2IZWA

Crystal structure of ryegrass mottle virus
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
178
structure length
178
Chain Sequence
QYGDITPAKNSGSLVRVTSSATAGTEVSGTVLFNVRNATELPWLSGQGSRYSKYRVRYAHFTWEPIVGSNTNGEVAMAMLYDVADVTSITIERLMQTRGGTWGPIWSPTRKRLSYDPEHASLPWYLSGVSSGAAAGNIQTPFQIAWAAQSSLVSTTLGRIMAEYLVELTDPVDVTINQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RYEGRASS MOTTLE VIRUS COAT PROTEIN
publication title The Three-Dimensional Structure of Ryegrass Mottle Virus at 2.9 A Resolution.
pubmed doi rcsb
molecule tags Virus
total genus 44
structure length 178
sequence length 178
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2izwA00
5C9AA 5C4WA 1VBB3 3JD71 1VAKA 3ZFEC 4IV3A 1AYN3 4GMP1 3DPRB 4CEYC 1RUC2 1EAH2 4NWVA 1NY71 5L7OA 1RUG3 1VBA1 2HWF2 1VB4A 5BNNC 4RHV3 3ZFFB 2RR12 1PGW2 5K0UB 2X5IC 3JBG2 1FOD3 2RS52 5BNPA 4JGZA 3VBOC 5ABJC 3VBUC 2RM23 3JD72 1E57A 1BMV1 1C8NA 4IV1C 4CDQB 2R061 5C9AC 5BNOA 1NY72 1VBA2 4RS5B 1MEC1 5J98B 1NCRB 4Q4Y3 1TMF1 2ZZQA 1ASJ2 4CDUA 3VBSA 1POV1 1RB8G 3CJIC 1HRI1 1ND3A 1BMV2 1MQTC 5CFDA 1AL23 5JZGB 2R062 4CEYB 1R081 1PIV1 3TN93 1VBB1 1VRH1 2GSYA 1MEC2 5BNNB 1TMF2 3NAPC 1PO13 3VBOB 5AC93 1HRI2 1RUG1 1H8TC 3DPRA 5ABJB 1QQP3 1NCQA 4WM7C 1FOD1 1PIV2 3ZFFA 1AR93 2DF7A 1VRH2 3J8F3 5K0UA 3JB4C 1WCDJ 2RS31 3VBRC 1HRV3 1VBC1 1NG0A 1RUG2 3CJIB 4CDQA 2HWD3 4RR3A 1K5MC 4GB33 5ACA1 4Q4Y1 1MQTB 2GH8A 2RMU2 4RS5A 1D4M1 1RVF3 1NCQC 1PO21 1NCRA 1BEV3 1RUD2 1AR83 1AL21 2RS32 1PVC1 4RFT0 5DDJ3 1FPN1 1VBC2 3NAPB 2WFF2 2HWC3 5K0UC 5JZGA 1H8TB 4CEYA 2XBO2 5ACA2 2FZ2A 4Q4Y2 4WM7B 1IHMA 1RUI3 4CDXC 1D4M2 1AR63 2FZ1A 5AC91 5BNNA 1PO22 4RR3C 2IZWA 4CDWB 1RUE1 1B35C 4RS5C 1AL22 3VBOA 1PVC2 4AEDC 5ABJA 1FPN2 3VBRB 1NCRC 2BUKA 1AR91 3VDDC 3J8F1 1QJX1 2HWB3 2WS93 1K5MB 2R041 3HAGA 4FTBA 5JZGC 2WZR3 4N53C 1VBD1 1NCQB 4Y4YA 2PLV3 1SMVA 1RUE2 2HWD1 3VBFB 1RUJ3 4Q4W3 3CJIA 1F2NA 1AR92 1MQTA 1R093 1QJX2 1AL0G 2R042 1R1A3 4LLFA 4CDXB 1X33A 5DDJ1 1V9U3 1VBD2 4RR3B 2HWD2 1CD3G 2VQ0A 1POV0 3NAPA 1B35B 3M8LA 1Z7S1 1H8TA 1ZBE3 4AEDB 1AR61 1ZBA3 4WM7A 1RHI3 3VDDB 1AYM3 5A32B 1NA1C 4CDWA 4JGYB 2RS13 4Q4V3 2XPJA 3IDEA 4N53B 3FBMA 2WS91 3VBRA 5FMOL 1QJU3 1Z7S2 1RUF3 1AR62 2HWE3 3JB8A 1AYN1 1HXS3 1K5MA 1VBE3 4Q4W1 1EV13 4RHV1 2QQPA 3VBFA 1A6CA 1R082 1TME3 4CDWC 1VBB2 1R1A1 2RM21 4QPGC 4CEWA 4FSJA 2BFUL 1V9U1 1AYN2 1RUH3 4BCUA 4N43C 4CDXA 4Q4W2 1QJZA 1F8VA 1RUC3 3VBHC 1EAH3 1NA1B 4PDWC 1BBT3 1ZBE1 1HX6A 4RHV2 1RMU3 1B35A 1FOD2 4AEDA 2RR13 1R1A2 5CFCA 2RM22 2RS53 4YVWC 3VBFC 3VDDA 2RS11 4RQPC 5A32A 3TN91 4JGYA 1ND2C 4CEWC 4N53A 1ZBE2 5J96B 2HWE1 1VBA3 1HXS1 1PO11 1OOPC 1ASJ3 1QQP1 1EV11 1QJY3 2RS12 4QPGB 4N43B 1TME1 3TN92 5CFCC 4QPIB 4GMP0 2R063 1W39A 4SBVA 3VBHB 2BBVA 4PDWB 1HQNA 2HWE2 3ZFGB 1HXS2 1RUH1 4JGYC 1MEC3 1HRV1 1PO12 5AC92 1QQP2 1BBT1 4YVWB 4GB31 1POV3 1HRI3 4RQPB 1RMU1 1NA1A 4WM8B 1RVF1 4NWWA 1ND2B 3J8F2 4CEWB 1BEV1 1PIV3 1AUYA 1AR81 5FMOS 1RUH2 1VRH3 1HRV2 4FTEA 2HWC1 1OOPB 1BBT2 4GB32 5C8CC 4Q4X3 2Y26A 1RMU2 1RUI1 5GKAC 4Z92B 4YVSC 1RVF2 5CFCB 1ASJ1 2TBVA 1BEV2 2MEV3 2RMU3 1QJY1 5A33B 1AR73 1C8M3 2BPA2 1AR82 5D8AC 2WWSA 1RUD3 2BFUS 1COV3 5DDJ2 2HWC2 4QPGA 2RS33 3S6PA 5C4WC 2HWB1 1VBC3 4N43A 2WFF3 2R073 4GH4B 4QPIA 1RUI2 4IV3C 3VBHA 2WZR1 2XBO3 5ACA3 4PDWA 1DDLA 3ZFGA 2PLV1 1QJY2 5L7OC 1D4M3 1RUJ1 1PO23 4YVWA 5BNPC 3ZFEB 1PVC3 4JGZC 4RQPA 1R091 2HWB2 1FPN3 5FOJB 2WS92 4WM8A 1FMD3 5C8CB 1ND2A 2WZR2 4YVSB 3ZXAC 2PLV2 2X5IB 5BNOC 4QPIC 1RUJ2 2ZTNA 1GFF2 4Q4X1 5D8AB 1OOPA 1RUE3 3VBUB 5LK7B 3ZFGC 4CDUC 4EJRA 3VBSC 2HWF3 1ZBA1 1NOVA 4IV1B 1R092 1RHI1 2MEV1 2RMU1 5C4WB 5C9AB 1ND3C 1AR71 1C8M1 1AYM1 1OPOA 3JBG3 1CJDA 1QJX3 5CFDC 1RUD1 4IV3B 1COV1 1V9U2 4Q4V1 5A33A 2R043 3LOBA 3JD73 4WM8C 5L7OB 4GMP3 2WFF1 2R071 1VBD3 4Q4X2 1QJU1 1RUF1 4FTSA 2XBO1 1ZBA2 5BNPB 1RHI2 2MEV2 4GH4A 4JGZB 1AR72 1C8M2 1AYM2 2ZAHA 3DPRC 1VBE1 1PGL1 1COV2 4Q4V2 1X36A 3ZFFC 5BNOB 1FMD1 2R072 3ZFEA 1QJU2 1RUF2 4CDUB 4Y5Z0 3VBSB 1Z7S3 5C8CA 1ND3B 1VBE2 4CDQC 1TMF3 1RUC1 4YVSA 1EAH1 1M06G 1EV12 2WLPA 1PGL2 2X5IA 5CFDB 4GH4C 2HWF1 5D8AA 1VB2A 1TME2 3VBUA 2RR11 1FMD2 1PGW1 1R083 3JBG1 2RS51 1OHFA 4IV1A
chains in the Genus database with same CATH superfamily
1QOTA 3VL8A 1W6MB 4QM8A 3WNKA 4CU9A 5IHRA 1NLRA 2WR9A 4QQLA 3ZIWA 4MGSA 5G05L 2BERA 4OI1A 2P3KA 1JHNA 4COZA 2ZHKA 1AYN3 2J1SA 3DPRB 3WW1A 1RYYA 4CEYC 1RUC2 3D0JA 4OYUA 4YNIA 2DCKA 4XBLA 1WMFA 2ZGUA 3HBKA 3IAPA 2ARCA 5LY2A 5B2GB 1VBA1 2D93A 2HEYF 2HWF2 5DAWA 2VNRA 3RI8A 3KT4A 5SV5A 2JE8A 1VB4A 2WUHA 4N7UA 4XJ9A 1JZ2A 1EUTA 4P9YA 4XDPA 4L0PA 3JBG2 4YZ3A 2RS52 5BNPA 3VBOC 5BXXA 5HCHA 2DVBA 4ES8A 2P3JA 5KHGA 2JIJA 4A7ZA 1E57A 2DCJA 3S5QA 1BHGA 3AMNA 3ZSMA 3GJBA 2LRPA 3MV11 3E6CC 5FMDA 4A4AA 5A3NA 4CDQB 2W08A 3IIIA 4GKYA 2RDSA 1BK1A 3WY6A 3VDBA 3ETPA 5EP9A 2R1DA 2V09A 3BB6A 4LKSA 4RS5B 2PTMA 1AF9A 4OULA 3WG4A 4C8DA 2DFCA 2PHTA 2UWAA 5C6CA 3R4DB 2K46A 4ISQA 1TMF1 2CY6A 2ZZQA 3IPVB 3KB5A 4M3CB 4XOGA 4WVMB 2IXCA 1VLNA 1OH3A 3NVCA 2BRTA 5C70A 1ND3A 1L3JA 1C5HA 3OGVA 4YW3A 3PHMA 3PJQA 5JIAA 3RZMA 1BMV2 4XHBA 1FV3A 4FPCA 2VW2A 5CFDA 4XQDA 4CEYB 1R081 3E1F1 5CEHA 4IW3A 4A6OA 5FPUA 2AENA 3MUY1 5IAXA 1VRH1 1GP6A 2D6NA 2VMFA 3H3LA 4HSJA 1NZCA 3ME2A 1KQRA 1A78A 1W6MA 1W8WA 1WLWA 2B9VA 1MZ5A 1XYNA 5A6XA 1H2NA 2A6ZA 1UU6A 4KL1A 4BPZA 2JDPA 3VBOB 4YZ5A 5AC93 5EWSA 4QB2A 1AZDA 1SEFA 1QQP3 3AZXA 3DPRA 1HB1A 2BBAA 5FZ7A 3A7QA 4CP1A 1IPSA 5CKNA 4F7ZA 1LB2A 1AHSA 1AX1A 3GBGA 2JD9A 2J1VA 3CO2A 5F5CA 3UNPA 3SNMA 5CB7A 2DTWA 3RI9A 2F4LA 1ZM1A 4Y5SA 3HMYA 2JWPA 4N90A 1C4RA 1LHUA 2VBPA 4UW5A 3T2QA 1CONA 1WLCA 2ZACA 3M2MA 4F8AA 1PNFA 4AEMA 2Z69A 4B1MA 4URAA 3LSEA 1J84A 1YO8A 4CDQA 4C1WA 2B8MA 4RR3A 1US2A 1K5MC 2DUPA 1IQAA 4Q4Y1 1GZWB 4D6SA 3GDBA 5IVCA 1UKGA 3B02A 4JTOA 4RS5A 3NNLA 3H9AA 4KWUA 4C1XA 5A3MA 2VJXA 4ET7A 1O4YA 4PJYA 4M3CA 1LCLA 2GH2A 4DOUA 3IPVA 4L92A 5EYXA 4BXFA 4UT5A 4WVMA 1RL3A 4PQ9A 5FDBA 4AHXA 3HIFA 3C7FA 3OUJA 4FPOB 4RFT0 4B4PA 1KDMA 5FO7B 1PM7A 2HWC3 2A6VA 3K4ZA 3ENRA 3HQUA 1ZRDA 4JC1A 4CEYA 5FZKA 2FMYA 2VZVA 1TEIA 1WD4A 4FQZA 4GAZA 4EROA 4AQ2A 1JHJA 2BNOA 2XBO2 5A80A 3VZNA 5JSRA 2R0FA 3ZO0B 1W03A 3URFA 4FOQA 4LKEA 1KGYA 1DF0A 4IEVA 4JQRA 1A3KA 1Y3TA 1UU4A 2JXAA 4CDWB 4CU8A 3OTFA 3VBOA 3OOXA 2Z42A 1YIFA 4Q0UA 2VZ1A 3L2HA 3ILFA 4PIXA 1NCRC 3HQXA 1W3XA 1GZ9A 5JSOA 1FT9A 4XFHA 1ONAA 3HEIA 1K5MB 4XUQA 4ARYA 5B4XA 5GLUA 4S2DA 3AZWA 4V2WA 3KWVA 5F2WA 4D6RA 4LR4A 4NPLA 4C0HA 4ZU7A 1KXGA 4YGCA 1JYVA 2W1SA 4XUTA 1VBD1 3O5SA 4COUA 2XJRA 5LRRA 1O91A 2GNDA 4I30A 5LASA 3RZJA 1WCSA 1CWPA 4AOCA 2KR2A 4MGIE 4TTGA 5K4LA 1GWMA 1NXMA 5FZFA 1GZWA 2OZ6A 2WJSA 1QJX2 1AL0G 3NSTA 5T5OA 2GP5A 2OKXA 2DVGA 3ABZA 3PIGA 5DAXA 1O5UA 2B4KA 2JECA 2JKBA 4ONUA 2A1XA 1DQ0A 2R042 5FAXA 5JOYA 4QD2A 4LLFA 4RSUA 2Q1ZB 1W0NA 4LORA 1US3A 3I2OA 4KG8A 1XSQA 1ULFA 3K51A 2YV8A 3CHXA 3O1PA 1POV0 3VN4A 2VMEA 4XZPA 3VZKA 2VCCA 1YI9A 3M8LA 1NX9A 3OEBA 5F3EA 1AXYA 1AR61 1D0HA 4V1PA 3I7DA 1CAVB 1AYM3 4W6WA 3MF9A 2VQAA 4FO9A 5D1IA 1X7NA 4CDWA 4Q4V3 2IXIA 2XPJA 1ZZ9A 3IDEA 2GMPA 4O61A 4A3ZA 2WO1A 1BCXA 2WABA 4QX3A 2SBAA 5DABA 4YW2A 3VBFB 1LR5A 4LUMA 5EPAA 2PAMA 4EYUA 1QJU3 1Z7S2 3OBZA 4DY5A 3LKJA 1PGSA 2JX9A 1X9PA 3JB8A 3P3PA 1NT0A 2A6YA 4FFFA 1AYN1 4CPBA 2IXHA 1K5MA 1UZVA 3OG2A 1FNYA 4Q26A 4L97A 3VL9A 3WF4A 5BY5A 3BTAA 2JE7A 2ZKNA 1W8ZA 1EV13 4TYSA 1H30A 4LXLA 5BNQA 1XPWA 2Z2SB 3AFKA 3LA3A 3OBRA 4D7TA 3WV6A 1A6CA 5DUXA 1I1EA 2V5DA 5KXDA 1XE7A 4YW5A 1ZZ6A 2C0ZA 3QACA 4FOVA 3H0OA 5D21A 4QPGC 1GMMA 1YQ5A 5LA2A 5IK5A 4MG2A 1ENSA 1XSRA 1JTZX 1RUH3 1JMUB 5C7GA 1XB9A 4L8QA 4LQRA 4CPBD 3VBHC 1EAH3 1L7QA 3AKRA 4DUVA 3N7LA 5F5IA 1U5ZA 3WXPA 1HX6A 1Q5OA 4AVAA 3PTRB 3AKQA 4LK6A 3ZX7A 4JKKA 1FOD2 1W9YA 2QJVA 3MBWA 4DO0A 3QD6A 1VAVA 4HN1A 5DZEA 5FXWA 1YUDA 1OQEA 4EN6B 1ZRRA 2VZSA 3VBFC 3TYJA 1CAVA 3GGLA 4IGOA 5FZBA 3RWKX 1WBLA 3O0XA 1E5RA 2W92A 3F95A 1SQ4A 4KQ7A 1S2EA 4CEWC 1GNHA 1UX7A 3AYEA 4O9EA 4MGZE 1ULDA 1DZRA 5I0UA 1F4AA 1MR5A 1XNTA 3A23A 5FZMA 3SEPA 4C91A 5IVJA 4OI4A 3PLQA 1O5LA 5JLVA 3HN3A 1N47A 4KGQA 1SZBA 1ASJ3 5GZFA 5FTTC 1QQP1 1W04A 3CQOA 3UJQA 4AFDA 2OS2A 4QPGB 1HB2A 3W58A 1NXD1 1UX6A 5L9RA 1RITA 3BU7A 4NMIA 4N9IA 2DV9A 4QPIB 2BP6A 1W39A 3VBHB 2BBVA 4OUSA 5JOXA 1O59A 2ZGMA 2TEPA 3ORJA 4BQXA 4IEYA 5FOBB 1PO12 3U14A 1F5JA 3BYWA 1SLAA 4CCJA 1SLIA 4Y20B 3N36A 1OLRA 1PM4A 1YFWA 3POWA 1BBT1 3TNQA 3ZSEA 4HBNA 1POV3 3ZXLA 4P9WA 1HRI3 1QOSA 4JV4A 4CUCA 4K8FA 3PMEA 2XDVA 1PX4A 1YLLA 3GZTB 3S57A 2XJQA 4QKNA 4HONA 2VZUA 4W50A 3ZMOA 4NWWA 1UMZA 1GV9A 3J8F2 4IE4A 5F6LB 1PIV3 4CEWB 3ZSKA 4D7YA 3FHQA 5FMOS 1LOEA 4HOOA 1RUH2 5A6QA 4UW6A 3RZKA 1JUHA 2YYOA 3GBFA 4FP2A 4KMQA 5IFTA 4FPYA 2HWC1 1YXWA 4LHKA 2YHJA 1DFQA 1YYNA 2DFBA 2DVAA 2LALA 2VZTA 4GB32 2HYKA 5FZ6A 4FXKB 2P1BA 5C8CC 4Q4X3 4HMZA 1D4VB 4MX3A 1S0FA 3H3ZA 3TOJA 2X53S 4XF4A 1J1TA 5DAPA 4V2VA 5C8WA 2H6CA 3WNXA 4H14A 2Q1FA 5A33B 3K2OA 1CVNA 5FZDA 1L7RA 4GWIA 4QHZA 1ZZ7A 2VUAA 3QH7A 1YJKA 4AFAA 2QDRA 1COV3 4R4XA 5DDJ2 5FLJA 3M7AA 4PIYA 4XIKA 4QPGA 2YC4A 2RS33 3QCWA 3I2KA 1XNKA 4YM3A 3N3HA 5A1AA 5I8TA 1IPJA 1VBC3 1GZCA 2RV9A 4Y1UA 5I93A 5HI0A 2JDUA 2JG8C 1Q43A 4QPIA 3OBTA 1OPMA 2HEVF 4IV3C 3VBHA 1TVGA 4HSLA 4YGDA 2DVFA 4EWDA 4YZ1A 5F5AA 1TNRA 4UOJA 2VGDA 1WLDA 2ZS6B 1D4M3 3D4KA 3DF0A 4M4RA 1T6BX 2YXSA 1PO23 3HPNA 3IZOA 4XJZA 5AFBA 2D7FA 3WDUA 4Y20A 1GP4A 2W47A 3I2IA 5FK7A 1X9TA 4JGZC 3ILNA 1WCQA 2DUOA 2J1EA 2OVUA 2F4PA 2XQRA 3TEWA 2WS92 4YG6A 5IW0A 2HJIA 2WBKA 1NQDA 1ZREA 5J3UA 3WX5A 3UGFA 3ES4A 3WD5A 5C8CB 3NNJA 4XFGA 4ITCA 5FPXA 2WZR2 4NIDA 4HL0A 3C8XA 5C3QA 2LROA 2X5IB 4XPVA 1CPNA 1LOCA 1N3OA 4UW3A 1RUJ2 1DQ6A 2ZTNA 4NVPA 5FZCA 4FFIA 5FBZA 2Y0OA 1QH7A 1RUE3 2PHDA 3HT1A 4WV8A 1DYKA 3ZFGC 3SCHA 3U4XA 4EJRA 4HZFA 4D3WA 4IV1B 3CF6E 5JR2A 4M0HA 1AYM1 3K4AA 1W2NA 3JUUA 4K7JA 2OPKA 5FFOC 4F83A 1RJ7A 2JG8B 2QUOA 1CQ9A 5EJ1B 2W95A 4IV3B 4Q4V1 5A33A 3T08A 4A6SA 2A7AA 3QH6A 3P3NA 2OXBA 2WT1A 4INDA 3RMYA 4A44A 1YC61 3TRSB 1J3RA 5DZFA 4AQ6A 4GA9A 4Q4X2 3RS6A 1QJU1 4E2SA 1UWWA 4LE3A 3RYKA 3T09A 1ZBA2 2IXKA 3DYMA 1L7LA 3LZZA 4JGZB 3ACLA 2OQ7A 2XLAA 5CBLA 5JI9A 2BJSA 3THPA 1JUIA 3K77A 1QKQA 2VM9A 3UGHA 3KQRA 1COV2 3N9NA 4CUBA 2R1BA 4CUAA 4EWEA 1BJQA 3MGUA 2VY0A 1UOGA 4CDQC 5CZKA 1E5HA 4B8EA 1XRUA 1OA3A 4K8RB 4YM1A 5FY0A 4COVA 1GYKA 4O9GA 4WZFA 5BUVA 5G04L 4ZHNA 2YGLA 2A73B 1CR7A 5C8CA 3N9PA 3T2TA 4BU2A 3G6JB 2C26A 1TMF3 4CU6A 4OHYA 4GKXA 4W6YA 1EAH1 3R4UA 5J1XA 1YNAA 2G19A 3KV4A 3WCSA 1PGL2 2WA3A 2X5IA 3C7GA 3DKWA 3EHKA 3L9JT 4XZUG 2WC2A 4E4SA 1KEXA 1TME2 3AZYA 1AVBA 3N7MA 4DMIA 1PGW1 1R083 1HLCA 3WR0A 4IV1A 3RSJA 4XFBA 5FXXA 1QGLA 5GZEA 4HVQA 3DUIA 2JG8A 4GWNA 5T52A 5FLHA 5JXIA 2Y0IA 3LA7A 3ZFEC 4IV3A 5JPNB 1H9PA 1Y7BA 2YC0A 5FWEA 5T55A 2K0GA 2VBBA 4NWVA 4LHLA 1IS4A 2D6PA 3NNGA 2WZEA 5IAVA 1NY71 4Y1VA 4UW4A 4URTA 2FDIA 1DGWX 3NV2A 4HKOA 4M01A 2JB8A 4RHV3 1POQA 2RR12 3CEWA 1WWYA 4QB1A 4JGZA 5FV3A 1GANA 3BPZA 3D8CA 4AI1A 4ARXA 3GBWA 4GJZA 3VBUC 2RM23 2E7AA 3H8XA 4E9KA 1C8NA 4FCAA 3UESA 1AXKA 2XVGA 5FO8B 1LKNA 4QU2A 3MFCA 5FMCA 3MO4A 5A7PA 4DINB 1LODA 1BLZA 5C3OA 1VBA2 4JHZA 4S2FA 3HQRA 4MXVA 5F8PA 5D2AA 3UL2A 1GOHA 4P5YA 4AEJA 3CBNA 4Q4Y3 4ATFA 4AW7A 4COYA 4XIOA 5C5UA 1H6YA 5JR7B 5F3IA 2QQIA 2NMNA 5C3RA 1RJ8A 2FMDA 3APBA 1POV1 3UJOA 1HRI1 1MS8A 1LTEA 2H6BA 4BOWA 1S2KA 5LW9A 3I2HA 3FLPA 5L36A 3UKNA 1W6QB 1W2UA 2CHHA 3WHTA 1PIV1 3BOPA 4DEQA 3TN93 1NLQA 4LJHA 5JXHA 1MS4A 1VBB1 1W8TA 2AEYA 3POGA 1UZWA 1OUXA 4D8MA 4DQAA 1SLLA 3K48A 4DUWA 2XG3A 4IEOA 1TMF2 2VECA 3MPPG 4IDZA 4LT5A 3SCFA 4ZU5A 1WMEA 2NP0A 1JOBA 3MICA 3QOPA 5E89A 5A3PA 1RUG1 3MW4A 4PCRA 1NE6A 1V6LA 3NWKA 4AL9A 1F15A 1YHFA 2CV6A 1HJGA 2W94A 3AFGA 3FFQA 3PU8A 4X8NA 2BV4A 4Q8LA 5FZAA 3RWNA 3O1TA 2Y64A 4Z8BA 3I2JA 1KFUL 2JDMA 3ZYIB 2X10A 3KT7A 5FZGA 3PUAA 4W6XA 3ZYFA 2IXLA 1VRH2 2G9ZA 3A0KA 3HNBM 1G6NA 1Y9QA 2ZEWA 3JB4C 3EJKA 3VZMA 1RUNA 2V5YA 3ALQA 1LJ7A 1I3HA 1OA2A 2RS31 1QJEA 4JDMA 2VOTA 4DB5A 1JZ5A 1UYPA 4R9AA 1W2AX 1NUKA 1PZ7A 3V65A 4CU7A 1VBC1 3PJYA 4UBGA 2VW1A 1N3QA 4YW6A 2WINB 4OHXA 1W8HA 3N35A 3WF2A 5K7PA 3MYXA 4OHVA 3M4FA 1ODMA 4IEUA 2RMU2 1D4M1 2EALA 5LK5A 4BLIA 2E9QA 1IQDC 2D43A 5FLIA 1PO21 4OMDA 2C24A 1NKGA 5LBCA 3ZPOA 5L9VA 1G9AA 1RUD2 1AR83 4OHZA 3VKOA 2Y6JA 3ZDSA 2J1AA 1HIXA 2YDEA 4P5HA 4YZ4A 3ZYHA 5IK4A 1G9BA 1R1ZA 2XJPA 3X29B 4IERA 1GQGA 3WW4A 2WFF2 3PVNA 1CESA 3FWEA 1W6QA 5ANNA 5C3PA 1W0PA 2W68A 4TXWA 1LOBA 2C1FA 2FZ2A 3RVHA 4Q4Y2 1IHMA 2X09A 4UYBA 5A3WA 1RUI3 3EXUA 4C0BA 4CDXC 3ZXGA 1AR63 1AX0A 4CP9B 1SBFA 1ZYBA 3MIBA 5DQ0A 3B00A 4RR3C 3BKZA 4LLOA 3BU0A 2RE9A 2QVSB 1RUE1 2VZQA 3AP6A 1W8NA 3ZYBA 1BKZA 4RS5C 3ZYRA 2Y33A 1RGSA 4AEDC 5A1LA 3MV01 3K3NA 4QKBA 3ACIA 3BTZA 3O0VA 3GZEA 1AR91 1V6MA 4KGGA 3ZXJA 2OYZA 3RZLA 3LCPA 1S0CA 2HWB3 1S4CA 4YM0A 3VD5A 1SCSA 1GUIA 1DZTA 1UIJA 2MPFA 1Y43B 4PIZA 3WQBA 2ORZA 3LDKA 1YJLA 3ACGA 4R9CA 5IJRA 4BISA 3T0DA 1Y9GA 4Y4YA 3J7MA 1YFXA 1UO9A 1CAUB 3QLQA 4NPRA 3F2ZA 1WA4A 2HWD1 1KD7A 2ZGNA 4IL7A 4Z82A 5EXOA 3LOIA 3I4IA 1WUVA 1DBNA 4OMCA 1U5YA 2YBPA 5J7MA 1X8EA 2VH9A 3I3MA 4IGQA 4KU8A 1JZ7A 4J1XA 1G9CA 5LRSA 1ENQA 1SDWA 3IMNA 5I8SA 2EA7A 2W52A 1R093 4R4ZA 3PVOA 1JYWA 4AAPA 2J42A 2NPIA 1PMHX 1LHOA 4XMIA 1VRBA 2O8QA 3DEMA 2GP3A 4HLTA 4WVWA 4CDXB 4YRDA 1JN2P 1H2KA 1WW5A 4L99A 4W65A 1VBD2 4F3JA 4RR3B 4DS0A 1CD3G 4FPEA 2VNOA 2VQ0A 2ZGSA 3VZLA 4HPKB 4RN5A 3LQCA 4AEDB 4XW3A 2WDBA 5FZLA 2PHWA 1OI6A 1W9WA 2D3SA 3VKMA 1PK6C 1CZTA 5KR7A 3PDQA 1JI6A 1QH6A 3VZOA 3H7JA 5F3GA 4AGGA 2Q0AA 4CP9A 1ZRCA 2VXJA 4JGYB 1G8WA 3TEXA 4DUXA 5F3CA 1KS4A 3GNEA 5I91A 2O1QA 2BVVA 4XC9A 3BGAA 1V6IA 3FBMA 4UF0B 4PI0A 1ODNA 1SFPA 3FC0A 3CJXA 2CDOA 4BQ5A 1WKYA 1H6XA 1RUF3 1AR62 1DCSA 1LGBA 1WMDA 1PHMA 1VPHA 2WO2A 3DCQA 2BGPA 3U1XA 5F7UA 2ARAA 1O8SA 1VBE3 3GHNA 1ULOA 4IE7A 2EIGA 2ZX3A 2AGSA 1UY0A 1CAUA 1U0AA 4RHV1 3KQ4B 2JDAA 4BA6A 4BMEA 1FNZA 2I07B 5C5TA 5HCAA 3NO8A 3J26N 5LEJA 4CDWC 1U5IA 1R1A1 1KFXL 3B01A 2RM21 3CMGA 4ZY9A 1V9U1 1AYN2 1W05A 4FPFA 1ZNPA 3FX3A 4ES9A 2PN5A 1PK6B 3GZAA 4CDXA 2C6SA 1XE0A 1QJZA 2BZDA 3UGGA 1B09A 3I8TA 1MS1A 4FPLA 4BM8A 1BBT3 2P5BA 3U37A 5LBFA 2QQKA 1JZ3A 4K20A 1REDA 3S7IA 3KM5A 3T2PA 3VUOA 5ISLA 3T3YA 4K21A 1GKBA 2VR4A 2YPJA 3T30A 4HPKA 2VOXA 4AEDA 3NV3A 5GZGA 4Y3OA 1N1YA 5IT6A 2R49A 2ZMLA 1K12A 3VD4A 5CFCA 3NJZA 1SG3A 1UPIA 5FJHA 4P9LA 3OPTA 4RQPC 1RUOA 4P02B 2Q8OA 4E8CA 5LEKA 2E26A 1EPWA 4DY3A 4O65A 5FYSA 1UQXA 3TN91 4JGYA 3O1RA 5FYHA 2DDUA 3HBZA 5FP3A 1WMXA 5A6ZA 5IATA 4LNVA 2XUEA 2HWE1 1W3VA 2EXHA 4UF0A 4J25A 4AXOA 3SHRA 3H7YA 4Y22B 1T2XA 2J7MA 3AMHA 3VGIA 5FR3A 2BNMA 2B46X 5LWBA 3V64A 3IDAA 4XJWA 4EV0A 3MIGA 2QBXA 3CDZB 4RYDA 5SV8A 4DIQA 1IS5A 4Y5TA 1LECA 4JRLA 3N7KA 4PBPA 1YI7A 5LCWL 2VNVA 1PVXA 4LIUA 5IVVA 3VD9A 1V6OA 5A3UA 1LAJA 4ASLA 4CXWA 4MOAA 3PNAA 3WUCA 4AVTA 4BDVB 4BHPA 2R063 2WIIB 3B7MA 4IE5A 4QXHA 4HN0A 2GNMA 3OGRA 4XUNA 3WG2A 2VTXA 4M0NA 3UV9A 4NHXA 5JOWA 3PU3A 2GAUA 2NLRA 3SCGA 1MEC3 4KNCA 1A8MA 5AC92 2AEZA 2R16A 1YRZA 4DRRA 1QQP2 2PHLA 4XILA 3MUZ1 1OKQA 1PK6A 1SLCA 3D5OA 4RQPB 4UFIA 1XNBA 2I2SA 3VKNA 2VQTA 1SACA 4WM8B 3KVBA 3THTA 1XU2A 2UY9A 4XBNA 5FY8A 4MUVA 3POJA 2Y6HA 1QF3A 2P6CA 3FHAA 4XAEA 3JZVA 1AR81 1S2BA 4KWLA 1LU1A 4CCCA 4N7IA 3MIDA 2A5ZA 3O12A 2WZPP 1SFYA 3NV1A 1Q8PA 4XBQA 2DU0A 3GCWA 2K2SA 4QHOA 4GZ9A 3IMMA 5E16A 1JODA 5T5PA 3KCYA 4XUOA 3E6BA 1BBT2 5KXEA 2CSGA 3POFA 4Y4RA 3RQ0A 2QQOA 3Q8EA 5FZOB 1RUI1 4Y24A 4E2QA 5GKAC 3B9IA 3ROUA 1O3SA 2LM3A 4IETA 4XTPA 4Z92B 3OGJA 5FXVA 4ZXEA 3DECA 2TBVA 1NAEA 1QJY1 3FUQA 3H1MA 4Y22A 2PXJA 2C5DA 2DCZA 3E6DA 3IT8A 1AJKA 2WWSA 4OHWA 3ZKYA 1S0GA 4QPYA 2ENRA 4I0BA 3T4HB 2HWC2 1W8OA 1GWKA 2FDJA 3NNMA 2O14A 4P9GA 5C4WC 3OPZA 2HWB1 2ZGRA 2GC2A 2A6XA 4FPGA 1KITA 2NQYA 5JCTA 1JZ8A 3AL6A 4TZDA 4AG4A 3CU7A 5KXBA 3H1YA 3N9MA 5ACA3 2WZ8A 3ZYPA 2XJUA 5JMOA 2BVBA 3I2FA 1ACCA 5T5JA 4QAWA 2UURA 1H8VA 3E5UA 5FY5A 4AEKA 2YMZA 1ALYA 1OLQA 1SDDB 1EY2A 1PVC3 3USSA 4RQPA 1R091 1D0GA 4XQ4A 1FPN3 2AYHA 3U07A 1QNWA 4WM8A 3SQOA 5FYBA 5FK8A 1EUUA 3U10A 3W21A 1S1AA 4LBKA 1UYZA 2F6BA 5FUNA 5KHIA 3FL7A 4FP3A 4JKMA 3WG1A 3ZXAC 3WDYA 1UY4A 5BNOC 1GU3A 2BGCA 3K46A 4QT6A 3WOGA 4QPIC 2P3YA 2BNNA 4H2AA 1KJRA 1SBDA 2VAUA 3CZUA 3Q8CA 4QXBA 4XTMA 5F6KA 5A6YA 1JZ4A 3AMQA 2NZ9A 1SLTA 1N3PA 2Y6KA 4CDUC 3W9AA 4L9BA 2PYTA 3Q8BA 5GALA 5KBFA 3NL1A 4EN0A 2OA2A 2MEV1 3KSCA 5C4WB 4P08A 5FZOA 5C9AB 3WINE 3RZHA 5E6HA 4XYXA 2ZMKA 4I0AA 3SITA 2E32A 2GDFA 1PZ8A 1UW8A 2E63A 4NPMA 1A8DA 2G9GA 4AGVA 4BIOA 4PQQA 2Y6FA 1IOAA 4JDNA 4BQ3A 3KHCA 4YGBA 4JTNA 4Q29A 3I2DA 2QDNA 2DUQA 5CNAA 1X8MA 1RUF1 2R30A 4BWOA 1REFA 2RVAA 4UBHA 1GQPA 4WVVA 2XBO1 1W28A 3WNNA 2ZGTA 2VPVA 1YFUA 4LPLA 3HVDA 3Q8AA 1BYHA 3ZLIA 2GN3A 1AYM2 1DLCA 1VBE1 4MHUA 5CIRA 2VUDA 5H9PA 1Q8SA 1IKQA 2VW0A 3SISA 4Q4V2 4AGRA 1H4GA 3EYPA 5KHHA 1MVEA 2VUJA 1OBNA 1X36A 2VCMA 1VALA 3RNSA 3ZFFC 4RL7A 5A1FA 2QQWA 5BNOB 2ID4A 4CCLA 3KS7A 2QQMA 1XQNA 2CDPA 4WVZA 1QJU2 2A6WA 1HDKA 2JICA 4Q0VA 4CDUB 4OFGA 4BQYA 3AX4A 5HXVA 1OQ1A 2XB6C 4PHZA 1O8PA 4LA2A 4COWA 1N1VA 5JOZA 1EV12 2JENA 1LOAA 1W2TA 5F9TA 4AWDA 1LHVA 3N4MA 2IWGB 4P14A 4HT1T 1F4HA 2E31A 2CAUA 1QIQA 1OHFA 1QJFA 1JXNA 2TUNA 2YUEA 2R0HA 1O4ZA 5C4WA 4A42A 5C9AA 1ZRFA 3ETQA 5FP4A 1LOFC 5I8YA 3U11A 1VBB3 4OQ8A 2XH6A 3WDWA 1MS5A 3JD71 1VAKA 2GN7A 4FFGA 4GMP1 2D97A 2VZ3A 1EAH2 4B29A 5KHKA 4JKLA 1GOGA 4CCNA 1S0DA 1LU2A 2RDRA 1RUG3 4RA0A 3UKVA 4TN7A 1OH4A 1AX2A 3AXEA 4K40A 3ZFFB 1ULGA 4LO8A 4LBNA 1PGW2 1XC6A 2X5IC 4XXAA 3WF0A 2FHRA 4FPJA 3EO6A 4BLJA 2BQPA 5K0UB 5E88A 4MGYE 3ITQA 4QB6A 1HB4A 4DXRA 4JAAA 4CYDA 4XMAA 4L11A 4IV1C 1Q8VA 2R061 5F5QA 4FAHA 2VVDA 3BODA 2B9UA 5BNOA 1NY72 2JDNA 3ZN5A 3H8UA 2LUWA 4RGGA 3T0AA 5I0SA 2DCTA 1MEC1 1LEMA 4QX0A 1UNBA 4CTEA 4LO4B 3M3QA 4XJAA 1ASJ2 4CDUA 3AYCA 4OUEA 3I2GA 3FBYA 1UOFA 5HPOA 5APAA 4AF9A 5IK8A 3H8OA 4R9BA 3EBRA 3NMBA 2XMLA 2C9KA 3T2OA 5JUVA 2WYSA 5C3SA 2XL7A 1MQTC 5JZGB 1DGRN 3U75A 4A7KA 3E5XA 4UXAA 3HD8B 3D82A 2Y34A 5CYYA 2JDYA 3HNYM 3LA2A 2UWCA 4FVVA 1Z0HA 2GSYA 2V73A 1WZXA 2A75A 2GU9A 2OT7A 4I02A 2WNOA 2RHPA 5CKMA 1QXRA 2VG9A 3MHZA 5GM0A 2PAKA 1I9RA 3NAPC 4XFFA 2E51A 2XONA 4CP2A 4YARA 1HRI2 3MDPA 1H8TC 1H0BA 1U12A 4YSFA 4BZ4A 3S5AA 1NCQA 5F2SA 1CZVA 3I54A 2WWUA 3O0WA 1KDKA 2ZX4A 4WM7C 5L19A 1DIWA 4EN8B 4OCTA 4I01A 4GWMA 1FOD1 1PIV2 2VOWA 4YZ2A 5HCBA 3WDTA 4K1YA 3ZFFA 2D5HA 1AR93 2DYCA 4TWTA 2DF7A 3WHUA 2I45A 5K0UA 1S55A 4CCKA 4D94A 5C71A 3N9QA 5JIUA 1OFNA 5IUQA 1WCDJ 2RJKA 2DWRA 3OY8B 3DL3A 3INAA 5F32A 1LULA 2EF6A 2LTNA 3VBRC 3WP5A 1HRV3 3KV9A 2FBEA 4Q0SA 4XDQA 3KCXA 3MZHA 1RUG2 1IKPA 2CL2A 1MZEA 4I0WB 4OI2A 3RZZA 5JMCA 3Q9OA 2HWD3 4GQ7A 2ZGQA 1UXXX 3DYPA 3IAQA 4IEQA 1STMA 3R05A 5ACA1 3GJAA 1MQTB 1Y9MA 3SH3A 5FZ4A 2GH8A 2VOVA 4Q2FA 5GLWA 2WT0A 5FZ8A 5GLZA 3MIFA 3WQ0A 3ZMNA 1D2QA 1HB3A 1KRIA 1RVF3 1K5JA 3KHBA 1ZX5A 1BEV3 4M4PA 5FZ0A 3RFRA 5A3OA 5BYNA 4JHTA 5HXMA 2R7EB 1AL21 2RS32 4FT8A 4QQOA 1PVC1 2A3WA 2Y6LA 3MIEA 1LOFA 4XJUA 5A7OA 5KHJA 1QY4A 1FPN1 5DG2A 2CNAA 1VBC2 3NAPB 4OUMA 3GYDA 2ZMNA 2Z4FA 1J58A 3M3CA 4PLNA 5JZGA 1H8TB 3BTXA 2DURA 2WL1A 3WDVA 2AZ5A 2UYAA 4QX5A 4H55A 5EYYA 3RJRA 4B7EA 1UD1A 5EQUA 2Q8CA 3WF3A 4WM7B 4QQPA 3ATGA 1D4M2 3AC0A 1J3QA 2ARXA 3AXDA 2FZ1A 2NM1A 2W91A 3CIHA 1PO22 4LBQB 3OSDA 4A3XA 1W0OA 2IZWA 3JQWA 2LS6A 1J3PA 2ZCWA 3LAGA 5CKQA 4QM9A 1NLSA 1XE8A 3FHIB 3LFMA 5FCCA 1C1LA 3VBRB 4A41A 3HOBA 2VNGA 4YLZA 4UFHA 2IVIB 4LOSA 4HXCA 4YM2A 3LGRA 2XR4A 5LBBA 3VDCA 3ZM8A 3D3AA 3J8F1 1TNFA 4XFCA 3QBQA 5A7QA 1HN1A 3T1LA 4IGPA 4E27A 3T4VA 3I97A 3RRDA 4LBJA 1C3HA 4FTBA 3RZGA 4N53C 3G7DA 2XOMA 2OQ6A 3I59B 4YG0A 4FXGB 3J4UH 1Q8QA 4TSVA 2PLV3 3OY8A 1RUE2 3R4SA 2O0OA 5DN2A 2RJ2A 3SXWA 5J36A 4O7XA 1GOFA 5A7SA 3J9SA 2ATFA 1ULCA 2E7QA 2XL9A 2ET7A 2DBIA 1AR92 1MQTA 5LA9A 3TEZA 4NAMA 4XACA 5LZ6A 2YY1A 4LE4A 4ASMB 1R1A3 2PMWB 3NW4A 4MADA 1W9FA 3BN6A 2VC9A 1X33A 5DDJ1 1V9U3 5EJZB 1PX3A 4BE3A 1YCIA 1UXZA 2HWD2 2IC1A 3FZ3A 2BTVC 4HK8A 4Q0QA 1S0EA 1DP0A 4CCOA 1W6OB 3OEAA 4AI8A 3NAPA 5F39A 4E4HA 2XJTA 2Y60A 3CLPA 1H8TA 3OJBA 1XJAA 1WW7A 1UYYA 3AYAA 1WD3A 1LOGA 2Y6GA 4WM7A 1RHI3 4ZU4A 1APNA 2FCTA 1QDOA 4LHNA 4KBBA 1OURA 1CJPA 4LBQA 1NA1C 3KVAA 1URXA 3ILRA 1TG7A 2PHFA 4U36A 2G1MA 4CVUA 1DQ1A 3D6EA 4FAGA 5CG8A 4XCBA 4N53B 1HN0A 3ST7A 1O3TA 1UY3A 4KWKA 3DGTA 2VCAA 4MZUA 4XF0A 2WS91 5FYVA 3VBRA 4BQ1A 4CXXA 1XU1A 4JDOA 1LHWA 4Q1PA 1J1LA 2PAEA 4Q1RA 2HWE3 3I3QA 2VO5A 3GALA 1CZSA 1OC1A 2UWBA 2VUCA 4QX7A 5A7NA 4Q4W1 3UT0A 4YW4A 3I59A 2XVKA 2RJLA 1TQ5A 3AP7A 3DKQA 4BYYA 3NKTA 3ZN4A 2JJ6A 3VLBB 2OUHA 1BVVA 1UOBA 4LTAA 4BMBA 3V0BB 2WQ8A 1R082 2YU2A 4EWAA 3WNMA 4LBQD 4NN0A 4X6RB 1JYTA 2ZX1A 4MVTA 2MHFA 2Y8KA 1Y4WA 3KF5A 3O1OA 2CWSA 3ZOIA 2GNBA 3OCPA 2TNFA 2QQJA 1UMIA 2BFUL 1FI2A 2VMDA 3A21A 1OKOA 4XEZA 3EQEA 1OQDA 1GSLA 2RDNA 4CZSA 4XQWA 3FMGA 1F8VA 1VE0A 1RUC3 2JKXA 1NA1B 3BTYA 1ZBE1 4RHV2 1JS9A 1W6OA 3K75B 1QXJA 3KT1A 3HJRA 4JQTA 5J98B 1JYIA 4KG0A 3UKTA 4AZZA 1R1A2 1G9FA 2VQUA 2RM22 2RS53 3MW2A 1NZIA 1JOPA 4M3CE 4NE9A 2RS11 2C9AA 5I0RA 5K8SA 5F37A 2H0BA 3POIA 1RIRA 2G9FA 1DGWA 1W9SA 1BQPA 1ND2C 1OXCA 4N53A 4M00A 1YQCA 4IEWA 1UY1A 5GJ6A 3WP3A 4ISRA 5J96B 3U78A 1HXS1 1E5SA 1ZVFA 2DVDA 3KF3A 2BOJA 5IVFA 3IIAA 1FYUA 3WF1A 1OOPC 2X29A 1NQJA 3M3EA 2ZKLA 3FE5A 1QJY3 2ZABA 4LBOA 5FYTA 4YYOA 2PFWA 2RG4A 2W1QA 2J1UA 2ZXQA 5IVEA 4XAAA 4ORFA 2YFZA 3LIGA 1TME1 1VIWB 3TN92 2XWBB 5CFCC 5GZCA 3V0BA 4GMP0 3PUHA 1CAXB 3NJYA 2JDHA 5KWRA 1ZA4A 3AK0A 2ZEXA 4SBVA 3AKSA 2KM2A 3A4UA 3TAYA 3ZXKA 4E4ZA 1UZZA 2HWE2 3W5MA 1HQLA 4JVAA 3ASIA 4JGYC 3CKHA 4UWDA 1K3IA 1HRV1 3VV1A 3RDIA 1VJ2A 4Q5OA 4B4RA 3PMSA 1OLME 1UIKA 4JRAA 2EICA 3GF6A 5FREA 4LMFA 4LBLA 1UCXA 1W6PB 2VBDA 2XHKA 4GXLA 2PHRA 4DFSA 2B42B 2W2IA 2W39A 3LE0A 4XJ8A 4DZGA 1HKDA 1RMU1 5DXDA 5IVBA 1UF2C 2CTVA 1NA1A 4QX2A 2BYVE 5LB6A 4ZKTB 3PUSA 2E33A 1RVF1 2PQSA 3DXUA 1ND2B 4Y33A 4W8JA 1BEV1 1YIPA 3POEA 1AUYA 1UPSA 2JEMA 4AVBA 3NJVA 3AP5A 1OOPB 3IKWA 4AVVA 3HR9A 4MLOA 2ERFA 3K4DA 4FOWA 2HKXA 3VHPA 1JYCA 4Q0PA 5FJKA 2XKPA 3RYRA 4NOTA 3E97A 5CFCB 3OUHA 2MEV3 4RD7A 4OVEA 4PF5A 4OQ9A 1AR82 2VXRA 2NN8A 2NMOA 5D8AC 2PELA 3ZR6A 5K9YA 1BVP1 2XLFA 3AM2A 2XHNA 4R8HA 5FYZA 1DQ4A 4NIIA 2JB4A 3TWIA 5KXCA 4NIAA 3SMHA 2A70A 3ZR5A 4AR2A 4NHMA 2GMMA 3BUCA 3B94A 5LATA 3WW2A 4LO7A 4GH4B 1AJOA 1CAXA 1RUI2 2WNVC 4QGLA 4EN7B 2K9ZA 1UMHA 2XBO3 4AAXA 1DDLA 4QXCA 2ZX2A 4XF3A 5FY4A 2PLV1 1IS3A 1QJY2 3JXSA 5FZ1A 1DYPA 3RPQA 2YGMA 5I0DA 4R52A 3THCA 5L7OC 3DXTA 3A0NA 3MLKA 2WSUA 4KBZA 3RJ2X 3ZSJA 3BCWA 4Y1XA 3SH5A 1W6PA 1PMIA 3ECQA 1Q56A 2W1WA 3LB9A 2CU5A 3SEEA 2X05A 3ES1A 3VHOA 2HWB2 5J37A 2D3PA 1WBFA 3OD4A 2D5FA 2J1TA 4GULA 2WLQA 2W5FA 4ATEA 1G7YA 3LPFA 1ND2A 4XCAA 3ZXDA 1JU3A 4LK7A 4OI0A 4AK3A 2A3YA 3AKTA 4DEVA 1G86A 3MI8A 3VHRA 4I3GA 1UY2A 5FZ9A 4UI9L 2ZGLA 5D8AB 2W9XA 1OOPA 3WSOA 5IFPA 2Q8DA 2WYFA 5LK7B 3IWZA 5EHDA 1CGPA 5B4NA 3VBSC 3HNMA 3UYJA 1NOVA 4CA9A 1R092 1RHI1 2AACA 2AC1A 1MACA 2RMU1 4Z07A 3WP4A 1Q3EA 1K42A 1AR71 1C8M1 1TE1B 2OUJA 1XNCA 1QDCA 5JDBA 4PLOA 4NO4A 1QJX3 1OF4A 1OSGA 1RUD1 1RXFA 2WNVB 2YBSA 5EJ3A 1DGLA 4AHWA 2R043 3LOBA 1CIYA 4M3CF 4PT6A 3IDBB 4YG3A 3H42B 3JD73 4WM8C 5FP9A 4RGAA 4GALA 4GWJA 4UFMA 5L7OB 5FZHA 4GMP3 2WFF1 1CAWB 2R071 3AP9A 2DU1A 3B69A 3M1HA 4ZPIA 2VMHA 4XABA 5LA0A 1H9WA 3BIEA 1F5FA 3H3UA 4HANA 3BVCA 1IZ3A 2F17A 3AZZA 5CG9A 3ZIXA 4GH4A 2MEV2 5GLVA 2ETEA 1V6JA 4FOYA 2G4IA 2VE1A 2ZAHA 2ZA9A 2ZGOA 4N8MA 1W99A 1PNGA 4LO5B 3AP4A 1TZOA 3C7HA 3LDBA 2D6KA 4OLLA 2OIIA 4XF9A 4NHLA 1D2SA 4AQSA 2GC0A 1H1MA 4YW7A 1MS3A 2VMGA 1FMD1 2UU8A 3DYOA 4XURA 5FPAA 3AMMA 4HKWA 1RUF2 4A45A 3FN9A 4META 4Y5Z0 4RGKA 1OF3A 1QHDA 3VBSB 2ZAAA 2WQ4A 5EV7A 1Z7S3 3WW3A 3USUB 2FD8A 4AHZA 2YZ4A 1VBE2 1RUC1 3TB0A 4EZHA 2WLPA 4QKFA 3KZ4C 4MHRA 5EFUA 1K45A 5EZWA 3VKFC 1KS5A 2R32A 3J7NA 4FFHA 2HWF1 3SKJE 1RXGA 3BALA 2ZJCA 5D8AA 1VB2A 1HQWA 1IG3A 3WLUA 2AR6A 4K6BA 4CXYA 1FX5A 2L9LA 3M3OA 4CCMA 3IDCB 3JBG1 5HBAA 2RS51 3GM8A 4BQ4A 3Q8FA 1S0JA 4QGNA 5BPXA 2ZGKA 3VB9A 2P4EA 5FPZA 3LFIA 2ZX0A 3POSA 5FPBA 4Z1VA 4KH9A 5HV0A 1H4HA 1RTVA 1I5PA 2CAVA 1OLMA 2WNVA 1DU3D 1M4WA 2WNUC 4U2AA 2ZHMA 2NYYA 3OBAA 5GLTA 3POBA 1WCUA 5L7OA 5FZ3A 1KJLA 4GIQA 1Q8OA 1CAWA 4AE2A 2XUMA 5CA6A 5BNNC 4NIGA 1RINA 1W8UA 1UL9A 4CCDA 2WAAA 4UFKA 1VAMA 2ORXA 1FOD3 4EZ4A 4X8PA 1DGRA 3JCIA 5ABJC 5JAXA 4L2NA 3PL0A 1CIWA 3JD72 4LBMA 1BMV1 1H2MA 2KD7A 2QQLA 2GC3A 4Y1ZA 4LO6B 4MGQA 4MV2A 5C9AC 3O14A 1YQ2A 3IB3A 2UY8A 2V72A 3VKLA 2BDRA 5DAVA 3WEZA 3ACFA 4I3PA 1PMJX 3GHMA 1NCRB 2AREA 2VTFA 4GD4A 4IE6A 5FKBA 3RGBA 3WG3A 4BXSV 2ZHNA 1QXPA 1W8FA 4HVRA 5ANQA 3VBSA 3ON7A 4K1ZA 3H50A 3USUA 1RB8G 1JU4A 3CJIC 1EPZA 3U0ZA 2CGNA 2ZZJA 1OUSA 1F35A 2WO3A 3MF6A 5T54A 3NRUA 4MSVA 3ZPYA 1CPMA 2D3RA 4NAOA 1AL23 2R062 5L9BA 5LBEA 1W90A 2WNUB 3LEMA 4IEZA 5FYIA 4DXSA 2RDQA 1NYWA 1OMIA 2XGXA 3WUDA 3R6SA 5J48A 1MEC2 2E6VA 3AZVA 4HETA 5L73A 4CE8A 5BNNB 4EE2A 4IUGA 1IG0A 2GMEA 4Y26A 3ZKUA 2D40A 5FYUA 2ZPXA 1PO13 3ZSLA 1GQHA 4JCKA 5ABJB 5HV4A 1VMFA 3M70A 4DNYA 4AFCA 3ZYGA 1IS6A 4MYEA 4P00B 1WW6A 4UFLA 5FBJA 3H8RA 1N1TA 4DPNA 4XDOA 1NE4A 3LWCA 3MFAA 1W9TA 2D6LX 3J8F3 4YFWA 1X82A 2VCBA 3JU9A 3LF7A 4S2HA 4DXZA 4IQPA 2VVFA 2CGPA 3P6BA 2P3IA 5FUPA 4HG6B 4NIHA 2BU9A 4LITA 3OGSA 4IXLA 5AVAA 1NG0A 3CJIB 2QCSB 1MVQA 1WLTA 5FYYA 5A7WB 2AH2A 4K3UA 4BK4A 4MGTA 1LENA 5KC6A 1OA4A 2EIBA 4GB33 4NR1A 1XNDA 4QKDA 2B39A 3OPWA 3KD4A 1HV1A 3PIJA 2ILMA 1QWRA 1MS0A 4QQ2A 4TLGA 4B1LA 4E8DA 2QFEA 3MIHA 1NCQC 1NCRA 3EMRA 4G3YC 4BIFA 3UK9A 4YWAA 5F1RA 4FQ4A 2Z5WA 4Z2AA 4PF1A 1VR3A 5DDJ3 2V4AA 5FYCA 5K0UC 5JPMB 1MS9A 1YEWA 2VOKA 2WNUA 2P6HA 3MLLA 3THDA 5ACA2 1DLLA 2EIEA 2GALA 4KI5M 3A22A 5JVVA 2YROA 5E8AA 3B9CA 4S2GA 2VMIA 4G9SB 5AC91 1H2LA 2A3XA 3WCRA 5BNNA 1DG6A 2W46A 2VZPA 5CAZA 4ZZ5A 4QXKA 4B4QA 2IFWA 2WQZC 1DYOA 1B35C 3SKVA 1AL22 1PVC2 1LESA 1C28A 1YWKA 4P9JA 5ABJA 1FPN2 1YQ8A 2BUKA 3CZJA 3PTYA 1LHNA 1GZTA 3VDDC 2VULA 1QJX1 1XXNA 2WS93 3L2YA 3SLIA 1D7PM 2R041 3B5LB 3HAGA 4HFSA 4B3NA 4BJ0A 2EXIA 2IFRA 3C7OA 5C33A 2XWJB 5FMBA 5JZGC 2E7TA 2BOIA 2WZR3 3AMPA 3K3OA 3J7HA 3MLJA 1O4TA 3POYA 2D6MA 1NCQB 2QE3A 3GZUC 2X8KA 1SMVA 4FBFA 5FO9B 1OFSA 1JOJA 2DBNA 1RUJ3 3AKPA 2CGOA 1BZWA 4LEJA 2XLGA 1WCKA 4Q4W3 2P37A 4YW1A 3TBDA 1LGNA 4HK9A 3T1MA 3CJIA 4I2OA 5A7WA 1V00A 5JI7A 1H1AA 3TNPB 3NNFA 1F2NA 2N7GA 3U4SA 3OYWB 1P8JA 4QU1A 1OVSA 2WKKA 1MZFA 5EIYB 3ACHA 3ZVXA 1UKRA 2XJSA 4MGKE 1SLBA 2D6OX 1V70A 3SH4A 1LGCA 4LOTA 3LDRA 3WDXA 2CYFA 4FPKA 4AYUA 1WGPA 2QQUA 4MXWB 3OD0A 5DMYA 1FV2A 5JSPA 4UFJA 3JQXA 1B35B 3LIHA 4ASKA 4IE0A 3H1WA 1Z7S1 1ZBE3 2HBTA 5DUWA 2Y38A 2YU1A 1ZBA3 2DCYA 3N7JA 4BK5A 4LULA 4ZONA 1LEDA 3VDDB 5FXZA 2W1UA 3DV8A 3VHNA 1S0BA 2UYBA 3CL1A 5A32B 2PHXA 4KWJA 1XYPA 1HV0A 3I3DA 3LEGA 4IEPA 1GICA 2RS13 1SHWB 3V0AB 4QX8A 2EAAA 2XJVA 4D69A 2E53A 1ST8A 1T6GC 4ZXKA 5DG1A 3O7OA 1A34A 3GXUA 2XQXA 1RC6A 4PLMA 5FMOL 4N9HA 1Z78A 1DQ2A 3HT2A 1PZ9A 3OF1A 4AFBA 4AI3A 4D7SA 5FPLA 4C90A 1HXS3 3FLRA 2B5HA 2HLEA 4QWNA 2WAOA 2ET1A 2HYXA 4XETA 1W6NB 1SCRA 4JZRA 5FIXA 3HN1A 2JD4A 4AI0A 4EN9B 3WQ1A 3AJZA 2QQPA 3VBFA 2ADDA 2OZJA 1QEXA 1FATA 1X50A 1TME3 3S7EA 1O3RA 2FDKA 1O6UA 5FUIA 1VBB2 1XOYA 4AHYA 5JXJA 1MZ6A 1UZ0A 3OYWA 4CEWA 4FSJA 5I0TA 2FDFA 2FCVA 2WT2A 3C2UA 2VVEA 4BCUA 4N43C 5FP8A 3ZXEA 5M0TA 4NRPA 1O3QA 1SFNA 3LSDA 2GNTA 2Q1MA 2XKOA 4Q4W2 4ZZ8A 3O1SA 3IBMA 5FYMA 1GP5A 1UAIA 2ZOEB 4PDWC 5T50A 1GNYA 4MXWA 2KA3A 3BOWA 2QQVA 1RMU3 1B35A 5KC5A 5IWFA 2VU9A 2WFPA 3WP6A 3CNAA 4DXTA 2RR13 4RFRB 1OD3A 3V56A 1OVPA 4LKFA 1CX1A 4YFZA 2VZOA 2EIDA 4YVWC 2ARBA 3VDDA 1ULEA 3C3VA 3VD7A 4LHSA 1J59A 1J83A 5A32A 4NROA 3WNOA 4AVSA 4QX1A 3V0AA 1F31A 1JYXA 3PUIA 4JX0A 1ZRIA 4PBOA 4K9SA 1GBGA 3MW3A 5A3LA 3S0MA 1ZBE2 3I3EA 1VBA3 2KXLA 1REEA 4QDQA 3FJSA 5FQ0B 3W20A 1ENXA 1I6XA 1PO11 2IXJA 2WN2A 3SC7X 3ZN6B 2WN3A 1C1FA 2XXZA 1EV11 1JZ6A 2RS12 4A2UA 5JXGA 1SPPB 5LY1A 1V0AA 2JDKA 3P1IA 4HKLA 4XE9A 1W6NA 1DZQA 3AJYA 4AI9A 1JH5A 3KGLA 4N43B 3BI3A 2ES3A 3O1MA 4A7YA 1U5XA 3OB8A 1C57A 2VMCA 2Q4SA 5AVPA 1H1IA 2HBUA 2ZEZA 4PDWB 1HQNA 1WW4A 3P5BA 3TEYA 4ZS3A 3ZFGB 1GWLA 1HXS2 1UZYA 4CP0A 1RUH1 2ZEYA 4LA3A 4QGMA 2Q8EA 4AFMA 3W5NA 3AB0A 3FFZA 4XF1A 4H7LA 5DAQA 2W0XA 3KCCA 1AXZA 3WZ1A 1ENRA 3NJXA 4SLIA 2BWCA 4YVWB 1E5IA 4GB31 4QDRA 1JYNA 5CISA 2Z79A 3C7EA 2BEOA 2QTWB 1ZZCA 4BQWA 5FKCA 4OZOA 1FAYA 4XFIA 2FQPA 4Q27A 4H7MA 3IN9A 1ZA7A 3UETA 1UOJA 2YFUA 4YGEA 3PVEA 1WA6X 2YG0A 3I49A 2D98A 3OUIA 3KGZA 1ZZBA 1N1SA 3RG0A 2O8OA 1VRH3 3KV6A 4AQTA 3E5QA 1HRV2 4WZCA 5H9SA 3J7LA 3PUQA 4FTEA 1O7FA 5BV6A 2WWJA 2J22A 3MPBA 3ZXFA 2BW8A 3RMXA 4XFAA 5JWPA 3WNPA 4BB3A 3PVBB 3T0BA 3OGGA 2Y26A 1RMU2 3D0SA 2JG9C 1SBEA 1V6KA 3VD3A 4YVSC 2QQNA 1ULPA 5FZIA 1RVF2 4LKDA 2VTXJ 3AVRA 3LPGA 1ASJ1 3S30A 1BEV2 2RMU3 2JIGA 1AR73 1C8M3 4NUBA 5FQ0A 2BPA2 3AL5A 1BK0A 5LA1A 3VZJA 1GNZA 3ZN6A 5FZEA 4DRVA 1RUD3 2BFUS 5TSWA 3AYDA 3W59A 1HJFA 1CX4A 4P9IA 1SPPA 2Q30A 2QZ3A 3S6PA 5DZGA 4UAPA 4AI2A 5DUUA 4N43A 2JDZA 3FUOA 2WFF3 4QPWA 5T5LA 2R073 4Y1YA 4D6QA 4CCEA 1GLHA 1XNAA 3MEPA 4BH9A 1ZZ8A 4X6QB 5FPVA 4I09A 4YPJA 2WZR1 1C5IA 2EAKA 2AUYA 4PDWA 5J09A 4XHXA 3ZFGA 5A70A 2YPDA 5IK7A 3KLSA 4D0QA 2YC2A 1OD5A 1RUJ1 1IGOA 2D44A 2ZHLA 1QOOA 3DN7A 4QMAA 4XVHA 2EVXA 1VMHA 2P2KA 4YVWA 5BNPC 3ZFEB 2A71A 1DHKB 2IVJA 1VP6A 5FOJB 2OPWA 1FMD3 1VMJA 4CSWA 3GCXA 1HW5A 2JG9B 2QKDA 3R0RA 2VD7A 5CVRA 3O1UA 2W3JA 4P9XA 2V4VA 4YVSB 4KU7A 2PLV2 3PURA 3LEKA 2C4XA 1FXZA 4NHYA 4R9DA 3RYPA 3WVJA 1XBFA 4Q8KA 3ZDVA 1GFF2 1XYOA 4Q4X1 3AVSA 5DUVA 2FDGA 3VBUB 2QZ2A 2SLIA 1BXHA 4W4ZA 5AFEA 5CADA 5FY1A 3KV5A 4MO3M 5FWJA 3N9LA 1ZBA1 2HWF3 4WBBA 1CN1A 4GJYA 2GC1A 1ND3C 1OPOA 5A3TA 1W2OA 4E2GA 1G9DA 1UU5A 4H3WA 2BGOA 3JBG3 2ZBJA 1CJDA 1YQ6A 2H0VA 1EYBA 5H9RA 4E4DX 1COV1 1V9U2 5CFDC 2YB7A 4TLFA 4CUGA 2OX0A 3BPSA 2YBKA 5HCFA 3FLTA 3WNLA 2PA7A 1IPKA 3M3IA 5H9QA 4AVCA 4NJ4A 1UN1A 4IESA 4LIVA 1QU0A 2CWMA 2HH9A 2QNKA 2PQQA 2P17A 2WRAA 1VBD3 1W06A 4QDSA 5FRAA 4B7KA 1QNYA 2ZGPA 4QQHA 5CU1A 4FTSA 2VZRA 4J1WA 3WT3A 2VL4A 5BNPB 1JW6A 1RHI2 2EXJA 1R64A 5DPNA 2WA4A 1AR72 1C8M2 4NHKA 3DPRC 3VDAA 2XVLA 1DQ5A 2DTYA 4OZXA 4EQVA 2ADEA 2W87A 4LUKA 4NRQA 3KMHA 1PGL1 2EXKA 3ZYJB 2PHUA 5FP7A 2HEWF 2WNEA 2B45X 3I3BA 1EP0A 3NV4A 3IM0A 4NRMA 1S0IA 4PI2A 3NKGA 3NQHA 2FCUA 3B93A 2R072 4HVOA 2LW8A 4ZS2A 3BIWE 2WSVA 5ERLA 3LEIA 4G4FA 3ZFEA 4CRQA 4Z2WA 4J6GA 3EB7A 2WO7A 1JBCA 5FY7A 4IEXA 1YFYA 5IVYA 2IUWA 2OW4A 2MNGA 4XXPA 5GZDA 5T3NA 1GR3A 2JG9A 2BWAA 1ND3B 1I5ZA 1QMJA 2B7YA 2P34A 1LNSA 3B3QE 4XUPA 4YVSA 3N9OA 1M06G 1V6NA 4MH0E 3HWJA 4QHBA 1F9KA 5CFDB 5FY9A 4GH4C 2FDHA 1UYXA 1LRHA 2J1RA 3O1VA 1OT5A 2Q5TA 4FPHA 5E1RA 2JE9A 3VBUA 2GZWA 2RR11 3WQ7A 5IYYA 1MPXA 1FMD2 2I74A 4BQ2A 4FI9A 2R6QA 3ELNA 3LD8A
chains in the Genus database with same CATH topology
1QOTA 3VL8A 1W6MB 4QM8A 1NLRA 4QQLA 3ZIWA 4OI1A 2P3KA 1JHNA 4COZA 2ZHKA 1AYN3 3WW1A 3DPRB 4CEYC 1RUC2 3D0JA 4YNIA 2DCKA 4XBLA 1WMFA 2ZGUA 5B2GB 1VBA1 2D93A 2HEYF 2HWF2 3RI8A 2VNRA 3KT4A 5SV5A 1VB4A 4N7UA 4XJ9A 4P9YA 3JBG2 4YZ3A 2RS52 5BNPA 3VBOC 5BXXA 2DVBA 4ES8A 2P3JA 5KHGA 4A7ZA 1E57A 2DCJA 3AMNA 3ZSMA 3E6CC 4CDQB 2W08A 4GKYA 1BK1A 3WY6A 2R1DA 2V09A 3BB6A 4RS5B 2PTMA 1AF9A 4OULA 3WG4A 5C6CA 2DFCA 2PHTA 2UWAA 3R4DB 4ISQA 1TMF1 2CY6A 2ZZQA 3IPVB 3KB5A 4M3CB 4XOGA 4WVMB 2IXCA 1VLNA 3NVCA 1ND3A 1L3JA 1C5HA 4YW3A 3PHMA 3PJQA 5JIAA 1BMV2 4XHBA 1FV3A 4FPCA 2VW2A 5CFDA 4XQDA 4CEYB 1R081 2AENA 1VRH1 2D6NA 4HSJA 1NZCA 3ME2A 1KQRA 1A78A 1W6MA 1WLWA 1MZ5A 1XYNA 1H2NA 2A6ZA 1UU6A 4KL1A 4BPZA 4YZ5A 3VBOB 5AC93 5EWSA 1AZDA 1SEFA 1QQP3 3AZXA 3DPRA 4CP1A 4F7ZA 1LB2A 1AHSA 1AX1A 3GBGA 3CO2A 3SNMA 5CB7A 2DTWA 3RI9A 1ZM1A 3HMYA 4N90A 1C4RA 1LHUA 4UW5A 1CONA 1WLCA 2ZACA 3M2MA 4F8AA 1PNFA 4AEMA 2Z69A 3LSEA 1YO8A 4CDQA 4C1WA 2B8MA 4RR3A 1K5MC 2DUPA 1IQAA 4Q4Y1 1GZWB 1UKGA 3B02A 4JTOA 4RS5A 3H9AA 4C1XA 5A3MA 1O4YA 4PJYA 4M3CA 1LCLA 2GH2A 4DOUA 3IPVA 4L92A 5EYXA 4WVMA 1RL3A 4PQ9A 5FDBA 4AHXA 3HIFA 4FPOB 4B4PA 4RFT0 1KDMA 5FO7B 1PM7A 2HWC3 2A6VA 3ENRA 1ZRDA 4JC1A 4CEYA 2FMYA 4EROA 1TEIA 1WD4A 4FQZA 4AQ2A 2XBO2 2BNOA 3VZNA 5JSRA 2R0FA 3ZO0B 3URFA 4FOQA 4JQRA 1DF0A 4IEVA 4CDWB 1A3KA 1Y3TA 1UU4A 2JXAA 3OTFA 3VBOA 2Z42A 1YIFA 4Q0UA 3L2HA 4PIXA 3ILFA 1NCRC 3HQXA 1GZ9A 5JSOA 1FT9A 4XFHA 1ONAA 1K5MB 5GLUA 4S2DA 3AZWA 4ZU7A 4LR4A 4C0HA 1KXGA 4YGCA 1VBD1 3O5SA 4COUA 2XJRA 5LRRA 1O91A 2GNDA 4I30A 1WCSA 4MGIE 1NXMA 1GZWA 2OZ6A 2WJSA 1QJX2 1AL0G 3NSTA 5T5OA 2DVGA 1O5UA 2JECA 2JKBA 4ONUA 1DQ0A 2R042 5FAXA 5JOYA 4QD2A 4LLFA 4RSUA 2Q1ZB 4KG8A 1ULFA 3K51A 2YV8A 1POV0 3VN4A 4XZPA 3VZKA 1YI9A 3M8LA 1AXYA 1AR61 1D0HA 4V1PA 3I7DA 1CAVB 1AYM3 4W6WA 3MF9A 2VQAA 4FO9A 5D1IA 1X7NA 4CDWA 4Q4V3 2IXIA 2XPJA 1ZZ9A 3IDEA 2GMPA 4YW2A 1BCXA 2SBAA 1LR5A 4LUMA 2PAMA 1QJU3 1Z7S2 4DY5A 3LKJA 1PGSA 2JX9A 3P3PA 3JB8A 2A6YA 1AYN1 2IXHA 1K5MA 1FNYA 4Q26A 4L97A 3VL9A 5BY5A 3BTAA 2JE7A 2ZKNA 4TYSA 1EV13 5BNQA 1H30A 2Z2SB 3AFKA 3LA3A 3OBRA 4D7TA 3WV6A 1A6CA 5DUXA 1I1EA 5KXDA 1XE7A 4YW5A 1ZZ6A 2C0ZA 3QACA 4FOVA 3H0OA 4QPGC 5IK5A 1ENSA 1JTZX 1RUH3 4L8QA 3VBHC 1EAH3 3AKRA 3N7LA 3WXPA 1U5ZA 1HX6A 1Q5OA 4AVAA 3AKQA 3ZX7A 1FOD2 2QJVA 3QD6A 1VAVA 4HN1A 5DZEA 1YUDA 1OQEA 4EN6B 1ZRRA 3VBFC 3TYJA 1CAVA 1WBLA 3O0XA 1SQ4A 4KQ7A 4CEWC 1GNHA 3AYEA 4O9EA 4MGZE 1ULDA 1DZRA 5I0UA 1MR5A 4C91A 4OI4A 3PLQA 1O5LA 5JLVA 1N47A 4KGQA 1ASJ3 5GZFA 5FTTC 1QQP1 3UJQA 4AFDA 4QPGB 3W58A 1NXD1 1UX6A 1RITA 3BU7A 4N9IA 2DV9A 4QPIB 1W39A 3VBHB 2BBVA 4OUSA 5JOXA 2ZGMA 2TEPA 4IEYA 5FOBB 1PO12 1F5JA 1SLAA 1SLIA 4Y20B 3N36A 1OLRA 1YFWA 3POWA 1BBT1 3TNQA 3ZSEA 4HBNA 1POV3 3ZXLA 4P9WA 1HRI3 1QOSA 4JV4A 4K8FA 3PMEA 1YLLA 3GZTB 2XJQA 3ZMOA 4NWWA 1UMZA 1GV9A 3J8F2 4CEWB 5F6LB 1PIV3 3ZSKA 4D7YA 5FMOS 1LOEA 1RUH2 4UW6A 1JUHA 2YYOA 3GBFA 4FP2A 4FPYA 2HWC1 1YXWA 4LHKA 2YHJA 1DFQA 1YYNA 2DFBA 2DVAA 2LALA 4GB32 2HYKA 4FXKB 5C8CC 4Q4X3 4HMZA 1D4VB 4MX3A 1S0FA 3H3ZA 3TOJA 2X53S 4XF4A 1J1TA 5C8WA 2H6CA 3WNXA 4H14A 5A33B 1CVNA 1ZZ7A 2VUAA 3QH7A 1YJKA 4AFAA 2QDRA 1COV3 4R4XA 5DDJ2 5FLJA 3M7AA 4PIYA 4XIKA 4QPGA 2RS33 3QCWA 1XNKA 4YM3A 3N3HA 5I8TA 1IPJA 1VBC3 1GZCA 4Y1UA 5I93A 5HI0A 2JG8C 4QPIA 1Q43A 3OBTA 1OPMA 2HEVF 4IV3C 3VBHA 4HSLA 4YGDA 2DVFA 4EWDA 4YZ1A 1TNRA 2VGDA 1WLDA 2ZS6B 1D4M3 3D4KA 3DF0A 2YXSA 1PO23 5AFBA 4XJZA 2D7FA 3WDUA 4Y20A 4JGZC 3ILNA 2DUOA 2OVUA 2F4PA 2WS92 4YG6A 2HJIA 1ZREA 1NQDA 5J3UA 3WX5A 3ES4A 3WD5A 5C8CB 4XFGA 4ITCA 5FPXA 2WZR2 4HL0A 2X5IB 4XPVA 1CPNA 1LOCA 1N3OA 4UW3A 1RUJ2 1DQ6A 2ZTNA 4NVPA 5FBZA 2Y0OA 1QH7A 1RUE3 2PHDA 3HT1A 4WV8A 1DYKA 3ZFGC 3SCHA 3U4XA 4EJRA 4HZFA 4D3WA 4IV1B 3CF6E 4M0HA 1AYM1 3JUUA 4K7JA 2OPKA 5FFOC 4F83A 1RJ7A 2JG8B 2QUOA 1CQ9A 4IV3B 4Q4V1 5A33A 2A7AA 3QH6A 3P3NA 2WT1A 4INDA 3RMYA 3TRSB 1J3RA 5DZFA 4AQ6A 4GA9A 4Q4X2 3RS6A 1QJU1 4E2SA 4LE3A 3RYKA 1ZBA2 2IXKA 3LZZA 4JGZB 3ACLA 2XLAA 5CBLA 5JI9A 3THPA 1JUIA 1QKQA 3KQRA 1COV2 2R1BA 4EWEA 1BJQA 3MGUA 2VY0A 4B8EA 1XRUA 1OA3A 4YM1A 4COVA 1GYKA 4O9GA 4WZFA 5BUVA 2YGLA 2A73B 1CR7A 5C8CA 3T2TA 3G6JB 1TMF3 4OHYA 4GKXA 4W6YA 1EAH1 3R4UA 1YNAA 3WCSA 1PGL2 2WA3A 2X5IA 3DKWA 3EHKA 3L9JT 2WC2A 4E4SA 1TME2 3AZYA 1AVBA 3N7MA 4DMIA 1PGW1 1R083 1HLCA 3WR0A 4IV1A 3RSJA 4XFBA 1QGLA 5GZEA 4HVQA 3DUIA 2JG8A 4GWNA 5T52A 5FLHA 2Y0IA 3LA7A 3ZFEC 4IV3A 5JPNB 1H9PA 1Y7BA 2YC0A 5T55A 2K0GA 4NWVA 4LHLA 1IS4A 2D6PA 1NY71 4Y1VA 4UW4A 4URTA 1DGWX 3NV2A 4HKOA 4M01A 4RHV3 2RR12 3CEWA 4JGZA 1GANA 3BPZA 3D8CA 4AI1A 3GBWA 3VBUC 2RM23 2E7AA 4E9KA 1C8NA 4FCAA 1AXKA 2XVGA 5FO8B 1LKNA 4QU2A 3MFCA 4DINB 1LODA 1VBA2 4S2FA 4MXVA 3UL2A 4ATFA 4AEJA 4AW7A 4Q4Y3 4COYA 4XIOA 5JR7B 2NMNA 1RJ8A 2FMDA 3APBA 1POV1 3UJOA 1HRI1 1MS8A 1LTEA 2H6BA 4BOWA 1S2KA 3FLPA 5L36A 3UKNA 1W6QB 1W2UA 3WHTA 1PIV1 3BOPA 3TN93 1MS4A 1VBB1 4DQAA 1SLLA 3K48A 2XG3A 4IEOA 1TMF2 2VECA 3MPPG 4LT5A 3SCFA 4ZU5A 1WMEA 2NP0A 3MICA 3QOPA 5E89A 1RUG1 3MW4A 4PCRA 1NE6A 1V6LA 3NWKA 1YHFA 2CV6A 3AFGA 3FFQA 4X8NA 3RWNA 4Q8LA 4Z8BA 1KFUL 3ZYIB 3KT7A 4W6XA 2IXLA 1VRH2 3A0KA 3VZMA 3JB4C 1G6NA 1Y9QA 1RUNA 3EJKA 2V5YA 3ALQA 1LJ7A 1I3HA 1OA2A 2RS31 4JDMA 4DB5A 4R9AA 1PZ7A 3V65A 1VBC1 3PJYA 4UBGA 2VW1A 1N3QA 2WINB 4OHXA 3N35A 5K7PA 3MYXA 4OHVA 3M4FA 4IEUA 2RMU2 1D4M1 2EALA 5LK5A 4BLIA 2E9QA 2D43A 5FLIA 1PO21 1G9AA 1RUD2 1AR83 4OHZA 3VKOA 3ZDSA 4YZ4A 1HIXA 2YDEA 4P5HA 5IK4A 1G9BA 1R1ZA 2XJPA 3X29B 4IERA 1GQGA 3WW4A 2WFF2 3PVNA 1CESA 3FWEA 1W6QA 1W0PA 2W68A 1LOBA 2C1FA 2FZ2A 4Q4Y2 1IHMA 1RUI3 3EXUA 4C0BA 4CDXC 3ZXGA 1AR63 1AX0A 1SBFA 1ZYBA 3MIBA 3B00A 4RR3C 4LLOA 2RE9A 2QVSB 1RUE1 3AP6A 3ZYRA 1BKZA 4RS5C 1RGSA 4AEDC 3O0VA 3ZXJA 1AR91 1V6MA 4KGGA 2OYZA 3LCPA 1S0CA 2HWB3 4YM0A 1SCSA 1DZTA 1UIJA 2MPFA 1Y43B 4PIZA 4R9CA 1YJLA 4Y4YA 3QLQA 1YFXA 4NPRA 1CAUB 5EZWA 1WA4A 2HWD1 1KD7A 2ZGNA 4IL7A 4Z82A 5EXOA 3LOIA 3I4IA 1WUVA 1DBNA 1U5YA 5J7MA 1X8EA 2VH9A 4KU8A 4J1XA 1G9CA 5LRSA 1ENQA 1SDWA 3IMNA 5I8SA 2EA7A 2W52A 1R093 4R4ZA 3PVOA 2NPIA 1LHOA 4XMIA 2O8QA 4WVWA 4HLTA 4CDXB 4YRDA 1JN2P 1H2KA 1WW5A 4L99A 4W65A 1VBD2 4F3JA 4RR3B 4DS0A 1CD3G 4FPEA 2VNOA 2VQ0A 2ZGSA 3VZLA 4HPKB 4AEDB 4XW3A 2PHWA 1OI6A 2D3SA 3VKMA 1PK6C 1QH6A 3VZOA 3H7JA 4AGGA 2Q0AA 1ZRCA 4JGYB 1G8WA 1KS4A 3GNEA 5I91A 2O1QA 2BVVA 1V6IA 3FBMA 3FC0A 3CJXA 1RUF3 1AR62 1LGBA 1WMDA 1PHMA 1VBE3 3GHNA 2EIGA 2ZX3A 2AGSA 1CAUA 1U0AA 4RHV1 4BA6A 4BMEA 1FNZA 2I07B 5HCAA 3NO8A 3J26N 5LEJA 4CDWC 1U5IA 1R1A1 1KFXL 3B01A 2RM21 1V9U1 1AYN2 4FPFA 1ZNPA 3FX3A 4ES9A 2PN5A 1PK6B 3GZAA 4CDXA 1QJZA 1B09A 3I8TA 1MS1A 4FPLA 4BM8A 1BBT3 4K20A 1REDA 3S7IA 3KM5A 3VUOA 4K21A 1GKBA 2YPJA 5GZGA 4HPKA 2VOXA 4AEDA 3NV3A 1N1YA 5IT6A 2R49A 2ZMLA 5CFCA 3NJZA 1UPIA 4P9LA 4RQPC 1RUOA 2Q8OA 5LEKA 1EPWA 4DY3A 3TN91 4JGYA 3HBZA 4LNVA 2HWE1 2EXHA 4AXOA 3SHRA 3H7YA 4Y22B 3AMHA 3VGIA 2BNMA 2B46X 3V64A 4XJWA 4EV0A 3MIGA 5SV8A 1IS5A 1LECA 4JRLA 3N7KA 4PBPA 1YI7A 1PVXA 1V6OA 4ASLA 3PNAA 3WUCA 4AVTA 4BHPA 2R063 2WIIB 3B7MA 4HN0A 2GNMA 3WG2A 3UV9A 4M0NA 5JOWA 2GAUA 2NLRA 3SCGA 1MEC3 4KNCA 1A8MA 5AC92 2R16A 1YRZA 4DRRA 1QQP2 2PHLA 4XILA 1OKQA 1PK6A 1SLCA 3D5OA 4RQPB 1XNBA 2I2SA 3VKNA 1SACA 4WM8B 3THTA 1XU2A 2UY9A 4XBNA 4MUVA 1QF3A 3JZVA 1AR81 1S2BA 4KWLA 1LU1A 4N7IA 3MIDA 2A5ZA 3O12A 2WZPP 1SFYA 3NV1A 1Q8PA 4XBQA 2DU0A 2K2SA 5E16A 5T5PA 3KCYA 5KXEA 3E6BA 1BBT2 3RQ0A 1RUI1 4Y24A 4E2QA 5GKAC 3B9IA 3ROUA 1O3SA 2LM3A 4IETA 4XTPA 4Z92B 3OGJA 2TBVA 1QJY1 3FUQA 3H1MA 4Y22A 2C5DA 2DCZA 3E6DA 3IT8A 1AJKA 2WWSA 4OHWA 1S0GA 4QPYA 2ENRA 4I0BA 2HWC2 4P9GA 5C4WC 3OPZA 2HWB1 2ZGRA 2GC2A 2A6XA 4FPGA 1KITA 2NQYA 5JCTA 4TZDA 4AG4A 3CU7A 5KXBA 3H1YA 5ACA3 3ZYPA 2XJUA 2BVBA 5T5JA 2UURA 1H8VA 3E5UA 4AEKA 2YMZA 1ALYA 1OLQA 1EY2A 1PVC3 3USSA 4RQPA 1R091 1D0GA 4XQ4A 1FPN3 2AYHA 3U07A 1QNWA 4WM8A 3U10A 1S1AA 4LBKA 2F6BA 5KHIA 4FP3A 3WG1A 3ZXAC 3WDYA 5BNOC 3WOGA 2BGCA 4QT6A 4QPIC 2BNNA 1KJRA 1SBDA 5F6KA 4XTMA 3AMQA 2NZ9A 1SLTA 1N3PA 4CDUC 3W9AA 4L9BA 2PYTA 5GALA 5KBFA 3NL1A 4EN0A 2OA2A 2MEV1 3KSCA 5C4WB 5C9AB 3WINE 4XYXA 2ZMKA 4I0AA 3SITA 2GDFA 1PZ8A 1UW8A 2E63A 1A8DA 2G9GA 4AGVA 4BIOA 1IOAA 4JDNA 4YGBA 4JTNA 4Q29A 3I2DA 2QDNA 2DUQA 5CNAA 1X8MA 1RUF1 2R30A 4BWOA 1REFA 4WVVA 4UBHA 2XBO1 2ZGTA 2VPVA 1YFUA 1BYHA 2GN3A 1AYM2 1VBE1 5CIRA 5H9PA 1Q8SA 1IKQA 2VW0A 3SISA 4Q4V2 4AGRA 1H4GA 5KHHA 1MVEA 2VUJA 1X36A 1VALA 3RNSA 3ZFFC 4RL7A 5BNOB 3KS7A 1XQNA 4WVZA 1QJU2 2A6WA 1HDKA 2JICA 4Q0VA 4CDUB 4OFGA 3AX4A 5HXVA 1OQ1A 2XB6C 4LA2A 4COWA 1N1VA 5JOZA 1EV12 2JENA 1LOAA 5F9TA 4AWDA 1LHVA 3N4MA 2IWGB 4P14A 4HT1T 2CAUA 2TUNA 1OHFA 1JXNA 1ZRFA 2YUEA 2R0HA 1O4ZA 5C4WA 5C9AA 3ETQA 1LOFC 5I8YA 3U11A 1VBB3 2XH6A 3WDWA 1MS5A 3JD71 1VAKA 2GN7A 4GMP1 2D97A 1EAH2 4B29A 5KHKA 1S0DA 1LU2A 1RUG3 4RA0A 3UKVA 1AX2A 3AXEA 4K40A 3ZFFB 1ULGA 4LO8A 4LBNA 1PGW2 4XXAA 2X5IC 5K0UB 4BLJA 2FHRA 4FPJA 3EO6A 2BQPA 5E88A 4MGYE 4JAAA 4CYDA 4XMAA 4L11A 4IV1C 1Q8VA 2R061 5F5QA 4FAHA 2VVDA 3BODA 2B9UA 5BNOA 1NY72 3ZN5A 3H8UA 2LUWA 4RGGA 5I0SA 2DCTA 1MEC1 1LEMA 4CTEA 4LO4B 3M3QA 4XJAA 1ASJ2 4CDUA 3AYCA 3FBYA 5IK8A 4AF9A 4R9BA 3EBRA 2XL7A 1MQTC 5JZGB 1DGRN 4A7KA 3E5XA 4UXAA 3HD8B 3D82A 3LA2A 2UWCA 4FVVA 1Z0HA 2GSYA 2V73A 2GU9A 2A75A 4I02A 2RHPA 2VG9A 1QXRA 5GM0A 2PAKA 1I9RA 3NAPC 4XFFA 2E51A 4CP2A 4YARA 1HRI2 3MDPA 1H8TC 1H0BA 1U12A 4YSFA 4BZ4A 1NCQA 3I54A 3O0WA 4WM7C 1KDKA 2ZX4A 5L19A 1DIWA 4EN8B 4I01A 4GWMA 1FOD1 1PIV2 2VOWA 4YZ2A 5HCBA 3WDTA 4K1YA 3ZFFA 2D5HA 1AR93 2DYCA 4TWTA 2DF7A 3WHUA 2I45A 5K0UA 1S55A 4D94A 5JIUA 1OFNA 5IUQA 1WCDJ 2RJKA 2DWRA 3OY8B 3DL3A 3INAA 3WP5A 1LULA 2EF6A 2LTNA 3VBRC 1HRV3 4Q0SA 2FBEA 4XDQA 3MZHA 3KCXA 1RUG2 1IKPA 2CL2A 1MZEA 4I0WB 4OI2A 3RZZA 5JMCA 3Q9OA 2HWD3 4GQ7A 2ZGQA 4IEQA 3R05A 5ACA1 1MQTB 3SH3A 2GH8A 2VOVA 4Q2FA 5GLWA 2WT0A 5GLZA 3MIFA 3WQ0A 3ZMNA 1D2QA 1KRIA 1RVF3 1ZX5A 1BEV3 5BYNA 1AL21 2RS32 4FT8A 4QQOA 1PVC1 2A3WA 3MIEA 1LOFA 4XJUA 5KHJA 1QY4A 1FPN1 5DG2A 2CNAA 1VBC2 3NAPB 4OUMA 3GYDA 2ZMNA 3M3CA 1J58A 4PLNA 5JZGA 1H8TB 2DURA 2WL1A 3WDVA 2AZ5A 2UYAA 4QX5A 4H55A 5EYYA 3RJRA 4B7EA 1UD1A 4WM7B 4QQPA 3ATGA 1D4M2 1J3QA 2ARXA 3AXDA 2FZ1A 2NM1A 4LBQB 1PO22 4A3XA 1W0OA 2IZWA 3JQWA 1J3PA 2ZCWA 3LAGA 5FCCA 4QM9A 1NLSA 1XE8A 3FHIB 1C1LA 3VBRB 2VNGA 4YLZA 4YM2A 3LGRA 3J8F1 1TNFA 4XFCA 3QBQA 3T1LA 4E27A 3RRDA 4LBJA 1C3HA 4FTBA 4N53C 3G7DA 3I59B 4YG0A 4FXGB 3J4UH 1Q8QA 4TSVA 2PLV3 3OY8A 1RUE2 3R4SA 2O0OA 3SXWA 5J36A 3J9SA 2ATFA