3NJYA

Crystal structure of jmjd2a complexed with 5-carboxy-8-hydroxyquinoline
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
347
structure length
347
Chain Sequence
LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Lysine-specific demethylase 4A
publication title Quantitative high-throughput screening identifies 8-hydroxyquinolines as cell-active histone demethylase inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2010-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3njyA01
3K3OA 5IVFA 4EZHA 5A3TA 4Y33A 4UF0B 5FZ1A 3U78A 5LY2A 5FYHA 2YPDA 4TN7A 4XDPA 5FXZA 5FZ0A 5IVEA 3PUQA 4QXCA 2WWJA 5A1FA 5A1LA 4GAZA 5FZMA 3N9LA 3N9NA 5FZKA 4HOOA 4BU2A 5F3EA 3PDQA 5FYIA 5FZLA 5FZ9A 3N9MA 5F2WA 4E4HA 4V2WA 5FPUA 3PUAA 3KV5A 5ANQA 3AL6A 5LWBA 5FZ6A 4GJZA 5FYUA 5FP7A 4HONA 4CCJA 5IVVA 5FJHA 5FY5A 3DXUA 5FY7A 5FZDA 3N9QA 5KR7A 4D6SA 4URAA 4C8DA 5FJKA 5A3PA 2W2IA 5A3WA 3N9OA 5F3IA 5IVBA 5FV3A 5FXXA 4QXBA 3LDBA 5FUNA 2XUEA 5FXWA 5F2SA 3UYJA 5FZ3A 5F32A 5F37A 4AAPA 4D6QA 5FY8A 2XMLA 3PU8A 5FYBA 5F5IA 3K2OA 3ZLIA 2YBPA 5FWJA 5F3CA 3PUSA 3KV4A 5A7PA 5A7WA 5FZIA 3PTRB 5IW0A 5FPAA 5FPBA 4D6RA 4LITA 2XDVA 2XXZA 3KV9A 5A7SA 4GD4A 3KVBA 5FY1A 5FZAA 2PXJA 5FP8A 5FBJA 5A7WB 3OPTA 5FZEA 4LXLA 5FYYA 5FZOA 4IGQA 5A7OA 4BISA 4DIQA 5FZCA 4DO0A 5F5AA 5F3GA 4BXFA 4CCLA 4QX8A 3OPWA 5FYVA 4V2VA 5IVJA 5FP3A 5FZFA 5FZOB 2OQ7A 4LIUA 5FUPA 4CCNA 4Y3OA 5A7NA 2Q8DA 4CCMA 5LY1A 2OQ6A 3KVAA 4GJYA 5FYZA 5IWFA 2YU1A 2YU2A 3AVRA 5FZ8A 3KV6A 5FZ7A 4AI9A 5CEHA 4IGPA 5FYSA 3K3NA 4QXHA 2OT7A 1VRBA 2OS2A 2YBKA 5FP4A 5FZGA 5A80A 5LW9A 5A3NA 5FPVA 5FY0A 4EYUA 5FYMA 3PU3A 5E6HA 3AVSA 5FZHA 4Y4RA 4LIVA 5A7QA 3ZPOA 5FYTA 3NJYA 5FZBA 3N9PA 4QWNA 4CCKA 4QU1A 2GP3A 2YBSA 5F5CA 5FP9A 3RVHA 4ASKA 2OX0A 5ISLA 2Q8CA 4CCOA 4IGOA 5IVCA 3AL5A 4CUGA 5FY4A 2GP5A 3LD8A 2Q8EA 4EZ4A 5FPLA 3U4SA 4QX7A 5FYCA 5FY9A 5FZ4A 5IVYA 5K4LA 4XDOA 4CSWA 2WWUA 5FXVA 4NUBA 4UF0A 5FWEA 3DXTA 3PURA 5F39A 2VD7A 2P5BA
chains in the Genus database with same CATH superfamily
1RUF1 5A3TA 3IM0A 2XWBB 2W47A 3AZZA 2VMCA 3AJYA 4MGSA 3VBUC 3LDKA 3ZFFB 1DQ2A 2Q0AA 4N9HA 4A44A 4AGVA 5SV8A 2W9XA 5AVAA 1RL3A 1F31A 2R32A 4XJWA 5FXZA 1NCRC 4UBGA 3H1YA 3OBZA 3WQ1A 2WWJA 2J1UA 2R49A 1Q8SA 2UWBA 3IT8A 5HCHA 1NE4A 4S2FA 1UOGA 3I54A 4QDSA 4GIQA 4YZ4A 1S0FA 5IAVA 4FOWA 5C5TA 1MS8A 2IXJA 4CYDA 4XACA 1AR73 2FD8A 2YXSA 5FPUA 2VZ1A 3QCWA 1W28A 2G9FA 3LIHA 5LRRA 2K0GA 2E33A 4Q29A 5C6CA 3WX5A 3MV01 3VL9A 5A3LA 1OVSA 4OVEA 5FJHA 3WINE 2BUKA 2QDNA 2FDKA 4FTBA 5G04L 1OFSA 3TNPB 1HN1A 2ES3A 1AR72 3FN9A 4AVVA 1DQ6A 1NQDA 4YARA 1EP0A 1I1EA 2CDPA 2N7GA 3VZLA 3ZFEA 1GV9A 2WZR1 3EXUA 4JGYC 4QX5A 4XW3A 1PGL1 3I2KA 3UYJA 5F32A 2VNOA 2Y6KA 4RQPB 1NY72 3D82A 3S7IA 4KBBA 1W6MB 5FYBA 2OVUA 5F5IA 3T1MA 2FMDA 1US3A 2DVFA 3TOJA 2OPKA 1ULPA 4IE6A 5HPOA 2QQOA 1YHFA 3RZKA 4INDA 5EQUA 4Q4Y2 3VBOB 3NNGA 3JD73 1UMIA 3LQCA 3Q8CA 3VHPA 1O91A 1W06A 2IC1A 4NAMA 2W95A 4QPGC 4BQ4A 3WF1A 1MS4A 1OLME 3ACFA 3E6BA 2MNGA 4JV4A 5DN2A 5FDBA 5J1XA 5HBAA 4MXWB 5DUUA 3RWKX 3TAYA 2FDJA 3DN7A 3RSJA 3DF0A 3WNPA 3KLSA 3WDWA 5FZFA 4EN6B 4ZHNA 1V9U3 4K21A 4Y5TA 2C6SA 1GYKA 5K0UC 4YVSA 3VZJA 3ENRA 3I59A 1OT5A 2NPIA 5F9TA 1RB8G 1VAVA 4Q0SA 3VD5A 3DPRB 1C5HA 1OC1A 2E26A 4PLNA 4N43A 1ULDA 1U0AA 1UOFA 5FYSA 5JLVA 1V9U2 4BQ2A 4LKDA 3CQOA 1QIQA 4ARYA 4WM7A 2JXAA 5BNNB 1JODA 1LOFC 1SHWB 2Y64A 4LO7A 4BQYA 1B35C 4RA0A 2J1TA 2XH6A 5LZ6A 5FLHA 1MVQA 2VR4A 3FL7A 2CWSA 3ILFA 4W8JA 1N1VA 4GXLA 1CZTA 4G9SB 2BW8A 1N3OA 2JIJA 3HR9A 4AFMA 1WA6X 4QPWA 4FOQA 4OYUA 2XLGA 3SKJE 1VIWB 1WMFA 4A3ZA 1W8TA 2TBVA 2AUYA 3BTAA 3DECA 5F7UA 1ST8A 3P6BA 2VMDA 1ND3B 1VBE3 2HEYF 4FPYA 1IS4A 3OF1A 1QQP1 4DXSA 1SBFA 3GBGA 1S0EA 3LWCA 4OUMA 4CDQA 3O1UA 1AR81 3ZFFC 4FT8A 2C0ZA 4KG8A 3VBUA 3NRUA 4FPHA 4I3GA 1QJX2 5E16A 4HMZA 3H1WA 4OHVA 2JDZA 1VBE2 2C5DA 4GMP3 1EAH2 2QQJA 1NA1B 3AXEA 5C3RA 4AFDA 3PHMA 4GKXA 3QH6A 4LHSA 2RS51 4HL0A 3L2YA 1KS5A 3BIWE 4B4QA 3IIIA 3TBDA 4JQTA 2ZGQA 2E7TA 4LA3A 1UCXA 4HBNA 2K2SA 4AFBA 3D5OA 5FMBA 5EJZB 2BGPA 4D7TA 1XJAA 3ZYPA 1SDDB 4NVPA 5FZ6A 1XPWA 3AZVA 3CF6E 5DZGA 1HDKA 5DAWA 5CKNA 2FDIA 3NNJA 1AUYA 1UQXA 3N9QA 3OG2A 5JSRA 4MGZE 2ID4A 2PYTA 4H7MA 3HT1A 4Q8LA 1DZQA 1R1A3 3FUQA 4RQPC 4PBOA 4I2OA 4ZXEA 2ADEA 5ACA3 4CXWA 2TNFA 1VBB2 1RMU1 3Q8AA 2DCTA 2E9QA 4LHNA 3GXUA 4OQ9A 4ATFA 1J1LA 1VBA3 4AQSA 4Y1ZA 5BYNA 3CU7A 1DGRN 5C4WC 1QJU2 1UD1A 4Y22A 3B69A 4QGLA 3VBOC 1UO9A 2ZHLA 4A7YA 3WP4A 4Q4V3 4LITA 2MPFA 2NYYA 3NV2A 2XHKA 5ACA2 5C7GA 4WVMA 4ES9A 2H0VA 3S5QA 3OPTA 1GOGA 2YFUA 5FO7B 3AMNA 4IGQA 2YC0A 3K77A 3MF9A 5FKCA 3UKTA 1AYN2 2A6ZA 4XMAA 4BYYA 2BFUL 4IV3B 3NNFA 4IXLA 3ZFGC 2CAVA 2PHWA 3FWEA 4P9GA 4XQ4A 2WN3A 4XHBA 3ZSLA 5K0UA 2WZ8A 4NE9A 1XQNA 2VY0A 2P37A 1RUC1 1S4CA 2ARXA 1KXGA 1X9PA 2VMIA 3BGAA 1UX7A 4GJYA 2ORXA 3ZSKA 4BQWA 4FVVA 3RZHA 3ZN4A 3ACGA 1GUIA 4XTPA 1AJKA 3ACIA 1DG6A 4HVOA 4Y5Z0 3ACHA 4UBHA 5A3MA 2RS11 3DV8A 3W21A 2E51A 4GB33 1WCSA 1CR7A 3IZOA 1IQDC 3LPFA 3WNLA 3THTA 4CCDA 2Y38A 1LOFA 3KT4A 5FZGA 5T5PA 1B35A 2VPVA 3VHNA 4HKLA 2CTVA 5DAPA 4PLOA 2YGLA 4S2GA 3PUIA 2A6WA 5FZHA 5A32A 2BGOA 1X8EA 2A6XA 2UYAA 2VBPA 2QZ3A 1UW8A 2R6QA 4Q8KA 1UL9A 2XVLA 4GB32 1TMF3 4PT6A 3TEXA 1NYWA 1WW7A 1SLBA 4XBQA 3EO6A 3WR0A 1AR93 1JMUB 3NL1A 4YZ3A 1MEC1 5CFCB 2Y6FA 5FY4A 1ND3C 2W68A 1UY1A 3AMQA 5DG2A 3R0RA 5FMOL 4IEVA 3MI8A 4QU2A 3I3MA 1TMF2 2WQ4A 3T4VA 4Q4W3 3G7DA 1R1ZA 4CUAA 2EALA 4SBVA 1WCDJ 4H55A 2P5BA 1GQHA 4NWWA 4NMIA 2EAAA 4QX2A 3ROUA 3UL2A 3FFZA 1NA1C 2XVGA 1YQCA 4A45A 5C70A 5LEKA 1UOBA 3KF5A 3RDIA 5DABA 1ODNA 2JDAA 4E2SA 2DDUA 5FOBB 1ZBE3 1K5MB 2WO1A 4GAZA 2VZ3A 4BMBA 5FZKA 5FLIA 2LALA 3B7MA 5LA0A 4J25A 1OH3A 1UY0A 3VZKA 1BEV3 3FBYA 4NO4A 1E5HA 2JB8A 3KMHA 3PUAA 1GZ9A 1V00A 2RS33 2VOXA 1WZXA 1RIRA 5IK7A 2A6YA 4Z2AA 1CJDA 1W0OA 2ARAA 3SQOA 4ZPIA 2CGPA 1F35A 4URAA 4E8DA 4C0BA 1PO23 3JD71 3Q9OA 3IMMA 2W2IA 5CVRA 5A3WA 3AX4A 3ZDSA 2HH9A 2YGMA 4WV8A 1MQTB 5CADA 4KWLA 2R042 2ILMA 3UKNA 4JZRA 2QBXA 3VN4A 4DRVA 3I2OA 5F37A 4W6WA 5HI0A 4P08A 4DOUA 5GLTA 1UXZA 2GH2A 3W5MA 3KT1A 1Y7BA 3RFRA 3VBOA 3WNKA 5I93A 5JI7A 2IXKA 3ILRA 3CLPA 4YW6A 5A7PA 2ZMLA 4FOYA 4AI0A 3PTYA 1H8TB 5DDJ1 3ZIXA 3POFA 4MXWA 2RE9A 2DV9A 3LKJA 5L7OB 1ZRRA 1CESA 2W92A 2YROA 4HK8A 4NHMA 4IV3C 1OXCA 3MZHA 1AX0A 2Y34A 2AGSA 5EPAA 4DIQA 3EBRA 1L3JA 1V6KA 3CIHA 5TSWA 1TVGA 2WFF3 3FUOA 3T1LA 4XJAA 2ZGUA 3LFMA 4KU7A 4NROA 3DPRA 2ZAHA 4CPBD 4W6YA 2ZACA 2Q8DA 1ZRFA 2VCCA 1X9TA 2P3JA 1EV11 1Y3TA 1LRHA 5KXBA 2QQUA 5IT6A 2RMU2 4MG2A 2VECA 1JZ3A 3WDVA 5BNNA 2SBAA 5KHIA 2LRPA 2XPJA 1AYM2 2VBDA 2VM9A 2VW0A 3H1MA 5APAA 1QH6A 3GYDA 2IFWA 3SCFA 3PVEA 2Z4FA 1WW5A 1WCUA 1O6UA 2OIIA 5EFUA 5CIRA 5E88A 2WO3A 3LAGA 2PHRA 1LOEA 5FKBA 3POWA 3RZZA 4Q0QA 4IERA 1J3QA 1ZZCA 2PHDA 4KL1A 5CFCC 2CU5A 1PMHX 3MHZA 5FP9A 4N53B 2GC2A 4MVTA 4QB6A 4DFSA 2QE3A 4IESA 4PIYA 3NKTA 1FMD1 3CJIB 3FE5A 4Y20B 1FAYA 1ND3A 2V5DA 4E27A 1TME3 4R9CA 1RUH1 2ZBJA 4PI0A 2CV6A 3RMYA 5A6XA 2XB6C 3MEPA 4XFGA 1H6YA 2DVDA 4LBOA 1LTEA 2D40A 2GMMA 3LIGA 2J1RA 5FQ0B 2FCVA 1VBD3 1POV0 2WDBA 5FZ0A 1NA1A 1Q8PA 3FLRA 1YFUA 1K5MC 3ZR5A 2JDHA 3QLQA 2GMPA 1W3VA 1VRH3 3B9IA 1XNCA 3ZN6B 4Y1VA 1AXKA 4G4FA 3RMXA 3BUCA 2Y0OA 3AXDA 4TZDA 4N8MA 4PIZA 2PLV3 3OD4A 3LDRA 4H3WA 2UY8A 3ATGA 3TNQA 1O3TA 3FHQA 1VB4A 4BIFA 4XF4A 3QBQA 2DYCA 4DINB 1VJ2A 1W90A 2MHFA 2PFWA 4P9YA 4YFWA 4CTEA 4EN7B 1NLSA 5BNOB 4L92A 1YEWA 1SPPB 3WP5A 1F2NA 1DDLA 4YWAA 1CVNA 4FQZA 4MUVA 3AL6A 1LESA 1GR3A 2XJSA 3A21A 1JYTA 2EIBA 2RDRA 5FP7A 5HCAA 4IL7A 4LBNA 4PHZA 3NV4A 3DXUA 5D21A 1W9FA 5E89A 5JOXA 3KHBA 1W05A 4TLGA 4D6SA 1MQTC 3AZWA 2ZKLA 1SEFA 2E7AA 1D4VB 3GCXA 2UU8A 2XKOA 3N9OA 4IEZA 3J7MA 4AQ2A 4GQ7A 5I8YA 1PO11 4NPLA 4M01A 1HRV3 4DRRA 2BNMA 1NAEA 4BOWA 5K9YA 1QF3A 3BYWA 1H8TC 1JXNA 3NJXA 4K3UA 4RGAA 4AGRA 3GZTB 5A70A 3PUSA 4XFBA 2RR13 3NWKA 2VW2A 4B7EA 5BUVA 5L7OC 2QNKA 1WCQA 3KCXA 5C71A 5FPAA 1RUF3 3E5XA 1VR3A 1Z7S3 1HRV2 1V6OA 2W0XA 4A2UA 5JSPA 3HQUA 2FDGA 2HWB2 4IV3A 1JHJA 1LCLA 1OUXA 1YI7A 2DUPA 1IPKA 2WNVA 1PIV1 3IBMA 1IGOA 1W2OA 1CPMA 4XOGA 3ZYBA 1BK0A 2VQAA 4Y26A 5C33A 2RR12 2AR6A 2GNDA 3JUUA 2F6BA 4L0PA 2A1XA 1RUF2 3DYPA 5EJ3A 1RUOA 1FV3A 4QX0A 1KRIA 1KJRA 4NRMA 3B3QE 1JU3A 3O1VA 1CPNA 1WLTA 1H4HA 3O0XA 1BVP1 1ENRA 3C3VA 2UWAA 1O3QA 3UJQA 1AR91 4OHWA 1HB3A 4M3CB 1T2XA 3RGBA 1ONAA 5FP4A 4E2GA 1GP6A 5A3NA 4XPVA 5F1RA 2XGXA 4HFSA 4LMFA 2DU1A 2DU0A 4Q4W1 3AVSA 1F4AA 2WZR3 1FV2A 4LHKA 4FPKA 4QMAA 2X5IB 5CFCA 1OOPB 4X6QB 1C8NA 1HLCA 1Q5OA 1C8M1 2YC4A 2YZ4A 4BZ4A 2K46A 4Q4X2 4BCUA 1X36A 3OGGA 4F3JA 5IVCA 1ZBE1 1BLZA 4FFHA 3DUIA 1H1AA 1ZX5A 4CUGA 4FAHA 5FO9B 1SLIA 1G9BA 3B00A 2JEMA 3RZJA 1PGL2 1OF3A 4DMIA 1QMJA 4Y5SA 5IVYA 4N90A 2ZTNA 3WXPA 5J36A 2YYOA 4MZUA 2OUHA 2J1AA 4UFKA 4CUCA 1OSGA 2RS31 3PUHA 3U4XA 1K5MA 2VZVA 3M2MA 3H8OA 1GSLA 2VOKA 1V6MA 2VE1A 4N9IA 2DBNA 5FZ1A 2HWD1 2HYKA 3V56A 4AHYA 2G9ZA 3U37A 4BMEA 4CPBA 1YWKA 1UZZA 3TEYA 2WWSA 1GZCA 3ZYFA 4IEYA 4QXCA 4D0QA 4CVUA 1PO21 4MSVA 3KS7A 4MGTA 1X82A 1I9RA 2NQYA 4HOOA 2VOTA 4BU2A 5BNOC 4YGEA 1G86A 2XKPA 4S2DA 3A0KA 2D43A 1Y9MA 2G1MA 1R082 3VL8A 3CEWA 3D4KA 5CNAA 2HWC3 4LA2A 4FPCA 1RVF1 3RRDA 4Q1RA 2Y6HA 3WHUA 4EWDA 1ACCA 1PZ9A 4YGDA 1MQTA 3MLLA 4HVQA 1WBLA 1ZZ6A 2V5YA 4QM8A 3K48A 5B2GB 2XOMA 1XYNA 5C8WA 4AVAA 3VDBA 1GNZA 1OVPA 1NLQA 5IFPA 1JI6A 2JDPA 4COZA 3B02A 4YM3A 1YIPA 3C7EA 2ZOEB 4O65A 3W58A 1ZVFA 4BA6A 4BH9A 1PZ8A 2WFF1 2CYFA 3ZM8A 1RUE1 4LPLA 5B4NA 1H8TA 3JZVA 1NCRB 4QKBA 4EV0A 4FO9A 4XJZA 3K2OA 3ZLIA 3NO8A 4AR2A 5L7OA 2CSGA 5F3CA 3E6DA 1QQP3 4EJRA 2WRAA 1W03A 1AR83 2R7EB 2WSUA 2Z69A 3OGRA 3WW1A 3J7NA 3U1XA 4YNIA 5DQ0A 1FATA 1AJOA 1RUJ1 4MX3A 3VDCA 3U0ZA 2VW1A 1W8FA 4MLOA 3EQEA 4QPIB 2E6VA 1UZ0A 5CFDB 5BPXA 1S2BA 1NKGA 3OBRA 4IEPA 5IJRA 2WT1A 3MYXA 1QQP2 2A3XA 4D69A 1Y9GA 2RS53 5JOYA 1MS0A 1O4YA 1QXJA 4P9JA 5JR2A 2QDRA 2FDFA 3LF7A 1G6NA 5J3UA 4XZUG 5L19A 3V65A 2VOWA 5DMYA 2GNMA 3MF6A 2RS52 4GWNA 1DLCA 1TME1 3W20A 5T5LA 3N3HA 1LOBA 1VAKA 3SEPA 3ZYRA 4OHYA 2IWGB 3H7YA 3VHOA 3ZR6A 2RJKA 2X5IC 1W9TA 1OOPC 1REEA 1RYYA 1JS9A 2AZ5A 2Y8KA 4EWEA 2LTNA 3HQRA 4N53A 3I2FA 3VBHC 4Y4RA 2EXHA 4EROA 4YZ5A 4Y20A 3USSA 3CJIA 2E32A 1VBD1 3N9PA 3ZXLA 1W6PB 4QPGB 2EIEA 3ZSEA 4DUWA 3KZ4C 5A6YA 3O1RA 3RVHA 1RMU3 4LBQB 4NAOA 4MYEA 3EYPA 1HRI3 5EHDA 4ONUA 1POV1 4CCOA 1DHKB 3NJZA 1K45A 3TB0A 2BGCA 1LJ7A 3LD8A 4YZ2A 1WLDA 2WO2A 4W65A 2WQZC 3N7MA 1PX3A 1LU1A 2PLV1 5DUXA 5FQ0A 5F6LB 5FZ4A 4B29A 1JZ8A 5DUVA 3GHNA 2ZGPA 1U12A 3LEGA 5HCFA 5LATA 5J37A 1RMU2 3MIDA 4YG3A 4DB5A 3CL1A 3PURA 2XONA 5F39A 3IDEA 4XYXA 2FZ1A 2VD7A 3OGJA 3URFA 3VLBB 3ZN6A 1W0NA 2D6KA 4I02A 4IUGA 5FPZA 2WNUB 3LEIA 1MZ5A 2KD7A 2PAMA 5FZLA 3T09A 4IQPA 3B5LB 5I8SA 5LY2A 1GOHA 3M3QA 4TN7A 1V0AA 3RZLA 1RUC3 4ZU7A 4O9EA 4OULA 5C8CA 1ZA7A 5BNOA 2IXIA 2QQMA 1SPPA 3VBSB 2GZWA 3PMEA 2ZZJA 5JZGB 2CDOA 2RS13 2V73A 1LENA 2EA7A 4V2WA 3Q8FA 3WW2A 1W9SA 3WUCA 4JX0A 2IFRA 2VXJA 5GZFA 4Z07A 4LNVA 4COYA 2Y0IA 1JYIA 1QOOA 4H14A 1CZVA 1CAXB 3O0WA 2WN2A 1J83A 4GJZA 4XF3A 5LBEA 4HONA 5FK8A 2VBBA 3WP3A 5GZDA 4F8AA 4P14A 3MIGA 2RS12 3JBG1 4IEXA 1ULGA 4JAAA 1Z7S1 1STMA 1RUG3 1HV0A 4LBLA 3VKNA 1PMIA 4LBQD 1MEC3 4AVSA 3K4AA 4GWJA 5FV3A 2P34A 5FRAA 5KXCA 1DQ5A 4MV2A 5FZ3A 1AX2A 4L2NA 2AC1A 2IVIB 3PU8A 4PLMA 2ZX1A 2W87A 3FHIB 1U5ZA 4E2QA 3UNPA 4AEDB 1UU4A 4QPIC 3T30A 3ALQA 2I2SA 1HV1A 5CFDC 4BIOA 2YG0A 2Z79A 2VVFA 4AGGA 2RG4A 2NN8A 5AFEA 2BBVA 2HBUA 3NSTA 4MGYE 4LBKA 4PF1A 3RPQA 1KQRA 1SACA 2JB4A 5AVPA 5FMOS 1W8ZA 1PK6B 4DO0A 5F5AA 1Q43A 2K9ZA 4YW7A 2XLFA 2C26A 4YM0A 3FLPA 5FZOB 4QXKA 2MEV3 4CDWB 4IEWA 5JUVA 1J3RA 2VQTA 2WT2A 5AFBA 2OQ6A 4M3CA 5IWFA 1UXXX 4PJYA 4M3CF 4BXSV 5HV4A 4DUVA 2BWAA 4XUQA 4MGIE 4KWUA 4TWTA 4EE2A 3I8TA 4QPYA 3N4MA 2VZSA 2X5IA 4NIAA 4CE8A 1OOPA 1OPMA 1ZBA3 3ZYJB 3ZXJA 5C4WB 3BTYA 1UZWA 4ITCA 3NAPB 5BXXA 1DYOA 5IK8A 3C7HA 2B9VA 1IOAA 3WF3A 4ZKTB 3ZPOA 4JHTA 1LGCA 1KDKA 1QEXA 3HBKA 3RI8A 2GP3A 3L2HA 2JG8B 5T54A 1XBFA 1IZ3A 3JD72 4JVAA 4COUA 2Z42A 3ZFGB 4GWIA 4FAGA 1BBT3 2QQLA 4EZ4A 3GJBA 2PHLA 4HSJA 3SLIA 5FPLA 5DDJ3 3AYDA 2VTXJ 1JU4A 5EV7A 3J26N 1PVXA 1A78A 3CMGA 1TNFA 3AYEA 2C9KA 2WNUC 4OUSA 1LHNA 4LK7A 3ASIA 1EPZA 3BB6A 3QH7A 5LBCA 3SH4A 4FBFA 1NXD1 2IXCA 1CN1A 3K4DA 2HWC1 2JENA 1QHDA 2XQXA 4LBMA 1SFNA 2BNOA 4LE3A 5KC6A 4OHZA 5FOJB 1OHFA 2YB7A 1LB2A 4K6BA 2Y60A 4QQOA 4NPMA 5GLZA 3VBSC 3WSOA 1EV13 1KITA 4IEOA 5JZGC 4UW4A 1AL0G 3WP6A 2VUDA 5GLUA 1IS3A 1WMDA 1G7YA 5JXIA 5FYIA 1VB2A 1N3QA 5CB7A 2VVDA 4AAXA 2UYBA 2WJSA 3ZDVA 3AP7A 4WBBA 3LCPA 1T6BX 2I45A 1EV12 4LR4A 1CX4A 4I0WB 5ANQA 4J1XA 4RGKA 4AFAA 2JE7A 2PAKA 2ZHNA 1XU2A 4R8HA 2P17A 5FLJA 2GU9A 1K42A 3OBTA 3KF3A 1FMD3 2VMEA 3L9JT 1NCRA 3R6SA 1DZRA 3TWIA 2DBIA 1RUH3 4CP0A 4BWOA 2ZAAA 5AC91 2PN5A 4AEDC 4XQWA 4FSJA 2B45X 1ZZ7A 1D0HA 3BODA 2EXKA 4QPIA 1FMD2 5CFDA 1RHI3 1AR63 2JE8A 1OMIA 3M3IA 1Y4WA 4META 4URTA 1PK6C 2D5FA 2WNEA 4A6OA 1OH4A 4RFT0 3HNBM 3O12A 4MGQA 4LXLA 1W3XA 2DCJA 4NR1A 4XVHA 1POQA 1PVC3 1QJY1 1YJKA 4CDWC 1UF2C 4A7ZA 4QX8A 1NT0A 3RI9A 3H3LA 1D0GA 4JGYA 4XF1A 5JPMB 3PL0A 2X09A 5F6KA 1ZA4A 1TEIA 3IIAA 4M00A 5F8PA 4XIKA 2E31A 4CCMA 1VMFA 4YW2A 1DBNA 5FBZA 3UKVA 2RV9A 3FJSA 2JD4A 1SFYA 3APBA 1Q8QA 1HRI1 3AKQA 1SDWA 2WT0A 2VULA 2WLQA 4D3WA 1O8PA 4RHV1 1R1A2 3NAPC 2LUWA 3I3DA 1PZ7A 2DUOA 3OOXA 2W1SA 3WY6A 1W6PA 4QPGA 3RWNA 4X8PA 1WBFA 3LA3A 3S57A 3AM2A 4LBQA 2D93A 3AMHA 3GZUC 3H42B 1VBA2 3MGUA 1UAIA 1PO13 1YQ5A 2JG8C 2FHRA 2HEWF 2R061 2YDEA 4LUKA 4QM9A 4AK3A 2NP0A 5KHJA 5L36A 1A3KA 2L9LA 1BZWA 3DKQA 3KT7A 2XWJB 4Q4V2 1H2LA 3ES4A 5C9AB 2WS91 3A23A 2VTXA 3ZSJA 1G9CA 3WQ0A 3MBWA 3LEKA 4CDXB 4GWMA 3PLQA 1PO12 1IQAA 5T50A 4QX7A 1IPSA 1YIFA 3DGTA 3J7HA 1WD3A 3MV11 2WNUA 2W1QA 4FFFA 5K4LA 3DKWA 5GKAC 1PIV3 3N7LA 4B7KA 1HIXA 1DGWA 2VXRA 3HIFA 4ZY9A 4R9BA 1XNTA 1VP6A 1XE0A 2BYVE 2HLEA 2VZQA 2TUNA 2JDNA 1FX5A 3D0JA 4XXAA 2GC1A 5M0TA 4O61A 4Q2FA 5A6QA 1UPIA 1OUSA 2HWE3 3LZZA 3H9AA 5I0UA 3VBSA 3SEEA 5LA1A 4Q1PA 1GU3A 5JZGA 4Z2WA 2DF7A 1PIV2 3PUQA 4XZPA 4CEWB 1YFWA 5A1FA 1RUG1 4NPRA 2WZPP 1OBNA 2XLAA 1N3PA 2ZGMA 4WZCA 3M3CA 4CP2A 1CAXA 2A71A 4YYOA 4AHZA 1W99A 1URXA 4K20A 5EXOA 3IDCB 3QACA 3EHKA 4FTSA 3V0AB 5KXDA 4XE9A 1O3RA 5IYYA 3WNMA 5LWBA 4AFCA 2UWCA 2Z2SB 1GP4A 3ZFFA 5H9SA 4ORFA 1AR92 3WHTA 4QDRA 1OLQA 1XSRA 3O0VA 1UYPA 3VD9A 3J8F3 5JMOA 2R1BA 1C8M3 1TQ5A 1H2NA 3KD4A 5GJ6A 2OKXA 1IS6A 4RN5A 4M4RA 5I0SA 5FXXA 3O1OA 1XRUA 2WFPA 3GGLA 4Q4W2 4BK5A 4HT1T 3UESA 4DY5A 2VZUA 4AEDA 2GC3A 2KXLA 3HT2A 1KS4A 1XU1A 5J48A 1SZBA 2JJ6A 4H2AA 5GLVA 4Z1VA 1C8M2 2MEV1 1O59A 5D8AB 5FREA 2PHUA 3KV4A 2B8MA 2B42B 4CCEA 5GM0A 1ZBE2 5IW0A 5C5UA 2WYFA 1KDMA 2VH9A 1PK6A 3THDA 1AL23 5C3SA 1JZ4A 2YPJA 2HWF3 2HWD3 3A7QA 1H2KA 5GZGA 1WLCA 5FZEA 1XNKA 4CDWA 1MZ6A 5FZOA 3W59A 3MIHA 4ZZ8A 1BEV2 3ZYIB 1NY71 1ZBA1 5JIAA 2AEZA 2IXLA 3BKZA 4RQPA 2RS32 3NNMA 3U75A 3WDXA 5FFOC 1QGLA 1CQ9A 1W6MA 2O1QA 5F5QA 3VV1A 4EQVA 2E53A 4QDQA 5K8SA 1YUDA 5J09A 2QFEA 4Q4Y1 4QHBA 1CAWB 1LOGA 4I01A 5L9RA 4B4RA 1TG7A 2YU2A 1MZEA 4JHZA 1WD4A 5DG1A 5C4WA 5I0RA 1PO22 1UIKA 1RVF3 3DYMA 5L9BA 1BBT1 4G3YC 3NAPA 2ET1A 4IGPA 5CEHA 1JZ2A 5JVVA 1I6XA 3I2DA 4WVWA 3FX3A 4O7XA 3D3AA 3SCHA 5LCWL 1EPWA 4ZU4A 1JOPA 5LB6A 3ELNA 2CWMA 2JG8A 3OYWB 3ZFGA 5C9AC 3B94A 4XBLA 1NX9A 3AZXA 3PJQA 5A33B 1LHWA 1RUE3 4ISQA 3BPZA 4PQ9A 3ZPYA 4CDXC 4P02B 1QJFA 4CDUC 1UIJA 1J1TA 2ARBA 4BDVB 4IEQA 3AL5A 4XUPA 4A41A 4AWDA 1SBDA 3CHXA 3W5NA 4AZZA 1SFPA 2D6NA 3K51A 3IB3A 4CRQA 4J1WA 1HJGA 1RUJ3 2WFF2 4O9GA 1GP5A 5L73A 5FXVA 2KM2A 3O1MA 3O5SA 1LULA 2WAAA 1UX6A 3HMYA 2WUHA 2QCSB 3INAA 5HXVA 5CG9A 1R64A 2RDQA 3FC0A 4CEWC 1RUJ2 1PMJX 2OXBA 4YRDA 3P3PA 4NRPA 3H3ZA 3MPPG 1A6CA 2GN3A 3FMGA 5B4XA 3SITA 4NJ4A 1OD5A 2D97A 5EP9A 2FMYA 5F3EA 4NWVA 4YW4A 4OI2A 2OUJA 4FP2A 4B4PA 4YG0A 2PHFA 4XJ9A 1UKRA 2O0OA 1S2EA 3ON7A 3VBRB 2EVXA 2BVBA 3ETQA 4HKWA 5CZKA 4UFLA 1QJEA 2J1EA 4PBPA 1EAH1 4QQLA 2Q5TA 3O1PA 1GFF2 2HYXA 3WV6A 1RHI1 1AR61 3DEMA 4B1MA 2DVAA 4D7SA 1FOD3 1TME2 4DEVA 5KR7A 4HETA 4QAWA 1LEDA 2VZTA 3Q8EA 4L11A 1POV3 1WMXA 3WF4A 1YNAA 2VVEA 4JKKA 4YGCA 2AACA 3HEIA 1PVC1 3NQHA 4CZSA 2QQKA 4HXCA 4L9BA 5D8AC 4AVTA 4YM1A 3ZKYA 1VBD2 1RJ8A 3MLJA 4FP3A 4OI4A 4QHZA 4DEQA 4D94A 1ULCA 2GSYA 3N35A 2UURA 4J6GA 5I91A 1VRH2 2E63A 1PX4A 2GNTA 5FPBA 5FO8B 5EJ1B 1LR5A 2ZX4A 1GKBA 1O4TA 2P3YA 5J96B 2ORZA 4F83A 5T3NA 4MGKE 2DFCA 1GMMA 2PLV2 5JMCA 5FBJA 4HPKB 3POSA 1DLLA 1RUNA 3W9AA 4IE7A 1H30A 4LTAA 4KG0A 4AI3A 3AZYA 1VBB1 1W9WA 5A3OA 4E8CA 4Q27A 4YVWB 1D4M1 3HPNA 1TE1B 4MO3M 1D2QA 1AF9A 1W6OB 2BJSA 2OQ7A 3HVDA 5GLWA 1I3HA 2FBEA 3IMNA 4XBNA 1N1YA 1O7FA 1XNDA 4DUXA 1YQ8A 2VCAA 2YU1A 1LODA 4HVRA 4ISRA 5FZ8A 4GH4B 2ZHMA 4GZ9A 4Q5OA 1BVVA 3BPSA 3PVNA 1AYN1 2PHXA 3K3NA 3JBG3 3PVBB 2OS2A 3GZEA 5HV0A 2ZGRA 1JOJA 2DCZA 5FPVA 3TYJA 5IAXA 2VAUA 1WA4A 3FFQA 3OY8B 3SISA 1HXS3 1TZOA 2B9UA 2JE9A 5C9AA 5FTTC 5LK5A 1YJLA 4WZFA 2BV4A 2J22A 2BU9A 4CDXA 3VHRA 3JBG2 5F5CA 5JOWA 1JYNA 1Z7S2 2HWE1 1PGW1 1YLLA 2JIGA 2Q8CA 2GAUA 2D6PA 2W46A 3CZUA 4P5YA 3EMRA 4E4DX 3UGFA 2ATFA 4HN1A 2XG3A 4KNCA 2W52A 4QGMA 4WVVA 4ES8A 3MICA 4K7JA 4MH0E 3UGGA 2XUMA 1C5IA 2TEPA 2QUOA 2G4IA 4CSWA 2X53S 4HLTA 2LW8A 5BY5A 3GZAA 2PA7A 2JDKA 2XJVA 4BK4A 5CG8A 4CEWA 2HKXA 3MFCA 5DXDA 1CAVB 4XC9A 4TSVA 1ZRCA 4DXRA 2WR9A 2O8OA 3KSCA 4RR3B 2WIIB 3J8F1 1APNA 2ZX3A 3VBHB 5A1LA 1ENSA 1K12A 3V0AA 1V6JA 1NZIA 1PNFA 3VBRC 3NW4A 1E5SA 3D8CA 5FZ9A 3KGZA 1VALA 2XL9A 3RJ2X 4AQ6A 2WZR2 1U5XA 2ZEYA 1BMV1 4B3NA 1JHNA 3MIBA 2F17A 3WDYA 3ORJA 4XCBA 1CD3G 3TN91 4JKLA 3POGA 4M4PA 3WW3A 1WGPA 1GNHA 2WA4A 1ALYA 4XQDA 1QNYA 4Q0VA 3WCSA 3AMPA 3AP5A 3A22A 4CUBA 1AL21 5I0DA 3G6JB 3NMBA 4CXYA 2HWF1 1GZWB 1UMZA 1XB9A 1DZTA 3AYCA 3ETPA 3LSEA 4XFIA 2EXIA 2VO5A 1NOVA 2R071 5D8AA 1KFUL 2JICA 3CNAA 1GANA 2PHTA 3SHRA 1O4ZA 4CEYB 1I5ZA 2C1FA 2RHPA 1XOYA 2ZGOA 2DTYA 4OLLA 3M3EA 3WW4A 2OZJA 1HQWA 3WG1A 1G8WA 4QQPA 5LA9A 5FZIA 4BLJA 3VB9A 3S6PA 2ZEZA 2BPA2 4YM2A 3KVBA 5KBFA 2DVGA 4TYSA 4KMQA 4XDQA 4LUMA 4YVWC 3UT0A 1ZZBA 3RS6A 1D2SA 2ET7A 2JKBA 2Y6LA 4CCLA 5JAXA 1CAWA 4FOVA 1N1TA 1XXNA 2FQPA 2HWC2 3PVOA 4BM8A 4UAPA 4I0BA 1Q8VA 3M3OA 4CCNA 3CDZB 2W5FA 2PQSA 3KVAA 4GH4C 1LNSA 4P00B 1KFXL 1SLTA 3SH3A 1DU3D 4Y4YA 4ZU5A 4PDWB 2BERA 3S0MA 3BCWA 1RGSA 3K4ZA 1CIYA 4UI9L 5JWPA 3ZX7A 1WKYA 1C1FA 3BIEA 2OT7A 3OYWA 5T55A 2YBKA 5IK5A 4MHRA 3FHAA 5A33A 4EN9B 4K1YA 1YCIA 3NJVA 3TRSB 1BKZA 5KC5A 4XXPA 1ZM1A 3N7JA 5FYTA 1QJZA 2D3SA 1OURA 2KR2A 4LKFA 4YPJA 4XTMA 5AC93 2DURA 1AR82 4QU1A 4ASKA 4IGOA 5DZEA 3DL3A 2ETEA 3CO2A 4WM8B 3GDBA 2ZXQA 1ASJ3 4RS5B 3JQXA 3LEMA 1U5IA 4LO4B 3T2TA 2JDYA 1XYPA 3H50A 1W2UA 2Q4SA 3SMHA 4LHLA 1MS1A 5AC92 2WL1A 3KGLA 4UFJA 3LOBA 1S0GA 1RUD1 1QJY3 1HQNA 1VPHA 1XNBA 5EYXA 1OKQA 4AVBA 4Y33A 4RR3C 3VDDB 1D7PM 2W39A 2YFZA 3U78A 1QDOA 1ODMA 4QKNA 5JOZA 4YSFA 2BQPA 1WW4A 3VZNA 1DYKA 5BNQA 1FOD1 3V64A 3TEZA 4N7IA 4QHOA 1J58A 1QJY2 2DCYA 5LBBA 2ZEXA 5CU1A 3VBRA 3ZOIA 3H0OA 3PDQA 2ERFA 3MW3A 3I2JA 5KHKA 4BE3A 3TEWA 5FMDA 4RHV3 1OLRA 3H3UA 4E4HA 5A3UA 5FPXA 4KWJA 2WNOA 1XSQA 3OPZA 5DAQA 3IPVB 1C57A 1LGNA 3AFGA 4IDZA 1JYVA 2ZGSA 1MPXA 1QOTA 4LT5A 4CP9B 2BRTA 3HOBA 3JU9A 4HSLA 1HRI2 4DS0A 3OUJA 2VUAA 4JTNA 4ZZ5A 2WQ8A 2R063 3AKTA 2F4LA 5DZFA 1MS5A 5H9PA 4HANA 3RYRA 3LOIA 3OTFA 1A8DA 1DGWX 1N1SA 4UFIA 1WCKA 1R093 2ZA9A 2WS93 4MADA 4CEYC 4Q0PA 3F95A 1B09A 1UNBA 2XUEA 1OQ1A 2Y6JA 3JXSA 5EZWA 3Q8BA 3IN9A 4D6QA 4NHYA 5FY8A 2R062 2XMLA 3LFIA 4NN0A 4PQQA 1SLAA 2RM23 3I7DA 1LU2A 1JYCA 3LB9A 2WAOA 1ENXA 4M3CE 1V6LA 1YFYA 1DQ0A 2IUWA 4LO6B 4HPKA 3IAQA 1FPN3 4FCAA 1RUC2 2QQPA 1L7RA 5JCTA 3O7OA 1H1IA 3J4UH 4AL9A 5IUQA 2QQNA 4MXVA 2CGNA 4YVWA 4Y1XA 3SC7X 1LAJA 1W6OA 4ASLA 3T0AA 4HZFA 4AHXA 2WO7A 1F9KA 1ND2B 4R9AA 4V2VA 4XUNA 4AI2A 3BTXA 1ZZ8A 4M0HA 3WG4A 2OW4A 1HXS1 3GALA 1ZZ9A 3I49A 4PDWC 2XBO1 2DCKA 4PIXA 3VKLA 2X8KA 3LSDA 3VD3A 2ZX2A 5LY1A 3U10A 2BP6A 2YMZA 1P8JA 3LPGA 2YUEA 3AYAA 1RUG2 5I0TA 2D7FA 1C1LA 4BQ5A 2Z5WA 2PQQA 4AI9A 1DYPA 3OY8A 1MEC2 3P3NA 1UY2A 2BVVA 1XE7A 2ZMKA 1JUIA 2CHHA 5LW9A 5JXJA 4A7KA 4BB3A 4P5HA 3OBAA 2BOJA 4P9IA 1N47A 1HB2A 3ES1A 4LIVA 3MW4A 4FXKB 4JCKA 4PF5A 2I74A 2VTFA 3IDAA 5GALA 4WM8C 3WCRA 4CCKA 1W04A 2YBSA 4RS5C 4DQAA 1OD3A 5LBFA 4DY3A 3THPA 3HJRA 3K75B 2GP5A 1YO8A 2V72A 1EUUA 2BBAA 2H6BA 2XL7A 4P9XA 4UW3A 4ZONA 2Y33A 4UW6A 4XEZA 3MUY1 4BQXA 5FYCA 2WINB 4XILA 2DUQA 1REDA 2NZ9A 1YYNA 3IDBB 4I3PA 1CAVA 3QOPA 1H9PA 3VDDC 5KHGA 2MEV2 4ZS3A 1JN2P 1UKGA 2EICA 3T0DA 4RD7A 3JB8A 4RR3A 4AOCA 5KXEA 1UN1A 3C8XA 4SLIA 2VZOA 3T08A 5EIYB 2W08A 4Q4X1 3VBHA 1G9AA 1W2AX 1PGSA 4LO8A 4DNYA 5C3OA 4AHWA 1W39A 1MZFA 1XYOA 3GBWA 4Q4Y3 2A75A 2WBKA 3BALA 2ADDA 1ZBA2 2Y6GA 3OCPA 1F15A 3PMSA 4WVZA 1OI6A 3HQXA 1MS3A 3MLKA 4IE0A 2V09A 2VMFA 1ULOA 4UXAA 1GZWA 3S30A 5IVVA 2WABA 1IG3A 3WVJA 2ZABA 3WLUA 1LKNA 1BBT2 1SG3A 3NKGA 1ZNPA 4F7ZA 4QQHA 2WYSA 5DDJ2 2F4PA 4CEYA 5H9RA 2JKXA 3VD4A 1QNWA 4AEMA 4N7UA 2W91A 1VAMA 4XMIA 4QXBA 1R081 3WOGA 5IK4A 1Q3EA 5FXWA 3B01A 1C28A 3CKHA 3SCGA 4W6XA 3RZGA 1JZ7A 4BPZA 4XHXA 1UYZA 4KWKA 4LKEA 2VMHA 4NIHA 5T5OA 1CWPA 3PTRB 3HN1A 1MVEA 4XFFA 2XXZA 3KV9A 1F5FA 1BHGA 1HJFA 4HK9A 2Q30A 3POIA 1QH7A 3UGHA 1HN0A 3VZMA 2QKDA 1O5UA 3OUHA 1ND2C 3VD7A 4OFGA 4DPNA 1COV1 3UV9A 5CA6A 1KEXA 4K8FA 1H4GA 1AHSA 2ENRA 3VDAA 1CGPA 3KQRA 3ZXDA 2P1BA 1FNYA 2VNVA 1H0BA 2DWRA 1X50A 4ASMB 4PDWA 2ZGTA 1OFNA 4OHXA 2VQUA 3WUDA 3AC0A 1F5JA 4I0AA 4KH9A 5H9QA 2KA3A 1QJX3 4R4ZA 3WDUA 1LEMA 1YFXA 3WNXA 2P6HA 4XUOA 3C2UA 3RYPA 5KWRA 1EAH3 1JW6A 2AEYA 2VQ0A 4NRQA 1ASJ1 1BQPA 3ME2A 4OMCA 4CCCA 2FDHA 1X8MA 1W6NB 4QXHA 3EB7A 4Z8BA 1BXHA 1IPJA 4OZOA 1RUH2 5CKQA 1OLMA 2RJLA 4EYUA 1J59A 1W8HA 2QTWB 4GMP0 5LASA 1S2KA 1RUI1 2SLIA 5J98B 2G9GA 4M0NA 1S0BA 4WM8A 5FZBA 1T6GC 3BU0A 4RS5A 3THCA 1DF0A 1RHI2 2A70A 4IE5A 4QB2A 4QWNA 1AR62 2BNNA 2JD9A 2EIDA 2ZS6B 1SCRA 2A6VA 1QXRA 1G9FA 3DYOA 1PM4A 2Q8EA 2JWPA 3WDTA 1VBC1 1XNAA 4GKYA 1PVC2 2GC0A 2XJRA 3U4SA 4MHUA 4OMDA 3ILNA 1CAUB 3CZJA 4XCAA 5JXGA 1FT9A 2R16A 5K7PA 3KCCA 4NIDA 2BWCA 4TLFA 3VDDA 1NUKA 3D0SA 2GH8A 3GBFA 1HW5A 3I3EA 2Q1ZB 4AXOA 4X8NA 2VC9A 4YZ1A 1VBB3 1CONA 3K3OA 1NE6A 1LHOA 1D4M3 3WG2A 5CISA 1QJU3 1REFA 2HEVF 1KGYA 5FYHA 3KM5A 1ZRDA 4XDPA 1IHMA 4BQ1A 2W94A 2JECA 4YW5A 1WW6A 4K40A 5LRSA 2AENA 2X10A 5FZMA 5J7MA 4I30A 1R091 3IPVA 4FPOB 1A8MA 2A5ZA 2OA2A 1HKDA 2OYZA 2WA3A 3UETA 2Q1MA 4GULA 3VKFC 1D4M2 1U5YA 3PIGA 4CP9A 1S0DA 1AYN3 1UMHA 1GQGA 2DTWA 3BU7A 5F2WA 2W3JA 3ZSMA 4CDUB 4R52A 4ZXKA 5JDBA 4UW5A 1DGRA 2VZRA 4AI1A 2D6LX 1YC61 1NZCA 3HBZA 5FCCA 2GN7A 4IW3A 3UK9A 4ET7A 2RM21 3D6EA 4IEUA 5FYUA 1EUTA 2GDFA 2JDMA 4B8EA 2QVSB 2AH2A 2R0FA 1FPN1 4JGZB 1RTVA 4LOTA 2ZMNA 5FUIA 5FZDA 5ANNA 5A6ZA 4C8DA 4BHPA 3ZMNA 1J3PA 3HN3A 3O14A 5A3PA 5LA2A 5HXMA 4FTEA 2WNVB 5ABJB 5F3IA 3MIEA 4LK6A 3IAPA 2O14A 3LDBA 1ENQA 4KBZA 1MR5A 3DPRC 5F2SA 5FUNA 3KHCA 2V4VA 4QT6A 5T5JA 4AAPA 1AXZA 2ARCA 2XJUA 3I4IA 1HB1A 3RNSA 1J84A 1YRZA 3ZO0B 3E1F1 4QGNA 4E9KA 5FWJA 1W0PA 3VUOA 2HWE2 1PGW2 2JX9A 2VCBA 4BJ0A 5BNNC 4C1XA 4QD2A 1L7QA 2XVKA 1AZDA 4UYBA 4NIIA 3F2ZA 2GMEA 4KU8A 2P2KA 1G9DA 4QB1A 2HBTA 1FYUA 3WG3A 1GQPA 1ND2A 2W1WA 5FP8A 3VGIA 3I97A 4CU9A 4QX1A 1JTZX 1HQLA 2R0HA 3GF6A 2IVJA 1GICA 2JG9B 1XC6A 3ACLA 4FI9A 4C0HA 1WMEA 2RJ2A 1GWMA 2B5HA 5A7NA 1CX1A 4AW7A 2P3IA 4JDOA 2FCTA 3OGVA 2Q1FA 5FYZA 3U14A 3ZIWA 1NLRA 4JC1A 5HCBA 1UWWA 3J8F2 3TN93 2XJQA 4CA9A 4HN0A 4Z92B 2ZKNA 1Y9QA 1YQ6A 2XR4A 3A4UA 4CP1A 1NCQB 1AR71 3ZXKA 1V6IA 1OKOA 1H2MA 4AE2A 4ARXA 4YW3A 1BMV2 1RINA 3T2OA 4DXZA 3PIJA 3E5UA 3PU3A 2WZEA 3TN92 2R073 4AF9A 3T2QA 4MOAA 3PJYA 3NV1A 1SMVA 2LROA 1Z78A 2OPWA 3I2IA 1AL22 3WF0A 2G19A 4Z82A 2HWF2 2HWD2 3VKOA 2D6MA 4OZXA 3O1SA 4CU7A 2PELA 4KGQA 2R072 1VMHA 3WZ1A 5BV6A 3E5QA 1DCSA 5IATA 4OCTA 4XFAA 5CAZA 2FCUA 2ZGNA 1OA4A 5GZEA 2VCMA 2WWUA 3IWZA 2R043 4UOJA 4OQ8A 5FWEA 3DXTA 4LKSA 2P6CA 4LLOA 2YV8A 3AP9A 1F4HA 3FZ3A 1V70A 3VKMA 2YPDA 3R4UA 1RVF2 1LOCA 4JRAA 2A7AA 2NMNA 2PAEA 3M1HA 3H8RA 4FPLA 4C90A 3T3YA 3BTZA 3N9NA 1W6QB 2GALA 1M06G 1KD7A 3T0BA 3AK0A 1V9U1 3ZXFA 2P4EA 3WNNA 1H1MA 1K5JA 1GLHA 3ITQA 4QKFA 4YW1A 4AI8A 4BLIA 2A3WA 5GZCA 3KV5A 1RJ7A 1RUE2 4JGZC 3NVCA 2QJVA 2VU9A 4YGBA 2NM1A 4CCJA 1NG0A 2JDUA 2C24A 5FY5A 3H8UA 1C3HA 3SNMA 2WNVC 5E8AA 2RMU3 4L8QA 4XAEA 5ABJC 1UU6A 2X05A 4Q26A 1IKQA 2VL4A 3AKRA 4FQ4A 4IE4A 5FJKA 4EWAA 1AYM3 1WUVA 3POEA 5IVBA 1UZYA 1SBEA 1W2NA 4DZGA 1DP0A 2EAKA 1O5LA 4L99A 1OF4A 2VZPA 1S0CA 3GJAA 1MS9A 4U36A 1QXPA 3JCIA 5C8CB 1JZ5A 1QOSA 3RJRA 3AJZA 3K46A 1RUD3 1W8UA 3OD0A 4HG6B 4XFHA 1VMJA 2VGDA 4XFCA 3V0BB 2HJIA 1QJX1 2XDVA 5A7SA 4GD4A 3ZXGA 3E6CC 4OUEA 5FZAA 1VBE1 2D6OX 2JG9C 2PXJA 2VG9A 3AKPA 4LLFA 5A7WB 1W8WA 2BZDA 5A7OA 2FZ2A 3POJA 5F3GA 1RUD2 5FYVA 1SLCA 1IS5A 1SLLA 2C9AA 3ZMOA 1GWKA 1M4WA 1JYXA 3BVCA 2J1SA 4LIUA 5FUPA 1QWRA 1FXZA 2VMGA 4GMP1 5FMCA 2J1VA 3J7LA 4NOTA 3T2PA 4Y24A 1OQEA 1UZVA 1XE8A 1W6NA 4JDNA 1ZREA 1FOD2 3KCYA 4KQ7A 1NCQC 3HWJA 3VBFB 5D2AA 3RZMA 1DQ1A 2RDNA 5T52A 3USUB 2UY9A 2B4KA 4E4ZA 2CL2A 2W1UA 4AYUA 4RYDA 4A42A 1VRBA 3M8LA 4LEJA 2VOVA 1JH5A 5BNPB 4KGGA 5LK7B 3P1IA 3AKSA 4QKDA 4A3XA 4L97A 5LEJA 1EYBA 3S7EA 2BDRA 2VJXA 3PNAA 2XJPA 2XJTA 2CY6A 3HNYM 3LA2A 4FPGA 4NIGA 1H6XA 1QJU1 3HD8B 1HB4A 3I2HA 1CAUA 1WLWA 2GNBA 4FFGA 4CXXA 1R1A1 2D5HA 3POBA 1LOAA 5ACA1 5C3PA 3KB5A 2CGOA 2H6CA 3POYA 1FI2A 1NXMA 4B1LA 2ZPXA 4FFIA 4XDOA 1VBA1 2OZ6A 1X7NA 3ECQA 1GWLA 1Q56A 2NLRA 3IKWA 4IV1B 4RFRB 1KJLA 4NHXA 3KQ4B 2B39A 5IVFA 2QQWA 3AFKA 4Q4V1 2BEOA 5CKMA 4OI1A 4EZHA 4C1WA 1YXWA 2RDSA 1DIWA 4UF0B 4UWDA 2DVBA 2DFBA 4EN8B 4NHKA 3OEAA 3JQWA 4TXWA 2XBO3 1RITA 2XQRA 1PHMA 4EN0A 5IVEA 1DFQA 3OGSA 4XUTA 4CDUA 5FR3A 2HWB3 3M70A 4U2AA 1W8OA 3N9LA 3UJOA 3P5BA 1O8SA 4K8RB 4LQRA 3J9SA 2X29A 4COVA 5JSOA 3FLTA 2B46X 3I3BA 3S5AA 3N9MA 5L9VA 3X29B 5D1IA 3ZYHA 5CBLA 1HXS2 2BTVC 1YQ2A 1CJPA 2AYHA 4GALA 2XBO2 4JGZA 5JIUA 1A34A 3A0NA 4Y1UA 1UOJA 3DCQA 2A73B 3O1TA 2QZ2A 4XURA 3WF2A 4GB31 5ABJA 2ZJCA 1H9WA 3NNLA 4R4XA 1OA2A 4RGGA 5FIXA 3H8XA 4C91A 1C4RA 1QKQA 4ATEA 1UPSA 3ZXAC 1Z0HA 2BOIA 3BOWA 1PNGA 2I07B 4X6RB 1BK1A 1X33A 1TMF1 3MFAA 3ZFEB 1QU0A 1CZSA 5EWSA 2E7QA 2D44A 3RYKA 1H8VA 3U07A 4PCRA 3RG0A 4D6RA 1E5RA 1S55A 1ZYBA 4OI0A 1AX1A 3LGRA 4Q4X3 1SCSA 1OA3A 2JG9A 2XHNA 3MIFA 5IHRA 3R05A 2EXJA 3HNMA 3WD5A 4N53C 4BISA 1US2A 5FZCA 3WNOA 4BXFA 5C3QA 1UYXA 3WQBA 3CJIC 3OPWA 4JKMA 5IVJA 1LGBA 3U11A 1GZTA 1UY4A 3GHMA 2QQVA 1OQDA 2VNRA 2ZGLA 3OB8A 4XAAA 4Y3OA 5EYYA 1LHVA 3VBFC 4AG4A 4COWA 1S0JA 1NCQA 2ZHKA 1YI9A 5CYYA 1PM7A 2ZGKA 4JDMA 4A4AA 5IFTA 1BJQA 4W50A 3M7AA 4YVSB 5BNPC 3I59B 3OSDA 1BEV1 4IETA 4YG6A 4V1PA 3NV3A 2H0BA 4XIOA 5A80A 3CBNA 5JXHA 2B7YA 4YLZA 5FYMA 4D8MA 4N43B 2R041 4XF9A 1L7LA 1R083 3GCWA 4WM7B 3I3QA 4H7LA 3MUZ1 3FBMA 5C8CC 3N7KA 1RXGA 4LORA 4P9LA 4XETA 4I09A 1BCXA 4K1ZA 4FPFA 1VLNA 1Q8OA 3AB0A 4LE4A 4NHLA 1DGLA 4IV1C 3QD6A 1JYWA 1S0IA 3MO4A 5G05L 1CIWA 3H7JA 4ZS2A 3JB4C 4NUBA 3LE0A 1IG0A 1QY4A 1COV3 1GBGA 5FAXA 4BQ3A 4LO5B 4AEKA 1V6NA 4CU6A 2PMWB 1E5IA 2ZCWA 3OUIA 2Q8OA 4E4SA 2VUCA 1AXYA 4XJUA 2P3KA 1JZ6A 5ERLA 1W6QA 1RXFA 3E97A 4CDQB 3N36A 4FXGB 2RMU1 3VBUB 5I8TA 3AMMA 1COV2 5JI9A 4HKOA 1W2TA 3AP4A 3ZXEA 1AYM1 4DXTA 4QX3A 5A1AA 4LJHA 1HX6A 3VZOA 5JPNB 2V4AA 4AEJA 3RQ0A 2RVAA 4K9SA 2AREA 3ABZA 1W8NA 3M4FA 3C7FA 4CU8A 2IXHA 3MPBA 2O8QA 1RUI3 1FNZA 2ZZQA 3WEZA 4QQ2A 3OJBA 4Q0UA 5FY7A 1ASJ2 2LM3A 1IKPA 1K3IA 1LHUA 4Y1YA 2YC2A 4P9WA 1ULFA 5E1RA 5KHHA 2ZX0A 4S2HA 2R30A 4RL7A 3ZFEC 4LULA 1RC6A 2WKKA 2WC2A 1RUI2 2LS6A 1VBC3 1DQ4A 1UYYA 1JBCA 1QDCA 5DUWA 1SQ4A 3MDPA 4JGYB 3V0BA 4GA9A 3ZVXA 4PI2A 4JQRA 2YBPA 3EJKA 4XJ8A 3GNEA 2C4XA 1NQJA 2CNAA 3KWVA 5A7WA 3BI3A 3SXWA 1WWYA 1TNRA 3ZKUA 1O3SA 1VBC2 2CAUA 5FY1A 1BYHA 3BN6A 1EY2A 1W9YA 3B93A 2J7MA 4Y22B 4CDQC 4R9DA 2ZEWA 3OEBA 5DAXA 4XF0A 1I5PA 2J42A 2D3PA 1MACA 2WSVA 5FYYA 4RHV2 2R1DA 3SKVA 4JTOA 3I2GA 4WVMB 4TTGA 1E57A 3R4SA 2VUJA 5FP3A 4AQTA 3VBFA 1VRH1 4XABA 3USUA 3AP6A 4YVSC 3AVRA 5K0UB 3ST7A 1UU5A 5BNPA 3KV6A 4KI5M 5FZ7A 3ZYGA 1R092 2WS92 3R4DB 2Y26A 4N43C 1GOFA 1GNYA 4W4ZA 5FY0A 3C7GA 2IZWA 2VNGA 2QQIA 4WM7C 2NMOA 5E6HA 3B9CA 3HAGA 4YFZA 1ZRIA 4RSUA 5FK7A 2RM22 4JRLA 2D3RA 5A7QA 3BOPA 3NJYA 2WLPA 2YY1A 3ZN5A 4A6SA 1UY3A 1B35B 3GM8A 4LOSA 5DAVA 4AVCA 4LBJA 1FPN2 1JUHA 2YHJA 3MW2A 4UFHA 5SV5A 5ISLA 2OX0A 2A3YA 5A32B 5JR7B 1AVBA 3SH5A 4UT5A 3T4HB 4UFMA 4GH4A 1JOBA 1HRV1 1ULEA 3C7OA 4FPJA 1OPOA 3WT3A 2BFUS 5DPNA 4IV1A 2HWB1 1F8VA 1LECA 2D98A 1S1AA 5FY9A 2EF6A 4FPEA 2EIGA 1Y43B 4UF0A 3WQ7A 3CJXA 2RR11 3LA7A 4D7YA 1VE0A 2PTMA
chains in the Genus database with same CATH topology
3K3OA 5IVFA 4EZHA 5A3TA 4Y33A 4UF0B 5FZ1A 3U78A 5LY2A 5FYHA 2YPDA 4TN7A 4XDPA 5FXZA 5FZ0A 5IVEA 3PUQA 4QXCA 2WWJA 5A1FA 5A1LA 4GAZA 5FZMA 3N9LA 3N9NA 5FZKA 4HOOA 4BU2A 5F3EA 3PDQA 5FYIA 5FZLA 5FZ9A 3N9MA 5F2WA 4E4HA 4V2WA 5FPUA 3PUAA 3KV5A 5ANQA 3AL6A 5LWBA 5FZ6A 4GJZA 5FYUA 5FP7A 4HONA 4CCJA 5IVVA 5FJHA 5FY5A 3DXUA 5FY7A 5FZDA 3N9QA 5KR7A 4D6SA 4URAA 4C8DA 5FJKA 5A3PA 2W2IA 5A3WA 3N9OA 5F3IA 5IVBA 5FV3A 5FXXA 4QXBA 3LDBA 5FUNA 2XUEA 5FXWA 5F2SA 3UYJA 5FZ3A 5F32A 5F37A 4AAPA 4D6QA 5FY8A 2XMLA 3PU8A 5FYBA 5F5IA 3K2OA 3ZLIA 2YBPA 5FWJA 5F3CA 3PUSA 3KV4A 5A7PA 5A7WA 5FZIA 3PTRB 5IW0A 5FPAA 5FPBA 4D6RA 4LITA 2XDVA 2XXZA 3KV9A 5A7SA 4GD4A 3KVBA 5FY1A 5FZAA 2PXJA 5FP8A 5FBJA 5A7WB 3OPTA 5FZEA 4LXLA 5FYYA 5FZOA 4IGQA 5A7OA 4BISA 4DIQA 5FZCA 4DO0A 5F5AA 5F3GA 4BXFA 4CCLA 4QX8A 3OPWA 5FYVA 4V2VA 5IVJA 5FP3A 5FZFA 5FZOB 2OQ7A 4LIUA 5FUPA 4CCNA 4Y3OA 5A7NA 2Q8DA 4CCMA 5LY1A 2OQ6A 3KVAA 4GJYA 5FYZA 5IWFA 2YU1A 2YU2A 3AVRA 5FZ8A 3KV6A 5FZ7A 4AI9A 5CEHA 4IGPA 5FYSA 3K3NA 4QXHA 2OT7A 1VRBA 2OS2A 2YBKA 5FP4A 5FZGA 5A80A 5LW9A 5A3NA 5FPVA 5FY0A 4EYUA 5FYMA 3PU3A 5E6HA 3AVSA 5FZHA 4Y4RA 4LIVA 5A7QA 3ZPOA 5FYTA 3NJYA 5FZBA 3N9PA 4QWNA 4CCKA 4QU1A 2GP3A 2YBSA 5F5CA 5FP9A 3RVHA 4ASKA 2OX0A 5ISLA 2Q8CA 4CCOA 4IGOA 5IVCA 3AL5A 4CUGA 5FY4A 2GP5A 3LD8A 2Q8EA 4EZ4A 5FPLA 3U4SA 4QX7A 5FYCA 5FY9A 5FZ4A 5IVYA 5K4LA 4XDOA 4CSWA 2WWUA 5FXVA 4NUBA 4UF0A 5FWEA 3DXTA 3PURA 5F39A 2VD7A 2P5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K3O A;  5IVF A;  4EZH A;  5A3T A;  4Y33 A;  4UF0 B;  5FZ1 A;  3U78 A;  5LY2 A;  5FYH A;  2YPD A;  4TN7 A;  4XDP A;  5FXZ A;  5FZ0 A;  5IVE A;  3PUQ A;  4QXC A;  2WWJ A;  5A1F A;  5A1L A;  4GAZ A;  5FZM A;  3N9L A;  3N9N A;  5FZK A;  4HOO A;  4BU2 A;  5F3E A;  3PDQ A;  5FYI A;  5FZL A;  5FZ9 A;  3N9M A;  5F2W A;  4E4H A;  4V2W A;  5FPU A;  3PUA A;  3KV5 A;  5ANQ A;  3AL6 A;  5LWB A;  5FZ6 A;  4GJZ A;  5FYU A;  5FP7 A;  4HON A;  4CCJ A;  5IVV A;  5FJH A;  5FY5 A;  3DXU A;  5FY7 A;  5FZD A;  3N9Q A;  5KR7 A;  4D6S A;  4URA A;  4C8D A;  5FJK A;  5A3P A;  2W2I A;  5A3W A;  3N9O A;  5F3I A;  5IVB A;  5FV3 A;  5FXX A;  4QXB A;  3LDB A;  5FUN A;  2XUE A;  5FXW A;  5F2S A;  3UYJ A;  5FZ3 A;  5F32 A;  5F37 A;  4AAP A;  4D6Q A;  5FY8 A;  2XML A;  3PU8 A;  5FYB A;  5F5I A;  3K2O A;  3ZLI A;  2YBP A;  5FWJ A;  5F3C A;  3PUS A;  3KV4 A;  5A7P A;  5A7W A;  5FZI A;  3PTR B;  5IW0 A;  5FPA A;  5FPB A;  4D6R A;  4LIT A;  2XDV A;  2XXZ A;  3KV9 A;  5A7S A;  4GD4 A;  3KVB A;  5FY1 A;  5FZA A;  2PXJ A;  5FP8 A;  5FBJ A;  5A7W B;  3OPT A;  5FZE A;  4LXL A;  5FYY A;  5FZO A;  4IGQ A;  5A7O A;  4BIS A;  4DIQ A;  5FZC A;  4DO0 A;  5F5A A;  5F3G A;  4BXF A;  4CCL A;  4QX8 A;  3OPW A;  5FYV A;  4V2V A;  5IVJ A;  5FP3 A;  5FZF A;  5FZO B;  2OQ7 A;  4LIU A;  5FUP A;  4CCN A;  4Y3O A;  5A7N A;  2Q8D A;  4CCM A;  5LY1 A;  2OQ6 A;  3KVA A;  4GJY A;  5FYZ A;  5IWF A;  2YU1 A;  2YU2 A;  3AVR A;  5FZ8 A;  3KV6 A;  5FZ7 A;  4AI9 A;  5CEH A;  4IGP A;  5FYS A;  3K3N A;  4QXH A;  2OT7 A;  1VRB A;  2OS2 A;  2YBK A;  5FP4 A;  5FZG A;  5A80 A;  5LW9 A;  5A3N A;  5FPV A;  5FY0 A;  4EYU A;  5FYM A;  3PU3 A;  5E6H A;  3AVS A;  5FZH A;  4Y4R A;  4LIV A;  5A7Q A;  3ZPO A;  5FYT A;  3NJY A;  5FZB A;  3N9P A;  4QWN A;  4CCK A;  4QU1 A;  2GP3 A;  2YBS A;  5F5C A;  5FP9 A;  3RVH A;  4ASK A;  2OX0 A;  5ISL A;  2Q8C A;  4CCO A;  4IGO A;  5IVC A;  3AL5 A;  4CUG A;  5FY4 A;  2GP5 A;  3LD8 A;  2Q8E A;  4EZ4 A;  5FPL A;  3U4S A;  4QX7 A;  5FYC A;  5FY9 A;  5FZ4 A;  5IVY A;  5K4L A;  4XDO A;  4CSW A;  2WWU A;  5FXV A;  4NUB A;  4UF0 A;  5FWE A;  3DXT A;  3PUR A;  5F39 A;  2VD7 A;  2P5B A; 
#chains in the Genus database with same CATH topology
 1RUF 1;  5A3T A;  3IM0 A;  2XWB B;  2W47 A;  3AZZ A;  2VMC A;  3AJY A;  4MGS A;  3VBU C;  3LDK A;  3ZFF B;  1DQ2 A;  2Q0A A;  4N9H A;  4A44 A;  4AGV A;  5SV8 A;  2W9X A;  5AVA A;  1RL3 A;  1F31 A;  2R32 A;  4XJW A;  5FXZ A;  1NCR C;  4UBG A;  3H1Y A;  3OBZ A;  3WQ1 A;  2WWJ A;  2J1U A;  2R49 A;  1Q8S A;  2UWB A;  3IT8 A;  5HCH A;  1NE4 A;  4S2F A;  1UOG A;  3I54 A;  4QDS A;  4GIQ A;  4YZ4 A;  1S0F A;  5IAV A;  4FOW A;  5C5T A;  1MS8 A;  2IXJ A;  4CYD A;  4XAC A;  1AR7 3;  2FD8 A;  2YXS A;  5FPU A;  2VZ1 A;  3QCW A;  1W28 A;  2G9F A;  3LIH A;  5LRR A;  2K0G A;  2E33 A;  4Q29 A;  5C6C A;  3WX5 A;  3MV0 1;  3VL9 A;  5A3L A;  1OVS A;  4OVE A;  5FJH A;  3WIN E;  2BUK A;  2QDN A;  2FDK A;  4FTB A;  5G04 L;  1OFS A;  3TNP B;  1HN1 A;  2ES3 A;  1AR7 2;  3FN9 A;  4AVV A;  1DQ6 A;  1NQD A;  4YAR A;  1EP0 A;  1I1E A;  2CDP A;  2N7G A;  3VZL A;  3ZFE A;  1GV9 A;  2WZR 1;  3EXU A;  4JGY C;  4QX5 A;  4XW3 A;  1PGL 1;  3I2K A;  3UYJ A;  5F32 A;  2VNO A;  2Y6K A;  4RQP B;  1NY7 2;  3D82 A;  3S7I A;  4KBB A;  1W6M B;  5FYB A;  2OVU A;  5F5I A;  3T1M A;  2FMD A;  1US3 A;  2DVF A;  3TOJ A;  2OPK A;  1ULP A;  4IE6 A;  5HPO A;  2QQO A;  1YHF A;  3RZK A;  4IND A;  5EQU A;  4Q4Y 2;  3VBO B;  3NNG A;  3JD7 3;  1UMI A;  3LQC A;  3Q8C A;  3VHP A;  1O91 A;  1W06 A;  2IC1 A;  4NAM A;  2W95 A;  4QPG C;  4BQ4 A;  3WF1 A;  1MS4 A;  1OLM E;  3ACF A;  3E6B A;  2MNG A;  4JV4 A;  5DN2 A;  5FDB A;  5J1X A;  5HBA A;  4MXW B;  5DUU A;  3RWK X;  3TAY A;  2FDJ A;  3DN7 A;  3RSJ A;  3DF0 A;  3WNP A;  3KLS A;  3WDW A;  5FZF A;  4EN6 B;  4ZHN A;  1V9U 3;  4K21 A;  4Y5T A;  2C6S A;  1GYK A;  5K0U C;  4YVS A;  3VZJ A;  3ENR A;  3I59 A;  1OT5 A;  2NPI A;  5F9T A;  1RB8 G;  1VAV A;  4Q0S A;  3VD5 A;  3DPR B;  1C5H A;  1OC1 A;  2E26 A;  4PLN A;  4N43 A;  1ULD A;  1U0A A;  1UOF A;  5FYS A;  5JLV A;  1V9U 2;  4BQ2 A;  4LKD A;  3CQO A;  1QIQ A;  4ARY A;  4WM7 A;  2JXA A;  5BNN B;  1JOD A;  1LOF C;  1SHW B;  2Y64 A;  4LO7 A;  4BQY A;  1B35 C;  4RA0 A;  2J1T A;  2XH6 A;  5LZ6 A;  5FLH A;  1MVQ A;  2VR4 A;  3FL7 A;  2CWS A;  3ILF A;  4W8J A;  1N1V A;  4GXL A;  1CZT A;  4G9S B;  2BW8 A;  1N3O A;  2JIJ A;  3HR9 A;  4AFM A;  1WA6 X;  4QPW A;  4FOQ A;  4OYU A;  2XLG A;  3SKJ E;  1VIW B;  1WMF A;  4A3Z A;  1W8T A;  2TBV A;  2AUY A;  3BTA A;  3DEC A;  5F7U A;  1ST8 A;  3P6B A;  2VMD A;  1ND3 B;  1VBE 3;  2HEY F;  4FPY A;  1IS4 A;  3OF1 A;  1QQP 1;  4DXS A;  1SBF A;  3GBG A;  1S0E A;  3LWC A;  4OUM A;  4CDQ A;  3O1U A;  1AR8 1;  3ZFF C;  4FT8 A;  2C0Z A;  4KG8 A;  3VBU A;  3NRU A;  4FPH A;  4I3G A;  1QJX 2;  5E16 A;  4HMZ A;  3H1W A;  4OHV A;  2JDZ A;  1VBE 2;  2C5D A;  4GMP 3;  1EAH 2;  2QQJ A;  1NA1 B;  3AXE A;  5C3R A;  4AFD A;  3PHM A;  4GKX A;  3QH6 A;  4LHS A;  2RS5 1;  4HL0 A;  3L2Y A;  1KS5 A;  3BIW E;  4B4Q A;  3III A;  3TBD A;  4JQT A;  2ZGQ A;  2E7T A;  4LA3 A;  1UCX A;  4HBN A;  2K2S A;  4AFB A;  3D5O A;  5FMB A;  5EJZ B;  2BGP A;  4D7T A;  1XJA A;  3ZYP A;  1SDD B;  4NVP A;  5FZ6 A;  1XPW A;  3AZV A;  3CF6 E;  5DZG A;  1HDK A;  5DAW A;  5CKN A;  2FDI A;  3NNJ A;  1AUY A;  1UQX A;  3N9Q A;  3OG2 A;  5JSR A;  4MGZ E;  2ID4 A;  2PYT A;  4H7M A;  3HT1 A;  4Q8L A;  1DZQ A;  1R1A 3;  3FUQ A;  4RQP C;  4PBO A;  4I2O A;  4ZXE A;  2ADE A;  5ACA 3;  4CXW A;  2TNF A;  1VBB 2;  1RMU 1;  3Q8A A;  2DCT A;  2E9Q A;  4LHN A;  3GXU A;  4OQ9 A;  4ATF A;  1J1L A;  1VBA 3;  4AQS A;  4Y1Z A;  5BYN A;  3CU7 A;  1DGR N;  5C4W C;  1QJU 2;  1UD1 A;  4Y22 A;  3B69 A;  4QGL A;  3VBO C;  1UO9 A;  2ZHL A;  4A7Y A;  3WP4 A;  4Q4V 3;  4LIT A;  2MPF A;  2NYY A;  3NV2 A;  2XHK A;  5ACA 2;  5C7G A;  4WVM A;  4ES9 A;  2H0V A;  3S5Q A;  3OPT A;  1GOG A;  2YFU A;  5FO7 B;  3AMN A;  4IGQ A;  2YC0 A;  3K77 A;  3MF9 A;  5FKC A;  3UKT A;  1AYN 2;  2A6Z A;  4XMA A;  4BYY A;  2BFU L;  4IV3 B;  3NNF A;  4IXL A;  3ZFG C;  2CAV A;  2PHW A;  3FWE A;  4P9G A;  4XQ4 A;  2WN3 A;  4XHB A;  3ZSL A;  5K0U A;  2WZ8 A;  4NE9 A;  1XQN A;  2VY0 A;  2P37 A;  1RUC 1;  1S4C A;  2ARX A;  1KXG A;  1X9P A;  2VMI A;  3BGA A;  1UX7 A;  4GJY A;  2ORX A;  3ZSK A;  4BQW A;  4FVV A;  3RZH A;  3ZN4 A;  3ACG A;  1GUI A;  4XTP A;  1AJK A;  3ACI A;  1DG6 A;  4HVO A;  4Y5Z 0;  3ACH A;  4UBH A;  5A3M A;  2RS1 1;  3DV8 A;  3W21 A;  2E51 A;  4GB3 3;  1WCS A;  1CR7 A;  3IZO A;  1IQD C;  3LPF A;  3WNL A;  3THT A;  4CCD A;  2Y38 A;  1LOF A;  3KT4 A;  5FZG A;  5T5P A;  1B35 A;  2VPV A;  3VHN A;  4HKL A;  2CTV A;  5DAP A;  4PLO A;  2YGL A;  4S2G A;  3PUI A;  2A6W A;  5FZH A;  5A32 A;  2BGO A;  1X8E A;  2A6X A;  2UYA A;  2VBP A;  2QZ3 A;  1UW8 A;  2R6Q A;  4Q8K A;  1UL9 A;  2XVL A;  4GB3 2;  1TMF 3;  4PT6 A;  3TEX A;  1NYW A;  1WW7 A;  1SLB A;  4XBQ A;  3EO6 A;  3WR0 A;  1AR9 3;  1JMU B;  3NL1 A;  4YZ3 A;  1MEC 1;  5CFC B;  2Y6F A;  5FY4 A;  1ND3 C;  2W68 A;  1UY1 A;  3AMQ A;  5DG2 A;  3R0R A;  5FMO L;  4IEV A;  3MI8 A;  4QU2 A;  3I3M A;  1TMF 2;  2WQ4 A;  3T4V A;  4Q4W 3;  3G7D A;  1R1Z A;  4CUA A;  2EAL A;  4SBV A;  1WCD J;  4H55 A;  2P5B A;  1GQH A;  4NWW A;  4NMI A;  2EAA A;  4QX2 A;  3ROU A;  3UL2 A;  3FFZ A;  1NA1 C;  2XVG A;  1YQC A;  4A45 A;  5C70 A;  5LEK A;  1UOB A;  3KF5 A;  3RDI A;  5DAB A;  1ODN A;  2JDA A;  4E2S A;  2DDU A;  5FOB B;  1ZBE 3;  1K5M B;  2WO1 A;  4GAZ A;  2VZ3 A;  4BMB A;  5FZK A;  5FLI A;  2LAL A;  3B7M A;  5LA0 A;  4J25 A;  1OH3 A;  1UY0 A;  3VZK A;  1BEV 3;  3FBY A;  4NO4 A;  1E5H A;  2JB8 A;  3KMH A;  3PUA A;  1GZ9 A;  1V00 A;  2RS3 3;  2VOX A;  1WZX A;  1RIR A;  5IK7 A;  2A6Y A;  4Z2A A;  1CJD A;  1W0O A;  2ARA A;  3SQO A;  4ZPI A;  2CGP A;  1F35 A;  4URA A;  4E8D A;  4C0B A;  1PO2 3;  3JD7 1;  3Q9O A;  3IMM A;  2W2I A;  5CVR A;  5A3W A;  3AX4 A;  3ZDS A;  2HH9 A;  2YGM A;  4WV8 A;  1MQT B;  5CAD A;  4KWL A;  2R04 2;  2ILM A;  3UKN A;  4JZR A;  2QBX A;  3VN4 A;  4DRV A;  3I2O A;  5F37 A;  4W6W A;  5HI0 A;  4P08 A;  4DOU A;  5GLT A;  1UXZ A;  2GH2 A;  3W5M A;  3KT1 A;  1Y7B A;  3RFR A;  3VBO A;  3WNK A;  5I93 A;  5JI7 A;  2IXK A;  3ILR A;  3CLP A;  4YW6 A;  5A7P A;  2ZML A;  4FOY A;  4AI0 A;  3PTY A;  1H8T B;  5DDJ 1;  3ZIX A;  3POF A;  4MXW A;  2RE9 A;  2DV9 A;  3LKJ A;  5L7O B;  1ZRR A;  1CES A;  2W92 A;  2YRO A;  4HK8 A;  4NHM A;  4IV3 C;  1OXC A;  3MZH A;  1AX0 A;  2Y34 A;  2AGS A;  5EPA A;  4DIQ A;  3EBR A;  1L3J A;  1V6K A;  3CIH A;  5TSW A;  1TVG A;  2WFF 3;  3FUO A;  3T1L A;  4XJA A;  2ZGU A;  3LFM A;  4KU7 A;  4NRO A;  3DPR A;  2ZAH A;  4CPB D;  4W6Y A;  2ZAC A;  2Q8D A;  1ZRF A;  2VCC A;  1X9T A;  2P3J A;  1EV1 1;  1Y3T A;  1LRH A;  5KXB A;  2QQU A;  5IT6 A;  2RMU 2;  4MG2 A;  2VEC A;  1JZ3 A;  3WDV A;  5BNN A;  2SBA A;  5KHI A;  2LRP A;  2XPJ A;  1AYM 2;  2VBD A;  2VM9 A;  2VW0 A;  3H1M A;  5APA A;  1QH6 A;  3GYD A;  2IFW A;  3SCF A;  3PVE A;  2Z4F A;  1WW5 A;  1WCU A;  1O6U A;  2OII A;  5EFU A;  5CIR A;  5E88 A;  2WO3 A;  3LAG A;  2PHR A;  1LOE A;  5FKB A;  3POW A;  3RZZ A;  4Q0Q A;  4IER A;  1J3Q A;  1ZZC A;  2PHD A;  4KL1 A;  5CFC C;  2CU5 A;  1PMH X;  3MHZ A;  5FP9 A;  4N53 B;  2GC2 A;  4MVT A;  4QB6 A;  4DFS A;  2QE3 A;  4IES A;  4PIY A;  3NKT A;  1FMD 1;  3CJI B;  3FE5 A;  4Y20 B;  1FAY A;  1ND3 A;  2V5D A;  4E27 A;  1TME 3;  4R9C A;  1RUH 1;  2ZBJ A;  4PI0 A;  2CV6 A;  3RMY A;  5A6X A;  2XB6 C;  3MEP A;  4XFG A;  1H6Y A;  2DVD A;  4LBO A;  1LTE A;  2D40 A;  2GMM A;  3LIG A;  2J1R A;  5FQ0 B;  2FCV A;  1VBD 3;  1POV 0;  2WDB A;  5FZ0 A;  1NA1 A;  1Q8P A;  3FLR A;  1YFU A;  1K5M C;  3ZR5 A;  2JDH A;  3QLQ A;  2GMP A;  1W3V A;  1VRH 3;  3B9I A;  1XNC A;  3ZN6 B;  4Y1V A;  1AXK A;  4G4F A;  3RMX A;  3BUC A;  2Y0O A;  3AXD A;  4TZD A;  4N8M A;  4PIZ A;  2PLV 3;  3OD4 A;  3LDR A;  4H3W A;  2UY8 A;  3ATG A;  3TNQ A;  1O3T A;  3FHQ A;  1VB4 A;  4BIF A;  4XF4 A;  3QBQ A;  2DYC A;  4DIN B;  1VJ2 A;  1W90 A;  2MHF A;  2PFW A;  4P9Y A;  4YFW A;  4CTE A;  4EN7 B;  1NLS A;  5BNO B;  4L92 A;  1YEW A;  1SPP B;  3WP5 A;  1F2N A;  1DDL A;  4YWA A;  1CVN A;  4FQZ A;  4MUV A;  3AL6 A;  1LES A;  1GR3 A;  2XJS A;  3A21 A;  1JYT A;  2EIB A;  2RDR A;  5FP7 A;  5HCA A;  4IL7 A;  4LBN A;  4PHZ A;  3NV4 A;  3DXU A;  5D21 A;  1W9F A;  5E89 A;  5JOX A;  3KHB A;  1W05 A;  4TLG A;  4D6S A;  1MQT C;  3AZW A;  2ZKL A;  1SEF A;  2E7A A;  1D4V B;  3GCX A;  2UU8 A;  2XKO A;  3N9O A;  4IEZ A;  3J7M A;  4AQ2 A;  4GQ7 A;  5I8Y A;  1PO1 1;  4NPL A;  4M01 A;  1HRV 3;  4DRR A;  2BNM A;  1NAE A;  4BOW A;  5K9Y A;  1QF3 A;  3BYW A;  1H8T C;  1JXN A;  3NJX A;  4K3U A;  4RGA A;  4AGR A;  3GZT B;  5A70 A;  3PUS A;  4XFB A;  2RR1 3;  3NWK A;  2VW2 A;  4B7E A;  5BUV A;  5L7O C;  2QNK A;  1WCQ A;  3KCX A;  5C71 A;  5FPA A;  1RUF 3;  3E5X A;  1VR3 A;  1Z7S 3;  1HRV 2;  1V6O A;  2W0X A;  4A2U A;  5JSP A;  3HQU A;  2FDG A;  2HWB 2;  4IV3 A;  1JHJ A;  1LCL A;  1OUX A;  1YI7 A;  2DUP A;  1IPK A;  2WNV A;  1PIV 1;  3IBM A;  1IGO A;  1W2O A;  1CPM A;  4XOG A;  3ZYB A;  1BK0 A;  2VQA A;  4Y26 A;  5C33 A;  2RR1 2;  2AR6 A;  2GND A;  3JUU A;  2F6B A;  4L0P A;  2A1X A;  1RUF 2;  3DYP A;  5EJ3 A;  1RUO A;  1FV3 A;  4QX0 A;  1KRI A;  1KJR A;  4NRM A;  3B3Q E;  1JU3 A;  3O1V A;  1CPN A;  1WLT A;  1H4H A;  3O0X A;  1BVP 1;  1ENR A;  3C3V A;  2UWA A;  1O3Q A;  3UJQ A;  1AR9 1;  4OHW A;  1HB3 A;  4M3C B;  1T2X A;  3RGB A;  1ONA A;  5FP4 A;  4E2G A;  1GP6 A;  5A3N A;  4XPV A;  5F1R A;  2XGX A;  4HFS A;  4LMF A;  2DU1 A;  2DU0 A;  4Q4W 1;  3AVS A;  1F4A A;  2WZR 3;  1FV2 A;  4LHK A;  4FPK A;  4QMA A;  2X5I B;  5CFC A;  1OOP B;  4X6Q B;  1C8N A;  1HLC A;  1Q5O A;  1C8M 1;  2YC4 A;  2YZ4 A;  4BZ4 A;  2K46 A;  4Q4X 2;  4BCU A;  1X36 A;  3OGG A;  4F3J A;  5IVC A;  1ZBE 1;  1BLZ A;  4FFH A;  3DUI A;  1H1A A;  1ZX5 A;  4CUG A;  4FAH A;  5FO9 B;  1SLI A;  1G9B A;  3B00 A;  2JEM A;  3RZJ A;  1PGL 2;  1OF3 A;  4DMI A;  1QMJ A;  4Y5S A;  5IVY A;  4N90 A;  2ZTN A;  3WXP A;  5J36 A;  2YYO A;  4MZU A;  2OUH A;  2J1A A;  4UFK A;  4CUC A;  1OSG A;  2RS3 1;  3PUH A;  3U4X A;  1K5M A;  2VZV A;  3M2M A;  3H8O A;  1GSL A;  2VOK A;  1V6M A;  2VE1 A;  4N9I A;  2DBN A;  5FZ1 A;  2HWD 1;  2HYK A;  3V56 A;  4AHY A;  2G9Z A;  3U37 A;  4BME A;  4CPB A;  1YWK A;  1UZZ A;  3TEY A;  2WWS A;  1GZC A;  3ZYF A;  4IEY A;  4QXC A;  4D0Q A;  4CVU A;  1PO2 1;  4MSV A;  3KS7 A;  4MGT A;  1X82 A;  1I9R A;  2NQY A;  4HOO A;  2VOT A;  4BU2 A;  5BNO C;  4YGE A;  1G86 A;  2XKP A;  4S2D A;  3A0K A;  2D43 A;  1Y9M A;  2G1M A;  1R08 2;  3VL8 A;  3CEW A;  3D4K A;  5CNA A;  2HWC 3;  4LA2 A;  4FPC A;  1RVF 1;  3RRD A;  4Q1R A;  2Y6H A;  3WHU A;  4EWD A;  1ACC A;  1PZ9 A;  4YGD A;  1MQT A;  3MLL A;  4HVQ A;  1WBL A;  1ZZ6 A;  2V5Y A;  4QM8 A;  3K48 A;  5B2G B;  2XOM A;  1XYN A;  5C8W A;  4AVA A;  3VDB A;  1GNZ A;  1OVP A;  1NLQ A;  5IFP A;  1JI6 A;  2JDP A;  4COZ A;  3B02 A;  4YM3 A;  1YIP A;  3C7E A;  2ZOE B;  4O65 A;  3W58 A;  1ZVF A;  4BA6 A;  4BH9 A;  1PZ8 A;  2WFF 1;  2CYF A;  3ZM8 A;  1RUE 1;  4LPL A;  5B4N A;  1H8T A;  3JZV A;  1NCR B;  4QKB A;  4EV0 A;  4FO9 A;  4XJZ A;  3K2O A;  3ZLI A;  3NO8 A;  4AR2 A;  5L7O A;  2CSG A;  5F3C A;  3E6D A;  1QQP 3;  4EJR A;  2WRA A;  1W03 A;  1AR8 3;  2R7E B;  2WSU A;  2Z69 A;  3OGR A;  3WW1 A;  3J7N A;  3U1X A;  4YNI A;  5DQ0 A;  1FAT A;  1AJO A;  1RUJ 1;  4MX3 A;  3VDC A;  3U0Z A;  2VW1 A;  1W8F A;  4MLO A;  3EQE A;  4QPI B;  2E6V A;  1UZ0 A;  5CFD B;  5BPX A;  1S2B A;  1NKG A;  3OBR A;  4IEP A;  5IJR A;  2WT1 A;  3MYX A;  1QQP 2;  2A3X A;  4D69 A;  1Y9G A;  2RS5 3;  5JOY A;  1MS0 A;  1O4Y A;  1QXJ A;  4P9J A;  5JR2 A;  2QDR A;  2FDF A;  3LF7 A;  1G6N A;  5J3U A;  4XZU G;  5L19 A;  3V65 A;  2VOW A;  5DMY A;  2GNM A;  3MF6 A;  2RS5 2;  4GWN A;  1DLC A;  1TME 1;  3W20 A;  5T5L A;  3N3H A;  1LOB A;  1VAK A;  3SEP A;  3ZYR A;  4OHY A;  2IWG B;  3H7Y A;  3VHO A;  3ZR6 A;  2RJK A;  2X5I C;  1W9T A;  1OOP C;  1REE A;  1RYY A;  1JS9 A;  2AZ5 A;  2Y8K A;  4EWE A;  2LTN A;  3HQR A;  4N53 A;  3I2F A;  3VBH C;  4Y4R A;  2EXH A;  4ERO A;  4YZ5 A;  4Y20 A;  3USS A;  3CJI A;  2E32 A;  1VBD 1;  3N9P A;  3ZXL A;  1W6P B;  4QPG B;  2EIE A;  3ZSE A;  4DUW A;  3KZ4 C;  5A6Y A;  3O1R A;  3RVH A;  1RMU 3;  4LBQ B;  4NAO A;  4MYE A;  3EYP A;  1HRI 3;  5EHD A;  4ONU A;  1POV 1;  4CCO A;  1DHK B;  3NJZ A;  1K45 A;  3TB0 A;  2BGC A;  1LJ7 A;  3LD8 A;  4YZ2 A;  1WLD A;  2WO2 A;  4W65 A;  2WQZ C;  3N7M A;  1PX3 A;  1LU1 A;  2PLV 1;  5DUX A;  5FQ0 A;  5F6L B;  5FZ4 A;  4B29 A;  1JZ8 A;  5DUV A;  3GHN A;  2ZGP A;  1U12 A;  3LEG A;  5HCF A;  5LAT A;  5J37 A;  1RMU 2;  3MID A;  4YG3 A;  4DB5 A;  3CL1 A;  3PUR A;  2XON A;  5F39 A;  3IDE A;  4XYX A;  2FZ1 A;  2VD7 A;  3OGJ A;  3URF A;  3VLB B;  3ZN6 A;  1W0N A;  2D6K A;  4I02 A;  4IUG A;  5FPZ A;  2WNU B;  3LEI A;  1MZ5 A;  2KD7 A;  2PAM A;  5FZL A;  3T09 A;  4IQP A;  3B5L B;  5I8S A;  5LY2 A;  1GOH A;  3M3Q A;  4TN7 A;  1V0A A;  3RZL A;  1RUC 3;  4ZU7 A;  4O9E A;  4OUL A;  5C8C A;  1ZA7 A;  5BNO A;  2IXI A;  2QQM A;  1SPP A;  3VBS B;  2GZW A;  3PME A;  2ZZJ A;  5JZG B;  2CDO A;  2RS1 3;  2V73 A;  1LEN A;  2EA7 A;  4V2W A;  3Q8F A;  3WW2 A;  1W9S A;  3WUC A;  4JX0 A;  2IFR A;  2VXJ A;  5GZF A;  4Z07 A;  4LNV A;  4COY A;  2Y0I A;  1JYI A;  1QOO A;  4H14 A;  1CZV A;  1CAX B;  3O0W A;  2WN2 A;  1J83 A;  4GJZ A;  4XF3 A;  5LBE A;  4HON A;  5FK8 A;  2VBB A;  3WP3 A;  5GZD A;  4F8A A;  4P14 A;  3MIG A;  2RS1 2;  3JBG 1;  4IEX A;  1ULG A;  4JAA A;  1Z7S 1;  1STM A;  1RUG 3;  1HV0 A;  4LBL A;  3VKN A;  1PMI A;  4LBQ D;  1MEC 3;  4AVS A;  3K4A A;  4GWJ A;  5FV3 A;  2P34 A;  5FRA A;  5KXC A;  1DQ5 A;  4MV2 A;  5FZ3 A;  1AX2 A;  4L2N A;  2AC1 A;  2IVI B;  3PU8 A;  4PLM A;  2ZX1 A;  2W87 A;  3FHI B;  1U5Z A;  4E2Q A;  3UNP A;  4AED B;  1UU4 A;  4QPI C;  3T30 A;  3ALQ A;  2I2S A;  1HV1 A;  5CFD C;  4BIO A;  2YG0 A;  2Z79 A;  2VVF A;  4AGG A;  2RG4 A;  2NN8 A;  5AFE A;  2BBV A;  2HBU A;  3NST A;  4MGY E;  4LBK A;  4PF1 A;  3RPQ A;  1KQR A;  1SAC A;  2JB4 A;  5AVP A;  5FMO S;  1W8Z A;  1PK6 B;  4DO0 A;  5F5A A;  1Q43 A;  2K9Z A;  4YW7 A;  2XLF A;  2C26 A;  4YM0 A;  3FLP A;  5FZO B;  4QXK A;  2MEV 3;  4CDW B;  4IEW A;  5JUV A;  1J3R A;  2VQT A;  2WT2 A;  5AFB A;  2OQ6 A;  4M3C A;  5IWF A;  1UXX X;  4PJY A;  4M3C F;  4BXS V;  5HV4 A;  4DUV A;  2BWA A;  4XUQ A;  4MGI E;  4KWU A;  4TWT A;  4EE2 A;  3I8T A;  4QPY A;  3N4M A;  2VZS A;  2X5I A;  4NIA A;  4CE8 A;  1OOP A;  1OPM A;  1ZBA 3;  3ZYJ B;  3ZXJ A;  5C4W B;  3BTY A;  1UZW A;  4ITC A;  3NAP B;  5BXX A;  1DYO A;  5IK8 A;  3C7H A;  2B9V A;  1IOA A;  3WF3 A;  4ZKT B;  3ZPO A;  4JHT A;  1LGC A;  1KDK A;  1QEX A;  3HBK A;  3RI8 A;  2GP3 A;  3L2H A;  2JG8 B;  5T54 A;  1XBF A;  1IZ3 A;  3JD7 2;  4JVA A;  4COU A;  2Z42 A;  3ZFG B;  4GWI A;  4FAG A;  1BBT 3;  2QQL A;  4EZ4 A;  3GJB A;  2PHL A;  4HSJ A;  3SLI A;  5FPL A;  5DDJ 3;  3AYD A;  2VTX J;  1JU4 A;  5EV7 A;  3J26 N;  1PVX A;  1A78 A;  3CMG A;  1TNF A;  3AYE A;  2C9K A;  2WNU C;  4OUS A;  1LHN A;  4LK7 A;  3ASI A;  1EPZ A;  3BB6 A;  3QH7 A;  5LBC A;  3SH4 A;  4FBF A;  1NXD 1;  2IXC A;  1CN1 A;  3K4D A;  2HWC 1;  2JEN A;  1QHD A;  2XQX A;  4LBM A;  1SFN A;  2BNO A;  4LE3 A;  5KC6 A;  4OHZ A;  5FOJ B;  1OHF A;  2YB7 A;  1LB2 A;  4K6B A;  2Y60 A;  4QQO A;  4NPM A;  5GLZ A;  3VBS C;  3WSO A;  1EV1 3;  1KIT A;  4IEO A;  5JZG C;  4UW4 A;  1AL0 G;  3WP6 A;  2VUD A;  5GLU A;  1IS3 A;  1WMD A;  1G7Y A;  5JXI A;  5FYI A;  1VB2 A;  1N3Q A;  5CB7 A;  2VVD A;  4AAX A;  2UYB A;  2WJS A;  3ZDV A;  3AP7 A;  4WBB A;  3LCP A;  1T6B X;  2I45 A;  1EV1 2;  4LR4 A;  1CX4 A;  4I0W B;  5ANQ A;  4J1X A;  4RGK A;  4AFA A;  2JE7 A;  2PAK A;  2ZHN A;  1XU2 A;  4R8H A;  2P17 A;  5FLJ A;  2GU9 A;  1K42 A;  3OBT A;  3KF3 A;  1FMD 3;  2VME A;  3L9J T;  1NCR A;  3R6S A;  1DZR A;  3TWI A;  2DBI A;  1RUH 3;  4CP0 A;  4BWO A;  2ZAA A;  5AC9 1;  2PN5 A;  4AED C;  4XQW A;  4FSJ A;  2B45 X;  1ZZ7 A;  1D0H A;  3BOD A;  2EXK A;  4QPI A;  1FMD 2;  5CFD A;  1RHI 3;  1AR6 3;  2JE8 A;  1OMI A;  3M3I A;  1Y4W A;  4MET A;  4URT A;  1PK6 C;  2D5F A;  2WNE A;  4A6O A;  1OH4 A;  4RFT 0;  3HNB M;  3O12 A;  4MGQ A;  4LXL A;  1W3X A;  2DCJ A;  4NR1 A;  4XVH A;  1POQ A;  1PVC 3;  1QJY 1;  1YJK A;  4CDW C;  1UF2 C;  4A7Z A;  4QX8 A;  1NT0 A;  3RI9 A;  3H3L A;  1D0G A;  4JGY A;  4XF1 A;  5JPM B;  3PL0 A;  2X09 A;  5F6K A;  1ZA4 A;  1TEI A;  3IIA A;  4M00 A;  5F8P A;  4XIK A;  2E31 A;  4CCM A;  1VMF A;  4YW2 A;  1DBN A;  5FBZ A;  3UKV A;  2RV9 A;  3FJS A;  2JD4 A;  1SFY A;  3APB A;  1Q8Q A;  1HRI 1;  3AKQ A;  1SDW A;  2WT0 A;  2VUL A;  2WLQ A;  4D3W A;  1O8P A;  4RHV 1;  1R1A 2;  3NAP C;  2LUW A;  3I3D A;  1PZ7 A;  2DUO A;  3OOX A;  2W1S A;  3WY6 A;  1W6P A;  4QPG A;  3RWN A;  4X8P A;  1WBF A;  3LA3 A;  3S57 A;  3AM2 A;  4LBQ A;  2D93 A;  3AMH A;  3GZU C;  3H42 B;  1VBA 2;  3MGU A;  1UAI A;  1PO1 3;  1YQ5 A;  2JG8 C;  2FHR A;  2HEW F;  2R06 1;  2YDE A;  4LUK A;  4QM9 A;  4AK3 A;  2NP0 A;  5KHJ A;  5L36 A;  1A3K A;  2L9L A;  1BZW A;  3DKQ A;  3KT7 A;  2XWJ B;  4Q4V 2;  1H2L A;  3ES4 A;  5C9A B;  2WS9 1;  3A23 A;  2VTX A;  3ZSJ A;  1G9C A;  3WQ0 A;  3MBW A;  3LEK A;  4CDX B;  4GWM A;  3PLQ A;  1PO1 2;  1IQA A;  5T50 A;  4QX7 A;  1IPS A;  1YIF A;  3DGT A;  3J7H A;  1WD3 A;  3MV1 1;  2WNU A;  2W1Q A;  4FFF A;  5K4L A;  3DKW A;  5GKA C;  1PIV 3;  3N7L A;  4B7K A;  1HIX A;  1DGW A;  2VXR A;  3HIF A;  4ZY9 A;  4R9B A;  1XNT A;  1VP6 A;  1XE0 A;  2BYV E;  2HLE A;  2VZQ A;  2TUN A;  2JDN A;  1FX5 A;  3D0J A;  4XXA A;  2GC1 A;  5M0T A;  4O61 A;  4Q2F A;  5A6Q A;  1UPI A;  1OUS A;  2HWE 3;  3LZZ A;  3H9A A;  5I0U A;  3VBS A;  3SEE A;  5LA1 A;  4Q1P A;  1GU3 A;  5JZG A;  4Z2W A;  2DF7 A;  1PIV 2;  3PUQ A;  4XZP A;  4CEW B;  1YFW A;  5A1F A;  1RUG 1;  4NPR A;  2WZP P;  1OBN A;  2XLA A;  1N3P A;  2ZGM A;  4WZC A;  3M3C A;  4CP2 A;  1CAX A;  2A71 A;  4YYO A;  4AHZ A;  1W99 A;  1URX A;  4K20 A;  5EXO A;  3IDC B;  3QAC A;  3EHK A;  4FTS A;  3V0A B;  5KXD A;  4XE9 A;  1O3R A;  5IYY A;  3WNM A;  5LWB A;  4AFC A;  2UWC A;  2Z2S B;  1GP4 A;  3ZFF A;  5H9S A;  4ORF A;  1AR9 2;  3WHT A;  4QDR A;  1OLQ A;  1XSR A;  3O0V A;  1UYP A;  3VD9 A;  3J8F 3;  5JMO A;  2R1B A;  1C8M 3;  1TQ5 A;  1H2N A;  3KD4 A;  5GJ6 A;  2OKX A;  1IS6 A;  4RN5 A;  4M4R A;  5I0S A;  5FXX A;  3O1O A;  1XRU A;  2WFP A;  3GGL A;  4Q4W 2;  4BK5 A;  4HT1 T;  3UES A;  4DY5 A;  2VZU A;  4AED A;  2GC3 A;  2KXL A;  3HT2 A;  1KS4 A;  1XU1 A;  5J48 A;  1SZB A;  2JJ6 A;  4H2A A;  5GLV A;  4Z1V A;  1C8M 2;  2MEV 1;  1O59 A;  5D8A B;  5FRE A;  2PHU A;  3KV4 A;  2B8M A;  2B42 B;  4CCE A;  5GM0 A;  1ZBE 2;  5IW0 A;  5C5U A;  2WYF A;  1KDM A;  2VH9 A;  1PK6 A;  3THD A;  1AL2 3;  5C3S A;  1JZ4 A;  2YPJ A;  2HWF 3;  2HWD 3;  3A7Q A;  1H2K A;  5GZG A;  1WLC A;  5FZE A;  1XNK A;  4CDW A;  1MZ6 A;  5FZO A;  3W59 A;  3MIH A;  4ZZ8 A;  1BEV 2;  3ZYI B;  1NY7 1;  1ZBA 1;  5JIA A;  2AEZ A;  2IXL A;  3BKZ A;  4RQP A;  2RS3 2;  3NNM A;  3U75 A;  3WDX A;  5FFO C;  1QGL A;  1CQ9 A;  1W6M A;  2O1Q A;  5F5Q A;  3VV1 A;  4EQV A;  2E53 A;  4QDQ A;  5K8S A;  1YUD A;  5J09 A;  2QFE A;  4Q4Y 1;  4QHB A;  1CAW B;  1LOG A;  4I01 A;  5L9R A;  4B4R A;  1TG7 A;  2YU2 A;  1MZE A;  4JHZ A;  1WD4 A;  5DG1 A;  5C4W A;  5I0R A;  1PO2 2;  1UIK A;  1RVF 3;  3DYM A;  5L9B A;  1BBT 1;  4G3Y C;  3NAP A;  2ET1 A;  4IGP A;  5CEH A;  1JZ2 A;  5JVV A;  1I6X A;  3I2D A;  4WVW A;  3FX3 A;  4O7X A;  3D3A A;  3SCH A;  5LCW L;  1EPW A;  4ZU4 A;  1JOP A;  5LB6 A;  3ELN A;  2CWM A;  2JG8 A;  3OYW B;  3ZFG A;  5C9A C;  3B94 A;  4XBL A;  1NX9 A;  3AZX A;  3PJQ A;  5A33 B;  1LHW A;  1RUE 3;  4ISQ A;  3BPZ A;  4PQ9 A;  3ZPY A;  4CDX C;  4P02 B;  1QJF A;  4CDU C;  1UIJ A;  1J1T A;  2ARB A;  4BDV B;  4IEQ A;  3AL5 A;  4XUP A;  4A41 A;  4AWD A;  1SBD A;  3CHX A;  3W5N A;  4AZZ A;  1SFP A;  2D6N A;  3K51 A;  3IB3 A;  4CRQ A;  4J1W A;  1HJG A;  1RUJ 3;  2WFF 2;  4O9G A;  1GP5 A;  5L73 A;  5FXV A;  2KM2 A;  3O1M A;  3O5S A;  1LUL A;  2WAA A;  1UX6 A;  3HMY A;  2WUH A;  2QCS B;  3INA A;  5HXV A;  5CG9 A;  1R64 A;  2RDQ A;  3FC0 A;  4CEW C;  1RUJ 2;  1PMJ X;  2OXB A;  4YRD A;  3P3P A;  4NRP A;  3H3Z A;  3MPP G;  1A6C A;  2GN3 A;  3FMG A;  5B4X A;  3SIT A;  4NJ4 A;  1OD5 A;  2D97 A;  5EP9 A;  2FMY A;  5F3E A;  4NWV A;  4YW4 A;  4OI2 A;  2OUJ A;  4FP2 A;  4B4P A;  4YG0 A;  2PHF A;  4XJ9 A;  1UKR A;  2O0O A;  1S2E A;  3ON7 A;  3VBR B;  2EVX A;  2BVB A;  3ETQ A;  4HKW A;  5CZK A;  4UFL A;  1QJE A;  2J1E A;  4PBP A;  1EAH 1;  4QQL A;  2Q5T A;  3O1P A;  1GFF 2;  2HYX A;  3WV6 A;  1RHI 1;  1AR6 1;  3DEM A;  4B1M A;  2DVA A;  4D7S A;  1FOD 3;  1TME 2;  4DEV A;  5KR7 A;  4HET A;  4QAW A;  1LED A;  2VZT A;  3Q8E A;  4L11 A;  1POV 3;  1WMX A;  3WF4 A;  1YNA A;  2VVE A;  4JKK A;  4YGC A;  2AAC A;  3HEI A;  1PVC 1;  3NQH A;  4CZS A;  2QQK A;  4HXC A;  4L9B A;  5D8A C;  4AVT A;  4YM1 A;  3ZKY A;  1VBD 2;  1RJ8 A;  3MLJ A;  4FP3 A;  4OI4 A;  4QHZ A;  4DEQ A;  4D94 A;  1ULC A;  2GSY A;  3N35 A;  2UUR A;  4J6G A;  5I91 A;  1VRH 2;  2E63 A;  1PX4 A;  2GNT A;  5FPB A;  5FO8 B;  5EJ1 B;  1LR5 A;  2ZX4 A;  1GKB A;  1O4T A;  2P3Y A;  5J96 B;  2ORZ A;  4F83 A;  5T3N A;  4MGK E;  2DFC A;  1GMM A;  2PLV 2;  5JMC A;  5FBJ A;  4HPK B;  3POS A;  1DLL A;  1RUN A;  3W9A A;  4IE7 A;  1H30 A;  4LTA A;  4KG0 A;  4AI3 A;  3AZY A;  1VBB 1;  1W9W A;  5A3O A;  4E8C A;  4Q27 A;  4YVW B;  1D4M 1;  3HPN A;  1TE1 B;  4MO3 M;  1D2Q A;  1AF9 A;  1W6O B;  2BJS A;  2OQ7 A;  3HVD A;  5GLW A;  1I3H A;  2FBE A;  3IMN A;  4XBN A;  1N1Y A;  1O7F A;  1XND A;  4DUX A;  1YQ8 A;  2VCA A;  2YU1 A;  1LOD A;  4HVR A;  4ISR A;  5FZ8 A;  4GH4 B;  2ZHM A;  4GZ9 A;  4Q5O A;  1BVV A;  3BPS A;  3PVN A;  1AYN 1;  2PHX A;  3K3N A;  3JBG 3;  3PVB B;  2OS2 A;  3GZE A;  5HV0 A;  2ZGR A;  1JOJ A;  2DCZ A;  5FPV A;  3TYJ A;  5IAX A;  2VAU A;  1WA4 A;  3FFQ A;  3OY8 B;  3SIS A;  1HXS 3;  1TZO A;  2B9U A;  2JE9 A;  5C9A A;  5FTT C;  5LK5 A;  1YJL A;  4WZF A;  2BV4 A;  2J22 A;  2BU9 A;  4CDX A;  3VHR A;  3JBG 2;  5F5C A;  5JOW A;  1JYN A;  1Z7S 2;  2HWE 1;  1PGW 1;  1YLL A;  2JIG A;  2Q8C A;  2GAU A;  2D6P A;  2W46 A;  3CZU A;  4P5Y A;  3EMR A;  4E4D X;  3UGF A;  2ATF A;  4HN1 A;  2XG3 A;  4KNC A;  2W52 A;  4QGM A;  4WVV A;  4ES8 A;  3MIC A;  4K7J A;  4MH0 E;  3UGG A;  2XUM A;  1C5I A;  2TEP A;  2QUO A;  2G4I A;  4CSW A;  2X53 S;  4HLT A;  2LW8 A;  5BY5 A;  3GZA A;  2PA7 A;  2JDK A;  2XJV A;  4BK4 A;  5CG8 A;  4CEW A;  2HKX A;  3MFC A;  5DXD A;  1CAV B;  4XC9 A;  4TSV A;  1ZRC A;  4DXR A;  2WR9 A;  2O8O A;  3KSC A;  4RR3 B;  2WII B;  3J8F 1;  1APN A;  2ZX3 A;  3VBH B;  5A1L A;  1ENS A;  1K12 A;  3V0A A;  1V6J A;  1NZI A;  1PNF A;  3VBR C;  3NW4 A;  1E5S A;  3D8C A;  5FZ9 A;  3KGZ A;  1VAL A;  2XL9 A;  3RJ2 X;  4AQ6 A;  2WZR 2;  1U5X A;  2ZEY A;  1BMV 1;  4B3N A;  1JHN A;  3MIB A;  2F17 A;  3WDY A;  3ORJ A;  4XCB A;  1CD3 G;  3TN9 1;  4JKL A;  3POG A;  4M4P A;  3WW3 A;  1WGP A;  1GNH A;  2WA4 A;  1ALY A;  4XQD A;  1QNY A;  4Q0V A;  3WCS A;  3AMP A;  3AP5 A;  3A22 A;  4CUB A;  1AL2 1;  5I0D A;  3G6J B;  3NMB A;  4CXY A;  2HWF 1;  1GZW B;  1UMZ A;  1XB9 A;  1DZT A;  3AYC A;  3ETP A;  3LSE A;  4XFI A;  2EXI A;  2VO5 A;  1NOV A;  2R07 1;  5D8A A;  1KFU L;  2JIC A;  3CNA A;  1GAN A;  2PHT A;  3SHR A;  1O4Z A;  4CEY B;  1I5Z A;  2C1F A;  2RHP A;  1XOY A;  2ZGO A;  2DTY A;  4OLL A;  3M3E A;  3WW4 A;  2OZJ A;  1HQW A;  3WG1 A;  1G8W A;  4QQP A;  5LA9 A;  5FZI A;  4BLJ A;  3VB9 A;  3S6P A;  2ZEZ A;  2BPA 2;  4YM2 A;  3KVB A;  5KBF A;  2DVG A;  4TYS A;  4KMQ A;  4XDQ A;  4LUM A;  4YVW C;  3UT0 A;  1ZZB A;  3RS6 A;  1D2S A;  2ET7 A;  2JKB A;  2Y6L A;  4CCL A;  5JAX A;  1CAW A;  4FOV A;  1N1T A;  1XXN A;  2FQP A;  2HWC 2;  3PVO A;  4BM8 A;  4UAP A;  4I0B A;  1Q8V A;  3M3O A;  4CCN A;  3CDZ B;  2W5F A;  2PQS A;  3KVA A;  4GH4 C;  1LNS A;  4P00 B;  1KFX L;  1SLT A;  3SH3 A;  1DU3 D;  4Y4Y A;  4ZU5 A;  4PDW B;  2BER A;  3S0M A;  3BCW A;  1RGS A;  3K4Z A;  1CIY A;  4UI9 L;  5JWP A;  3ZX7 A;  1WKY A;  1C1F A;  3BIE A;  2OT7 A;  3OYW A;  5T55 A;  2YBK A;  5IK5 A;  4MHR A;  3FHA A;  5A33 A;  4EN9 B;  4K1Y A;  1YCI A;  3NJV A;  3TRS B;  1BKZ A;  5KC5 A;  4XXP A;  1ZM1 A;  3N7J A;  5FYT A;  1QJZ A;  2D3S A;  1OUR A;  2KR2 A;  4LKF A;  4YPJ A;  4XTM A;  5AC9 3;  2DUR A;  1AR8 2;  4QU1 A;  4ASK A;  4IGO A;  5DZE A;  3DL3 A;  2ETE A;  3CO2 A;  4WM8 B;  3GDB A;  2ZXQ A;  1ASJ 3;  4RS5 B;  3JQX A;  3LEM A;  1U5I A;  4LO4 B;  3T2T A;  2JDY A;  1XYP A;  3H50 A;  1W2U A;  2Q4S A;  3SMH A;  4LHL A;  1MS1 A;  5AC9 2;  2WL1 A;  3KGL A;  4UFJ A;  3LOB A;  1S0G A;  1RUD 1;  1QJY 3;  1HQN A;  1VPH A;  1XNB A;  5EYX A;  1OKQ A;  4AVB A;  4Y33 A;  4RR3 C;  3VDD B;  1D7P M;  2W39 A;  2YFZ A;  3U78 A;  1QDO A;  1ODM A;  4QKN A;  5JOZ A;  4YSF A;  2BQP A;  1WW4 A;  3VZN A;  1DYK A;  5BNQ A;  1FOD 1;  3V64 A;  3TEZ A;  4N7I A;  4QHO A;  1J58 A;  1QJY 2;  2DCY A;  5LBB A;  2ZEX A;  5CU1 A;  3VBR A;  3ZOI A;  3H0O A;  3PDQ A;  2ERF A;  3MW3 A;  3I2J A;  5KHK A;  4BE3 A;  3TEW A;  5FMD A;  4RHV 3;  1OLR A;  3H3U A;  4E4H A;  5A3U A;  5FPX A;  4KWJ A;  2WNO A;  1XSQ A;  3OPZ A;  5DAQ A;  3IPV B;  1C57 A;  1LGN A;  3AFG A;  4IDZ A;  1JYV A;  2ZGS A;  1MPX A;  1QOT A;  4LT5 A;  4CP9 B;  2BRT A;  3HOB A;  3JU9 A;  4HSL A;  1HRI 2;  4DS0 A;  3OUJ A;  2VUA A;  4JTN A;  4ZZ5 A;  2WQ8 A;  2R06 3;  3AKT A;  2F4L A;  5DZF A;  1MS5 A;  5H9P A;  4HAN A;  3RYR A;  3LOI A;  3OTF A;  1A8D A;  1DGW X;  1N1S A;  4UFI A;  1WCK A;  1R09 3;  2ZA9 A;  2WS9 3;  4MAD A;  4CEY C;  4Q0P A;  3F95 A;  1B09 A;  1UNB A;  2XUE A;  1OQ1 A;  2Y6J A;  3JXS A;  5EZW A;  3Q8B A;  3IN9 A;  4D6Q A;  4NHY A;  5FY8 A;  2R06 2;  2XML A;  3LFI A;  4NN0 A;  4PQQ A;  1SLA A;  2RM2 3;  3I7D A;  1LU2 A;  1JYC A;  3LB9 A;  2WAO A;  1ENX A;  4M3C E;  1V6L A;  1YFY A;  1DQ0 A;  2IUW A;  4LO6 B;  4HPK A;  3IAQ A;  1FPN 3;  4FCA A;  1RUC 2;  2QQP A;  1L7R A;  5JCT A;  3O7O A;  1H1I A;  3J4U H;  4AL9 A;  5IUQ A;  2QQN A;  4MXV A;  2CGN A;  4YVW A;  4Y1X A;  3SC7 X;  1LAJ A;  1W6O A;  4ASL A;  3T0A A;  4HZF A;  4AHX A;  2WO7 A;  1F9K A;  1ND2 B;  4R9A A;  4V2V A;  4XUN A;  4AI2 A;  3BTX A;  1ZZ8 A;  4M0H A;  3WG4 A;  2OW4 A;  1HXS 1;  3GAL A;  1ZZ9 A;  3I49 A;  4PDW C;  2XBO 1;  2DCK A;  4PIX A;  3VKL A;  2X8K A;  3LSD A;  3VD3 A;  2ZX2 A;  5LY1 A;  3U10 A;  2BP6 A;  2YMZ A;  1P8J A;  3LPG A;  2YUE A;  3AYA A;  1RUG 2;  5I0T A;  2D7F A;  1C1L A;  4BQ5 A;  2Z5W A;  2PQQ A;  4AI9 A;  1DYP A;  3OY8 A;  1MEC 2;  3P3N A;  1UY2 A;  2BVV A;  1XE7 A;  2ZMK A;  1JUI A;  2CHH A;  5LW9 A;  5JXJ A;  4A7K A;  4BB3 A;  4P5H A;  3OBA A;  2BOJ A;  4P9I A;  1N47 A;  1HB2 A;  3ES1 A;  4LIV A;  3MW4 A;  4FXK B;  4JCK A;  4PF5 A;  2I74 A;  2VTF A;  3IDA A;  5GAL A;  4WM8 C;  3WCR A;  4CCK A;  1W04 A;  2YBS A;  4RS5 C;  4DQA A;  1OD3 A;  5LBF A;  4DY3 A;  3THP A;  3HJR A;  3K75 B;  2GP5 A;  1YO8 A;  2V72 A;  1EUU A;  2BBA A;  2H6B A;  2XL7 A;  4P9X A;  4UW3 A;  4ZON A;  2Y33 A;  4UW6 A;  4XEZ A;  3MUY 1;  4BQX A;  5FYC A;  2WIN B;  4XIL A;  2DUQ A;  1RED A;  2NZ9 A;  1YYN A;  3IDB B;  4I3P A;  1CAV A;  3QOP A;  1H9P A;  3VDD C;  5KHG A;  2MEV 2;  4ZS3 A;  1JN2 P;  1UKG A;  2EIC A;  3T0D A;  4RD7 A;  3JB8 A;  4RR3 A;  4AOC A;  5KXE A;  1UN1 A;  3C8X A;  4SLI A;  2VZO A;  3T08 A;  5EIY B;  2W08 A;  4Q4X 1;  3VBH A;  1G9A A;  1W2A X;  1PGS A;  4LO8 A;  4DNY A;  5C3O A;  4AHW A;  1W39 A;  1MZF A;  1XYO A;  3GBW A;  4Q4Y 3;  2A75 A;  2WBK A;  3BAL A;  2ADD A;  1ZBA 2;  2Y6G A;  3OCP A;  1F15 A;  3PMS A;  4WVZ A;  1OI6 A;  3HQX A;  1MS3 A;  3MLK A;  4IE0 A;  2V09 A;  2VMF A;  1ULO A;  4UXA A;  1GZW A;  3S30 A;  5IVV A;  2WAB A;  1IG3 A;  3WVJ A;  2ZAB A;  3WLU A;  1LKN A;  1BBT 2;  1SG3 A;  3NKG A;  1ZNP A;  4F7Z A;  4QQH A;  2WYS A;  5DDJ 2;  2F4P A;  4CEY A;  5H9R A;  2JKX A;  3VD4 A;  1QNW A;  4AEM A;  4N7U A;  2W91 A;  1VAM A;  4XMI A;  4QXB A;  1R08 1;  3WOG A;  5IK4 A;  1Q3E A;  5FXW A;  3B01 A;  1C28 A;  3CKH A;  3SCG A;  4W6X A;  3RZG A;  1JZ7 A;  4BPZ A;  4XHX A;  1UYZ A;  4KWK A;  4LKE A;  2VMH A;  4NIH A;  5T5O A;  1CWP A;  3PTR B;  3HN1 A;  1MVE A;  4XFF A;  2XXZ A;  3KV9 A;  1F5F A;  1BHG A;  1HJF A;  4HK9 A;  2Q30 A;  3POI A;  1QH7 A;  3UGH A;  1HN0 A;  3VZM A;  2QKD A;  1O5U A;  3OUH A;  1ND2 C;  3VD7 A;  4OFG A;  4DPN A;  1COV 1;  3UV9 A;  5CA6 A;  1KEX A;  4K8F A;  1H4G A;  1AHS A;  2ENR A;  3VDA A;  1CGP A;  3KQR A;  3ZXD A;  2P1B A;  1FNY A;  2VNV A;  1H0B A;  2DWR A;  1X50 A;  4ASM B;  4PDW A;  2ZGT A;  1OFN A;  4OHX A;  2VQU A;  3WUD A;  3AC0 A;  1F5J A;  4I0A A;  4KH9 A;  5H9Q A;  2KA3 A;  1QJX 3;  4R4Z A;  3WDU A;  1LEM A;  1YFX A;  3WNX A;  2P6H A;  4XUO A;  3C2U A;  3RYP A;  5KWR A;  1EAH 3;  1JW6 A;  2AEY A;  2VQ0 A;  4NRQ A;  1ASJ 1;  1BQP A;  3ME2 A;  4OMC A;  4CCC A;  2FDH A;  1X8M A;  1W6N B;  4QXH A;  3EB7 A;  4Z8B A;  1BXH A;  1IPJ A;  4OZO A;  1RUH 2;  5CKQ A;  1OLM A;  2RJL A;  4EYU A;  1J59 A;  1W8H A;  2QTW B;  4GMP 0;  5LAS A;  1S2K A;  1RUI 1;  2SLI A;  5J98 B;  2G9G A;  4M0N A;  1S0B A;  4WM8 A;  5FZB A;  1T6G C;  3BU0 A;  4RS5 A;  3THC A;  1DF0 A;  1RHI 2;  2A70 A;  4IE5 A;  4QB2 A;  4QWN A;  1AR6 2;  2BNN A;  2JD9 A;  2EID A;  2ZS6 B;  1SCR A;  2A6V A;  1QXR A;  1G9F A;  3DYO A;  1PM4 A;  2Q8E A;  2JWP A;  3WDT A;  1VBC 1;  1XNA A;  4GKY A;  1PVC 2;  2GC0 A;  2XJR A;  3U4S A;  4MHU A;  4OMD A;  3ILN A;  1CAU B;  3CZJ A;  4XCA A;  5JXG A;  1FT9 A;  2R16 A;  5K7P A;  3KCC A;  4NID A;  2BWC A;  4TLF A;  3VDD A;  1NUK A;  3D0S A;  2GH8 A;  3GBF A;  1HW5 A;  3I3E A;  2Q1Z B;  4AXO A;  4X8N A;  2VC9 A;  4YZ1 A;  1VBB 3;  1CON A;  3K3O A;  1NE6 A;  1LHO A;  1D4M 3;  3WG2 A;  5CIS A;  1QJU 3;  1REF A;  2HEV F;  1KGY A;  5FYH A;  3KM5 A;  1ZRD A;  4XDP A;  1IHM A;  4BQ1 A;  2W94 A;  2JEC A;  4YW5 A;  1WW6 A;  4K40 A;  5LRS A;  2AEN A;  2X10 A;  5FZM A;  5J7M A;  4I30 A;  1R09 1;  3IPV A;  4FPO B;  1A8M A;  2A5Z A;  2OA2 A;  1HKD A;  2OYZ A;  2WA3 A;  3UET A;  2Q1M A;  4GUL A;  3VKF C;  1D4M 2;  1U5Y A;  3PIG A;  4CP9 A;  1S0D A;  1AYN 3;  1UMH A;  1GQG A;  2DTW A;  3BU7 A;  5F2W A;  2W3J A;  3ZSM A;  4CDU B;  4R52 A;  4ZXK A;  5JDB A;  4UW5 A;  1DGR A;  2VZR A;  4AI1 A;  2D6L X;  1YC6 1;  1NZC A;  3HBZ A;  5FCC A;  2GN7 A;  4IW3 A;  3UK9 A;  4ET7 A;  2RM2 1;  3D6E A;  4IEU A;  5FYU A;  1EUT A;  2GDF A;  2JDM A;  4B8E A;  2QVS B;  2AH2 A;  2R0F A;  1FPN 1;  4JGZ B;  1RTV A;  4LOT A;  2ZMN A;  5FUI A;  5FZD A;  5ANN A;  5A6Z A;  4C8D A;  4BHP A;  3ZMN A;  1J3P A;  3HN3 A;  3O14 A;  5A3P A;  5LA2 A;  5HXM A;  4FTE A;  2WNV B;  5ABJ B;  5F3I A;  3MIE A;  4LK6 A;  3IAP A;  2O14 A;  3LDB A;  1ENQ A;  4KBZ A;  1MR5 A;  3DPR C;  5F2S A;  5FUN A;  3KHC A;  2V4V A;  4QT6 A;  5T5J A;  4AAP A;  1AXZ A;  2ARC A;  2XJU A;  3I4I A;  1HB1 A;  3RNS A;  1J84 A;  1YRZ A;  3ZO0 B;  3E1F 1;  4QGN A;  4E9K A;  5FWJ A;  1W0P A;  3VUO A;  2HWE 2;  1PGW 2;  2JX9 A;  2VCB A;  4BJ0 A;  5BNN C;  4C1X A;  4QD2 A;  1L7Q A;  2XVK A;  1AZD A;  4UYB A;  4NII A;  3F2Z A;  2GME A;  4KU8 A;  2P2K A;  1G9D A;  4QB1 A;  2HBT A;  1FYU A;  3WG3 A;  1GQP A;  1ND2 A;  2W1W A;  5FP8 A;  3VGI A;  3I97 A;  4CU9 A;  4QX1 A;  1JTZ X;  1HQL A;  2R0H A;  3GF6 A;  2IVJ A;  1GIC A;  2JG9 B;  1XC6 A;  3ACL A;  4FI9 A;  4C0H A;  1WME A;  2RJ2 A;  1GWM A;  2B5H A;  5A7N A;  1CX1 A;  4AW7 A;  2P3I A;  4JDO A;  2FCT A;  3OGV A;  2Q1F A;  5FYZ A;  3U14 A;  3ZIW A;  1NLR A;  4JC1 A;  5HCB A;  1UWW A;  3J8F 2;  3TN9 3;  2XJQ A;  4CA9 A;  4HN0 A;  4Z92 B;  2ZKN A;  1Y9Q A;  1YQ6 A;  2XR4 A;  3A4U A;  4CP1 A;  1NCQ B;  1AR7 1;  3ZXK A;  1V6I A;  1OKO A;  1H2M A;  4AE2 A;  4ARX A;  4YW3 A;  1BMV 2;  1RIN A;  3T2O A;  4DXZ A;  3PIJ A;  3E5U A;  3PU3 A;  2WZE A;  3TN9 2;  2R07 3;  4AF9 A;  3T2Q A;  4MOA A;  3PJY A;  3NV1 A;  1SMV A;  2LRO A;  1Z78 A;  2OPW A;  3I2I A;  1AL2 2;  3WF0 A;  2G19 A;  4Z82 A;  2HWF 2;  2HWD 2;  3VKO A;  2D6M A;  4OZX A;  3O1S A;  4CU7 A;  2PEL A;  4KGQ A;  2R07 2;  1VMH A;  3WZ1 A;  5BV6 A;  3E5Q A;  1DCS A;  5IAT A;  4OCT A;  4XFA A;  5CAZ A;  2FCU A;  2ZGN A;  1OA4 A;  5GZE A;  2VCM A;  2WWU A;  3IWZ A;  2R04 3;  4UOJ A;  4OQ8 A;  5FWE A;  3DXT A;  4LKS A;  2P6C A;  4LLO A;  2YV8 A;  3AP9 A;  1F4H A;  3FZ3 A;  1V70 A;  3VKM A;  2YPD A;  3R4U A;  1RVF 2;  1LOC A;  4JRA A;  2A7A A;  2NMN A;  2PAE A;  3M1H A;  3H8R A;  4FPL A;  4C90 A;  3T3Y A;  3BTZ A;  3N9N A;  1W6Q B;  2GAL A;  1M06 G;  1KD7 A;  3T0B A;  3AK0 A;  1V9U 1;  3ZXF A;  2P4E A;  3WNN A;  1H1M A;  1K5J A;  1GLH A;  3ITQ A;  4QKF A;  4YW1 A;  4AI8 A;  4BLI A;  2A3W A;  5GZC A;  3KV5 A;  1RJ7 A;  1RUE 2;  4JGZ C;  3NVC A;  2QJV A;  2VU9 A;  4YGB A;  2NM1 A;  4CCJ A;  1NG0 A;  2JDU A;  2C24 A;  5FY5 A;  3H8U A;  1C3H A;  3SNM A;  2WNV C;  5E8A A;  2RMU 3;  4L8Q A;  4XAE A;  5ABJ C;  1UU6 A;  2X05 A;  4Q26 A;  1IKQ A;  2VL4 A;  3AKR A;  4FQ4 A;  4IE4 A;  5FJK A;  4EWA A;  1AYM 3;  1WUV A;  3POE A;  5IVB A;  1UZY A;  1SBE A;  1W2N A;  4DZG A;  1DP0 A;  2EAK A;  1O5L A;  4L99 A;  1OF4 A;  2VZP A;  1S0C A;  3GJA A;  1MS9 A;  4U36 A;  1QXP A;  3JCI A;  5C8C B;  1JZ5 A;  1QOS A;  3RJR A;  3AJZ A;  3K46 A;  1RUD 3;  1W8U A;  3OD0 A;  4HG6 B;  4XFH A;  1VMJ A;  2VGD A;  4XFC A;  3V0B B;  2HJI A;  1QJX 1;  2XDV A;  5A7S A;  4GD4 A;  3ZXG A;  3E6C C;  4OUE A;  5FZA A;  1VBE 1;  2D6O X;  2JG9 C;  2PXJ A;  2VG9 A;  3AKP A;  4LLF A;  5A7W B;  1W8W A;  2BZD A;  5A7O A;  2FZ2 A;  3POJ A;  5F3G A;  1RUD 2;  5FYV A;  1SLC A;  1IS5 A;  1SLL A;  2C9A A;  3ZMO A;  1GWK A;  1M4W A;  1JYX A;  3BVC A;  2J1S A;  4LIU A;  5FUP A;  1QWR A;  1FXZ A;  2VMG A;  4GMP 1;  5FMC A;  2J1V A;  3J7L A;  4NOT A;  3T2P A;  4Y24 A;  1OQE A;  1UZV A;  1XE8 A;  1W6N A;  4JDN A;  1ZRE A;  1FOD 2;  3KCY A;  4KQ7 A;  1NCQ C;  3HWJ A;  3VBF B;  5D2A A;  3RZM A;  1DQ1 A;  2RDN A;  5T52 A;  3USU B;  2UY9 A;  2B4K A;  4E4Z A;  2CL2 A;  2W1U A;  4AYU A;  4RYD A;  4A42 A;  1VRB A;  3M8L A;  4LEJ A;  2VOV A;  1JH5 A;  5BNP B;  4KGG A;  5LK7 B;  3P1I A;  3AKS A;  4QKD A;  4A3X A;  4L97 A;  5LEJ A;  1EYB A;  3S7E A;  2BDR A;  2VJX A;  3PNA A;  2XJP A;  2XJT A;  2CY6 A;  3HNY M;  3LA2 A;  4FPG A;  4NIG A;  1H6X A;  1QJU 1;  3HD8 B;  1HB4 A;  3I2H A;  1CAU A;  1WLW A;  2GNB A;  4FFG A;  4CXX A;  1R1A 1;  2D5H A;  3POB A;  1LOA A;  5ACA 1;  5C3P A;  3KB5 A;  2CGO A;  2H6C A;  3POY A;  1FI2 A;  1NXM A;  4B1L A;  2ZPX A;  4FFI A;  4XDO A;  1VBA 1;  2OZ6 A;  1X7N A;  3ECQ A;  1GWL A;  1Q56 A;  2NLR A;  3IKW A;  4IV1 B;  4RFR B;  1KJL A;  4NHX A;  3KQ4 B;  2B39 A;  5IVF A;  2QQW A;  3AFK A;  4Q4V 1;  2BEO A;  5CKM A;  4OI1 A;  4EZH A;  4C1W A;  1YXW A;  2RDS A;  1DIW A;  4UF0 B;  4UWD A;  2DVB A;  2DFB A;  4EN8 B;  4NHK A;  3OEA A;  3JQW A;  4TXW A;  2XBO 3;  1RIT A;  2XQR A;  1PHM A;  4EN0 A;  5IVE A;  1DFQ A;  3OGS A;  4XUT A;  4CDU A;  5FR3 A;  2HWB 3;  3M70 A;  4U2A A;  1W8O A;  3N9L A;  3UJO A;  3P5B A;  1O8S A;  4K8R B;  4LQR A;  3J9S A;  2X29 A;  4COV A;  5JSO A;  3FLT A;  2B46 X;  3I3B A;  3S5A A;  3N9M A;  5L9V A;  3X29 B;  5D1I A;  3ZYH A;  5CBL A;  1HXS 2;  2BTV C;  1YQ2 A;  1CJP A;  2AYH A;  4GAL A;  2XBO 2;  4JGZ A;  5JIU A;  1A34 A;  3A0N A;  4Y1U A;  1UOJ A;  3DCQ A;  2A73 B;  3O1T A;  2QZ2 A;  4XUR A;  3WF2 A;  4GB3 1;  5ABJ A;  2ZJC A;  1H9W A;  3NNL A;  4R4X A;  1OA2 A;  4RGG A;  5FIX A;  3H8X A;  4C91 A;  1C4R A;  1QKQ A;  4ATE A;  1UPS A;  3ZXA C;  1Z0H A;  2BOI A;  3BOW A;  1PNG A;  2I07 B;  4X6R B;  1BK1 A;  1X33 A;  1TMF 1;  3MFA A;  3ZFE B;  1QU0 A;  1CZS A;  5EWS A;  2E7Q A;  2D44 A;  3RYK A;  1H8V A;  3U07 A;  4PCR A;  3RG0 A;  4D6R A;  1E5R A;  1S55 A;  1ZYB A;  4OI0 A;  1AX1 A;  3LGR A;  4Q4X 3;  1SCS A;  1OA3 A;  2JG9 A;  2XHN A;  3MIF A;  5IHR A;  3R05 A;  2EXJ A;  3HNM A;  3WD5 A;  4N53 C;  4BIS A;  1US2 A;  5FZC A;  3WNO A;  4BXF A;  5C3Q A;  1UYX A;  3WQB A;  3CJI C;  3OPW A;  4JKM A;  5IVJ A;  1LGB A;  3U11 A;  1GZT A;  1UY4 A;  3GHM A;  2QQV A;  1OQD A;  2VNR A;  2ZGL A;  3OB8 A;  4XAA A;  4Y3O A;  5EYY A;  1LHV A;  3VBF C;  4AG4 A;  4COW A;  1S0J A;  1NCQ A;  2ZHK A;  1YI9 A;  5CYY A;  1PM7 A;  2ZGK A;  4JDM A;  4A4A A;  5IFT A;  1BJQ A;  4W50 A;  3M7A A;  4YVS B;  5BNP C;  3I59 B;  3OSD A;  1BEV 1;  4IET A;  4YG6 A;  4V1P A;  3NV3 A;  2H0B A;  4XIO A;  5A80 A;  3CBN A;  5JXH A;  2B7Y A;  4YLZ A;  5FYM A;  4D8M A;  4N43 B;  2R04 1;  4XF9 A;  1L7L A;  1R08 3;  3GCW A;  4WM7 B;  3I3Q A;  4H7L A;  3MUZ 1;  3FBM A;  5C8C C;  3N7K A;  1RXG A;  4LOR A;  4P9L A;  4XET A;  4I09 A;  1BCX A;  4K1Z A;  4FPF A;  1VLN A;  1Q8O A;  3AB0 A;  4LE4 A;  4NHL A;  1DGL A;  4IV1 C;  3QD6 A;  1JYW A;  1S0I A;  3MO4 A;  5G05 L;  1CIW A;  3H7J A;  4ZS2 A;  3JB4 C;  4NUB A;  3LE0 A;  1IG0 A;  1QY4 A;  1COV 3;  1GBG A;  5FAX A;  4BQ3 A;  4LO5 B;  4AEK A;  1V6N A;  4CU6 A;  2PMW B;  1E5I A;  2ZCW A;  3OUI A;  2Q8O A;  4E4S A;  2VUC A;  1AXY A;  4XJU A;  2P3K A;  1JZ6 A;  5ERL A;  1W6Q A;  1RXF A;  3E97 A;  4CDQ B;  3N36 A;  4FXG B;  2RMU 1;  3VBU B;  5I8T A;  3AMM A;  1COV 2;  5JI9 A;  4HKO A;  1W2T A;  3AP4 A;  3ZXE A;  1AYM 1;  4DXT A;  4QX3 A;  5A1A A;  4LJH A;  1HX6 A;  3VZO A;  5JPN B;  2V4A A;  4AEJ A;  3RQ0 A;  2RVA A;  4K9S A;  2ARE A;  3ABZ A;  1W8N A;  3M4F A;  3C7F A;  4CU8 A;  2IXH A;  3MPB A;  2O8Q A;  1RUI 3;  1FNZ A;  2ZZQ A;  3WEZ A;  4QQ2 A;  3OJB A;  4Q0U A;  5FY7 A;  1ASJ 2;  2LM3 A;  1IKP A;  1K3I A;  1LHU A;  4Y1Y A;  2YC2 A;  4P9W A;  1ULF A;  5E1R A;  5KHH A;  2ZX0 A;  4S2H A;  2R30 A;  4RL7 A;  3ZFE C;  4LUL A;  1RC6 A;  2WKK A;  2WC2 A;  1RUI 2;  2LS6 A;  1VBC 3;  1DQ4 A;  1UYY A;  1JBC A;  1QDC A;  5DUW A;  1SQ4 A;  3MDP A;  4JGY B;  3V0B A;  4GA9 A;  3ZVX A;  4PI2 A;  4JQR A;  2YBP A;  3EJK A;  4XJ8 A;  3GNE A;  2C4X A;  1NQJ A;  2CNA A;  3KWV A;  5A7W A;  3BI3 A;  3SXW A;  1WWY A;  1TNR A;  3ZKU A;  1O3S A;  1VBC 2;  2CAU A;  5FY1 A;  1BYH A;  3BN6 A;  1EY2 A;  1W9Y A;  3B93 A;  2J7M A;  4Y22 B;  4CDQ C;  4R9D A;  2ZEW A;  3OEB A;  5DAX A;  4XF0 A;  1I5P A;  2J42 A;  2D3P A;  1MAC A;  2WSV A;  5FYY A;  4RHV 2;  2R1D A;  3SKV A;  4JTO A;  3I2G A;  4WVM B;  4TTG A;  1E57 A;  3R4S A;  2VUJ A;  5FP3 A;  4AQT A;  3VBF A;  1VRH 1;  4XAB A;  3USU A;  3AP6 A;  4YVS C;  3AVR A;  5K0U B;  3ST7 A;  1UU5 A;  5BNP A;  3KV6 A;  4KI5 M;  5FZ7 A;  3ZYG A;  1R09 2;  2WS9 2;  3R4D B;  2Y26 A;  4N43 C;  1GOF A;  1GNY A;  4W4Z A;  5FY0 A;  3C7G A;  2IZW A;  2VNG A;  2QQI A;  4WM7 C;  2NMO A;  5E6H A;  3B9C A;  3HAG A;  4YFZ A;  1ZRI A;  4RSU A;  5FK7 A;  2RM2 2;  4JRL A;  2D3R A;  5A7Q A;  3BOP A;  3NJY A;  2WLP A;  2YY1 A;  3ZN5 A;  4A6S A;  1UY3 A;  1B35 B;  3GM8 A;  4LOS A;  5DAV A;  4AVC A;  4LBJ A;  1FPN 2;  1JUH A;  2YHJ A;  3MW2 A;  4UFH A;  5SV5 A;  5ISL A;  2OX0 A;  2A3Y A;  5A32 B;  5JR7 B;  1AVB A;  3SH5 A;  4UT5 A;  3T4H B;  4UFM A;  4GH4 A;  1JOB A;  1HRV 1;  1ULE A;  3C7O A;  4FPJ A;  1OPO A;  3WT3 A;  2BFU S;  5DPN A;  4IV1 A;  2HWB 1;  1F8V A;  1LEC A;  2D98 A;  1S1A A;  5FY9 A;  2EF6 A;  4FPE A;  2EIG A;  1Y43 B;  4UF0 A;  3WQ7 A;  3CJX A;  2RR1 1;  3LA7 A;  4D7Y A;  1VE0 A;  2PTM A; 
#chains in the Genus database with same CATH homology
 3K3O A;  5IVF A;  4EZH A;  5A3T A;  4Y33 A;  4UF0 B;  5FZ1 A;  3U78 A;  5LY2 A;  5FYH A;  2YPD A;  4TN7 A;  4XDP A;  5FXZ A;  5FZ0 A;  5IVE A;  3PUQ A;  4QXC A;  2WWJ A;  5A1F A;  5A1L A;  4GAZ A;  5FZM A;  3N9L A;  3N9N A;  5FZK A;  4HOO A;  4BU2 A;  5F3E A;  3PDQ A;  5FYI A;  5FZL A;  5FZ9 A;  3N9M A;  5F2W A;  4E4H A;  4V2W A;  5FPU A;  3PUA A;  3KV5 A;  5ANQ A;  3AL6 A;  5LWB A;  5FZ6 A;  4GJZ A;  5FYU A;  5FP7 A;  4HON A;  4CCJ A;  5IVV A;  5FJH A;  5FY5 A;  3DXU A;  5FY7 A;  5FZD A;  3N9Q A;  5KR7 A;  4D6S A;  4URA A;  4C8D A;  5FJK A;  5A3P A;  2W2I A;  5A3W A;  3N9O A;  5F3I A;  5IVB A;  5FV3 A;  5FXX A;  4QXB A;  3LDB A;  5FUN A;  2XUE A;  5FXW A;  5F2S A;  3UYJ A;  5FZ3 A;  5F32 A;  5F37 A;  4AAP A;  4D6Q A;  5FY8 A;  2XML A;  3PU8 A;  5FYB A;  5F5I A;  3K2O A;  3ZLI A;  2YBP A;  5FWJ A;  5F3C A;  3PUS A;  3KV4 A;  5A7P A;  5A7W A;  5FZI A;  3PTR B;  5IW0 A;  5FPA A;  5FPB A;  4D6R A;  4LIT A;  2XDV A;  2XXZ A;  3KV9 A;  5A7S A;  4GD4 A;  3KVB A;  5FY1 A;  5FZA A;  2PXJ A;  5FP8 A;  5FBJ A;  5A7W B;  3OPT A;  5FZE A;  4LXL A;  5FYY A;  5FZO A;  4IGQ A;  5A7O A;  4BIS A;  4DIQ A;  5FZC A;  4DO0 A;  5F5A A;  5F3G A;  4BXF A;  4CCL A;  4QX8 A;  3OPW A;  5FYV A;  4V2V A;  5IVJ A;  5FP3 A;  5FZF A;  5FZO B;  2OQ7 A;  4LIU A;  5FUP A;  4CCN A;  4Y3O A;  5A7N A;  2Q8D A;  4CCM A;  5LY1 A;  2OQ6 A;  3KVA A;  4GJY A;  5FYZ A;  5IWF A;  2YU1 A;  2YU2 A;  3AVR A;  5FZ8 A;  3KV6 A;  5FZ7 A;  4AI9 A;  5CEH A;  4IGP A;  5FYS A;  3K3N A;  4QXH A;  2OT7 A;  1VRB A;  2OS2 A;  2YBK A;  5FP4 A;  5FZG A;  5A80 A;  5LW9 A;  5A3N A;  5FPV A;  5FY0 A;  4EYU A;  5FYM A;  3PU3 A;  5E6H A;  3AVS A;  5FZH A;  4Y4R A;  4LIV A;  5A7Q A;  3ZPO A;  5FYT A;  3NJY A;  5FZB A;  3N9P A;  4QWN A;  4CCK A;  4QU1 A;  2GP3 A;  2YBS A;  5F5C A;  5FP9 A;  3RVH A;  4ASK A;  2OX0 A;  5ISL A;  2Q8C A;  4CCO A;  4IGO A;  5IVC A;  3AL5 A;  4CUG A;  5FY4 A;  2GP5 A;  3LD8 A;  2Q8E A;  4EZ4 A;  5FPL A;  3U4S A;  4QX7 A;  5FYC A;  5FY9 A;  5FZ4 A;  5IVY A;  5K4L A;  4XDO A;  4CSW A;  2WWU A;  5FXV A;  4NUB A;  4UF0 A;  5FWE A;  3DXT A;  3PUR A;  5F39 A;  2VD7 A;  2P5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...