3NJYA

Crystal structure of jmjd2a complexed with 5-carboxy-8-hydroxyquinoline
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
347
structure length
347
Chain Sequence
LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 4A
publication title Quantitative high-throughput screening identifies 8-hydroxyquinolines as cell-active histone demethylase inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 105
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2010-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3njyA01
3PU8A 4IGPA 5A7WB 3DXUA 4Y33A 3K3NA 2GP5A 3K3OA 2XMLA 4QXHA 5LWBA 4QU1A 4UF0B 5FZBA 5IWFA 4IGQA 3PUQA 4Y3OA 4NUBA 5FYSA 3AVRA 5FYUA 5A1FA 5FZEA 2PXJA 5A3NA 5F3CA 5IVEA 4BISA 4HONA 5LY2A 5FP4A 5FWEA 5A3TA 5F3EA 3U78A 5A80A 5FY5A 5FZ8A 3N9LA 4QX8A 5FP7A 4BU2A 4C8DA 4AI9A 3NJYA 2YU2A 3N9NA 4LIUA 5FZKA 4EYUA 4GD4A 5FP9A 4HOOA 5A3WA 5LY1A 3KVBA 5FY7A 5K4LA 4EZHA 4IGOA 3AL5A 4QXCA 3LD8A 5FY0A 5IVFA 5F3IA 2XXZA 5FP3A 5LW9A 5A3PA 2GP3A 2OS2A 2VD7A 4V2WA 4QXBA 3PUAA 5F5AA 4LITA 5FXVA 4CCNA 5FPVA 4CSWA 5FYCA 3PTRB 4D6RA 3K2OA 5CEHA 2OT7A 3ZPOA 3KV9A 5FWJA 5A7NA 3PDQA 2XUEA 4CCJA 5FYMA 5F39A 5FY1A 5F32A 3RVHA 3U4SA 5IVBA 5FPLA 4URAA 3OPTA 4XDOA 5FJHA 5FUPA 5FYYA 3AVSA 3N9MA 5FJKA 5FY4A 5FXWA 4DIQA 4DO0A 4LXLA 3KV6A 2YBPA 4QX7A 5F5CA 2P5BA 5FY9A 5FZ4A 4ASKA 5F2SA 4E4HA 5IVYA 4TN7A 5FYVA 2YU1A 4AAPA 3KV5A 5F3GA 3PUSA 5FPBA 5FZ0A 2YPDA 5FUNA 5FY8A 3N9OA 2Q8DA 4CCOA 5A7WA 3OPWA 4BXFA 5FZ7A 2WWUA 5FZCA 3N9PA 5FZOA 4GJZA 5FZLA 2XDVA 5FYIA 2Q8EA 5ISLA 5FPAA 1VRBA 4D6QA 5FXZA 5FZ3A 3KV4A 4EZ4A 4XDPA 5IW0A 5KR7A 2W2IA 5A7SA 5F37A 5IVCA 5FZ1A 3LDBA 5F2WA 5FXXA 5A7QA 5FV3A 5FZ9A 4D6SA 5FZOB 5FYTA 3N9QA 4Y4RA 4GAZA 5FYZA 3AL6A 3PU3A 5FZMA 4CCKA 2OQ7A 5FBJA 5FYBA 5FZDA 5FZFA 5FZAA 2Q8CA 2OX0A 5FZIA 5IVVA 4QWNA 5A7PA 4GJYA 4V2VA 3DXTA 4CUGA 5FPUA 5A7OA 5FZHA 5FZGA 3KVAA 5E6HA 3PURA 5A1LA 5IVJA 5FP8A 5F5IA 3UYJA 4UF0A 3ZLIA 5FZ6A 4CCLA 2WWJA 2OQ6A 2YBKA 4LIVA 4CCMA 2YBSA 5FYHA 5ANQA
chains in the Genus database with same CATH superfamily
2Q5TA 3PU8A 4IQPA 5JIAA 1FYUA 3O12A 4W50A 2BTVC 3ZSMA 3IBMA 4CP1A 3K3OA 3PJQA 2MPFA 1RGSA 4BLIA 1H2NA 4ZU7A 5LWBA 3BU7A 5HCHA 1R091 1WMXA 2BZDA 4XJ9A 1W2UA 5DMYA 1K5JA 3POFA 4PF5A 4OI1A 4XTPA 1QXPA 3WP4A 5A1FA 5C8WA 3O1OA 1RUI3 3OD4A 1NXMA 3VBRB 1UXXX 4KU8A 2WN3A 5FREA 3T1LA 4AG4A 3POEA 1ONAA 4GH4A 1LHWA 2ARBA 4CEWC 1Z7S1 2HWD1 3VHPA 4BU2A 2VZOA 1G6NA 1UAIA 2VC9A 1RXGA 1BBT2 1U0AA 2NLRA 2RS11 1GQGA 4OHZA 3UV9A 1W8UA 4JTNA 1IS3A 2WLPA 4HT1T 1DGWA 2QQIA 1GP6A 4OHWA 3OGSA 2VMIA 1UX6A 5EPAA 4AR2A 3ZSLA 4M3CA 4ONUA 4DOUA 2XJPA 1H2MA 2IZWA 4FPYA 5F3IA 4MYEA 3AFKA 4LHLA 3D6EA 1ZZCA 4K40A 3WCRA 5I8TA 4HXCA 1TME3 1IG3A 4P02B 1OUSA 3WG3A 4B1LA 4QQHA 3ES1A 4DUWA 1RVF1 4DY3A 3K2OA 4LBMA 2LROA 1ZBE2 2BGPA 3SMHA 4RHV2 3KV9A 2IXJA 5A7NA 3VZMA 3EHKA 1JXNA 5F8PA 2XUEA 4QGNA 1VIWB 1X9TA 5T3NA 4FQZA 1OD3A 4K6BA 3W21A 4J6GA 5G05L 2Z79A 1E5SA 4XEZA 5K9YA 1NA1A 1LRHA 2PTMA 3E1F1 3MF6A 3OBTA 4HVRA 4L97A 4PIZA 4ASKA 4BDVB 3VGIA 1OQEA 5EQUA 5IVYA 2HEYF 1ULEA 5J96B 3KV5A 2OIIA 4FP2A 3WSOA 1F5JA 1QQP3 1H8TC 1RXFA 1ZA7A 1GQHA 1JYCA 4N53B 5A7WA 4PLMA 3O1SA 2VOKA 1RHI3 1C8M2 3I97A 3J7HA 5FFOC 5CADA 3N35A 3TB0A 1SLTA 4K7JA 1TZOA 3MW3A 2JIJA 5A7SA 4RFRB 3SKVA 2E33A 2VOTA 1OPMA 1R093 5FZ9A 2YMZA 2R061 3FN9A 1DIWA 4Q4W3 4NN0A 2WINB 5D8AA 1TNFA 4AHYA 1OA3A 1HLCA 2P17A 1FX5A 2Y6GA 3PU3A 2QQNA 2P6CA 5IHRA 1R081 1ND3A 5FIXA 3K51A 4QM9A 1MZ5A 3MZHA 1QOOA 1J59A 1NKGA 1FPN2 4PQ9A 1EP0A 2PHFA 3MI8A 2IVJA 2RS13 4Z1VA 3HBZA 1WMFA 1YFYA 1EUUA 2DBNA 2NMOA 4RGAA 3WG4A 4D8MA 1U5IA 1PGW1 2B4KA 1V6LA 1XU2A 4OMCA 1CWPA 1QEXA 2Y64A 3BIWE 1HN0A 4DMIA 1K5MC 1SHWB 4A42A 1MS9A 2W94A 4O9EA 4L92A 4YZ1A 2BUKA 4E4ZA 2VNOA 1MQTB 4O65A 5AVPA 4YZ5A 2WJSA 1L3JA 3UK9A 5G04L 4Q4X1 4HKWA 1LENA 5F3CA 4CDUC 1LCLA 2DBIA 4LBQD 4UFKA 5C5TA 1WLDA 5EJZB 4BYYA 1QJX3 5K7PA 3SCFA 3RG0A 2XH6A 3EMRA 2UWAA 5KHJA 2B5HA 4GXLA 1EAH1 1LOGA 1GP4A 1NE6A 1OLRA 2G1MA 3JQXA 1RMU1 3U11A 1WWYA 3T0DA 1JUIA 1LHNA 1DGLA 1YFWA 3NNGA 3BOWA 4LBOA 1L7QA 4XBQA 3PVNA 2OKXA 5IK8A 3SCGA 3JXSA 5CKQA 2NN8A 5C8CC 5GLUA 4BK4A 3NRUA 3ZO0B 5HV0A 2HWE3 1RUH1 3LEKA 2XL9A 5BY5A 3K4DA 1E5HA 3POSA 3ZYRA 1VJ2A 2HEWF 1G9AA 2VUJA 4M4PA 2BDRA 4COYA 4NIGA 1DLCA 5FBZA 4RQPC 2GC2A 5APAA 2XJTA 1X9PA 3IDCB 1GOFA 4Q0QA 1WMEA 5IK7A 1VRH2 2CAUA 2H0BA 2W39A 5FYCA 5H9RA 2FDJA 3KF5A 2J22A 3D3AA 1RUC1 1W0OA 2QQJA 2KD7A 3O1MA 1AR81 2JG8B 4Y1VA 3POIA 5L9VA 2D6NA 1AUYA 5SV8A 4LKFA 5ABJA 3FJSA 3R4SA 4LNVA 5FQ0B 3HT2A 3M3EA 2Y6HA 2AENA 4F83A 2PHDA 4QX7A 5DUVA 1LR5A 1HRI1 3CIHA 4QX0A 4XFHA 4MG2A 2VTXA 1PGL2 4KL1A 1PMJX 1ASJ3 1DQ4A 1J83A 2BRTA 2MEV1 2EXIA 4XF3A 1REFA 3TN92 1W8WA 4HN0A 4IEWA 3WNLA 3DN7A 4TZDA 4YM3A 4KU7A 1UPSA 2W47A 2YG0A 4RYDA 5EYXA 5FZLA 3I7DA 5KHGA 2JDNA 3B9CA 3OB8A 3AZYA 5IAVA 4I2OA 5DABA 2VMFA 2GNTA 4MV2A 3VBUC 4RFT0 4XW3A 1RUD2 1OKOA 3C7EA 5BNPA 4IV3C 2VZRA 4K1YA 4Z2WA 5F1RA 5A7QA 4D94A 4FXKB 3ZIXA 3R4DB 2E63A 3AKQA 3BALA 1S2KA 2JE8A 2ZHMA 3NO8A 1QJU2 3MIBA 3RQ0A 2RM22 3UGHA 3BTZA 5FZAA 4XDQA 1PO22 1S0FA 2CGOA 2V5DA 2E53A 3N7KA 1F35A 5FLHA 4MZUA 3AP9A 3DXTA 3T2OA 3O5SA 4COZA 2I07B 2C9AA 1ULDA 1AYN2 3FLPA 4YW6A 3WNPA 1AYM2 2ZHKA 1D4M1 4NR1A 5BNNC 2GN7A 4UF0A 2VNGA 2YYOA 4YVSC 1LB2A 1XE0A 2VXJA 2RJKA 4CCMA 3OPZA 3WDXA 4N43A 2IUWA 3IMNA 1WW4A 1KQRA 5A7WB 3S6PA 3CZUA 5T5PA 3BPZA 5KC6A 3C7GA 3O1UA 1J84A 3T0AA 3THPA 2ZAAA 2XBO2 4MGTA 2R071 2XJUA 3J7MA 3IT8A 2EIEA 2XB6C 4Q1PA 4WBBA 3O0XA 2I74A 2E32A 3JD72 4AWDA 1UIJA 5J36A 1J1TA 1YQ6A 3H3LA 4FI9A 5L9RA 4H7MA 4C1XA 3GBWA 3H42B 5F3EA 4GKXA 4UW6A 3NVCA 2JE9A 4V1PA 5BUVA 4OFGA 4E4SA 2HEVF 4KG0A 4MGYE 4EYUA 2IXHA 3VBSA 5IK4A 1QJY2 1H30A 1Y7BA 2WFF1 2VQUA 2WO1A 4B7KA 3ACGA 1SPPA 4OI2A 2WR9A 2XLFA 2PMWB 3OBRA 4QAWA 5FY7A 3UKTA 4IGOA 1H4GA 4ZKTB 3HQUA 5FO8B 4XOGA 2QUOA 4HKOA 2HWD2 3VBOB 3ETQA 4P00B 2QQOA 3HNMA 3ZXDA 3PUAA 4AEDC 4IE0A 3TEWA 4YM0A 2HWB2 1WA6X 2ORZA 1WMDA 3ZFFA 1UOFA 2J7MA 1TQ5A 2ZGRA 3D82A 4WV8A 3RPQA 4EJRA 5E8AA 3CHXA 1TEIA 2VJXA 1S0BA 3D5OA 1H8TB 4J25A 1AR93 4LQRA 2TNFA 5F39A 4CU8A 3NJZA 3MIHA 4D0QA 5C9AC 5J09A 1UIKA 3WQ0A 2WS91 4CA9A 4FTBA 1S2EA 5C4WA 3AP6A 1XE7A 1CIWA 2W08A 3QCWA 4I3GA 1OBNA 2WT1A 4OMDA 3JUUA 4YG0A 1WZXA 2P5BA 1WKYA 2WAAA 1CAVA 3RZZA 3VZNA 1EYBA 3B00A 4BA6A 3PL0A 4ZS3A 3OF1A 3DV8A 1Q8QA 5F3GA 2GMEA 2ZJCA 5FUNA 1VBD3 3U14A 3VDDA 5LA0A 1W9YA 4TXWA 1DZQA 4CDQB 2R042 1PM7A 5CFCC 4LORA 1DGRA 2HH9A 5I0DA 2VQ0A 2QBXA 2IXCA 1COV3 5FYIA 1RUOA 3WDUA 3WW3A 3SNMA 5ACA3 2RG4A 4UW5A 2QQWA 4QQPA 1AR73 1UO9A 3POWA 3H8UA 1RUNA 2DCJA 5F2WA 3WZ1A 4G3YC 1OT5A 4BWOA 5I0TA 3K4ZA 5FKCA 3AL6A 5DQ0A 4OLLA 3FLTA 1BZWA 1CX4A 3LFMA 1EY2A 2OX0A 4LO8A 4S2HA 3VZLA 2YPJA 4CRQA 4LUKA 1S1AA 4ET7A 4AQ2A 1QKQA 4CDWA 4GWMA 3QD6A 4KBZA 5E16A 4Q0PA 3WF0A 1UQXA 2R062 3L2YA 1YFXA 2Y38A 4FFHA 3SCHA 3WF1A 3KD4A 4M3CE 3T4VA 5T54A 5I0SA 2ZACA 3WT3A 2G19A 1V6MA 2YROA 3CJIB 1R082 3L9JT 4AI2A 2X09A 2YFUA 3FE5A 2UU8A 4Q2FA 4GB33 2GNDA 3FX3A 5FAXA 4P9XA 4OULA 4L99A 4KWUA 1ZYBA 2QKDA 2BV4A 1IOAA 3ELNA 5JI9A 1WCKA 4FPJA 2ZEXA 1S0EA 1EUTA 1OQDA 2RVAA 4XABA 5GZFA 1XNBA 3E5UA 1GNZA 1IG0A 1O4YA 4XETA 5FY5A 2YGLA 3Q8CA 4HANA 1W04A 2CGNA 2LTNA 4XIOA 3WXPA 4ASLA 3GHMA 1GZWB 3H7JA 1AHSA 3UKNA 3O1RA 2AUYA 4Q4X2 5GALA 1G86A 2VOWA 5JPMB 5J3UA 4BQYA 2Z2SB 1XYNA 1ZZ8A 3ZN6B 2ZGPA 2D3SA 3GZUC 4W4ZA 3LDRA 1JH5A 1MEC3 3IKWA 3NKGA 2ZEYA 1OA4A 1W2NA 4K20A 1CAUB 3WDTA 1EAH2 1BBT1 2FMYA 2LUWA 2LW8A 5A3PA 4G9SB 4PDWA 5A1AA 2DVBA 5LEKA 3RZGA 1RMU2 1X50A 5D21A 1OF3A 5F5AA 4QX5A 1VBC1 3MGUA 4CCNA 4YW7A 1N1SA 3ST7A 4EROA 3ZYHA 1XSQA 2CWSA 3JB8A 3NAPC 4AF9A 2B42B 1RUH2 3VZOA 4A3ZA 2F17A 2JKXA 4QXKA 4R8HA 3UT0A 2VUCA 1MZEA 3AZZA 4DXTA 1S0DA 4A4AA 3BKZA 4ZPIA 1GU3A 2RJLA 1Y43B 4PCRA 2PELA 5EV7A 3MF9A 1N3QA 4CYDA 2Q1MA 4AVVA 5FJKA 1F5FA 2BERA 4OHXA 5F5CA 3MLKA 3BGAA 4LJHA 4RHV1 3ZR6A 2B9VA 2WT0A 1VAMA 4XQDA 3UKVA 1NXD1 4BMEA 3I3MA 1RUC2 2RDQA 3Q8FA 4JV4A 1AR82 1VBB3 2W91A 1BEV2 4XF4A 1CIYA 3LOBA 1H6YA 4Q4V1 3SC7X 1CAWA 2DCZA 5I0UA 5A6ZA 1POQA 1R1ZA 3DYPA 4PLOA 4F3JA 1NT0A 4LOTA 3ON7A 1DGWX 2C1FA 4BXFA 3WW1A 1LAJA 4HK9A 4FT8A 3INAA 1ND2C 2P6HA 3RYRA 4E2GA 3KV4A 4Q4Y1 1NAEA 5EWSA 4YGCA 1N1TA 1IHMA 3BUCA 3MFCA 4RA0A 1YI9A 2QVSB 5EXOA 4QHBA 1LEDA 2WT2A 3V65A 3HIFA 4D6SA 5BNNB 4XMIA 4MVTA 5FYTA 4NVPA 4NHLA 4WM8A 4YGBA 2W92A 2YZ4A 5FBJA 4AEKA 4M00A 1LU2A 3IIIA 2D6MA 4HKLA 1MS0A 1HV1A 2MHFA 5AFBA 3I3BA 4L8QA 3V56A 3H8OA 1SDDB 4XHBA 5FZGA 1VAKA 5JXGA 3VDAA 1DZTA 2VMDA 4L0PA 4AGVA 4YSFA 3OBZA 5LRSA 3JCIA 3ZYBA 5KHHA 4LMFA 2OYZA 3AFGA 1E5IA 3ECQA 4QPIC 1AX2A 5JLVA 5FYHA 1FPN1 2J1SA 3MLJA 2C4XA 1BBT3 1APNA 3O0WA 2VZPA 4LEJA 1FI2A 3IM0A 1D4M2 4A7ZA 1GICA 1W6MB 5FYSA 4I0AA 2PXJA 1W28A 1K12A 3JU9A 1JZ8A 1N1VA 3PTYA 1LOFC 4K3UA 1DQ2A 3ROUA 1Y4WA 4IE5A 3EB7A 1SQ4A 3ILRA 3RYKA 4ES8A 2R7EB 2IFWA 1OOPB 5BNOC 2R072 3KCXA 4AEDB 1HRV3 2OPWA 3AMHA 4CVUA 1RJ8A 2WN2A 1QMJA 1ZBE3 2TUNA 3WF2A 1W8FA 1RIRA 4OUMA 2R49A 2GNMA 1A34A 2V4AA 2WNUC 1WGPA 3HEIA 1W06A 3WW2A 5IFTA 4AEMA 5ERLA 1PVC1 1IPSA 1QDCA 2K0GA 3M3CA 4Y24A 3AM2A 4B7EA 3LSDA 4S2GA 2VQAA 2QTWB 1NLSA 2WNOA 2WFF2 4YGDA 4DY5A 3RMXA 3BTYA 1NCQA 3D8CA 4JDMA 1UW8A 3GCXA 1LU1A 2JDUA 3M2MA 3ZPOA 4AVBA 1YWKA 1N1YA 1PMIA 3NMBA 1S2BA 2FDHA 2ZGSA 3T2PA 4PIYA 4CEYC 1C8M3 4ZZ8A 3IMMA 1POV0 2BBAA 4NHKA 4XBLA 4N9IA 4N53A 4YW3A 1E5RA 3WNNA 2WKKA 1QHDA 5DXDA 3BTXA 2X53S 1US2A 4JQTA 3U1XA 2VW2A 5FTTC 4AAPA 4I01A 2D5HA 5AVAA 3AYDA 4E8CA 3ZFGC 4OHYA 2DWRA 4ZS2A 3N9OA 4OQ9A 3RS6A 1NOVA 2FDFA 2GSYA 2CSGA 4YVWC 4AOCA 2VQTA 3GJBA 3WP3A 1SZBA 2DUPA 3IZOA 3ZYPA 3I2DA 4M0NA 1FPN3 4EV0A 3V0BB 4CDXC 1O6UA 3KT7A 3PMEA 3TN91 5EP9A 3RZKA 4AI1A 3DPRC 4W65A 4WZCA 5KHKA 1CESA 2OUHA 2ETEA 3DCQA 1RJ7A 2VXRA 2LALA 4ZU5A 1BLZA 1SBFA 3T09A 3N9QA 1H2LA 5A6YA 3VKOA 5FYBA 2CDPA 1EV13 5FZDA 5FZFA 4AFBA 3LIGA 4XUPA 2JECA 2PFWA 2I2SA 1Z0HA 1RUD1 2A5ZA 2J1RA 3JBG2 1PK6B 3MIDA 3AMQA 4QDRA 5FZIA 5A7PA 2RDRA 4QT6A 1SFPA 3ZDVA 1CPMA 2N7GA 3FBMA 1CZTA 5CIRA 4I09A 5FUIA 2UWCA 1JBCA 2DUQA 4Y1YA 4B3NA 1WCQA 3H1YA 1MQTA 1V6NA 3OYWB 3WINE 2RM21 4A3XA 2D6KA 4CE8A 5EYYA 3WF4A 1PO21 1W3VA 2WWJA 3KZ4C 2ZX4A 4JAAA 1CJDA 1Q8SA 5IK5A 2G9FA 1ZRDA 1XQNA 1FMD1 1GYKA 1D2SA 4IEZA 5CVRA 3IN9A 1JOPA 4XCBA 3K3NA 1HB1A 1UOJA 5JXHA 2XJQA 3NSTA 3I3QA 4Y3OA 2QDRA 3WX5A 3AVRA 5A3NA 2BPA2 4FAHA 4LBQB 2P1BA 5FP4A 3IAPA 2HBTA 1PX3A 1Y3TA 1H9WA 1WBLA 2IVIB 3KLSA 1W3XA 4OUSA 5EHDA 2W1QA 2Y34A 1FV2A 4NWVA 5FPZA 4AZZA 4IEVA 4MXVA 4IV1C 1UMHA 4WM8B 4HVQA 5DAPA 2BVBA 5DN2A 2FDGA 4JZRA 3I59B 1C28A 1REDA 1VRH3 3AK0A 3N9NA 3ZN4A 1HN1A 5FP9A 4A7KA 2LRPA 2JJ6A 3NAPB 4OCTA 3TOJA 4LR4A 5JZGC 4QGMA 2UWBA 2XOMA 1OA2A 4H3WA 3MDPA 3H3UA 4DXRA 3OG2A 1O3TA 1Q43A 3LB9A 4MXWB 3VHRA 4QB1A 3PVEA 3CQOA 1QIQA 1TMF2 1W9TA 2JG8A 1QJY1 3NL1A 1OI6A 1UYPA 1C4RA 1YXWA 4DB5A 1JYTA 3GALA 5FQ0A 2RV9A 1DYPA 3CU7A 3M8LA 3PTRB 1FAYA 1HJGA 2QQVA 3V0AA 3AXDA 4B4RA 4DQAA 1LGBA 1WD3A 2D44A 3WDWA 1PZ9A 4SLIA 4NHYA 4SBVA 4BJ0A 1G9BA 1UXZA 3KCCA 2CAVA 1IPKA 4OVEA 4M3CF 1W6OB 5KXBA 1OC1A 2HWB1 4JRAA 5FPLA 5JSRA 1NY71 5FYYA 1O91A 2ERFA 1NA1C 1VBC2 1XJAA 1OLME 1RUD3 4UAPA 4XC9A 1WCSA 1ACCA 2QJVA 1U12A 1JI6A 3J8F2 3NJVA 4CTEA 3RZJA 1ST8A 4Q8KA 3H3ZA 5C70A 1C1LA 1K3IA 2YPDA 1QJU3 2H0VA 2RM23 1F9KA 1V0AA 4W6WA 2PLV2 2JWPA 1PO23 4BIOA 1YFUA 2ET7A 1LOAA 2E31A 4ES9A 1OFNA 1ODNA 4YYOA 1AYN3 2IXKA 3HAGA 3V64A 5LBEA 5JOYA 3N7JA 1AYM3 5HXVA 3I49A 1SEFA 4PI0A 4NPMA 3ALQA 5FXXA 5FV3A 2JG9C 3LF7A 2R041 3P1IA 3AYEA 4Q4V2 2QCSB 1NCQB 2OXBA 2ID4A 3LIHA 4IEYA 2XVLA 5FMOL 3IDAA 1AX1A 1UZ0A 3FHIB 3S0MA 4N8MA 1OVSA 3F2ZA 2OQ7A 1YYNA 1DGRN 2P3JA 3QLQA 2VZ1A 4FOQA 3DGTA 4KQ7A 4LPLA 2E51A 4O9GA 4UWDA 4ATFA 4BK5A 1A78A 4Q4Y2 4YW4A 3UGFA 1JZ4A 5JCTA 1VPHA 2XBO3 3GCWA 4QQOA 5C71A 5FZHA 1IS6A 2O14A 5C3RA 1YRZA 1VBA1 4CEWA 4G4FA 1UY2A 1JN2P 2Z69A 2BOJA 1HXS1 1WLTA 2IC1A 2WLQA 3JD73 5DG2A 4BB3A 3A0NA 2KA3A 1Y9GA 5FZ6A 5JWPA 2WUHA 1CZSA 3KHBA 3WOGA 4LIVA 4NRMA 4LA2A 2BWAA 3H0OA 2GH8A 3HNBM 4R4ZA 1Y9QA 3WDVA 4IGPA 4R9CA 4U36A 4Z82A 1O4TA 5JUVA 2JDZA 4R52A 4Z2AA 1YJLA 4PBPA 1B35C 4IEOA 4MH0E 4Y5Z0 5BNOB 4FQ4A 2EAKA 4QU1A 1V6KA 3AKRA 4UXAA 5IWFA 2RS51 4JHTA 3BI3A 3VD4A 1LOCA 3WR0A 5A3LA 2ZHNA 3C7OA 5LATA 1G8WA 1DQ5A 2CL2A 5L7OC 3NV3A 2VR4A 4CXWA 2O0OA 1AJKA 1Z7S3 2HWD3 2JD4A 3R4UA 4E27A 4CPBA 4MSVA 2EVXA 2ZABA 4QX8A 4AAXA 4C8DA 5M0TA 4GQ7A 3VBOA 3P6BA 1CD3G 2WZ8A 3DKQA 4HOOA 5LY1A 1DU3D 2EAAA 4FVVA 4LK7A 3WUCA 3SEPA 2XG3A 4FO9A 4LT5A 4BQXA 1KEXA 4EZHA 5J48A 3POYA 1SLLA 3AZWA 3F95A 2GN3A 4CEYB 4FPCA 1XB9A 4QU2A 3KGLA 1H8TA 2CHHA 2GALA 4QM8A 3RZHA 2VD7A 1UMZA 2GMMA 1RVF3 4KNCA 3ABZA 3UESA 2D3RA 1POV1 4OZOA 5LBFA 1MS8A 4Y4YA 2WO3A 3T4HB 4XJ8A 4XUNA 2R16A 4TSVA 3VBFC 2R043 2HWC1 5DUXA 3VKMA 4UW3A 5DZGA 1PVC2 2PHUA 1QJEA 5ABJC 3ZFEC 5I0RA 1CAXB 1A8DA 5FJHA 4CDQA 1GV9A 4N9HA 1QDOA 4HBNA 2CNAA 4DPNA 1BK1A 1Q3EA 1XU1A 1GUIA 1FV3A 4XQ4A 1OMIA 5FZ0A 2HLEA 1UZYA 1S55A 3ES4A 2JEMA 3ZSKA 1GWMA 3URFA 2VUAA 4INDA 2BNOA 2DCKA 1PIV1 5A32B 1ULGA 1RUG1 2XHNA 1V9U1 1VR3A 4LO6B 3ZSEA 4AQTA 1W8HA 2JIGA 1QXJA 5ISLA 5K0UC 2ZPXA 1UZWA 2AZ5A 2W46A 1GFF2 2V09A 1KDKA 3KM5A 1BEV1 2W1UA 3HNYM 4FFFA 4KGQA 4XUTA 5KR7A 2R063 3K48A 1W6NA 3MUY1 4H2AA 4HETA 4I3PA 3AP5A 5FMDA 5T50A 3P3PA 1CONA 4XZPA 3RJ2X 2A70A 5FZOB 3IIAA 4IW3A 1UOBA 2VZVA 4P9LA 3WCSA 2A1XA 1R083 3NNJA 4ORFA 4UFLA 2Q0AA 3VD3A 5FZMA 3WNOA 4LOSA 3ORJA 3ZXAC 4BPZA 4UFIA 2YUEA 5J1XA 3N7MA 3FUQA 3PIJA 4HLTA 4CXYA 2OVUA 4JDOA 5FLIA 3CJIA 1I5ZA 1UMIA 3M3IA 4OI0A 1J3RA 2DU1A 4JQRA 4YZ3A 4XE9A 2D98A 3T30A 4NIHA 1NX9A 3T08A 3POJA 3ZSJA 2F4PA 1NLRA 2XQXA 4IERA 3SH5A 3U10A 4JDNA 1SLBA 3KCYA 3LPFA 5DDJ1 3I3DA 2CTVA 1HB3A 4COWA 1NQJA 5F6KA 3EBRA 3OUIA 1A6CA 5C8CA 2BJSA 1GSLA 2Q1ZB 2ZMKA 2DU0A 4PF1A 4ZZ5A 4IV1B 4XUOA 4Y5TA 4RL7A 1DHKB 4Q4X3 3BU0A 4J1WA 4GALA 4QXHA 1DP0A 5FLJA 1WW6A 3PUIA 2GZWA 2ILMA 3VDCA 1GZWA 5A6QA 4KWJA 3I2IA 3EO6A 2RR11 1GOGA 1X33A 1XNTA 3ACFA 3VN4A 1VAVA 1EAH3 1HDKA 1FMD2 1XNDA 4RS5C 3ZN6A 2E7TA 3R05A 5BNQA 2VBBA 1W0NA 1RMU3 2J1UA 2D7FA 3EXUA 2OZ6A 3BYWA 4WVMB 5KWRA 1CAUA 1PM4A 4MUVA 3QACA 1AXZA 1YQ8A 2XJSA 2XQRA 1X8MA 4IEXA 3WLUA 4E2SA 4O7XA 5FDBA 1AR61 1DQ6A 1YIFA 1RUH3 1W8TA 3VDBA 3ZXKA 4FSJA 2Y8KA 3MFAA 4CEWB 2VNVA 5DAXA 4DS0A 4S2DA 4E9KA 2IXLA 2G9GA 2RJ2A 5IUQA 5K8SA 2RMU2 3HQRA 1T6BX 2W0XA 3DF0A 2VCBA 3LD8A 3CDZB 1W9FA 4AVAA 5HCAA 3MUZ1 3WP6A 4MX3A 1PNGA 4JGYC 2OS2A 4ASMB 2WA4A 2JDYA 2OUJA 5CNAA 2ARXA 1QNYA 5JAXA 1MPXA 1KJRA 4Y22A 1BKZA 5JI7A 2NYYA 1RUC3 4GULA 2J1TA 4DZGA 5CEHA 1AR83 3OGJA 3RI9A 4P9IA 1RTVA 3VBUA 2EIBA 3JZVA 4YLZA 4K1ZA 4GKYA 3B93A 3UETA 4CUAA 1AX0A 3RSJA 3GBGA 5C4WC 1HRI3 3N9MA 5EIYB 2YB7A 4B8EA 2FHRA 5KHIA 4QQLA 5FZ4A 4YZ4A 4URTA 2MEV3 2A6YA 3LFIA 4GIQA 4QDQA 1L7LA 4XILA 2LS6A 1JYVA 1RHI2 1GQPA 2JG9B 3ZN5A 2BP6A 5C3QA 3VDDC 4YFWA 2Q8DA 4BXSV 3HR9A 4ATEA 1H1MA 2YHJA 4PI2A 3WHTA 4H7LA 1NY72 5BNNA 4GJZA 2Q8EA 4NRQA 4D6QA 3VUOA 1FNZA 1YHFA 2A7AA 3MLLA 4KMQA 3MIFA 3FUOA 1OXCA 5F37A 4DEQA 1MR5A 5HI0A 3THCA 4QPIB 1HB2A 1XOYA 2D5FA 2P34A 3M3OA 1GWKA 3OY8B 4XFIA 3X29B 3M70A 5JVVA 2X5IC 5FK8A 2JB4A 3AX4A 1RUF1 4JKKA 2VU9A 3B69A 3WP5A 3I2GA 3SLIA 5FMOS 1K45A 1OUXA 1YNAA 5HCBA 3RZMA 2D3PA 3KSCA 4RGKA 1ZA4A 1B35B 2RS31 2FCVA 3SKJE 1W05A 1M06G 4QX1A 1D4M3 2CWMA 3W5NA 1C5HA 1STMA 4O61A 1GNYA 1WLWA 4L11A 5L7OB 3JBG1 4IESA 3H8XA 1W6MA 2OQ6A 4DRRA 2DCYA 2BQPA 4AGGA 2W87A 5IT6A 2VUDA 5LK5A 2R073 2W9XA 2W68A 2ARCA 1VBA2 1DFQA 2VNRA 5FZBA 1JHJA 1HXS2 1LJ7A 3POBA 4BIFA 5FYUA 2UYAA 1OOPA 1UZZA 5LB6A 3RWKX 4AEDA 1HB4A 1K5MB 4HONA 1W6NB 1O8PA 4MO3M 4TWTA 5C5UA 2Y0IA 3H9AA 3ZYJB 2AR6A 3N9LA 1ZBA1 3A4UA 2HWF2 2WFF3 3ZXLA 2ARAA 2YU2A 2VZUA 2RS52 4CDUB 2VZQA 3UJOA 2VCAA 1XNCA 5C9AA 2DDUA 4E2QA 3BB6A 3BODA 2BWCA 3PUHA 4QHOA 2E7QA 4EN6B 4QKFA 1SLCA 4DNYA 3VBFB 2D6PA 5B4XA 1ALYA 2EXKA 3PLQA 3Q9OA 4A44A 3I2OA 4I02A 3ZFEB 4DUXA 2X29A 4QXBA 4N7UA 5C8CB 3N3HA 5KC5A 1A8MA 4XXPA 4LITA 1DYOA 1PZ7A 3LE0A 2XL7A 3KT1A 2BBVA 2PQQA 3ATGA 1I5PA 5FWJA 1YQ2A 1EPZA 2WABA 4B4PA 3WVJA 4CU7A 3KMHA 4RQPB 2WS93 1TMF1 3SH3A 5IYYA 1OFSA 5F32A 4A7YA 1UNBA 4AQ6A 4BQ4A 3NJXA 2ZZQA 3WNKA 5FUPA 3B02A 3ZMOA 5K0UB 2WA3A 3HMYA 2K46A 1UKGA 2YBPA 2XR4A 2XHKA 2OW4A 1G9DA 3B94A 5J98B 5A3MA 1TNRA 3MW2A 2FZ1A 3V0BA 2ET1A 4ZHNA 1URXA 2HWC2 2Z42A 3B5LB 4HG6B 3NV4A 1LOBA 3TEXA 4DXSA 3OTFA 1YCIA 5LRRA 1BYHA 1UY4A 1UZVA 4AVTA 1RUJ1 3OPWA 1JYXA 4OQ8A 3A21A 4XFCA 1AJOA 1ULFA 5FKBA 3RYPA 1UU5A 2WO7A 3J8F1 5FZ3A 1L7RA 2Z4FA 5CA6A 2AEZA 5FMBA 4FPKA 4D3WA 1FOD1 2WNVC 4YW2A 4CXXA 1PK6A 1IZ3A 4DFSA 1PGSA 4Y22B 2C0ZA 4D7SA 2PLV1 5A33B 5CZKA 3DYMA 1ODMA 1PIV2 3RDIA 1QH6A 5JMCA 1RUG2 2WAOA 1V9U2 4NIDA 4HL0A 3VBUB 3ITQA 3VBHC 3OYWA 4YGEA 5KXCA 3I2FA 3T1MA 4TYSA 1VMFA 2G9ZA 4IV3B 2B8MA 1JYIA 4Q0SA 4LHNA 1NQDA 4C0HA 4Y5SA 5E1RA 1IQAA 2HJIA 3OGGA 3G6JB 3QH6A 3O1PA 3H1WA 4M4RA 3MICA 1XNAA 3IAQA 2PN5A 2VCCA 2O8OA 4NPRA 4QDSA 4XURA 5FMCA 4ARXA 4CCLA 3M7AA 2ZS6B 2ADDA 4QMAA 1ZRRA 2VW0A 3AZVA 1W6QB 1BHGA 4IEQA 5ANQA 2EA7A 4LBQA 4XAEA 5AFEA 1O5LA 2A6WA 3VBRC 4XZUG 4GMP0 3S57A 3LGRA 4FTEA 2F6BA 3OEAA 4ZU4A 2J1VA 4YVSB 1ZREA 3LA2A 3CNAA 1LULA 1J3QA 4OYUA 1VMJA 1OF4A 2EXHA 3I59A 1RUE2 1LKNA 5DDJ2 4UYBA 1S0CA 4OZXA 5KBFA 4QPGC 3K77A 2CU5A 3NAPA 5EFUA 3N36A 5JR7B 5T5JA 1H8VA 1LGNA 1OSGA 1SCSA 3OEBA 1H1IA 1KS5A 4MADA 1NCRC 3S7EA 4DEVA 4EWEA 5JMOA 1JZ5A 2XKPA 2E6VA 4CP0A 3H8RA 4MXWA 2AREA 4AGRA 2GU9A 3EYPA 4C1WA 2GDFA 2VOVA 2RR12 1LECA 3MEPA 2WC2A 1UCXA 2R32A 5LBCA 1C3HA 5FY0A 1S0JA 3W20A 4NIAA 2A6XA 2C24A 2WSVA 3LCPA 4UFHA 4CZSA 3NWKA 1VBC3 1LHVA 3UGGA 2VH9A 2WSUA 3IPVA 3MBWA 2JX9A 1AR92 3DEMA 3N7LA 4IDZA 2XPJA 1P8JA 1W6OA 2WZR2 4XHXA 1AR62 1JS9A 1BMV1 1I6XA 4Q0VA 1XRUA 4E4DX 1N47A 4BLJA 3NNMA 2W1SA 5I8YA 4XACA 3ZPYA 2ZBJA 4ISQA 2PAMA 2J1AA 2XONA 1IS5A 3R0RA 2ZOEB 4X8NA 4YG6A 2PLV3 2DFBA 2CGPA 5LA9A 3WG1A 1ULOA 2QQMA 4FP3A 4FPOB 1TE1B 1DQ0A 4LHSA 4RHV3 4A45A 2VZSA 3NW4A 3LOIA 2BVVA 3ZIWA 4LXLA 4I30A 5JSOA 4Q4V3 2E7AA 2YU1A 3FWEA 1JU3A 2KM2A 3OSDA 5FPBA 1COV2 2JKBA 4PT6A 5BV6A 4AYUA 5C9AB 1O3RA 3TNPB 5ACA2 4HSLA 4TLFA 1HX6A 2ENRA 3RMYA 4Q29A 2FZ2A 1U5YA 1QF3A 4Q4Y3 1FATA 4R9BA 4X8PA 3VD7A 4R9DA 4AHXA 3ILNA 4RR3C 2YGMA 3EJKA 4EN7B 3QH7A 5FXZA 4JGZC 1G9CA 4QPIA 4F8AA 3I3EA 5I8SA 5JXJA 5KXDA 4COUA 1PNFA 3HD8B 5CFCB 4WM7C 4WVVA 2YC0A 2A3YA 4JCKA 1OH3A 3LA7A 4PHZA 4M01A 2EICA 1SBEA 2O1QA 1JYWA 2XWJB 5FYZA 4XCAA 5HCFA 2PHTA 1OQ1A 3GHNA 1F31A 5IVVA 4XAAA 5DZFA 3USUA 1VBE1 5AC92 3LEMA 2ZZJA 2WL1A 4HPKB 1LOFA 5A7OA 1X36A 4NRPA 3ACLA 1F4AA 3PURA 4BQWA 5BNOA 2ZGMA 2FD8A 1Q56A 2ZGLA 1RUF2 3T2TA 1W8NA 1PO12 3L2HA 2IWGB 4HVOA 4IEPA 4JC1A 1W2TA 2RS32 4JKLA 3K75B 1VMHA 4U2AA 4NHMA 5DAQA 4Z07A 3MHZA 1GKBA 4FAGA 2CV6A 4COVA 3LQCA 1R1A2 5DAWA 1KRIA 3U75A 4XYXA 1JODA 3FL7A 1SDWA 5T52A 4QPWA 1KITA 3C8XA 1RUI1 2H6CA 3QOPA 3VD9A 2AACA 3MYXA 1GZ9A 2B39A 2W5FA 4CEYA 4HZFA 5FZKA 2YXSA 4WVZA 2F4LA 2MNGA 2PHXA 5H9QA 5A3WA 2Y6JA 1ULPA 1HJFA 3JQWA 4EE2A 5CFDC 5HPOA 3NV2A 2D97A 4QX3A 2A71A 5K4LA 1BQPA 1GNHA 1PVC3 1SBDA 1JOJA 1ZNPA 2Q1FA 3FLRA 4QXCA 5EJ1B 1JHNA 5LA1A 1O3QA 2VECA 3O14A 1ZBA2 1U5ZA 2A3XA 3SH4A 4Y1UA 4V2WA 4QHZA 1XYPA 3WDYA 1J3PA 4YVWA 4Q26A 1CAXA 3A23A 5CISA 1TME1 2RMU1 2VG9A 3WNMA 4GH4C 3W58A 3WD5A 4JHZA 5GLVA 2XLGA 1W2AX 3ZR5A 1BVVA 3I8TA 4CCJA 3K46A 4FOYA 4NO4A 2V72A 2ZEWA 3LZZA 3SEEA 1R64A 2WYSA 2XLAA 4CP9B 4URAA 2GC3A 2VCMA 4YG3A 5A32A 5FY4A 1CGPA 1MS5A 5FY9A 1HQNA 3LSEA 5CAZA 3MIEA 2WNVB 3OD0A 3ZXGA 4UBHA 4ARYA 2QQKA 2Q8OA 3ACHA 3O0VA 4B4QA 3AC0A 3WY6A 1UU6A 4LK6A 3ZXEA 5FOBB 2QZ3A 3NQHA 1QOTA 2FDIA 1MVEA 1SFYA 3PMSA 2ZMLA 5FZ7A 3VBHB 2WZEA 3PVOA 5FZOA 4IETA 2XDVA 3TN93 1X8EA 5FPAA 2V4VA 1VRBA 2D6OX 2C6SA 2JICA 2E9QA 3OJBA 5D1IA 4YZ2A 1RHI1 3OCPA 3VZJA 4D7YA 1CX1A 4FOWA 1SFNA 1US3A 2ZMNA 1SLAA 4HMZA 3IPVB 3A0KA 2QE3A 3FMGA 2SLIA 5BXXA 3AKSA 5L36A 1OPOA 4XXAA 1ND2B 5DUUA 2VZ3A 3CZJA 1RUJ2 3NNFA 4AVSA 4GAZA 5GZCA 3GBFA 3VKNA 5GZDA 4BE3A 4Q4W1 4P08A 4PBOA 1QJZA 2JDHA 4QWNA 2XWBB 2VVEA 4NWWA 1YQCA 1FOD2 4ZXEA 2BGOA 3HT1A 1IKPA 3THTA 1RC6A 2JDPA 4IV1A 1MS3A 2BGCA 4P14A 1W9WA 1HW5A 2C26A 3MO4A 4GMP1 5FP8A 4HSJA 5B2GB 1IS4A 4QGLA 1LTEA 1RITA 4HFSA 4LKDA 3DL3A 4QQ2A 1FMD3 2NZ9A 3AXEA 4AFCA 1ENRA 1O8SA 4LE3A 3LPGA 3GM8A 3ZKYA 4P5YA 4QPGB 1JZ3A 1VB4A 2YBSA 1N3PA 2AYHA 5LW9A 4PLNA 5JZGA 1NCRB 3T0BA 5J7MA 4Y33A 3HPNA 2GP5A 4R9AA 4B1MA 5F6LB 1IGOA 4EQVA 5D8AC 4RD7A 4K9SA 2FBEA 3PUQA 1YLLA 4WVMA 3VKLA 4D7TA 1ND3C 2UY9A 3AYCA 3GF6A 4BISA 2GC1A 1V6OA 2V5YA 2RMU3 2AH2A 1HRV2 3VD5A 4LLOA 2BFUS 1UKRA 3GZEA 3VHOA 1X7NA 1QJX1 3Q8EA 1LOEA 2W1WA 2IFRA 4LO7A 1U5XA 4JX0A 3ETPA 4FPLA 2D93A 5JOXA 1ZZ6A 3VBOC 1D7PM 2C5DA 2KXLA 4GD4A 4QPYA 3USUB 4CUBA 1KD7A 3WQ1A 5IAXA 1EPWA 4LKEA 1XSRA 4XUQA 4NPLA 3AP4A 3AL5A 4FXGB 1LESA 1GLHA 2HWF1 2RE9A 3KQRA 1QJY3 5C33A 5IVFA 2HWE1 5JOWA 5F9TA 3U4XA 2V73A 3WQBA 3ME2A 4YRDA 1MVQA 2JXAA 5IATA 4QX2A 2B46X 2ZHLA 1JTZX 4KI5M 4QKDA 1JZ7A 2WNUB 3ZMNA 3E6BA 4UFMA 4L9BA 4X6RB 1WW5A 3WEZA 1AL0G 4GA9A 1WD4A 1W39A 3CLPA 1V70A 4RSUA 5CU1A 2HWB3 2DURA 5FYMA 2EIGA 2ZX2A 3GDBA 5FY1A 2JG9A 2BW8A 1KFXL 2CDOA 1KJLA 3TEYA 2WRAA 5CG9A 4GWNA 4RR3B 5EZWA 1UYXA 5FXWA 4CDQC 1BMV2 4JGZB 4N90A 4YARA 3TWIA 3EQEA 1J58A 1QNWA 1UF2C 3AZXA 4EN9B 4OHVA 4WM7B 3CJXA 4NE9A 2G4IA 4EWAA 1X82A 3VL8A 5DZEA 1ASJ1 1UN1A 4GMP3 1LNSA 1JUHA 1W8ZA 1PZ8A 4NOTA 1HIXA 3OY8A 4UT5A 2CYFA 3E5QA 4MGIE 4FPGA 3S30A 3SQOA 3OUHA 2DCTA 2GAUA 2LM3A 2VTFA 3I2JA 5GZEA 3ZFGB 4XDPA 5LK7B 2JDAA 2W2IA 4LO4B 3R6SA 5BYNA 1EV12 3KF3A 4YVWB 5GLZA 1GZCA 1CR7A 3CBNA 1B35A 2NQYA 3IWZA 1IPJA 3OGVA 4OI4A 5C3PA 1RL3A 4TTGA 1HV0A 2YDEA 3D4KA 4MOAA 3MPPG 4CDXB 2VW1A 3C3VA 1JYNA 3APBA 2WQ4A 2Y6FA 4H55A 4LKSA 5L7OA 5L19A 1DBNA 1NZCA 3DPRB 4UOJA 3RFRA 4V2VA 3CJIC 5HBAA 1UX7A 1VBA3 1DLLA 5IJRA 3VKFC 4GZ9A 1HXS3 1W0PA 3KGZA 3B01A 1JOBA 2PHLA 3RWNA 3DECA 2R0FA 4AVCA 5F5IA 4QB6A 5BPXA 3I2KA 2ZAHA 3H50A 2P3KA 1GP5A 5L73A 4AQSA 1WCUA 1AL22 1QH7A 1BVP1 3MV11 1K5MA 5BNPC 1VBE2 1WLCA 2HWF3 4IE4A 1NE4A 1PVXA 2GMPA 2NMNA 2RS53 2VAUA 1KFUL 4FBFA 4GWJA 1SG3A 5HV4A 4LO5B 1IKQA 3BIEA 4NUBA 3GXUA 1LHUA 1DG6A 4W8JA 4CUCA 5CFDB 4CDUA 1CJPA 1QXRA 1QJFA 3ILFA 3K4AA 1DCSA 1DZRA 2VVDA 5ANNA 5FWEA 5A3TA 2JD9A 3U78A 2BYVE 2Q4SA 5A80A 5LCWL 2B45X 1UWWA 4AI3A 1YEWA 2FCUA 3VBFA 3V0AB 2A6ZA 3D0SA 1ZVFA 4KG8A 5C6CA 4JRLA 4P9WA 5FO7B 1RUE1 4LIUA 4Y20A 2P2KA 2Z5WA 1JZ2A 3ZFEA 2VGDA 2VO5A 3PIGA 4N43C 3VHNA 1GR3A 4GH4B 2ZX0A 3AJYA 2PAEA 2ZKNA 1RUI2 2WNEA 4UW4A 3JB4C 3WQ7A 5J37A 2PHRA 1XXNA 3ASIA 1W99A 2WQZC 1POV3 4RQPA 4IL7A 3HWJA 1OH4A 1WCDJ 2BEOA 5JZGB 4K8RB 5FXVA 1VP6A 4J1XA 4X6QB 4M3CB 5FOJB 3OGRA 2ZGTA 3J26N 1OHFA 5K0UA 2HWC3 4YM1A 1O5UA 3NNLA 3W59A 2VVFA 4XF1A 5L9BA 2XJRA 3W9AA 3DYOA 3AKTA 3BN6A 1RINA 3PNAA 4FPHA 4IXLA 5A3OA 1AR91 4ISRA 3VBSC 1GANA 2WZR1 4Q0UA 3OPTA 1J1LA 3U37A 3TBDA 4BOWA 1YO8A 2XGXA 1SCRA 2DVDA 2VULA 1TME2 2WWSA 5DUWA 4E4HA 5FR3A 2C9KA 4RGGA 1XBFA 4TN7A 5FYVA 3HN3A 5CKMA 1F2NA 5D2AA 1PIV3 3TRSB 5A6XA 1RUG3 1V9U3 2ZA9A 3HOBA 1A3KA 2JDMA 4NMIA 1NA1B 1I3HA 1KGYA 4CCOA 3S5AA 1VBD1 2DV9A 3MIGA 5A33A 3T3YA 5JXIA 3ZFFC 2FDKA 4XBNA 1UYYA 1BEV3 3RZLA 4FFGA 3LDKA 5DPNA 2XKOA 1O3SA 1COV1 1DDLA 1QWRA 5IW0A 4IV3A 5ACA1 1G7YA 3WG2A 1LEMA 4MHUA 4ZY9A 1GMMA 1HQLA 1OURA 1AR71 3AP7A 3CMGA 2FMDA 3POGA 1G9FA 5KXEA 1D0GA 2HYKA 1WUVA 1OD5A 1QQP2 2VTXJ 1W2OA 2YC2A 3WV6A 2WDBA 2HYXA 2QNKA 2YC4A 2Y6LA 3I54A 3Q8BA 2X05A 1QOSA 4NROA 1XE8A 2OZJA 1UOGA 4RS5A 1AF9A 3T2QA 1W6QA 4JTOA 2HKXA 5D8AB 2K9ZA 1C5IA 1BCXA 1RUE3 3NV1A 5DDJ3 1GZTA 4XMAA 1HKDA 4NJ4A 4A6OA 5JR2A 1R092 1ND3B 2E26A 3E6DA 2ES3A 4YVSA 3ZLIA 4CCDA 1RB8G 4Q4W2 2YBKA 3CL1A 5AC91 2WFPA 1W6PA 4XVHA 1AXKA 2VMEA 2EXJA 4MHRA 3ZXFA 4CCCA 4YFZA 3FZ3A 2XMLA 1WBFA 3BOPA 4ITCA 5C3OA 1Z7S2 4IGQA 4YNIA 2RR13 4GB31 4JGYA 3SITA 3ZM8A 5JPNB 2RS12 1OOPC 4LA3A 1UY1A 4XPVA 3SHRA 4LBLA 1PO11 4XF0A 4AL9A 1DYKA 3P5BA 4PQQA 5T5LA 3RRDA 4CDWC 1XNKA 2NM1A 3AMNA 4IE7A 2K2SA 1H0BA 5LASA 1MS4A 3KT4A 2JENA 5FZ8A 1R1A1 2WZR3 2AEYA 4KWLA 1AR63 1JMUB 4XQWA 4C91A 2QQUA 3J7LA 2A73B 2JB8A 3J7NA 1I9RA 3ZYIB 3WF3A 2WBKA 1AXYA 4QB2A 1YC61 3AYAA 2GC0A 2QQLA 3VZKA 3MPBA 1RVF2 4BCUA 2X10A 3B7MA 4DUVA 2BNMA 3BPSA 4KWKA 5DAVA 1QJX2 1QU0A 1MEC1 2XXZA 5FP3A 3FC0A 5FRAA 4I0BA 1UYZA 2GP3A 3W5MA 2UYBA 4IEUA 1ZZ9A 4L2NA 1KXGA 3G7DA 2BU9A 3BCWA 3S5QA 3VL9A 2ZX3A 3M1HA 1W8OA 1MS1A 3WW4A 3DKWA 2VBPA 2XUMA 1H9PA 3PDQA 5LEJA 3O1TA 2NP0A 2HWE2 2BOIA 3RVHA 5IVBA 2O8QA 4FOVA 2DFCA 5GM0A 5CBLA 1RYYA 2X5IA 4DIQA 2Y6KA 3FFQA 4XIKA 3TAYA 1MZFA 3KV6A 3KQ4B 1M4WA 2A3WA 5F2SA 2SBAA 3FHAA 3I4IA 4Y20B 5TSWA 5ABJB 4Y1ZA 3LA3A 4NHXA 1OLMA 2VBDA 4PDWC 1NLQA 5FY8A 3IDEA 4FTSA 1O4ZA 2QFEA 5A3UA 3CF6E 1VBB1 3OUJA 5GJ6A 1UY3A 5CFCA 3U07A 2WWUA 5F7UA 2RDSA 4XJAA 2P37A 5AC93 1E57A 1H4HA 2X8KA 3UL2A 5JSPA 2D43A 5I93A 3NKTA 2JDKA 4CCEA 5FZ1A 1PK6C 3ACIA 1LHOA 2ZEZA 1ENXA 1ASJ2 4HPKA 1RUF3 4MGZE 4AXOA 4BQ3A 3PVBB 2PYTA 1PO13 3CEWA 1TG7A 1ENQA 1PGW2 1ZZ7A 2RS33 2P3YA 5H9PA 4AW7A 4E8DA 3H1MA 4WZFA 4XJWA 5BNPB 1D2QA 3BTAA 1REEA 4CUGA 4K21A 1R1A3 1YUDA 4LBJA 4TLGA 2Y33A 5E6HA 4CU9A 3FFZA 3JBG3 4QD2A 5A1LA 3WHUA 1NYWA 3AMMA 4BQ2A 4N7IA 3RJRA 5I91A 1JZ6A 4BM8A 2ZGNA 3M3QA 2GH2A 5FK7A 1OLQA 1W90A 2TEPA 1KS4A 2YV8A 1GBGA 5IFPA 4KBBA 3ENRA 4Z8BA 1UPIA 1FXZA 2UY8A 4CU6A 2VOXA 5H9SA 5CG8A 4UF0B 4WM8C 2PHWA 3IDBB 2YY1A 4N43B 4KH9A 5FZEA 3TYJA 1BJQA 1GWLA 5IVEA 3SXWA 2P4EA 4S2FA 4XFFA 2ZGOA 5LY2A 3S7IA 1S0GA 3AMPA 3KS7A 4BQ1A 1KDMA 4Y1XA 3USSA 1LGCA 1ZBA3 4META 1S4CA 5LA2A 4XFBA 5E89A 2B7YA 2ZGQA 3I2HA 2QQPA 3HN1A 5B4NA 5FP7A 1ZX5A 4AI9A 4NAOA 3O1VA 3E97A 3VB9A 3THDA 5T5OA 1B09A 2TBVA 5C7GA 2P3IA 3KVBA 4RS5B 1HRV1 4EN0A 4CPBD 1VB2A 1ZBE1 3LWCA 3C7HA 3ZYFA 4FPFA 2DTWA 2IXIA 2WIIB 2A6VA 3VBSB 1H1AA 1Q8VA 4QKNA 2BFUL 1H6XA 2L9LA 2R30A 3C2UA 3H7YA 1W6PB 2ZXQA 1JW6A 5LBBA 4P9YA 1SPPB 5SV5A 4AE2A 1V6JA 4AFMA 4CP9A 4LHKA 1F8VA 4K8FA 4PJYA 3ZVXA 1TVGA 3GZTB 2OT7A 1UL9A 4YW1A 1FNYA 1TMF3 1VALA 2DVAA 2W3JA 3GGLA 2XVGA 1HRI2 4UBGA 1H2KA 1OKQA 1YI7A 1FT9A 2DVFA 4JGYB 4XFGA 2QZ2A 2WNVA 5DG1A 1UD1A 1MACA 2GNBA 2ORXA 3KWVA 1ULCA 2MEV2 2OA2A 3QBQA 4XJZA 3D0JA 1ZZBA 2ZX1A 1PHMA 4LLFA 3U4SA 5FPXA 3ZFFB 2WQ8A 4XDOA 4LBNA 1C8M1 2J1EA 2EF6A 1OVPA 4LE4A 4DO0A 5JIUA 5JDBA 3ZX7A 3J9SA 3VBHA 3RI8A 1LODA 3FHQA 3N4MA 2ZKLA 3HVDA 1Z78A 5C3SA 4FFIA 3PUSA 2Y26A 2DUOA 2RHPA 4M0HA 1RUJ3 1YJKA 1VLNA 2VMCA 4ZXKA 4AHWA 4CP2A 5C4WB 3MW4A 4XFAA 3J8F3 2D40A 1W03A 1T2XA 1CAVB 1NCQC 1ND2A 1FOD3 3J4UH 3PHMA 4Q8LA 1Y9MA 5A70A 2JE7A 5GZGA 4KGGA 3GYDA 2KR2A 3VDDB 1D4VB 4ZONA 5IVCA 2RDNA 2FQPA 2VE1A 2H6BA 3VBRA 1CN1A 5GKAC 3ZKUA 4EWDA 2WO2A 4XJUA 4FPEA 2R0HA 1PMHX 1F4HA 2EALA 4JVAA 4W6YA 3VV1A 1VBD2 4N53C 4Y4RA 4DINB 4CCKA 3PJYA 3Q8AA 1V6IA 2A75A 3GNEA 2PQSA 3KHCA 2Q8CA 4IUGA 5CB7A 1D0HA 1EV11 4GJYA 4PIXA 1Q8PA 1UU4A 4QPGA 1UY0A 2B9UA 2DYCA 5FPUA 1N3OA 4Y26A 3KVAA 2X5IB 4BH9A 1NCRA 1AR72 2NPIA 4NAMA 4W6XA 1WW7A 4D69A 3LAGA 2ZGUA 3SISA 3UYJA 3ZXJA 3HQXA 4MGQA 1XYOA 3DUIA 4C90A 2Q30A 4H14A 4R4XA 5F5QA 4CDWB 1ZRCA 3LKJA 1DF0A 4I0WB 3P3NA 1CQ9A 3DXUA 1ZM1A 3ZDSA 3AB0A 4AEJA 5GLWA 4LTAA 2OPKA 2VL4A 2ZCWA 4A41A 4F7ZA 3GJAA 4YW5A 1AL21 5JOZA 3ZYGA 4BMBA 3AJZA 2AC1A 5FCCA 3OOXA 5E88A 4Q5OA 2WZPP 1NG0A 2WYFA 1PX4A 3A7QA 5HXMA 3NJYA 4Z92B 1MQTC 4HN1A 2VM9A 4GB32 2VMHA 1VE0A 3VLBB 1F15A 1O59A 1SMVA 2I45A 1VRH1 2QDNA 4EN8B 2DVGA 1C1FA 2Y60A 2WNUA 1GOHA 1QY4A 4JKMA 1ZRFA 2VY0A 2UURA 4AK3A 2ZGKA 1NZIA 3E6CC 4QKBA 4P5HA 1BXHA 1HQWA 4AFDA 3HBKA 2ADEA 1SLIA 2J42A 1C8NA 3A22A 4C0BA 2WS92 4CSWA 5FPVA 3WNXA 3O7OA 4RR3A 4A6SA 4D6RA 3UJQA 4XF9A 3MV01 1Q5OA 1S0IA 4JGZA 4MGSA 4AHZA 1QGLA 1PGL1 3BVCA 2R6QA 1AVBA 2PAKA 3ZOIA 4PDWB 4BZ4A 3M4FA 1MEC2 4MLOA 4A2UA 4WM7A 2DF7A 2VPVA 2R1BA 1JU4A 2AGSA 2XVKA 3CKHA 2HBUA 1C57A 1CPNA 2ZTNA 1YQ5A 3AVSA 3FBYA 1XC6A 3LEIA 4B29A 2EIDA 2PA7A 2XJVA 4LULA 2W95A 1CZVA 1Q8OA 1YIPA 2VMGA 4WVWA 3ZFGA 1I1EA 3B9IA 2JG8C 2Y0OA 3HJRA 4HK8A 5CYYA 4MGKE 2DTYA 3AKPA 1DQ1A 3C7FA 4BQ5A 5FZCA 4FCAA 2W52A 1QJU1 1V00A 3E5XA 3N9PA 5EJ3A 4DRVA 5LZ6A 2YFZA 4AI0A 4YM2A 3TEZA 4EZ4A 1IQDC 2FCTA 1ENSA 3RNSA 4CDXA 3IB3A 4LBKA 5CKNA 3TNQA 1CAWB 1ZRIA 1CVNA 3DPRA 3LDBA 1AYN1 4RN5A 4DXZA 3UNPA 1K42A 4GWIA 1AYM1 4P9JA 4AFAA 1VBB2 4XTMA 3RGBA 4P9GA 1SACA 4YWAA 1AL23 5GLTA 3GZAA 2VZTA 5FO9B 1T6GC 1WA4A 1VBE3 1AZDA 4BHPA 1W9SA 1BK0A 3LEGA 1XPWA 4Q27A 5T55A 2ATFA 4LUMA 4UI9L 2R1DA 1O7FA 3KB5A 4IE6A 2D6LX 2BNNA 3OBAA 4OUEA 3U0ZA 3CO2A 1QQP1 2XBO1 5IVJA 1NUKA 3WUDA 4NIIA 4UFJA 1MZ6A 3JD71 2CY6A 4Q1RA 4AI8A 3B3QE 5CFDA 4YPJA
chains in the Genus database with same CATH topology
3PU8A 4IGPA 5A7WB 3DXUA 4Y33A 3K3NA 2GP5A 3K3OA 2XMLA 4QXHA 5LWBA 4QU1A 4UF0B 5FZBA 5IWFA 4IGQA 3PUQA 4Y3OA 4NUBA 5FYSA 3AVRA 5FYUA 5A1FA 5FZEA 2PXJA 5A3NA 5F3CA 5IVEA 4BISA 4HONA 5LY2A 5FP4A 5FWEA 5A3TA 5F3EA 3U78A 5A80A 5FY5A 5FZ8A 3N9LA 4QX8A 5FP7A 4BU2A 4C8DA 4AI9A 3NJYA 2YU2A 3N9NA 4LIUA 5FZKA 4EYUA 4GD4A 5FP9A 4HOOA 5A3WA 5LY1A 3KVBA 5FY7A 5K4LA 4EZHA 4IGOA 3AL5A 4QXCA 3LD8A 5FY0A 5IVFA 5F3IA 2XXZA 5FP3A 5LW9A 5A3PA 2GP3A 2OS2A 2VD7A 4V2WA 4QXBA 3PUAA 5F5AA 4LITA 5FXVA 4CCNA 5FPVA 4CSWA 5FYCA 3PTRB 4D6RA 3K2OA 5CEHA 2OT7A 3ZPOA 3KV9A 5FWJA 5A7NA 3PDQA 2XUEA 4CCJA 5FYMA 5F39A 5FY1A 5F32A 3RVHA 3U4SA 5IVBA 5FPLA 4URAA 3OPTA 4XDOA 5FJHA 5FUPA 5FYYA 3AVSA 3N9MA 5FJKA 5FY4A 5FXWA 4DIQA 4DO0A 4LXLA 3KV6A 2YBPA 4QX7A 5F5CA 2P5BA 5FY9A 5FZ4A 4ASKA 5F2SA 4E4HA 5IVYA 4TN7A 5FYVA 2YU1A 4AAPA 3KV5A 5F3GA 3PUSA 5FPBA 5FZ0A 2YPDA 5FUNA 5FY8A 3N9OA 2Q8DA 4CCOA 5A7WA 3OPWA 4BXFA 5FZ7A 2WWUA 5FZCA 3N9PA 5FZOA 4GJZA 5FZLA 2XDVA 5FYIA 2Q8EA 5ISLA 5FPAA 1VRBA 4D6QA 5FXZA 5FZ3A 3KV4A 4EZ4A 4XDPA 5IW0A 5KR7A 2W2IA 5A7SA 5F37A 5IVCA 5FZ1A 3LDBA 5F2WA 5FXXA 5A7QA 5FV3A 5FZ9A 4D6SA 5FZOB 5FYTA 3N9QA 4Y4RA 4GAZA 5FYZA 3AL6A 3PU3A 5FZMA 4CCKA 2OQ7A 5FBJA 5FYBA 5FZDA 5FZFA 5FZAA 2Q8CA 2OX0A 5FZIA 5IVVA 4QWNA 5A7PA 4GJYA 4V2VA 3DXTA 4CUGA 5FPUA 5A7OA 5FZHA 5FZGA 3KVAA 5E6HA 3PURA 5A1LA 5IVJA 5FP8A 5F5IA 3UYJA 4UF0A 3ZLIA 5FZ6A 4CCLA 2WWJA 2OQ6A 2YBKA 4LIVA 4CCMA 2YBSA 5FYHA 5ANQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PU8 A;  4IGP A;  5A7W B;  3DXU A;  4Y33 A;  3K3N A;  2GP5 A;  3K3O A;  2XML A;  4QXH A;  5LWB A;  4QU1 A;  4UF0 B;  5FZB A;  5IWF A;  4IGQ A;  3PUQ A;  4Y3O A;  4NUB A;  5FYS A;  3AVR A;  5FYU A;  5A1F A;  5FZE A;  2PXJ A;  5A3N A;  5F3C A;  5IVE A;  4BIS A;  4HON A;  5LY2 A;  5FP4 A;  5FWE A;  5A3T A;  5F3E A;  3U78 A;  5A80 A;  5FY5 A;  5FZ8 A;  3N9L A;  4QX8 A;  5FP7 A;  4BU2 A;  4C8D A;  4AI9 A;  3NJY A;  2YU2 A;  3N9N A;  4LIU A;  5FZK A;  4EYU A;  4GD4 A;  5FP9 A;  4HOO A;  5A3W A;  5LY1 A;  3KVB A;  5FY7 A;  5K4L A;  4EZH A;  4IGO A;  3AL5 A;  4QXC A;  3LD8 A;  5FY0 A;  5IVF A;  5F3I A;  2XXZ A;  5FP3 A;  5LW9 A;  5A3P A;  2GP3 A;  2OS2 A;  2VD7 A;  4V2W A;  4QXB A;  3PUA A;  5F5A A;  4LIT A;  5FXV A;  4CCN A;  5FPV A;  4CSW A;  5FYC A;  3PTR B;  4D6R A;  3K2O A;  5CEH A;  2OT7 A;  3ZPO A;  3KV9 A;  5FWJ A;  5A7N A;  3PDQ A;  2XUE A;  4CCJ A;  5FYM A;  5F39 A;  5FY1 A;  5F32 A;  3RVH A;  3U4S A;  5IVB A;  5FPL A;  4URA A;  3OPT A;  4XDO A;  5FJH A;  5FUP A;  5FYY A;  3AVS A;  3N9M A;  5FJK A;  5FY4 A;  5FXW A;  4DIQ A;  4DO0 A;  4LXL A;  3KV6 A;  2YBP A;  4QX7 A;  5F5C A;  2P5B A;  5FY9 A;  5FZ4 A;  4ASK A;  5F2S A;  4E4H A;  5IVY A;  4TN7 A;  5FYV A;  2YU1 A;  4AAP A;  3KV5 A;  5F3G A;  3PUS A;  5FPB A;  5FZ0 A;  2YPD A;  5FUN A;  5FY8 A;  3N9O A;  2Q8D A;  4CCO A;  5A7W A;  3OPW A;  4BXF A;  5FZ7 A;  2WWU A;  5FZC A;  3N9P A;  5FZO A;  4GJZ A;  5FZL A;  2XDV A;  5FYI A;  2Q8E A;  5ISL A;  5FPA A;  1VRB A;  4D6Q A;  5FXZ A;  5FZ3 A;  3KV4 A;  4EZ4 A;  4XDP A;  5IW0 A;  5KR7 A;  2W2I A;  5A7S A;  5F37 A;  5IVC A;  5FZ1 A;  3LDB A;  5F2W A;  5FXX A;  5A7Q A;  5FV3 A;  5FZ9 A;  4D6S A;  5FZO B;  5FYT A;  3N9Q A;  4Y4R A;  4GAZ A;  5FYZ A;  3AL6 A;  3PU3 A;  5FZM A;  4CCK A;  2OQ7 A;  5FBJ A;  5FYB A;  5FZD A;  5FZF A;  5FZA A;  2Q8C A;  2OX0 A;  5FZI A;  5IVV A;  4QWN A;  5A7P A;  4GJY A;  4V2V A;  3DXT A;  4CUG A;  5FPU A;  5A7O A;  5FZH A;  5FZG A;  3KVA A;  5E6H A;  3PUR A;  5A1L A;  5IVJ A;  5FP8 A;  5F5I A;  3UYJ A;  4UF0 A;  3ZLI A;  5FZ6 A;  4CCL A;  2WWJ A;  2OQ6 A;  2YBK A;  4LIV A;  4CCM A;  2YBS A;  5FYH A;  5ANQ A; 
#chains in the Genus database with same CATH topology
 2Q5T A;  3PU8 A;  4IQP A;  5JIA A;  1FYU A;  3O12 A;  4W50 A;  2BTV C;  3ZSM A;  3IBM A;  4CP1 A;  3K3O A;  3PJQ A;  2MPF A;  1RGS A;  4BLI A;  1H2N A;  4ZU7 A;  5LWB A;  3BU7 A;  5HCH A;  1R09 1;  1WMX A;  2BZD A;  4XJ9 A;  1W2U A;  5DMY A;  1K5J A;  3POF A;  4PF5 A;  4OI1 A;  4XTP A;  1QXP A;  3WP4 A;  5A1F A;  5C8W A;  3O1O A;  1RUI 3;  3OD4 A;  1NXM A;  3VBR B;  1UXX X;  4KU8 A;  2WN3 A;  5FRE A;  3T1L A;  4AG4 A;  3POE A;  1ONA A;  4GH4 A;  1LHW A;  2ARB A;  4CEW C;  1Z7S 1;  2HWD 1;  3VHP A;  4BU2 A;  2VZO A;  1G6N A;  1UAI A;  2VC9 A;  1RXG A;  1BBT 2;  1U0A A;  2NLR A;  2RS1 1;  1GQG A;  4OHZ A;  3UV9 A;  1W8U A;  4JTN A;  1IS3 A;  2WLP A;  4HT1 T;  1DGW A;  2QQI A;  1GP6 A;  4OHW A;  3OGS A;  2VMI A;  1UX6 A;  5EPA A;  4AR2 A;  3ZSL A;  4M3C A;  4ONU A;  4DOU A;  2XJP A;  1H2M A;  2IZW A;  4FPY A;  5F3I A;  4MYE A;  3AFK A;  4LHL A;  3D6E A;  1ZZC A;  4K40 A;  3WCR A;  5I8T A;  4HXC A;  1TME 3;  1IG3 A;  4P02 B;  1OUS A;  3WG3 A;  4B1L A;  4QQH A;  3ES1 A;  4DUW A;  1RVF 1;  4DY3 A;  3K2O A;  4LBM A;  2LRO A;  1ZBE 2;  2BGP A;  3SMH A;  4RHV 2;  3KV9 A;  2IXJ A;  5A7N A;  3VZM A;  3EHK A;  1JXN A;  5F8P A;  2XUE A;  4QGN A;  1VIW B;  1X9T A;  5T3N A;  4FQZ A;  1OD3 A;  4K6B A;  3W21 A;  4J6G A;  5G05 L;  2Z79 A;  1E5S A;  4XEZ A;  5K9Y A;  1NA1 A;  1LRH A;  2PTM A;  3E1F 1;  3MF6 A;  3OBT A;  4HVR A;  4L97 A;  4PIZ A;  4ASK A;  4BDV B;  3VGI A;  1OQE A;  5EQU A;  5IVY A;  2HEY F;  1ULE A;  5J96 B;  3KV5 A;  2OII A;  4FP2 A;  3WSO A;  1F5J A;  1QQP 3;  1H8T C;  1RXF A;  1ZA7 A;  1GQH A;  1JYC A;  4N53 B;  5A7W A;  4PLM A;  3O1S A;  2VOK A;  1RHI 3;  1C8M 2;  3I97 A;  3J7H A;  5FFO C;  5CAD A;  3N35 A;  3TB0 A;  1SLT A;  4K7J A;  1TZO A;  3MW3 A;  2JIJ A;  5A7S A;  4RFR B;  3SKV A;  2E33 A;  2VOT A;  1OPM A;  1R09 3;  5FZ9 A;  2YMZ A;  2R06 1;  3FN9 A;  1DIW A;  4Q4W 3;  4NN0 A;  2WIN B;  5D8A A;  1TNF A;  4AHY A;  1OA3 A;  1HLC A;  2P17 A;  1FX5 A;  2Y6G A;  3PU3 A;  2QQN A;  2P6C A;  5IHR A;  1R08 1;  1ND3 A;  5FIX A;  3K51 A;  4QM9 A;  1MZ5 A;  3MZH A;  1QOO A;  1J59 A;  1NKG A;  1FPN 2;  4PQ9 A;  1EP0 A;  2PHF A;  3MI8 A;  2IVJ A;  2RS1 3;  4Z1V A;  3HBZ A;  1WMF A;  1YFY A;  1EUU A;  2DBN A;  2NMO A;  4RGA A;  3WG4 A;  4D8M A;  1U5I A;  1PGW 1;  2B4K A;  1V6L A;  1XU2 A;  4OMC A;  1CWP A;  1QEX A;  2Y64 A;  3BIW E;  1HN0 A;  4DMI A;  1K5M C;  1SHW B;  4A42 A;  1MS9 A;  2W94 A;  4O9E A;  4L92 A;  4YZ1 A;  2BUK A;  4E4Z A;  2VNO A;  1MQT B;  4O65 A;  5AVP A;  4YZ5 A;  2WJS A;  1L3J A;  3UK9 A;  5G04 L;  4Q4X 1;  4HKW A;  1LEN A;  5F3C A;  4CDU C;  1LCL A;  2DBI A;  4LBQ D;  4UFK A;  5C5T A;  1WLD A;  5EJZ B;  4BYY A;  1QJX 3;  5K7P A;  3SCF A;  3RG0 A;  2XH6 A;  3EMR A;  2UWA A;  5KHJ A;  2B5H A;  4GXL A;  1EAH 1;  1LOG A;  1GP4 A;  1NE6 A;  1OLR A;  2G1M A;  3JQX A;  1RMU 1;  3U11 A;  1WWY A;  3T0D A;  1JUI A;  1LHN A;  1DGL A;  1YFW A;  3NNG A;  3BOW A;  4LBO A;  1L7Q A;  4XBQ A;  3PVN A;  2OKX A;  5IK8 A;  3SCG A;  3JXS A;  5CKQ A;  2NN8 A;  5C8C C;  5GLU A;  4BK4 A;  3NRU A;  3ZO0 B;  5HV0 A;  2HWE 3;  1RUH 1;  3LEK A;  2XL9 A;  5BY5 A;  3K4D A;  1E5H A;  3POS A;  3ZYR A;  1VJ2 A;  2HEW F;  1G9A A;  2VUJ A;  4M4P A;  2BDR A;  4COY A;  4NIG A;  1DLC A;  5FBZ A;  4RQP C;  2GC2 A;  5APA A;  2XJT A;  1X9P A;  3IDC B;  1GOF A;  4Q0Q A;  1WME A;  5IK7 A;  1VRH 2;  2CAU A;  2H0B A;  2W39 A;  5FYC A;  5H9R A;  2FDJ A;  3KF5 A;  2J22 A;  3D3A A;  1RUC 1;  1W0O A;  2QQJ A;  2KD7 A;  3O1M A;  1AR8 1;  2JG8 B;  4Y1V A;  3POI A;  5L9V A;  2D6N A;  1AUY A;  5SV8 A;  4LKF A;  5ABJ A;  3FJS A;  3R4S A;  4LNV A;  5FQ0 B;  3HT2 A;  3M3E A;  2Y6H A;  2AEN A;  4F83 A;  2PHD A;  4QX7 A;  5DUV A;  1LR5 A;  1HRI 1;  3CIH A;  4QX0 A;  4XFH A;  4MG2 A;  2VTX A;  1PGL 2;  4KL1 A;  1PMJ X;  1ASJ 3;  1DQ4 A;  1J83 A;  2BRT A;  2MEV 1;  2EXI A;  4XF3 A;  1REF A;  3TN9 2;  1W8W A;  4HN0 A;  4IEW A;  3WNL A;  3DN7 A;  4TZD A;  4YM3 A;  4KU7 A;  1UPS A;  2W47 A;  2YG0 A;  4RYD A;  5EYX A;  5FZL A;  3I7D A;  5KHG A;  2JDN A;  3B9C A;  3OB8 A;  3AZY A;  5IAV A;  4I2O A;  5DAB A;  2VMF A;  2GNT A;  4MV2 A;  3VBU C;  4RFT 0;  4XW3 A;  1RUD 2;  1OKO A;  3C7E A;  5BNP A;  4IV3 C;  2VZR A;  4K1Y A;  4Z2W A;  5F1R A;  5A7Q A;  4D94 A;  4FXK B;  3ZIX A;  3R4D B;  2E63 A;  3AKQ A;  3BAL A;  1S2K A;  2JE8 A;  2ZHM A;  3NO8 A;  1QJU 2;  3MIB A;  3RQ0 A;  2RM2 2;  3UGH A;  3BTZ A;  5FZA A;  4XDQ A;  1PO2 2;  1S0F A;  2CGO A;  2V5D A;  2E53 A;  3N7K A;  1F35 A;  5FLH A;  4MZU A;  3AP9 A;  3DXT A;  3T2O A;  3O5S A;  4COZ A;  2I07 B;  2C9A A;  1ULD A;  1AYN 2;  3FLP A;  4YW6 A;  3WNP A;  1AYM 2;  2ZHK A;  1D4M 1;  4NR1 A;  5BNN C;  2GN7 A;  4UF0 A;  2VNG A;  2YYO A;  4YVS C;  1LB2 A;  1XE0 A;  2VXJ A;  2RJK A;  4CCM A;  3OPZ A;  3WDX A;  4N43 A;  2IUW A;  3IMN A;  1WW4 A;  1KQR A;  5A7W B;  3S6P A;  3CZU A;  5T5P A;  3BPZ A;  5KC6 A;  3C7G A;  3O1U A;  1J84 A;  3T0A A;  3THP A;  2ZAA A;  2XBO 2;  4MGT A;  2R07 1;  2XJU A;  3J7M A;  3IT8 A;  2EIE A;  2XB6 C;  4Q1P A;  4WBB A;  3O0X A;  2I74 A;  2E32 A;  3JD7 2;  4AWD A;  1UIJ A;  5J36 A;  1J1T A;  1YQ6 A;  3H3L A;  4FI9 A;  5L9R A;  4H7M A;  4C1X A;  3GBW A;  3H42 B;  5F3E A;  4GKX A;  4UW6 A;  3NVC A;  2JE9 A;  4V1P A;  5BUV A;  4OFG A;  4E4S A;  2HEV F;  4KG0 A;  4MGY E;  4EYU A;  2IXH A;  3VBS A;  5IK4 A;  1QJY 2;  1H30 A;  1Y7B A;  2WFF 1;  2VQU A;  2WO1 A;  4B7K A;  3ACG A;  1SPP A;  4OI2 A;  2WR9 A;  2XLF A;  2PMW B;  3OBR A;  4QAW A;  5FY7 A;  3UKT A;  4IGO A;  1H4G A;  4ZKT B;  3HQU A;  5FO8 B;  4XOG A;  2QUO A;  4HKO A;  2HWD 2;  3VBO B;  3ETQ A;  4P00 B;  2QQO A;  3HNM A;  3ZXD A;  3PUA A;  4AED C;  4IE0 A;  3TEW A;  4YM0 A;  2HWB 2;  1WA6 X;  2ORZ A;  1WMD A;  3ZFF A;  1UOF A;  2J7M A;  1TQ5 A;  2ZGR A;  3D82 A;  4WV8 A;  3RPQ A;  4EJR A;  5E8A A;  3CHX A;  1TEI A;  2VJX A;  1S0B A;  3D5O A;  1H8T B;  4J25 A;  1AR9 3;  4LQR A;  2TNF A;  5F39 A;  4CU8 A;  3NJZ A;  3MIH A;  4D0Q A;  5C9A C;  5J09 A;  1UIK A;  3WQ0 A;  2WS9 1;  4CA9 A;  4FTB A;  1S2E A;  5C4W A;  3AP6 A;  1XE7 A;  1CIW A;  2W08 A;  3QCW A;  4I3G A;  1OBN A;  2WT1 A;  4OMD A;  3JUU A;  4YG0 A;  1WZX A;  2P5B A;  1WKY A;  2WAA A;  1CAV A;  3RZZ A;  3VZN A;  1EYB A;  3B00 A;  4BA6 A;  3PL0 A;  4ZS3 A;  3OF1 A;  3DV8 A;  1Q8Q A;  5F3G A;  2GME A;  2ZJC A;  5FUN A;  1VBD 3;  3U14 A;  3VDD A;  5LA0 A;  1W9Y A;  4TXW A;  1DZQ A;  4CDQ B;  2R04 2;  1PM7 A;  5CFC C;  4LOR A;  1DGR A;  2HH9 A;  5I0D A;  2VQ0 A;  2QBX A;  2IXC A;  1COV 3;  5FYI A;  1RUO A;  3WDU A;  3WW3 A;  3SNM A;  5ACA 3;  2RG4 A;  4UW5 A;  2QQW A;  4QQP A;  1AR7 3;  1UO9 A;  3POW A;  3H8U A;  1RUN A;  2DCJ A;  5F2W A;  3WZ1 A;  4G3Y C;  1OT5 A;  4BWO A;  5I0T A;  3K4Z A;  5FKC A;  3AL6 A;  5DQ0 A;  4OLL A;  3FLT A;  1BZW A;  1CX4 A;  3LFM A;  1EY2 A;  2OX0 A;  4LO8 A;  4S2H A;  3VZL A;  2YPJ A;  4CRQ A;  4LUK A;  1S1A A;  4ET7 A;  4AQ2 A;  1QKQ A;  4CDW A;  4GWM A;  3QD6 A;  4KBZ A;  5E16 A;  4Q0P A;  3WF0 A;  1UQX A;  2R06 2;  3L2Y A;  1YFX A;  2Y38 A;  4FFH A;  3SCH A;  3WF1 A;  3KD4 A;  4M3C E;  3T4V A;  5T54 A;  5I0S A;  2ZAC A;  3WT3 A;  2G19 A;  1V6M A;  2YRO A;  3CJI B;  1R08 2;  3L9J T;  4AI2 A;  2X09 A;  2YFU A;  3FE5 A;  2UU8 A;  4Q2F A;  4GB3 3;  2GND A;  3FX3 A;  5FAX A;  4P9X A;  4OUL A;  4L99 A;  4KWU A;  1ZYB A;  2QKD A;  2BV4 A;  1IOA A;  3ELN A;  5JI9 A;  1WCK A;  4FPJ A;  2ZEX A;  1S0E A;  1EUT A;  1OQD A;  2RVA A;  4XAB A;  5GZF A;  1XNB A;  3E5U A;  1GNZ A;  1IG0 A;  1O4Y A;  4XET A;  5FY5 A;  2YGL A;  3Q8C A;  4HAN A;  1W04 A;  2CGN A;  2LTN A;  4XIO A;  3WXP A;  4ASL A;  3GHM A;  1GZW B;  3H7J A;  1AHS A;  3UKN A;  3O1R A;  2AUY A;  4Q4X 2;  5GAL A;  1G86 A;  2VOW A;  5JPM B;  5J3U A;  4BQY A;  2Z2S B;  1XYN A;  1ZZ8 A;  3ZN6 B;  2ZGP A;  2D3S A;  3GZU C;  4W4Z A;  3LDR A;  1JH5 A;  1MEC 3;  3IKW A;  3NKG A;  2ZEY A;  1OA4 A;  1W2N A;  4K20 A;  1CAU B;  3WDT A;  1EAH 2;  1BBT 1;  2FMY A;  2LUW A;  2LW8 A;  5A3P A;  4G9S B;  4PDW A;  5A1A A;  2DVB A;  5LEK A;  3RZG A;  1RMU 2;  1X50 A;  5D21 A;  1OF3 A;  5F5A A;  4QX5 A;  1VBC 1;  3MGU A;  4CCN A;  4YW7 A;  1N1S A;  3ST7 A;  4ERO A;  3ZYH A;  1XSQ A;  2CWS A;  3JB8 A;  3NAP C;  4AF9 A;  2B42 B;  1RUH 2;  3VZO A;  4A3Z A;  2F17 A;  2JKX A;  4QXK A;  4R8H A;  3UT0 A;  2VUC A;  1MZE A;  3AZZ A;  4DXT A;  1S0D A;  4A4A A;  3BKZ A;  4ZPI A;  1GU3 A;  2RJL A;  1Y43 B;  4PCR A;  2PEL A;  5EV7 A;  3MF9 A;  1N3Q A;  4CYD A;  2Q1M A;  4AVV A;  5FJK A;  1F5F A;  2BER A;  4OHX A;  5F5C A;  3MLK A;  3BGA A;  4LJH A;  4RHV 1;  3ZR6 A;  2B9V A;  2WT0 A;  1VAM A;  4XQD A;  3UKV A;  1NXD 1;  4BME A;  3I3M A;  1RUC 2;  2RDQ A;  3Q8F A;  4JV4 A;  1AR8 2;  1VBB 3;  2W91 A;  1BEV 2;  4XF4 A;  1CIY A;  3LOB A;  1H6Y A;  4Q4V 1;  3SC7 X;  1CAW A;  2DCZ A;  5I0U A;  5A6Z A;  1POQ A;  1R1Z A;  3DYP A;  4PLO A;  4F3J A;  1NT0 A;  4LOT A;  3ON7 A;  1DGW X;  2C1F A;  4BXF A;  3WW1 A;  1LAJ A;  4HK9 A;  4FT8 A;  3INA A;  1ND2 C;  2P6H A;  3RYR A;  4E2G A;  3KV4 A;  4Q4Y 1;  1NAE A;  5EWS A;  4YGC A;  1N1T A;  1IHM A;  3BUC A;  3MFC A;  4RA0 A;  1YI9 A;  2QVS B;  5EXO A;  4QHB A;  1LED A;  2WT2 A;  3V65 A;  3HIF A;  4D6S A;  5BNN B;  4XMI A;  4MVT A;  5FYT A;  4NVP A;  4NHL A;  4WM8 A;  4YGB A;  2W92 A;  2YZ4 A;  5FBJ A;  4AEK A;  4M00 A;  1LU2 A;  3III A;  2D6M A;  4HKL A;  1MS0 A;  1HV1 A;  2MHF A;  5AFB A;  3I3B A;  4L8Q A;  3V56 A;  3H8O A;  1SDD B;  4XHB A;  5FZG A;  1VAK A;  5JXG A;  3VDA A;  1DZT A;  2VMD A;  4L0P A;  4AGV A;  4YSF A;  3OBZ A;  5LRS A;  3JCI A;  3ZYB A;  5KHH A;  4LMF A;  2OYZ A;  3AFG A;  1E5I A;  3ECQ A;  4QPI C;  1AX2 A;  5JLV A;  5FYH A;  1FPN 1;  2J1S A;  3MLJ A;  2C4X A;  1BBT 3;  1APN A;  3O0W A;  2VZP A;  4LEJ A;  1FI2 A;  3IM0 A;  1D4M 2;  4A7Z A;  1GIC A;  1W6M B;  5FYS A;  4I0A A;  2PXJ A;  1W28 A;  1K12 A;  3JU9 A;  1JZ8 A;  1N1V A;  3PTY A;  1LOF C;  4K3U A;  1DQ2 A;  3ROU A;  1Y4W A;  4IE5 A;  3EB7 A;  1SQ4 A;  3ILR A;  3RYK A;  4ES8 A;  2R7E B;  2IFW A;  1OOP B;  5BNO C;  2R07 2;  3KCX A;  4AED B;  1HRV 3;  2OPW A;  3AMH A;  4CVU A;  1RJ8 A;  2WN2 A;  1QMJ A;  1ZBE 3;  2TUN A;  3WF2 A;  1W8F A;  1RIR A;  4OUM A;  2R49 A;  2GNM A;  1A34 A;  2V4A A;  2WNU C;  1WGP A;  3HEI A;  1W06 A;  3WW2 A;  5IFT A;  4AEM A;  5ERL A;  1PVC 1;  1IPS A;  1QDC A;  2K0G A;  3M3C A;  4Y24 A;  3AM2 A;  4B7E A;  3LSD A;  4S2G A;  2VQA A;  2QTW B;  1NLS A;  2WNO A;  2WFF 2;  4YGD A;  4DY5 A;  3RMX A;  3BTY A;  1NCQ A;  3D8C A;  4JDM A;  1UW8 A;  3GCX A;  1LU1 A;  2JDU A;  3M2M A;  3ZPO A;  4AVB A;  1YWK A;  1N1Y A;  1PMI A;  3NMB A;  1S2B A;  2FDH A;  2ZGS A;  3T2P A;  4PIY A;  4CEY C;  1C8M 3;  4ZZ8 A;  3IMM A;  1POV 0;  2BBA A;  4NHK A;  4XBL A;  4N9I A;  4N53 A;  4YW3 A;  1E5R A;  3WNN A;  2WKK A;  1QHD A;  5DXD A;  3BTX A;  2X53 S;  1US2 A;  4JQT A;  3U1X A;  2VW2 A;  5FTT C;  4AAP A;  4I01 A;  2D5H A;  5AVA A;  3AYD A;  4E8C A;  3ZFG C;  4OHY A;  2DWR A;  4ZS2 A;  3N9O A;  4OQ9 A;  3RS6 A;  1NOV A;  2FDF A;  2GSY A;  2CSG A;  4YVW C;  4AOC A;  2VQT A;  3GJB A;  3WP3 A;  1SZB A;  2DUP A;  3IZO A;  3ZYP A;  3I2D A;  4M0N A;  1FPN 3;  4EV0 A;  3V0B B;  4CDX C;  1O6U A;  3KT7 A;  3PME A;  3TN9 1;  5EP9 A;  3RZK A;  4AI1 A;  3DPR C;  4W65 A;  4WZC A;  5KHK A;  1CES A;  2OUH A;  2ETE A;  3DCQ A;  1RJ7 A;  2VXR A;  2LAL A;  4ZU5 A;  1BLZ A;  1SBF A;  3T09 A;  3N9Q A;  1H2L A;  5A6Y A;  3VKO A;  5FYB A;  2CDP A;  1EV1 3;  5FZD A;  5FZF A;  4AFB A;  3LIG A;  4XUP A;  2JEC A;  2PFW A;  2I2S A;  1Z0H A;  1RUD 1;  2A5Z A;  2J1R A;  3JBG 2;  1PK6 B;  3MID A;  3AMQ A;  4QDR A;  5FZI A;  5A7P A;  2RDR A;  4QT6 A;  1SFP A;  3ZDV A;  1CPM A;  2N7G A;  3FBM A;  1CZT A;  5CIR A;  4I09 A;  5FUI A;  2UWC A;  1JBC A;  2DUQ A;  4Y1Y A;  4B3N A;  1WCQ A;  3H1Y A;  1MQT A;  1V6N A;  3OYW B;  3WIN E;  2RM2 1;  4A3X A;  2D6K A;  4CE8 A;  5EYY A;  3WF4 A;  1PO2 1;  1W3V A;  2WWJ A;  3KZ4 C;  2ZX4 A;  4JAA A;  1CJD A;  1Q8S A;  5IK5 A;  2G9F A;  1ZRD A;  1XQN A;  1FMD 1;  1GYK A;  1D2S A;  4IEZ A;  5CVR A;  3IN9 A;  1JOP A;  4XCB A;  3K3N A;  1HB1 A;  1UOJ A;  5JXH A;  2XJQ A;  3NST A;  3I3Q A;  4Y3O A;  2QDR A;  3WX5 A;  3AVR A;  5A3N A;  2BPA 2;  4FAH A;  4LBQ B;  2P1B A;  5FP4 A;  3IAP A;  2HBT A;  1PX3 A;  1Y3T A;  1H9W A;  1WBL A;  2IVI B;  3KLS A;  1W3X A;  4OUS A;  5EHD A;  2W1Q A;  2Y34 A;  1FV2 A;  4NWV A;  5FPZ A;  4AZZ A;  4IEV A;  4MXV A;  4IV1 C;  1UMH A;  4WM8 B;  4HVQ A;  5DAP A;  2BVB A;  5DN2 A;  2FDG A;  4JZR A;  3I59 B;  1C28 A;  1RED A;  1VRH 3;  3AK0 A;  3N9N A;  3ZN4 A;  1HN1 A;  5FP9 A;  4A7K A;  2LRP A;  2JJ6 A;  3NAP B;  4OCT A;  3TOJ A;  4LR4 A;  5JZG C;  4QGM A;  2UWB A;  2XOM A;  1OA2 A;  4H3W A;  3MDP A;  3H3U A;  4DXR A;  3OG2 A;  1O3T A;  1Q43 A;  3LB9 A;  4MXW B;  3VHR A;  4QB1 A;  3PVE A;  3CQO A;  1QIQ A;  1TMF 2;  1W9T A;  2JG8 A;  1QJY 1;  3NL1 A;  1OI6 A;  1UYP A;  1C4R A;  1YXW A;  4DB5 A;  1JYT A;  3GAL A;  5FQ0 A;  2RV9 A;  1DYP A;  3CU7 A;  3M8L A;  3PTR B;  1FAY A;  1HJG A;  2QQV A;  3V0A A;  3AXD A;  4B4R A;  4DQA A;  1LGB A;  1WD3 A;  2D44 A;  3WDW A;  1PZ9 A;  4SLI A;  4NHY A;  4SBV A;  4BJ0 A;  1G9B A;  1UXZ A;  3KCC A;  2CAV A;  1IPK A;  4OVE A;  4M3C F;  1W6O B;  5KXB A;  1OC1 A;  2HWB 1;  4JRA A;  5FPL A;  5JSR A;  1NY7 1;  5FYY A;  1O91 A;  2ERF A;  1NA1 C;  1VBC 2;  1XJA A;  1OLM E;  1RUD 3;  4UAP A;  4XC9 A;  1WCS A;  1ACC A;  2QJV A;  1U12 A;  1JI6 A;  3J8F 2;  3NJV A;  4CTE A;  3RZJ A;  1ST8 A;  4Q8K A;  3H3Z A;  5C70 A;  1C1L A;  1K3I A;  2YPD A;  1QJU 3;  2H0V A;  2RM2 3;  1F9K A;  1V0A A;  4W6W A;  2PLV 2;  2JWP A;  1PO2 3;  4BIO A;  1YFU A;  2ET7 A;  1LOA A;  2E31 A;  4ES9 A;  1OFN A;  1ODN A;  4YYO A;  1AYN 3;  2IXK A;  3HAG A;  3V64 A;  5LBE A;  5JOY A;  3N7J A;  1AYM 3;  5HXV A;  3I49 A;  1SEF A;  4PI0 A;  4NPM A;  3ALQ A;  5FXX A;  5FV3 A;  2JG9 C;  3LF7 A;  2R04 1;  3P1I A;  3AYE A;  4Q4V 2;  2QCS B;  1NCQ B;  2OXB A;  2ID4 A;  3LIH A;  4IEY A;  2XVL A;  5FMO L;  3IDA A;  1AX1 A;  1UZ0 A;  3FHI B;  3S0M A;  4N8M A;  1OVS A;  3F2Z A;  2OQ7 A;  1YYN A;  1DGR N;  2P3J A;  3QLQ A;  2VZ1 A;  4FOQ A;  3DGT A;  4KQ7 A;  4LPL A;  2E51 A;  4O9G A;  4UWD A;  4ATF A;  4BK5 A;  1A78 A;  4Q4Y 2;  4YW4 A;  3UGF A;  1JZ4 A;  5JCT A;  1VPH A;  2XBO 3;  3GCW A;  4QQO A;  5C71 A;  5FZH A;  1IS6 A;  2O14 A;  5C3R A;  1YRZ A;  1VBA 1;  4CEW A;  4G4F A;  1UY2 A;  1JN2 P;  2Z69 A;  2BOJ A;  1HXS 1;  1WLT A;  2IC1 A;  2WLQ A;  3JD7 3;  5DG2 A;  4BB3 A;  3A0N A;  2KA3 A;  1Y9G A;  5FZ6 A;  5JWP A;  2WUH A;  1CZS A;  3KHB A;  3WOG A;  4LIV A;  4NRM A;  4LA2 A;  2BWA A;  3H0O A;  2GH8 A;  3HNB M;  4R4Z A;  1Y9Q A;  3WDV A;  4IGP A;  4R9C A;  4U36 A;  4Z82 A;  1O4T A;  5JUV A;  2JDZ A;  4R52 A;  4Z2A A;  1YJL A;  4PBP A;  1B35 C;  4IEO A;  4MH0 E;  4Y5Z 0;  5BNO B;  4FQ4 A;  2EAK A;  4QU1 A;  1V6K A;  3AKR A;  4UXA A;  5IWF A;  2RS5 1;  4JHT A;  3BI3 A;  3VD4 A;  1LOC A;  3WR0 A;  5A3L A;  2ZHN A;  3C7O A;  5LAT A;  1G8W A;  1DQ5 A;  2CL2 A;  5L7O C;  3NV3 A;  2VR4 A;  4CXW A;  2O0O A;  1AJK A;  1Z7S 3;  2HWD 3;  2JD4 A;  3R4U A;  4E27 A;  4CPB A;  4MSV A;  2EVX A;  2ZAB A;  4QX8 A;  4AAX A;  4C8D A;  5M0T A;  4GQ7 A;  3VBO A;  3P6B A;  1CD3 G;  2WZ8 A;  3DKQ A;  4HOO A;  5LY1 A;  1DU3 D;  2EAA A;  4FVV A;  4LK7 A;  3WUC A;  3SEP A;  2XG3 A;  4FO9 A;  4LT5 A;  4BQX A;  1KEX A;  4EZH A;  5J48 A;  3POY A;  1SLL A;  3AZW A;  3F95 A;  2GN3 A;  4CEY B;  4FPC A;  1XB9 A;  4QU2 A;  3KGL A;  1H8T A;  2CHH A;  2GAL A;  4QM8 A;  3RZH A;  2VD7 A;  1UMZ A;  2GMM A;  1RVF 3;  4KNC A;  3ABZ A;  3UES A;  2D3R A;  1POV 1;  4OZO A;  5LBF A;  1MS8 A;  4Y4Y A;  2WO3 A;  3T4H B;  4XJ8 A;  4XUN A;  2R16 A;  4TSV A;  3VBF C;  2R04 3;  2HWC 1;  5DUX A;  3VKM A;  4UW3 A;  5DZG A;  1PVC 2;  2PHU A;  1QJE A;  5ABJ C;  3ZFE C;  5I0R A;  1CAX B;  1A8D A;  5FJH A;  4CDQ A;  1GV9 A;  4N9H A;  1QDO A;  4HBN A;  2CNA A;  4DPN A;  1BK1 A;  1Q3E A;  1XU1 A;  1GUI A;  1FV3 A;  4XQ4 A;  1OMI A;  5FZ0 A;  2HLE A;  1UZY A;  1S55 A;  3ES4 A;  2JEM A;  3ZSK A;  1GWM A;  3URF A;  2VUA A;  4IND A;  2BNO A;  2DCK A;  1PIV 1;  5A32 B;  1ULG A;  1RUG 1;  2XHN A;  1V9U 1;  1VR3 A;  4LO6 B;  3ZSE A;  4AQT A;  1W8H A;  2JIG A;  1QXJ A;  5ISL A;  5K0U C;  2ZPX A;  1UZW A;  2AZ5 A;  2W46 A;  1GFF 2;  2V09 A;  1KDK A;  3KM5 A;  1BEV 1;  2W1U A;  3HNY M;  4FFF A;  4KGQ A;  4XUT A;  5KR7 A;  2R06 3;  3K48 A;  1W6N A;  3MUY 1;  4H2A A;  4HET A;  4I3P A;  3AP5 A;  5FMD A;  5T50 A;  3P3P A;  1CON A;  4XZP A;  3RJ2 X;  2A70 A;  5FZO B;  3IIA A;  4IW3 A;  1UOB A;  2VZV A;  4P9L A;  3WCS A;  2A1X A;  1R08 3;  3NNJ A;  4ORF A;  4UFL A;  2Q0A A;  3VD3 A;  5FZM A;  3WNO A;  4LOS A;  3ORJ A;  3ZXA C;  4BPZ A;  4UFI A;  2YUE A;  5J1X A;  3N7M A;  3FUQ A;  3PIJ A;  4HLT A;  4CXY A;  2OVU A;  4JDO A;  5FLI A;  3CJI A;  1I5Z A;  1UMI A;  3M3I A;  4OI0 A;  1J3R A;  2DU1 A;  4JQR A;  4YZ3 A;  4XE9 A;  2D98 A;  3T30 A;  4NIH A;  1NX9 A;  3T08 A;  3POJ A;  3ZSJ A;  2F4P A;  1NLR A;  2XQX A;  4IER A;  3SH5 A;  3U10 A;  4JDN A;  1SLB A;  3KCY A;  3LPF A;  5DDJ 1;  3I3D A;  2CTV A;  1HB3 A;  4COW A;  1NQJ A;  5F6K A;  3EBR A;  3OUI A;  1A6C A;  5C8C A;  2BJS A;  1GSL A;  2Q1Z B;  2ZMK A;  2DU0 A;  4PF1 A;  4ZZ5 A;  4IV1 B;  4XUO A;  4Y5T A;  4RL7 A;  1DHK B;  4Q4X 3;  3BU0 A;  4J1W A;  4GAL A;  4QXH A;  1DP0 A;  5FLJ A;  1WW6 A;  3PUI A;  2GZW A;  2ILM A;  3VDC A;  1GZW A;  5A6Q A;  4KWJ A;  3I2I A;  3EO6 A;  2RR1 1;  1GOG A;  1X33 A;  1XNT A;  3ACF A;  3VN4 A;  1VAV A;  1EAH 3;  1HDK A;  1FMD 2;  1XND A;  4RS5 C;  3ZN6 A;  2E7T A;  3R05 A;  5BNQ A;  2VBB A;  1W0N A;  1RMU 3;  2J1U A;  2D7F A;  3EXU A;  2OZ6 A;  3BYW A;  4WVM B;  5KWR A;  1CAU A;  1PM4 A;  4MUV A;  3QAC A;  1AXZ A;  1YQ8 A;  2XJS A;  2XQR A;  1X8M A;  4IEX A;  3WLU A;  4E2S A;  4O7X A;  5FDB A;  1AR6 1;  1DQ6 A;  1YIF A;  1RUH 3;  1W8T A;  3VDB A;  3ZXK A;  4FSJ A;  2Y8K A;  3MFA A;  4CEW B;  2VNV A;  5DAX A;  4DS0 A;  4S2D A;  4E9K A;  2IXL A;  2G9G A;  2RJ2 A;  5IUQ A;  5K8S A;  2RMU 2;  3HQR A;  1T6B X;  2W0X A;  3DF0 A;  2VCB A;  3LD8 A;  3CDZ B;  1W9F A;  4AVA A;  5HCA A;  3MUZ 1;  3WP6 A;  4MX3 A;  1PNG A;  4JGY C;  2OS2 A;  4ASM B;  2WA4 A;  2JDY A;  2OUJ A;  5CNA A;  2ARX A;  1QNY A;  5JAX A;  1MPX A;  1KJR A;  4Y22 A;  1BKZ A;  5JI7 A;  2NYY A;  1RUC 3;  4GUL A;  2J1T A;  4DZG A;  5CEH A;  1AR8 3;  3OGJ A;  3RI9 A;  4P9I A;  1RTV A;  3VBU A;  2EIB A;  3JZV A;  4YLZ A;  4K1Z A;  4GKY A;  3B93 A;  3UET A;  4CUA A;  1AX0 A;  3RSJ A;  3GBG A;  5C4W C;  1HRI 3;  3N9M A;  5EIY B;  2YB7 A;  4B8E A;  2FHR A;  5KHI A;  4QQL A;  5FZ4 A;  4YZ4 A;  4URT A;  2MEV 3;  2A6Y A;  3LFI A;  4GIQ A;  4QDQ A;  1L7L A;  4XIL A;  2LS6 A;  1JYV A;  1RHI 2;  1GQP A;  2JG9 B;  3ZN5 A;  2BP6 A;  5C3Q A;  3VDD C;  4YFW A;  2Q8D A;  4BXS V;  3HR9 A;  4ATE A;  1H1M A;  2YHJ A;  4PI2 A;  3WHT A;  4H7L A;  1NY7 2;  5BNN A;  4GJZ A;  2Q8E A;  4NRQ A;  4D6Q A;  3VUO A;  1FNZ A;  1YHF A;  2A7A A;  3MLL A;  4KMQ A;  3MIF A;  3FUO A;  1OXC A;  5F37 A;  4DEQ A;  1MR5 A;  5HI0 A;  3THC A;  4QPI B;  1HB2 A;  1XOY A;  2D5F A;  2P34 A;  3M3O A;  1GWK A;  3OY8 B;  4XFI A;  3X29 B;  3M70 A;  5JVV A;  2X5I C;  5FK8 A;  2JB4 A;  3AX4 A;  1RUF 1;  4JKK A;  2VU9 A;  3B69 A;  3WP5 A;  3I2G A;  3SLI A;  5FMO S;  1K45 A;  1OUX A;  1YNA A;  5HCB A;  3RZM A;  2D3P A;  3KSC A;  4RGK A;  1ZA4 A;  1B35 B;  2RS3 1;  2FCV A;  3SKJ E;  1W05 A;  1M06 G;  4QX1 A;  1D4M 3;  2CWM A;  3W5N A;  1C5H A;  1STM A;  4O61 A;  1GNY A;  1WLW A;  4L11 A;  5L7O B;  3JBG 1;  4IES A;  3H8X A;  1W6M A;  2OQ6 A;  4DRR A;  2DCY A;  2BQP A;  4AGG A;  2W87 A;  5IT6 A;  2VUD A;  5LK5 A;  2R07 3;  2W9X A;  2W68 A;  2ARC A;  1VBA 2;  1DFQ A;  2VNR A;  5FZB A;  1JHJ A;  1HXS 2;  1LJ7 A;  3POB A;  4BIF A;  5FYU A;  2UYA A;  1OOP A;  1UZZ A;  5LB6 A;  3RWK X;  4AED A;  1HB4 A;  1K5M B;  4HON A;  1W6N B;  1O8P A;  4MO3 M;  4TWT A;  5C5U A;  2Y0I A;  3H9A A;  3ZYJ B;  2AR6 A;  3N9L A;  1ZBA 1;  3A4U A;  2HWF 2;  2WFF 3;  3ZXL A;  2ARA A;  2YU2 A;  2VZU A;  2RS5 2;  4CDU B;  2VZQ A;  3UJO A;  2VCA A;  1XNC A;  5C9A A;  2DDU A;  4E2Q A;  3BB6 A;  3BOD A;  2BWC A;  3PUH A;  4QHO A;  2E7Q A;  4EN6 B;  4QKF A;  1SLC A;  4DNY A;  3VBF B;  2D6P A;  5B4X A;  1ALY A;  2EXK A;  3PLQ A;  3Q9O A;  4A44 A;  3I2O A;  4I02 A;  3ZFE B;  4DUX A;  2X29 A;  4QXB A;  4N7U A;  5C8C B;  3N3H A;  5KC5 A;  1A8M A;  4XXP A;  4LIT A;  1DYO A;  1PZ7 A;  3LE0 A;  2XL7 A;  3KT1 A;  2BBV A;  2PQQ A;  3ATG A;  1I5P A;  5FWJ A;  1YQ2 A;  1EPZ A;  2WAB A;  4B4P A;  3WVJ A;  4CU7 A;  3KMH A;  4RQP B;  2WS9 3;  1TMF 1;  3SH3 A;  5IYY A;  1OFS A;  5F32 A;  4A7Y A;  1UNB A;  4AQ6 A;  4BQ4 A;  3NJX A;  2ZZQ A;  3WNK A;  5FUP A;  3B02 A;  3ZMO A;  5K0U B;  2WA3 A;  3HMY A;  2K46 A;  1UKG A;  2YBP A;  2XR4 A;  2XHK A;  2OW4 A;  1G9D A;  3B94 A;  5J98 B;  5A3M A;  1TNR A;  3MW2 A;  2FZ1 A;  3V0B A;  2ET1 A;  4ZHN A;  1URX A;  2HWC 2;  2Z42 A;  3B5L B;  4HG6 B;  3NV4 A;  1LOB A;  3TEX A;  4DXS A;  3OTF A;  1YCI A;  5LRR A;  1BYH A;  1UY4 A;  1UZV A;  4AVT A;  1RUJ 1;  3OPW A;  1JYX A;  4OQ8 A;  3A21 A;  4XFC A;  1AJO A;  1ULF A;  5FKB A;  3RYP A;  1UU5 A;  2WO7 A;  3J8F 1;  5FZ3 A;  1L7R A;  2Z4F A;  5CA6 A;  2AEZ A;  5FMB A;  4FPK A;  4D3W A;  1FOD 1;  2WNV C;  4YW2 A;  4CXX A;  1PK6 A;  1IZ3 A;  4DFS A;  1PGS A;  4Y22 B;  2C0Z A;  4D7S A;  2PLV 1;  5A33 B;  5CZK A;  3DYM A;  1ODM A;  1PIV 2;  3RDI A;  1QH6 A;  5JMC A;  1RUG 2;  2WAO A;  1V9U 2;  4NID A;  4HL0 A;  3VBU B;  3ITQ A;  3VBH C;  3OYW A;  4YGE A;  5KXC A;  3I2F A;  3T1M A;  4TYS A;  1VMF A;  2G9Z A;  4IV3 B;  2B8M A;  1JYI A;  4Q0S A;  4LHN A;  1NQD A;  4C0H A;  4Y5S A;  5E1R A;  1IQA A;  2HJI A;  3OGG A;  3G6J B;  3QH6 A;  3O1P A;  3H1W A;  4M4R A;  3MIC A;  1XNA A;  3IAQ A;  2PN5 A;  2VCC A;  2O8O A;  4NPR A;  4QDS A;  4XUR A;  5FMC A;  4ARX A;  4CCL A;  3M7A A;  2ZS6 B;  2ADD A;  4QMA A;  1ZRR A;  2VW0 A;  3AZV A;  1W6Q B;  1BHG A;  4IEQ A;  5ANQ A;  2EA7 A;  4LBQ A;  4XAE A;  5AFE A;  1O5L A;  2A6W A;  3VBR C;  4XZU G;  4GMP 0;  3S57 A;  3LGR A;  4FTE A;  2F6B A;  3OEA A;  4ZU4 A;  2J1V A;  4YVS B;  1ZRE A;  3LA2 A;  3CNA A;  1LUL A;  1J3Q A;  4OYU A;  1VMJ A;  1OF4 A;  2EXH A;  3I59 A;  1RUE 2;  1LKN A;  5DDJ 2;  4UYB A;  1S0C A;  4OZX A;  5KBF A;  4QPG C;  3K77 A;  2CU5 A;  3NAP A;  5EFU A;  3N36 A;  5JR7 B;  5T5J A;  1H8V A;  1LGN A;  1OSG A;  1SCS A;  3OEB A;  1H1I A;  1KS5 A;  4MAD A;  1NCR C;  3S7E A;  4DEV A;  4EWE A;  5JMO A;  1JZ5 A;  2XKP A;  2E6V A;  4CP0 A;  3H8R A;  4MXW A;  2ARE A;  4AGR A;  2GU9 A;  3EYP A;  4C1W A;  2GDF A;  2VOV A;  2RR1 2;  1LEC A;  3MEP A;  2WC2 A;  1UCX A;  2R32 A;  5LBC A;  1C3H A;  5FY0 A;  1S0J A;  3W20 A;  4NIA A;  2A6X A;  2C24 A;  2WSV A;  3LCP A;  4UFH A;  4CZS A;  3NWK A;  1VBC 3;  1LHV A;  3UGG A;  2VH9 A;  2WSU A;  3IPV A;  3MBW A;  2JX9 A;  1AR9 2;  3DEM A;  3N7L A;  4IDZ A;  2XPJ A;  1P8J A;  1W6O A;  2WZR 2;  4XHX A;  1AR6 2;  1JS9 A;  1BMV 1;  1I6X A;  4Q0V A;  1XRU A;  4E4D X;  1N47 A;  4BLJ A;  3NNM A;  2W1S A;  5I8Y A;  4XAC A;  3ZPY A;  2ZBJ A;  4ISQ A;  2PAM A;  2J1A A;  2XON A;  1IS5 A;  3R0R A;  2ZOE B;  4X8N A;  4YG6 A;  2PLV 3;  2DFB A;  2CGP A;  5LA9 A;  3WG1 A;  1ULO A;  2QQM A;  4FP3 A;  4FPO B;  1TE1 B;  1DQ0 A;  4LHS A;  4RHV 3;  4A45 A;  2VZS A;  3NW4 A;  3LOI A;  2BVV A;  3ZIW A;  4LXL A;  4I30 A;  5JSO A;  4Q4V 3;  2E7A A;  2YU1 A;  3FWE A;  1JU3 A;  2KM2 A;  3OSD A;  5FPB A;  1COV 2;  2JKB A;  4PT6 A;  5BV6 A;  4AYU A;  5C9A B;  1O3R A;  3TNP B;  5ACA 2;  4HSL A;  4TLF A;  1HX6 A;  2ENR A;  3RMY A;  4Q29 A;  2FZ2 A;  1U5Y A;  1QF3 A;  4Q4Y 3;  1FAT A;  4R9B A;  4X8P A;  3VD7 A;  4R9D A;  4AHX A;  3ILN A;  4RR3 C;  2YGM A;  3EJK A;  4EN7 B;  3QH7 A;  5FXZ A;  4JGZ C;  1G9C A;  4QPI A;  4F8A A;  3I3E A;  5I8S A;  5JXJ A;  5KXD A;  4COU A;  1PNF A;  3HD8 B;  5CFC B;  4WM7 C;  4WVV A;  2YC0 A;  2A3Y A;  4JCK A;  1OH3 A;  3LA7 A;  4PHZ A;  4M01 A;  2EIC A;  1SBE A;  2O1Q A;  1JYW A;  2XWJ B;  5FYZ A;  4XCA A;  5HCF A;  2PHT A;  1OQ1 A;  3GHN A;  1F31 A;  5IVV A;  4XAA A;  5DZF A;  3USU A;  1VBE 1;  5AC9 2;  3LEM A;  2ZZJ A;  2WL1 A;  4HPK B;  1LOF A;  5A7O A;  1X36 A;  4NRP A;  3ACL A;  1F4A A;  3PUR A;  4BQW A;  5BNO A;  2ZGM A;  2FD8 A;  1Q56 A;  2ZGL A;  1RUF 2;  3T2T A;  1W8N A;  1PO1 2;  3L2H A;  2IWG B;  4HVO A;  4IEP A;  4JC1 A;  1W2T A;  2RS3 2;  4JKL A;  3K75 B;  1VMH A;  4U2A A;  4NHM A;  5DAQ A;  4Z07 A;  3MHZ A;  1GKB A;  4FAG A;  2CV6 A;  4COV A;  3LQC A;  1R1A 2;  5DAW A;  1KRI A;  3U75 A;  4XYX A;  1JOD A;  3FL7 A;  1SDW A;  5T52 A;  4QPW A;  1KIT A;  3C8X A;  1RUI 1;  2H6C A;  3QOP A;  3VD9 A;  2AAC A;  3MYX A;  1GZ9 A;  2B39 A;  2W5F A;  4CEY A;  4HZF A;  5FZK A;  2YXS A;  4WVZ A;  2F4L A;  2MNG A;  2PHX A;  5H9Q A;  5A3W A;  2Y6J A;  1ULP A;  1HJF A;  3JQW A;  4EE2 A;  5CFD C;  5HPO A;  3NV2 A;  2D97 A;  4QX3 A;  2A71 A;  5K4L A;  1BQP A;  1GNH A;  1PVC 3;  1SBD A;  1JOJ A;  1ZNP A;  2Q1F A;  3FLR A;  4QXC A;  5EJ1 B;  1JHN A;  5LA1 A;  1O3Q A;  2VEC A;  3O14 A;  1ZBA 2;  1U5Z A;  2A3X A;  3SH4 A;  4Y1U A;  4V2W A;  4QHZ A;  1XYP A;  3WDY A;  1J3P A;  4YVW A;  4Q26 A;  1CAX A;  3A23 A;  5CIS A;  1TME 1;  2RMU 1;  2VG9 A;  3WNM A;  4GH4 C;  3W58 A;  3WD5 A;  4JHZ A;  5GLV A;  2XLG A;  1W2A X;  3ZR5 A;  1BVV A;  3I8T A;  4CCJ A;  3K46 A;  4FOY A;  4NO4 A;  2V72 A;  2ZEW A;  3LZZ A;  3SEE A;  1R64 A;  2WYS A;  2XLA A;  4CP9 B;  4URA A;  2GC3 A;  2VCM A;  4YG3 A;  5A32 A;  5FY4 A;  1CGP A;  1MS5 A;  5FY9 A;  1HQN A;  3LSE A;  5CAZ A;  3MIE A;  2WNV B;  3OD0 A;  3ZXG A;  4UBH A;  4ARY A;  2QQK A;  2Q8O A;  3ACH A;  3O0V A;  4B4Q A;  3AC0 A;  3WY6 A;  1UU6 A;  4LK6 A;  3ZXE A;  5FOB B;  2QZ3 A;  3NQH A;  1QOT A;  2FDI A;  1MVE A;  1SFY A;  3PMS A;  2ZML A;  5FZ7 A;  3VBH B;  2WZE A;  3PVO A;  5FZO A;  4IET A;  2XDV A;  3TN9 3;  1X8E A;  5FPA A;  2V4V A;  1VRB A;  2D6O X;  2C6S A;  2JIC A;  2E9Q A;  3OJB A;  5D1I A;  4YZ2 A;  1RHI 1;  3OCP A;  3VZJ A;  4D7Y A;  1CX1 A;  4FOW A;  1SFN A;  1US3 A;  2ZMN A;  1SLA A;  4HMZ A;  3IPV B;  3A0K A;  2QE3 A;  3FMG A;  2SLI A;  5BXX A;  3AKS A;  5L36 A;  1OPO A;  4XXA A;  1ND2 B;  5DUU A;  2VZ3 A;  3CZJ A;  1RUJ 2;  3NNF A;  4AVS A;  4GAZ A;  5GZC A;  3GBF A;  3VKN A;  5GZD A;  4BE3 A;  4Q4W 1;  4P08 A;  4PBO A;  1QJZ A;  2JDH A;  4QWN A;  2XWB B;  2VVE A;  4NWW A;  1YQC A;  1FOD 2;  4ZXE A;  2BGO A;  3HT1 A;  1IKP A;  3THT A;  1RC6 A;  2JDP A;  4IV1 A;  1MS3 A;  2BGC A;  4P14 A;  1W9W A;  1HW5 A;  2C26 A;  3MO4 A;  4GMP 1;  5FP8 A;  4HSJ A;  5B2G B;  1IS4 A;  4QGL A;  1LTE A;  1RIT A;  4HFS A;  4LKD A;  3DL3 A;  4QQ2 A;  1FMD 3;  2NZ9 A;  3AXE A;  4AFC A;  1ENR A;  1O8S A;  4LE3 A;  3LPG A;  3GM8 A;  3ZKY A;  4P5Y A;  4QPG B;  1JZ3 A;  1VB4 A;  2YBS A;  1N3P A;  2AYH A;  5LW9 A;  4PLN A;  5JZG A;  1NCR B;  3T0B A;  5J7M A;  4Y33 A;  3HPN A;  2GP5 A;  4R9A A;  4B1M A;  5F6L B;  1IGO A;  4EQV A;  5D8A C;  4RD7 A;  4K9S A;  2FBE A;  3PUQ A;  1YLL A;  4WVM A;  3VKL A;  4D7T A;  1ND3 C;  2UY9 A;  3AYC A;  3GF6 A;  4BIS A;  2GC1 A;  1V6O A;  2V5Y A;  2RMU 3;  2AH2 A;  1HRV 2;  3VD5 A;  4LLO A;  2BFU S;  1UKR A;  3GZE A;  3VHO A;  1X7N A;  1QJX 1;  3Q8E A;  1LOE A;  2W1W A;  2IFR A;  4LO7 A;  1U5X A;  4JX0 A;  3ETP A;  4FPL A;  2D93 A;  5JOX A;  1ZZ6 A;  3VBO C;  1D7P M;  2C5D A;  2KXL A;  4GD4 A;  4QPY A;  3USU B;  4CUB A;  1KD7 A;  3WQ1 A;  5IAX A;  1EPW A;  4LKE A;  1XSR A;  4XUQ A;  4NPL A;  3AP4 A;  3AL5 A;  4FXG B;  1LES A;  1GLH A;  2HWF 1;  2RE9 A;  3KQR A;  1QJY 3;  5C33 A;  5IVF A;  2HWE 1;  5JOW A;  5F9T A;  3U4X A;  2V73 A;  3WQB A;  3ME2 A;  4YRD A;  1MVQ A;  2JXA A;  5IAT A;  4QX2 A;  2B46 X;  2ZHL A;  1JTZ X;  4KI5 M;  4QKD A;  1JZ7 A;  2WNU B;  3ZMN A;  3E6B A;  4UFM A;  4L9B A;  4X6R B;  1WW5 A;  3WEZ A;  1AL0 G;  4GA9 A;  1WD4 A;  1W39 A;  3CLP A;  1V70 A;  4RSU A;  5CU1 A;  2HWB 3;  2DUR A;  5FYM A;  2EIG A;  2ZX2 A;  3GDB A;  5FY1 A;  2JG9 A;  2BW8 A;  1KFX L;  2CDO A;  1KJL A;  3TEY A;  2WRA A;  5CG9 A;  4GWN A;  4RR3 B;  5EZW A;  1UYX A;  5FXW A;  4CDQ C;  1BMV 2;  4JGZ B;  4N90 A;  4YAR A;  3TWI A;  3EQE A;  1J58 A;  1QNW A;  1UF2 C;  3AZX A;  4EN9 B;  4OHV A;  4WM7 B;  3CJX A;  4NE9 A;  2G4I A;  4EWA A;  1X82 A;  3VL8 A;  5DZE A;  1ASJ 1;  1UN1 A;  4GMP 3;  1LNS A;  1JUH A;  1W8Z A;  1PZ8 A;  4NOT A;  1HIX A;  3OY8 A;  4UT5 A;  2CYF A;  3E5Q A;  4MGI E;  4FPG A;  3S30 A;  3SQO A;  3OUH A;  2DCT A;  2GAU A;  2LM3 A;  2VTF A;  3I2J A;  5GZE A;  3ZFG B;  4XDP A;  5LK7 B;  2JDA A;  2W2I A;  4LO4 B;  3R6S A;  5BYN A;  1EV1 2;  3KF3 A;  4YVW B;  5GLZ A;  1GZC A;  1CR7 A;  3CBN A;  1B35 A;  2NQY A;  3IWZ A;  1IPJ A;  3OGV A;  4OI4 A;  5C3P A;  1RL3 A;  4TTG A;  1HV0 A;  2YDE A;  3D4K A;  4MOA A;  3MPP G;  4CDX B;  2VW1 A;  3C3V A;  1JYN A;  3APB A;  2WQ4 A;  2Y6F A;  4H55 A;  4LKS A;  5L7O A;  5L19 A;  1DBN A;  1NZC A;  3DPR B;  4UOJ A;  3RFR A;  4V2V A;  3CJI C;  5HBA A;  1UX7 A;  1VBA 3;  1DLL A;  5IJR A;  3VKF C;  4GZ9 A;  1HXS 3;  1W0P A;  3KGZ A;  3B01 A;  1JOB A;  2PHL A;  3RWN A;  3DEC A;  2R0F A;  4AVC A;  5F5I A;  4QB6 A;  5BPX A;  3I2K A;  2ZAH A;  3H50 A;  2P3K A;  1GP5 A;  5L73 A;  4AQS A;  1WCU A;  1AL2 2;  1QH7 A;  1BVP 1;  3MV1 1;  1K5M A;  5BNP C;  1VBE 2;  1WLC A;  2HWF 3;  4IE4 A;  1NE4 A;  1PVX A;  2GMP A;  2NMN A;  2RS5 3;  2VAU A;  1KFU L;  4FBF A;  4GWJ A;  1SG3 A;  5HV4 A;  4LO5 B;  1IKQ A;  3BIE A;  4NUB A;  3GXU A;  1LHU A;  1DG6 A;  4W8J A;  4CUC A;  5CFD B;  4CDU A;  1CJP A;  1QXR A;  1QJF A;  3ILF A;  3K4A A;  1DCS A;  1DZR A;  2VVD A;  5ANN A;  5FWE A;  5A3T A;  2JD9 A;  3U78 A;  2BYV E;  2Q4S A;  5A80 A;  5LCW L;  2B45 X;  1UWW A;  4AI3 A;  1YEW A;  2FCU A;  3VBF A;  3V0A B;  2A6Z A;  3D0S A;  1ZVF A;  4KG8 A;  5C6C A;  4JRL A;  4P9W A;  5FO7 B;  1RUE 1;  4LIU A;  4Y20 A;  2P2K A;  2Z5W A;  1JZ2 A;  3ZFE A;  2VGD A;  2VO5 A;  3PIG A;  4N43 C;  3VHN A;  1GR3 A;  4GH4 B;  2ZX0 A;  3AJY A;  2PAE A;  2ZKN A;  1RUI 2;  2WNE A;  4UW4 A;  3JB4 C;  3WQ7 A;  5J37 A;  2PHR A;  1XXN A;  3ASI A;  1W99 A;  2WQZ C;  1POV 3;  4RQP A;  4IL7 A;  3HWJ A;  1OH4 A;  1WCD J;  2BEO A;  5JZG B;  4K8R B;  5FXV A;  1VP6 A;  4J1X A;  4X6Q B;  4M3C B;  5FOJ B;  3OGR A;  2ZGT A;  3J26 N;  1OHF A;  5K0U A;  2HWC 3;  4YM1 A;  1O5U A;  3NNL A;  3W59 A;  2VVF A;  4XF1 A;  5L9B A;  2XJR A;  3W9A A;  3DYO A;  3AKT A;  3BN6 A;  1RIN A;  3PNA A;  4FPH A;  4IXL A;  5A3O A;  1AR9 1;  4ISR A;  3VBS C;  1GAN A;  2WZR 1;  4Q0U A;  3OPT A;  1J1L A;  3U37 A;  3TBD A;  4BOW A;  1YO8 A;  2XGX A;  1SCR A;  2DVD A;  2VUL A;  1TME 2;  2WWS A;  5DUW A;  4E4H A;  5FR3 A;  2C9K A;  4RGG A;  1XBF A;  4TN7 A;  5FYV A;  3HN3 A;  5CKM A;  1F2N A;  5D2A A;  1PIV 3;  3TRS B;  5A6X A;  1RUG 3;  1V9U 3;  2ZA9 A;  3HOB A;  1A3K A;  2JDM A;  4NMI A;  1NA1 B;  1I3H A;  1KGY A;  4CCO A;  3S5A A;  1VBD 1;  2DV9 A;  3MIG A;  5A33 A;  3T3Y A;  5JXI A;  3ZFF C;  2FDK A;  4XBN A;  1UYY A;  1BEV 3;  3RZL A;  4FFG A;  3LDK A;  5DPN A;  2XKO A;  1O3S A;  1COV 1;  1DDL A;  1QWR A;  5IW0 A;  4IV3 A;  5ACA 1;  1G7Y A;  3WG2 A;  1LEM A;  4MHU A;  4ZY9 A;  1GMM A;  1HQL A;  1OUR A;  1AR7 1;  3AP7 A;  3CMG A;  2FMD A;  3POG A;  1G9F A;  5KXE A;  1D0G A;  2HYK A;  1WUV A;  1OD5 A;  1QQP 2;  2VTX J;  1W2O A;  2YC2 A;  3WV6 A;  2WDB A;  2HYX A;  2QNK A;  2YC4 A;  2Y6L A;  3I54 A;  3Q8B A;  2X05 A;  1QOS A;  4NRO A;  1XE8 A;  2OZJ A;  1UOG A;  4RS5 A;  1AF9 A;  3T2Q A;  1W6Q A;  4JTO A;  2HKX A;  5D8A B;  2K9Z A;  1C5I A;  1BCX A;  1RUE 3;  3NV1 A;  5DDJ 3;  1GZT A;  4XMA A;  1HKD A;  4NJ4 A;  4A6O A;  5JR2 A;  1R09 2;  1ND3 B;  2E26 A;  3E6D A;  2ES3 A;  4YVS A;  3ZLI A;  4CCD A;  1RB8 G;  4Q4W 2;  2YBK A;  3CL1 A;  5AC9 1;  2WFP A;  1W6P A;  4XVH A;  1AXK A;  2VME A;  2EXJ A;  4MHR A;  3ZXF A;  4CCC A;  4YFZ A;  3FZ3 A;  2XML A;  1WBF A;  3BOP A;  4ITC A;  5C3O A;  1Z7S 2;  4IGQ A;  4YNI A;  2RR1 3;  4GB3 1;  4JGY A;  3SIT A;  3ZM8 A;  5JPN B;  2RS1 2;  1OOP C;  4LA3 A;  1UY1 A;  4XPV A;  3SHR A;  4LBL A;  1PO1 1;  4XF0 A;  4AL9 A;  1DYK A;  3P5B A;  4PQQ A;  5T5L A;  3RRD A;  4CDW C;  1XNK A;  2NM1 A;  3AMN A;  4IE7 A;  2K2S A;  1H0B A;  5LAS A;  1MS4 A;  3KT4 A;  2JEN A;  5FZ8 A;  1R1A 1;  2WZR 3;  2AEY A;  4KWL A;  1AR6 3;  1JMU B;  4XQW A;  4C91 A;  2QQU A;  3J7L A;  2A73 B;  2JB8 A;  3J7N A;  1I9R A;  3ZYI B;  3WF3 A;  2WBK A;  1AXY A;  4QB2 A;  1YC6 1;  3AYA A;  2GC0 A;  2QQL A;  3VZK A;  3MPB A;  1RVF 2;  4BCU A;  2X10 A;  3B7M A;  4DUV A;  2BNM A;  3BPS A;  4KWK A;  5DAV A;  1QJX 2;  1QU0 A;  1MEC 1;  2XXZ A;  5FP3 A;  3FC0 A;  5FRA A;  4I0B A;  1UYZ A;  2GP3 A;  3W5M A;  2UYB A;  4IEU A;  1ZZ9 A;  4L2N A;  1KXG A;  3G7D A;  2BU9 A;  3BCW A;  3S5Q A;  3VL9 A;  2ZX3 A;  3M1H A;  1W8O A;  1MS1 A;  3WW4 A;  3DKW A;  2VBP A;  2XUM A;  1H9P A;  3PDQ A;  5LEJ A;  3O1T A;  2NP0 A;  2HWE 2;  2BOI A;  3RVH A;  5IVB A;  2O8Q A;  4FOV A;  2DFC A;  5GM0 A;  5CBL A;  1RYY A;  2X5I A;  4DIQ A;  2Y6K A;  3FFQ A;  4XIK A;  3TAY A;  1MZF A;  3KV6 A;  3KQ4 B;  1M4W A;  2A3W A;  5F2S A;  2SBA A;  3FHA A;  3I4I A;  4Y20 B;  5TSW A;  5ABJ B;  4Y1Z A;  3LA3 A;  4NHX A;  1OLM A;  2VBD A;  4PDW C;  1NLQ A;  5FY8 A;  3IDE A;  4FTS A;  1O4Z A;  2QFE A;  5A3U A;  3CF6 E;  1VBB 1;  3OUJ A;  5GJ6 A;  1UY3 A;  5CFC A;  3U07 A;  2WWU A;  5F7U A;  2RDS A;  4XJA A;  2P37 A;  5AC9 3;  1E57 A;  1H4H A;  2X8K A;  3UL2 A;  5JSP A;  2D43 A;  5I93 A;  3NKT A;  2JDK A;  4CCE A;  5FZ1 A;  1PK6 C;  3ACI A;  1LHO A;  2ZEZ A;  1ENX A;  1ASJ 2;  4HPK A;  1RUF 3;  4MGZ E;  4AXO A;  4BQ3 A;  3PVB B;  2PYT A;  1PO1 3;  3CEW A;  1TG7 A;  1ENQ A;  1PGW 2;  1ZZ7 A;  2RS3 3;  2P3Y A;  5H9P A;  4AW7 A;  4E8D A;  3H1M A;  4WZF A;  4XJW A;  5BNP B;  1D2Q A;  3BTA A;  1REE A;  4CUG A;  4K21 A;  1R1A 3;  1YUD A;  4LBJ A;  4TLG A;  2Y33 A;  5E6H A;  4CU9 A;  3FFZ A;  3JBG 3;  4QD2 A;  5A1L A;  3WHU A;  1NYW A;  3AMM A;  4BQ2 A;  4N7I A;  3RJR A;  5I91 A;  1JZ6 A;  4BM8 A;  2ZGN A;  3M3Q A;  2GH2 A;  5FK7 A;  1OLQ A;  1W90 A;  2TEP A;  1KS4 A;  2YV8 A;  1GBG A;  5IFP A;  4KBB A;  3ENR A;  4Z8B A;  1UPI A;  1FXZ A;  2UY8 A;  4CU6 A;  2VOX A;  5H9S A;  5CG8 A;  4UF0 B;  4WM8 C;  2PHW A;  3IDB B;  2YY1 A;  4N43 B;  4KH9 A;  5FZE A;  3TYJ A;  1BJQ A;  1GWL A;  5IVE A;  3SXW A;  2P4E A;  4S2F A;  4XFF A;  2ZGO A;  5LY2 A;  3S7I A;  1S0G A;  3AMP A;  3KS7 A;  4BQ1 A;  1KDM A;  4Y1X A;  3USS A;  1LGC A;  1ZBA 3;  4MET A;  1S4C A;  5LA2 A;  4XFB A;  5E89 A;  2B7Y A;  2ZGQ A;  3I2H A;  2QQP A;  3HN1 A;  5B4N A;  5FP7 A;  1ZX5 A;  4AI9 A;  4NAO A;  3O1V A;  3E97 A;  3VB9 A;  3THD A;  5T5O A;  1B09 A;  2TBV A;  5C7G A;  2P3I A;  3KVB A;  4RS5 B;  1HRV 1;  4EN0 A;  4CPB D;  1VB2 A;  1ZBE 1;  3LWC A;  3C7H A;  3ZYF A;  4FPF A;  2DTW A;  2IXI A;  2WII B;  2A6V A;  3VBS B;  1H1A A;  1Q8V A;  4QKN A;  2BFU L;  1H6X A;  2L9L A;  2R30 A;  3C2U A;  3H7Y A;  1W6P B;  2ZXQ A;  1JW6 A;  5LBB A;  4P9Y A;  1SPP B;  5SV5 A;  4AE2 A;  1V6J A;  4AFM A;  4CP9 A;  4LHK A;  1F8V A;  4K8F A;  4PJY A;  3ZVX A;  1TVG A;  3GZT B;  2OT7 A;  1UL9 A;  4YW1 A;  1FNY A;  1TMF 3;  1VAL A;  2DVA A;  2W3J A;  3GGL A;  2XVG A;  1HRI 2;  4UBG A;  1H2K A;  1OKQ A;  1YI7 A;  1FT9 A;  2DVF A;  4JGY B;  4XFG A;  2QZ2 A;  2WNV A;  5DG1 A;  1UD1 A;  1MAC A;  2GNB A;  2ORX A;  3KWV A;  1ULC A;  2MEV 2;  2OA2 A;  3QBQ A;  4XJZ A;  3D0J A;  1ZZB A;  2ZX1 A;  1PHM A;  4LLF A;  3U4S A;  5FPX A;  3ZFF B;  2WQ8 A;  4XDO A;  4LBN A;  1C8M 1;  2J1E A;  2EF6 A;  1OVP A;  4LE4 A;  4DO0 A;  5JIU A;  5JDB A;  3ZX7 A;  3J9S A;  3VBH A;  3RI8 A;  1LOD A;  3FHQ A;  3N4M A;  2ZKL A;  3HVD A;  1Z78 A;  5C3S A;  4FFI A;  3PUS A;  2Y26 A;  2DUO A;  2RHP A;  4M0H A;  1RUJ 3;  1YJK A;  1VLN A;  2VMC A;  4ZXK A;  4AHW A;  4CP2 A;  5C4W B;  3MW4 A;  4XFA A;  3J8F 3;  2D40 A;  1W03 A;  1T2X A;  1CAV B;  1NCQ C;  1ND2 A;  1FOD 3;  3J4U H;  3PHM A;  4Q8L A;  1Y9M A;  5A70 A;  2JE7 A;  5GZG A;  4KGG A;  3GYD A;  2KR2 A;  3VDD B;  1D4V B;  4ZON A;  5IVC A;  2RDN A;  2FQP A;  2VE1 A;  2H6B A;  3VBR A;  1CN1 A;  5GKA C;  3ZKU A;  4EWD A;  2WO2 A;  4XJU A;  4FPE A;  2R0H A;  1PMH X;  1F4H A;  2EAL A;  4JVA A;  4W6Y A;  3VV1 A;  1VBD 2;  4N53 C;  4Y4R A;  4DIN B;  4CCK A;  3PJY A;  3Q8A A;  1V6I A;  2A75 A;  3GNE A;  2PQS A;  3KHC A;  2Q8C A;  4IUG A;  5CB7 A;  1D0H A;  1EV1 1;  4GJY A;  4PIX A;  1Q8P A;  1UU4 A;  4QPG A;  1UY0 A;  2B9U A;  2DYC A;  5FPU A;  1N3O A;  4Y26 A;  3KVA A;  2X5I B;  4BH9 A;  1NCR A;  1AR7 2;  2NPI A;  4NAM A;  4W6X A;  1WW7 A;  4D69 A;  3LAG A;  2ZGU A;  3SIS A;  3UYJ A;  3ZXJ A;  3HQX A;  4MGQ A;  1XYO A;  3DUI A;  4C90 A;  2Q30 A;  4H14 A;  4R4X A;  5F5Q A;  4CDW B;  1ZRC A;  3LKJ A;  1DF0 A;  4I0W B;  3P3N A;  1CQ9 A;  3DXU A;  1ZM1 A;  3ZDS A;  3AB0 A;  4AEJ A;  5GLW A;  4LTA A;  2OPK A;  2VL4 A;  2ZCW A;  4A41 A;  4F7Z A;  3GJA A;  4YW5 A;  1AL2 1;  5JOZ A;  3ZYG A;  4BMB A;  3AJZ A;  2AC1 A;  5FCC A;  3OOX A;  5E88 A;  4Q5O A;  2WZP P;  1NG0 A;  2WYF A;  1PX4 A;  3A7Q A;  5HXM A;  3NJY A;  4Z92 B;  1MQT C;  4HN1 A;  2VM9 A;  4GB3 2;  2VMH A;  1VE0 A;  3VLB B;  1F15 A;  1O59 A;  1SMV A;  2I45 A;  1VRH 1;  2QDN A;  4EN8 B;  2DVG A;  1C1F A;  2Y60 A;  2WNU A;  1GOH A;  1QY4 A;  4JKM A;  1ZRF A;  2VY0 A;  2UUR A;  4AK3 A;  2ZGK A;  1NZI A;  3E6C C;  4QKB A;  4P5H A;  1BXH A;  1HQW A;  4AFD A;  3HBK A;  2ADE A;  1SLI A;  2J42 A;  1C8N A;  3A22 A;  4C0B A;  2WS9 2;  4CSW A;  5FPV A;  3WNX A;  3O7O A;  4RR3 A;  4A6S A;  4D6R A;  3UJQ A;  4XF9 A;  3MV0 1;  1Q5O A;  1S0I A;  4JGZ A;  4MGS A;  4AHZ A;  1QGL A;  1PGL 1;  3BVC A;  2R6Q A;  1AVB A;  2PAK A;  3ZOI A;  4PDW B;  4BZ4 A;  3M4F A;  1MEC 2;  4MLO A;  4A2U A;  4WM7 A;  2DF7 A;  2VPV A;  2R1B A;  1JU4 A;  2AGS A;  2XVK A;  3CKH A;  2HBU A;  1C57 A;  1CPN A;  2ZTN A;  1YQ5 A;  3AVS A;  3FBY A;  1XC6 A;  3LEI A;  4B29 A;  2EID A;  2PA7 A;  2XJV A;  4LUL A;  2W95 A;  1CZV A;  1Q8O A;  1YIP A;  2VMG A;  4WVW A;  3ZFG A;  1I1E A;  3B9I A;  2JG8 C;  2Y0O A;  3HJR A;  4HK8 A;  5CYY A;  4MGK E;  2DTY A;  3AKP A;  1DQ1 A;  3C7F A;  4BQ5 A;  5FZC A;  4FCA A;  2W52 A;  1QJU 1;  1V00 A;  3E5X A;  3N9P A;  5EJ3 A;  4DRV A;  5LZ6 A;  2YFZ A;  4AI0 A;  4YM2 A;  3TEZ A;  4EZ4 A;  1IQD C;  2FCT A;  1ENS A;  3RNS A;  4CDX A;  3IB3 A;  4LBK A;  5CKN A;  3TNQ A;  1CAW B;  1ZRI A;  1CVN A;  3DPR A;  3LDB A;  1AYN 1;  4RN5 A;  4DXZ A;  3UNP A;  1K42 A;  4GWI A;  1AYM 1;  4P9J A;  4AFA A;  1VBB 2;  4XTM A;  3RGB A;  4P9G A;  1SAC A;  4YWA A;  1AL2 3;  5GLT A;  3GZA A;  2VZT A;  5FO9 B;  1T6G C;  1WA4 A;  1VBE 3;  1AZD A;  4BHP A;  1W9S A;  1BK0 A;  3LEG A;  1XPW A;  4Q27 A;  5T55 A;  2ATF A;  4LUM A;  4UI9 L;  2R1D A;  1O7F A;  3KB5 A;  4IE6 A;  2D6L X;  2BNN A;  3OBA A;  4OUE A;  3U0Z A;  3CO2 A;  1QQP 1;  2XBO 1;  5IVJ A;  1NUK A;  3WUD A;  4NII A;  4UFJ A;  1MZ6 A;  3JD7 1;  2CY6 A;  4Q1R A;  4AI8 A;  3B3Q E;  5CFD A;  4YPJ A; 
#chains in the Genus database with same CATH homology
 3PU8 A;  4IGP A;  5A7W B;  3DXU A;  4Y33 A;  3K3N A;  2GP5 A;  3K3O A;  2XML A;  4QXH A;  5LWB A;  4QU1 A;  4UF0 B;  5FZB A;  5IWF A;  4IGQ A;  3PUQ A;  4Y3O A;  4NUB A;  5FYS A;  3AVR A;  5FYU A;  5A1F A;  5FZE A;  2PXJ A;  5A3N A;  5F3C A;  5IVE A;  4BIS A;  4HON A;  5LY2 A;  5FP4 A;  5FWE A;  5A3T A;  5F3E A;  3U78 A;  5A80 A;  5FY5 A;  5FZ8 A;  3N9L A;  4QX8 A;  5FP7 A;  4BU2 A;  4C8D A;  4AI9 A;  3NJY A;  2YU2 A;  3N9N A;  4LIU A;  5FZK A;  4EYU A;  4GD4 A;  5FP9 A;  4HOO A;  5A3W A;  5LY1 A;  3KVB A;  5FY7 A;  5K4L A;  4EZH A;  4IGO A;  3AL5 A;  4QXC A;  3LD8 A;  5FY0 A;  5IVF A;  5F3I A;  2XXZ A;  5FP3 A;  5LW9 A;  5A3P A;  2GP3 A;  2OS2 A;  2VD7 A;  4V2W A;  4QXB A;  3PUA A;  5F5A A;  4LIT A;  5FXV A;  4CCN A;  5FPV A;  4CSW A;  5FYC A;  3PTR B;  4D6R A;  3K2O A;  5CEH A;  2OT7 A;  3ZPO A;  3KV9 A;  5FWJ A;  5A7N A;  3PDQ A;  2XUE A;  4CCJ A;  5FYM A;  5F39 A;  5FY1 A;  5F32 A;  3RVH A;  3U4S A;  5IVB A;  5FPL A;  4URA A;  3OPT A;  4XDO A;  5FJH A;  5FUP A;  5FYY A;  3AVS A;  3N9M A;  5FJK A;  5FY4 A;  5FXW A;  4DIQ A;  4DO0 A;  4LXL A;  3KV6 A;  2YBP A;  4QX7 A;  5F5C A;  2P5B A;  5FY9 A;  5FZ4 A;  4ASK A;  5F2S A;  4E4H A;  5IVY A;  4TN7 A;  5FYV A;  2YU1 A;  4AAP A;  3KV5 A;  5F3G A;  3PUS A;  5FPB A;  5FZ0 A;  2YPD A;  5FUN A;  5FY8 A;  3N9O A;  2Q8D A;  4CCO A;  5A7W A;  3OPW A;  4BXF A;  5FZ7 A;  2WWU A;  5FZC A;  3N9P A;  5FZO A;  4GJZ A;  5FZL A;  2XDV A;  5FYI A;  2Q8E A;  5ISL A;  5FPA A;  1VRB A;  4D6Q A;  5FXZ A;  5FZ3 A;  3KV4 A;  4EZ4 A;  4XDP A;  5IW0 A;  5KR7 A;  2W2I A;  5A7S A;  5F37 A;  5IVC A;  5FZ1 A;  3LDB A;  5F2W A;  5FXX A;  5A7Q A;  5FV3 A;  5FZ9 A;  4D6S A;  5FZO B;  5FYT A;  3N9Q A;  4Y4R A;  4GAZ A;  5FYZ A;  3AL6 A;  3PU3 A;  5FZM A;  4CCK A;  2OQ7 A;  5FBJ A;  5FYB A;  5FZD A;  5FZF A;  5FZA A;  2Q8C A;  2OX0 A;  5FZI A;  5IVV A;  4QWN A;  5A7P A;  4GJY A;  4V2V A;  3DXT A;  4CUG A;  5FPU A;  5A7O A;  5FZH A;  5FZG A;  3KVA A;  5E6H A;  3PUR A;  5A1L A;  5IVJ A;  5FP8 A;  5F5I A;  3UYJ A;  4UF0 A;  3ZLI A;  5FZ6 A;  4CCL A;  2WWJ A;  2OQ6 A;  2YBK A;  4LIV A;  4CCM A;  2YBS A;  5FYH A;  5ANQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...