4UFLA

Mouse galactocerebrosidase complexed with deoxy-galacto-noeurostegine dgn
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
644
structure length
641
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GALACTOCEREBROSIDASE
publication title Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 216
structure length 641
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4uflA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4uflA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uflA01
3M5VA 7A3HA 2WO5A 1ISYA 2YPIA 1G7UA 4UNLA 3LI0A 1C8VA 4AMAA 1MQRA 4W85A 3T0AA 1FXQA 3ABRA 5D32A 4FB7A 3AYRA 4JKKA 4NUWA 4GUFA 4LUJA 2XUCA 1V3IA 1FH8A 1A5CA 1XC6A 2CNCA 2AC1A 4PMUA 4UOQA 3S5QA 2E9BA 3U7VA 3OSDA 2QPSA 3BG5A 5DLCA 4NJGA 1DORA 4FHAA 2VKZG 5A8GA 3RF9A 3PZUA 1FX6A 4ATDA 5C8BB 1KFBA 1S46A 2X2GA 3OBAA 1JYWA 2BS9A 1WOAA 1GQKA 3MSGA 3VCRA 3ZFHA 4D6EA 4QSHA 3CTTA 1UKSA 3BCDA 1RD5A 1AQHA 3VD4A 3NQ2A 2J77A 4O54A 1C8QA 3B9AA 2VNCA 2V82A 2ADEA 4W89A 2OZ0A 4CQAA 3EXRA 2GVLA 1I75A 2V2DA 1QBAA 4GUIA 1I2QA 3SCNA 2Y8VA 1A50A 4GJ1A 1IT0A 1ODZA 4J3TA 5DXYA 4NRRA 5BYWA 4W84A 1JFXA 1JUBA 3LLFA 1YTEA 2ZX6A 4GIAA 1AQMA 1F7BA 3R5EA 3G1SA 4O19A 2XSAA 3T2PA 1OFPA 4AYSA 1Q6GA 1EUNA 1HL2A 1VQTA 5IXEA 5HUPA 5G4WA 5AC6A 2RHGA 4LWWA 1VJSA 1BWKA 4DPQA 2WKGA 1GG1A 2NLIA 1A5BA 2A4AA 2OLHA 4GQRA 4LVAA 4EE9A 3W74A 1YQ2A 3AZTA 2AGKA 3RMJA 2FHFA 1SU5A 5AC5A 4UTMA 2VRKA 1Q6RA 3O6CA 4XZWA 2X1RA 1TCDA 3TQVA 2ZX7A 1EP3A 5FD0A 4WIWA 1KXTA 3UWYA 4OGZA 4D6GA 5K9CA 3HB9A 1ML1A 1SMAA 3EX6A 4IWWA 3WF1A 1H1ZA 1XCWA 1MZHA 1R85A 2QEZA 3PBGA 1X1OA 4QAWA 3TC7A 2WKJA 3SSJA 2V3GA 1G4EA 4JCLA 2VFEA 3ZS4A 1LG2A 4RCXA 3WDIA 2GJNA 1OJXA 1V6VA 3A9IA 4Q33A 1X6UA 2CPUA 4JYFA 2XG9A 2YL5A 3G0XA 1XBXA 4AF0B 4OBRA 1B9ZA 3N9SA 4QAIA 3NQAA 1BYBA 1K3UA 3W2KA 5LSMA 2G3MA 5DO8A 3BCFA 4IMEA 4MY9A 4N9CA 3RJYA 3RILA 3TSBA 3BAWA 1SZGA 4N4PA 1E4IA 3GM8A 4K68A 1XBYA 4AW7A 3TE9A 5LGXA 1UHVA 1N55A 3AXXA 3O15A 3TX9A 3W0KA 4ICNA 5A6SA 3G1FA 3QEZA 2G3JA 5HPCA 3HBKA 4RE3A 1V08A 5GNYA 5D9MA 3KAOA 2WCAA 1PCKA 1X6LA 4Z0JA 4D6CA 7CGTA 2JEPA 3ABQA 2W79A 1BGGA 4MLRA 2EKCA 3HPSA 2GK1A 3MANA 1TE1A 1NFBA 2CYGA 1TTQA 2VQUA 5K2ZA 1HN1A 1MW0A 3OZOA 4M1RA 4ACYA 1LTDA 4CN6A 1C9DA 2EPHA 3ATZA 4PCSA 3F5JA 3F5KA 2VQTA 1W1YA 1PIIA 4W93A 1XDLA 1KFKA 1SZNA 2E68A 3BG3A 3OA5A 3W37A 4UTFA 3CMGA 3W83A 3DGRA 2I9EA 1EP2A 1T96A 2QF7A 3VDHA 2NV2A 3WENA 5FKBA 4QLKA 4B1MA 1E4MM 2Q3OA 5CXPA 4AD5A 4YN5A 5AHEA 3VUPA 3NSNA 1H50A 2BNJA 2DP3A 3LLDA 1EDGA 3N2XA 1P6WA 2VURA 4L4OA 1ZU8A 3WQVA 1TFVA 4M82A 1TG7A 2O7SA 1JG9A 3WNMA 3IJ7A 1HFBA 1FFQA 1W56A 2V9DA 3T4CA 1TREA 3DYMA 1E4LA 1E6QM 3W81A 2CZ5A 3WDHA 4KH2A 2VTFA 3W86A 1XXXA 4Y9AA 3DI1A 1FCVA 1E0XA 2ZWZA 4GRSA 1W5PA 3VD7A 3TV8A 4O11A 2YA0A 1LQ0A 1SFLA 3GR8A 1KGWA 1XV8A 4HMDA 4UCFA 3WD1A 3ARWA 3O07A 1EDTA 2W0UA 4RL3A 5D38A 2C3ZA 1OT2A 1H2JA 5IBXC 2JGQA 3AO0A 1DHKA 4YMZA 2WJZA 4MB1A 1XH2A 4O1CA 2JKEA 4N9DA 2G41A 2TAAA 5I77A 3TW6A 1LF1A 1LL4A 4DF0A 2CLFA 3W23A 1J0HA 3CUIA 1KGUA 1VHNA 4YL2A 1UWRA 2AEYA 3BARA 1WAWA 2A21A 4MPQA 3ZQ9A 1XUZA 3OG2A 4DEFA 4Z1BA 1CTNA 3L67A 3WN6A 1G94A 3VPLA 1YXCA 1J11A 4M81A 2NV1A 2WBGA 3KXQA 1F73A 3CZ8A 4JHOA 1L9WA 3PULA 3LCWA 4O4WA 1CPUA 1CXFA 1KFLA 1ZFJA 3VMOA 5KTLA 1Z44A 4XTDA 3Q58A 1TA3A 4P7QA 1JZ3A 4Z0SA 1OX4A 2ZX5A 3WK2A 1KW1A 4O12A 1JCLA 4WY0B 3MHFA 1O95A 3O63A 4EF9A 1B2YA 5TQLA 4K8EA 1H09A 1NSJA 3SI9A 2CZEA 5C70A 1V02A 1PV8A 1J10A 4AZZA 3IGXA 1GHRA 4CU7A 2DT2A 4J3XA 4UMBA 4D1IA 1QPOA 1U83A 1RQHA 2C13A 4OWGA 4UTLA 4X3ZA 1UWIA 5EBAA 1W2TA 1W3HA 1I1WA 4PMRA 4PH6A 3NO5A 1FP9A 1UD2A 3W7JA 5A8NA 1CXIA 3SFKA 1JXKA 5ABFA 4AEFA 4C1LA 3F5LA 2CERA 2ZZ7A 5TBOA 3HJEA 4AZGA 1R86A 5CLTA 5D9NA 5A8QA 3TTOA 1P1XA 3BMWA 3PC0A 4JY9A 2EJ1A 3TA6A 5KZ6A 3NQVA 1M7XA 4NZJA 2RDUA 1YYAA 2VJXA 4YHGA 4UFLA 2DSWA 3WD3A 4IM4A 3W1XA 4EQVA 1JULA 5J5RA 1ST8A 4LV9A 3SC7X 4OUEA 4CLMA 4UNKA 3WD4A 1HVXA 1V6WA 3OA3A 3G0SA 1QNPA 2VRJA 2YIHA 2BZNA 3TUUA 1XYZA 3BGAA 2DORA 2GJLA 4LVGA 1OGGA 3T08A 1EA9C 1ITXA 5FKCA 5CSSA 4H8VA 5CPTA 1ZAJA 3VX1A 1GTHA 3UETA 2FPTA 2WPGA 4NRSA 2YGYA 4HKPA 1TMQA 3WDQA 3VO0A 2ZXAA 1AQ0A 5CPOA 1CECA 1C3FA 3TTQA 1GHSA 4DELA 2X2YA 1G0CA 2V3DA 2A85A 1TQXA 3W27A 4N02A 2FTPA 2ZX9A 4LNYA 3DHDA 1WDSA 1IXNA 1CW2A 1CX9A 3E0IA 4B16A 2YL9A 3SECA 2BVYA 1JDDA 3IIXA 2CHNA 1NWTA 1HO4A 2FHCA 4MTVA 3EBVA 3MBDA 3POCA 4Z1AA 4PMQA 4JL2A 4M24A 1FDZA 2FHBA 2PB1A 2VVNA 4Z2HA 2OWWA 2D0FA 5I3DA 3KZSA 3BW4A 4O0ZA 5FEWA 1M04A 3G8EA 4TX9A 4LY8A 4RR4A 4NX5A 4RZ4A 5AHLA 1ESWA 2P10A 3CIVA 8A3HA 1FWRA 1PBGA 5FL1A 5EFDA 2E6DA 1FY6A 4MKNA 4JFTA 2I14A 3ZSSA 1GG0A 4OKDA 4V27A 3WJXA 2CBJA 3S9YA 4FF5A 3UXAA 4U31A 3UY8A 1XSJA 2ATMA 2ISSA 2X09A 3WNNA 3WBEA 1K9FA 3GAYA 2J7EA 3AJ7A 3BMVA 1TPWA 3CT7A 3SUSA 5F2IA 4AZ7A 2B7QA 3AQUA 4LRSA 4MY8A 3PTMA 2F2HA 1V5XA 1HKKA 2WXDM 3FXYA 3UQNA 2J7HA 1LG1A 1XC4A 3WEMA 1W5QA 3N9KA 4U5KA 2ZIDA 3RM8A 1EO7A 3W85A 4NT0A 4HPXA 1HIZA 1QVBA 2Y4SA 4ZXOA 1FWSA 3LRMA 4J7RA 4AD4A 1VIWA 1UOKA 3QR3A 4RE2A 2XVNA 4A3HA 3EDEA 4A4AA 3GNDA 4AIUA 1Q3NA 4E0CA 4BF7A 3L2MA 5LGZA 4MJZA 4WY0A 5FEXA 3TQKA 4CCCA 2ZA1A 2J74A 2A7PA 4LYPA 4Q32A 3OGRA 3SCUA 1E55A 3PY2A 1UWQA 1A5SA 5C6MA 2DEPA 3CO4A 4JHZA 2D3LA 4QP0A 3TA9A 2E8ZA 4TMCA 3O16A 1JCJA 2Y89A 3NA8A 3P61A 4UQAA 3O1NA 1UA7A 1J0ZA 4LYRA 1L6SA 4U3AA 3PM6A 1H1YA 1NWSA 3MUXA 1SSDA 2Y7EA 3CWNA 4K36A 1ODUA 3BSHA 2BXZA 3GDRA 1DQWA 3AROA 3D5HA 4N4QA 3ALFA 4BWLC 1ISWA 3CBWA 4P7RA 2VEPA 2XGIA 4XZ9A 2C15A 3AIWA 3BLKA 1E0WA 1JCNA 1V02E 2FB2A 3WDRA 1UJPA 3LIGA 3SCRA 2V5DA 2AAMA 3N9RA 4O8RA 1CLXA 1PZ3A 3ABSA 4AZBA 1BAGA 1EB3A 3P62A 1LBMA 2QCFA 2GUYA 2XPKA 3NPXA 3VNZA 3ZR5A 4WOQA 1GVOA 1W32A 4EKJA 4DPPA 4PL2A 2GUUA 2BHUA 1DQXA 3O2LA 2OYMA 4PMYA 5G2HA 2RGLA 3KVLA 1G9HA 2NXIA 3IEBA 1MFVA 3CPUA 1JFHA 3GDLA 1MQQA 2UWFA 3NYDA 2CLIA 3WUGA 4W9TA 4XZBA 1J2WA 2QQWA 1OFEA 4A3YA 2ZXQA 4TX6A 2CWNA 2WPBA 2OWCA 2WNZA 3TFXA 2X30A 2J6XA 1XYFA 4Z2JA 4IPJA 5F1VA 4FNTA 4FXRA 3GKAA 3WUFA 2WANA 2WMHA 1W5NA 2G97A 1CGTA 4B9ZA 4O52A 2A7RA 1HKJA 3JS3A 1MWOA 1QI2A 2O9PA 3GLCA 1QW9A 2XVPA 3CZLA 3IANA 3I3EA 2RFGA 3TW7A 3L4WA 4JFUA 4PUDA 2DGAA 3VU2A 3GB6A 1ZALA 3UZJA 1YHTA 3MI3A 2OMAA 2VT0A 2ZDRA 3LHVA 3DI0A 4EWND 3PZIA 5FF7A 1A5AA 3QC3A 2DDXA 4HOZA 2HMCA 2VX4A 1QFEA 1CI1A 3GVGA 5TIMA 4D72A 3P7YA 4YWIA 2DZPA 2ZRXA 3G1AA 3M07A 4UMAA 1C7SA 1AL8A 1XGZA 4NJKA 3CHDA 3VDCA 3I7RA 3C2VA 4PFMA 3N14A 3CM4A 1F05A 3EX2A 3UYCA 4E8CA 1W3KA 1NOUA 2VX5A 2BY2A 5G4EA 5GVJA 1G4TA 3EWXA 4WUIA 2H3BA 3NYZA 5CPMA 1HJUA 1KCKA 4H04A 2DZUA 4MDOA 5I3IA 3W82A 1QPQA 2CU0A 1ZBWA 4D2JA 2A6NA 3GIYA 3CQ0A 4H4IA 2W63A 3WDPP 4HT3A 5K9DA 2F84A 3WNLA 3NSXA 2YR1A 3LCHA 1SW7A 2V0TA 3C2OA 3RIKA 3PIJA 4ACZB 5E9AA 1R2RA 1BHGA 4P7LA 4WSKA 4LT9A 1TIMA 3P81A 1H49A 3DHPA 3HU7A 2GOUA 4E2OA 1UR8A 2H3DA 4GNJA 4Y96A 3STGA 1DL3A 4AEEA 4U2YA 3NQGA 5I24A 2A1YA 3DENA 3PIGA 1G4SA 3PUEA 3AIEA 3NUKA 2E3ZA 4LQ1A 1F76A 1RV8A 3N11A 2XN0A 3LTSA 3NDYA 1I2NA 5C71A 2QCNA 3P67A 2VFFA 1SZFA 1PX4A 4GWEA 1Q4NX 1D9EA 1LDCA 4IMFA 3L66A 4UNIA 2FGZA 2JALA 5A6BD 3TSMA 3LCIA 4IX2A 1EPXA 2OT0A 3W87A 2W66A 4AIOA 3BH4A 3WFZA 5A8PA 1W3IA 4Z2GA 3GKFA 4UOZA 3VIMA 3TQ0A 1OSEA 3ARTA 1UCWA 4NXKA 2WHKA 2J7GA 3ECQA 4MZ1A 1K7FA 3TCEA 3SJ3A 4KFOA 2DT1A 4JTTA 3QPZA 3G3DA 2O7QA 1IZJA 1O5XA 4W7UA 1J0YA 1ONRA 1OF6A 1C92A 2C14A 4IPNB 1JQXA 1Q6CA 1ZY9A 1NWRA 2GDUA 1C8XA 1TUXA 4MFDA 2CXGA 1OX5A 1JCYA 1ZJBA 1P0KA 4R27A 4LUIA 3PB0A 5D33A 4MJ2A 3WNKA 3N2MA 1US3A 5BRPA 2G5WA 1UUOA 1UQZA 3CUHA 4HA1A 3CUGA 5AOUA 1C8YA 1E15A 4XWUA 5AYZA 2V5LA 1T99A 2WLZA 5AYIA 1JZ4A 3W24A 2J9XA 4IPLA 3DFNA 3BLFA 2BV9A 1UR9A 2G3IA 3I68A 1XD1A 4QFUA 1GOIA 2D0HA 1MO0A 3WK0A 1DV7A 3L21A 3G6MA 2GFTA 5CSYA 4AZ6A 2QUTA 1VHCA 3IV3A 3OIHA 1LOLA 1TO3A 3AMCA 4XB3A 1EHNA 1I2RA 2CKRA 3EXSA 3EXTA 1VJZA 4PBGA 1EEPA 4QNWA 3MMUA 2CBIA 1K03A 4P7OA 3NQ6A 1TV8A 1VLWA 3LHUA 3FHAA 4GO8A 2WQPA 2ABAA 3W2NA 4O13A 1EH9A 1JF5A 1W9BM 5A2CA 4BI7A 1WX0A 1O5KA 4YLWA 2VFDA 1O4UA 1OIFA 3N3MA 1KCLA 3TR2A 1ME9A 3CHEA 3NQMA 2VZSA 3F4NA 1JF6A 2AAAA 2QQUA 3HG4A 4R7JA 1S3HA 4GQQA 3L4YA 3QF0A 3B0UX 4J27A 3W7GA 4ADTA 2ZA3A 1IF2A 4FNSA 1L8NA 4P8WA 4R53A 2WNWA 3MHGA 2A2IA 4HPJA 4AZCB 2YFNA 5ABEA 2JF7A 3G18A 2QCLA 3P5ZA 5TD4A 1HTIA 4JN6A 4XQ6A 4UTUA 1LRTA 1Y9GA 1CZ1A 2G4FA 4AD1A 4PODA 3R89A 1HX0A 1PX3A 4MIMA 3WBAA 4JDBA 2XYLA 4NJJA 4MNMA 4ACZA 5FOOA 4BK9A 1OHLA 1W0MA 4UTJA 2Z1KA 1GQLA 3SW6A 1UWTA 5HQEA 5AY7A 1LRNA 2CZFA 2FFCA 2QF8A 3MP4A 3INPA 1ZB5A 1PIFA 3S2CA 3BLPX 3TNOA 2TRSA 4HZ6A 3QHNA 1GPWA 2HTMA 4PTXA 3UESA 3BVJA 3L2IA 4U2ZA 2X0YA 2E8YA 3ZIZA 2OJPA 3WSUA 2NX1A 4QCFA 4FFGA 2V81A 4AHPA 2YBTA 4NVTA 4HMEA 4CVUA 2ZRVA 5M03A 3ZWSA 1E0VA 2DJXA 3VIGA 3EX3A 3U2OA 3VINA 2D73A 2J7FA 4PC8A 5G2WA 2O9TA 3W1PA 3M44A 2ZE0A 4PSPA 5LA1A 1CXEA 2Y63A 1PCWA 2CKSA 3HF3A 4MNLA 3CHFA 3IGSA 3LMYA 3OG3A 4X9SA 3PWAA 2WCGA 5LA2A 3KX6A 4ZZ9A 3VKKA 5FCZA 4JYEA 1B90A 1EXPA 3FY1A 3W7KA 1I4NA 1YXYA 3H54A 2ZZ2A 1QOQA 1XCXA 1OYCA 4OV4A 3B9DA 1AMKA 5CPLA 3RLUA 1GOOA 1XDMA 2H90A 1PZ2A 3STCA 3BAJA 5AYBA 2WSPA 1FXPA 3KOFA 1YADA 3ZWTA 1JI2A 3W7DA 4LVFA 2WMKA 1CIUA 3NAVA 1ZS2A 2X1TA 5A2AA 3VM7A 4HNUA 1E6RA 4JAWA 3GYEA 3A47A 2RKXA 2FQIA 2FGLA 1NOWA 1TQJA 3AXIA 1H5YA 4QISA 1G01A 2W4XA 1B57A 1TPDA 3LERA 5D2TA 3UWQA 2J8GA 3PZGA 2QCGA 1QOXA 4O1DA 3JR2A 3WMSA 1RPXA 3SY5A 5BMXA 2VFIA 1YDNA 4FXSA 2JFEX 4QJ1A 3U75A 3W2JA 1Y0EA 3A4AA 1XD0A 3YPIA 1TZ7A 4W5ZA 3GDMA 1DWJM 3WJWA 2E77A 4O1BA 2Y7FA 3W73A 1JZ6A 1VPXA 5AC7A 3VNDA 2XVKA 3AXHA 3ANYA 1GOKA 3WQWA 1R47A 4NZFA 4OIFA 4OV9A 4ORMA 3EWZA 1KGXA 4NI3A 1UR2A 3WD2A 4O57A 4FLSA 3DHFA 4DQWA 1DVJA 4IMDA 1HJVA 4S3JA 5EKYA 1W3NA 3DFSA 4K6AA 3I3DA 3TONA 3W1UA 2J75A 4UR9A 1HKMA 1QHPA 3KL3A 4N42A 3CEUA 1CXLA 5DBUA 4J3VA 3D3AA 3VGDA 4S2BA 1KM1A 2ATSA 4K7VA 4UTWC 1BKSA 3CEPA 4KWWA 1OIMA 4H3DA 3CUFA 5BXRA 3VGBA 2G96A 3B05A 3C56A 1ADOA 1VENA 3AIRA 3N13A 3M41A 3C4UA 3TOPA 3KRSA 1VFOA 3LGEA 2W6RA 4AZCA 1IV8A 3WQ5A 3WNOA 4IX0A 1BTMA 3U5YA 3A5FA 1GOXA 2KZHA 4FNPA 1CGUA 3KFTA 2DIJA 2V3FA 4JFVA 1EGZA 1CXKA 1EP1A 4FF7A 1EQPA 4W88A 1LROA 1J0JA 3CZEA 5JBDA 4JTGA 3J7HA 3I7QA 3O06A 4PMVA 4F9DA 1CGXA 5HPOA 5IFPA 2WM0A 4Z2IA 4U33A 2YA2A 4O1AA 3R8RA 1CEOA 1GW1A 3VMPA 5FMDA 5FEPA 5MHBA 3BAYA 3L0KA 3E9AA 3MUZ1 1ALDA 3CB8A 5BCAA 1MXDA 1VAHA 3DKLA 1RR2A 3PR2A 1D2KA 3I7SA 1WZKA 3NZRA 5SWUA 4WKFA 1K8XA 1KM3A 4IUOA 1JYVA 2A3BA 2A3CA 4ZQOA 2PWGA 2FIQA 4DM2A 3DZ1A 3W70A 1WDPA 1JNDA 3WY1A 5K9XA 4UMCA 3BSGA 4MAVA 1Q6DA 4MJ4A 5BXTA 1MEWA 4FIQA 4DBEA 3P60A 3OB8A 3SGUA 3W71A 1R46A 3ZJKA 2GQ8A 1V3MA 3MKKA 4HSOA 3AMLA 4PUEA 3SCVA 3NR0A 4QM1A 3M9YA 2ZUUA 3N17A 3VX0A 3LCXA 4OQVA 1NWUA 1C91A 1H41A 1VGAA 1E5NA 1UZ1A 2TPSA 3CTLA 2ZRZA 1TTPA 3RU6A 3KRZA 5I3KA 1E51A 1L0PA 4JTHA 1JL8A 4N6EA 4W8LA 4JYDA 2XM1A 4D6FA 4D6DA 1FUYA 3DFQA 3DYPA 1UD4A 3GDBA 1NVMA 4M6QA 5DY3A 1J9YA 4YHEA 1FQ0A 1UBSA 5CKSA 1PHQA 1JAEA 4PMZA 3II1A 2R14A 1VS1A 1HF6A 1H61A 4N9EA 3GK0A 1KQZA 3IJ9A 3W1AA 4ZENA 9CGTA 3NQFA 1LWHA 3S5OA 4RLIA 2BLEA 3ARVA 3ABOA 4TIMA 2B7PA 3B8DA 4X0VA 3S1WA 2XIIA 1L6YA 2Y2WA 3BGGA 4ZXLA 3W7LA 3DAQA 4W7VA 3KRUA 1ZBVA 3LFIA 4YCPA 4TTGA 1WZAA 5LA0A 3HG3A 2X0HA 5HNNA 2UY2A 4EANA 1HL9A 2QUVA 1R2TA 2AEZA 5LNSA 2UV8G 4MPKA 1JR1A 3PTQA 5LYRA 6A3HA 2A6LA 4LS1A 3AZRA 5LHFA 4LS2A 1OB0A 3RDKA 2IXUA 3W7CA 3CHCA 1QAPA 5D09A 3LXBA 3N1AA 5EMYA 3W38A 4MB4A 4PCFA 1FCUA 5BXSA 1RD6A 2WC3A 5DFAA 3UD6A 3G3MA 1H0IA 2V5CA 1US2A 1VYSX 1QPNA 1LLWA 1X6NA 1SFJA 2YL6A 2VX6A 2CIPA 1K8ZA 1HG3A 2ZWYA 3IJ8A 3K8KA 4BQ4A 1VBRA 4AD0A 3EWWA 4NX0A 1ZNNA 1VYRA 3DFOA 3UGHA 1UUQA 5HOSA 2GJXB 3NGJA 4Y6GA 3RLVA 4AH7A 5IHRA 2XSBA 3ZT5A 4JS3A 3ZR6A 3L4XA 3BC9A 4GO9A 3CZGA 3WNPA 1ICPA 1WV2A 3P74A 5AB3A 4EVZA 2HSAA 4U28A 1I45A 2XGBA 4MDPA 3VIFA 1UD6A 3BW3A 4OBSA 5H2ZA 4FK9A 2QAPA 3DXIA 1OCQA 1H63A 4ZVJA 4JCMA 5D8WA 2QCHA 2ZZ3A 2DH3A 5D8ZA 1X8FA 3QRHA 3VD9A 1XH0A 2HISA 1BWLA 1SO3A 3EWBX 4P2VA 1UZ4A 1WO2A 3CMJA 4Q4KA 3SURA 5CGQA 1OVDA 3SUUA 1DWAM 1A53A 4ZE4A 3EDKA 1WAUA 2Z2UA 1LOSA 1OK4A 3C2RA 3PSWA 4UR8A 2D2OA 2QAFA 4O0KA 3SCSA 1Q6OA 1ZAIA 1ZCOA 2XN1A 1OT1A 2D3NA 1M5WA 3WH6A 8TIMA 1M03A 3FN9A 4LVBA 3AHZA 1CGWA 3OBKA 1ICSA 1E70M 3PHAA 3NMBA 4ONVA 2G3NA 4AF0A 3GR7A 3WH5A 4QLJA 3MV01 4RZ5A 2W5FA 2DZXA 4KGLA 5LZLA 3AMDA 2NUXA 4MZ8A 4GXPA 3N04A 4IISA 3LCGA 5CG7A 3PVFA 2NUYA 1UD3A 2ZA2A 3WQ6A 1GVIA 3PZNA 2P1FA 3TAOA 1B0IA 1RQEA 3VMNA 1Y7VA 3LRLA 1J0IA 3N12A 4MB5A 4CGTA 1I2PA 2A3HA 4FLQA 2Z6JA 4WLCA 4AWTA 1H7OA 1IIGA 1VCGA 3WFAA 3AHVA 5IM51 1HJXA 3T40A 4UR7A 3LXCA 3BAIA 4QLLA 4A21A 2WWDA 3EDFA 4ORIA 3FOKA 3SGZA 2A0NA 1GUVA 4HU0A 4M80A 4FEZA 1V3JA 1JCMP 1ITCA 2Y6ZA 3G1HA 5I0DA 3JUGA 3N73A 3NQ8A 3TFCA 2OYLA 4IQLA 4CNNA 3M6YA 2PBOA 1TJPA 2FH6A 1OG0A 2TMDA 4DWSB 4U4MA 1TVPA 3AFBA 3NG3A 4LVDA 4AAJA 4DWSD 2CCRA 5F4XA 1L2UA 2Y62A 4IGHA 3SCWA 2PI6A 4PRWA 1O7AA 5A6KA 3TAKA 4GC4A 4NXSA 4CD4A 3RCNA 1NF7A 3M7SA 3S1XA 1V0LA 1K9DA 3L4TA 2AQWA 5EY5A 1E43A 3MYPA 4UTTC 3UG5A 2YDSA 4BQ2A 3BG9A 1H60A 3HMCA 2VI0A 3L5MA 3MS8A 3FHQA 5CGMA 1G6CA 1MYRA 1LORA 4HTYA 2NUWA 4DUXA 1KR1A 1V0NA 4ZQRA 2VOTA 4LU0A 1A3HA 3W25A 4H7VA 4UFHA 1W3LA 1B3VA 5JIPA 3G1YA 1NP2A 2CLOA 1V03A 2C0AA 5LHEA 1QI0A 2ZUWA 1AL7A 3LXAA 2QCMA 1SZEA 3EDDA 3K8LA 4H6KA 4MUZA 1KM0A 2RDWA 3EX1A 3O9NA 4AMCA 4HU8A 2V30A 3IGUA 3GTNA 4BFAA 2ZBTA 4ATWA 3M16A 4K37A 2FDSA 1VLIA 1TSIA 1MW1A 1HJSA 2C0HA 1KA9F 4UFMA 5LKYA 2WOQA 1RP8A 1XFBA 3AI0A 3F4VA 1BFNA 3QFEA 3NPUA 3SIZA 3G6LA 5LNWA 3PN8A 5D9PA 1MXSA 3AHYA 1QHOA 2CLHA 1U33A 7TIMA 1AVAA 3CH9A 1JYNA 3VNYA 1C90A 4GPNA 3IK2A 4KRUA 1JVNA 2C6QA 1OGSA 1PX8A 1H7XA 3GXPA 2OSXA 2ZTKA 4O50A 3W28A 3AISA 1MXGA 1HP5A 2ZUTA 4JTJA 1VRXA 1TJRA 1UD5A 5HDRA 5E70A 4JTFA 3TMLA 2UY4A 4Y7EA 1GOMA 2GVGA 4PMOA 3CLMA 4U3CA 4N6FA 2PWEA 4PYSA 1OK6A 3FS2A 2ZXBA 1W1VA 3HN3A 3VIIA 3S5YA 4P8VA 1F6PA 1KM6A 4WXYA 2OYKA 1UR4A 2Y85A 1E1EA 1OD0A 1V6UA 4Q22A 1GJWA 5DT7A 4UQDA 4URIA 3LRKA 1Z48A 5E6ZA 3TP4A 4HNVA 5FEZA 3B4UA 2XFWA 1M7OA 3HOJA 1KM4A 1VF8A 3GDTA 1G7VA 2J88A 3G1DA 1YTDA 4JX5A 2Q3RA 4FX6M 4KKXA 4MAZA 1LYXA 5F1UA 3W1QA 5KMYA 1E71M 2QKFA 4A2RA 4L4PA 3FKRA 4KRTA 4WOZA 1XRVA 2VEKA 5E93A 5A8OA 4M19A 4D6JA 2CLKA 2A5HA 2DZTA 3QSTA 4LPCA 1ZBKA 1D3HA 4EOUA 1HJQA 3VTRA 3WH8A 4TMBA 5I2UA 1GJUA 3BGJA 2HS6A 3W6YA 4ATLA 1QNVA 3IIVA 4WY0F 3GNOA 3WMCA 5BW6A 5D04C 3VIPA 1EIXA 5CPSA 2YLAA 3AZSA 3W7NA 3W6LA 2WCSA 4DF2A 1P4CA 2PC4A 1UB3A 2V2CA 3MHUA 4PEEA 2O9RA 1ZJAA 3VVGA 3FJ6A 1I2OA 1CNVA 5FF0A 3MJYA 4DWSA 4XBKA 3PAJA 1FP8A 1EQCA 4A2SA 3WUEA 5I3HA 1LL6A 4DBDA 1O94A 1QI5A 1PEZA 1FBAA 1B3YA 2NT0A 1H0GA 1H62A 2ZRWA 3HGRA 3W1LA 2J7CA 3LIHA 1WXJA 3NQ7A 3QMSA 1TRDA 5BMWA 5FMBA 2GQ9A 3QHOA 4GZJA 2GVJA 3SCTA 3DECA 2WZEA 4PMDA 2Z0IA 1ZL1A 1B4EA 3AIVA 1KFWA 2XN2A 3A4WA 3NQDA 1R30A 1E6NA 3CC1A 3NJ3A 3G24A 4TR9A 4F8XA 1GNXA 2DSKA 3KVKA 4YCOA 3MWAA 4OZOA 4POCA 2ZZ5A 5FIXA 1WPCA 1NH6A 1KV8A 1QWGA 2AMGA 3GH4A 1XBZA 1JQVA 2XVGA 1VC4A 1ME8A 1H1NA 1SW0A 1HXJA 4Q7NA 3THAA 3VI2A 2CITA 3MO4A 4FNQA 4B9YA 3EMZA 2ZX8A 2NW0A 5D02A 1B30A 3M5YA 2WC7A 3WF0A 4JXCA 3A6OA 2VRQA 4O17A 5L9FA 2Y88A 1SPQA 3FJLA 3M5ZA 2XFYA 5KSWA 5K4ZA 4J9JA 3Q37A 1WB0A 5DXXA 1BPLB 1V6YA 1SR9A 4JZ5A 3LTYA 3VE9A 2WZHA 2QJIA 2PWDA 2YDRA 3PUOA 1DEDA 3ZSTA 3O8AA 4KWVA 1KBIA 1PL9A 1LRQA 1KFCA 3NM3A 3PG9A 3A3HA 1GOWA 4IUGA 3TROA 2PWHA 5BRQA 1EDQA 1KV5A 3QSRA 1RP9A 3T55A 3W1NA 1XL9A 4AHQA 3A24A 4PCTA 3TTSA 1O60A 1LLOA 1GYNA 3AICA 1XBVA 1K7XA 3BV4A 2B4GA 1OX6A 3T44A 1XM3A 1Z42A 4OT7A 3R13A 3I3BA 3KE0A 5CZJA 1V3LA 3F03K 2VXNA 1W9UA 2E6YA 5CQ1A 4TTUA 2NXHA 3PBVA 1QR7A 4JTSA 4N2YA 5C54A 3AIBA 5DT5A 4XBSA 1W8SA 1M7PA 4GUHA 3N18A 1E40A 4ADUA 1JD9A 1GZJA 1OFBA 3VILA 3W4RA 1UR1A 3B0VC 4XKYB 1YPFA 1I8JA 1GYLA 1UASA 1SMDA 2J78A 3T2QA 3VGEA 2YA1A 3HPZA 4PTWA 3LPFA 4G1KA 4NJIA 1P0NA 1JJKA 4CU6A 2YOCA 4TO8A 1IIHA 4O53A 2B7OA 1XCFA 3WL1A 3CPRA 1UA3A 2ZRYA 4TUFA 1MQPA 4D6IA 2B7NA 3UWWA 3WQ8A 1KTBA 1KLZA 4GI6A 4ZQMA 4P7NA 3UG4A 3AS2A 1J4EA 2WBKA 5JIWA 1QOPA 3BAXA 1DHPA 5A69A 1OINA 3GZAA 4KFPA 1MVYA 4XUYA 2DSVA 6TIMA 3IIOA 4CVWA 3SCPA 3GNPA 3MYOA 3GXTA 5K4XA 1PPIA 2VCBA 1VCVA 2J27A 4XUGA 1G5AA 2WMJA 3VGGA 2PE4A 3CU2A 3M47A 4OU1A 3HBLA 2A3AA 2CBVA 2EPNA 4W7WA 3NOEA 1AG1O 3P8IA 5AHNA 3WDJA 3OLEA 5HULA 1N82A 4GZEA 5BXPA 2QJGA 4BQ3A 1JDAA 1LZOA 2BSLA 3W7OA 1BYCA 1U30A 1PS9A 3GYCA 3LPGA 4XTIA 5FI8A 2VZVA 2XQRA 2G95A 4WSJA 2YFOA 3L5AA 4FLRA 5E6YA 1FFRA 2W62A 2YJQA 3KHJA 5HUOA 1K9TA 4JFSA 1DOSA 5EYWA 3LDKA 3PSVA 1E6PA 5BRBA 4CD5A 2JEQA 3N19B 1FH7A 4AVFA 3LCFA 3LX9A 3W7QA 1R2SA 2JF6A 5E0KA 4JKLA 2XWEA 4JIQA 4HA3A 3VIJA 5K7JA 3BO9A 2JKPA 5HBFA 4CQ9A 3NL3A 3TSDA 3NCOA 3KF5A 4I7UA 3CUJA 1H11A 5CPQA 1OYBA 1TVNA 2C18A 4WJXA 3VGHA 1KXHA 2OT1A 2WK2A 1GOQA 5ABHA 2WW5A 1VB9A 1XSKA 3PZOA 4Z2LA 2YYTA 1S5WA 3ARSA 3UWUA 2DZSA 2EEXA 1Y4WA 4HNTA 1EWEA 1W91A 2DPEA 4UOJA 2NT1A 1HKIA 3UR8A 3PG8A 6CGTA 1I1XA 5LNVA 1JDCA 4I7WA 1ICQA 4F66A 4BZYA 4AD3A 1F4AA 3NIYA 3EB2A 3EWYA 2G8ZA 3TXZA 1F2JA 5K3VA 4B3KA 3PB2A 1F4HA 3SCQA 4UTHA 2ZICA 5AHIA 2VVSA 5I23A 3MO7A 1TR1A 2WMFA 2ZZ1A 4LGXA 2IXVA 1GVFA 1ISZA 1JNEA 2AOSA 1TTIA 3E96A 3PBYA 3NNTA 4E2DA 3ZT6A 1L6WA 2Z1BA 2VFGA 3WF2A 5BNKA 4FO4A 1W9XA 2WMIB 3STEA 4DO6A 2BY1A 1JRCA 3NL5A 2NXGA 1LP6A 1Z41A 4IOTA 1AW1A 3ARUA 3ZOAA 3RPMA 4A22A 4M6PA 4MZYA 4EIVA 1K6AA 3W1RA 3PZQA 2VCAA 3U7BA 4RK8A 1GWJA 1UH4A 4LXFA 3UERA 3VOCA 5IHSA 1JZ8A 3SUWA 4J3UA 4HNNA 1R7AA 4B15A 3LHZA 4P61A 1OABA 1AMYA 1THFD 3W1MA 1B3XA 1K9EA 1UKQA 4QCEA 3HPXA 3PBWA 3A23A 3KVJA 2C1HA 3LBCA 2JE8A 3I6RA 1ECEA 5CGTA 3VGFA 4XX6A 4O16A 2J62A 1KFJA 2UY3A 2YW3A 2FDMA 1VFMA 5FIPA 3IRDA 4XKYA 4P8UA 1W1TA 2VL4A 4MADA 4L4LA 3BLIA 1JZ5A 1V3HA 2VEIA 1G67A 3POHA 5JBFA 3PF3A 2BXYA 4LV4A 3THDA 5KITA 3FFSA 3NPWA 1UR0A 5DCDA 2MANA 2DZVA 4KFNA 1YXDA 1TTJA 3N34A 4A3UA 3IAQA 3VDAA 3MBFA 1SSGA 3P5YA 4MYAA 3K1DA 4ADSA 2Q8LA 3S6DA 2WHLA 1H5VA 4LX4A 4DM1A 3IAPA 2BX7A 1M6JA 1WDQA 3THQA 2CEQA 1V3KA 2WSQA 1H4PA 4NJHA 2WHJA 5ABGA 2V5BA 3G22A 5GPRA 5EMUA 1VR6A 1VYPX 2FJKA 4NU7A 2GK1B 1DBTA 4LC6A 4LRTA 3D0CA 2YSWA 3DFPA 1TPB1 1VRDA 4AB4A 3NDZA 4V28A 5A5WA 2VC6A 5HWNA 5AYXA 1V7YA 3VDBA 1T0OA 2Y24A 1GVRA 1JAKA 2Z1SA 2W92A 3C6CA 3WQ4A 1JYXA 1VEPA 2WSRA 1TPUA 3W29A 1RZMA 2WYSA 3TK7A 2XTKA 2V38A 3DU0A 5FF3A 5AN7A 2PRLA 3C8FA 1WA3A 4HIBA 3FYPA 3TH6A 3TKFA 1KXQA 2C7FA 3T78A 2YLLA 3ZT7A 5D37A 5HINA 2YKKA 4M29A 3T0BA 3STFA 4RJEA 3UR7A 5D03A 3SUTA 3GAKA 3S6TA 1ZENA 3S0CA 1EHAA 1W3JA 1LM1A 4UUIA 1H7NA 3FYOA 3MV11 4F79A 5BWFA 3S1VA 1SW3A 5IBXA 1LL7A 1KWKA 4IXHA 5E0CA 2FB3A 2QHAA 5FK7A 1XSIA 2JIEA 5AHMA 3EX4A 1X7FA 5FESA 3L4ZA 2HS8A 2C8NA 1MSSA 3W7MA 2E0PA 3VKJA 4PTNA 1QNRA 3BAKA 2XJ7A 1YDOA 3CHVA 3UWVA 2ZFAA 4UTKA 3RK8A 4UQCA 5A6LA 4O10A 3LF7A 1UKTA 1UYQA 3HG2A 3KL0A 1JRBA 2D20A 3T09A 3VIOA 2QJHA 5T26A 1DWHM 4X0NA 3AOFA 3K46A 5HWMA 2NZLA 5LNUA 3B8SA 5A6AA 2YDAA 1KTNA 4QDMA 3R2GA 3WEOA 2E9MA 2JIWA 2BVTA 1W9PA 1U2YA 2VENA 1ISXA 5KEZA 1EUAA 4WF7A 5CZKA 1TPH1 4CCDA 2BTMA 3WJYA 1BVZA 5CSUA 3VFLA 4UQ9A 1KM5A 2GDVA 3WF3A 4ML9A 1O6IA 2X16A 1W9VA 4GUJA 4JTIA 1JGIA 3USBA 1TA3B 3AMGA 4NSBA 1KQYA 5D4YA 4AD2A 2QR6A 1NP0A 1OX4B 1UWSA 2JBMA 2CFFA 3OVRA 1Q6FA 2WMIA 4LS0A 3T2OA 4JIPA 3LPPA 4M56A 3VIHA 1GVSA 1B4KA 1TMHA 5CSRA 5DCEA 4NNCA 3O6AA 1QW8A 1RVGA 4O4VA 1C93A 4F9JA 4S2CA 4ALDA 2UY5A 3UXDA 5KZDA 2QMKA 2VCCA 2ZTJA 1WZMA 3QYQA 5FF4A 2ZUNA 1YTKA 1PJ9A 5I5RA 3CGTA 1J5TA 3QHMA 1SUXA 3RNDA 1GQNA 2WC4A 3AIQA 5ABFB 3WELA 3CLWA 3DYOA 1HVQA 3O6DA 2PURA 3IIZA 3OHIA 2H6RA 4MJMA 1Q6QA 3W7EA 2ADDA 1N7KA 3C3NA 5DCBA 4ML4A 4PSRA 4FFHA 3NXFA 4KWUA 3QMTA 4R33A 1LJYA 3MW7A 2DSZA 3GH7A 3W72A 3QZEA 3PUDA 1KR0A 4YPJA 4W5UA 5E09A 5F7UA 4CN1A 4E8DA 1OFDA 4UFKA 1OWQA 4LW7A 3PZVA 1JD7A 3MSDA 3SEPA 2OSYA 1ZBCA 1CBGA 2Y7GA 1HL8A 2YL8A 3WKZA 3ZJ6A 4C7DA 2CLLA 3SZ8A 1GZGA 1JUKA 2B0MA 3PS7A 4CNPA 1DP0A 1V0MA 4R5EA 2BHZA 3L65A 3PZ9A 5EB8A 1HO1A 3W7PA 5J5DA 1VJIA 1Q6LA 3HGJA 3B0PA 4LOCA 2DIEA 4W8BA 4UZUA 3ALGA 3Q94A 4Y90A 4ZFMA 4N9BA 3QJAA 1B9BA 1RQBA 2ISWA 3F1QA 1GTEA 1WBHA 3C52A 3C2EA 1N8FA 2NWRA 5D2VA 3EEGA 4GBUA 1BG9A 1QDSA 2YCEA 4GFSA 2FH8A 3SR7A 5AFDA 3E1F1 2Y7DA 3EKLA 4W86A 3A4XA 5ECUA 2V2HA 1CENA 5F2LA 8CGTA 3UZ5A 2CLMA 1EIBA 4UTTA 4CD8A 2QCCA 1TPC1 2GPTA 4IMGA 3KWXA 2W91A 2E5BA 2YDQA 1B3ZA 1VH7A 1QI3A 3BLEA 3I65A 2JGYA 3GNRA 3FNDA 3U1XA 3M46A 4BI5A 4AY1A 4DUWA 4JR5A 3LM7A 5CZTA 2ZRUA 3VD5A 2CHOA 3LDVA 5FKYA 1E9LA 2EBNA 2WSKA 2D23A 5DELA 1QPRA 3E02A 4K38A 3EKZA 4MNJA 1SR0A 5A6MA 3KL5A 3HGOA 1WNOA 3K30A 4RX0A 1UD8A 3GXFA 1P5BA 1LLZA 3L0NA 2QQVA 4GI8A 4BQ5A 3LHTA 5D05A 3QH2A 1EOMA 1OM0A 1F5ZA 1J0KA 2J47A 4MOZA 3DH7A 1FOBA 2PCQA 2VZOA 4HXCA 3NZ1A 1LWJA 4AXNA 3QW4B 5I3FA 4M7TA 2E40A 3FIGA 1QNSA 4AHOA 5A6JA 1TYGA 5IFTA 1HNYA 2BWGA 1MEIA 4TVCA 1OGBA 3G8RA 2DH2A 3CZKA 3EMCA 4O28A 3ZMRA 4B5NA 3U5UA 1UWUA 2E6AA 1C7TA 1YDVA 4E38A 2VR5A 3FAWA 5M3WA 2Y61A 3U14A 4AISA 1W1ZA 5HMSA 1W54A 4JY8A 3IVTA 1VFFA 2J4GA 2YBUA 1LBLA 4KMQA 1FCBA 4IXXA 5L6UA 1AW5A 2YX0A 4BWLA 1B1YA 1GVQA 1BVNP 4ZL1A 1QO2A 1WKYA 3WIJA 3OGSA 3ARXA 3MMWA 4JTUA 3FLUA 1U5JA 2E5CA 1F6KA 3BK0A 1DWGM 3G1XA 4ZQPA 3OLGA 1FHDA 3OIXA 1JCXA 2EGZA 4JDYA 5D2WA 3HO8A 3TTYA 2QV4A 1TPFA 1DKWA 2RDTA 5DY2A 3RM4A 2O92A 5D30A 3SCOA 3S5ZA 4CCEA 1IXOA 3PZMA 3P8JA 4LC8A 4Z08A 4EAMA 3LI1A 4TXEA 4WJEA 5D9OA 1BQCA 1FA2A 3AHXA 1QNQA 3NQCA 3P82A 4WZHA 4UQEA 3NEVA 1OF8A 1K7EA 4JTKA 1Y9MA 3TJLA 3GBEA 4AXKA 3S5NA 3UNDA 5HR6A 5DEZA 4BCEA 4B1LA 3LB0A 4E2BA 5I3JA 2QCEA 3MMDA 4MB3A 3B06A 5CPNA 5G5IA 1FDJA 3SIMA 4WX2A 1UKPA 2VZUA 6TAAA 1TV5A 3C0JA 3PTKA 2R8WA 2Q8XA 2D24A 1KFEA 3CIXA 3V1PA 1OFQA 4H2CA 4EK7A 2ABBA 4PEKA 1DWIM 3VIKA 5DBTA 1JI1A 3WF4A 4CUCA 1MW2A 4UIOA 1BYAA 4JX4A 2DJLA 1TPVA 3IIPA 2R94A 5G1TA 3E49A 4FNUA 3GDKA 3WK3A 2OSWA 1WE5A 1QPKA 4BF9A 4WQ6A 5IDIA 1PHWA 5F2MA 1CXHA 2IUZA 3EWUA 4PTMA 4J3SA 3UCQA 4E4PA 4PL1A 1H7WA 1KBBA 2E5DA 3GZ3A 1ZJIA 3UGFA 3PBUA 3W88A 5AYYA 1M01A 3FW6A 1PE1A 3WL0A 5A95A 2CESA 3L0GA 5EA9A 2V8ZA 3AS0A 3B03A 1OFRA 1W5OA 5ABTA 2WVVB 3GH5A 2VR4A 1H7RA 3R12A 3AHTA 3VM5A 4AWSA 2A7NA 3PZTA 3C61A 4UCGA 2DSUA 4RZ6A 5HWJA 3KEHA 4CKQA 3OEXA 1FWWA 4HZ7A 2GJXA 4HSNA 2E1DA 3A5VA 3FKKA 3MP5A 4QIUA 2ZZ6A 1Q45A 3L5LA 1M53A 4X9YA 1SO6A 3N15A 4OBTA 1VZWA 2DT0A 4M5PA 1H7PA 1W31A 3NL2A 3RWKX 4IJBA 2BY0A 4UFJA 4GUGA 1UG6A 1GORA 1SYTA 3WEZA 3K8MA 4FX8A 4Z2KA 1DJNA 4K39A 1WDRA 2V3EA 4Y8FA 4O15A 2OX1A 1HP4A 1XHGA 5FF2A 2BVDA 1KB3A 1JXJA 1S5VA 4XV0A 4I9AA 2NX3A 5G2IA 1NAL1 2ZYFA 5H91A 3WMBA 1FCQA 2X1SA 3LV5A 3AMKA 4QHZA 2J8FA 1B31A 4H8HA 2E9LA 4HZ8A 1VEMA 2D22A 4UC5A 2ALDA 1WQ5A 4QITA 3QMRA 1NOFA 3B9EA 3DHUA 3THCA 4JFWA 5EBUA 1OD8A 2GSJA 1Z32X 2VOMA 4TX8A 3S1UA 3UWZA 4AZHA 4MFEA 4QQ3A 1MEHA 2PRHA 4K8HA 2IQTA 4FX7A 4K7YA 2R91A 4JX6A 4OHQA 3RJXA 4GINA 3MI2A 3UGGA 3ZO9A 1PIGA 1B3OA 2VO5A 2QCDB 1D3GA 4FFIA 4JGDA 1FDYA 1EX5A 2X05A 1UH3A 3E12A 1BGAA 3ELFA 3P84A 2WV8A 1W2VA 1FWNA 3L68A 5C5YA 1WZLA 2VZTA 5U4NA 3GXNA 3A22A 4JKMA 4CU8A 3GXIA 3Q2DA 5EL1A 1VCFA 1JZ2A 1BG4A 1NARA 1QI4A 2RH9A 3UY7A 3K4DA 3HMJG 4AZ5A 3TIMA 5A94A 4Z1DA 1CLVA 2X8RA 2WSYA 1OYAA 3MUY1 3LHWA 3BW2A 1IZKA 3CIWA 3U6WA 2WHMA 1NF0A 5I3GA 3QGVA 5FMCA 2WAGA 2ZUSA 2TYSA 3APGA 3WUBA 4UFIA 2WNNA 3L9CA 4HOXA 1W37A 4PTVA 1ISVA 2A3EA 3W26A 4RXFA 4CD7A 4MVAA 1IGSA 3M7WA 1D3CA 2Y8KA 5I78A 3HG5A 5KINA 2D1ZA 1UYPA 5A8MA 2LLEA 3IVSA 1CDGA 2GVYA 1XUUA 4OE7A 3ARZA 4GI9A 1FHLA 3W07A 4B3LA 1E3ZA 1WCGA 5I79A 2YYUA 5HXMA 4M8UA 3WH9A 7TAAA 3SUVA 2EAWA 1E6ZA 3OGVA 3HGSA 1QNOA 3NDOA 5GQBA 1KWGA 4AEOA 2J7DA 1OBAA 2CBUA 4H41A 1W5MA 2WVUA 2FPVA 2X1UA 2C19A 2DQXA 3W76A 1GVYA 4NNAA 4WKHA 2VELA 3RMEA 1E72M 4CD6A 1UUMA 1D7FA 1LCOA 5CJ5A 5EPDA 1NM9A 4IPIA 5F2GA 3IVUA 3WFLA 2PF0A 3WH7A 3ZM8A 3LBMA 1KLYA 3TDFA 2WVVA 3NQEA 1R7OA 2EPOA 4OOUA 5M5DA 3G1VA 5DN1A 3QOMA 4TVUA 4RV8A 1E3XA 1VBUA 4W8AA 1QCWA 4CNOA 2WB5A 3W53A 4BS0A 4TVDA 3W84A 4M6VA 5HNRA 2PC8A 4WKAA 1VEOA 3LCLA 4PMNA 3LHYA 3OVPA 4MYXA 2E4TA 5G1YA 4JNMA 4FNRA 4O14A 2WLYA 3FAXA 1FWTA 1ME7A 2ZOXA 3TU9A 3ARRA 3G0UA 3ARPA 1EWDA 1X1NA 3GXDA 6ALDA 4D1JA 3W3OA 2Y70A 4JTEA 4MLJA 3KF3A 1W1PA 3UG3A 1ZAHA 1DJQA 1EOKA 4LYQA 3QW3A 1NEYA 4ZE5A 2BY3A 3LDRA 1GPFA 4TOQA 1OFOA 3MU7A 1GCYA 5BOOA 4DUVA 4ZEPA 3T7VA 3H3LA 2O9OA 4MY1A 4NQ1A 2EO7A 1H51A 4V2XA 4HHPA 3M6DA 1JUEA 3S42A 2VFHA 3OLDA 2HVMA 2XWDA 3HJZA 3TXVA 3DBPA 1Q6EA 3VE7A 1G4PA 1S5TA 4DXVA 1NQ6A 3OVQA 3WJSA 5DMYA 3F4WA 4NNBA 1J01A 2QLYA 2DU2A 2QCDA 2ZQ0A 5CZ0A 5DF0A 4X2RA 1E1FA 2J9ZA 5D2XA 2RGMA 1G69A 3QQ0A 3QQ1A 3LTPA 4S1FA 4HOWA 2EF9A 5C2XA 2NX9A 3MUIA 1QHZA 2GQAA 2XFFA 1E4NA 2VMFA 4D71A 3HQ1A 4QNEA 3ARQA 3ATYA 2QDHA 1C29A 3K4AA 4W87A 5A3HA 3W75A 1KM2A 4AWUA 4D6HA 2DZWA 2CETA 2J24A 1BEUA 1TV7A 5CZSA 2F7FA 3W7RA 4DO4A 1E6SM 2GJPA 3BPWA 2J79A 3B04A 3M0ZA 1W2PA 3L2LA 4L4MA 4JIEA 5JUVA 5AHFA 1SO4A 3WD0A 1WYIA 3DKJA 3MI6A 4C1KA 3M1ZA 1E6XM 1BLIA 1DWFM 4H8UA 1SO5A 2WNQA 4FIRA 4EF8A 5A2BA 2JK2A 1BYDA 2BHYA 3LV6A 4AWEA 4CN4A 3L4UA 4BA0A 2CW6A 4HN4A 3AJXA 5E0FA 3AIUA 1F74A 3P80A 1DTUA 1HT6A 4JEQA 4BR1A 2E09A 4CQ8A 4UQBA 4IMCA 1YPIA 3A21A 2E6FA 4JQTA 2J9YA 5D2YA 3UPBA 4BI6A 2VEMA 3OZPA 5GNXA 3LPOA 4KGJA 3GBDA 2VC9A 2EXOA 4RKAA 1HUVA 1OFAA 1GJPA 4JICA 5E1QA 4Z1CA 3FEMA 3TJXA 3NSMA 3HIJA 4FMVA 3O6YX 2ZCGA 1PVNA 1YLVA 5HJLA 1IXPA 1BTCA 3H53A 2BFGA 1W3TA 2JKAA 1KTCA 1K02A 4GKLA 4HMCA 2NWSA 1KBKA 3WK1A 3DFTA 1E56A 2PRMA 1GQIA 2WZIA 4DWSC 3W1TA 3T0DA 1T8XA 2CZDA 1V0KA 4LTSA 3RO8A 4PA8A 2EQDA 3NM1A 1GQJA 1BSIA 3KVMA 2FPYA 4UTWA 3NVTA 2YW4A 3M5XA 4ZQNA 3FA5A 3WJZA 3LOTA 1CYGA 2EPKX 2F8QA 2QMJA 4P8XA 1AW2A 4RE4A 4TU1A 4AZIA 3QM3A 5U7SA 2XFRA 1PAMA 2XHYA 2Y5EA 3L4VA 4HPHA 2I1OA 4UZSA 3AYSA 4FFFA 1GT8A 2XM2A 1J18A 1VFUA 4UXDA 3TC6A 1LBFA 1K8YA 1QO5A 1TPEA 4PMXA 2ZUMA 4X22A 4DF1A 1FH9A 3CZJA 5FK8A 3DC0A 4HA4A 4OJYA 5HR7A 4I7VA 2H8XA 2XVLA 4FLOA 3V75A 4DO5A 1G1YA 1CGVA 3ARYA 3W22A 1GEQA 4MNKA 5CLWA 1H3GA 2WKLA 3VD3A 3W6MA 4AC1X 5F4WA 5F4SA 1KBJA 2W67A 3LEMA 5GNZA 2XIBA 3GX9A 5I6SA 4J3WA 3GXMA 4ZQCA 3W7IA 1J12A 2PBGA 4C7FA 2OWXA 4ZMGA 5LNRA 1WDWA 4HPGA 1KXVA 1CGYA 2QPUA 1SFSA 1R8LA 2ISVA 3JRKA 5KZMA 2VX7A 1MFUA 4RXGA 3NPVA 4JL1A 2C16A 1XI3A 3MP3A 1QMLA 4GE8A 1RH9A 5C55A 1ZHAA 3W2UA 3TMQA 1V6XA 1MW3A 1QBBA 2J25A 2EHHA 1A47A 2YZRA 1CWYA 2WMGA 2WVSA 3EYPA 5CG0A 2ZUVA 2VUYA 3AS1A 1R87A 3O05A 4N0RA 2NSXA 3U57A 1XH1A 1TB3A 4PN2A 2GJRA 5JBEA 3M43A 2X1IA 4NZCA 3UEQA 4GXMA 3UPWA 1GONA 2TSYA 5A6BA 3ZR4A 2DT3A 1RPKA 5EFFA 4YXGA 4M7SA 2PWFA 1E5JA 4JD4A 3IMMA 4GZIA 3AS3A 1B3WA 5M17A 3W7HA 3GNNA 1EO5A 5KZEA 1SQ7A 4S3KA 3QPYA 1W9DM 4UTIA 1AK5A 3RFAA 1BF2A 1WBJA 1XKYA 3W2LA 4WD0A 5AC8A 4HP5A 5BROA 2W61A 3MUAA 2Q8ZA 3RM9A 2EPLX 2YXGA 2H8ZA 1TRIA 2BXVA 2ESCA 1JZ7A 2OXBA 4U5IA 1UKOA 3CWOX 4O18A 3W9ZA 4A29A 2EPMX 4OOZA 5AC4A 4AIEA 2J7BA 4WXZA 1E73M 5FL0A 3BXWA 5ANNA 4WK9A 2F61A 1IXQA 3NL6A 1X1ZA 3W2MA 1WP6A 2WVTA 3ZJ7A 2CLEA 2QUUA 2ZZ4A 5A1AA 4R34A 3EDJA 3U8GA 3EMQA 3C2FA 2QDGA 1EA0A 1HJWA 2B31A 2P0OA 2FLIA 1TCMA 3OLIA 2D0GA 3MMTA 2Z6IA 2WWCA 4JTLA 1WOBA 2OCZA 1UH2A 2ZXDA 3H55A 1JIBA 3ZJ8A 3S8HA 1LOQA 1UQYA 4J28A 3QOKA 4NF7A 4C7GA
chains in the Genus database with same CATH superfamily
2WO5A 2IPJA 1FPN2 3W9AA 1TWSA 3T0AA 4BE3A 2ARXA 2YC2A 2VQAA 1FXQA 5D32A 2CGPA 3AYRA 4JKKA 1UZWA 5A7NA 2XUCA 1V3IA 1XQLA 3K51A 3NSTA 3U7VA 2WQZC 1GOFA 1DORA 3HQNA 3RF9A 2A70A 4QDQA 3OBAA 1EJTC 2BS9A 4DB7A 1MS0A 3MSGA 3VCRA 1QNWA 3QY7A 3LFMA 4QSHA 1ZX5A 3CTTA 4LMFA 1JGMA 3VK5A 2J77A 3WLQA 1RUF3 3FGCB 5DABA 1OT5A 3GHUA 3N9NA 1A50A 1IT0A 4GJ1A 4NRRA 3VUSA 4W84A 1SFYA 1JFXA 6XIMA 2YCLB 2POTA 4D9PA 4NG3A 1JW6A 3G1SA 3BWWA 2OODA 4AYSA 1Q6GA 2BW8A 4XETA 3TEYA 5IXEA 3IUHA 5AC6A 5FO8B 2RHGA 3WDYA 4K8GA 4DPQA 2HYKA 4YVVA 4H7CA 4QRNA 1OSGA 4K21A 4OCTA 3W74A 3KCYA 4GD4A 5AC5A 2I2SA 4UTMA 5F5AA 3O6CA 4Q4V2 4E4HA 1POQA 1AL0G 1J93A 2X1RA 5F32A 3QFWA 5FD0A 3TQVA 4WV8A 2P76A 3GG8A 3UWYA 2VBDA 1NKGA 2VW0A 4Q8KA 5K9CA 3EX6A 4IWWA 3RNSA 4O61A 3PBGA 4L6HA 3SSJA 1LG2A 4RCXA 3A9IA 4MHUA 2XG9A 1B9ZA 4QAIA 3NQAA 5DO8A 3RJYA 1KEXA 3BAWA 4LALA 2OO0A 4XAGA 5CISA 3GTIA 3VZJA 1UHVA 3AXXA 3O15A 3TX9A 5A6SA 3I49A 3G1FA 1L7RA 3QEZA 1H4HA 2G3JA 4BCUA 1CWPA 1H8TC 5D9MA 1X6LA 2I45A 2DVDA 2JEPA 1VBA2 3I59A 4E4DX 2W79A 2OW4A 3ABQA 1PO9A 1BGGA 4MLRA 3S6OA 1OZMA 2GK1A 1TE1A 1NFBA 2CYGA 3OZOA 1X8EA 5T3NA 4ACYA 5K2ZA 1LQ2A 3F5KA 1W99A 5AC93 1JUIA 1XDLA 3CK5A 3SKJE 4UTFA 3MYXA 3CMGA 2BOGX 1EP2A 4MGTA 1T96A 2QF7A 2X5IA 2NV2A 3VDHA 1C1FA 1W6QA 4B1MA 4XUNA 5AHEA 1SFPA 1H50A 4M00A 2BNJA 4PIZA 1AD1A 4BYYA 4X6QB 1P6WA 2E1WA 2VURA 3N2XA 3ABZA 4M82A 1JG9A 4RPQA 3IJ7A 1PKMA 2V9DA 3W81A 4G9SB 2Z42A 4KH2A 1E0XA 3TV8A 3ZX7A 3H7UA 1CZVA 4XAFA 3ARWA 2ZGRA 1QDCA 5D38A 1XIIA 3P5BA 4I9JA 1H2JA 2JGQA 1DHKA 3HMYA 4MB1A 1XIDA 1ZGDA 3D4KA 2JKEA 4DHGA 1LF1A 1J0HA 4NKCA 3W23A 3CUIA 4L1XA 1TV3A 1VHNA 4WGXA 4YL2A 1UWRA 2ZBJA 3OG2A 1CTNA 1YXCA 4XK2A 5FAGA 1GWKA 1YNQA 2GLKA 4FXFA 3KXQA 1F73A 1L9WA 4MM1A 1VBE3 3AX4A 3LCWA 4CNUA 3B69A 3DN5A 1ZFJA 1TQ5A 4LK7A 4OHVA 3VMOA 1JZ3A 1Z44A 2TEPA 1OX4A 3WK2A 1XC6A 2PHDA 1O95A 3QYSA 1NSJA 2RS32 2JKXA 1J10A 4AZZA 4CU7A 4CP1A 1L3JA 3TYZA 3BN6A 4OWGA 1U83A 2C13A 4X3ZA 3W01A 1W3HA 1I1WA 5FY5A 5ABJC 1IHMA 1FP9A 3AZVA 2B81A 5A8NA 1CXIA 1JXKA 5ABFA 4AEFA 4C1LA 2XONA 1KO0A 2CERA 3HJEA 1R083 5D9NA 1Q7MA 3BMWA 2EJ1A 4JY9A 4B92A 1CZSA 1M7XA 3KTXA 4XQDA 1IR1A 2VJXA 3LEIA 5FZ3A 3W1XA 1W6MB 4H6EA 1ST8A 4OUEA 2PDXA 4UNKA 2YBSA 3RCYA 1V6WA 2D97A 4FPGA 4GK8A 1QNPA 5FWJA 3FX3A 5GZEA 4ZSUA 5D8AA 2HE8A 4ILSA 1DXIA 5BNPA 2HXTA 4LVGA 1O4TA 4LJHA 1ITXA 1GTHA 2I9UA 4IIGA 2WPGA 3WDQA 2YGYA 1TMQA 4RQPC 1AHSA 1CECA 3RZHA 1Z7S2 1Z3NA 4DYKA 3JU2A 4LNYA 1IXNA 2LROA 1BQGA 2QQ6A 5HMEA 2XDVA 2BVYA 3WV6A 3PUIA 3E38A 1PKLA 2FHCA 1WUEA 4MTVA 1QU0A 1W04A 3MBDA 5EHDA 1ZYBA 2GZWA 4E2VA 3ZLIA 3OTRA 5CFCA 1FDZA 4Y22A 2UY8A 4Z2HA 4FVVA 5LA9A 2D0FA 5FYZA 1CT5A 3PJWA 3BW4A 4O0ZA 3VZXA 5EMLA 3SAZA 5FEWA 5BNNC 5K0UB 1A0EA 8A3HA 1FWRA 3RGBA 5EFDA 4GH4A 4MKNA 1SDWA 2X53S 1Q8AA 3WJXA 1OF4A 4H9ZA 4J1WA 1XSJA 3UY8A 4YW1A 3RCMA 1K9FA 4HGXA 5LBBA 4L6OA 1TPWA 1REDA 3SUSA 4AZ7A 1DLCA 3ZN6A 2WNVA 2FCVA 4AE2A 2F2HA 1V5XA 3D3FA 2J7HA 1LG1A 2PDWA 1XC4A 1UP2A 3CQHA 3N9KA 4A44A 3W85A 4LUSB 5H1WA 4ZXOA 4J7RA 1QMJA 1QNYA 3ZSJA 3QR3A 4CQBA 4RE2A 4A3HA 4A4AA 3GNDA 4RDVA 4AIUA 4E0CA 1NCQB 1GOHA 4L92A 1HLCA 3ZMNA 3TQKA 4CCCA 3UJEA 6PTDA 1Q63A 4I90A 1PVC1 1UWQA 4GKTA 1A5SA 3DG7A 4L1GA 3NA8A 1U5YA 1UA7A 1L6SA 1FPN3 4U3AA 1NFGA 3C2UA 2GSEA 1ODUA 2Y7EA 4O9EA 4K36A 2BXZA 3AROA 3GDRA 4N4QA 3ZSEA 1CLKA 3MDWA 2P3IA 2EICA 5EMJA 5LIYX 3CBWA 4P7RA 2QZ3A 4L65A 4XZ9A 2F4PA 3ZXKA 4GACA 3STPA 2X8KA 4L8QA 2FB2A 3SCRA 3C7OA 1EJRC 5AVNA 4HCDA 1GKPA 2CWXA 4O8RA 1PZ3A 4AZBA 4XD3A 4DWDA 1BAGA 4RL7A 4D7TA 5DDJ1 3P62A 3VNZA 1V70A 4EKJA 3NPXA 4G56A 1W32A 4WOQA 1A8DA 4DPPA 3M3QA 2YBPA 1XNCA 2NXIA 3CPUA 1JFHA 1H1MA 2DWRA 3NYDA 2Y5JA 3O3RA 4XZBA 1J2WA 2VWTA 1OFEA 1CCWB 5CG9A 4TX6A 4RFT0 3BUCA 4EX4A 1OQ1A 2J22A 4FXRA 2WANA 1CB7B 1Z8AA 2WMHA 1MWOA 2A7RA 3NNGA 2O9PA 3GLCA 3VTRA 3VXGA 4JFUA 2DGAA 4TWTA 3GB6A 1NY71 3MI3A 2PMWB 4QEEA 3KDOA 4B4FA 3DI0A 4EWND 1A5AA 3QC3A 4P5UA 2GGHA 4LB4A 1OOPA 1CI1A 2RS12 5TIMA 5AKQA 2FDKA 5CFDC 4B7KA 2SBAA 3I7RA 4PFMA 3WQ7A 1DYOA 2FBEA 1F05A 3E3HA 4HKOA 2WNUA 3APBA 2H3BA 3NYZA 1HJUA 4MDOA 4URTA 1PTGA 4DUOA 2VUAA 1RXOB 1S2UA 2YR1A 3RIKA 3PIJA 1TVLA 2IXIA 3K48A 4P7LA 1TIMA 2GN3A 1OVSA 4GNJA 4ZS3A 1DL3A 3CU7A 5C8CB 3PIGA 5AECA 4LQ1A 4X63A 2R32A 4CDQC 2QCNA 4KIRA 4KPLA 4LO5B 4GWEA 1FVPA 1MI3A 1D9EA 1LOFC 2WRAA 4YVWB 2XUMA 3LCIA 3POBA 3BH4A 1W3IA 4Z2GA 1UKRA 3GKFA 4UOZA 3VIMA 3BTAA 3UJSA 3SJ3A 4BKNA 4COZA 2WJEA 3UZZA 1GNHA 3AK0A 4Q2FA 1C92A 5EWSA 3I2OA 1T6MA 1NWRA 1TUXA 4MFDA 1RBLA 1FI2A 2YBKA 1JCYA 3U2ZA 4DZIA 4LUIA 3J8F1 3WINE 4RGGA 1SFTA 3N2MA 5A6QA 5BRPA 1UQZA 4LBKA 4GBDA 3CUGA 4B3ZA 4IEUA 4AI0A 1T99A 4R9CA 3NNMA 1W8ZA 7REQB 5AYIA 2PQQA 2Q30A 1LT8A 1JZ4A 4IPLA 1PNGA 2BV9A 4ZKTB 3LGDA 1UR9A 3I68A 1B35A 1LB2A 1GOIA 2D0HA 1MO0A 1FV2A 5C3RA 3PNZA 4J2PA 4XF0A 2PLCA 4XB3A 4I5UA 3ZSLA 1SACA 4LSBA 4AEDA 1R64A 3EXSA 4JHTA 5DN2A 1SJCA 1EEPA 4QNWA 5JSPA 2PMQA 3MLJA 1TV8A 3LHUA 3H2MA 2J1AA 1CQ9A 3DPRC 1JF5A 3W2NA 5A2CA 1ENQA 3VNKA 3N3MA 3CHEA 2VZSA 2AAAA 3N3TA 2QQUA 4GQQA 4QWNA 1P6BA 4J27A 1GZ9A 3T4VA 2GWGA 3TN91 2BERA 4P8WA 2CSGA 2BTVC 4NHYA 4HPJA 3BYWA 2YFNA 2JF7A 4YTQA 1LRTA 4PODA 2PLV1 1AYM1 1HX0A 1ZZBA 4MIMA 1AJOA 2I5GA 2XH4A 3OYWA 4MNMA 4ACZA 5FOOA 1IG3A 4YYOA 1FMD2 1OHLA 1W0MA 3UJRA 4XXAA 5LATA 4MMWA 3TEXA 3MP4A 1PIFA 3BLPX 3QHNA 2XLFA 1GKQA 1GPWA 2W3JA 4O1FA 3BVJA 3L2IA 1HXS2 4XF4A 2CGOA 4JAAA 5B4XA 3O0FA 2ILMA 4FFGA 2V81A 1U12A 4OYUA 1X8MA 3BIWE 3DKQA 3VL8A 4CCMA 4PBOA 4PC8A 1JDFA 5LA1A 2W1UA 3JD71 1PCWA 3HF3A 4CSWA 1T5AA 4MNLA 2VHLA 4GMEA 3CB3A 3FMGA 4GZ7A 1IEXA 1YRRA 2ZZ2A 1QOQA 1AMKA 5IATA 1PYMA 3SM0A 4HVQA 2D6KA 4Y1ZA 3ZWTA 3SH4A 5HV4A 3I3QA 1HGWA 2CU5A 1HN0A 3POGA 3BTYA 2X1TA 4JAWA 3GYEA 3ZVHB 3A47A 3LSEA 4H9TA 2FQIA 1IEWA 1NOWA 3AXIA 4QISA 1DIDA 1B57A 3PZGA 4BQXA 2CGNA 2QCGA 1V6IA 2OGYA 2PQSA 1QOXA 1XDJA 4I9TA 1RPXA 1AD4A 1RCQA 1YDNA 3H6OA 5A33B 3JQXA 5D1IA 4FXSA 3WO8A 5JR2A 1PWLA 2JFEX 4QJ1A 3U75A 3A4AA 3ZFGB 1XD0A 1DWJM 3GDMA 4PUWA 2QKDA 3W73A 4QM8A 3VNDA 4A05A 3VZMA 2QIIA 3ZYBA 4CCJA 4NZFA 3EWZA 4FOYA 2C4XA 2N7GA 4JTCA 4XIMA 1WLDA 4FLSA 4O57A 1NT0A 1HJVA 2MPFA 1W3NA 3W1UA 1XBFA 4IQEA 1CXLA 3FK4A 5KHJA 4J3VA 3PURA 3UFYA 2PFWA 2SFPA 4GNKB 4UTWC 5A3PA 1UU4A 2G96A 3LNMA 1VENA 3AIRA 4M3CA 3B02A 2W6RA 1F31A 1UIOA 1U5HA 4Q4W1 4FNPA 2V3FA 3FC0A 1EQPA 4W88A 2OIIA 1J0JA 1ENUA 3J7HA 3O06A 5IFPA 2WM0A 4Z2IA 5FXZA 1LGNA 2YA2A 1HRV3 5FMDA 2XDFA 2V09A 3AMNA 4ZSTA 5MHBA 3MICA 3BAYA 4IE0A 1ALDA 3CB8A 1VAHA 2VGFA 1RR2A 3I7SA 4AVNA 1FKWA 2GZXA 4NIIA 5SWUA 1KM3A 4IUOA 3ITGA 3AXEA 2A3BA 4GABA 4G6CA 4IIHA 4ZQOA 2IXHA 3L2HA 2NQ5A 3WY1A 4XACA 5A6TC 2XQXA 3KV4A 3AYVA 3V0BA 4C6JA 2PYTA 3RUBL 3ITOA 3P60A 4GY0A 2GC2A 3OB8A 3SGUA 4Z8BA 1R46A 1K42A 3NR0A 3UF9A 4NR1A 2BDQA 3VX0A 2VE1A 4XCAA 1K6WA 1H41A 2QQNA 2TPSA 3QVQA 4XJUA 5I3KA 4L7ZA 3VBRC 1L0PA 2FMOA 1JL8A 4JTHA 4W8LA 1OHFA 3ZLHA 3GDBA 4F2TA 3PU3A 1RMU3 1RUE3 4J4KA 3VNMA 4H9XA 5XINA 2O55A 5CKSA 2TBVA 1NU5A 1RUI2 2NQ9A 1HF6A 1RUSA 3GK0A 4HTBA 2J1RA 2RDSA 2ZABA 3PVEA 2BLEA 1EGMA 4K3ZA 2B7PA 3BB6A 2UYBA 4X0VA 2XIIA 3S1WA 1YC61 4GLEA 1D2QA 1ZBVA 4YCPA 4EANA 3DC8A 4KBBA 2QUVA 3MI8A 1EBGA 3GJBA 6A3HA 1DQ2A 2H9AB 4LS2A 1P6CA 3EA1A 1XSQA 3RDKA 4GGHA 5EMYA 1QAPA 2Z1WA 2WC3A 1RHCA 3UD6A 4XPVA 3G3MA 2VGGA 1US2A 1DIKA 5H6HA 3O7OA 3FGCA 3PUQA 1VBRA 4Q8LA 1VYRA 1QQP2 2EIEA 2WINB 5HOSA 4Y6GA 4JS3A 4QPGC 3WNPA 3IPVB 4IV1C 5HBAA 3BW3A 3UXKA 4LXLA 1OCQA 2FJUB 1VB4A 3NAPC 1GLHA 2VD7A 4RE0A 1XH0A 4ZU7A 1W90A 3U4FA 1MVEA 1TMLA 1AR73 3CJXA 5AC91 1OVDA 4JGZB 1A53A 4HANA 1OK4A 2D2OA 3PSWA 4QE4A 3TOYA 1M5WA 3FN9A 8TIMA 5IVBA 2GNTA 3KQ4B 1E70M 1UPMB 4I0AA 3OGJA 4ONVA 1JHNA 4O9GA 4LKFA 2DZXA 4GXPA 3EQEA 4YNGA 4LE3A 4Y1VA 4YGEA 5FPZA 3BOXA 3N04A 4IISA 3WCZA 3E0FA 3BU0A 2VC7A 1D2SA 2IVIB 3PZNA 1J3RA 3TAOA 1WMFA 1RQEA 3N12A 4MB5A 2ZPXA 4OLLA 3NO8A 2DVXA 1ASJ2 1UXXX 2IFWA 3M2MA 1O1HA 4AWTA 3CH0A 5H9QA 1XLCA 5CC7A 2ZGOA 1HJXA 3BAIA 3LXCA 3H2CA 4AGVA 3VDGA 1IS4A 3T9PA 4ORIA 4DJFC 2A0NA 3JZVA 2WFPA 1V3JA 2GMEA 1A5MC 5JCTA 1Z0HA 5I0DA 3JUGA 4MWAE 1XLGA 4LBQD 2PBOA 1TJPA 5L7OB 4QQLA 2FH6A 1VBE1 2WZR1 1OG0A 4DWSB 2R073 4R8HA 1XIFA 3A3XA 2GNBA 4WDUA 2PI6A 1LECA 4GQBA 3TAKA 4GC4A 4CD4A 3RCNA 3M7SA 1RVKA 3L4TA 1NXMA 9XIAA 3UG5A 1M06G 4AC7C 2GAUA 3S3GA 4BQ2A 2YXXA 3KS7A 2OR2A 2QQKA 5JXHA 3HMCA 3MS8A 4GKXA 3WX7A 1MYRA 4PRRA 1LORA 4HTYA 2XIOA 4FTSA 3X29B 3FJ4A 1GNYA 2VDIA 2Y0FA 1RIRA 2Y0OA 1XRSA 4OHYA 3WLIA 1R081 3WP5A 4C91A 2C0AA 5LHEA 4LPLA 1MEC2 2GN7A 1SZEA 1YYNA 3EDDA 2R063 3N6QA 4H6KA 4MUZA 4GWNA 3EX1A 3O9NA 4AMCA 3NO1A 4ATWA 4L11A 4KQNA 1KA9F 2WOQA 4QPIA 1A5UA 2RJ2A 3MZNA 3TYEA 1OLMA 1W8OA 2PTMA 3C7FA 3G6LA 3QFEA 5KC5A 3SIZA 2ZGQA 1MXSA 1I60A 4OTKA 1U33A 1JYNA 2PSNA 4GPNA 3IK2A 4H3WA 4N9IA 5FYIA 5FP3A 5JMCA 1PX8A 2OSXA 3GXPA 4O50A 4C6MA 2WFF2 1HP5A 4H83A 5KXCA 3CYVA 5E70A 4LUTA 2C1IA 5CBJA 4N6FA 2LTNA 2ZXBA 3WLPA 1W1VA 3HN3A 4S3BA 3ALQA 4P8VA 6ENLA 4WXYA 2R043 2HKXA 5E6ZA 2YGLA 4URIA 4HNVA 5FEZA 5FR3A 1VF8A 2QYGA 1G7VA 2J88A 2Q3RA 1PDYA 4KKXA 4ZBCA 2WYFA 5F1UA 4XVDA 4L4PA 3LENA 4EWDA 3RRAA 1XRVA 5A8OA 4M19A 2XH6A 1W6NA 2BUKA 1ZBKA 1HJQA 1MNZA 1AR83 3QZAA 4ZODA 2K0GA 5DUWA 4ATLA 1QNVA 3WMCA 4MGIE 1S2TA 2YLAA 3W6LA 3JQWA 1NFPA 1XP3A 4R52A 4DF2A 3H9AA 1P4CA 3NNFA 2PC4A 2FDJA 3E5BA 1ZJAA 5KHIA 3FJ6A 5FMOS 1CNVA 5FF0A 1UPIA 4XBKA 1Q3EA 1FP8A 2YG0A 1EQCA 4A2SA 4BIOA 3VBUC 4CDXC 5F9TA 5I3HA 4C6FA 1QJX1 2ZX4A 5EPAA 1QI5A 4F2BA 2XHKA 1H0GA 1H62A 3LIHA 1AL21 1KDKA 1YCIA 3PJYA 5FMBA 2GQ9A 4GZJA 2GVJA 2WZEA 2Z0IA 3DGBA 1ZL1A 3AIVA 4YVPA 4XZHA 5LBEA 1R30A 2HROA 3CC1A 1YMYA 3NJ3A 4B5UA 4F8XA 1GNXA 2DSKA 4YCOA 4UBGA 4OHZA 2Y6GA 5FIXA 3RPDA 1AXKA 3ILFA 4AGRA 5DMNA 1O12A 1HXJA 3VI2A 2PDYA 4JRLA 5AFEA 5D02A 2XBO3 2L5HA 4FI4A 8RUCA 2WC7A 2JICA 3A6OA 3FJLA 3M5ZA 3KZPA 5FYHA 4JZ5A 3LTYA 5A7QA 3VE9A 2WZHA 3JZUA 4HBNA 4K1GA 2E28A 1DEDA 1IHIA 1G9DA 1LRQA 1GOWA 3I4IA 5DZEA 5CYYA 5BRQA 3IDEA 3NV1A 4GXWA 3T55A 2OZTA 4OUSA 3W1NA 3E6EA 1EC8A 3B7MA 5B7ZA 1XBVA 3BV4A 4A6SA 2VMCA 5FJJA 3T44A 1XM3A 1Z42A 2VW1A 3R13A 1PUDA 1D7KA 2Z2SB 4QB6A 4K8RB 3CF6E 2NXHA 1QR7A 5DT5A 5M03A 4XBSA 5FLJA 1M7PA 4GUHA 1E0UA 3W4RA 3B0VC 2QDDA 4XKYB 1UASA 2R24A 1SMDA 4B5XA 1RSCA 3WLNA 2YA1A 5DUXA 1G8WA 3CV7A 1QXRA 1YEYA 2XG3A 3WL1A 2YHJA 2PDFA 4ZPIA 4KCUA 2NV9A 1MQPA 5FV3A 1KTBA 4MGSA 1KLZA 4ZQMA 1J4EA 1FYUA 3BAXA 3KTCA 4IGOA 5IK4A 6REQB 1OINA 3GZAA 3M0XA 2RS53 4KFPA 4XUYA 5CJNA 2BWAA 5JPMB 3DOPA 4BHYA 2WMJA 3VGGA 2Y33A 2A3AA 3HBLA 3NOEA 1AG1O 3BJTA 3AYTA 3OLEA 5HULA 1JDAA 2HYXA 2QFEA 1HZYA 2CZVA 7ODCA 1U30A 3GYCA 4P5HA 2VZVA 4CDUB 4WR3A 1SLIA 3E5QA 3WQ1A 4FLRA 5E6YA 2W62A 1K9TA 3MVTA 5EYWA 3PSVA 1E6PA 2JEQA 5G4HC 5FJRA 1TE6A 4AVFA 3LCFA 3DX5A 2OLAA 2JF6A 4ZB2A 2XWEA 1NCRA 4JIQA 3A7QA 3VC6A 1VBD2 3NCOA 3TSDA 3RZKA 2HWD2 1TVNA 4PF5A 4HKWA 3QZ6A 1YX1A 4ZO8A 3PZOA 5F3CA 1S5WA 2YYTA 3ARSA 4HNTA 2R1DA 1W91A 1E9YB 1ONXA 3U4XA 5C8CA 6CGTA 1JDCA 4I7WA 4BA6A 2WS91 1YNPA 1F4AA 4Q3MA 3TXZA 5FY8A 5L9BA 3N9LA 2DFCA 3MO7A 2PDBA 3SBFA 4UAPA 4DO7A 2QDRA 4YVWA 4ZXKA 2AOSA 3O1UA 3E96A 4B91A 2Z1BA 1LHNA 3WVJA 4Q4PA 4YWSA 5BNKA 3STEA 3WOGA 2POZA 3SQMA 3NL5A 3AMQA 2NXGA 5RUBA 1LP6A 4IOTA 4ZCWA 3URNA 4M6PA 2FDGA 1MS5A 3IS4A 2UWBA 5ACA3 4UF0B 4PBEA 1R092 4J3UA 1R7AA 4B15A 4XF1A 3VBHC 1OABA 1C57A 4CRQA 1K9EA 4XISA 4AAPA 3VGFA 3SQOA 3NQBA 5L73A 2NZ9A 5FIPA 1LHUA 3ZYGA 2RJHA 3PF3A 5JBFA 3THDA 3KP1A 1SLTA 4YARA 2DVGA 3WLUA 2DZVA 4KFNA 2QUOA 2PHRA 4A3UA 3VDAA 3PWIA 4QQPA 2IUWA 1DE5A 4DM1A 4ADSA 1MEC3 4LCQA 3THQA 1C8NA 1V3KA 3OODA 3J4UH 3ZOIA 4XAYA 5ABGA 5EMUA 4P9LA 4NU7A 4PMJA 3QV6A 1S38A 3D0CA 4Q7IA 1TPB1 1VRDA 1AJZA 1V7YA 4Q1PA 3IARA 4E4ZA 1JYXA 1TPUA 1GQPA 4LKSA 4I02A 2ZZJA 5AN7A 2PRLA 1K1DA 1WA3A 5T8GA 5BNNB 2YLLA 3TH6A 5I23A 3K3OA 3ZT7A 2YKKA 5HINA 3URQA 1FOD3 3STFA 2QW5A 2ZMNA 2Q0AA 1XISA 4ZB5A 1V6KA 2J8TA 2NVDA 1EHAA 2BP6A 3DCPA 1LM1A 4UUIA 1H7NA 1Q7ZA 3FYOA 1ONWA 4DBWA 5BWFA 1POV3 4IXHA 2GSYA 2FB3A 1GNZA 5I07A 5C9RA 1XSIA 5AHMA 1SLLA 4ES9A 2X41A 3L4ZA 4JQ1A 3W7MA 2F6KA 3O0XA 4F48A 3BAKA 2XJ7A 4UTKA 3CHVA 2ZFAA 3RK8A 5A6LA 4Y26A 3HG2A 2P8CA 3I4KA 1JRBA 3ZVIA 3T09A 4DI9A 5T26A 3O1MA 4NIHA 3USUB 1RUJ1 1DWHM 4X0NA 4XZNX 4G1NA 2VOXA 2EG6A 5IJRA 5A6AA 5HQLA 3R2GA 4FAGA 4BQ1A 2VENA 1ISXA 4WF7A 2OKTA 2BTMA 3VFLA 1KM5A 1LOAA 4GYPC 1BSLA 1EC9A 1JGIA 3AMGA 3OQEA 3GSMA 5D4YA 1NP0A 2QR6A 3A4UA 1UWSA 3ZXLA 5E8AA 2BWCA 2LM3A 2WMIA 4LS0A 5JI9A 3VIHA 1TMHA 4FQ4A 3GG7A 4DEVA 5DCEA 2OUJA 1C93A 1RVGA 4D6RA 4O4VA 1I0BA 4YTRA 1RITA 4S2CA 4RN5A 5G05L 4M6UA 2QMKA 2VCCA 4DZAA 2ZTJA 4ERGA 4IH3A 3O5SA 5DX7A 3CGTA 1SUXA 2WC4A 3JVAA 1PVXA 1UY1A 4GGBA 3WELA 1HVQA 2VXJA 4IESA 3OHIA 1W39A 1N7KA 2G37A 4RDYA 4ML4A 4GKYA 3HN1A 3LE0A 3Q8BA 4DRVA 3MW7A 3RITA 4PDWA 4DMIA 2IXKA 1GWMA 1KR0A 3FXGA 4W5UA 5F7UA 3PZVA 2Z29A 3WLRA 1JD7A 2WDBA 1KD0A 5I8SA 2Y7GA 2B0MA 2WZTA 3PZ9A 1ZSXA 1S2WA 1YQCA 3FBYA 1LOGA 5FOJB 1ZQ5A 1N1YA 4N53B 1HO1A 2DIEA 4LOCA 1HRV1 3ALGA 4ZFMA 2XL7A 1B9BA 4EXBA 3F1QA 3FEQA 5HMDA 3AAMA 2VNOA 1GR3A 2Y7DA 5ECUA 2V2HA 8CGTA 5F2LA 2CLMA 2JIJA 3ZYRA 4Q4Y3 2JG9C 1D0GA 4LA3A 2HVNA 3KWXA 4AFYA 2HWE3 1B3ZA 4PIXA 4V33A 3I65A 3GNRA 3WLHA 5IK7A 4AY1A 4BI5A 2LALA 5FXWA 3EGJA 4DUWA 3LM7A 3VD5A 5CZTA 1NAEA 1EXBA 2YB1A 3ABXA 3KV6A 3RJRA 3NTYA 4LAOA 1E9LA 3SRHA 3T42A 4J40A 2WSKA 2GYIA 4BJHA 4QXKA 4BK4A 4B8EA 3B97A 5DELA 2G9ZA 4MNJA 2REQA 3M64A 3CL1A 1LLZA 1S2EA 2QQVA 1BF6A 4IIBA 2EXJA 1ITQA 3TN4A 3BOPA 2XLGA 2J47A 4MGYE 4MOZA 5C3SA 1ZUAX 3M0YA 1FOBA 3TYJA 2PCQA 4A7KA 4CDQB 4HHMA 4HXCA 2XPJA 1K5MA 4QT6A 1XGDA 3QW4B 1RTVA 2W0XA 3VHOA 4M7TA 3FIGA 3IWPA 1QNSA 5A6JA 3BUVA 3QTPA 4XZMX 2VUJA 5FPLA 2BWGA 3WNXA 1OGBA 3G8RA 1VIWB 1QUMA 4JOMA 1HW6A 1AX2A 2ZGNA 3ZMRA 1M41A 3OQ8A 2H6CA 3FAWA 4E38A 2F6BA 3PUGA 1CESA 3NJXA 4DIQA 2VZRA 2YBUA 5FYCA 4K6BA 1FCBA 1B1YA 4IXXA 2YX0A 1WKYA 3QACA 4P5YA 4R9AA 3FLPA 1EJVC 4GIEA 2EGZA 5D2WA 3HO8A 2RDRA 3TTYA 1UCXA 2QV4A 4IEVA 4AWDA 3RM4A