4UFLA

Mouse galactocerebrosidase complexed with deoxy-galacto-noeurostegine dgn
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
644
structure length
641
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GALACTOCEREBROSIDASE
publication title Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 216
structure length 641
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4uflA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4uflA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uflA01
4HA1A 5HUPA 3W1PA 4ATWA 4ICNA 3G18A 1JUBA 1E71M 3VGDA 2WYSA 3T0AA 3DKJA 2EPLX 1KTNA 4D2JA 1SSDA 1O4UA 5D37A 3VO0A 3CT7A 2GJNA 2C6QA 3F5LA 2WKJA 3QW3A 1J0JA 3TE9A 3WENA 4U2YA 4CU8A 1S3HA 3W7IA 3WL0A 3VTRA 3WFZA 4UTFA 1OFQA 1AQMA 2WHMA 4EAMA 1Y9MA 1CENA 4W5ZA 3L4ZA 2J47A 3C8FA 1DBTA 4IMGA 4OT7A 5KZMA 3MHUA 3VIJA 5CG7A 4IQLA 2WAGA 1OFDA 1O95A 1GOKA 3K8LA 3WUGA 3TQKA 2HTMA 1CNVA 1F4HA 5GQBA 1V6UA 4JN6A 2V5LA 1JCXA 1QNOA 4ACZA 3LHWA 2ISSA 3BLIA 2C7FA 4O11A 1N8FA 5IFTA 1UZ1A 3N34A 3N3MA 1FOBA 2YXGA 4FHAA 1HFBA 4NZCA 4QLJA 1R2SA 1HL2A 3NGJA 1AMYA 1SO4A 3T2PA 1JNDA 1MQRA 4Z2JA 3VKJA 2HSAA 5M5DA 4O17A 2E5BA 4LT9A 4O4WA 3TR2A 3CZEA 4A4AA 1VPXA 1KFCA 4N0RA 3ARTA 2V81A 1ISZA 4ZXLA 3HGJA 5AHNA 1PIFA 5D30A 1KXHA 4IMCA 4BQ2A 2WVVA 2XVLA 1V3IA 1QI3A 5ABFB 1JDCA 3LEMA 1TTIA 1W3LA 1XHGA 3BAXA 5BMWA 1JF6A 1UKTA 3W22A 2WCSA 2WZHA 4HT3A 3FAWA 2NX3A 1PZ2A 3GDTA 4DM2A 1BGGA 3NYDA 5A6SA 4A2RA 1EOKA 1K02A 5CQ1A 1H1ZA 5HXMA 1QMLA 1VJSA 2W63A 1G69A 1QDSA 4XBKA 3TOPA 4Q32A 2EPMX 1ZHAA 3C2VA 4MFDA 2YLAA 3ARUA 3CO4A 1WDPA 2XVGA 3DECA 3ZJ6A 1GTHA 1C91A 1GOXA 1OYAA 3HG5A 1S5VA 4GNJA 4ZMGA 3O8AA 5ABHA 4O52A 4JXCA 2IQTA 3DU0A 3O6AA 3G0XA 4MB4A 2WM0A 2V5BA 3PSVA 1IXQA 4HPGA 4IX2A 5I24A 4YN5A 3FY1A 4QNWA 3D5HA 1XDLA 2XM2A 1V3HA 1G4PA 4O10A 2ZICA 3NCOA 2E40A 3W26A 4NZFA 2WWDA 4BF9A 2D2OA 3O07A 1HJXA 1VRXA 3W1TA 1J11A 3G0SA 4D6EA 4Y96A 3G1YA 4CKQA 1THFD 3W7NA 4QFUA 3C52A 2WMFA 3NPXA 3A9IA 1UB3A 2OSYA 3AHVA 3APGA 4AW7A 1V6XA 4ORMA 1C8VA 2KZHA 4MLJA 2CYGA 1JJKA 3M6DA 3P60A 2E4TA 4TOQA 5GNYA 1MWOA 4PL2A 4ZQCA 5LZLA 3KHJA 2X2YA 4TVUA 3ZJKA 3LPPA 2CZEA 5AOUA 3LCHA 1VBUA 2O92A 3QRHA 3IK2A 3NMBA 1K7EA 1SSGA 2D24A 2QKFA 4ATLA 4TX6A 3RM9A 3RO8A 1HN1A 1N82A 4B9ZA 1BSIA 3NQEA 2YA2A 3GBDA 5EKYA 4BQ5A 1BWKA 3QW4B 2C1HA 3K8MA 3TX9A 5D4YA 1J10A 2YR1A 2RGLA 4H8VA 4KFPA 2VXNA 1QNPA 2CLLA 1K9TA 1SMDA 4MZYA 3PZIA 3ZO9A 4UFKA 4W8LA 1Q6LA 3R12A 1ESWA 1H5VA 3QSRA 1K9FA 3LBMA 1UWUA 1NWTA 3HOJA 1ZBCA 3OSDA 5LHFA 4PMRA 4LRTA 4JQTA 2VFIA 4XBSA 3EX3A 1TG7A 3O2LA 3WMSA 3CB8A 2A7NA 3BW2A 1VHCA 1LG2A 4FIRA 1B3ZA 3EMZA 5FF4A 3DFTA 2D0HA 1DV7A 2CLHA 5CZJA 3TW6A 4LYQA 3BV4A 5I0DA 4WY0A 4UFMA 1M6JA 1WZAA 4WSJA 4D71A 3ECQA 2ZRXA 4KWVA 2G41A 3VM5A 3WEZA 4Z2HA 1JYXA 3LX9A 3FYOA 2WLZA 5LGZA 1GVOA 1PE1A 3O6CA 5F2LA 3VIGA 1JZ5A 2XGBA 4HA3A 1DTUA 5A6LA 3O15A 5FCZA 1VYPX 4E38A 3P8IA 1RH9A 2JF6A 1CTNA 4YHEA 3GXDA 3ZFHA 2VR4A 4FIQA 4P7OA 3WH9A 5FMDA 3HJZA 3IGSA 4N02A 1E55A 4AIUA 2QUVA 4B1MA 2Z1BA 5DCDA 1UWRA 1V6WA 1A5CA 3PG9A 1LOQA 5C2XA 3EEGA 3QM3A 4MTVA 3UETA 2J74A 3N2XA 4YLWA 3PIGA 2E09A 1RD6A 2PB1A 2JBMA 3AZSA 1YDNA 3J7HA 4HTYA 3BAIA 2Q8ZA 4MZ8A 3B0UX 5FL1A 3K30A 3T7VA 2Z6JA 5F1UA 1BLIA 2VC9A 3SCVA 2E5DA 2H90A 1UCWA 1RPXA 1ISYA 2VEMA 1UD2A 4UUIA 3HPZA 5CLTA 5E70A 4AIOA 1KM3A 4P7LA 1EUAA 1RQEA 5CPSA 1KM2A 2OYLA 3QMSA 1OHLA 2V38A 4BS0A 4IXXA 1J0YA 4DPQA 2CZ5A 5U4NA 2JE8A 4P7RA 4H6KA 3FEMA 3QEZA 1UWQA 1V02E 2XIIA 1FCUA 4FNRA 3G0UA 1XBYA 3Q37A 1WQ5A 5EA9A 2PWGA 4H3DA 5BXPA 3BG5A 2XVNA 1QPOA 3BH4A 4AAJA 1QWGA 2C19A 1IV8A 2ZUUA 4JTEA 3FLUA 3IV3A 3JR2A 1SR9A 2Y6ZA 2C14A 1ALDA 3PUOA 1L0PA 4J3VA 2OYMA 1CYGA 4M82A 4TX8A 2QJHA 4PH6A 1AG1O 1R2RA 2J9YA 2OX1A 3IVUA 2DPEA 1EIXA 1UR2A 5I6SA 3LGEA 3EYPA 4PN2A 4U4MA 1KBIA 1Z32X 1WZMA 3NVTA 3EDEA 3KAOA 4PTVA 4JTJA 4S3KA 3A24A 4IPIA 4WQ6A 4TX9A 4XTDA 4O1DA 2J8FA 3BW3A 5HNRA 1ITXA 2A3BA 1H11A 4JX5A 2R94A 4JYEA 4Z1AA 2EAWA 2XSAA 5D09A 3NL3A 2DH3A 2BHZA 1HF6A 5D9NA 4RXGA 2D22A 2WNWA 3O05A 3GNRA 3VKKA 1GONA 2J25A 3I65A 1V02A 3I7RA 3GNPA 4IM4A 2WB5A 4FB7A 3QF0A 5AYIA 3W29A 2BVTA 5HR6A 1X6NA 4PTXA 4UXDA 4MFEA 1DWJM 4YPJA 2V9DA 3G1XA 1D9EA 2CXGA 6A3HA 2CBJA 2DSWA 3U5YA 4N6FA 3ABSA 4S1FA 4PTMA 4QCEA 2OWCA 1TTQA 4BWLA 4YL2A 1C7SA 3WL1A 1VEOA 5I5RA 3I68A 5E0CA 1RP9A 2XVPA 2H3BA 2R14A 3N9SA 4WXZA 1VAHA 1HT6A 1UH4A 2B4GA 4X9SA 4CGTA 4K7YA 2ZUNA 4BCEA 5BXSA 2WC7A 1B3OA 3PZQA 4JX6A 3BLFA 1J18A 1MFVA 1IF2A 2WLYA 1CXFA 4XKYA 4GI6A 5TD4A 5K7JA 2D23A 5F4XA 4CD7A 5FF3A 2ZZ3A 2PCQA 2Y88A 3TMQA 5BMXA 3CIXA 3MWAA 3QFEA 3MP4A 3W1LA 4HZ7A 4TXEA 3E02A 3DYOA 3GXMA 5I3FA 1VEMA 5HULA 1CXEA 2DZTA 1XCWA 2PBGA 3F5KA 4GQQA 1N7KA 2J78A 4IUGA 1H7PA 3TSDA 1OSEA 3WQ5A 4TO8A 4JTKA 2DIEA 3VPLA 2D0GA 7TIMA 1RVGA 4EWND 1W3IA 3P81A 1Q6QA 1ME9A 1EH9A 1WZLA 3NDZA 4I7WA 1VJZA 2OXBA 5K9XA 4RX0A 4PUEA 4S2CA 2J6XA 2V30A 4N2YA 2ZZ7A 3LHUA 1VEPA 3VIPA 4D6CA 1K8ZA 1YPIA 3FJ6A 4YMZA 3L4UA 2WHLA 2TPSA 1Q6EA 2RDTA 1E1FA 4FLRA 2VZTA 1I2QA 4LVAA 3M7SA 2EPOA 2VFHA 3AZTA 1XCXA 1IIGA 1UD4A 4M8UA 3WDPP 4AIEA 4NX0A 4LVFA 1R87A 1JULA 4DWSD 3W7QA 4P61A 3TSMA 1G4TA 1K7FA 5D38A 2DT2A 1QHPA 4FLOA 2GQAA 3NQ7A 4C7DA 2DIJA 1W3HA 1G5AA 3WD3A 1EUNA 2UWFA 2A21A 4A21A 2FHBA 2BSLA 4O1CA 2QDGA 3PZNA 1MYRA 3N2MA 2RHGA 1ECEA 1WX0A 4OKDA 3CHCA 1SZNA 4Q4KA 4D6IA 2GOUA 4Q22A 3WJXA 2PWDA 4YCOA 3UWUA 2YBUA 1E4IA 4AD2A 4UFHA 3KVKA 4QM1A 1FH8A 3VM7A 2ATMA 4UIOA 1PVNA 1TV5A 3MUXA 1JR1A 3IJ9A 2CLMA 1EDQA 3W2NA 1PEZA 3WDQA 1K9DA 4NRRA 3WNOA 2WBGA 4CCDA 2W67A 4BI5A 3ATYA 2BXVA 2IXVA 2GJRA 5LNWA 1OYCA 2JK2A 1FP9A 2AEZA 4J3UA 1UKQA 2WPGA 5HJLA 3W2KA 1S5WA 2W6RA 4NI3A 2ZRWA 5FEPA 2VX4A 2GK1B 3RWKX 1O6IA 1E6PA 2OWXA 2VMFA 1W5PA 3E12A 3G3MA 8TIMA 1JIBA 1VCGA 3A4AA 4BZYA 3RMEA 1TREA 2JALA 3E96A 3W7DA 1SYTA 3CBWA 2VRJA 5C55A 5EMUA 2O9PA 1TTPA 1BG4A 3PZMA 5HOSA 2VFFA 4FX7A 4B15A 4HNVA 1S5TA 3HQ1A 3M6YA 5G1YA 3INPA 3L0NA 1H7WA 3C2FA 3G1VA 5G2WA 2QCDA 3T55A 3PBGA 3UEQA 3VE9A 4AHOA 4DWSB 1FUYA 4LTSA 3NQAA 4M29A 5LA0A 2O7QA 4KGLA 2NLIA 4I7VA 4WIWA 3GDRA 3HPXA 3A47A 4DWSC 5GNZA 4UTUA 4ZL1A 3BGAA 4UMCA 1GQJA 1FWTA 1LTDA 2DORA 4RK8A 1PBGA 1J2WA 2X1TA 2AC1A 3FXYA 1UR4A 1QI4A 2FPVA 1AL7A 1HP5A 3CMGA 1Q45A 1QO5A 3OBAA 4UTLA 3QC3A 4UTWA 1CXHA 1KBKA 3EWWA 4R53A 5HQEA 3PZGA 3IIZA 3WK1A 4D6DA 3MANA 4LQ1A 1LBMA 5TBOA 1LBLA 2QHAA 4UZUA 1C8QA 1C9DA 4PMZA 1P1XA 4MAVA 3PB2A 4JTSA 3RNDA 5LSMA 1ZBWA 3CGTA 4UQEA 4CVWA 2CLIA 2VFEA 1HVXA 4K8HA 5C54A 2V3DA 2GVGA 3VGBA 3SURA 3U8GA 3G8RA 1JI2A 1LOLA 2A85A 1FXQA 3TV8A 3OIXA 4ADSA 4JY9A 1JYNA 1G1YA 1TA3A 1W9XA 4LVDA 1ISWA 3WMBA 3ABRA 2G97A 3VMOA 3OEXA 1OCQA 1VJIA 3AIRA 1A5SA 4R5EA 2ZOXA 1QOQA 3GXPA 3LMYA 4DUWA 2D0FA 3UPWA 4HOWA 3AIQA 3M41A 4OE7A 1NARA 3UY8A 4ACZB 3W72A 2E68A 1JD7A 2DT1A 2DSKA 5IHRA 1B57A 3BO9A 1W9BM 3MO4A 1RPKA 3NL5A 3O9NA 4M1RA 3RMJA 3WDHA 3WEMA 2XN0A 1BTCA 1C90A 4AWEA 5K3VA 4UOQA 3CHFA 5FI8A 1KGUA 1J5TA 2E9MA 3W6LA 3N19B 4G1KA 4IGHA 1VFUA 1QI2A 1W9UA 4JGDA 1B3YA 4B9YA 4MKNA 1KM4A 4BI7A 3C3NA 2WVVB 1B90A 3BCFA 3U7BA 2CW6A 4LVGA 1FHDA 1WPCA 1XH0A 4J27A 1SPQA 3UXDA 3GXFA 1FA2A 3KZSA 4JKLA 2BX7A 2J9ZA 1GTEA 4WY0F 3RK8A 1Z42A 1JDAA 4E8DA 2JKEA 1LCOA 2E6FA 1OFAA 1TV8A 1HJUA 3WQ8A 1UKOA 3CHEA 1EWEA 1KGWA 4XZWA 4A3HA 4O4VA 4MYXA 4YCPA 2J79A 2WNZA 2GVJA 3LRLA 3NXFA 2Y63A 1U30A 5LNSA 3WF4A 3N12A 3MP5A 5HWJA 4L4PA 1I8JA 1TPB1 1BVZA 3WF2A 3NZRA 4U5KA 4JTUA 3DZ1A 4JKKA 4OWGA 2YL9A 1X1ZA 3I7SA 5BROA 1GQNA 1G01A 4OBRA 3W1NA 2JIWA 3TTSA 3LFIA 2CLKA 4GC4A 4UTIA 1C29A 3G1FA 1OX4A 1NAL1 4AYSA 5ANNA 1TO3A 2F2HA 1DJNA 3EXSA 1IIHA 1QNVA 1HVQA 2Y4SA 3CZLA 1ST8A 1VH7A 4PEKA 2W4XA 1OT1A 4Z1CA 2X8RA 4ADUA 5FEWA 2CZDA 4JTFA 5FKBA 2QJGA 4K39A 1GT8A 4Z0JA 1XV8A 3UERA 4CD8A 4EF9A 3HG3A 1QAPA 1AW2A 5DXYA 3P5YA 1UD3A 3ARSA 2YDQA 3W3OA 4UZSA 1PCKA 2CWNA 2VEKA 1NOFA 4WKFA 3Q94A 3KVMA 4MJ2A 4OV9A 2ZTJA 2ZX7A 5BXRA 5AC8A 1HJSA 1VQTA 3LCFA 4ADTA 3CTLA 2Y7DA 3NR0A 4MPQA 3OIHA 1G67A 1E40A 3UG4A 1Y4WA 4RCXA 3EBVA 3GLCA 1KGXA 4PMUA 4M19A 1JFHA 3H53A 1K8YA 4IWWA 1BHGA 2BHYA 2O9RA 1YDOA 2Y8VA 3L68A 1OINA 4ZQMA 4Z1DA 4CNNA 2ZXBA 5A5WA 2DT0A 5AHEA 4HPXA 2J7HA 3AISA 1W5MA 5A94A 3GH7A 3PM6A 3QOKA 3UNDA 2JF7A 1I2PA 2WMIB 4EF8A 4YXGA 4ATDA 3ZM8A 8A3HA 3U75A 3F4VA 1FY6A 3CWOX 2WW5A 1KW1A 2UY2A 7A3HA 2VELA 4WY0B 1J0ZA 4H7VA 3MSGA 1A53A 1EDGA 4PC8A 3WUEA 4PODA 4AVFA 4JTIA 4PMOA 3R2GA 1B1YA 2ESCA 5FL0A 2ZQ0A 6CGTA 1OD0A 4NF7A 2BXZA 4OV4A 3RLVA 1HO1A 5D8ZA 3TQ0A 5HWNA 4NJJA 3CPRA 4W5UA 1HNYA 4FFGA 3UQNA 1U33A 1VS1A 4LXFA 4WJEA 4QJ1A 3GDBA 8CGTA 4F8XA 2E1DA 4FFFA 3IIXA 3NG3A 1CZ1A 2ISVA 3GR7A 3LRMA 2YPIA 1YXYA 4GINA 1P4CA 1H7OA 4M5PA 1UZ4A 2WZEA 2VRQA 3LTYA 4YWIA 3S0CA 1J9YA 5ABTA 1P6WA 1H60A 2G3IA 4E2DA 2DT3A 5HR7A 4AWTA 2WMKA 4AB4A 4WF7A 3OVPA 1TPVA 3MU7A 2CLOA 2PRLA 3GAYA 5A8PA 2XIBA 1M5WA 2VTFA 2WOQA 3WDIA 2DP3A 4XUGA 4OUEA 2FPYA 2RDWA 3B03A 3UY7A 3KL0A 1H09A 3ANYA 1QI0A 7CGTA 3SW6A 1GUVA 2GVYA 3WH7A 3M5XA 1SW0A 3CUFA 1YTKA 3UCQA 4PEEA 1KXTA 3JS3A 3NQ2A 3S6DA 4KGJA 1H5YA 3TTQA 1UKSA 4P8WA 2Y70A 1WB0A 3VUPA 3H54A 1OFPA 3ABOA 3NQMA 4S3JA 1TCDA 2TAAA 3DHPA 4QHZA 2WBKA 3BG3A 2GDVA 1R46A 4AD0A 3ZR6A 4D6FA 3K8KA 2WWCA 1HKIA 4A2SA 1FCVA 4O12A 5LA2A 3MUY1 2OLHA 2WQPA 3P5ZA 2PRHA 1UASA 3HF3A 3MP3A 2XQRA 1NOWA 3F5JA 1H1NA 4GFSA 1W2PA 4J3WA 1KFEA 5A6KA 2HMCA 3C2RA 1OGSA 3LXAA 1X6UA 3SIZA 3WNPA 1E6XM 2PRMA 3S8HA 4W8AA 2QV4A 3DH7A 4X0VA 2FJKA 2A3AA 2AGKA 1JL8A 4J28A 1PL9A 3AHZA 3EWBX 2BVYA 4PCFA 1B0IA 3U57A 3BLPX 1OM0A 1K7XA 3BCDA 1WDWA 3VD9A 4K38A 4NJHA 2VO5A 1JUEA 1E6QM 3MW7A 1QBAA 4LYRA 4AY1A 3L0KA 4X22A 3GZ3A 4NQ1A 4P7QA 2B7OA 4LWWA 2C15A 3U1XA 5HUOA 3L4XA 5M17A 3NQCA 3PBYA 1WAUA 3WK3A 2NT0A 1J4EA 4LNYA 4RV8A 4B16A 4UCFA 2BY0A 3TAKA 3W70A 1E4MM 1WKYA 3NIYA 1JZ6A 2C13A 4LRSA 5A8QA 3RM8A 1ZS2A 3M1ZA 3LTPA 4AH7A 3CUGA 3CUIA 3VFLA 1R7AA 4JY8A 1EO7A 3KL3A 5EL1A 3HBKA 5BRPA 1VCFA 2JFEX 4UQBA 3AFBA 5AC6A 1NQ6A 3MBDA 5J5RA 2FH6A 1QPRA 3C2EA 1J0HA 4UR9A 2YW4A 2DZWA 3QH2A 4ZQPA 4BWLC 1LWJA 1OGGA 3W74A 1ICSA 1GQIA 3CH9A 1HKMA 3LDRA 2IXUA 1TMHA 3M5YA 2G96A 3LCLA 1E3XA 4Z2KA 3KXQA 1EQCA 2XWDA 4GKLA 5BRQA 1BWLA 3U7VA 4HMDA 2A3CA 2E6AA 3II1A 2OT1A 4IUOA 3BARA 1W2VA 1WDQA 1YQ2A 2AEYA 2VZOA 3N9KA 4WXYA 4XKYB 2CBUA 4ML4A 1UQYA 2FIQA 4CD4A 3W87A 1IXNA 3HG2A 2DQXA 3AIWA 4AZGA 3WNKA 4DF1A 5LHEA 5D2XA 1GZGA 1KTCA 4RLIA 3TJLA 1DORA 2V3EA 4X9YA 4BA0A 1D7FA 6TAAA 1LG1A 1VZWA 1RQBA 1MQPA 1F76A 3NOEA 2GJXA 1GVFA 2J77A 1TYGA 3HGSA 3HPSA 1OJXA 3DFNA 2BHUA 2OYKA 1LDCA 2ALDA 1Y7VA 4NU7A 2GSJA 1PIGA 2B7NA 5BNKA 1E15A 4LS2A 2WVUA 3GKFA 1NF0A 4CCCA 3B8SA 5A6BA 3GXTA 4JFUA 1VHNA 3IANA 2QAFA 2WV8A 3WH5A 3WMCA 4AMCA 5E0KA 3AJ7A 1H3GA 1VENA 2DEPA 1OFOA 1E0WA 1Q6GA 3SUSA 3W27A 3W38A 2ZTKA 1TPH1 4M6VA 2CERA 1BYAA 2XSBA 1EX5A 5DN1A 1L6SA 5EB8A 2HVMA 2HS8A 3OZOA 2VOTA 3W1MA 3TDFA 4V27A 1OF8A 3R89A 4R7JA 3I3DA 2QF7A 4W84A 2WMHA 3ZR4A 1QR7A 4FFHA 1X1OA 3B8DA 1F5ZA 1ML1A 1VLIA 3A21A 4JS3A 4LV9A 4XWUA 3GNDA 3DC0A 2D20A 5AC4A 4RE4A 5T26A 2WKLA 1H0IA 4AF0A 3AMCA 3W07A 2J7GA 1XD0A 4CD5A 5CGTA 1DKWA 3VDAA 1BAGA 3OZPA 5DBUA 1OD8A 3R5EA 4H8UA 1UWSA 3MI3A 4AXNA 3LLDA 5LNUA 1I4NA 3TTOA 1LZOA 2ZXQA 3LTSA 1FP8A 3KRSA 5FIPA 5IHSA 2FHCA 3W75A 2ZZ4A 4UTMA 3L66A 1E6RA 5KSWA 5A2CA 1OABA 2PC8A 1FWSA 3L4YA 3GM8A 3N13A 5C70A 4GE8A 2V2DA 3NJ3A 2YA1A 4LYPA 3I7QA 2ZXAA 3NSNA 1ADOA 2G3JA 3GYEA 3W86A 5E09A 4GI8A 1UG6A 1ICPA 3ARYA 1B3XA 1KV8A 1MFUA 3S1UA 3QQ0A 3W24A 2WMIA 3NPWA 1XSKA 4MB5A 3AXXA 3PUDA 4V28A 2BV9A 5I77A 1TUXA 1X6LA 4HZ6A 3P62A 1E6SM 1R7OA 1KFKA 2A7RA 5JIPA 3T08A 1LLZA 3TCEA 1JVNA 2W91A 1ZENA 1CLXA 2YL8A 5EFFA 2QAPA 4OHQA 1NP2A 3PAJA 3W7GA 3CLWA 4U5IA 2QCEA 5FF7A 3S9YA 5CGMA 3VGEA 3FNDA 2QCDB 3OGSA 3MMTA 3NQDA 5LNVA 4F9JA 1V08A 2EF9A 5DY2A 1QW8A 1KM0A 2VUYA 2VZUA 3HU7A 2XJ7A 4KFNA 3B06A 4QNEA 4JCMA 1FDZA 1JRBA 4MDPA 3PN8A 4TTGA 4FO4A 3SJ3A 3T78A 1ZY9A 2OZ0A 3L4WA 4ZFMA 4H2CA 1ZALA 2W61A 3OLGA 3OA3A 5F1VA 1EP1A 1UA7A 2NT1A 3LXBA 1SO3A 3GAKA 2EHHA 2E3ZA 3VX0A 4LC8A 4JZ5A 4WUIA 3GKAA 5LGXA 1WYIA 3W1XA 5KINA 4BQ4A 4QISA 4LS1A 3TC6A 2PI6A 1KM6A 5FKYA 3SGUA 1OIFA 5EPDA 2Q8LA 4MB3A 1TB3A 2NZLA 3GIYA 4U3AA 1VLWA 2YL6A 1TRDA 4MOZA 4CN4A 3AMGA 3MV11 1UR8A 4UTWC 1G0CA 5A8GA 3L2LA 1XH1A 2DH2A 4ZZ9A 1GOMA 2VC6A 5BWFA 5F4WA 1W1PA 2O9TA 1MXGA 4EE9A 2YCEA 2WCGA 2X05A 1KWGA 1DWAM 3C6CA 1UA3A 2CESA 1H62A 2VENA 3CQ0A 2V2HA 1CDGA 1G94A 1XC6A 4PMXA 1YTEA 4JYDA 1A3HA 1HJVA 1TA3B 3E0IA 5BW6A 1JZ3A 1Q3NA 1BQCA 1JYWA 3PBVA 2VX7A 2JKPA 5DT7A 4CN6A 1H49A 5JBFA 2CFFA 2FB2A 2J7BA 3UESA 3IGXA 4JICA 5AB3A 2V5DA 4CU7A 1ME8A 3VMNA 1JZ8A 1GNXA 2XFRA 3NAVA 1TIMA 4EIVA 5M3WA 4HU8A 1XC4A 1G7VA 4F79A 3SUUA 2TYSA 4E4PA 4XQ6A 4RJEA 3TK7A 3OVQA 3AS0A 3TC7A 2G5WA 2WNQA 3GZAA 4ZENA 1MQQA 3AS2A 4L4OA 1I2RA 5K9CA 1DHPA 4FX8A 4UQDA 2ZUVA 3EDFA 3HJEA 4L4LA 3W82A 3CEUA 3AS3A 5C6MA 2DSVA 3TA9A 3UPBA 4HHPA 3NO5A 4Z2GA 2YW3A 4AZIA 3W23A 1PHWA 2QLYA 2VCAA 2VQTA 3D3AA 4E8CA 3IJ7A 3ZJ7A 3GDKA 2J7FA 4LU0A 2X0HA 3OGVA 2GUUA 1JQXA 3W76A 1GHRA 2WSKA 2J7EA 1AMKA 3FKRA 1V0NA 4AC1X 3W1RA 2YZRA 3OG3A 4R33A 1W8SA 3WQ6A 4N42A 4D1JA 4HNNA 5SWUA 1EHAA 2YA0A 2ATSA 5AHFA 2B0MA 1EP2A 1W5QA 1NF7A 3G22A 2EO7A 3TP4A 1H1YA 4ACYA 3LOTA 2EXOA 3VIIA 3VI2A 3RU6A 3CIWA 2F61A 2V82A 5KZ6A 1FQ0A 3ZWSA 4AMAA 4JCLA 3PIJA 3VD4A 3WY1A 2Y5EA 4GPNA 1OX4B 3NM3A 2UY4A 3PBUA 2ZRVA 3SCSA 3YPIA 1R30A 4R27A 4Q7NA 2DZUA 1BKSA 3LRKA 2QPSA 1F73A 3RF9A 1TPWA 1W1TA 3KE0A 3M7WA 4J9JA 2W5FA 1P5BA 3KRUA 2DZXA 5ABGA 4FF5A 1QFEA 4MVAA 4O0ZA 2E9LA 2CHOA 4QLKA 5HBFA 1XD1A 5D2TA 4OZOA 4PUDA 4MYAA 3TROA 3VIOA 1SFJA 1ZJAA 3W7HA 4UC5A 3EWXA 1M04A 3MUZ1 1F6KA 1ZAHA 2ABBA 1A47A 4UOJA 1LOSA 4HZ8A 1MEIA 2ADEA 4POCA 4KKXA 2XVKA 3W84A 4PMQA 3AO0A 2JEQA 2JKAA 4U31A 5CPMA 5LA1A 4PA8A 1DOSA 3PR2A 4JIPA 4IJBA 2YSWA 3BAJA 4DM1A 3DENA 1OB0A 3JUGA 4V2XA 1NFBA 4UFJA 3WELA 2QMKA 2WANA 2A7PA 3UR7A 3GH4A 3PHAA 3VD5A 3CM4A 4BF7A 4PMYA 1KCKA 5DELA 2ZWZA 3VD7A 1W5NA 1JD9A 3LIHA 1I45A 3RFAA 4U33A 2A1YA 4AD3A 2VL4A 4OOUA 1JAEA 3FHQA 2DSZA 3I3EA 2XN1A 1TR1A 4F9DA 2XFYA 3IGUA 2NXIA 1WE5A 1BTMA 1E72M 2VVNA 4HU0A 4KMQA 3LB0A 3W1UA 3R13A 1C92A 1JF5A 4C7GA 1KFJA 5CXPA 3WUBA 3I6RA 1A5AA 3BK0A 2X16A 3WQWA 2AAMA 2WCAA 3EX4A 2A4AA 3IRDA 3WJSA 2IUZA 1EWDA 1WOAA 4UR8A 2Z1KA 5IDIA 3VGHA 2C16A 1G7UA 1VCVA 1AL8A 1CGTA 2Q8XA 1RZMA 4PMDA 2E8ZA 1UD8A 2I9EA 3TJXA 2ZUMA 1W91A 3QQ1A 2LLEA 3NSMA 2Y89A 3LHVA 4FXRA 3TFCA 3A5FA 2QMJA 3LPFA 3BAWA 3W7MA 2CITA 1VYSX 3N17A 4P7NA 2X1RA 3CIVA 3T2QA 2OJPA 1SW7A 2I14A 2C18A 4O8RA 3DI0A 2ZIDA 3TXVA 1GJUA 2PBOA 4OGZA 2ZZ2A 2WVSA 2ZDRA 1PZ3A 2VEPA 4NJIA 2BFGA 3ZMRA 1WO2A 2ZUSA 4U2ZA 3EWZA 1G4EA 4AZZA 3VD3A 1O7AA 3BC9A 3MI2A 3QMRA 5I3DA 1XBXA 1JDDA 3GXNA 1GG0A 1O94A 1B30A 4W93A 2ZZ1A 6ALDA 3SEPA 5KMYA 3AXHA 4A3YA 4RKAA 1OWQA 3UWZA 4OOZA 4QAWA 4UTJA 2FH8A 5CKSA 1W2TA 4JIQA 4GUFA 3LDKA 5LYRA 5H2ZA 3P7YA 5I3JA 4O1AA 4MY8A 1FDYA 1T0OA 2XM1A 1GCYA 5FKCA 2DU2A 5G1TA 1JCJA 1YLVA 3TAOA 1JXKA 2RGMA 3E9AA 1ZAIA 2PWEA 3VGFA 2OSWA 2QCMA 1EP3A 4O18A 1JZ7A 5CZTA 1F74A 1IXPA 1A50A 3KFTA 5D2WA 1CPUA 2W79A 2XN2A 5DO8A 5A1AA 4K8EA 1YXDA 4ALDA 5BYWA 4EQVA 2J7CA 3T09A 3U14A 3ZIZA 1WA3A 1V0LA 4DF0A 5D2VA 1CGXA 1PCWA 4UFLA 4FEZA 2BVDA 2RDUA 2TRSA 3GK0A 4EVZA 3THQA 4UTTA 4QSHA 2WXDM 1BFNA 2VZVA 1D3HA 3WD2A 2Q3OA 4N6EA 4DUXA 5JBDA 2QUTA 4AISA 1EOMA 1XBVA 1HL9A 1KA9F 3M9YA 1WP6A 2W92A 4HMEA 5E6YA 4O16A 3AHTA 4AD1A 1UH3A 4O57A 1GVYA 5DY3A 1NEYA 3T2OA 5I3IA 5HINA 3N15A 3P61A 3WIJA 3MMWA 1Z41A 2F8QA 3P80A 3PWAA 4X3ZA 3GVGA 3STEA 1KM5A 3UWVA 1IZKA 1QPQA 3MI6A 2FFCA 5CZ0A 1M01A 3LHTA 3A4WA 4UQAA 4GUJA 1V3MA 5CPQA 1MZHA 1LORA 2ZCGA 3IVSA 2YYUA 3L5MA 1ODZA 3OBKA 1HKJA 2QCGA 4O13A 1QNSA 2QCLA 1H7XA 5LKYA 3U5UA 1R85A 4IPLA 1V6YA 3KWXA 5F2GA 4WKHA 3SC7X 3FKKA 1PX3A 2CKRA 5F2MA 1GG1A 4QAIA 4GUIA 4OJYA 4KFOA 2ZZ6A 5LNRA 1IZJA 3SY5A 4LS0A 4UOZA 4MY9A 1QPKA 2ZXDA 3VOCA 4WZHA 3RILA 1NOUA 1DWGM 2QQVA 1XFBA 4I9AA 2WPBA 1B31A 1D3CA 3ALFA 5AYYA 3NQ6A 3PZTA 4M56A 1GQLA 4EK7A 2R91A 5I23A 2EPHA 1QOPA 3WD1A 5CSSA 5F2IA 3PULA 5EBAA 5FK8A 2GUYA 3LIGA 3W1QA 2ZX8A 4PFMA 2GJXB 3UG3A 4WK9A 1H2JA 5DXXA 3W53A 2ABAA 3VDBA 3AIEA 4PYSA 1OGBA 2Y2WA 1CGWA 1JYVA 4JTLA 1W54A 4N9BA 1WBJA 2J88A 3LHZA 4E2BA 1QNRA 3UXAA 2DZSA 4LGXA 5ECUA 1ZJIA 3HBLA 3PF3A 4HNUA 3N9RA 4DQWA 1VB9A 2QUUA 4TMCA 2X0YA 3THCA 3CPUA 4Z2IA 1CBGA 1BYBA 3LDVA 3IIVA 1DHKA 2CZFA 1GVIA 3CZKA 3TU9A 3VINA 3DFOA 1MW3A 3IJ8A 1BYDA 5E6ZA 3WUFA 1HUVA 4ZQNA 1EB3A 1OF6A 1SZFA 2YFOA 3MYPA 2EBNA 2VNCA 4LX4A 1KWKA 1OX5A 1EO5A 1BGAA 1TTJA 5D32A 4JIEA 4JFWA 1GEQA 4M6PA 4O14A 2ZWYA 1E5NA 1E4LA 4BR1A 4AF0B 4AHQA 3LLFA 3QPZA 1YDVA 5F7UA 2A6NA 1XH2A 3EMCA 4C1LA 1TQJA 3EKLA 1K8XA 1LL6A 1EIBA 5I2UA 7TAAA 3W2LA 2YOCA 5BCAA 1M53A 4UTHA 4IMFA 3TH6A 2DJLA 4JKMA 3UGHA 1UD6A 1KV5A 3VU2A 1XSJA 3PY2A 1R8LA 1UWIA 1UR1A 3W2JA 3VDCA 2H8ZA 1H0GA 1K9EA 2UY5A 3MMUA 2ZX6A 2W0UA 1ZBVA 4GXPA 5F4SA 1UR9A 1SFLA 3HGOA 1CXKA 3SZ8A 2CPUA 3BVJA 3UGFA 2BY3A 3ZQ9A 2WMGA 1LYXA 1KBBA 3WH6A 4GJ1A 4BK9A 2WSPA 2D3NA 3P82A 4PL1A 1AQ0A 3L21A 4MADA 1SO6A 2XYLA 4CN1A 2A3EA 1N55A 4W7VA 3BMWA 2NWSA 1DVJA 3W7CA 1V3JA 2WJZA 3TONA 2VURA 1YTDA 1CXIA 3CMJA 2YJQA 3WK0A 1MVYA 4JTGA 1MW2A 5CG0A 2CNCA 3QOMA 1H7RA 1SU5A 2PURA 2RFGA 2XTKA 3CWNA 1JXJA 1H7NA 1V6VA 2PE4A 1MSSA 1L6WA 2JGQA 2NV1A 4DXVA 3G1HA 1GVRA 3A3HA 5HPCA 5DFAA 2CETA 4QCFA 3RJYA 1CECA 2E77A 1QNQA 2GQ9A 1IXOA 3EX6A 1C3FA 2QCHA 1XYZA 2O7SA 2XHYA 1BYCA 5KTLA 4Z2LA 1TRIA 3WQVA 1UHVA 3FW6A 3L5LA 3S5NA 4UMBA 3DKLA 3THAA 2ZRYA 1W3KA 4DUVA 5E1QA 2OSXA 1LBFA 4O15A 1MO0A 3RLUA 1NM9A 2BY2A 4GQRA 4CD6A 1SZGA 1OBAA 2QDHA 3DFQA 2A2IA 5IM51 3EDKA 1B9ZA 5FK7A 2TSYA 5D9OA 4FNUA 1W9PA 3NSXA 4NRSA 1JQVA 4OIFA 3VGGA 3PC0A 1ZJBA 5DCEA 1FWRA 4E0CA 2ZE0A 5A2AA 1HIZA 1ZB5A 3T0BA 4OU1A 1I2OA 3HG4A 4GXMA 1KBJA 4JEQA 1EQPA 4PSRA 3P84A 4CNPA 1EPXA 5FEZA 1RR2A 2WHKA 3WF0A 1LRQA 3LV6A 4NNAA 3WF1A 5A8MA 4HIBA 2J4GA 1CI1A 3W88A 3MBFA 3KVJA 1U2YA 3MSDA 1KFBA 3W6MA 2V2CA 1K6AA 3Q2DA 4Z0SA 3EDJA 3KF5A 3O1NA 2H3DA 3SR7A 3S42A 3VIFA 1OVDA 4AWUA 3ARVA 4D6GA 4RE3A 3LPOA 4JFSA 4KRUA 3GR8A 1FWWA 3IEBA 3AJXA 4ZE4A 1I75A 4IISA 1TZ7A 3L67A 3S5OA 3RCNA 1F7BA 1F6PA 4H8HA 2VZSA 1XUZA 3C4UA 5JBEA 1B4KA 5M03A 4D6HA 1TVNA 3MUIA 3PZUA 2FTPA 3W71A 1ZU8A 1F2JA 1M7XA 3CUHA 3L65A 3ZSSA 5C5YA 1PAMA 3SCPA 2X30A 2E9BA 4H41A 3GNNA 5HWMA 4K6AA 2NUWA 1MW0A 4JL1A 4MPKA 3LHYA 3S2CA 5D9PA 4ORIA 1HKKA 1ICQA 3FIGA 4CU6A 3M5ZA 1EGZA 3E49A 2ISWA 1MEWA 2NX1A 2QQUA 1GOIA 4AD4A 1CLVA 1LROA 1E6NA 3DHFA 1IGSA 5EBUA 4Z1BA 5L6UA 5MHBA 4IMEA 1GHSA 2AMGA 2CU0A 1FCBA 1ISVA 2GVLA 1BEUA 1E73M 4PRWA 4F66A 3F4WA 3SI9A 1C8YA 3V1PA 1UYQA 1OT2A 3B04A 3VNZA 2Y7FA 2X1IA 2DDXA 4MY1A 3PZ9A 4ML9A 2J27A 3MHGA 3ZT7A 1E5JA 1KLZA 2XG9A 5FF2A 1ODUA 1NWSA 5CPTA 2D73A 2J75A 2ZUTA 1V0MA 4QDMA 5C8BB 4GRSA 3R8RA 5I79A 4H04A 2R8WA 3VDHA 2WHJA 1J0KA 1W31A 3W83A 3KVLA 3A4XA 4QLLA 3NYZA 4OQVA 1WNOA 4TVCA 4O54A 1E1EA 4TMBA 4NSBA 3AICA 3EXRA 3M5VA 4QQ3A 1J12A 3WH8A 3ZR5A 4FNSA 3ARWA 3GBEA 5JUVA 1MW1A 4CQAA 3BSHA 3AS1A 3TUUA 3N04A 1D2KA 3A6OA 1C7TA 1UR0A 1JCNA 3OG2A 2NSXA 3SCRA 1JAKA 3B9AA 4W87A 3WBEA 3O6DA 2PF0A 4Y6GA 4HSNA 1Q6CA 3IIOA 1P0NA 2A6LA 3WKZA 5D33A 1GWJA 3EX2A 5CZSA 4JHOA 5AHLA 1KXVA 3W7KA 2DZPA 2G4FA 2VI0A 3CZGA 3W7OA 3M16A 5D2YA 1FFRA 2VKZG 1TPUA 3C61A 3LCIA 1TQXA 2FLIA 4Y8FA 1PIIA 1MEHA 1JCMP 1UKPA 3OGRA 1RQHA 4PMNA 4JDBA 3DFSA 3UWYA 1HX0A 3AIVA 3B05A 5D8WA 5HMSA 1H4PA 2Y7EA 3SUTA 2CLEA 3NQGA 2WKGA 3HMCA 4CCEA 4XZ9A 3IIPA 3S5YA 1OG0A 3KOFA 5KZDA 1JGIA 2VOMA 3VE7A 1AVAA 3AOFA 3ARPA 3AMKA 3W6YA 1GYNA 4GO8A 3W7PA 3AYSA 3VIMA 9CGTA 3WDRA 2BWGA 5TQLA 1E9LA 3NL6A 4HNTA 1PS9A 1JNEA 4O28A 3HO8A 1US3A 1GJWA 1H50A 4CUCA 1IT0A 3O6YX 1FX6A 4WKAA 4K68A 3TIMA 1KQZA 4TVDA 5K9DA 4HXCA 2ZRUA 1XBZA 4JNMA 6TIMA 2AAAA 3BAYA 2J24A 5HDRA 5BXTA 3USBA 4TTUA 5GPRA 4DBDA 3BLEA 4DO6A 1V3LA 3L4TA 5AC5A 2RH9A 3ZSTA 2P0OA 2QJIA 2QQWA 2NXHA 5K2ZA 2FPTA 4JR5A 4QIUA 3S1WA 4W7WA 3C56A 2V8ZA 2CIPA 3HIJA 2NV2A 4FX6M 3U6WA 3WJYA 5A69A 3F4NA 3ALGA 4TU1A 4NUWA 3BPWA 3MV01 5A8OA 1YHTA 3GH5A 2A3HA 1EEPA 4O50A 2CBVA 3ZS4A 2CKSA 3RIKA 3W25A 3G24A 3WDJA 2BTMA 3IVTA 4Y90A 1K03A 3WF3A 1P0KA 2I1OA 4O0KA 1E0XA 3SCTA 2YFNA 5ABEA 1JG9A 2QCFA 1DWFM 3K4DA 3QHNA 5I3GA 3EWUA 2WSQA 2Y7GA 5D04C 5I3KA 3MYOA 4OBTA 1SW3A 2JIEA 1KR0A 5D03A 1XUUA 1LJYA 5CZKA 3RJXA 4Z08A 3UZ5A 4HSOA 1E4NA 1TVPA 1BF2A 4RL3A 1QPNA 1ZBKA 4JTTA 3ELFA 3AHXA 4X0NA 3B9DA 3LCGA 3PS7A 1YXCA 3WNNA 3CU2A 3WN6A 1D3GA 5J5DA 1TSIA 4W86A 4AZCA 5DT5A 2O9OA 4XX6A 1HJQA 4HPHA 1LLOA 4FNTA 4MLRA 4AZ6A 1H41A 1TPEA 2NXGA 2ZX5A 5A3HA 3T0DA 5IBXC 3VCRA 3BGGA 1C93A 4AZ7A 1L8NA 2WC3A 3S1XA 4P8UA 1CXLA 3LCXA 4MUZA 3IMMA 1WOBA 1O60A 3S5ZA 5AN7A 1I1XA 4E2OA 4MJZA 3K4AA 3STFA 4URIA 1L2UA 3JRKA 1KB3A 2YDSA 4B3KA 2E6YA 4O1BA 3POHA 3FFSA 1DWHM 1KLYA 3W4RA 3LBCA 5GNXA 4W7UA 4ZQRA 1GJPA 4PMVA 3W81A 4UTTC 2B31A 1PV8A 4DO4A 1BG9A 5A6MA 4MIMA 3SCQA 1HJWA 2BS9A 4UNIA 2D3LA 1FWNA 3TMLA 1VC4A 4RZ6A 3BLKA 4NNBA 2CLFA 3S5QA 3WBAA 2J8GA 5CPOA 2D1ZA 3C2OA 3V75A 2EPKX 1LRTA 1TJRA 1V3KA 1AQHA 3MUAA 4ZE5A 4UTKA 4RZ5A 2OWWA 4LV4A 3TFXA 4LY8A 4EOUA 4PTNA 3SCNA 3A5VA 4AZ5A 5HNNA 4MB1A 4A3UA 2OCZA 4B5NA 3SGZA 1KM1A 2NWRA 1NP0A 3N14A 1WBHA 3ZT5A 4JX4A 5FEXA 4GBUA 2FQIA 3OVRA 1VBRA 1XRVA 3W73A 5AFDA 1Q6OA 1HP4A 3PTKA 3PZOA 3FYPA 4Y7EA 5GVJA 1NH6A 3SCUA 1VYRA 1UBSA 3DFPA 3HGRA 1HTIA 2GJLA 3G1SA 1TE1A 2V3FA 3ZT6A 2YIHA 4HOZA 2Y24A 2Y8KA 3M07A 3BMVA 3TTYA 1OYBA 4GWEA 1E6ZA 3I3BA 4FXSA 3NM1A 3N11A 3B0PA 3LERA 3ZWTA 5BOOA 5L9FA 1WDSA 1ISXA 3S6TA 2W62A 3T4CA 4JD4A 4W85A 2Y62A 4UNKA 2DGAA 1Q4NX 1NWUA 1V5XA 2FGZA 2JGYA 5G2IA 3AI0A 4TUFA 4UFIA 3RPMA 1FCQA 3HB9A 3KF3A 2MANA 2DZVA 1QW9A 4PBGA 1O5KA 3B4UA 1E0VA 3WFLA 2Z6IA 1GW1A 2DSUA 1KXQA 3EXTA 2GPTA 1CGVA 2AOSA 4IPJA 2F84A 2GDUA 3FAXA 4FFIA 2YLLA 3MJYA 3W2UA 5AHIA 2QF8A 2VT0A 5D9MA 1I2NA 4GI9A 3UG5A 3QYQA 4NT0A 4RZ4A 2Z1SA 4WLCA 1G4SA 3AXIA 3STCA 1WAWA 3L9CA 2ZX9A 1DWIM 3M0ZA 5K4ZA 2VQUA 3N73A 4GUHA 1K3UA 4QP0A 4K37A 4CVUA 2WC4A 3ARZA 2ZA1A 5KEZA 3SCOA 2EKCA 3Q58A 5AYXA 4U28A 3TA6A 3EX1A 1G9HA 1Y0EA 1UYPA 2PC4A 1VGAA 4LVBA 2GFTA 1RD5A 1VR6A 2ZBTA 1CGUA 5FF0A 1FH9A 2WSRA 3DAQA 3DI1A 2NUYA 4GZIA 5AYBA 5G4WA 2VVSA 3G1AA 4Q33A 3QJAA 1XYFA 4GZEA 4J3SA 2ADDA 4FLQA 1KTBA 3AMDA 5ABFA 3BGJA 3EKZA 1HL8A 1TMQA 2X1UA 5TIMA 3UYCA 4UR7A 4RXFA 3PSWA 5E93A 3CZ8A 3L4VA 4WSKA 4N4QA 1PX8A 2ZA3A 4L4MA 3BW4A 1ZCOA 1CGYA 1SMAA 4FK9A 1E43A 1LLWA 3WNLA 4Y9AA 1V7YA 1HXJA 3GX9A 1UUOA 1GOWA 3THDA 3DBPA 1YADA 2V3GA 3VX1A 3NA8A 3UWQA 3EMQA 2WK2A 3MMDA 1C8XA 1VFFA 3DHUA 4JYFA 4O19A 1UUQA 1R47A 1NSJA 3LXCA 5DF0A 2E8YA 1VFMA 1L6YA 1KR1A 3NUKA 1S46A 4NXKA 3VNDA 3ARXA 1GPWA 2XPKA 5DEZA 1B4EA 1W5OA 5FESA 5EMYA 1B3VA 5CPLA 3T40A 1W9DM 5EYWA 1GZJA 1H51A 4B1LA 2X1SA 4XZBA 2FHFA 3KL5A 1UWTA 3ZOAA 3GDMA 4MJ4A 3SCWA 4DPPA 4LW7A 1Q6FA 3UD6A 1TCMA 4HKPA 2C0HA 3M46A 1EDTA 5I3HA 4TIMA 3VIHA 5I78A 1OX6A 4IPNB 1TV7A 2RKXA 1KFWA 1V0KA 3L2MA 1Y9GA 1LWHA 3NEVA 3G8EA 1XI3A 2FDSA 1H61A 2GJPA 2J62A 3DYPA 4MJMA 1OK6A 4N9EA 4CNOA 2YKKA 1Z44A 3ABQA 3H55A 2Z2UA 4M80A 3AQUA 4HPJA 3NDOA 4IX0A 3QZEA 4LOCA 4NVTA 5IXEA 3UWWA 1DP0A 4M6QA 3BXWA 4M7SA 1WDRA 2X09A 4RE2A 3DHDA 3MHFA 1GYLA 2VX5A 1CW2A 2BNJA 4GZJA 1UUMA 5CSYA 3IAPA 1KCLA 4UQ9A 2W66A 4MAZA 2P10A 3S1VA 4H4IA 4AXKA 3GXIA 5CGQA 2VX6A 1W1VA 5D02A 5EFDA 1JUKA 3GYCA 2NX9A 4D72A 1QOXA 1JZ4A 3WQ4A 2UY3A 5A6AA 1DQWA 1EA0A 1G6CA 1QHZA 1JI1A 3NNTA 1UQZA 5G5IA 4FNQA 3T44A 3O06A 4S2BA 3CTTA 3AYRA 2FB3A 1CIUA 1KFLA 2H6RA 3PG8A 3IAQA 2VJXA 3NQFA 5A6JA 1T99A 5CPNA 4LUJA 1I1WA 1T96A 3W85A 5AYZA 5IBXA 4FNPA 3AIUA 1ZL1A 3LF7A 5FD0A 3B9EA 1QVBA 3A22A 3ARQA 3ZJ8A 4IOTA 1B2YA 2OT0A 2WVTA 1L9WA 3FOKA 2FDMA 3PZVA 3OB8A 4B3LA 2C0AA 3LCWA 2HISA 4ZXOA 3TKFA 1DL3A 5FIXA 1XSIA 4MNKA 5FMBA 3NPUA 1SR0A 4AZBA 3W37A 3PTQA 1JFXA 1QI5A 4HN4A 4W9TA 3BAKA 5CJ5A 2YX0A 2NUXA 2XGIA 2VCBA 1UOKA 1FH7A 4CQ8A 4A29A 4ZVJA 4BFAA 2QEZA 1CX9A 1LL4A 5A6BD 1ZAJA 1ZNNA 1M7PA 4GIAA 2YL5A 4J3TA 1W1ZA 2GQ8A 1Q6RA 1KQYA 1TFVA 1CEOA 1LP6A 1F05A 4BI6A 3CEPA 4UQCA 3STGA 4FMVA 2YGYA 3NQVA 5D05A 3EDDA 4JHZA 4WOQA 5AHMA 3WK2A 4JDYA 2CHNA 3QR3A 4R34A 1AW5A 2WSYA 2ZFAA 3DYMA 5AY7A 4ZEPA 2VRKA 4JTHA 3K46A 2G3MA 2H8XA 3AIBA 1WV2A 3QHOA 3H3LA 2Q3RA 1JCLA 3PUEA 5KZEA 3M44A 3QHMA 4K7VA 2CEQA 3A23A 5KITA 3C0JA 5DCBA 2YDRA 1PHQA 4GO9A 4AHPA 4BQ3A 2TMDA 3W2MA 4AD5A 1RV8A 2VFDA 1TPC1 1GOQA 3G3DA 4PSPA 2UV8G 1XKYA 3P8JA 4JL2A 5FMCA 4D1IA 4O53A 4RR4A 3L2IA 3BSGA 4MZ1A 2CBIA 3BG9A 1OFRA 3NQ8A 1E51A 4GUGA 4HA4A 5DBTA 3W9ZA 2PWHA 5A8NA 1OFEA 1GVSA 1TPFA 3F1QA 4W8BA 4HMCA 3W7EA 4J3XA 3F03K 2P1FA 5U7SA 3SIMA 2XUCA 3QSTA 4UNLA 4CLMA 2E6DA 3WJWA 4DBEA 1E56A 1DJQA 3B0VC 2F7FA 4FF7A 2B7PA 4C7FA 4XV0A 5CSUA 1W3JA 5CLWA 2QR6A 3CLMA 2WNNA 3NPVA 1EXPA 2V5CA 3SUWA 1XM3A 1EHNA 4WOZA 5A2BA 3WEOA 5G2HA 1LQ0A 4UCGA 1US2A 4WD0A 2E0PA 4JFVA 4DF2A 1ONRA 1XCFA 1GVQA 5DMYA 3OHIA 3E1F1 3FN9A 3L5AA 1SUXA 5C71A 1VRDA 1FHLA 5IFPA 1SZEA 3AMLA 1HG3A 4PCTA 3KRZA 3DXIA 4IMDA 3EWYA 3OA5A 3NL2A 5AC7A 4AZHA 1QO2A 1JZ2A 4P2VA 3W1AA 2Y61A 3NZ1A 3OLIA 3POCA 4PTWA 3N18A 2E5CA 4LC6A 1BVNP 1Q6DA 2VR5A 5HPOA 2A0NA 3SSJA 4LUIA 1F4AA 2G8ZA 2YYTA 3SUVA 3W7JA 4JAWA 4EKJA 1XDMA 1NWRA 3UR8A 3WFAA 1LRNA 4QITA 3TSBA 4EANA 5H91A 4XB3A 4UMAA 4MNMA 1X8FA 3CZJA 4KRTA 1QHOA 1PX4A 4HP5A 3VMPA 3D0CA 5CSRA 1OK4A 4WJXA 4J7RA 1SQ7A 3FA5A 4MNJA 5FOOA 2XFWA 1TPDA 3TQVA 3WJZA 3O63A 2X2GA 2FGLA 3LPGA 4XTIA 4ZQOA 4IXHA 4KWUA 4M7TA 5JIWA 3CUJA 2WO5A 3K1DA 2Y85A 3M43A 3PB0A 1QBBA 1UJPA 4NNCA 1GORA 1GOOA 3HN3A 1H63A 1FBAA 1X7FA 3ATZA 4LPCA 4NXSA 2PWFA 4M81A 2C8NA 2EJ1A 2EGZA 3PBWA 3DGRA 3P67A 5E9AA 3OLEA 1R86A 1MXSA 4AEEA 2HS6A 3VILA 3LI0A 4NX5A 4W89A 3KX6A 3PTMA 1W3NA 3UZJA 3O16A 4XUYA 5BRBA 3FJLA 4KWWA 3WNMA 1B9BA 3GB6A 1R2TA 1E3ZA 3SFKA 2Z0IA 1PPIA 2ZYFA 2AQWA 3LM7A 2ZA2A 4YHGA 1YYAA 3G6LA 1M03A 1A5BA 1V03A 3WD0A 1RP8A 3WSUA 1VIWA 4ONVA 3ARRA 4MDOA 4NZJA 3OLDA 3GTNA 4X2RA 1XGZA 1VF8A 3RM4A 1UH2A 4TR9A 4DO5A 2VFGA 4P8VA 3QMTA 5G4EA 1XXXA 2XFFA 1BPLB 1TJPA 4JFTA 2V0TA 4PCSA 4DELA 1J01A 2ZUWA 4AZCB 3TXZA 4NJGA 5A95A 3TNOA 1FXPA 1QCWA 3W28A 3VNYA 2B7QA 1HO4A 4A22A 3CC1A 1AK5A 1OIMA 2EPNA 4KH2A 3UGGA 3P74A 4N9CA 2G3NA 3G6MA 1W37A 1FFQA 3MS8A 1JRCA 4CQ9A 3SECA 1LM1A 1ITCA 3AROA 1YPFA 3G1DA 3GDLA 1E70M 3FHAA 3MKKA 4WX2A 1OFBA 1T8XA 1NVMA 3MO7A 3PVFA 5E0FA 4N4PA 2C3ZA 4OBSA 1GQKA 1JCYA 3TW7A 1LF1A 1CWYA 1LL7A 3GNOA 2WMJA 2QCCA 2CCRA 2ZZ5A 1DQXA 3EB2A 1WZKA 3QGVA 3CHVA 4AEFA 1VFOA 4M24A 2GK1A 4MNLA 3AZRA 3VVGA 1EA9C 2BY1A 3KEHA 1ZFJA 2VCCA 4W88A 4K36A 1SO5A 3CHDA 4U3CA 1SFSA 1UD5A 2BXYA 2YBTA 3L0GA 3QPYA 2QCNA 3HMJG 2NW0A 4NJKA 2EEXA 3FS2A 1B3WA 2QPUA 4I7UA 5DLCA 1X1NA 3VIKA 3AHYA 2WZIA 2G95A 3W0KA 2J9XA 2A5HA 3W7RA 2BZNA 3W7LA 1ME7A 1U83A 1U5JA 4C1KA 4DWSA 1W1YA 2EQDA 3N1AA 1O5XA 4HOXA 1M7OA 1MXDA 2ZRZA 5K4XA 2JEPA 1Z48A 4AEOA 2J7DA 1WXJA 1AW1A 5EY5A 4N9DA 2OMAA 2YDAA 1WCGA 2VEIA 3LI1A 1FDJA 1PJ9A 4AWSA 1GPFA 2DJXA 2XWEA 3WD4A 1W0MA 1J0IA 3RDKA 4FLSA 2BLEA 4P8XA 4DEFA 3LV5A 1W56A 1DEDA 3U2OA 1W32A 1W9VA 3NDYA 1XL9A 3M47A 1W3TA 4D6JA
chains in the Genus database with same CATH superfamily
4Q8TA 2J1VA 2OKTA 3W1PA 4ICNA 1JUBA 5F5AA 4RDWA 4CDQA 2EPLX 4I9TA 1U1UA 1Z8AA 1DGWA 3F5LA 2WO7A 2PAEA 4U2YA 3R8GA 2A3XA 3T3YA 4GJYA 1AQMA 4EAMA 5SV5A 2HWF3 3L4ZA 3S83A 3UVIA 2OZJA 5KZMA 4HQVA 3GZTB 4IQLA 4K9SA 2WAGA 1AH4A 1OC5A 1F4HA 1GR3A 2JB8A 3QCWA 2NLRA 1XRUA 1QNOA 2V5LA 2ISSA 4AVNA 1OFSA 3BLIA 4O11A 3N34A 3WQ4A 3NGJA 2HSAA 3CAQA 5M5DA 4A4AA 4CDUC 1KFCA 4N0RA 4JAAA 2V81A 3ZXJA 2WT2A 1KXHA 3QOPA 3SH5A 1SFTA 3LEMA 2DCYA 3WMLA 1JF6A 2WZHA 1SLTA 3W22A 4QU1A 4ZCWA 3FAWA 4PBOA 4FCAA 5A80A 3GDTA 1BEV3 1EOKA 3ZFEB 5HXMA 4KW2A 1VJSA 3JZVA 4MFDA 4KQ7A 1PTGA 2UBPC 3ZJ6A 4W6YA 4LKDA 4IGPA 4ZMGA 1S5VA 3O8AA 3HFYA 2ZGTA 4YWSA 3LEPA 4HOOA 4MGIE 1ITUA 3O6AA 3G0XA 2WM0A 3PSVA 3INAA 3VAVA 3KLSA 4JIHA 5I24A 1C8M3 5KWRA 5EWSA 2Y6KA 1XDLA 2XM2A 1G4PA 4LBNA 3PU3A 2WWDA 1VLNA 3O07A 3OUJA 3S6PA 2DURA 2ZKMX 3M70A 3C52A 1R3QA 1UB3A 4BE3A 1V9U3 4ORMA 4MLJA 1JJKA 1G9FA 1H8TB 4A45A 4MOAA 1WLDA 4ZQCA 2RV9A 3KHJA 3OBRA 2CSGA 1WW4A 3OYWB 4R85A 2CZEA 3LOIA 4RA0A 3NMBA 3NNGA 5D8AC 3XINA 3RM9A 2WNVC 2OZTA 1BSIA 3NQEA 1QUMA 4UI9L 3K8MA 3R10A 5D4YA 5APAA 4Q7BA 4RR3B 4Q8NA 4KFPA 3PZIA 1V6LA 4UFKA 4W8LA 3IIAA 4FZIA 1XIDA 1ZBCA 3EO6A 8RUCA 2GOKA 3EX3A 3O2LA 4H00A 3NAPA 3REQA 2OT7A 3EMZA 2D0HA 4LYQA 3HPFA 1M6JA 4WSJA 1GNYA 5EGRA 3TC3A 2PP1A 3ACLA 3VM5A 4Q4V1 1EJVC 4YVSC 3FYOA 1GVOA 1PE1A 3O6CA 5F2LA 1WXYA 4J2MA 4K1ZA 3O15A 2QDEA 2CHHA 5FZ6A 1V6TA 2VR4A 3EQEA 3KBMA 1UL9A 5FMDA 1LUCA 2RDRA 2VM8A 1DTNA 5F1RA 4MTVA 5LEJA 3PIGA 3WW4A 3WLRA 4MMWA 5FDBA 1UPMB 2R82A 3AZSA 1YDNA 5EMKA 3BAIA 4REQB 3P6LA 3K30A 3ENRA 1XF0A 4MGYE 2H90A 2IKGA 5K0UC 2A1XA 4YFWA 2I5GA 2WFF3 1EUAA 3G1RA 2OYLA 3APBA 2CZ5A 1HB3A 4GVIA 4P7RA 5I0SA 1LT7A 4H6KA 1UWQA 1V02E 4S3AA 4FNRA 1M3UA 3G0UA 3URBA 3O3RA 2VXRA 2Z1WA 4HJWA 1GKRA 1QPOA 1IV8A 4JTEA 4XZHA 3U4AA 1X8MA 2C14A 4J3VA 1CYGA 3GBWA 1PK6A 3HWJA 1R2RA 1JPIA 2DPEA 7REQA 4U4MA 1KBIA 3EDEA 3BDKA 4S3KA 4UYBA 3DESA 4IPIA 2P3IA 5FY0A 4TX9A 2Z7KA 4XTDA 4O1DA 1H11A 3FFZA 4D7SA 3N6HA 5D09A 2R061 1UBPC 4GCAA 4AEDC 2Z42A 3O05A 3GNPA 3JD72 5D21A 2W3ZA 3QF0A 4XIAA 1V6MA 2V9DA 3G1XA 1D9EA 5BZAA 2GH2A 1CZTA 3TBDA 4QCEA 4C65A 1ONAA 1TTQA 4M6UA 4V2VA 1C7SA 4ILSA 1AZDA 3KGLA 5A6QA 5LB6A 3I68A 5E0CA 1U5HA 4CDXC 3AKQA 4WXZA 2QJNA 4X9SA 3RRDA 2DTYA 1IT8A 4DXTA 1LU1A 1B3OA 1ODMA 3PZQA 4WM8B 4G6CA 1VBB2 1NA1C 5TD4A 2Q1FA 1XIEA 5FF3A 4AVVA 3I2GA 3CIXA 5A7OA 3QFEA 3DYOA 3GXMA 1MS4A 1VEMA 5I3FA 5JZGC 2VMDA 3Q9OA 3MIEA 1A3XA 4ATFA 4GQQA 1DJHA 1MMFA 4BZ4A 2DIEA 1ITQA 1TQ5A 2D0GA 7TIMA 4HMCA 4AQ6A 1XXNA 1VJZA 4PUEA 4S2CA 2GMEA 4GIQA 4D6CA 3FJ6A 2YU1A 3OPWA 2WHLA 3GHTA 2D43A 1I2QA 3M7SA 4LVAA 2Z00A 2VFHA 1XCXA 1IIGA 4M8UA 3W7QA 1W6PA 1K7FA 2Q8DA 2DT2A 3UXLA 3PBMA 4C7DA 1HXS2 1G5AA 3VL8A 3WD3A 3NFUA 2QDGA 4K2SA 5FZLA 3DFYA 3NV4A 4Q22A 4XIOA 1QWRA 3FYYA 3UWUA 1XIBA 1CD3G 4LF2A 1JR1A 3HNMA 2NMNA 2PGRA 1R5YA 4NRRA 4CCDA 1ASJ2 5KHKA 4YW5A 4D3WA 2IXVA 1PSCA 3WDVA 1FP9A 2AEZA 4NIDA 1S5WA 1YUDA 4NPRA 4HKOA 3T81A 3GE7A 1O6IA 2OWXA 5F5IA 4FOQA 4H9XA 1YX1A 2CLPA 1JIBA 5RUBA 3F2BA 2JALA 3E96A 3J8F3 3CBWA 4EXAA 1TMF1 4DIAA 1S0EA 1FTXA 4B15A 5G1YA 3S3GA 4YW2A 1H7WA 3C2FA 2HDJA 1HGYA 2QCDA 4US6A 4KL1A 2FD8A 3VE9A 5C0QA 1FUYA 3NQAA 4QGMA 5LA0A 5C9AC 2NLIA 4I7VA 4YZ4A 3A47A 4LLOA 4KPLA 5GNZA 4AI9A 3BGAA 1GQJA 4JPGA 4UMCA 1FWTA 2DORA 5C4WA 1QI4A 1CN1A 2J13A 3PZGA 3IIZA 4D6DA 2B46X 2RR11 5TBOA 3RYSA 3RPQA 1P43A 1P1XA 3PB2A 3RNDA 4RNIA 5F39A 5LSMA 1J96A 3CGTA 2XBO2 3VGBA 2OZ8A 3SURA 1JI2A 2A85A 4W8JA 2PDKA 2OS2A 3TV8A 3OIXA 4ISQA 1BBT1 1JODA 1BKZA 3WXPA 1H1MA 2FZMA 1TR9A 3UGRA 3WMBA 4PB3A 3ABRA 1RB8G 3P2VA 3IGHX 3MICA 5LRSA 3G77A 4R5EA 3GXPA 1OCBA 4HOWA 3AIQA 3M41A 4XAPA 3UY8A 4ACZB 2DT1A 1QTWA 3FBYA 1KFUL 4M1RA 3PANA 3L9JT 1NCRA 1V6JA 3CHFA 3N19B 5LWBA 4G1KA 4IGHA 2DF7A 1QI2A 1W9UA 1LOEA 1B3YA 4MKNA 4BI7A 3RGBA 4DY5A 1O5UA 4Q3MA 3GXFA 4FSJA 3KZSA 4B5VA 5FQ0B 4Z8BA 1GTEA 3ZVHB 4E8DA 1Z42A 3QXBA 4Y4RA 3MDWA 4JNYA 5T5JA 1TV8A 1HJUA 2VQAA 1MACA 2UY9A 3E5BA 1KGWA 4D6JA 4KWLA 4O4VA 4YCPA 4FQ4A 3LRLA 1WCDJ 2WZR3 2WIIB 2ISFA 4LQRA 3WF4A 4AEJA 3N12A 3B9OA 2WNUC 4ZU5A 4XBNA 5GZDA 3WP3A 3UV9A 2FGBA 4JTUA 3N6JA 1P0BA 4HKLA 2BWCA 3JQXA 1NJJA 3LFIA 2ADAA 2CLKA 1C29A 5FAXA 3G1FA 1KJLA 1AR63 1DJNA 1IIHA 1KS4A 1QNVA 2Y4SA 4L65A 1ST8A 5F9TA 2W4XA 1EKOA 4Z1CA 1DIDA 2X8RA 3UJFA 4ZXEA 2CZDA 2RJGA 4ZODA 3ILRA 3IJQA 1XX1A 2FZDA 4AFDA 2FDIA 4HYVA 4EF9A 1QAPA 1AW2A 1E1CA 2YDQA 2OZ3A 1LEMA 3Q94A 2ZTJA 1UU6A 1H2KA 2J1SA 3KWVA 4B29A 3WBXA 3WUDA 1X8CA 5AFEA 2Y7DA 4MPQA 3UWEA 3RN6A 1Q5OA 3EBVA 3O1TA 4A7KA 4RHV2 3H53A 1BHGA 4IWWA 4RFRB 1OINA 1F3XA 4DEQA 1QH7A 4Z1DA 4CNNA 4ZXKA 1R1A3 2GWNA 3O12A 2Y0FA 4CCOA 3K13A 1I2PA 1UW9A 4KBXA 3ZM8A 3RO6A 5DDJ3 2WW5A 1ND2B 1FT9A 2W9MA 4CDWC 1HB2A 5LATA 4WY0B 1YJKA 3R2GA 3PUQA 2ESCA 4NF7A 1ENQA 5D8ZA 3CPRA 4W5UA 1HNYA 3URAA 3UQNA 4IIGA 8CGTA 1FNZA 1NDYA 2AGTA 4IH3A 2XGXA 3IIXA 1NFGA 5ERLA 2J7MA 1CZ1A 3KM8A 3LRMA 1S0BA 1H7OA 2WZEA 5BNNA 3LTYA 4LTAA 4YWIA 3S0CA 5JOWA 1J9YA 4HNCA 5HJXA 1P48A 2WMKA 2LALA 3TOJA 1PGL1 3MU7A 2PRLA 1EAH1 1M5WA 3WDIA 1VMFA 2CZVA 2IMRA 2RDWA 3B03A 2BNMA 1YTKA 4DYEA 2YBPA 3JS3A 1EJUC 1AA1B 3TTQA 1EP0A 3LZZA 4NAEB 1O4ZA 1OFPA 3ZLFA 1F9CA 1TJ1A 1OD5A 2JDPA 5FZFA 2QFEA 3B8UA 2VECA 1HQTA 5IVJA 1JOBA 2PDYA 3PVBB 3P5ZA 2WS91 1EX1A 3MP3A 3F5JA 4M3PA 4CTEA 4FPSA 1H1NA 5DX7A 3ZPOA 1KFEA 4Q4V3 1VRH1 3SIZA 1E6XM 4W8AA 3RZKA 2QV4A 2AGKA 3NWRA 4PCFA 1K7XA 4OHXA 3CBNA 4MLOA 1JUEA 3MW7A 2ORZA 5FYIA 4AY1A 3L0KA 3OPSA 3AJZA 4CSWA 1O6UA 1KS5A 2PAMA 3L4XA 3OODA 3NQCA 2WQZC 1HGWA 3VZZA 4UCFA 2BY0A 1WKYA 3LB9A 1JDFA 2VZRA 2XJUA 4H7CA 4AH7A 3EOOA 4FR1A 4H9ZA 4JY8A 5EL1A 3HBKA 5BRPA 2PGWA 3HQOA 3AFBA 4R9DA 1W8FA 4GALA 3FFQA 2IZWA 2JD4A 4QTGA 4XHBA 4FPGA 5LW9A 2PDMA 1KKOA 3BODA 3CH9A 4G1NA 3ITYA 5DXDA 4HYWA 2XWDA 2VOKA 1BWLA 4HMDA 2A3CA 2VGGA 1J1LA 3ZOIA 3WLLA 4WXYA 4XKYB 3V0AA 2DQXA 1FOD2 2JENA 5HQLA 3TJLA 1G9CA 1DORA 4AFAA 1D7FA 4Y5SA 5HK4A 4V33A 2P0IA 1RUI1 4B4RA 2GJXA 1UZZA 1TYGA 4PIXA 3I2IA 2V4VA 2PYTA 1LGNA 2BHUA 2ALDA 4JRAA 4G5DA 5JXGA 1BMV2 4CCCA 4AG4A 3GXTA 5HJYA 2E26A 2NLYA 2WV8A 3DERA 5E0KA 1BEV2 2DEPA 3POWA 3W38A 1PMHX 3IDBB 1TPH1 5DN1A 1GKBA 1T5AA 5EB8A 2HVMA 1J84A 2HS8A 3OZOA 4V27A 3O1RA 4KESA 5F6KA 3PMEA 2QF7A 4W84A 1QR7A 3B8DA 1ML1A 4XWUA 3OQ8A 4AF0A 3AMCA 2FZ9A 1XD0A 1C8M2 1DKWA 2YGLA 1BAGA 4H8UA 4PUUA 4MZUA 3H0OA 2INEA 5LNUA 1LZOA 3LTSA 2PSNA 2ZZ4A 5KSWA 2BUKA 2V2DA 2YA1A 4OHYA 4XETA 3PNZA 4AY7A 1HDKA 3NSNA 1ADOA 2ZGUA 2G3JA 2HWC2 4CEXC 1XYPA 1ICPA 4FOVA 1KV8A 3I59B 3KBJA 5E9XA 1ZZ7A 3AXXA 5I77A 4IL2A 4XIKA 3J7NA 1KFKA 3BQ5A 1LLZA 1JVNA 1RUC2 1CLXA 1ZENA 3H12A 3GY1A 4U5IA 5FPLA 4HD5A 2BASA 3WG1A 4GD4A 5HV4A 4D8ZA 5CGMA 4NOTA 3VGEA 2W39A 2XH2A 3IT8A 4Z92B 5DY2A 2E25A 1KM0A 1POKA 4IEWA 4CUAA 1K8CA 1JRBA 4FO4A 2XUEA 1ZY9A 2R6QA 4XUQA 4H6RA 3OLGA 3ACIA 2NQLA 5F1VA 4LANA 3LXBA 1IQAA 1DJYA 1EJRC 2EHHA 3VX0A 4NIGA 1R3WA 2XDVA 1OIFA 2Q8LA 1TB3A 4U3AA 2YL6A 4MOZA 3AMGA 1UR8A 3NRUA 2YCKX 2F38A 3CB3A 3M3IA 3LD5A 1QQP3 5I07A 3POJA 2DH2A 4GH3A 5DUWA 3FGCA 3P93A 2YCEA 2WCGA 1OF4A 1UA3A 2QQNA 1CDGA 2DUQA 1H62A 2VENA 3CQ0A 3MIHA 1HJVA 3N4MA 5BW6A 3MF6A 3MI8A 1JYWA 5FR3A 5BNOB 3E0FA 4O1EA 3Q8BA 4I8DA 4CN6A 1H49A 2R6OA 2FB2A 2J7BA 3BUCA 4Q8PA 3IGXA 2V5DA 5AB3A 4IQDA 4ARXA 1GZWA 3W01A 4EIVA 4C6KA 4HU8A 1TMF3 1XC4A 1NDWA 4F79A 3RHGA 1XLMA 3OVQA 2WFF2 3PWIA 2WNQA 3H3UA 1VMHA 1MQQA 1FRBA 3HAGA 3AL5A 5K9CA 4AEDB 5T3NA 3LSBA 4CPBD 2Z2SB 4K8RB 2A3LA 1CT5A 2PMQA 3WQCA 1HIXA 2BOJA 1QNWA 4PBEA 3TA9A 2A73B 1KEXA 4AZIA 1PHWA 4RDVA 9XIMA 4LSBA 3UP8A 1UYXA 1VBD1 2KAUC 2PHXA 1AMKA 2Z2AA 1E5RA 4IV1A 3WCRA 4GISA 4L8QA 1EP2A 4D6RA 1H1YA 1IQDC 5DZGA 3JB8A 1YKWA 2F61A 1BBT3 3PIJA 3D46A 3H50A 3R4UA 1RHI2 3QR0A 4R27A 3POEA 4Q27A 2DZUA 4J9JA 2W5FA 1P5BA 3P3BA 1QFEA 4O0ZA 5HBFA 2I74A 1P7TB 5D2TA 1DG6A 1Y43B 3Q67A 2QBXA 2VDGA 4OUSA 3VIOA 2WZPP 2EALA 4UC5A 3KQ4B 1A47A 2OEKA 3T07A 5EV7A 1CVNA 2XVKA 2HYXA 5G1MA 1LR5A 2GC3A 3PR2A 3ZXEA 3BOFA 4NZ4A 5FY8A 3LK6A 1NFBA 3WELA 1A8DA 3PHAA 3ETQA 3ZN6B 2ZWZA 3N4FA 1PWMA 1JD9A 1W5NA 3ZLHA 4XBJA 2A1YA 4OI1A 2BGOA 5AC92 2V5JA 3FHQA 2XN1A 4RFT0 4CNUA 3FA4A 2ZDSA 5JR7B 1WE5A 4LUMA 5EYXA 3O1VA 1BTMA 1E72M 1Y7BA 1PVC3 4HU0A 3EMRA 3LB0A 1ENRA 4U2AA 4XO7A 1C92A 2XOMA 1KFJA 5CXPA 1A5AA 3BK0A 3VHOA 2W68A 3IRDA 1EWDA 1WOAA 4UR8A 3UNPA 2C16A 1VCVA 4U10A 3B8VA 1F8IA 2I9EA 3TJXA 4Q0VA 4XJ8A 1JGMA 1W91A 3OTRA 3RYKA 4WVWA 2ZHMA 3LHVA 4C5YA 4QPGC 4RQPB 3TFCA 4P5YA 4NN0A 5KHHA 2XJVA 1RINA 3LPFA 3BAWA 2WA4A 1OCJA 4XACA 1AJ0A 1W05A 1XRSA 2I14A 4XXAA 2DTWA 3IV8A 4AGGA 3WLNA 3TXVA 4Y1ZA 2PBOA 3IWPA 3CNAA 2VEPA 3H7UA 2CYFA 2HWB2 4A3QA 1O7AA 3QV6A 4RKAA 4UTJA 4LO6B 3TW9A 3MZHA 2KXLA 5H2ZA 3CAVA 1T0OA 3CDZB 2JG9A 2QCMA 3J8F2 5CZTA 1F74A 5DO8A 1CPUA 3KFTA 5D2WA 2W79A 2VVEA 4K8EA 1YXDA 3XIMA 1LJ7A 3U14A 1LQAA 3H26A 4DXZA 4UFLA 4LNCA 3O1OA 2TRSA 1W6NA 1A34A 3THQA 4BXFA 2EKGA 2WXDM 4QSHA 2PDBA 5CKNA 1ENSA 3WD2A 2QUTA 4Y22B 4TWTA 1QJZA 2W92A 4XBLA 5E6YA 2QE3A 3LSDA 3MFAA 1NEYA 4IE6A 1NFPA 2F8QA 3PWAA 3GVGA 2HWD1 2YUEA 3STEA 3HQXA 1KM5A 3GW3A 3VKMA 4ZY9A 2UWCA 4XQ4A 2ET1A 3LHTA 4FALA 1POV0 4Y1XA 1EAH3 7XIMA 3LEKA 1FWAC 1V3MA 1TWZA 3FXGA 5CCZA 1OLMA 3NQBA 1QNSA 1HKJA 2QCGA 4QPIA 1H7XA 2CGNA 4WKHA 3SC7X 3FKKA 4AEMA 4NE9A 3VBUC 1ZPTA 2VMCA 1C9WA 1GG1A 1IZJA 4UOZA 4Z07A 1QPKA 3VOCA 4WZHA 1NOUA 2QQVA 4I9AA 4C6BA 4EK7A 4P9XA 3PZTA 3H8AA 3OY8A 2GUYA 3GW0A 4QQHA 3KV5A 1H2JA 3CS2A 3RPTA 3W53A 2ABAA 4PYSA 1OGBA 1CGWA 4JGZA 4BKNA 1QNRA 2DZSA 4UXAA 4LGXA 9XIAA 4P02B 4Z2IA 4P5HA 1RA5A 2VMIA 2VD7A 3LDVA 4HKWA 4A3RA 3IIVA 3KOWA 1GVIA 3VINA 4CEWA 3EOSA 3IJ8A 4XFFA 3ZFGB 3WUFA 1JOPA 3AFKA 1OF6A 1SZFA 2VNCA 4WM7A 2F4LA 7ENLA 1OX5A 5XIMA 2WZR2 4YU1A 2HROA 2WINB 4JFWA 5CFDB 2ZWYA 3IBMA 3ES8A 2KR2A 4BF5A 1CZVA 1UU5A 1QJU2 3W2LA 4EXQA 4FPCA 5BCAA 3TN93 2DJLA 3PUGA 1UWIA 3DGBA 2H8ZA 4DIQA 1DGRA 1H0GA 1JU4A 1AR62 2W0UA 4KBBA 4XJUA 1R6WA 1SFLA 4XFAA 3SZ8A 1WXZA 1UZ0A 2WSPA 2D3NA 3P82A 4W6XA 4GB31 1ONXA 2VW2A 3PLQA 1SO6A 3GFXA 1YFYA 3VB9A 1N55A 3S4TA 1RUI3 2P53A 3BMWA 3E6BA 1W9YA 5LBEA 1DVJA 2NWSA 4COUA 3TONA 4EROA 2YJQA 2ACQA 4JTGA 1MW2A 5CG0A 3BU7A 4JQ3A 2GMMA 4DXVA 2CDOA 3F95A 4NPLA 3A3HA 3ITTA 5HPCA 4J35A 3RJYA 1R1A2 3EX6A 1C3FA 3AUJA 2QCHA 3NKTA 4NZ1A 1PO11 2XHYA 4LK6A 3RDIA 4N90A 3R4DB 1OHFA 3S5NA 5DDJ2 1W3KA 1NAEA 2ZRYA 1DF0A 4ZB5A 3ZSKA 2OSXA 1LBFA 1NM9A 2XQXA 5EU9A 1OBAA 2PFHA 2OXNA 3DFQA 1XPGA 2A2IA 5IM51 5E6HA 1B9ZA 5D9OA 4Y9PA 4FNUA 4NRSA 3VGGA 4CVWA 3R4SA 1BVWA 5A2AA 4XDOA 2WDBA 4OU1A 1I2OA 2NYYA 4DHGA 1SG3A 3ZYJB 3KV9A 3P84A 5BU9A 1I3HA 1RXFA 3L2HA 3LV6A 4NNAA 4DJFA 3NV3A 1ADSA 3SKJE 5FZ7A 3C8NA 3HQNA 4HIBA 1CI1A 3KVJA 1U2YA 1DXFA 4IQPA 2DVTA 3W6MA 1Y3TA 4CEYB 2DVFA 3GTIA 3Q2DA 4Z0SA 2B9VA 3KF5A 3SR7A 3S42A 4KWSA 4QX0A 4RE3A 3LPOA 1XB9A 3UWYA 3AJXA 4IISA 5E16A 1PUDA 3ITGA 3S5OA 3RCNA 4H8HA 2VZSA 4YZ5A 4MH0E 1W8OA 3IS4A 2H6BA 2IXJA 3PZUA 2FTPA 1ZU8A 1UWWA 1F2JA 3W71A 3L65A 5C5YA 1S1AA 2E9BA 4QGCA 3S57A 3CQOA 1R092 1HRV1 1O4YA 2V5YA 4N9IA 5D9PA 4H19A 1HKKA 4CU6A 2JICA 3M5ZA 3IDEA 4IP5A 6XIAA 1E6NA 4YYFA 2PELA 2OGJA 5L6UA 2HWE1 1ISVA 3IUDA 2XKPA 3F4WA 2NVDA 1UYQA 3AMHA 4GH1A 3VNZA 4M3CE 1ZZMA 2DDXA 3FA3A 4L5ZA 2J27A 3MHGA 3ZT7A 2O8QA 3SSZA 4META 4XFHA 4EP8C 5J98B 4Q8LA 2E7AA 5I79A 4HZMA 2R8WA 4GYFA 3BI3A 4MWAB 1W39A 1W31A 3W83A 3KVLA 2WC2A 3P3PA 1E1EA 4TMBA 3EXRA 2KX9A 3WH8A 3VZLA 4CQAA 1TVLA 1D2KA 4K20A 1UR0A 2NSXA 1ZZ6A 1WD4A 3ZPYA 3THTA 3IIOA 1JBCA 3RI8A 4A3ZA 3HZ3A 1E9IA 1GWJA 4XHXA 5CZSA 4QEHA 3FSTA 2P6HA 4LEJA 3M16A 4ROPA 5D2YA 2VKZG 2I5QA 3LCIA 5DANA 4Y8FA 1MEHA 4FOWA 1FI2A 4GX8A 3OGRA 4HPKA 3VHNA 4NVPA 2OPWA 1XYMA 5HMSA 4JGYC 2ZHLA 1VBD3 4L1WA 5KZDA 1DLLA 3VE7A 1J6OA 1WMDA 4DLFA 5DAQA 1Q8PA 3QYSA 3VIMA 9CGTA 2BWGA 5TQLA 3NL6A 1US3A 4HNTA 4KEVA 1PDZA 2YXSA 1RSCA 1FX6A 4WKAA 4KS0A 4YYCA 2ZRUA 3BAYA 5HDRA 3EZ4A 3S2JA 4B2DA 5BXTA 3FUOA 1V3LA 3UZZA 5LIWX 2P0OA 2QJIA 2RMU3 2NXHA 5GZFA 4M51A 1CAWB 2JKXA 2V67A 3HIJA 3WJYA 4E2VA 3AJYA 4IV3C 1M9HA 3MV01 2CBVA 3ZS4A 2W08A 2JD9A 2BTMA 3WF3A 1P0KA 3E3HA 5BNPC 3SCTA 2RJ2A 2YFNA 3H6OA 1FAYA 3K4DA 3URQA 3PUSA 5FYMA 4PR4A 1S2BA 5D03A 5FJOA 2C0ZA 3AXEA 4MM1A 1E4NA 1TVPA 1ZBKA 3ELFA 1Q8OA 1J93A 1LU2A 3LCGA 1SFYA 1YXCA 4IQJA 3SB0A 4AZCA 5J5DA 1HLCA 2QUOA 3SCFA 3AYCA 5KXCA 1LLOA 1RTVA 3AFGA 4YGBA 1H41A 5A3HA 2ASHA 4O9EA 3VCRA 4IIEA 2Z4FA 5LY2A 4BYYA 1CXLA 1WOBA 4HVXA 1H9PA 3MYXA 4CCNA 3S5ZA 4BCUA 3K4AA 1L2UA 4ITCA 3FFSA 1KLYA 4Y20A 4ZQRA 2PDWA 4DI9A 2DVBA 2B31A 4HCHA 5T9BG 4DO4A 4MIMA 3SCQA 1HJWA 2FTYA 4UBPC 4RZ6A 4XILA 2RS11 3ZSEA 1LB2A 1NY1A 3WBAA 4H01A 1O68A 2J8GA 3C2OA 3V75A 2EPKX 1V3KA 1AQHA 4GQ7A 4F2BA 2Y33A 3GG7A 1W6OB 4LV4A 1RVF1 2J22A 1QQP2 3A5VA 3WDUA 3QV9A 4NRMA 3AU2A 4BIOA 3SGZA 3ZLGA 3N14A 4B8EA 5FEXA 1U1HA 4GBUA 1XRVA 3W73A 2VAUA 3ID7A 3ITVA 4LUYA 3PTKA 1ULEA 1NH6A 1RUE3 3UJSA 2YIHA 3PL0A 4WRHA 3BMVA 2WA3A 1AD1A 1OYBA 1E6ZA 3TTYA 4FXSA 3N11A 1M68A 4GIEA 1WDSA 3GNEA 3ZWTA 2JDZA 4JD4A 4W85A 2DGAA 1V5XA 3AI0A 4PB4A 1OT5A 4UFIA 3HB9A 3UXIA 4YS1A 3OZYA 4Z1YA 1R3YA 1MUCA 1ONWA 4Y8EA 1RUD3 1GW1A 3KLLA 3FVDA 2GDUA 2F84A 3FAXA 4FFIA 2UYAA 2YLLA 4IMAA 3MJYA 2GGJA 4FPLA 2W1WA 2QF8A 3N29A 4GI9A 3QYQA 4NT0A 4RZ4A 1V51A 3E5XA 2ZX9A 3ITCA 3M0ZA 3MA8A 2X5IB 4GMP0 3N73A 4NROA 2HWD3 4BPZA 4GUHA 1NELA 2HCVA 3U11A 2WC4A 4CDUA 5FZ4A 3Q58A 5AYXA 4C6OA 3EX1A 2GFTA 1VR6A 5FF0A 2VVSA 4URAA 4P00B 4JHMA 2ADDA 2WAAA 4Q4W3 1KTBA 4BDVB 3EKZA 4YTRA 1QJFA 3BE7A 4DRSA 2XJSA 2Q4SA 3PSWA 4QDWA 4WSKA 2ZA3A 1ZCOA 1SMAA 4EV0A 4C6PA 2YC2A 3OYXA 3RJ2X 3SRFA 3GX9A 1UUOA 3OW1A 3DBPA 4LO7A 3QR1A 3EMQA 3BZGA 4ET7A 3MMDA 2TEPA 3CJPA 2LM3A 3HJRA 3RCYA 2R073 3LXCA 4QJ3B 4XXPA 3NUKA 3TYZA 3WLJA 2XPKA 2D6KA 5EMYA 2L9LA 4HT1T 5EYWA 1XNKA 4RW5A 4AY8A 5A7PA 4CCKA 4IGMA 1UWTA 4MJ4A 5HXVA 1Q6FA 4FO9A 4RDZA 4CUGA 3UW6A 2FQPA 4HKPA 1UOFA 2XLGA 5I3HA 3BTAA 3HVDA 3VIHA 5ABJC 1CIWA 1C1LA 4MXVA 1ZRFA 1LWHA 2WNVA 3H2AA 1XINA 4CNOA 1ZCCA 2ZHKA 1Z44A