4UFLA

Mouse galactocerebrosidase complexed with deoxy-galacto-noeurostegine dgn
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
644
structure length
641
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords GALACTOCEREBROSIDASE
total genus 216
structure length 641
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4uflA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4uflA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uflA01
1FUYA 2FJKA 4O0KA 3SGUA 4OQVA 1EWDA 3F1QA 4HMEA 6ALDA 1S46A 4TVDA 5F4SA 5JBDA 2XWDA 3G1SA 3PG8A 2VQTA 3AIBA 2J8GA 2V3GA 2ZA2A 5AYYA 3MI2A 3S2CA 4Q4KA 1H0GA 2G3MA 5FK7A 5K7JA 4HMDA 3T7VA 1PL9A 4WJXA 1NP2A 1GQJA 3AS1A 2ZE0A 2IXUA 4QP0A 2OWXA 2ZUMA 3KE0A 3DKJA 3G0XA 5EA9A 3NQAA 3W7DA 3AZTA 3F5LA 1ISYA 2WK2A 4YHGA 5CGQA 3BMVA 3E1F1 3CM4A 5K9XA 1FP8A 1TCDA 2JEQA 4AD4A 3U6WA 3PS7A 3F5KA 2ZA3A 5DLCA 5I3HA 3V1PA 1GWJA 5CSYA 2HMCA 3KL3A 1ZHAA 4R33A 2ZRUA 4ZMGA 1MXSA 4UIOA 1WDSA 2W4XA 4CVUA 1G4PA 1XC6A 4N6EA 1RD6A 4AZGA 3BAJA 2J78A 4Y6GA 1GNXA 3APGA 3QR3A 4NX0A 4KFPA 1GONA 3EDKA 3GNDA 1NWUA 4PMDA 4UZUA 1OCQA 1O60A 3LPPA 1MVYA 4XTIA 1K7XA 2CHOA 1VR6A 2Q8XA 3BARA 1X7FA 2PC8A 4U5KA 1VLIA 4ACYA 2J7BA 1C93A 5D05A 4RR4A 1K9DA 1KTCA 1W2TA 4NF7A 5I23A 3BV4A 1KLYA 4ZXLA 1SZGA 3E02A 3HOJA 4UR8A 1F4AA 3ARXA 1KFEA 3QGVA 3QMSA 1E9LA 3T55A 1J0HA 4RZ5A 4WF7A 4P7QA 3IAPA 3T4CA 1PCWA 1ISVA 2Y7EA 4GNJA 4UOZA 2QLYA 3O16A 1C8YA 2VC9A 2E77A 2YFOA 1JNEA 3WQ6A 2QCHA 5FCZA 2BXZA 5K4ZA 1W5OA 2YW4A 2ADEA 3L0NA 1OG0A 1YLVA 3O06A 4UTJA 1QNSA 3LGEA 4QLKA 4RJEA 1LDCA 5E70A 2QCDA 1TR1A 3HG3A 3TTOA 2X0YA 2X1TA 3W87A 5G1YA 4HT3A 2VCAA 3ZS4A 3CO4A 4ML4A 4NJIA 1G01A 1UHVA 1OX6A 2MANA 2XYLA 1HIZA 2CBJA 4F79A 1Y9GA 1WCGA 5FI8A 4A22A 3PZIA 1UWQA 2C0AA 3STFA 3U2OA 4WOZA 4E2DA 3W7RA 3I7RA 3ZSTA 1LBMA 3C3NA 3B0UX 1EUAA 2Y6ZA 1H7OA 4J27A 2RDWA 3AZSA 4OBSA 3WL0A 3UG3A 1BYBA 3TQVA 4E4PA 4FNTA 1BVNP 2NX3A 4FLRA 4MB3A 5CSUA 1TPC1 3G22A 2DZUA 5C55A 1EP3A 5EL1A 4FLOA 3KRSA 2HISA 4HP5A 4WKHA 3LTPA 1CGTA 1UOKA 4UCFA 1W3NA 2ABAA 3N11A 3PZTA 1QWGA 4UNKA 1VFMA 4QLLA 3RCNA 2TAAA 3WSUA 1UQYA 3SCNA 1KM3A 5HOSA 2ZX7A 5C71A 2WKGA 2W61A 5A1AA 4W8AA 5CPNA 1EHNA 5BWFA 3LI1A 3C2FA 4ATWA 5CPTA 5A2AA 2XN1A 1VJZA 3WELA 4DPPA 4K37A 3WQ5A 3MW7A 5FF0A 2WANA 1C92A 3LPOA 3DHPA 1SFLA 1FFRA 4PTWA 4O15A 1CECA 2WAGA 4GZEA 1PCKA 4FNQA 2PWEA 2Y24A 2YCEA 4H8UA 4XZWA 5C8BB 1U83A 4JFUA 3UD6A 2TPSA 4K8EA 1RP9A 7CGTA 4XUYA 3PSWA 3IJ9A 4MY8A 1L6WA 3ALFA 2AGKA 3G1VA 1ODUA 4U3AA 4N9CA 1BEUA 3MYPA 3HPSA 3LRLA 1E72M 2DIEA 2UWFA 3KAOA 4TTUA 4W84A 3CIWA 2CBVA 2V81A 3BG5A 3GLCA 4O16A 2GJPA 5L9FA 4Z2IA 1JZ3A 5D32A 4B3KA 3UZJA 5FF7A 1UKPA 3DXIA 3G24A 3TC6A 3UWZA 4JIPA 3K1DA 1GEQA 2OYMA 4PYSA 2BY1A 2QCGA 1JL8A 4Q32A 2VL4A 4O50A 1I1WA 1UUQA 4PODA 2CERA 4MKNA 3A22A 3P7YA 1XYZA 3O07A 1JDDA 3BVJA 2QMKA 3M46A 3GNOA 1GORA 2Z1BA 3OVQA 3HG4A 4UQBA 3G1XA 4JD4A 2DZPA 4X0NA 3IIVA 4RL3A 1MEWA 3THQA 4PTMA 1G69A 1KGUA 1YDVA 4RXFA 1CIUA 5LKYA 3WNMA 4UTUA 5HR6A 1BGGA 1V02A 1V08A 1UA3A 4AZCB 1M5WA 4MJZA 1W9XA 2UY5A 1C8QA 1XGZA 4Q7NA 3BO9A 3AO0A 3WH7A 4LQ1A 3L4ZA 3KL5A 4FMVA 2Y85A 1JGIA 3LTSA 3G6MA 3P5ZA 1VBRA 3IIPA 3T09A 4Y7EA 1OFQA 1BF2A 3L4YA 5IHRA 4WK9A 1LBFA 1AW5A 2A21A 3UR7A 1KFCA 3A21A 3RF9A 3NQMA 5LNSA 3IANA 3C52A 4M24A 4PMYA 2YW3A 5AOUA 4KWWA 5FEPA 1O7AA 3IIZA 5DT7A 5EFFA 1EB3A 4GUFA 3CC1A 2XGIA 1YXDA 3MV01 3CHEA 1XXXA 2V0TA 3G1AA 3IJ7A 4D6DA 2O7QA 1TV8A 3GYCA 3BXWA 3W2LA 4FFGA 1OD8A 4OBTA 4UQCA 2CZDA 3NSMA 4RE3A 1EOMA 2XQRA 4YCPA 3CMJA 5CQ1A 1EA0A 3GAKA 2ALDA 2X16A 3ELFA 1DWAM 1MEIA 4V27A 3SCTA 3OEXA 3UPWA 2IQTA 1DKWA 4YLWA 1GVIA 2VX4A 3A4WA 2NWSA 1TMQA 3RIKA 5D30A 3LCIA 1NWRA 5CJ5A 2VMFA 2NUWA 1OT2A 2BY0A 1VFFA 3CZJA 3LLDA 2DP3A 4DBEA 4DWSD 5A6MA 2J25A 3R89A 4JR5A 2V2HA 2PRMA 3GDMA 1OIFA 4IPJA 4PTVA 3LLFA 3TCEA 1KR1A 1M6JA 1JVNA 4BR1A 1Y9MA 1ICSA 3GIYA 4HIBA 5E09A 4JDBA 4GPNA 1ZAJA 4OV9A 4NU7A 3SCUA 5I78A 3OBAA 1GVFA 2NV2A 1X1OA 1B3OA 3MJYA 2Y4SA 2GVJA 1EIBA 3VINA 4JTHA 3CGTA 4L4MA 3AROA 2DQXA 4BWLA 5I3FA 4B16A 1KLZA 4JY9A 2Y5EA 1VYRA 4ATDA 1JF6A 4D6FA 1GOOA 2AQWA 3BMWA 1OIMA 2XFRA 3WEMA 2IXVA 1IXPA 1WP6A 4NRRA 3LIHA 1JCXA 1G4SA 4EOUA 1WAWA 5IXEA 4E0CA 3AI0A 3BG3A 1NOUA 3WFZA 1OX5A 3SCQA 2I14A 2X30A 3ZM8A 2G3IA 5D37A 4OBRA 3S1VA 3PIJA 4XZ9A 4IPLA 3W1PA 3EEGA 1E6QM 3NMBA 5DCBA 5FIXA 3FW6A 3MWAA 3MO4A 2XG9A 5CPLA 2YKKA 1RZMA 3OIXA 3ZT6A 1GG1A 1NEYA 2HSAA 2JKAA 2V5BA 2CIPA 2V3FA 3CHDA 5I2UA 4ZQMA 3PR2A 3G1HA 3S42A 2VFHA 1SW3A 5AHMA 2BV9A 3CUIA 3VIOA 1C90A 5HINA 1BG4A 3QMRA 4MTVA 3T2OA 3M5VA 4U33A 5FF4A 1C29A 5TQLA 1VPXA 3C6CA 2O9PA 3AHXA 4BK9A 3TSMA 3VGEA 3VX1A 1J10A 4Z2JA 3NQDA 4H8VA 3WF4A 1BYDA 4M7SA 2E8YA 4MVAA 3GXDA 4I9AA 3LPFA 5GNYA 1EO7A 4CCCA 1I2PA 1SZEA 1VYPX 2ZCGA 1GW1A 3M6DA 3TW7A 2W6RA 3TU9A 1TE1A 3OLDA 1PIFA 3HGOA 4LUJA 3S5QA 1SO4A 3MHFA 3UWWA 4AD1A 3PN8A 3ZT5A 3MP4A 3AJXA 1LZOA 4FB7A 3GXPA 4MAVA 3EMZA 4UTTA 1HNYA 6CGTA 1B1YA 4WY0B 4CN6A 5A8PA 4A3HA 5AHIA 4GBUA 3TC7A 2VVNA 3W24A 3M7SA 4KWUA 1ISXA 3KRZA 3NQ7A 4AB4A 2DZSA 1BPLB 1CGWA 4O19A 2NXHA 1QBAA 1HJUA 1FXPA 1WDWA 3A5VA 1JYXA 1JZ5A 3W2MA 1TV5A 3MMWA 1E55A 3LHTA 1YXCA 1OB0A 2VZUA 2CZFA 1ICQA 1DHKA 4CU6A 2TRSA 1PX3A 1XL9A 2VX7A 3SURA 3HIJA 2J88A 5AN7A 3GR7A 3QW3A 2J62A 3NAVA 4UFJA 4XUGA 3EX3A 5F2LA 1W1YA 1VIWA 4HOZA 5G4WA 1YPIA 2YX0A 2D0FA 3SCWA 3HF3A 1D7FA 1OF8A 2ZXQA 5FKBA 3GNRA 2VCCA 5BCAA 3GVGA 3IEBA 3PB0A 1E5JA 4WXZA 2QQWA 1P0KA 4E38A 1BFNA 1DORA 3O05A 3GKAA 3OLEA 3LFIA 5CG7A 1FWNA 1ZY9A 2DZWA 2ZX9A 3WF0A 3ZJ6A 4CUCA 1ZU8A 3AIQA 3HU7A 1DQWA 3VGHA 4POCA 1E6ZA 4X22A 1C8VA 1UKSA 4M5PA 3CHFA 4O54A 1TA3A 3SW6A 2V5DA 3GXFA 1P0NA 4HXCA 2HS8A 3P82A 3KX6A 2RGLA 2ZFAA 3O15A 2Y62A 1QW9A 1G67A 2QAPA 2E5CA 4XKYB 4OUEA 1JG9A 3NQVA 2GVYA 1SO3A 1CYGA 3DYOA 3HGSA 1SO6A 3CB8A 4BQ4A 1XH0A 1RPKA 2NZLA 1ML1A 2WBKA 4HOWA 2ZWYA 5AHEA 1EH9A 4Z2HA 4WOQA 5CPSA 4HMCA 4YCOA 4MADA 4ZXOA 2HTMA 1DWFM 3CZGA 3C61A 3W2UA 1AK5A 3BLFA 2V2CA 4IMFA 4TVCA 2EKCA 1GJPA 2P1FA 3IGUA 1VHCA 2J8FA 3UEQA 1XDMA 3PTKA 2VNCA 4ZQOA 3AMKA 1G0CA 4UTLA 1EX5A 4M8UA 3WMCA 3VE9A 3U5YA 2FH6A 5LZLA 3FYPA 5DT5A 4M81A 1F74A 3L21A 2J47A 2VR5A 3MUZ1 3FJ6A 4F8XA 4OT7A 3ATYA 2CLOA 1H50A 2W79A 4XWUA 5L6UA 1XCWA 1J11A 4YMZA 1XSIA 1PJ9A 3DAQA 3UCQA 4MJ2A 1GVSA 5HQEA 4O1AA 3HPXA 4JL2A 2OXBA 1GG0A 2V5LA 1QHPA 3VIGA 6A3HA 1QNPA 3EX4A 3TK7A 3N34A 3PG9A 2BFGA 3DGRA 3K4DA 2XGBA 1QPOA 1OFAA 4TU1A 3NGJA 1DWHM 4AEOA 3THCA 3CZLA 3I6RA 3SIMA 4AD2A 1O5XA 3LCFA 1R8LA 5BNKA 2E8ZA 3OB8A 4DF0A 4C7DA 4RLIA 4IM4A 5E6ZA 5AYZA 3WK2A 2V9DA 1K9FA 4TTGA 1KBIA 1TPUA 3ZWTA 4XX6A 4UNIA 1PPIA 1OGSA 2VZVA 3AMDA 4RCXA 3UG4A 1H1YA 3QEZA 4ADUA 1IIGA 4AHQA 1C9DA 5D04C 1V3KA 1VLWA 5I3GA 4PH6A 3GDLA 1E71M 2QKFA 3G8RA 2XUCA 3NDZA 5E6YA 1VYSX 2WNZA 4UTWA 3W74A 1L0PA 1I2RA 2BHZA 4JNMA 1TV7A 1DL3A 4QIUA 4XQ6A 4UTWC 4FEZA 3TQKA 2YYUA 3VO0A 4AXNA 4MB4A 5ABTA 1KXQA 4PMNA 2NXIA 1SR9A 4WSKA 3M0ZA 3LF7A 3NVTA 2QDHA 1FCBA 3W1RA 1OK4A 4ACZA 4H2CA 1A53A 2OWWA 4OOZA 4ZFMA 2YBUA 1YTEA 3EDDA 3SCRA 3CEPA 1RQEA 4OJYA 1QW8A 5AC4A 1JRCA 3W76A 1OFDA 3AXXA 2VT0A 2PC4A 4CLMA 3N1AA 3B8DA 1W54A 5KMYA 3SUTA 4RZ4A 3M5ZA 4U2YA 1X6UA 2QCCA 5EPDA 3VGDA 3CZEA 1EP1A 5DXYA 1O4UA 3AIUA 2WB5A 1HP4A 1S5VA 2DSZA 1V6YA 5E0KA 3EMCA 3HJZA 5DCDA 2VRJA 3ARUA 5BYWA 1XFBA 1S5WA 4NXSA 2XN0A 4GJ1A 4GIAA 5FL0A 2ZRZA 3CQ0A 3TXZA 4Z08A 4IPNB 2X1UA 3W7EA 4X9YA 3BAWA 3NZRA 1FHLA 2A3HA 5I24A 4QLJA 4DEFA 5AFDA 2Z2UA 4K6AA 1WBJA 3M7WA 2VUYA 1K9EA 2WJZA 2J9XA 3A9IA 3WNKA 2GUUA 3D3AA 4JTGA 4K7VA 3OG2A 1LF1A 5CZJA 2EPLX 4ATLA 2D24A 4AZBA 1R47A 3WNOA 1TVPA 5IBXC 4B1MA 4M19A 2J7GA 4UQ9A 4CU7A 3N19B 1BVZA 3O63A 3QOKA 1JUBA 4FIRA 4AF0A 3VIHA 1KFKA 1W9DM 5A94A 3EX1A 1H49A 3W7MA 4UTKA 3VD5A 1YTKA 4XKYA 5K9DA 4NJGA 1A50A 2BS9A 2WXDM 2Y70A 3HPZA 2ZWZA 2GQ9A 3OIHA 4HZ8A 4CN4A 3NZ1A 3LHWA 1QCWA 2CITA 2YSWA 2DH2A 4D2JA 2EPHA 2QJHA 5D38A 4TX8A 4J3XA 1OYCA 4IWWA 1ODZA 5AYIA 1HJWA 1NM9A 1H7PA 4O4VA 1RQBA 4JIEA 1RPXA 3A4XA 3FA5A 2YPIA 3L5AA 1C8XA 2ZXBA 4PA8A 2FFCA 2YL8A 3ARPA 1R46A 3PZMA 2X0HA 2P10A 1E1EA 2NUYA 5G2WA 2VX6A 2YBTA 4JCMA 3W37A 5A6AA 1FY6A 2FB3A 3MUY1 4N6FA 1JYVA 4WLCA 1XDLA 4IGHA 2XFWA 4BQ3A 4C7FA 1K6AA 5EYWA 3F4VA 1KQZA 1K7FA 2A3CA 2VFIA 1FBAA 4OGZA 4A2RA 1CGXA 4JHOA 4UFMA 1P6WA 5KTLA 4R5EA 2CPUA 2PB1A 3U57A 4JKMA 4HOXA 3MKKA 2OWCA 2X2YA 3WH5A 1QFEA 1JDAA 3VNDA 3LB0A 3E49A 3CPUA 4PTNA 1R7AA 1W2VA 4Z1DA 1B57A 1V0NA 5I0DA 4UFHA 2NX1A 3QRHA 4CQAA 4MLJA 3L4WA 4ZENA 5BW6A 4NSBA 1LOSA 3BK0A 3PC0A 4FX8A 4FIQA 4C1KA 1W9PA 3NJ3A 5IFTA 4GC4A 1E1FA 3MHUA 3N2MA 4IX2A 3SUUA 2GDVA 2RDTA 1GZJA 1TB3A 1W5NA 5HUOA 1CZ1A 2EBNA 3TIMA 1VRXA 3KVJA 1UWSA 1HUVA 4AZHA 4DF2A 1ZBVA 4NUWA 2XIBA 2VURA 1AQHA 1TJPA 3DU0A 4AISA 3TSBA 1QPRA 1FQ0A 1L6SA 4JCLA 2FGZA 4LW7A 1YXYA 3Q94A 1AL8A 1UYQA 3OGRA 2ZZ1A 1HO4A 2R91A 4HNNA 4ORMA 3NR0A 2JGQA 1B0IA 2E3ZA 4K68A 1H7RA 1RQHA 3NG3A 5HULA 3W7IA 3L67A 1X8FA 2CZ5A 2C6QA 4UFKA 3W7GA 3W7JA 1G5AA 4NXKA 5JUVA 3MBFA 1PIIA 2ZXAA 2VXNA 3TMQA 3ZR6A 3PZVA 3WF1A 1WYIA 4X0VA 5BROA 8CGTA 2E1DA 3C0JA 4I7UA 3QPYA 4GWEA 3W38A 3WD0A 5CZTA 4TR9A 1Q6RA 1US3A 4HA1A 3G3MA 3WD4A 1U5JA 3WK1A 1HTIA 4M29A 4LVBA 4FFIA 2PRLA 4U28A 3A6OA 2C8NA 4UTMA 4N02A 1VFOA 4UR9A 1B3YA 2YXGA 4HPJA 4OHQA 4PMXA 3O1NA 3N15A 1KM5A 3FYOA 4RE4A 3VIMA 4JYEA 4GI8A 3TTQA 5GNXA 2X1IA 5D9MA 4JYDA 3G0UA 1LL6A 1K8YA 1TVNA 2EF9A 1E0XA 2WW5A 3IVUA 2ZX8A 1E70M 1XSJA 4LYPA 3W70A 2V3EA 1QDSA 3KZSA 3AXHA 5FL1A 1H51A 1H1ZA 1CDGA 3BCDA 1TPB1 4FXRA 2B7NA 3M5XA 3AHZA 2X8RA 4ZEPA 1UYPA 1I8JA 1PHWA 4UTTC 1HN1A 1QI4A 3SGZA 4IJBA 1DHPA 2FB2A 4JHZA 2WKJA 2C19A 1HX0A 5A8QA 2W0UA 3EWBX 5TBOA 3L0GA 4D6IA 2BLEA 2WMIA 3LCXA 3RM9A 1T99A 4AZ6A 2FH8A 2ISSA 3IIOA 3MP3A 4PCFA 2OSYA 4X3ZA 5FIPA 1H3GA 3TUUA 4IQLA 5CSSA 3L66A 1M7OA 3W7NA 5H2ZA 3W07A 4JKLA 3VI2A 4ONVA 1AVAA 3DH7A 3QZEA 3AYSA 4DUWA 3B05A 3LHVA 3VE7A 3BAXA 5JIPA 1K7EA 4BF9A 4MNKA 1W9BM 2V5CA 3OHIA 1CI1A 2EQDA 2ZA1A 1ZJBA 4NQ1A 3W6MA 4AAJA 5KSWA 5BRBA 5DCEA 4MJ4A 2WNQA 3VNZA 3W7LA 5EB8A 3IVSA 1GJWA 1VF8A 2G96A 2XTKA 4OU1A 3N9RA 3AHVA 3LBCA 3MO7A 2WLZA 1GTEA 2A2IA 2VEKA 1DWGM 1JI2A 1MWOA 1X1NA 1TPWA 2F84A 3CHVA 4JICA 3C2RA 8TIMA 1FX6A 1MW1A 2WMHA 3HMCA 3NEVA 2JE8A 1GQLA 2CETA 3WQVA 1UB3A 3CUHA 2WO5A 1OYAA 4O11A 2VI0A 4D1IA 1R86A 2WVUA 3SUSA 4ZE5A 2A0NA 1RD5A 4LU0A 1E40A 1H7WA 5G5IA 3TAKA 3W7PA 3GB6A 5KITA 3WDIA 3UZ5A 3HGJA 1K9TA 2YJQA 4Y90A 4BFAA 3BAYA 4PUEA 1ONRA 1W5QA 3W1NA 1PZ2A 3TA6A 2EPMX 1SR0A 3GXNA 1W91A 3VD7A 3DI0A 3KF5A 1SFJA 3QFEA 2J7HA 3NQFA 3SR7A 2J7CA 4QNEA 2CBUA 4JX6A 1PIGA 4LRTA 2EXOA 3SUVA 1W3LA 1AMKA 1PZ3A 2BY3A 1LM1A 3T0BA 2QUTA 4HN4A 5E1QA 5F4XA 4P2VA 3MMUA 1LWHA 3QW4B 4FF5A 2CLEA 1HFBA 1HVXA 3QM3A 2OLHA 5LGXA 1JQVA 1UR8A 1E56A 2WMGA 3NPWA 1B4KA 1LRTA 4UMCA 3ZO9A 3MI6A 3KXQA 3THAA 2NV1A 1OFEA 4LS2A 3S5YA 2GQ8A 2QQUA 1UR1A 4MB5A 4P7NA 4P8UA 2C14A 1KGWA 4XBKA 2Y7GA 1B90A 4D72A 1Y0EA 5CPMA 3W53A 2PWFA 1BYAA 2ISVA 1HG3A 5C70A 1H0IA 3NL5A 3LXBA 3RK8A 4KMQA 2AAMA 3VM5A 3W1TA 2QHAA 1TJRA 1O5KA 4UTHA 3W6LA 4TO8A 3DFQA 3L4XA 4WZHA 4LPCA 3EX6A 5HPOA 3EWUA 2J9ZA 4FNSA 4XTDA 2QV4A 2WVVB 5HR7A 3L68A 4GUIA 1E0VA 1QO5A 5FMCA 2RHGA 1I2QA 1OWQA 2D0GA 2NW0A 5D03A 3EBVA 3CZKA 1MFVA 2P0OA 3OSDA 1W8SA 2CW6A 4O18A 4WXYA 5KZMA 1OT1A 2CHNA 2QPUA 1UD3A 2F2HA 4H04A 1QOPA 1OGBA 4ZQRA 2JKEA 3GDTA 2CBIA 3A4AA 2D73A 3SECA 1XBVA 1MQPA 1SMAA 3F5JA 4Z2GA 1PVNA 3LTYA 3USBA 3DHFA 2XSAA 4KRUA 1YADA 1IXOA 1LLWA 1J01A 4HZ6A 5CG0A 4AH7A 5C2XA 4P7RA 4B9YA 1NAL1 1G7UA 1ESWA 3VGGA 4N4QA 1AW2A 1JCYA 1Q6QA 1BTMA 1OSEA 3P84A 4AWUA 1TREA 1ZFJA 2C0HA 3WUGA 4EAMA 1XH1A 1LORA 1VEMA 2JK2A 5CKSA 1DWIM 2NT0A 1QMLA 4OOUA 3M9YA 4K36A 4DQWA 4J3WA 4HPGA 3VGFA 1UWRA 4MFEA 1FDZA 3OBKA 5I77A 2ADDA 1ME7A 1UD6A 3K30A 1VCVA 4L4PA 3UY7A 2G3JA 4S2CA 1TRIA 3VIKA 3A24A 3W4RA 5IHSA 3NL6A 3ABSA 4Y96A 4W8BA 4CKQA 3SY5A 1E4IA 2BVDA 4NI3A 3W9ZA 3NL2A 4QJ1A 4D1JA 1J9YA 1QPQA 3CBWA 1DVJA 1WDRA 4MDOA 4PCSA 4CD5A 2ZTJA 5HXMA 2ZRVA 4IXHA 5LA1A 5JBFA 4AMAA 2EGZA 2ZOXA 2RKXA 4DUVA 4L4OA 4GUJA 4CNOA 2QF7A 3ALGA 3AJ7A 3D0CA 4HTYA 1VBUA 2WCAA 3WIJA 3MSDA 2GJNA 3LHUA 2GOUA 3BLIA 1R2TA 2PI6A 4AYSA 3W1XA 3TXVA 4GI9A 3UQNA 1E73M 1FCVA 1HL8A 4J3SA 5ABFA 4B5NA 3I3EA 3T0AA 5A2CA 4ZL1A 1Z42A 2WVTA 5BMXA 2ZBTA 3ARVA 1W0MA 4I7WA 4B15A 4W86A 2GQAA 1A3HA 4CU8A 1BSIA 4HZ7A 4FO4A 4S3JA 3F4WA 5DMYA 1OF6A 1G7VA 2DZTA 2WOQA 4F66A 1ZS2A 2YL9A 4CD7A 3S1XA 4AY1A 2GJXA 3NL3A 3U7BA 3BGJA 4GXPA 4BCEA 1V6WA 1TPH1 2F61A 3PHAA 1UQZA 1ZL1A 2C18A 4Y9AA 4KFOA 4UMAA 3TNOA 2V30A 1QNVA 2E6AA 1ZB5A 1R2SA 1VRDA 1PV8A 1JZ6A 1SU5A 3IJ8A 3W71A 4QHZA 4UMBA 1V3JA 4GINA 4EF8A 2OSXA 4AMCA 5BMWA 2FIQA 3GTNA 4E8DA 4LVDA 4EVZA 3VMOA 1XD0A 3JS3A 4ZQCA 3HMJG 1MQRA 3II1A 3L9CA 3PF3A 3R2GA 1ICPA 4IOTA 3IMMA 1QPNA 3M1ZA 3UPBA 1J0IA 4AWEA 3TE9A 3W7OA 2X1RA 4BWLC 1QBBA 1UR9A 2YLLA 4W7UA 2VKZG 2A6NA 3CHCA 3GYEA 4GFSA 4D6CA 3UWUA 2PE4A 3WH6A 2E0PA 2QCFA 4DWSA 4MY9A 1NWSA 4Z1CA 1L2UA 3NYDA 5DBUA 3OA5A 2QAFA 2OX1A 1WE5A 3W22A 1U2YA 2VVSA 1JZ2A 2BTMA 2GK1B 3SI9A 3GH7A 4F9JA 5D02A 1LJYA 3VIFA 4X2RA 3T44A 3W81A 3ZJ7A 1NSJA 3M6YA 3HBLA 3NCOA 5CGMA 2CLFA 1QHZA 1LROA 2WSRA 1EPXA 3FHQA 1JI1A 2CLLA 3PSVA 3QC3A 3I3DA 1RVGA 4HKPA 3NPXA 1QI5A 2VRKA 3ZT7A 2TSYA 2E6DA 4KH2A 1XCFA 3VD3A 3O6DA 3U75A 4CQ9A 3NNTA 5MHBA 3PBUA 1BKSA 4O53A 3FKKA 1WDQA 3TJXA 1H5YA 4JXCA 1MFUA 4HA4A 3VOCA 1Z41A 2CLHA 1DJQA 2C7FA 4QAWA 2FHCA 1NF7A 4RX0A 2RH9A 4CD6A 1ZAIA 3GNPA 1RV8A 5HWJA 1KGXA 4H7VA 1OGGA 1U33A 5EY5A 3JRKA 5I5RA 1Q6DA 4LS1A 1E6PA 2G3NA 2UV8G 3NIYA 2WWCA 4N9BA 1E4NA 1GYNA 4LVAA 5HMSA 3ARRA 3TW6A 1QOXA 4AIOA 3W7QA 4WY0A 4U3CA 3N3MA 3TSDA 3RO8A 1NQ6A 2XM1A 2WCSA 3EX2A 3S1UA 3RPMA 2BX7A 4CCDA 3TFXA 4TUFA 4UQAA 3WBAA 3T2QA 1UH3A 3PZUA 4FLQA 3AOFA 3FAXA 2BVYA 3A5FA 3IVTA 3M5YA 4O14A 2J7FA 3THDA 4KKXA 4IXXA 2XVLA 4P8WA 2GJRA 2JIEA 1P1XA 3W7KA 5I3IA 3VM7A 4WKAA 4J9JA 2B7OA 1HJVA 1WAUA 5I79A 1K3UA 4I7VA 5A8GA 2V3DA 3HQ1A 3OLGA 3T40A 4HA3A 4PCTA 1JYNA 4UQEA 4DBDA 3L4TA 2VJXA 4O4WA 4MPQA 3QPZA 2J27A 2D3NA 3ANYA 2JFEX 3MU7A 1OX4B 2LLEA 3SFKA 3ZQ9A 4TX6A 1W1ZA 1HO1A 3BLKA 4J3TA 1KA9F 1MSSA 2H6RA 3VFLA 1EXPA 5KZDA 3L2LA 3L5LA 2E40A 2CU0A 4W85A 1VEOA 3LMYA 3FS2A 4U31A 2WPGA 3OLIA 2PRHA 4A2SA 3U14A 5A6JA 2G8ZA 4Z0SA 1JF5A 1ZJIA 2O9TA 1G4EA 2CKSA 1OHLA 1CNVA 3GZAA 4AIUA 1IT0A 1DBTA 1UG6A 5I3DA 2Z0IA 3WDJA 4QQ3A 3MI3A 3O2LA 2DSUA 5E0FA 1S3HA 4O1DA 2AC1A 1W3TA 2QEZA 1KBBA 3VVGA 3H3LA 1QI0A 1YDOA 3STEA 1EP2A 3GH5A 4BS0A 2B7QA 2NT1A 4DWSC 4WKFA 1CGVA 4FX6M 4ADTA 1LRNA 2PWHA 4JQTA 1LBLA 3N73A 1E3XA 4LVGA 4HU8A 1H63A 2B31A 1LOLA 3E9AA 1EQCA 1KM4A 1Q6GA 2WMFA 2Y89A 2QJGA 4D71A 1MZHA 2VZSA 4LV9A 5CSRA 5GQBA 3SZ8A 3NDYA 3RJYA 1YDNA 2WKLA 4PSPA 2ZUNA 4DELA 2I9EA 3CT7A 4ADSA 3WNPA 4XZBA 1OFBA 3GKFA 1F5ZA 5EBUA 1G9HA 1OYBA 1FH8A 2Y61A 3BG9A 1M01A 3RJXA 4NNAA 3E0IA 3S0CA 2WHKA 7A3HA 4CD4A 1XHGA 4WY0F 2J7EA 3QJAA 1CGYA 4NT0A 5DELA 4HNUA 1F2JA 1J0YA 3R5EA 2WZEA 1QNRA 3WENA 1H1NA 1B3XA 2PF0A 4U5IA 3SEPA 1CLVA 3AFBA 1IV8A 3RMJA 1GVYA 3ARZA 3CIXA 3T0DA 4FHAA 3WDPP 3LCWA 5D09A 2BSLA 3C56A 1YYAA 3TA9A 1BWLA 1UUOA 4KFNA 1Y7VA 5AY7A 1F6PA 4PL2A 3CUJA 1IIHA 4D6EA 2GJLA 2DH3A 4W8LA 4R53A 3P81A 1I45A 3NO5A 1OVDA 1ZBCA 3ZMRA 1Q6FA 3DYPA 4PEEA 1TTQA 3PWAA 2DJXA 3CLMA 5CGTA 1TQJA 5U7SA 1VS1A 2X1SA 2VZTA 2NSXA 5G2HA 2W91A 4UC5A 4ZZ9A 2D1ZA 3EXSA 2O7SA 3NDOA 2A3AA 2YA0A 3KWXA 3KRUA 3NOEA 4AZ7A 1US2A 3WF2A 1X6NA 1QPKA 3HO8A 3ZFHA 2E9MA 3WD1A 3MSGA 3WF3A 1D3HA 3POCA 2EAWA 2E5BA 3LIGA 2QCMA 1KM0A 1X6LA 3L5MA 2D20A 2DT2A 3UGGA 1OFOA 2WV8A 1V6VA 3MHGA 4LRSA 1XYFA 1JCMP 4MB1A 3W1MA 3EKZA 3QYQA 4H41A 5E0CA 2VELA 2E4TA 4M82A 3QH2A 2VTFA 3NQ2A 1D2KA 1UWTA 2CLMA 5AHNA 2E6YA 2F7FA 1ECEA 4W7WA 1JD7A 1DEDA 3LHYA 3TAOA 1K03A 4O8RA 2Y7DA 4NJKA 1JD9A 2XWEA 5D8WA 5FKYA 1ZENA 3SJ3A 4PMUA 1EQPA 3VTRA 1N7KA 4PUDA 2WHLA 3AIVA 3L4VA 3FNDA 3TONA 3A23A 2C1HA 1GVQA 1R87A 1AL7A 1JIBA 3LERA 3P74A 1CX9A 1FDJA 3AISA 3FKRA 1KQYA 3ARQA 3GDKA 1V6XA 2V8ZA 5KZ6A 4RK8A 5A3HA 2UY2A 4U2ZA 1SZFA 3DC0A 3H54A 1HJQA 2DPEA 2DSKA 4JS3A 3MMTA 2QDGA 2DIJA 3P5YA 3C2VA 1CW2A 2DT3A 2EPOA 2CCRA 2ZZ3A 2A3EA 3VMNA 1JAKA 1MO0A 2E09A 4PBGA 4B1LA 1BHGA 1DQXA 5GVJA 1E0WA 4DM1A 5EMUA 2BY2A 3GDRA 2F8QA 3FLUA 4NNCA 4TXEA 5A95A 2J24A 3BAIA 1KM6A 2UY3A 2YR1A 1Q6EA 5F1VA 1WNOA 1WZAA 4DM2A 3VD9A 1AMYA 5EBAA 1C7SA 3B9AA 1KXTA 3PB2A 1WA3A 1W1VA 4MAZA 2VRQA 3LCGA 1LL4A 1GZGA 3TTYA 5IBXA 1SUXA 1DWJM 2JEPA 2XN2A 1J0KA 5E93A 3B4UA 2FHFA 3TKFA 2J6XA 1OINA 3MP5A 2XFYA 1W5MA 2BHUA 2YL5A 4AZ5A 4M6QA 2H3BA 3UXDA 3S9YA 5AB3A 1DJNA 2OZ0A 3EWZA 2GUYA 4PTXA 4HU0A 1FHDA 4DO6A 3S8HA 1ADOA 1ST8A 4UR7A 4LV4A 2QF8A 2ZZ4A 4S3KA 3VIPA 5F2IA 3DFOA 4BQ5A 2JF6A 2BWGA 3NQGA 5GNZA 1FDYA 3A3HA 3K4AA 1V3HA 1GOKA 3VDHA 4GUGA 1V3IA 4S2BA 2CNCA 1KWGA 2CFFA 3WK3A 3LI0A 1X1ZA 1LRQA 3ABRA 4XBSA 2D22A 1MEHA 3RWKX 1TUXA 4TVUA 3MS8A 2D3LA 3MYOA 1R85A 4UFLA 1R30A 4FXSA 3T08A 4YWIA 3PZQA 1AG1O 3VIIA 2B0MA 4A29A 3G8EA 5EFDA 1GQNA 4FFFA 4XB3A 5D2VA 2BZNA 6TIMA 2H3DA 2ISWA 3DHUA 3SUWA 2FPVA 4RV8A 3MANA 4H6KA 1O94A 2X2GA 1H62A 1XUUA 3EXTA 1G94A 2DU2A 3L0KA 2XVKA 2RFGA 3P8IA 3CEUA 2J77A 1E6RA 3BW3A 3OVPA 3ARTA 1N82A 3QMTA 3KF3A 2W92A 3AS2A 1F7BA 1G6CA 3G3DA 1CPUA 5A6BD 3N2XA 1OD0A 1JZ4A 3IGSA 2AMGA 4CN1A 1TTPA 1XM3A 5DBTA 5TD4A 3IIXA 2D2OA 3FAWA 3EB2A 1GPWA 2XFFA 1UKQA 4YHEA 2WHMA 1O6IA 1RH9A 3CTTA 4O28A 3GBDA 3PY2A 4R27A 4R34A 5H91A 4LY8A 1MXGA 1V6UA 3YPIA 3CH9A 4A3YA 1F6KA 3TOPA 5D2YA 4OWGA 3WJZA 1ISZA 1UKOA 3MV11 3LBMA 1VC4A 1E43A 1E51A 2WHJA 1SZNA 1VZWA 3N9KA 1Z44A 1M7PA 2WC4A 4M6PA 1CENA 1A5CA 1W31A 2V2DA 2ZZ5A 4NJHA 4KGJA 1R2RA 1JUKA 3AXIA 1WO2A 5M17A 5AC8A 2W67A 1P4CA 1E4MM 1PX8A 2X05A 1JAEA 3EMQA 1QAPA 5LSMA 2NUXA 5U4NA 4AZCA 1BTCA 1BYCA 1DP0A 4FFHA 3GM8A 4BF7A 1N8FA 1W5PA 4TIMA 3W2JA 5AYXA 1G4TA 3LM7A 3LOTA 3PBWA 5FF3A 2V38A 3O9NA 1Q45A 3QHNA 3W0KA 4CGTA 1ITCA 1VCGA 3N18A 1VGAA 2DJLA 4HSNA 2TMDA 3GAYA 3AMCA 2PBOA 1TTJA 2AEYA 2ESCA 3NUKA 4LNYA 3W7CA 3T2PA 2VOTA 1B3ZA 4JTSA 1VJSA 3WD3A 4OZOA 1KXHA 4W93A 4C1LA 3WUEA 2PCQA 4RXGA 3NPUA 4JIQA 1TIMA 3I65A 4JY8A 3WJYA 3IK2A 4AZIA 1GOWA 1KFWA 3ECQA 1B9BA 4N9EA 2JIWA 4OE7A 4NX5A 5CZ0A 1W3IA 5F7UA 3ZWSA 3RDKA 4P61A 3QF0A 4PSRA 3WD2A 2CYGA 3G1DA 1FH9A 5D2XA 2Z1KA 1CXEA 2YFNA 3UWYA 2GFTA 2A85A 1UH2A 4JTJA 1WZKA 5A6LA 2C3ZA 2CLIA 2YA1A 2EHHA 4PMQA 2VFEA 2GK1A 1FCUA 1M7XA 4URIA 4UFIA 1M03A 3FHAA 5EKYA 1D3CA 2WM0A 4YPJA 4WD0A 3QHOA 2A1YA 1JUEA 3GXIA 2Y8VA 3OG3A 2XM2A 3WQ8A 1C7TA 2R8WA 5FESA 2BXYA 3EWXA 4MNJA 5DO8A 4YN5A 5T26A 1LL7A 2WSQA 4N0RA 3UGFA 3DFSA 5IDIA 1I1XA 4J3VA 3BH4A 3KFTA 3WQWA 2XVPA 1KFJA 4LTSA 2VO5A 2FHBA 3P80A 1YQ2A 4N9DA 4TOQA 3ZOAA 2NWRA 3K8LA 2VC6A 1ITXA 1UZ1A 5A6KA 1EIXA 2VFFA 4LX4A 3BW4A 2CZEA 3MBDA 2E9LA 2GJXB 4AD0A 3EDFA 3VKJA 1I4NA 5CPQA 3W28A 1OABA 3M43A 1W37A 4MNMA 1ZCOA 3W26A 1VH7A 4QITA 1HP5A 3IRDA 5LNUA 4E2OA 4DUXA 4MUZA 1SO5A 2G97A 2GVLA 4AWSA 1QNOA 3RILA 3UERA 1FWSA 4RKAA 1OJXA 3RU6A 1OK6A 4W7VA 3NSNA 3PZ9A 5LA2A 3W1AA 1OFPA 1V7YA 3GK0A 1G1YA 1P5BA 4CQ8A 1UD4A 2CESA 3DFPA 3B03A 5ABFB 5KEZA 3S1WA 3NA8A 4BI5A 1MYRA 4JX5A 5DXXA 2WCGA 2GSJA 2E9BA 3OVRA 1XV8A 4LUIA 2W5FA 4LOCA 3PZNA 5AYBA 2FLIA 1W9VA 2UY4A 1U30A 5A6BA 1VB9A 4B9ZA 3DZ1A 2XVGA 4WIWA 1MW0A 5DEZA 1A5SA 1LTDA 3LRKA 4FNPA 3GDBA 3VDCA 3BLEA 5KZEA 1CXFA 1KBKA 3ZSSA 4UTFA 5I3JA 3CUFA 3CZ8A 2DDXA 4PMVA 4A4AA 3WDQA 3I7QA 3N14A 3W73A 5BXPA 2ZDRA 2ZZ7A 5A8OA 5FEWA 2WPBA 2YZRA 1QHOA 3F4NA 1JDCA 1J2WA 2J7DA 4CVWA 3WH8A 3TMLA 1GVOA 4IPIA 1B31A 3PUDA 2Y8KA 1LYXA 3MUAA 2FDSA 3IGXA 1EEPA 4JFVA 5A6SA 2X09A 1K8XA 2PWGA 1LP6A 4IISA 2O9RA 4D6HA 4JZ5A 3B9DA 1FH7A 1JZ7A 1M04A 1NH6A 3NYZA 5D33A 4Q33A 2FPTA 3UGHA 2WSYA 1JRBA 1XSKA 1LCOA 1QI2A 3H55A 2WQPA 1DTUA 5DY3A 2YLAA 2BVTA 2TYSA 5DF0A 4GUHA 3FN9A 3VNYA 3INPA 3LX9A 1MW3A 4FX7A 2EPKX 2A7NA 1OX4A 4LWWA 4DPQA 1H41A 2O9OA 1JCNA 1GOQA 2ABBA 2DT0A 5F2GA 2ZIDA 3FY1A 3WL1A 2Y63A 3CWOX 5IM51 1BGAA 4H3DA 2ZUUA 3BC9A 4BQ2A 3QOMA 3GH4A 3UWVA 2FPYA 3L2MA 2VEPA 1J12A 4M6VA 1JNDA 5J5DA 1A47A 1GOMA 3EDEA 3HN3A 5LNVA 1A5BA 2RGMA 2DGAA 4AEEA 3DHDA 4DWSB 3E12A 4ACZB 5LA0A 1Q6CA 5FKCA 1VFUA 3TR2A 3VCRA 4EQVA 4BI7A 1Y4WA 2EJ1A 1FOBA 4MZYA 2EO7A 3BGGA 1BLIA 4AHPA 1TTIA 2J75A 3ZJKA 4LC8A 4GXMA 1NARA 4LYQA 3ABOA 1UH4A 5BXTA 1V0KA 1ZALA 3PUOA 4AW7A 3FIGA 2QR6A 4WQ6A 4MY1A 2QCEA 3M16A 5ECUA 2E5DA 2XJ7A 1HL9A 1EUNA 4EK7A 4LXFA 1Q3NA 2D23A 3PIGA 2ZUWA 4LGXA 1KM1A 3WMSA 1M53A 3BAKA 1F4HA 4MOZA 5DN1A 3TJLA 4MYXA 1QOQA 1Q6OA 1XBXA 2C16A 3W6YA 5FMDA 4W9TA 1HF6A 1F05A 2WC3A 4O12A 3B0VC 1BWKA 1WOBA 3L65A 7TIMA 3S5NA 3IV3A 3K8MA 1ZJAA 4XV0A 1XBZA 3B0PA 4K7YA 1GHSA 4JKKA 1L6YA 3WDHA 1IZJA 3AYRA 2CLKA 4O0ZA 5M5DA 3BGAA 8A3HA 4AXKA 5HNNA 3A47A 1H4PA 1QI3A 1V3MA 1WZLA 3AHTA 3W2NA 3VDBA 3EWYA 4PFMA 4JL1A 3FFSA 3ATZA 4Z1AA 3DENA 2WSPA 4GO8A 5JBEA 1KCLA 2YIHA 4F9DA 2DSWA 3B06A 5A5WA 2WMKA 1KXVA 1PAMA 3HGRA 3WNNA 1FXQA 2DORA 5AHFA 4CD8A 3UETA 4PRWA 1H61A 5HBFA 5LHFA 2BNJA 3LXAA 4W89A 3FEMA 3SCOA 1KV5A 2JBMA 1MQQA 3Q37A 3PVFA 1XCXA 2ATMA 3QQ0A 4QDMA 1W3HA 4Z2KA 5I3KA 1WZMA 4DXVA 4Z2LA 2A4AA 3LPGA 4W5ZA 1CWYA 1OFRA 4BA0A 1XRVA 2H8XA 4YXGA 4ICNA 1EA9C 3VKKA 2FGLA 3L2IA 1GHRA 3S5ZA 3K8KA 5K4XA 1BG9A 5KINA 1CBGA 3O8AA 4GO9A 4AWTA 2Q8ZA 3UNDA 2A6LA 5AHLA 1WDPA 2D0HA 5CXPA 3DI1A 1HVQA 2V82A 3OGSA 2QPSA 4D6JA 1JZ8A 1JFXA 1LLZA 1I2NA 1H5VA 2G41A 2ZUVA 5SWUA 2ZYFA 1GYLA 5LYRA 1ME8A 1W1TA 4GZJA 4PC8A 1F76A 1TO3A 1V5XA 3W83A 1JCLA 1WKYA 3JR2A 3W2KA 1UBSA 4JTTA 1EWEA 1EO5A 1UR0A 4FK9A 1CXKA 3OZOA 4P7OA 3PUEA 3AMLA 4CCEA 2VEIA 5AC6A 4K39A 3C4UA 2OJPA 2OMAA 4JTIA 4JTKA 1XD1A 3GR8A 4UOQA 1JULA 4A3UA 3W1UA 1KTBA 4LC6A 2DSVA 1HJSA 3W25A 5G1TA 3EDJA 4PEKA 1XKYA 4MYAA 5BRPA 1WQ5A 5DY2A 5A8NA 5HUPA 3LEMA 2IUZA 2R14A 2QCNA 4PMOA 2PURA 4E2BA 2XVNA 4J3UA 3PTMA 3U5UA 4L4LA 4E8CA 1HKIA 3PULA 1TCMA 4QISA 3W23A 3LDVA 1H2JA 2OYLA 4NZFA 1PE1A 1D3GA 4IMCA 5C5YA 1RP8A 3UXAA 4MJMA 1WX0A 1H7XA 1QR7A 1VJIA 1OM0A 1VAHA 5D2WA 3G1YA 1Q4NX 5FD0A 3VU2A 3WQ4A 4EWND 1TYGA 4DO5A 4RZ6A 3O6AA 3STGA 2Q3OA 3CLWA 2WNWA 3W72A 1KW1A 4JYFA 1GOIA 3MMDA 5ABGA 2DZVA 2ZX5A 3LDKA 1WBHA 3NQ8A 1GOXA 3O6CA 4P7LA 1H09A 1OBAA 3ZJ8A 1GT8A 1K02A 3NM3A 1HT6A 4Z1BA 3NXFA 4JDYA 1D9EA 1KBJA 3WUBA 1ME9A 3EWWA 3WN6A 1KV8A 2J4GA 1V3LA 3CUGA 3G6LA 4WX2A 1KCKA 2DZXA 2OT1A 2WZHA 3N17A 1PHQA 4KGLA 2VOMA 3BLPX 2H90A 4MDPA 4JAWA 4UCGA 2W66A 2Y88A 2FDMA 3DECA 4TMBA 4QAIA 3FXYA 2ZUTA 4M1RA 1UJPA 5J5RA 1PEZA 3U8GA 3LCLA 2GDUA 4JTEA 5D9NA 3W3OA 4JFTA 3POHA 3SCVA 1UKTA 2YDAA 3TH6A 3VMPA 3C2EA 3P67A 4NNBA 5TIMA 3B9EA 4W87A 5JIWA 3I7SA 4TMCA 3KVLA 1SSGA 2ZXDA 4V2XA 5M3WA 2ZZ6A 3N12A 4OKDA 4AHOA 1XC4A 4MLRA 1TQXA 1ZBKA 1ZAHA 2A7RA 1TRDA 3R12A 5CZKA 5BOOA 3W88A 3PM6A 3GBEA 4P8VA 3CTLA 5F4WA 1E6SM 4AEFA 1S5TA 1T0OA 2Q3RA 3FOKA 1FWWA 3RFAA 2WMIB 2EEXA 1IXQA 4O13A 1E4LA 2XHYA 1IF2A 4JFWA 4MIMA 3W86A 4FNRA 3DFTA 1V0MA 1JXKA 1Z48A 3LV6A 2DEPA 4OIFA 4JFSA 3HG5A 2QCLA 2J74A 5A69A 3N9SA 4B3LA 2Y7FA 3P8JA 5FEZA 3R13A 3ABQA 1NFBA 1J0JA 3UYCA 1JYWA 4QCEA 4N4PA 5A8MA 5C54A 4EKJA 1EGZA 5CLTA 1VHNA 1QNQA 1A5AA 1C91A 2G5WA 1W32A 3KOFA 2ZTKA 5AC7A 4QFUA 3VPLA 3G18A 5FEXA 1EOKA 2ZRXA 3L4UA 2QQVA 1SYTA 3W82A 1KFBA 3DYMA 3ARSA 4NRSA 4CNPA 5D2TA 4ORIA 1TG7A 4GE8A 4JGDA 3NQ6A 4HNTA 2Y2WA 3N13A 3CWNA 2WWDA 1PS9A 2XSBA 3N04A 4J28A 3Q2DA 1XUZA 2GVGA 2EPNA 4GQRA 5HWNA 3WEZA 2GPTA 4LVFA 1E15A 5GPRA 3ZR4A 3W7HA 1LQ0A 5ANNA 3WBEA 3I68A 4AIEA 3WKZA 3WY1A 3HB9A 4PMZA 3P61A 4NZJA 3W85A 3WJXA 3ARWA 5AC5A 4H8HA 5D4YA 3MUXA 1CXHA 4K8HA 1SW0A 4MFDA 1WXJA 3PZOA 2YGYA 1SSDA 3M47A 4NZCA 1E3ZA 2ATSA 3MUIA 4ALDA 1FWRA 9CGTA 1VCFA 2KZHA 1W3KA 3GNNA 1B3WA 2CWNA 1HJXA 3S6DA 3STCA 4GQQA 4HHPA 4J7RA 2PBGA 2R94A 3TFCA 3S5OA 3RNDA 3CU2A 4H4IA 4NJJA 2VZOA 1CEOA 1UD2A 3H53A 1WPCA 5ABHA 1T96A 3WK0A 1UUMA 3W1LA 2WVSA 4ML9A 1ZNNA 4PMRA 3HBKA 3T78A 3VDAA 5E9AA 1BQCA 4DO4A 3AIWA 3TQ0A 2WC7A 1GQIA 3TX9A 3G1FA 4FNUA 4O1CA 4UXDA 1UD5A 3SSJA 2YDQA 4V28A 1VENA 3QSTA 1UWIA 2JKPA 2Q8LA 3WDRA 3RMEA 3WJWA 1HXJA 2CXGA 3I3BA 1AQ0A 1FA2A 3LXCA 3R8RA 3QHMA 5FK8A 4EIVA 1CGUA 1EDQA 2CEQA 3D5HA 3PBYA 3B8SA 3AZRA 3SC7X 2HS6A 3PAJA 1EDGA 1MW2A 1V02E 3W84A 2OT0A 2J9YA 2C13A 3GXTA 2Z6IA 4JN6A 4EANA 3TROA 1UCWA 4LT9A 1I2OA 1CXLA 3IAQA 5DFAA 5A2BA 3HG2A 1B30A 2W62A 3VGBA 2WLYA 1N55A 3LDRA 3DKLA 1T8XA 2YYTA 3UG5A 2XIIA 3F03K 1KR0A 1UR2A 4R7JA 4MZ1A 3J7HA 5HNRA 4M7TA 4UNLA 4IMEA 2VQUA 5CLWA 4WUIA 1LWJA 5LNRA 2OCZA 2QJIA 4ZVJA 1NWTA 3NQCA 5IFPA 5CPOA 1FCQA 3M41A 1NP0A 1HKJA 2CKRA 2HVMA 1E5NA 3RM8A 1L8NA 3RLVA 1WOAA 1QVBA 1XI3A 1YTDA 3W27A 3CIVA 1W2PA 4GI6A 5K2ZA 2ZX6A 4IUGA 3WH9A 2VFGA 2Z1SA 1W56A 3AIRA 1TSIA 1TPFA 4HPXA 4FLSA 4RE2A 4BZYA 3WNLA 2ZZ2A 2OSWA 2XPKA 3KL0A 1NF0A 1YPFA 1TA3B 2QUVA 2ZRYA 3UWQA 4O57A 1J4EA 4KWVA 1GTHA 5C6MA 3AIEA 1LOQA 1Q6LA 2OYKA 3RM4A 1E6NA 2NXGA 5F1UA 4S1FA 5HWMA 3G0SA 1HKMA 1PX4A 4G1KA 1B2YA 1GQKA 4D6GA 1JJKA 4MNLA 5BRQA 1H11A 5D8ZA 3ZIZA 1NOWA 1MXDA 3BSGA 1EDTA 3CPRA 4UOJA 3EYPA 5LNWA 1C3FA 4QSHA 4Y8FA 1J0ZA 2WZIA 3LHZA 5ABEA 2FQIA 1UASA 4OV4A 1XBYA 4PL1A 4O10A 4BI6A 1TMHA 3VILA 2YDSA 1HL2A 1JR1A 1IXNA 5HPCA 2WSKA 4GRSA 4JTUA 1V0LA 1KTNA 1YHTA 4TX9A 5K9CA 2VR4A 1E6XM 3KEHA 1B9ZA 1JXJA 2YA2A 2RDUA 3WFAA 4QCFA 4GKLA 4HPHA 3HJEA 4AVFA 2JALA 2AAAA 2A5HA 3S6TA 4AC1X 4M80A 1SFSA 2A3BA 1CLXA 1W1PA 2AOSA 2QUUA 5G2IA 3RLUA 3W75A 3WFLA 3W29A 5F2MA 5EMYA 5HDRA 4GZIA 3WUFA 2QCDB 1SQ7A 4IX0A 4QM1A 1TPDA 4UTIA 1ISWA 4MZ8A 2VENA 1GVRA 1UWUA 1NVMA 3GZ3A 3O6YX 3SCPA 2ZQ0A 3CMGA 3M44A 3TTSA 5M03A 1I75A 3KVMA 1UR4A 4UZSA 2QMJA 4AD5A 2BHYA 3B04A 4M56A 3W1QA 1HKKA 3WEOA 1ZBWA 1RR2A 1JQXA 3QSRA 4ZQNA 1IZKA 1K8ZA 3M07A 3TP4A 1ALDA 2B7PA 2PWDA 2C15A 1CXIA 3EXRA 3ARYA 5FF2A 1H60A 4YL2A 4JEQA 4AF0B 3V75A 4QNWA 2YDRA 4DF1A 7TAAA 3E96A 2ZRWA 4O52A 3AS3A 4CNNA 3TV8A 4Q22A 1J5TA 4JTFA 4IMGA 1AW1A 1VEPA 2NX9A 2I1OA 4IMDA 5CZSA 5I6SA 1GUVA 3AQUA 3AS0A 3Q58A 4ZQPA 1VQTA 3VD4A 4LS0A 2J79A 2FTPA 2WVVA 1QO2A 4JTLA 4O17A 1DOSA 1KWKA 2E6FA 3C8FA 1H7NA 2ZICA 4U4MA 1KB3A 4W88A 1DV7A 3LCHA 5D9OA 2E68A 4X9SA 4EF9A 1FFQA 3PBVA 4AD3A 1Z32X 1SW7A 1FWTA 2DT1A 3AMGA 3FJLA 1WV2A 3K46A 3NPVA 4A21A 2WMJA 1KFLA 5K3VA 3JUGA 4KRTA 3WJSA 1NOFA 2NLIA 1XH2A 1V03A 2WNNA 3AICA 4WJEA 1WB0A 1TPVA 1O95A 5HJLA 2VX5A 5D9PA 5LHEA 1PBGA 1J18A 3BSHA 3NSXA 1AQMA 4IUOA 6TAAA 3NM1A 1GJUA 2AEZA 3P60A 3OZPA 4AZZA 2W63A 2JF7A 1JFHA 1GPFA 3TDFA 4N42A 5BXRA 1TFVA 3PZGA 3SIZA 1EHAA 3LRMA 1F73A 3AHYA 3SCSA 2YL6A 3VUPA 4K38A 1TPEA 3KHJA 1R7OA 4ZE4A 4HNVA 2WBGA 3LV5A 3VX0A 1TZ7A 1B3VA 3BW2A 3QQ1A 3P62A 4WSJA 3UY8A 2YOCA 5FMBA 2Z6JA 3OGVA 2H8ZA 3DBPA 4JX4A 3WMBA 1UZ4A 3ZR5A 4FF7A 1SPQA 1LLOA 5FOOA 3NQEA 4HSOA 2VCBA 3EKLA 5G4EA 1LG2A 4PN2A 3UESA 3VIJA 1GCYA 1B4EA 2JGYA 4LYRA 4MPKA 3BCFA 4Z0JA 3UR8A 4NVTA 2BXVA 2A7PA 2G4FA 3U1XA 1THFD 3GX9A 5BXSA 1UD8A 4P8XA 2O92A 2VFDA 1KM2A 4UUIA 3U7VA 3PTQA 5LGZA 4C7GA 2G95A 2B4GA 3DFNA 2WYSA 2VEMA 1SMDA 4EE9A 4N2YA 1UA7A 1W3JA 2ZUSA 3PBGA 4W5UA 1IGSA 3GXMA 1JCJA 1LG1A 4O1BA 4UQDA 1BAGA 3OA3A 1CTNA 1FP9A 3KVKA 1L9WA 3BPWA 3C2OA 1W9UA
chains in the Genus database with same CATH superfamily
1JHJA 2FJKA 2JD9A 2GVEA 3SGUA 4K2SA 1EWDA 2OPJA 4Q8QA 6ALDA 4TVDA 4HPKA 4COWA 4I9JA 2VQTA 1LAJA 3PG8A 3AIBA 4MV2A 5AYYA 3S2CA 3LWCA 2G3MA 5K7JA 4HMDA 3K4ZA 1NP2A 4LJHA 1RUG3 4QP0A 1V0AA 5BNOC 2OWXA 3J8F1 3CXOA 1OQEA 2X53S 3TAYA 3DKJA 3G0XA 3HBZA 3F5LA 3ACHA 1DZQA 3BMVA 3GTXA 2JEQA 1TCDA 4IGNA 3U6WA 3AVSA 5FPAA 4HNLA 5A3TA 1MS3A 5CSYA 4REQB 1Q63A 2ZRUA 4ZMGA 4CVUA 1RVKA 3LEPA 4N6EA 2PAMA 4ASLA 1RXFA 1WW7A 3APGA 2DCJA 1LKNA 3RX2A 2OZJA 3JU9A 4Y4RA 1OH4A 3J8F3 1K7XA 2CHOA 4H9UA 4WDUA 4XTIA 2PC8A 4LCQA 1VLIA 4EWDA 4U5KA 1WUFA 2J7BA 3VK5A 4ACYA 4EPEC 5FZ8A 3IDAA 3OU8A 1IPJA 4OHYA 2XLGA 1OCNA 3ARXA 4KT2A 2CZVA 2QNKA 3T55A 1EGMA 3T4CA 1PCWA 4Z8BA 3O16A 3I3QA 1JNEA 2V5KA 2YW4A 3O06A 2ADEA 1QNSA 1OG0A 3L0NA 3H4WA 4QLKA 5E70A 2OTDA 1UQXA 1TR1A 3TTOA 2X1TA 5G1YA 4HT3A 1TX2A 4NILA 4NJIA 1G01A 2MANA 5ACA3 2CBJA 1QTWA 1Y9GA 4HK6A 4PUKA 3ZFFB 5CKQA 4WOZA 1LBMA 4OUIA 3KBWA 4OBSA 3AZSA 1YNQA 1OI6A 4INFA 3TQVA 2XPJA 4OUMA 4FNTA 1MEC1 4L0PA 2DVUA 3GFYA 2IPFA 4KWOA 3G22A 1OC5A 2DZUA 4WKHA 2J1AA 2HISA 2DUAA 4QLLA 4YRDA 4E4ZA 1QWGA 3RCNA 3AUJA 1KM3A 1POV1 5CPNA 1VJZA 2XN1A 3WELA 4K37A 2VZQA 3LENA 4PBOA 3WQ5A 1PUDA 1SFLA 3AWOA 4PTWA 3GXUA 4O15A 1CECA 3FHIB 3ILNA 3CS2A 4FNQA 5J98B 2Y24A 4WHBA 2GNDA 1C28A 3C0SA 5C8BB 4JFUA 1UP3A 4N53A 3UD6A 4K8EA 4H7LA 4IIFA 4XUYA 4P9IA 1EPVA 1RUH2 4RDVA 1VB4A 4K21A 5FUNA 3ALFA 1BKZA 4XK2A 3MHZA 3VKCA 1UU4A 3HPSA 1E72M 4TTUA 1JOBA 4W84A 1JZ3A 4AOCA 2FZBA 4O16A 5L9FA 3VBFB 3UZJA 2PUZA 3G77A 1J96A 2OYMA 3R7MA 2BY1A 2QCGA 3X29B 2VL4A 4MKSA 5AVPA 3BUVA 1XYZA 3M46A 1XG4A 2Z1BA 3OVQA 2VULA 3Q8EA 4DRSA 1PKYA 1KJRA 1LENA 2DZPA 4X0NA 3THQA 4PTMA 4S3CA 5LKYA 1ULEA 4UTUA 1BGGA 2NLRA 2E26A 1V02A 1UA3A 5B7YA 3GRIA 1C8QA 1XGZA 1CVNA 3VKLA 5BNQA 3BO9A 3AO0A 4Q7NA 4LQ1A 1IT8A 4IIHA 1HN0A 2TNFA 1JGIA 4AUBA 1VBRA 3JU2A 1OFQA 1BF2A 1AW5A 2A21A 3UR7A 1QXLA 2Y34A 5LNSA 4QGMA 4QXKA 4PI0A 3VOGA 3IANA 1UJQA 4KWWA 2DBNA 3FYYA 3TWIA 4LEJA 1EB3A 3MV01 1XYAA 1ZBA2 1P0BA 3K77A 2UWAA 1QRQA 3NO3A 1K4GA 1EOMA 4RE3A 3T0TA 4GJYA 1QOSA 5DZGA 3BANA 2RR12 5LY2A 5FXVA 3CMJA 3KHBA 3N7MA 2IWGB 2ALDA 2X16A 3ELFA 4GABA 4J3ZA 4V27A 4LANA 4Q1RA 2VX4A 1HW6A 4OHZA 4PLOA 4JCKA 5FDBA 1VFFA 3LLDA 2NP0A 4DBEA 2RHPA 4DJFC 3GDMA 4PTVA 3LLFA 5FZDA 3T1LA 4BWOA 2HWGA 2AH2A 3GIYA 4GPNA 1ZAJA 3W00A 2MEV2 4KW2A 4XBNA 4C6IA 3BB6A 1B3OA 1EIBA 3FJSA 4QU2A 4J4KA 3CGTA 3UYIA 4L4MA 3WCZA 2IW0A 4BWLA 5I3FA 4OVEA 1VYRA 2R30A 3OYZA 3E6EA 3P5BA 2AQWA 3ZPYA 4NRRA 3LIHA 2WNUA 2ZTNA 3N9PA 4PIZA 1JCXA 1G4SA 4EOUA 1NYWA 4ZOCA 1NOUA 3SCQA 3DKWA 2I14A 2X30A 3RX4A 3ZM8A 3PIJA 1UZ0A 2Z7KA 1DHKB 4XDQA 5DCBA 1PK6B 4F0SA 2XG9A 1FXZA 1PM4A 3R4DB 2PGRA 4LCSA 3CHDA 5LY1A 5I2UA 4ZQMA 3DGTA 5A33B 3G1HA 1C90A 3OYWA 4C6BA 3QMRA 3T2OA 3M5VA 4MWAE 2E67A 2FMYA 3C6CA 2XONA 3TSMA 4GH1A 3LGRA 1J10A 2INEA 1QU4A 1UP0A 4KBZA 4US5A 4K1WA 2WA4A 3BCWA 4MVAA 1F9KA 1SZEA 5DRIA 3T0CA 1TE1A 1Q56A 4C90A 3BOLA 4Q8WA 3UWWA 4AD1A 4BYYA 4MAVA 3GXPA 1S1AA 3HQNA 4CN6A 5I93A 4MGIE 3KV5A 3REQB 4A3HA 5AHIA 2JE9A 3AZZA 2NLYA 1ENQA 4L1GA 5J8LA 2VXRA 2NXHA 4B5WA 1ZZMA 1JYXA 1WDWA 4XF1A 2DZAA 2VZUA 3QR1A 1ICQA 1DHKA 1ENRA 2TRSA 1ZX5A 4AY7A 4B4RA 3QW3A 4XJWA 3O1MA 1QGLA 4HOZA 1RBAA 4YTTA 4XBJA 2YX0A 3SCWA 2HWF3 3HF3A 2UURA 5I91A 1LOFC 3S57A 5A80A 1OQDA 2PDQA 5GZEA 3GGLA 5ISLA 4YNGA 1P6BA 3LFIA 3OLEA 1ZY9A 5C9UA 3P14A 5LIYX 1H0BA 4CUCA 1ZU8A 4CDWC 4GK8A 4POCA 2HH9A 4QPGB 3K3NA 3CHFA 4O54A 3SW6A 4HXCA 3SB0A 4P5YA 3P82A 2RGLA 1SFYA 1YI9A 2Y62A 2NMNA 1QW9A 3NO1A 1DYPA 4XKYB 4OUEA 3V0SA 4JTRA 1UYZA 1WBLA 1RPKA 1VBE1 4L97A 2WBKA 4XQ4A 3S30A 2W1QA 1EH9A 5AHEA 4Z2HA 2EXKA 4MADA 4ZXOA 3W2UA 3S0MA 2QQKA 4DY1A 2VC7A 4TVCA 1GJPA 1CAUB 1VHCA 4M8UA 3VE9A 4GWNA 3WUCA 1W8ZA 2FH6A 4LSBA 5EPAA 3FYPA 4M81A 2J47A 2VR5A 3FJ6A 3AYTA 4F8XA 4OT7A 2UBPC 3ATYA 2CLOA 3I2FA 3LFMA 4XWUA 4YMZA 5CYYA 1YQ8A 3DAQA 1JYIA 5FY5A 1GVSA 4O1AA 3HPXA 1FWCC 2ACSA 3EX4A 2VW1A 4A8RA 4AEOA 4RHV3 3THCA 1GQPA 3CZLA 4EWAA 1ND3C 1O5XA 3AMMA 3OB8A 4XAEA 2E8ZA 2OYZA 4ES8A 3ZSLA 1K9FA 1KBIA 4FOVA 4XX6A 2Y6KA 3H8UA 1E1CA 1GNYA 1NELA 2XIOA 4ADUA 4AHQA 1OCBA 1EAH3 5E6YA 4R9DA 1E71M 2FZ8A 2QKFA 2P34A 4QDSA 1UXZA 4UTWA 2ISFA 5EFUA 1I2RA 1M3UA 3OGJA 5CFCC 5HJXA 4JNMA 4FEZA 4JX0A 3VZNA 1W8NA 1XQLA 4MB4A 3S46A 3A0NA 5A7WA 2ID4A 1SR9A 4XZLX 3LF7A 3ETQA 3MIEA 3S7EA 1ELSA 4ZXKA 1YTEA 2YBUA 3EDDA 3SCRA 3TYJA 5AC4A 4OJYA 1FRBA 1JRCA 3AXXA 2XHNA 3CKHA 3M0XA 1ASJ2 2PC4A 5C4WB 3SUTA 3T30A 1X6UA 2QCCA 1EBHA 1EC9A 3N7KA 1EP1A 3THUA 4PUJA 1DE5A 5DXYA 1RIRA 3URAA 4K20A 3QGAC 2YYOA 5DCDA 5F3CA 2VRJA 4XMIA 3ARUA 3CL8A 5F5QA 1UZWA 4DXZA 2ZRZA 4IPNB 3UR5A 2VAUA 2WWSA 2X1UA 3U4FA 2J1VA 1TKKA 4QLJA 2UU8A 2Z2UA 4M0XA 1WBJA 3M7WA 3CQKA 2VUYA 2WJZA 2J9XA 3RRXA 4K7VA 4GGBA 3OG2A 3ZFGC 2E63A 1LF1A 5CZJA 2D24A 3NL1A 4GC3A 3KLLA 4UQ9A 2J7GA 5IBXC 4CU7A 3WR0A 4Y9OA 4FIRA 1Z78A 4BZ4A 3VIHA 3VD5A 3EX1A 2WS91 4UTKA 4RD7A 2WXDM 2IKJA 5C9ZA 4XFGA 2CITA 4YIWA 1JYTA 4NZ1A 1NDVA 4PHZA 4HN8A 3IB3A 4J1OA 1ODZA 2ORXA 5DZFA 1H7PA 3XISA 4O4VA 4FO9A 1NFPA 1RQBA 1QK0A 1WXZA 3A4XA 4QRNA 2VTXA 4IEWA 2ZXBA 3U9IA 2PMWB 3PUAA 3WDVA 3PZMA 4KQNA 4QS5A 4XAGA 5A6AA 1RUI3 4N6FA 1JYVA 5EYYA 1XDLA 4I9MA 5E16A 1K6AA 4QM8A 5KHGA 2XH7A 1KEXA 2XIQA 2F6XA 2BV4A 2VFIA 3I54A 4UFMA 2CPUA 4JKMA 2CGNA 1SLAA 3AL5A 1JDAA 1E57A 1Y3TA 3CPUA 4B92A 4Z1DA 1B57A 2PGFA 2HE5A 4NSBA 5BW6A 3AJYA 3BK0A 3PC0A 5FPUA 4C1KA 3NJ3A 2IXIA 2PP1A 1E1FA 4IG2B 3N2MA 4IX2A 3SUUA 4AEMA 5HUOA 4JGYC 3V64A 4LKDA 5FJIA 2VUCA 3XINA 1Q13A 4AZHA 1ZBVA 3UYJA 2XIBA 5JMUA 4P9JA 3GC2A 3ZVHB 4AISA 4CTEA 5FAGA 3B8IA 2YHJA 1AL8A 3VABA 3R8HA 1HO4A 3KCYA 4ORMA 1B0IA 4K68A 3NG3A 3MFCA 2VDGA 1YRRA 1G5AA 4HJFA 4FSJA 1PIIA 2VXNA 4LULA 3SJNA 4X0VA 8CGTA 4TN7A 2R061 3W38A 1OQFA 1US3A 4QHOA 5JU6A 4IE4A 2P8CA 3A6OA 1K1DA 1X97A 1MDRA 4HFSA 3OD0A 4CE8A 1VFOA 3NNJA 2WA3A 4HPJA 4PMXA 3N15A 1KM5A 4RE4A 2O8OA 3GJAA 4B4PA 3TWBA 3TTQA 1WMFA 1AYM1 2X1IA 5GNXA 3GBWA 3G0UA 1TVNA 4LIUA 2EF9A 3QCWA 3KV4A 4GNVA 1IYXA 2ZX8A 2E53A 3WYZA 1QDSA 2IUWA 4YW4A 2PDIA 1H1ZA 2BUKA 1DIDA 4DMIA 3OO2A 4ZEPA 2IFRA 1QI4A 1S2UA 3BTNA 4NASA 1PDYA 1S2WA 4QE5A 4FPCA 5KXEA 4MF4A 2ISSA 2OSYA 3MP3A 4KIRA 4PCFA 5FIPA 2DVFA 1F8MA 3TUUA 6REQB 3W7NA 3O5SA 2R1NA 4US5D 5LIXX 5DPNA 4OQ9A 5BV6A 4XAZA 2PHDA 4DUWA 3LHVA 2PFHA 1X9TA 2ZAAA 1K7EA 3URFA 4J25A 5FMOL 4MNKA 4QSFA 2V5CA 4NAEB 2EQDA 2FJUB 2ZA1A 4NQ1A 3PNAA 3VN4A 3FDKA 1BCXA 2XTKA 3N6QA 2PP0A 3MO7A 1UOJA 1GTEA 2ORZA 3VDDA 2DQWA 2F84A 3CHVA 4BQ4A 3C2RA 1FX6A 4ZTXA 5CKMA 1UB3A 2VI0A 1XJBA 3E5BA 1R86A 4AVNA 3FDGA 3KQRA 4LU0A 4YVWC 4PE8A 1N8WA 3GB6A 3BAYA 2YJQA 4BFAA 4PUEA 3GTFA 1PZ2A 1W5QA 1SR0A 4YYCA 5FZKA 1W91A 1W2NA 3R25A 3KF5A 4F2BA 4EP8C 4DFSA 3CAVA 4JX6A 4LRTA 3GG1A 1PDZA 2ZKLA 2ALRA 2BY3A 2QUTA 4HN4A 5E1QA 1N1YA 4FPSA 4LBRA 2Y0IA 3SEEA 1UR8A 4QJ4B 3NPWA 4UMCA 1LRTA 3MI6A 3S5YA 2QQUA 4CCJA 2WT2A 4HHLA 1CX4A 1EEXA 1Y0EA 5CPMA 1VIZA 3W53A 2ISVA 1HG3A 3NL5A 2ODOA 1O5KA 1V9U1 4TO8A 1VBA1 4D6SA 4LPCA 4K6BA 3EX6A 3EWUA 4XTDA 5HR7A 1QO5A 2G9ZA 5D03A 3EBVA 3V0TA 1MFVA 2P0OA 3OSDA 1OT1A 4FOKA 4H04A 4L80A 3W01A 4B5UA 2Y6FA 2F2HA 1OGBA 4NPMA 1QOPA 2JKEA 3GDTA 1NE4A 2D73A 4YLZA 3ZKUA 3VHOA 4GX9A 1WA6X 4KWKA 1IXOA 1MRQA 4YARA 3TW9A 1NDWA 4QDWA 1ESWA 3IPVB 2JENA 5F2SA 2DWRA 3P84A 5FV3A 1ZFJA 1AR61 1S0IA 1QMLA 4OOUA 1WMDA 4J1WA 3INAA 3USZA 1FDZA 5I77A 5FZBA 1TUFA 4AQ2A 3H0OA 1MI3A 3UY7A 3ENLA 1TRIA 4QB6A 2Z25A 3UCDA 1RUH1 2QIIA 4Y96A 1HRV1 3E2VA 1ZZ6A 4QJ1A 1DVJA 4C1NB 4CD5A 5HXMA 2ZTJA 1TV4A 1ZUAX 4AMAA 2ZOXA 3NXLA 3VBUB 3AJ7A 4HHMA 2WCAA 2D6NA 3WIJA 2GJNA 1CAWB 3VBHA 3AJZA 1R2TA 1DPMA 4WM7C 3W1XA 4G8TA 3MC5A 4J3SA 3TXVA 2PTYA 3OEAA 1Q7MA 1BQGA 4B5NA 4A7YA 3VBRB 4RHV1 1XRUA 3I6TA 4AEDC 2A71A 1NA1C 1TV3A 4W86A 2WO7A 4QKFA 4CU8A 1XYNA 3RYRA 4FO4A 4MGGA 3SKJE 3W21A 1OF6A 2WOQA 4CD7A 4M0HA 2P4EA 2GJXA 1VRH3 2FDJA 3NL3A 3QC0A 3BGJA 4GXPA 4BCEA 4DJDD 2OLAA 1M65A 1ZL1A 2C18A 4Y9AA 3H50A 4KFOA 3PJTA 4UMAA 1EAH1 1ZB5A 1R2SA 4XO6A 1VRDA 1PV8A 4QX4A 1UY2A 3U4XA 1SU5A 4JTDA 1X33A 3RHGA 1BBT1 1V3JA 4GINA 4AMCA 3SKVA 4BEUA 4E8DA 3GTNA 4FQZA 1ICPA 4I8YA 1XLJA 1QBBA 1UR9A 2VWSA 4BWLC 2A6NA 5D8AC 2HXTA 3GYEA 4D6CA 1BF6A 2PE4A 2E0PA 1OZQA 1DCSA 4Z1CA 2QZ3A 1L2UA 1L6GA 5DBUA 2GNBA 2OX1A 3Q45A 3U10A 4YWAA 2PP3A 3SY8A 2XJVA 2GK1B 3M3OA 2PTDA 5DRCA 3TN6A 4IV1C 1LJYA 1XLBA 1NSJA 3M6YA 1A6CA 2CLFA 2Y6GA 2CHHA 1JI1A 4JQ4A 1RUG1 3I3DA 2ZC1A 4ZO8A 4HKPA 2O55A 3NPXA 4URTA 4XD5A 3O1TA 3ZFFA 3VD3A 5C4WA 3O6DA 3NNTA 3H12A 5FJTA 4E27A 1WDQA 4JXCA 4HA4A 1XIDA 1M4WA 2CLHA 3KCCA 1DJQA 2C7FA 2XSXA 1JH5A 4JGZB 2VD9A 4GMP1 2E33A 4V1PA 5GLTA 4Y22A 2PHRA 1RV8A 3GNPA 3D46A 4YU1A 3B9OA 4XYXA 1Q6DA 1GZTA 4ZO6A 2WWCA 3UW6A 1E4NA 1UY1A 3QKEA 4LVAA 2W9MA 1QOXA 4AIOA 1ZJHA 2XM1A 3EJKA 4UQAA 2XJSA 1UPPA 3WBAA 1H6XA 3CJXA 3T2QA 4XILA 4RV3A 2C1GA 1AL22 1L8PA 3AOFA 4M6UA 4O14A 3IVTA 2J7FA 2Z2SB 1LB2A 1RUC2 2XVLA 4NIIA 3W5NA 3VKNA 4J9JA 2B7OA 4FPYA 2E32A 1K3UA 3F2DA 2VUJA 1I3HA 2ZGPA 4K8GA 4ZOBA 4LYKA 1X8EA 1QJY2 4MPQA 4JN7A 3V0AA 3A9BA 4O7XA 4P9XA 3QPZA 1ZTVA 1UAIA 3ZQ9A 2LLEA 5FYTA 4TX6A 1NKGA 4US6A 4C6LA 3VFLA 1EXPA 5KZDA 2E40A 5J36A 1MNSA 1XLEA 1MR5A 2KM2A 3MPBA 4A2SA 4H6RA 4LO4B 4AQ6A 4ZFCA 3P3PA 1IT0A 3C0LA 4GVGA 4QQ3A 1LEMA 2SLIA 1XE8A 2AC1A 1W3TA 4N8MA 1QI0A 2JECA 1YDOA 3FCPA 1K3IA 1EP2A 3GH5A 1YLLA 2B7QA 4WJ8A 1CGVA 4FX6M 1LBLA 1M9HA 3N73A 2B31A 3ORWA 1Q6GA 1R1A3 1KM4A 2QJGA 4LF2A 2EALA 4D71A 2VZSA 1MZHA 5CSRA 4P9YA 3RJYA 4PSPA 2ZUNA 3D0SA 1MVEA 3R8GA 1OFBA 5I0UA 1F5ZA 4GYFA 1G9HA 3UXKA 1M01A 4NNAA 3S0CA 2QULA 1XHGA 4WY0F 2J7EA 2VVEA 5A70A 4S2FA 1QNRA 2PF0A 3H8AA 5AC93 2VE1A 4AHWA 2GNTA 1ALYA 2QDNA 3CIXA 1GNZA 4KCVA 1GVEA 3WDPP 4AVAA 3C56A 3TA9A 3USUA 3P81A 3ZMRA 2DJXA 3GZEA 3GCXA 2NSXA 4ZZ9A 2D1ZA 3KWXA 3PMEA 1Z8AA 3RCYA 3WF2A 1X6NA 3WD1A 4NI8A 2B7YA 2D40A 3POCA 3IARA 2E5BA 1KM0A 1XYFA 2ERFA 1JCMP 4MB1A 3TYBA 5E0CA 4FALA 3NQ2A 4H9VA 2CLMA 3ME2A 5EMMA 1HB1A 1JD9A 4O8RA 2Y7DA 5D8WA 2GMMA 3W02A 1EQPA 2PDGA 2WHLA 3TONA 4LBLA 3B8UA 3P74A 1CX9A 4XXAA 3GDKA 2DURA 1DZRA 4GALA 3ZYJB 2VP8A 3H54A 2DSKA 3P3BA 4NAEA 2ZJCA 2BB0A 1EUTA 2EPOA 3C2VA 2DT3A 1C5IA 1QJY3 1RA5A 2ZZ3A 1B35C 3QVQA 1MO0A 1BVWA 1DQXA 5GVJA 1E0WA 1GR3A 1X39A 5EMUA 2F8QA 3CQIA 4NNCA 2J24A 2ZS6B 4DM2A 1PSCA 2HROA 1VP5A 2OEJA 2JICA 3N7JA 5FY4A 1Y43B 3ITQA 1UWWA 2VRQA 1BRLA 3K46A 1LWIA 4DI8A 1J0KA 2UYBA 2FHFA 1OINA 1YPXA 2F4LA 2J6XA 5LIWX 2YL5A 1YE6A 2WNVA 2VWTA 3UXDA 5FZGA 3ROUA 2OZ0A 3VZKA 4XSMA 3S8HA 1CONA 1ADOA 1CPMA 5GM0A 4LV4A 2QF8A 2ZZ4A 4QPYA 3GHMA 2Q6ZA 3HAGA 2PAJA 3NOYA 1V3HA 1FWAC 1KWGA 5AC91 2VU9A 4OHXA 3PK7A 1X1ZA 4GFIA 2D22A 1OMIA 1MEHA 1TUXA 3FFQA 1R85A 3O1SA 1R30A 5FP3A 3PZQA 1AG1O 3ZYHA 1OY0A 2VVFA 5FJUA 4XIMA 3EO6A 2BZNA 2H3DA 3GBGA 2Y8UA 2AL2A 5JZGC 2XVKA 2DU2A 3PUQA 3CEUA 4IEXA 3H22A 3ARTA 3QMTA 2W92A 4KCWA 1G6CA 2FZDA 2PTMA 3BSMA 3TN5A 2FDKA 1OD0A 2PZNA 3DXUA 1TTPA 5DBTA 2D2OA 1SM9A 4MWAB 4QG9A 1UKQA 4LUYA 4O28A 5FTTC 3IBMA 1EJUC 3ZYIB 4YZ2A 5I0TA 2VMGA 1MXGA 5H91A 4W4QA 1F6KA 5D2YA 3WJZA 1A3XA 3MV11 1RUH3 3LBMA 3GW0A 3N9KA 1M7PA 4FXKB 2V2DA 3PUHA 1UMIA 4KGJA 5IAVA 1P4CA 1E4MM 3Q67A 2X05A 1PX8A 4GBDA 4MGSA 4PUNA 4HVOA 4AZCA 2ZGRA 4FFHA 5JXGA 4E4HA 1WUEA 5AYXA 1G4TA 3V56A 5FF3A 4EN8B 1VCGA 8XIAA 4NIDA 3MJMA 4YGBA 1NAEA 5HV0A 3AMCA 3GAYA 2PBOA 1H2LA 4XVDA 3NUKA 1ULPA 3T2PA 1B3ZA 2YPJA 9XIAA 5JCTA 2PCQA 1UIOA 1C8M1 4RXGA 3I65A 1PWLA 4QX0A 2VGDA 1GOWA 4NL1A 3GVVA 1B9BA 3N25A 4GACA 4NX5A 1RUD2 1W3IA 5F7UA 3TNQA 2PDHA 3WD2A 2OZ6A 3RJ2X 3KOZA 3WY6A 1RK6A 4GB32 4IP7A 1MQTC 1UH2A 4JTJA 4V2WA 1WZKA 2YA1A 4XDPA 2EHHA 2VFEA 4LPLA 3MUCA 1FCUA 3U11A 1XIJA 3I2JA 1M03A 3QLLA 1DYSA 2CNAA 1S0FA 4D6QA 1JUEA 5LIUX 3SRKA 1QUMA 5FESA 3C7OA 3F2BA 2C26A 2FVLA 3WMLA 4N0RA 1SLCA 1I1XA 2NVAA 2V5JA 2D43A 1OURA 2XVPA 3P80A 1YQ2A 4R9BA 1HJGA 4IESA 3ZOAA 2NWRA 3K8LA 4RFT0 1EIXA 3CL1A 2H0BA 3BW4A 3SAZA 4O9GA 1B54A 3MBDA 2JDNA 3LA7A 2GJXB 5DMLA 3VKJA 4ZB2A 4XHXA 1ZCOA 4MNMA 3W26A 4QITA 1P0DA 3OBTA 4E9KA 4DUXA 1SEFA 3RMXA 4Z17A 2G97A 2XH6A 2GVLA 3RILA 4CEYC 4RKAA 3JD72 1W6OA 3AX4A 3HT1A 3W1AA 1OFPA 1V7YA 3PTYA 5ABFB 4BCUA 3UJ2A 1MYRA 5FZEA 4JX5A 2WCGA 2GSJA 4LNVA 3OVRA 3PZNA 4LOCA 3EXUA 3WOGA 5F6LB 1LOEA 1RVF2 2OW4A 5A6BA 4IEVA 4B9ZA 3TOYA 3DZ1A 1MW0A 3TBDA 1R64A 3ZDVA 3B00A 1GKBA 5KZEA 4YW1A 2DUQA 4UTFA 4EPDC 1O3QA 2NQZA 2PODA 2DDXA 3R10A 1F2NA 4IJCA 3WDQA 3I7QA 1YEYA 4B8EA 5A8OA 5FEWA 2WS92 4DIAA 1QHOA 4TQTA 3TMLA 1Q2RA 4IPIA 1GKPA 1QJU3 1B31A 5A6SA 1EEPA 1M41A 5GALA 4JFVA 1GICA 3QKZA 4Q4MA 2PWGA 1LP6A 4IISA 1NH6A 2PQQA 4CPBD 2R49A 3DG6A 2BVTA 2TYSA 4Y5SA 3DDMA 2VOVA 4MGQA 2EPKX 3LX9A 2HPIA 1AX2A 4CQCA 1WMXA 2O9OA 1GOQA 2ABBA 1XE7A 5F2GA 2ZIDA 4BK5A 1SCRA 1JN2P 3WL1A 1RUF1 1BGAA 2Y63A 5IM51 3VNLA 4BQ2A 2AQOA 3VNJA 1DTNA 1H4GA 3SGGA 3O0XA 5JR7B 5C9AA 1GOMA 3SQSA 3EDEA 3WQOA 2MUCA 4DWSB 3E12A 4ACZB 5LA0A 1VFUA 2ZVIA 3R43A 3TR2A 2K9ZA 4N7UA 4BI7A 2EJ1A 4XUNA 1TTIA 5HCBA 1NARA 4LYQA 2J66A 1CGPA 2DW7A 1VD6A 3PUOA 3ME3A 5BNOB 3CF6E 2PD5A 2XB6C 4EX4A 3VKMA 2OX0A 3KBVA 2E5DA 1YWKA 2XJ7A 1IQDC 3WQ1A 1EUNA 4QDRA 1Q3NA 2D23A 4HD5A 3WMSA 2QDRA 2RJKA 4BM8A 1ZRFA 1HKDA 1F4HA 2RUSA 4FI4A 2OVLA 3TJLA 4YG0A 1OUXA 3W6YA 2VOXA 1OD3A 1OFNA 4O12A 3S5NA 3UXIA 1YNAA 3HQPA 2YCJA 1W2UA 3AYAA 3LA3A 1XBZA 4K7YA 5FBJA 3WDHA 8A3HA 5CC7A 3N3TA 1A3KA 2IS7A 3A47A 2P1BA 1V3MA 4HQVA 2HWF2 3VDBA 5LA1A 4BMBA 2RR13 4GO8A 3LZ3A 4F9DA 3B06A 1KXVA 1VBB2 3HGRA 1W6QA 2VTXJ 1H61A 2WZTA 1MQQA 4CDWA 1XDJA 1XCXA 3BCJA 3WLSA 1MZEA 1EYWA 3QQ0A 1W3HA 4DXVA 2P5BA 3E5QA 1ZZBA 2ZGTA 4TLGA 1IS4A 1JOJA 4IERA 1EA9C 2R042 1R3TA 5BPXA 2BDQA 5EQUA 4CDUB 3AP5A 4D0QA 2D0HA 4KBBA 1HVQA 1A8MA 4LKEA 2V82A 4DY5A 2QPSA 1JZ8A 4D6JA 1UKRA 1Z0HA 2BYVE 2PHLA 1NFGA 2KA3A 1ME8A 1J3RA 1AODA 1W1TA 4PC8A 2P3EA 2GH8A 1V5XA 2HJIA 3GZUC 3W2KA 1QJU2 4GH4C 4OULA 4J40A 1WZXA 5CVRA 2VEIA 1ADSA 4K39A 1LTEA 3C4UA 5LEKA 4NWWA 3P2VA 2DSVA 2GMEA 1H6YA 4Y8EA 5CCZA 2R072 5F9TA 2R9RA 5BRPA 5HUPA 1GZCA 3LEMA 2IUZA</