4GB33

Human coxsackievirus b3 strain rd coat protein
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
238
structure length
238
Chain Sequence
b'GLPTMNTPGSCQFLTSDDFQSPSAMPQYDVTPEMRIPGEVKNLMEIAEVDSVVPVQNVGEKVNSMEAYQIPVRSNEGSGTQVFGFPLQPGYSSVFSRTLLGEILNYYTHWSGSIKLTFMFCGSAMATGKFLLAYSPPGAGAPTKRVDAMLGTHVVWDVGLQSSCVLCIPWISQTHYRYVASDEYTAGGFITCWYQTNIVVPADAQSSCYIMCFVSACNDFSVRLLKDTPFITQQNFFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords coat protein 1
publication title The Crystal Structure of a Coxsackievirus B3-RD Variant and a Refined 9-Angstrom Cryo-Electron Microscopy Reconstruction of the Virus Complexed with Decay-Accelerating Factor (DAF) Provide a New Footprint of DAF on the Virus Surface.
pubmed doi rcsb
molecule tags Virus
total genus 42
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4gb3300
3S6PA 1PO21 5CFCA 1EAH3 4Q4Y1 4RS5B 4N53B 1AUYA 5CFCC 1HRI2 1RUH3 4Y5Z0 3VBFA 5ACA2 4JGYB 5A33B 3VBFC 4GB32 1OHFA 4FTBA 4PDWB 1FOD3 1RVF1 3DPRA 1AYM3 1R091 1PVC1 1RUH2 1DDLA 5K0UA 1PO13 3DPRC 3ZXAC 5K0UC 1VBE3 1PGL2 1K5MA 3IDEA 2RM22 1R083 2ZZQA 4JGZB 2RMU1 2RR12 4WM8A 2QQPA 1K5MC 1D4M3 1QJZA 5C8CB 1B35B 4WM8C 3VBSA 1VBE2 4CEYA 1RUI2 2HWF3 4GH4C 1F2NA 1RUF3 1RUC3 3VBSC 1R082 4CEYC 1ZBE3 4Z92B 4CDWA 5BNOB 2XBO2 5C4WB 2HWC1 4Q4V1 4CDWC 4RQPA 5CFCB 1C8M2 2BFUS 3JD71 1NA1A 1RUC2 1HXS1 4RQPC 1ZBE2 1AYN3 1RB8G 3TN93 1AL22 1NA1C 5DDJ3 1RHI3 1ZBA1 1Z7S2 1VBD3 1RMU2 3VBRA 2HWD3 1QQP2 2WZR1 1QJX1 4RR3A 3VBOA 5K0UB 3VBRC 1RUJ2 2BBVA 4RR3C 4WM7A 5DDJ2 3VBOC 1HRI1 1VBA3 1VBD2 1K5MB 4WM7C 3J8F3 1QJU3 4WM8B 1EAH1 4RS5A 4N53A 1OPOA 1RUE3 3VBSB 1RUH1 4RS5C 1X33A 1VBA2 4N53C 4Q4X2 4JGYA 3J8F2 2XPJA 1R1A3 4JGYC 4CDWB 1FOD1 2WFF1 2GH8A 1AYM1 1NCQA 4Y4YA 4IV1A 1PO11 5AC93 1NCQC 3VBUA 4IV1C 1VBE1 1RUD2 5GKAC 1H8TA 3HAGA 2R062 3VBUC 2BPA2 1R081 1H8TC 1BEV3 2WS93 1D4M1 5C8CA 1HRV3 3VBRB 3JB4C 4RR3B 5C8CC 3VBOB 4QPGA 5D8AA 2HWF1 1RUF1 4GMP3 4WM7B 1RUG2 1HX6A 1ZBE1 4EJRA 5BNOA 4QPGC 1BEV2 1BBT3 2WS92 5ACA3 1HRV2 5C4WA 1TMF2 4N43A 5BNOC 4GB33 2PLV3 1VB2A 5C4WC 4N43C 2RS53 1COV3 1FMD2 3ZFGB 1AYN1 1BBT2 1VBB3 3TN91 1C8NA 1AR93 2GSYA 3VBHA 5DDJ1 2PLV2 1RHI1 2RS32 2RM23 3VBHC 1VBD1 1ND3A 2RS52 2HWD1 1COV2 2RR13 4FTEA 1A6CA 1E57A 4CDXB 1NCQB 2HWE2 2RS13 4IV1B 1VBB2 2WWSA 1AR92 1V9U2 1RUI3 3VBUB 1VBA1 1EV12 1H8TB 2FZ2A 3J8F1 1QJU1 2RS12 2XBO3 1VRH2 4YVSA 1RUE1 2BFUL 1C8M3 2R041 1PGW1 1POV0 4QPGB 5D8AB 4Q4W2 4YVSC 3JBG2 1AL23 1R1A1 1AR72 4N43B 1NY71 1ASJ3 1Z7S3 1RMU3 4QPIA 1QQP3 5AC91 4QPIC 4RHV2 1RUJ3 1IHMA 3VBHB 1ASJ2 1AR62 1BMV2 4NWWA 1BEV1 2WS91 1ND3B 3NAPA 1TME3 1PIV3 3NAPC 4GMP1 3JB8A 4CEWA 4Q4X3 5ACA1 5CFDB 4CEWC 4GB31 1PO22 1M06G 2PLV1 1TME2 1PIV2 2RS51 3ZFGA 1COV1 4YVSB 3ZFGC 2IZWA 5LK7B 1RUD3 1PGL1 1QJY3 2R063 2RM21 1NCRA 5C9AA 1RVF2 4CDXA 2HWB3 1R092 2RR11 2VQ0A 4CDQB 1PVC2 1NCRC 1VAKA 5C9AC 2RS11 4QPIB 3M8LA 4CDXC 3VDDA 1RUI1 2MEV3 1QJY2 5FMOS 3VDDC 1RUG3 2HWB2 1X36A 1NG0A 1TMF3 2XBO1 4Q4V3 1C8M1 3NAPB 5J98B 2MEV2 1FMD3 1RUC1 5D8AC 3ZFEB 4CEWB 1AL21 1CD3G 4FTSA 4LLFA 3LOBA 2HWC2 4Q4V2 3FBMA 1ASJ1 1ZBA3 2RS33 1Z7S1 1BMV1 1RMU1 1QQP1 3JD72 2WZR3 5A32A 1HXS2 2HWE3 1POV3 1OOPA 5BNPB 1RUJ1 1V9U3 1OOPC 1VBC3 5FOJB 1ZBA2 1WCDJ 1EV13 3ZFFA 1FPN3 1AR83 1NCRB 5C9AB 2WZR2 3ZFFC 1QJX2 5L7OA 1ND3C 1VRH3 4SBVA 1TME1 2WLPA 1PIV1 2R073 1VBC2 3CJIA 5L7OC 3VDDB 2X5IB 1FPN2 4Q4W3 4Q4X1 5CFDA 1AR82 3CJIC 3JBG3 1MEC3 1AR73 5CFDC 1F8VA 1EAH2 2WFF3 2R072 5JZGB 4RHV3 1MEC2 4GMP0 1RUD1 4AEDB 2DF7A 1ND2A 1QJY1 2R061 4CDQA 1FOD2 2WFF2 1AR63 2HWB1 1AYM2 1HQNA 1ND2C 1PO12 4CDQC 4CDUB 1AL0G 5A32B 4GH4A 1MQTA 1OOPB 2FZ1A 2MEV1 4FSJA 4YVWB 2Y26A 5BNNA 1RUG1 1MQTC 3ZFFB 1D4M2 1HRV1 1TMF1 4IV3A 5BNNC 1PO23 4Q4Y3 5L7OB 4IV3C 1SMVA 2HWF2 1FMD1 1RUF2 3ZFEA 3CJIB 1BBT1 1VB4A 3VBFB 1NOVA 3ZFEC 4Q4Y2 2RS31 1RVF3 1R093 2TBVA 1CJDA 1PVC3 2ZTNA 3DPRB 5BNPA 2HWE1 1POV1 1AYN2 5ABJA 1VBB1 3TN92 1AR91 1V9U1 5BNPC 5ABJC 1VBC1 5FMOL 1RHI2 1EV11 1FPN1 1AR81 1ND2B 2BUKA 2HWD2 2RMU3 5J96B 1VRH1 2R071 4NWVA 2X5IA 4GH4B 2R043 1GFF2 1MQTB 4CEYB 4Q4W1 5A33A 2X5IC 1QJU2 2RMU2 5BNNB 3JBG1 1MEC1 1AR71 4PDWA 2HWC3 4IV3B 1RUE2 2ZAHA 2R042 1PGW2 4PDWC 4RFT0 4RQPB 3JD73 5JZGA 1HXS3 1NA1B 4AEDA 4RHV1 5JZGC 1R1A2 4JGZA 4AEDC 1NY72 1AR61 4BCUA 4CDUA 4JGZC 1B35A 5AC92 1QJX3 1W39A 5ABJB 4CDUC 4YVWA 1B35C 1HRI3 4YVWC
chains in the Genus database with same CATH superfamily
2JE7A 2EAKA 3S6PA 4NRPA 1UOGA 4EN9B 4Q4Y1 1QGLA 5DUXA 4DXSA 5DUUA 1CPNA 1AUYA 2OS2A 2NM1A 1K45A 2WR9A 1Q8OA 1RUH3 4LIVA 5GZEA 2Y60A 1C1FA 5CEHA 1HLCA 1REFA 3I2GA 5ACA2 3THTA 1FV2A 4P00B 2JB4A 4MGSA 1M4WA 5CG9A 4BWOA 4FCAA 2RDNA 3QLQA 4JDNA 4M0HA 4Z2WA 4FTBA 4ZS2A 1FOD3 1U5YA 5FBJA 4EWAA 2XJQA 4ASKA 1AF9A 4YNIA 1ST8A 5B4NA 2B4KA 5M0TA 4BQ4A 2ZMNA 3ZYFA 4A42A 3C3VA 2H6CA 3ITQA 1O4TA 3AXDA 4Y3OA 4B1LA 1JYVA 3O7OA 2J1SA 5HCFA 3S5AA 5ANNA 3ZMNA 5E88A 2IXKA 2XHKA 2ZZQA 4JGZB 5FYMA 1QJEA 3VDAA 1VAMA 2RR12 4FQZA 1W6OB 4MADA 5KWRA 3KVBA 3V0AB 1QJZA 4LOSA 1B35B 2B8MA 3ZYRA 3AYAA 1HQWA 1QMJA 4XJWA 4Z82A 4KG8A 3BTYA 1RUI2 2BWAA 1WMXA 1JU3A 3PU3A 4S2GA 4W6WA 5FO8B 2J1TA 1XE0A 1F2NA 1KGYA 3ENRA 4GH4C 4ARYA 1R082 5IW0A 1GYKA 1LGCA 1XU2A 4GQ7A 1W0OA 3WW1A 3AYEA 2VBDA 4Q1RA 2HWC1 3W59A 1WCKA 4RQPA 2BW8A 2WJSA 2VG9A 1VR3A 2XL9A 2ZMKA 5DPNA 3JD71 4AFAA 4CCKA 4FPCA 2PHRA 4RQPC 1ZBE2 3GZTB 3ZIXA 4CCNA 2W1SA 3FC0A 1AL22 5LEJA 5F3IA 5EQUA 1IPSA 1GNHA 1RHI3 2GP5A 4XUPA 1LHUA 2RDRA 2A7AA 2XJUA 4M4PA 2Q1FA 3LPFA 4NIIA 1SBDA 1C5HA 2SLIA 2WZR1 2R6QA 4HK9A 3VBOA 1F31A 4FQ4A 1RUJ2 2JENA 4KNCA 1T6GC 3K75B 4YW5A 5FV3A 4JKKA 3VBOC 1HRI1 3OG2A 3RI8A 3NO8A 1DYKA 1KDKA 1VBA3 1NUKA 1LB2A 4B29A 4DRVA 1R64A 4QGLA 4MYEA 3BPZA 3NJXA 4D69A 3MW2A 1OFNA 2MHFA 1FNYA 1APNA 4NMIA 1UY2A 3GM8A 4XABA 4BQ3A 4JDOA 1W8HA 1LOGA 1L7RA 1BCXA 3NNFA 4YW7A 5F3CA 2CWSA 5DN2A 1YLLA 4JVAA 1AX1A 4LIUA 3HN1A 2LS6A 4Q4X2 1IS3A 5IVJA 3GDBA 2FBEA 1S0CA 3D0SA 4I0BA 2WC2A 4HONA 1GWKA 3OD4A 3RNSA 4E8CA 3WD5A 2JDAA 3O0WA 2VQTA 1AYM1 4HLTA 4GWIA 1O5UA 4M3CF 3K4ZA 1PO11 4OHZA 4B4PA 3ZR5A 3VLBB 3PIGA 2C24A 1RITA 4I3GA 2VZUA 4IE7A 2UYBA 3CL1A 4ZS3A 4MHRA 4FOWA 1F4AA 3I2DA 3IIAA 4ISQA 5C7GA 3WCRA 3ZIWA 1DQ5A 3NWKA 4M01A 1D4M1 2YUEA 4FOQA 1D0GA 1STMA 1AX2A 2IXJA 4YARA 3VBOB 3WZ1A 5EYXA 5F5AA 4AHYA 1JZ5A 4DB5A 1WD3A 1RUF1 4GMP3 1O3SA 1HX6A 4EJRA 3QCWA 4AVTA 4W8JA 1BEV2 2J22A 4ASMB 4PQ9A 3PIJA 4QX2A 5FTTC 1YQ2A 3R4UA 1HRV2 3BGAA 3OUIA 3I3QA 3U4SA 4A41A 4MGTA 3BKZA 1W6QA 1WKYA 3RQ0A 4XBQA 1WW4A 3E5QA 2E33A 4CRQA 2JG8A 1OLMA 1HV0A 3KCXA 3PVEA 3ZSKA 4CU9A 2RJLA 2JEMA 4RYDA 2JDHA 5FXZA 1TNFA 2O8OA 1W8TA 2IXCA 3WG2A 2EA7A 2JG8C 1C1LA 4IGQA 1NE4A 2E32A 4YM0A 3TN91 1C8NA 1AR93 2GSYA 2WT1A 4IL7A 3VBHA 1W9FA 2VOWA 4DXRA 2J1UA 5DDJ1 3CF6E 4CXYA 1IZ3A 4KH9A 5GLTA 4P9JA 2FDKA 2R16A 4XF0A 5K9YA 4HSLA 3VBHC 2DYCA 3RI9A 3U11A 4ZHNA 2HWD1 2GMPA 1QKQA 1YRZA 5A3WA 3LKJA 3SCFA 4IW3A 5JR7B 3GJBA 4UFKA 1DCSA 1V6IA 1YIPA 1DG6A 1MS0A 2HWE2 5FZ4A 4B7EA 1SLLA 1VBB2 3RJRA 3AMPA 3DF0A 1AZDA 2E63A 1GZWA 4GJYA 4BYYA 3HJRA 2VZTA 2A73B 2ORXA 3MYXA 4HN0A 2X53S 3J26N 3J8F1 3DXUA 1QJU1 2DU0A 4J25A 1GZCA 4YM2A 2PAMA 4XXPA 4E9KA 2E26A 4MUVA 2XBO3 5LK5A 3WXPA 2W39A 4JHZA 4IEVA 4BQWA 3LFIA 4YVSA 2BFUL 5CKMA 1C8M3 2R041 4N9IA 2VUJA 3Q8AA 1POV0 1UMIA 3N7MA 1UOBA 3DL3A 4KMQA 2NP0A 2XLGA 4YVSC 1GKBA 4HFSA 4BQ5A 4H3WA 3MIBA 4FFGA 3JBG2 2VQAA 3ZYJB 2ZEZA 1YFXA 1R1A1 3H1MA 1S2KA 2QQKA 4UBGA 2VNRA 4D6SA 1VE0A 2YHJA 1OVSA 2BTVC 3OJBA 4UI9L 2PQSA 3ACFA 2ZGLA 2W08A 3VL8A 1PMIA 4YZ2A 1QQP3 2JG8B 5FP9A 2KA3A 5F6KA 3VD5A 2A3WA 4MVTA 3ZXKA 4OQ8A 4AW7A 2Q1ZB 2P34A 4NHMA 4RHV2 2DURA 3EXUA 3OOXA 5EPAA 5EWSA 1YHFA 1IHMA 2EVXA 3AM2A 3VBHB 3V0BB 5FPAA 5JOWA 1AR62 1BMV2 4NWWA 5B2GB 3NNMA 2JWPA 2WS91 4NPRA 4OI2A 1IS4A 5LRRA 3I2FA 3OPZA 2VMGA 4I0WB 1UX6A 5IFTA 2AC1A 4CYDA 1CPMA 3D8CA 4JHTA 2WSUA 3E97A 1PIV3 2PAEA 3BVCA 1GZWB 3OTFA 2ERFA 1D2QA 5LY2A 3I2HA 1DGWX 1ULOA 4YFWA 4E4ZA 4XHXA 4CU6A 5D2AA 3IMNA 2VUDA 3N36A 4U36A 1UYPA 2J1RA 3WQ0A 3O0VA 4GB31 1PO22 3VHNA 4N90A 1TME2 4FVVA 1G9AA 4FFHA 4G4FA 2RS51 4GWNA 1COV1 4YVSB 1OH3A 2QQOA 2WT2A 4QHBA 2G9ZA 2JD9A 4D7SA 1RGSA 4C91A 2JKBA 4BHPA 1SLBA 1RUD3 4COVA 1OXCA 5J1XA 4NIGA 2JIJA 2D40A 1U5IA 2RM21 2P4EA 2W5FA 4A7ZA 3IPVB 4CDXA 4XACA 1R092 2VQ0A 3N7LA 3ZLIA 4NRMA 1TEIA 4ZU4A 3H0OA 3HPNA 3B00A 4CDXC 3UT0A 4Y1ZA 4Y33A 1J3QA 2W1UA 3T0DA 2BWCA 3MW3A 4CSWA 4QKBA 4GKYA 1QJY2 5FMOS 1OI6A 5IT6A 3ZN5A 4XJUA 3I59A 5FWJA 4UW6A 4OUMA 5A3LA 1JW6A 1MZFA 1Q8SA 5HV4A 3AZVA 5JAXA 1NG0A 1TMF3 2LUWA 5A6ZA 1ZRCA 3H8UA 2VCAA 4AI2A 2VZOA 4LUKA 3THDA 4BQ1A 2CDOA 3CU7A 2PHFA 3UJOA 3B69A 4BDVB 1JU4A 5D8AC 3SEEA 3GHNA 1SPPA 3OBRA 2WZPP 2HEYF 1CD3G 1OH4A 2PHUA 2PMWB 4Q4V2 3ES4A 4WBBA 3WHTA 2WZEA 4IEWA 1C57A 2ETEA 1BK0A 1Z7S1 3VN4A 3VKMA 5KHJA 4I2OA 2DFCA 2YC0A 5KR7A 1XYOA 4LBJA 5BV6A 3ZKUA 1OOPA 1ZYBA 1CAUB 2AACA 3HBZA 4ARXA 1CIWA 1OOPC 3AFGA 4RFRB 2ZHNA 4QAWA 5KHHA 3ZFFA 1EV13 1LHNA 1FPN3 3DYOA 1L7QA 2Z5WA 2HH9A 2WYSA 5FIXA 5FMBA 5FZAA 3ZFFC 3TNPB 3K3NA 2LTNA 3M3OA 1JYWA 5L7OA 4NIDA 4XIKA 3KS7A 1ZRRA 2WLPA 2DTYA 5T5PA 4LK7A 2L9LA 2PHWA 1IKPA 1MS5A 1QOOA 1UOFA 2DU1A 1VBC2 2WBKA 3CJIA 1F5JA 4O7XA 4AI0A 4IEQA 5L7OC 4UFIA 5FMDA 4QGNA 2ZX1A 1YI7A 1HDKA 4BISA 1IG3A 3CJIC 1ACCA 3VZLA 3O1RA 4CCCA 5EJ3A 1YJLA 1F8VA 3AP5A 2F17A 3B5LB 3Q8BA 3U10A 3WNLA 3AJZA 2JE8A 4AI8A 2CGPA 3AMQA 1ULGA 4LHLA 3LOIA 1UD1A 4UAPA 1O3TA 4YGEA 2HBUA 5IVBA 2QTWB 3SITA 4JTOA 4W65A 5ANQA 3TEXA 3N3HA 4UF0A 5JIAA 4KGQA 2V72A 4ATFA 1ND2A 2O1QA 1V6KA 1FOD2 2WFF2 3I8TA 4IDZA 1IQDC 1S4CA 2XWJB 1HQNA 1ND2C 1FYUA 2WAOA 5FUIA 4CXXA 1J83A 1QXRA 4NHYA 4XIOA 4AEMA 1UY1A 1XC6A 4QB1A 3NNLA 3JZVA 3P3PA 1OOPB 1K3IA 1Q43A 3AFKA 2R0HA 5CISA 2MEV1 4NR1A 3I3DA 1AVBA 5FAXA 2OZJA 4ZKTB 3B7MA 5CB7A 1RUG1 4CP2A 2QVSB 4HVOA 3ZFFB 1KXGA 2Z79A 1CESA 3ILNA 2Y6LA 1GQGA 4Q4Y3 5L7OB 4WVMA 4AI9A 1UWWA 4WVZA 1HW5A 4HPKA 1KFXL 1SBEA 2BYVE 3HNBM 4FOYA 1ENRA 4L9BA 2RG4A 3CJIB 5LB6A 2W91A 4LO8A 2Q8DA 3PLQA 5FLHA 2P3JA 4GD4A 3VB9A 4URAA 1EUUA 2ZGOA 3NV1A 3WNPA 2VMIA 4JC1A 3RRDA 1O3RA 2E7TA 5FDBA 3SH4A 1JYCA 2W3JA 4FI9A 4FPEA 2TBVA 2ZTNA 5BNPA 5ABJA 1POV1 2UY8A 4HKLA 3H8XA 2XUEA 1AR91 3SH5A 3NQHA 2BQPA 1OF4A 1RXFA 3WW2A 5ABJC 5BNPC 4UF0B 1RHI2 4GALA 3SKVA 4DXZA 2JJ6A 2EIEA 1ND2B 2VH9A 4YW2A 2D93A 4A6OA 1JOJA 4Q0SA 3USUA 5KHIA 1R1ZA 1XJAA 4FOVA 1MACA 1VRH1 4HZFA 5FZ8A 1H2KA 1LOAA 5IYYA 4PIZA 1LOEA 2ZX2A 2WT0A 3W5MA 1YEWA 3MIDA 5FZFA 3SC7X 4ORFA 2QJVA 4CEYB 1WA6X 4Q4W1 4GWJA 5F8PA 4JQRA 1RUNA 1W0NA 1MEC1 1AR71 3TNQA 3NL1A 4DEVA 2HWC3 5FYSA 1TZOA 3MV01 2H0VA 1DYOA 3QOPA 4WVMB 4XUOA 5FXVA 1V6MA 3JD73 4EN8B 3VD3A 4HPKB 5CBLA 5JZGA 1ZZ6A 3U75A 3WW3A 2VNOA 4GIQA 2AYHA 1NA1B 3TYJA 1NXMA 1VMHA 3BN6A 5EP9A 4ES9A 5JZGC 4OI0A 3VDCA 1IG0A 4ZY9A 1NY72 5EFUA 1N1SA 2FQPA 3DYPA 3LFMA 3SLIA 3HD8B 3N9MA 2A1XA 1PNFA 5IAXA 2VULA 5ABJB 5F37A 3W5NA 1JUHA 2ZAAA 2A70A 1CAWA 3JUUA 4QPWA 3ZPOA 1HRI3 2WWUA 2G1MA 4E4HA 5DAQA 2QQLA 4XF9A 2Y38A 3FHQA 3LA7A 4WZFA 4HG6B 4Y22A 2ID4A 2IWGB 3RMXA 1JODA 3NJYA 1J3PA 1H1MA 1UY4A 4AVBA 2PQQA 3L9JT 3NMBA 2ZGRA 3S30A 1KJLA 5A7NA 2BGPA 4Y5Z0 1XNKA 1HJGA 2YY1A 1I5ZA 2XONA 4JGYB 2UWAA 3WDWA 4DIQA 5C6CA 4Y4RA 2HYKA 4N9HA 2D5HA 3EHKA 1WUVA 1OHFA 1UXXX 1MVEA 5C3PA 2QQMA 4KL1A 1SLCA 3O12A 4YGDA 1MR5A 1AYM3 3B9CA 4Q8KA 3AC0A 2OUJA 4LULA 1BVP1 1MS1A 1ZRIA 4QT6A 1PO13 1DYPA 5BYNA 2GAUA 2ARBA 2PAKA 2JDKA 2YBPA 5T50A 4AGGA 2ZCWA 1H2LA 3LIGA 2XH6A 4Q26A 1JZ6A 1CZTA 1OUSA 5DZEA 3I49A 3ELNA 4BXFA 3MDPA 4OMDA 1PGL2 3IDEA 2EXIA 4XETA 5F5CA 2ATFA 2GDFA 2GMMA 3EO6A 2CWMA 4HKWA 4WM8A 2BEOA 5KXDA 2QQPA 1RINA 1D4M3 4AHWA 5H9RA 3S0MA 5IVCA 2FCVA 4WM8C 1QJFA 3WINE 2D44A 4KWJA 4NUBA 1HV1A 3VBSA 1VBE2 2DBIA 4PQQA 2P3IA 1X82A 2VU9A 1UZYA 1H6YA 1CAWB 1RUF3 3VBSC 4AI3A 1GWMA 4Z92B 2GNBA 3PJQA 4AQTA 3ZN6A 5BNOB 3GBFA 3IM0A 4WVWA 4BJ0A 2XBO2 1BVVA 1F4HA 3H3ZA 3M7AA 5C4WB 3T2QA 4J1XA 4Y22B 2A6YA 3M1HA 5FQ0B 1V6LA 1C8M2 2XQRA 1YFYA 3TWIA 3S57A 1JYIA 3GHMA 3WDYA 1RUC2 1CWPA 1YYNA 2VZRA 2VTXA 2VZSA 5DAXA 2P5BA 2QCSB 4FFFA 2YC4A 3TN93 3C7OA 4CUBA 5C3SA 5I0RA 4UW3A 5DDJ3 1UQXA 4XURA 5HCAA 1ZNPA 3KV4A 1WCSA 2DV9A 2ZOEB 3UL2A 4J1WA 4QB6A 4EWDA 5A1AA 1ZVFA 3Q8CA 3WSOA 1Q3EA 2HWD3 2WSVA 4S2DA 1QQP2 4UFMA 4NAMA 2WUHA 5CYYA 4KWLA 4Q1PA 4XOGA 3AZZA 2RV9A 4LMFA 2DVGA 2BBVA 3DYMA 4MGKE 4WM7A 4YG3A 5K7PA 5IJRA 4IEZA 1E5IA 1OA3A 1VBD2 5CNAA 4WM7C 1GWLA 3SNMA 1A3KA 3J8F3 1QJU3 3PVOA 3GZUC 2I45A 2RE9A 2ZX0A 4WM8B 1EAH1 2K0GA 1OT5A 1LECA 1YIFA 4R9CA 3WW4A 1S55A 5DAPA 1S1AA 4EV0A 3ZSJA 1W3VA 4PIYA 3VBSB 4DY5A 1FNZA 3WNKA 5CIRA 4D6RA 3MO4A 1WBLA 1H6XA 4X6QB 1R1A3 3ZN6B 3OGSA 1JH5A 1Y9MA 1SQ4A 4W6YA 1OD3A 2Q4SA 1GP5A 3PL0A 3ON7A 2CTVA 3KF3A 4XUTA 2OPWA 4YM1A 3POFA 3WF4A 1U5ZA 2W94A 2ZGQA 2DVDA 4BLIA 4ZU7A 2YZ4A 5F39A 1XU1A 2Y33A 5CKQA 3VBUA 1I1EA 3KZ4C 4NRQA 4Z8BA 1RUD2 5GKAC 1H8TA 4HANA 3FL7A 4AOCA 4O9EA 3VBUC 2BPA2 4NO4A 1R081 2VZ3A 4X8NA 1SZBA 1UIJA 1H8TC 2FMDA 2BGOA 4BQXA 3V0AA 2WS93 4QXHA 3WT3A 3ZN4A 2ZGUA 1J1TA 2TNFA 2FDGA 1GICA 5IVEA 1OKOA 2B9UA 4UFJA 1PX4A 3O5SA 4YWAA 2ZBJA 1ALYA 4XFAA 4M0NA 4A2UA 5A3NA 5F3GA 1N3QA 1RC6A 4WM7B 2G9FA 1IOAA 1ZBE1 2Q5TA 3HT1A 1UO9A 3IT8A 3IAQA 3KSCA 4HT1T 5GLZA 3BI3A 1JOPA 4CXWA 3FZ3A 1TMF2 1CZVA 5IVFA 4N43A 5L19A 3NKGA 4GB33 2YGLA 1HB3A 4OMCA 1N1TA 1XNBA 2DFBA 2CL2A 2W92A 4N43C 2UURA 2RS53 1UZVA 1COV3 2VE1A 3ZFGB 1AYN1 1IS6A 1NKGA 1BBT2 4YZ3A 2VOKA 2XHNA 2QE3A 3IDAA 3AP7A 1AXYA 2BNNA 5JI7A 2E9QA 2PLV2 3CJXA 5DXDA 5FKBA 4XMAA 4AFCA 2AGSA 2RM23 3FBYA 2AR6A 5KXCA 3FHAA 3C7HA 2E51A 4I0AA 4MH0E 1A78A 3T1MA 5FO9B 1V70A 3FX3A 1SLAA 2D6KA 4F8AA 4QQHA 4BOWA 3VBUB 4PLMA 4XFIA 4LBQB 4QXBA 4UOJA 1EV12 1H8TB 2FZ2A 5EIYB 4LOTA 1G9CA 5JMOA 3AK0A 3BODA 4NHXA 3S5QA 1LHVA 2UWBA 1F15A 2RS12 2EIDA 3LA3A 1JUIA 2EXHA 4U2AA 2RDSA 1LU1A 3PUIA 3ZDSA 1UMHA 3LIHA 3ILRA 4XMIA 3T2OA 1HN0A 2C1FA 1WMEA 3OF1A 1GBGA 4MHUA 4AK3A 1DP0A 2BV4A 2DCJA 4YRDA 4HOOA 3K4AA 4QX8A 3ABZA 3UKNA 2Z42A 3ZSEA 3ZXJA 4BU2A 5FZ1A 4QX3A 3VGIA 1W6MA 4N43B 2JKXA 1W9TA 4NROA 1U12A 1Z7S3 5DZGA 5SV5A 1GQPA 4QPIA 2DVBA 4A3XA 5AC91 3MBWA 2V5YA 5E1RA 4CE8A 2ZKLA 2QNKA 1SFNA 1ZZBA 3NVCA 5FYBA 4QPIC 5AVPA 1BLZA 1UKRA 1H9WA 4R52A 2Q8OA 2WABA 3OCPA 3TEWA 4I30A 1ASJ2 1LOCA 4Y1YA 4Y1VA 3RZHA 4ZONA 4BB3A 1BEV1 1Y9GA 4FAHA 2G9GA 5C70A 4XEZA 1Q5OA 4XYXA 2QZ3A 1YJKA 2KR2A 4JCKA 3THPA 4TLGA 3U14A 3ZYBA 4EE2A 2ENRA 4EZ4A 1W2TA 2QQNA 2XJSA 3MLJA 1KFUL 2GN3A 4NPLA 1OSGA 3ACIA 2YB7A 3HNMA 4RN5A 1W8FA 2PHLA 3QD6A 5FZ6A 4QQLA 4QM9A 2GU9A 2BGCA 1ULPA 1XPWA 5FY1A 4ZXEA 5LA2A 2O14A 4Q0UA 4KG0A 1OLRA 3RSJA 4UBHA 5FLJA 1AXKA 3I3EA 5JR2A 5GZCA 2A6VA 4AF9A 4W50A 4LITA 4C8DA 3AVSA 4P02B 4OUEA 1XNDA 5FZIA 4XE9A 4AEJA 4NIHA 2ZS6B 4XDOA 5IK8A 3T2TA 1VP6A 3KF5A 3WUDA 1ENSA 1OD5A 1PNGA 1REEA 3GGLA 3ES1A 3K4DA 4Y5SA 3CZJA 3E5UA 1NCRA 1DGRN 5JOYA 2A75A 1W6MB 3D5OA 4CDQB 2CHHA 3I2JA 1GZ9A 4LNVA 3LEIA 2Q8CA 1NCRC 1VAKA 2JB8A 2QDNA 4AL9A 1X8EA 3M8LA 4QPIB 4QDSA 4NN0A 2WRAA 4AAXA 4QQOA 5KC6A 2GALA 2AUYA 2I74A 2VBPA 1LCLA 1RTVA 2MEV3 3LE0A 1SEFA 4Q5OA 4E27A 1DFQA 1NXD1 3WF0A 1QF3A 1RUG3 2Z69A 5FYHA 4A6SA 1GNZA 2HWB2 5IK5A 5J3UA 4LLOA 4Y1UA 2VM9A 4FP2A 1O4ZA 4FTEA 4R8HA 4XW3A 4YW1A 3AKSA 1W99A 1BKZA 2MPFA 5C8WA 4I3PA 4R9BA 2EALA 2F6BA 4C0BA 2CDPA 3AKRA 3POGA 3GYDA 2ADEA 3ZFEB 5JPNB 1ULCA 2R0FA 3RWKX 1XSQA 4FTSA 1IGOA 3LOBA 2HWC2 1ZBA3 1J59A 1BMV1 1RMU1 4INDA 5C3RA 5G05L 3JD72 4BM8A 2DBNA 1POV3 4HMZA 5CA6A 1AXZA 1N1YA 4IEUA 4L99A 4UWDA 5LATA 3FHIB 3V0BA 2OUHA 4K9SA 2RHPA 1DZRA 1ZZ8A 3R0RA 4H14A 4I01A 5F6LB 1JYXA 2X29A 5LZ6A 2XWBB 3LQCA 4LPLA 1NCRB 2A6WA 1OUXA 3AMMA 2WZR2 3MF9A 2J7MA 3GXUA 4B3NA 2JECA 1VRH3 2VZQA 5HXMA 1RIRA 1TME1 2DCZA 4MXVA 4DFSA 3H1YA 3FFQA 3FE5A 4P9IA 3M3IA 3T09A 2VR4A 3WG1A 4I09A 1NX9A 3KCYA 2X5IB 5EJZB 4Q4W3 3PUAA 1AR82 2K2SA 3T08A 3B01A 3WF2A 1O8PA 3MIFA 3ILFA 1QDCA 1MEC3 3KT1A 1AR73 4GJZA 4CU8A 4QX5A 2PTMA 2W9XA 2XOMA 3LD8A 3UV9A 4P9GA 4RGAA 1QXJA 3MLLA 3AP6A 2R072 5T55A 5F2SA 4HK8A 1U0AA 1CVNA 2D6LX 3O1SA 1ZRDA 1DBNA 4QHZA 1UN1A 2AZ5A 5DG2A 2TUNA 4XFCA 4GMP0 1WLDA 4AEDB 3O1OA 3IPVA 1QJY1 2R061 3CQOA 1AYM2 3Q8EA 4XQWA 4C90A 1EUTA 2NLRA 4P08A 1PO12 2WIIB 3EBRA 3HBKA 5I8YA 2VMFA 2BNOA 2JDYA 3LA2A 1QH6A 3POSA 3ZXGA 1MQTA 1EP0A 3MFAA 1XYPA 1DQ1A 4L0PA 1XYNA 5EV7A 1QY4A 3J9SA 2HEWF 1MQTC 2D7FA 2ZEWA 3NJZA 1JZ8A 4JV4A 1D4M2 2YMZA 4LBMA 3PJYA 4IV3A 2BOJA 1KDMA 4CUCA 3U07A 4GULA 4OZXA 1Q56A 4IV3C 1CQ9A 2A71A 2VNVA 1SMVA 5FKCA 2IVJA 5HI0A 2OKXA 1E5SA 1FMD1 5FY9A 1RUF2 2RJKA 5JIUA 5LCWL 1W8UA 1UL9A 4C1WA 1VB4A 3VBFB 3RWNA 4ET7A 1NOVA 5DAVA 1DHKB 5K4LA 1PM7A 2LW8A 2YU1A 3IB3A 3I3BA 1DGWA 2P1BA 3MHZA 5A7SA 3ZO0B 2PHTA 3N7JA 4TSVA 4XBNA 4IUGA 2RS31 1CIYA 3FWEA 5I0DA 1NZIA 2G4IA 4GZ9A 2XKOA 4FPJA 4K21A 4YYOA 4S2FA 1SBFA 1OMIA 1W2AX 2WAAA 2C26A 3AP4A 3DPRB 1CAUA 2DUQA 4IEOA 4OYUA 4DQAA 3TN92 3OBTA 2XJRA 1V9U1 4R9DA 1OLME 1YXWA 1VBC1 4YLZA 3HWJA 1JYTA 1TVGA 5FMOL 4PF5A 2DDUA 1W06A 2BOIA 2W87A 3O0XA 2HWD2 4N7IA 4B1MA 2VO5A 3BB6A 1T2XA 4K20A 2EF6A 4TWTA 3VZOA 3APBA 4M00A 5J96B 5H9SA 3PVBB 4UW4A 2OYZA 5FUNA 1QWRA 4Q29A 2Q8EA 2JE9A 2XDVA 3DUIA 1GFF2 1MQTB 1NT0A 4XJ9A 1GR3A 3AXEA 5A33A 1RJ7A 1QJU2 2RMU2 1ZX5A 4GAZA 4IE6A 4XF3A 4MLOA 4CCEA 4N8MA 4UFHA 1FAYA 1OBNA 4HETA 3PURA 4IV3B 3VKFC 5A3UA 2C9KA 3AYCA 3IDBB 5HBAA 4OHWA 2R042 1IS5A 3KCCA 1EY2A 2B45X 1DIWA 5FYVA 1PM4A 1WWYA 3TEYA 3SKJE 2X05A 5EHDA 1R1A2 3NJVA 1Q8PA 3EQEA 3OGGA 1J58A 4N7UA 3OSDA 5A7OA 4AVVA 1RJ8A 2BERA 1FATA 3NKTA 1QEXA 1CAVA 4NE9A 4YFZA 2XXZA 1UCXA 1W39A 3AKPA 1LRHA 4JX0A 3K51A 5LBEA 4A7YA 2OQ7A 4AR2A 3H7JA 3WVJA 2W68A 3FJSA 5DQ0A 5I8TA 2QQJA 1JHJA 5KBFA 2D98A 4K40A 4QD2A 3AZXA 4MGZE 4Y20B 3RS6A 3VZNA 1F5FA 5T5LA 4LK6A 1Y9QA 1EAH3 2R32A 2X10A 4FPYA 4PBPA 1G7YA 3MPPG 4OZOA 4RS5B 4N53B 5AVAA 3LDRA 1W8WA 2ET1A 4IE4A 5FY5A 2GNMA 5FR3A 4RL7A 1ULDA 3CBNA 1L7LA 5A7PA 1J3RA 3MPBA 5FZMA 2K9ZA 4COUA 4TZDA 5A33B 3UKVA 1YQ8A 2D6OX 3UNPA 4GB32 1DLCA 4E4SA 1RVF1 1VJ2A 2YC2A 1PVC1 1RUH2 2Z4FA 3CDZB 5J37A 2C0ZA 4PLOA 1URXA 3ETQA 4L97A 4E2QA 5IFPA 1REDA 3ZXAC 1V0AA 3A23A 4E2SA 1UY0A 3POYA 1NLSA 2YFZA 1JS9A 2RM22 4XQ4A 3WV6A 3MIEA 2HYXA 1R083 3A21A 4QPYA 3NSTA 1S2EA 2WYFA 3PTRB 3OUHA 5DUWA 1OA2A 1UKGA 2XMLA 2ZEYA 3VZMA 3ETPA 4G3YC 4A3ZA 4HBNA 4WZCA 1VIWB 1KS5A 5C8CB 5LA1A 1US2A 1CAVB 3RYKA 4LORA 2D6MA 4CEYA 4B8EA 3MIGA 4EQVA 3VDBA 3X29B 1QOSA 5FZGA 2R30A 3DEMA 4QXKA 1UXZA 4LQRA 4CEYC 1ZBE3 2RJ2A 1LGNA 3KT4A 5A6XA 1LR5A 1XQNA 4CDWA 3VL9A 4A44A 4CP9A 1W2NA 4AQ6A 4ZPIA 2W1QA 1ZA7A 2QZ2A 5H9QA 3LWCA 4CDWC 5KHKA 4OUSA 4LO6B 3S7IA 1NZCA 1G9DA 1I9RA 4BA6A 2PXJA 3PVNA 4P14A 1NA1A 1OFSA 4Y24A 1HXS1 2ADDA 1AYN3 4CCLA 1OQ1A 5FK8A 4QWNA 1O7FA 1NA1C 4LBNA 4E8DA 5J48A 2ZJCA 4TN7A 1ZBA1 4ZZ5A 4AEKA 1Z7S2 3OGRA 1FI2A 1PK6A 2D3SA 2WNOA 5GLVA 3VBRA 4COZA 3V56A 2TEPA 5C5UA 1QJX1 5FXWA 5CU1A 1MS9A 4A7KA 2EIBA 1PK6C 3FUQA 4MV2A 4CCOA 3VBRC 3K3OA 4FPGA 1QU0A 3N7KA 3AKTA 2WO1A 1ZM1A 3DN7A 4V1PA 3M4FA 2XJTA 3ACHA 1NYWA 1Y43B 1IPKA 2R7EB 4K1ZA 4MG2A 1DQ2A 2Q1MA 2YV8A 2WNUA 4FBFA 3T0AA 4QDRA 3HVDA 2V5DA 1SLIA 3OBAA 2AREA 2D97A 2WNUC 2YBSA 5FK7A 1J84A 1Y7BA 1W2OA 3DXTA 1VMFA 5CVRA 2GNDA 5T3NA 2OX0A 3UKTA 3VKNA 3SHRA 3HEIA 1VBA2 2VW1A 3J7LA 4BQ2A 1RUOA 4JGYA 4ES8A 2ZHMA 1SG3A 3WUCA 3IN9A 3JCIA 4IESA 1TG7A 5T52A 2HBTA 2YYOA 4JGYC 5DG1A 1UY3A 1WLCA 4LKSA 4CDWB 2D6PA 4CP9B 4JDMA 4QKNA 2ZABA 4PT6A 2GH8A 5HV0A 1NCQA 2ZZJA 3IMMA 2VECA 3D0JA 2Y6HA 4YSFA 2Y64A 5A1LA 3WX5A 5AC93 1S2BA 1WMDA 1NCQC 3UYJA 4RSUA 3V65A 1I5PA 1VBE1 1GUIA 4OHVA 1CGPA 1U5XA 2NN8A 2PYTA 2R1DA 1NE6A 3I2KA 2VBBA 4JKMA 1LHOA 3POEA 1W3XA 4A4AA 1BEV3 1E5RA 1JTZX 1SCRA 1HRV3 3WNXA 1PK6B 3VBRB 3JB4C 4MOAA 3ZSMA 2D3PA 1X9PA 4PI2A 2R1BA 3GNEA 3VHRA 4QPGA 1JHNA 4O65A 2HWF1 5JSPA 4PLNA 4XVHA 1W2UA 1RUG2 3U78A 5BNOA 4QPGC 4V2VA 4IERA 4XQDA 3N9NA 1ULEA 5JOZA 1G86A 5FWEA 5C4WA 5CZKA 3RG0A 5FQ0A 2WNUB 4M3CA 2ZGTA 5A1FA 1LULA 2IUWA 4PBOA 5BNOC 4QQPA 4QQ2A 4W6XA 2ZHLA 3D4KA 4EROA 4Q2FA 3MIHA 5C4WC 3T1LA 4CUGA 1L3JA 1NLQA 4FO9A 3IKWA 1DF0A 2LROA 4KWUA 1O8SA 5JLVA 1D2SA 4PCRA 1ENXA 1WCQA 3LPGA 2UY9A 2A3XA 4C1XA 5JDBA 1YI9A 1VBB3 1KJRA 2VXRA 2B42B 2XVLA 1UOJA 4BMEA 5IAVA 2JIGA 1CZSA 2W95A 4V2WA 1Q8QA 3ZSLA 4ATEA 3MLKA 4FP3A 4TXWA 1LAJA 4SLIA 1VBD1 1ND3A 1DZQA 3RJ2X 4BH9A 4LBLA 1A6CA 1E57A 3SCHA 3VD4A 1NCQB 1UU4A 1HB4A 3IAPA 2P37A 3WG4A 5FZ0A 3R4SA 4LO5B 3CNAA 2WWSA 1AR92 1HIXA 4XILA 4OQ9A 3JQWA 5FYTA 3WF3A 1NQJA 2CGNA 2XKPA 4XF4A 1UF2C 4ZXKA 2VL4A 4YM3A 4EN7B 5I0SA 1ODMA 1VRH2 3D6EA 4OHXA 5FP8A 3LGRA 4P9YA 1RUE1 3H7YA 4AQ2A 1PGW1 1QIQA 2VC9A 1WCUA 4QPGB 4Q4W2 5FZHA 4Q8LA 1KEXA 4YG0A 3WEZA 1MS4A 3U1XA 2P6CA 4UW5A 3R4DB 1AR72 3D3AA 4PHZA 2NMNA 2GC2A 4XAAA 4M3CB 3OBZA 1H4GA 2YXSA 4X6RB 5GZFA 4ISRA 1RMU3 3ZYGA 4HKOA 4QGMA 3IIIA 3LZZA 3ME2A 4D94A 4YZ5A 5ERLA 1LKNA 3RVHA 2BDRA 5CADA 1GU3A 3USSA 3HMYA 5IWFA 4HSJA 1H8VA 3OGJA 4CP0A 4CU7A 4NAOA 2WA3A 4AE2A 1JMUB 1ND3B 3AMHA 3ATGA 3F2ZA 4YW3A 4XC9A 1ONAA 2WDBA 3WHUA 3WF1A 4BLJA 2J42A 1TME3 3OY8B 2QQVA 1W9YA 5A3TA 3VKLA 1XNCA 4FFIA 5BNQA 3N4MA 2VMDA 1VALA 1VLNA 3JB8A 4CEWA 1PX3A 1OC1A 4AYUA 5JMCA 2IXIA 4AAPA 3WR0A 3O1TA 1WGPA 1S0BA 1ZZCA 3E5XA 3T4VA 4YZ1A 5ACA1 5CFDB 4KBZA 3OPWA 3ST7A 2XJPA 3E1F1 3ZXDA 4CEWC 2PLV1 3RZGA 3TAYA 1M06G 1SHWB 3ROUA 1A34A 4LUMA 2VZ1A 5C3QA 3LCPA 1PIV2 3VHOA 5LRSA 1YC61 2W52A 4MO3M 1BK1A 3ZFGA 3BUCA 2ARXA 1YFWA 3ZXFA 4LE3A 2EICA 4LBOA 5GJ6A 3ZFGC 3BOWA 1DU3D 5F2WA 5L9BA 3BPSA 4CCMA 2IVIB 4RGKA 1QJY3 2R063 4FPFA 5FZBA 1YNAA 2QDRA 4K8RB 2RR11 4QXCA 3NNJA 4K1YA 1JN2P 3M3EA 2GP3A 2RS11 2VPVA 1QNWA 3LB9A 3V64A 2HJIA 5D21A 5J09A 2WL1A 3VDDA 4LBQA 1RUI1 2VUAA 4HXCA 5BPXA 3C2UA 4TYSA 1KRIA 2B7YA 3VDDC 3HR9A 2GNTA 2KXLA 4J6GA 2F4LA 4M4RA 3BTZA 1X8MA 2VZVA 1UZWA 4DMIA 4TTGA 4FXKB 3H8OA 2YGMA 3GF6A 4P5HA 2OA2A 3B9IA 5C33A 5KXEA 1IQAA 1GNYA 1CX4A 1LEDA 1B09A 1WD4A 2EIGA 1HKDA 2X09A 4Q4V3 4Y1XA 5K8SA 2VMHA 2F4PA 1UYZA 2A5ZA 5J98B 2P17A 4NVPA 1FMD3 5HCBA 2OPKA 3MI8A 5A70A 5BUVA 4OFGA 1MZ5A 1RL3A 5I0UA 4MX3A 4CEWB 1PMHX 1AL21 1QXPA 1KITA 4OCTA 4X8PA 5IATA 1XE7A 2AEYA 3NV2A 4LLFA 1PZ7A 3I2IA 4DUWA 1ASJ1 1NLRA 2RS33 2VNGA 2VCCA 3HOBA 3LDBA 5FFOC 4DNYA 4XJAA 2FCTA 3POIA 1LTEA 1RUJ1 1S0DA 1NQDA 1V9U3 4JRAA 4URTA 2WLQA 3PUHA 3KV9A 5FZLA 1DQ0A 1VBC3 2XQXA 5FZEA 1H2NA 1WCDJ 2VTFA 2XLFA 2ZACA 1QHDA 3LEGA 2WQ4A 4FT8A 3MICA 3LAGA 4CPBA 3H9AA 1D0HA 2VW2A 5FZCA 5J36A 5LW9A 2FDFA 4LA2A 5IK7A 2OQ6A 2VUCA 3I2OA 2VVFA 3SQOA 3PU8A 4SBVA 4EZHA 1FX5A 1N3OA 3ZVXA 4LTAA 4BE3A 2R49A 3D82A 3RDIA 3VDDB 2VMCA 1MZ6A 4QKFA 1A8MA 1FPN2 2GZWA 1GOHA 4Q4X1 5C5TA 4H55A 2VAUA 1ODNA 3P1IA 2YFUA 5FPZA 4YG6A 1KD7A 2YROA 2VY0A 3AL6A 1EAH2 2GMEA 2V73A 3OEBA 4CTEA 4NHKA 1AJOA 1LJ7A 2GC0A 2WFF3 2A6XA 2ZPXA 2JDNA 4B4QA 2VVEA 4AFMA 3CO2A 1X9TA 4PJYA 2DCKA 3POWA 3UJQA 3U4XA 4ITCA 1D7PM 2XGXA 3CIHA 4YGBA 1W8ZA 3UGGA 4XUNA 1WW6A 3IDCB 3MUZ1 2IXLA 3UGHA 2DF7A 2CY6A 2DWRA 4CDQA 1OF3A 1MS8A 4LHSA 4CCDA 3NRUA 2HWB1 4DRRA 2Q30A 1UIKA 1DQ4A 2CNAA 5FBZA 2ZX4A 4LEJA 4BMBA 4CDQC 3BIWE 5SV8A 1N1VA 1POQA 2AH2A 2WKKA 3FLTA 3T3YA 4CDUB 3IBMA 3G6JB 4LHNA 1AL0G 1YFUA 1Z78A 4GH4A 2V4VA 4YZ4A 3ALQA 4BK5A 3GCXA 5GZGA 1RXGA 3BYWA 4QDQA 4META 5ISLA 4YVWB 5FJHA 5JSOA 3KVAA 5FYIA 5C3OA 3IZOA 2YPJA 1HRV1 4QU2A 3W9AA 1G9BA 5FPLA 1W6PA 5F3EA 4G9SB 4CP1A 2WO7A 5LWBA 4L92A 4ZZ8A 1K5JA 1O4YA 2H6BA 3URFA 3ZR6A 2VXJA 4QX7A 4F7ZA 3PUQA 3ZFEA 1UYYA 2JX9A 4D8MA 5FPUA 4K3UA 3AYDA 4YW6A 3M3QA 2WN2A 1W9SA 3AKQA 4PF1A 3ZFEC 1LOBA 4JKLA 1T6BX 3LF7A 2AEZA 2FMYA 4Q4Y2 1SDDB 1RVF3 2AENA 1OQEA 1MVQA 1PVC3 2V4AA 1PMJX 1ZZ9A 2HWE1 1AYN2 3O1PA 4EN0A 1VBB1 2JDMA 1V6NA 2ZHKA 4Z2AA 3I97A 1SACA 1UW8A 4O61A 4XUQA 5DUVA 1HB1A 4C0HA 2XUMA 3N9PA 4LKDA 3T2PA 1HB2A 1AR81 3POBA 1GLHA 3W21A 3MEPA 3RYPA 4D3WA 5L9RA 2VGDA 5B4XA 4BQYA 3EJKA 4LJHA 2DUOA 2BBAA 1H1IA 4LO4B 1S0IA 2R071 3A4UA 2X5IA 3KB5A 3GCWA 3OEAA 4GH4B 4DO0A 1UNBA 3BU7A 4XCBA 1W05A 4JZRA 4R4XA 1BZWA 3GBGA 5E89A 2PELA 2X5IC 3RGBA 3RPQA 2JD4A 3JBG1 3U0ZA 1SFYA 4XJZA 3WDUA 1W8NA 4PDWA 5FZ7A 2Z2SB 5FXXA 3VV1A 2E31A 3ASIA 1UPSA 1W6PB 1S0GA 3ORJA 1VMJA 3PNAA 3K77A 2ZAHA 5FYYA 4PDWC 5J7MA 5HPOA 4RQPB 2VZPA 2WWJA 1UPIA 1HXS3 3LSEA 3PTYA 1EPZA 2BU9A 4AEDA 2W46A 2G19A 1CN1A 2ZX3A 4RHV1 4NOTA 4OULA 1BYHA 2LM3A 2C5DA 4AEDC 5IHRA 1WW7A 3H3UA 1AR61 4BCUA 3QH7A 5GM0A 5AC92 4LKEA 3TEZA 1KS4A 2BJSA 1QJX3 1VPHA 2J1EA 2PN5A 4FXGB 5EXOA 5FY8A 2VTXJ 3AB0A 2HKXA 4O9GA 2H0BA 3DGTA 1QDOA 2QQWA 3VD9A 3SCGA 4OLLA 1CAXA 2CGOA 1VRBA 3Q8FA 5F5QA 3WLUA 4AGVA 1Y3TA 4BZ4A 5L73A 3TB0A 4Z07A 4HVQA 3ECQA 3KMHA 1YQ5A 2GC3A 3GALA 1PO21 1OA4A 4BIFA 4F83A 5CFCA 4D6QA 3N9LA 2VCBA 5JUVA 4AVCA 4FPKA 3ZXEA 2ZKNA 3OUJA 4XAEA 1BHGA 5E16A 3P6BA 3P5BA 5CFCC 1HRI2 2ORZA 3H3LA 1WZXA 4MZUA 3VBFA 5JCTA 2I2SA 2FDHA 3A7QA 3HQRA 3KGZA 4B7KA 4JRLA 3VBFC 3BOPA 4FPLA 1LNSA 3I54A 1H1AA 4JTNA 1JXNA 4PDWB 4COWA 2PHDA 3DPRA 1R091 2NPIA 3SH3A 3WOGA 3VKOA 1DLLA 1YUDA 3W20A 1DDLA 5K0UA 1KQRA 1O59A 4RD7A 5EZWA 4Y5TA 3DPRC 2WFPA 2KD7A 1H4HA 2ZMLA 4AVSA 2ARAA 1CJPA 4KI5M 4XCAA 4LKFA 5K0UC 1VBE3 2ZGKA 3OYWA 4R4ZA 1UYXA 2XLAA 3F95A 1K5MA 3N9OA 1I3HA 2QQUA 4R9AA 3KT7A 1LESA 4IXLA 2RMU1 2CSGA 1K5MC 3E6DA 1XNTA 5AFEA 5GLWA 2B39A 5JXIA 2B5HA 5IUQA 5FJKA 4DS0A 5F7UA 4IEYA 2FD8A 3UK9A 2E7AA 2B9VA 1SLTA 2FHRA 2HWF3 2YU2A 1RUC3 3AP9A 1WLTA 4NHLA 3LDKA 1CAXB 4XJ8A 2SBAA 3HQXA 3C7EA 1XNAA 2DTWA 3KV5A 4Q4V1 2NZ9A 1W6QB 4I02A 1HJFA 4KGGA 5CFCB 2BFUS 4KWKA 3J7MA 3M70A 4UT5A 5FMCA 2CYFA 5E8AA 4BK4A 2RDQA 2FCUA 2N7GA 3FFZA 1W90A 1C28A 2WQ8A 5I0TA 1RB8G 5FYCA 1H9PA 2IFRA 2JDUA 4LO7A 1K12A 2D3RA 3EB7A 2VCMA 4UFLA 1IKQA 5JPMB 2IC1A 3N35A 1VBD3 1RMU2 4AVAA 4QU1A 4DZGA 1F35A 3GBWA 3AZYA 3RFRA 2BP6A 3KV6A 4RR3A 1ZA4A 2UWCA 5K0UB 5CG8A 2X8KA 5FOBB 1S0EA 4LA3A 5CKNA 5FO7B 4XFGA 4RR3C 3ZYHA 5DDJ2 3I7DA 5DZFA 1RYYA 1V00A 3OYWB 4AFBA 3LEMA 3MV11 4IGPA 4DOUA 1LHWA 3QACA 1UX7A 1K5MB 3NV3A 1S0JA 4Y20A 4CA9A 1OQDA 4EWEA 1S0FA 2VOVA 3A0NA 3Q9OA 1E5HA 4OHYA 1H2MA 3KLSA 4RS5A 2XR4A 3POJA 4N53A 5G04L 5GLUA 4COYA 3VD7A 1HQLA 1OPOA 4QMAA 4MGYE 1RUE3 2EAAA 1W8OA 5APAA 3U37A 1OURA 3RZZA 4AG4A 1RUH1 4RS5C 2GC1A 3BTXA 1MS3A 1NAEA 1X33A 2CV6A 4N53C 5JI9A 5A3OA 1JZ3A 3HN3A 4AHXA 4B4RA 3J8F2 1ULFA 5FZDA 5A3MA 2XPJA 1UU5A 4L11A 5I93A 1XSRA 4QX0A 4E2GA 3O1MA 2P2KA 2WO2A 5DABA 1FOD1 3VUOA 2WFF1 3BCWA 4GA9A 3KHBA 3J7NA 3P3NA 4Y4YA 5JVVA 4IV1A 3KGLA 1H30A 3C7GA 3WP3A 3VZJA 3WDTA 3CHXA 5F5IA 4A45A 5AFBA 2Y34A 2O0OA 4IV1C 2W1WA 3T0BA 5EYYA 2E7QA 1G9FA 2CAVA 2I07B 3H42B 3HAGA 3KQRA 5D1IA 3WDXA 5LEKA 3H1WA 2R062 2VOXA 3W58A 1JOBA 5FZ9A 5CAZA 3CEWA 5JXGA 5LA0A 1ZZ7A 4L8QA 2D5FA 3BTAA 5C8CA 3OGVA 2VVDA 4P9LA 1OVPA 4RR3B 5C8CC 3B93A 5D8AA 1AX0A 3OPTA 1US3A 5HXVA 4EYUA 2WNEA 2GN7A 4YPJA 3WQ1A 1BBT3 2WS92 5FZOA 5GZDA 4DUXA 4XDPA 2BNMA 5ACA3 2WZ8A 1SFPA 2PLV3 1VB2A 4DUVA 4XFBA 4JAAA 1X7NA 3PHMA 1WMFA 1GP6A 4L2NA 2GH2A 1FMD2 3GZEA 2NMOA 1YQ6A 4P9XA 5FLIA 4XTPA 1LOFA 3CKHA 3AJYA 3TBDA 4H7MA 4K7JA 5FYZA 1RHI1 4DY3A 2RS32 2WN3A 1LOFC 3A22A 2RS52 2WQZC 4WV8A 1COV2 2RR13 1Q8VA 5IVVA 4Y26A 4CDXB 1G6NA 3BU0A 2JDZA 3KQ4B 2RS13 2VD7A 4IV1B 3DCQA 4AQSA 2Y6JA 1UZ0A 2J1VA 1V9U2 5E6HA 4D0QA 2LALA 1CX1A 4P9WA 1RUI3 2W47A 2C6SA 1ZRFA 2QQIA 2ZGMA 1VBA1 5LA9A 3MGUA 5T5JA 3WNMA 4D7YA 2Y0OA 1X50A 3CLPA 3I59B 4LE4A 1FXZA 3S7EA 5FY4A 1Z0HA 2BVVA 3R6SA 3UETA 5JSRA 2K46A 3VZKA 3BALA 5FP3A 4NIAA 1OPMA 4GKXA 5BXXA 5F32A 3ZYIB 5D8AB 2LRPA 4CZSA 4XHBA 3THCA 5T5OA 3NW4A 1FT9A 4TLFA 3AMNA 1FV3A 1AL23 1LODA 3T30A 2P6HA 3AX4A 5FZOB 1SPPB 5I91A 5DMYA 1NY71 2UU8A 4H2AA 1AJKA 2P3KA 1ASJ3 4XPVA 4QM8A 5FPXA 1F9KA 2DCTA 4MGIE 2VMEA 1GANA 4OI1A 5A7WA 1JZ2A 3ZX7A 5GALA 5L36A 4PI0A 4XFHA 1IPJA 2YPDA 1RUJ3 1XB9A 3FLRA 3VHPA 5FZ3A 3OD0A 1DGLA 2JG9A 1O3QA 1AHSA 5KHGA 2QKDA 4AZZA 1JZ4A 4AGRA 3GZAA 3ACLA 2JG9C 4KBBA 4IQPA 1LGBA 3OB8A 4LR4A 3C7FA 3WQBA 1UMZA 2EXJA 3NAPA 3RZLA 1CONA 3K46A 4UYBA 3WP5A 4QB2A 2A6ZA 2DVFA 2P3YA 2HEVF 4H7LA 2XG3A 3NAPC 4GMP1 4OI4A 1VAVA 1JBCA 4Q4X3 5FPVA 5F9TA 4AWDA 1GV9A 2XL7A 3JU9A 3ZDVA 3KHCA 2ZGNA 5HCHA 4AI1A 3AZWA 2QFEA 3ZKYA 2PA7A 3GJAA 3WNNA 3HQUA 1K42A 1W04A 1G8WA 2ZGPA 3NNGA 4S2HA 1TE1B 1GP4A 1PZ8A 2OXBA 1EYBA 4LBQD 5FCCA 2UYAA 2Y8KA 5JWPA 1YCIA 2IZWA 5LK7B 3M2MA 3I3MA 2YDEA 5FYUA 1PGL1 1O6UA 2EXKA 2Y6FA 3KWVA 4QHOA 3SISA 1UZZA 5C9AA 4BXSV 1RVF2 5KC5A 2HWB3 5FREA 5JOXA 4IE0A 1PVC2 4NJ4A 2ILMA 5C9AC 2O8QA 3JQXA 2Q0AA 5A7WB 1QH7A 4IETA 2WO3A 1WBFA 1V6OA 2ZEXA 4ONUA 3ZOIA 1C5IA 3NV4A 4RGGA 1JYNA 1DZTA 3PUSA 2PHXA 3FN9A 1BXHA 3SEPA 5KXBA 2JG9B 1PHMA 1X36A 1GZTA 1V6JA 2D6NA 1WLWA 3FUOA 1I6XA 3RZJA 2FDIA 2XBO1 5A7QA 3M3CA 3CZUA 1J1LA 3WNOA 3I4IA 2PFWA 3O1UA 1ENQA 3QBQA 4XTMA 1C8M1 3NAPB 5FPBA 2OIIA 1W0PA 2MEV2 4LXLA 5A6QA 4IEXA 3RZMA 1RUC1 4QX1A 4KU8A 5DAWA 5A3PA 2VJXA 1XOYA 5EJ1B 1XE8A 3DKWA 3HT2A 4YW4A 1QNYA 2ES3A 3FBMA 3K2OA 4CPBD 1A8DA 4ZU5A 2Y6GA 1TQ5A 2C4XA 1QQP1 5FP4A 2WZR3 5A32A 2MNGA 1HXS2 2ZGSA 2HWE3 4XDQA 4LHKA 1SCSA 5BNPB 2C9AA 3PMSA 5F1RA 4XBLA 3ZMOA 3MUY1 1OLQA 2KM2A 5FY7A 5FOJB 1MPXA 4FPOB 3WQ7A 3G7DA 1ZBA2 3A0KA 5H9PA 1AR83 1LEMA 2JXAA 5C9AB 1O5LA 4MXWA 1QJX2 1Y4WA 2OT7A 1MZEA 3AL5A 3B02A 3OY8A 4JQTA 3USUB 1ND3C 3ZYPA 1W28A 1TNRA 3O1VA 2XB6C 3JXSA 1PIV1 1YO8A 2R073 5C71A 4IE5A 3N9QA 5A6YA 3O14A 3RMYA 3K48A 2OVUA 3KD4A 5JXJA 3ZM8A 5CFDA 3RYRA 3JBG3 4ASLA 4YGCA 3TRSB 3AVRA 5CFDC 3T4HB 1JI6A 4AFDA 5IVYA 3ZPYA 3PMEA 4CUAA 1JZ7A 1BQPA 2YBKA 3DKQA 1EPWA 4DXTA 1LU2A 2OW4A 3EYPA 3E6BA 4HL0A 2WNVA 5JZGB 4RHV3 4CCJA 1MEC2 1RUD1 3MF6A 4CVUA 3DV8A 1P8JA 2WNVC 2ZXQA 4XZUG 4KQ7A 3WP4A 3RZKA 1AR63 2XVKA 2WA4A 3H8RA 3FLPA 3LEKA 5LASA 5FY0A 3FMGA 2BRTA 4P5YA 3LSDA 3WY6A 2JDPA 4K6BA 5A32B 1PVXA 4KU7A 2FZ1A 4D7TA 2V09A 2RVAA 4Q27A 2E53A 4FSJA 2BVBA 3UESA 1OKQA 4DPNA 2Y26A 4LBKA 5T54A 5BNNA 4PIXA 4XFFA 2VOTA 2FDJA 1PGSA 2WINB 4WVVA 1GQHA 1TMF1 3TOJA 3WCSA 5BNNC 2BZDA 1ZREA 1W9WA 1GOGA 4MXWB 1PO23 1DQ6A 2ARCA 2W0XA 1W03A 2VQUA 3MW4A 3QH6A 3IWZA 3UGFA 1BJQA 4AHZA 2XVGA 1XXNA 2HWF2 2YG0A 4NPMA 4BIOA 1QOTA 1BBT1 2OZ6A 2Y0IA 3MFCA 2IFWA 4Q0PA 2IXHA 2QBXA 3PDQA 4W4ZA 4MGQA 4IEPA 3CMGA 4UXAA 4XF1A 3BIEA 3B94A 3B3QE 3WP6A 1UU6A 5LBFA 1R093 1GSLA 1YQCA 1CJDA 4M3CE 3HNYM 1XRUA 4E4DX 4GXLA 2VW0A 1PZ9A 5I8SA 5L9VA 2WNVB 3EMRA 4Q0QA 3WDVA 1W6NA 3WG3A 4GWMA 1EV11 5IK4A 1FPN1 1C3HA 2DVAA 2BUKA 3J4UH 4FAGA 4F3JA 4HVRA 2RMU3 5FRAA 5A80A 3MZHA 3C8XA 4XXAA 1CR7A 1C4RA 3INAA 5LY1A 5LBBA 5FP7A 4K8FA 4NWVA 2HLEA 2R043 1SDWA 3DECA 1YWKA 3J7HA 5FZKA 4IGOA 5BY5A 4HN1A 4EN6B 2W2IA 5BNNB 4OVEA 2NQYA 2Y6KA 3SMHA 3L2HA 2CU5A 1H0BA 4Q0VA 1GMMA 2CAUA 2ZA9A 1RUE2 5LBCA 4Z1VA 1D4VB 3H50A 3SXWA 1PGW2 4RFT0 2B46X 4BPZA 1UAIA 3HIFA 1O91A 2JICA 1LENA 4LT5A 2DUPA 4DINB 2DCYA 5JXHA 2XJVA 4JGZA 4DEQA 1WA4A 1W6OA 3E6CC 2A3YA 5TSWA 2NYYA 4CDUA 4JGZC 1N47A 1B35A 1WW5A 3ACGA 4QKDA 1N3PA 4RA0A 3ZXLA 2ET7A 1DGRA 1HN1A 4MSVA 1XBFA 2J1AA 3R05A 4AXOA 4CDUC 4YVWA 1B35C 2QUOA 4FPHA 3L2YA 3KM5A 4XZPA 1GOFA 2D43A 5FUPA 1W6NB 4YVWC 2E6VA
chains in the Genus database with same CATH topology
2JE7A 2EAKA 3S6PA 4EN9B 4Q4Y1 1QGLA 5DUXA 5DUUA 1CPNA 1AUYA 2NM1A 1Q8OA 1RUH3 5GZEA 1C1FA 1HLCA 1REFA 5ACA2 3THTA 1FV2A 1M4WA 5CG9A 4BWOA 4FCAA 4JDNA 3QLQA 4M0HA 4Z2WA 4FTBA 4EWAA 1FOD3 1U5YA 2XJQA 1AF9A 4YNIA 2ZMNA 3C3VA 2H6CA 1O4TA 3AXDA 3O7OA 5HCFA 3ZMNA 5E88A 2IXKA 2XHKA 2ZZQA 4JGZB 1VAMA 2RR12 4FQZA 1W6OB 5KWRA 3V0AB 1QJZA 1B35B 2B8MA 3ZYRA 3AYAA 1HQWA 1QMJA 4XJWA 4Z82A 4KG8A 1RUI2 2BWAA 4S2GA 4W6WA 5FO8B 3ENRA 4GH4C 1F2NA 1R082 1GYKA 1LGCA 1XU2A 4GQ7A 1W0OA 3WW1A 3AYEA 4Q1RA 2HWC1 3W59A 1WCKA 4RQPA 2BW8A 2WJSA 2VG9A 1VR3A 2XL9A 2ZMKA 3JD71 4AFAA 4FPCA 2PHRA 4RQPC 1ZBE2 3GZTB 3ZIXA 3FC0A 1AL22 5LEJA 1GNHA 1RHI3 1LHUA 2A7AA 2XJUA 1SBDA 1C5HA 2SLIA 2WZR1 2R6QA 4HK9A 3VBOA 1F31A 4FQ4A 1RUJ2 2JENA 4KNCA 1T6GC 4YW5A 3VBOC 1HRI1 3RI8A 3NO8A 1DYKA 1KDKA 1VBA3 1LB2A 4B29A 4DRVA 4QGLA 4MYEA 3BPZA 4D69A 3MW2A 1OFNA 2MHFA 1FNYA 1APNA 4JDOA 1LOGA 1BCXA 2CWSA 1YLLA 4JVAA 1AX1A 3HN1A 4Q4X2 1IS3A 2FBEA 1S0CA 3D0SA 4I0BA 2WC2A 3RNSA 3OD4A 3WD5A 3O0WA 1AYM1 4HLTA 1O5UA 4M3CF 1PO11 4OHZA 4B4PA 3VLBB 1RITA 4I3GA 2UYBA 3CL1A 4FOWA 3I2DA 3IIAA 4ISQA 3WCRA 3ZIWA 1DQ5A 3NWKA 4M01A 1D4M1 2YUEA 4FOQA 1D0GA 1AX2A 2IXJA 4YARA 3VBOB 3WZ1A 5EYXA 4AHYA 4DB5A 1WD3A 1RUF1 4GMP3 1O3SA 1HX6A 4EJRA 3QCWA 4AVTA 1BEV2 4ASMB 4PQ9A 5FTTC 3R4UA 1HRV2 1W6QA 3RQ0A 4XBQA 1WW4A 3E5QA 4CRQA 2JG8A 1HV0A 3KCXA 3PVEA 3ZSKA 2RJLA 2JEMA 1TNFA 2O8OA 2IXCA 3WG2A 2EA7A 2JG8C 1C1LA 4YM0A 1NE4A 3TN91 1C8NA 1AR93 2GSYA 2WT1A 4IL7A 3VBHA 2VOWA 5DDJ1 3CF6E 1IZ3A 4KH9A 5GLTA 4P9JA 2R16A 4XF0A 5K9YA 4HSLA 3VBHC 2DYCA 3RI9A 3U11A 2HWD1 2GMPA 1QKQA 1YRZA 3SCFA 3LKJA 4FTEA 5JR7B 4B7EA 1V6IA 1YIPA 1DG6A 1MS0A 2HWE2 1SLLA 1VBB2 3RJRA 3AMPA 3DF0A 1AZDA 2E63A 1GZWA 4BYYA 2A73B 3MYXA 4HN0A 2X53S 3J26N 3J8F1 4YM2A 1QJU1 2DU0A 1GZCA 2PAMA 4XXPA 4E9KA 4MUVA 3WXPA 2XBO3 5LK5A 2W39A 4IEVA 4YVSA 2BFUL 1C8M3 2R041 4N9IA 2VUJA 1POV0 3N7MA 3DL3A 2NP0A 2XLGA 4YVSC 1GKBA 4HFSA 4H3WA 3MIBA 3JBG2 2VQAA 3ZYJB 1YFXA 1R1A1 3H1MA 1S2KA 4UBGA 2VNRA 2YHJA 3OJBA 2BTVC 2ZGLA 2W08A 3VL8A 1PMIA 4YZ2A 1QQP3 2JG8B 2KA3A 5F6KA 2A3WA 4MVTA 3ZXKA 4AW7A 2Q1ZB 2P34A 4NHMA 4RHV2 2DURA 3EXUA 5EWSA 1YHFA 1IHMA 2EVXA 3AM2A 3VBHB 3V0BB 5JOWA 1AR62 1BMV2 4NWWA 5B2GB 2WS91 4NPRA 4OI2A 1IS4A 5LRRA 3OPZA 2VMGA 4I0WB 1UX6A 4CYDA 1CPMA 3D8CA 2WSUA 3E97A 1PIV3 2PAEA 1GZWB 3OTFA 2ERFA 1D2QA 1DGWX 4YFWA 4E4ZA 4XHXA 3IMNA 3N36A 4U36A 3WQ0A 3O0VA 4GB31 1PO22 3VHNA 4N90A 1TME2 4FVVA 1G9AA 4G4FA 2RS51 4GWNA 1COV1 4YVSB 2WT2A 4QHBA 4D7SA 1RGSA 4C91A 2JKBA 4BHPA 1SLBA 1RUD3 4COVA 2D40A 1U5IA 2RM21 4A7ZA 3IPVB 4CDXA 1R092 2VQ0A 3N7LA 1TEIA 4ZU4A 3H0OA 4CDXC 3B00A 4Y1ZA 1J3QA 2BWCA 3MW3A 4GKYA 1QJY2 5FMOS 1OI6A 5IT6A 3ZN5A 4XJUA 3I59A 4UW6A 4OUMA 5A3LA 1JW6A 1MZFA 1Q8SA 5JAXA 3AZVA 1NG0A 1TMF3 2LUWA 1ZRCA 3H8UA 4AI2A 4LUKA 4BQ1A 3CU7A 2PHFA 3UJOA 3B69A 5D8AC 3GHNA 2WZPP 3OBRA 2HEYF 1CD3G 2PHUA 4Q4V2 3ES4A 4WBBA 3WHTA 4IEWA 1C57A 2ETEA 1Z7S1 3VN4A 3VKMA 5KHJA 4I2OA 2DFCA 2YC0A 1XYOA 4LBJA 5BV6A 1OOPA 1ZYBA 1CAUB 3HBZA 1CIWA 1OOPC 3AFGA 2ZHNA 5KHHA 3ZFFA 1EV13 1LHNA 1FPN3 2Z5WA 3ZFFC 3TNPB 2LTNA 3M3OA 5L7OA 4XIKA 3KS7A 1ZRRA 2WLPA 2DTYA 5T5PA 2PHWA 1IKPA 1MS5A 1QOOA 2DU1A 5CAZA 1VBC2 3CJIA 4AI0A 1F5JA 5L7OC 4IEQA 4QGNA 2ZX1A 1YI7A 1HDKA 3CJIC 3VZLA 5EJ3A 1YJLA 1F8VA 3AP5A 3B5LB 3U10A 3AJZA 4AI8A 2CGPA 3AMQA 1ULGA 4LHLA 3LOIA 1UD1A 1O3TA 4YGEA 3SITA 4JTOA 4W65A 3N3HA 5JIAA 4KGQA 4ATFA 1ND2A 2O1QA 1V6KA 1FOD2 2WFF2 3I8TA 2XWJB 1HQNA 1ND2C 1FYUA 1QXRA 4XIOA 4AEMA 3JZVA 3P3PA 1OOPB 3AFKA 1Q43A 2R0HA 2MEV1 4NR1A 5FAXA 1AVBA 4ZKTB 2OZJA 3B7MA 5CB7A 1RUG1 4CP2A 2QVSB 4HVOA 3ZFFB 1KXGA 2Z79A 1CESA 3ILNA 1GQGA 4Q4Y3 5L7OB 4WVMA 4WVZA 1HW5A 4HPKA 1KFXL 1SBEA 2BYVE 4FOYA 1ENRA 4L9BA 3CJIB 4LO8A 3PLQA 5FLHA 2P3JA 2ZGOA 3NV1A 2VMIA 4JC1A 3RRDA 1O3RA 2E7TA 5FDBA 3SH4A 1JYCA 4FPEA 2TBVA 2ZTNA 5BNPA 5ABJA 1POV1 2UY8A 4HKLA 1AR91 3SH5A 2BQPA 5BNPC 3WW2A 5ABJC 1RHI2 4GALA 4DXZA 2JJ6A 2VH9A 1ND2B 4YW2A 2D93A 1JOJA 4Q0SA 3USUA 5KHIA 1R1ZA 4FOVA 1MACA 1VRH1 4HZFA 1H2KA 1LOAA 4PIZA 1LOEA 2ZX2A 2WT0A 3MIDA 4ORFA 2QJVA 4CEYB 4Q4W1 4JQRA 1RUNA 1MEC1 1AR71 3TNQA 3NL1A 2HWC3 2H0VA 3QOPA 4WVMB 4EN8B 1V6MA 3JD73 5CBLA 5JZGA 4HPKB 1ZZ6A 3WW3A 2VNOA 4GIQA 2AYHA 1NA1B 3TYJA 1NXMA 5JZGC 4OI0A 4ES9A 1NY72 5EFUA 1N1SA 2FQPA 3SLIA 3HD8B 1PNFA 2VULA 5ABJB 1JUHA 2ZAAA 2A70A 1CAWA 3JUUA 1HRI3 4XF9A 2Y38A 3LA7A 4WZFA 4Y22A 2IWGB 3RMXA 1J3PA 1H1MA 4AVBA 2PQQA 3L9JT 2ZGRA 3S30A 1KJLA 4Y5Z0 1XNKA 2YY1A 1I5ZA 4JGYB 3WDWA 2UWAA 5C6CA 2HYKA 4N9HA 2D5HA 3EHKA 1WUVA 1OHFA 1MVEA 4KL1A 1SLCA 3O12A 4YGDA 1MR5A 1AYM3 3B9CA 4Q8KA 2OUJA 4LULA 1BVP1 1MS1A 4QT6A 1PO13 1DYPA 5BYNA 2GAUA 2ARBA 2PAKA 5T50A 4AGGA 2ZCWA 1H2LA 4Q26A 2XH6A 5DZEA 3ELNA 3MDPA 1PGL2 3IDEA 2EXIA 4XETA 2ATFA 2GDFA 2GMMA 3EO6A 2CWMA 4HKWA 4WM8A 2BEOA 5KXDA 2QQPA 1RINA 1D4M3 4AHWA 5H9RA 3S0MA 4WM8C 3WINE 2D44A 4KWJA 3VBSA 1HV1A 1VBE2 2P3IA 1X82A 2VU9A 1UZYA 1CAWB 1RUF3 3VBSC 4AI3A 4Z92B 2GNBA 3PJQA 4AQTA 3ZN6A 5BNOB 3GBFA 3IM0A 4WVWA 2XBO2 1BVVA 3H3ZA 3M7AA 5C4WB 4J1XA 4Y22B 2A6YA 3M1HA 5FQ0B 1V6LA 1C8M2 1YFYA 3TWIA 1JYIA 3GHMA 3WDYA 1RUC2 1YYNA 2QCSB 3TN93 5I0RA 4UW3A 5DDJ3 5HCAA 1ZNPA 1WCSA 2DV9A 2ZOEB 3UL2A 4J1WA 4EWDA 1ZVFA 1Q3EA 2HWD3 2WSVA 4S2DA 1QQP2 4KWLA 4Q1PA 4XOGA 3AZZA 2DVGA 2BBVA 4MGKE 4WM7A 4YG3A 5K7PA 4IEZA 1OA3A 1VBD2 5CNAA 4WM7C 3SNMA 1A3KA 3J8F3 1QJU3 3PVOA 3GZUC 2I45A 2RE9A 2ZX0A 4WM8B 1EAH1 2K0GA 1YIFA 1LECA 4R9CA 3WW4A 1S55A 4EV0A 1S1AA 3ZSJA 4PIYA 3VBSB 4DY5A 1FNZA 5CIRA 1WBLA 4X6QB 1R1A3 3ZN6B 1JH5A 1SQ4A 4W6YA 2Q4SA 2CTVA 4YM1A 1U5ZA 2ZGQA 4BLIA 2DVDA 4ZU7A 2YZ4A 1XU1A 3VBUA 1I1EA 3KZ4C 4Z8BA 1RUD2 5GKAC 1H8TA 4HANA 4O9EA 3VBUC 2BPA2 4NO4A 1R081 4X8NA 1UIJA 1H8TC 2FMDA 3V0AA 2WS93 3WT3A 3ZN4A 2ZGUA 1J1TA 2TNFA 1GICA 2B9UA 3O5SA 2ZBJA 1ALYA 4XFAA 4M0NA 4A2UA 1N3QA 1RC6A 4WM7B 2G9FA 1IOAA 1ZBE1 2Q5TA 3HT1A 3IT8A 3KSCA 5GLZA 4HT1T 3FZ3A 1TMF2 4N43A 5L19A 3NKGA 4GB33 2YGLA 1N1TA 1XNBA 2DFBA 2CL2A 4N43C 2UURA 2RS53 1COV3 3ZFGB 1AYN1 1IS6A 1BBT2 4YZ3A 2VOKA 2QE3A 3AP7A 1AXYA 2BNNA 5JI7A 2E9QA 2PLV2 3CJXA 5DXDA 4XMAA 4AFCA 2AGSA 2RM23 3FBYA 2AR6A 5KXCA 2E51A 4I0AA 4MH0E 1A78A 3T1MA 5FO9B 1V70A 3FX3A 1SLAA 2D6KA 4F8AA 4QQHA 4BOWA 3VBUB 4PLMA 4XFIA 4LBQB 1EV12 1H8TB 2FZ2A 1G9CA 3AK0A 3BODA 1LHVA 2UWBA 2RS12 3LA3A 1JUIA 2EXHA 4U2AA 1LU1A 3ZDSA 3ILRA 4XMIA 2C1FA 1WMEA 3OF1A 1GBGA 4AK3A 2DCJA 4YRDA 3UKNA 3ZSEA 2Z42A 3ZXJA 3VGIA 1W6MA 4N43B 1U12A 1Z7S3 5DZGA 5SV5A 4QPIA 2DVBA 4A3XA 5AC91 2V5YA 5E1RA 2ZKLA 2QNKA 1SFNA 1ZZBA 3NVCA 4QPIC 5AVPA 4R52A 1UKRA 1H9WA 2Q8OA 3OCPA 4I30A 1ASJ2 1LOCA 4Y1YA 4Y1VA 1BEV1 4FAHA 2G9GA 4XEZA 1Q5OA 4XYXA 2QZ3A 1YJKA 4JCKA 3THPA 2ENRA 2XJSA 3MLJA 1KFUL 2GN3A 1OSGA 2PHLA 3QD6A 4QQLA 4QM9A 2GU9A 2BGCA 4Q0UA 4KG0A 1OLRA 3RSJA 4UBHA 5FLJA 1AXKA 5GZCA 2A6VA 4AF9A 1XNDA 4AEJA 4XE9A 2ZS6B 5IK8A 3T2TA 1VP6A 3WUDA 1ENSA 1OD5A 1PNGA 1REEA 3ES1A 3E5UA 1NCRA 1DGRN 5JOYA 2A75A 1W6MB 3D5OA 4CDQB 1GZ9A 4LNVA 1NCRC 1VAKA 2QDNA 1X8EA 3M8LA 4QPIB 4NN0A 4QQOA 5KC6A 2GALA 2AUYA 2I74A 1LCLA 1RTVA 2MEV3 1SEFA 4E27A 1DFQA 1NXD1 1QF3A 1RUG3 2Z69A 5IK5A 1GNZA 2HWB2 5J3UA 4LLOA 4Y1UA 4FP2A 1O4ZA 4R8HA 4XW3A 4YW1A 3AKSA 1BKZA 2MPFA 5C8WA 4I3PA 4R9BA 2EALA 2F6BA 4C0BA 5JPNB 3AKRA 3GYDA 3ZFEB 1ULCA 2R0FA 4FTSA 1IGOA 3LOBA 2HWC2 1ZBA3 1J59A 1BMV1 1RMU1 4INDA 3JD72 4BM8A 1POV3 4HMZA 5CA6A 1AXZA 1N1YA 4IEUA 4L99A 3FHIB 3V0BA 2OUHA 4K9SA 2RHPA 1DZRA 1ZZ8A 3R0RA 4H14A 4I01A 5F6LB 2X29A 2XWBB 1NCRB 2A6WA 3AMMA 2WZR2 3MF9A 4B3NA 2JECA 1VRH3 1RIRA 1TME1 2DCZA 4MXVA 4DFSA 3H1YA 3FFQA 3FE5A 4P9IA 3M3IA 3WG1A 4I09A 3KCYA 2X5IB 4Q4W3 1AR82 2K2SA 3B01A 3MIFA 3ILFA 1QDCA 1MEC3 3KT1A 1AR73 4QX5A 2PTMA 3UV9A 4P9GA 4RGAA 1QXJA 3MLLA 3AP6A 2R072 5T55A 4HK8A 1U0AA 1CVNA 2D6LX 1ZRDA 1DBNA 1UN1A 2AZ5A 5DG2A 2TUNA 4XFCA 4GMP0 1WLDA 4AEDB 3IPVA 1QJY1 2R061 1AYM2 4XQWA 4C90A 2NLRA 1PO12 2WIIB 3EBRA 5I8YA 2BNOA 3LA2A 1QH6A 3POSA 3ZXGA 1MQTA 1EP0A 3MFAA 1XYPA 1DQ1A 1XYNA 5EV7A 1QY4A 3J9SA 2HEWF 1MQTC 2D7FA 3NJZA 4JV4A 1D4M2 2YMZA 4LBMA 3PJYA 4IV3A 1KDMA 3U07A 4GULA 4OZXA 1Q56A 4IV3C 1CQ9A 2A71A 1SMVA 5HI0A 1FMD1 1RUF2 2RJKA 5JIUA 1UL9A 4C1WA 1VB4A 3VBFB 3RWNA 1NOVA 1DHKB 1PM7A 3ZO0B 1DGWA 2PHTA 3N7JA 4TSVA 4XBNA 2RS31 3FWEA 2G4IA 4K21A 2XKOA 4FPJA 4YYOA 4S2FA 1SBFA 1OMIA 3AP4A 3DPRB 1CAUA 2DUQA 4IEOA 4DQAA 3TN92 3OBTA 2XJRA 1V9U1 4R9DA 1YXWA 1VBC1 4YLZA 3HWJA 5FMOL 4PF5A 3O0XA 2HWD2 4N7IA 3BB6A 4K20A 2EF6A 4TWTA 3VZOA 3APBA 4M00A 5J96B 5H9SA 3PVBB 4UW4A 2OYZA 1QWRA 4Q29A 2JE9A 3DUIA 1GFF2 1MQTB 4XJ9A 1GR3A 3AXEA 5A33A 1RJ7A 1QJU2 2RMU2 1ZX5A 4XF3A 4MLOA 1FAYA 4HETA 4IV3B 3VKFC 5HBAA 3AYCA 3IDBB 4OHWA 2R042 1IS5A 3KCCA 1EY2A 2B45X 1DIWA 1R1A2 1Q8PA 3EQEA 3OGGA 1J58A 4N7UA 4AVVA 1RJ8A 1FATA 3NKTA 1CAVA 4YFZA 1UCXA 1W39A 3AKPA 1LRHA 3K51A 4A7YA 3H7JA 3WVJA 2W68A 3FJSA 5I8TA 5KBFA 2D98A 4K40A 4QD2A 3AZXA 4MGZE 4Y20B 3RS6A 3VZNA 1F5FA 5T5LA 1Y9QA 1EAH3 2R32A 4FPYA 4PBPA 1G7YA 3MPPG 4RS5B 5AVAA 4N53B 2ET1A 2GNMA 4RL7A 1ULDA 1J3RA 3MPBA 2K9ZA 4COUA 4TZDA 5A33B 3UKVA 2D6OX 4GB32 4E4SA 1RVF1 1VJ2A 1PVC1 1RUH2 2C0ZA 4PLOA 1URXA 3ETQA 4L97A 4E2QA 1REDA 3ZXAC 4E2SA 3POYA 1NLSA 4XQ4A 2RM22 3WV6A 3MIEA 1R083 4QPYA 3NSTA 3VZMA 5DUWA 1OA2A 1UKGA 4G3YC 4HBNA 4WZCA 1VIWB 1KS5A 5C8CB 1CAVB 3RYKA 2D6MA 4CEYA 4B8EA 3MIGA 3X29B 1QOSA 2R30A 4QXKA 4CEYC 1ZBE3 1LGNA 3KT4A 1LR5A 1XQNA 4CDWA 3VL9A 4AQ6A 2QZ2A 5H9QA 5KHKA 3LWCA 4CDWC 4OUSA 4LO6B 3S7IA 1NZCA 1G9DA 1I9RA 4BA6A 3PVNA 4P14A 1NA1A 1OFSA 4Y24A 1HXS1 1AYN3 1OQ1A 1O7FA 1NA1C 4LBNA 5J48A 2ZJCA 1ZBA1 4AEKA 1Z7S2 4COZA 1FI2A 1PK6A 2D3SA 5GLVA 3VBRA 3V56A 2TEPA 1QJX1 5CU1A 1MS9A 4A7KA 1PK6C 3FUQA 4MV2A 3VBRC 4FPGA 1QU0A 3N7KA 3AKTA 1ZM1A 3DN7A 4V1PA 3M4FA 2XJTA 1NYWA 1Y43B 1IPKA 4K1ZA 1DQ2A 2Q1MA 2YV8A 2WNUA 4FBFA 1SLIA 2AREA 2D97A 2WNUC 1Y7BA 5CVRA 2GNDA 5T3NA 3UKTA 3VKNA 3SHRA 1VBA2 2VW1A 1RUOA 4JGYA 4ES8A 2ZHMA 3WUCA 3IN9A 3JCIA 4IESA 5T52A 2YYOA 4JGYC 5DG1A 1WLCA 4CDWB 2D6PA 4JDMA 2ZABA 2GH8A 1NCQA 2ZZJA 2VECA 3D0JA 4YSFA 5AC93 3WX5A 1S2BA 1WMDA 1NCQC 3V65A 4RSUA 1VBE1 4OHVA 1CGPA 1U5XA 2NN8A 2PYTA 2R1DA 1NE6A 1LHOA 1BEV3 1JTZX 1SCRA 1HRV3 3WNXA 1PK6B 3VBRB 3JB4C 3ZSMA 2D3PA 2R1BA 3GNEA 3VHRA 4QPGA 1JHNA 2HWF1 5JSPA 4PLNA 1W2UA 1RUG2 5BNOA 4QPGC 4IERA 4XQDA 5JOZA 1ULEA 1G86A 5C4WA 3RG0A 5FQ0A 2WNUB 4M3CA 2ZGTA 5BNOC 1LULA 4PBOA 4QQPA 4QQ2A 4W6XA 2ZHLA 3D4KA 4EROA 4Q2FA 3MIHA 5C4WC 3T1LA 1L3JA 5JLVA 4FO9A 3IKWA 1DF0A 1D2SA 4PCRA 1ENXA 5JDBA 2UY9A 2A3XA 4C1XA 1YI9A