2IZWA

Crystal structure of ryegrass mottle virus
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
178
structure length
178
Chain Sequence
QYGDITPAKNSGSLVRVTSSATAGTEVSGTVLFNVRNATELPWLSGQGSRYSKYRVRYAHFTWEPIVGSNTNGEVAMAMLYDVADVTSITIERLMQTRGGTWGPIWSPTRKRLSYDPEHASLPWYLSGVSSGAAAGNIQTPFQIAWAAQSSLVSTTLGRIMAEYLVELTDPVDVTINQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Three-Dimensional Structure of Ryegrass Mottle Virus at 2.9 A Resolution.
pubmed doi rcsb
molecule tags Virus
molecule keywords RYEGRASS MOTTLE VIRUS COAT PROTEIN
total genus 44
structure length 178
sequence length 178
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2izwA00
1POV0 2RS32 3NAPC 1VBD2 1VBA2 1ZBE2 4GH4A 5BNOC 5BNNB 1RUG2 2BPA2 3FBMA 1RHI2 1PGW1 1BEV1 4CDXC 1HX6A 1Z7S3 1HXS3 1POV3 1AR71 4EJRA 2BFUL 2WS93 1R083 1BMV1 1QJY3 5L7OB 1PIV1 2HWC2 4CDUA 5BNPB 1AR61 2HWF2 1HQNA 1RUE3 1RB8G 5L7OA 1AYM3 1RUD3 1FOD3 4Q4X1 2Y26A 1ZBA3 1EV11 1D4M3 1NG0A 2WFF2 1OHFA 1R1A2 4RR3B 4QPIB 4Q4V3 4Q4Y2 4IV1C 4RFT0 5C8CB 1AR73 1B35B 4WM8A 4GMP0 2RMU1 4NWVA 1TME2 5FMOL 4QPIC 4N53A 5D8AB 3CJIA 1EV12 1C8NA 3VBSA 1RUH3 4WM8B 1EAH1 1RUI1 1H8TC 1VRH3 3J8F2 4CEYB 1E57A 2XBO3 3VBSB 1TMF2 4IV3C 1VBE2 5LK7B 3JD73 1QQP3 3JBG2 4N43A 3TN91 5BNPC 1COV2 5C9AC 2HWF1 1NA1A 2HWC3 1AR62 2QQPA 4RHV1 3VDDC 5K0UC 4RQPC 2DF7A 5ABJC 4N43B 4IV3A 2R061 2RR12 2X5IC 5BNPA 1ND3C 1QJX1 1AL23 3DPRA 1HRI2 1Z7S2 3TN92 3ZFEB 1PO22 5D8AC 2WFF3 4CDXB 2RS13 1AR81 1MEC3 1VB2A 1NOVA 1BBT3 2HWD3 4JGYC 1VBD1 1A6CA 1EAH2 1RUI2 1VBC2 5ACA2 5C8CA 2MEV1 1VAKA 3J8F1 3VBRB 4N53B 1RUF3 1QQP1 5D8AA 1RUJ2 1HRI3 3HAGA 1RMU3 1RUD1 2RM22 4YVWB 3VBHB 5JZGC 4Q4W3 1FOD2 1R092 4YVWA 3ZFGA 1COV3 1NCRB 4FSJA 1TMF3 1MQTC 2RMU3 2RM21 1NCRA 1K5MA 1RVF1 5CFDB 1ZBE1 4N43C 1AYN1 1VBC1 1MQTA 1PGL2 2RS51 1NY71 1VBE1 1PGW2 2R071 3VBOB 1AUYA 5C9AA 1RUC3 1BBT2 3VBOC 2HWD2 4FTEA 4RHV2 2RMU2 5ABJA 1ZBA2 2WZR3 1PVC3 2PLV3 3ZFFA 1RUD2 1HXS1 5GKAC 3S6PA 2R063 1VBA1 3VBUB 4GH4C 1NY72 1R091 1ND2C 1RUG1 3ZXAC 1F8VA 2RR13 1OOPA 1BEV2 3JB8A 2RM23 3VBFC 2XBO1 4SBVA 1NCQA 1AYN3 2WWSA 1OOPC 1V9U1 1PO13 2RS12 3J8F3 1RUC1 3VBFA 4Z92B 2ZTNA 5J96B 1PO23 1RHI3 1TME1 2HWB2 4AEDA 2RS33 4NWWA 1QJU3 1HRV3 4LLFA 4CDQB 1VBA3 1AL22 4CDQA 5FOJB 4YVSC 1R1A1 3ZFFB 3JBG3 2GSYA 1FMD3 2BUKA 1RUE2 2HWF3 4CDUB 4GB31 4BCUA 1VBB2 4GMP3 2PLV2 1AR93 1QJX2 5DDJ2 1RUC2 1Z7S1 4RS5B 5AC91 1IHMA 1RUJ3 1FPN3 4Q4V2 4Q4Y3 1FPN2 2HWE2 1ASJ2 2XPJA 1AR72 2HWB3 4GB32 5BNNA 5C4WC 1RVF2 1VBB1 4QPGC 2X5IA 1R081 1QJY1 5A33A 1R1A3 3ZFEC 5DDJ3 1C8M1 1MEC2 1D4M2 5A33B 4CDWB 4GH4B 1RUF1 1AYM2 4JGZC 4Q4X3 1ZBA1 2MEV3 4JGZB 1R082 1AR91 3IDEA 4FTSA 1GFF2 1PO11 4IV3B 1QQP2 4Q4Y1 1X36A 1RUF2 1QJU2 1VB4A 2FZ1A 1RUH1 5ACA3 1EAH3 1ND3A 1RUI3 5JZGA 1PVC2 4RR3C 4RS5A 1PGL1 1V9U2 1PO12 1ZBE3 3CJIC 1AR83 2RS11 3TN93 1ASJ3 2HWE3 3JBG1 1FMD1 3VBRA 1AYM1 1AR82 4Y4YA 1M06G 1HRV2 4WM7C 1BEV3 4IV1A 1AR92 1QJX3 2R073 1NA1B 1AL0G 2ZAHA 3VBRC 4Q4W1 5AC92 1R093 4PDWA 4Q4V1 1FMD2 2XBO2 2HWD1 4YVSB 1FPN1 5A32B 3ZFFC 3VBUC 1X33A 4PDWB 1WCDJ 1QJY2 3DPRB 1NA1C 2MEV2 2WS92 5DDJ1 1VRH1 1C8M2 2FZ2A 1ND3B 5BNOB 4AEDC 1VBC3 1RMU1 3DPRC 4RHV3 4CEWA 4QPIA 4N53C 4CEYC 1B35A 2WLPA 5CFCB 4CEWB 1TMF1 3CJIB 4Q4W2 1QJU1 3JB4C 2R041 4IV1B 4CEWC 1RMU2 5CFCA 3ZFGC 4CEYA 1AR63 2WFF1 1VBE3 2RS53 3VBHA 2RS52 4YVSA 5A32A 4Y5Z0 1VRH2 1NCQC 1HRI1 5CFDA 1EV13 5L7OC 4GMP1 1RUH2 1MQTB 5FMOS 2TBVA 4PDWC 1TME3 5BNOA 2BBVA 3ZFEA 1K5MB 5CFDC 1MEC1 4CDXA 5C4WB 2HWB1 2IZWA 3VBUA 5K0UA 3VDDA 3LOBA 4RQPA 4CDQC 5BNNC 5C4WA 4FTBA 1CJDA 1RVF3 5ABJB 1C8M3 3VDDB 5K0UB 4WM7B 1FOD1 3M8LA 1RHI1 2HWC1 3NAPA 1NCQB 1D4M1 1PO21 1POV1 2BFUS 1QJZA 3NAPB 1ND2A 1HXS2 1OOPB 4JGYA 1PVC1 3ZFGB 1F2NA 3VBFB 2PLV1 5AC93 5ACA1 1CD3G 2R062 1B35C 3JD72 5C8CC 2VQ0A 1K5MC 4JGYB 1BMV2 2WZR2 1PIV3 2X5IB 1RUG3 1PIV2 5CFCC 1BBT1 1ASJ1 2HWE1 4GB33 1OPOA 4CDWA 1DDLA 3VBOA 4AEDB 3JD71 4CDUC 5C9AB 1W39A 2GH8A 2WZR1 1V9U3 5J98B 4JGZA 4RQPB 1RUJ1 4CDWC 1COV1 2ZZQA 2R042 4WM8C 1SMVA 1NCRC 4WM7A 1H8TB 1HRV1 1VBB3 1AL21 2RS31 2RR11 3VBSC 1AYN2 2R043 4QPGB 2WS91 4YVWC 1H8TA 5JZGB 2R072 3VBHC 1ND2B 1VBD3 4QPGA 4RR3A 4Q4X2 4RS5C 1RUE1
chains in the Genus database with same CATH superfamily
3KGZA 4HANA 1Y7BA 3NAPC 1VBD2 1VIWB 3THPA 2XB6C 4AQ6A 4P9WA 4AFCA 1FAYA 1QJEA 4GH4A 4XZPA 5FREA 5BNNB 2WNVA 4A3XA 1RHI2 4LQRA 4QDSA 4BU2A 4YGBA 4BIOA 2A71A 4CDXC 3PTYA 4WVMB 4KG8A 5FZKA 1FT9A 2HKXA 3W21A 5CEHA 3PJQA 1POV3 1NLQA 2JG8B 3FFQA 3APBA 5GLZA 3I2DA 3K46A 5FYSA 3O0WA 3V0BA 4GKXA 5A1FA 3S0MA 4LO6B 5LBCA 1BMV1 4FPOB 3AC0A 2DCKA 2YG0A 4AEKA 4A45A 1SLLA 3AKRA 1PIV1 2HWC2 2UY9A 5KHHA 5L9VA 1IPKA 4CDUA 2GMPA 5BNPB 5FPUA 1HQNA 1RUE3 5FYUA 2KD7A 5A7NA 3WOGA 4JKKA 5L7OA 1RB8G 3BU7A 2QQIA 1RUD3 4U36A 1ZBA3 4ASMB 2XUEA 3WF0A 1G6NA 1NG0A 2YBSA 2O8QA 5FUPA 4ZKTB 3HBKA 1W8OA 4A3ZA 4Y1UA 2CY6A 2D6PA 4R4XA 5E88A 1CJPA 4B29A 4BB3A 2CAUA 1W6MB 1O4YA 1ODMA 1W2AX 4Q4V3 2D5HA 4IV1C 4RFT0 4XF9A 5C8CB 4LA2A 1UW8A 4NOTA 1UIJA 2VZPA 4WM8A 1LAJA 2OXBA 4N53A 5D8AB 5T5PA 4AHZA 2ZEYA 3AZXA 1LECA 1UNBA 1WMDA 2VZUA 1LULA 3VBSA 4DEVA 4WM8B 4D0QA 1O91A 3MGUA 4BDVB 4YZ5A 2HEWF 3NNMA 1H8TC 1VRH3 3KGLA 4PIZA 1N1YA 1TMF2 1WW6A 5LK7B 1VBE2 1O4TA 2K9ZA 3EB7A 1DCSA 2Z69A 2VECA 3DN7A 1COV2 5K4LA 2HWC3 2P6CA 2D44A 4XJ8A 5KC6A 1AR62 3POYA 3V65A 3ZYHA 1SLAA 1ZX5A 4HN1A 1CAXB 5ABJC 2MNGA 2ZHMA 2JG9B 5A70A 2R30A 1G9FA 1DQ1A 4N43B 4HT1T 3IT8A 5DG2A 2RR12 2SBAA 1UZYA 4ZPIA 2JIJA 3MIEA 1O8PA 2FD8A 1A8MA 2ZX1A 4XXPA 3AMNA 4DXSA 3DPRA 3OYWB 5A7WA 1HRI2 2BNNA 2CSGA 4N9IA 1Z7S2 4Y20B 1PO22 1PX3A 2WUHA 5A7PA 4QQHA 4CUAA 5L9RA 4BQWA 1AR81 1VB2A 2HWD3 4XTPA 5FZ6A 1BBT3 1Q43A 1XYNA 3I97A 2UY8A 1A6CA 5EQUA 4BA6A 4I09A 5JR7B 1Q3EA 5DZFA 4ATFA 3NL1A 4K21A 5J36A 4AL9A 3GYDA 4WVZA 4AWDA 4COZA 4NPRA 4C91A 1OF3A 3LE0A 1MZFA 5IVCA 2ZGPA 1E5IA 3MLLA 4QX5A 4FCAA 4OI0A 3OUIA 4CP9B 3KHCA 4DUWA 1NAEA 2O0OA 3AP7A 3MYXA 4YVWA 3FUQA 1UZZA 5APAA 1LOCA 1NCRB 5L73A 3RZKA 3D0JA 2C4XA 3I59A 3WT3A 2ARBA 3LDBA 5A6XA 2ZMKA 1LOFC 2RMU3 5FPLA 4FO9A 2YPJA 3U37A 1NCRA 3KQRA 3VKOA 1GOHA 3I59B 1DGLA 1ZBE1 3R4UA 1LESA 3JCIA 3PVOA 1AYN1 1J58A 1OLMA 1VBC1 1UZVA 3VKMA 1PGL2 5JOZA 3H8OA 4BQYA 1GZWB 1H2KA 3VD3A 4Y5SA 3USSA 1AUYA 1SPPB 2L9LA 5C9AA 1OLME 1RUC3 3E6DA 1U5XA 1MS0A 4XJ9A 4ZONA 1D7PM 2VOVA 3TOJA 3VBOC 2PTMA 4CUBA 3AKTA 4LUKA 4ISRA 2VBPA 4BOWA 5I93A 1SPPA 2FHRA 2PLV3 2BTVC 3B7MA 1RUD2 3GZTB 1HXS1 1S55A 4OI4A 1SFPA 3GBGA 4QQLA 1ZRDA 2BERA 1W8TA 4DINB 2W5FA 5GZGA 1JUIA 3B01A 1FV3A 1ND2C 4HSLA 5FJHA 4JZRA 3ZXAC 4G3YC 1UMIA 4PT6A 2VNGA 4CRQA 4E9KA 1V00A 2VCAA 1IG0A 1V0AA 3ZSLA 1W9FA 1GBGA 2VR4A 3ETQA 2E26A 4O65A 1G9AA 1AYN3 3GHMA 5A3LA 2BZDA 3ZSMA 4RFRB 3K75B 1V9U1 2YMZA 1PO13 1YCIA 1UPIA 3I4IA 4UW4A 3KF3A 2RS12 3ZXLA 4AK3A 3WHTA 4UF0A 2VVDA 4LIUA 4FT8A 3N9NA 1IPJA 1O3QA 5IK7A 3MIDA 1RHI3 3WW3A 1TME1 5FZDA 4AEDA 1ZRRA 5F5IA 1G8WA 1HRV3 1QJU3 2TEPA 4HXCA 4CDQB 5G04L 1UYZA 1O4ZA 3AJYA 1AL22 4YFWA 1GWMA 2NMOA 4KNCA 1OUSA 3PTRB 4QU1A 5H9SA 4DZGA 5T55A 4COVA 2WNUC 5J1XA 4QQOA 4AXOA 1ODNA 1W9SA 2Y6HA 1KEXA 5EXOA 5LA9A 2JXAA 5F39A 3JBG3 4YM3A 2GSYA 2YHJA 5JSOA 2VL4A 1SDDB 3NJYA 3U11A 3ILNA 5FLJA 1RUE2 5B4XA 2HWF3 3WW4A 4TLGA 4BCUA 3WG4A 1VBB2 1DYPA 4GMP3 3T2PA 2Q8DA 3VKNA 3AP4A 3BVCA 5IHRA 1PM7A 1SBDA 1JYVA 3KB5A 4OI1A 2QJVA 1WLCA 3M3QA 3VZKA 2O1QA 2GNBA 5CG8A 2P17A 3AP5A 1CAWA 4B7KA 2CGPA 2D93A 2IXHA 3P3NA 1CZVA 4Q4V2 3H8XA 2DVFA 3HT2A 2AGSA 4LITA 4XF4A 2W1SA 2DBNA 4QKDA 4N7UA 4YW2A 1KS5A 1U12A 2J22A 5DDJ3 2QQWA 4IW3A 3VL8A 3LEGA 2AENA 2QQJA 1OF4A 4D6SA 3AVSA 3IDAA 2BVBA 2JG8A 5A33B 5IT6A 4CDWB 1UXZA 1LHWA 3POIA 4Q0VA 3WNKA 4YWAA 5LK5A 5F3CA 1FNYA 3AMPA 3HNYM 4Q4X3 5LRSA 3UKVA 1QOTA 1ZBA1 2EIBA 1JOPA 4QHBA 2MEV3 2DYCA 4HPKA 4CU9A 4LXLA 2WT2A 1OQEA 3H7JA 1RGSA 2YY1A 4FTSA 1ULEA 2FMDA 3GBWA 5FK7A 1GQPA 4ASKA 1WWYA 1GFF2 2GC3A 4N7IA 4XBNA 4DRRA 4JTNA 4IV3B 2JICA 3AJZA 2HEYF 3FE5A 4UW6A 3WG2A 4CCOA 4Q4Y1 3SH3A 3EQEA 1WBLA 2Y6LA 4OFGA 4OUEA 2QDNA 4YGDA 1VB4A 4MYEA 1OQ1A 2VMCA 3EJKA 3H1YA 2QZ2A 3AMQA 5AFBA 3N4MA 3CZJA 1EAH3 1RUI3 5KXBA 4UAPA 5BNQA 1W6MA 4PCRA 1FI2A 3P6BA 2VQAA 1GANA 1DBNA 3MHZA 4DMIA 4RS5A 2PQSA 1JZ8A 3G7DA 2XMLA 4HKLA 4NO4A 4PLOA 4MXVA 1WZXA 5A6ZA 4LK7A 1MS1A 2ZGSA 4UI9L 4EE2A 2IFRA 1TG7A 2B39A 5A3WA 1KQRA 1BEV3 2A6VA 4IV1A 5J7MA 1CX4A 1AR92 5IAXA 1J1TA 3KCXA 3ZPYA 1ZZ9A 1REDA 1H0BA 3POGA 2ARAA 3HNBM 4Q27A 4LHSA 3WUDA 1R093 2Y6GA 5FZ8A 4KG0A 1GMMA 1NQDA 5A32B 1FPN1 4AI3A 3VN4A 4OHXA 5FP8A 2RJ2A 3B3QE 3K4AA 3J7NA 4SLIA 3SCGA 3IAPA 2WSUA 1UMZA 3KZ4C 4AFAA 4DFSA 4Z1VA 2UU8A 3WP3A 2A6WA 4HVOA 2GC1A 2W08A 5JI9A 2B46X 2MEV2 2WYFA 3B9CA 2YPDA 3O14A 4QKBA 4AGVA 1O3SA 3ILFA 4JRAA 3WV6A 3ZXKA 1BQPA 1QDCA 3AX4A 3OGRA 5BNOB 1RUOA 4NHKA 1W0NA 1WBFA 2JDMA 2VGDA 4AEDC 1RMU1 2Q8EA 4P5HA 4CCLA 2B7YA 4YSFA 2FDHA 4KU8A 3DPRC 5FY9A 3HQXA 3USUA 4CU8A 5A1AA 3N7JA 4E8DA 2XL7A 3R05A 4YARA 2WLPA 1H1MA 4XQ4A 4XUOA 3USUB 1ZA7A 5C3SA 4A7YA 2CHHA 2ZX4A 2QFEA 5DG1A 1WGPA 1XNTA 2R041 4IV1B 1YI9A 4N8MA 1Y9GA 3ZFGC 1WCQA 2AEZA 2XKPA 2P3YA 5FZCA 3N36A 4QHOA 3H3LA 2B42B 4B4PA 2EIEA 1A78A 1JW6A 4YM2A 2G9GA 3E5UA 3VBHA 4R52A 3WF3A 1SFYA 4Y5Z0 3DCQA 4PBPA 2V09A 4BK4A 3T1LA 1NCQC 2R7EB 1ULCA 2Y33A 1MPXA 2VTXJ 2W92A 4JDNA 5CFDA 1JODA 1GP5A 4M3CE 4A41A 2C5DA 3TB0A 4GMP1 2NQYA 4Q29A 2D40A 1MQTB 2FDJA 3IZOA 5FMOS 4OUMA 3H7YA 4YGEA 4BM8A 3X29B 4FAHA 5EIYB 5KHIA 1W9WA 2CU5A 1MEC1 4CDXA 2IWGB 2JG8C 1VALA 2BGPA 2GP5A 2Z2SB 3DKQA 2H6CA 3JQXA 3L2HA 4AHXA 5C4WB 4KMQA 3EHKA 2PHUA 3POBA 4QXBA 3T0DA 4FPHA 5BNNC 5C4WA 1SDWA 1ACCA 4JHTA 3LEIA 4N9HA 1HDKA 2VMIA 3WF2A 4BYYA 5A3NA 1CJDA 1W3VA 5I0SA 3A22A 4GJYA 5A7SA 2QQKA 2EIDA 3VDDB 5I91A 1Y9MA 2WT1A 3FHQA 4PF1A 3PU3A 4MLOA 2YB7A 3KWVA 4PF5A 3T2OA 2XWJB 2OT7A 2D3RA 1POV1 2F6BA 2LW8A 2BFUS 1QJZA 1HIXA 4D7YA 3KVAA 1OSGA 3UK9A 4MXWB 4A6OA 4K1ZA 3VBFB 5DABA 3RQ0A 1CD3G 1B35C 4KGGA 3W58A 2OA2A 5FMDA 5F37A 1K5MC 4YM0A 4HFSA 4UOJA 5FMCA 2WZR2 1CESA 2WA4A 1PIV3 1UF2C 5JLVA 1DZRA 4BZ4A 1BBT1 1HB3A 1W6PA 1ASJ1 2HWE1 2JDUA 3AYEA 2ARCA 3UKNA 4CDWA 5HCFA 3PU8A 1ULPA 2BQPA 3U78A 1DDLA 4K8RB 3KF5A 3PIGA 4ASLA 1W6PB 2D6KA 4QAWA 2GH8A 3CJXA 2PHTA 4LORA 2DUOA 1CPNA 1W9YA 4P9JA 1X7NA 4JTOA 1OQDA 3H9AA 3BTZA 4GZ9A 4I0WB 1COV1 3M3CA 4EWEA 2BV4A 2ZZQA 1L7LA 2WNUA 3FWEA 5JSPA 5IK8A 3MLJA 3ZO0B 2P1BA 2NLRA 4P02B 3B00A 3LEMA 1VBB3 5CADA 3LFMA 2RR11 5A3TA 5DAXA 3IIIA 4QPGB 5JZGB 2ERFA 2R072 3PURA 2RJLA 3MO4A 1ND2B 3GM8A 4WV8A 4QU2A 1W8HA 4M3CF 1LHNA 4XUNA 5FYZA 2AREA 2WRAA 3SNMA 3P3PA 1YI7A 4BHPA 2XVLA 3MF9A 3R4DB 4Q4X2 4Q0QA 3WDTA 2YDEA 4XIOA 1HJFA 1YYNA 4DUXA 3GDBA 2VZVA 1BHGA 1WMXA 2C1FA 4XDOA 1OKQA 3RZJA 1ZBE2 3ZYFA 3WDXA 5E16A 4CCDA 5BNOC 5HCBA 4HG6B 3MZHA 3PVBB 3FZ3A 1BEV1 3NV4A 4H55A 1LOGA 3CLPA 1OPMA 1TQ5A 4KGQA 3ZKUA 5KHKA 3FHAA 1HXS3 2VZTA 5DAPA 4JAAA 2VH9A 1AR71 2YUEA 4K3UA 5KR7A 4OHZA 3RFRA 2WS93 1H4HA 1YEWA 4NHXA 4XUPA 1E5SA 4NIDA 1PK6C 1CAXA 4ZHNA 1WLTA 3WXPA 5FZMA 3U4SA 1VMJA 3U1XA 1MACA 2CL2A 3BI3A 3ORJA 1F5FA 5JXHA 1AR61 4FVVA 1JZ3A 1O3RA 3CQOA 4P14A 4LHNA 4NAOA 5IVBA 1AYM3 1UPSA 5I0RA 1N1TA 4YW4A 2MHFA 3V56A 5A6YA 4WZCA 1XB9A 2Y26A 3WQ0A 1EV11 1D4M3 5LASA 4P00B 3N3HA 3ZPOA 1WMFA 4JC1A 4BLJA 1R1A2 1W90A 4TWTA 3H1WA 4Z2AA 1X9TA 2QQOA 1QXRA 4LBQD 4YZ1A 3FHIB 5F8PA 5IVFA 1IKQA 4GXLA 4PQ9A 1AR73 4OHVA 2JDZA 2RMU1 1TME2 4QPWA 1FXZA 2DVBA 2PHXA 4J25A 5IAVA 3CJIA 4TXWA 3TEWA 1EV12 2EAAA 2ZMLA 1C8NA 4YLZA 1TE1B 2VXJA 2XVGA 4MOAA 2WNOA 1Y4WA 5T50A 2V5YA 4NR1A 1W6NB 3B9IA 4BLIA 4CEYB 2Q1ZB 3LGRA 5SV5A 4LR4A 3T09A 1SZBA 4IV3C 2ZKNA 4LMFA 2D7FA 4GIQA 5GM0A 3OD4A 1QQP3 4N43A 5BNPC 1UYXA 2PAMA 1CX1A 2BEOA 4NIGA 4RHV1 3WNOA 3VDDC 2DF7A 2YV8A 3CO2A 5CIRA 5FY1A 3D5OA 4QX8A 5LBEA 2QNKA 1ZM1A 5C5UA 2X5IC 5CG9A 1QKQA 2GC0A 3BOWA 2F17A 1UOBA 2YC4A 4Y20A 4FI9A 3S7EA 4D69A 2A6YA 3I3DA 5BNPA 1ND3C 4EN7B 2GZWA 4J1WA 1H9PA 3SISA 3ZKYA 2EICA 1AL23 5M0TA 2D6NA 5FYTA 4KI5M 3C8XA 1R1ZA 3TN92 4QDRA 5ERLA 1UO9A 3OD0A 2WFF3 4QX0A 3SQOA 4IE0A 4LBJA 5A7WB 4AHWA 2RS13 5G05L 4JCKA 3L2YA 3VHRA 5C3OA 4Y1VA 1V6KA 1VBC2 2D6MA 2IXKA 4GULA 4KL1A 3THCA 2KA3A 5ACA2 3A4UA 1K12A 2XJQA 3J8F1 4HK8A 4LBLA 4CCJA 1XRUA 4FPLA 4OVEA 3J7HA 3T4VA 5J48A 1QQP1 1SHWB 3K4DA 4O7XA 3D3AA 3BIWE 4LEJA 5GZEA 5A80A 5FOBB 1JU3A 1JBCA 1IG3A 4FPGA 4KWJA 3VHNA 4DXRA 3Q9OA 4NAMA 1UX7A 2VNOA 2VTFA 2LTNA 3LFIA 4IEQA 1CWPA 2RM22 3D82A 1KFUL 1D0HA 4QM8A 4Q4W3 4YVWB 4WVWA 4CP2A 4UXAA 1HQWA 1W8UA 2ENRA 3LQCA 5FZLA 1CIWA 3RI9A 1S2KA 3O1VA 1MVEA 4NRQA 3NJXA 4NHLA 1JOBA 2J42A 5DAWA 2D6LX 3ZFGA 3BU0A 4UT5A 3HWJA 4ZS2A 4FSJA 1TMF3 2AYHA 3MIGA 4IEZA 2ZGQA 3AFGA 3V0AA 2PHDA 1NLSA 2RM21 5IYYA 4FFHA 2OZJA 1NE6A 3I2IA 5CU1A 3RWKX 4YG0A 3POSA 1UU4A 4IESA 4F3JA 5C33A 2LM3A 1GNZA 2XJTA 4HMZA 1NY71 3QH6A 1BKZA 4IEWA 1VBE1 1WD3A 3VV1A 4Y1YA 1MZEA 1PGW2 2R071 4HN0A 2TNFA 3MLKA 1QNWA 2VUCA 1IS3A 4OHYA 4MGQA 1Z78A 4M4PA 1H4GA 5LB6A 3PUSA 1ZBA2 4GJZA 4HOOA 3W5MA 1OXCA 2A6ZA 3VUOA 4YW1A 3VKFC 2IXJA 4X8NA 4I3PA 1VBA1 2E6VA 5F32A 2X05A 3VBUB 2ZGTA 3I3BA 1S0JA 1NY72 5FYYA 1YQ2A 1R091 2TUNA 4RD7A 5JOXA 3H3UA 1OOPA 1BEV2 2DVGA 2VW2A 2YU1A 3HQRA 2K46A 2D43A 5EYYA 4KWUA 1Q8OA 4ZU7A 1QY4A 3KV6A 2FDKA 1HN0A 2PHRA 3D8CA 3V64A 3VZLA 1QGLA 1CAWB 3OJBA 2P2KA 3WINE 1W03A 4C0HA 2VG9A 1V6IA 4EWDA 4MX3A 3B02A 1XOYA 5KXCA 2YGMA 1UU5A 5DMYA 3O5SA 3OUHA 4ATEA 3I2OA 4W65A 3OY8A 1R64A 2JX9A 4AAXA 1PO23 1LHOA 3BOPA 5A7QA 3P1IA 2P3JA 3MI8A 1BVP1 1PMIA 2XWBB 3HPNA 1W05A 4MGZE 4ZY9A 1L7QA 3RG0A 4RL7A 3ZN4A 1RTVA 5FR3A 3RZMA 1H6YA 1VMHA 5KXEA 3WW1A 4AVAA 3KT4A 1UXXX 1XE8A 5FKCA 4CDQA 5FOJB 2C0ZA 1R1A1 4XJUA 2OS2A 4M01A 1DQ0A 1LNSA 4E27A 2B8MA 4MO3M 5ANNA 4A6SA 5FXXA 4YZ3A 2ET7A 1FMD3 4AGGA 4IE5A 3LIGA 5FPBA 1MR5A 3WUCA 5EPAA 1KFXL 1H1AA 4A44A 2FCUA 1XYPA 4FPYA 2ET1A 4XJWA 4Z2WA 4K7JA 2PLV2 3RMXA 1QJX2 5L36A 4K6BA 1JOJA 1DQ2A 3AK0A 2YC0A 3NJVA 3WEZA 1RUC2 2VW0A 4RGKA 1Z7S1 1LU2A 2W95A 4CZSA 1IHMA 3FLRA 4LBQA 1FPN3 1UIKA 1Y3TA 3VZOA 1W99A 5C70A 4NJ4A 1ZZ7A 1RIRA 3DYPA 3OOXA 2QTWB 5FZHA 1AR72 4DXTA 5BNNA 1H2LA 2BW8A 3PUQA 3LA3A 4LBQB 1UN1A 1LKNA 3AL5A 1R081 1LEDA 1D4VB 3PLQA 4XW3A 4ZXEA 1XBFA 1R1A3 3H8UA 2MPFA 1OD3A 2Q30A 5HXVA 3ZOIA 4CCCA 4AR2A 2WT0A 3IAQA 5FY0A 1MEC2 5E6HA 3DYMA 1DYOA 3OBRA 4LKSA 3FLPA 4A7KA 4BXFA 4YW7A 5EYXA 4AFDA 1AYM2 4JGZC 1W6OA 4XFCA 1YFWA 2JG9C 2OYZA 3ACFA 5DAQA 4Q1PA 3ZYGA 2DWRA 2PHWA 3I3MA 4BQ1A 3DV8A 3M3EA 1AR91 4JGZB 2VW1A 4AGRA 2NZ9A 2Z4FA 4AI9A 1JZ5A 3WNPA 3FN9A 1UZ0A 4BH9A 4CA9A 1QQP2 4QX7A 1PK6B 3BTXA 1X36A 3CBNA 3FBYA 1H2NA 2FZ1A 1H6XA 1XU1A 5KWRA 1XSRA 4JHZA 1ND3A 2W94A 5E89A 3N7KA 3D6EA 2GNDA 3BGAA 4YG3A 2QBXA 2JKBA 3GJAA 4RR3C 3Q8FA 4Q26A 5BV6A 4CCMA 1PO12 4FXGB 1XU2A 4X6QB 2XL9A 3ZMNA 2RS11 2FCTA 4QKNA 3TN93 1XSQA 3Q8EA 1ASJ3 2HWE3 3IPVB 2PHLA 3JBG1 3JQWA 4IEUA 3FJSA 4Y4YA 1HRV2 5FPVA 2QQUA 1ZZ6A 4JX0A 1T6GC 4WM7C 1GNYA 4XOGA 4FPEA 4R9CA 1D0GA 3PVNA 4Q8LA 4UFKA 1BK0A 1Q8PA 2HYXA 2R073 3NV3A 4Z07A 4IE7A 5LW9A 2BBAA 5FZBA 2ZAHA 2DCZA 5T5OA 2XONA 2AZ5A 1YIPA 4CP9A 3M4FA 3M70A 4TLFA 3O1UA 1FX5A 3ABZA 3IM0A 4I30A 5H9RA 4FPKA 4PI2A 2XBO2 5KC5A 3NV1A 1JYCA 2X29A 1ENXA 2VOXA 3T4HB 3ZMOA 3ZFFC 4MG2A 3VBUC 3POWA 4PDWB 4B8EA 2WAOA 2PYTA 1SLTA 3TNPB 3AZVA 5DQ0A 3DPRB 3V0BB 1OI6A 3NNGA 3S30A 3WDUA 4IGQA 1Y43B 1GP4A 5DDJ1 2QZ3A 3C7HA 4XAEA 3O1TA 2R1BA 5FV3A 4QPYA 4PHZA 1ND3B 1APNA 3T08A 3POFA 4IDZA 1EP0A 3ZR5A 3AM2A 4DRVA 5IATA 1KJRA 5CKMA 2WBKA 4P9YA 2QKDA 1AF9A 2VMGA 4CEWA 3VZMA 4QPIA 4URAA 4Z8BA 4CEYC 5IFPA 2ZMNA 2WQ4A 1A3KA 3VDCA 1K45A 2DCTA 1MS9A 2R0HA 2JE7A 3HD8B 5CNAA 5EJ1B 5CFCB 1ZZ8A 1VP6A 3CJIB 3OEBA 4AW7A 4H2AA 5T5LA 1XE0A 1DLLA 4UWDA 1DQ4A 1V6OA 2RE9A 4CEWC 5FQ0A 1QOOA 3RYPA 3POEA 1ULGA 3RRDA 1YLLA 2W0XA 4LE4A 1AJOA 3U4XA 2R6QA 3ZSKA 1OVPA 2Y0IA 2LALA 2WZEA 1ENQA 2ZACA 2RS53 2WIIB 3E6CC 1WA4A 2JB8A 1GYKA 4YGCA 2W9XA 3NNFA 4YVSA 3WP4A 5BYNA 3JUUA 3UETA 1W04A 3PMSA 4KBZA 4R9DA 3H50A 4H7MA 2J7MA 1HRI1 4LBKA 1CGPA 2E7QA 1H2MA 1EV13 4AI2A 5JPMB 3UV9A 4XFHA 3O1SA 3NRUA 3QLQA 5FYBA 5HI0A 4NROA 1RUH2 4IEYA 4ITCA 5IUQA 3SEPA 2C6SA 1QIQA 4P08A 5BUVA 5F6KA 4Q5OA 3AXDA 2VZSA 2F4LA 1LOFA 4QD2A 1K5MB 5FZEA 2VZQA 5CFDC 4F7ZA 1S4CA 3DECA 1DHKB 1H30A 3AVRA 4LOSA 1PNGA 1REEA 3RI8A 3ZLIA 3PVEA 2Y64A 2V72A 1UYYA 2IZWA 2VD7A 4YZ4A 4XACA 1RC6A 2Y6FA 3RMYA 4CDQC 3IDBB 1QXPA 4DXZA 3TEZA 5H9QA 3LOBA 1CQ9A 2PAEA 5FRAA 1RJ7A 1B09A 1DYKA 2V5DA 3MF6A 5FPZA 4CU7A 3LPFA 4EV0A 1PMJX 1UOGA 3FC0A 5ABJB 1C8M3 3BCWA 2GH2A 2B45X 1OA4A 2VCMA 5B4NA 3HEIA 4LBOA 1OLRA 2DUPA 1CIYA 2CGNA 4H14A 1NCQB 1D4M1 1ULFA 1FYUA 3NJZA 3M1HA 3ZDVA 1I5PA 4MGTA 3BYWA 3NV2A 4YW5A 2WQZC 3I7DA 3B69A 2RG4A 1OURA 1ND2A 3NAPB 1HXS2 3ES1A 1JYIA 2GMEA 1F2NA 1X50A 4R9BA 3CHXA 4NRMA 3KSCA 1SLIA 2VMFA 2R062 3RDIA 1Q5OA 1C5IA 1STMA 1U5IA 5FKBA 3RVHA 2VQ0A 1UYPA 5JXJA 2J1EA 2R32A 4JGYB 4QB6A 3W9AA 5GLUA 2I2SA 2CWMA 3R0RA 3TYJA 4JDOA 1IZ3A 1DGRN 5TSWA 2J1AA 3ZYIB 1XNCA 2HBTA 4MHRA 1EUUA 4XILA 3UJOA 1I1EA 1T6BX 4P9LA 2ES3A 3JU9A 1X8MA 1S2BA 2VE1A 1L3JA 1W28A 2G19A 1G86A 1C1FA 4ES9A 1YQ5A 4KH9A 1IS4A 1HB4A 2Q4SA 4OI2A 1CAUB 3I2KA 4AEDB 4M3CA 4XIKA 1W39A 3EO6A 3K2OA 2RVAA 4EYUA 2W52A 4HPKB 4NE9A 3VGIA 1PMHX 4JGZA 3OGJA 2AH2A 4RQPB 4OZXA 4CDWC 5BXXA 4QX1A 4V2VA 5FZ3A 4M00A 2P6HA 1V70A 2ZJCA 1AVBA 1C4RA 4WM8C 4XQWA 1J84A 1NCRC 1H8TB 1HRV1 4Y24A 1AL21 3DKWA 4PI0A 3C7GA 3LB9A 1JYXA 3VBSC 4PLNA 5JOWA 1LOEA 3HT1A 2I74A 4D6QA 2Y38A 5GALA 1H8TA 5A3UA 1HJGA 2HEVF 3LEKA 4MGKE 2Y6KA 4BE3A 4XCAA 2XDVA 3K3NA 4QPGA 4CP1A 2P4EA 2LUWA 3DUIA 3LSEA 3ALQA 4GWNA 4XCBA 4COYA 4RR3A 4RS5C 1GZCA 1RUE1 2VO5A 3C7OA 1POV0 2ZGNA 3BTAA 2RS32 3OG2A 4AQTA 3IPVA 4IEOA 3CNAA 5E8AA 3AZYA 3OY8B 2PQQA 4I02A 1DGRA 2J1VA 1RUG2 2YFUA 4LBMA 2BPA2 1MZ6A 3FBMA 3LD8A 2A5ZA 4PQQA 1W6OB 1JZ6A 1NT0A 1PGW1 2Q1FA 4H3WA 2QUOA 1G9DA 3NW4A 5HXMA 2OQ6A 4IE6A 3B93A 4OUSA 3G6JB 1F15A 1LR5A 2BGCA 3A0NA 4IE4A 5BY5A 4P5YA 4XUQA 4EN9B 4MGIE 2JE9A 2BFUL 1N3QA 4Q8KA 2ATFA 4HL0A 1EUTA 3GBFA 3D0SA 4BQ3A 4FQZA 3VLBB 1ONAA 2A3XA 1KJLA 5DUVA 4DUVA 2IVIB 3RYKA 1I6XA 1U5ZA 4B1MA 4P9IA 5JVVA 5JDBA 2HWF2 1H8VA 4XETA 2JDYA 3CL1A 3S7IA 2QQNA 4MZUA 1IOAA 5JI7A 4Q4X1 4PLMA 4XFAA 1NX9A 1MS3A 1NZIA 3T1MA 3IWZA 1J3PA 3SEEA 4BQ2A 1OC1A 2VBBA 2R1DA 2XJVA 1OHFA 3LKJA 3ME2A 2BWCA 2UYAA 3GF6A 5LA2A 5F9TA 3WQBA 1JZ2A 4IEPA 4V2WA 5DXDA 5I0DA 1AX2A 4RR3B 4JKMA 2VTXA 3WG1A 3KCYA 4Q4Y2 4QPIB 4AHYA 2PA7A 3RYRA 1B35B 2J1TA 2BGOA 4J1XA 4QPIC 4W4ZA 5F3EA 5FMOL 3PUIA 4EN8B 4OCTA 4D7SA 2G4IA 3J26N 4CCEA 2OPWA 1AXKA 4XF3A 2ZEXA 1RUH3 3HQUA 1EAH1 1RUI1 2W1UA 4COUA 3S57A 5EHDA 4GALA 2E51A 2ZEZA 3ACLA 3URFA 4CTEA 4LK6A 3J8F2 3AYCA 3WY6A 1QXJA 1E57A 3VBSB 2E33A 4QGLA 3CKHA 1QH7A 3C3VA 2HLEA 4QB1A 1NA1A 5F7UA 1BVVA 3A23A 3LIHA 4HONA 4D6RA 5K0UC 4FOWA 5J37A 4TTGA 2GNTA 2BNMA 2DU1A 3EMRA 3K3OA 2DFCA 5CKQA 3TWIA 4IV3A 4BWOA 3QBQA 1SLBA 3WNMA 4YG6A 3J7LA 4MGSA 4CSWA 1RITA 4J6GA 2ZX3A 4LKDA 1LODA 1QJX1 2XLGA 4K1YA 3M3OA 4HKWA 5A3OA 3WVJA 4MSVA 4GWJA 5FP7A 1OLQA 1ST8A 1ZRFA 5FUNA 4OLLA 3CIHA 2IVJA 4B1LA 4LJHA 4U2AA 4CDXB 3W59A 4C90A 3ACGA 4FPCA 5D21A 1S0GA 4JGYC 4D7TA 1NOVA 2EXJA 5FZ0A 1M4WA 2B4KA 1NLRA 2WQ8A 2DBIA 4CXXA 3ZSEA 2VZOA 3RNSA 1OH3A 2MEV1 2VOWA 5B2GB 1VAKA 2ZOEB 3AMHA 5C8CA 3W5NA 3Q8AA 1LCLA 1GP6A 2UWBA 4XZUG 2D3SA 3VBRB 2WNVC 1WMEA 4GQ7A 1RUJ2 1XQNA 1HRI3 2WWUA 5FZGA 3ON7A 3WHUA 5AFEA 4G9SB 4UFJA 4GKYA 2O14A 1RMU3 4ZZ8A 1P8JA 2XG3A 2XOMA 3BN6A 5FZAA 3T30A 5JR2A 3VBHB 4NIHA 4E2GA 1WCUA 3K77A 1FOD2 1R092 2DFBA 3RPQA 5GLVA 5A6QA 1QWRA 4LBNA 5J3UA 3ZX7A 2A75A 3ECQA 4V1PA 5FK8A 3F2ZA 4DB5A 2DCJA 2QQMA 4XYXA 1MQTC 3WW2A 2ILMA 4CU6A 3KHBA 4N90A 3F95A 3RJRA 4DY5A 1DIWA 1K5MA 1W2TA 2H0VA 3GZAA 2DVDA 4XMIA 4BIFA 1QU0A 5EV7A 2V4VA 4OYUA 2CDOA 4JV4A 4XFIA 5FY7A 4N43C 1EPZA 1W6QA 2J1SA 3M3IA 1WCKA 4DNYA 1QF3A 1V6LA 4GA9A 4IETA 4URTA 3CU7A 4C0BA 4NIAA 3VBOB 5CISA 5FP4A 1LENA 2JB4A 1S0BA 2VZRA 3MUZ1 3N9PA 2V4AA 5JIAA 3OEAA 1DG6A 2GAUA 2HWD2 3GXUA 1UMHA 4RHV2 2RMU2 5AVAA 5ABJA 3ZXGA 1PVC3 3ZYBA 1KITA 2VUJA 3KCCA 4KWLA 4I0AA 5GKAC 5DZGA 1YUDA 2R063 4FPJA 3SXWA 2JDKA 4GH4C 2OQ7A 3U0ZA 2FCVA 3HNMA 3QH7A 2DTWA 2DDUA 1RUG1 3VKLA 3SC7X 3OPTA 3I54A 1Q8SA 2A7AA 2GDFA 3OSDA 4FQ4A 3LPGA 3JB8A 2EXIA 1ZRIA 3SMHA 3E6BA 1UL9A 4UW3A 2CGOA 3A7QA 3VBFC 2XBO1 3WZ1A 5JWPA 3NO8A 1LGCA 1F31A 5FXZA 4AQSA 2FMYA 1OOPC 2WJSA 1YJLA 3N9OA 2RDRA 1HN1A 3C7EA 4EZ4A 2ZZJA 3J8F3 1RUC1 1N1SA 3VBFA 4XFFA 2F4PA 2LRPA 2ZTNA 2EF6A 1F4AA 1YQCA 3NMBA 4S2DA 4ZU5A 3VZNA 1ZZCA 5J96B 4XXAA 1ZZBA 4LA3A 4EWAA 3RSJA 2HWB2 1PM4A 3UT0A 4UF0B 2RS33 1UOJA 2YZ4A 4A2UA 4BMBA 1VAMA 4XFBA 3I2FA 2KM2A 2D3PA 3AKQA 3MV01 4NIIA 1OH4A 1JXNA 2RDNA 1UX6A 5FBJA 4YM1A 5DN2A 3T0AA 4HETA 3LA2A 4YYOA 3HOBA 5JMCA 3ST7A 3MBWA 2Y0OA 3FL7A 3BPZA 3ZFFB 4B3NA 2W46A 5IWFA 2FDIA 2UWCA 1GOFA 2BUKA 1ZYBA 3ZYJB 4HVRA 2ZX2A 2E63A 1PK6A 3UGFA 4GB31 3WQ1A 4FBFA 1XYOA 3NKTA 2VMHA 5DDJ2 5FUIA 5EJ3A 3BKZA 4IERA 3DGTA 3UESA 2UYBA 3QCWA 3IDCB 2A3YA 2XR4A 2ZAAA 5AC91 5K9YA 1S1AA 1RUJ3 5GZFA 5CAZA 1OD5A 2X8KA 1LU1A 3ES4A 4Q4Y3 1KDMA 1PZ9A 2XJPA 2ZCWA 3GZUC 2HWE2 1ASJ2 1WW7A 2XVKA 2HWB3 2XPJA 3NKGA 4GB32 4CVUA 4YFZA 5C4WC 1RVF2 1VBB1 4F83A 4QPGC 5FZIA 3NWKA 4KWKA 2XJRA 1S2EA 5FLHA 1CPMA 3O0VA 4RA0A 2FDGA 2WO7A 5D2AA 2A73B 3H42B 2DTYA 5CA6A 4FP2A 5DUUA 3PDQA 1LEMA 1N3PA 5EJZB 1PZ7A 3MICA 3IMNA 4Q0UA 5K8SA 3WDYA 2YGLA 2AEYA 4OMCA 1RUF1 2E7AA 2GP3A 3MFCA 3UJQA 2C24A 1TVGA 1O5UA 1GNHA 1KRIA 3N7LA 4XF0A 1US2A 5SV8A 1GSLA 1DGWX 1N47A 4FPFA 3TBDA 4HSJA 1V6MA 2FQPA 5FPXA 2IXIA 2KXLA 1F5JA 2EA7A 3AP6A 3VL9A 1T2XA 4COWA 1IQAA 1GICA 1RUF2 2JJ6A 2XGXA 3LDRA 5LY1A 1VLNA 2Q1MA 1LGBA 1XXNA 4HKOA 4LO4B 1RUH1 2EAKA 3MIBA 1HB1A 5JZGA 3WCRA 1PVC2 4AI1A 5FY8A 1C1LA 2VOKA 4BPZA 4E8CA 2PHFA 4R9AA 5IVVA 1F9KA 2VY0A 1JN2P 3AKSA 1AXZA 3ELNA 4XTMA 3SCHA 2VU9A 1AR83 2X53S 1EPWA 1O59A 4F8AA 1UD1A 3B94A 4FOQA 5LA0A 3NNLA 4QGNA 4L2NA 1FMD1 2PFWA 2WZ8A 3AP9A 1AYM1 1AR82 3P5BA 1YJKA 1REFA 1UY1A 2B9VA 1IS5A 4L11A 3ITQA 4XHXA 1QJX3 2ZKLA 4BK5A 2Q0AA 3VD7A 5GJ6A 2IXLA 5FIXA 2PELA 2B5HA 5FO8B 1WA6X 4IUGA 5DZEA 3VHPA 2WL1A 4AVVA 1DU3D 5LY2A 5LA1A 5EFUA 4AI0A 3CZUA 1J83A 1FMD2 3MW2A 3ZM8A 2HWD1 4YVSB 5ISLA 1W8ZA 4ZS3A 4YPJA 1LJ7A 3Q8BA 1FNZA 5CB7A 2VULA 2NYYA 4DY3A 1MS8A 4Y5TA 1QJY2 2IUWA 3V0AB 2OVUA 1NA1C 1N1VA 2XLAA 3ZYPA 2JG9A 2QQLA 1C8M2 5FTTC 2R16A 5FO7B 2DV9A 2W87A 5C7GA 2FZ2A 4QT6A 2OUHA 3ZXJA 1D2SA 2W1WA 3QD6A 5DPNA 4ZXKA 1OBNA 1DGWA 1VBC3 5JUVA 1Y9QA 4K9SA 1BZWA 1YXWA 1MS5A 2A3WA 4LLOA 3VD9A 1YQ6A 4IQPA 3FLTA 1UZWA 1RYYA 4RHV3 4S2HA 4XPVA 4D8MA 2ZGLA 4N53C 4DIQA 3ATGA 4LO7A 2ZBJA 4OHWA 1RL3A 4W8JA 3SITA 4FFFA 5A7OA 2VBDA 1VJ2A 1WKYA 4QQ2A 2RDSA 4JDMA 4LE3A 1SEFA 3ZN5A 1PHMA 4Q4W2 5FYIA 1QJU1 3JB4C 5H9PA 1RMU2 1VRBA 3LDKA 5F3IA 4TZDA 5CFCA 4CEYA 1AR63 1POQA 1A8DA 2WFF1 5I8SA 2BU9A 3SHRA 3LA7A 2YROA 1IGOA 4OZOA 4PIYA 4XMAA 4QXCA 1UAIA 5FBZA 3LF7A 1O5LA 2A6XA 5FZOA 3O1PA 2VM9A 3BIEA 3R4SA 1SCSA 4IXLA 1VRH2 5IFTA 4UFMA 2Z42A 1ZNPA 1ALYA 3SKJE 5IVYA 4Y22A 1NUKA 5L7OC 1W6QB 3WSOA 3ZDSA 3WF1A 4XE9A 1H1IA 2CTVA 3BODA 2QQVA 1X9PA 1CONA 2TBVA 1O3TA 2JKXA 3OYWA 2EVXA 3MW4A 1TME3 2EIGA 5BNOA 2BBVA 1QNYA 5GZCA 3MDPA 5FP9A 3TEXA 4A7ZA 4K20A 2JD4A 4CP0A 2JENA 4LIVA 2BOIA 5LEJA 1G9BA 2VCCA 3UYJA 4R4ZA 1W2UA 2HWB1 2Q8OA 5DUWA 2YXSA 3ILRA 1WCSA 2C26A 5I8TA 1GZWA 4L9BA 3VBUA 2E9QA 3LWCA 1OT5A 2UWAA 3VDDA 1MVQA 2HYKA 1HLCA 1HKDA 4XAAA 1RVF3 1G7YA 4K40A 2EXKA 3T2QA 4WM7B 2RV9A 4Y33A 1YFUA 1J3QA 4Y1XA 1DZQA 1RJ8A 4KU7A 1TNRA 3OUJA 1RHI1 2HWC1 3H0OA 3LAGA 2P34A 4ARXA 4AQ2A 4GWIA 5C3RA 3VDAA 5HCAA 2OPKA 4L97A 4ET7A 1LOBA 3KQ4B 3N35A 4JGYA 1OA2A 3N9QA 4LUMA 3ZFGB 5IVJA 1KS4A 5AC93 2VZ1A 5FZ4A 3KMHA 3T2TA 3ZIXA 4DO0A 5ACA1 1O7FA 3M2MA 5C8CC 1BMV2 2ZGKA 1SG3A 3K51A 3ZSJA 3WG3A 2AUYA 3E1F1 1ENSA 2X5IB 3PJYA 1C3HA 2BP6A 2W91A 5DAVA 2OKXA 1PIV2 4XQDA 4NHYA 4C1XA 4EN6B 4AYUA 2ZGMA 1W2NA 1W06A 3N7MA 3JXSA 1W2OA 1BJQA 4GB33 1JUHA 1OPOA 2RDQA 4QDQA 3H8RA 4QXHA 2JECA 3VBOA 5LATA 1UQXA 2R0FA 5T52A 5IVEA 2JE8A 3QOPA 4LHLA 4PBOA 3GALA 4DS0A 4OQ9A 2WZR1 3WP5A 4GD4A 3ZN6B 1CAUA 1DFQA 2W39A 2C9KA 1GOGA 4XJAA 1YIFA 5LZ6A 1CVNA 1RUJ1 1AXYA 1TZOA 3GCWA 1BK1A 4X8PA 5I0UA 1ZRCA 3UKTA 3E97A 2WYSA 4EROA 1JH5A 4NUBA 3GGLA 5T5JA 1SQ4A 3HJRA 4HZFA 4QQPA 1YFYA 1Z0HA 3DF0A 4Q1RA 1O6UA 3LOIA 4ES8A 3O12A 2VPVA 2WS91 2FBEA 4X6RB 3WLUA 4YVWC 4OQ8A 2IXCA 5FZ9A 4INDA 5FJKA 4NPMA 1BXHA 3VBHC 1XNBA 4XC9A 1I5ZA 1OMIA 1XNKA 2VUDA 2I07B 2LS6A 3OCPA 3I2HA 4EZHA 1AX0A 2VNVA 2NMNA 3ASIA 2WZPP 5J09A 2JDNA 1S0EA 5DUXA 2WNVB 2BDRA 2W2IA 4AEJA 1IQDC 3PL0A 4PIXA 1ZREA 2NM1A 1VBA2 3MIHA 2CYFA 4Q0SA 5FWJA 4L99A 4LOTA 3A21A 3I2GA 4ZU4A 4AFBA 3SCFA 3SH4A 5FYMA 1LHVA 2SLIA 2PN5A 1HQLA 3DXTA 2DUQA 1JS9A 1HX6A 1QJFA 3PHMA 1VAVA 4HK9A 1Z7S3 4M4RA 1DQ6A 2Z79A 3J7MA 4AE2A 3PUHA 3BTYA 3HBZA 4BXSV 1GQGA 4EJRA 4WVMA 2ORZA 5JAXA 4QMAA 4UBHA 2ZX0A 3O0XA 4XBLA 1MS4A 1R083 1UKGA 4C1WA 1LB2A 5IJRA 2WINB 1QJY3 1YNAA 2WNUB 2XJSA 5LBFA 5L7OB 2B9UA 5FXVA 4YNIA 4R8HA 1EYBA 1HV1A 3DYOA 2WO1A 4OULA 3ROUA 3O1MA 2ZGOA 1FOD3 2VJXA 2WO2A 2QE3A 4MGYE 5JSRA 2X10A 4AEMA 3IB3A 4NHMA 3WDWA 2WFF2 2CV6A 1S0CA 1YRZA 4ARYA 1V6NA 1TNFA 5IK5A 4CXYA 1YC61 1JI6A 4XUTA 3WR0A 4FAGA 2CNAA 2VVEA 2OX0A 3OGGA 1JYTA 1SBEA 1X82A 3EYPA 4GMP0 1UU6A 4NWVA 4B7EA 2VOTA 2XKOA 3I49A 2P5BA 5FWEA 3TRSB 5JXIA 3D4KA 2O8OA 1CZSA 4DOUA 1GKBA 2ETEA 2HJIA 4LTAA 2XBO3 2H0BA 2G9ZA 2P37A 4HLTA 1D2QA 1IS6A 2BOJA 4BQ5A 1W3XA 5F6LB 1JHNA 1TEIA 3E5XA 2R49A 1W6NA 3JD73 4DPNA 3JBG2 4O61A 3TN91 5C6CA 5C9AC 2HWF1 3B5LB 4E4SA 1IPSA 3H3ZA 2QQPA 5C8WA 4RQPC 2D98A 2GN7A 4OMDA 3R6SA 4EN0A 2WNEA 1YHFA 2D5FA 3ZR6A 2R061 4I2OA 4UFLA 4AFMA 1WLWA 2BRTA 4META 1XNDA 2WAAA 4C8DA 2YBKA 3OTFA 3RZGA 2FDFA 1GWKA 4CE8A 3I8TA 1S0DA 4P9GA 4XURA 2GNMA 3ZFEB 1OFSA 1W8NA 3OBTA 3WX5A 1YQ8A 2XXZA 5D8AC 3ZVXA 1W0PA 1MEC3 4QXKA 1O8SA 4WVVA 5CYYA 2NP0A 1RUNA 1K3IA 4UFIA 1VBD1 3EBRA 5FP3A 1EAH2 1RUI2 4M0NA 4XDQA 5FFOC 1AHSA 3THDA 4FOYA 2EXHA 4N53B 1RUF3 5D8AA 1GR3A 2ADDA 5HPOA 5LCWL 2E32A 3HAGA 2Y8KA 1PNFA 4S2GA 3T0BA 1UKRA 1Q56A 1RUD1 5FZOB 5JZGC 2WR9A 2VQTA 3WCSA 4RN5A 2WKKA 4Y1ZA 3C2UA 2OW4A 1UY2A 3GZEA 1COV3 2ZA9A 1ULOA 3UL2A 1SCRA 2ID4A 2W1QA 4GAZA 3KLSA 4CPBD 1YWKA 1CAVA 2Y6JA 4FXKB 3GHNA 4LO8A 1WUVA 4QB2A 1JZ4A 1XJAA 4UYBA 2DU0A 4CCNA 4Z82A 1RVF1 4G4FA 3FMGA 5LRRA 2ZHKA 1K42A 5CFDB 4XHBA 1E5RA 2WFPA 5FYCA 1MQTA 2RS51 2ZXQA 3U75A 1YO8A 1KDKA 1GZTA 4O9GA 3KS7A 4Q0PA 4CXWA 2ZGRA 3BUCA 1BBT2 1UCXA 3N9MA 3ZN6A 2N7GA 4AVCA 5FO9B 4FTEA 2LROA 2GC2A 4FOVA 1J1LA 2WZR3 4W50A 3ZFFA 5A1LA 1J3RA 4JKLA 2HBUA 1XE7A 3AYDA 1VPHA 3EXUA 2GMMA 4FFGA 4MADA 3S6PA 1Q8VA 2WN2A 3MV11 1OKOA 2GU9A 1Q8QA 2XLFA 3UNPA 3BB6A 1X8EA 1FATA 1MZ5A 2J1UA 1F8VA 3I2JA 1AZDA 1ULDA 3VDBA 2Q5TA 3AL6A 3OBAA 2RR13 4I3GA 5C3PA 5FZFA 3PNAA 4IGPA 5LBBA 2RM23 3KD4A 1LHUA 3AKPA 2WO3A 1LGNA 1U5YA 4NN0A 3RZZA 2W47A 4SBVA 4QM9A 3SKVA 1NCQA 5C71A 2WWSA 1GUIA 4LHKA 1F35A 3HR9A 1VR3A 2A1XA 3CF6E 1JU4A 4BMEA 4XDPA 1GU3A 1VE0A 3ENRA 4W6XA 3RWNA 5GLTA 1NZCA 3KV4A 4BQXA 3ETPA 1W9TA 3AZWA 3RS6A 3KVBA 2ZHLA 5CKNA 3VZJA 1NYWA 3NQHA 4NWWA 4D94A 4LLFA 4YZ2A 1VBA3 4L0PA 4RSUA 3WNXA 1PZ8A 3GCXA 4EQVA 4I0BA 4LKEA 1F4HA 1YFXA 2Z5WA 3WNLA 3S5AA 1QH6A 4JQRA 1JMUB 3IMMA 1W0OA 5KHGA 3OBZA 4ZZ5A 4LULA 3IKWA 4QKFA 4YVSC 1QHDA 2H6BA 1DLCA 1AJKA 4AG4A 3BPSA 4NPLA 4JVAA 1K5JA 3E5QA 3N9LA 2ARXA 4AVTA 1GLHA 1WW4A 2JDHA 2OUJA 4Y4RA 4A4AA 1QOSA 1I9RA 5F3GA 2P3KA 4CDUB 1SFNA 3S5QA 2HH9A 5FPAA 4BISA 1W8FA 2AR6A 4MHUA 5EP9A 1AR93 4K8FA 5FAXA 1OUXA 5T3NA 2E31A 3OGVA 5L9BA 3ZXFA 4RS5B 2XJUA 2V73A 4HBNA 5HV4A 3UGHA 1JYWA 1WW5A 1E5HA 1KXGA 3U07A 1FPN2 1JHJA 1SACA 2PXJA 2X09A 5FZ7A 4HVQA 2WABA 3MPBA 4LPLA 3RZHA 2D97A 2X5IA 4Q2FA 1QJY1 4QX2A 5A33A 3KM5A 1PGSA 3MW3A 2YU2A 3PMEA 4NMIA 5EWSA 3M7AA 3ZFEC 5E1RA 5FY5A 1S0IA 1DF0A 2J1RA 2VNRA 2G1MA 1HB2A 1C8M1 4O9EA 1D4M2 5EZWA 4GH4B 2VAUA 4LO5B 1PX4A 3PUAA 2PMWB 1US3A 5I0TA 5JOYA 1WLDA 1H9WA 3VB9A 5JIUA 3AMMA 5FY4A 2RJKA 1R082 1LOAA 5AVPA 3IDEA 3CDZB 1NXMA 3PIJA 4RYDA 4CUCA 3VHOA 1PO11 2WWJA 2W3JA 3T3YA 2NN8A 5FDBA 4Z92B 5BPXA 1SLCA 3JZVA 4AVBA 1C57A 1QJU2 5LWBA 2G9FA 2WDBA 4PJYA 2QCSB 3SLIA 1BCXA 1JTZX 1L7RA 2YC2A 4QX3A 5ACA3 3VD4A 4BQ4A 3DEMA 1W8WA 2ADEA 2ZS6B 4FP3A 4P9XA 4CCKA 4S2FA 1PGL1 3I3QA 1V9U2 3KT7A 1FV2A 1ENRA 4XVHA 1QMJA 3SH5A 1ZBE3 3CJIC 3HN3A 2YYOA 2ZABA 4Y26A 4XJZA 2Q8CA 1RXFA 3O1OA 3VBRA 2IFWA 5FYHA 4W6YA 1M06G 3AZZA 3HVDA 5IW0A 5F5CA 4XEZA 3TAYA 1QEXA 5FQ0B 2JDPA 4RGAA 1C28A 1UWWA 2A70A 1NA1B 1AL0G 3OPZA 5A3MA 3VBRC 2DCYA 2E7TA 4Q4W1 5AC92 4E4HA 2ZGUA 3IN9A 4PDWA 3NSTA 3DXUA 4Q4V1 3BALA 2XQRA 4AAPA 2XUMA 2VZ3A 5IK4A 3CMGA 2WN3A 3L9JT 1X33A 3O1RA 1WCDJ 3I3EA 2JEMA 2JD9A 1OFNA 4L8QA 4MH0E 3NNJA 2WS92 1VRH1 5KHJA 4KQ7A 5JMOA 3FUOA 5HV0A 1GWLA 2ZHNA 4TYSA 3U14A 5FYVA 1OVSA 2GALA 1QDOA 2NPIA 4Y3OA 2BYVE 3RGBA 2YFZA 1LTEA 3QACA 2K2SA 1SBFA 3MIFA 5HBAA 5KBFA 4UFHA 1GQHA 1B35A 4TSVA 4XFGA 1S0FA 3ZIWA 5ANQA 3KT1A 3ZXEA 3POJA 5T54A 2JIGA 4CEWB 1TMF1 5F5AA 1G9CA 3TEYA 3MPPG 1BYHA 3AFKA 1UY0A 5LEKA 4QGMA 5FCCA 3RJ2X 4LNVA 1JYNA 4QWNA 5CZKA 2GN3A 2BWAA 5K7PA 5C3QA 1PVXA 1OA3A 1RXGA 2VVFA 4LKFA 5GZDA 2WC2A 5L19A 2PAKA 3OGSA 4W6WA 1VBE3 1NQJA 1XNAA 5A3PA 4Y22B 2RS52 5A32A 1BLZA 4E2QA 3ACIA 3KV9A 3WF4A 1N3OA 1C5HA 4L92A 2IC1A 3WQ7A 4LT5A 1CZTA 5FMBA 1XPWA 4M0HA 5C5TA 1DP0A 2BJSA 1CAVB 5CBLA 2QVSB 2YBPA 1HV0A 3WP6A 4CYDA 2ZPXA 4PDWC 1CR7A 1NE4A 1NXD1 2C9AA 4DQAA 5CVRA 3MFAA 3ZFEA 3VD5A 2XQXA 4WBBA 3ZYRA 2AACA 1HW5A 5F5QA 2BVVA 3LZZA 2RHPA 4FFIA 4BJ0A 2DVAA 3J4UH 5F2SA 1A34A 1VMFA 3CEWA 2WLQA 4YRDA 3TNQA 3RZLA 2VXRA 4AVSA 4IEXA 5K0UA 4RQPA 4QHZA 3THTA 1U0AA 4FTBA 4AI8A 3AB0A 5HCHA 2ZEWA 1DQ5A 4JRLA 4DEQA 5K0UB 3DL3A 3C7FA 4CPBA 2JDAA 2CAVA 1UY3A 1FOD1 4ONUA 2CDPA 3MUY1 3M8LA 4ISQA 5KXDA 1GZ9A 3ACHA 1ZA4A 3NAPA 4I01A 4NRPA 3W20A 3UGGA 1PO21 2AC1A 3AYAA 4YW3A 3MEPA 3U10A 2CWSA 4XABA 1URXA 5FZ1A 4A42A 1NKGA 4B4RA 1GV9A 2WSVA 1OOPB 1JZ7A 1PVC1 2VUAA 2E53A 3O7OA 3GJBA 4UW5A 4WZFA 2VMDA 2JWPA 2PLV1 5FLIA 3JD72 4JQTA 4MV2A 2VQUA 1UY4A 3K48A 3HIFA 2UURA 3HMYA 4ORFA 3K4ZA 2OIIA 1UOFA 1AX1A 1RUG3 2OZ6A 2Y34A 4E2SA 5CFCC 2K0GA 1RINA 3GNEA 4AZZA 3INAA 5FXWA 3ZXDA 1KGYA 4CUGA 1ZVFA 5F2WA 2VCBA 1LRHA 2XHKA 5GLWA 5I8YA 2WA3A 3FFZA 3JD71 4TN7A 4CDUC 4UBGA 1EY2A 5C9AB 4GWMA 5JCTA 3WD5A 5D1IA 3Q8CA 4RGGA 3AXEA 1V9U3 5F1RA 5J98B 3OF1A 2BNOA 1V6JA 2VMEA 4M3CB 3KV5A 4AF9A 1DZTA 1CN1A 2I45A 3WNNA 2KR2A 1KD7A 2ORXA 2R042 3HN1A 4XF1A 2VC9A 3LSDA 4IEVA 4MUVA 1SMVA 1J59A 1I3HA 3OB8A 4WM7A 2W68A 2RS31 4E4DX 3IIAA 4KBBA 1AYN2 2DURA 3J9SA 4XBQA 2R043 2QDRA 2EALA 2XH6A 4D3WA 4YW6A 1XC6A 4MVTA 4NVPA 3LCPA 4E4ZA 4IGOA 1IKPA 3A0KA 4B4QA 5JXGA 3WDVA 3NVCA 4MXWA 1VBD3 2P3IA 1WD4A 3IBMA 2XHNA 3FX3A 4AOCA 2D6OX 4IL7A 2Y60A 4H7LA 5JPNB 3OPWA 3H1MA
chains in the Genus database with same CATH topology
3KGZA 4HANA 1Y7BA 3NAPC 1VBD2 1VIWB 3THPA 2XB6C 4AQ6A 4P9WA 4AFCA 1FAYA 4GH4A 4XZPA 5FREA 5BNNB 2WNVA 4A3XA 1RHI2 4YGBA 4BIOA 2A71A 4CDXC 3PTYA 4WVMB 4KG8A 1FT9A 2HKXA 3PJQA 1POV3 2JG8B 3FFQA 3APBA 5GLZA 3I2DA 3O0WA 3V0BA 4GKXA 3S0MA 4LO6B 1BMV1 4FPOB 2DCKA 4AEKA 1SLLA 3AKRA 1PIV1 2HWC2 2UY9A 5KHHA 1IPKA 4CDUA 2GMPA 5BNPB 1HQNA 1RUE3 3WOGA 1RB8G 5L7OA 3BU7A 1RUD3 4U36A 1ZBA3 4ASMB 1G6NA 1NG0A 2O8QA 4ZKTB 4Y1UA 2CY6A 2D6PA 4R4XA 5E88A 1CJPA 4B29A 2CAUA 1W6MB 1O4YA 4Q4V3 2D5HA 4IV1C 4RFT0 4XF9A 5C8CB 4LA2A 1UW8A 4NOTA 1UIJA 4WM8A 4AHZA 4N53A 5D8AB 5T5PA 3AZXA 1LECA 1WMDA 1LULA 3VBSA 4WM8B 1O91A 3MGUA 4YZ5A 2HEWF 1H8TC 1VRH3 3KGLA 4PIZA 1N1YA 1TMF2 1WW6A 5LK7B 1VBE2 1O4TA 2K9ZA 2Z69A 2VECA 3DN7A 1COV2 1AR62 2HWC3 4XJ8A 2D44A 5KC6A 3POYA 3V65A 1SLAA 1ZX5A 4HN1A 1CAXB 5ABJC 2MNGA 2ZHMA 2JG9B 2R30A 1G9FA 1DQ1A 4N43B 4HT1T 3IT8A 5DG2A 2RR12 2SBAA 1UZYA 3MIEA 1A8MA 2ZX1A 4XXPA 3AMNA 3DPRA 3OYWB 1HRI2 2BNNA 4N9IA 4Y20B 1Z7S2 1PO22 4QQHA 1AR81 1VB2A 2HWD3 4XTPA 1BBT3 1Q43A 1XYNA 2UY8A 1A6CA 4BA6A 4I09A 5JR7B 1Q3EA 5DZFA 4ATFA 3NL1A 4K21A 5J36A 3GYDA 4WVZA 4AWDA 4COZA 4NPRA 4C91A 1MZFA 2ZGPA 3MLLA 4QX5A 4FCAA 4OI0A 2O0OA 3AP7A 3MYXA 4YVWA 3FUQA 1UZZA 5L73A 1LOCA 1NCRB 3D0JA 3I59A 3WT3A 2ARBA 2ZMKA 1LOFC 2RMU3 4FO9A 2YPJA 1NCRA 3KQRA 3VKOA 3I59B 1DGLA 1ZBE1 3R4UA 1LESA 3JCIA 3PVOA 1AYN1 1J58A 1VBC1 3VKMA 1PGL2 5JOZA 1GZWB 1H2KA 3USSA 1AUYA 5C9AA 1RUC3 3E6DA 1U5XA 1MS0A 4XJ9A 3TOJA 2VOVA 3VBOC 2PTMA 3AKTA 4LUKA 4ISRA 4BOWA 5I93A 2FHRA 2PLV3 2BTVC 3B7MA 1RUD2 3GZTB 1HXS1 1S55A 4OI4A 3GBGA 4QQLA 1ZRDA 4DINB 5GZGA 1JUIA 3B01A 1FV3A 1ND2C 4HSLA 3ZXAC 4G3YC 2VNGA 4CRQA 4E9KA 1V00A 3ZSLA 1GBGA 1G9AA 3ETQA 1AYN3 3GHMA 5A3LA 3ZSMA 1V9U1 2YMZA 1PO13 1YCIA 1UPIA 3I4IA 4UW4A 2RS12 3ZXLA 4AK3A 3WHTA 2VVDA 1O3QA 4FT8A 1IPJA 5IK7A 3MIDA 1RHI3 3WW3A 1TME1 4AEDA 1ZRRA 1G8WA 1HRV3 1QJU3 2TEPA 4CDQB 1O4ZA 3AJYA 1AL22 4YFWA 2NMOA 4KNCA 5H9SA 4DZGA 5T55A 4COVA 2WNUC 4QQOA 4AXOA 5EXOA 2JXAA 3JBG3 4YM3A 2GSYA 2YHJA 5JSOA 3U11A 3ILNA 5FLJA 1RUE2 2HWF3 3WW4A 4BCUA 3WG4A 1VBB2 1DYPA 4GMP3 3VKNA 3AP4A 1PM7A 1SBDA 3KB5A 4OI1A 2QJVA 1WLCA 3M3QA 3VZKA 2O1QA 2GNBA 5CG8A 2P17A 3AP5A 1CAWA 4B7KA 2CGPA 2D93A 2IXHA 3P3NA 4Q4V2 2DVFA 3HT2A 2AGSA 4XF4A 4N7UA 4YW2A 1KS5A 1U12A 5DDJ3 3VL8A 2AENA 2BVBA 2JG8A 5A33B 5IT6A 4CDWB 1LHWA 4Q0VA 5LK5A 1FNYA 3AMPA 4Q4X3 5LRSA 3UKVA 1QOTA 1ZBA1 4QHBA 2MEV3 2DYCA 4HPKA 2WT2A 1OQEA 3H7JA 1RGSA 2YY1A 4FTSA 1ULEA 2FMDA 3GBWA 1GFF2 2GC3A 4N7IA 4XBNA 4DRRA 4JTNA 4IV3B 2JICA 3AJZA 2HEYF 3FE5A 4UW6A 3WG2A 4Q4Y1 3SH3A 3EQEA 1WBLA 4OFGA 2QDNA 4YGDA 1VB4A 4MYEA 1OQ1A 3EJKA 3H1YA 5AFBA 2QZ2A 3AMQA 3N4MA 1EAH3 1RUI3 5KXBA 5BNQA 1W6MA 4PCRA 1FI2A 2VQAA 1GANA 1DBNA 4DMIA 4RS5A 3G7DA 4PLOA 4HKLA 4NO4A 4MXVA 1MS1A 2ZGSA 2IFRA 2B39A 1KQRA 1BEV3 2A6VA 4IV1A 5J7MA 1CX4A 1AR92 1J1TA 3KCXA 3ZPYA 1ZZ9A 1REDA 1H0BA 4Q27A 3WUDA 1R093 4KG0A 1NQDA 5A32B 1FPN1 4AI3A 3VN4A 4OHXA 3B3QE 4SLIA 3SCGA 2WSUA 1UMZA 3KZ4C 4AFAA 4Z1VA 2UU8A 3WP3A 2A6WA 4HVOA 2GC1A 2W08A 5JI9A 2B46X 2MEV2 3B9CA 3O14A 4AGVA 1O3SA 3ILFA 4JRAA 3WV6A 3ZXKA 1BQPA 1QDCA 3AX4A 5BNOB 1RUOA 4NHKA 1WBFA 2VGDA 4AEDC 1RMU1 4P5HA 2B7YA 4YSFA 4KU8A 3DPRC 3HQXA 3USUA 3N7JA 2XL7A 3R05A 4YARA 2WLPA 1H1MA 4XQ4A 3USUB 4A7YA 2ZX4A 2QFEA 5DG1A 1WGPA 2R041 4IV1B 1YI9A 3ZFGC 2XKPA 3N36A 2B42B 4B4PA 1A78A 1JW6A 4YM2A 2G9GA 3E5UA 3VBHA 4R52A 1SFYA 4Y5Z0 4PBPA 2V09A 3T1LA 1NCQC 1ULCA 4JDNA 5CFDA 4M3CE 2C5DA 3TB0A 4GMP1 2NQYA 4Q29A 2D40A 1MQTB 5FMOS 4OUMA 3H7YA 4YGEA 4BM8A 3X29B 4FAHA 5KHIA 1MEC1 4CDXA 2IWGB 2JG8C 1VALA 2Z2SB 3L2HA 3JQXA 2H6CA 4AHXA 5C4WB 3EHKA 2PHUA 4FPHA 5BNNC 5C4WA 1SDWA 4N9HA 4BYYA 1HDKA 2VMIA 5I0SA 1CJDA 3VDDB 5I91A 2WT1A 4MLOA 4PF5A 2XWJB 2D3RA 1POV1 2F6BA 2BFUS 1QJZA 1HIXA 4D7YA 1OSGA 3UK9A 4MXWB 4K1ZA 3VBFB 3RQ0A 1CD3G 1B35C 4KGGA 3W58A 2OA2A 1K5MC 4YM0A 4HFSA 2WZR2 1CESA 2WA4A 1PIV3 1UF2C 5JLVA 1DZRA 4BZ4A 1BBT1 1W6PA 1ASJ1 2HWE1 3AYEA 3UKNA 4CDWA 5HCFA 2BQPA 1DDLA 4ASLA 1W6PB 2D6KA 2GH8A 3CJXA 2PHTA 2DUOA 1CPNA 4P9JA 1X7NA 4JTOA 1OQDA 3H9AA 4I0WB 1COV1 3M3CA 4EWEA 2ZZQA 2WNUA 3FWEA 5JSPA 5IK8A 3MLJA 3ZO0B 2NLRA 3B00A 1VBB3 5CADA 2RR11 4QPGB 5JZGB 2ERFA 2R072 2RJLA 1ND2B 4WV8A 4QU2A 4M3CF 1LHNA 2AREA 3SNMA 3P3PA 1YI7A 4BHPA 2XVLA 3MF9A 3R4DB 4Q4X2 4Q0QA 3WDTA 2YDEA 4XIOA 1YYNA 2C1FA 1OKQA 1ZBE2 3WDXA 5E16A 5BNOC 5HCBA 3MZHA 3PVBB 3FZ3A 1BEV1 3NV4A 4H55A 1LOGA 3CLPA 1OPMA 1TQ5A 4KGQA 5KHKA 1HXS3 4JAAA 2VH9A 1AR71 2YUEA 4K3UA 4OHZA 2WS93 1H4HA 1PK6C 1CAXA 1WLTA 3WXPA 1MACA 2CL2A 1O3RA 1F5FA 1AR61 4FVVA 4P14A 4LHNA 1AYM3 1UPSA 5I0RA 1N1TA 4YW4A 2MHFA 3V56A 4WZCA 2Y26A 3WQ0A 1EV11 1D4M3 3N3HA 1WMFA 4JC1A 4BLJA 1R1A2 4TWTA 3H1WA 1QXRA 4LBQD 4YZ1A 3FHIB 1IKQA 4GXLA 4PQ9A 1AR73 4OHVA 2JDZA 2RMU1 1TME2 1FXZA 2DVBA 2PHXA 3CJIA 1EV12 2EAAA 2ZMLA 1C8NA 4YLZA 1TE1B 2XVGA 5T50A 2V5YA 4NR1A 1W6NB 3B9IA 4BLIA 4CEYB 2Q1ZB 3LGRA 5SV5A 4LR4A 4IV3C 2ZKNA 5GM0A 2D7FA 4GIQA 3OD4A 1QQP3 4N43A 5BNPC 2PAMA 2BEOA 4RHV1 3VDDC 2DF7A 2YV8A 3CO2A 5CIRA 3D5OA 2QNKA 1ZM1A 5CG9A 2X5IC 1QKQA 2GC0A 3BOWA 4Y20A 3S7EA 4D69A 2A6YA 5BNPA 1ND3C 4EN7B 2GZWA 4J1WA 1H9PA 3SISA 1AL23 2D6NA 1R1ZA 3TN92 3OD0A 2WFF3 4AHWA 4LBJA 2RS13 4JCKA 3L2YA 3VHRA 4Y1VA 1V6KA 1VBC2 2D6MA 2IXKA 4GULA 4KL1A 5ACA2 2KA3A 3A4UA 4LBLA 2XJQA 3J8F1 4HK8A 1XRUA 4FPLA 4OVEA 5J48A 1QQP1 5GZEA 5FOBB 3BIWE 4LEJA 1JBCA 4KWJA 4FPGA 3VHNA 3Q9OA 2VNOA 4IEQA 2LTNA 2RM22 3D82A 1KFUL 1D0HA 4QM8A 4Q4W3 4YVWB 4WVWA 4CP2A 4UXAA 1HQWA 2ENRA 1CIWA 3RI9A 1S2KA 1MVEA 4NHLA 3ZFGA 2D6LX 3HWJA 4FSJA 1TMF3 2AYHA 3MIGA 4IEZA 2ZGQA 3AFGA 3V0AA 2PHDA 1NLSA 2RM21 2OZJA 1NE6A 5CU1A 4YG0A 3POSA 1UU4A 4IESA 4F3JA 5C33A 2LM3A 1GNZA 2XJTA 4HMZA 1NY71 3QH6A 1BKZA 4IEWA 1VBE1 1WD3A 3VV1A 4Y1YA 1MZEA 1PGW2 2R071 4HN0A 2TNFA 3MLKA 1QNWA 1IS3A 4OHYA 1Z78A 1H4GA 1ZBA2 2A6ZA 3VUOA 4YW1A 3VKFC 2IXJA 4X8NA 4I3PA 1VBA1 2E6VA 3VBUB 2ZGTA 1S0JA 1NY72 1R091 2TUNA 4RD7A 5JOXA 3H3UA 2VW2A 1OOPA 1BEV2 2DVGA 2D43A 5EYYA 1Q8OA 4ZU7A 1QY4A 2PHRA 3D8CA 3V64A 3VZLA 1QGLA 1CAWB 3OJBA 2P2KA 3WINE 4C0HA 2VG9A 1V6IA 4EWDA 4MX3A 3B02A 5KXCA 2YGMA 1UU5A 3O5SA 4ATEA 4W65A 3OY8A 2JX9A 1PO23 1LHOA 3BOPA 2P3JA 3MI8A 1BVP1 1PMIA 2XWBB 4MGZE 3RG0A 4RL7A 3ZN4A 1RTVA 5KXEA 3WW1A 4AVAA 3KT4A 1XE8A 4CDQA 5FOJB 2C0ZA 1R1A1 4XJUA 4M01A 1DQ0A 4E27A 2B8MA 4YZ3A 2ET7A 1FMD3 4AGGA 1MR5A 3WUCA 1KFXL 1H1AA 1XYPA 4FPYA 2ET1A 4XJWA 4Z2WA 4K7JA 2PLV2 3RMXA 1QJX2 5L36A 4K6BA 1JOJA 1DQ2A 3AK0A 2YC0A 1RUC2 2VW0A 1Z7S1 1LU2A 4CZSA 1IHMA 3FLRA 4LBQA 1FPN3 1UIKA 1Y3TA 3VZOA 1ZZ7A 1RIRA 1AR72 5BNNA 1H2LA 2BW8A 3LA3A 4LBQB 1UN1A 1LKNA 1R081 1LEDA 1D4VB 3PLQA 4XW3A 3H8UA 1R1A3 2MPFA 2Q30A 5HXVA 2WT0A 1MEC2 3OBRA 4A7KA 3FLPA 5EYXA 4AFDA 1AYM2 4JGZC 1W6OA 4XFCA 1YFWA 2JG9C 2OYZA 4Q1PA 3ZYGA 2DWRA 2PHWA 4BQ1A 3DV8A 3M3EA 1AR91 4JGZB 2VW1A 4AGRA 2NZ9A 4BH9A 1QQP2 1PK6B 1X36A 3FBYA 1H2NA 2FZ1A 1XU1A 5KWRA 1ND3A 5E89A 3N7KA 3D6EA 2GNDA 4YG3A 2JKBA 4RR3C 4Q26A 5BV6A 1PO12 4FXGB 1XU2A 4X6QB 2XL9A 3ZMNA 2RS11 3TN93 1ASJ3 2HWE3 3IPVB 2PHLA 3JBG1 3JQWA 4IEUA 3FJSA 4Y4YA 1HRV2 1ZZ6A 1T6GC 4WM7C 4XOGA 4FPEA 4R9CA 1D0GA 3PVNA 4Q8LA 1Q8PA 2R073 3NV3A 4Z07A 2ZAHA 2DCZA 5T5OA 2AZ5A 1YIPA 3M4FA 3M70A 4TLFA 1FX5A 3IM0A 4I30A 5H9RA 4FPKA 2XBO2 5KC5A 3NV1A 1JYCA 2X29A 1ENXA 2VOXA 3ZMOA 3ZFFC 3VBUC 3POWA 4PDWB 4B8EA 3TNPB 2PYTA 1SLTA 3AZVA 3DPRB 1OI6A 3S30A 3WDUA 1Y43B 5DDJ1 2QZ3A 2R1BA 4QPYA 1ND3B 1APNA 1EP0A 3AM2A 4DRVA 1KJRA 4P9YA 2QKDA 1AF9A 2VMGA 4CEWA 3VZMA 4QPIA 4Z8BA 4CEYC 2ZMNA 2WQ4A 1A3KA 2DCTA 1MS9A 2R0HA 2JE7A 3HD8B 5CNAA 5CFCB 1ZZ8A 1VP6A 3CJIB 4AW7A 5T5LA 1DLLA 5FQ0A 1DQ4A 1V6OA 2RE9A 4CEWC 1QOOA 3RYPA 1ULGA 3RRDA 1YLLA 2W0XA 4LE4A 1AJOA 3U4XA 2R6QA 3ZSKA 2Y0IA 2LALA 1ENQA 2ZACA 2RS53 2WIIB 3E6CC 1WA4A 4YGCA 1GYKA 3WP4A 4YVSA 5BYNA 3JUUA 3PMSA 4R9DA 3H50A 4H7MA 1CGPA 1HRI1 4LBKA 2E7QA 1H2MA 1EV13 4AI2A 5JPMB 3UV9A 4XFHA 5HI0A 3QLQA 1RUH2 4IEYA 4ITCA 5IUQA 5BUVA 5F6KA 3AXDA 1LOFA 4QD2A 1K5MB 5CFDC 4F7ZA 1DHKB 1H30A 3RI8A 1PNGA 1REEA 3PVEA 2IZWA 4YZ4A 4DXZA 1RC6A 3RMYA 4CDQC 3LOBA 3IDBB 1QXPA 5H9QA 1CQ9A 2PAEA 5FRAA 1RJ7A 1B09A 1DYKA 3MF6A 5FPZA 4EV0A 3FC0A 5ABJB 1C8M3 3BCWA 2GH2A 2B45X 1OA4A 4LBOA 1OLRA 2DUPA 2CGNA 4H14A 1NCQB 1D4M1 1ULFA 1FYUA 3NJZA 3M1HA 3NV2A 4YW5A 2WQZC 3I7DA 3B69A 3NAPB 1ND2A 1HXS2 3ES1A 1JYIA 2GMEA 1F2NA 1X50A 4R9BA 3RDIA 3KSCA 1SLIA 2R062 1Q5OA 1C5IA 1U5IA 2VQ0A 4JGYB 2R32A 3W9AA 5GLUA 2I2SA 2CWMA 3R0RA 3TYJA 4JDOA 1IZ3A 1DGRN 5TSWA 3ZYIB 1XNCA 4XILA 3UJOA 1I1EA 4P9LA 2ES3A 3JU9A 1X8MA 1S2BA 1L3JA 1G86A 1C1FA 4ES9A 4KH9A 1IS4A 2Q4SA 4OI2A 1CAUB 4AEDB 4M3CA 4XIKA 1W39A 3EO6A 2W52A 4HPKB 3VGIA 4JGZA 3OGJA 2AH2A 4RQPB 4OZXA 4CDWC 5BXXA 4M00A 2ZJCA 1V70A 1AVBA 1C4RA 4WM8C 4XQWA 1NCRC 1H8TB 1HRV1 4Y24A 1AL21 3DKWA 3LB9A 3VBSC 4PLNA 5JOWA 1LOEA 3HT1A 2I74A 2Y38A 5GALA 1H8TA 2HEVF 4MGKE 4BE3A 4QPGA 4CP1A 2LUWA 3DUIA 3LSEA 3ALQA 4GWNA 4COYA 4RR3A 4RS5C 1GZCA 1RUE1 3BTAA 1POV0 2ZGNA 4AQTA 2RS32 3IPVA 4IEOA 3CNAA 5E8AA 3AZYA 3OY8B 2PQQA 4I02A 1DGRA 1RUG2 4LBMA 2BPA2 1MZ6A 3FBMA 2A5ZA 1W6OB 1PGW1 4H3WA 1G9DA 2QUOA 3NW4A 3B93A 4OUSA 3G6JB 5BY5A 1LR5A 2BGCA 3A0NA 4EN9B 4MGIE 2JE9A 2BFUL 1N3QA 4Q8KA 2ATFA 4HL0A 3GBFA 3D0SA 4FQZA 3VLBB 1ONAA 2A3XA 1KJLA 5DUVA 3RYKA 1I6XA 1U5ZA 4P9IA 5JVVA 5JDBA 2HWF2 1H8VA 4XETA 3CL1A 3S7IA 4MZUA 1IOAA 5JI7A 4Q4X1 4PLMA 4XFAA 1MS3A 3T1MA 3IWZA 1J3PA 2R1DA 2XJVA 1OHFA 3LKJA 3ME2A 2BWCA 2UYAA 3GF6A 5F9TA 4IEPA 5DXDA 1AX2A 4RR3B 3WG1A 3KCYA 4Q4Y2 4QPIB 4AHYA 2PA7A 3RYRA 1B35B 4J1XA 5FMOL 4QPIC 4EN8B 4D7SA 2G4IA 3J26N 1AXKA 4XF3A 1RUH3 1EAH1 1RUI1 4COUA 4GALA 2E51A 3ACLA 3URFA 4CTEA 3J8F2 3AYCA 3WY6A 1QXJA 1E57A 3VBSB 4QGLA 1QH7A 3C3VA 1NA1A 1BVVA 5J37A 5K0UC 4FOWA 2GNTA 2BNMA 2DU1A 4DFSA 2DFCA 3TWIA 4IV3A 4BWOA 3QBQA 1SLBA 4YG6A 1RITA 4J6GA 2ZX3A 1LODA 1QJX1 2XLGA 4K1YA 3M3OA 4HKWA 3WVJA 4MSVA 1OLQA 1ZRFA 4OLLA 4U2AA 4CDXB 3W59A 4C90A 4FPCA 1S0GA 4JGYC 4D7TA 1NOVA 2EXJA 1M4WA 1NLRA 3ZSEA 3RNSA 2MEV1 5B2GB 2VOWA 5C8CA 1VAKA 2ZOEB 3AMHA 1LCLA 2UWBA 3VBRB 2D3SA 4E4ZA 2WNVC 1WMEA 4GQ7A 1RUJ2 1XQNA 1HRI3 5AFEA 3WHUA 4G9SB 4GKYA 1RMU3 2XG3A 3VBHB 4E2GA 1FOD2 1R092 2DFBA 3RPQA 5GLVA 1QWRA 4LBNA 5J3UA 3ZX7A 2A75A 3ECQA 4V1PA 4DB5A 2DCJA 4XYXA 1MQTC 3WW2A 2ILMA 4N90A 3RJRA 4DY5A 1DIWA 1K5MA 2H0VA 3GZAA 2DVDA 4XMIA 4BIFA 1QU0A 5EV7A 4JV4A 4XFIA 4N43C 1EPZA 1W6QA 3M3IA 1WCKA 4DNYA 1QF3A 1V6LA 4GA9A 4IETA 4URTA 3CU7A 4C0BA 3VBOB 1LENA 1S0BA 5JIAA 1DG6A 2GAUA 2HWD2 4RHV2