3EX4A 3SGZA 2WVVB 3SZ8A 4UTUA 3ANYA 5I3DA 2VR5A 3IV3A 4N9DA 1HL9A 3W72A 3N3MA 3BG5A 1XUZA 2C19A 1RPKA 3LCXA 2UY4A 1C3FA 4MFDA 2ZUWA 3N73A 3EX6A 5F2MA 2OX1A 4TMBA 3LV6A 2Z2UA 1IF2A 2H90A 4RZ4A 2W6RA 1J0HA 4N4PA 3P62A 4XKYB 1EDQA 2XYLA 4N9CA 4CD6A 2XFFA 3EXRA 3UERA 3CIVA 1OX5A 5AYBA 4JY8A 3U5UA 3T0BA 1PV8A 2OYLA 1I1XA 4FHAA 1JI2A 2QF8A 2RGLA 3MUIA 1T8XA 2RDTA 1ADOA 4P8WA 4WXZA 1I2QA 4C7FA 2NXGA 1MXDA 2VFIA 1JDDA 3DFTA 1MW0A 2E4TA 2VX4A 3F5JA 3L65A 1DWFM 3L0NA 1W3JA 2H3BA 3R5EA 2WHMA 5E1QA 2BXYA 1XL9A 2A0NA 3S5QA 3KVKA 3MI2A 4CNNA 3NSMA 1VZWA 1CTNA 4WIWA 1XGZA 4PMUA 1SFJA 3WDQA 3HG3A 4BWLC 2GJPA 4JTEA 3F5KA 4TMCA 2VRJA 5A95A 3JR2A 1EDTA 3EDKA 5JBDA 2FHBA 1LCOA 1CXLA 1JNDA 3GX9A 1FCUA 2IQTA 5BNKA 1SR0A 4FNQA 4RR4A 2E5BA 2WHLA 3C61A 4S3JA 2ISSA 3AICA 4TTUA 3NPXA 2GJRA 3L0KA 2ZUUA 3BMWA 5ECUA 5CPTA 4HSNA 2FHCA 3OLIA 4R33A 3PBYA 3U6WA 1KLZA 4RCXA 2YLLA 3DECA 5A8PA 3U57A 1V6WA 4Z1DA 4GFSA 1GJPA 1QO5A 2Q8ZA 4JNMA 4JIQA 3SEPA 3TQVA 1RR2A 3WNOA 1WXJA 5CZTA 3APGA 3C2FA 3M0ZA 2YGYA 1TQJA 3A22A 1K9FA 1UWIA 4ZE5A 3P81A 4BR1A 2J7DA 2W79A 1AQHA 3W22A 1TPFA 2YJQA 3U7VA 3BAWA 3SW6A 1KFEA 1V7YA 3NYZA 3IIPA 4OGZA 3BVJA 3W7CA 5KZEA 3EDEA 1VJZA 2PI6A 1Q6QA 3M47A 4K7VA 1HL8A 2W62A 1ICQA 1LLZA 2V38A 5CSYA 3FYPA 1PBGA 4U3AA 2PBOA 4XZBA 2F84A 1UA7A 1CBGA 2Y89A 2X1UA 3W07A 3N12A 2X0YA 3EX3A 1O5XA 4NNAA 1EP3A 2NT1A 1E6XM 1UZ1A 1HJUA 3FYOA 4M29A 3SCOA 1MQPA 5IFPA 4BF7A 1OX4B 3WK2A 3OGSA 1F76A 3QOMA 5ABGA 4PTNA 3AMLA 3VIGA 1J10A 3G1VA 3UESA 1EHAA 4JFTA 1S3HA 3W76A 2AAAA 1FFRA 5F7UA 2C14A 5KMYA 1QHPA 4HP5A 4RE3A 4LW7A 5BYWA 4GIAA 1ICPA 4U3CA 4OBSA 1BPLB 1C9DA 3CM4A 3WBAA 2ZFAA 1V6YA 1THFD 1HKMA 4EE9A 4A3YA 1EDGA 1Q6FA 4S2BA 2C7FA 1GOOA 5HDRA 3B9DA 1W31A 4JHZA 2YL5A 2B0MA 2CEQA 5LYRA 3NZRA 1UD8A 2FLIA 3LDVA 3VKKA 4AIOA 4KFOA 5DCEA 5HMSA 2EO7A 1W9PA 1KCKA 1H7NA 1E4NA 2VVSA 3EBVA 2J7GA 3O6AA 4JFWA 5KITA 2WMIB 3LHZA 3CC1A 3GXNA 3O05A 4O28A 3AIWA 3HB9A 4DEFA 5FKYA 3S1WA 3ZO9A 2DT0A 4JEQA 1GVOA 3OBAA 1F4HA 1GVQA 1VYSX 1MW1A 1W9XA 2BHUA 1FBAA 1LL6A 1P5BA 4AZ7A 2EAWA 2ZRYA 3IIOA 3LCGA 1FWWA 1JZ2A 1ML1A 1VH7A 1EIXA 4MJMA 1UKPA 5A69A 4P7NA 2ZUTA 3QJAA 2VI0A 2V82A 3BAKA 5AC8A 1JCMP 2DSKA 1F2JA 3KEHA 3O6YX 3KXQA 4O0KA 1QI5A 4X0VA 2OT0A 3FJ6A 1TVNA 4X9SA 2DSVA 4RE4A 1GJUA 4HOZA 4YWIA 2XGBA 2BZNA 1HP4A 2ZWYA 5GNXA 3G0XA 5DLCA 2D0GA 4IMDA 3EB2A 1DKWA 3AHTA 4K38A 2VCCA 2D24A 3TMQA 4NQ1A 2WSYA 1CIUA 3H55A 3C2VA 1EH9A 4Z1AA 4UQDA 1M01A 5AFDA 3EXTA 4NRSA 4P7OA 3K46A 3GR8A 3U1XA 2BY3A 3KOFA 3KL3A 5BROA 1E9LA 4JTFA 1NWSA 2YLAA 4AIUA 4BI5A 2FFCA 3VIJA 3G3DA 1GPWA 3G0UA 1H7OA 3N9SA 5FF7A 5BMXA 3LMYA 4MDPA 5A2AA 4MY9A 1JD9A 3WMSA 2V2HA 1BKSA 4OHQA 4I7UA 4Y6GA 2ZZ6A 5ABTA 1UBSA 4YXGA 3PF3A 3TFCA 1HKIA 1CNVA 1V03A 2WHJA 4FX7A 4MOZA 2E8YA 5GVJA 1LWHA 2G8ZA 4JTGA 3UGHA 4GKLA 4IUGA 1B30A 3QHNA 1EUAA 1LRTA 2VCAA 2BHZA 3M16A 1US3A 1FDJA 5DEZA 5FF2A 3BARA 2NX9A 1OIFA 1UWSA 2A21A 2J47A 5EY5A 3RU6A 3W7JA 4O52A 2JF6A 2W61A 3I3DA 5JIWA 1VEPA 5BRPA 3KRUA 2YBUA 5AHFA 1OX6A 2JKPA 3KVJA 1QCWA 3PZUA 5G5IA 1F6PA 2NWRA 2CZ5A 3UZJA 1L0PA 1UR4A 4W88A 2DZPA 3T08A 3W2NA 3W26A 3NM1A 4EKJA 2C0AA 1X1NA 2PRHA 4A2RA 3WH6A 4OBRA 3DI0A 1VPXA 4AMCA 2CZEA 5LKYA 3OIXA 4OUEA 1KXVA 4M6QA 2WZEA 4W8AA 1XCXA 5GQBA 5D8ZA 3ZR4A 1CGUA 4JS3A 1FH8A 4XZWA 1G4SA 1CX9A 1JAEA 4NXSA 1GJWA 1BGAA 2ZTJA 2QR6A 4LUJA 2JBMA 5I3HA 1FA2A 3TQKA 2JALA 3IK2A 3NQMA 4WUIA 2C18A 5D9NA 2YBTA 5F2LA 2J7CA 4JFSA 1UA3A 3AHZA 4ACYA 5I0DA 3A4AA 1VQTA 1ZS2A 1H60A 3VFLA 4U33A 5IHSA 3NVTA 5E70A 3CUJA 4Z1CA 1XKYA 3C2EA 4MVAA 3HGOA 2QQVA 3HPZA 3CHDA 4FLQA 2QCEA 4AF0A 4U5KA 4J3VA 3ARRA 3ZT7A 5J5DA 3HG4A 1D3HA 1JCLA 2VO5A 1H7XA 3D0CA 5AYZA 5LHEA 3P5YA 4ICNA 2NXIA 1UD6A 3AIRA 2WMKA 3EDJA 3I3EA 4FK9A 3CZJA 1ZJAA 3E02A 4NZJA 2ZRVA 3W70A 3L68A 1PIFA 4MFEA 5C71A 2GVGA 5CLTA 2Q3RA 2NXHA 3NQAA 3OIHA 4MJ4A 3DHPA 3AHVA 4PTXA 3VX1A 2CNCA 4FB7A 5CPSA 1D9EA 3DKLA 1MO0A 3G6LA 3RIKA 2NUWA 4HNUA 1E72M 4XB3A 2CCRA 2ZE0A 1LOSA 1LP6A 1WOAA 3W7OA 1FOBA 2CLLA 3MO4A 2PC8A 4X0NA 1U83A 4X22A 4EOUA 3W4RA 5FMDA 2VX6A 3VO0A 4NJKA 2ABAA 5L9FA 2X1TA 4GC4A 5CXPA 4UCGA 3L2LA 4W7UA 4JAWA 4LC8A 3NXFA 1E56A 3VNYA 3I7SA 2A3BA 4H8HA 2FDSA 3DGRA 1C8QA 4UQ9A 3AYRA 3RJXA 3EX1A 4NXKA 3P7YA 3HG2A 3DENA 4UFHA 3EX2A 4W84A 1CENA 1RP8A 1W2PA 6CGTA 3GH4A 2PWEA 2W5FA 2ZQ0A 1GTEA 4DELA 2CLOA 1O94A 4A29A 2CPUA 3C0JA 3GXFA 4Y7EA 1JZ4A 2GFTA 5CGQA 2ZUVA 1K02A 3PBGA 2Q3OA 5G1TA 1PZ3A 4Z0JA 3G1DA 1V02E 1I45A 2DU2A 5I2UA 4MNKA 2CU0A 4E4PA 4FO4A 2E6YA 4B1LA 1UR9A 3HJZA 4TVCA 1XDLA 5F1UA 3ELFA 4ADTA 3EWYA 2PBGA 2A7RA 2E9LA 4DWSA 2X8RA 2X1SA 4IPLA 1HVQA 2YFNA 4AZCB 4FMVA 1C8VA 3MW7A 4C1KA 3DHUA 4JCMA 2HISA 4O8RA 3VINA 3R89A 2H8ZA 1KA9F 2ZZ7A 3BSGA 4FF5A 2Z0IA 4O1DA 2WKJA 2O9RA 3I7RA 5K2ZA 3EDFA 3WEOA 3BAIA 3DFQA 1VFUA 1S46A 4UNLA 3F5LA 4QJ1A 5HOSA 1K9DA 2HSAA 4XQ6A 4UCFA 4HT3A 2QMJA 3ZJKA 3NQEA 2FPVA 3FXYA 4MB4A 1W1PA 1WZMA 3QZEA 2WVVA 1TIMA 4JX5A 2BXVA 1ZL1A 1MXGA 1LYXA 3GVGA 2IUZA 1S5TA 3WD0A 2ISWA 1SO6A 3S0CA 2Z1SA 3ZT6A 1WZLA 3L4ZA 4HA1A 1BWLA 3IVSA 1JCJA 1LJYA 4L4LA 4N6FA 1I2NA 3HQ1A 2XN1A 4O18A 2WCSA 4F66A 2PRMA 4OV4A 2ZUNA 1T96A 2J9ZA 1UG6A 4BQ2A 3GZ3A 4X3ZA 1G9HA 1UQYA 3LCLA 3PULA 1HN1A 1NF7A 1VFFA 1OFBA 4CD8A 3VGEA 1FHLA 3W7GA 4GUJA 1EXPA 2A3CA 1W1ZA 5HJLA 2CLMA 4F9DA 4WXYA 1SO4A 4R53A 1EWEA 3ZT5A 3OZPA 2WWCA 3WMBA 4DM2A 5DMYA 3NQVA 2BY2A 3PBVA 5JIPA 2V0TA 4AZGA 1JCYA 3IVTA 3W88A 3DHDA 5FESA 4EANA 3PUEA 3G8EA 3R13A 1G94A 1H41A 5AYIA 4UFIA 5BMWA 1ISWA 1HKKA 1SZFA 4DWSD 2JEQA 2OWCA 2Q8XA 1XBYA 4UOQA 3FFSA 1XH0A 4D6DA 1PPIA 4FNPA 4C7DA 2PWHA 1GHRA 4WKAA 2X0HA 4IWWA 1EO7A 3WF1A 1HIZA 2R8WA 3EMCA 4W7WA 3II1A 5A6BA 3BW4A 1JUEA 3W1TA 1TV5A 1NP0A 3DI1A 1K8ZA 5D9OA 4AXNA 2X05A 1GQKA 1E0XA 2CBVA 1WYIA 4TXEA 1HO1A 3ARSA 1GOMA 4RK8A 3TROA 4CUCA 3PM6A 5F4WA 3N9KA 3NEVA 5FK8A 2JK2A 3O06A 3OA3A 4Q33A 1QHOA 2CZDA 3W28A 2VEMA 1Q6GA 1UB3A 4OZOA 4R27A 2XSAA 2EF9A 3W53A 5FMBA 2VQUA 1GVIA 1E3ZA 2BSLA 2YIHA 2Z6IA 1B3OA 4TOQA 2XFWA 2X16A 2GQ8A 3BW3A 2VKZG 2E3ZA 4LY8A 1BWKA 1N82A 1BYAA 4H6KA 5CPOA 2VRKA 2WNZA 1QPQA 4LVFA 3WENA 3C52A 1KXTA 3CMJA 3VX0A 2NV2A 1GVSA 1SZNA 3RK8A 2J24A 1DL3A 2O9PA 1FWNA 1PL9A 2FIQA 1W9DM 4R7JA 2QJGA 3MV01 4W7VA 2YOCA 2HVMA 1WZKA 3LRKA 2WNQA 2VVNA 3T7VA 4CU7A 2QDGA 4MLJA 4B5NA 3SCPA 4AZ5A 2F7FA 3KRZA 2HS8A 1OF8A 1E1FA 3PSVA 3PIGA 3ECQA 2BLEA 3ARQA 4HSOA 3PG9A 1TRIA 2E77A 1TTPA 3G1XA 4D6GA 4LGXA 1ME7A 3J7HA 3W3OA 5BCAA 4JTKA 1OG0A 3OLEA 1DWIM 3IANA 1EX5A 1O95A 1LL4A 3NQFA 1R7AA 1TVPA 3UR7A 1GQNA 1UASA 3UG5A 5IBXA 3VOCA 1EB3A 4BI6A 3W0KA 1SQ7A 3UPBA 2VXNA 1XXXA 3PHAA 3TTQA 2WXDM 3GNRA 3WMCA 1JYNA 1RQHA 1D3CA 2CLEA 4TUFA 4QFUA 3PTKA 4ZXLA 1KFKA 4GINA 2ZX7A 2ATMA 1L6WA 5G2HA 4HXCA 3L66A 3W1LA 5DELA 5AHLA 1FH7A 1UD4A 1UHVA 3WQ5A 4D6FA 4DUWA 3IIVA 3K4AA 3I7QA 4P7LA 3GKFA 2XN2A 5A6AA 2I1OA 1KBIA 1HUVA 1FWRA 2A1YA 1UUOA 2A85A 2WO5A 4O17A 1V6VA 3AXIA 2E09A 3WDJA 3TSMA 3LHTA 1ZBVA 1UYPA 4O4VA 9CGTA 1HT6A 1FCBA 2ZXDA 3MMDA 4PMXA 3TX9A 5K9DA 1UKSA 3W7HA 1DOSA 1M5WA 1HL2A 3DXIA 1JGIA 3VDAA 1JFHA 3THQA 4PC8A 1WCGA 2BWGA 1BVZA 2X2YA 4MB5A 1EA0A 3SCSA 1TO3A 3VIHA 3T2QA 4W86A 1R46A 4DO6A 1QBBA 2TAAA 4LYRA 3HBLA 3EKZA 4QHZA 4LS2A 1GOWA 2AEZA 1ZJIA 1JFXA 4WKFA 1HKJA 4AEOA 4P7QA 2QCGA 3LCIA 3G3MA 4G1KA 1CGXA 1ZJBA 3ARVA 3VMNA 4WQ6A 2G97A 4IMFA 2YX0A 1E15A 5ANNA 3THDA 3RPMA 3U75A 1PE1A 1UOKA 3IJ9A 1G1YA 2GK1A 5EBUA 2FGLA 5GPRA 1NSJA 4O54A 2AAMA 1AMYA 1UR0A 4RJEA 5HUPA 1WP6A 4AY1A 3W38A 3ABOA 1DWGM 4MPQA 4RZ5A 5DBTA 5D05A 3W1RA 4DPPA 1J0IA 5CKSA 1MEWA 2YSWA 1A53A 4PL1A 4FX8A 3WK1A 5C6MA 5KSWA 1UQZA 4NNCA 4BQ4A 3BCDA 3M1ZA 3NQ7A 2YPIA 1GORA 1QVBA 2XGIA 3QPZA 4J3UA 4W8BA 4EAMA 3MKKA 3VPLA 1T0OA 1OYAA 5FIPA 2FH6A 6ALDA 5E0KA 2WZIA 4D71A 2C8NA 1CYGA 1JULA 2RKXA 1P4CA 4MZYA 3M41A 5A8OA 4AWUA 5DXYA 3F4NA 1KB3A 2R14A 3RFAA 1ST8A 3L5AA 2ADEA 2WCGA 4HKPA 3TE9A 1GONA 2BS9A 4Q22A 1TV7A 4UTJA 3G1AA 3B0UX 3E9AA 3RMJA 3STEA 3AXHA 5A6JA 2QCFA 3O63A 3SCUA 2BTMA 2OSWA 1J5TA 1LRNA 4EF9A 4AHQA 3A21A 2MANA 3NQGA 2J62A 4LXFA 1O4UA 1V5XA 1ZAIA 4ZQCA 3CZLA 5D8WA 1JQXA 1CEOA 1DQXA 1W5MA 2ZXAA 3BG9A 2WPBA 1UR2A 2W4XA 3IJ7A 3K8MA 1PEZA 4JCLA 1KGXA 3GKAA 4AZIA 1ISXA 5FCZA 3UNDA 3W2KA 3QSTA 1MXSA 5CSSA 2EBNA 3QMSA 2Y7FA 4UR7A 7CGTA 1UKOA 3AQUA 2DH2A 3TW7A 3B0PA 1OK6A 3H54A 2C16A 3VIKA 5DXXA 1E3XA 2EPNA 5A3HA 2V5DA 5M17A 3MBFA 3AXXA 4PMDA 1KFJA 4H8UA 2FPTA 1E55A 4GXMA 4AIEA 4IPNB 1C8YA 2J7EA 1F73A 4JY9A 4JDBA 4LT9A 3V1PA 3MMUA 3VDCA 5D9MA 3W2UA 1GG1A 2CLIA 3FKRA 4PMQA 2NSXA 3NL2A 3OHIA 1RD5A 2QMKA 1SYTA 5AHMA 1X1OA 4GRSA 6A3HA 4CCDA 1KV8A 1E4IA 1DORA 4ZE4A 1JYXA 3LIGA 1SFSA 4UUIA 3PN8A 1WNOA 1KWKA 3ZR6A 2A3HA 5EFDA 4D6IA 3QHOA 4ATLA 2VEKA 1CW2A 2VQTA 3BSHA 3WELA 1B3VA 4P2VA 1CDGA 1UWQA 3CWOX 4NZFA 1C93A 1XBXA 4ACZB 4CD7A 5EYWA 1QNVA 3LRMA 2Y8KA 1VJIA 1FH9A 1OVDA 1BSIA 4TX6A 1TA3B 3MV11 1Y9GA 4UC5A 2NW0A 3TV8A 1RV8A 5KZDA 4OJYA 3PZOA 4ADUA 2WKLA 2XUCA 4AZBA 1QOXA 1YDVA 4LOCA 3PZTA 1WAWA 4HMCA 4M8UA 4QCFA 5DT7A 5CPNA 3MI3A 3CGTA 3WFAA 4B16A 3TAKA 2VJXA 8CGTA 2BY0A 3LERA 2A7NA 3AHYA 4QDMA 5LA0A 4GXPA 1GPFA 3WH7A 1E40A 1EWDA 3GR7A 2RFGA 4BS0A 4ML4A 3W81A 4AYSA 4W89A 1C7TA 3B9EA 1V3MA 3T0AA 3GAKA 3VUPA 3BK0A 3NQCA 3MS8A 3M5ZA 1M7PA 3U8GA 1BF2A 3LB0A 4GI9A 2DZXA 1GQLA 1J12A 4ATWA 1MSSA 1XYZA 3DZ1A 4TR9A 4O50A 2Q8LA 3G6MA 4KWUA 2QCDA 1AQMA 2VOTA 2ZUMA 1E71M 1ODUA 3HN3A 1TPDA 5FF4A 5KTLA 3M46A 3PTMA 5IDIA 1YPIA 4JIPA 2XVNA 2XM1A 1G7UA 3PY2A 4UFKA 1G4PA 2DT3A 2WNNA 1OYBA 3TXZA 2G3MA 3ARZA 4TO8A 2J4GA 1DHPA 5U4NA 1R85A 1FQ0A 3WNLA 3B03A 4J27A 1H7WA 1VCFA 3ARYA 1SU5A 1UH4A 3ARPA 5D2XA 3MYOA 3W37A 4UFLA 2Z1KA 3W2LA 4NZCA 2ZRUA 4UTTA 3AI0A 3NL3A 1A5BA 2JKEA 3LI0A 4PEEA 1LL7A 3PS7A 1OCQA 1L2UA 4DXVA 1Y0EA 1PX4A 1K3UA 4AZZA 2VEIA 2EPKX 4KKXA 4HOWA 5TBOA 2VENA 5DO8A 4DUXA 1JZ5A 2FB2A 3TA9A 2OCZA 1OIMA 3P60A 2V5BA 4FX6M 4HIBA 1MFVA 3BGGA 3NL5A 3W2MA 5AHEA 3HU7A 2H3DA 3DFSA 1LWJA 2A3AA 2WKGA 4GI8A 3O15A 1WDQA 3WD4A 2HTMA 1W5QA 1OFPA 3TQ0A 1DEDA 3GNOA 4IX2A 3TTSA 4D6JA 2WNWA 5HINA 4Y90A 3G18A 2Y5EA 1B57A 3RDKA 3PUDA 2V3DA 4MTVA 4M56A 4EWND 2VFGA 3BCFA 4FLOA 4M5PA 3LPFA 4O10A 4BA0A 1X1ZA 3UYCA 1H5YA 2QLYA 2XFRA 2TSYA 2WCAA 3GXIA 1DVJA 2NWSA 2B31A 3WJSA 1FDZA 1DV7A 4JFUA 2HMCA 1H7RA 3FIGA 3UXAA 2X09A 3W1AA 3FHQA 4JL1A 2YDSA 1FHDA 4JTIA 1EQPA 1AG1O 3UQNA 1A47A 3CUFA 4GZIA 4U31A 5LNVA 3VM7A 5CQ1A 1J01A 2G41A 3WL0A 3UWUA 3W7PA 1W9BM 1I75A 4PCFA 2NT0A 4UTFA 1U30A 2PB1A 1R2RA 3N04A 1HXJA 4UMCA 1GZJA 4MB3A 1H0IA 1SSGA 2CLFA 1JIBA 5C5YA 3B0VC 3E49A 2DORA 2GUYA 1Z48A 1RVGA 1SSDA 4ZVJA 5AC6A 2CLHA 5AHNA 3N19B 4Q32A 4DPQA 1B31A 1PJ9A 4OWGA 1MQQA 2DIJA 3W24A 2JFEX 2WJZA 5HR7A 5DCBA 2ZCGA 4TVDA 1PS9A 2A6NA 2V8ZA 1OINA 4FXRA 1M04A 4YCPA 4NX0A 5A2CA 3S1VA 2NX3A 3WY1A 4V27A 5KZMA 2E68A 1SZEA 4AEFA 1KTBA 4AD5A 1QNOA 1J9YA 3O6DA 3F4WA 3LBCA 2D2OA 4O4WA 3W84A 4J3SA 4BF9A 1I2PA 3QC3A 4OOZA 1GVFA 3MP4A 3P8JA 3GDBA 3SURA 4AZ6A 4P8XA 3RM4A 4D1IA 4GUHA 3RILA 4AW7A 4LS0A 4PYSA 5EMUA 1E5JA 1DBTA 2EHHA 1GQJA 2PE4A 1KFWA 1OGSA 4AD1A 4CVWA 1JF6A 1X6NA 4HU8A 4Z2KA 3U7BA 3QW4B 1D2KA 3T0DA 1SW0A 3KVMA 2YXGA 4E0CA 4QNWA 3B9AA 5E9AA 3ABSA 3TC6A 1IXOA 4AAJA 3THCA 3IJ8A 2UWFA 1QOPA 4PSRA 3VMPA 3C2OA 3S5OA 4UXDA 1GWJA 3MSDA 5KINA 3EWZA 4O19A 3WF2A 1I1WA 4JTTA 4ZL1A 4ZXOA 4D6CA 2QCMA 2XTKA 5A94A 4KRUA 2ABBA 1M53A 3FS2A 1ITXA 3FNDA 4OIFA 1XRVA 3FAXA 4H7VA 5EB8A 3GDRA 1A50A 3M5XA 4QLJA 3AISA 4U2ZA 4O1AA 2D3LA 3GXPA 5A6SA 1GG0A 3SI9A 3L4TA 4WOQA 2UY5A 1V0NA 3QHMA 4LWWA 4Z0SA 3NQDA 1M6JA 2QJIA 5HWNA 3VD7A 5DN1A 1NF0A 3HGJA 1BAGA 3CO4A 3W83A 1ISYA 4JTHA 3VKJA 4H04A 3ZJ7A 1WB0A 4GUFA 1UD3A 1QI0A 1BLIA 1OB0A 1HJWA 3LI1A 3WJXA 2ZX6A 3L4XA 4JR5A 1HJXA 2UY3A 1R2TA 4QISA 4WY0F 4TTGA 2WSRA 5LNWA 2ZX5A 1LOLA 1N7KA 2XQRA 2J9YA 5F4SA 2DH3A 3RMEA 4XBSA 3VIOA 3AS1A 5I78A 4LPCA 1JRCA 3LDKA 5H91A 1JRBA 5D09A 1NOWA 1B4KA 1OT1A 2QPUA 4PUEA 4W5UA 3WDPP 1XI3A 3A4XA 3VGFA 3LEMA 3KF3A 2YDRA 1JVNA 1E6PA 4RV8A 4WOZA 2BXZA 3IIXA 3W2JA 4MY8A 3OB8A 3PZNA 5CLWA 1RZMA 2JEPA 1QNSA 2BHYA 4H8VA 3R2GA 2ZA1A 2RH9A 4OE7A 4AZCA 1F7BA 3PG8A 3WD2A 1OFDA 3NSXA 2J77A 1H51A 3TAOA 3VE9A 1B9ZA 2HS6A 3W7EA 3W25A 5EFFA 4Z2IA 4YMZA 4JGDA 2ZZ3A 3B04A 3CQ0A 1NAL1 1EA9C 3CPUA 3BC9A 2J7HA 4WJEA 4PA8A 2WLYA 3NSNA 4IX0A 3G1YA 1WE5A 3WH5A 2GK1B 4LC6A 3L67A 1TMQA 1V3LA 3MO7A 1MVYA 5I79A 2VZTA 1SMAA 1W3LA 3W23A 1VIWA 3AS2A 7A3HA 1WO2A 4H3DA 1Q6DA 2ZA2A 1QI4A 2QF7A 1E6ZA 1AL8A 3VGBA 5BXRA 4JTUA 2R94A 5CPLA 4H4IA 3W1UA 1WDRA 2CFFA 4FEZA 3T40A 1KWGA 1LRQA 4EF8A 3PC0A 4IXXA 5ABEA 2WM0A 4JKMA 4UOJA 2P0OA 1JXKA 3P82A 1Q3NA 5EPDA 2JGQA 5DFAA 5A2BA 1K03A 1XSIA 3GZAA 5AY7A 3TUUA 4DBDA 1TR1A 2C13A 3BLFA 3PBUA 4O14A 3T78A 4D72A 2QCHA 2JE8A 1C8XA 3OBKA 3OA5A 1EOMA 1YYAA 4PTWA 4FFIA 3SUUA 3GDKA 2V2CA 3DU0A 3LIHA 3QF0A 1V0MA 1FY6A 1KFBA 4JXCA 4M7SA 3M6DA 3K8KA 1BGGA 3LXCA 4DO5A 3VDHA 2W67A 4NNBA 3FAWA 4HNVA 3AJ7A 3CZGA 1WBJA 4M7TA 1HX0A 3W7IA 1QHZA 1QW8A 2WVTA 2OYMA 1RPXA 3ZOAA 1IXPA 1TB3A 3T44A 1G6CA 2D0FA 1PZ2A 5FK7A 1W5OA 1J4EA 1EOKA 2P10A 3L2MA 3NZ1A 1FCVA 1VRDA 3FOKA 3LLFA 3N34A 2VOMA 1C92A 5AYXA 1HJQA 1KBKA 3WDRA 3WL1A 1TCMA 3M44A 2FGZA 1GTHA 2VFFA 4PMYA 4AC1X 3G1FA 1ZY9A 2DZUA 3DFPA 4RLIA 5D2YA 2QQUA 2WBGA 1WDPA 1GT8A 3KE0A 1F6KA 3IGUA 2X1RA 2YDAA 3NNTA 3VGHA 2Y2WA 3LV5A 5E09A 2W63A 3T2OA 1R2SA 3WF4A 3GXTA 3IEBA 2XVGA 2PRLA 3OVRA 3MU7A 2WSKA 1VFOA 1UR8A 3UGFA 4HU0A 3ZJ8A 3UD6A 2YL8A 3Q94A 2OZ0A 1KV5A 1UJPA 3G1HA 3LBMA 1LG1A 2G3IA 2XVLA 1EQCA 2J25A 4IQLA 1M7OA 1I4NA 2ZRWA 4JTJA 4MZ1A 4S2CA 3EWXA 3W1MA 1U33A 2YR1A 3N14A 4UTWC 3OG3A 4JDYA 1UWUA 3NG3A 3CHEA 4KWVA 1IXQA 3RLVA 4Y96A 1HFBA 3VGDA 2V3GA 2C6QA 2XG9A 2UV8G 3VD4A 4L4OA 4RX0A 5D32A 1VYPX 3PIJA 5A5WA 1MQRA 4Z08A 4J3WA 3ZMRA 2DP3A 3E0IA 1Q4NX 2EPMX 2YKKA 3EWUA 2ZZ1A 3NQ2A 1KM4A 2V3EA 1W9UA 1U2YA 4KWWA 4URIA 1XBVA 3DYMA 3QSRA 2BNJA 3IAPA 1TTIA 4DM1A 4FLSA 4OU1A 4UTIA 4YN5A 2CESA 1BYBA 4XTDA 2BVYA 3TR2A 3ATZA 1VEOA 1AQ0A 3WEMA 4DUVA 1OFEA 3VIFA 7TAAA 3G1SA 4C1LA 4DO4A 1HTIA 2E6FA 3W75A 1I8JA 4NJIA 4XTIA 3W7MA 4WSKA 1SMDA 3HMCA 1ME9A 1G4EA 1VJSA 4QLLA 3SIMA 1EGZA 4MNMA 4GPNA 4UQCA 4GNJA 3UWZA 4CKQA 1FCQA 1A5CA 1Q45A 1QPRA 1UCWA 1ZAHA 2B7PA 4K7YA 1W5NA 1UWRA 2B7OA 4EIVA 3IAQA 2XWEA 4KRTA 4PODA 1U5JA 1W0MA 2O7QA 2ZWZA 3WNKA 4FF7A 4HPHA 4DF2A 5BW6A 4NRRA 4MJ2A 5CJ5A 5T26A 4HNTA 1H7PA 4HZ7A 1JZ7A 1JCNA 3LOTA 2QCDB 4KH2A 3GH7A 4AZHA 1EUNA 1W37A 5F2IA 1VYRA 1KCLA 1H5VA 3BAJA 3EXSA 2NZLA 1BTMA 3MUY1 3O16A 4GQRA 4O15A 3KAOA 4KMQA 2QAFA 4P7RA 4AEEA 3UWQA 4BFAA 1ZFJA 5TIMA 4GUGA 4EQVA 2Z1BA 5FEWA 3RF9A 5GNZA 3QOKA 3FW6A 2FJKA 3DYPA 5FKBA 1T99A 4WD0A 4KFPA 5AOUA 4Z1BA 3OSDA 5A8NA 4J3XA 4JZ5A 3OLGA 1IZJA 2B7NA 2WSQA 1YTKA 1AW1A 1ZCOA 5EBAA 5ABFB 1W3KA 2P1FA 3W7DA 1DWHM 1AL7A 3MHFA 2TYSA 4U5IA 1W5PA 3P5ZA 3L5MA 4IXHA 4GJ1A 4H41A 2G95A 3TTOA 5D38A 4EK7A 2GVJA 2Y7GA 1GEQA 4QLKA 1VGAA 3TA6A 1LROA 4TVUA 3ARTA 2VC6A 1DJNA 2A7PA 2OMAA 2V5CA 3C6CA 3A3HA 1KTNA 1R87A 1TSIA 3AOFA 3SECA 4CU6A 3Q58A 1E5NA 4HMEA 1V3IA 1TMHA 3W87A 2WMGA 3NIYA 4CQ9A 3AZRA 3N9RA 1XUUA 3QMRA 4IMGA 2FB3A 3CTTA 2OJPA 1YHTA 3A6OA 1JI1A 4UIOA 3SUTA 1R7OA 3KFTA 2XVPA 2O92A 3TOPA 2YZRA 3S9YA 3WJYA 1IIHA 4RZ6A 1JNEA 2KZHA 3G8RA 4XBKA 2XSBA 4UQEA 2B4GA 4UZSA 4UFMA 3UR8A 3L5LA 3B05A 4GE8A 4ZEPA 1NVMA 1YPFA 1W2VA 2ZUSA 2QUTA 2DJLA 3TSBA 3MHUA 3EEGA 2Y24A 4BK9A 4LRSA 2I14A 3CH9A 1R47A 1MW3A 3WF3A 4UOZA 1TPVA 1E73M 4GZJA 4HMDA 1XC4A 1E1EA 3N11A 2WB5A 3WD1A 1B90A 1PCKA 4LNYA 1JAKA 2WSPA 4MB1A 4Z2JA 3LFIA 2JKAA 3G24A 4A3UA 4I7VA 2WC3A 4PFMA 3O8AA 4QAIA 5D04C 2VELA 2YA1A 4FFHA 1W56A 4JICA 5LZLA 3N13A 2E0PA 2CKSA 4CNPA 2PWDA 3C2RA 4IPIA 3NR0A 3W1NA 1JDCA 1D3GA 2PWGA 4ALDA 3NMBA 1K8XA 5HR6A 4N9EA 4EVZA 2BFGA 2VTFA 1GW1A 3LHYA 3RWKX 2FH8A 4XWUA 1ZNNA 1H0GA 3D5HA 1B1YA 4LQ1A 4PBGA 4LVAA 2ZXBA 1VF8A 2O9OA 3MJYA 3FN9A 1ISZA 3W82A 1OWQA 4E8CA 3ARXA 3CHCA 3GTNA 4ONVA 4DQWA 3H3LA 5HUOA 3QQ1A 3ZWTA 1BYDA 3AFBA 2JIEA 2F8QA 3TMLA 4MUZA 1DP0A 1WKYA 2ZOXA 3TDFA 1K7EA 1HJSA 3OZOA 4P8VA 1TPB1 3EMQA 1LBLA 1TPC1 1FXPA 1JG9A 5BWFA 1FUYA 1W1VA 3HJEA 1WQ5A 2WPGA 1NWUA 2BX7A 2J7FA 5I5RA 3SC7X 3AO0A 3N2XA 3FEMA 1GOQA 3GXMA 1LZOA 5HWMA 4RXGA 1V0LA 4ADSA 3CWNA 4PMOA 1TPH1 2E9MA 1JJKA 3WUFA 3BLPX 4AF0B 1QPOA 1E6QM 3LPGA 3EDDA 3NPUA 1MEHA 1OFAA 1OGGA 4A21A 2VRQA 3AROA 3WUBA 4DWSB 3LHUA 3VDBA 1MW2A 3M5VA 1TG7A 2AEYA 1ZB5A 4O12A 2ZBTA 4BZYA 1BG4A 1W1TA 4UTMA 4GO9A 1SO3A 3CB8A 3CIXA 4HPGA 1WDWA 5FF3A 1NQ6A 4ZQMA 3PTQA 2E9BA 1R86A 2G4FA 2A4AA 2WW5A 1X6LA 4LYQA 1VCGA 2ZRZA 4CCEA 5TD4A 3OGVA 2TMDA 4QQ3A 3WUGA 2CZFA 1ZAJA 2ATSA 2VCBA 3WNPA 3W7NA 3KRSA 2D20A 3F1QA 1FFQA 3E96A 1V08A 1WA3A 2QAPA 5EMYA 3ZIZA 5A6BD 5FEZA 2YW4A 3GNNA 4IOTA 1VENA 2WK2A 2NV1A 2DZVA 2QEZA 3W71A 4WKHA 3SCQA 4I9AA 1XH1A 3VI2A 1F74A 3ZSTA 2D23A 3ARWA 1IIGA 1RH9A 5CGTA 3NM3A 3MP5A 5D37A 3WK0A 3VGGA 4E38A 2EJ1A 2E6DA 1IZKA 4J3TA 3EWWA 1J18A 1NOUA 4L4PA 1Z41A 2YFOA 3GB6A 4J9JA 3W7RA 1TFVA 1UD2A 1OJXA 2J74A 4C7GA 4GQQA 5E6ZA 3IGSA 3M5YA 2JF7A 4GI6A 2CW6A 1B9BA 1KBJA 4P61A 1W54A 1H3GA 4WZHA 1BFNA 2ALDA 1JL8A 2DIEA 2WAGA 1VEMA 3N1AA 3W27A 2Y7EA 1K7FA 3L2IA 2VL4A 3M07A 1XV8A 4QSHA 1FP9A 4ZZ9A 1K9EA 2QUUA 3USBA 4LRTA 1CLXA 4W9TA 4WY0A 3VM5A 5HWJA 3WFLA 5BXPA 5C70A 3NA8A 3DFOA 1H63A 4N9BA 2AOSA 2GUUA 2J88A 3A24A 1TE1A 2EPLX 5JBFA 3BGAA 4JX6A 2I9EA 1JZ3A 1SFLA 5F2GA 4JIEA 3AMGA 1K9TA 1WX0A 2VZSA 4OKDA 4JHOA 1SPQA 3VE7A 1A3HA 1C90A 1GYLA 2YW3A 1EHNA 4PSPA 3NDZA 3ZJ6A 3P61A 1QAPA 3NDYA 3S5YA 2YA0A 3TXVA 2TRSA 1WBHA 1Z32X 4PCTA 2J78A 3W6LA 1K6AA 4OQVA 5H2ZA 4M80A 2WC4A 4MPKA 3W6YA 1SZGA 3DH7A 4F79A 1ONRA 4IJBA 3W7QA 5HNNA 3HIJA 5KEZA 1E51A 3ZSSA 2CXGA 5LHFA 3NQ6A 1JR1A 3PZQA 4AXKA 4QAWA 5FOOA 3K1DA 4WSJA 3DHFA 2VNCA 1VCVA 1WPCA 2WMFA 4O11A 4NSBA 1ITCA 1ALDA 2ZIDA 1UZ4A 4PTMA 2XJ7A 3WUEA 1OYCA 3Q2DA 2YDQA 3SCVA 2C1HA 1SW7A 2CBIA 2AMGA 1IV8A 4YCOA 1J0KA 1BQCA 1TA3A 3NCOA 4UR9A 3L9CA 3VILA 1KM1A 2C3ZA 4HPXA 3TP4A 3TFXA 2FQIA 4HOXA 3S2CA 5C8BB 1GUVA 3OVQA 1B3YA 4UNKA 3O6CA 5D03A 1XFBA 1UYQA 1E4MM 5J5RA 1CI1A 4K8HA 1VRXA 4ZQOA 4F8XA 4M1RA 8A3HA 3GM8A 5AHIA 4HZ6A 4JTSA 1X7FA 3A9IA 4M81A 2JGYA 1XSJA 3NPWA 2BVDA 5E6YA 3WEZA 4XZ9A 2CHOA 2C15A 3QPYA 3PAJA 1KXQA 1XYFA 4O53A 2E40A 1EP1A 3BW2A 3WSUA 5E0FA 3BAYA 3QH2A 1NWRA 5LSMA 5EA9A 3DKJA 4KGLA 1J0JA 3D3AA 2QKFA 3L4YA 2ZX9A 3BMVA 3TJXA 2YL9A 4NUWA 2Y70A 3WIJA 4HZ8A 3LPOA 4A3HA 3DYOA 3E12A 5G4WA 3WQVA 4O0ZA 3O1NA 4UQAA 5HPOA 1VLIA 2GJLA 1JDAA 1YXDA 4JQTA 2OXBA 5FL1A 3EYPA 3P8IA 1J0YA 4AD2A 1FWTA 2Y6ZA 3G0SA 4HA3A 1YXYA 4N42A 8TIMA 3LX9A 1V6XA 4FNRA 3VD3A 2VFDA 4B9ZA 4AHOA 1VFMA 4CVUA 2CLKA 5FIXA 3NQ8A 3SJ3A 3AZTA 5TQLA 2VX5A 4PMRA 3LHWA 1QR7A 4OT7A 2V9DA 5AC7A 1NFBA 2ESCA 1QDSA 3CPRA 2WBKA 1CECA 2CBJA 1GOXA 1B0IA 4OOUA 3N18A 2GJNA 4JL2A 1P0KA 3STCA 3ABRA 4HHPA 2CBUA 2AC1A 1GYNA 3I65A 1E0WA 3GDMA 3FJLA 1ZALA 3CEPA 3L4UA 3AS0A 3NYDA 2J27A 3BO9A 1OHLA 1QBAA 4M6VA 3SCNA 3ABQA 3V75A 2QPSA 3CZ8A 5K9XA 1YLVA 4NJGA 1OX4A 3ZM8A 1AMKA 3C4UA 2PURA 2D22A 4FFFA 4RKAA 1KM6A 3QGVA 1DJQA 3MUXA 3PB2A 1GHSA 1CGWA 2G3NA 4E2DA 4CGTA 1ZU8A 1MFUA 3A23A 2WVUA 2DJXA 3UWVA 3LF7A 3BG3A 5I6SA 4K39A 5G2WA 5IM51 2OYKA 1XBZA 1C91A 3QMTA 4I7WA 3YPIA
chains in the Genus database with same CATH superfamily
3ZN6B 1PGL2 1BEUA 1YDOA 1XM3A 2VMIA 4Z2LA 2Y8VA 5F6LB 1YFUA 5XIMA 2H6RA 3ZWSA 4F0RA 3HPSA 1FWSA 1AW5A 4PMZA 4TX8A 1JXNA 2DGAA 4PCSA 3V35A 3GDLA 2J7MA 4ASTA 1I5ZA 1FWDC 3WKZA 1UUQA 3AIBA 3BSMA 5CBJA 1PX3A 3I59A 4BQWA 4IE0A 4LH8A 1E43A 2QDDA 3WFZA 4MWAA 2PDKA 4JRAA 3ZFEA 1TYGA 4QMAA 1V0KA 4LIVA 1RCQA 6TAAA 2EPHA 3NOYA 3M6YA 2DFCA 1PTDA 1Y4WA 4F3JA 4LU0A 4D0QA 1G8WA 5KBFA 3SR7A 1Z7S1 3SQSA 5I3IA 2OLSA 1UZYA 1JCXA 2W08A 4J1WA 4RHV3 4YFZA 2DFBA 2XPKA 5DMNA 1YJKA 3R0DA 5A6LA 1XNKA 4PN2A 1Q6OA 2RGMA 1A5MC 3GIYA 4QGMA 4MH0E 1BVNP 3B8WA 3GFYA 4Z17A 2C1IA 2XVKA 2D73A 2L9LA 2XWDA 4PJYA 3AWOA 3SY5A 3VBFB 3CEUA 2PFWA 1O6UA 1WW5A 3CJIA 4RR3B 3I2IA 2VUYA 3CBWA 2E7QA 1DTNA 3A5FA 4LS1A 1YQ2A 3TTYA 3OBZA 4JDMA 4PH6A 3ZYRA 3HV9A 2DSZA 1EKOA 3D6EA 3CNAA 1OM0A 5FZOB 3M0XA 2NLIA 3PMSA 3ZXAC 1AUYA 1OFOA 2C0HA 3BXWA 3BOWA 5DMLA 4HVOA 2YYOA 4DRVA 1W3NA 3WNNA 2WIIB 4HKWA 1Z78A 2BV9A 3SN1A 3U5YA 2XU2A 4HTBA 3UJSA 4CD4A 2OVLA 1UIPA 4RS5B 4KU8A 3S5AA 4IFKA 4MM1A 2YBPA 3O2LA 1BKHA 1QKQA 4KIEA 1LOQA 1UU5A 5AC4A 1DHKA 2FCUA 4ZTYA 3GIQA 1OK4A 4GBUA 1LQAA 2OX0A 5FZGA 3LQCA 4CQ8A 1E6SM 3ZMOA 4NHLA 1V02A 3JBG1 2YG0A 1FOD1 4Y9AA 5FEPA 4B92A 3HTWA 3VKAA 2OKXA 1SLLA 1XNCA 5AFBA 1RUH2 4R5EA 1B3WA 1SJDA 1OF6A 4LBJA 1I9RA 2VMFA 2R1DA 4YSFA 1SVDA 2Y64A 1MEIA 2DTWA 4MZUA 1JYWA 5HBFA 1PX8A 2IXHA 2AYHA 1H4GA 2QCCA 3CQKA 4NJJA 2J1UA 2HE8A 1WGPA 2B5HA 3AIVA 2GNDA 2V4AA 4ATFA 4KRZA 2J1AA 4J7RA 4RL3A 4ZQNA 3IZOA 1CXIA 3T55A 3UJRA 2TPSA 5C5TA 3FY1A 2PGWA 2A6LA 4AVTA 4IGNA 1Q6RA 2HJPA 4OHZA 2OQ6A 1W8HA 5PTDA 2X53S 1HRV2 5CZ0A 2F2HA 1W0PA 3WZ0E 1ELSA 1PHMA 5JDBA 4D9PA 4M3CA 4DJEA 1TRDA 4AVFA 5KHGA 3VHNA 1V3JA 3WDXA 4QX1A 4CDWA 1GWMA 4W8LA 5I24A 2QQWA 1D4M3 2GNBA 4IGOA 4O0QA 3CHVA 2VURA 4HN1A 1P6BA 2W87A 1TCDA 3Q37A 2BVWA 4W93A 2GWNA 3ZFGC 2CGOA 4B3NA 1BTCA 1J11A 4AX6A 3TYUA 1VBC3 1SLIA 1DQWA 3RXZA 4B3KA 2VQ0A 1MZRA 3PMEA 3R0RA 4PL2A 3LGEA 4P9IA 1OGBA 3X29B 1I2RA 3M0KA 3CTTA 4YL2A 3W85A 4KGJA 3SEEA 4L61A 1UX6A 3WCRA 3CLWA 3ZYIB 4UWDA 3E6BA 2AL2B 2VC5A 3QGAC 3UWWA 1QJX3 4B2DA 2NV9A 2GQ9A 3V3WA 3ZPYA 4S3EA 3OBEA 4RE2A 4RGKA 4GD0A 3FVMA 4QQLA 4C0HA 3BAXA 5LA1A 5GZEA 4AWTA 3BPWA 1YMYA 3GLCA 3ZYBA 3VZJA 1XBFA 1LWIA 5CG7A 1J59A 1UW9A 4GULA 1PCWA 4TU1A 3IDEA 2OB3A 5LNUA 1M03A 2D6PA 3UETA 3AM2A 4BY3A 1SJAA 3CQOA 3CIWA 4Y5SA 1QJY2 1UOZA 2E6AA 2GOUA 4AX7A 2OKTA 4D8AA 4GWEA 4Y24A 5AVPA 2PC4A 3UPMA 1ONXA 4JN7A 1W1YA 4XX6A 2Q8EA 2XZ7A 1PO11 4LNVA 2OZ3A 1KM5A 1NP2A 2EJAA 1FDYA 3L4WA 4LV9A 5SV8A 2YY1A 1EJVC 1QATA 2J9XA 4G9PA 1LGCA 1CGPA 5E0CA 3WLIA 1BYCA 4JBRA 2D98A 5I00A 4YLZA 4V15A 1V51A 5FMCA 4ARXA 1PIIA 3VTRA 3CH0A 4B3LA 2FHFA 1QK0A 5A6MA 4UMBA 4IMAA 4Y1XA 4ZU7A 1QJEA 4AEDA 3POCA 4JD4A 4Q2FA 1OSEA 3B8DA 2OSYA 1O12A 4AWSA 3MF9A 3VNZA 2IC1A 3WH8A 2D5FA 1WLTA 1QMJA 1YQ5A 4ZS3A 3HOJA 2CLPA 4FIRA 1RUC3 4DUOA 4QQPA 4A3ZA 1TTQA 4D7TA 4FNUA 4A8NA 1HNYA 1ZZ8A 3RO8A 4A22A 4GWMA 2V5JA 4CQDA 3V0AB 2D3RA 4PUJA 3PVEA 1XH2A 4ZQRA 3TH6A 1R091 2EXOA 3NJ3A 3WLNA 3WW1A 3PSWA 2BOJA 2YA2A 1RUH3 2XL7A 2VX7A 1ESWA 1LBMA 5AC5A 3BWWA 3PANA 1I9CB 1FWJC 2XISA 5MF5A 2GVYA 2YYTA 3TWBA 3CT7A 2ISDA 5JLVA 2EPOA 2EG6A 1HKWA 3TSDA 3I8TA 3VIMA 5GLVA 4QITA 4AWEA 2VULA 1H09A 3H2NA 5CC5A 4HK9A 1VHNA 4NJHA 3IV8A 5LBFA 4RQPA 3OQ8A 4LV4A 3VL9A 3QY6A 2CHHA 1MZHA 1PIV3 3OOQA 2X8KA 1NEYA 4WCJA 2YCKX 3UCCA 1O4TA 2ZXQA 3E2QA 4M3CE 5FA5A 2RDNA 2IXLA 2GMEA 2JB8A 2FMOA 3RZMA 3FC0A 1XOYA 1J0ZA 1GOKA 5DUUA 4A7KA 3KD4A 4CDXA 1F6YA 4ZO6A 4TX9A 1UR1A 2REQB 3T07A 1WV2A 2PDIA 3MANA 4GKTA 1H1YA 1PK6C 4FOKA 3FHIB 1WBLA 4L92A 5T52A 1Z42A 1MS8A 1I0BA 1KDKA 4XZMX 1O7AA 5B4XA 3MIFA 5DRIA 1J1TA 3UG4A 3VZKA 4V28A 2FQPA 4UQBA 3N2MA 2PPGA 1Y5XA 2YCLA 2J79A 2WV8A 3PJYA 3T09A 1I6XA 2XHYA 3VZLA 4UTWA 4PUWA 1AXZA 1XCFA 5D30A 2VZOA 4E4FA 1FI2A 5T55A 5CSUA 3B3DA 2BGQA 4E2GA 2J8FA 1MRQA 2EGZA 1EJUC 4UF0B 1G9AA 4ZOEA 1OFQA 2GSJA 2BY1A 4EN6B 1EAH1 2ZA9A 1JD7A 4UTTC 5CGMA 2RDSA 3WF0A 3C8FA 5LIYX 4E4DX 2ZDRA 1ULFA 3S30A 4NYYA 5GZGA 2Y8UA 2ZVIA 1NARA 3BU7A 4C0BA 1PHQA 2HE5A 2VFHA 4JIHA 2JIJA 1CAUB 3AMNA 3RLHA 4ZU4A 2AACA 2WDBA 3TYCA 5FMOL 1Q7QA 4JTDA 3SGGA 2Y61A 3MBDA 4N8MA 1KR0A 1XLBA 2LLEA 4HK6A 2DQXA 2QUNA 1PUDA 2WS93 4Q4Y2 3I2JA 5F5AA 3U10A 3RZGA 2X7VA 2IS7A 5I3FA 3VIPA 3AZWA 1IEIA 3AHXA 3TYDA 5FZFA 1RVF2 5FI8A 3W59A 4CDQC 5C55A 5DUWA 4XZHA 1FX5A 2W2IA 4ZENA 1VRBA 1PO21 4U28A 5D2VA 4IEUA 4IMCA 3I7DA 3GVVA 4NI3A 1DTUA 1WLWA 2YMZA 2ZGKA 1EAH2 4TLGA 4F0KA 1NAEA 3M70A 3IACA 3P74A 4Q8PA 5C2XA 1EYBA 1OFRA 2A3EA 3HGRA 5BNOC 1XJAA 1CLVA 2WMHA 1W6MA 5D21A 3VNJA 1NKGA 1QOQA 4Q4V1 3G77A 3VNMA 2WFPA 2HZGA 2Y7DA 2ZGTA 2WVVB 3RYPA 3SZ8A 3IV3A 1LUCA 3N3MA 2C19A 4MFDA 2ZUWA 3CS2A 3N73A 5F2MA 1XLEA 3RPMA 2XYLA 4N4PA 4N9CA 4EXAA 2C9AA 2Z2SB 1OX5A 4ZSTA 3U5UA 1ZTVA 4I0WB 3TLQA 3BOPA 1JI2A 3MUIA 3URAA 1ADOA 1UKGA 4P8WA 1TE1B 4TQTA 3DFTA 3CQIA 3GVQA 1L3JA 2PAJA 3IKWA 4YTSA 4LCRA 1DJWA 4C1NA 4M0NA 2C6SA 1DJZA 4XQ4A 1VMHA 4HCDA 2PD9A 3C2YA 1SFJA 4QEEA 5A3WA 1CX4A 5A95A 1EDTA 3JR2A 1W28A 5BNQA 2PA7A 3R0KA 3ZIXA 1W9YA 4M00A 3KDOA 5BNKA 1OT5A 4RR4A 5CFCC 2XGZA 2GJRA 2WNUB 1KLZA 2A6VA 5CJNA 2YLLA 2FZBA 1HJGA 2EIGA 4Z1DA 1OLQA 3SEPA 4JIQA 3WNOA 1PSCA 1RR2A 1Y65A 3C2FA 4XJUA 4PDWB 4BR1A 2GH8A 2WAAA 3LZ3A 1TPFA 4Y5Z0 3SH4A 1YDYA 3BAWA 1V7YA 1X82A 2PN5A 1C1FA 2PHLA 4HPNA 2V38A 3L2HA 3GFXA 3MVIA 3ZX7A 3Q65A 2X1UA 5JAXA 4L7ZA 2VP8A 4NNAA 1E6XM 1UZ1A 3FYOA 1LHNA 4O61A 2R9RA 3VIGA 1F76A 5CVRA 1DE5A 4H2AA 2C14A 2POZA 3TCSA 5BYWA 3W01A 4GIAA 4U3CA 1MUCA 3WBAA 2AR6A 3CM4A 4EE9A 4A3YA 4QEHA 3DESA 4XYXA 5FY8A 1UMHA 3K3NA 5LYRA 4Y20A 1XPGA 1ADDA 1SZBA 5DCEA 1MVQA 4HMZA 3AKRA 1W9PA 4F3HA 4Y2WA 3E0FA 5K7PA 3USUB 3NV4A 1CQ9A 1X38A 4URTA 3V4BA 2O56A 2DT0A 1GVOA 2HWB1 1F4HA 1VYSX 2BHUA 1FBAA 5CFDA 2EAWA 3LCGA 3IIOA 1JZ2A 1FWWA 3J9SA 1VH7A 3TYZA 5CC6A 2FZ2A 2ZUTA 1C8NA 2AGSA 3GTFA 3SH5A 5BPXA 4A6GA 2OQHA 3NNJA 1TVNA 2DSVA 3KV9A 1VIWB 4CDUA 4HOZA 2BZNA 1AR92 4LANA 4C6EA 2I45A 3ZXGA 3ROUA 2PU0A 4FOUA 3HN1A 4DAFA 1ZCCA 1EH9A 1J83A 2SFPA 4Z1AA 4DYJA 3EO6A 4OUMA 4GACA 3GR8A 2BY3A 3QTPA 4FXFA 2PGRA 3P1IA 1TWIA 1UX7A 1NWSA 2YLAA 2ZX3A 2I5QA 1H7OA 2ACQA 5FF7A 4YM1A 1OA4A 4MDPA 4C6CA 2V2HA 2OZTA 4I7UA 3KTXA 4Y6GA 4P00B 1BVP1 3O1OA 2WHJA 4MOZA 1QGLA 4JTGA 3UGHA 4HYWA 4IUGA 1N8IA 3QHNA 1LRTA 5FRAA 4H7LA 2XB6C 1FDJA 4YM2A 1SDWA 2JQXA 5DEZA 5FJRA 2NX9A 1UWSA 3KB5A 2C0ZA 3I3DA 5JIWA 3N29A 4FPKA 5AHFA 1YIPA 3KVJA 3PZUA 1AJZA 1V6JA 5G5IA 2NWRA 2CZ5A 4REQB 1UR4A 2LROA 3RZZA 4KT2A 1PMJX 1X1NA 2PRHA 4AMCA 4Q4QA 2EG7A 3OIXA 1VMJA 1XCXA 2DVDA 4ZO8A 2XBO2 1W8NA 4GVGA 3AKTA 2HK1A 1CX9A 3LD5A 1AYN3 2I07B 1FA2A 2QR6A 3IK2A 2JBMA 4LUJA 4WUIA 2HWC2 1R5YA 2J7CA 1UA3A 1P48A 4CEYA 1ZS2A 3UA4A 2W47A 3FX4A 3VFLA 4CPBD 3O3RA 5HATA 1XKYA 2QCEA 4J3VA 4A44A 2GQ3A 3WXPA 3ZT7A 4GNKB 5J5DA 1PKNA 4AEMA 5T5OA 4GQ0A 3P5YA 1A5OC 2PSNA 3CZJA 3I10A 1JHNA 3VCNA 1T41A 4MJ4A 3DHPA 2WKKA 3GVWA 1AODA 2FVKA 4FAGA 1ZYBA 2NUWA 2CCRA 4N9HA 2A6XA 1LP6A 1HXS1 4KWJA 3W7OA 4XJ9A 4MSSA 4X0NA 3K4ZA 4X22A 3W4RA 5CAKA 5FMDA 3RG0A 4P02B 2X1TA 4GC4A 4O8AA 2E25A 4W7UA 1IZ3A 2A3BA 1GKPA 2FDSA 5D1IA 1C8QA 3R7MA 3AYRA 3RJXA 3MW3A 3DENA 4UFHA 2X29A 3KVBA 1J8VA 1W2PA 4ECLA 4KCWA 3PNZA 1WBFA 4URAA 1GTEA 2OO6A 1XYPA 5CC3A 3C0JA 4HL0A 4S39A 5CGQA 1KEXA 1WW7A 5F2SA 1AD1A 1PZ3A 3ATGA 1LULA 5CFDB 4MNKA 3SCFA 2VXRA 1D4VB 1UR9A 3VBSA 1S2AA 3N9NA 5F1UA 2P6HA 3WDYA 1EZ2A 3TEVA 2PBGA 4FXKB 3BANA 1DYSA 2Z25A 4DWSA 3VKOA 2OPJA 4IPLA 1YQCA 3HT1A 4AZCB 2WZTA 1UYYA 3DHUA 4MGGA 3A13A 2ALRA 2J1EA 2H8ZA 1KA9F 3RS6A 5T3NA 1BVVA 4ZOBA 4G7EB 3BAIA 2JJ6A 3DFQA 3WEOA 1YNPA 2HSAA 4HT3A 4Z8BA 5LY1A 1TIMA 2BXVA 1ZL1A 2IUZA 2IUWA 5F9TA 3ZT6A 2DUZA 4DB7A 2JDPA 1XIEA 3ZFGB 3IVSA 2ID4A 4LHLA 1GW9A 3AXMA 1TME1 4OV4A 2Z42A 2VGGA 1BWVA 3A9BA 4CD8A 3PULA 3H1MA 1NF7A 1OFBA 2MUCA 1FHLA 4RNHA 4YVPA 2CLMA 4ZONA 4WXYA 2I57A 3WHUA 4R53A 1EWEA 3T8LA 1WCDJ 2QQKA 4DM2A 4E27A 1RHI1 5JIPA 2UYAA 4IT1A 1XKJA 4RGGA 1G94A 3EHKA 3S5SA 3A0NA 4EXBA 3GTIA 5BMWA 3GYDA 4DJDD 2ZGSA 3FBMA 2FDKA 1XH0A 1FWAC 4FNPA 4EPEC 3CV6A 4C6JA 4BLJA 3NAPA 2AGTA 1UY3A 3II1A 1JUEA 1FXZA 2A6WA 3JU9A 1XXNA 1W9FA 1GQKA 3P3BA 5C3RA 5D9OA 2CBVA 1W6PB 1WYIA 2P3EA 2WNOA 4TXEA 2FCTA 3VNKA 1Z7S2 1JYTA 3OA3A 1QHOA 4Q33A 1AL22 2CZDA 3W28A 2Z27A 3VKDA 2WO1A 2RMU2 5FPLA 2E7AA 2BSLA 4DO7A 2GQ8A 3H26A 1JN2P 4G56A 2E3ZA 4GXLA 4H6KA 4NZ5A 4LVFA 3WLJA 2R073 4FPFA 2DU1A 3D8CA 2QZ2A 3RZKA 3ES4A 1GVSA 4UXAA 3AL5A 2J24A 3L7RA 4ENLA 1PL9A 1W03A 2FIQA 2IQ0A 3LGGA 5FBZA 3MV01 4R7JA 2NVDA 3ZFFC 1WZKA 3C0LA 2VVNA 3OPWA 2QDGA 4JQAA 3HQRA 3R11A 1E1FA 3ECQA 4Q8MA 3UNPA 3UCDA 3OUHA 3P0WA 3N9QA 1TRIA 3TYAA 1TTPA 4L9ZA 1OG0A 2DCKA 2AMXA 5FP7A 1O95A 2DYCA 1R7AA 1GQNA 1YIXA 5IBXA 4QX7A 4QX5A 3W0KA 1SQ7A 3UPBA 1Q8QA 2VXNA 1D3CA 3U48A 4RPPA 4QFUA 3PTKA 2WNVA 4ZXLA 2RMU1 4ZFCA 5CGTA 5G2HA 4HXCA 3WDWA 3W1LA 4L65A 3I7QA 1W6NA 3ITQA 3RI9A 3E5PA 3CZUA 1VE0A 3BJTA 1XIGA 1SLCA 2YDEA 3CO2A 3TSMA 2UBPC 1OMIA 1UOJA 1ZBVA 1UYPA 4LITA 1W90A 1HT6A 4PMXA 3MMDA 3NJZA 5K9DA 4Z2AA 2ZAAA 1M5WA 1JGIA 3DXIA 3NQHA 3THQA 4P9JA 1EA0A 4RFRB 5GLUA 3T2QA 2XJSA 1R46A 4ASMB 2Z79A 3PAOA 3DPRB 3HBLA 4RNFA 5T9BG 1OA3A 2AEZA 1JFXA 1ZJIA 4WKFA 1F3EA 1NY72 1ZJBA 4WQ6A 1E15A 3THDA 1F3TA 1XNAA 1PE1A 1NDWA 3IJ9A 1RBOB 1NSJA 1UR0A 4IF2A 1O3TA 3N36A 4JIIX 1DWGM 3P14A 5DBTA 2ZGUA 4RZ5A 4XIAA 5D05A 2E7FA 4PL1A 5CKSA 5C6MA 4Q4Y3 3WK1A 4R9XA 4J3UA 1VBB1 4DXSA 3MKKA 4BIFA 3VPLA 1AJKA 5FIPA 5FPAA 3QVQA 5DXYA 4N53B 3RFAA 1BXHA 3CU7A 2WCGA 2ADEA 3TE9A 2BS9A 4UBPC 1S2TA 4GBDA 1AA1B 3G1AA 3VUSA 5HQLA 3GF6A 1XIMA 3FE5A 3AXHA 2ZACA 3O63A 1W04A 3WMLA 3I2DA 1J5TA 1YYNA 2BBFA 1M7JA 3A21A 2MANA 4AHQA 1V9U2 5I0SA 2J62A 1V5XA 2ON3A 3K8MA 3BG9A 2WPBA 5DZEA 3VA8A 3W2KA 3QSTA 5C9UA 4UW4A 5CSSA 4FPYA 4YG6A 4SBVA 3ILFA 1TV4A 1TZOA 1T6GC 1KFJA 4H8UA 4OI2A 2FPTA 1UNBA 3W5NA 5DQPA 1E55A 1C8YA 4LOTA 5SV5A 1E1CB 4JDBA 2VBBA 1UZVA 1KJLA 2CLIA 3KHCA 5I0TA 1O3SA 2CU5A 4PMQA 4L6OA 1GOFA 1Q5MA 5AHMA 1ULCA 2PS2A 4GRSA 1TX0A 1UZWA 3NNMA 4DEVA 6A3HA 4QPIB 2VW1A 1X8MA 3LQLA 3QXBA 4L6DA 3PN8A 1WCQA 1WNOA 2ZGRA 5EFDA 4D6IA 3VBRC 4ILSA 1CW2A 3I6EA 1CDGA 4ACZB 4CD7A 2YCLB 3I4IA 1YRRA 3BE7A 3I3QA 1OVDA 4M3CF 3MV11 1SZRA 4UC5A 4ADUA 1OSGA 1WAWA 4L9YA 4QCFA 4DJFD 3CGTA 2SBAA 4YW4A 1FWIC 3F95A 2VJXA 2OPWA 3O1PA 8CGTA 2HPMA 5CKMA 3FK4A 3WH7A 1VRH3 5FWEA 3MZNA 3UZZA 1EWDA 4IEOA 4LEJA 4AYSA 3KS5A 1F2NA 2EAKA 3GAKA 2OOFA 1M7PA 3U8GA 1BF2A 3LB0A 2P8CA 5FP4A 5CADA 3KBNA 3FLTA 1JPKA 2Q8LA 3G6MA 2GUBA 2QCDA 3U4AA 1TV2A 4JNZA 3UFYA 3BZJA 5BNOB 3N35A 2JB4A 1R6WA 2HRWA 5FTTC 4QDSA 3JBG2 5C9WA 2WNNA 4C6OA 3E3HA 2JEMA 5U4NA 1M4WA 2VY0A 4QSFA 1VCFA 1Q56A 2BU9A 1UH4A 2J1TA 3ES7A 5D2XA 3A7QA 4HHMA 2Z1KA 1Z0HA 4NZCA 3ITXA 3AI0A 1A5BA 1D4M1 4PEEA 3WQGA 3RX2A 4Q3MA 4MGYE 5FMOS 4KKXA 4HOWA 1JZ5A 5DO8A 5M1TA 4QWNA 4CZSA 2F6BA 3R6IA 4L56A 1VBGA 1AR83 1MFVA 4HIBA 3BGGA 3NL5A 3W2MA 3ZYJB 3UBPC 1GQPA 4E2SA 1NLQA 4U36A 3U07A 2H3DA 4GI8A 3PUQA 1WDQA 4AYUA 3TQ0A 1W5QA 4Y90A 4GGHA 2AH2A 1S5MA 1B57A 1OXCA 4A8IA 4PE8A 5L7OA 4XXPA 4AG4A 4O10A 3N9OA 3WQ1A 2QLYA 2TSYA 3GXIA 2B31A 1DV7A 3MLKA 3BLLA 4JFUA 2X09A 1H7RA 2HMCA 3FIGA 4K3ZA 4JL1A 1W9TA 4JTIA 1EQPA 4LBRA 4GYFA 4U31A 5LNVA 1Z7AA 4CYDA 3KT1A 4HK5A 5CQ1A 3WL0A 4U2AA 3W7PA 2FFIA 1R2RA 3N04A 4PDWC 1SSGA 3GXUA 2CLFA 5GZCA 2GUYA 1SSDA 2R82A 5AHNA 4FTSA 4LY4A 1B31A 2JFEX 4IV1B 4I8YA 4MGZE 2PDMA 4QGNA 2PDGA 2IWGB 4TVDA 3MDUA 2C71A 2V8ZA 2E67A 3GW0A 5A2CA 4ZS2A 2XJUA 5KZMA 1DHKB 2YCJA 3O6DA 4WVMA 3LBCA 2D2OA 4O4WA 3RQ0A 4AQ2A 2JG8A 4XF9A 1GVFA 3GDBA 3RM4A 4D1IA 1H0BA 4AW7A 5EMUA 3N7MA 1KFWA 2ZEXA 3PPCA 1X6NA 4KG0A 3U7BA 1ND3C 2A6YA 3ELNA 3ABSA 4AAJA 1HW6A 4PDWA 4PSRA 3TN92 3C2OA 4UXDA 1OKOA 5KINA 2W9XA 4UW6A 3VNLA 3OZMA 4ZL1A 3CJIB 4RR3A 4O1EA 2ABBA 1AX2A 1PM4A 3I2GA 4FPEA 3GDRA 3GQYA 8XIMA 3GALA 3GXPA 3B9IA 1GG0A 3NKGA 3SI9A 2YHJA 3L4TA 1RTVA 3OHMB 1V0NA 3QHMA 4GK8A 4WOQA 4Z0SA 2KR2A 5FZOA 1KRMA 3H12A 3VD7A 3NQDA 5HWNA 4GY7A 1ULDA 1XIFA 2BGOA 4H04A 3FLRA 4Q0PA 5FYIA 4U10A 3T2TA 1WB0A 1QI0A 2VBPA 1ZLPA 1BLIA 1OB0A 1HJWA 4H1ZA 2ZX6A 3LI1A 3L4XA 3ZVHA 4A7YA 4J25A 1HJXA 3S46A 3LM3A 1CD3G 2J9YA 3MIHA 3RMEA 3WHTA 5I78A 4R3UA 2FBEA 2V67A 2FMDA 1RXOB 2GNMA 1QXPA 3RI8A 4OCTA 3DUIA 3A4XA 1JVNA 4XZNX 4RV8A 2BXZA 4WOZA 2D7FA 4BLIA 1PKYA 4B5WA 4G8TA 4AY7A 1DQ2A 1F9CA 4K20A 3WD2A 1OFDA 2W27A 3K13A 3TAOA 1B9ZA 3VBHB 2HS6A 3W7EA 4YMZA 3B04A 5KHKA 3CQ0A 4DS0A 3KBSA 2A3WA 1XYOA 4WJEA 1EJWC 4IX0A 2GK1B 2L5HA 2XGXA 2VZTA 4CDUB 1VIWA 1BEV1 3W23A 7A3HA 3K48A 3LOBA 1C5IA 1ONWA 2QF7A 5FQ0B 1W1A1 4S3AA 5BXRA 4GX9A 1NE4A 1NA1C 3POEA 5C6CA 1AH0A 4NAFA 1NZIA 1LRQA 1L2QA 4EF8A 2PA6A 3GO2A 5GJNA 4ZPIA 1WXYA 3QKEA 1QXLA 3WR0A 1Q3NA 4Y9OA 4RHV2 5EPDA 1K03A 4O14A 3BLFA 5KETA 3VZZA 1WCSA 1C8XA 2PQSA 1CWPA 3SUUA 2I2SA 3QF0A 3LIHA 4M7SA 3ON7A 5REQA 2GH2A 1F8IA 2RS32 1X36A 3AJ7A 1QW8A 1QHZA 3SMHA 2WVTA 1RPXA 3PPGA 4JN8A 2GC3A 4IG2A 3EA3A 1PZ2A 4F0MA 5FK7A 4YYOA 3N34A 1KBKA 5FUIA 3M44A 3KOZA 2HBXA 3CJIC 2DIKA 2KX9A 3G1FA 3DFPA 3HNYM 4YNGA 2RR12 2V4VA 2Y34A 1WDPA 1GKBA 2TODA 8RUCA 1F6KA 2YDAA 5I7GA 5A1FA 3GUWA 4LUTB 5C8WA 3I4EA 2W63A 3DX5A 1HQWA 2PRLA 3OVRA 1UY1A 5LBEA 3UD6A 2OZ0A 3LBMA 1LG1A 3CL6A 3S2MA 1M7OA 3UJEA 2ZRWA 4JTJA 3LZZA 4C60A 2PTWA 1U33A 1ZBA2 1EV12 2RS53 3NL1A 4UTWC 3OG3A 1EJXC 3NG3A 3CHEA 4KWVA 3VGDA 4RFT0 4N53C 4CXXA 2C6QA 2XG9A 3VFCA 1DPMA 4RX0A 4GZ9A 4C5ZA 1VYPX 1MQRA 5A5WA 4MGSA 4QX2A 3LSCA 3ZMRA 1C9WA 1ZQ5A 2G3FA 2FTYA 1Q4NX 3ERPA 3NQ2A 3GJAA 1ASJ1 2IXKA 1KQRA 3DYMA 3QPEA 3EMRA 2BNJA 4MGTA 4J40A 4KETA 1CCWB 4UTIA 2CESA 3CLPA 3OD4A 4OVEA 1AUSL 1BYBA 4XTDA 1R083 1K12A 3WEMA 4G4FA 1XPYA 3VBHC 4DUVA 1VBE3 1ENSA 4C1LA 3O0FA 2E6FA 1COV1 2ZS6B 4FO9A 4QX0A 3HMCA 4NMIA 1VJSA 3LEGA 4GPNA 4CKQA 4I0AA 1A5CA 2FCVA 1FCQA 2B7PA 3KUMA 1QUMA 1HV0A 1UWRA 2B7OA 4QDPA 4EIVA 2O7QA 3BYWA 5AC92 4B4PA 3AYCA 4NRRA 4D94A 5CJ5A 1SLBA 1PNFA 2CV6A 1IZCA 2PD5A 1MZEA 3GH7A 2ORXA 4KNCA 1EUNA 4ISRA 5FBJA 1REQA 2VOVA 2YC2A 5A6XA</