4GB33

Human coxsackievirus b3 strain rd coat protein
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
238
structure length
238
Chain Sequence
GLPTMNTPGSCQFLTSDDFQSPSAMPQYDVTPEMRIPGEVKNLMEIAEVDSVVPVQNVGEKVNSMEAYQIPVRSNEGSGTQVFGFPLQPGYSSVFSRTLLGEILNYYTHWSGSIKLTFMFCGSAMATGKFLLAYSPPGAGAPTKRVDAMLGTHVVWDVGLQSSCVLCIPWISQTHYRYVASDEYTAGGFITCWYQTNIVVPADAQSSCYIMCFVSACNDFSVRLLKDTPFITQQNFFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of a Coxsackievirus B3-RD Variant and a Refined 9-Angstrom Cryo-Electron Microscopy Reconstruction of the Virus Complexed with Decay-Accelerating Factor (DAF) Provide a New Footprint of DAF on the Virus Surface.
pubmed doi rcsb
molecule tags Virus
molecule keywords coat protein 1
total genus 42
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4gb3300
3VBHB 5BNNA 1VBC3 1AR72 1C8M1 2HWC1 3VBOA 3VDDA 3DPRA 1CD3G 1FOD2 4RS5C 2FZ1A 5C9AC 4JGYC 5BNOC 1RMU3 1NCRC 2HWB3 1ND3A 5D8AB 4GMP0 1A6CA 1PO12 5J98B 1VBA1 5BNNC 5K0UC 4QPIA 1VBA2 1OHFA 4N43A 4FTEA 1PO11 1QJU3 4CDWC 2RMU3 3ZXAC 2GSYA 1K5MC 1FOD1 1HX6A 1QJZA 1FOD3 1AYM2 4Q4X3 2PLV3 2HWC2 5CFCB 2BBVA 5D8AC 1AYM1 5FMOS 2TBVA 2X5IA 5CFDC 2R043 4Q4W3 1FMD3 1POV0 4CEWC 1NCRB 1QJU2 3VBRB 3VDDB 5K0UA 5AC91 1V9U3 1TME1 1VB4A 2R072 4N43C 1RUE2 1EAH3 1VRH1 5BNOA 1RUF2 4JGZC 1PIV1 1PVC1 1TMF3 1AUYA 2FZ2A 3VBFC 3VBUB 4AEDC 4CDWA 4WM8B 1AR92 1HRI1 4JGYA 1PO22 3M8LA 3ZFGC 4CEYA 1DDLA 1PGW2 4FTSA 1NOVA 5ACA3 1AR71 1C8M2 5CFDB 1BBT3 2WS93 1MEC3 1D4M1 3CJIB 1VBE2 2X5IC 3ZFEB 4Q4Y3 4Q4V2 4JGZB 2HWF3 2HWF1 5AC93 5DDJ3 4RHV1 1POV1 5FOJB 1RUI3 1RUH2 4IV1C 4RR3B 4CEYC 1NA1C 5JZGB 2RR13 5C4WC 1BEV3 1QJY3 4NWVA 2WZR2 1AYM3 1HRI3 5CFDA 1AR61 4YVWC 1RUJ3 3VBUC 4AEDB 4Q4W1 1E57A 1ND2B 4CDQA 3NAPC 3JBG1 1ASJ1 5CFCC 1AYN2 1OPOA 4Q4V3 4RFT0 5ACA1 2HWD1 1WCDJ 3JD73 2WS92 4RR3A 4IV1B 1NCQB 1VBB1 1R093 2MEV2 4YVSA 1FPN2 1QJX1 2IZWA 1HRV2 4GB32 1B35A 1NA1A 4WM7C 1RUG2 4SBVA 2DF7A 1COV2 4NWWA 1ND2A 1FPN3 2MEV3 2HWB1 3NAPB 2PLV1 1R1A1 1OOPC 2ZTNA 3VBSC 1AR82 1RHI1 4BCUA 1BBT1 1EV13 1H8TA 3FBMA 4CDWB 2R041 4WM8C 1AYN3 1QQP1 4QPGB 5A32A 1RUJ2 1NG0A 1ZBE3 1BMV2 4PDWB 2RR11 1MQTB 1R081 1QJY2 3CJIC 3ZFEC 2ZZQA 1RVF2 4WM7B 1ND3B 5D8AA 1RUH3 1RUI2 1VBD1 2RMU2 4Q4Y2 1X33A 1HQNA 3VBRC 4CEWA 5C4WB 1MEC2 2RS31 1F2NA 1RUD3 4RR3C 1OOPA 3VBOB 3VBFA 1NA1B 1C8M3 4YVWB 1C8NA 4GMP1 1R091 3J8F2 3JB4C 4GMP3 1COV3 4N43B 4RHV3 5C8CA 2WWSA 1RUG3 2BPA2 4CDUB 2RM21 1Z7S1 1TMF2 2VQ0A 4PDWC 4Y5Z0 1M06G 1NY72 1R083 1RUF3 4CDXB 1AL22 1RUC2 2GH8A 1HXS2 1ZBA2 1VBC2 2R061 4Y4YA 1EV11 2WFF2 4FTBA 1ND3C 1V9U2 4CDQC 2XBO1 3TN92 5C9AA 2RS53 2HWE2 2RS51 1AL0G 1FMD2 1RUD1 3JD71 1PGL1 2WLPA 3VBOC 4RQPA 4Q4X1 1RVF3 2RS11 2WZR3 2HWC3 1EAH1 1GFF2 1BEV2 1BEV1 1NCQA 4QPIB 3ZFGA 4Q4X2 4CEWB 1PIV3 1PVC3 1VBD3 1ZBE2 1CJDA 1Z7S3 5DDJ2 5C8CC 1FMD1 1F8VA 3LOBA 1RMU1 4QPIC 1R1A3 5A33B 2HWE3 3ZFGB 2HWD3 1VBA3 4RS5B 5L7OB 1EV12 2WFF3 2R062 1AR83 4CDUA 1VBC1 1ZBA1 4N53A 1HXS1 4PDWA 1AL21 1RUC1 5J96B 1AL23 1RMU2 1RUC3 1NY71 4GH4C 1PO23 1TMF1 1Z7S2 5DDJ1 1ZBE1 1X36A 4JGZA 2ZAHA 1HRV3 4GB33 1OOPB 5K0UB 3ZFFA 1H8TB 1R092 3J8F3 4IV3B 1EAH2 1K5MB 1W39A 4CEYB 2BFUS 2RS12 1AR73 5FMOL 2R073 1PGL2 5BNPB 3JD72 1RUD2 1VAKA 1MEC1 4RQPC 3JBG3 2HWE1 2RMU1 2RS52 4IV3C 2XPJA 1MQTA 3S6PA 3TN93 4CDXC 3TN91 1TME3 2XBO2 4CDUC 1V9U1 2WFF1 3VBHC 1RVF1 2RS13 1HXS3 3VBFB 3HAGA 1QJY1 4N53B 4YVWA 1R082 5C9AB 2RR12 4GH4B 1RB8G 4RS5A 2RM22 5C4WA 1NCRA 4LLFA 1RUJ1 5BNPA 4FSJA 4N53C 3VDDC 2BFUL 1ASJ3 1VB2A 3J8F1 4JGYB 3ZFFC 2RS33 2R063 1BBT2 1RHI2 1AR81 5C8CB 2RS32 1VBB3 1PO13 3DPRB 4RQPB 1R1A2 2HWB2 4Q4Y1 1COV1 1POV3 1RUG1 3VBHA 1VBD2 4YVSC 3CJIA 1RUI1 3ZFEA 1HRV1 4GB31 1QJX2 1FPN1 5L7OC 4QPGC 2X5IB 1ND2C 4CDQB 1RUE3 1BMV1 4WM7A 3JB8A 1QQP2 1AYN1 1QQP3 3ZFFB 4WM8A 3JBG2 3VBUA 1NCQC 1H8TC 5JZGA 4Q4W2 2R042 3VBSA 1AR62 5BNNB 1SMVA 5BNOB 4YVSB 4QPGA 5A32B 1ZBA3 1VRH3 2PLV2 4IV1A 5A33A 4EJRA 1QJX3 5BNPC 1RUH1 5L7OA 4RHV2 4Q4V1 2QQPA 1B35C 1VBE1 2MEV1 1D4M2 1IHMA 5ABJC 4AEDA 1VBB2 1RHI3 4GH4A 2WS91 5LK7B 4Z92B 1D4M3 2HWD2 1PGW1 5ACA2 1ASJ2 5JZGC 1PO21 3IDEA 1AR91 1HRI2 3VBSB 1AR93 2RM23 1PIV2 1PVC2 5ABJA 2WZR1 3VBRA 1RUF1 1VRH2 1RUE1 2R071 3DPRC 5GKAC 4CDXA 1K5MA 1AR63 4IV3A 1TME2 2XBO3 3NAPA 5AC92 2HWF2 1QJU1 5ABJB 1VBE3 5CFCA 1B35B 1MQTC 2Y26A 2BUKA
chains in the Genus database with same CATH superfamily
3CQOA 5DABA 5FXWA 4ZZ8A 4D8MA 5EZWA 4IXLA 4MH0E 2O0OA 4OUSA 3N7JA 1XNDA 1CAWA 2WRAA 3WW2A 3VBOA 1MS0A 1ZX5A 4LORA 4AAXA 1H2NA 4O9GA 3L2YA 4ONUA 1WWYA 5FPLA 2W1WA 1QMJA 4CUCA 4DRVA 4QB2A 1O8PA 2CYFA 5FCCA 2A7AA 1ZNPA 1UZ0A 1IPJA 1ND3A 1W04A 3HQUA 4JHTA 1A6CA 2BGOA 2IWGB 3CU7A 2G4IA 3UL2A 2HEYF 2VBBA 2WUHA 4QPYA 2ATFA 4U2AA 5K0UC 4B3NA 3CZUA 1FATA 3ZN6B 3PLQA 4XFCA 2C9AA 5M0TA 3OJBA 4LBQD 3BKZA 2ZMKA 1MR5A 1T2XA 4XQWA 2ZXQA 4ZZ5A 1GR3A 1F4HA 1LOEA 1UXXX 2Y6JA 4CDWC 3RI9A 4GD4A 4CUBA 4E2SA 4IEXA 2JEMA 2IXCA 4XETA 3ZXAC 1NXD1 3QLQA 3OD0A 1W6NA 2GC2A 4M3CE 4UFJA 3BALA 1FOD3 1AYM2 2B8MA 2ZX0A 2XGXA 2W47A 2PLV3 2QCSB 3E1F1 5E8AA 4OZXA 5L19A 5CFCB 4CP9B 1OQDA 1WKYA 4QGNA 3J7MA 3WG3A 4DQAA 3I2HA 3VN4A 1E5IA 2E63A 2JIGA 2R043 5A80A 1GP5A 4S2DA 2Z42A 3HT2A 3J4UH 1CZVA 2BWAA 3OEBA 1POV0 4NIDA 2FCVA 3ZSLA 4CCKA 1MACA 4CCOA 2DUPA 1DFQA 5CNAA 2GNTA 1CN1A 3EHKA 3L9JT 1KS4A 3DCQA 4OUMA 2Q8DA 1U12A 2V4AA 3VKMA 1VB4A 2CSGA 3SHRA 4WZFA 2VW2A 2R072 1HIXA 3WHUA 3DKQA 1HLCA 1EAH3 1RINA 2BWCA 4LBLA 5KXDA 1UYPA 3AP5A 1UMIA 2Z79A 5BNOA 4M3CB 3EO6A 1E5HA 1PIV1 1TMF3 1NQJA 3VBFC 4R9CA 3VBUB 2QQMA 1S2KA 2XG3A 2Y60A 5D1IA 4BWOA 3WOGA 2J1SA 4CDWA 1X9PA 1CQ9A 2CWSA 5HV4A 3S57A 1H1AA 3F2ZA 5FZFA 1VLNA 1PVXA 3ZFGC 4ZS2A 4CEYA 4XFHA 5AVAA 4OFGA 4CXYA 3J7NA 5CFDB 4LUKA 3KM5A 1VMHA 3M3OA 3BCWA 4IE5A 4DUWA 1GWMA 5KWRA 2VQUA 3ZFEB 1VBE2 2X5IC 4CCDA 1S0BA 4Q4V2 4JZRA 5EHDA 4AI9A 3GBWA 4XJZA 4RHV1 1POV1 3THCA 1UX7A 5JUVA 2WO1A 4GULA 3WDVA 1LTEA 3IDAA 5F39A 1W6PA 1ZVFA 5FYIA 3ZKUA 1JOBA 4CEYC 1TNFA 3ZDVA 3MW4A 4D94A 2I74A 4RGKA 4AFBA 5A7WB 5LY2A 1BEV3 4NWVA 1HB3A 1YQCA 4Y24A 5FZ3A 4HMZA 1AYM3 2HLEA 1DLCA 3I49A 2VM9A 2FDFA 4N9HA 1UZYA 4AEDB 4Q4W1 3WW3A 1PMHX 5FZMA 4CDQA 3RYKA 3VD7A 2E32A 4UW4A 2WYFA 5EPAA 2UWBA 3JU9A 4Q1RA 4QKBA 2UY8A 3IIAA 2RDNA 3POFA 1JODA 4UAPA 3WV6A 2WS92 1G6NA 2QDNA 4IV1B 1NYWA 5K9YA 2A70A 3HJRA 3OEAA 3PIJA 4UBGA 3HBKA 4XCAA 5GZFA 2JG9C 3ZMOA 3HNBM 1FPN2 3GDBA 4ET7A 2B9VA 4Y22A 2VZOA 1HRV2 2EVXA 1CWPA 1NA1A 1KJLA 5F3CA 1KJRA 1V70A 3TBDA 2DF7A 5AC93 1RUNA 3KQ4B 2XL9A 3WD5A 4G9SB 5FZ9A 3A21A 1H1IA 3C3VA 2PAKA 1C28A 1DQ2A 2TEPA 5KHKA 4R9DA 3PNAA 1GOGA 3LEKA 4FAHA 1WGPA 4CDWB 2R041 4QHZA 5HXVA 1I6XA 3QH6A 4CPBD 1JXNA 1W8UA 2GC3A 3I2DA 2G9ZA 1BCXA 3LD8A 3ZN5A 4XDOA 5C5TA 4AVSA 1AYN3 3T0AA 1YO8A 2XJSA 4XOGA 5F2WA 4Q0VA 3WCRA 4E27A 3EXUA 1XC6A 3K77A 3ELNA 1BMV2 3NJZA 4PDWB 4K1YA 4YZ3A 3WX5A 1PX3A 1GICA 2RR11 2ZGRA 3TOJA 3VHRA 2X29A 3OBAA 1MQTB 1JYIA 1QIQA 1YFXA 4A6OA 3CJIC 4LT5A 2RJ2A 1DGWA 2ES3A 2GNDA 3MEPA 1ND3B 1UO9A 3EYPA 3ZSMA 4Z2AA 3MHZA 3NNJA 1L7QA 4QX3A 3WF4A 2IXIA 2R0HA 2WLQA 3JQWA 4XJ8A 3CKHA 1LHVA 1LGCA 3UJQA 1UYZA 2E7AA 4Y1ZA 2ZHLA 3AKSA 2CGOA 3KT7A 4AFDA 1F2NA 1RUD3 2E7QA 2WDBA 2YB7A 3QACA 4RR3C 3TB0A 3VBFA 5EIYB 1J59A 1JZ2A 4MYEA 4JKLA 3WCSA 5FKBA 2DCZA 4EN6B 4COWA 5FXXA 3K46A 1RTVA 1T6GC 4JAAA 4M4PA 4MXWB 3EBRA 4IE4A 2W46A 2DVGA 4YVWB 3JB4C 3DXTA 4GMP3 4QDRA 4CP1A 1KXGA 3DYPA 1UQXA 2VGDA 3MPPG 4Y1VA 2H6BA 5FXVA 1COV3 1ULEA 2PMWB 1XU2A 4KGGA 4R52A 4EE2A 1IS6A 4COUA 1D2SA 4PT6A 5SV8A 2RM21 1JW6A 5FPAA 2VU9A 3S0MA 1GZ9A 2WZPP 3WF2A 2VOVA 4BPZA 4CXXA 2P3KA 1MZFA 1R083 3KF3A 2YU2A 1RUC2 4CDXB 2PHTA 2BW8A 3OPZA 4PIYA 5BYNA 1HXS2 1JYVA 4BYYA 1VBC2 4CXWA 1XYPA 3NKGA 2R061 1V6MA 4K40A 4BE3A 3LSDA 4Y3OA 3PJYA 2ERFA 4WZCA 1V9U2 3SC7X 3AB0A 4LKFA 2XBO1 5FYTA 2ZABA 4NIAA 3KV4A 4XF9A 3INAA 4Z8BA 2BBAA 1G9BA 2PAEA 3CHXA 1YJLA 2HWE2 3POWA 4BMEA 1Y4WA 3T1MA 1OVPA 4OHYA 4UT5A 3C8XA 1RC6A 4N7UA 1RIRA 1FMD2 1SZBA 3OYWB 3ZYIB 4LLOA 3AMNA 1O59A 5JMOA 4LO5B 3H1MA 4Q4X1 3AYDA 1JI6A 4D3WA 2BERA 4NHXA 3B7MA 3LF7A 1NCQA 5GZCA 2HKXA 4QPIB 2EAKA 5FYYA 1DIWA 3U10A 3ATGA 2Y0OA 4HN1A 1G9AA 2CNAA 2ZX4A 3GF6A 1XPWA 2AEYA 4IEYA 5K8SA 3HPNA 2Q4SA 4A2UA 2IVJA 2IXKA 2VJXA 4IEZA 5FJHA 3ZYHA 3BTZA 4XAEA 2J1VA 4META 4QPIC 1JUHA 1CIWA 1HB2A 4XYXA 2IXHA 1KD7A 2HWD3 1VBA3 2PELA 4RS5B 4YARA 2JENA 1FI2A 4AI0A 2Z4FA 1ZZ6A 3KCCA 4MHUA 1AR83 1SDDB 4QQOA 2EIGA 4Y4RA 1WMXA 2A6ZA 1W2TA 1YUDA 2BV4A 1TG7A 4JC1A 3MZHA 4QM8A 4MLOA 3E5UA 4NPMA 1RMU2 4IE0A 3MW3A 1W6MA 1PO23 2B42B 3KCXA 4GWMA 1Z7S2 4LIVA 3EB7A 3LWCA 5JOZA 1ENXA 2OUHA 4Q29A 5FZLA 3ZOIA 5LY1A 4GB33 5K0UB 2R49A 3GM8A 1JOJA 4JDOA 4BJ0A 2Q1FA 3GNEA 3I2IA 5J37A 2XUEA 5FP8A 2JKXA 4AI3A 4FPOB 4AI8A 2E9QA 5J7MA 2VVFA 2KA3A 3OSDA 1DZQA 5LB6A 2JDKA 1VAKA 4MGKE 5FZAA 1MEC1 3W59A 2SLIA 1PNGA 1YQ5A 5FYSA 5H9PA 2HWE1 4KI5M 4PF5A 4UWDA 3TN93 4YZ4A 3OGSA 3TN91 1XRUA 3URFA 5IVEA 5A70A 4CDUC 1LU2A 3B94A 4LPLA 4NPLA 5FFOC 2CTVA 3DXUA 4DO0A 1RVF1 2RS13 1L3JA 1CVNA 1UL9A 3HAGA 1OF4A 3JCIA 1QJY1 4IERA 4LK7A 2L9LA 4A4AA 3PVBB 5FREA 3RJ2X 1DQ5A 2YG0A 1AF9A 3SITA 1XSQA 2WR9A 2RM22 5AFEA 3RG0A 4LLFA 1KDMA 3NWKA 1UWWA 4NR1A 5GLTA 5DQ0A 4NIGA 2VY0A 5FP4A 2A6WA 4N53C 2PHRA 4OLLA 5CKQA 2QTWB 3U4SA 1GNZA 3VDDC 4PF1A 4DUVA 2OYZA 5EYYA 1D7PM 2XH6A 2YY1A 3J8F1 1UF2C 1W0NA 1F9KA 2ZHKA 4Q5OA 1LAJA 3K51A 4DXRA 2RS33 5I8SA 1BBT2 3ZYRA 4E2QA 5A7WA 5I8YA 4LK6A 2NN8A 3FBYA 3NL1A 3IAQA 3HD8B 1XQNA 3THTA 4GKYA 4AHWA 3ZKYA 2JDNA 4RQPB 1V6LA 4HBNA 1HB1A 2HWB2 3BN6A 4QU2A 2HBUA 3GHNA 4UW6A 3AZXA 1D0HA 2VE1A 1X8MA 1KQRA 4CVUA 1LECA 1NLRA 4B8EA 3VBHA 2LUWA 5IUQA 2WKKA 4QKNA 4GA9A 4ZU5A 1G9FA 3AP9A 3GYDA 4MGIE 1QJX2 3SCFA 4YLZA 2JD9A 4KWLA 5DN2A 4KWKA 4NRPA 1JZ5A 4O61A 4I3PA 2NQYA 2GAUA 5DZGA 3ES4A 1AJOA 2ORZA 2X5IB 4Z82A 3N9LA 1RUE3 5F9TA 4NRMA 4D7YA 1LNSA 3ME2A 4EZ4A 2BQPA 1D4VB 4JRLA 4Z2WA 2A3YA 4FOQA 4COZA 1ZRRA 1AYN1 4WM8A 3S5AA 2FMDA 3VBUA 2W3JA 1H8TC 4QB1A 3MYXA 2NYYA 4COYA 1V6KA 5F7UA 5JZGA 3H7YA 2R042 3T2OA 2BYVE 2HBTA 1QNWA 2VUJA 5A32B 1EUUA 5C7GA 3NVCA 1VRH3 4XAAA 4V2VA 2A1XA 3ENRA 1HDKA 5DZFA 1I1EA 2WO2A 5JXGA 3PVOA 1VALA 4XFIA 2OPWA 1ST8A 1XNKA 1U0AA 3SKJE 3MDPA 1IGOA 1OVSA 3WLUA 2Y34A 1FV2A 1GOFA 1UU5A 1YI9A 3GHMA 1RUH1 5L7OA 3LIHA 3A0KA 4P00B 1QOOA 3ZSEA 4CCNA 4LIUA 3D0SA 4NO4A 3PJQA 4P9GA 1LU1A 1W2UA 1DBNA 1LEDA 3ALQA 2XQXA 3AMHA 4A45A 4HZFA 1UYXA 2ZBJA 1WCKA 1YI7A 2WS91 1K5JA 3JQXA 1CAUB 3N36A 1UAIA 5LK7B 2HWD2 1G86A 1U5YA 3E6DA 4LBQA 2X05A 1LHOA 2QVSB 5C3RA 1YWKA 2AZ5A 4AGGA 1RGSA 1X9TA 5J09A 1PO21 2PQSA 4M3CF 4WVMA 4Y26A 1JHJA 3VBSB 1HQWA 4PBPA 1WCQA 4PLNA 2V4VA 2XJVA 3UT0A 1Y7BA 4JX0A 1UY2A 1OPMA 2J1EA 4R4ZA 1ZRFA 3VBRA 2RVAA 3D4KA 4UFIA 2F4PA 4ZONA 3P6BA 2B39A 2H0VA 5GKAC 2YYOA 3T30A 4LA2A 3NAPA 3HOBA 1E5SA 3FLPA 1C5IA 1GUIA 3T4HB 3LQCA 1ZZ7A 5JR2A 2B45X 2I2SA 2ZKLA 5CAZA 1SFNA 2ZHNA 2P34A 3UK9A 2OIIA 1W0PA 1D2QA 2P37A 2NM1A 3MFCA 4K8RB 4LO4B 3FN9A 5FYZA 3O1MA 4W8JA 2ZKNA 3R4SA 2V72A 1QH7A 2C24A 2WNUA 1J83A 3ACLA 3IT8A 5IK4A 5HCBA 3USUA 5BNNA 1AR72 1C8M1 2WN2A 2YHJA 3FWEA 4MX3A 2NMNA 4NVPA 5F8PA 5KBFA 4WVVA 1UY0A 3LAGA 4YG0A 3VDDA 2PAMA 1F5JA 1HN0A 1AXZA 1W03A 1WW6A 5GZGA 1FOD2 4FPEA 1FNYA 3ZXFA 5FO8B 3M4FA 3EJKA 2RV9A 4HPKB 3B9IA 1Q5OA 3O1UA 2FZ1A 5L73A 4LHKA 1NCRC 4HT1T 1JS9A 4R4XA 5C8WA 4GMP0 1PO12 5JPNB 4TN7A 2ILMA 3FZ3A 2D3PA 3WEZA 5FUNA 1ZRCA 3ILFA 2AH2A 5JXIA 2FMYA 2CU5A 4CU6A 1WCUA 3LA7A 4QPIA 4DNYA 4W6XA 1OHFA 1A8DA 4HVRA 4FTEA 2C1FA 3FJSA 2JB4A 4OHWA 3SNMA 1QJU3 5HPOA 2DTYA 3HQXA 2HJIA 3Q8CA 3LDBA 5JIAA 2QZ2A 4KMQA 4TSVA 5E6HA 4KG0A 4Z1VA 5DUWA 2WQZC 3T09A 2C5DA 4BM8A 4E8DA 4RA0A 5F1RA 3ZSKA 1K5MC 1QJZA 1EYBA 2YC2A 5I0RA 4XMAA 1GNYA 2PA7A 1I3HA 4K1ZA 1C1FA 2EIEA 4R9BA 3I54A 1DF0A 2HWC2 3MF9A 5D8AC 2NP0A 1IKQA 2BEOA 2BBVA 1GZWB 4I0AA 3H3ZA 5FYUA 3SLIA 1AYM1 5K4LA 2A73B 3KS7A 5G04L 2DDUA 1LCLA 2TBVA 3DECA 4GWIA 4KBZA 3TWIA 4DIQA 5CFDC 4IEWA 2VZUA 2PHDA 2ET1A 4CUAA 3M3EA 1W6QA 4P9IA 3RZHA 2JG8B 3R0RA 4CEWC 2CDOA 4QDSA 2XHKA 3VBRB 3HIFA 3VDDB 2YU1A 2JE9A 4NHKA 2BOIA 3L2HA 1TME1 4QT6A 5FUPA 3ZLIA 4CTEA 1W9FA 2HH9A 1FV3A 3ZIWA 2D6NA 4LJHA 1XNBA 1VPHA 1N3QA 3UJOA 3IDCB 2OKXA 3AJZA 1PVC1 1O4YA 1SQ4A 2XWJB 3O1RA 1AUYA 4BLIA 2FZ2A 4AEDC 4WM8B 1N1TA 4FPYA 1J84A 3RZMA 3K4ZA 2JIJA 3TRSB 1REEA 1QHDA 4NROA 3PMEA 3E97A 5BNQA 1PGW2 2E51A 3GBGA 5ACA3 5DMYA 1RUOA 4Q0QA 5FY1A 4HLTA 3LPFA 5IVYA 1CAVA 1KDKA 3AK0A 4IE6A 4PJYA 1YXWA 4BIFA 2JG9B 1F15A 4Q4Y3 5H9SA 2ZGTA 4N9IA 4NPRA 5IATA 2DTWA 3AVSA 3MF6A 2HWF1 3S7IA 5DDJ3 2XONA 4LR4A 1S2EA 4U36A 1MS5A 1XNAA 1RUI3 1RUH2 1WCSA 2VTFA 1W3XA 3I2JA 3O0XA 4FOVA 3NV4A 4IV1C 4DRRA 5F37A 1OKOA 4I30A 5DAQA 5F5CA 2Q8EA 1OLME 2CGNA 1NT0A 1WLWA 4V2WA 2JDUA 1QJY3 1S0DA 2JDPA 3PHMA 3LCPA 4INDA 1ZA7A 1RJ8A 4MOAA 1VE0A 3UKTA 4Q2FA 4UFMA 2ZEWA 5CFDA 1S1AA 1AR61 4AVTA 5CIRA 1LEMA 4BQ5A 2P6CA 3CEWA 3MGUA 3POIA 4FQ4A 3O1TA 4M0HA 3PU3A 3VKFC 3AZZA 3ZYFA 4BZ4A 3QCWA 1ASJ1 5KR7A 1O91A 2WT2A 4Q4V3 2FD8A 1YYNA 4R8HA 4JDNA 3OGVA 2CWMA 1OF3A 1YFWA 5GZEA 4FFHA 3PUQA 4RR3A 2DU0A 3WF0A 3W21A 3T3YA 1NCQB 2PN5A 4XJAA 4P08A 2XLFA 3FHAA 1URXA 4K20A 1SFYA 5FPZA 2MEV2 3OUIA 1LGBA 5C3PA 4YVSA 3JXSA 3V0BA 2XB6C 2BNNA 2XVKA 4WM7C 5HBAA 4LBJA 1OLRA 5FY5A 3ZN6A 4XDPA 1AVBA 1W9TA 1I5PA 4NWWA 3OD4A 1P8JA 2MEV3 4IEPA 2HWB1 1W6QB 2PLV1 3AJYA 3FLRA 5JI7A 1JYWA 3RZGA 3N9OA 1VAMA 3AYAA 3ZYPA 3A7QA 4LO6B 1WA6X 4BCUA 4MHRA 3H8RA 5CKMA 1EV13 3ETQA 1QGLA 5GLUA 1EPWA 1DGRN 1SFPA 3RZJA 4CRQA 2ZCWA 2ADDA 2PHUA 2D5HA 3AFGA 4GWNA 4HFSA 4P9WA 4YW6A 4EN0A 1KGYA 1SLIA 3CL1A 4UW3A 4CUGA 3TEZA 3V0BB 2WN3A 5A32A 1AJKA 3TEWA 4O7XA 2QQLA 1NG0A 1ZBE3 4H3WA 3ACIA 5C3QA 1OD5A 2XLGA 1H0BA 4IDZA 5EXOA 1R081 2D6PA 1R1ZA 3SEPA 1QJY2 2YUEA 4JRAA 3U37A 1IG0A 3ZFEC 1N1YA 1RVF2 2V09A 4Q0UA 4WM7B 3V64A 1W9YA 5FRAA 1RUH3 1RUI2 4AFMA 1SCSA 4DY5A 1SCRA 5CG8A 1A3KA 4Q4Y2 1OFSA 5FUIA 4DB5A 2DBNA 5FYBA 2ZMNA 3VBRC 1PM7A 3EQEA 5C4WB 3HNMA 2RS31 5JAXA 2PHLA 4DMIA 2WNVC 3MV01 1CIYA 2R32A 4GMP1 1R091 2ENRA 4XMIA 4XUQA 2WL1A 4GIQA 1ULDA 5FQ0A 4JCKA 3BTXA 2VMCA 3AP6A 2G9FA 2WWSA 1RUG3 4MGSA 2UURA 2WA4A 4RGAA 4XUPA 5C3SA 1MS3A 2VMEA 2IXLA 4RD7A 3MIFA 1GSLA 2OS2A 3VD5A 3P5BA 4KNCA 4Y5Z0 3ZR6A 1M06G 1QKQA 1SBDA 3FMGA 2PTMA 1JTZX 3B01A 4OCTA 5F3EA 4DZGA 3Q9OA 2GH8A 1DGLA 4XXAA 1KEXA 4S2GA 4UF0A 1ZZBA 1QDCA 4Y4YA 4GWJA 4O65A 4D6RA 4CP9A 1WBFA 2GU9A 1J58A 4CDQC 4LHNA 2JJ6A 4XJ9A 1N3OA 1S0IA 3PMSA 4XJWA 2Q8OA 2VG9A 1W2OA 4W6WA 2KD7A 3H3LA 4OUEA 1UN1A 5T5JA 1RUD1 2KM2A 2VD7A 4YW7A 3HN1A 4XZUG 4YFZA 1BJQA 2BP6A 3LZZA 5D2AA 4LA3A 3AXDA 1UOJA 3AKRA 2P6HA 3AKPA 4NIIA 3RZKA 5EJ1B 2HWC3 2UWCA 4P9LA 2FQPA 3AKQA 5C33A 2RDSA 3ZFGA 4BK5A 2G1MA 4Q4X2 5HV0A 1IOAA 1UY1A 1VBD3 4XBQA 5FZ6A 2NPIA 1V6OA 5DDJ2 5C8CC 1FMD1 3HNYM 2Z69A 4XUTA 1UZWA 3VZJA 3WY6A 5JXHA 3HBZA 1MZ6A 3KGZA 3KV9A 1ZRDA 1ZM1A 2IVIB 2WO7A 3WG2A 4Q26A 4XDQA 1R1A3 2ZACA 2HWE3 2ZX3A 4ORFA 5A33B 3KHCA 5L7OB 3A4UA 2LS6A 2E31A 2ZGUA 4YGBA 5F2SA 4B4PA 1FX5A 4QKFA 3A0NA 5AC91 2R062 3V65A 1HQLA 4C8DA 2HEVF 1ZBA1 4QXKA 5J3UA 1HXS1 2B4KA 2DFBA 2XR4A 3WDYA 4PDWA 4AVAA 2X09A 3D82A 3NQHA 3AZYA 1RUC3 4GH4C 1YHFA 1NY71 3B69A 2EXIA 1ZBE1 1X36A 1S0EA 2O14A 2ZAHA 4ZS3A 1W8FA 3U14A 4BQ1A 5FP7A 5LZ6A 3KWVA 2VCAA 5FPVA 3UGHA 3JUUA 4XF0A 3C7FA 3PDQA 1W06A 2WNEA 1RXFA 4AG4A 4EN9B 1ZRIA 4BQXA 1AHSA 5I0DA 4PI2A 1PZ8A 3A23A 3AMQA 4A42A 1PGL2 2A3WA 1RUD2 4RQPC 4XEZA 2JDMA 4AR2A 2AUYA 2O1QA 3J7LA 5EQUA 1LOFA 3OUJA 2RMU1 3QOPA 5JXJA 1MQTA 3S6PA 4CDXC 4LKEA 5BUVA 4FT8A 4RGGA 3T2PA 1JYXA 1US2A 3AP7A 3R6SA 1SLAA 4DINB 4C0HA 1UMZA 3VBFB 2XDVA 1SDWA 3UESA 2WFPA 3M1HA 4N53B 3WP5A 3VL8A 4NRQA 3LB9A 3M7AA 1QF3A 2PHXA 2XJTA 3KF5A 3PVNA 3SH3A 3VDAA 2EICA 2RR12 2P3JA 3IB3A 2XUMA 5J1XA 1RB8G 1N1VA 1H1MA 1WMFA 4D7SA 5A3LA 1YFUA 4BB3A 5KHIA 4L2NA 1NCRA 1HV1A 1RUJ1 5CZKA 4BA6A 5BNPA 3OOXA 3OGRA 4UXAA 4ASMB 2Y8KA 4OI1A 1O7FA 2XOMA 2EIBA 3ORJA 1ASJ3 3MUZ1 1W8HA 5A3UA 4JHZA 3FUOA 2JDHA 1DYOA 2IUWA 2QFEA 4RSUA 5IT6A 1Y9MA 4G3YC 2OT7A 5LBCA 1N47A 2RS32 2XXZA 4QGLA 1VBB3 1PO13 3DPRB 5FP3A 1WMDA 4TLGA 1C3HA 5DZEA 4TYSA 3BPZA 1ULPA 4YGDA 2QNKA 3CIHA 4S2FA 2WBKA 1IQDC 1HV0A 3VZKA 1RUG1 4YG6A 2JECA 1RUI1 2ARCA 4OHVA 4WVZA 3ZFEA 5CG9A 3ZXLA 1NX9A 4JQRA 4AQSA 1OQEA 2ET7A 2QKDA 4FI9A 3AL6A 4EV0A 4RL7A 2OW4A 3U07A 2P17A 1O4ZA 4L11A 1LOBA 1SBEA 4XILA 4CDQB 3TNQA 3FUQA 2VO5A 3B9CA 1OA2A 1N1SA 3BUCA 2QQUA 3AYEA 4FPGA 1YCIA 3BVCA 4WM7A 2J1AA 3K3NA 5ERLA 2QQNA 5A7OA 2IC1A 2YFZA 4RN5A 3JB8A 4BXFA 1UY3A 1QEXA 2CAVA 2VULA 3USSA 4B4RA 3FL7A 1QQP3 4DEVA 5FZ1A 1NCQC 5A6XA 4UI9L 5A6QA 1FT9A 4FXGB 4Q4W2 2VNVA 3O0WA 3OPWA 5BNOB 1XYOA 1LOAA 3WF3A 2VBDA 3NJVA 3E6BA 1V0AA 3WF1A 3NSTA 1GQHA 1MZEA 1QWRA 5C5UA 1VJ2A 5IFTA 4H2AA 4EJRA 5T54A 1JU3A 3WDTA 2VNRA 3MBWA 3G7DA 3DUIA 4LNVA 3ZDSA 3O1OA 1X8EA 5DUXA 5GLWA 1UCXA 1O8SA 3IWZA 4RHV2 3RGBA 4BLJA 1I9RA 2QZ3A 4QXCA 5FAXA 3ZPOA 1B35C 1VIWB 3KVAA 3POEA 3DGTA 3W58A 1J1TA 4FPJA 4E4HA 5FZ8A 1ALYA 2QQKA 4AGRA 5ABJC 1VBB2 2WO3A 2E53A 3DEMA 2W1SA 4GH4A 1FAYA 2XVLA 4N90A 2BU9A 2DFCA 2E26A 3UYJA 4ATFA 1NE6A 2VECA 5JOXA 2DUQA 1ZZ9A 5HCHA 3OY8A 1LR5A 5A1FA 1QJEA 2BJSA 1ASJ2 1GOHA 2Q30A 2Y6GA 3J9SA 4IGQA 4XQ4A 5JZGC 4I01A 1XSRA 1ACCA 1H4GA 1HJFA 2HEWF 4CU9A 1OLQA 5EV7A 1FNZA 3QD6A 1OUXA 4HK9A 5F5IA 4B7KA 1JZ4A 1PIV2 3W9AA 4M0NA 1UZZA 3APBA 1CPNA 2F4LA 1RUF1 2Y0IA 5L9BA 1Q8QA 2A75A 2GDFA 3WZ1A 1F5FA 3MI8A 4XHBA 1G9CA 3WNLA 2R071 4IV3A 5AC92 3WDXA 3H7JA 5SV5A 3RWNA 1W8WA 1HN1A 2VMDA 2VOWA 1QJU1 5F32A 4LITA 4XFGA 4AHYA 4AXOA 5ABJB 1GMMA 1ULFA 2K0GA 1MQTC 3WG4A 3ZX7A 4S2HA 3V0AA 2Y26A 4L9BA 3RDIA 1DU3D 3H9AA 2JKBA 1WLDA 4QM9A 2AR6A 2VXRA 2VUCA 2WWUA 5TSWA 4AYUA 1VBC3 4P02B 2DUOA 1DQ4A 3B93A 5E16A 5I8TA 1XJAA 4MV2A 2DV9A 2W1QA 3DPRA 1YEWA 2P3IA 5FZ7A 1DGWX 4QU1A 1OURA 2RJKA 3H3UA 4N8MA 1KRIA 5J48A 1UIKA 4DXTA 4RS5C 4K6BA 2GH2A 4LBMA 4YZ2A 1RMU3 4AEMA 2JG8A 4OVEA 4Q8KA 5FPXA 5LATA 5KHJA 5D8AB 2XL7A 2D7FA 4D6SA 1VBA1 2XKPA 2W52A 4GALA 1GZCA 1UU6A 2BNOA 2LW8A 2ZGSA 4BDVB 5C71A 1BVVA 1VBA2 2W68A 3DKWA 5I93A 3NNMA 3BGAA 3FHIB 1JOPA 3N9QA 4N43A 3LA2A 2BVBA 4QX7A 4Y1XA 4DFSA 1V6JA 4KG8A 3SXWA 5JOYA 1W2NA 1QH6A 1O3SA 1UPIA 5JSOA 4ASKA 1KITA 4AAPA 3NV1A 1L7RA 2JDAA 4I0WB 4UFKA 1OA4A 4FOYA 3M2MA 4XURA 3ACHA 5FZOA 1HX6A 3ZXGA 5HCAA 5A6ZA 1US3A 1Y43B 3PTYA 2R1DA 4JTOA 4Q4X3 5JCTA 3W20A 1H2LA 1JN2P 5FY7A 2R1BA 1UXZA 3B02A 4XBNA 1J3QA 2VUDA 5LBBA 3SEEA 4NHLA 5JIUA 2WNVA 3WW4A 2FDIA 2WC2A 4HKLA 5FZ0A 4XQDA 4BQYA 3AM2A 3RWKX 1GYKA 1FMD3 2DCJA 2ZMLA 1I5ZA 1UKGA 1QJU2 4Y33A 5ANNA 3D5OA 2EAAA 5HXMA 2VH9A 5FLHA 3ZYJB 1V9U3 2W9XA 4LO8A 5BV6A 5B4NA 4LBKA 4O9EA 1HW5A 1QOSA 4QX5A 1WA4A 2ZGLA 4L97A 1X82A 5HCFA 2D93A 2J7MA 3IIIA 1LOCA 1RUF2 3LKJA 1LULA 2EXHA 2I07B 3I2OA 1WBLA 3CMGA 4BXSV 2C0ZA 4PHZA 2PYTA 2VBPA 5AVPA 4BK4A 1W8ZA 1POQA 3LEGA 3UV9A 4QPWA 3V0AB 1AR92 1HRI1 4MO3M 2AREA 2Z2SB 4JGYA 4CP2A 1VR3A 1WD3A 4XF1A 3M8LA 2GN3A 2C6SA 1W3VA 1EP0A 3HR9A 1DDLA 2JDYA 4OI4A 4LMFA 4HANA 1NOVA 2GC0A 3WHTA 3HN3A 1AR71 1C8M2 1GZWA 2N7GA 5A1LA 1YC61 2WABA 4AVCA 2ZZJA 3VD9A 1XE7A 2WS93 1MEC3 1KFUL 4QQHA 1D4M1 3X29B 1KFXL 1S55A 2XMLA 1CAWB 1CPMA 2EXKA 2XKOA 3VUOA 1OI6A 4LE4A 1B09A 5F5AA 1W05A 3GJBA 5GLZA 1AZDA 1GBGA 4FFIA 1GANA 3AXEA 2LRPA 4GKXA 3VKLA 1BZWA 3Q8EA 2CY6A 3TEYA 4DXZA 1LHNA 5FY0A 5LWBA 5JZGB 2RR13 4P5HA 1DP0A 2LM3A 4DS0A 5IK5A 3ZVXA 2ZGMA 2FCUA 3AVRA 1A78A 2UY9A 4PBOA 1A8MA 4QMAA 4BIOA 4YM2A 1AX0A 4IL7A 2WNVB 1JU4A 3AX4A 4MGYE 5L9VA 1DHKB 1ND2B 5APAA 5CFCC 5FOBB 1XOYA 4RFT0 2D3SA 5FP9A 1Z78A 5A3PA 4MGTA 2HWD1 1WCDJ 4ISRA 5FYHA 2VR4A 3JD73 3ZMNA 3LE0A 3N7MA 3NRUA 2XJRA 4OYUA 3VHNA 2DU1A 3BOPA 1R093 1REFA 3B3QE 3USUB 4FPLA 5T55A 4XJUA 3UGGA 3D3AA 3H1YA 5KC6A 2FDHA 3ZIXA 1CAUA 1ODMA 3HQRA 3PTRB 3R4DB 2IZWA 3WT3A 4F83A 2E6VA 4LOTA 1M4WA 5C3OA 4XHXA 1O6UA 1RUG2 4SBVA 1O5UA 1COV2 2DCKA 1W8TA 2YZ4A 3ILRA 2OZJA 4FCAA 1FPN3 2E7TA 2ZPXA 3ABZA 4ES9A 1OOPC 5FTTC 1NLQA 5DG2A 1Q8SA 2EIDA 4EWEA 4V1PA 1OC1A 4LBOA 1H8TA 3FBMA 4J6GA 5JVVA 4WM8C 2JX9A 4BU2A 3VD4A 2WT0A 1SPPB 1DZRA 2Y38A 1LODA 3KT1A 3PUHA 3AMMA 4KL1A 3ST7A 2GP3A 3D6EA 3OUHA 3ES1A 2FDGA 1UY4A 3S5QA 5T5PA 4BQ2A 4ES8A 1RUJ2 4YM3A 2YPJA 1JZ8A 5T50A 2VQAA 4BQ3A 1HJGA 3B5LB 2YGLA 4E8CA 4GQ7A 2KR2A 1OH3A 3H42B 3H8XA 5ANQA 1JH5A 1BHGA 1H9WA 5D8AA 5A3OA 4FBFA 1W9WA 5FZEA 4HXCA 1W0OA 4Y5SA 4YPJA 1GV9A 1H4HA 2AEZA 2D97A 3T08A 2ZGOA 1OKQA 4TXWA 2VZVA 2RMU2 2B9UA 2ZEXA 3K4AA 5FY4A 1QJFA 3SISA 1X33A 3Q8AA 4ZHNA 1LB2A 4ARXA 4C0BA 3KCYA 4CEWA 2VCCA 4YSFA 4KWJA 4W50A 3MIHA 4ZPIA 3T1LA 3RZLA 3KZ4C 1DQ0A 1W6PB 1C8NA 2BVVA 3I8TA 2WNUB 3J8F2 1W6MB 4G4FA 2GMPA 4PLOA 4OQ8A 1IS5A 5FZCA 1OD3A 5C8CA 3OY8B 1PZ7A 1UKRA 2HYKA 4EZHA 2BPA2 4MSVA 1WZXA 3IZOA 1YLLA 1TMF2 2VQ0A 3LPGA 3P3PA 5JSPA 2B7YA 2FCTA 4PDWC 4HETA 4PCRA 1NY72 3WXPA 1MPXA 3PU8A 4Q0SA 3N9MA 4B1MA 4YW1A 2P1BA 2D6LX 4AOCA 1DQ1A 1ZBA2 2QUOA 4LO7A 4CCMA 3WNOA 2VMGA 1EV11 1OBNA 2WFF2 4I02A 4A7KA 1ND3C 4D0QA 4FTBA 4KBBA 4Y1UA 1WW7A 2YROA 4YW2A 1CAXA 3KQRA 3KVBA 3N7LA 4IEUA 5LASA 3TN92 5HI0A 5B2GB 1XXNA 1CONA 1LOGA 4AEKA 1F35A 4CSWA 3RMXA 3VZMA 2Y64A 3O0VA 5DUVA 5A7SA 3LGRA 1T6BX 1GU3A 4BISA 4QQ2A 4M3CA 3JD71 4LULA 1RXGA 5FWJA 4AQ6A 4LBQB 3SCGA 2BOJA 2WLPA 1MS1A 3VBOC 1W8OA 3WQBA 1HB4A 3J7HA 4YWAA 1OMIA 1BEV1 5IWFA 2F17A 3C7EA 3BYWA 3SKVA 4JVAA 4HVOA 2C4XA 1PVC3 3U0ZA 3WINE 1RJ7A 4EQVA 2GN7A 4UFLA 4NMIA 5T52A 3OB8A 1O3RA 1BYHA 1CJDA 1NE4A 1Z7S3 1RYYA 1BLZA 2Y6HA 4AL9A 4ASLA 2RDQA 4RYDA 4ZY9A 3LOBA 3WP3A 1QDOA 1S4CA 3H50A 4P9JA 1RMU1 2R0FA 4QX1A 2A6VA 2WJSA 3K4DA 4TLFA 1UX6A 3R05A 4EWAA 5A3NA 4QX2A 3KGLA 1OT5A 5KC5A 4CDUA 3KLSA 1V6IA 4N53A 2VZ1A 5A7PA 5LRSA 4AI1A 1AL21 5J96B 5KHGA 3M70A 1AL23 3O1PA 2Q5TA 2ZGPA 1W90A 5IVCA 2W87A 2YFUA 3MPBA 4KU8A 5I0TA 4JGZA 4AFCA 4YW4A 4NUBA 3DL3A 4IEVA 1CZTA 2WZEA 5IW0A 3ZFFA 3MIDA 3OPTA 3PUIA 3FE5A 2OQ7A 3LIGA 4OHZA 3I3QA 5A3MA 1R092 3J8F3 4NOTA 5JDBA 1W39A 3I3EA 1AR73 5FMOL 2R073 2J42A 3C2UA 4UF0B 2PHFA 3A22A 4XUOA 1TZOA 5A7NA 2CV6A 3THDA 3BIEA 1A34A 3JD72 4DXSA 4E9KA 1PM4A 2V73A 4JV4A 1CJPA 3JBG3 4AK3A 2NZ9A 1W6OA 4AVBA 1YQ8A 3OF1A 3ZYGA 2WINB 2XBO2 3OTFA 1RL3A 5CYYA 3U78A 1V9U1 2BTVC 2WFF1 4MXVA 3FC0A 1J3RA 1JYNA 4L99A 2VNGA 4GXLA 4IW3A 2WZ8A 4CCLA 4YVWA 2D5FA 4XTMA 4DPNA 1R082 2WYSA 1W6OB 4LE3A 5FO9B 3AYCA 3J26N 4K7JA 3VDCA 5LEJA 3M3CA 5C4WA 3BTYA 3WDWA 2QQVA 2ARXA 4P9YA 1GP4A 3FFQA 1ONAA 2BFUL 4DOUA 2PQQA 1VB2A 2PFWA 4JGYB 2WAOA 2VNOA 4B7EA 2B5HA 1WW5A 3VZNA 3RYRA 3BOWA 3GGLA 2R063 1AX2A 1RHI2 1AR81 1NZIA 4LEJA 3ZM8A 2WSVA 4EN8B 3AFKA 3KSCA 4TZDA 3E5XA 4HG6B 1ZZ8A 3MO4A 5FDBA 1R1A2 1LHUA 2VUAA 2W0XA 4QQPA 1XE8A 1WLTA 2CHHA 5D21A 4CPBA 4E4ZA 3N7KA 1MVEA 2HYXA 3UKNA 2BZDA 4YVSC 3SH4A 3CJIA 4GB31 4I3GA 2A6XA 1DGRA 4XC9A 4C1XA 3NO8A 2FDKA 1UMHA 2RE9A 2W08A 5L7OC 4H14A 2Q8CA 1GQPA 1PMJX 2QBXA 2WWJA 4QPGC 3WDUA 1OH4A 1VMFA 2YBKA 3BI3A 3GBFA 1BQPA 2A3XA 4XIKA 2H0BA 4YW5A 5AFBA 4FQZA 2YPDA 4MADA 1O3QA 1BMV1 4UFHA 3WNKA 3ZO0B 1CZSA 2ZEYA 3E6CC 4XBLA 1H2MA 1XNCA 4XE9A 4CZSA 4Y20B 1LRHA 1QXJA 2NMOA 3ZFFB 1IS3A 1O3TA 3JBG2 5DUUA 4XFFA 4JKMA 3V56A 3ZXDA 4AGVA 3IMMA 1AR62 5BNNB 4R9AA 1SMVA 3WW1A 2QDRA 4YVSB 4QPGA 2D3RA 1ZBA3 4KGQA 1CESA 1YFYA 2W5FA 1GWKA 4XACA 4Q27A 5B4XA 3SMHA 4CP0A 5JLVA 1DCSA 1JBCA 4JTNA 5FZHA 2WIIB 1YJKA 4XVHA 1REDA 3M3IA 4IV1A 3RVHA 3T4VA 1X50A 2JWPA 2G9GA 5A33A 2XHNA 2OVUA 4ZU7A 1QJX3 1Z0HA 2GMEA 3RNSA 5CEHA 2KXLA 3VV1A 1D0GA 4YZ1A 2GC1A 1AX1A 3ACFA 4LUMA 3AL5A 3KD4A 2VL4A 1IKPA 4ISQA 4YW3A 1ULGA 4K9SA 3T0BA 4Y1YA 5IHRA 5A3WA 1AXKA 3ITQA 2VAUA 3CDZB 1DQ6A 4FVVA 1LENA 3TYJA 2ORXA 4FO9A 1PGW1 2ARBA 4I09A 1JZ3A 5FYVA 4YZ5A 4BQWA 2QQJA 4FOWA 4QQLA 5LEKA 2ARAA 2YDEA 1U5XA 5F6KA 1PK6C 3BU0A 3AKTA 1ZA4A 2WAAA 3LEIA 5IVVA 3K48A 3W5MA 3WNMA 5CADA 4WVWA 3D8CA 5JOWA 2RM23 2P4EA 4I2OA 1PVC2 1TNRA 3BPSA 4AE2A 5ABJA 2D44A 3WP4A 2AC1A 2ID4A 5BY5A 2QQIA 3PVEA 1VRH2 1QXRA 3LOIA 1RUE1 2LROA 3CJXA 5IK8A 1CGPA 5CVRA 1K5MA 5LK5A 4NIHA 1TME2 2DURA 3GCWA 4YNIA 5T3NA 3SQOA 1MS9A 3WUDA 1LJ7A 2ZGNA 1JMUB 3OG2A 4MVTA 3IMNA 4LKDA 3I97A 2IXJA 4A7YA 5CFCA 4IUGA 3RJRA 3GZUC 1S0GA 1G8WA 1Y9QA 2BUKA 3MIBA 4K21A 3NJXA 4FPCA 3BU7A 3VBHB 2NLRA 5IAVA 4HVQA 5CISA 2GZWA 2VZ3A 2HWC1 1LKNA 1SBFA 1F4AA 1Y9GA 1K12A 3VKOA 1NKGA 3P3NA 1LOFC 3I3DA 3K75B 4KQ7A 1CD3G 5FMDA 5J36A 3O1VA 2FBEA 1CAXB 1BVP1 5LRRA 2ADEA 3I4IA 1ODNA 5ISLA 1DLLA 2K46A 3H1WA 4CU7A 1VRBA 1JHNA 4M00A 5C9AC 4JGYC 1GP6A 5BNOC 4ZXEA 1WD4A 2HWB3 2OPKA 3ZR5A 1V6NA 3KV6A 5J98B 3UGFA 2OUJA 2WSUA 4WV8A 4XTPA 3RPQA 3KV5A 3LDKA 4D7TA 1Q3EA 2I45A 4URTA 4HKOA 3IN9A 5BNNC 4AVVA 2VTXA 2CDPA 1O5LA 3K2OA 2R7EB 1EUTA 3F95A 3MFAA 2WNOA 1UD1A 1V00A 3CLPA 3B00A 1PO11 5G05L 3O1SA 4IETA 4GZ9A 4NJ4A 4IGPA 3TNPB 1HKDA 2RMU3 4FP2A 5IVJA 1K45A 1WUVA 2GSYA 1QU0A 3C7OA 3FHQA 2F6BA 5FR3A 1FOD1 1G9DA 4TTGA 2OX0A 3U4XA 2JICA 3HVDA 1W8NA 3LFMA 5L9RA 1JZ6A 1STMA 4HN0A 3WQ1A 2W92A 3VB9A 3WNNA 2MHFA 2Q1MA 5EWSA 2K9ZA 1S0JA 4E4SA 2IFRA 5FMOS 2VZPA 2EF6A 4NHYA 5FMCA 4P14A 2AACA 1PZ9A 2D98A 2X5IA 5FYCA 2X8KA 4Q4W3 1Y3TA 4CCCA 1YQ6A 4AEJA 3I3BA 3ETPA 4NAOA 4UYBA 4NHMA 2DVFA 2QE3A 3ZYBA 1NCRB 2AYHA 2ZGKA 4A3ZA 3CBNA 4NN0A 3RS6A 3WG1A 5LW9A 5K0UA 1SLBA 4OZOA 1IG3A 4BMBA 4N43C 1RUE2 1X7NA 4NAMA 3KHBA 2VZSA 4OHXA 1VRH1 3RMYA 1OQ1A 2VCBA 2J22A 4K8FA 4JGZC 3SCHA 2GP5A 2XJPA 2XQRA 5FZBA 5A7QA 4OULA 1XE0A 1K42A 5FJKA 5LA0A 2VZRA 2P5BA 2OXBA 5JPMB 2W94A 1PO22 5E1RA 5DPNA 5K7PA 5JSRA 1LHWA 2J1UA 2LTNA 3LEMA 4FTSA 5E89A 1NZCA 4AI2A 2Y6KA 5FZDA 2WQ8A 1MZ5A 3LA3A 1XB9A 2JDZA 2GMMA 2VVEA 3N9NA 4IQPA 1BBT3 1PNFA 4X8PA 1C5HA 5IVBA 4H7LA 1W28A 1Q56A 3CJIB 4JGZB 4FPFA 2HWF3 2ZX2A 3NJYA 3OBZA 4D6QA 4UBHA 2YXSA 5FOJB 5BXXA 1UZVA 2WA3A 3AZWA 4ZU4A 3IAPA 2RDRA 2ZS6B 4ITCA 4MXWA 4PIZA 1PK6A 4RR3B 3WQ7A 1NA1C 1ULCA 1PHMA 4X6QB 4L92A 4P5YA 3VHPA 4HOOA 4YG3A 1QNYA 5C4WC 5FBZA 3NV3A 5FWEA 3T2TA 5IVFA 5BPXA 4FPHA 3WSOA 2W1UA 2WZR2 2CAUA 2YC4A 4Y20A 1WLCA 5F3IA 4J25A 4J1XA 2P3YA 4QAWA 2UU8A 3CNAA 1HRI3 3IBMA 4JDMA 1SEFA 1RUJ3 4P9XA 4YVWC 3VBUC 4WBBA 4AF9A 1BKZA 3WP6A 1E57A 1EY2A 3NAPC 3JBG1 3ROUA 1FYUA 1AYN2 1OPOA 3FX3A 5EFUA 3S7EA 5ACA1 1H8VA 3NKTA 3WUCA 2AENA 1W9SA 1FXZA 4MGQA 2JE7A 3IPVB 5LBFA 3RZZA 3WQ0A 4MGZE 5DAVA 5FY8A 3RFRA 2X10A 2VTXJ 1G7YA 1VBB1 3NW4A 3OYWA 5GJ6A 2YC0A 5C6CA 1ZREA 3CO2A 1O4TA 4QWNA 1QJX1 4GB32 5H9QA 5F5QA 1B35A 3I2FA 3POGA 4YGEA 5GZDA 1SACA 3I3MA 1QY4A 4LQRA 3VZOA 4HK8A 4XF3A 5IYYA 3KB5A 2VZTA 1ND2A 4QB6A 3NAPB 1R1A1 2V5DA 4URAA 3MW2A 4XZPA 2ZTNA 4FPKA 1C57A 1DYKA 3DYOA 5IJRA 3VBSC 5JR7B 3KMHA 5IAXA 1AR82 1RHI1 1YQ2A 1H6YA 1BBT1 4A3XA 3ZN4A 5JI9A 4ATEA 3DYMA 1W2AX 5I0SA 1YIFA 2QQOA 5FK7A 2VZQA 1OFNA 3ZPYA 3R4UA 3FLTA 5H9RA 3I59A 4COVA 2WQ4A 1QQP1 3C7HA 5F6LB 4QPGB 3D0JA 1JUIA 5F3GA 3AMPA 3GALA 2ZHMA 4K3UA 2V5YA 1UNBA 4QXHA 3ZXJA 4CE8A 2DVBA 1IPSA 2LALA 4JQTA 3PURA 5I0UA 3K3OA 2ZZQA 1PMIA 1IPKA 2VOTA 3FFZA 4LXLA 5FLIA 2CGPA 2WT1A 4EWDA 2VPVA 1TQ5A 1VBD1 5DG1A 4FXKB 3M3QA 5FPUA 1QXPA 1JYTA 3ZSJA 1KS5A 1UIJA 4HPKA 2WNUC 5FZ4A 3LFIA 3PL0A 4BH9A 1HQNA 2DCTA 1GQGA 4EROA 2Y6FA 1MEC2 2BGPA 3C7GA 1SLLA 1ULOA 4QX8A 4QX0A 1OOPA 3HEIA 3VBOB 1ZYBA 1NA1B 2A71A 3CZJA 2YGMA 4IGOA 1C8M3 5EJZB 3VD3A 5A1AA 4I0BA 2P2KA 3MLLA 2ZGQA 3O12A 1PK6B 2XLAA 5DAWA 5EJ3A 4ZKTB 1VMJA 5JMCA 2FHRA 2D6MA 4OQ9A 1H30A 2XJUA 4DUXA 4FAGA 2XWBB 3O5SA 4N43B 4E4DX 4RHV3 2VCMA 2D40A 2ZAAA 3IDBB 4CDUB 4L8QA 1XBFA 2O8OA 1H9PA 1Z7S1 5C70A 5LBEA 1YNAA 5EYXA 1K3IA 1SPPA 4GJZA 1UW8A 1RUF3 1XYNA 4CCEA 1AL22 3GCXA 3IM0A 3NNFA 3E5QA 4QGMA 1Q8PA 1TE1B 2XJQA 3I2GA 5FK8A 1IZ3A 4ARYA 3MIGA 2CL2A 3H8OA 3PUAA 2Q1ZB 3O7OA 3I2KA 3VZLA 2ZA9A 4CA9A 2DYCA 4CCJA 5LA1A 5C9AA 2RS53 2A5ZA 2MPFA 3P1IA 5FV3A 2RS51 5FZGA 4ZXKA 1AL0G 3LSEA 2K2SA 5FZOB 3NMBA 2YBPA 4IEOA 2Z5WA 3SH5A 5FQ0B 3T0DA 2Y6LA 5FZKA 5A3TA 1UOFA 5FKCA 1NQDA 1PGL1 2GNBA 2W95A 5LA9A 4RQPA 3IPVA 1RVF3 2RS11 2WZR3 4YM1A 4YFWA 5FZIA 3AC0A 1EAH1 2XVGA 3THPA 5I91A 1BK1A 1GFF2 1BEV2 3KT4A 5E88A 2IFWA 1MVQA 3DF0A 2VMHA 1IQAA 2JG8C 4CEWB 2D6OX 1PIV3 4YRDA 5KXCA 1CR7A 2C26A 4F7ZA 2O8QA 2UYBA 2R16A 4RFRB 5CA6A 1ZBE2 4XPVA 2PXJA 2R30A 3NNGA 5KXEA 4JKKA 1S2BA 1ENRA 2A6YA 2J1RA 2GNMA 3IKWA 4OI2A 4A41A 5DAPA 3ZFGB 4W65A 3UNPA 2VOXA 1AXYA 5FLJA 1MS4A 5GALA 1SHWB 1EV12 1WMEA 1QOTA 3BTAA 4GJYA 1H6XA 2WFF3 4IEQA 4Y22B 5CB7A 2VC9A 1VBC1 1NUKA 2VVDA 1W6NB 3VKNA 3WNXA 1RUC1 1YRZA 2PHWA 4A6SA 3O14A 5A6YA 3W5NA 2MNGA 4XABA 4CYDA 3VHOA 3Q8FA 1TMF1 4AHXA 5DDJ1 1UOGA 4LOSA 1C4RA 1NAEA 4X6RB 1HRV3 1OOPB 2W91A 2YV8A 1SG3A 3G6JB 1GNHA 5JWPA 3VDBA 1H8TB 1YIPA 4KU7A 4PLMA 1OXCA 2FDJA 4QHOA 1APNA 3EMRA 4IV3B 4Q8LA 1EAH2 1K5MB 4UOJA 4CEYB 2BFUS 2RS12 2VXJA 3WNPA 4XIOA 4QDQA 2DVAA 3OBTA 3RYPA 5BNPB 4LHSA 4AFAA 1LGNA 2VQTA 1J3PA 4YM0A 5T5LA 2GALA 4BQ4A 3OGGA 3ACGA 2RS52 3AZVA 3ON7A 4IV3C 2RJLA 2XPJA 3U11A 1BXHA 1ENQA 1TME3 2VMFA 3OCPA 1TVGA 3VBHC 2C9KA 1SLTA 4OI0A 5CBLA 1PX4A 1HXS3 3GZTB 1R64A 2D43A 2JE8A 3U75A 4F3JA 5L36A 5IK7A 2UWAA 3QBQA 3MICA 3POYA 5C9AB 2B46X 1CAVB 4F8AA 4GH4B 4LBNA 4RS5A 3LDRA 4Z07A 3MLJA 3GJAA 2Q0AA 5KHHA 2RG4A 5GLVA 1Q8VA 4E2GA 4FSJA 2SBAA 3PIGA 1F31A 2D6KA 1JYCA 1N3PA 4L0PA 4C91A 4PIXA 3HT1A 5LA2A 3GZAA 4W4ZA 3TEXA 4AHZA 2W39A 5FPBA 1UOBA 3ZFFC 3WVJA 2G19A 2OZ6A 3GZEA 5KXBA 2DCYA 4XXPA 2EA7A 3WR0A 2DWRA 3H8UA 3RI8A 5C8CB 1UYYA 2ETEA 3DN7A 1SLCA 3BODA 4HONA 4MG2A 4M4RA 4Q4Y1 1COV1 1POV3 3CF6E 3ECQA 2BGCA 4QXBA 3S30A 1OLMA 1VBD2 2JG9A 1GLHA 4LHLA 3BIWE 4XFAA 5FO7B 1HRV1 3QH7A 5T5OA 4OMCA 1FPN1 1ZZCA 2R6QA 4GAZA 5DXDA 4A7ZA 2Y33A 2AGSA 3POJA 4XFBA 1TEIA 1L7LA 5FIXA 3UKVA 2JD4A 4AQ2A 5FY9A 5LCWL 1GWLA 3MUY1 1ND2C 2UYAA 4HKWA 5CU1A 4BHPA 3HMYA 4X8NA 4IE7A 2OQ6A 1CX1A 4Y5TA 1Q8OA 1IS4A 1DG6A 2RHPA 3H0OA 3VL9A 1UU4A 1JZ7A 1E5RA 1W99A 1QQP2 4AQTA 4EN7B 4B4QA 2DBIA 2JXAA 4HSJA 4SLIA 1GZTA 4PI0A 3MV11 3ZXKA 1S0FA 2ZJCA 3RRDA 1LESA 4MZUA 5CKNA 2VMIA 3VBSA 1VAVA 4D69A 4QD2A 3ILNA 4HSLA 4N7IA 1OA3A 4AWDA 1DYPA 1Q43A 4QKDA 4UW5A 4NE9A 4H55A 3OGJA 3UETA 3N3HA 2PLV2 3ASIA 3NNLA 4J1WA 2QQWA 2TUNA 2H6CA 1VP6A 3N35A 4AZZA 4M01A 1RITA 2YMZA 4XCBA 3GXUA 5BNPC 2ZOEB 1NXMA 2ZX1A 4XW3A 4C90A 2YBSA 4W6YA 2DVDA 3POSA 4Q4V1 4A44A 2QQPA 4HL0A 2VW0A 1VBE1 3HWJA 5FYMA 2MEV1 3DV8A 1D4M2 4H7MA 2VW1A 1IHMA 4XF4A 3T2QA 4AEDA 3RQ0A 4C1WA 3NV2A 1RHI3 4LTAA 2E33A 3OBRA 3TAYA 4PQQA 1J1LA 5DAXA 1ENSA 4B29A 3JZVA 3AP4A 1EPZA 5EP9A 5FMBA 3ZXEA 2TNFA 4Z92B 4DEQA 1WW4A 1D4M3 2BNMA 2X53S 2EALA 3MLKA 2BRTA 5ACA2 1UPSA 4Q0PA 1C1LA 4KH9A 4AW7A 2JB8A 3IDEA 4CU8A 2W2IA 3MIEA 3U1XA 3BB6A 1CX4A 3POBA 3N4MA 4EYUA 1AR91 1HRI2 1XNTA 3I7DA 3I59B 1AR93 3Q8BA 1MS8A 4IESA 1GKBA 4TWTA 4B1LA 2ZEZA 1OUSA 1PGSA 2WZR1 1XU1A 2J1TA 3PUSA 4PQ9A 4YGCA 1S0CA 2OA2A 2EXJA 2BDRA 4QHBA 1NLSA 4FFGA 3VLBB 4DY3A 4LKSA 1U5IA 3DPRC 4CDXA 4FFFA 4MUVA 5GM0A 1AR63 4KWUA 2VOKA 1OSGA 2XBO3 5IFPA 1H2KA 2QJVA 1F8VA 4XUNA 1BK0A 3RSJA 5FBJA 2HWF2 5FXZA 4FP3A 4Q1PA 1VBE3 4BOWA 1B35B 4OMDA 1DZTA 3N9PA 1U5ZA 4YYOA 3VGIA 4WVMB
chains in the Genus database with same CATH topology
5EZWA 4IXLA 4MH0E 2O0OA 4OUSA 3N7JA 1XNDA 1CAWA 3WW2A 3VBOA 1MS0A 1ZX5A 1H2NA 4O9GA 3L2YA 4ONUA 1QMJA 4DRVA 2CYFA 5FCCA 2A7AA 1ZNPA 1IPJA 1ND3A 1A6CA 2IWGB 3CU7A 2G4IA 3UL2A 2HEYF 4QPYA 2ATFA 4U2AA 5K0UC 4B3NA 1FATA 3ZN6B 3PLQA 4XFCA 2C9AA 3OJBA 4LBQD 2ZMKA 1MR5A 4XQWA 1GR3A 1LOEA 4E2SA 4CDWC 3RI9A 4IEXA 2JEMA 2IXCA 4XETA 3ZXAC 1NXD1 3QLQA 3OD0A 1W6NA 2GC2A 4M3CE 3BALA 1FOD3 1AYM2 2B8MA 2ZX0A 2XGXA 5L19A 2PLV3 2QCSB 5E8AA 4OZXA 5CFCB 1OQDA 4QGNA 3WG3A 4DQAA 3VN4A 2E63A 2R043 4S2DA 2Z42A 3HT2A 3J4UH 2BWAA 1POV0 3ZSLA 1MACA 2DUPA 1DFQA 5CNAA 2GNTA 1CN1A 3EHKA 3L9JT 1KS4A 4OUMA 3VKMA 5AC91 1U12A 3VUOA 1VB4A 3SHRA 4WZFA 2VW2A 2R072 1HIXA 3WHUA 1HLCA 1EAH3 1RINA 2BWCA 4LBLA 5KXDA 3AP5A 5BNOA 2Z79A 4M3CB 3EO6A 1PIV1 1TMF3 1NQJA 3VBFC 4R9CA 3VBUB 4CDWA 1S2KA 2XG3A 5D1IA 4BWOA 3WOGA 2CWSA 1CQ9A 1H1AA 1VLNA 1PVXA 3ZFGC 4CEYA 4XFHA 5AVAA 4OFGA 5CFDB 4LUKA 3KM5A 3M3OA 3BCWA 5KWRA 3ZFEB 1VBE2 2X5IC 1S0BA 4Q4V2 3GBWA 4XJZA 4RHV1 1POV1 4GULA 3WDVA 1LTEA 4EWAA 4CEYC 1W6PA 1ZVFA 1TNFA 4D94A 3MW4A 2I74A 4AFBA 1BEV3 4NWVA 4Y24A 4HMZA 1AYM3 4N9HA 1UZYA 4AEDB 4Q4W1 3WW3A 4CDQA 3RYKA 4UW4A 2UWBA 3JU9A 4Q1RA 2UY8A 3IIAA 3WV6A 2WS92 1G6NA 2QDNA 4IV1B 1NYWA 5K9YA 2A70A 4UBGA 5GZFA 2JG9C 3ZMOA 1FPN2 4Y22A 1HRV2 2EVXA 1NA1A 1KJLA 1KJRA 1V70A 3TBDA 2DF7A 1RUNA 2XL9A 3WD5A 4G9SB 1H1IA 3C3VA 2PAKA 1C28A 1DQ2A 2TEPA 5KHKA 4R9DA 3PNAA 4FAHA 1WGPA 4CDWB 2R041 5HXVA 1I6XA 3QH6A 1JXNA 2GC3A 3I2DA 1BCXA 3ZN5A 4AVSA 1AYN3 1YO8A 2XJSA 4XOGA 4Q0VA 3WCRA 4E27A 3EXUA 1BMV2 3ELNA 3NJZA 4PDWB 4K1YA 4YZ3A 3WX5A 1GICA 2RR11 2ZGRA 3TOJA 3VHRA 2X29A 1MQTB 1JYIA 1YFXA 3CJIC 4LT5A 1DGWA 2ES3A 2GNDA 3MEPA 1ND3B 3ZSMA 2IXIA 2R0HA 2WLQA 3JQWA 4XJ8A 1LHVA 1LGCA 3UJQA 2E7AA 4Y1ZA 2ZHLA 3AKSA 2CGOA 3KT7A 4AFDA 1F2NA 1RUD3 2E7QA 3QACA 4RR3C 3TB0A 1J59A 3VBFA 4MYEA 3WCSA 2DCZA 4EN6B 4COWA 4OI0A 1RTVA 1T6GC 4JAAA 4MXWB 4YVWB 3EBRA 3WZ1A 2DVGA 3JB4C 4GMP3 4CP1A 1KXGA 4Y1VA 2VGDA 3MPPG 2H6BA 1COV3 1ULEA 4R52A 1XU2A 4KGGA 1IS6A 4COUA 1D2SA 5SV8A 2RM21 1JW6A 2VU9A 3S0MA 1GZ9A 2WZPP 4BPZA 2VOVA 2P3KA 1MZFA 1R083 4CDXB 1RUC2 2PHTA 2BW8A 3OPZA 4PIYA 5BYNA 1HXS2 4BYYA 1VBC2 1XYPA 3NKGA 2R061 1V6MA 4K40A 4BE3A 3LSDA 3PJYA 2ERFA 4WZCA 1V9U2 3AB0A 2XBO1 2ZABA 4XF9A 3INAA 4Z8BA 1G9BA 2PAEA 1YJLA 2HWE2 3POWA 4BMEA 3T1MA 4OHYA 1RC6A 4N7UA 1RIRA 1FMD2 3OYWB 3ZYIB 4LLOA 3AMNA 4LO5B 3H1MA 4Q4X1 3AYDA 4D3WA 3B7MA 1NCQA 5GZCA 2HKXA 4QPIB 2EAKA 1DIWA 3U10A 3ATGA 2Y0OA 4HN1A 1G9AA 2CNAA 2ZX4A 3GF6A 4IEYA 5K8SA 2Q4SA 4A2UA 2IXKA 4IEZA 4META 4QPIC 1JUHA 1CIWA 4XYXA 2IXHA 1KD7A 2HWD3 1VBA3 2PELA 4RS5B 4YARA 2JENA 1FI2A 4AI0A 1ZZ6A 3KCCA 1AR83 4QQOA 2EIGA 2A6ZA 3MZHA 1YUDA 4JC1A 4QM8A 4MLOA 3E5UA 1RMU2 3MW3A 1W6MA 1PO23 2B42B 3KCXA 4GWMA 1Z7S2 3LWCA 5JOZA 1ENXA 2OUHA 4Q29A 4GB33 5K0UB 2R49A 1JOJA 4JDOA 3GNEA 5J37A 4AI3A 4FPOB 4AI8A 2E9QA 5J7MA 2VVFA 2KA3A 1DZQA 1VAKA 4MGKE 1MEC1 3W59A 2SLIA 1PNGA 5H9PA 2HWE1 4PF5A 3TN93 4YZ4A 3TN91 1XRUA 3URFA 4CDUC 1LU2A 3B94A 5FFOC 2CTVA 1RVF1 2RS13 1L3JA 1CVNA 1UL9A 3HAGA 3JCIA 1QJY1 4IERA 3PVBB 5FREA 3RJ2X 1DQ5A 1AF9A 3SITA 2RM22 5AFEA 3RG0A 4LLFA 1KDMA 3NWKA 4NR1A 5GLTA 2VY0A 2A6WA 4N53C 2PHRA 4OLLA 3VDDC 1GNZA 2OYZA 5EYYA 2XH6A 2YY1A 3J8F1 1UF2C 1F9KA 2ZHKA 3K51A 2RS33 5I8SA 1BBT2 3ZYRA 4E2QA 5I8YA 2NN8A 3FBYA 3NL1A 3HD8B 1XQNA 3THTA 4GKYA 4AHWA 4RQPB 1V6LA 4HBNA 2HWB2 4QU2A 3GHNA 4UW6A 3AZXA 1D0HA 1X8MA 1KQRA 1LECA 1NLRA 4B8EA 3VBHA 2LUWA 5IUQA 2WKKA 4ZU5A 4GA9A 1G9FA 3AP9A 3GYDA 4MGIE 1QJX2 3SCFA 4YLZA 4KWLA 4KWKA 4I3PA 2NQYA 2GAUA 5DZGA 3ES4A 1AJOA 2X5IB 4Z82A 1RUE3 5F9TA 4D7YA 3ME2A 2BQPA 1D4VB 4JRLA 4Z2WA 2A3YA 4FOQA 4COZA 1ZRRA 1AYN1 4WM8A 2FMDA 3VBUA 1H8TC 3MYXA 2NYYA 4COYA 1V6KA 5JZGA 3H7YA 2R042 2BYVE 1QNWA 2VUJA 5A32B 3NVCA 1VRH3 3ENRA 1HDKA 5DZFA 1I1EA 3PVOA 1VALA 4XFIA 1XNKA 1U0AA 3MDPA 1IGOA 3WLUA 1FV2A 1UU5A 1YI9A 3GHMA 1RUH1 5L7OA 3A0KA 1QOOA 3ZSEA 3D0SA 4NO4A 3PJQA 4P9GA 1LU1A 1W2UA 1DBNA 1LEDA 3ALQA 3AMHA 4HZFA 2ZBJA 1WCKA 2WS91 1YI7A 3JQXA 1CAUB 3N36A 1UAIA 5LK7B 2HWD2 1G86A 1U5YA 3E6DA 4LBQA 1LHOA 2QVSB 1YWKA 2AZ5A 4AGGA 1RGSA 5J09A 1PO21 4M3CF 4WVMA 4Y26A 3VBSB 1HQWA 4PBPA 4PLNA 2XJVA 1Y7BA 1ZRFA 1OPMA 4R4ZA 3VBRA 3D4KA 2F4PA 2B39A 2H0VA 5GKAC 2YYOA 4LA2A 3NAPA 3FLPA 1C5IA 1ZZ7A 2B45X 2I2SA 2ZKLA 5CAZA 1SFNA 2ZHNA 2P34A 3UK9A 2OIIA 1W0PA 1D2QA 2P37A 2NM1A 3MFCA 4LO4B 2ZKNA 3R4SA 1QH7A 2WNUA 3ACLA 3IT8A 5IK4A 5HCBA 3USUA 5BNNA 1AR72 1C8M1 2YHJA 3FWEA 4MX3A 5KBFA 2NMNA 4NVPA 4WVVA 3LAGA 4YG0A 3VDDA 2PAMA 1F5JA 1AXZA 1WW6A 5GZGA 1FOD2 4FPEA 1FNYA 3ZXFA 5FO8B 3M4FA 3EJKA 4HPKB 3B9IA 1Q5OA 2FZ1A 5L73A 4LHKA 1NCRC 4HT1T 4R4XA 5C8WA 4GMP0 1PO12 5JPNB 2ILMA 3FZ3A 2D3PA 1ZRCA 3ILFA 2AH2A 2FMYA 3LA7A 4QPIA 4DNYA 4W6XA 1OHFA 1A8DA 4HVRA 4FTEA 2C1FA 3FJSA 3SNMA 4OHWA 1QJU3 2DTYA 3HQXA 2HJIA 5JIAA 2QZ2A 4TSVA 4Z1VA 4KG0A 5DUWA 2WQZC 2C5DA 4BM8A 4RA0A 5F1RA 3ZSKA 1K5MC 1QJZA 1EYBA 5I0RA 4XMAA 2PA7A 1I3HA 4K1ZA 1C1FA 4R9BA 3I54A 1DF0A 2HWC2 3MF9A 5D8AC 2NP0A 1IKQA 2BEOA 2BBVA 1GZWB 4I0AA 3H3ZA 3SLIA 1AYM1 2A73B 3KS7A 1LCLA 2TBVA 3TWIA 5CFDC 4IEWA 2PHDA 2ET1A 3M3EA 1W6QA 4P9IA 2JG8B 3R0RA 4CEWC 2XHKA 3VBRB 3HIFA 3VDDB 2JE9A 4NHKA 3L2HA 4QT6A 1TME1 4CTEA 1FV3A 3ZIWA 2D6NA 1XNBA 1N3QA 3UJOA 3IDCB 3AJZA 1PVC1 1O4YA 1SQ4A 2XWJB 1AUYA 4BLIA 2FZ2A 4AEDC 4WM8B 1N1TA 4FPYA 3TRSB 1REEA 1QHDA 3PMEA 3E97A 5BNQA 1PGW2 2E51A 3GBGA 5ACA3 1RUOA 4Q0QA 4HLTA 1CAVA 1KDKA 3AK0A 4PJYA 1YXWA 4BIFA 2JG9B 5H9SA 4Q4Y3 2ZGTA 4N9IA 4NPRA 2DTWA 3MF6A 3S7IA 2HWF1 5AC93 5DDJ3 4LR4A 4U36A 1MS5A 1RUI3 1RUH2 1WCSA 4FOVA 4DRRA 3O0XA 4IV1C 3NV4A 4I30A 2CGNA 1WLWA 4INDA 1QJY3 1S0DA 3PHMA 3LCPA 1RJ8A 3UKTA 4Q2FA 5CFDA 1S1AA 1AR61 4AVTA 5CIRA 1LEMA 3CEWA 3MGUA 4FQ4A 4M0HA 3VKFC 3AZZA 4BZ4A 3QCWA 1ASJ1 1O91A 2WT2A 4Q4V3 1YYNA 4R8HA 4JDNA 2CWMA 5GZEA 1YFWA 4RR3A 2DU0A 1NCQB 2PN5A 4XJAA 2XLFA 1URXA 4K20A 1SFYA 5FPZA 2MEV2 1LGBA 4YVSA 3V0BA 2XB6C 2BNNA 2XVKA 4WM7C 5HBAA 4LBJA 1OLRA 3ZN6A 1AVBA 4NWWA 3OD4A 2MEV3 4IEPA 2HWB1 1W6QB 2PLV1 3AJYA 3FLRA 5JI7A 1VAMA 3AYAA 3ZYPA 4LO6B 4BCUA 1EV13 3ETQA 1QGLA 5GLUA 1EPWA 1DGRN 4CRQA 2ZCWA 3AFGA 2PHUA 2D5HA 4GWNA 4HFSA 4P9WA 4EN0A 3CL1A 1SLIA 4UW3A 3V0BB 5A32A 1AJKA 4H3WA 1NG0A 1ZBE3 1OD5A 2XLGA 1H0BA 5EXOA 1R081 2D6PA 1R1ZA 1QJY2 2YUEA 4JRAA 3ZFEC 1N1YA 1RVF2 2V09A 4Q0UA 4WM7B 3V64A 5FRAA 1RUH3 1RUI2 4AFMA 1SCSA 4DY5A 1SCRA 5CG8A 1A3KA 4Q4Y2 1OFSA 4DB5A 2ZMNA 3VBRC 1PM7A 3EQEA 5C4WB 2RS31 5JAXA 2PHLA 4DMIA 2WNVC 2R32A 4GMP1 1R091 2ENRA 4XMIA 2WL1A 4GIQA 1ULDA 5FQ0A 4JCKA 3AP6A 2G9FA 2WWSA 1RUG3 4RGAA 2UURA 2WA4A 1MS3A 2IXLA 4RD7A 3MIFA 1GSLA 4KNCA 4Y5Z0 1M06G 1QKQA 1SBDA 3FMGA 2PTMA 1JTZX 3B01A 4DZGA 3Q9OA 2GH8A 1DGLA 4XXAA 4S2GA 1ZZBA 1QDCA 4Y4YA 1WBFA 2GU9A 1J58A 4CDQC 4LHNA 2JJ6A 4XJ9A 1N3OA 1S0IA 3PMSA 4XJWA 2Q8OA 2VG9A 4W6WA 1UN1A 5T5JA 1RUD1 2KM2A 3HN1A 4YFZA 1BJQA 3LZZA 4LA3A 3AXDA 3AKRA 3AKPA 2HWC3 2UWCA 4P9LA 2FQPA 3AKQA 5C33A 3ZFGA 4Q4X2 1IOAA 1VBD3 4XBQA 2NPIA 1V6OA 5DDJ2 5C8CC 1FMD1 2Z69A 3VZJA 1ZRDA 3WY6A 1F8VA 3HBZA 1MZ6A 3KGZA 1ZM1A 3WG2A 4Q26A 4XDQA 1R1A3 2ZACA 2HWE3 2ZX3A 4ORFA 5A33B 5L7OB 3A4UA 2ZGUA 4YGBA 4B4PA 1FX5A 3A0NA 2R062 3V65A 1HQLA 2HEVF 1ZBA1 4QXKA 5J3UA 1HXS1 2DFBA 3WDYA 4PDWA 4AVAA 3D82A 3AZYA 1RUC3 4GH4C 1YHFA 1NY71 3B69A 2EXIA 1ZBE1 1X36A 1S0EA 2ZAHA 4BQ1A 3JUUA 4XF0A 2WNEA 4AG4A 4EN9B 1AHSA 1PZ8A 3AMQA 1PGL2 2A3WA 1RUD2 4RQPC 4XEZA 2AUYA 2O1QA 1LOFA 3QOPA 2RMU1 1MQTA 3S6PA 4CDXC 5BUVA 4FT8A 4RGGA 3AP7A 3R6SA 1SLAA 4DINB 4C0HA 1UMZA 3VBFB 1SDWA 2WFPA 3M1HA 4N53B 3WP5A 3VL8A 3LB9A 3M7AA 1QF3A 2PHXA 2XJTA 3PVNA 3SH3A 2RR12 2P3JA 2XUMA 1RB8G 1N1VA 1H1MA 1WMFA 4D7SA 5A3LA 1YFUA 5KHIA 4L2NA 1NCRA 1HV1A 1RUJ1 4BA6A 5BNPA 4ASMB 4UXAA 4OI1A 1O7FA 1ASJ3 3FUOA 2QFEA 4RSUA 5IT6A 4G3YC 1N47A 2RS32 4QGLA 1VBB3 1PO13 3DPRB 1WMDA 1C3HA 5DZEA 4TYSA 3BPZA 4YGDA 2QNKA 4S2FA 1HV0A 3VZKA 1RUG1 4YG6A 2JECA 1RUI1 4OHVA 4WVZA 3ZFEA 5CG9A 3ZXLA 4JQRA 4AQSA 1OQEA 2ET7A 2QKDA 4EV0A 4RL7A 2OW4A 3U07A 2P17A 1O4ZA 4L11A 1LOBA 1SBEA 4XILA 4CDQB 3TNQA 3FUQA 3B9CA 1OA2A 1N1SA 3AYEA 4FPGA 1YCIA 4WM7A 2IC1A 3JB8A 2CAVA 2VULA 3USSA 4B4RA 1QQP3 1NCQC 1FT9A 4FXGB 4Q4W2 3O0WA 5BNOB 1XYOA 1LOAA 3E6BA 3NSTA 1GQHA 1MZEA 1QWRA 1VJ2A 4EJRA 5T54A 3WDTA 2VNRA 3G7DA 3DUIA 4LNVA 3ZDSA 1X8EA 5DUXA 5GLWA 1UCXA 3IWZA 4BLJA 4RHV2 1I9RA 2QZ3A 5FAXA 1B35C 1VIWB 3W58A 3DGTA 1J1TA 4FPJA 5ABJC 1ALYA 4AGRA 1VBB2 2E53A 4GH4A 1FAYA 2XVLA 4N90A 2DFCA 4ATFA 1NE6A 2VECA 5JOXA 2DUQA 1ZZ9A 3OY8A 1LR5A 2Q30A 1ASJ2 5JZGC 4XQ4A 3J9SA 4I01A 1H4GA 2HEWF 1OLQA 5EV7A 1FNZA 3QD6A 4HK9A 4B7KA 1PIV2 3W9AA 4M0NA 1UZZA 3APBA 1CPNA 1RUF1 2Y0IA 1Q8QA 2A75A 2GDFA 1G9CA 1F5FA 3MI8A 4XHBA 2R071 4IV3A 5AC92 3WDXA 3H7JA 5SV5A 3RWNA 2VOWA 1QJU1 4AXOA 5ABJB 4XFGA 4AHYA 1ULFA 2K0GA 1MQTC 3WG4A 3ZX7A 4S2HA 3V0AA 2Y26A 4L9BA 3RDIA 1DU3D 3H9AA 2JKBA 1WLDA 4QM9A 2AR6A 2VXRA 4AYUA 5TSWA 1VBC3 2DUOA 1DQ4A 3B93A 5E16A 5I8TA 4MV2A 2DV9A 3DPRA 2P3IA 1DGWX 2RJKA 3H3UA 1KRIA 5J48A 1UIKA 4RS5C 4K6BA 2GH2A 4LBMA 4YZ2A 1RMU3 4AEMA 2JG8A 4OVEA 5FPXA 5KHJA 5D8AB 2XL7A 2D7FA 1VBA1 2XKPA 2W52A 4GALA 1GZCA 1UU6A 2BNOA 2ZGSA 5I93A 1BVVA 1VBA2 2W68A 3DKWA 3FHIB 4N43A 4DFSA 4Q8KA 3LA2A 2BVBA 4Y1XA 1V6JA 4KG8A 3SXWA 5JOYA 1QH6A 1O3SA 1UPIA 5JSOA 1KITA 3NV1A 4I0WB 1OA4A 4FOYA 3M2MA 1HX6A 3ZXGA 5HCAA 1Y43B 3PTYA 2R1DA 4JTOA 4Q4X3 5JCTA 1H2LA 1JN2P 2R1BA 3B02A 4XBNA 1J3QA 5JIUA 4NHLA 2WNVA 3WW4A 2WC2A 4HKLA 4XQDA 3AM2A 1GYKA 1FMD3 2DCJA 2ZMLA 1I5ZA 1UKGA 1QJU2 3D5OA 2EAAA 2VH9A 5FLHA 3ZYJB 1V9U3 4LO8A 5BV6A 4LBKA 4O9EA 1HW5A 1QOSA 4QX5A 1WA4A 2ZGLA 4L97A 1X82A 5HCFA 2D93A 1LOCA 1RUF2 3LKJA 1LULA 2EXHA 2I07B 1WBLA 2C0ZA 2PYTA 5AVPA 3UV9A 3V0AB 1AR92 1HRI1 2AREA 2Z2SB 4JGYA 4CP2A 1VR3A 1WD3A 4XF1A 3M8LA 2GN3A 1EP0A 3HR9A 1DDLA 4OI4A 4HANA 1NOVA 2GC0A 3WHTA 1AR71 1C8M2 1GZWA 2N7GA 4AVCA 2ZZJA 1XE7A 2WS93 1MEC3 1KFUL 4QQHA 1D4M1 3X29B 1KFXL 1S55A 1CAWB 1CPMA 2EXKA 2XKOA 1OI6A 4LE4A 1B09A 5GLZA 1AZDA 1GBGA 1GANA 3AXEA 3VKLA 4GKXA 1BZWA 2CY6A 1LHNA 5JZGB 2RR13 4P5HA 2LM3A 5IK5A 4DS0A 3ZVXA 2ZGMA 1A78A 2UY9A 4PBOA 1A8MA 4QMAA 4BIOA 4YM2A 1AX0A 4IL7A 2WNVB 4MGYE 3AX4A 1DHKB 1ND2B 5FOBB 5CFCC 4RFT0 2D3SA 1Z78A 2HWD1 1WCDJ 4ISRA 3JD73 3ZMNA 3N7MA 2XJRA 3VHNA 2DU1A 3BOPA 1R093 1REFA 3B3QE 3USUB 4FPLA 5T55A 4XJUA 3H1YA 5KC6A 3ZIXA 1CAUA 3R4DB 4F83A 2IZWA 3WT3A 2E6VA 1M4WA 4XHXA 1RUG2 4SBVA 1O5UA 1COV2 2DCKA 2YZ4A 3ILRA 2OZJA 4FCAA 1FPN3 2E7TA 2ZPXA 4ES9A 1OOPC 5FTTC 5DG2A 1Q8SA 4EWEA 4V1PA 4LBOA 1H8TA 3FBMA