4UFLA

Mouse galactocerebrosidase complexed with deoxy-galacto-noeurostegine dgn
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
644
structure length
641
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords GALACTOCEREBROSIDASE
total genus 216
structure length 641
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4uflA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4uflA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uflA01
2G96A 4HU0A 1EOKA 2Y88A 4AY1A 4IUGA 4A3UA 1R2RA 2V5BA 3O16A 3W1MA 4N2YA 2O92A 3M43A 2TPSA 4C7GA 2OYKA 4FO4A 1TV5A 2WAGA 4PMXA 5TQLA 2CLHA 4CD5A 3PTMA 1UKOA 3LLFA 3W37A 3B4UA 2ZBTA 4AD5A 5LNSA 3PSVA 1M01A 2VZVA 1HKIA 2R8WA 2BX7A 3WENA 1G67A 3Q2DA 3U6WA 1W9VA 5JBEA 2XGBA 3ANYA 1HG3A 2G4FA 4PBGA 3VOCA 4A3HA 2ZRZA 4KFOA 4C1KA 1XUZA 5K9CA 3O8AA 3WMSA 4Z1CA 4XZWA 1X7FA 2ZA2A 3GNOA 1EIXA 4FNRA 1QFEA 5FF0A 3NQMA 2PBGA 5DN1A 1LTDA 2GDVA 4D2JA 2WZEA 3MP4A 4OHQA 2H8ZA 1M7OA 3BG5A 4XUGA 1W3NA 1QHPA 3ATYA 5F2GA 3MV01 1U83A 2V3EA 2V5CA 3F5LA 1XKYA 4ZE5A 1UH2A 3HG5A 1GORA 1T99A 1ZBVA 2OLHA 9CGTA 1JF5A 3HPZA 3NVTA 1XCFA 2ZX8A 2VX6A 3W7PA 5DMYA 1B4EA 2DQXA 1PX3A 1KFCA 1E4LA 1ZAIA 3QMTA 1AL7A 4FIQA 4WF7A 4B9YA 1QAPA 3LX9A 1TUXA 3VGEA 4Z1AA 2VJXA 1OX5A 5LA2A 1RD5A 1W3HA 3TTSA 2PWHA 2Y7DA 3DYOA 4JD4A 2V30A 4S2CA 1E3XA 3MJYA 1UR1A 4JYDA 3N17A 2WKGA 3APGA 2BFGA 5TBOA 2FGLA 3ZSTA 3HBLA 3WK2A 1LWJA 1KB3A 2A3BA 3LBCA 1JL8A 4IMGA 1W91A 3JS3A 2FQIA 5HOSA 2ISVA 5IFPA 4WJEA 1K9FA 4ZQMA 2C15A 3R89A 1W9PA 1OX4B 3S42A 5CPSA 1VPXA 4JNMA 5KITA 4QDMA 1QI4A 2PF0A 2ZZ1A 3MUZ1 1F74A 1J0JA 1H5YA 3WNOA 1BG9A 1SFLA 1SUXA 2F8QA 3PM6A 3ZM8A 1TFVA 3O6YX 1TVNA 3P5YA 1DQXA 3DZ1A 3FS2A 4AWEA 5CSSA 3R8RA 2Q8XA 1M04A 2P10A 1HJVA 3ABRA 1OGBA 1UHVA 4A4AA 2A1YA 4PMVA 2OJPA 1XL9A 1NFBA 3M5VA 1AW5A 1VH7A 3NZ1A 1J10A 4UQAA 4TO8A 3BK0A 3W7EA 4HNVA 1S5VA 2YL9A 2QLYA 4PUDA 4LY8A 5CZTA 4Z0JA 4HPGA 4BS0A 3P74A 2QV4A 2CU0A 1W5OA 5KZ6A 3ALGA 1CLVA 1SZFA 1Q4NX 1FX6A 4JIPA 2GQAA 4LUJA 3LHZA 4Q32A 2QCNA 1X6LA 3ZJ8A 2NV2A 1EUAA 5IHSA 3HPSA 4LU0A 2CITA 3SCQA 2W4XA 3W88A 2D0FA 4E8CA 3MBFA 3AS2A 1I8JA 4TMBA 2VQTA 1BGGA 5I2UA 1RH9A 2VL4A 1FWSA 3OSDA 1W9XA 1JYVA 3RM4A 2VFEA 3SUUA 4CQ8A 4KGLA 4BR1A 3NQFA 3CIWA 1IXOA 1AMYA 1EXPA 2WVVB 4Q33A 3ABSA 4LNYA 5CSUA 4MB3A 3W1AA 1EQCA 4AZZA 1VENA 4CD7A 4HNUA 4MB5A 5AC7A 1Y0EA 1ZJIA 3SCTA 3W86A 1WXJA 3M9YA 4DQWA 3VO0A 1KGUA 1W2VA 4PCSA 3LI0A 4NJJA 4ZQPA 1E1EA 3CZEA 2G95A 4GIAA 3M46A 3UPWA 3SIZA 2RH9A 3STFA 3ZS4A 1HVQA 1YYAA 2ZA3A 1W9BM 4P7RA 3GDTA 4DWSC 1KFKA 2ZZ2A 1MVYA 1BVNP 3F4VA 4TU1A 1YDNA 2PWDA 4N6FA 4X9SA 1JRBA 2EGZA 4ICNA 4JR5A 2V82A 1CGVA 4WOZA 4M81A 2NW0A 1NWRA 3GXNA 4MNLA 1HIZA 4CCDA 1P1XA 4P8XA 2WCGA 4JL2A 3HU7A 3CC1A 3KRSA 3NQ2A 4FHAA 1H50A 5K4ZA 3VD4A 1XBYA 4AF0B 2OWXA 4KWUA 2QMKA 2C8NA 4D6JA 2C18A 4AIEA 3NQGA 1JGIA 2CXGA 2YIHA 1O5KA 1LLWA 1JXKA 1GONA 3DHDA 2A6LA 4JTGA 1GTEA 4ACZA 3TC7A 1JYWA 5D4YA 4FFGA 3TMQA 1L8NA 3GR8A 4W5ZA 3F03K 1BWKA 4JAWA 3EWUA 3VM7A 2B7NA 4X3ZA 1GQLA 1GOKA 3GH7A 1ML1A 2W61A 1CEOA 2NUYA 1Y9MA 1NWTA 3AXHA 2PWFA 2JEQA 3WH5A 3DHUA 3G18A 3GXTA 1XI3A 4DBEA 4UR7A 5FEXA 3VDCA 4O8RA 1TRDA 3NPXA 1L0PA 3NQ7A 2YXGA 4ZXLA 1QCWA 1R8LA 4GUJA 5G1YA 4LC6A 4JGDA 1E55A 1TTIA 2G97A 4LUIA 3AS0A 5EMYA 1DWJM 5HUPA 2WCSA 1GVSA 2VR5A 2J9ZA 1A53A 3AISA 5D37A 2VO5A 2OYLA 4MADA 2DZVA 3LCXA 3PVFA 2NXGA 1EA0A 2D20A 2AGKA 4BQ2A 3TAKA 3A4WA 1CXLA 1I4NA 2VT0A 3CZGA 3KWXA 2QQWA 3AOFA 1W2PA 1XD1A 2W92A 3CZKA 3RCNA 3EBVA 2ZX5A 4N4PA 5I3DA 1JIBA 2GVLA 1CLXA 3HPXA 3WD4A 4K8EA 2V3DA 1BTCA 1NF7A 1KTCA 4K37A 3T44A 1OFBA 2X1RA 5ABFA 4U3AA 4UMCA 5GNYA 1CPUA 1ZL1A 4HKPA 1D2KA 3FOKA 2WSPA 2OSYA 1QVBA 4UFLA 3CBWA 3NCOA 2PE4A 1MWOA 3N9RA 3KXQA 4GXPA 5DXXA 2E9BA 4R33A 2X16A 3VD7A 3LHUA 1FDZA 3L67A 1YXCA 3GNDA 4O50A 1GJPA 4ONVA 4HIBA 4O18A 3P80A 3I7RA 3USBA 1JXJA 5HWJA 1V02E 1TV8A 2QF8A 1VF8A 3KVMA 2D22A 4GNJA 4MDPA 1UR0A 3UZJA 4FLRA 2WPGA 1W3KA 4B3LA 1E6QM 2UWFA 1W31A 2CZEA 4TVCA 1C8QA 2YZRA 4MTVA 2BHZA 1CXHA 2VENA 3ECQA 3WNNA 1IT0A 4CGTA 4MB4A 3CIVA 2AEYA 4YHEA 6TAAA 4P8UA 1ISVA 4JFWA 1KTBA 3G3DA 5CGQA 2VMFA 1H62A 1EPXA 4Z1DA 2YBUA 1LLZA 4GZJA 1ISXA 4JEQA 1M7XA 2GOUA 3HG2A 5AB3A 2VOTA 3VPLA 6TIMA 4TUFA 4D1JA 1H7PA 1SO4A 4UMAA 3LPOA 4LC8A 4FFIA 3FYPA 2F84A 3UQNA 1JCLA 3PWAA 3C61A 2ZRYA 4WY0F 4RXFA 2FJKA 3RLVA 1UYQA 5ECUA 5FL1A 3GXPA 4FNTA 1E1FA 8TIMA 1WZLA 3IGUA 1VRXA 2C16A 4IPIA 1GOIA 2ZUWA 3LRLA 1CW2A 5FIXA 3G1AA 1A5AA 2PI6A 3LERA 5AC6A 3BLKA 1KM1A 3KFTA 1VR6A 5K3VA 4LVGA 4ADSA 1ZNNA 3T2OA 4RE3A 5CPMA 3A6OA 2YOCA 3EXTA 1TCDA 1FDJA 1IXNA 1DBTA 3BW4A 1L6WA 3P62A 1X1NA 2WK2A 3EMCA 5EMUA 3O6CA 2CIPA 2EF9A 3NQVA 5LA1A 4JX4A 5GPRA 3BGJA 4WY0A 2DZPA 3CB8A 3AMKA 2EPNA 4WSJA 1PVNA 2J7BA 4YPJA 1OT2A 3L21A 2DT2A 3NDOA 1ZBWA 1DWFM 2QF7A 4Y8FA 4HU8A 4Z2IA 1E71M 2GFTA 4JTHA 3BLPX 3S5OA 4UQ9A 3VMPA 4JTJA 3O2LA 4PUEA 3AJXA 3TUUA 3U7VA 3DFOA 3SCSA 3SUTA 1H60A 3G1XA 1QW9A 2W63A 3L66A 3QW4B 1WZMA 3AMLA 1KW1A 3B03A 3WQVA 1WZAA 4PMYA 1C91A 1PX8A 1R7OA 3QSRA 1GOOA 1V02A 2ZOXA 2XPKA 1SFJA 3TTQA 3CUGA 2QJGA 2YX0A 4JTKA 1ZBKA 4D6HA 5A95A 3SCUA 1U2YA 1BTMA 1G94A 2WHLA 4AAJA 3LXCA 2TYSA 3KE0A 4TTUA 4JX5A 4UFIA 1F2JA 4JCLA 1A47A 4JFUA 3W7LA 5I5RA 1KWKA 2WJZA 4IPNB 3ABOA 3C56A 4M7SA 3AROA 1KM0A 1D3GA 2EBNA 4CU7A 2QJHA 2Z2UA 4M6VA 4H41A 4MDOA 1BVZA 3BSGA 3MUY1 1TRIA 1UWIA 3BW3A 3KOFA 5BW6A 4NRRA 3NSXA 5FF2A 3S1WA 1VCVA 3ZO9A 1F5ZA 3AQUA 4K68A 4W5UA 4LV4A 5D04C 3NQAA 1JDDA 2FHBA 3BW2A 2YDRA 1KM6A 2YFOA 3W9ZA 4J3TA 4LYRA 3MHFA 4V27A 5DO8A 1TO3A 1TPUA 4FNSA 1UA7A 3OGVA 3POHA 3EB2A 4W89A 2WHKA 3LCWA 3VE7A 4WQ6A 3E12A 4CCEA 4NX5A 3W83A 1UZ1A 4PODA 3MI2A 2Z0IA 3LRKA 5E0KA 3VI2A 4AD0A 4UOQA 5LKYA 3UYCA 3ZWTA 2Q3RA 2YDQA 3NSNA 3VVGA 1M03A 1FCUA 4LT9A 3VGFA 1WOAA 2WMIA 1L2UA 3NGJA 3KRUA 3EDJA 1TA3A 4JL1A 1ONRA 3W25A 1GWJA 4JY9A 1E9LA 1MZHA 4F79A 3L68A 5G2IA 3W23A 2WMGA 4XWUA 4WXYA 1VJSA 3QF0A 1BG4A 2IXVA 4A29A 1BFNA 2BLEA 4MPKA 1XBVA 2GK1A 2O9PA 4CN4A 5I3KA 1OF8A 1C8YA 1G01A 3L4TA 4B3KA 4CCCA 1JVNA 3GAKA 1LORA 3E49A 3ARZA 3WNPA 4X0VA 1QOXA 4UZUA 1VZWA 3PC0A 3CHCA 4LVAA 4U3CA 1GQJA 3N1AA 4JICA 1HKMA 5D33A 3S5ZA 4MOZA 4RKAA 1QO2A 3U14A 3DFNA 2VZSA 3AYRA 4O10A 3MV11 3ELFA 4AWTA 1M5WA 2TRSA 1E56A 3AMGA 4AVFA 1GCYA 2BVTA 3OZOA 4EWND 5D2YA 1CGUA 4HP5A 4WIWA 2WV8A 1MQRA 3STEA 3SCNA 1IXQA 2R91A 5KSWA 3BAJA 1UCWA 1JQVA 2ISWA 2XVPA 1HUVA 3DHPA 5FKCA 3AFBA 4C1LA 1CGXA 2XYLA 1ALDA 4PMDA 1UYPA 5A69A 1LL4A 2Y2WA 3C2FA 1R87A 4JFVA 3CWOX 5HWMA 3G8EA 4N9EA 3FN9A 1EUNA 1EWEA 5M03A 1XC4A 4AZHA 1BWLA 1BLIA 5K4XA 4FX8A 1YPIA 4JTLA 3OLEA 3MP5A 5E1QA 5EA9A 3ZSSA 3WJYA 2QPUA 4UFHA 1XUUA 3EX1A 1F73A 3K4DA 1KTNA 4JDBA 5A6MA 3G1DA 1Y4WA 3GAYA 3T0BA 1TIMA 2RGLA 5A2CA 2VCBA 1C7SA 1EH9A 3OEXA 1KLYA 1OFAA 1YTEA 4JYEA 1IZJA 3T0DA 4HT3A 3TC6A 5DBTA 4PCTA 3BAIA 4AMAA 3WUFA 4M82A 1UD5A 4PFMA 4ZE4A 1UASA 4PA8A 3R5EA 5AHEA 4I7UA 5I3IA 1BHGA 1CZ1A 2X1IA 3G6LA 1JZ4A 2OSXA 4Y96A 5D38A 4BFAA 1OWQA 3EDEA 4DO4A 3O9NA 2WB5A 3D3AA 3VMOA 3W2NA 3OLDA 1MO0A 4GI6A 1V03A 1KGWA 3EYPA 4AH7A 4A2SA 1J0IA 1F6KA 1RQHA 4Q4KA 1AG1O 4MZ8A 1H49A 3W2UA 1K6AA 3VGBA 4YCPA 3WQ6A 4IPJA 2CBJA 5G1TA 3FEMA 2XVNA 4UFKA 2VEKA 2P1FA 1RD6A 1EA9C 3ALFA 4RZ5A 3FYOA 2VVSA 2W67A 4DWSB 3UR8A 1KV5A 5A5WA 1SR0A 1FWNA 3NZRA 1ADOA 2DZWA 3SCWA 3BO9A 3GDBA 4X0NA 1JZ6A 1NEYA 1C9DA 3EX4A 3KX6A 4MFEA 5DLCA 1LOQA 4GJ1A 1Q6GA 1UKQA 3ZJ6A 3W38A 3G6MA 3T7VA 1A50A 3C8FA 1T8XA 4U5IA 5AC5A 5BXSA 1W3TA 1AQHA 4UNKA 2Y24A 3FKKA 2ZCGA 5M3WA 1J18A 3M6YA 4BI5A 1KXHA 4QP0A 2MANA 3K4AA 4HMCA 4BF7A 1V0KA 4B15A 1H41A 1E0VA 3OVPA 2VKZG 3FIGA 3PZMA 2CLIA 4WY0B 3VX0A 1UD3A 3IIOA 3O15A 2DT0A 4JKLA 1Z44A 4MPQA 3SGUA 2WHJA 3VGGA 3W24A 3N3MA 1UWRA 2A3EA 3M5ZA 4N9BA 5D03A 1Y9GA 1C90A 3BMVA 4NRSA 1S5TA 2XGIA 4KWWA 3WUEA 3NAVA 2CZFA 3OBAA 2DZTA 4G1KA 4UNLA 5K2ZA 3NYDA 4J3UA 3WEZA 3TR2A 1C3FA 3F4WA 3MMWA 4IMEA 4NZFA 3DHFA 3OA5A 3RO8A 1TPC1 3IEBA 1O6IA 1QPNA 4H8HA 3UERA 3BARA 3WD2A 1W3JA 1W9UA 3ARYA 4H6KA 1SMAA 3GH4A 1UUMA 1G4PA 5LSMA 3YPIA 1HTIA 2IQTA 4IPLA 5FMBA 4D6EA 2CWNA 1B9ZA 1HFBA 2OXBA 3OA3A 4DF1A 1X8FA 4GZEA 4WSKA 4D6GA 3BVJA 4QLLA 1ZJAA 4IOTA 1HP5A 3OB8A 4HMEA 1GQNA 5I3HA 2BNJA 1KBIA 3DFQA 1R30A 2VXNA 4WD0A 1CYGA 4Y9AA 2WVVA 2O9TA 1XCXA 2J47A 1B30A 1FY6A 1SPQA 1UR4A 1VC4A 2PWEA 5ABEA 1OCQA 5D30A 5KZDA 2JALA 1ZFJA 2CLEA 2WXDM 3GNNA 3MMUA 3SCOA 7TAAA 1DV7A 1THFD 1HL2A 2CLOA 1ZJBA 2EPKX 2QCGA 2PRHA 4OBRA 1LM1A 2GPTA 4NX0A 2BY2A 1Z42A 4JHZA 1X1OA 3LEMA 4LS1A 1J0ZA 4P7NA 4QCEA 4IWWA 3VU2A 2CW6A 3L0GA 5F2IA 4FEZA 1O4UA 4O13A 1H1NA 2Y70A 1U30A 3I7SA 4R7JA 1J01A 1QHOA 3EXSA 5AHNA 1K3UA 3W1NA 2WWDA 4QHZA 3W7HA 3AIUA 5I79A 3EDFA 4AEFA 3GKFA 4RLIA 1PHQA 5A94A 2RDTA 3HG4A 1K02A 3ARSA 4ZQRA 5FEWA 2JFEX 4TXEA 2WSYA 3OBKA 2CFFA 2QCLA 3TSDA 2Y62A 4LXFA 3WFZA 2WNWA 3PF3A 4HZ8A 2OSWA 2OZ0A 1TV7A 4JS3A 3UXAA 1TMHA 4AD4A 1VJIA 2FLIA 1DTUA 4CNOA 2CLFA 3IV3A 1TQXA 1V5XA 4ZXOA 3HBKA 3CMJA 1FH8A 1VAHA 4W88A 4O11A 3WJXA 5IDIA 1I2OA 3S8HA 1JUKA 4TR9A 3MHUA 5KTLA 5F1VA 3NYZA 2WW5A 4JIEA 4BWLA 5FMDA 2VEMA 1QPRA 4O4WA 1LLOA 1XH0A 4NSBA 3VIPA 3N12A 3W6MA 2Z1SA 3WFLA 4M6QA 5IM51 3TQVA 4O0KA 3NMBA 3WJSA 3PIJA 2CYGA 4U5KA 1N7KA 2V38A 2FPTA 1OFRA 3T78A 2QPSA 5HUOA 2ADDA 3VIJA 3VTRA 4O54A 4O15A 1E51A 3KVKA 1OBAA 4UFJA 3WH7A 3GXMA 2VX5A 2WSQA 5DELA 1GVOA 3B8DA 2UY2A 2ZRVA 1C8XA 3IMMA 3KL0A 4WJXA 4M19A 2X1UA 3PZUA 4HA1A 2JIWA 2DIEA 1AQ0A 1OYAA 2GJLA 7A3HA 3VKKA 2Y89A 8A3HA 1FA2A 1VQTA 1DJNA 4UXDA 2E3ZA 1HJWA 3S1UA 1PCWA 3NOEA 1GQIA 4NU7A 2WLYA 3IGXA 3Q94A 2QUVA 3QM3A 3G1VA 1K8XA 2YGYA 4MIMA 1EP2A 4O19A 1GJWA 1PHWA 2A7NA 2WMHA 1W2TA 3W28A 1O94A 2JGYA 4DXVA 1FXPA 1F4HA 2WVSA 3NQEA 2BWGA 1B3YA 3LDVA 5C55A 5A8PA 2E4TA 4WOQA 1UH3A 1UJPA 3WDHA 1B3OA 5L6UA 1J0KA 2ZUNA 8CGTA 1JZ7A 2J8FA 4Y7EA 3ARXA 4M6PA 1JNEA 3U75A 3O1NA 4W7UA 4IXHA 5I3FA 5K9DA 4PMOA 5BXPA 2Y8KA 3UGGA 3EKZA 3PN8A 1UH4A 1LWHA 3A5VA 4EK7A 5F4SA 1WZKA 1WBJA 4MYAA 1UQZA 3NPVA 3AHYA 4O4VA 3AZTA 3TXZA 3MSGA 4HZ6A 5ABGA 5E6ZA 3CMGA 4TTGA 3UWVA 3AMDA 3LOTA 5HNNA 3SIMA 1CXKA 1JAEA 4TOQA 3C6CA 4UZSA 1GTHA 4IMFA 4CUCA 1QPKA 1NARA 1V6YA 4W8LA 3UETA 3AIEA 1LRNA 1YADA 5LGZA 1ZBCA 2O7QA 3STGA 1EIBA 5F2MA 4ZQOA 4R27A 1US2A 1AW1A 4FXSA 2C14A 1O5XA 2NX1A 2VEIA 1IV8A 3VIHA 1UB3A 4CNNA 1PAMA 1QPQA 1GJUA 5I77A 1TPWA 1HL8A 3VKJA 1SSGA 4AF0A 1ZY9A 3NDZA 2B4GA 4D6DA 4AZBA 1FDYA 3AIWA 4OZOA 1HNYA 3FLUA 5BRQA 1HL9A 4HOZA 3QHOA 1F05A 3WBAA 1ZS2A 5AFDA 3GZ3A 2J7FA 3AS1A 3U7BA 1MEHA 4D6CA 5A8NA 2V2HA 1IGSA 3B06A 1UWTA 3BG9A 3IVSA 4YHGA 3WNKA 1K8YA 4J3XA 3QZEA 3NXFA 3CQ0A 4NF7A 2BY1A 1YPFA 3PBUA 3KEHA 5CPTA 3ZWSA 4ATWA 1XYFA 1QO5A 2DH2A 3VD3A 2GVGA 1GYNA 5DCEA 1IIHA 2GQ8A 3M0ZA 5T26A 4NZCA 3W27A 2XHYA 3ZR6A 5IHRA 3L4UA 2J75A 1YXDA 4HSOA 2Y8VA 4KFPA 3WFAA 3GK0A 1Q6RA 1GOMA 1PCKA 1I2PA 2DZXA 4A2RA 5J5DA 2ZWZA 3RIKA 1KQZA 2H3BA 3C52A 1E5JA 1T96A 1KXQA 3PAJA 3PUEA 2EAWA 1UKPA 4AZCB 1VB9A 1SMDA 5EPDA 3K8MA 1RQEA 4PMRA 3WF1A 3NO5A 2A21A 1X6NA 2EEXA 1A5BA 4IJBA 1JNDA 1A5CA 1HXJA 1UD4A 1MW1A 5F7UA 1LOSA 2VEPA 2CPUA 4PSRA 3S5NA 3FJLA 1EX5A 1SO5A 1ZHAA 3NUKA 3K30A 3LXBA 4LRSA 2VCCA 3LHTA 3FXYA 1E6XM 1TPDA 5C2XA 2E09A 5DXYA 3TE9A 1LL6A 3W75A 3L9CA 2JKEA 4CLMA 4QAWA 3MMDA 3CHFA 1GW1A 1FH7A 4V28A 2ZZ6A 4EKJA 1JYNA 3IJ9A 2ZX7A 4AZ7A 3ZJ7A 5A8QA 4PSPA 4O52A 4OWGA 1DHPA 4O17A 3M41A 1W1PA 3E02A 1XSKA 1TSIA 4MY1A 3OG2A 1GPFA 3VNYA 4V2XA 5HMSA 2BY3A 4HNNA 1WPCA 4HXCA 1GVQA 2X2GA 1TPFA 3W7RA 1EO7A 3SEPA 1CGTA 4RL3A 3W22A 4O1AA 1WAUA 5FF3A 1CTNA 5BXTA 2LLEA 1E40A 1NM9A 4O1DA 1WDSA 3WEMA 1G7UA 2Y6ZA 4GRSA 3STCA 2XFRA 1JDCA 3WQWA 4H8VA 4JIQA 4JTIA 3HJZA 4X2RA 3W3OA 4GXMA 4QSHA 1GT8A 3B04A 3GX9A 3PG9A 3TX9A 3ARWA 4MNMA 5AHFA 4B5NA 1G5AA 3RM9A 1OINA 2B7PA 4KWVA 1WKYA 4AEOA 3KRZA 5E70A 3N9SA 3ZFHA 3HMCA 5A6KA 2XJ7A 1H7OA 1H0IA 1KFBA 1H61A 2ZZ5A 4Z0SA 3HQ1A 4DO5A 1SSDA 1FCQA 2ZXBA 1XDMA 4MZ1A 2C3ZA 4LRTA 5HPOA 3FHAA 3CUJA 3D5HA 2DJXA 1E72M 4AZIA 2J7CA 3EKLA 2GK1B 1DQWA 4R5EA 2NXHA 2I9EA 4F66A 5I78A 3CZLA 2YA1A 3LPFA 2HS6A 3E9AA 1FWRA 1DWAM 1WDQA 5ANNA 1WNOA 5CGTA 1GOWA 2YPIA 1MSSA 3P84A 3TXVA 3PY2A 5D2VA 3PZGA 1E4MM 3ZT7A 1CI1A 3S6TA 3K1DA 4WKAA 3QC3A 1OYBA 4GO8A 1JF6A 1SQ7A 4MLJA 3C4UA 4P2VA 3TJLA 1BSIA 3CLMA 2E0PA 3GNPA 1W1ZA 3VD5A 4M24A 5A8MA 3E96A 3W74A 1QOPA 5GVJA 3W70A 3DAQA 1NF0A 4KRTA 1IF2A 1MFUA 2ALDA 3LV5A 5BMXA 3SC7X 1EGZA 4AISA 5I3GA 3IIVA 2VZUA 4ZQCA 1BYDA 4XUYA 3LI1A 3AHZA 1HJQA 2NT1A 1HVXA 1R85A 3THAA 3TA9A 1W3IA 1BQCA 1CXIA 3PZ9A 4YL2A 4W8BA 3PSWA 4W86A 3SI9A 1FWTA 4I9AA 1PIIA 3FJ6A 1CXEA 4EIVA 1VFOA 3OGSA 4H4IA 4OGZA 5L9FA 2E6DA 1HO4A 3AI0A 4W84A 3W7QA 3BC9A 5CZJA 3MYPA 2W66A 4MJZA 5A8OA 2VQUA 5F4XA 2E6YA 2HTMA 1TB3A 1VFMA 2YA2A 1M7PA 3U8GA 2D3LA 3RM8A 1OJXA 2Y7EA 5F2LA 2NWRA 1E0WA 2GJXA 3FKRA 1X6UA 1TJRA 4OOZA 4CVWA 2BTMA 1ZAHA 2JEPA 3P8IA 3L5LA 3SFKA 3IGSA 3S9YA 3BAWA 2QDHA 2JIEA 3LFIA 2RHGA 2OYMA 1V3KA 1LF1A 2H90A 3HMJG 3GH5A 2VRJA 3TQKA 2PC4A 3EMQA 1XSJA 3BXWA 3W1XA 4EF8A 1DKWA 4FX6M 5KZEA 2WYSA 1J2WA 2NXIA 2OT0A 4A21A 2Q8ZA 1DL3A 1W1YA 2IXUA 3UY8A 4A3YA 4EE9A 3AIRA 3W85A 2XVKA 3WQ4A 4D6FA 4RX0A 2NT0A 5A6BA 1WDWA 3UG4A 3DU0A 3W72A 4DELA 1V3HA 2WC3A 1JULA 1OIMA 3DFPA 1E43A 4K7VA 2TSYA 2NUWA 2WVUA 4FX7A 2VFIA 3L2IA 3OLGA 5E6YA 3A22A 3AIVA 3LHYA 3N34A 5JIPA 3ZT6A 3VDBA 2YR1A 4S3JA 2V2CA 3LHWA 3A47A 1R2SA 4BCEA 3LRMA 1MW3A 1B2YA 4CD4A 5A2BA 3PIGA 5KMYA 3UPBA 4AIOA 5HDRA 3WJWA 4LVDA 3GBEA 3CUIA 5CZKA 1R46A 1AQMA 1JCNA 1SZGA 2DZUA 1B3ZA 3UZ5A 1KXTA 1E15A 5AC8A 4F9JA 1ZENA 2X1SA 4NXSA 1TCMA 3IJ7A 4UCFA 5TIMA 1UA3A 3AHXA 2V3FA 2B31A 2VRQA 1W1VA 5AYXA 4PC8A 2A3AA 3UEQA 5CPNA 1JZ2A 3PHAA 1QMLA 1GPWA 4PL1A 1HKKA 3LCGA 2DIJA 1DOSA 3WD3A 4GUGA 4C7FA 4MJ2A 1JCMP 1K9TA 3UD6A 3O05A 2DSKA 3WELA 2Y61A 2VCAA 4CU6A 5AYBA 1TTQA 3SUSA 4MYXA 1PV8A 5HPCA 5KEZA 4MAVA 5CGMA 3TKFA 1QI5A 1LZOA 4M29A 2QMJA 1WDRA 2G41A 4QITA 1RV8A 2JBMA 2AC1A 2RGMA 4MNJA 2WSRA 2FFCA 3WN6A 3CM4A 3VILA 2WNQA 1KBKA 3VIMA 2XN1A 2CETA 4B16A 3SCVA 1JI1A 3QSTA 3E0IA 4RK8A 3TSMA 3DYMA 4LYQA 2ZZ3A 3KF3A 2CBUA 4HOWA 1K7XA 3O63A 2FB3A 2VFDA 1ITXA 1LQ0A 1YTDA 2J24A 4IM4A 2CBIA 2NV1A 3WDPP 1WO2A 4GPNA 4JKKA 3TU9A 3HB9A 3W1RA 3HGRA 4IMDA 2YLLA 2ESCA 5BXRA 3A4XA 3L2LA 4K36A 3VIGA 1O60A 4MKNA 1XM3A 3RWKX 1QBAA 2ATMA 3WY1A 3IK2A 1QWGA 1I2RA 3BCFA 3EWWA 5CG7A 1ICPA 2ZUMA 3E1F1 3HGOA 1GG1A 2CHNA 4RE2A 2AQWA 1N82A 3N2MA 4R34A 3VIFA 1CGWA 3GDMA 5AHLA 3SY5A 1EO5A 1QI3A 1AMKA 2W91A 1VCGA 2I1OA 3GKAA 4JXCA 2J74A 4JCMA 3BGAA 2X09A 3DECA 3WUGA 4E2BA 4U33A 1HF6A 1NAL1 3ZT5A 1W5PA 1TVPA 4M80A 5CZ0A 3RJYA 4AZCA 1CXFA 1PS9A 3R2GA 1RZMA 2WM0A 1O7AA 5DEZA 4OKDA 5C54A 3W76A 5HINA 3CO4A 4QIUA 3CGTA 4HPHA 2KZHA 1OG0A 4GUIA 5FL0A 2GJNA 3OG3A 4HHPA 4ZQNA 5DCBA 4OV4A 4LGXA 1K9DA 1OK4A 4JKMA 5G4WA 3LV6A 5JBDA 1Z32X 1LOLA 1R2TA 2QCMA 2E68A 5EB8A 3RJXA 3OIHA 1KM3A 4WX2A 2VFGA 5LNVA 1ME9A 1OFOA 3W7JA 3F5JA 4DM2A 2OMAA 1DORA 3VX1A 2W62A 2FB2A 2XTKA 3ARVA 1E0XA 1VHNA 1JCXA 4YCOA 4AHQA 4IX0A 4TX9A 1OF6A 4MJMA 1DWGM 1TPB1 4D1IA 1LBFA 3DXIA 1E4NA 1V6VA 2W5FA 4U31A 3SR7A 1F7BA 2FDSA 4IGHA 2XIBA 4PEKA 4CN1A 3PULA 1B31A 5FMCA 4H04A 4GUFA 2G3NA 4AD3A 1D3HA 2QR6A 1NVMA 2J9YA 1EWDA 4JTSA 1B3VA 1SFSA 1UD6A 3OGRA 4BQ3A 1V6UA 5EY5A 4BK9A 1JZ3A 3KL3A 1BEUA 3BGGA 1FCBA 3N19B 1BYBA 1UZ4A 1OABA 5CQ1A 4LVBA 4AEEA 3NQDA 3NL5A 3LIHA 1UR8A 5FF4A 2FGZA 4DEFA 1V0LA 1W1TA 3EMZA 4QLJA 1UUOA 4H7VA 1OSEA 3NA8A 2FH6A 4J3VA 1G6CA 4S2BA 1XHGA 5TD4A 4AZ5A 5C8BB 3H53A 3G1YA 4B9ZA 3CH9A 2XWEA 3C2RA 3MHGA 3TCEA 2JKPA 3OHIA 2PRLA 4HN4A 3WF3A 1C29A 4ZMGA 2ZYFA 7CGTA 2HS8A 4W87A 5G5IA 5D2XA 2XG9A 4UNIA 4DPQA 4NJKA 1CDGA 1HO1A 2AMGA 1KM5A 2F2HA 4MB1A 1H2JA 1Z41A 2YL8A 3BAYA 3N13A 3UWWA 1YXYA 5I6SA 3VMNA 2ZIDA 2ZX9A 4UTWA 4GI8A 3AYSA 1MW0A 3CPUA 4NNBA 1JUBA 3AIQA 1FHLA 2BXZA 3M47A 1JI2A 3PS7A 4UUIA 2BVYA 5A8GA 4UTLA 4IX2A 3W2JA 5E09A 2DP3A 3TFXA 4XQ6A 3MSDA 1WOBA 3TTYA 2ZRUA 3CWNA 2ZUVA 2XSBA 1KQYA 1TZ7A 5FKYA 5A6JA 1JD7A 5K9XA 1V3LA 4DM1A 1XCWA 5CJ5A 2ZZ7A 4XBKA 1TE1A 1HJXA 1W0MA 3TH6A 3A5FA 1KBJA 1NOFA 4O28A 2B7QA 1OFPA 3SW6A 3GYEA 2O7SA 5BNKA 4NI3A 3THDA 2HMCA 1FHDA 1HN1A 1DVJA 2DU2A 4GBUA 1OHLA 1VGAA 3W81A 3QMSA 2AOSA 2X8RA 4FNPA 4WZHA 4PTMA 2BXVA 3G0SA 3IVUA 4I7WA 4W9TA 3MUXA 3QRHA 1XC6A 4LPCA 1H63A 1WCGA 1A5SA 4RE4A 3LGEA 3LXAA 1D7FA 4AW7A 2JGQA 3GM8A 3SCRA 4E38A 5EBAA 3WNMA 1HX0A 3ARPA 2G8ZA 1NWUA 1LJYA 3M5XA 3PUOA 3AO0A 3O06A 1OFQA 3TW6A 3C2OA 1YQ2A 1OD8A 3VGHA 4P7OA 3EWZA 1K8ZA 2Y63A 4DF0A 3NDYA 1RP9A 3DKLA 3EWYA 1VBRA 2Q3OA 1NH6A 4Z2LA 3QEZA 2YFNA 2ATSA 4Y6GA 4A22A 1UR9A 1KFLA 4LV9A 1PJ9A 2A3HA 3EDKA 5FESA 1OX4A 1LYXA 4F8XA 3WQ5A 5CLTA 3N11A 5D32A 1H7WA 3ZMRA 3IRDA 2RDWA 2PRMA 1EEPA 3NM1A 3PTQA 3NQ6A 1NP2A 2X0HA 3DBPA 1GYLA 4AHOA 3W0KA 1GVYA 5A6AA 1D9EA 5CSRA 5IFTA 1ICSA 1LDCA 2FHFA 4TX6A 2V8ZA 3M7SA 4GWEA 3T2QA 3RU6A 3B0UX 1RPXA 2QCEA 3WK3A 4RJEA 3NG3A 3CEPA 3AS3A 2A7RA 3VE9A 1XDLA 2ZQ0A 3QQ0A 3RLUA 5H2ZA 3LCIA 1ZU8A 2WCAA 3QFEA 2Z1BA 3B0PA 3SUVA 5LHFA 3UESA 4NZJA 2HISA 3I65A 5FI8A 1G9HA 3I3DA 1J4EA 3BLFA 1E73M 4D71A 3GIYA 3J7HA 3M7WA 1I1WA 1VFFA 4DWSA 3W2KA 5A6SA 3I7QA 1KM2A 4RR4A 4ZFMA 3A9IA 3S0CA 1PE1A 5A6BD 4BI7A 3PB2A 1SU5A 1B3WA 1KCLA 2V2DA 3DH7A 4LTSA 3MI3A 3BLIA 4LOCA 2J77A 2NZLA 3AHTA 3T0AA 3PBVA 1VYSX 1QW8A 3S1XA 4W85A 3THQA 3LMYA 4MVAA 1GG0A 1I75A 3L4ZA 2V9DA 5LGXA 2X2YA 4QLKA 2E6AA 3NL6A 3UGHA 4AC1X 1GZGA 1DP0A 3TDFA 2VFFA 3HOJA 2JE8A 1K7EA 4M1RA 4PTNA 4RZ4A 3KL5A 2DGAA 2ZUUA 4KGJA 3W87A 2DORA 5F4WA 4BF9A 2GQ9A 4UTKA 3OVRA 3W1PA 5FF7A 1M53A 3VIOA 5C70A 1GEQA 5ABTA 4JHOA 4L4LA 2A2IA 2DZSA 3IIPA 1ECEA 3TFCA 4AZ6A 2QQVA 2HSAA 1OGGA 4NQ1A 2GVJA 3INPA 4PMQA 5JUVA 1N55A 5BRPA 3GB6A 1VJZA 2EXOA 1QI2A 3O6AA 4AYSA 3W29A 3W07A 3VINA 1H0GA 2UY5A 2D0HA 4RV8A 2J4GA 4QAIA 3OLIA 3W6LA 1CIUA 1C8VA 4UFMA 3NQCA 1PL9A 4DF2A 4FLOA 4X22A 3OVQA 2E6FA 3SURA 4LX4A 3F4NA 2QCDB 2WMFA 1TQJA 4BWLC 4NJHA 1HKJA 2E8ZA 3BH4A 1B57A 2RFGA 4OBSA 4PTVA 4L4MA 1GVFA 3L0NA 3FY1A 2Z6IA 2H6RA 4AB4A 1J9YA 2D23A 3M6DA 1ZCOA 5KINA 3W73A 5E93A 4MY9A 1JYXA 2QDGA 3TW7A 4I7VA 1CWYA 1XGZA 3C2EA 2PCQA 2VZTA 3BAKA 5CLWA 3LTSA 4QQ3A 4MJ4A 1UR2A 1TPVA 3MW7A 5LHEA 2ZXDA 3P82A 4JDYA 4BA0A 3VM5A 2JF7A 3A4AA 4DWSD 3QH2A 5M5DA 4UTFA 3A23A 2NX3A 1EDQA 2G3JA 5IBXA 1ISYA 4LYPA 1J5TA 3PBWA 1KFWA 5HULA 3WH8A 4EF9A 1M6JA 5F1UA 4BI6A 2VR4A 3PBYA 3NIYA 1NWSA 4UC5A 5AYZA 1JCYA 2FIQA 3H54A 2WO5A 4BZYA 2GDUA 2ZDRA 5BCAA 3WD0A 1W37A 2GJRA 2ZFAA 4TMCA 3L5MA 3M07A 4KFNA 5FIPA 4URIA 4AD1A 3W1QA 3UWYA 1SW3A 2CLLA 1OYCA 3G1SA 3HG3A 1US3A 4XB3A 5FCZA 5GNZA 1G69A 1KM4A 2HVMA 2ABAA 2ZICA 2BHUA 4J9JA 1QNVA 2YYTA 5C5YA 5GNXA 1LP6A 4Y90A 2WNNA 1ST8A 4N9DA 5BOOA 4NJGA 4ZL1A 5KZMA 4AIUA 2EHHA 2AEZA 1W56A 3TIMA 1E70M 5HWNA 2CESA 3CU2A 2E40A 4FLQA 2OWWA 3W6YA 4Q7NA 1BF2A 4QFUA 1QDSA 4N0RA 3UCQA 1R86A 3TA6A 2C0AA 2ZTKA 5AN7A 1EDGA 1H3GA 2WWCA 3GBDA 4QNEA 4LQ1A 2X05A 5AHIA 3SJ3A 4JTUA 3QGVA 1JG9A 1SZNA 1FQ0A 3BPWA 3S2CA 1Q6DA 3N73A 5AYYA 4OOUA 1V3IA 1QNSA 4J27A 4E0CA 2QAPA 1B9BA 3B0VC 5LNUA 3CZ8A 3KVJA 4N4QA 4FF5A 1TYGA 1V0NA 1H1ZA 1BPLB 2EKCA 2ZXQA 4ATLA 2EPOA 5I24A 1OIFA 4OU1A 1UUQA 5G4EA 1E3ZA 4QISA 1UWQA 4YN5A 5AY7A 1Q6CA 3W7MA 5FK7A 1Z48A 3M44A 4QM1A 1NQ6A 3VNZA 2C6QA 4OJYA 1KCKA 4DBDA 1VRDA 1EHNA 1L6YA 2BHYA 4H2CA 3CPRA 1Q6EA 3ARQA 4M8UA 4LVFA 1DEDA 3QOMA 3SCPA 3EX3A 1MXSA 3W84A 3OIXA 2WKJA 3AZRA 3RILA 4JN6A 2YLAA 4P8VA 5I23A 1OFDA 4OIFA 1AL8A 4HPJA 2Q8LA 3DKJA 2BV9A 4NNCA 3FA5A 3V1PA 3WH9A 3LDKA 1SW0A 3LDRA 1ME7A 4UQCA 3QPZA 4X9YA 2QEZA 1CX9A 5LNRA 1F4AA 4UTUA 5HR7A 1G7VA 2V0TA 1KFJA 1GHRA 1ODUA 5EL1A 1D3CA 3WMCA 3AMCA 1GVRA 1H7NA 3KZSA 2OWCA 2GJPA 1FUYA 3EWBX 3GXDA 1K03A 4TVUA 3N14A 4ML9A 1PEZA 5G2WA 1H5VA 2D0GA 5MHBA 1HJUA 3G24A 2ZE0A 1JFXA 1Q6OA 2WOQA 1PPIA 3VDAA 5JBFA 1W32A 4ORMA 3FAXA 2ZZ4A 1B90A 1G4TA 3R12A 5DT7A 3WF2A 2EPLX 2DPEA 1SYTA 3MS8A 2CLMA 2WMIB 3BAXA 4TIMA 2XUCA 2YJQA 2DH3A 3MI6A 2QUUA 3VUPA 4JQTA 4N6EA 4P7LA 5LZLA 3EX2A 3VDHA 3H3LA 2XWDA 3K8KA 5AC4A 3W1UA 1LG1A 2VTFA 2VNCA 3PUDA 5HNRA 1OK6A 2X0YA 3VGDA 5CPQA 1R47A 4QNWA 4DUXA 3GTNA 3CUHA 1FP8A 3I3EA 1CENA 1UD8A 1B3XA 4D72A 2A4AA 1CBGA 2D3NA 3T08A 4UTMA 4BQ4A 1ESWA 1V7YA 2F61A 2Y4SA 4NT0A 4CVUA 1KXVA 2E5DA 3T09A 1SZEA 4O1BA 3LB0A 2IUZA 1NOUA 1OT1A 5ABFB 1H11A 3LBMA 2VFHA 2BZNA 3NNTA 2GSJA 1YHTA 2A6NA 1W9DM 2C19A 1ODZA 3W7OA 1FOBA 1TJPA 2ZTJA 1IXPA 2ZA1A 2I14A 3HN3A 1LBMA 3VCRA 4LW7A 5D9OA 4KRUA 4L4PA 5E0FA 3TP4A 4PEEA 1KFEA 3WK1A 4K7YA 5CKSA 1J0YA 1MQPA 2UY3A 1TTJA 3RNDA 2GVYA 1N8FA 2QUTA 3B9AA 1ITCA 3EEGA 1A3HA 1UKSA 3L4YA 1FH9A 3W7GA 2AAAA 2J7DA 3WBEA 3W7IA 1JZ8A 1JCJA 5DT5A 2CZ5A 3I3BA 2VRKA 1C7TA 3P60A 4CQ9A 3KF5A 1C92A 1MW2A 3U2OA 1QHZA 5AYIA 1JAKA 2J25A 5CXPA 1TREA 4AHPA 5DBUA 4JZ5A 4PCFA 4L4OA 3DFTA 4IMCA 3FHQA 1B1YA 1OVDA 3KAOA 4UR8A 1VEOA 4GKLA 2QAFA 1S46A 2DSUA 4GI9A 2YW3A 4ML4A 5CG0A 1BYCA 2ADEA 3TK7A 2GUYA 5A1AA 1KBBA 4AD2A 3AXIA 3RDKA 3QMRA 2E8YA 2EQDA 1EB3A 3HF3A 3QPYA 2VZOA 4F9DA 1GQKA 3NJ3A 3N04A 1VYPX 4N42A 1LG2A 4XKYB 3GDLA 3HIJA 1FBAA 1JQXA 3W1LA 4EQVA 1H09A 1UG6A 4FXRA 3ZIZA 1WA3A 1P6WA 3PTKA 3C3NA 3IANA 3IIXA 5I3JA 3RF9A 5I0DA 2OT1A 2Y7GA 3IVTA 1VLIA 3ZQ9A 2WVTA 1JDAA 1RP8A 2XFFA 5A3HA 3L2MA 3EXRA 5EFDA 2E77A 5D8ZA 1YDOA 2J62A 1JZ5A 1HJSA 1OB0A 1QOQA 4E2OA 3T2PA 3BV4A 5FOOA 3G0UA 4OQVA 1F76A 3WSUA 2JF6A 4EVZA 3K46A 3UWQA 3QR3A 4S3KA 3CT7A 4UQDA 4R53A 4UTIA 4CNPA 3P67A 5CZSA 1XH2A 2E9MA 3B8SA 4WKHA 2ZUTA 3LCHA 4N9CA 3L4XA 4Q22A 1VEMA 2B7OA 2QCFA 3MKKA 4K38A 3QOKA 1Q6FA 3L4WA 1S3HA 1OFEA 2CBVA 1V3MA 5FD0A 3ZJKA 4WK9A 1EDTA 3SSJA 3KVLA 5D2WA 4FB7A 3NQ8A 2J9XA 3DFSA 4K39A 3WJZA 3LF7A 5IBXC 2CEQA 3WF4A 2YDAA 2Y85A 1CECA 3NL2A 3H55A 3JR2A 3O6DA 1PZ2A 2YKKA 2VI0A 2FPVA 3MBDA 4ADUA 4NVTA 3DI1A 4RXGA 3VNDA 3PR2A 4GQQA 3W1TA 4HTYA 4NJIA 3S5QA 4RZ6A 1NP0A 1QI0A 4P7QA 3THCA 1LL7A 4O16A 4JTEA 2YDSA 4WLCA 3MMTA 1SO6A 2CZDA 2ZRXA 5H91A 1WB0A 4ZVJA 4UTHA 3W2LA 1QR7A 5C71A 1V0MA 4AZGA 2WBKA 3RMEA 1BAGA 1UWSA 4QCFA 1DWIM 1ZAJA 3BSHA 3RPMA 2H3DA 1DWHM 4OV9A 2E9LA 3M1ZA 4O1CA 3W7DA 5GQBA 1XFBA 4W7VA 3DC0A 2E5BA 3MU7A 2NUXA 2CKSA 4B1LA 2W79A 4H3DA 4DO6A 3NPWA 3Q37A 3QQ1A 1E6RA 2WMKA 4PTWA 2WPBA 4KKXA 3ARUA 3CEUA 3PZNA 3U5UA 4QJ1A 2FTPA 3W7CA 4EAMA 3A24A 1TG7A 3SUWA 4U2ZA 1PZ3A 3I6RA 3N15A 5M17A 1P0NA 3GDRA 4JFTA 1GOQA 3WF0A 2VURA 2PB1A 4ALDA 1R7AA 3FW6A 1SR9A 2WKLA 4UR9A 4NXKA 3WL0A 2QKFA 2VC6A 5EBUA 4ATDA 1FFRA 3TONA 3PZIA 2C0HA 6CGTA 1IIGA 2YL6A 2G5WA 4IISA 1W8SA 1L9WA 4J7RA 3WIJA 5K7JA 1FP9A 1H1YA 1SO3A 1FCVA 2DJLA 4ACYA 3W4RA 2R94A 3A21A 5FEPA 5D05A 2ZUSA 3T4CA 4JX6A 4GC4A 3GYCA 4UTJA 5E9AA 1W5QA 1X1ZA 4O53A 3MP3A 1IZKA 2BSLA 3A3HA 1ICQA 4IUOA 4HZ7A 2UY4A 3U57A 1KA9F 4AXNA 3FAWA 2G3MA 1OD0A 2CLKA 4PL2A 3GDKA 1Q45A 1VLWA 1UKTA 2O9OA 1JUEA 2XM2A 4Z2JA 3ZR4A 1E4IA 4MNKA 2YCEA 4BQ5A 5LA0A 1TPH1 1J11A 4AXKA 1TTPA 3TJXA 3TSBA 2CHOA 3QYQA 3W7NA 4M7TA 4P61A 1QBBA 3NSMA 2XVLA 1YLVA 4ACZB 3I68A 3TROA 5C6MA 2ZWYA 4DUVA 1TA3B 2VVNA 5HBFA 1O95A 3TV8A 1JFHA 2XVGA 1FXQA 1WP6A 1S5WA 1GUVA 2GUUA 2D73A 1B4KA 3UNDA 1XSIA 2A3CA 5D9NA 3TAOA 2BY0A 3U1XA 4UOZA 1EP3A 3NR0A 4JFSA 3TMLA 3W7KA 1G4EA 1VIWA 1PIGA 2FH8A 1K7FA 1VEPA 3AIBA 1RQBA 3WL1A 3AXXA 2XN2A 2PC8A 4UMBA 4FMVA 2NLIA 1KR0A 1XD0A 3P8JA 3C0JA 2J79A 3MO4A 4HNTA 2WMJA 4Z2KA 1Y7VA 2VC9A 3ATZA 4XZBA 3TTOA 3PG8A 2YSWA 4GFSA 2J8GA 2WZHA 2UV8G 3IAPA 2V81A 3G22A 4GUHA 2YA0A 2X1TA 3UG3A 3UG5A 4J3WA 4YLWA 5U7SA 2WC4A 2WLZA 3B05A 4AWSA 1HT6A 4UOJA 2VX4A 3LIGA 4FFHA 2EJ1A 2TAAA 3DYPA 2X30A 3L65A 2WBGA 3GXFA 1LRTA 3G1FA 3L0KA 3LCFA 1H7RA 1UOKA 4PRWA 4UQEA 4E4PA 2OX1A 4CKQA 3BCDA 1U33A 1G0CA 1YDVA 1XYZA 4O12A 1NOWA 5A2AA 4IXXA 1C93A 3LLDA 2VUYA 1VHCA 4FNUA 4O0ZA 1W3LA 2Y5EA 5CSYA 1AK5A 1QNRA 4UTTA 4M56A 3TOPA 3UR7A 4N02A 3EDDA 5FK8A 4GZIA 3CUFA 1V08A 4TX8A 5IXEA 3VIKA 4Z2GA 1AVAA 4W93A 1VYRA 1FWWA 1EQPA 1XBZA 2WHMA 1MFVA 1V6WA 2F7FA 4ZZ9A 2E1DA 3NL3A 1QNPA 4GINA 3CHDA 2B0MA 2E5CA 3GVGA 2J78A 3S5YA 4OT7A 3T40A 3UWZA 3TNOA 4EANA 1MEWA 4J28A 2EO7A 5DF0A 4WKFA 3KHJA 1XRVA 4P8WA 3ARTA 3LM7A 3SGZA 2YYUA 2PBOA 3OZPA 2C13A 1JRCA 4AWUA 1TR1A 4DUWA 1GZJA 4PN2A 3T55A 1H51A 3MWAA 3P61A 3UWUA 3K8LA 1E6ZA 5E0CA 1I1XA 2CKRA 1RR2A 4GQRA 5LNWA 4XTIA 3WK0A 3PZOA 3M5YA 3SZ8A 3RMJA 5AOUA 3LCLA 5J5RA 2ZRWA 5JIWA 2VOMA 3VIIA 4IQLA 4AMCA 1P0KA 3LTPA 1L6SA 1DHKA 2XSAA 2WC7A 1XXXA 2XFWA 5CPOA 7TIMA 4YWIA 4H8UA 1NSJA 2A7PA 3F1QA 3WEOA 2P0OA 5DY2A 1XBXA 3CIXA 1LBLA 2DSWA 1BKSA 1V3JA 4HA4A 2XM1A 2OCZA 3N2XA 3AJ7A 4LS0A 4CN6A 4ADTA 4TVDA 1MXDA 1AW2A 4J3SA 3WDIA 5CPLA 4D6IA 4CD6A 2J88A 1WAWA 4C7DA 2DT3A 1OX6A 1LCOA 3HGSA 4MZYA 3W82A 1I2QA 1RPKA 3IAQA 1JJKA 2YL5A 3PBGA 5BROA 4JY8A 3G0XA 1BGAA 1QNQA 4WXZA 1WYIA 2DEPA 2O9RA 1EP1A 3UGFA 3RFAA 4UTWC 4MY8A 2A85A 3G3MA 4KMQA 3WQ8A 1KGXA 4XBSA 4XV0A 3MANA 2ABBA 2XIIA 1H4PA 4LWWA 4KH2A 1EHAA 2J6XA 3UXDA 1Q6QA 4XX6A 1ISWA 3IIZA 1CNVA 1EOMA 4O57A 1PX4A 4U2YA 5D2TA 1E6PA 3MUIA 3JUGA 3MO7A 5D8WA 1JD9A 2VX7A 3GNRA 3POCA 4JYFA 5HR6A 3SECA 1XV8A 1GOXA 4FF7A 3WMBA 3F5KA 4PYSA 1G1YA 5HQEA 3UY7A 3L4VA 4U28A 1UBSA 6ALDA 1WE5A 1MYRA 3WDQA 4WUIA 3W53A 3QJAA 1PIFA 3DGRA 3D0CA 3EWXA 1UWUA 2DSZA 4Z2HA 1E6SM 3W26A 4RCXA 2ZXAA 1I2NA 2XQRA 2FPYA 3DENA 4K6AA 4POCA 4EOUA 1J12A 4OUEA 5D09A 1VBUA 1UQYA 4CD8A 5ABHA 4ZENA 1F6PA 3WH6A 2GJXB 2JK2A 4OBTA 1J0HA 4ZEPA 3WKZA 3CTLA 1Q6LA 2C1HA 6A3HA 3PZVA 2EPHA 4PMZA 3G8RA 1GNXA 2J7HA 3IJ8A 2A0NA 3V75A 2V5LA 1YTKA 1TPEA 4JTFA 4MLRA 1W5NA 4B1MA 1VFUA 2V3GA 5EKYA 3ARRA 3AICA 1KV8A 5D9PA 5SWUA 1WX0A 2WZIA 3QHMA 1WQ5A 2Z1KA 1CGYA 1ME8A 2NX9A 4HSNA 3LPPA 2V5DA 3CLWA 2R14A 4NNAA 2JKAA 3W2MA 4PH6A 3ABQA 1ZB5A 4W8AA 5A6LA 2CNCA 2NWSA 2QHAA 3GXIA 2EPMX 1E6NA 4O14A 5DY3A 3C2VA 1TMQA 4DPPA 5DFAA 1KWGA 1RVGA 3QHNA 1WBHA 3BMWA 4Z08A 5D9MA 4GO9A 3FNDA 3VD9A 3ZR5A 2D2OA 1XH1A 3DI0A 3RK8A 4HPXA 1U5JA 5FEZA 3II1A 5LYRA 5AHMA 3R13A 4NUWA 4E8DA 3PZTA 3P81A 3HJEA 2FHCA 3N9KA 4CQAA 4UQBA 1LROA 1SW7A 3P7YA 3M16A 4U4MA 4FK9A 3CHVA 4ORIA 3VFLA 1DJQA 2Y7FA 3GR7A 5D02A 5U4NA 3WDJA 4M5PA 2J7GA 1W5MA 1K9EA 3U5YA 3P5ZA 2H8XA 1MQQA 5BYWA 3LTYA 4S1FA 4UTTC 1FFQA 4PMNA 4HA3A 2WSKA 2ISSA 1GVIA 3HO8A 1V6XA 4XTDA 4MAZA 5DCDA 1BYAA 2DSVA 3B9DA 2WNZA 3B9EA 4YXGA 4FLSA 5EFFA 2ZX6A 5EYWA 1OGSA 3FFSA 1E5NA 2QCCA 1T0OA 2D1ZA 3CTTA 2BVDA 1WV2A 3CZJA 4HMDA 5HXMA 4MUZA 1GHSA 4YMZA 1QNOA 4OE7A 1H7XA 3Q58A 2WQPA 4HOXA 2VELA 2C7FA 2XFYA 2W0UA 2BXYA 3LPGA 3L5AA 2PWGA 3AHVA 2XN0A 4LS2A 4CU8A 4XZ9A 1B0IA 4XKYA 3BLEA 1Q3NA 4JTTA 3NM3A 4PMUA 1UD2A 4GE8A 3QW3A 2DT1A 2G3IA 2WANA 1P4CA 4Z1BA 4PTXA 3WNLA 3MUAA 2A5HA 2RDUA 3WUBA 4FNQA 3AZSA 4K8HA 3PB0A 2J27A 3W71A 2CCRA 1JR1A 3JRKA 3S1VA 5BRBA 3LHVA 3HGJA 1I45A 2BS9A 2PURA 4MFDA 1KR1A 3G1HA 2QCHA 2J7EA 3BG3A 1MEIA 4W7WA 1G4SA 3NEVA 5HJLA 1VCFA 5G2HA 3ZOAA 5BMWA 3S6DA 2QJIA 1HP4A 2TMDA 3N18A 2NSXA 3WDRA 2YBTA 5FKBA 2AAMA 3GLCA 2CERA 2FDMA 1OM0A 3EX6A 1WDPA 1ISZA 3CHEA 4UCGA 1ZALA 2W6RA 4FIRA 3O07A 5BWFA 1W54A 3PZQA 2YW4A 3MYOA 2D24A 3TQ0A 1QPOA 2RKXA 1KLZA 2Z6JA 3NPUA 2QCDA 4UIOA 2DDXA 3GZAA 1P5BA 4FFFA 1LRQA 2QQUA 4E2DA 1MXGA 1PBGA 1VS1A 3WD1A
chains in the Genus database with same CATH superfamily
3H9AA 1WMXA 4BPZA 4IUGA 2J8TA 5HQLA 3BWWA 3CJIA 3HQOA 4KCVA 2TPSA 1FI2A 3EXUA 4C7GA 2OYKA 4FO4A 1HV0A 3G2GA 1F3TA 2NVAA 3TN3A 3W37A 5LNSA 2BX7A 2R9RA 3U6WA 1W9VA 5AKQA 2XGBA 4PRRA 4YZ3A 2ZRZA 5HMDA 3UXIA 3WDWA 3ETPA 1NE6A 4FNRA 5FF0A 5JPNB 2PBGA 1UOJA 1LTDA 4UW3A 3A9BA 2H8ZA 1AQFA 4CXWA 2P3YA 3MV01 3TJIA 3GS6A 1UH2A 1Q66A 9CGTA 3KGLA 1MRQA 2W3JA 3M0IA 2ZX8A 5HCAA 1B4EA 1O7FA 1PX3A 1KFCA 2V5JA 4KEMA 2R1PA 4EV0A 1M68A 2B81A 4UF0B 1AL7A 2DVFA 3MSRA 3H2EA 3VGEA 2VJXA 1OX5A 4NASA 4COUA 2YYOA 4IV1C 1W9TA 1OC6A 1TEIA 1UR1A 2YFUA 5JR2A 1H8VA 3APGA 2FGLA 3HBLA 1LWJA 3RI8A 4GK8A 1IR2A 3EHKA 2A3BA 4IMGA 4A35A 2FQIA 1KQRA 3K75B 2CU5A 3AP5A 1QI4A 2ZZ1A 3MUZ1 2VTXA 3WNOA 3RRDA 1TFVA 3NL1A 1ZP3A 3P5YA 4U2AA 3R8RA 4HN8A 1M04A 2P10A 4IT1A 2GAUA 5FJOA 3AVRA 4JEJA 4A4AA 1FOD3 4QPIA 4CCMA 2OJPA 3P93A 5C9RA 1W8TA 1JPKA 1NFBA 1AW5A 1VH7A 3UR2A 4WDXA 2RJKA 2YL9A 1Q8JA 2OUHA 3WCZA 4PHZA 4HTBA 4K21A 2J6VA 1PHMA 1FX6A 4JIPA 3LHZA 1X6LA 4DNMA 2NV2A 1TX2A 2HQAA 4FPJA 1KNWA 3MBFA 1DQ2A 1JOBA 3CV6A 4TMBA 4R9AA 5I2UA 1BGGA 1OZQA 1O5LA 2BDRA 2PGFA 3OSDA 1W9XA 3SN0A 5F9TA 1JYVA 3SUUA 4CQ8A 5XIMA 1EXPA 1FWIC 3RYSA 1IXOA 4HETA 2X0SA 5F6LB 3MI8A 4Q33A 5BYNA 2ACRA 1EQCA 1VENA 4CD7A 4HNUA 4MB5A 5AC7A 3NKTA 2E7TA 4CDWB 3W86A 3ME3A 1WCDJ 1STMA 2A6WA 2BUKA 3OGGA 3CZEA 4P7RA 1FATA 1HVQA 3N4EA 2PTYA 4DB5A 3RPDA 3VBRC 4CDXA 1YDNA 2FMDA 4TU1A 4N6FA 4JR5A 2EGZA 4HMZA 2AENA 4QDSA 2R82A 2P5BA 1NDYA 3VV1A 1F6YA 4P8XA 3WLHA 1VBC2 2WCGA 4KGQA 5K4ZA 3SRDA 4AF0B 4KWUA 5A3NA 1IT7A 3L7RA 4LB4A 1LOFC 5FZDA 1VBGA 4OYUA 1ULPA 3DHDA 4DO7A 1D7KA 4JTGA 1V00A 1GK8A 5IT6A 1PWMA 4GFIA 4ACZA 1B54A 4IE6A 1XYNA 4W5ZA 3TMQA 1QJZA 4PLMA 5A3OA 1GOKA 4UBPC 2W61A 2NUYA 2DUPA 1Y9MA 2BGOA 4KU7A 2PWFA 2JEQA 3AXHA 2W08A 2PHRA 5A7QA 1SBEA 1XI3A 4F3HA 4DBEA 2GVEA 5A7NA 4O8RA 1XPGA 1K5JA 1TRDA 3NPXA 2OXNA 3S9IA 2QS8A 4LBQD 3QVQA 4LC6A 5EMYA 1GVSA 2J9ZA 1MZEA 3AISA 4AU0A 4ENLA 2GN7A 1F07A 2Y5JA 3OD0A 3GCWA 4U36A 5GLUA 1O66A 1UIOA 3CZGA 3KWXA 2QQWA 3AOFA 4LITA 1W2PA 2W92A 1CGPA 5IVJA 1FTXA 3WD4A 4BIFA 3T44A 1T6GC 2G50A 2X1RA 5ECVA 1CPUA 1D2KA 4HKPA 5TF0A 1N1VA 3NCOA 1IG3A 3KXQA 3RWNA 2E9BA 2XINA 3L67A 5DQPA 1DTNA 4HIBA 1NFPA 5IYYA 3KVMA 4MDPA 3R58A 4I5RA 4S3BA 1UR0A 3VCNA 2ISFA 4B3LA 3H8UA 1I3HA 5AC92 2CZEA 3UKVA 2WZPP 2BHZA 3MIHA 1LHNA 3WNNA 1NCQA 2DCTA 2AEYA 1QH7A 1ISVA 2JDYA 1W8WA 3G3DA 2VMFA 1ZVFA 1IWPA 1LLZA 1M7XA 3NAPA 1E5IA 1J58A 1I5ZA 1EJXC 4ASTA 2O1QA 3LPOA 4LC8A 3WQ1A 2VC7A 4FP1A 3UQNA 5DDJ3 3PWAA 3C61A 5IVFA 4QX1A 3RZKA 4FNTA 3KLLA 4HJFA 3INAA 4DJFD 8TIMA 5FYIA 2Y5SA 1VRXA 2ZUWA 5FIXA 3G1AA 5AC6A 5CG9A 3BLKA 4Q27A 5K3VA 5FZ4A 4LVGA 2JG8A 3C7HA 1FT9A 4RE3A 5CPMA 2YOCA 3EXTA 4P08A 3BW4A 3P62A 4B4RA 1V6MA 3O6CA 1JHNA 3NQVA 1KXGA 1KRMA 3GG1A 3OUIA 3L21A 2DT2A 2QVHA 7ENLA 4JTJA 1P7TB 1RCQA 4ZOBA 1U5VA 4QU1A 2NPIA 1R3WA 1H60A 1O1ZA 1V02A 3QSRA 1SFJA 3NV4A 2QJGA 3UG8A 1SFNA 3HQXA 3KE0A 4TTUA 2BYVE 4H2AA 4HSHA 2EICA 4B7KA 1F2JA 1VMFA 1A47A 1AJ2A 4C6LA 2WJZA 2WZR3 4GKYA 4M7SA 4QX2A 4CU7A 2Z2UA 1UU5A 1TRIA 3S2NA 1UWIA 5BW6A 1VCVA 2VBBA 1BJQA 4K68A 1JW6A 2SBAA 4LV4A 2A70A 3NQAA 3RZMA 3DCPA 4FNSA 2BMBA 4W89A 1AR83 1QOTA 3LCWA 4HVRA 4CCEA 1UZ1A 4GH3A 1OC5A 2J1UA 3VKNA 4E4FA 4YVSC 4DRVA 2VZQA 1WLCA 2Q3RA 3VVGA 1FCUA 1I6NA 1NJJA 4F2UA 3BJSA 1TA3A 1GWJA 3NQBA 3I7DA 3PNZA 3THUA 2NZ9A 5F39A 2WMGA 4EWAA 4XWUA 3VOIA 1VJSA 1W6NA 5C9XA 3OOQA 4MPKA 1H2MA 5A1LA 4BA6A 1LENA 4B3KA 1ZBA2 1LORA 3V18A 1W6MB 3WNPA 4IW3A 3KBWA 3NEHA 4KEUA 2HWD2 3WQ0A 3CHCA 3WQOA 4LVAA 4N53C 3IZOA 3N1AA 2X10A 3QYSA 5D33A 4RKAA 5B2GB 1KKRA 3UA4A 1O6UA 5CCZA 4O10A 2E26A 3ELFA 4JQ3A 1PMIA 2POTA 4B5SA 4NIHA 2HWE1 2BVTA 1AXZA 3UZZA 1IEIA 4RDYA 4AG0A 1DIDA 1UCWA 1JQVA 1HUVA 5FKCA 2YU1A 4C6EA 4M00A 1ALDA 2NQ9A 2GP3A 3C2FA 4N43C 3CWOX 4N9EA 1EUNA 1EWEA 3E97A 1XC4A 3QBQA 1HW6A 2NVCA 5K4XA 2P4EA 5A6XA 3FFQA 1V9U2 1G7YA 3CEWA 4R8HA 1EF3A 2VC5A 3B9IA 3K4DA 1KTNA 4QJ3B 3WHTA 3G1DA 3GAYA 1KC7A 1TIMA 4UI9L 4IV3A 5A2CA 1GANA 5EQUA 1TWSA 4LAMA 2IXCA 4IV1A 2I5QA 4AC7C 3VBFA 3FL7A 3GHSA 5LY1A 5AHEA 4I7UA 4GB32 1JZ4A 4KS0A 1H0BA 1OVPA 2WB5A 4RS5C 1GBGA 4ZTYA 1RITA 1MO0A 3EYPA 1XQNA 4IMAA 1HRV3 2R30A 2EAKA 2DFBA 3W2UA 2Z2AA 2YCIX 3VGBA 1F3XA 2XVNA 4Y5Z0 3A4JA 4PCNA 3C3VA 2VEKA 4G6CA 1O8SA 2ZGPA 3LQGA 3KTCA 3M64A 3FMGA 4GULA 5FP8A 3V35A 1ADOA 4JNYA 2HWE2 1Q6GA 3OYZA 3G6MA 1A50A 1T8XA 3MFAA 3FJ4A 4QP0A 2MANA 4CEXC 1V0KA 4EP8C 3M2MA 2PP0A 1IQ8A 2QPXA 5FPVA 4WY0B 1PKMA 2OFJA 2DT0A 1G6NA 3W24A 1C90A 5D03A 4NRSA 1VBE2 3WUCA 5GJ6A 2CZFA 4HBKA 4G1KA 2VGIA 1GZWB 3F4WA 2J1EA 3CF6E 4H00A 3OA5A 1JOJA 3RO8A 4WSHA 1QPNA 4H8HA 4ZB0A 5BZAA 3H42B 4YVWC 1W3JA 1XYLA 3IARA 3GH4A 1V9U3 1AODA 3N4FA 2IQTA 3N2TA 4YU1A 4D6EA 4K3ZA 2OXBA 1X8FA 4C65A 1ZJAA 4I9MA 1R3RA 5I3HA 1CLKA 2BNJA 1OQEA 1KBIA 3OF1A 4R9XA 1V6IA 1DJYA 3OPTA 3APBA 4DQAA 2WVVA 4KG8A 2J47A 1S0DA 1R1A1 2DV0A 5FAGA 4DJDA 2XOMA 2JD4A 1UR4A 2TODA 3HNBM 4XAZA 1DV7A 1THFD 4WGXA 2FVKA 3AZVA 4BQXA 4NX0A 1Z42A 4JHZA 3OYWB 4LS1A 4IWWA 4EN8B 3X29B 4FEZA 1H1NA 1U30A 4PDWB 2A3WA 3QLLA 3W1NA 4QHZA 3AIUA 1C8M3 4WJ8A 4RLIA 3TYCA 2JG9C 2CAVA 4GJJA 3ARSA 4TXEA 2WSYA 2Y62A 4LXFA 1KCXA 4OTKA 2WNWA 4FXGB 1RUF1 3FSTA 3UJQA 1TV7A 2FDIA 3SNMA 5EPAA 3IS4A 1OLRA 3LMZA 1TQXA 1P1MA 3HBKA 3GJBA 4NIGA 2OLAA 2WW5A 5KTLA 5FMDA 4QM8A 4NSBA 3H1MA 3VIPA 1BSLA 4LSBA 3W6MA 4AVVA 5IM51 1GKQA 3N3HA 4U5KA 3PIJA 1S4CA 3ITQA 1G8WA 3KUMA 1OFRA 4HG6B 5HUOA 5JU6A 4O15A 3KVKA 3JD72 1OBAA 3UJOA 4AR2A 4AY7A 5FYVA 4BHPA 4OLLA 3KL0A 2ZRVA 2O14A 2JIWA 1CAXB 1EV11 2Z26A 1AR91 2GJLA 1VQTA 4UXDA 3RNSA 2IKIA 4CTEA 4NU7A 1KITA 3M1HA 2WLYA 3OCPA 3IGXA 3Q94A 5F5QA 4S3EA 3G1VA 2YGYA 4MIMA 1RUH2 2RV9A 1PHWA 5CEHA 4TYSA 1FXPA 1LQ2A 2FCTA 2Q4SA 2BWGA 3HV8A 3ZLGA 1B3YA 9XIAA 2OW4A 1IPSA 1UH3A 1Z6KA 5GKAC 8CGTA 1JZ7A 4Y7EA 1ODNA 2YZ4A 4M6PA 4C60A 1W03A 4K9SA 2G0WA 4IXHA 5K9DA 1A78A 3UGGA 3EKZA 5FXVA 3TNBA 1NA1B 3A5VA 1WZKA 1I5PA 4YW4A 3AZTA 5ABGA 3TXZA 3CMGA 4E4ZA 4TTGA 3RX2A 2VMEA 1CXKA 5A33A 3CL6A 4UZSA 1WCSA 4IMFA 3AFKA 3PJQA 3UETA 2PAMA 2Z29A 1YADA 5FJTA 2PHTA 2O7QA 3KV9A 4TN7A 3N29A 1IGWA 1E5HA 2C14A 2ZHMA 1RUSA 3EWDA 1QPQA 2HBVA 2UU8A 5CNAA 3VKJA 4AF0A 3JUUA 2HNHA 2P8CA 4COVA 2PDJA 1HNYA 2J1VA 3N7KA 2J7MA 3GZ3A 3VDDA 3U7BA 1MEHA 4CDXB 4D6CA 4BZ4A 2V2HA 2BOGX 1IGSA 4XFHA 1UC4A 3WNKA 3IWPA 3QZEA 1YPFA 4ATWA 2GSYA 2DH2A 1WA6X 2BGCA 3VB9A 3W27A 3M0ZA 1QJY1 5IHRA 3N7LA 2XHYA 5GLZA 1V51A 1NFGA 4KFPA 3U10A 1Q6RA 3H23A 6REQB 5C5UA 3ZFFB 4F0HA 3VUSA 1D4M2 2DZXA 1OFNA 4A2RA 4JGYA 5LEKA 3R0UA 4L6OA 1QU0A 2PPGA 1T96A 3PAJA 3PUEA 1UKPA 4AZCB 1UYZA 2PDKA 3WF1A 3NO5A 2EEXA 1A5BA 3LU2A 3D0SA 1MDRA 3V16A 1UD4A 3VNMA 4B5XA 1U22A 2OODA 1SO5A 1TJ2A 1E5SA 4YNIA 2VCCA 4GB31 1RIRA 4IP7A 1J1LA 1FWBC 2PF8A 2E09A 3TE9A 1LQAA 5FREA 4B4QA 3I2OA 1ITQA 1VBE1 5T5OA 3CHFA 3TN6A 1HQLA 1WCKA 4EKJA 1RJPA 3IJ9A 4B2DD 3ZJ7A 2FVMA 3I3MA 4O52A 4O17A 4A8LA 1U5IA 2BQPA 1W1PA 5J1XA 2OPJA 4MY1A 1GPFA 3VNYA 4BE3A 2P3EA 1EO7A 1UZDA 4XUTA 3BUCA 1CGTA 3ACIA 3W22A 1W0PA 3GJAA 5FF3A 4A3XA 1WDSA 3B97A 4GRSA 3STCA 1GFF2 3VDGA 3WQPA 4JTIA 4LUTA 1T7LA 3PDQA 3TX9A 4BY3A 1QJY2 2A6YA 2B7PA 1DGRN 3N9SA 3VBOA 2HCVA 4JZRA 1OADA 2NQLA 1KFBA 2I9UA 4CSWA 3HQ1A 4BXFA 1XDMA 2C3ZA 5LBFA 3FHAA 3LA7A 3D3FA 4AFAA 2NXHA 4HLTA 4LLOA 3CZLA 1OZMA 4XCBA 2BP1A 5ANNA 3CWHA 4M0XA 3PZGA 3PY2A 3ZXKA 5L7OA 5D2VA 2DU1A 1I0DA 3ZT7A 4WKAA 3QC3A 5HMEA 2WA3A 4ONUA 4MLJA 3C4UA 3FDKA 2E0PA 4M24A 2VZRA 4JQ2A 5A8MA 1ZZ6A 5GM0A 5GVJA 4KRTA 4YLZA 1IF2A 4AISA 5FYYA 3IIVA 2VZUA 3VK5A 2Q02A 4XD6A 4PZVA 3Q8AA 1HVXA 4Q8WA 1W3IA 3PZ9A 3PSWA 1Y5VA 5A3LA 3WNXA 2O0TA 2OGJA 1CXEA 4NHYA 3ZVHB 1OA3A 3BC9A 3W7QA 3MYPA 2W66A 4L97A 3GR4A 2ZZQA 2RDNA 3R4DB 5F4XA 1TB3A 3GC5A 2YA2A 4YG3A 3JQWA 4DXXA 1E0WA 2GJXA 3FKRA 2XWBB 2BTMA 3E5PA 3S9YA 3A0KA 3RMXA 1W8FA 3DBNA 2NLYA 4QDPA 1LF1A 4XYXA 3NURA 8XIAA 1GZCA 1XSJA 1X8MA 4EF8A 2BODX 1XPWA 2Q8ZA 4EE9A 3URBA 3WLUA 5A6BA 2VUCA 4UWDA 5EFUA 2R0HA 3DFPA 3H70A 2OEMA 1XE7A 3ZYIB 1I1EA 5E6YA 3LZ5A 1EPVA 4PDWA 4NVPA 3VDBA 2PDUA 2VGFA 1FWHC 2G4JA 4Y2WA 5T9BG 3LHWA 2VP8A 1MW3A 2Y60A 1B2YA 3PIGA 1I60A 1GWKA 4AIOA 5HDRA 5F5AA 4AGGA 4LVDA 1XLBA 3O0VA 3ZN5A 4LQRA 1UA3A 4PC8A 2EIGA 3UEQA 4LKSA 3PHAA 1FV2A 1AR62 1AR92 1OH4A 2DV9A 3WD3A 1K9TA 4BIOA 3O05A 3GZUC 2HXUA 1HKVA 2Y61A 2P1BA 4CU6A 1AR71 4MYXA 1PV8A 1ZA7A 4XEZA 5KEZA 1R5YA 5CGMA 4INFA 3TKFA 3ZIWA 3FBYA 1RV8A 2FFCA 5KR7A 4BXSV 3WN6A 4UW5A 3CM4A 3VILA 2VBDA 1J84A 1IS5A 2RS52 1JI1A 1TMF2 5E16A 3TSMA 3GALA 1ZZCA 4XJ8A 2V72A 2FB3A 1ITXA 1YTDA 1G9DA 4XO6A 3WDPP 2BNNA 4EN9B 2V6AA 3HGRA 3HB9A 3W1RA 4MH0E 1L8PA 3VIGA 1R1A3 1Z8AA 4MKNA 2ATMA 3LSCA 3WY1A 3MY9A 1I2RA 1SFTA 5CG7A 3IV8A 5HNTA 4AF9A 1N82A 3N2MA 4Q0UA 1EO5A 5FJJA 1FPN3 1S1RA 3A3WA 2J74A 2HEJA 3BGAA 2D2JA 5FZ8A 1UD1A 1UPPA 1UPSA 5HI0A 2OZTA 2HWF3 5CZ0A 3RJYA 2CLPA 1PS9A 4U10A 2XLGA 1DYPA 2WM0A 1LOCA 4OKDA 3W76A 3CO4A 5HINA 2KZHA 1OG0A 5ENLA 5FL0A 2GJNA 4ZQNA 3MPBA 5DCBA 1JYCA 4HVQA 4QE5A 1FPN2 1IEVA 4JKMA 5G4WA 5JBDA 1NXD1 1R2TA 1KM3A 4GGHA 5FZMA 4DZHA 5LNVA 3CJIC 3W7JA 3R0KA 3N4MA 2XONA 1DORA 3VX1A 4Q4X1 3OZYA 3NQHA 1PGW1 1VBA1 3ARVA 2ZX4A 4LT5A 1XE0A 4AHQA 1W6QA 1OF6A 1WXYA 4W6YA 1TPB1 1RUG1 2GSHA 2W5FA 3DXIA 1V6VA 4XISA 2GMMA 4U31A 4D6SA 4XZHA 4ZO8A 3SDOA 3SR7A 3ST7A 4PEKA 2WUHA 1UPMB 5FMCA 4H04A 4CDUC 3GW0A 3ZFGA 1NVMA 1EWDA 1B3VA 4LBOA 3JBG1 3GNXA 3PJTA 2VMIA 1PO21 1TZZA 2ALRA 4AEEA 1QJX3 2Z69A 3LIHA 3S57A 1XYCA 3NL5A 3BPSA 1UUOA 4H19A 3F95A 3M0HA 4J3VA 2Q1ZB 3NA8A 1XHGA 2OB3A 3H53A 3G1YA 3SKVA 4Q4X3 5H6HA 3TYEA 3TCEA 2JKPA 3WG3A 4HN4A 4ZMGA 3H3UA 2HS8A 4W87A 2YCJA 1LTEA 1EV12 1LT7A 4NJKA 1HO1A 1EPZA 3UWWA 1YXYA 2IKHA 2ZX9A 4GI8A 2OVUA 3AYSA 3CPUA 4Q8QA 2PODA 3PS7A 4UUIA 4UTLA 2PAKA 4BLJA 4ZB2A 4EYUA 2BASA 4DB7A 2ZRUA 3CWNA 4US5A 2ES3A 4R9CA 1FPN1 2VBPA 1O5QA 5A6JA 5K9XA 1V3LA 5H9PA 4OQ9A 3A5FA 5GJMA 1NOFA 4FPEA 4O28A 1OFPA 3OJBA 3THDA 2HMCA 1HN1A 4LR4A 2PDHA 3W00A 4CP9B 3HWJA 1HB2A 2BXVA 2PDCA 3G0SA 3IVUA 3MUXA 2OUJA 1H63A 4KBZA 3N36A 2JGQA 2HKXA 3WNMA 4JGZB 2R1MA 4F0KA 3QKEA 4LBKA 2V63A 4LHKA 3M5XA 3VKBA 2Y6FA 3AO0A 3B40A 3PUOA 3TW6A 1SLAA 1OD8A 3RYRA 5DZGA 1NH6A 3KBSA 1KFLA 2E28A 1PM4A 2A3HA 4JQRA 3OEAA 3WQ5A 1IQDC 1OCBA 1H7WA 4QX3A 2PRMA 3PTQA 3EWCA 1QIQA 5CBLA 4TX6A 3M7SA 3RU6A 1K42A 2QCEA 5HXVA 5FJUA 4FALA 1ULEA 2WNOA 4RJEA 1ZRRA 1S0JA 1ZU8A 2YC2A 3SUVA 4DXTA 3B0PA 4S23A 1ENRA 2GALA 5LHFA 1GOHA 2LRPA 1W8UA 1G9HA 4Y22A 3UVIA 3GIYA 3CDZB 1I1WA 1RINA 3B0YA 3PMEA 2WN2A 4I6VA 3S0CA 4BI7A 3PB2A 4JTRA 4Z2WA 4LTSA 2J77A 3MI3A 3BLIA 4Q4V2 2NZLA 2CWMA 4XACA 4AEJA 1QW8A 2PSNA 4W85A 1C3HA 5LGXA 2JJ6A 3D6EA 5LBCA 1DP0A 4QTGA 3HOJA 1K7EA 4M1RA 3C7GA 4PTNA 3UCCA 4RZ4A 3LA2A 1W05A 3FCPA 5FPZA 4MUVA 5BNOB 1JEZA 4CQDA 2DORA 3AZXA 4FXKB 3PBMA 2ZVRA 5FF7A 3VIOA 5C70A 2INFA 4JHOA 5ABTA 1GOGA 4DY1A 3VGIA 3T81A 1J3RA 2QQLA 2HSAA 4GYPA 4IDZA 3B3QE 1N55A 5T9CE 3J7LA 2Y0FA 2EXOA 2CC0A 3W07A 1ENUA 1ZSXA 4BLIA 2ZHNA 2J4GA 4M4PA 4QAIA 3S46A 4ZR8A 1CIUA 3NFUA 3B0XA 1KRBC 1C8VA 4JN7A 4JGYB 4WEVX 4X22A 3F4NA 4ERGA 2X8KA 1AH0A 1KBLA 1HKJA 2RFGA 3JD73 1GVFA 1QTWA 2QDEA 2D23A 4AB4A 2XIQA 1OD5A 3W73A 4MY9A 5DABA 4XFCA 1XGZA 1W28A 4MGIE 2WQ4A 1ZBE3 2VWSA 1NY72 3ZYJB 4JTNA 3V1HA 3QH2A 4NHLA 3TNQA 2BDQA 3A23A 4AFCA 3N4AA 1LT8A 4EF9A 5F1UA 1NY1A 4BI6A 2VR4A 4BMEA 4H55A 5HCFA 1JCYA 3H54A 2D6LX 4UC5A 4LF2A 2IPGA 2GDUA 5HBAA 3DERA 1W37A 1QUMA 2GWNA 2W52A 3W1QA 3KCJA 3AMNA 2HVMA 4OMDA 4ICCX 2BHUA 1EY2A 1QQP1 5FZ9A 1LP6A 5GJPA 2FTWA 4N9DA 4AIUA 3BI3A 2AEZA 2EHHA 3TIMA 5DQ0A 3WHUA 2CESA 3CU2A 1QDSA 1QW7A 2PLV3 1R86A 1J83A 1XYAA 4QNEA 1W2UA 2ARAA 4GJIA 1SZNA 3PANA 2BW8A 3RZHA 4OOUA 2D6PA 5AYYA 1JUIA 3CZ8A 5LNUA 3KVJA 3BQ5A 1TYGA 1AUYA 1BPLB 1QXLA 4NOTA 2EKCA 1VAVA 3TYJA 5IRPA 2TEPA 5CC7A 1Z48A 2IVIB 3M44A 1NQ6A 3VNZA 4RDWA 3T4HB 3EGJA 1PYMA 1L6YA 1Q85A 1Q6EA 3CPRA 1MQTC 3QOMA 3EX3A 1MXSA 3BLLA 5LW9A 5A7WB 2OKTA 1O1HA 2YLAA 3B9OA 4OIFA 4Y1ZA 4WM8A 2BP6A 2E6VA 3FK4A 4Y9MA 4OFCA 2BV9A 5H9RA 1CQ9A 1KDKA 2ET7A 1SW0A 3FA5A 4UQCA 3H26A 3S7IA 4X9YA 5LNRA 1GHRA 2JIGA 1SLLA 1D3CA 1GVRA 1PZ7A 1H7NA 3EWBX 3GXDA 4GYFA 4TVUA 4XAGA 3N14A 4H9VA 1PEZA 5DUWA 5F37A 4ML9A 2JB4A 1HJUA 1A8MA 2REQB 1Q6OA 4H3WA 2CHHA 1YE4A 4DY5A 1W32A 3FAXA 2A1XA 2I2SA 3HJRA 3WF2A 1OHFA 5DT7A 5LEJA 2EPLX 4QR6A 4E4HA 3MS8A 1GKPA 2XUCA 2YJQA 1TME3 3N2OA 4N6EA 2ASHA 3EX2A 3VDHA 3K8KA 1RYYA 1DLCA 1GMMA 3PUDA 2DCJA 3E0VA 1RGSA 1R47A 4I9TA 4QNWA 2PP3A 3GTNA 3LY0A 1UX6A 1UD8A 3Q8CA 3KB5A 4UTMA 2AQOA 3ZIXA 1JPIA 2F61A 2Y4SA 4NT0A 4BEQA 1DJGA 3LQLA 1F9CA 4Q4W2 3LN3A 1H11A 2RR13 4K8GA 2GSJA 1UZHA 3NNTA 3UJ2A 3PURA 2OU4A 1ODZA 3NTYA 3ENRA 2F4PA 3EPNA 4LANA 1TIWA 3VCRA 4LW7A 2VUJA 4KRUA 3CV2A 4YW2A 3IUHA 3WK1A 1AR72 1MQPA 2UY3A 5FZ7A 3AZWA 4L5ZA 4Y5TA 1ZRCA 3OBEA 3EEGA 5EMJA 1AJOA 2VWTA 3MDUA 4B4HA 5CAKA 2BWAA 2J7DA 3H3ZA 3ZSEA 5LIXX 1JZ8A 2XDFA 1JCJA 5REQA 2CZ5A 2JXAA 1C7TA 5AYIA 1XPYA 3ILNA 5DBUA 4JZ5A 4L4OA 5D8AB 4H9YA 1TE6A 4ML4A 2P17A 5M0TA 4NUBA 1BYCA 1EUTA 1IYXA 2Y1HA 1AZDA 2VZOA 4CUBA 3SHRA 4I5XA 4F9DA 5FZ1A 4RGKA 1UG6A 1SPPA 1C9WA 4OI1A 1P6WA 5I3JA 5I0DA 2ZGNA 4IGPA 3QKZA 1QQP3 2VW1A 1CPNA 4HKWA 2WVTA 4L6DA 7REQA 1MDLA 3EXRA 1KRIA 3WLPA 2E31A 2WZR1 2J62A 1HJSA 2P3KA 2AL2B 5CEWA 1F76A 3AFGA 4DZ5A 3QR3A 4UTIA 2E9MA 4N9IA 5CZSA 4WKHA 4N9CA 1VEMA 4LTAA 3QOKA 2O4QA 3L4WA 3ZJKA 1V3MA 4WK9A 1EGMA 2GH8A 4FB7A 3C86A 4J35A 2CEQA 4K39A 3WJZA 2X41A 3ES4A 4C5YA 3VZLA 2RR12 3JR2A 1QF3A 3LGDA 2B9UA 2FPVA 3MBDA 4ADUA 3ES1A 4NVTA 2LW8A 3GU9A 4G8TA 1ENSA 3PR2A 1SJBA 4HTYA 4JQAA 3BYWA 1NXMA 3THCA 1NP0A 1QI0A 1LL7A 3BOXA 2YDSA 4O16A 1AD4A 2CZDA 5H91A 5LWBA 1DGWA 1E5RA 1SFYA 4ZONA 3I97A 3TWBA 4LHSA 4MGYE 1BAGA 3BSHA 2NYYA 2E9LA 4AFBA 4IEVA 3AXKA 2A3LA 2NUXA 3M0KA 4B1LA 2WMKA 3NPWA 1E6RA 2WPBA 1ALYA 3CEUA 2FTPA 4YW6A 4GZ9A 3SUWA 4U2ZA 4LY4A 1Z9AA 3GDRA 4JFTA 1GOQA 3MZNA 3FW6A 4JCKA 3VBOB 4YW3A 3WL0A 4KWJA 1RBAA 3PZIA 1S0IA 2C0HA 3Q65A 5B7YA 1IIGA 4AEKA 1YE6A 1W8SA 5K7JA 2DFCA</