4UFLA

Mouse galactocerebrosidase complexed with deoxy-galacto-noeurostegine dgn
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
644
structure length
641
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords GALACTOCEREBROSIDASE
total genus 216
structure length 641
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4uflA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4uflA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uflA01
1LDCA 1M7PA 1OGGA 1VBRA 1GJUA 1Q6OA 3VIIA 4OE7A 1UWQA 1R30A 4LVDA 4Q32A 3FS2A 4R7JA 3WF1A 4PCTA 3U14A 3WK0A 1BTCA 3O06A 3MANA 5HPCA 3QMRA 1FP9A 4JTSA 4DPQA 1QO2A 3PBWA 3AHTA 5AFDA 4JDYA 4EKJA 3FOKA 4XQ6A 3M46A 3PZNA 5G5IA 3AMLA 1LORA 4E38A 3LGEA 7CGTA 1M03A 3IVSA 3CTTA 3O63A 3N2MA 1UR4A 1X8FA 1KBKA 1O4UA 1W5QA 3EWXA 2CLEA 1MXSA 2DZPA 2ZX7A 3F4WA 2ZZ2A 3IIXA 4NNCA 4WX2A 5EBAA 3OA5A 4HU8A 4MNKA 1GOQA 1EUNA 1Q6QA 3D0CA 2DZVA 4AAJA 1IV8A 5L9FA 2C3ZA 2W92A 1TFVA 2WOQA 2GK1A 3UETA 3N73A 3W74A 1B3ZA 1EOMA 1AVAA 4LGXA 4JTLA 3AI0A 2E40A 2ZRXA 2H90A 1TQJA 2BXVA 3S6TA 2WNWA 2GK1B 4F66A 3SC7X 3TAKA 3JRKA 1WB0A 2HS6A 4FEZA 4Q4KA 2RGLA 3P8IA 5GQBA 4ZQPA 3RJXA 1ZJIA 3W7DA 3E49A 3S0CA 1HFBA 4RZ4A 2XVKA 5KITA 1PL9A 1Q6EA 4CQ8A 1HO1A 2YL5A 3N15A 4GO9A 4JY8A 2J8FA 4OU1A 1VLWA 4P8UA 2GSJA 2YL9A 4P7QA 3SW6A 2DT1A 3PBVA 2GFTA 5ECUA 3TTSA 1ISXA 1KV8A 2H8XA 5CGMA 5BROA 1JDCA 5LNWA 4UQBA 4OHQA 1TZ7A 2BXYA 2YKKA 4Z1CA 4EAMA 2CPUA 3OVPA 1B0IA 2CLFA 2DH3A 3SUTA 2X1SA 1IGSA 1LL4A 2J7GA 1ZL1A 2ZWZA 4NT0A 1NH6A 5JBEA 3SCOA 4Z1AA 1UD3A 4BI5A 1R2RA 2NXGA 2VFHA 2R91A 3P82A 4AD1A 2X16A 5AHEA 1QNVA 3LX9A 4JFUA 3P81A 2GVLA 1W1PA 5HPOA 5ABFB 5JBFA 2F8QA 3C2VA 2OLHA 2W61A 3ZO9A 1KM5A 5F1VA 4URIA 3GXTA 4F9DA 2ALDA 2WVSA 2XWEA 4WXZA 4IGHA 5CKSA 4LYPA 4AIOA 3DHUA 1WOBA 3TTOA 4CD4A 1E6XM 5DLCA 4MNLA 5LHEA 1IIHA 2W66A 4J3UA 4CD5A 3RFAA 3ARQA 5FEPA 3HGRA 4U3CA 5CGQA 2J47A 1KM3A 3S1VA 2I9EA 2WHMA 4MYAA 1I8JA 3L67A 3VE9A 1CBGA 1NF0A 1E5JA 1EHNA 1VBUA 4J3XA 4M81A 3RPMA 3W1MA 3T09A 3LF7A 2G3NA 3NQ2A 1SO6A 4FF7A 4POCA 1E4NA 4WIWA 2ZYFA 2CKSA 4EK7A 3CZEA 3GNRA 3WK1A 1R7OA 2W63A 5CSRA 4P8WA 4KWVA 4JAWA 4YHEA 4L4LA 2J7EA 4JFSA 2QCGA 1T0OA 3CH9A 3R8RA 1JYXA 1LOQA 3PZTA 2G3IA 4PRWA 3W23A 1W2PA 4F9JA 4TMBA 3VD7A 3FW6A 5E1QA 2PC4A 1GTEA 1D2KA 1LQ0A 2YJQA 4RJEA 3AOFA 5LNRA 1OYCA 4PMQA 1JYWA 1ESWA 3OA3A 3OG3A 2WWCA 4QFUA 1W3TA 3P60A 2YA0A 1EWDA 3UR7A 5LSMA 3U1XA 4GZIA 3EX6A 2J8GA 1KM1A 4RLIA 2UY3A 3WQ6A 1GVIA 1HJQA 3R5EA 1E3XA 5FF2A 3JUGA 1E1EA 1K9FA 4R5EA 5K9CA 3M5ZA 1UH2A 4W7WA 4W88A 3VPLA 4LUIA 3E96A 2B4GA 1KGXA 3DECA 1H7RA 3W1NA 4O16A 1AL7A 3WFZA 5D8ZA 4CGTA 4YCOA 1K7FA 2BXZA 3F5JA 4UCFA 1SZFA 3LRMA 4AW7A 4ZVJA 3QH2A 1TYGA 1T99A 2PRHA 2FPVA 1AG1O 4JFWA 3BAJA 4HSOA 3NG3A 3AS1A 1PE1A 1TE1A 4DO4A 1KTCA 1VHNA 1D3CA 2WB5A 3TR2A 1QW9A 3GKAA 5AHFA 2VZOA 1K03A 2Y24A 3SUVA 3WQ5A 4WF7A 4PUDA 1G69A 1EGZA 1MVYA 3T0DA 5G2HA 3VGDA 4NSBA 4IWWA 3ZJ8A 1TIMA 2ZZ7A 2Y7GA 4HA1A 2V5BA 2J9YA 4M82A 4DQWA 3CUFA 3AZTA 4HPHA 1OVDA 3BSGA 3WJSA 1QI2A 3L4UA 4J7RA 1GVQA 3GTNA 3W1TA 3QR3A 2PBOA 5CLWA 1HJWA 1E6ZA 2A1YA 1C93A 1XM3A 3A6OA 4AISA 1UG6A 2WVTA 4WJEA 4UFHA 3QEZA 1TVNA 3CZGA 4NX5A 4UFMA 3CBWA 1H11A 3N17A 3W7HA 2J7DA 3QMTA 3L4VA 3MP3A 3RLUA 4MZ1A 2YPIA 3B04A 3M47A 3RILA 1AK5A 5TIMA 3UYCA 1R2TA 1JUKA 1HN1A 3BXWA 3WL0A 1A5SA 5A8QA 1C8VA 3GNDA 2HMCA 2C16A 1RD5A 5BYWA 1K9TA 1O94A 1D7FA 5H91A 2PWEA 3TQVA 2Y8KA 2W91A 1FOBA 2F61A 2FLIA 5DCBA 3NR0A 2QCLA 1KCLA 1E4MM 4HNTA 3ECQA 4TX6A 4XKYA 4PMNA 1H2JA 4U5IA 1KB3A 3TAOA 1W37A 3A5FA 3NOEA 1H7NA 4MKNA 1Z48A 5K4XA 3ARUA 3OGRA 9CGTA 5FF7A 2E6FA 4UNLA 4XUGA 1BF2A 5D02A 1XBYA 1GJWA 3NDZA 3WFAA 2DSUA 2ZICA 1MW1A 4Z2JA 4CQ9A 1I45A 2WZIA 1JZ8A 2Y63A 4J3TA 2X09A 4J27A 4HOXA 4O4VA 4H8VA 3QFEA 1K8XA 3KHJA 4BR1A 2NWSA 5A8GA 2X0YA 4XBKA 2YDAA 3N14A 4AWTA 4P8XA 4GRSA 4CN4A 3FIGA 1DKWA 1JUBA 4P2VA 3W7RA 1LWHA 2ZXQA 3IGSA 1E3ZA 5LNUA 5I3GA 1OT1A 1XYFA 1SW0A 4UFLA 2CKRA 4DBDA 1F4AA 4O14A 1WDQA 3LHZA 3OLGA 2YBTA 4D71A 3K4AA 1GQJA 2YFOA 4GNJA 3MO4A 1TB3A 2XYLA 3W7CA 1ZY9A 1OYBA 5CPLA 4XUYA 2J7HA 4JD4A 1YQ2A 1V02E 4KFPA 3T0BA 4U33A 3NQGA 2ZRZA 1JDDA 3TONA 4U2YA 2VEIA 3QGVA 3EMZA 4FXSA 2YDQA 3OGSA 4M1RA 1ZALA 4NNBA 2A7NA 1EDGA 3BLIA 1VEPA 1J10A 3MI6A 1T8XA 4JXCA 5CPMA 1DHKA 5FIPA 3UWWA 1XDLA 1E43A 1QW8A 3BGGA 1JR1A 1RZMA 3IIPA 5DCDA 5C6MA 1B90A 2VKZG 3W2JA 1JNEA 2XSBA 4L4OA 5DELA 1VCGA 4JIQA 3NSMA 4O28A 2CHNA 1Y9MA 3HF3A 3WUEA 2VENA 3B4UA 3MO7A 2DEPA 4NJGA 2ZOXA 1JGIA 2EPHA 2E68A 2ZZ6A 1M7OA 2GJNA 2Q8ZA 3CEPA 3M5VA 1WYIA 3UQNA 2WZEA 5CPTA 1SSDA 4W93A 4B3LA 3QYQA 1OF6A 5H2ZA 5IM51 5BOOA 1UD4A 1M7XA 2GUYA 4K39A 3WQWA 4LTSA 3QC3A 3WNPA 4Y9AA 2F2HA 3DYOA 3WH7A 1BWLA 1ICSA 2QEZA 1LP6A 2G97A 3FFSA 3TK7A 1KXVA 4EANA 1OHLA 1BFNA 4AMCA 1B57A 2D2OA 1W9UA 1QI5A 3BC9A 3USBA 4MB5A 1GYLA 1TR1A 4AD5A 1B9ZA 3QW3A 3IAPA 1UKTA 1L6WA 3ARSA 1E6NA 6A3HA 3UG4A 5G1TA 4F8XA 4D1IA 5DN1A 1EUAA 2WC4A 3W7PA 3D3AA 1N8FA 3P62A 1CYGA 1V02A 2VTFA 1OFRA 1YPFA 1VQTA 1VZWA 3HMJG 4PCSA 4XV0A 2DGAA 2ZTJA 2WQPA 4WOQA 2A7PA 4NJIA 1GOMA 5FKYA 1UKOA 2DQXA 5E0CA 4R34A 2ZUVA 3EEGA 3KL3A 4LC6A 3YPIA 2VR5A 1O95A 3CHVA 2BS9A 1U2YA 2Y62A 4UMBA 4MB4A 3F03K 1QHPA 3NQAA 2UWFA 4HZ6A 2QDHA 3HO8A 4TTUA 2WM0A 3NL6A 5A94A 3IJ8A 1G94A 3ZQ9A 1DHPA 1FWTA 3PC0A 4FNQA 2XFWA 3RO8A 2TPSA 4MJZA 2W0UA 3HG5A 3PZUA 1OABA 3GIYA 2H6RA 4PYSA 4HA3A 4ZQCA 4KGJA 1MFUA 3A21A 3PSWA 4FFHA 2XVNA 3M41A 5AYYA 5LNSA 1LOSA 2DZUA 1E6QM 4MAZA 4UC5A 3WUBA 1N7KA 1W1TA 3CEUA 4O18A 5JBDA 3LFIA 3W26A 2CLIA 4NI3A 3T78A 2CERA 2QCCA 1P1XA 4HOWA 4BF7A 3LDRA 4M6VA 2PB1A 3B9AA 5GPRA 3AXIA 4N02A 5K7JA 3B9DA 4UR9A 2ATSA 3HG3A 3AMCA 4OBSA 1G4EA 1OFPA 4DUVA 4KWWA 3EYPA 4PSPA 1UBSA 4RL3A 1JL8A 1RH9A 1S46A 1BTMA 3QQ1A 4O57A 4IMFA 3N9RA 4KFOA 1CENA 3G24A 3W1LA 1KGWA 1YDVA 2E5DA 3A4AA 3L5MA 4AXNA 5BWFA 3PIJA 2C6QA 3WF4A 5ABFA 3EWWA 3NQFA 2V9DA 2QMKA 1LROA 5TBOA 3T44A 3VIPA 2QCNA 3MUY1 3DU0A 1F7BA 2JEPA 4R33A 1HL2A 2YZRA 4AWSA 2QCHA 3G1VA 4OIFA 4QDMA 4DWSC 5FI8A 1XYZA 5M03A 2GVYA 3U6WA 1TCDA 5BRBA 3SUUA 2E5CA 1IXNA 3AO0A 3LTYA 3TFXA 2W4XA 5CXPA 2E0PA 5BNKA 2WVVB 4FLSA 3VX1A 3MMDA 3AHYA 2CLMA 2VEKA 2FHFA 1KFEA 5IXEA 4WY0B 1BAGA 4CNOA 3ZOAA 5CPQA 1B9BA 4Y90A 3W3OA 1YDNA 1RVGA 4PMYA 4UQCA 3SUWA 3OLDA 3ZM8A 1GOOA 3TA9A 3QOKA 3WUFA 1X6LA 3DH7A 5BXSA 1SMAA 5K9DA 5A6JA 4AB4A 3W27A 3SCWA 1DV7A 3AMKA 1KBIA 4MFEA 4B9ZA 5I0DA 3G0UA 1CXIA 1WQ5A 3PBUA 4YXGA 4GI6A 5ABGA 4AC1X 3ANYA 4XBSA 2Z0IA 2FGZA 1FXPA 2XVPA 4MJ2A 2CCRA 4MOZA 5FL1A 3G8EA 4JTIA 1QWGA 3TH6A 2OYKA 1EH9A 3SCRA 1XH1A 3VVGA 1NSJA 1M04A 3TC6A 4IUOA 4UTHA 2G5WA 4PODA 4H6KA 4IMEA 1XHGA 4TU1A 2O9RA 4IUGA 2RDUA 2ABBA 2FB3A 4MAVA 3T2OA 3FXYA 2ZUWA 1E6SM 2XM2A 2W6RA 1E40A 3QQ0A 1X1ZA 5KSWA 4EVZA 2WBKA 2D3LA 3BSHA 4WSKA 4JX4A 3AIEA 3OVRA 3BH4A 4TX9A 3KAOA 1AL8A 2A3HA 2FH8A 1GUVA 2J9XA 5HWJA 4FX8A 1TMQA 3SIZA 5G4WA 5BMXA 3P5ZA 4JTUA 1UUOA 1C91A 1QFEA 4MJMA 5HQEA 2VMFA 3I7RA 2FB2A 4LV4A 1FFQA 1OIMA 1IF2A 1ISVA 4AZBA 4LYQA 5KZDA 2D0GA 4M8UA 2ZDRA 1DWHM 3L4WA 2JBMA 1E55A 5ABEA 2VURA 4JICA 4ONVA 1UB3A 3LTPA 5FCZA 3TMLA 4PEKA 4V2XA 3NZ1A 1FX6A 1HP5A 4JDBA 3OZPA 3UG5A 3QJAA 3PAJA 4HN4A 1UWIA 1XCXA 3WDQA 2J24A 4RR4A 1JZ7A 2TYSA 8A3HA 3MHFA 4G1KA 3RM8A 4UCGA 3PZIA 3GXPA 1Z41A 4NZJA 2E9BA 2PWDA 1FY6A 2BV9A 2VZVA 1NOUA 4CN1A 1HJVA 3W2LA 2FPTA 1JCNA 4S2CA 4UTMA 1HKIA 5A6SA 1EWEA 3G1YA 2VQUA 3MI2A 1OCQA 1UHVA 3EMQA 3SCUA 3VIOA 3NQEA 5LKYA 5HUOA 3HOJA 4DF2A 1G4PA 1K3UA 3FNDA 3U8GA 1OGBA 2A3CA 4BF9A 3IVTA 1EB3A 3L5AA 3OIXA 4AEOA 2W5FA 3AHZA 3WF3A 1UYPA 2CHOA 3ABQA 1HJSA 1VRDA 1VF8A 3SCVA 1KWKA 3DKLA 1GWJA 2EPNA 1A47A 1NWTA 1TTQA 5HXMA 4LS1A 4FFFA 1VYPX 6TAAA 3S5ZA 3U57A 3TTYA 3L2MA 3C3NA 2NZLA 2DT3A 4A2RA 1VR6A 4TXEA 1AQ0A 4LVFA 4UTLA 1G9HA 5AC5A 1CEOA 2WMFA 3DHDA 2FIQA 2JALA 3VIGA 3NSXA 1TO3A 5K2ZA 3GYEA 1L6YA 2A6LA 5CLTA 1OGSA 2X1RA 1MQRA 2AEZA 3WMCA 4U2ZA 2GJPA 3I6RA 1OD8A 4S3JA 5LA1A 1L2UA 3KF5A 4FMVA 4HZ8A 3ZSSA 1KQZA 2GVJA 1UD5A 1EEPA 3TQKA 1QPQA 3NDYA 4XZ9A 2VCCA 3AFBA 3AICA 5AHLA 1Z44A 1PZ3A 4ML4A 4GPNA 1CNVA 1E4IA 2OWCA 3C4UA 1UWTA 2NW0A 4WLCA 4GC4A 1OFEA 4LC8A 1UA7A 1DORA 2AC1A 1VLIA 1WZLA 3P8JA 1H1NA 1D9EA 2GDVA 1SUXA 3LRLA 4JTKA 4EIVA 1WZAA 2XM1A 3LI1A 2OCZA 3ZJ6A 3NZRA 1TTIA 1SFSA 1BPLB 4HMDA 2YYTA 4DUXA 4MTVA 4N9EA 3F1QA 2OWXA 4KGLA 4CNPA 3EXTA 1OSEA 4AZZA 3O16A 5DFAA 1XBXA 1JYVA 1P6WA 4XB3A 1J0YA 3PBGA 4DUWA 4JR5A 2VVNA 2WCGA 4A3UA 2WPBA 2QCDB 4K38A 3DXIA 2VXNA 5K3VA 1UH4A 1C92A 3AIUA 1DVJA 2J7FA 2EPOA 2G95A 4NVTA 2YDRA 3G6LA 4D6GA 3U7VA 3NPVA 2AAMA 3KVMA 3SCTA 2QLYA 4HIBA 2IQTA 4LQ1A 5BRPA 1U5JA 5D2XA 1VC4A 3S1XA 4AD3A 3S1WA 3ALGA 4C1LA 3C2EA 3PZGA 5D8WA 4FO4A 1SZNA 3LI0A 1CGUA 1H0GA 1NQ6A 3MV01 4B5NA 2J4GA 1KXTA 3GDRA 2WO5A 3VE7A 1CTNA 1LRTA 2V3EA 2NX1A 4MY1A 1G01A 1SSGA 3MS8A 2A3AA 2YL8A 2ZUNA 4J3WA 3BPWA 2J88A 2QKFA 1W3HA 4LX4A 3HPZA 2C19A 3BAYA 3FAWA 2ZX8A 3BLEA 4V28A 2WXDM 3QRHA 1SZEA 1JAKA 1TQXA 4AVFA 4UNKA 1LF1A 4AIUA 3ATZA 4I9AA 4LW7A 2XGIA 1XSJA 4N4QA 3SGZA 2WK2A 1CIUA 1GZJA 4JHOA 2Y89A 3PZMA 2VCAA 1C8QA 3LHVA 3T2QA 3FJLA 3K30A 1F74A 4CKQA 2J77A 2X1UA 4HPGA 2J7CA 3WK3A 1NOFA 3EMCA 4PTXA 4O15A 1M53A 1E51A 3SECA 3FKRA 2J62A 1O5KA 1PHWA 4W86A 4N6FA 1HNYA 3SI9A 1TPEA 3KRUA 5C54A 3W22A 3W7LA 4IPNB 3RDKA 3M1ZA 2QCMA 1JFXA 2ZQ0A 2DZXA 3WQ4A 1EOKA 1QOXA 3POHA 1KFKA 3LHTA 2ZUTA 3BW2A 1CGXA 2CLLA 3WBEA 3S5NA 1Q6RA 5CPNA 3TQ0A 3DFOA 1UASA 1MZHA 4JGDA 3VNYA 3EDKA 3POCA 4P7RA 4JCMA 3UEQA 1JRCA 3LERA 2EPMX 2HVMA 5D4YA 1W5PA 1V3HA 3W38A 1LYXA 2GUUA 2WLZA 5HR6A 4WZHA 4GINA 4WK9A 1FCVA 3NCOA 1H0IA 3C2OA 6ALDA 1OJXA 2BTMA 4FNRA 1WZMA 3L0GA 4LOCA 1XSIA 3IRDA 3AZRA 4O0ZA 4LRTA 3WSUA 2VEPA 4H2CA 3CZLA 3A9IA 1AMKA 3HB9A 5C8BB 5FEXA 3OZOA 1OX4B 1WCGA 3GYCA 4GUIA 1KLZA 4XKYB 1QPNA 1ONRA 1SU5A 2VT0A 2Z1KA 3AMGA 3KL5A 4QJ1A 5D09A 4O53A 1NWUA 3CMGA 5AYIA 1GHRA 1HUVA 3LCHA 3G1AA 3OHIA 4IMCA 1NARA 3UY8A 1VB9A 5E6YA 2J25A 2DSKA 1FH7A 2V8ZA 2WANA 3B0PA 4LS2A 4IJBA 2PWGA 1BYCA 3S8HA 1YHTA 2VJXA 4DBEA 3PUEA 1Z42A 2BX7A 1PJ9A 3W6LA 1W2VA 1XI3A 4DEFA 2DSZA 3WN6A 3AIBA 4FF5A 3TJXA 1DOSA 2YA2A 3GZ3A 1RPKA 3WDPP 5FOOA 2E4TA 1DJNA 1TV8A 1XGZA 3G22A 4CCDA 3CPUA 4B16A 3GVGA 3W7JA 4W84A 4B15A 1I1XA 1ZAIA 4KRUA 2PRLA 1GVRA 1ICPA 3A24A 4UIOA 3ARXA 1JG9A 3OLEA 3EX3A 7TAAA 2V2DA 2Z6JA 2V3FA 5KZEA 3UR8A 3WQVA 2CFFA 3GKFA 4WY0F 4NZCA 3LCLA 2FHBA 4Z2GA 3U75A 1C8YA 1PV8A 1X6NA 5DXXA 3T40A 2NX3A 5D9PA 3ARWA 3K46A 4O13A 1W5OA 3TX9A 3VMNA 1LM1A 4JYDA 2CXGA 5BRQA 3LV6A 1S5VA 3N18A 1KV5A 3RF9A 5CPOA 3E0IA 2PE4A 4IMDA 4WD0A 4IPJA 3TC7A 4UTFA 5KMYA 1PHQA 1OX6A 2UY5A 3EDJA 3GBDA 3DBPA 3OEXA 3W28A 4MY9A 5D32A 3NL5A 3LHWA 3NIYA 3VD5A 1ICQA 4I7WA 4W7UA 1MW0A 1BEUA 1IXPA 1TRIA 3GXIA 4P7NA 3E9AA 1R2SA 3EWYA 2Y8VA 3K8LA 4WSJA 1IXOA 1K9EA 1QNOA 2PURA 1XL9A 2C1HA 2XN0A 3W71A 1EIBA 1ADOA 2CITA 1QNRA 3UGGA 3UWVA 2NXIA 2VX4A 2OSXA 1D3HA 5EFFA 4W87A 1W54A 3STEA 1LOLA 3WMBA 2AOSA 5A3HA 1QCWA 1G0CA 3ARYA 1W3KA 3EX1A 5U4NA 5A6LA 1W5NA 2X05A 1HVQA 5A8OA 1SZGA 2QJIA 3G1SA 1VFFA 1G4TA 1KBBA 2EBNA 1TJRA 2ZRYA 3BG5A 4NUWA 1BG4A 2VELA 1Q6GA 4O19A 5CZTA 3Q2DA 3B03A 1UR2A 3LCGA 2B7NA 4ICNA 3WD1A 3M5YA 4GO8A 3VO0A 3LIHA 3BAXA 2EHHA 3W83A 1J0IA 3GDBA 5CPSA 2YW3A 3S5OA 2GJXB 3NPXA 2NUWA 3FHAA 1HF6A 1YDOA 3KOFA 1FWRA 5IHRA 2AGKA 5E09A 4JKKA 3QHNA 2D23A 4TMCA 4B9YA 3AJ7A 4Z08A 3CUGA 1WBJA 4NNAA 3WD3A 5A6BA 1JJKA 3ARRA 3W87A 3CIWA 1MQPA 4M29A 3WH8A 4ZEPA 5A95A 3L9CA 1UJPA 5EMUA 2C0HA 4AIEA 5GNYA 2CW6A 3W2MA 1J9YA 1D3GA 2VFDA 3ARPA 3PN8A 3HG2A 4D6DA 2YSWA 3W1XA 4ATWA 1C9DA 2NXHA 5HR7A 1SR0A 1SMDA 1BLIA 1ZHAA 1ZBVA 1LBFA 3BVJA 1UWRA 3WY1A 1OFAA 2CZEA 1LLWA 1JI1A 1F76A 4A29A 2O9TA 1O7AA 4D6IA 3WK2A 1LBLA 3A5VA 4RV8A 3W24A 3VKJA 4DO6A 4D6JA 1B4EA 1J18A 1K7XA 3SFKA 5HOSA 3NDOA 5AHMA 4O12A 4GE8A 4QLLA 1R46A 3VNZA 4UR8A 3WQ8A 3W29A 1MW2A 2YL6A 4UQ9A 5AHIA 1CGVA 1V6WA 2QR6A 4JHZA 5I2UA 1YXCA 2C18A 3W1UA 5CZJA 1ZBKA 2JIEA 3DZ1A 4NQ1A 3HU7A 4H3DA 4JL1A 1CW2A 1THFD 1BYBA 3UPWA 1X1OA 3JS3A 1MYRA 5I24A 4H04A 4O50A 3NL3A 3W9ZA 1LTDA 1SPQA 4M6QA 2VI0A 3N9KA 3UG3A 1ZNNA 3TSBA 1JAEA 1U83A 1LL6A 4LY8A 1EXPA 2O7QA 5EL1A 1B1YA 4CUCA 3AXXA 3W1PA 3PM6A 1QO5A 1L0PA 2QMJA 4IPLA 4DM1A 2WSYA 4ADTA 1KM4A 1GONA 1UD6A 3WKZA 3DYMA 3ZR4A 4K8EA 3RM4A 1U33A 5F7UA 1ZBWA 3TA6A 1PIGA 5I23A 4CD6A 1W5MA 5D2VA 4XZBA 4AHQA 1WBHA 2FQIA 4RZ6A 1O5XA 4QQ3A 4ZMGA 2D3NA 2NLIA 1NOWA 1XCWA 1LRNA 3P80A 4AWUA 4FXRA 4PBGA 5AHNA 2BWGA 2A4AA 3P67A 1BVNP 2UY2A 3P5YA 2VC6A 3OG2A 5G4EA 2NV1A 2VOMA 3E02A 3L5LA 3AHXA 3I3DA 3IEBA 4H8UA 4EOUA 5CJ5A 1S5TA 1LLZA 1J2WA 1Q6CA 4OOUA 4BQ3A 2EJ1A 5DY3A 5A8NA 5AC4A 2XIIA 4AD2A 4TVCA 3CPRA 3M0ZA 1H63A 1QAPA 2XGBA 1Y9GA 1E56A 4UMAA 3O05A 1RQBA 5A2AA 2VVSA 4ACYA 4OQVA 1B2YA 1W9DM 3L4XA 3SUSA 2WYSA 3UWQA 1I4NA 2DIJA 4N42A 1GZGA 3QMSA 4UTIA 2JF7A 3UZJA 4AEFA 3PZ9A 1VHCA 1V3KA 5T26A 5BXPA 2I1OA 1GG1A 1TJPA 5G1YA 3GR8A 2E3ZA 3AYSA 2X1IA 5HJLA 3UXDA 4PFMA 2RFGA 2Y5EA 4HNVA 2FPYA 3KX6A 1BWKA 3GH7A 1F73A 3LPOA 4OUEA 3EB2A 1DL3A 3E1F1 4FX7A 2YFNA 1BYDA 1GVFA 1UR1A 3U7BA 3VKKA 5D2YA 2VCBA 1P4CA 1JCJA 1UR8A 1MXDA 3AS2A 4W89A 1QDSA 5I6SA 1KFBA 4S1FA 4HA4A 1C7SA 5F1UA 4UFIA 3B05A 3KRZA 3RU6A 2G8ZA 3QHMA 4Y96A 3TW6A 4GI8A 3WEOA 2WWDA 5F2IA 4UTKA 3MBFA 4JYFA 2Y85A 1UH3A 2D0FA 5I77A 3B06A 1EHAA 2WMJA 2VOTA 2JKPA 3FKKA 3IVUA 2J6XA 1V6VA 2RH9A 1P0KA 5E0FA 1HKKA 3UCQA 4MNJA 4CN6A 5FEWA 3GXMA 3MMUA 5EY5A 3TJLA 4A21A 3VGHA 8CGTA 4OV9A 2WZHA 4FHAA 4M6PA 5JUVA 1Y4WA 5G2WA 3L4YA 1H7PA 3DC0A 3QZEA 3BW3A 3I7QA 1MXGA 3MUIA 3QPYA 3LXAA 3HJEA 1GJPA 1ITXA 3MYOA 1H62A 2V5DA 2WBGA 1E72M 2PWFA 5I3KA 3M6DA 4EQVA 3V1PA 3GZAA 1VH7A 5FKCA 1KQYA 1KA9F 3UWZA 4J28A 3LB0A 5BXTA 3OSDA 1FH8A 4IM4A 4M7SA 2ADDA 4AD0A 1FCQA 3VX0A 2C15A 3M6YA 1SO5A 4K7YA 5D30A 4PMOA 5ANNA 1XBVA 3CLWA 1BGAA 3IIZA 1HVXA 3L4ZA 1H49A 3KXQA 1OD0A 2G4FA 2DPEA 1W3NA 1KBJA 1XFBA 2PWHA 1KM6A 4ZXLA 5FESA 4XZWA 4M5PA 5FEZA 2IUZA 2AMGA 4A3YA 2E6AA 2DT2A 2FHCA 2V2CA 1QBBA 1YLVA 4L4MA 1FQ0A 1FDYA 4E0CA 4CVUA 1RP8A 4RE3A 1F5ZA 3MV11 3T0AA 3ZSTA 3PZOA 4MUZA 4GJ1A 1V0NA 4DELA 4BZYA 2JEQA 2CU0A 3NJ3A 4F79A 1SW3A 3C0JA 4MY8A 2CEQA 4ADSA 4TTGA 2YLLA 3S2CA 1JZ5A 1VJZA 2X0HA 3AQUA 1V3JA 4P8VA 3LOTA 4FK9A 3VILA 3TNOA 2BFGA 1CXEA 3G1DA 3VM5A 4PTNA 1FCBA 1SR9A 1VCFA 1J0KA 4C7DA 4IX0A 4MPQA 1V6YA 1GPWA 5CZSA 3VMOA 3ZWTA 2DP3A 2Q8XA 3CWNA 3GR7A 4JFTA 3U5UA 3UY7A 3LHYA 3A22A 4NJJA 3A3HA 2O7SA 3IIOA 1XD0A 2WMKA 1IZJA 4O17A 4Z1BA 1CGTA 1HKMA 5A6AA 5D2WA 3PTQA 1F2JA 4HHPA 4MLJA 4OKDA 2ESCA 2EF9A 3MUZ1 1OINA 1FWSA 1VGAA 2YIHA 4TUFA 4QP0A 1KCKA 3QW4B 1EDTA 2XN1A 4IXXA 5I3HA 3T2PA 1KFCA 5A6BD 1EP2A 5F2LA 2WCSA 1MEIA 1S5WA 2XSAA 3CUJA 2QUUA 3G1XA 4Q33A 2DSWA 3GH5A 2ZCGA 1LZOA 2AEYA 3OVQA 2HSAA 4AEEA 1H09A 5IFPA 4MB3A 4W9TA 3W7IA 1EX5A 3ABRA 1HT6A 1UR9A 4KRTA 4FNSA 1US3A 2A3EA 3MSGA 3P74A 3IV3A 3F5KA 4B1MA 2Y4SA 3LLFA 4XX6A 1PIFA 2EAWA 4DWSA 2FTPA 3OIHA 2E77A 4N9DA 2FDMA 4D6CA 2CBIA 3GX9A 1A5BA 3CZ8A 1JQVA 4AY1A 4ZE5A 5TQLA 1EQCA 2Y6ZA 3NM1A 5HDRA 7TIMA 3ATYA 1E15A 2V5CA 2YDSA 5FL0A 4K8HA 4U5KA 1FHLA 5D9OA 4QNEA 3ALFA 1MW3A 3M07A 1V08A 3C8FA 2X8RA 3M44A 3UERA 5HULA 1XH0A 4FLOA 5IFTA 3ARVA 3IJ9A 4GKLA 1XC6A 4LWWA 2TRSA 3GXNA 3LXBA 3NQMA 3RLVA 3CLMA 2NT0A 3OGVA 2QUTA 4N0RA 5D9MA 2YW4A 5M3WA 1A5AA 3RWKX 4MDPA 3WH5A 1UA3A 2H8ZA 4QAWA 1PZ2A 4UOZA 1X7FA 2NV2A 5E0KA 1QVBA 2WMHA 1CXKA 4ZE4A 1LG2A 5A1AA 1OB0A 1TPB1 1H5YA 2EXOA 3T4CA 3TXZA 3W1AA 3DFPA 4ML9A 1W8SA 3NUKA 4U3AA 3LCXA 1MEWA 3VM7A 1UKQA 2CYGA 2V82A 2NUXA 3TCEA 1OYAA 1MQQA 3LBMA 1A3HA 2XTKA 3A23A 2QQUA 1VEMA 3RMEA 1Y0EA 1LWJA 3IGXA 1LJYA 5BXRA 1IXQA 2F7FA 4H4IA 1HJXA 4O4WA 1CDGA 4Q7NA 3W82A 3B9EA 3G3MA 3PUOA 4LVGA 3AIWA 1JNDA 2ZX5A 1NWRA 5LGXA 1VEOA 1WKYA 1O6IA 3STCA 1W91A 4TIMA 1TREA 2QDGA 2ZZ5A 4ZL1A 4D72A 4KWUA 2V2HA 3S42A 1G6CA 1R85A 3N11A 3THAA 1ECEA 2B0MA 2TSYA 4UTJA 3EWBX 4M7TA 2ZTKA 4RX0A 2X2GA 3C61A 3HGOA 4PC8A 1GVYA 1ZENA 3MUAA 1Q45A 3U5YA 1H1ZA 1JCYA 4KKXA 1QNQA 4K36A 1K9DA 2XPKA 4AZIA 3NQDA 4U4MA 5A2CA 1J11A 5DEZA 3LDVA 1FP8A 1V7YA 2C14A 1XV8A 3PTKA 2DDXA 1HXJA 3W1QA 2VX7A 3II1A 3PSVA 1QMLA 3IMMA 4MVAA 1WO2A 3ZT7A 1FCUA 3WDJA 4AZ6A 2ISWA 1JIBA 3W4RA 3SURA 3LBCA 1A5CA 3THDA 3W73A 5FMBA 4UQAA 4W5ZA 1G1YA 4ACZA 1X1NA 1V03A 3TXVA 3NPWA 2D73A 4WKAA 4FNUA 3MMTA 4H8HA 1UZ1A 5MHBA 1K02A 2GVGA 5JIPA 3O15A 4JTJA 2DJLA 4BI6A 1BSIA 3W0KA 4OZOA 1TPH1 3GDKA 4ZZ9A 2ZIDA 3FHQA 4DWSD 4ZQRA 2WC3A 1W1ZA 1H50A 4ADUA 2C13A 2BNJA 2A5HA 2VQTA 4BCEA 3HMCA 3IAQA 2WVVA 3VDBA 4JKLA 3VDCA 4PMXA 4IXHA 1JZ4A 3KRSA 4PMRA 3E12A 4NJKA 3S5YA 2ZA3A 2DT0A 4GQRA 2B7OA 4HNNA 2VFEA 3Q94A 2DSVA 2VEMA 1JRBA 4I7UA 4NXKA 1DWAM 5CG7A 3M43A 3VGGA 5CSUA 4RXGA 4BS0A 1E0WA 3VINA 3BARA 1N55A 3M7WA 3IGUA 1ME7A 3EDDA 4W7VA 1E1FA 2X1TA 1B3YA 3HPXA 3RM9A 1XSKA 2BY1A 1TMHA 1B31A 1HKJA 3M16A 3NNTA 2WAGA 3WD2A 1BKSA 2ZZ1A 3N19B 3L68A 3WMSA 5C71A 4LT9A 2D24A 2V38A 1PCKA 2VFFA 1KFLA 2BZNA 1ZCOA 2TMDA 3LXCA 5E6ZA 3UESA 4BQ2A 4RCXA 5I78A 1H3GA 3DGRA 1IT0A 1F05A 3F4NA 1H60A 3KVJA 4O1AA 1KXQA 1W9VA 4OV4A 3VTRA 3GAYA 1KWGA 3N12A 1DBTA 2E5BA 2G3JA 4PTVA 1J0ZA 3GLCA 4HPXA 4UTWA 2VRQA 1CI1A 1I2RA 1XUUA 5D05A 3MHUA 3S1UA 4FB7A 5I3FA 3CZKA 4E4PA 3MW7A 2WNZA 3DFTA 3W2NA 4C1KA 5FF3A 2FH6A 1TSIA 1E4LA 2CNCA 2UV8G 3BW4A 2EPKX 1VCVA 2P1FA 1I2NA 3NQ7A 1OT2A 1SFLA 3LCWA 1V3MA 1AMYA 3OB8A 1L6SA 5HMSA 1RV8A 2D22A 2J78A 2Q3OA 3RK8A 2Z1SA 1NEYA 1CXLA 2A6NA 3O1NA 5AC6A 2QV4A 2Y61A 3IANA 5M5DA 3MSDA 1I1WA 4CD8A 3ABOA 5D04C 4RKAA 3BCDA 1E73M 2CWNA 5IBXC 1H51A 1NM9A 3O8AA 3DHPA 3NAVA 3VIKA 4PA8A 2WSRA 3MI3A 4W8AA 2VX5A 1KTNA 1B30A 3WNKA 4CU7A 4QCFA 4O10A 4NF7A 1QPRA 1WOAA 4QAIA 1H4PA 1NVMA 1KXHA 3WUGA 3NA8A 1TG7A 4OBRA 3K8MA 1OWQA 3WF0A 4HOZA 5M17A 4JIPA 5I3DA 5FF0A 1RPXA 3WH9A 4PMUA 4LUJA 4BA0A 3THQA 3IIVA 1GOKA 3WEMA 3VD4A 1WXJA 1W2TA 2HS8A 3H53A 4HMCA 4N4PA 5D2TA 3CQ0A 1KM0A 3PG9A 1ZB5A 1DQXA 2OZ0A 4ORIA 4XWUA 2JK2A 4RXFA 4HPJA 3M7SA 1ZBCA 1GVOA 2WJZA 4JTTA 2E09A 4FX6M 1W31A 3W37A 1LG1A 3BMVA 2DIEA 1GVSA 3UNDA 1GQNA 3CIXA 3NYDA 2MANA 2QQWA 1G67A 3O6AA 4BWLC 3P61A 4O52A 4PN2A 3PB0A 4U28A 2YOCA 5HINA 1JUEA 1SYTA 2NT1A 3G0SA 4V27A 1WDWA 3INPA 1SFJA 5EKYA 3C56A 5FK8A 3LRKA 1GOWA 1UD2A 3VOCA 3NQCA 2XWDA 2DH2A 5I79A 4K6AA 2QAFA 2WPGA 2C8NA 2C0AA 1R8LA 4PEEA 3RIKA 1YADA 3ZR5A 2V0TA 3KVLA 1KW1A 3ZIZA 4JNMA 1UWSA 5LYRA 4KH2A 2UY4A 3CHFA 3VGEA 3QM3A 5LHFA 5EB8A 3T08A 3W81A 3NM3A 4XTIA 1QNSA 2WMIA 3KE0A 1CWYA 4HXCA 5C55A 1PBGA 5A5WA 3AS0A 4KMQA 1Y7VA 1KFWA 3WD4A 2VUYA 4X9YA 1HO4A 1WAUA 4Q22A 3EWUA 1OFBA 1CZ1A 2ZE0A 3VIMA 2WCAA 2YXGA 3CC1A 1JI2A 1R86A 4AZCB 4O1CA 1UCWA 2D0HA 1EA0A 3KFTA 2VO5A 4S3KA 3W07A 5A8PA 2YX0A 2QPUA 2G96A 1XC4A 1VFMA 2PRMA 5C5YA 3N04A 3TMQA 2QJGA 2E9MA 1FA2A 1EO7A 1W1YA 3AIQA 1WZKA 5CQ1A 5I3IA 3FEMA 2CBVA 2CIPA 3I7SA 2Z2UA 4TVDA 2JE8A 2XHYA 3BCFA 4UFKA 2AQWA 3PF3A 2F84A 3PG8A 4GXPA 4UNIA 7A3HA 5DXYA 3NVTA 1JF6A 1HP4A 3IK2A 2OT0A 4UR7A 2QF8A 3EKLA 1VAHA 1MEHA 2GQ8A 4UXDA 1LRQA 4GQQA 3AJXA 4LXFA 4HTYA 1H61A 4W5UA 1WDPA 4NU7A 2B31A 2CZFA 1KM2A 2FFCA 4JQTA 4NZFA 1W32A 2IXVA 2PBGA 1B3OA 3VDHA 1IIGA 4S2BA 3VUPA 4AWEA 5EYWA 1CGWA 1Z32X 3BLPX 3ZR6A 2B7PA 2QAPA 1TV5A 1VJSA 1VPXA 3TDFA 4WXYA 3I3BA 3KVKA 2EKCA 1F6PA 1U30A 2RDWA 1QHOA 4E8CA 3LHUA 3CHCA 3WNMA 1TPUA 5G2IA 1J12A 1I2PA 1K8ZA 3NGJA 1E9LA 3FA5A 4PTWA 1B3XA 1QBAA 1G4SA 1DWFM 5F2MA 3TIMA 2YGYA 3WJZA 3SCNA 2FDSA 1JCLA 3K8KA 1J0JA 2BHUA 4O0KA 3QSRA 3WDIA 3W2UA 3GM8A 4ATDA 1JXKA 5L6UA 3MWAA 3W7KA 1ISWA 2ZWYA 2NX9A 4GUFA 1VIWA 3DI1A 2BLEA 3DFQA 3CIVA 2XUCA 2OSYA 1OM0A 4DPPA 1E0VA 1KR1A 3B8DA 1TPWA 3HIJA 5AC8A 1Q3NA 1NWSA 1OK4A 4LV9A 4AHOA 1UR0A 3BO9A 1ZAHA 1UYQA 2JF6A 4HSNA 1JQXA 3BLKA 3G8RA 2V3DA 3ZT6A 1JZ2A 4FNPA 3VIHA 3ZJKA 4MZYA 3CO4A 1K7EA 4A3HA 4JYEA 2PCQA 3TSDA 1K8YA 1CGYA 4Z2LA 1JCMP 1FDZA 1J0HA 2Y88A 1NAL1 1HG3A 2ZA1A 3HQ1A 2CETA 3GH4A 1GQIA 3W25A 1XDMA 2BVYA 3ZMRA 5LZLA 4MPKA 5AYBA 2OXBA 3W7QA 4D6EA 1TTPA 1OX5A 1I75A 3APGA 1NFBA 3IJ7A 4IPIA 1RD6A 1AQMA 2QUVA 3GDLA 3HGSA 4HMEA 3GB6A 1G7VA 5LA0A 4M19A 3CUIA 4QLKA 1A53A 3M5XA 1YXYA 5K9XA 1OX4A 3UD6A 4OBTA 1TPC1 2FGLA 2BY3A 2ZUUA 3RNDA 2LLEA 1MSSA 4UUIA 4QHZA 5AC7A 3L2IA 3TROA 5J5DA 3UWUA 1QR7A 5KZMA 2O9PA 2WSQA 3W85A 5DT7A 3SCPA 4CQAA 5F4WA 4RK8A 4K7VA 3W72A 4FFIA 3VCRA 5AOUA 4B3KA 4IQLA 3B0UX 5CZKA 3PBYA 5E93A 3S9YA 3BG3A 3PZVA 3UXAA 1QI0A 2V3GA 1VFOA 2ADEA 3STGA 3W1RA 2WHKA 1FBAA 3DFSA 2XVGA 1R87A 1YYAA 4O1BA 1W1VA 2QCFA 2BY0A 1V6UA 3BGAA 3WFLA 3MP5A 4TVUA 2JIWA 2RDTA 1YTKA 2WMIB 2GOUA 1TPVA 3BAWA 5C70A 1AW2A 2ZRVA 4QISA 1LL7A 2WMGA 3KEHA 4YHGA 5DT5A 5EA9A 2YBUA 3EX2A 4M80A 5BCAA 2XN2A 3WD0A 5EMYA 2VC9A 4JN6A 1H41A 3M9YA 1N82A 3PTMA 3W7GA 1BQCA 4DXVA 1ITCA 2DJXA 3I3EA 1NP2A 1TA3A 2J75A 2VRJA 4U31A 4D6HA 4MFDA 1AW5A 1G7UA 1EP3A 1JD9A 3TSMA 1DEDA 4Y8FA 4EWND 1ZJAA 2CLHA 3AIRA 4IX2A 4ALDA 1ZJBA 2E6DA 3CHDA 4FLRA 3H55A 1E6PA 3L4TA 4BQ4A 1GYNA 1OK6A 2WLYA 2E6YA 5CZ0A 2R14A 1GTHA 1FDJA 1OBAA 3FJ6A 1M6JA 3Q58A 1M5WA 3R89A 1MWOA 2ATMA 5A69A 1RQHA 3F5LA 4QCEA 4CU6A 1V5XA 2VNCA 5FF4A 1J5TA 1Q6DA 1FXQA 3HPSA 3MUXA 4IOTA 5JIWA 4K68A 1QPOA 1UKPA 2OYLA 4A4AA 1G5AA 3WF2A 3FYOA 1DP0A 1MFVA 3N1AA 2NSXA 5HUPA 1ZFJA 3EBVA 2GPTA 4RE2A 3GXDA 1CECA 5BW6A 3AROA 3KL0A 4YN5A 4CLMA 5FIXA 1BGGA 1WP6A 2GDUA 3A47A 4LRSA 4LU0A 4TO8A 3I65A 3NQVA 2O9OA 4C7FA 1PX8A 1FHDA 1F6KA 2DZWA 2P0OA 1LLOA 4JEQA 1E71M 3W7MA 4CU8A 2XFRA 3VIFA 1FH9A 3L66A 1ALDA 1OFDA 4JY9A 2BVTA 1ISZA 3NPUA 1X6UA 3PS7A 1HIZA 5HWMA 2CESA 2W79A 5CSSA 4QIUA 3GK0A 3PVFA 2WKJA 1C3FA 1TPFA 4WOZA 5LNVA 3TKFA 2VX6A 4HKPA 1JULA 1WA3A 4K37A 1UUQA 5D9NA 5LA2A 1KR0A 4M24A 5D38A 3L65A 2GQ9A 4PCFA 1BVZA 2D20A 2WKGA 3MU7A 3NEVA 1KFJA 3CTLA 1H1YA 3L0NA 3NXFA 4QSHA 1GOIA 1WX0A 1OG0A 2BVDA 3C52A 2EEXA 1L9WA 1JFHA 3VIJA 1XD1A 1DWIM 3G6MA 3EKZA 2WKLA 1UUMA 3LPPA 2WHJA 4O8RA 1XCFA 1KLYA 4EF9A 4YPJA 4AHPA 3CU2A 3TFCA 5DBUA 3N34A 3T55A 2ZRWA 1FUYA 3N3MA 4GUJA 2Y7FA 2R8WA 5DCEA 1IZKA 2JFEX 3AXHA 3FN9A 4JL2A 3C2RA 4JCLA 3EXSA 3DKJA 4Z1DA 5FKBA 5KZ6A 1ML1A 3JR2A 2ZXBA 4GUHA 3CZJA 3SCSA 3WNNA 3UZ5A 4MADA 4N6EA 4D6FA 4BWLA 4PL2A 1CLVA 1H7OA 1W9XA 1YXDA 3STFA 1DJQA 4UFJA 2CLKA 2V5LA 3A4WA 3WH6A 1PIIA 2OWWA 3CB8A 1GPFA 3W6MA 4LVBA 5J5RA 3LMYA 1C29A 4J3VA 1FWWA 2Y2WA 4W85A 4AZHA 3NQ6A 3LEMA 3BK0A 3CUHA 2EO7A 4LVAA 4N9BA 1VRXA 4ZENA 4W8LA 4AZGA 3LLDA 3DI0A 3WJXA 1QI3A 1V0MA 2PF0A 4B1LA 1W56A 2Z6IA 2A85A 4J9JA 5F4XA 1SO4A 1DWGM 1E5NA 1EDQA 2XFFA 5F4SA 3KF3A 2OMAA 2OX1A 5IDIA 2G3MA 3WBAA 1V0KA 2VR4A 4WKFA 3ZT5A 4JTEA 2R94A 1XRVA 3VD3A 2DZSA 1OF8A 4E2BA 3K1DA 3O07A 4TR9A 2CZDA 1ZU8A 3TV8A 4UTTA 3T7VA 4GIAA 4GUGA 3LCFA 4LS0A 1EA9C 1UWUA 2D1ZA 1P0NA 3DYPA 4NRRA 4CVWA 3N9SA 3H54A 4XTDA 1E0XA 5EBUA 4N2YA 3O9NA 5ABHA 1ME8A 3G1HA 1HJUA 1TVPA 1J4EA 4YCPA 1L8NA 3MBDA 3SEPA 3LV5A 4LNYA 2WSPA 3MKKA 2FJKA 1EO5A 4MNMA 2ISVA 3EWZA 3QSTA 3RMJA 4MZ8A 3QHOA 3C2FA 2DU2A 4PUEA 4MB1A 4GI9A 4CNNA 1TTJA 5DF0A 3HBLA 2A21A 3PIGA 1ZS2A 1AW1A 2Y70A 5FMCA 4GZJA 1CLXA 4HP5A 3OBAA 2JKEA 1JDAA 3W7NA 1O60A 1P5BA 2JGYA 1GCYA 1WPCA 4DM2A 1SO3A 3I68A 4ZQNA 5GNXA 3UWYA 3LPGA 3ZFHA 1K6AA 4AYSA 1JYNA 4WQ6A 4YLWA 8TIMA 4GBUA 2PI6A 2DZTA 1GNXA 5A6KA 2ABAA 2GQAA 4D2JA 3R12A 3WNOA 4MLRA 1RQEA 1JF5A 2ZX6A 5BMWA 1W0MA 4X2RA 1W3IA 5K4ZA 4UQEA 1QOPA 4FNTA 3W7EA 5DBTA 5DMYA 1GQKA 2VL4A 4PSRA 3P84A 3BGJA 2GJLA 3G3DA 4JTHA 3C6CA 2ZUSA 3AIVA 5E70A 5E9AA 4QLJA 4BI7A 4P7OA 5KEZA 4MIMA 2E8YA 3AISA 1Q4NX 3VNDA 2O92A 3HBKA 1GEQA 2ZXAA 5HWNA 3N2XA 4UZUA 4JX5A 3QF0A 3HGJA 3W88A 4N9CA 4Z0SA 4A22A 1BHGA 3B8SA 3ZS4A 4I7VA 1EPXA 3WJWA 4FFGA 4HNUA 4QITA 3PUDA 1ODZA 2VZTA 4O1DA 3P7YA 1HX0A 4OWGA 3N13A 4Z2HA 1VS1A 3LM7A 3UGHA 4HT3A 4C7GA 3R2GA 2A2IA 4LYRA 1CX9A 2Q3RA 1AQHA 3NYZA 4AZ7A 3PB2A 2GJXA 4WUIA 4ZFMA 3LIGA 5AYZA 2V30A 2VRKA 1WNOA 4YL2A 1PX3A 4FIRA 1EIXA 3L21A 1ME9A 2E1DA 3ZWSA 4MYXA 1QPKA 1EP1A 2WVUA 3WNLA 3G18A 3MP4A 2A3BA 4O11A 3MMWA 3LTSA 1ODUA 3GNNA 5CGTA 1KTBA 2XFYA 4GZEA 1JCXA 2H3BA 4TX8A 2ZA2A 2AAAA 2J27A 3R13A 4RZ5A 1UKSA 4E2OA 4W8BA 1T96A 4DO5A 2OJPA 3ARTA 3OBKA 1PVNA 3NMBA 3SJ3A 2A7RA 3DFNA 2CBUA 3QOMA 4JFVA 3W86A 3BAKA 3DENA 4UQDA 4Z2IA 3OLIA 1DQWA 3G0XA 4L4PA 3QPZA 1FFRA 3ELFA 5SWUA 1WDSA 2BHYA 2BHZA 4H41A 4JIEA 3O6DA 4YWIA 5A6MA 4P61A 4AZ5A 4DF0A 3VGFA 2OYMA 1XKYA 4JX6A 1W9BM 3UPBA 1W9PA 2ISSA 1UD8A 4MJ4A 4EE9A 1Q6FA 2J9ZA 2YLAA 4O54A 3THCA 3O6YX 1NF7A 1DWJM 1UQYA 1VENA 2WW5A 4PL1A 3MHGA 5DO8A 1JXJA 4ACZB 1QNPA 3GXFA 1DTUA 3WIJA 3TUUA 4JZ5A 4RE4A 3GDTA 2Y7EA 3EDFA 3WEZA 4YMZA 2QHAA 1V0LA 1FWNA 1XUZA 3S5QA 1QOQA 4AXKA 1E6RA 3BG9A 1TV7A 4AZCA 3VGBA 1R47A 3HN3A 3B0VC 5F2GA 2XQRA 1V3LA 4UMCA 2WNQA 1TCMA 1JZ3A 4JTGA 5D03A 4EF8A 3LPFA 2X30A 3W53A 2IXUA 1HL8A 1WV2A 1NP0A 3W2KA 4IISA 2RGMA 2YYUA 4CD7A 6TIMA 1ZAJA 5GVJA 1TA3B 1A50A 1YTDA 4ORMA 1KGUA 1PPIA 2B7QA 1GQLA 4JTFA 3W76A 3PHAA 1ISYA 3WDHA 3DHFA 2WV8A 4FIQA 4ZQMA 1VJIA 1XH2A 1E70M 5FK7A 4ZQOA 4H7VA 1SW7A 3GNOA 2HTMA 4PH6A 3BLFA 3AYRA 3Q37A 5FD0A 1MO0A 1Q6LA 3AS3A 4UZSA 5KTLA 3CT7A 4UTWC 1C90A 2EGZA 3SZ8A 3EDEA 2VFIA 1PS9A 4QNWA 4UOQA 2OT1A 4UTTC 4OJYA 4DWSB 2PC8A 1GG0A 2WNNA 3W75A 3SSJA 2J7BA 2W67A 1M01A 1WE5A 2EPLX 2XVLA 5AB3A 5C2XA 1OIFA 1VFUA 3AHVA 3AMDA 5GNZA 1US2A 4R53A 4GWEA 4X22A 1WDRA 3WJYA 5FMDA 3WDRA 2YCEA 2QCEA 2VZSA 1GOXA 4X9SA 2C7FA 3VMPA 3WENA 4A2SA 2YA1A 4X0VA 5EFDA 1GHSA 2OSWA 3WELA 3PR2A 3DAQA 1LCOA 2QPSA 4CCEA 5DY2A 4D1JA 2VZUA 3S6DA 3ABSA 2DORA 1BG9A 4GFSA 4ATLA 3L2LA 4X3ZA 2BY2A 1H7XA 4PMVA 3CMJA 4AMAA 1VYSX 1TPDA 3HJZA 4UOJA 2JGQA 4GXMA 3PWAA 1RP9A 1I2OA 3A4XA 3FAXA 4Y7EA 4Y6GA 3GNPA 4NXSA 4CCCA 4UTUA 3GBEA 5U7SA 1V3IA 5CSYA 1JZ6A 2ZZ3A 4PMZA 1PEZA 1GORA 1B4KA 1S3HA 5AYXA 3O6CA 1TUXA 3UGFA 4JS3A 3TOPA 3NO5A 2RKXA 5TD4A 1I2QA 4AF0A 3CM4A 1H5VA 3TTQA 4P7LA 5D33A 1CXFA 5I5RA 5EPDA 3SGUA 2E8ZA 2J79A 3EXRA 2Q8LA 4AF0B 4LPCA 2H3DA 3SR7A 3U2OA 1YTEA 1UQZA 4Z2KA 1C8XA 1XXXA 1YPIA 2W62A 4BQ5A 2QJHA 1R7AA 3MYPA 4NRSA 3W70A 4Z0JA 1CPUA 2WSKA 3SY5A 3KZSA 2BSLA 5IBXA 3GDMA 3V75A 3VFLA 4OOZA 1QHZA 2ZZ4A 4HZ7A 4NX0A 4TOQA 3TP4A 1H7WA 1GT8A 2CLOA 4X0NA 2ZBTA 3J7HA 3VU2A 1HTIA 3W84A 3WL1A 4OT7A 3CGTA 4ZXOA 3VI2A 1B3VA 4KFNA 5LGZA 4AH7A 2Y7DA 1TRDA 1CXHA 1W3LA 4PTMA 1RR2A 3BV4A 2HISA 2NUYA 2VFGA 5ABTA 3W7OA 1BYAA 5AY7A 1SQ7A 1WAWA 2A0NA 1J01A 1PAMA 2EQDA 3F4VA 4J3SA 4BK9A 3FY1A 2I14A 3NL2A 2JKAA 1V6XA 2CZ5A 4FLQA 4WKHA 1PX4A 3BMWA 3EX4A 3TU9A 3FYPA 4QM1A 2RHGA 1HL9A 2WHLA 2NWRA 2ZXDA 4MDOA 4PMDA 3O2LA 3L0KA 3LDKA 2ZX9A 1VYRA 4WJXA 1XBZA 3D5HA 3BAIA 2Z1BA 4IMGA 2E9LA 3SIMA 2XG9A 4M56A 2V81A 3PULA 1LBMA 3G1FA 1JVNA 6CGTA 5HBFA 5HNRA 1C7TA 2ZFAA 3CWOX 3H3LA 1OFOA 3HG4A 3MJYA 4NJHA 3W6YA 1EQPA 2QQVA 2J74A 5A8MA 4E8DA 3VD9A 2YR1A 2ZRUA 4WY0A 2XIBA 3PY2A 3PZQA 5KINA 1W3JA 3ZJ7A 1F4HA 4E2DA 3LCIA 3TE9A 4BFAA 1OFQA 2KZHA 3NQ8A 4R27A 5HNNA 3RJYA 1B3WA 2QF7A 3RCNA 2QCDA 3VDAA 3FLUA 3K4DA 1ST8A 3NSNA 1JD7A 3KWXA 3CHEA 5A2BA 2G41A 4AD4A 5CG0A 1QI4A 5I3JA 2GJRA 2WC7A 5IHSA 1UOKA 2X2YA 1UZ4A 3ARZA 1GW1A 5AN7A 4JKMA 1PCWA 3TW7A 2XJ7A 4DF1A 2CBJA 2ZUMA 3GAKA 3SCQA 2TAAA 5D37A 3AZSA 4OGZA 2P10A 4HU0A
chains in the Genus database with same CATH superfamily
1LDCA 1R5YA 1OGGA 1GJUA 2UWBA 2PDFA 3GZTB 3R11A 2Y64A 4Q32A 2FKPA 4R7JA 4PCTA 3O06A 3LA3A 3QMRA 4L1WA 4DPQA 5AFDA 1UWAA 3H70A 4XQ6A 4C6PA 3H8XA 3N6HA 3O63A 1UR4A 4O1EA 1OKOA 4LXLA 2ZADA 2XINA 4WX2A 3OA5A 4HU8A 2IMRA 4XAAA 1Q6QA 4C6IA 1O59A 2W92A 3UETA 3GF6A 3NNMA 4H3WA 3N73A 4JTLA 2BZDA 2BXVA 1GEHA 4F66A 1H8TA 5L73A 1OKQA 3WQFA 3C5QA 4MUVA 4LIVA 4JHMA 3GNXA 2FMYA 2WABA 2QKDA 2YL5A 1HO1A 4AFMA 1QNWA 1U12A 4OU1A 2E32A 4CEYA 1VLWA 2XUMA 2YL9A 3JBG1 2X5IB 4YM1A 5CKNA 5ABJC 5JCTA 2GFTA 1QATA 5EJ3A 5LNWA 2VMGA 4OHQA 4UQBA 2YKKA 4Z1CA 4EAMA 2CPUA 1B0IA 2R1DA 2QBXA 4ES4A 2WM1A 1UD3A 2AENA 3CL8A 3CNAA 2NXGA 2FMOA 4L5ZA 4DVOA 2Z5WA 3JZUA 4Y9MA 4HVQA 2OLHA 5F1VA 4DUOA 4F9DA 1ZZ9A 2QXWA 3B8UA 2TUNA 3H7VA 2UWAA 3QBUA 1E6XM 4CD5A 1F9KA 3ARQA 3M0MA 1G8WA 3J8F3 2J47A 1KM3A 3S1VA 4ZXKA 2WHMA 1J79A 1YC61 1PYFA 1I8JA 1CBGA 4M0XA 3VE9A 3GHUA 1A3KA 3ETQA 3LF7A 2G3NA 3NQ2A 1VMJA 3A7QA 1E4NA 1F5JA 4OHYA 4NAFA 5CSRA 4P8WA 4JAWA 3ENLA 2O14A 2QDRA 2QCGA 2GN7A 5DUXA 4XOGA 2C24A 3R8RA 3ZYRA 1LOQA 3QPEA 1W2PA 1P8JA 2R0HA 3FW6A 5GLVA 3VKOA 1IR2A 1J3QA 4KIRA 5LNRA 1OYCA 5RUBA 5BNNC 1W0PA 3OA3A 2INFA 1W3TA 1PDZA 1XSRA 3LN3A 4K3ZA 3HBZA 3WQ6A 2J8GA 1E3XA 5FF2A 1E1EA 4W7WA 3M5ZA 2CYFA 1VKFA 4LUIA 4OTKA 1KGXA 2B4GA 1AL7A 3WW3A 2GNBA 4YCOA 2VR2A 4UCFA 1S1AA 1SZFA 4MSVA 4D7SA 1CAVB 5AFBA 4AU0A 2ES3A 4GYPA 1VAVA 4HSOA 4DAIA 4KG8A 4ORFA 1XYCA 4H6EA 2WB5A 3VNIA 1H2KA 4R8HA 2VZOA 3SUVA 4L97A 1G69A 1EGZA 1MVYA 5G2HA 3R6SA 2QGHA 3ZJ8A 3N36A 4RYDA 1PIV1 2HWD1 4ASLA 1DCSA 2VTXJ 2Y7GA 1U5XA 2V5BA 2YY1A 3CUFA 1VP5A 3AZTA 4HPHA 1QI2A 2UU8A 3VOGA 3GTNA 1WA6X 1YUDA 2A1YA 1L7LA 1VALA 4F0RA 4UFHA 3CZGA 3QEZA 2W3JA 3FL7A 1R1A2 1MQTB 5AVPA 1HDKA 3VUSA 2ODOA 3MP3A 3LK6A 3RLUA 3B04A 1AK5A 5C3QA 5TIMA 3UYCA 1R2TA 4LO4B 1HN1A 1SDDB 5A8QA 5M2FX 3P3BA 2C16A 5BYWA 4ZONA 2GH2A 1D7FA 4XIKA 2Y8KA 4LBLA 3TQVA 5MKGB 2J7MA 5FY5A 4MXWB 1MRAA 1ULOA 2F61A 5DCBA 3QGAC 3WYZA 3ZN5A 4XKYA 1H2JA 9CGTA 3ARUA 1CAXA 5FQ0A 1W6MB 4UNLA 4XUGA 1BF2A 5D02A 2QUOA 3WFAA 4JAAA 2ACSA 4KBBA 1KS5A 1DQ5A 5FJTA 3M3QA 4HOXA 3QFEA 2X0YA 3N4MA 3LCPA 1EKOA 1GGOA 4P2VA 4CCMA 2OU4A 2VOVA 3IGSA 4DB7A 1XYFA 2ZX3A 2RS12 2DF7A 3IBMA 1A5NC 1UC5A 2CKRA 2VUNA 1WDQA 3OLGA 2YBTA 3ZVHA 4D71A 4CYDA 3M7AA 1TV2A 1OYBA 1ZVFA 3MFCA 1UIOA 2EF6A 3M0LA 3K13A 3T0BA 4U33A 2BB0A 4LHSA 4GYFA 4J1XA 2YDQA 4ICMA 4YRDA 4YARA 4SBVA 2NQ5A 1VAMA 2GC1A 1T8XA 3TNQA 1IEIA 3UWWA 4HONA 2OIIA 3HJRA 1MEC3 1JNEA 2VKZG 4L4OA 5ACA2 1VCGA 2D69A 1OH4A 2CAUA 3WW2A 1E0TA 1NA1C 1YNQA 2DEPA 3CEPA 5DN2A 2IQ0A 1STMA 3QYQA 1UD4A 5H2ZA 3CL6A 1M7XA 4W50A 5IVJA 4K39A 4XZNX 3HV8A 4COYA 3QC3A 3WNPA 3GG1A 4CP9A 4I5RA 3R6IA 4JDMA 1XNKA 3VN4A 5BNOC 4MB5A 3USBA 4AD5A 1L6WA 1PVC3 1E6NA 6A3HA 5G1TA 5ABJA 4PI2A 3AALA 1XQNA 4H55A 3D3AA 1N8FA 2XZ9A 2VDIA 3P62A 5HCHA 1VQTA 5FBJA 3HMJG 4XV0A 2DGAA 3GW3A 2WQPA 5E88A 1UKOA 4F48A 4LC6A 1O95A 2BS9A 4DJFA 4UMBA 1QHPA 3VABA 3VBRC 4TTUA 2WM0A 4FNQA 3L23A 3RO8A 4DXXA 2XFWA 3PZUA 3QYSA 3ZLFA 1TJ0A 2ZZJA 4LBUA 3SRKA 3EO6A 3M70A 1MFUA 1EF3A 1RJQA 5LNSA 4GD4A 5L9BA 5AYYA 2DZUA 3TYEA 4UC5A 1N7KA 4KW2A 4O18A 5JBDA 1HX6A 5LRSA 3W26A 5REQB 3PWGA 3T78A 3LDRA 4M6VA 5GZEA 3B9AA 3BZGA 5BNPB 3B9DA 4UR9A 3ZZ1A 4Q8UA 3AMCA 4DUVA 3IPVA 1UBSA 1RH9A 2PHWA 1BTMA 1OSGA 4IMFA 3N9RA 1UMYA 3G24A 4CE8A 1WXZA 1Y8BA 3A4AA 5JQ9A 1H2LA 3H7YA 3PIJA 4UWDA 3VHNA 5AVAA 2WA3A 2YB1A 3LEKA 1LROA 3LGRA 5BV6A 2JEPA 4R33A 1UY0A 4OIFA 4AWSA 3G1VA 4DWSC 3O14A 1XYZA 2PSNA 1Q13A 2ILMA 2W4XA 5CXPA 5BNKA 4D6SA 1RUI2 4UW3A 2V5JA 5FFOC 1BAGA 3GRIA 4CNOA 2EG8A 5CPQA 1RVGA 5FYSA 1JDFA 3OLDA 3M0YA 2QJJA 2XJSA 3ITLA 2BOFX 1ND2B 1BVWA 5A6JA 1X36A 1VJ2A 1XLBA 3W27A 3SCWA 1DV7A 4CCJA 2CL2A 4IFRA 3OD0A 5DAXA 4HQVA 1XJAA 2A79A 1GZWB 3MJMA 1TME3 2CCRA 1ZBE3 1PO11 4Y22A 3WZ0E 3GWQA 5H9PA 4G8TA 3TC6A 4IUOA 2G5WA 4PODA 2DVBA 4IUGA 3N3TA 1QXLA 3QZAA 4MAVA 2ONEA 3FXYA 2PWVA 2W6RA 3CJXA 1REQA 2B9UA 5KSWA 5A3OA 2R7EB 1NQJA 4HZFA 3IIIA 3BH4A 1AL8A 4WR3A 4XYXA 2YC0A 4RW3A 3GBFA 4Z2WA 3P5ZA 1T6GC 5FZBA 3NAPB 1QFEA 1JHJA 3VHRA 4DMIA 2FB2A 1ISVA 2I74A 1EJXC 4M8UA 4AYUA 5FLIA 5JDBA 2ZC1A 4RGAA 1GZ1A 2PGEA 3CXOA 2FZDA 3BU0A 4GMP0 1FOD1 2QIWA 4YW4A 3HT2A 1HP5A 2P6CA 3OZPA 2JIJA 4HN4A 3PAJA 1RUE2 2PYTA 3T1LA 4JTCA 3WDQA 2J24A 1JZ7A 1AJOA 2GWNA 1TELA 4M01A 1Z41A 4CN1A 4NOTA 4PE8A 1NOUA 1HJVA 3KDNA 2FPTA 3W2LA 5FPLA 4UTMA 3PAOA 3G1YA 3MI2A 3EMQA 1UX7A 3AMMA 2BVVA 3NQEA 3FGCB 4DF2A 2PPGA 1RALA 2Q8EA 4XBLA 3JB8A 3M1HA 1XB9A 2J42A 3IVTA 3L5AA 1ULCA 1GUIA 3WF3A 4HK6A 5DQ0A 3LWCA 3Q8BA 1VF8A 3DKLA 1NIUA 1NWTA 3ZXWA 2B7YA 3GR4A 5FJIA 4IL2A 3OOXA 1E57A 3OTFA 2BPA2 5F32A 5JZGB 3KQRA 4LVFA 1G9HA 4GIEA 1RJ7A 2JALA 1ZREA 3RZMA 1EV11 1RUG3 4QPGC 3H12A 4NIHA 3CZUA 1L6YA 4IV1C 3ZFFC 3GTFA 5CLTA 1OGSA 1MQRA 3PVBB 4U2ZA 2GJPA 2QJVA 1UD5A 2GVJA 3WX5A 2VGDA 3EA3A 4FA3A 4IP5A 2OGYA 4XETA 2NW0A 4WLCA 4GC4A 3RDIA 2V67A 1OFEA 2AC1A 2ICSA 3MLJA 3AZVA 1N8WA 1SUXA 3LRLA 4JTKA 1RXFA 5F1RA 1WZAA 4EIVA 2OCZA 3GYDA 2YYTA 4MTVA 4AI3A 4KGLA 4Q3MA 2IXKA 1JYVA 2UYAA 4DUWA 3PBGA 4CNTA 1OURA 1C8M2 3T3YA 4A3UA 2QCDB 1UH4A 3AIUA 6XIAA 1C92A 4JGZC 5FWJA 4F8AA 3G6LA 2YDRA 4NVTA 5A7WB 1E9ZB 1ENSA 4IGSA 3QY7A 1WW4A 6REQA 1N3OA 3ALGA 5DAWA 4K2SA 3KSCA 3PZGA 2BMBA 4H01A 5FO7B 1KXTA 3GDRA 2WO5A 2HWC2 3VE7A 4MY1A 2PWUA 2A3AA 3BTXA 2YL8A 3TR9A 3E6DA 3OZYA 4HT1T 1FATA 3G7DA 4XG1A 2WXDM 3FA4A 3QRHA 4CCNA 1LF1A 4PB5A 4UNKA 4AIUA 1MS4A 4I9AA 4XQ4A 1GZJA 3BWWA 3PZMA 1UROA 1AXKA 2VCAA 3DPRA 4BPZA 3IUIA 5H9SA 3T2QA 3UK9A 3FJLA 4QMAA 1CQ9A 1F74A 2R063 4HPGA 2DVUA 2J7CA 1ZRRA 2I45A 5XINA 3WDTA 1C5HA 3VZYA 1O5KA 1QWKA 4NILA 2VUJA 1TPEA 1GANA 5C54A 3DXTA 3W7LA 3RDKA 3AFGA 1EOKA 2QQKA 4QU1A 3POHA 1KFKA 4YGEA 2CLLA 3R25A 1Q6RA 3BOFA 3DFOA 1S0FA 1MZHA 1UASA 2D2GA 3EDKA 4RL7A 2EPMX 4IV3A 2HVMA 4NJ4A 1LYXA 4GINA 3O5SA 2GNDA 1VBD3 1Z69A 1OJXA 1WZMA 4FNRA 1AX0A 4LOCA 3AZRA 1AMKA 4QQHA 3ZMOA 1SU5A 3KL5A 5BPXA 4O53A 5AYIA 3QN3A 3M64A 1CGPA 1EJWC 1VB4A 3OHIA 3UY8A 3UR5A 4JQ3A 3B02A 2XUEA 3HD8B 2HH9A 1E5HA 1NCRA 2CWXA 3PUEA 1XNBA 3OEBA 3VDDC 1W2VA 1XI3A 5CFDA 2DSZA 3AIBA 4RS5B 2E63A 3VA8A 3TJXA 1VBB1 5FZ1A 4Y1ZA 2WL1A 1X38A 1XGZA 2XH7A 3CPUA 2P4EA 3PJQA 3GVGA 3USZA 3W7JA 1W9TA 4KRUA 2XB6C 3ARXA 1XYOA 5B2GB 2J1EA 3U2ZA 4YTQA 2CFFA 5FYZA 3GKFA 4NZCA 1O8SA 2FHBA 4Z2GA 2UY9A 5DXXA 4GGBA 3B9OA 4I6VA 3ARWA 3K46A 3TX9A 3VMNA 4LCSA 5AVHA 1LM1A 4JYDA 2CXGA 5BRQA 3GO2A 1KV5A 2ZGNA 1EJUC 3RF9A 3IK4A 5CPOA 1W39A 1KKOA 3KT7A 1SJBA 4LOSA 1Q66A 5KMYA 4Q4X3 4K20A 2UY5A 3GBDA 4V1YA 3OEXA 4MY9A 5D32A 3LHWA 3ABZA 1S0CA 1AJKA 3RPDA 1ENRA 1OC1A 2PFWA 1IXPA 3QH7A 3VCCA 4AFAA 4PULA 3K8LA 3FWEA 1KEXA 4XJAA 5DDJ3 5DAPA 3W71A 1ADOA 1UOFA 2NXIA 1W54A 1LOLA 2K9ZA 2NZ9A 1J83A 3ARYA 1REQB 3P14A 2Z69A 5DZGA 3OUHA 3G1SA 3BLLA 2ZRYA 3GSMA 4O19A 5CZTA 2HK0A 1UR2A 2WFF3 3B03A 1GBGA 1CPNA 3VO0A 2RDRA 3MYXA 4GACA 2R043 1FOD2 3PMSA 8RUCA 3H26A 3DG7A 3MQTA 1D4M3 2D3RA 1YDOA 1D4M2 2MPFA 4A44A 5F2WA 3O1TA 4TMCA 1ZM1A 2H9AA 3CUGA 4Z08A 4NNAA 3TW9A 4TSVA 1EYBA 3CIWA 2WFF1 2OZJA 1RVF1 3S30A 2VGFA 1UJPA 5GNYA 3VV1A 3ARPA 3LSEA 4GWIA 1D3GA 3HG2A 2YSWA 1YXWA 4ATWA 3X29B 5HR7A 1KITA 1VBA1 5DMYA 2O9TA 1LLWA 3AWOA 1QXRA 1LBLA 2I2SA 3W24A 4DO6A 4D6JA 1B4EA 5C7HA 1XU1A 1RUE1 3M0VA 4GE8A 3ZO0B 2Z25A 4YVWC 4YW7A 1CGVA 5I2UA 1W0NA 2Y0FA 5CZJA 4AEMA 4K8FA 3BPZA 5F6LB 3UCDA 1MYRA 3K2GA 4IEVA 1ZRQA 1DYSA 3RI8A 3KCXA 4OI0A 4M6QA 2PLV3 3UG3A 4CZSA 4Y1UA 3ZFFA 1JAEA 1QXPA 1U83A 1ZNNA 3TSBA 3WY6A 1B1YA 1L0PA 4IPLA 4DIAA 2ZGTA 4ADTA 4HSJA 2HNHA 3DYMA 4K8GA 4KBXA 3ZR4A 5F7UA 1ZBWA 4EPDC 2XIQA 3TA6A 4LA2A 3Q9OA 5I23A 4H9XA 4CD6A 4FQ4A 2FQIA 2WWSA 4RZ6A 4Q4X2 2NLIA 3FLTA 5FZOA 2P37A 4PBGA 5AHNA 1YJLA 1M68A 4FXKB 4CEYC 5G4EA 2WQ4A 3E02A 3I3DA 3L5LA 3IJLA 4XFGA 1DGWX 1IQAA 1Q6CA 4DNYA 5A8NA 4JTAA 1YQ8A 3ELNA 3R8GA 3C7HA 2XGBA 3I2JA 1Y9GA 1RQBA 1J58A 1CT5A 2X7WA 5A2AA 1IPKA 3GCWA 1W9DM 3UWQA 4AEFA 3UNPA 4N42A 1W06A 1GZGA 2JF7A 3QMSA 3UZJA 2DZAA 1UIJA 4F0KA 5T26A 5BXPA 2E3ZA 3AYSA 1R3QA 1DE6A 2X1IA 5HJLA 4PFMA 4HNVA 1BWKA 3ME2A 1F73A 1V9U2 1DL3A 4Y5SA 5T3NA 4PHZA 1YNAA 1JCJA 1UR8A 1Q7ZA 3VZMA 4H9YA 4KI5M 3KBJA 2PEVA 3B05A 3D0SA 4Y96A 4NAEA 3ZVXA 4JYFA 2NVAA 3V7PA 5I77A 3V65A 3VXGA 5I7GA 1WZXA 5K9YA 4ZOAA 2VNRA 2FDJA 4KIEA 5G1MA 4L1GA 3UCQA 3GXMA 2GP5A 1WBLA 3BLDA 3VGHA 8CGTA 1KC7A 4JGYB 1Y4WA 2PAKA 3MUIA 3QPYA 5FJRA 4B91A 2V5DA 2WBGA 1E72M 1RTVA 5I3KA 3F2DA 4I09A 3V1PA 3CKHA 3T4HB 4FSAA 1BKZA 1SLTA 1ITQA 1FH8A 4IM4A 4M7SA 2ADDA 2WNUA 2R042 3VX0A 2C15A 1PO23 5LEKA 1XBVA 1MS5A 3QTPA 3L4ZA 1OD0A 2G4FA 2HWF1 4G7EA 5A7SA 1W3NA 1MZEA 1XGEA 5J96B 2MHFA 3QZ6A 3WBWA 1GOGA 4MWAE 2NQJA 1AR81 2IUZA 5HV4A 3LA7A 2ZGOA 1QBBA 4L4MA 2WQ8A 3KZ4C 4O9GA 4GYPC 3ZYHA 4GH4C 4X63A 3UFYA 2CU0A 3NJ3A 4F79A 4TTGA 2WN3A 4P8VA 3LOTA 1SJCA 3VILA 4KCTA 4PTNA 1FCBA 1GP6A 3OJGA 4C7DA 2C1GA 4IX0A 2ACUA 4HJWA 3VMOA 3BTAA 4I8YA 2Q8XA 4L56A 4JFTA 3BYWA 3U5UA 3VZKA 4GYKA 3U4SA 2O8QA 3A22A 4NJJA 3IIOA 1W3VA 2WS93 1CGTA 5A6AA 4YVSC 2P3EA 3PTQA 4HGXA 1F2JA 5D2WA 4AFBA 5FZFA 3MC5A 4OKDA 3BE7A 4GG9A 4XZHA 1O3RA 5JWPA 5DMMA 3JB4C 5I3HA 4O65A 5I0RA 2XSAA 2HRWA 4YTUA 2YCJA 3G1XA 2QVNA 1DZQA 4ZO6A 3KS5A 5T55A 1MZ6A 1LZOA 2ON3A 2HSAA 4AEEA 3W7IA 3ABRA 3VKCA 2W52A 4KU8A 3KOZA 2WQDA 4B1MA 3LLFA 4DWSA 1A0DA 4NPRA 2QQ6A 4N9DA 1BMV1 3S2MA 1R1A3 3LEIA 3AMNA 3VUOA 2YDSA 3ALFA 1MW3A 1RUG2 2X8RA 3UERA 3M44A 4Z2AA 4HA0A 5KHGA 2NT0A 3NQMA 3OGVA 4N0RA 5D9MA 2QUTA 4PDWB 4GULA 2FVLA 3WXPA 4Z92B 1A5AA 4W8JA 4RHV2 1PSCA 4MDPA 1WDDA 4PDWC 3RMXA 4DPNA 1PZ2A 1QVBA 5J98B 2XWJB 3T4CA 2Q6ZA 3W1AA 2ZPXA 1O3SA 4WVVA 4CEUC 2E25A 1PYMA 2G3FA 3KLLA 1MQQA 4QE1A 1A3HA 3RMEA 1EFZA 1Y0EA 1HJGA 1LJYA 3ZFEC 3LMZA 4O4WA 3W82A 3L7RA 3AIWA 3R4DB 4JTRA 4XAGA 2LTNA 1MR5A 2XJVA 1XIJA 1C28A 3STCA 4TIMA 1JI6A 1DXIA 4AG4A 4XVHA 4Q29A 1G9BA 4WDWA 1CZSA 1XRUA 2TSYA 1BVP1 4UTJA 3EWBX 1EAH3 2WNUB 1GZTA 1H30A 4NZ1A 3C61A 2QZ2A 1R093 1UPMB 1K42A 4KKXA 4U4MA 2CWSA 5CCZA 2FZ2A 1WKEA 2E6VA 3TOJA 3W1QA 3PSVA 3DGTA 2DFAA 1TMF1 3H23A 3WDJA 2PZNA 1A5CA 4W5ZA 4Y8EA 1X1NA 1V03A 4FAMA 1AR61 4XF0A 4FNUA 3MMTA 4H8HA 1COV1 2VQ0A 1UZ1A 5LIKX 2G4JA 4YW5A 3FHQA 2WC3A 4QJ3B 1SG3A 4ZCWA 4L9YA 2ZHLA 2C13A 4Y26A 3WQDA 4ADUA 3TLLA 4BCEA 4JKLA 1AD1A 3E12A 4Q4W1 4GYJA 1W6QA 1EP0A 4C6KA 2VEMA 4RNIA 4NXKA 2HNEA 4ZB0A 1W6QB 1ME7A 3G6JB 1E1FA 2X1TA 3HPXA 1XSKA 3H4WA 3OOQA 1J3PA 1WW5A 1HKJA 2WAGA 3NNTA 2EAKA 3WD2A 2P8BA 3WMSA 3WQ7A 4LT9A 5HCBA 4YLZA 1W6TA 2V38A 3HPAA 5C4WC 3IDBB 2VFFA 2PHDA 3LXCA 5E6ZA 1RLCL 4S2FA 3UESA 5I78A 4RCXA 3V18A 4IEZA 3KVJA 4NPLA 2GOKA 4YGCA 1TWDA 1KXQA 3RNSA 3GVWA 3VTRA 3GAYA 1QQP3 4ZZ5A 1DBTA 2G3JA 1VBGA 1AL0G 2DUXA 4RN5A 1I2RA 4FB7A 5D05A 3MHUA 4E4PA 2WO2A 2WNZA 3DFTA 4ZO7A 2JICA 1DGLA 2UV8G 2PDQA 2FYMA 3BW4A 4IPPA 3GIPA 2OQYA 2P1FA 3BTZA 5FP9A 1FPN3 3CV1A 5HMSA 1OF4A 5HI0A 1TWSA 2ALRA 2J78A 3KS7A 3NAPA 2Q3OA 1NEYA 3T0TA 3RX3A 2A6NA 2IFWA 2JG9B 1AL22 1DIDA 4ZB5A 3B8TA 4CD8A 3U48A 1IEVA 4GLEA 4ERAA 5FRAA 1RXOB 3ZYIB 3ABXA 5CC6A 1BJQA 2CWNA 2P3ZA 3WHTA 2WSRA 4IXLA 3QC0A 1B30A 1KTNA 4O10A 4LBKA 4NF7A 1KXHA 1NVMA 3WUGA 4RNJA 3WF0A 5A70A 2PODA 2Z2SB 1LEMA 3THQA 3VD4A 2QDDA 1XDJA 3CQ0A 2C91A 1KM0A 4ORIA 4HPJA 3N9PA 3H2MA 4AR2A 3AXDA 2XDVA 2E09A 3BMVA 4P9YA 3UNDA 1E1CA 3NYDA 3MPPG 4HN8A 5BWAA 2QQWA 1FMD3 5FUIA 3RJ2X 4BU2A 3P61A 4O52A 4XFCA 1SYTA 1WDWA 2OO0A 5EKYA 4YVSA 4Q4V1 3GUWA 4NIGA 1GOWA 4FT8A 3NQCA 4Z1VA 1RUD2 2QAFA 4NHXA 5CU1A 4A3XA 1R8LA 1YADA 3KWSA 2YYOA 3R10A 4W6WA 3GHMA 2P3YA 3VGEA 2X53S 2DUOA 4F83A 4XTIA 1ZUAX 4MV2A 5HXVA 4HN1A 4HXCA 1PBGA 3WLPA 5A5WA 5C55A 1Y7VA 4ASMB 2VUYA 1MDRA 1WAUA 4PRRA 1CZ1A 3VIMA 2WCAA 1JI2A 4AZCB 2H0BA 1EA0A 1FWIC 3RYPA 3R58A 4AG0A 4GQBA 3KP0A 5CEWA 3N04A 2QJGA 1S0EA 4LO5B 5I3IA 3FEMA 5FPVA 3ZXAC 1Q56A 3PG8A 2VXJA 2C71A 4GXPA 5DXYA 1HP4A 1Z3NA 2WT1A 1OQFA 2R0FA 3QR0A 3ITGA 4UXDA 5FZ9A 4LXFA 4HTYA 1H61A 2GWGA 4NU7A 1NCQA 3C7GA 3WG4A 2FFCA 2IXVA 3LSDA 2PBGA 3FXGA 3M3CA 3VUPA 3VOHA 1LGCA 2QAPA 1VJSA 3ZFEA 1VPXA 4WXYA 1W2UA 4FTEA 1F61A 3GIQA 2JDKA 5FZ7A 4E8CA 4GIYA 5FY9A 3VCNA 5FZ6A 1LUCB 1DWFM 5FY0A 4XAPA 3UCCA 2BHUA 2NMOA 1C3HA 4YYFA 2PCEA 4I0WB 4N53A 3KM8A 5ABJB 4GKYA 2ZWYA 3DI1A 3H0OA 3CIVA 1KKRA 3U0HA 1KR1A 4DPPA 1BMV2 1Q3NA 1NWSA 1OK4A 1UR0A 4ZOBA 1SVDA 1ZBA1 4LNVA 4MYEA 1IQDC 1W1A1 3ILFA 2V3DA 4DO7A 5PTDA 4RFT0 1K7EA 3NKGA 2PCQA 3TSDA 7ENLA 1K8YA 2XH6A 4OQ8A 1FDZA 1J0HA 1S0JA 4CUBA 5FCCA 3HQ1A 1XDMA 1LTEA 5CH9A 5AYBA 2OXBA 3KBNA 3AVSA 1TTPA 4FS9A 4I3GA 5AZ0A 1ZCCA 3IJ7A 1RD6A 2XWBB 4FOQA 4YZ3A 4OI2A 4HMEA 2BFUL 4JRAA 1SPPB 3A64A 3D82A 1OX4A 1TPC1 2LLEA 3PDQA 4UUIA 4JQ1A 1UJQA 5AC7A 4QD2A 4EN7B 2WSQA 4XUTA 4RK8A 2P1BA 4CP1A 3VCRA 2V4VA 3PBYA 5E93A 5JPNB 2WT0A 2QQJA 1ZRDA 5FAJA 2V3GA 4FR6A 3W1RA 1FBAA 1R87A 4YM3A 1RINA 2ARCA 3ZFGC 3EXUA 5CIRA 4ONUA 1MACA 2RDTA 2WMIB 4AVOA 2ZRVA 2WMGA 2Q8CA 3KEHA 5BCAA 3TTEA 2QUMA 3BALA 3TYBA 2VC9A 1UU5A 3M9YA 4MOAA 1PKLA 3H24A 3PUHA 2Y8UA 1BQCA 3W7GA 4IFKB 1NP2A 4U31A 3V0BB 2E26A 4XD5A 3J8F1 1QOSA 2Z00A 4Y8FA 3CV2A 4CDWB 2XL7A 1ZJAA 3E0WA 4IX2A 1E6PA 1Q85A 2QQNA 4GI4A 2E6YA 1CAUB 4M51A 1GTHA 1FDJA 4C6DA 1AYM2 2XJQA 1V5XA 1NAEA 4QR6A 1J5TA 1Q6DA 1HZYA 2C5DA 4IOTA 4MWAD 1UKPA 4Q0PA 1OUSA 3WF2A 4BE3A 1UZWA 4H7ZA 3FYOA 4YVPA 1DP0A 3UYIA 5T5PA 3OUJA 3E6BA 1ZFJA 1VPHA 1QUMA 1CECA 3AROA 5BW6A 3MY9A 2WNVC 2DCYA 4A2UA 1WP6A 5FIXA 3A47A 4LRSA 4TO8A 2XR4A 4IW3A 4N90A 1LLOA 1E71M 1YQ5A 2REQA 1FH9A 3WLIA 3I4IA 3TN92 4NP7A 1JN2P 1ISZA 4AEJA 1HIZA 2W79A 4QIUA 1VR3A 1C3FA 4PB3A 4AI0A 4WOZA 4RNFA 1SCRA 4NZ5A 4N9HA 4A6OA 2VX6A 4D69A 4Q4OA 1K5JA 1TUFA 4NYUA 5D38A 4PCFA 2D20A 1KFJA 3CTLA 2BVDA 3NXFA 1Q8SA 3C52A 3IKWA 4HTBA 3EKZA 3SSZA 1UUMA 3LPPA 1HKVA 4HETA 3N34A 3N3MA 4J4KA 5EIYB 3ZXFA 1FWDC 3RFRA 2HCVA 5EXOA 5MKGA 5KZ6A 2ZXBA 3WNNA 3ALQA 4FI4A 4MADA 4N6EA 3U07A 3ORWA 4PL2A 4XCBA 1W9XA 1AH4A 3STFA 1DJQA 1ULEA 4UFJA 2YCIX 1ZBA3 5HV0A 1PIIA 4AQ6A 1XX1A 2I9UA 1GPFA 3CB8A 2OWWA 3W6MA 2CTVA 3O0XA 3QV6A 3RRAA 1FPN2 3MIGA 3BK0A</