4GB33

Human coxsackievirus b3 strain rd coat protein
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
238
structure length
238
Chain Sequence
GLPTMNTPGSCQFLTSDDFQSPSAMPQYDVTPEMRIPGEVKNLMEIAEVDSVVPVQNVGEKVNSMEAYQIPVRSNEGSGTQVFGFPLQPGYSSVFSRTLLGEILNYYTHWSGSIKLTFMFCGSAMATGKFLLAYSPPGAGAPTKRVDAMLGTHVVWDVGLQSSCVLCIPWISQTHYRYVASDEYTAGGFITCWYQTNIVVPADAQSSCYIMCFVSACNDFSVRLLKDTPFITQQNFFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords coat protein 1
publication title The Crystal Structure of a Coxsackievirus B3-RD Variant and a Refined 9-Angstrom Cryo-Electron Microscopy Reconstruction of the Virus Complexed with Decay-Accelerating Factor (DAF) Provide a New Footprint of DAF on the Virus Surface.
pubmed doi rcsb
total genus 42
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4gb3300
1C8NA 2HWB2 2HWD3 4GH4C 4N53A 1NA1A 1PO12 1OPOA 1VB2A 4GH4B 3ZFEC 5L7OA 1VBB2 3CJIC 1FOD3 5CFDA 4CDWC 5K0UC 2RR13 3FBMA 4CDXB 2FZ1A 1RUI2 3VBFC 5CFCA 1RHI2 3VBFB 1K5MC 1ND2C 1K5MB 1M06G 4QPGC 1COV3 1ASJ2 5C9AA 4QPGB 5J96B 1FMD1 1POV1 1ND3C 2HWE2 2R041 1QJX1 3M8LA 3TN92 1ZBA2 5A32A 4CDUC 2HWC3 1QJY2 1PVC2 1EV11 4RR3B 2RS31 1SMVA 1RUH1 1VBC1 2HWF2 1F2NA 1QJZA 4CEWA 1H8TC 1BMV1 1VBA2 3JBG3 4IV3A 1X36A 4RS5C 1AR73 3VBSA 2R073 4LLFA 4RHV3 4Q4Y1 3JB8A 1PIV2 2MEV3 4Q4W1 5J98B 3VBHA 2HWB1 5C4WA 1R093 1QQP3 3IDEA 3J8F2 1PO11 4Q4X3 4PDWC 1VBB1 1AYN3 2RMU3 4PDWB 3VBRC 5AC93 4YVWB 1A6CA 1NG0A 3VBRB 3ZFGC 1RUI1 2RS11 1RHI1 3NAPA 5BNNC 1F8VA 3ZXAC 4BCUA 1TME1 1ASJ1 1OOPC 1V9U3 1OOPB 4IV1A 1NCRA 1RUC3 1MQTC 1VBE1 2HWE1 1MQTB 1C8M3 1CD3G 3TN91 1RUG1 1B35C 1NCQA 1QJX2 1Z7S3 1BBT2 4QPIB 5ACA2 1MEC3 1B35B 1RUJ3 1R083 4CEYC 1AR83 1QJY1 5DDJ2 2WFF3 1EAH3 4N43C 2HWF1 1VBC2 1RUH2 4AEDA 5BNPC 1FPN3 1VRH3 1PO23 1QJU2 1RVF2 1HRI3 5ABJA 3VBUB 4JGYB 1D4M3 1VBA1 3DPRC 2X5IA 4WM8C 3ZFFC 1RUE3 3ZFFB 4Q4W2 1RUD3 1DDLA 3JD73 1HXS3 2ZAHA 3JBG2 3J8F1 4Z92B 1R1A3 2R072 1AL23 4Q4V3 2DF7A 2HWD1 2BFUS 3ZFEB 3CJIB 4GH4A 1QQP2 2RM23 4CDWB 5K0UB 1HRV3 2RS12 2WS93 4GB32 2IZWA 4CDXA 4N53C 1NA1C 2RMU2 3VBFA 4CDQC 1ND2B 1TME2 5FMOL 2BUKA 2WZR3 1K5MA 4CDQB 4EJRA 1OHFA 5D8AC 1VBE2 2QQPA 5CFCC 2R063 4QPGA 5D8AB 1ND3B 1BBT1 5ACA1 1V9U2 1RUG2 1WCDJ 3LOBA 1RUF2 1PGL1 1RUC2 3JB4C 1AL0G 1POV3 4YVSC 1VBD2 5DDJ1 4YVSB 4CDUB 4NWVA 5JZGC 1AR62 3VDDC 4RR3A 1QJU1 4RQPC 1RVF1 4RQPB 1BEV2 1EV13 2RS33 1GFF2 1H8TB 4JGZC 1AYM3 2PLV2 1NOVA 4JGZB 1PO22 4RS5B 1RMU2 1HX6A 3JBG1 2XBO3 2R071 4CEWC 4RHV1 2BFUL 2ZZQA 2MEV1 4IV3C 4Q4Y3 3VBSC 1RUE2 1R091 4FTBA 1QQP1 2HWD2 3JD72 1HXS2 3VBHC 5C4WC 4PDWA 4GB31 3ZFGB 1ZBE3 1AR93 2ZTNA 4YVWA 3VBRA 2WLPA 2RMU1 1FOD2 5AC91 5BNNB 3VBOC 2RR12 1PGW2 3S6PA 3VBOB 1HRV2 4WM7C 5BNOC 3NAPC 1OOPA 4WM7B 5BNOB 4GMP3 1V9U1 1COV2 1TMF3 1MQTA 1ASJ3 1RUF1 1RUC1 1PGL2 4QPIA 2Y26A 1B35A 1NCRC 2HWE3 1RB8G 1VBD1 4CEYB 1VAKA 3TN93 1X33A 1AR61 1RUJ1 1R081 1ZBA3 4N43B 4FSJA 5BNPB 4FTSA 1CJDA 5C8CC 2HWC2 1BEV1 1PVC3 1VB4A 5C8CB 2XPJA 3DPRB 1VRH1 2PLV1 3VBUA 4JGYA 5A33B 1PO21 4WM8B 1RMU1 1D4M1 1NY71 5ABJC 3ZFFA 2RS53 1AR72 4RHV2 2X5IC 1RUE1 2BPA2 1PIV3 2MEV2 1R092 3JD71 1HXS1 1R1A1 3ZFEA 3J8F3 3CJIA 1AL21 4Q4X2 4CDWA 5K0UA 4Q4V1 1AYN2 1FOD1 4RFT0 2RR11 4Y5Z0 1PGW1 5AC92 4N53B 1NA1B 2RM21 2GH8A 5L7OC 1HRV1 5CFDC 2WS91 5L7OB 2VQ0A 1ZBE2 1AR92 5CFDB 1ND2A 1W39A 4CDQA 4CDXC 5CFCB 1COV1 2WZR1 5D8AA 1ND3A 5C9AC 1FMD3 2R061 5C9AB 1C8M2 2R043 1QJX3 1Z7S2 1TMF2 1BBT3 5ACA3 1MEC2 3HAGA 4Y4YA 1RUJ2 1R082 1AUYA 4YVSA 4CDUA 5JZGB 3VDDB 1AR82 2HWC1 5A32B 5JZGA 5LK7B 3VDDA 5DDJ3 2WFF2 1EAH2 1VBC3 1RUH3 4RQPA 4SBVA 1FPN2 1VRH2 4GMP0 1H8TA 1QJU3 1HRI2 1RVF3 4RR3C 5FOJB 1D4M2 4JGZA 4RS5A 1NY72 1AYM1 1AR71 1HQNA 4CEWB 4Q4W3 4IV3B 3VBSB 1RUD2 2HWB3 2XBO1 2FZ2A 2RS52 1R1A2 4Q4X1 3VBHB 5C4WB 1PO13 1AL22 1AYN1 1VBB3 4Q4V2 3ZFGA 2RM22 1ZBE1 5BNNA 1AR91 1RUI3 2RS13 2WS92 4GB33 1RHI3 3VBOA 2BBVA 4YVWC 4NWWA 1E57A 3NAPB 2WWSA 1TME3 2WZR2 4WM7A 5BNOA 1VBE3 4IV1C 1C8M1 2R062 4GMP1 4IV1B 1NCRB 1Z7S1 1TMF1 1RUG3 1MEC1 1RUF3 1NCQC 4CEYA 1FMD2 1NCQB 2TBVA 1AR81 5FMOS 4N43A 4QPIC 1VBD3 2R042 1QJY3 2GSYA 2WFF1 1EAH1 5BNPA 1ZBA1 1AR63 1FPN1 2HWF3 5C8CA 4AEDC 1HRI1 3DPRA 4AEDB 1PVC1 5A33A 1BEV3 1EV12 1VBA3 2RS32 4WM8A 1POV0 1AYM2 5ABJB 4FTEA 2PLV3 3VBUC 4JGYC 2X5IB 1IHMA 1RUD1 1RMU3 5GKAC 1BMV2 2XBO2 2RS51 1PIV1 4Q4Y2
chains in the Genus database with same CATH superfamily
2E53A 2AC1A 4JDMA 3WZ1A 2VG9A 1PX3A 3M3QA 4GH4C 3IBMA 4N53A 1NA1A 4QD2A 1PO12 4JQRA 1QOOA 4Y26A 2XJRA 4YWAA 1UMZA 4YYOA 3URFA 5L7OA 1VBB2 1WWYA 2UURA 4R9CA 1YQ8A 2XXZA 5DZEA 3VDCA 5K0UC 4TN7A 3NRUA 3LGRA 5C3SA 4UW6A 3IAPA 1S0DA 1Q56A 1RHI2 3VBFB 2E7QA 2XVGA 1S0GA 2XLGA 4QM9A 3GGLA 2BERA 1AF9A 1JHNA 1GP4A 4GD4A 5DMYA 2ZMNA 3T09A 4FQ4A 3O1RA 1POV1 2JD9A 1W6OA 1WW5A 1ND3C 4YLZA 3KMHA 4XZUG 4BB3A 1QJX1 1RJ8A 3M8LA 1JHJA 3RZGA 4BZ4A 3AYAA 5JSOA 4UAPA 3SEPA 2VTXJ 3VGIA 3WDVA 5KC6A 3VZMA 2QQMA 1SBDA 1W8NA 4HOOA 1OH3A 2JG8B 4FOVA 2ZEYA 1ZA7A 4XW3A 1OMIA 1SLCA 1W28A 1EV11 3DXTA 3NV4A 4DINB 1VBC1 3USUB 2E6VA 4ONUA 4OUEA 5CKMA 3M2MA 1US2A 1W9WA 1SACA 1SLBA 5FY9A 2VZ3A 1WBFA 4QQHA 1D0HA 1G8WA 2WQ4A 1JMUB 4FOWA 5BPXA 1H8TC 2Y38A 4QPWA 4C1XA 3JBG3 2J1RA 4XQDA 3NNMA 4B3NA 2EAKA 4LLFA 1KEXA 1W04A 2XGXA 2XUEA 3POFA 3QCWA 5FXXA 4Q4Y1 3HT1A 3WF2A 3JB8A 4BQ4A 1WA4A 4AFMA 3AP7A 3IIIA 4Q4W1 3U11A 4E4ZA 5LY1A 1V6JA 2RVAA 3PUSA 3OYWB 4UOJA 2JDUA 5HPOA 1QQP3 4KWLA 2ADDA 2E7AA 1LRHA 3OBRA 1QH6A 3MGUA 3IDEA 1OKOA 1A78A 1JW6A 3AB0A 2ZHMA 1ZZ7A 4UW4A 5FUIA 2K9ZA 2ZGRA 2XONA 3BVCA 3P3PA 3UYJA 3NVCA 2X29A 4YVWB 1NG0A 1O8SA 3ZFGC 4Q0SA 2HYKA 3NNFA 3RWNA 5A3LA 3HD8B 5CIRA 5FIXA 3HQXA 5CU1A 5J37A 3G6JB 4QQLA 4FT8A 1Q5OA 3U10A 4ASMB 5BNNC 4K8FA 2ERFA 1L7RA 3OBAA 4IE5A 3MHZA 3BKZA 2DDUA 1DBNA 1GZWB 1OOPC 4DO0A 2PHFA 3R05A 1ULGA 3UJOA 4IV1A 5LA1A 3CEWA 3SLIA 2A5ZA 4QX1A 1MQTC 1YQ6A 2Y0OA 3BN6A 1GZTA 3ZYBA 5GLZA 3N7MA 3BIEA 3E6DA 2G4IA 4IE0A 2J1AA 5EYYA 3U1XA 1NCQA 1QJX2 4W6YA 3HBZA 4KGQA 4FPOB 1MEC3 4TSVA 2JIGA 1SPPB 5I8SA 4AWDA 2WNVB 5FQ0A 1PMJX 4LKDA 1DQ2A 3R4SA 1V6IA 3KV4A 4PHZA 3ZXKA 2YFZA 4LBMA 3POIA 4QPYA 3BGAA 1TE1B 2WFF3 2K2SA 2WNOA 3AZYA 2HWF1 1VBC2 4NIAA 2EALA 1LODA 5BNPC 1VRH3 3G7DA 1CAUB 3AZXA 5FYIA 3K4DA 2IXHA 3FUQA 3NV3A 2VMDA 3PUHA 5JIAA 1DCSA 3ASIA 5CAZA 5FFOC 1CZSA 1D4M3 3DPRC 2Y6HA 3S57A 2OUJA 2BJSA 1XPWA 1OLMA 4E2QA 2IFRA 4MSVA 3ABZA 1ZZ8A 1N1SA 4NHMA 3O0XA 4YW7A 4MO3M 3VD3A 3I2DA 4Q4W2 4QQPA 5C70A 4FAGA 3BU0A 4R4ZA 1RUD3 3AZWA 3ZSMA 3LZZA 3LCPA 4ASKA 3J8F1 1XQNA 5A3TA 2QFEA 1SFPA 1L3JA 2YV8A 3SNMA 2ZEWA 2QTWB 4LJHA 1JOJA 1YJLA 4WZCA 3IDAA 3RSJA 2R0FA 4AFBA 2WA3A 4U36A 4DUVA 2WWJA 3GM8A 5IK7A 3AP4A 4GH4A 4N8MA 3RS6A 5BY5A 5EIYB 2CDPA 3BODA 4XIOA 5K0UB 1EUTA 2WN2A 2YDEA 4KBBA 4MGIE 4DRVA 3CDZB 1OBNA 3K4ZA 3I2OA 1UY3A 3NQHA 4LHNA 3ON7A 1DQ1A 4QDQA 1KD7A 2OZ6A 1UX6A 2D98A 1ZVFA 2DVDA 4FPLA 5FZMA 1XNTA 2EXJA 4MV2A 1YWKA 4BDVB 1RYYA 1U5XA 2BUKA 5E8AA 4CDQB 5E89A 5K4LA 5L9VA 1W9FA 1OHFA 5D8AC 2AYHA 1J3QA 3ORJA 2Q30A 3VD5A 4Q0UA 5CFCC 3PUAA 5A1FA 1NXMA 2JWPA 1ND3B 5FYTA 1V9U2 3OUIA 1JN2P 2WRAA 2ZMKA 1RUF2 2C9KA 1S0BA 2VZRA 1FXZA 3JB4C 4PIYA 1AL0G 1S1AA 2LRPA 4DFSA 4KI5M 2DTWA 1UZWA 4COUA 5C3RA 3ZLIA 4IE4A 1VMFA 1CIYA 4RA0A 2FMYA 1ZRIA 3CL1A 4Z1VA 2JX9A 1XYPA 2YC4A 3ES4A 4I02A 3ACHA 1CAXA 4MGZE 4XXPA 3FWEA 2B7YA 3GHNA 4YM2A 4B4QA 4LOSA 3ZYRA 3DECA 1HN0A 1NXD1 1MZFA 2J1EA 2ET1A 4R9AA 1BEV2 1OT5A 3CF6E 2KD7A 1GFF2 1K3IA 1PK6A 1H8TB 2RS33 4YZ5A 1AYM3 1SLAA 2I07B 2D43A 1PO22 2Q0AA 2OKXA 2W94A 4BQ1A 3FMGA 2D97A 4WVMB 2VY0A 3I54A 1RGSA 2P2KA 1H1MA 2XBO3 4AHWA 4IUGA 4QDRA 5A6ZA 4FXKB 4AVVA 4XXAA 4XJ9A 4YM0A 4ZXEA 5HCHA 1E5IA 1W9SA 4KU8A 4YW5A 3N3HA 1N1YA 3ZO0B 4YZ1A 4QM8A 3V0BB 4IEZA 2GDFA 3JD72 1HXS2 1GMMA 1VR3A 5T5JA 3RNSA 2X05A 4ES9A 2ARBA 3B69A 3ZFGB 1ZBE3 4W4ZA 4ZU7A 2FDGA 2XWJB 2RMU1 1W9TA 2VCMA 1AVBA 3BI3A 1ZREA 1FOD2 4V1PA 2EF6A 3OGVA 4XYXA 4DY5A 2RR12 1V6KA 5IAVA 1PGW2 5BNNB 1OQDA 1YFUA 1CESA 3S6PA 1LULA 3VBOB 4J1XA 4CP0A 3RZZA 5FYYA 3GJAA 2ILMA 4MVTA 1IG3A 4ZPIA 5BNOC 2E32A 1S0EA 2JDYA 4JKKA 3I2KA 1ZRDA 4LULA 3NAPC 1OOPA 5LA9A 4JKMA 3A0NA 1F9KA 4GMP3 2QQJA 1LGCA 1MQTA 3MYXA 4XF0A 3ZM8A 4QX5A 1RUC1 3MIFA 1B09A 4XFFA 1I5ZA 3SQOA 3VZJA 5KXEA 4QPIA 2B9UA 1O5UA 3OY8B 5FWEA 5A3PA 2WO1A 3ZXDA 2RDNA 4E4SA 2XL7A 5JVVA 3UGGA 2UYBA 2C6SA 5C33A 2VUAA 1LHNA 4IEOA 1IPKA 1RUJ1 4URAA 3MO4A 1PVXA 4UF0A 3UNPA 2UU8A 4FSJA 5LATA 5BNPB 1UL9A 1V0AA 1W03A 1CJDA 4XFCA 4D7TA 5FXVA 2CU5A 4R9DA 2VE1A 2G19A 4XJUA 1VB4A 1W6QA 4K3UA 1XRUA 3ROUA 1O5LA 4E4DX 2LALA 5LBCA 3ZKYA 4AF9A 4COZA 3DPRB 2PLV1 5IWFA 5A33B 1UIKA 4AEJA 1OXCA 4MHUA 2QQVA 4N7IA 5JXHA 2GC3A 4QKDA 3VHOA 4L97A 3Q8EA 3WNPA 4F3JA 4TYSA 3D0JA 1YNAA 3FLTA 3UGHA 5ABJC 4DXZA 2Z42A 4D6SA 2GALA 2C9AA 4LQRA 1AR72 3M3IA 1OLQA 4XOGA 2YGMA 4ASLA 2BPA2 3CBNA 4QKNA 4E8CA 4NAOA 1N47A 2VOKA 3QH7A 4H14A 3A0KA 5FCCA 4FBFA 1CAVA 1G9DA 1NX9A 2R16A 3H1YA 1DQ4A 2QNKA 2VVFA 2JDPA 3CU7A 3ZFEA 3O1VA 4Q4X2 2R49A 4Q5OA 2ZX3A 3CKHA 2ZX4A 1F5JA 3NO8A 1AYN2 4Q4V1 4RFT0 3ZR5A 5F37A 3RDIA 4Y5Z0 5DG1A 5AC92 2JEMA 2RG4A 4FO9A 2RM21 1FV3A 2W68A 2ZHNA 3WNOA 3ECQA 5FO8B 5FLJA 2Y6KA 5CFDB 1NUKA 2D6MA 4FOQA 1ND2A 1UZVA 3AFGA 4Q1PA 5APAA 4WZFA 3PVEA 5C5UA 4F8AA 3AKSA 3VDBA 2P3KA 1W6MA 4FPKA 4MADA 4WVWA 4EWDA 5CFCB 3POYA 5H9QA 2P6HA 4CPBD 2AENA 4XJAA 4ARYA 1U5IA 5KWRA 5D8AA 3NNJA 5HXVA 2OPWA 2RDRA 3M4FA 5C9AC 1QDCA 4B8EA 4K21A 4L99A 2WO2A 4DXTA 1NZIA 2IXJA 2XKOA 3POJA 4TZDA 1QJX3 1CAWA 1X8EA 2W1WA 1C28A 5E1RA 2W2IA 3NJZA 1RUJ2 4IGQA 4RN5A 1AUYA 1EPZA 2ZCWA 1D2QA 2CTVA 4XAEA 4L8QA 5F3CA 2Q5TA 2D93A 2IXLA 2PN5A 1OC1A 1ULFA 2ZPXA 1UYXA 4N90A 1VBC3 3P6BA 4AQ2A 1ZRFA 4EN8B 1JOPA 3O1TA 3PHMA 4GMP0 3ZN4A 1YC61 3JUUA 3SITA 5FZLA 3GYDA 1HRI2 4RR3C 2JENA 4A3ZA 3RZMA 1LOFA 4LO8A 5DG2A 5FPXA 3OPZA 4QX2A 4RS5A 5H9PA 1VAMA 4A3XA 3AYEA 2DFBA 1S55A 3ZXLA 5E6HA 5LK5A 2HBUA 4OHZA 5FXZA 1WCUA 3R4UA 1JUIA 1WUVA 4W50A 5EZWA 3BCWA 4NRMA 3NKTA 3N35A 4Q4W3 5JMCA 1Q8PA 1STMA 5ERLA 1C1FA 1XE0A 1ZRCA 2FZ2A 1JZ7A 3WQ7A 4ZONA 1IZ3A 2YB7A 3N4MA 2VU9A 2Q1ZB 4GJYA 4I0BA 4QU1A 1VMJA 3A21A 1JYNA 4Q4V2 1LOGA 4AR2A 2CGNA 1O91A 2GP5A 1DF0A 1N1TA 2RM22 4YPJA 5FZBA 1VMHA 1AR91 4HVOA 4P9WA 1GV9A 2BOIA 2WIIB 1OI6A 4CVUA 4HL0A 5FY1A 4D7SA 5JXGA 2VNGA 4NWWA 3N9PA 3NAPB 2WWSA 1MVQA 5BNOA 3IPVB 4IETA 4XQWA 4YM3A 3KB5A 1BZWA 1GOGA 2ZGNA 3I4IA 2JKBA 2GC0A 2ATFA 2XHNA 2Y6JA 4LA3A 3DEMA 1WA6X 3T2PA 5FZAA 1MEC1 2F6BA 3GBFA 3J7MA 1RUF3 4AAXA 3I2HA 4CEYA 1XYNA 2VBBA 4YM1A 1H1AA 2CYFA 2B39A 3LA7A 1ULEA 2PHXA 4NHKA 4ORFA 5FMDA 1GQGA 5A7WA 3FHIB 4BXSV 5CG9A 4N43A 1HJFA 3GALA 4XHBA 2UWBA 4GWMA 2GSYA 2WFF1 4MLOA 4XUNA 5DQ0A 1CZTA 3DUIA 2HWF3 5FLHA 4CP9A 3OBZA 3S7IA 1LOCA 3BALA 1Z0HA 4M4PA 1KJLA 2WQ8A 2OVUA 5F1RA 1BEV3 3K3OA 3AKRA 4Z82A 3FFZA 1POV0 3AVRA 5ABJB 3OD4A 3VHRA 3RZKA 4WV8A 3UESA 4EN0A 1RJ7A 3IDCB 1RUD1 2QQOA 4BJ0A 1UMIA 3O1OA 1OSGA 1VPHA 2X09A 5JPNB 1BMV2 1O4ZA 4D94A 1KS5A 3APBA 1N3OA 5CKNA 2IXKA 1W0PA 4YW6A 4P9XA 1H2MA 2CWMA 4LBQB 4AGRA 5LBEA 2HWB2 4FFFA 3POBA 1D7PM 3FN9A 2VZPA 4HK9A 1SFNA 1ENQA 4EV0A 4UBHA 1GUIA 1FATA 1OPOA 2BVVA 1CN1A 3RJ2X 2GC2A 3CJIC 1FOD3 4JAAA 4CDWC 1HW5A 2RR13 5F9TA 1MZEA 1KJRA 1UOFA 2EIBA 4W8JA 1NZCA 1CWPA 3VBFC 4XDQA 4NIGA 2FDJA 1WW7A 2I74A 1BVP1 2GMEA 1KRIA 3AJZA 3LEIA 3LA2A 3CNAA 4Q0VA 1I6XA 4QWNA 2RV9A 5DUVA 2LUWA 2KXLA 3KF5A 5LEKA 4C0HA 1OUXA 3VN4A 2WQZC 5EV7A 3SKVA 4AVAA 1ASJ2 3C8XA 5C9AA 1LECA 4QPGB 5IVEA 1OLRA 1FMD1 4MHRA 5FP8A 4YZ4A 1O8PA 5C3OA 3OGRA 2HWE2 2P17A 1HKDA 2PTMA 3B9IA 5FZOA 1UCXA 2XL9A 4YG3A 4F7ZA 2W1SA 3BIWE 1RXFA 2DVGA 3B01A 5FZGA 1D4VB 5A32A 2JG8C 4XEZA 3AYCA 1Q8QA 4RFRB 4RL7A 5HCFA 4F83A 1WD3A 4P5YA 3ES1A 4Y22B 3ZSEA 1CONA 4TLGA 4CDUC 5FUNA 4DZGA 4JDOA 1QJY2 3RQ0A 5BUVA 4KL1A 2RS31 4RR3B 3MIEA 1URXA 3WSOA 1GANA 1SCRA 1SMVA 2EA7A 2QE3A 4FP2A 4XILA 2W0XA 4XUQA 3OPWA 1ALYA 2RDSA 5H9SA 1KDMA 1F2NA 1DQ0A 1OPMA 3T2OA 3WG2A 4GXLA 4I0AA 4MZUA 4FPHA 1XYOA 1QJZA 1MS8A 4CEWA 3RI9A 4JHTA 5J3UA 2WAAA 5EQUA 4OMDA 1AR73 3C3VA 5SV5A 1QOTA 1X82A 4PLNA 5FP3A 2W87A 5J98B 2A6VA 2V5DA 3VBHA 2G1MA 4KWJA 2BDRA 1ZA4A 1MS5A 2Y8KA 1XNBA 4XBLA 1OVPA 1PO11 3C7GA 5DAWA 3H42B 4I30A 4Q4X3 1OF4A 2XB6C 5JWPA 1VBB1 1AYN3 1OVSA 2RMU3 1UMHA 2ZS6B 4M01A 3RMXA 5AC93 1A6CA 4L0PA 4H55A 3V0AB 3IN9A 2RS11 1V6OA 3PU8A 4AOCA 5BV6A 2L9LA 4NHLA 3MZHA 4XZPA 5A7NA 1RHI1 5FZ8A 1IOAA 2PQQA 2LTNA 3EQEA 4BMBA 4YNIA 3PMSA 3RYRA 2BWAA 2HH9A 1TME1 5F8PA 3ZN6A 5KXDA 4LE3A 1Y9QA 3LE0A 5EJ3A 2VQAA 2ZEZA 4CU9A 3O0WA 2E51A 1NCRA 2TEPA 1I5PA 1RUC3 1SFYA 1XBFA 2VNVA 3PNAA 4O7XA 2VXRA 2XVKA 4PLOA 2NM1A 4HPKA 1O4YA 1CD3G 3UGFA 1RUG1 1X9TA 3KLSA 4LHKA 3WG4A 4YARA 3T2TA 1B35B 4O9EA 3MDPA 2WNVC 4HLTA 1RUJ3 4URTA 4ET7A 2A3WA 1O3QA 2GAUA 2JKXA 4DY3A 2XLFA 2ZXQA 3IT8A 3KV6A 2PHUA 3MIDA 3RMYA 1DHKB 4AGVA 2UYAA 4OVEA 5FWJA 1UU5A 3OEBA 1YFWA 2BQPA 4AQ6A 4XQ4A 1RVF2 1HRI3 1BK1A 4BQXA 4MXWB 3T2QA 3AJYA 1QHDA 4CE8A 1UYYA 3O1SA 1DGRA 5IHRA 5FAXA 2VBPA 1GICA 4LT5A 3M70A 4CUAA 4JVAA 4O9GA 2D6KA 4LUKA 4WM8C 1G7YA 2QQLA 3EXUA 2JE9A 1NT0A 5FZ3A 2GP3A 2JE8A 3LQCA 1XU2A 1WMEA 4BM8A 1V6MA 3VLBB 1W6NA 2VOXA 3R4DB 4KBZA 2ZAHA 2JIJA 4S2FA 2OPKA 3T0DA 4X8PA 4XAAA 4Z92B 1MPXA 1AX0A 2R072 2X8KA 2OA2A 3LDBA 4UYBA 4XMAA 2P5BA 3DGTA 4Q4V3 2D7FA 2Y6LA 4G9SB 3LB9A 1VRBA 3CJIB 2QQIA 3HQUA 2RM23 5FO7B 4CDWB 3OD0A 4IGPA 4MOAA 2RS12 2BVBA 4GB32 4NUBA 4YW1A 4QHZA 3WW3A 2D5FA 3T3YA 4D7YA 5IFPA 1MS1A 1UOBA 5IVCA 3FE5A 2VOTA 2VQUA 1ZZ6A 1W3VA 2ORZA 3KGZA 3VBFA 4CDQC 1TME2 4JKLA 1FYUA 3B93A 3DF0A 3WQBA 4UXAA 5AVAA 3H8UA 1QJEA 1SLLA 4OYUA 5CNAA 1CJPA 3LAGA 2DCYA 4AW7A 5JAXA 1X7NA 3ZXEA 2QQPA 2XJVA 2YHJA 5IVBA 5F3EA 2JXAA 3C7EA 4B4RA 1RUG2 1AHSA 1VE0A 3BPZA 4X6RB 3WR0A 4JTNA 3LOBA 2LROA 1HB2A 4Q8KA 2Q4SA 1ULOA 4ZU5A 3OG2A 4KWKA 1VBD2 5CISA 4RYDA 3I2IA 3PLQA 3T0BA 4CDUB 2JG8A 1C5HA 1RC6A 2WR9A 4M3CB 3WF1A 2WL1A 4JC1A 1AR62 1QNWA 4L2NA 3MF9A 5FXWA 4A44A 2DCJA 4HKLA 1NQJA 4LKFA 4NE9A 3B00A 3NSTA 3USUA 1PZ9A 2A3XA 3UKVA 2GMPA 3QLQA 3MV01 1XJAA 4RQPB 4QX8A 1UW8A 2AUYA 5M0TA 3ZSJA 1WCKA 1MS9A 1KDKA 2WJSA 5LBBA 3HNBM 3HIFA 4JGZB 3H8XA 2BV4A 3V65A 1JZ3A 1OA2A 1O59A 1AXZA 2VOWA 5T5OA 1HX6A 1QEXA 2YBKA 3KVAA 5FYUA 4CXWA 1J1TA 2BGOA 3OYWA 4NIDA 2ZZQA 3E5UA 3O1MA 1TG7A 3KHBA 2EICA 4XF9A 2PHRA 3MIHA 4IV3C 2QQWA 3HR9A 1RUE2 3VBSC 4UBGA 5EXOA 1R091 5FY7A 3T4VA 1H4GA 3N7JA 3SXWA 5F2SA 1BXHA 2V72A 5C4WC 4HETA 2YY1A 3GZAA 3UT0A 3ZMOA 1AR93 2ZTNA 1QOSA 2BBAA 4YVWA 3IZOA 4D0QA 5LA2A 3SMHA 4QXKA 1XU1A 4EN6B 4ISQA 3VBOC 1QWRA 4BA6A 1LCLA 3ZMNA 4CUCA 5IATA 1TZOA 1ODNA 1MZ6A 1HRV2 1UU6A 4KG8A 3BOWA 4LIVA 2FD8A 3J7NA 3AZVA 5IK4A 1GZWA 1OLME 3H8OA 1ONAA 5FZ7A 4WM7B 4A7ZA 4A7KA 1JZ5A 1V9U1 4OULA 1RTVA 5L36A 4B1LA 1ASJ3 4E9KA 1RUF1 3I7DA 2DCTA 3MLLA 4ARXA 2A6YA 3RYKA 1IS6A 1F4HA 2XVLA 2Y26A 3NV2A 2D44A 2HWE3 2BRTA 4IQPA 5A3WA 3P1IA 1SPPA 2CHHA 4M3CF 1RXGA 4CRQA 3WNMA 2WNVA 3OUJA 3I3MA 3MUZ1 3UKNA 2ES3A 1X33A 2VULA 1AJKA 2Y34A 3LPGA 5T5PA 3AMHA 3GDBA 4QAWA 5GLUA 4DXRA 1UY2A 5L73A 4HKOA 1OURA 2VAUA 4QKFA 4FTSA 3UJQA 2HWC2 1BEV1 1CAUA 1C4RA 3H3ZA 4N9IA 3E1F1 3RWKX 4Z8BA 5C8CB 5IYYA 2ARXA 4IEVA 1ENSA 1UX7A 4LORA 2VMEA 2NP0A 3E6CC 4XFAA 1PO21 3UK9A 2QBXA 4HMZA 4HSJA 4NAMA 1PZ7A 1R1ZA 4I2OA 4WM8B 1UKRA 3BTAA 3WP4A 4MGKE 5FRAA 1O4TA 4O61A 4Y4RA 4BQ2A 1KFUL 3AXEA 4QXHA 2WDBA 3U0ZA 1DLLA 2Y6FA 4INDA 5FPBA 5FBJA 1XNKA 3RVHA 3SC7X 1ENRA 3ILNA 2X5IC 2PHDA 2VZSA 5T3NA 3AP5A 4C8DA 3J7HA 3OSDA 4EZHA 2BWCA 2XQXA 1R092 4YW2A 3JD71 1HXS1 3P5BA 4PIXA 2RJKA 3LFIA 4QX7A 3FHQA 4DEVA 4LEJA 3KV5A 4Z2AA 4CCEA 2ZOEB 5J7MA 3H50A 3NW4A 3PDQA 1UIJA 3AM2A 3R0RA 4GJZA 3TEWA 2AACA 3U75A 1LR5A 4H7MA 5K0UA 4AXOA 2P4EA 3N9MA 1UOGA 1FOD1 2K46A 1H6XA 3O12A 4IE6A 4YFWA 2RR11 5J48A 2FDIA 1PGW1 2W08A 2FCTA 4LO6B 5CFDC 1JZ8A 1PNGA 2HEVF 3FZ3A 1SLTA 2VQ0A 1ZX5A 1GYKA 5FYVA 4AI3A 3WCRA 4CDQA 1LTEA 4CDXC 4E4HA 1IKQA 4ZZ5A 3AKTA 3NNGA 2WFPA 4IEPA 2WZR1 1DQ6A 3DYMA 1UOJA 4V2VA 1OD5A 1G9CA 1ND3A 3MW4A 5EJZB 2Q1MA 1FMD3 2R061 1GBGA 2ZGLA 1OH4A 4AG4A 2VMFA 5CBLA 1C8M2 1MS0A 3THPA 3U37A 1L7QA 2XR4A 5FJHA 3WQ0A 3ZYHA 4AFCA 1O3RA 5J36A 1REDA 1TMF2 5DAQA 2JD4A 2SLIA 4Y4YA 3VV1A 3K2OA 1QDOA 4IDZA 4UWDA 1PMHX 2WNUC 1YI9A 3QACA 4EN7B 1RUNA 3D0SA 4GKXA 1H9PA 1FNZA 3MV11 5C8WA 1EAH2 5I0SA 1XNDA 3Q8FA 1OFNA 4IL7A 1UZYA 2Y64A 4LMFA 4M4RA 1VAVA 4XBQA 4M00A 4BWOA 2JDZA 1H8TA 3K3NA 1RVF3 3HJRA 3NNLA 4OLLA 4Y1ZA 3MIBA 4ES8A 2BYVE 5FOJB 2XOMA 4CCJA 3KSCA 2CWSA 3OBTA 3KCYA 1AR71 4WVMA 4JCKA 1YLLA 3NJXA 1NE6A 4U2AA 1N3QA 3W20A 2DUQA 1HQNA 2FDFA 1D0GA 2Q8OA 4JZRA 5FZ6A 2DVFA 2D5HA 2VZUA 4BK5A 2B46X 5F2WA 5JI7A 4IV3B 3ZYFA 3VBSB 3IWZA 2WZPP 5IVFA 5FZFA 2BTVC 1RIRA 3CZUA 4LNVA 3V0BA 1LOEA 2D3SA 2RS52 4MX3A 1H2NA 4Q4X1 4PIZA 2FMDA 2DWRA 3ZSLA 1PO13 5DAXA 4A6SA 5C4WB 4XCBA 2R1BA 1AYN1 2C0ZA 3T0AA 3WNNA 1VBB3 3ZFGA 2ZGOA 3RZJA 2H6BA 1JYXA 3HT2A 3C2UA 2W3JA 3SKJE 5FY8A 1JYWA 5DAPA 3WW1A 5BNNA 2RS13 1G86A 3DCQA 4GB33 2EIGA 2PFWA 4B1MA 5IVJA 1RHI3 2HJIA 3PTRB 3VBOA 5L19A 3N36A 4J6GA 1K12A 3OOXA 1RL3A 2UWAA 1IG0A 4NIIA 1US3A 4FCAA 3ZXJA 1F8VA 1GOFA 4EQVA 3B94A 1AJOA 4RGAA 3T1LA 4S2DA 1TME3 3TEXA 2WZR2 2XWBB 2VC9A 2E31A 4XVHA 4J25A 3ZVXA 2XG3A 2KM2A 5B4XA 2JDHA 4XTMA 5A7SA 3ZR6A 4YSFA 4CU6A 4A2UA 5F32A 4H2AA 3W5NA 2A7AA 2R062 4K1YA 3ZX7A 2D6LX 2VQTA 2VZ1A 2C5DA 2VUJA 1KITA 1W05A 1RUG3 2OQ7A 1UN1A 3GNEA 3O0VA 3OY8A 3PVNA 4H7LA 3POGA 4QKBA 2G9ZA 5IJRA 4W6WA 3D8CA 2ZEXA 5HCAA 5EJ1B 2DURA 1IS5A 5FMOS 5JIUA 3VKFC 2YFUA 1VBD3 2BGPA 2BP6A 1TEIA 2R042 3EMRA 4XMIA 5BNPA 4XUPA 3H3LA 4YGBA 1ZBA1 1AR63 4LO5B 4PBOA 4Q26A 5C6CA 5DAVA 2O14A 3KM5A 4HN1A 1N3PA 3WHTA 4BXFA 3WUDA 1H1IA 1HRI1 2A70A 1WGPA 3DPRA 3VKNA 3M1HA 3MLKA 3EHKA 5FY4A 3ZIXA 1V6LA 4AEDB 1PVC1 5A33A 2XLAA 4FAHA 1IKPA 1WD4A 1LB2A 3WDTA 2IFWA 5TSWA 2NMNA 3H1MA 1OQEA 3WW2A 4AE2A 2EXHA 2BNOA 5FZ1A 2GNMA 5ISLA 1QNYA 1PM7A 1UNBA 4PBPA 4JGYC 2X5IB 3VBUC 5JPMB 1J3RA 3LEKA 4AI1A 4HG6B 4CCOA 2PA7A 1O3SA 1MZ5A 2ZGQA 2VECA 3FLPA 3OB8A 3U4SA 3VUOA 1XE8A 1UZZA 3AMMA 2XH6A 5JOYA 5T50A 1UYZA 1I3HA 2ETEA 4QU2A 4MXVA 3VD7A 4YGDA 5F3IA 5G04L 4XC9A 2A73B 4A41A 4K20A 5FZKA 1C8NA 1RITA 2RJLA 4EE2A 3I3QA 2DVAA 3AYDA 5HI0A 1FAYA 3M3EA 1XSRA 1DG6A 1VB2A 5DN2A 3DL3A 3O7OA 1WW6A 3ACIA 5FV3A 4YG6A 2FQPA 2ZGMA 5CKQA 5CFDA 3LF7A 3WP5A 3VD9A 4HVRA 1S0CA 4LO4B 4XCAA 2Q8CA 4CDXB 2FZ1A 1MS3A 1RUI2 4OQ8A 4QGLA 5CFCA 3I49A 4WVZA 5JMOA 3KV9A 2BU9A 4ZY9A 4QMAA 4N9HA 5FJKA 3T4HB 4B29A 1GU3A 1J1LA 1GLHA 3ZXFA 1K5MB 3PJYA 5EFUA 5FO9B 3RJRA 1M06G 2QUOA 4LUMA 4BOWA 4IEYA 2WZEA 1GP5A 3LDKA 4QPGC 4Y1UA 1YEWA 1H0BA 3NKGA 5EPAA 5KC5A 4BQWA 1U0AA 2GN3A 2JG9B 3Q8BA 2VVEA 3EB7A 3C7OA 3GBWA 2WNUB 4IEWA 4YRDA 4GA9A 2B5HA 3AZZA 1PM4A 1WLTA 4YG0A 3TN92 2J1VA 5EYXA 1ZBA2 4R52A 2YUEA 1F15A 1XC6A 2Q1FA 2ZACA 3VKOA 4IEXA 1LJ7A 2TUNA 2YU2A 2CGOA 5KHIA 1JZ2A 2HWC3 1BHGA 1X8MA 1PVC2 3N7KA 4MGQA 1OA4A 1JODA 2NZ9A 1V6NA 2ZGKA 2RJ2A 1G9BA 3OGGA 4GWNA 3WW4A 4B7KA 2VGDA 4HXCA 2RDQA 3J7LA 4TLFA 3KCXA 1GZCA 1A8DA 2AR6A 3VHPA 3O14A 5JXIA 3CZJA 1BMV1 1R64A 3PL0A 5F6KA 2OT7A 1VBA2 3THCA 2O8OA 1NQDA 3GZTB 2BNMA 3D6EA 1X36A 3VZKA 5GZEA 2Z79A 4FPGA 5FBZA 5CEHA 2LM3A 4PF1A 3ZN5A 3AFKA 5BYNA 2HWB1 1R093 2VH9A 2KA3A 2VD7A 3OEAA 4N7UA 3BTYA 3B3QE 1D2SA 5FLIA 5BXXA 1DGLA 3EJKA 3T08A 4NR1A 3EBRA 1IQDC 1M4WA 3LEMA 2QDNA 3PIGA 4IEQA 4P08A 1WMXA 4PDWB 5FP7A 4UT5A 4K1ZA 1W8ZA 2VO5A 4Q0PA 3VBRB 5FMCA 5FZEA 4AK3A 1DYPA 4YW4A 2ZKLA 1HV1A 1YUDA 1G9FA 3NAPA 5CYYA 3WP6A 3ITQA 2OW4A 4CXXA 3IPVA 1S0JA 2PHWA 4GAZA 4BCUA 3ST7A 5F7UA 2FDKA 3SHRA 2V5YA 5ANQA 3VHNA 4KMQA 1ASJ1 1V9U3 2OYZA 1UD1A 3WVJA 3EO6A 4BU2A 1U5ZA 2GH2A 5FYSA 3OGJA 2AEYA 1OD3A 2HWE1 3GCXA 1C8M3 5JR7B 4TWTA 3M3OA 3ZDVA 1B35C 1KFXL 1BBT2 1OA3A 5ACA2 3V64A 2VUDA 1IS3A 2VW2A 2OIIA 1XNCA 2P6CA 4HZFA 2WT1A 1W6PB 4LPLA 4P5HA 4CP1A 4LBNA 1A3KA 3I3DA 3JQXA 1QJY1 3MUY1 3MF6A 3P3NA 3IB3A 4L92A 5DDJ2 5GLTA 3ZIWA 1EAH3 2XQRA 5HCBA 4OCTA 2FCVA 1YIPA 3NJYA 1ZZCA 3GZEA 4W65A 2YG0A 4XFBA 3SEEA 2VMHA 4ATFA 4E2GA 1HJGA 1PO23 3CJXA 1QJU2 4OI4A 3Q8AA 5ABJA 3UETA 2B42B 1YO8A 3VBUB 4JGYB 4UW5A 1DZQA 3WOGA 5IK8A 2H6CA 2W39A 2PAMA 1U12A 3IKWA 1QXPA 2QQUA 2VMGA 4CYDA 1T6GC 4XACA 1UZ0A 1W8WA 1DIWA 2D3RA 4XF3A 3VB9A 1YYNA 3CHXA 4LK7A 3WG1A 3ZFFB 1S0IA 5FZ9A 3JD73 1HXS3 1E5HA 3SH3A 3JBG2 1VJ2A 2FBEA 3A4UA 4LBQA 1LHUA 4XDOA 4OI2A 3U07A 4D69A 1LGNA 3LIHA 3J4UH 3A23A 5DUUA 3AMNA 4X6QB 1YFYA 3N9NA 5DUXA 2ZA9A 4CUGA 4CUBA 2DF7A 5IVVA 5KHGA 2HWD1 4OI1A 2O8QA 4DS0A 1QQP2 4XBNA 1H8VA 1DYKA 3WG3A 1JUHA 5FREA 4N53C 4P9LA 2OS2A 1NA1C 2CY6A 2QDRA 2W1UA 3ETQA 3KT1A 4M0NA 2J42A 2VZQA 3H7YA 4UFMA 5FMOL 2WZR3 3TBDA 1N1VA 1W06A 4EJRA 1UAIA 4DUXA 2A6XA 4M0HA 1JU4A 3DYOA 2XDVA 4UFIA 2R063 4QPGA 4ITCA 4KWUA 5K9YA 2OZJA 4LHLA 2VW0A 3HOBA 1I1EA 1WCDJ 3ME2A 4HBNA 2IVIB 5I0TA 3VDAA 2P1BA 1IQAA 4AHZA 2XMLA 3VZNA 4UFHA 2RE9A 5I0DA 5FOBB 2W5FA 4AEKA 1BJQA 1H6YA 4YVSB 4Y22A 3WDWA 5F5CA 5CZKA 5JZGC 2CV6A 1YI7A 3F95A 2HKXA 1DZRA 1Y9MA 4RR3A 3T1MA 4BE3A 1H4HA 3WD5A 2YYOA 3E5QA 1RVF1 4RQPC 1HB4A 1HB1A 1W0OA 1MVEA 1POQA 1X50A 1SCSA 3WEZA 3BU7A 2OQ6A 2O1QA 1FT9A 4JGZC 3TYJA 5A80A 4CA9A 4CZSA 2R32A 3NJVA 4HVQA 3IM0A 3L9JT 4P9IA 5FYZA 1H2KA 3I59B 1RMU2 3RI8A 2QJVA 5HV4A 3U4XA 1KQRA 5F6LB 5I8TA 1JYTA 4XUOA 2VW1A 1AXYA 2XJTA 3WY6A 2R071 3RYPA 4I0WB 2BFUL 4RHV1 4AFDA 3JXSA 1ST8A 3ZOIA 3ZYJB 4DUWA 4RGGA 5LRSA 5KXCA 2MEV1 2C24A 5D1IA 4BH9A 1JOBA 1TNRA 2HWD2 3E6BA 4LKEA 5F5QA 4MG2A 1CGPA 2WN3A 4GB31 4IXLA 3H0OA 4OZOA 3TEYA 3K4AA 5FK8A 4OHXA 2WLPA 3V0AA 3BYWA 2BZDA 4R8HA 2BNNA 3I2JA 1H9WA 3WT3A 5FZCA 4JDNA 1UXZA 1LGBA 3HNMA 3K46A 1C1LA 1YJKA 2JDKA 2D6NA 1SG3A 2G9GA 1NYWA 3AP9A 3C7FA 4WM7C 1F5FA 2I45A 2V73A 2W47A 3S7EA 4CCDA 5GZDA 4A45A 3KWVA 4Y20B 3VL8A 3THTA 4I01A 1COV2 1LNSA 1PZ8A 3PUIA 1ACCA 3B02A 4GALA 5FYCA 1JBCA 1B35A 1BLZA 5I8YA 1Y9GA 4S2GA 1VBD1 4NHYA 1RB8G 1NAEA 2VXJA 1WCSA 1WLDA 1VAKA 3C7HA 3GBGA 4AAPA 3TN93 1SLIA 3RGBA 4Y1YA 5C71A 1E5RA 1AR61 1DP0A 4XPVA 1R081 1ZBA3 3NL1A 5DXDA 5IFTA 3OGSA 1LEDA 2WA4A 3INAA 4PI0A 1IPJA 4COYA 4AEMA 5C8CC 1DQ5A 3TRSB 1K42A 3ETPA 3AK0A 2GZWA 4IGOA 4LA2A 1RINA 1PVC3 4BPZA 4CCMA 1S2EA 2ZGTA 2D40A 4NMIA 1MS4A 4MXWA 4AVTA 4DNYA 2QZ3A 4XFGA 4CSWA 5F3GA 5JXJA 3ILFA 4BLIA 2I2SA 3WDYA 3BTZA 1G6NA 2IUWA 1WMDA 2DBIA 2WZ8A 4R4XA 4MYEA 4XF4A 3R6SA 2LS6A 5I93A 3PMEA 2DUPA 3B5LB 5HBAA 2WYFA 1J83A 4RHV2 5D21A 2ZJCA 1RUE1 4A4AA 3S5AA 2MEV2 4LXLA 4OI0A 1WLCA 1C3HA 1W90A 1R1A1 5T55A 3HN3A 4H3WA 3CJIA 1UPIA 1AL21 4CDWA 3D4KA 4QB6A 2XJUA 4M3CE 1BK0A 3WQ1A 3PUQA 2YPJA 5C3QA 3V56A 4N53B 1NA1B 2F4LA 1HRV1 4KNCA 4PQ9A 2WAOA 2W46A 1A8MA 2WS91 2YPDA 5IUQA 5L9BA 1ZBE2 5FPAA 3Q8CA 5L7OB 1PX4A 1DZTA 4P9GA 5JSRA 1QY4A 2GNDA 3E97A 1W39A 4G4FA 1SEFA 5FY5A 2DV9A 5CA6A 5IAXA 4TXWA 2HEYF 2WABA 4FFHA 1ULPA 5JUVA 5DABA 3N7LA 2VTFA 4K6BA 4BQ5A 3W58A 2W9XA 1GNYA 1HLCA 3QH6A 5A3MA 3WNLA 5FUPA 1JYIA 4YGCA 4FPYA 2YBSA 3AP6A 2WT2A 1Z7S2 3FC0A 3JZVA 1BBT3 5ACA3 5JOZA 5G05L 3HAGA 1W6OB 1UWWA 1R082 4NPMA 4AI2A 3N9LA 4GIQA 1GWKA 3D3AA 3OPTA 1QXJA 3UV9A 4CDUA 3NMBA 4M3CA 5JZGB 4BISA 5JOWA 1AR82 2HWC1 1FV2A 1ENXA 2ZHKA 5GZFA 2VPVA 3MI8A 1ZZBA 5A70A 5JZGA 4LBLA 1UY1A 5DDJ3 4FPFA 3HQRA 2CAVA 2YC2A 4QGNA 1DGWX 1CVNA 1P8JA 2ZX2A 4RQPA 4YW3A 1FPN2 3UKTA 1GOHA 2JDNA 4ISRA 4XJZA 1QJU3 2WKKA 4QGMA 4NJ4A 4HT1T 2VBDA 2PHLA 2VL4A 2CAUA 4JGZA 4OUSA 5LEJA 1LOAA 4G3YC 2NQYA 5GJ6A 4Y1VA 2WSUA 2A6ZA 2W92A 2JDMA 2F4PA 5GZGA 3KD4A 1PK6C 2DCKA 4LKSA 1CPNA 1W2UA 2AGSA 1LHVA 3KVBA 2HWB3 1E5SA 3A22A 3MW3A 3OCPA 2C26A 4Q8LA 4UFLA 2ZBJA 5FPVA 3WF0A 4HFSA 4Y1XA 3DYPA 1YQ2A 1R1A2 1MACA 4IW3A 4GQ7A 1C5IA 1AL22 4MGSA 4MUVA 3SCGA 1JH5A 1RUOA 1O6UA 2ID4A 2ORXA 5CG8A 3HBKA 2SBAA 2IVJA 1DFQA 1XE7A 4Y33A 2WS92 3K75B 3JCIA 4PF5A 4RGKA 1LHWA 1PMIA 5FKBA 3ATGA 5LBFA 1E57A 2WC2A 4QQ2A 1LOBA 1YQCA 2LW8A 1YRZA 3DXUA 4O65A 5DUWA 1PNFA 3AMPA 2ARCA 4WM7A 2GMMA 2E33A 2W52A 4OHVA 2A71A 1QU0A 5AC91 1ULCA 1W8OA 1C8M1 4A42A 2BW8A 5DZFA 4IV1B 1GSLA 1TMF1 3MICA 3AL5A 5GZCA 3KF3A 2QVSB 1EYBA 2BOJA 2W95A 1GNZA 3ALQA 1UYPA 3ILRA 1NCQB 1W0NA 3WCSA 4I3PA 4YZ2A 1CPMA 3VD4A 1QF3A 1HIXA 4QPIC 2VMIA 2XKPA 4RSUA 2ZAAA 1QJY3 4LOTA 5FPZA 1EAH1 5JOXA 3IMMA 3TNPB 5FQ0B 4FFIA 5C8CA 4AEDC 3LIGA 4QXBA 1F31A 2OX0A 2ZABA 3FHAA 3LEGA 3M7AA 1TVGA 1BCXA 3CLPA 2N7GA 1EV12 2YC0A 2ZHLA 4OQ9A 4WM8A 4Q2FA 4AQSA 3HEIA 4LTAA 3OTFA 4CU7A 4P02B 1YXWA 3LSEA 3POEA 4AHYA 5FYHA 1NLQA 1RMU3 4Y24A 4D8MA 5I91A 3MLJA 2E63A 2JDAA 2V4VA 4XTPA 2VVDA 2RS51 3CO2A 2J1UA 5L9RA 3SCHA 3W21A 4AI8A 1TQ5A 1PIV1 4ZU4A 4Q4Y2 3VL9A 3WNKA 3AMQA 2B4KA 4ZZ8A 2VTXA 3RRDA 4XDPA 5T54A 4HKWA 1W2AX 2HWD3 4COWA 1FX5A 1SBEA 4AL9A 1W9YA 2VCAA 2CSGA 1IGOA 3PVBB 4LO7A 4WVVA 5KHHA 4FOYA 4A7YA 4BMEA 4FVVA 5IK5A 3LDRA 5DZGA 2BEOA 3I3EA 4GH4B 4NIHA 3ZFEC 2JECA 3PJQA 4PJYA 2YMZA 1V70A 4NPRA 1SDDB 3GHMA 5HV0A 3FBMA 2NYYA 5F5IA 4L9BA 1CX4A 1OUSA 2VZOA 5EWSA 3RZLA 4Q27A 4Q0QA 5E16A 1K5MC 3ENRA 2R0HA 1W8UA 3BPSA 3TWIA 1ND2C 4UW3A 4D3WA 4A6OA 2DUOA 4P9YA 2PHTA 2CL2A 2PAEA 1T6BX 1COV3 3KHCA 3L2YA 5A3NA 4AVCA 5J96B 1JYVA 1K45A 2JG9C 5I0UA 3FJSA 3NV1A 5LA0A 3KZ4C 3B9CA 3ZPOA 1UKGA 1VALA 2R041 4OFGA 3AC0A 2ET7A 4LBQD 1ODMA 4JRAA 4XJ8A 5C3PA 1W99A 3H1WA 3LFMA 4XHXA 3MW2A 4NPLA 4K8RB 3WXPA 3BB6A 3WINE 1UQXA 5JI9A 4FP3A 4GZ9A 1J58A 2JJ6A 4XETA 4CU8A 5F5AA 2FDHA 1CAXB 4NN0A 5IT6A 1RUH1 1Z78A 3IAQA 5LWBA 2HWF2 1IPSA 2PELA 4HN0A 5LB6A 4AQTA 1IS4A 1Q43A 1BKZA 4ZKTB 4XF1A 3SH4A 5SV8A 1LKNA 5FK7A 4IE7A 1PK6B 1C57A 2YBPA 3IIAA 3VZLA 4LE4A 3WDXA 4HONA 4C0BA 2Z4FA 3ZYIB 1Y4WA 2A3YA 1LOFC 1OQ1A 2ZGSA 4IV3A 4RS5C 1LU1A 3VBSA 2R073 4RHV3 2H0VA 3MPBA 2WBKA 5FPLA 3FL7A 1PIV2 3FFQA 3FUOA 2MEV3 4LR4A 4PI2A 5FZ4A 3ZKUA 2J1TA 1I9RA 3KGLA 5C4WA 3WLUA 5KHKA 1OKQA 5FKCA 3USSA 2PAKA 1T2XA 1LHOA 2UY9A 3J8F2 1O7FA 4BIOA 1JS9A 1ZRRA 1GZ9A 2MNGA 3PTYA 4PDWC 4XIKA 5FPUA 4QXCA 4XJWA 2JB8A 2MHFA 3VBRC 2EVXA 2QZ2A 1WMFA 2JE7A 3BTXA 2A6WA 2DVBA 2EAAA 1RUI1 2H0BA 2ADEA 4J1WA 2F17A 2WT0A 5C7GA 2EIDA 2HYXA 3RG0A 4FPCA 1L7LA 5CVRA 1XB9A 2A75A 4QX3A 3S30A 3ZXAC 4EYUA 3S0MA 2CNAA 3Q9OA 5FZHA 3AKPA 2GN7A 2ZX1A 3AL6A 3BUCA 1GQHA 2EXKA 4AZZA 1LEMA 3H9AA 3H7JA 5KXBA 1OOPB 4XUTA 3AX4A 3POWA 2WLQA 3POSA 2VNRA 1VBE1 5FP9A 1QH7A 4QHOA 5FP4A 3ACGA 1MQTB 5EHDA 4BK4A 4JQTA 3UL2A 3TN91 5A7OA 1J59A 1Z7S3 5JCTA 4QPIB 3HMYA 1XOYA 4BHPA 4FXGB 1R083 3O5SA 1EY2A 5IW0A 3WF4A 1GR3A 1CIWA 2C1FA 3KQRA 3N9OA 4CEYC 1AR83 1YCIA 2GC1A 4GWIA 4LK6A 4EWAA 2RHPA 4UF0B 1Q8OA 5GLWA 4N43C 3CQOA 4AEDA 1RUH2 2E26A 5A7PA 4Y3OA 1FPN3 3U78A 1YHFA 2HEWF 1QKQA 1H30A 1W6QB 1YIFA 3KQ4B 1Q8VA 5FYBA 5AFEA 3MPPG 2DTYA 2QQKA 4DB5A 3CIHA 1VBA1 1W3XA 1EPWA 2X5IA 4PCRA 2J1SA 2V09A 3ZFFC 1OFSA 2IXIA 1CX1A 1W2NA 4I3GA 1RUE3 1HQLA 1ZNPA 1KXGA 3FX3A 1A34A 2OXBA 3JU9A 4NOTA 1DDLA 4ZXKA 1U5YA 3DN7A 3ACFA 5FY0A 1R1A3 5FDBA 1X9PA 4UFKA 1AL23 1CAVB 2YU1A 5A7QA 1JXNA 4OHWA 2WO3A 2YXSA 4AVSA 1VP6A 2BFUS 3ZFEB 3MBWA 4FPEA 5FYMA 3AXDA 2Y33A 1DGRN 1GWMA 2AZ5A 2Q8EA 3ACLA 1HRV3 2C4XA 2WS93 2PMWB 4V2WA 3I2FA 2NMOA 4K7JA 1HB3A 2IZWA 4CDXA 2VM9A 5A1AA 4DOUA 2RMU2 3TNQA 1K5JA 2FHRA 3WV6A 1MR5A 4MH0E 3S5QA 1ND2B 1V00A 2DFCA 1GQPA 2WINB 3I97A 4XFIA 3LD8A 2XHKA 1K5MA 1W6MB 5LRRA 4UFJA 1FI2A 5FR3A 3FLRA 1WLWA 1VBE2 2YROA 2WO7A 1XXNA 5D8AB 4BYYA 4E2SA 3I2GA 1UY4A 4RD7A 5LZ6A 3LPFA 3W9AA 4CXYA 1BBT1 5ACA1 5AFBA 2JG9A 2WNUA 4DRRA 1PGL1 2E7TA 4OHYA 1RUC2 2J22A 3QOPA 5JLVA 2EIEA 4YGEA 4Y5SA 5LY2A 1CAWB 1POV3 3TAYA 4ZHNA 1DLCA 5K7PA 4YVSC 5IVYA 2VMCA 4KQ7A 3WP3A 4BQYA 5DDJ1 5FMBA 4C90A 4Z2WA 3K77A 4B4PA 1XNAA 4NWVA 5B4NA 4W6XA 2VR4A 2D6OX 3O1UA 3N9QA 3VDDC 1JU3A 4CP2A 3WDUA 3E5XA 1QJU1 2O0OA 4YZ3A 3HNYM 2Y60A 2ZX0A 5AVPA 1O3TA 3PU3A 4AYUA 1EV13 4Q1RA 3LKJA 5J1XA 2PLV2 2QCSB 1QGLA 1NOVA 2CDOA 4RS5B 3IMNA 1W2TA 1CQ9A 2YZ4A 3EYPA 3GZUC 2W1QA 5DPNA 4Z07A 3IDBB 2Y6GA 3JBG1 1S2BA 1YFXA 2NPIA 4OZXA 4CEWC 2GU9A 4CCLA 1EP0A 4Q29A 4LIUA 4NROA 4Q4Y3 4YFZA 1NLRA 1W8FA 4FTBA 4JRLA 1QQP1 2NLRA 3O1PA 1W2OA 3KCCA 3VBHC 5LCWL 4PDWA 2B45X 1AZDA 1OF3A 3VBRA 1WZXA 4LITA 2NN8A 1NLSA 4PQQA 4GWJA 5J09A 1HN1A 3RZHA 4BQ3A 1S0FA 3I8TA 4ZS2A 3ZXGA 3DV8A 4AGGA 4EROA 2AREA 4JV4A 3W59A 1DGWA 2K0GA 1AX1A 2P3JA 2WYSA 2ZGUA 3PVOA 5E88A 4CCCA 5BNOB 1NKGA 1JI6A 2GNBA 4K9SA 2A1XA 5HXMA 4XABA 1F35A 1TMF3 3U14A 2E9QA 2B8MA 1SHWB 3I3BA 5JSPA 5CB7A 2DU1A 1PGL2 2PXJA 3RPQA 1NCRC 5B2GB 3ZDSA 1HDKA 5GALA 4QHBA 3KT4A 2WWUA 2VUCA 4DIQA 4CEYB 1W6PA 3LSDA 4MGTA 4QB2A 1Q3EA 1VIWB 5A7WB 4Y5TA 5FZIA 2QKDA 2DU0A 1UF2C 4N43B 2PYTA 3H3UA 3VKMA 2EXIA 4C1WA 1WCQA 3LOIA 1QIQA 2KR2A 4KG0A 4CP9B 4P00B 2XPJA 1KGYA 2J7MA 3QBQA 4GKYA 1WKYA 1VRH1 2VNOA 2IWGB 4JGYA 3VBUA 3WX5A 4CCKA 4X8NA 1RMU1 1D4M1 3GXUA 1G9AA 3CMGA 5I0RA 4D6RA 1JZ4A 1S2KA 1NY71 3GCWA 2P37A 5D2AA 3ZFFA 1GWLA 2RS53 3D5OA 1BQPA 4KH9A 1HV0A 1QXRA 2X53S 5K8SA 1GKBA 2JICA 1PIV3 5LASA 5F39A 5A6QA 1AX2A 3MIGA 2VCCA 1UO9A 2Z5WA 2OUHA 3ELNA 1W8TA 2VZVA 3J8F3 4IESA 1J84A 2WNEA 4MGYE 1CR7A 2TNFA 1Q8SA 4LHSA 1REFA 2UY8A 1UU4A 4P14A 2Z2SB 4EWEA 2GH8A 5L7OC 5JR2A 1ZM1A 2UWCA 2FCUA 2R1DA 2P3IA 1AR92 4S2HA 4K40A 4DXSA 2VCBA 3BOPA 3A7QA 2R30A 3OJBA 4XFHA 3KT7A 3RFRA 2AEZA 1COV1 4BIFA 4L11A 1CZVA 1EUUA 1LENA 1SZBA 4XE9A 5T5LA 1UY0A 3L2HA 1PGSA 1WBLA 3SH5A 1JTZX 4OUMA 2X10A 5A1LA 2XJSA 3K48A 2YGLA 2V4AA 5C9AB 1WW4A 4IERA 2JB4A 2R043 2XUMA 4R9BA 3KS7A 4IEUA 4C91A 3DKQA 4QDSA 4E27A 3OF1A 3GF6A 1MEC2 1REEA 1ZYBA 3T30A 1PHMA 1H2LA 3MEPA 4UI9L 2IC1A 3J26N 4FPJA 4NRPA 4YVSA 4NO4A 5FZOB 2D3PA 3VDDB 2R6QA 4QT6A 3JQWA 4FFGA 4EZ4A 5KR7A 1NE4A 5A32B 5LK7B 3VDDA 5KBFA 2WFF2 2ZZJA 3FBYA 1Y7BA 3D82A 1GNHA 5KHJA 1RUH3 3H8RA 2ZKNA 4HK8A 4SBVA 1QMJA 1VRH2 4AI9A 4DMIA 4JHZA 2DCZA 3THDA 4KU7A 3TOJA 1D4M2 5C5TA 4OMCA 1UXXX 4AHXA 5CADA 1NY72 1AYM1 1XSQA 4QQOA 3HWJA 3I59A 3OUHA 4GULA 3ZSKA 2ZGPA 4CEWB 4KGGA 4XURA 4ZS3A 4QX0A 3F2ZA 1J3PA 2DYCA 3LWCA 3QD6A 3WF3A 1RUD2 4FQZA 1LU2A 2AH2A 2XBO1 1QJFA 2PQSA 1JYCA 3GJBA 3J9SA 4CTEA 2VJXA 4AI0A 4COVA 2W91A 3VBHB 2HLEA 3VKLA 3AKQA 2P34A 4BLJA 2XJQA 1LAJA 2ZMLA 3WUCA 3NWKA 5ANNA 4META 1SQ4A 1ZBE1 1RUI3 1YQ5A 3W5MA 5FZ0A 1DYOA 4NVPA 2BBVA 3WNXA 2MPFA 4YVWC 1BYHA 3VZOA 4E8DA 1ULDA 2ARAA 4HANA 4LBJA 3WHUA 4FI9A 4JX0A 4PT6A 5A3OA 1GP6A 3B7MA 5FZDA 3K51A 1BVVA 4Y20A 2VZTA 4DEQA 5LW9A 1Y43B 4D6QA 1APNA 2R7EB 3ZN6B 4NHXA 1VBE3 3ZYGA 4IV1C 1Y3TA 3ZPYA 5A6YA 3SCFA 2B9VA 1VLNA 2Y0IA 4GMP1 3TEZA 1NCRB 4NRQA 1Z7S1 5H9RA 4JTOA 5EP9A 3AVSA 3TB0A 4DPNA 1JZ6A 2IXCA 4HSLA 1NCQC 3PIJA 4HPKB 5GLVA 1FMD2 2WSVA 5JDBA 2TBVA 3HPNA 4I09A 1AR81 4B7EA 1UPSA 5BNQA 5GM0A 1ZZ9A 4DQAA 3ZYPA 2GNTA 4LBOA 2P3YA 4QB1A 1FPN1 3PURA 2WUHA 4EN9B 3MFCA 2CGPA 1SBFA 4ATEA 4P9JA 3HVDA 3DKWA 1W8HA 4LLOA 3SISA 4TTGA 1FNYA 1KS4A 1VBA3 2RS32 1SDWA 2Q8DA 1DU3D 4CPBA 1AYM2 2VOVA 1AXKA 2D6PA 5A3UA 2ENRA 2PLV3 4SLIA 4FTEA 2QQNA 1TNFA 4AFAA 4AVBA 1IHMA 3X29B 1HQWA 3MFAA 2HBTA 5A6XA 3HN1A 2XJPA 5GKAC 2DBNA 2XBO2 5FTTC 3LA3A 2G9FA 1LESA 4PLMA 5T52A 4CCNA 2Z69A 2BGCA 3M3CA 4LBKA 1F4AA 1W6NB 1S4CA 4WBBA
chains in the Genus database with same CATH topology
2E53A 4JDMA 3WZ1A 2VG9A 3M3QA 4GH4C 4N53A 3IBMA 4QD2A 1NA1A 4Y26A 1PO12 4JQRA 1QOOA 4YYOA 2XJRA 1UMZA 3URFA 5L7OA 1VBB2 2UURA 4R9CA 5K0UC 5DZEA 3LGRA 4UW6A 1S0DA 1Q56A 1RHI2 3VBFB 2E7QA 2XVGA 1S0GA 2XLGA 4QM9A 1AF9A 1JHNA 2ZMNA 4FQ4A 1POV1 1W6OA 1WW5A 1ND3C 4YLZA 3KMHA 1QJX1 1RJ8A 3M8LA 4BZ4A 3AYAA 5JSOA 3VGIA 3WDVA 5KC6A 3VZMA 1SBDA 2JG8B 4FOVA 4XW3A 1OMIA 1SLCA 1EV11 3NV4A 4DINB 1VBC1 3USUB 2E6VA 4ONUA 3M2MA 1SACA 1SLBA 4QQHA 1WBFA 1D0HA 1G8WA 2WQ4A 4FOWA 5BPXA 1H8TC 2Y38A 4C1XA 3JBG3 4XQDA 4B3NA 2EAKA 4LLFA 2XGXA 3QCWA 4Q4Y1 3HT1A 3JB8A 1WA4A 4AFMA 3AP7A 4Q4W1 3U11A 4E4ZA 1V6JA 3OYWB 1QQP3 4KWLA 2E7AA 1LRHA 3OBRA 1QH6A 3MGUA 3IDEA 1A78A 1JW6A 3AB0A 2ZHMA 1ZZ7A 4UW4A 2K9ZA 2ZGRA 3P3PA 3NVCA 2X29A 4YVWB 1NG0A 3ZFGC 4Q0SA 2HYKA 3RWNA 5A3LA 3HD8B 5CIRA 3HQXA 5CU1A 5J37A 3G6JB 4QQLA 4FT8A 1Q5OA 3U10A 4ASMB 5BNNC 4K8FA 2ERFA 1DBNA 1GZWB 1OOPC 2PHFA 3R05A 1ULGA 3UJOA 4IV1A 3CEWA 3SLIA 2A5ZA 1MQTC 2Y0OA 5GLZA 3N7MA 3E6DA 2G4IA 5EYYA 1NCQA 1QJX2 4W6YA 3HBZA 4KGQA 4FPOB 1MEC3 4TSVA 5I8SA 4AWDA 2WNVB 5FQ0A 1DQ2A 3R4SA 1V6IA 3ZXKA 4LBMA 4QPYA 1TE1B 2WFF3 2K2SA 3AZYA 2HWF1 1VBC2 2EALA 1LODA 5BNPC 1VRH3 3G7DA 1CAUB 3AZXA 2IXHA 3FUQA 3NV3A 5JIAA 3ASIA 5CAZA 5FFOC 1D4M3 3DPRC 2OUJA 4E2QA 2IFRA 4MSVA 4NHMA 1ZZ8A 1N1SA 3O0XA 3I2DA 4Q4W2 4QQPA 4FAGA 4R4ZA 1RUD3 3AZWA 3ZSMA 3LZZA 3LCPA 3J8F1 1XQNA 2QFEA 1L3JA 2YV8A 3SNMA 3RSJA 1JOJA 1YJLA 4WZCA 2R0FA 4AFBA 2WA3A 4U36A 5IK7A 3AP4A 4GH4A 3RS6A 5BY5A 3BODA 5K0UB 4XIOA 2YDEA 4KBBA 4MGIE 4DRVA 4LHNA 1DQ1A 1KD7A 2OZ6A 1UX6A 2D98A 1ZVFA 2DVDA 4FPLA 2EXJA 4MV2A 1YWKA 1U5XA 2BUKA 5E8AA 4CDQB 5E89A 1OHFA 5D8AC 2AYHA 1J3QA 2Q30A 5CFCC 4Q0UA 1NXMA 1ND3B 1V9U2 1JN2P 2ZMKA 1RUF2 1S0BA 1FXZA 3JB4C 4PIYA 1AL0G 1S1AA 4DFSA 4COUA 2DTWA 4RA0A 2FMYA 3CL1A 4Z1VA 2JX9A 1XYPA 3ES4A 4I02A 1CAXA 4MGZE 4XXPA 3FWEA 2B7YA 3GHNA 4YM2A 4B4QA 3ZYRA 1NXD1 1MZFA 2ET1A 4R9AA 1BEV2 3CF6E 2RS33 1GFF2 1PK6A 1H8TB 4YZ5A 1AYM3 1SLAA 2I07B 2D43A 1PO22 2Q0AA 4BQ1A 3FMGA 2D97A 4WVMB 2VY0A 3I54A 1RGSA 2P2KA 1H1MA 2XBO3 4AHWA 4FXKB 4AVVA 4XXAA 4XJ9A 4YM0A 4KU8A 4YW5A 3N3HA 1N1YA 3ZO0B 4YZ1A 4QM8A 3V0BB 4IEZA 2GDFA 3JD72 1HXS2 5T5JA 1VR3A 3RNSA 4ES9A 2ARBA 3B69A 3ZFGB 1ZBE3 4ZU7A 2XWJB 2RMU1 1AVBA 1ZREA 1FOD2 4V1PA 2EF6A 4XYXA 4DY5A 5AC91 2RR12 1V6KA 5BNNB 1PGW2 1OQDA 1YFUA 1CESA 3S6PA 1LULA 3VBOB 4J1XA 4CP0A 3RZZA 2ILMA 4MVTA 5BNOC 1S0EA 1ZRDA 4LULA 3NAPC 1OOPA 3A0NA 1F9KA 4GMP3 1LGCA 1MQTA 3MYXA 4XF0A 4QX5A 1RUC1 3MIFA 1B09A 4XFFA 1I5ZA 5KXEA 3VZJA 4QPIA 2B9UA 1O5UA 3OY8B 3ZXDA 4E4SA 2XL7A 5JVVA 5C33A 2UYBA 2VUAA 1LHNA 4IEOA 1IPKA 1RUJ1 1PVXA 4FSJA 2UU8A 5BNPB 1UL9A 4XFCA 1CJDA 4D7TA 4R9DA 4XJUA 1VB4A 1W6QA 4K3UA 1XRUA 3ROUA 1O5LA 4E4DX 2LALA 4COZA 4AF9A 3DPRB 2PLV1 5A33B 1UIKA 4AEJA 4N7IA 2GC3A 3VHOA 4L97A 4F3JA 4TYSA 3D0JA 1YNAA 3FLTA 5ABJC 4DXZA 2Z42A 2GALA 2C9AA 1AR72 3M3IA 1OLQA 4XOGA 2YGMA 4ASLA 2BPA2 1N47A 2VOKA 3QH7A 4H14A 3A0KA 5FCCA 4FBFA 1CAVA 1G9DA 2R16A 3H1YA 1DQ4A 2QNKA 2VVFA 3CU7A 3ZFEA 4Q4X2 2R49A 2ZX3A 2ZX4A 1F5JA 3NO8A 1AYN2 4Q4V1 4RFT0 3RDIA 4Y5Z0 5DG1A 5AC92 2JEMA 4FO9A 2RM21 1FV3A 2W68A 2ZHNA 5FO8B 3ECQA 5FLJA 5CFDB 2D6MA 4FOQA 1ND2A 3AFGA 4Q1PA 4WZFA 3PVEA 4F8AA 3AKSA 2P3KA 1W6MA 4FPKA 4WVWA 4EWDA 5CFCB 3POYA 5H9QA 5KWRA 2AENA 4XJAA 1U5IA 5D8AA 5HXVA 3M4FA 5C9AC 1QDCA 4B8EA 4K21A 4L99A 2IXJA 2XKOA 4TZDA 1QJX3 1CAWA 1X8EA 1C28A 5E1RA 3NJZA 1RUJ2 1AUYA 1EPZA 2ZCWA 1D2QA 2CTVA 4L8QA 2Q5TA 2D93A 2IXLA 2PN5A 1ULFA 2ZPXA 4N90A 1VBC3 4AQ2A 1ZRFA 4EN8B 3PHMA 4GMP0 3ZN4A 3JUUA 3SITA 3GYDA 1HRI2 4RR3C 2JENA 1LOFA 4LO8A 5DG2A 5FPXA 3OPZA 5H9PA 4RS5A 1VAMA 4A3XA 3AYEA 2DFBA 1S55A 3ZXLA 5LK5A 4OHZA 3R4UA 1JUIA 1WUVA 5EZWA 3BCWA 3NKTA 3N35A 4Q4W3 5JMCA 1Q8PA 1ZRCA 1C1FA 2FZ2A 3WQ7A 1IZ3A 3N4MA 2VU9A 2Q1ZB 4I0BA 4Q4V2 1LOGA 2CGNA 1O91A 1DF0A 1N1TA 2RM22 1AR91 4HVOA 4P9WA 1GV9A 2WIIB 1OI6A 4HL0A 4D7SA 2VNGA 4NWWA 3NAPB 2WWSA 1MVQA 5BNOA 3IPVB 4IETA 4XQWA 4YM3A 3KB5A 1BZWA 2ZGNA 3I4IA 2JKBA 2GC0A 2ATFA 4LA3A 1MEC1 2F6BA 3GBFA 1RUF3 4CEYA 1XYNA 4YM1A 1H1AA 2CYFA 2B39A 3LA7A 1ULEA 2PHXA 4NHKA 4ORFA 1GQGA 3FHIB 5CG9A 4N43A 3GALA 4XHBA 2UWBA 4GWMA 2GSYA 2WFF1 4MLOA 3DUIA 2HWF3 5FLHA 3S7IA 1LOCA 3BALA 1Z0HA 1KJLA 2OVUA 5F1RA 1BEV3 3AKRA 4Z82A 3FFZA 1POV0 5ABJB 3OD4A 3VHRA 4WV8A 4EN0A 1RJ7A 3IDCB 1RUD1 1OSGA 5JPNB 1BMV2 1O4ZA 4D94A 1KS5A 3APBA 1N3OA 2IXKA 1W0PA 4P9XA 1H2MA 2CWMA 4LBQB 4AGRA 2HWB2 4HK9A 1SFNA 1ENQA 4EV0A 4UBHA 1FATA 1OPOA 2BVVA 1CN1A 3RJ2X 2GC2A 3CJIC 1FOD3 4JAAA 4CDWC 1HW5A 2RR13 5F9TA 1MZEA 1KJRA 1NZCA 3VBFC 4XDQA 1WW7A 2I74A 1BVP1 2GMEA 1KRIA 3AJZA 3LA2A 3CNAA 4Q0VA 1I6XA 5DUVA 2LUWA 2KXLA 5LEKA 4C0HA 3VN4A 2WQZC 5EV7A 4AVAA 1ASJ2 5C9AA 1LECA 4QPGB 1OLRA 1FMD1 4YZ4A 2HWE2 2P17A 1HKDA 2PTMA 3B9IA 1UCXA 2XL9A 4YG3A 4F7ZA 3BIWE 2DVGA 3B01A 1D4VB 5A32A 2JG8C 4XEZA 3AYCA 1Q8QA 4RL7A 4F83A 5HCFA 1WD3A 3ES1A 4Y22B 3ZSEA 1CONA 4CDUC 4DZGA 4JDOA 1QJY2 3RQ0A 5BUVA 4KL1A 2RS31 4RR3B 3MIEA 1URXA 1GANA 1SCRA 1SMVA 2EA7A 2QE3A 4FP2A 4XILA 2W0XA 5H9SA 1ALYA 1KDMA 1F2NA 1DQ0A 1OPMA 3WG2A 4GXLA 4I0AA 4MZUA 4FPHA 1XYOA 1QJZA 1MS8A 4CEWA 3RI9A 5J3UA 1AR73 3C3VA 5SV5A 1QOTA 1X82A 4PLNA 5J98B 2A6VA 3VBHA 4KWJA 1ZA4A 1MS5A 1XNBA 4XBLA 1PO11 4I30A 4Q4X3 2XB6C 5JWPA 1VBB1 1AYN3 2RMU3 2ZS6B 4M01A 3RMXA 5AC93 1A6CA 4H55A 3V0AB 3IN9A 2RS11 1V6OA 5BV6A 3MZHA 4NHLA 4XZPA 1RHI1 1IOAA 2PQQA 2LTNA 3EQEA 4BMBA 4YNIA 3PMSA 3RYRA 2BWAA 1TME1 3ZN6A 5KXDA 4LE3A 1Y9QA 5EJ3A 2VQAA 3O0WA 2E51A 1NCRA 2TEPA 1RUC3 1SFYA 3PNAA 4PLOA 2VXRA 2XVKA 2NM1A 4HPKA 1O4YA 1CD3G 1RUG1 4YARA 3KLSA 4LHKA 3WG4A 3T2TA 1B35B 4O9EA 3MDPA 2WNVC 4HLTA 1RUJ3 4URTA 2A3WA 1O3QA 2GAUA 4DY3A 2XLFA 3IT8A 2PHUA 3MIDA 3RMYA 1DHKB 4AGVA 2UYAA 4OVEA 1UU5A 1YFWA 2BQPA 4AQ6A 4XQ4A 1RVF2 1HRI3 1BK1A 4MXWB 3AJYA 1QHDA 1DGRA 5FAXA 1GICA 4LT5A 3M70A 4JVAA 4O9GA 2D6KA 4LUKA 4WM8C 1G7YA 3EXUA 2JE9A 1XU2A 1WMEA 4BM8A 1V6MA 3VLBB 1W6NA 2VOXA 3R4DB 2ZAHA 4S2FA 2OPKA 4X8PA 4Z92B 1AX0A 2R072 2X8KA 2OA2A 4XMAA 3DGTA 4Q4V3 2D7FA 4G9SB 3LB9A 3CJIB 2RM23 5FO7B 4CDWB 3OD0A 2RS12 2BVBA 4GB32 4YW1A 3WW3A 2D5FA 4D7YA 1MS1A 3FE5A 1ZZ6A 3VBFA 4CDQC 3KGZA 1TME2 1FYUA 3B93A 3DF0A 4UXAA 5AVAA 3H8UA 1SLLA 5CNAA 1CJPA 3LAGA 2DCYA 4AW7A 5JAXA 1X7NA 3ZXEA 2QQPA 2XJVA 2YHJA 2JXAA 4B4RA 1RUG2 1AHSA 4X6RB 3BPZA 3WR0A 4JTNA 3LOBA 4Q8KA 2Q4SA 4ZU5A 4KWKA 1VBD2 3PLQA 4CDUB 2JG8A 1C5HA 1RC6A 4M3CB 2WL1A 4JC1A 1AR62 1QNWA 4L2NA 3MF9A 2DCJA 4HKLA 1NQJA 3B00A 3NSTA 3USUA 1PZ9A 2A3XA 3UKVA 2GMPA 3QLQA 4RQPB 1UW8A 2AUYA 3ZSJA 1WCKA 1MS9A 1KDKA 2WJSA 3HIFA 4JGZB 3V65A 1OA2A 1AXZA 2VOWA 5T5OA 1HX6A 1J1TA 3OYWA 2ZZQA 3E5UA 4XF9A 2PHRA 3MIHA 4IV3C 3HR9A 1RUE2 3VBSC 4UBGA 5EXOA 1R091 1H4GA 3N7JA 3SXWA 1BXHA 5C4WC 4HETA 2YY1A 3GZAA 3ZMOA 1AR93 2ZTNA 1QOSA 4YVWA 3SMHA 4QXKA 1XU1A 4EN6B 4ISQA 3VBOC 1QWRA 4BA6A 1LCLA 3ZMNA 1MZ6A 1HRV2 1UU6A 4KG8A 3BOWA 3AZVA 5IK4A 1GZWA 1ONAA 4WM7B 4A7ZA 4A7KA 1V9U1 4OULA 1RTVA 5L36A 1ASJ3 4E9KA 1RUF1 3I7DA 2DCTA 3MLLA 2A6YA 3RYKA 1IS6A 2XVLA 2Y26A 3NV2A 2D44A 2HWE3 4IQPA 4CRQA 4M3CF 2WNVA 3UKNA 2ES3A 1X33A 2VULA 1AJKA 5T5PA 3AMHA 5GLUA 5L73A 4HKOA 4FTSA 3UJQA 2HWC2 1BEV1 1CAUA 1C4RA 3H3ZA 4N9IA 4Z8BA 5C8CB 2ARXA 4IEVA 1ENSA 2NP0A 3E6CC 4XFAA 1PO21 3UK9A 4HMZA 4HSJA 1PZ7A 1R1ZA 4I2OA 4WM8B 1UKRA 3BTAA 3WP4A 4MGKE 5FRAA 1O4TA 1KFUL 3AXEA 3U0ZA 1DLLA 4INDA 1XNKA 1ENRA 3ILNA 2X5IC 2PHDA 5T3NA 3AP5A 2BWCA 1R092 4YW2A 3JD71 1HXS1 4PIXA 2RJKA 4LEJA 5J7MA 2ZOEB 3H50A 3NW4A 3R0RA 1UIJA 3AM2A 4AXOA 1LR5A 4H7MA 5K0UA 1FOD1 3O12A 4YFWA 2RR11 5J48A 1PGW1 2W08A 4LO6B 5CFDC 1PNGA 2HEVF 3FZ3A 1SLTA 2VQ0A 1ZX5A 1GYKA 4AI3A 3WCRA 4CDQA 1LTEA 4CDXC 1IKQA 3AKTA 2WFPA 4IEPA 2WZR1 1DQ6A 1OD5A 1G9CA 1ND3A 3MW4A 2Q1MA 1FMD3 2R061 1GBGA 2ZGLA 4AG4A 5CBLA 1C8M2 1MS0A 3THPA 4AFCA 3WQ0A 1O3RA 5J36A 1REDA 1TMF2 2JD4A 2SLIA 4Y4YA 3VV1A 1QDOA 3QACA 2WNUC 1YI9A 1RUNA 3D0SA 4GKXA 1H9PA 1FNZA 5C8WA 1EAH2 5I0SA 1XNDA 1OFNA 4IL7A 1UZYA 1VAVA 4XBQA 4M00A 4BWOA 2JDZA 1H8TA 1RVF3 4OLLA 4ES8A 4Y1ZA 3MIBA 2BYVE 5FOJB 3KSCA 2CWSA 3OBTA 3KCYA 1AR71 4WVMA 4JCKA 1YLLA 1NE6A 4U2AA 1N3QA 2DUQA 1HQNA 1D0GA 2Q8OA 2DVFA 2D5HA 2B46X 5JI7A 4IV3B 3VBSB 3IWZA 2WZPP 2BTVC 1RIRA 4LNVA 1LOEA 2D3SA 2RS52 4MX3A 1H2NA 4Q4X1 4PIZA 2FMDA 2DWRA 3ZSLA 1PO13 5C4WB 3V0BA 2R1BA 1AYN1 2C0ZA 1VBB3 3ZFGA 2ZGOA 2H6BA 3HT2A 3C2UA 3WW1A 5BNNA 2RS13 1G86A 4GB33 2EIGA 2PFWA 1RHI3 2HJIA 3VBOA 5L19A 3N36A 4J6GA 1RL3A 2UWAA 3ZXJA 4FCAA 3B94A 1AJOA 4RGAA 3T1LA 4S2DA 1TME3 2WZR2 2XWBB 3ZVXA 2XG3A 2KM2A 4XTMA 4YSFA 4A2UA 2A7AA 2R062 4K1YA 3ZX7A 2D6LX 2C5DA 2VUJA 1KITA 3O0VA 1RUG3 3OY8A 1UN1A 3GNEA 4H7LA 3PVNA 4W6WA 3D8CA 5HCAA 5FMOS 2DURA 1IS5A 5JIUA 3VKFC 1VBD3 2R042 4XMIA 1TEIA 5BNPA 4YGBA 1ZBA1 1AR63 4LO5B 4PBOA 4Q26A 5C6CA 3KM5A 4HN1A 1N3PA 3WHTA 3WUDA 1H1IA 1HRI1 2A70A 1WGPA 3DPRA 3VKNA 3M1HA 3MLKA 3EHKA 3ZIXA 4AEDB 1V6LA 4FAHA 1PVC1 5A33A 2XLAA 1IKPA 1WD4A 1LB2A 3WDTA 2IFWA 5TSWA 2NMNA 3H1MA 1OQEA 3WW2A 4AE2A 2EXHA 2BNOA 2GNMA 1QNYA 1PM7A 4PBPA 4JGYC 2X5IB 3VBUC 5JPMB 1J3RA 4AI1A 2PA7A 1O3SA 1MZ5A 2ZGQA 2VECA 3FLPA 3VUOA 1XE8A 1UZZA 3AMMA 2XH6A 5JOYA 5T50A 1I3HA 2ETEA 4QU2A 4MXVA 4YGDA 2A73B 4K20A 1C8NA 1RITA 2RJLA 2DVAA 3AYDA 5HI0A 1FAYA 3M3EA 1DG6A 1VB2A 3DL3A 3O7OA 1WW6A 4YG6A 2FQPA 2ZGMA 5CFDA 3WP5A 4HVRA 1S0CA 4LO4B 4CDXB 2FZ1A 1MS3A 1RUI2 4QGLA 5CFCA 4WVZA 4QMAA 4N9HA 4B29A 1J1LA 1GLHA 3ZXFA 1K5MB 3PJYA 5EFUA 5FO9B 3RJRA 1M06G 2QUOA 4LUMA 4BOWA 4IEYA 4QPGC 4Y1UA 1H0BA 3NKGA 5KC5A 1U0AA 2GN3A 2JG9B 2VVEA 3GBWA 2WNUB 4IEWA 4YRDA 4GA9A 2B5HA 3AZZA 1WLTA 3TN92 4YG0A 5EYXA 1ZBA2 4R52A 2YUEA 5JSPA 2ZACA 5KHIA 3VKOA 4IEXA 1LJ7A 2TUNA 2CGOA 2HWC3 1X8MA 1PVC2 3N7KA 1OA4A 2NZ9A 1V6NA 2ZGKA 1G9BA 3OGGA 4GWNA 3WW4A 4B7KA 2VGDA 4TLFA 3KCXA 1GZCA 1A8DA 2AR6A 3VHPA 3O14A 1BMV1 5F6KA 1VBA2 2O8OA 1NQDA 3GZTB 2BNMA 3D6EA 1X36A 3VZKA 5GZEA 2Z79A 4FPGA 5FBZA 2LM3A 3ZN5A 3AFKA 5BYNA 2HWB1 1R093 2VH9A 2KA3A 4N7UA 3B3QE 1D2SA 5FLIA 5BXXA 1DGLA 3EJKA 4NR1A 3EBRA 1M4WA 4IEQA 2QDNA 4PDWB 4K1ZA 4Q0PA 3VBRB 4AK3A 1DYPA 4YW4A 2ZKLA 1HV1A 1YUDA 1G9FA 3NAPA 3WP6A 2OW4A 3IPVA 1S0JA 2PHWA 4BCUA 3ST7A 3SHRA 2V5YA 3VHNA 1ASJ1 1V9U3 2OYZA 1UD1A 3WVJA 3EO6A 1U5ZA 2GH2A 3OGJA 2HWE1 1C8M3 5JR7B 4TWTA 3M3OA 1B35C 1KFXL 1BBT2 1OA3A 5ACA2 3V64A 1IS3A 2VW2A 2OIIA 1XNCA 4HZFA 2WT1A 1W6PB 4P5HA 4CP1A 4LBNA 1A3KA 3JQXA 1QJY1 3MF6A 3P3NA 4L92A 5DDJ2 5GLTA 3ZIWA 1EAH3 5HCBA 1YIPA 1ZZCA 4W65A 4XFBA 4ATFA 2VMHA 4E2GA 1PO23 3CJXA 1QJU2 4OI4A 5ABJA 2B42B 1YO8A 3VBUB 4JGYB 4UW5A