2IZWA

Crystal structure of ryegrass mottle virus
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
178
structure length
178
Chain Sequence
QYGDITPAKNSGSLVRVTSSATAGTEVSGTVLFNVRNATELPWLSGQGSRYSKYRVRYAHFTWEPIVGSNTNGEVAMAMLYDVADVTSITIERLMQTRGGTWGPIWSPTRKRLSYDPEHASLPWYLSGVSSGAAAGNIQTPFQIAWAAQSSLVSTTLGRIMAEYLVELTDPVDVTINQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Three-Dimensional Structure of Ryegrass Mottle Virus at 2.9 A Resolution.
pubmed doi rcsb
molecule tags Virus
molecule keywords RYEGRASS MOTTLE VIRUS COAT PROTEIN
total genus 44
structure length 178
sequence length 178
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2izwA00
5K0UC 1NCQB 2TBVA 3VBFB 4Z92B 1QQP3 5L7OC 1ASJ1 4Q4V2 2RS31 2RS52 5L7OB 5J98B 1PIV2 1ZBA3 1RHI3 3VBRC 1H8TB 5CFDB 1RUJ3 3CJIC 4CDUA 4CEYA 4QPGC 1AR71 1RUF1 5BNPB 3VDDB 4WM7B 1POV1 3VBOB 1RUJ1 4PDWA 1AL21 2X5IB 1BEV3 4EJRA 4QPGA 1PGL1 4CEWB 2RM23 4GB31 3VBSB 1QJY3 2HWD3 1FOD1 1B35A 1EAH1 5FOJB 1PVC3 1Z7S2 2HWD2 1TME1 1R1A3 2PLV1 1AR81 1HRI1 4RQPC 3VBFA 5JZGB 4JGZC 1NCRC 1EV13 5C9AC 1RUH1 2BFUS 2BBVA 2RMU3 4CDWB 1D4M3 5A32A 4WM8C 1HRV2 1RUE2 5BNPC 1AYN2 4CDXB 2R061 1PO12 1D4M1 1MQTC 4LLFA 4CEYB 4NWWA 1PIV3 1ZBA2 1RUI3 1ASJ2 4YVWC 5AC93 1CD3G 2HWD1 4RHV2 1PVC1 1QJX1 1A6CA 1K5MA 1FOD3 2HWF2 1AR73 4GB32 1OOPB 1ND3C 1NCQA 1R083 3DPRA 4Q4V3 1BEV2 1ND3B 4Y4YA 2HWB3 4GH4C 1AR61 1RUG3 1RUG2 1IHMA 3JBG1 3VBUC 1AYN1 2FZ2A 5C8CB 4YVWA 1VBB3 4Q4X2 4IV1A 2R072 1QJZA 1HQNA 1VBE1 5GKAC 1RUC3 1NY71 1X33A 2MEV2 1RHI1 1RVF1 2XBO1 4RQPA 3VBFC 4AEDC 5AC91 1BMV2 2HWE1 4N43A 3J8F2 3IDEA 1RB8G 2RR11 2ZTNA 1MQTA 2HWC3 1R093 2VQ0A 1OHFA 2RM21 1QJY2 1C8M1 1FMD3 5J96B 4WM7C 3NAPB 2RS13 5A32B 1OOPC 3VBOC 5D8AC 2HWC1 2WFF3 1VBC2 2HWB1 3HAGA 1VBC3 1VBE2 1EV12 4JGYA 4Q4W2 1RMU1 4Q4Y3 1QJU2 1RUI1 2RS12 1TME3 2ZZQA 1FMD2 5BNOA 2GH8A 2HWC2 4Q4W1 1PO11 1EV11 1HXS1 4CDXA 1NA1A 3ZFGA 4Q4V1 1TMF3 1RUD2 1BEV1 1QJU3 1C8NA 1RVF3 2XBO3 3VBOA 1AL0G 4CDQB 5BNNC 1VAKA 4Q4W3 1TMF2 4CDQC 4N53A 2R063 2WZR2 1ND2B 1PGW2 2HWE2 2MEV3 1RUF2 3JD73 4AEDA 1R082 1VB4A 1F8VA 3TN92 1CJDA 1HRV3 1RUE3 1C8M3 1WCDJ 4YVSB 1V9U1 2R041 2MEV1 1RUH3 4RHV3 1RHI2 2WS91 4GMP0 1AL23 1AR82 1BBT3 1HRI2 1R081 5ACA3 5C4WA 1PGL2 1MEC1 4IV3B 4JGYB 1POV0 1ND2C 1NG0A 5C8CA 2X5IA 4QPIA 5DDJ3 1RMU2 1ND3A 2PLV2 1AR92 2RM22 1TME2 4RFT0 3ZFGB 3S6PA 1HXS2 5C4WB 4JGZB 5C4WC 3LOBA 1H8TA 1V9U2 2R042 1RUC2 5C8CC 2R073 2WS92 2RS32 1NCQC 4Y5Z0 4QPGB 2R062 1D4M2 1K5MC 1ZBA1 5C9AA 1BBT1 3TN91 2RS53 4N53B 1COV2 1R1A1 4GH4B 1COV3 3VBRB 1RUD3 4N53C 1QJX3 5ABJA 1VRH3 1B35C 5BNPA 1Z7S3 4WM8A 1POV3 1VB2A 4N43B 2RS33 3CJIB 1AUYA 1M06G 4PDWC 1NCRA 1K5MB 1RUD1 2HWE3 4GMP3 5FMOL 1EAH2 4YVSC 3ZFEC 3JBG3 2WFF2 3JBG2 1RUG1 2IZWA 1PO22 1PO13 4Q4X1 5FMOS 4JGZA 4CDUC 1ZBE1 1QQP2 4WM8B 5BNOC 2ZAHA 4GMP1 5LK7B 3VBRA 1AR62 5K0UB 4RS5A 3ZFEB 1QQP1 5C9AB 1F2NA 4CDWA 1BBT2 1MEC2 4RQPB 2Y26A 1EAH3 1VBD3 4JGYC 5L7OA 1B35B 2XPJA 1RUC1 3ZFFC 4N43C 4FTSA 1BMV1 1NA1C 3CJIA 3VBSA 5JZGC 1NA1B 1E57A 3JD71 1W39A 5ABJB 5CFCC 1R1A2 1ZBE3 1HX6A 4CDUB 1RUJ2 1H8TC 3DPRB 4IV3A 1VRH2 2DF7A 2RR13 1ZBE2 3NAPC 5CFDC 3JB4C 1RUF3 3JB8A 1VBB1 4NWVA 2RS11 1OPOA 1QJU1 1RUI2 4RR3A 2WFF1 1AYM1 1DDLA 2X5IC 1ND2A 4BCUA 1AR72 2R043 1V9U3 3JD72 3J8F1 1HRV1 1RUE1 4CDQA 1TMF1 1AYM3 3VDDC 4QPIC 4RHV1 4RS5C 1AR93 1RUH2 2GSYA 5BNNA 3VBSC 5JZGA 3VBHB 1X36A 1RMU3 5BNOB 1VBA3 3TN93 1FPN3 4CDXC 3ZFFA 3VBHA 1VRH1 5ACA2 2WZR3 4PDWB 1VBD2 1VBA1 3VBUB 4IV1B 3ZFEA 1HXS3 3ZFGC 1MEC3 5D8AB 4WM7A 2WWSA 4FSJA 1C8M2 1FPN1 3ZXAC 4CDWC 5CFCB 2PLV3 5D8AA 1R092 1OOPA 1VBA2 1VBD1 1PVC2 4FTEA 4Q4Y1 5DDJ2 2HWF1 1QJX2 3J8F3 1COV1 1VBB2 4Q4X3 4RR3B 2RS51 1PIV1 1NCRB 4YVSA 1AYN3 2R071 2WS93 3VBHC 3FBMA 2RR12 4CEYC 4SBVA 5K0UA 2BUKA 2RMU2 4GH4A 2WZR1 5ABJC 3VDDA 4QPIB 5AC92 1AR91 3VBUA 1RVF2 2XBO2 1PO21 1ASJ3 5CFDA 1AYM2 2BPA2 1GFF2 1Z7S1 3M8LA 4GB33 4IV3C 1NY72 1FOD2 2HWF3 3ZFFB 1FMD1 2FZ1A 4RR3C 1R091 5BNNB 5ACA1 2QQPA 1PO23 4IV1C 5DDJ1 4Q4Y2 4AEDB 1AL22 1AR83 1HRI3 1VBC1 4YVWB 1NOVA 1VBE3 4RS5B 4CEWA 2HWB2 5A33B 3NAPA 4CEWC 5CFCA 4FTBA 2RMU1 2WLPA 3DPRC 2BFUL 5A33A 1AR63 1FPN2 1PGW1 1QJY1 1MQTB 1SMVA
chains in the Genus database with same CATH superfamily
4BLIA 2B9UA 3UT0A 5GZGA 1NCQB 2TBVA 5D1IA 3S57A 3JU9A 5F6LB 2LM3A 2QTWB 4I02A 4MGSA 1JI6A 3TRSB 5A3MA 4GQ7A 3PTRB 5IUQA 1ASJ1 5HCHA 3O12A 5GLWA 5L7OB 1UN1A 1PIV2 4R9BA 5FJHA 2XJVA 1H8TB 2QE3A 1VRBA 4AFAA 2FMDA 3AFKA 4DXZA 3U0ZA 1L7QA 1XYPA 1ZRDA 1RUJ3 3PJQA 1WCQA 4INDA 5FP9A 5FZMA 4DXSA 2VUJA 3BIWE 1NT0A 4CEYA 2V09A 1ULPA 2WO2A 3FC0A 4M4RA 1JZ4A 2WL1A 4BQ1A 4XXPA 2W68A 5GZCA 3ZIWA 1QNYA 5FYIA 2OZ6A 1WKYA 4KGQA 2VULA 4Q8KA 2XVLA 3DF0A 5FP4A 2Y60A 1UIJA 2ARBA 3B93A 2X5IB 3K3NA 5CB7A 1U5ZA 4ARXA 5F9TA 3VDBA 5IW0A 4URTA 1NZCA 1KFUL 1QJY3 2VNGA 5FY8A 3VBSB 3FUOA 1NLQA 2ZXQA 4LO4B 5DUVA 5FOJB 1SHWB 2FMYA 4XXAA 3CBNA 1KS5A 5A7WA 5J7MA 1W05A 3T0BA 4RQPC 2FCUA 3M3QA 3U4SA 4H7LA 5C3OA 1RUH1 4ZXKA 2NZ9A 4XEZA 3O0XA 2BBVA 4ISRA 3TNPB 5E89A 4WVZA 4MG2A 4YRDA 1HRV2 2WN2A 4HFSA 1LENA 2AUYA 1OH4A 1PO12 4GD4A 4Y33A 4XFGA 4NOTA 3MW2A 4M3CA 3WW2A 5BNQA 2AEYA 2XH6A 5F3IA 3H0OA 3RQ0A 1JZ6A 1ZZ8A 4IUGA 4QPWA 2BNNA 4XJZA 5GJ6A 3ZXJA 5JPNB 4EN6B 1PHMA 3NV3A 5JXJA 4Y26A 3AZXA 2GMMA 3I4IA 4KWLA 3RYPA 3WOGA 2D3RA 1PVC1 2IXJA 1QJX1 2EIDA 1PNGA 1A6CA 1IOAA 4NHKA 5LY1A 4AL9A 1FOD3 4H55A 4FXGB 2YY1A 3IDBB 2VXRA 4FPHA 2JIGA 2PHXA 3AP7A 4KG8A 5IVVA 3DGTA 4XIKA 4E2QA 3OPZA 2JD9A 4QHOA 3VUOA 4OI4A 3AL5A 1MZ6A 2WNVB 3GNEA 3WXPA 1HV1A 3RYRA 2HWB3 4XUNA 4ZKTB 1MVQA 3VZJA 4EN7B 1AR61 3SCGA 1IG3A 1HJGA 1KDKA 1ZA7A 3KV4A 4AFMA 5FOBB 1RL3A 3H7JA 3MUZ1 3ZYBA 2Y6KA 5J09A 2FBEA 4YG0A 4K40A 4IV1A 3RNSA 2VQUA 1VBE1 5EWSA 2QFEA 5FYBA 1ZZBA 1ULFA 1NY71 2GMPA 4D6QA 5FPXA 3KSCA 4A7KA 2MEV2 3AM2A 1V6KA 3ECQA 2DU1A 5T5JA 4AE2A 2YDEA 1CAUB 4FP3A 3WUDA 2GNTA 4W6WA 4RQPA 1G8WA 5ISLA 2D6OX 2ZOEB 3AP9A 3ZLIA 2QKDA 2BOJA 5T5LA 3ZMNA 2L9LA 2WYFA 4N43A 4CXWA 1W8ZA 1G9FA 2O1QA 3BGAA 1D0GA 3IDEA 4TWTA 1LOFA 2WO7A 5FWEA 4B29A 1RB8G 3TBDA 4CPBA 3F2ZA 4XBNA 1YJKA 4BQWA 1OHFA 2RM21 3OG2A 3WG1A 1FMD3 3CO2A 4QB2A 4UI9L 3QCWA 5DUUA 3LEKA 3WQ0A 4XFIA 4JV4A 1OC1A 5EXOA 4GKYA 1OH3A 4XJWA 3SEPA 2HWC1 5LBFA 3J26N 4NIDA 1EV12 3MO4A 3OOXA 3MIDA 3LEIA 2CY6A 2YPJA 4I3PA 4W8JA 1XJAA 2MPFA 1QKQA 2VZRA 2B46X 1JYWA 2LUWA 2ZZQA 5BNOA 5SV5A 2VOKA 3OEBA 1YFXA 2RDSA 5E6HA 4Q4W1 1EV11 3ZXEA 1W04A 3T4VA 4CDXA 3ZFGA 2VBBA 3H3ZA 3WG2A 5A6ZA 1RUD2 1H6YA 2HYXA 4YNIA 1C8NA 1RVF3 4AAPA 1G9DA 4X6RB 2AENA 3AFGA 4MX3A 2RE9A 4AI2A 1TMF2 2BGPA 4FXKB 4NRPA 4X6QB 5FZLA 3D5OA 4CDQC 2XOMA 1W2UA 3ZM8A 2D98A 2FHRA 4KWJA 2WWJA 2WZR2 3W21A 5GZDA 3AC0A 2MEV3 3ES4A 1QF3A 1RUF2 1UPSA 3MW3A 4LKFA 4E4HA 2WZ8A 4L0PA 3RS6A 2YC2A 3N7KA 5IFPA 2QQWA 4JC1A 5C70A 4CU8A 1HRV3 2WQ4A 1GR3A 2VPVA 4YVSB 2JDYA 5AVPA 2UYAA 3QLQA 3RZZA 3AJYA 1YFUA 4BE3A 2VM9A 3CZJA 3KGLA 3PU8A 3OGGA 3NWKA 5H9QA 1MS3A 4QQLA 1WA4A 3B9CA 4LKEA 4RGGA 1ZREA 1AR82 2V73A 4W6YA 1AJOA 1UY4A 1CZSA 5C4WA 1PGL2 1GQPA 1MEC1 4QDQA 1LR5A 3VZKA 2C0ZA 1V0AA 4JGYB 3LIGA 4LLOA 1ST8A 5FZCA 5A1LA 2ZX2A 1RMU2 4XURA 3T3YA 2ZX3A 3RI9A 4R9AA 4ONUA 1ALYA 3TOJA 3WY6A 1WA6X 2PLV2 3USUA 2PXJA 2DCKA 2JDMA 5A3UA 2ZHNA 1WWYA 4RFT0 4E8DA 5C6CA 2Q8EA 2VVEA 4QKBA 1W0NA 3C7HA 2JDUA 1HXS2 1UZVA 4QWNA 4JGZB 3KVBA 2XQRA 4WVMB 1QJFA 3E6DA 4J25A 2V4AA 1C28A 2UU8A 4HONA 2E53A 1F35A 4YGCA 1H8TA 1WLCA 1GQGA 1RUC2 2ZJCA 1OXCA 3RRDA 4BA6A 4YYOA 3I97A 1XNTA 1UOFA 2CL2A 2Y33A 1NCQC 3KB5A 4QKNA 3VHNA 2J22A 2VBDA 2XWJB 2GH2A 5AFEA 5IVJA 3ZXKA 5C3RA 1ZBA1 4YW7A 2O8QA 3MEPA 4NHLA 5F37A 2W1QA 1BBT1 2H0BA 5GLTA 1ENQA 1PM7A 3ZYJB 4CUAA 3S30A 1H2MA 4R4ZA 2TUNA 4GH4B 1XNDA 4DEQA 5FP8A 1RUD3 2BV4A 3GHMA 3WQ7A 4NROA 4BHPA 2VAUA 5LA1A 1D7PM 5BNPA 4LMFA 3RZHA 1Z7S3 3ACGA 4TLFA 1JBCA 1DQ5A 1VB2A 3LDKA 5CKMA 1JZ2A 3O1OA 1OMIA 3DN7A 3IIIA 2OT7A 1DQ4A 4L2NA 4PDWC 1NCRA 1CAUA 2O14A 1RUD1 2KXLA 3HR9A 5CVRA 4DO0A 3WINE 3VZMA 1ULEA 4P5HA 2WNVC 1UKRA 2WFF2 3AKSA 3JBG3 4NHXA 4O9EA 5DG2A 5FJKA 4CCDA 4D7SA 1RUG1 2VCAA 3EHKA 1PO22 5FUIA 3T30A 2Z5WA 1SEFA 5T3NA 1QU0A 1JOBA 1ZBE1 2EVXA 2IXHA 3AL6A 5T50A 1QH7A 5FBJA 5A3LA 4EN0A 3ENRA 1W06A 2ZAHA 1UU5A 1CIWA 3I2DA 3OBTA 4LHSA 5F8PA 4J1XA 4LBQA 1OVSA 4JHTA 2Y6FA 5EIYB 1WMFA 1QOSA 3ZMOA 1OURA 4X8NA 2ID4A 3MFAA 4XTPA 5EHDA 4IL7A 5C9AB 1GP6A 1HDKA 3LB9A 4B1LA 1UYZA 4XUQA 1MEC2 1GOFA 4E27A 2QQLA 1EAH3 3T0DA 1VR3A 1PZ9A 1X8EA 3C8XA 2VZOA 3NNLA 3S0MA 2P6CA 5L7OA 1SLTA 3WG4A 2A3WA 1OLMA 2VZPA 4XCBA 4QDRA 1ZRFA 1Q8VA 4AEJA 5FK8A 1GP5A 4AEKA 4HXCA 2WT2A 3VHOA 4ES9A 2ZKLA 1LEDA 3CJIA 4AXOA 3OY8B 2ZEXA 3J7LA 1CIYA 4HK8A 1NA1B 1NXD1 2C24A 1W9WA 4Q1RA 4QXHA 3FFQA 1FNYA 1ENRA 3IN9A 4PIZA 3I3EA 2R0FA 5TSWA 1U5YA 4PLMA 5KHJA 2IVIB 3WG3A 4C90A 4CDUB 4C0BA 3NJYA 4BOWA 1S0CA 3WD5A 1H8TC 2RJ2A 3VD3A 4AQSA 4PI0A 4XHBA 5LZ6A 1GUIA 4Z8BA 3N9OA 1WBFA 3A4UA 3AXDA 1NE6A 3WNNA 3QOPA 4W4ZA 2XJSA 3AB0A 5F2SA 3BTZA 1VBB1 4NWVA 2RS11 4DMIA 2SLIA 4Y1ZA 1S0BA 5FZKA 3BTYA 4RR3A 4IEPA 2Q8CA 1OT5A 1SLAA 4QB6A 3ZSJA 5EZWA 1CJPA 1AYM1 1SLIA 2X5IC 3KCCA 4MADA 4OHYA 3AMNA 3GM8A 1FV2A 1BKZA 1AR72 1V6OA 1VMHA 3MGUA 4BCUA 2HEYF 5IK4A 4PQQA 3CU7A 4WVVA 2VH9A 4GWIA 1NLSA 1HRV1 4CDQA 3O1UA 5I91A 3UGHA 1IPKA 1DGRN 3A0NA 4QPIC 4PLNA 5DXDA 4RHV1 4P00B 3ZXFA 5FV3A 3ABZA 2CAUA 4ZONA 1J1LA 3O1TA 2CGNA 1XSRA 5I0UA 4D6RA 4PCRA 1X9PA 3MPPG 4LR4A 3DUIA 5FZ8A 2VVDA 2VVFA 5FXWA 4RA0A 5IWFA 3VBSC 3RZJA 1OVPA 1RMU3 5BNOB 1VBA3 4QB1A 1URXA 2ORZA 4AGRA 4GJYA 1C4RA 1REEA 2QQOA 1GNZA 4LUMA 3BYWA 1VRH1 2JJ6A 3AMMA 3N7LA 5FYMA 4DY3A 4PDWB 4NIHA 3EMRA 2BVVA 1TE1B 2RJLA 3H7YA 4UW3A 3LKJA 4QGMA 5I0RA 3ZFGC 3AZWA 3INAA 3MF6A 2J1VA 5D8AB 2JICA 1GWMA 1E5HA 2WJSA 2YZ4A 2W0XA 3H8OA 2W94A 5DUXA 4AGVA 1FPN1 4BQYA 4P9GA 3WV6A 4Q1PA 5FKBA 2CGPA 1W6OA 3SCHA 3I2GA 3K77A 1DZRA 1R092 2ZZJA 3B00A 4FVVA 3BU0A 4FTEA 2GP5A 1XE8A 4Q4Y1 4GULA 5LEJA 4WZFA 5DDJ2 1NKGA 2EIGA 3J8F3 1UNBA 2X29A 3MUY1 1NX9A 3BVCA 1COV1 4U2AA 3UKVA 2QVSB 4AHZA 4JCKA 4AVAA 2VMGA 4X8PA 1PNFA 1O5LA 2RS51 3HJRA 5C5TA 1PK6C 1J3QA 3WW1A 1IG0A 5IVBA 4MHUA 2VOTA 4XZUG 3C3VA 4OHVA 2AACA 4YW5A 5C3PA 2BP6A 2VQTA 3LZZA 5A7QA 1T2XA 2G9GA 2V5DA 3GHNA 2PAMA 4ATFA 1V6LA 2WS93 3NQHA 4QX8A 1RUNA 3KS7A 3MYXA 1D0HA 1GKBA 3U14A 4B1MA 3ALQA 4Y22B 3SNMA 2BUKA 1XXNA 1LESA 1KEXA 1MACA 4M00A 4Q5OA 1W6MA 4A7ZA 1DLLA 1WMEA 3N9PA 4AYUA 1O4YA 2XHNA 3LA2A 2XLAA 4QPIB 1AR91 2IXCA 3M2MA 3VBUA 4GWNA 1PO21 2DFBA 5CFDA 2OX0A 1AYM2 3S5AA 2BPA2 3N9NA 1Z7S1 1GZCA 2C5DA 5LBCA 1F15A 2WABA 3ZSEA 4DRVA 3U78A 4YZ2A 4DNYA 2ZHMA 1MPXA 2DYCA 2P34A 3VL9A 3M4FA 1A8MA 3VD5A 3DYOA 3ILNA 1EPZA 3TNQA 3MI8A 4XMIA 5BNNB 3PVBB 4PLOA 4RL7A 4UW5A 5FYTA 3FWEA 2ILMA 4JDOA 4XDPA 4COZA 5C5UA 5KXEA 2WNEA 1AL22 1VBC1 1X82A 1H0BA 2EIBA 4LBJA 2QZ2A 4LHKA 1BLZA 4N9IA 4RS5B 2JXAA 3T2QA 4CEWA 4CXXA 2ZHLA 3HD8B 5LW9A 3I54A 5A33B 4O9GA 2B42B 4K1YA 3ZKUA 1JUIA 3U11A 4D3WA 5CFCA 3MV11 2RMU1 1LKNA 4YG6A 1OUSA 5IK7A 5GM0A 1H1MA 3IKWA 5F2WA 4AWDA 5DQ0A 1GLHA 1QJY1 1MQTB 4QU2A 1JHJA 1CVNA 1S2EA 1UMHA 3OUHA 5IJRA 4XBLA 4IETA 1LRHA 2UURA 3POGA 4ZHNA 1KD7A 2BWCA 5CA6A 4DXTA 4TN7A 3GZTB 5KHIA 3VD4A 5L7OC 4DPNA 5I8TA 5M0TA 5JWPA 3D82A 1UZYA 2CDOA 3WT3A 5L9RA 2YC0A 3POJA 3VBRC 4GJZA 2DUPA 2AGSA 2UWAA 3KV9A 3P3PA 4MGQA 2EAKA 1S4CA 3E5QA 3V56A 3IZOA 4OI2A 1E5RA 1W9FA 2VZTA 3CJIC 1H8VA 2HYKA 2Y0IA 4Z2AA 3LGRA 2QBXA 4QPGC 1SG3A 3HWJA 3WP3A 2Q1MA 1Q43A 4E9KA 5IYYA 2A3XA 4LBQB 2JX9A 1WW6A 3Q8EA 5FREA 2VOXA 3VDDB 3I3MA 1YJLA 1POV1 3OGVA 1SDWA 1U12A 2DBIA 2PA7A 4YW1A 5FZ9A 5FO8B 2GC0A 2ZCWA 2WNUB 3CQOA 5EFUA 4IE0A 5B4XA 3K4DA 3NW4A 3OB8A 4QPGA 4EJRA 1DGLA 2ZGTA 2FDGA 2ZX4A 3CMGA 1O3QA 3OBZA 5I93A 2VNOA 1FT9A 2A7AA 1EAH1 2QQMA 2BGOA 4K9SA 1K3IA 3R4SA 5DAXA 3T4HB 1JN2P 2PQSA 2JB4A 3T0AA 2YYOA 3L2HA 2HWD2 5H9PA 5FDBA 2VZQA 1TME1 4RD7A 3TAYA 3S7IA 3WX5A 4K3UA 4EN8B 2YUEA 3ACIA 3P6BA 3VBFA 3DV8A 4CP2A 4ES8A 2VMDA 2ZEYA 5I0SA 1EV13 2BFUS 3WZ1A 2RMU3 1D4M3 2E7AA 1QIQA 3HQRA 3HQXA 4WM8C 1WLWA 3MV01 4XMAA 2VU9A 4FCAA 3IAPA 4AZZA 2XDVA 4MGYE 3DKQA 4QGNA 5FYHA 1RJ7A 4CE8A 4UF0A 4AVVA 1UMIA 2R061 3HN1A 4OQ9A 2PN5A 1MQTC 2JDKA 3F95A 4S2DA 4ASKA 1BQPA 1N3PA 5CEHA 1RUI3 1RYYA 1ASJ2 4YVWC 4MV2A 4WV8A 4BISA 2HLEA 2VL4A 5L73A 1SQ4A 3SLIA 4I0WB 2W91A 1ULOA 3NKGA 3KT1A 2HWD1 3Q8AA 1W8NA 1QMJA 4IEWA 4LO7A 4Q0PA 4ZZ5A 3NL1A 3WDXA 1MS4A 2V72A 4URAA 4OLLA 2DWRA 3KF3A 1CGPA 5EQUA 1BVVA 2VUCA 3M3IA 1RC6A 3OTFA 1AR73 1LOGA 3MF9A 1SFYA 5AVAA 4L11A 1W6PB 3SH4A 2GMEA 1JZ7A 1NCQA 2PAEA 4MOAA 2VMEA 4OULA 2ZGNA 3DPRA 1W6MB 1ENXA 1W28A 4OZXA 4TSVA 3LSEA 1BEV2 4DB5A 4COVA 2F4PA 3E1F1 4KGGA 1O6UA 1ZZ9A 4GH4C 1RUG3 2PHDA 2ERFA 3JBG1 2WFPA 3FFZA 1Y9QA 3HN3A 2JDZA 1HQLA 1RITA 5FWJA 4Q4X2 5FZ7A 1LU1A 1RXFA 2YFUA 3LA7A 4CCNA 4BQ3A 2R072 1UY0A 2Y6LA 4LK6A 1HQNA 2C4XA 2MHFA 2WWUA 3WEZA 1Q8PA 1HB4A 4BWOA 4LTAA 3ACLA 1X33A 2OVUA 5A7WB 1LGNA 1S0GA 3VL8A 1RHI1 2BYVE 2XMLA 3MPBA 1VLNA 3I59B 3E97A 4OVEA 1BMV2 5AC91 3VDAA 4XFCA 1XE0A 4I0AA 2DBNA 2HWE1 3MHZA 4IE5A 5F6KA 1N47A 1SFPA 3ETQA 2I45A 3OPTA 5GALA 1RUOA 5B2GB 3J8F2 3ZXGA 1GOGA 4P02B 4FFFA 5FBZA 3MFCA 5I0DA 1F4HA 1LOCA 3RZKA 1MQTA 4YFWA 3RZLA 4FPKA 1R093 3POEA 2VQ0A 3WW3A 3GGLA 1UAIA 1C8M1 3RPQA 2ARXA 4LEJA 5FY1A 2EA7A 3H8XA 2IVJA 2Q8DA 3PMSA 4J1WA 1ZZ7A 3OCPA 3WP6A 4BLJA 3VBOC 3H42B 3QD6A 4K7JA 2DVDA 1AX0A 1VBE2 3DXTA 2UWBA 4GAZA 1RMU1 1V70A 1S0IA 3T08A 1D2SA 4ARYA 3OGJA 3B9IA 1JMUB 3N9QA 2C6SA 1Q8SA 4P5YA 4NE9A 2VXJA 1IPJA 5IATA 4A42A 2HWC2 3B7MA 4EE2A 5L19A 1VP6A 4Q26A 3ZR5A 1PO11 3MICA 3QH6A 1RJ8A 1HXS1 1UD1A 1UWWA 4Q4V1 1PX4A 5IVFA 1DG6A 5FY9A 1BEV1 2YC4A 5CG8A 1UZZA 4CDQB 4JRLA 1AL0G 3BB6A 1XE7A 1VAKA 3K2OA 1O5UA 4KU8A 2BVBA 3D8CA 4Q4W3 5KBFA 1XNCA 3LSDA 4UFIA 5FYSA 2ZGKA 3HT2A 3RDIA 3FHQA 4LJHA 4FPYA 4OCTA 4I3GA 3PUQA 4NAOA 4P9IA 3ES1A 3UETA 5KXDA 1BXHA 4BMEA 3I3BA 2PFWA 1F8VA 2GN7A 1OKQA 1AXYA 1CJDA 2OUJA 2R16A 3A22A 3CL1A 1RUE3 1WCDJ 1C8M3 3I2JA 4IEVA 1H2NA 4JHZA 4P9WA 3AZVA 3M3CA 1V9U1 2R041 4GZ9A 2MEV1 1P8JA 4AVCA 1O8PA 5F7UA 4G9SB 2WS91 3PURA 2XJUA 5JI7A 1AL23 1CQ9A 5CADA 3PMEA 1W0OA 4JKKA 2R30A 2UWCA 3OYWB 3NMBA 3BIEA 4LO6B 2JE9A 5JMOA 2PAKA 1KS4A 3ZYFA 5L9VA 3A21A 4Y5SA 1D2QA 2J1AA 2X5IA 4PIXA 2D6NA 3THDA 3T2PA 2EXHA 1W8OA 2Q1FA 3H8UA 4KI5M 3FLPA 2FCVA 4XBQA 4R9CA 4XHXA 1PK6B 4RFRB 3LD8A 1QOOA 5E1RA 4YPJA 4ATEA 4TZDA 3ILRA 1GZTA 5FKCA 3KHCA 2YBKA 4W50A 4PT6A 3S6PA 4HBNA 4CUCA 2VR4A 4XQ4A 2BJSA 2BDRA 1GBGA 1OQEA 1V9U2 2R042 1DQ2A 4Q0UA 4UFLA 4UOJA 1OUXA 5F39A 4D8MA 4OI0A 2W39A 3NV4A 5CAZA 5HV0A 1KGYA 2ET7A 3UL2A 4Y5Z0 3DYPA 5FO9B 4IGQA 1UYPA 3W20A 2QQJA 4MGTA 2Q8OA 2R062 5BXXA 4CP9B 2XUMA 2VZUA 4LPLA 2GNBA 2K46A 3MLKA 5GLZA 5A7PA 1V00A 4Q27A 1FNZA 2Y8KA 1WZXA 4DIQA 2RS53 3A7QA 3LA3A 5JIAA 3SC7X 2JEMA 1S0DA 4BH9A 1COV3 1O7FA 2KD7A 2WA4A 3VD9A 2GC2A 1QJX3 5ABJA 4R8HA 1B35C 1KFXL 4Y1UA 4HN1A 2D43A 4WM8A 4LORA 3E5UA 3WR0A 5KHGA 3D0SA 2J1SA 4HVRA 2AEZA 2RS33 1WD3A 2P4EA 2P3JA 2BNMA 5A1AA 1WW5A 1K5JA 1K12A 3ZDSA 5FZ6A 2A5ZA 3WLUA 2VMFA 2YHJA 4AVSA 1EAH2 3ZFEC 1MR5A 2VECA 4F83A 4TTGA 2WNUC 4PBPA 5G05L 5LBEA 3RMYA 1WMXA 2N7GA 5F3GA 2XJTA 3ZYHA 2A3YA 3FLRA 3LFMA 4Q4X1 2ZGPA 2GALA 2R1BA 3A0KA 1QWRA 3NSTA 2KA3A 3PJYA 4UFHA 4CDUC 4UT5A 1ZA4A 1YQ6A 5BNOC 3SHRA 3AZYA 1H9PA 1PZ8A 1YQ8A 4CVUA 5K8SA 4GMP1 3MIGA 3USUB 5LRRA 2JKBA 1NAEA 2Q4SA 5K0UB 3ZOIA 4OHZA 1XNKA 3ZFEB 2FDKA 4LNVA 1F2NA 4CDWA 1M4WA 4QX7A 3KD4A 2OQ6A 5B4NA 4DOUA 4RQPB 2Y26A 3J9SA 1PX3A 4L99A 2W1UA 2YG0A 1DGRA 4LHNA 4JGYC 3GCWA 2CV6A 2RDNA 2D93A 2W1SA 3BALA 4MLOA 3WDWA 1OD3A 3OD0A 1IS6A 1SCRA 1LOBA 1OA3A 1Y9GA 1KQRA 4NIGA 2IUWA 3I2HA 4PHZA 1LHWA 2CAVA 4N43C 4Q0SA 5SV8A 4N7UA 4A6OA 2W3JA 2VGDA 4EZHA 5A3TA 1BMV1 1I5PA 1NA1C 3CIHA 4HETA 2GU9A 3VBSA 4H14A 1OFSA 2WLQA 4D0QA 1W6OB 1ZYBA 4GXLA 4N7IA 1IKQA 1I5ZA 1PZ7A 5CFCC 4UBGA 2BTVC 3DEMA 4Q8LA 3FUQA 4AFCA 1UY1A 2W52A 1MS0A 1I9RA 1PGSA 1TNFA 5LA2A 5CISA 1AJKA 4IV3A 1W6QB 2EICA 3HQUA 2DF7A 3AJZA 3GF6A 5FZIA 2A6XA 5H9SA 2P3IA 3JB4C 2IWGB 5EYYA 1HIXA 4ORFA 3JB8A 5L9BA 4EZ4A 5JMCA 5GZFA 2A6WA 3ZPOA 3WF4A 1QOTA 1LOAA 3AX4A 4XUPA 1LNSA 1YQ5A 4LULA 5FUNA 5ANNA 1LU2A 1W99A 2BERA 3PDQA 5CNAA 5EPAA 5J36A 4L97A 2HKXA 1DDLA 2CSGA 4SLIA 5HXVA 5FZ1A 1Z0HA 1VALA 3NV2A 4BQ2A 1MZ5A 5IK5A 2ZPXA 3H50A 1WGPA 2OQ7A 4BB3A 4EN9B 3FZ3A 1OLME 3WHTA 3ZSLA 1W03A 3LFIA 2WR9A 3NRUA 2Q1ZB 4RS5C 3U4XA 5DUWA 1OLQA 2W92A 4OFGA 3N4MA 3V0BA 2R7EB 1AR93 4FAHA 1Q5OA 3AMPA 2J1UA 2BOIA 2GSYA 4LKDA 5BNNA 4YW3A 2WT1A 4AHYA 1SLCA 1FPN3 4XVHA 2JG9A 2C9KA 4PF5A 4A4AA 5JDBA 4LE3A 4FPFA 4BDVB 2I2SA 5FPBA 3SEEA 3VBHA 1CR7A 4FAGA 2Z4FA 1DCSA 1DQ1A 1NLRA 2VUAA 5HCAA 2CU5A 4UBHA 5JXIA 4IV1B 3HEIA 5IHRA 3O1MA 3POIA 4DFSA 1UZ0A 1G9BA 3WDUA 4UF0B 4OQ8A 4FSJA 1KITA 2GC1A 2JG9C 4LIVA 5E88A 4EWAA 1HV0A 3B01A 4A45A 4BQ4A 1LODA 4S2FA 4MXVA 1PVXA 4XDOA 1OOPA 2J1EA 1C3HA 4ZXEA 3ZN6A 4DQAA 3USSA 1MVEA 5CBLA 3N9LA 2HWF1 1QJX2 1GNYA 3QACA 1VAVA 3ME2A 2DCYA 1VBB2 4RR3B 4RGKA 3NJZA 2ZACA 3WF1A 3WSOA 4AAXA 1EUUA 1YEWA 3R6SA 2XL7A 3HBZA 2OUHA 3PLQA 4ZU5A 3VD7A 2OIIA 3I8TA 5DN2A 3FE5A 5CKNA 1LHUA 3LCPA 4HN0A 1LOFC 4NRMA 3RJRA 1QY4A 4M3CB 2QQIA 2YB7A 5KC6A 3KQRA 2JG8A 4XUOA 3VN4A 1G9AA 5J3UA 3POWA 5K0UA 5LWBA 1MS1A 2PHRA 5FZOB 5CYYA 2RV9A 2CNAA 4EROA 2VZ3A 1W2OA 3I2KA 3ACFA 1W9YA 5LRSA 1O3TA 1VIWB 5KXCA 1GZ9A 5KWRA 3ZDVA 4N9HA 1J59A 1Z78A 2BBAA 3J7NA 2KR2A 4E8CA 2DDUA 5J48A 4BQ5A 2F6BA 1UPIA 1EPWA 1QJEA 3VKLA 4RR3C 2JD4A 4YZ3A 2BQPA 2QQPA 3AVRA 4PBOA 5DDJ1 3EXUA 5CZKA 2QZ3A 1AR83 4XACA 4XILA 5F3EA 1NOVA 4HKOA 2A6VA 2PMWB 2HWB2 1RXGA 3APBA 2D40A 4NIAA 2XKPA 1GV9A 2ZEWA 4CUGA 4IXLA 2JDNA 2WBKA 3ZYRA 3LWCA 2BFUL 4LIUA 4JRAA 3IDCB 4LXLA 4YM2A 5KR7A 1K42A 1SMVA 3GALA 1MS8A 3S5QA 1FAYA 5K0UC 2A75A 3ZSMA 1FXZA 5BV6A 5HV4A 2VW2A 1DP0A 3P5BA 1LULA 1RINA 3G6JB 4CCKA 4Z92B 1HB3A 2G19A 3CLPA 3KGZA 4FO9A 4TXWA 2E51A 4MYEA 5DZFA 4UFJA 3O7OA 4MHRA 4C1WA 1YHFA 4WZCA 2RS52 4GWMA 1RHI3 3RMXA 5JLVA 1LHNA 2H6CA 4A41A 4FOYA 4JTOA 5T5OA 5FYUA 3KF5A 3PUHA 4Q29A 1YYNA 2PHFA 4CDUA 4IE6A 1BK0A 4IEZA 1RUF1 4IEOA 3C2UA 1IZ3A 2P3KA 2R49A 4UW6A 4YZ4A 5BNPB 1C1LA 3V65A 4UFMA 4XJ9A 1AXKA 3L9JT 4L92A 2WT0A 1CONA 2VUDA 3OSDA 3WNKA 3VBOB 2W87A 1YC61 1LAJA 1RUJ1 3AKQA 4LOTA 3M7AA 3ZYIB 2RM23 2VZVA 1F5JA 2FCTA 1WMDA 2Z79A 3SQOA 3THCA 2HWD3 1VMFA 5E16A 1F9KA 2VTXA 5FYVA 2R0HA 4AFBA 3SXWA 2ZGRA 2RHPA 5FLHA 1UYYA 2WYSA 4WBBA 4B4QA 1XSQA 4QAWA 1HRI1 5FZ0A 4HMZA 3QBQA 5JZGB 4JGZC 3WVJA 3B5LB 5C9AC 5LY2A 3VHRA 1XRUA 1MS5A 1UXXX 2ZGSA 1CWPA 3VZNA 4HOOA 1LCLA 2DFCA 1B09A 1ZVFA 2ET1A 2C1FA 3I2FA 1GANA 1Y3TA 1GQHA 3AXEA 4XPVA 5BNPC 3UESA 2E33A 3SH5A 4D69A 2DUQA 1J83A 5IVYA 3GBFA 4DS0A 3LPFA 2I07B 1Q8QA 1H2KA 1KXGA 1D4M1 2JE8A 1JH5A 4LLFA 4CEYB 1EYBA 2DURA 2VD7A 4FFHA 4YM0A 3A23A 1PIV3 4A44A 1L7LA 4KQ7A 3TEYA 1PMHX 4H3WA 2FDHA 2A71A 3N9MA 4IW3A 4W6XA 1ODMA 4Y24A 3VHPA 4BU2A 2QCSB 1W6NA 5JXGA 1UKGA 4QGLA 4YG3A 3BN6A 2D3PA 2VZSA 4K20A 2OA2A 4RHV2 1ULGA 1CZTA 1K5MA 2A73B 5GLVA 4GB32 3VLBB 4BXSV 2WSUA 4ITCA 2RDRA 4CYDA 5FZOA 5G04L 1DYKA 5A3WA 4BJ0A 1ND3B 4FOVA 2A1XA 4FP2A 4LBOA 2GN3A 4DRRA 1IHMA 1F31A 1ACCA 2X10A 3VBUC 4CU9A 5FQ0A 5LA9A 1SBEA 5C8CB 1OD5A 4XUTA 4YVWA 2IXKA 1VBB3 2TNFA 3IMMA 1QJZA 5GKAC 2DCTA 3ZVXA 1SBDA 1JXNA 1RUC3 3I59A 3I7DA 2XKOA 4A2UA 4AI3A 3CJXA 3IDAA 2D5FA 4JQRA 4V1PA 1W6NB 4PF1A 4XAAA 4XAEA 1GZWB 4KBZA 1UCXA 1XB9A 4FPJA 1RVF1 2VCBA 2WN3A 3KZ4C 5DAVA 2XGXA 3CKHA 1WW7A 4XIOA 1PM4A 4HANA 5K4LA 2XG3A 4KWKA 4YW6A 4MZUA 3EYPA 1PK6A 2DVAA 3RGBA 3UKTA 1DBNA 3RJ2X 1O3SA 2ZAAA 3CDZB 3H9AA 4OI1A 3I3QA 3ZO0B 2AYHA 1QJY2 3ELNA 4RSUA 4XJAA 5J96B 5JSOA 2JG8C 4WM7C 2ZGMA 5FZEA 2RS13 5A32B 1CAXB 1OOPC 3WQBA 4CCOA 4CRQA 3FBYA 4ZPIA 1VBC2 3KMHA 3HAGA 1VBC3 4JGYA 4QHZA 4CA9A 4CCCA 1S2KA 1H4GA 1YRZA 4F7ZA 1GNHA 1O4TA 2UY8A 3QH7A 3RVHA 4M4PA 3UJQA 4GALA 4NAMA 2GNDA 2RS12 3ZN5A 3MBWA 4I01A 1Y9MA 1YUDA 5FFOC 1XQNA 2GH8A 4OMCA 4QXBA 4NIIA 3UK9A 1J1TA 4HK9A 3AVSA 5FY5A 2CYFA 5FZDA 3RG0A 1TNRA 4I09A 2WAOA 4XCAA 3ZYPA 1OQDA 4LO8A 1QJU3 3SKVA 3VBOA 2P17A 3AKTA 3NKTA 3IB3A 3NJVA 4XYXA 5BNNC 2E63A 3PIGA 2AZ5A 1SCSA 1CAVB 1N1YA 1AVBA 4N53A 1OA2A 1XNAA 2R063 4XZPA 1ND2B 2VZ1A 2HWE2 2PHTA 1CZVA 5CU1A 5GZEA 3JD73 1JS9A 3AKRA 3MIBA 2Q30A 3IT8A 5DG1A 5ANQA 4AEDA 2XJRA 1VB4A 3OY8A 4R4XA 4PIYA 1LEMA 5DMYA 5FPVA 3BTAA 2IXIA 1WCSA 3C7FA 4LKSA 2K0GA 4GKXA 4GMP0 3AYCA 3VV1A 4G4FA 4BM8A 1HQWA 2V5YA 3ZR6A 4BQXA 2E7TA 3FMGA 4QX2A 5C3QA 1ND2C 2K2SA 1WUVA 3HNYM 1UOGA 4QPIA 3RFRA 5LASA 1ND3A 4AG4A 3VKOA 3WHUA 2J1TA 3IAQA 3EB7A 1KDMA 2E31A 2RM22 4M01A 1FX5A 1TME2 2W08A 3BI3A 2X8KA 3V0AB 1PMJX 5JIUA 2WDBA 5IT6A 5KHKA 3ZFGB 5J37A 1SLLA 2FDIA 4L9BA 5C4WB 4YGDA 1VAMA 1WLDA 2F4LA 4YSFA 3LOBA 5JOYA 1H30A 2P2KA 2J1RA 4QXKA 3I2IA 4DUVA 3ASIA 5C8CC 2R073 2WS92 3HOBA 2X05A 2OZJA 1UX7A 1V6JA 3UKNA 4NUBA 1H6XA 5C9AA 1XPWA 1YFYA 2RVAA 1YIFA 3R4DB 5FZAA 3OJBA 3TN91 1W8FA 1UY3A 2VOWA 1D4VB 2NM1A 3ZN6B 3PU3A 4FPLA 4PJYA 4RYDA 3JQXA 4KMQA 2Q5TA 2VOVA 1APNA 2R32A 4FOQA 4N53C 3OF1A 1OA4A 4XF4A 5FZBA 1VRH3 3RI8A 1UF2C 1W2NA 2DVBA 4CTEA 1QGLA 5K7PA 1POV3 2PHLA 4N43B 3B3QE 3JZVA 1NQDA 4LITA 3CJIB 1M06G 1XC6A 1W9SA 4U36A 1S1AA 4IEYA 1GZWA 2EALA 2WKKA 2WO3A 5FP7A 4EWEA 1AF9A 2YU1A 4CXYA 5FMOL 4IDZA 4YVSC 3UGGA 1QDOA 3H3UA 3JBG2 2JIJA 3IPVB 1EUTA 1Q8OA 2HBTA 4META 2IZWA 4R9DA 1GSLA 1PO13 2BEOA 2EXJA 4BXFA 5FMOS 4JGZA 2D6PA 4Z2WA 1QQP2 2ETEA 1AX1A 5F3CA 1ZM1A 5FK7A 5FIXA 3AZZA 4XQWA 5LK7B 3UYJA 5C7GA 5FPUA 2VE1A 1EY2A 1FATA 3LPGA 5FR3A 1LTEA 1A78A 2XXZA 4YGBA 1JOJA 4AI8A 4S2HA 1ZRIA 3DL3A 1BK1A 1BJQA 4P9YA 1W8UA 5CKQA 2XB6C 1BBT2 3HMYA 3POBA 1Y4WA 1XBFA 3X29B 2AREA 4QX5A 5BY5A 1JZ8A 4XFAA 1ZZ6A 1WBLA 2JG9B 5HBAA 1VBD3 2VCCA 2ATFA 4CPBD 2QQNA 1OQ1A 2JWPA 2E7QA 2LTNA 4NRQA 5FZFA 4A3XA 1B35B 1C5HA 2DCJA 3GZUC 5JVVA 1LGBA 1RUC1 3W58A 4C0HA 3K46A 3ZFFC 4CUBA 4YM3A 5F5CA 3O1PA 4CU6A 2D3SA 2VO5A 1CN1A 2YBPA 4N90A 1OLRA 4FTSA 4AR2A 3BTXA 4UW4A 3K4AA 4J6GA 4XJ8A 3K3OA 3WW4A 4MUVA 1DQ0A 3MDPA 1DZQA 4BK4A 2G9ZA 4BMBA 5C3SA 1A3KA 2ZX1A 5ABJB 4ZZ8A 5JSPA 1R1A2 1U0AA 5F32A 5JR2A 1T6BX 1ZBE3 1O91A 2ARCA 1HX6A 2F17A 4B4PA 4I2OA 4S2GA 4EYUA 5IVCA 2OPKA 1LJ7A 1O59A 4LBNA 1VRH2 5APAA 2RR13 3K48A 5LEKA 3E6CC 4EWDA 5IAVA 2E9QA 5A7NA 2VMHA 3ETPA 1J58A 3OBAA 4XE9A 1RUF3 2VQAA 3OGRA 1W3VA 4Y5TA 1PMIA 1OPOA 1QJU1 1RUI2 2Y38A 3PIJA 5FCCA 1DHKB 5FUPA 5JCTA 1JYVA 2WFF1 3O0VA 5I8SA 3T1LA 1JOPA 5T52A 4Y20A 1OFNA 5JI9A 4IEXA 4BIFA 4HG6B 4RN5A 3WP5A 4JKLA 1JYIA 5FMBA 1DU3D 2VMIA 4AI1A 5JOWA 1H2LA 3DECA 1N1VA 1T6GC 5FTTC 2BGCA 3J8F1 1QNWA 3MIFA 1YFWA 1ODNA 2DTYA 4E4ZA 1TMF1 1SPPA 4QM9A 1REFA 3T09A 1CESA 2ZKNA 2LS6A 2ZHKA 4LT5A 3VZOA 1E5SA 5FXXA 5C8WA 4Q0QA 3TEXA 3WF2A 5L36A 3EJKA 3J7MA 1SDDB 3RZGA 2B39A 5JZGA 1W90A 4YARA 3DCQA 1X9TA 3VBHB 5JPMB 1I1EA 4I30A 1JU4A 1GMMA 2O0OA 2WSVA 2ZX0A 1HLCA 4OZOA 5D21A 3ZN4A 4CDXC 2XJQA 1UU4A 4HVQA 3ZFFA 4BK5A 5ACA2 4LA3A 2WZR3 4AQ6A 2WNUA 2R6QA 1S2BA 1GWLA 3RYKA 1YLLA 1YO8A 1VBD2 1VBA1 3H3LA 3VBUB 3ZFEA 2YGMA 2OXBA 3N35A 5E8AA 1HXS3 3RWKX 1W0PA 4IGOA 2Y6GA 4WM7A 2WWSA 1Y7BA 2QQVA 3D3AA 4JVAA 4XF3A 3TWIA 2WUHA 1XU2A 2P5BA 5FYCA 5A6YA 2JE7A 1VBA2 1VBD1 2RG4A 1J3PA 4UWDA 5A6XA 5FPAA 3ATGA 2XJPA 3EO6A 5FMCA 4Y1XA 3KM5A 1O3RA 1UZWA 3OPWA 1OI6A 4Q4X3 1N3OA 4CCMA 2CWMA 4P14A 5HCBA 2JB8A 4LUKA 3ZIXA 1ZNPA 1IS5A 1Y43B 2JKXA 4H7MA 2LW8A 2RDQA 4D7YA 4ZU7A 4YVSA 4E4DX 1AYN3 3R05A 2C9AA 5KC5A 1JW6A 3AKPA 3HIFA 4C91A 3FBMA 4QKFA 3W5MA 3AMQA 1N3QA 2VCMA 3NO8A 4R52A 5DPNA 2NP0A 5FZ4A 2FDJA 2Y64A 2IXLA 5LB6A 2A6YA 3OBRA 4MGKE 2WZR1 3M3EA 2BRTA 1UOJA 1QH6A 4K1ZA 3R4UA 2WINB 4L8QA 3OUIA 2E26A 1RVF2 1WLTA 5EYXA 1ASJ3 1DF0A 1TG7A 1S0EA 4F8AA 4QM8A 3GJBA 2LALA 2P6HA 4IV3C 4C1XA 2A70A 5FPZA 4Z1VA 2OKXA 4G3YC 1NY72 1FOD2 2ZGOA 4CU7A 2WNOA 1KRIA 4WVWA 1E5IA 2HH9A 2YPDA 1AHSA 2WQ8A 3WNMA 4DZGA 3J7HA 4YW4A 1CX4A 3N36A 2FZ1A 1XNBA 1R091 5F5AA 2QNKA 1RGSA 5ACA1 4WVMA 1OPMA 5DZEA 1X8MA 5A6QA 3KT7A 1GYKA 4E2SA 2Z42A 1HRI3 2E32A 4YZ5A 1H9WA 4Q2FA 1VBE3 5DAWA 3URFA 3LQCA 1HW5A 1OKOA 3HVDA 1X7NA 1UU6A 3NNMA 1CAXA 4FTBA 1ENSA 1H1IA 4O7XA 2H0VA 2ENRA 4KBBA 3DPRC 3JQWA 1AR63 1FPN2 1PGW1 4GA9A 4KG0A 4YWAA 3KV5A 4QU1A 5C33A 3OGSA 4NJ4A 2WIIB 1UO9A 4QX0A 1AX2A 1W2TA 3OYWA 3GDBA 2XLFA 3PNAA 3VBFB 4FI9A 2PQQA 1HN1A 3BOPA 5EJ3A 2DCZA 1QQP3 4V2WA 3HNMA 4H2AA 4Q4V2 5A80A 5HXMA 2RS31 5IFTA 1HB2A 4EV0A 1O4ZA 1ZBA3 5J98B 3O1VA 3SMHA 4IESA 5FY0A 4YZ1A 4FPOB 4LO5B 4CCLA 4DY5A 3CZUA 5CFDB 3D4KA 4RGAA 3POYA 4NVPA 3ILFA 1AR71 4NPLA 3K51A 1W6QA 1JZ3A 4HL0A 1REDA 4WM7B 2Y6HA 2J42A 1VJ2A 1C1FA 4COWA 3MW4A 4MVTA 4B8EA 5T54A 1G9CA 2XL9A 3PUAA 4PDWA 1AL21 1BEV3 4DINB 1WD4A 2EIEA 1PGL1 4CEWB 5JUVA 4CP9A 4CZSA 4GB31 5ERLA 4M0HA 4A6SA 2ORXA 1FOD1 3CHXA 1B35A 3UGFA 1NE4A 2GAUA 1PVC3 1U5XA 1Z7S2 1IGOA 2XVGA 3ZPYA 4IERA 3ZX7A 1LHOA 2P37A 4P9LA 5FY7A 1R1A3 2PLV1 3OD4A 4HSLA 4AEMA 3ON7A 1BZWA 1AR81 1MS9A 3D0JA 2GZWA 5HCFA 2QJVA 5BYNA 1NCRC 5FRAA 3THTA 4XFFA 3WNPA 1DYPA 5DABA 4MH0E 1U5IA 4CDWB 4YFZA 5I8YA 5A32A 1X50A 2R1DA 4Y3OA 3TB0A 1RUE2 4AK3A 2MNGA 2QDNA 4B7EA 5IK8A 3AYAA 1GWKA 2E6VA 4AFDA 4ASLA 1AYN2 4CDXB 5JSRA 1W6PA 4JKMA 2W1WA 3LDRA 4BIOA 1UL9A 1QHDA 2OPWA 1NZIA 1W8HA 3CNAA 1ZBA2 4NWWA 4OUEA 4XETA 3HBKA 5FO7B 4OHXA 3E6BA 2CDPA 2W95A 2EF6A 5AC93 1CD3G 3K4ZA 4OMDA 5JR7B 2VNRA 4AW7A 4OYUA 3BUCA 1A34A 3VKMA 1GICA 3V64A 2OYZA 1US2A 4PQ9A 3NNJA 1H1AA 2D97A 1TQ5A 2HBUA 3ZKYA 4PI2A 1JYTA 1XYNA 3FHAA 1IQDC 1NUKA 2ADDA 2HWF2 4XJUA 4Z82A 2NN8A 4QX1A 5T5PA 3ITQA 3HPNA 4AOCA 5CG9A 3BU7A 1YQCA 1OOPB 1DGWA 1NXMA 1ND3C 1UX6A 1R083 1XU1A 2SBAA 2WO1A 2B4KA 3JXSA 4LQRA 3N7JA 4FPEA 1SPPB 4Q4V3 5HPOA 3VB9A 4Y4YA 4B7KA 2PELA 2YBSA 4LE4A 3W5NA 4XF9A 5C71A 1J3RA 1RUG2 2ZGLA 2ZMKA 3POFA 4P08A 1IPSA 4YGEA 1AYN1 4CCEA 2W46A 4K6BA 1UMZA 3LF7A 2BZDA 2CGOA 2FZ2A 3HNBM 1F4AA 4FQ4A 5A3NA 4UXAA 3O5SA 4HLTA 4AI0A 2IC1A 3Q9OA 3RWNA 5A70A 4DEVA 3WDYA 4BZ4A 3NNFA 4AGGA 2OW4A 3LAGA 1HN0A 3FL7A 2BWAA 2RJKA 4XW3A 2XBO1 4YW2A 3VBFC 4AEDC 5A1FA 1CAWA 1Q3EA 1VE0A 4COUA 3KV6A 2ZBJA 2QQKA 4QD2A 3VZLA 4CCJA 2WZEA 4MGIE 1UW8A 1UYXA 1ZZCA 2WC2A 1FV3A 2RR11 1S0FA 2ZTNA 3GBWA 5EP9A 4GIQA 2HWC3 3O1SA 4P9XA 2ZGQA 1BCXA 2VTXJ 5AFBA 3U07A 4XOGA 3B02A 3DKWA 3NAPB 3KWVA 3ZYGA 3T2TA 4JDMA 1XOYA 5LCWL 5EJZB 3WCSA 4O65A 1RIRA 5D8AC 2WFF3 3CEWA 3BPZA 5A3PA 2HWB1 4Q4W2 4QX3A 3U75A 2D5HA 4D6SA 3JCIA 1QXRA 5FZGA 4Q4Y3 3BKZA 1QJU2 1RUI1 2XUEA 4IE7A 2CTVA 4MSVA 5FLJA 4DXRA 4XFBA 1TME3 2O8OA 3WDTA 4FFIA 1FMD2 3R0RA 3IMNA 4N8MA 4QPYA 1AXZA 3GZAA 1MZEA 3OEAA 1IS4A 5FYYA 2B45X 1QEXA 2GC3A 3P3NA 3Q8FA 4IQPA 4BPZA 4E4SA 1NYWA 1W3XA 2ZMLA 3UJOA 3V0BB 2JECA 2LROA 1TMF3 1CAVA 3WCRA 2K9ZA 2QUOA 1EP0A 3T2OA 3GBGA 5LBBA 2XBO3 4C8DA 3M70A 4AI9A 2JENA 3J4UH 4XQDA 2NLRA 1ULDA 1XYOA 1JTZX 4M3CE 3ZSKA 2BU9A 2TEPA 2W9XA 2D44A 2NYYA 3AP6A 2WNVA 2C26A 1PGW2 5FXVA 4KH9A 2WZPP 1V6NA 2EXIA 2Y0OA 1R082 3C7GA 1HJFA 3WUCA 2J7MA 3RZMA 4YLZA 3TN92 3NV1A 3LE0A 2QDRA 3IPVA 3PUIA 1LB2A 1SBFA 3JUUA 4NO4A 3ROUA 2Z2SB 4QDSA 5FY4A 1HB1A 1RUH3 2QQUA 1ZRCA 4RHV3 4MXWB 5K9YA 1RHI2 2VNVA 1HRI2 1BBT3 1LGCA 5A7OA 5A3OA 1R081 5ACA3 3NNGA 2AR6A 1GP4A 4DUXA 4IV3B 5FZ3A 3I3DA 2HJIA 4K21A 1TEIA 1POV0 1R64A 4TLGA 5T55A 1NG0A 5C8CA 3IIAA 4KNCA 1SACA 2XWBB 2WRAA 3MIEA 5DDJ3 3MLJA 2X53S 4OUMA 3ST7A 5F1RA 1UY2A 5FPLA 3VKFC 1DGWX 1VMJA 2VJXA 3AP4A 1UOBA 3EQEA 4QQHA 1DIWA 4HVOA 4XFHA 3MZHA 4M3CF 5FP3A 3GYDA 3N3HA 1AR92 1N1SA 2ADEA 4V2VA 3L2YA 4XABA 1BYHA 3PHMA 3PVEA 5GLUA 3WNOA 4Y4RA 2XQXA 3FJSA 1JODA 1RTVA 4JQTA 2ZABA 2B7YA 2D6LX 5C4WC 3DXUA 3WF0A 3KCXA 4ZY9A 2B5HA 3G7DA 2VTFA 4QT6A 1DYOA 4AHWA 1QXJA 2AH2A 4MXWA 2XR4A 4KU7A 2RS32 5DAPA 1OSGA 4AF9A 2Y34A 3GCXA 3B94A 2YROA 1Q56A 2PHUA 4QPGB 4D94A 4XDQA 4QQOA 1D4M2 1K5MC 4QHBA 3H8RA 3BOWA 2XVKA 1TVGA 3SCFA 1JHNA 3VGIA 2UY9A 1MZFA 4Z07A 1F5FA 1A8DA 1I6XA 4N53B 1COV2 1R1A1 2G1MA 2GP3A 2VMCA 3VBRB 1BVP1 3VDCA 3ORJA 3HT1A 4FPGA 4ZS3A 4FOWA 4NR1A 2ZA9A 3P1IA 3S7EA 1HKDA 4CSWA 2DVGA 2JDAA 3OUJA 5JOZA 3FX3A 3KLSA 2CWSA 3EBRA 2Q0AA 1ONAA 4Y22A 4NPRA 1CPNA 3U10A 2VY0A 4EQVA 1AUYA 1K5MB 4QXCA 2VG9A 2BW8A 1YIPA 4Y20B 2HWE3 4GMP3 1CX1A 1AZDA 2FDFA 1JYNA 1JYXA 1DQ6A 1SZBA 2XHKA 4D7TA 2DTWA 1DFQA 3H1MA 4KL1A 4NPMA 1G6NA 3AYEA 3WP4A 4Q0VA 1WCUA 5BPXA 5JAXA 4FQZA 4AVBA 5FZHA 1ZX5A 4WM8B 4CP1A 1IKPA 1US3A 1YXWA 2W47A 2EXKA 4I0BA 2D6KA 2ARAA 3H1YA 3KCYA 4K8RB 1YI9A 2GNMA 3VBRA 1NQJA 3PTYA 4HT1T 4LBMA 1AR62 5I0TA 1WCKA 2ES3A 1SFNA 1UIKA 2ZMNA 5DAQA 4XTMA 2VW1A 4RS5A 2YXSA 1JU3A 3KHBA 1QQP1 3Q8BA 2X09A 2B9VA 3IBMA 5FMDA 5D2AA 3U1XA 2DU0A 1W9TA 4AVTA 1J84A 3THPA 1JUHA 3ZXDA 5EJ1B 2XPJA 5IVEA 4LK7A 4FFGA 2CHHA 4A7YA 4QKDA 2YFZA 3PUSA 4QQ2A 4JDNA 1WW4A 2W2IA 4F3JA 4UAPA 5JZGC 4NHYA 3WNLA 1V6MA 4O61A 1E57A 4Y1VA 3AMHA 1S55A 3JD71 1R1ZA 1SLBA 1W39A 5F5IA 3H1WA 1LOEA 3LOIA 5LA0A 2NQYA 3VKNA 4IEUA 1OBNA 2WAAA 1QDCA 3B69A 5IAXA 1RUJ2 3MIHA 3DPRB 3LEMA 4LOSA 3W59A 5J1XA 4AQ2A 4ZU4A 2NMNA 1ZBE2 3NAPC 4UFKA 5CFDC 3UV9A 4FBFA 3BCWA 4FPCA 4P9JA 3BPSA 2HEVF 4HKLA 3I2OA 1O8SA 4HPKA 2GDFA 4MGZE 3ACHA 4K8FA 4LBKA 4OHWA 3C7EA 5F5QA 1FYUA 3TEZA 3AYDA 4GWJA 4TYSA 2JDHA 3TYJA 4CP0A 3O0WA 4KWUA 4E2GA 4XF1A 1ND2A 1V9U3 2JDPA 2PTMA 2R043 1L7RA 2YGLA 3JD72 3K75B 4AQTA 1YI7A 4ET7A 2XLGA 1RUE1 3C7OA 4JTNA 3O14A 2V4VA 2KM2A 1AYM3 4JZRA 3VDDC 1BHGA 4ASMB 1JZ5A 4XF0A 1C57A 5LK5A 1IQAA 2G4IA 2D6MA 3U37A 3WF3A 2FD8A 4QMAA 4AHXA 4QQPA 1GU3A 1RUH2 2DVFA 2ZS6B 4MO3M 5LATA 1ZRRA 5BUVA 4JX0A 5EV7A 1X36A 2D7FA 3GZEA 5JOXA 3M3OA 3TN93 3LDBA 4JAAA 2YV8A 1OF4A 3GXUA 2VC9A 2NMOA 3CF6E 3SH3A 4A3ZA 2G9FA 3O1RA 2LRPA 5FQ0B 1KJRA 4LBLA 5FYZA 3LEGA 1JYCA 4M0NA 4W65A 1S0JA 4ISQA 1C5IA 1MEC3 1YWKA 2UYBA 2EAAA 1KJLA 1K45A 3SISA 4ZS2A 1C8M2 3POSA 2I74A 3ZXAC 3DYMA 4CDWC 3KT4A 5KHHA 5CFCB 2PLV3 5D8AA 4HZFA 2H6BA 2Y6JA 4BYYA 3D6EA 4B4RA 1W8TA 1PVC2 1FI2A 3WQ1A 5KXBA 2JG8B 1H4HA 3NJXA 3E5XA 3IWZA 4DUWA 1DLCA 4COYA 1OF3A 2NPIA 2VBPA 4HSJA 3SKJE 2PHWA 3MLLA 1G7YA 2PYTA 2IFRA 2ZGUA 3FLTA 4IEQA 3AP5A 2FQPA 1V6IA 5CIRA 2XONA 4LBQD 1PIV1 4NHMA 2BNOA 5H9RA 4NN0A 1NCRB 1YQ2A 3W9AA 1N1TA 3WDVA 4B3NA 1VPHA 2R071 1STMA 2Z69A 3VBHC 1POQA 3BODA 3T1MA 2RR12 4CEYC 4SBVA 2A6ZA 1UXZA 3IM0A 1LECA 4Y1YA 2RMU2 2W5FA 4GH4A 1L3JA 1W2AX 3PVNA 4XC9A 4HKWA 5ABJC 3VDDA 2VW0A 2IFWA 4FT8A 2WQZC 4LHLA 5AC92 3Q8CA 2XBO2 2YU2A 4LA2A 5FAXA 3KVAA 4IE4A 2WA3A 4IGPA 1GFF2 3M1HA 1DZTA 3M8LA 4GB33 5JXHA 3I49A 3KQ4B 1CAWB 1CPMA 2ZEZA 4NMIA 1IS3A 2HWF3 5FLIA 3ZFFB 1LHVA 4UYBA 1FMD1 3TEWA 2AC1A 4HPKB 2DV9A 3AK0A 3NVCA 4YM1A 3PVOA 1G86A 1PO23 1UQXA 4IV1C 3UNPA 5HI0A 4Q4Y2 3LIHA 4AEDB 4YVWB 3FHIB 5FXZA 2HEWF 1W8WA 3RSJA 1GOHA 4OUSA 1TZOA 3NAPA 4CEWC 3V0AA 2P1BA 3ZXLA 1YCIA 3FN9A 2DUOA 5DZGA 1YNAA 3GJAA 3N7MA 3SITA 1QXPA 3PL0A 2B8MA 1ULCA 2WLPA 2YMZA 1I3HA 5A33A 5A7SA 3WNXA 1NA1A 2P3YA 2OS2A
chains in the Genus database with same CATH topology
4BLIA 2B9UA 5GZGA 1NCQB 2TBVA 5D1IA 3JU9A 5F6LB 2LM3A 4I02A 3TRSB 5A3MA 4GQ7A 5IUQA 1ASJ1 3O12A 5GLWA 5L7OB 1UN1A 1PIV2 4R9BA 2XJVA 1H8TB 2QE3A 4AFAA 2FMDA 3AFKA 4DXZA 3U0ZA 1XYPA 1ZRDA 1RUJ3 3PJQA 4INDA 2VUJA 3BIWE 4CEYA 2V09A 3FC0A 2WL1A 4BQ1A 4XXPA 2W68A 5GZCA 3ZIWA 1QNYA 2OZ6A 4KGQA 2VULA 4Q8KA 2XVLA 3DF0A 1UIJA 2ARBA 3B93A 2X5IB 5F9TA 5CB7A 1U5ZA 4URTA 1NZCA 1KFUL 1QJY3 2VNGA 3VBSB 3FUOA 4LO4B 5DUVA 5FOJB 2FMYA 4XXAA 1KS5A 5J7MA 4RQPC 3M3QA 4H7LA 1RUH1 4ZXKA 2NZ9A 4XEZA 3O0XA 2BBVA 4ISRA 3TNPB 5E89A 4WVZA 4YRDA 1HRV2 4HFSA 1LENA 2AUYA 1PO12 4XFGA 4NOTA 3MW2A 4M3CA 3WW2A 5BNQA 2XH6A 3H0OA 3RQ0A 1ZZ8A 4XJZA 5GJ6A 2BNNA 3ZXJA 5JPNB 4EN6B 1PHMA 3NV3A 4Y26A 3AZXA 2GMMA 3I4IA 4KWLA 3RYPA 3WOGA 2D3RA 1PVC1 2IXJA 1QJX1 1PNGA 1A6CA 1IOAA 4NHKA 1FOD3 4H55A 4FXGB 2YY1A 3IDBB 2VXRA 4FPHA 4KG8A 3AP7A 2PHXA 3DGTA 4XIKA 4E2QA 3OPZA 3VUOA 4OI4A 3WXPA 1MZ6A 2WNVB 3GNEA 1HV1A 3RYRA 2HWB3 4ZKTB 1MVQA 3VZJA 4EN7B 1AR61 3SCGA 1KDKA 5FOBB 4AFMA 1RL3A 3H7JA 5J09A 2FBEA 4YG0A 4K40A 4IV1A 3RNSA 1VBE1 5EWSA 2QFEA 5FPXA 1ZZBA 1ULFA 1NY71 2GMPA 3KSCA 4A7KA 2MEV2 3AM2A 1V6KA 3ECQA 2DU1A 5T5JA 4AE2A 2YDEA 1CAUB 4FP3A 3WUDA 2GNTA 4W6WA 4RQPA 1G8WA 2D6OX 2ZOEB 3AP9A 2QKDA 5T5LA 3ZMNA 4N43A 1G9FA 2O1QA 3IDEA 1D0GA 4TWTA 1RB8G 1LOFA 4B29A 3TBDA 4XBNA 1YJKA 1OHFA 2RM21 3WG1A 1FMD3 3CO2A 3WQ0A 3QCWA 5DUUA 4XFIA 4JV4A 5EXOA 4GKYA 4XJWA 2HWC1 3J26N 1EV12 3MIDA 2CY6A 2YPJA 4I3PA 2MPFA 1QKQA 2B46X 2LUWA 2ZZQA 5BNOA 5SV5A 2VOKA 1YFXA 4Q4W1 1EV11 3ZXEA 4CDXA 3ZFGA 3H3ZA 3WG2A 1RUD2 4YNIA 1C8NA 1RVF3 1G9DA 4X6RB 2AENA 3AFGA 4MX3A 2RE9A 4AI2A 1TMF2 4FXKB 4CDQC 4X6QB 3D5OA 1W2UA 2D98A 2FHRA 4KWJA 2WZR2 5GZDA 2MEV3 3ES4A 1QF3A 1RUF2 1UPSA 3MW3A 3RS6A 3N7KA 4JC1A 2WQ4A 1HRV3 1GR3A 2VPVA 4YVSB 5AVPA 3RZZA 2UYAA 3QLQA 4BE3A 3AJYA 1YFUA 3KGLA 3OGGA 3NWKA 5H9QA 1MS3A 4QQLA 1WA4A 3B9CA 4RGGA 1ZREA 1AR82 2V73A 4W6YA 1AJOA 1PGL2 5C4WA 1MEC1 3VZKA 1LR5A 2C0ZA 4JGYB 4LLOA 2ZX2A 1RMU2 2ZX3A 3RI9A 4R9AA 4ONUA 1ALYA 3TOJA 3WY6A 2PLV2 3USUA 2DCKA 2ZHNA 4RFT0 5C6CA 2VVEA 1HXS2 4JGZB 4WVMB 3E6DA 1C28A 2UU8A 2E53A 4YGCA 1H8TA 1WLCA 1GQGA 1RUC2 2ZJCA 3RRDA 4BA6A 4YYOA 2CL2A 1NCQC 3KB5A 3VHNA 2XWJB 2GH2A 5AFEA 3ZXKA 1ZBA1 2O8QA 3MEPA 4NHLA 5GLTA 1BBT1 2H0BA 1ENQA 1PM7A 3ZYJB 3S30A 1H2MA 4R4ZA 2TUNA 4GH4B 1XNDA 1RUD3 3GHMA 3WQ7A 4BHPA 5BNPA 1Z7S3 4TLFA 1JBCA 1DQ5A 1VB2A 1OMIA 3DN7A 1DQ4A 4L2NA 4PDWC 1NCRA 1CAUA 1RUD1 2KXLA 3HR9A 5CVRA 3WINE 3VZMA 1ULEA 4P5HA 2WNVC 1UKRA 2WFF2 3AKSA 3JBG3 4O9EA 5DG2A 4D7SA 1RUG1 3EHKA 1PO22 2Z5WA 1SEFA 5T3NA 1QU0A 1ZBE1 2EVXA 5T50A 2IXHA 1QH7A 5A3LA 4EN0A 3ENRA 2ZAHA 1UU5A 1CIWA 3I2DA 3OBTA 4J1XA 4LBQA 1WMFA 1QOSA 3ZMOA 4X8NA 3MFAA 4XTPA 4IL7A 5C9AB 3LB9A 1HDKA 1MEC2 4E27A 1EAH3 1VR3A 1PZ9A 1X8EA 3S0MA 5L7OA 1SLTA 3WG4A 2A3WA 1ZRFA 1Q8VA 4AEJA 4AEKA 2WT2A 3VHOA 4ES9A 2ZKLA 1LEDA 3CJIA 4AXOA 3OY8B 4HK8A 1NA1B 1NXD1 4Q1RA 3FFQA 1FNYA 1ENRA 3IN9A 4PIZA 2R0FA 5TSWA 1U5YA 4PLMA 5KHJA 3WG3A 4C90A 4CDUB 4C0BA 4BOWA 1S0CA 3WD5A 1H8TC 4AQSA 4XHBA 4Z8BA 1WBFA 3A4UA 3AXDA 1NE6A 3QOPA 2XJSA 3AB0A 1VBB1 4NWVA 2RS11 4DMIA 2SLIA 4Y1ZA 1S0BA 4RR3A 4IEPA 1SLAA 3ZSJA 5EZWA 1CJPA 1AYM1 1SLIA 2X5IC 3KCCA 4OHYA 3AMNA 1FV2A 1BKZA 1AR72 1V6OA 3MGUA 4BCUA 5IK4A 2HEYF 3CU7A 4WVVA 2VH9A 1NLSA 1HRV1 4CDQA 5I91A 1IPKA 1DGRN 3A0NA 4QPIC 4PLNA 5DXDA 4RHV1 3ZXFA 2CAUA 1J1LA 2CGNA 5I0UA 4PCRA 3MPPG 4LR4A 3DUIA 2VVDA 2VVFA 3VBSC 4RA0A 1RMU3 5BNOB 1VBA3 1URXA 4AGRA 1C4RA 1REEA 1GNZA 4LUMA 1VRH1 2JJ6A 3AMMA 3N7LA 4DY3A 4PDWB 2BVVA 1TE1B 2RJLA 3H7YA 4UW3A 3LKJA 4QGMA 5I0RA 3ZFGC 3AZWA 3INAA 3MF6A 5D8AB 2JICA 2WJSA 2YZ4A 2W0XA 5DUXA 4AGVA 1FPN1 4P9GA 3WV6A 4Q1PA 2CGPA 1W6OA 3SCHA 1DZRA 1R092 2ZZJA 3B00A 4FVVA 4FTEA 1XE8A 4Q4Y1 4GULA 5LEJA 4WZFA 5DDJ2 2EIGA 3J8F3 2X29A 4AHZA 3UKVA 1COV1 4U2AA 4AVAA 2QVSB 4JCKA 2VMGA 4X8PA 1PNFA 1O5LA 2RS51 1PK6C 1J3QA 3WW1A 3C3VA 4OHVA 4YW5A 3LZZA 2G9GA 3GHNA 2PAMA 4ATFA 1V6LA 2WS93 1RUNA 3KS7A 3MYXA 1D0HA 1GKBA 3ALQA 4Y22B 3SNMA 2BUKA 1XXNA 1LESA 1MACA 4M00A 1W6MA 4A7ZA 1DLLA 1WMEA 4AYUA 1O4YA 3LA2A 2XLAA 4QPIB 1AR91 2IXCA 3M2MA 3VBUA 4GWNA 1PO21 2DFBA 5CFDA 1AYM2 2BPA2 1Z7S1 1GZCA 2C5DA 3ZSEA 4DRVA 4YZ2A 4DNYA 2ZHMA 2DYCA 2P34A 3VL9A 3M4FA 1A8MA 3ILNA 1EPZA 3TNQA 3MI8A 4XMIA 5BNNB 3PVBB 4PLOA 4RL7A 4UW5A 4COZA 3FWEA 2ILMA 4JDOA 5KXEA 2WNEA 1AL22 1VBC1 1X82A 1H0BA 4LBJA 4N9IA 2QZ2A 4LHKA 4RS5B 2JXAA 4CEWA 2ZHLA 3HD8B 3I54A 5A33B 4O9GA 2B42B 4K1YA 5CFCA 1JUIA 3U11A 4D3WA 2RMU1 1LKNA 4YG6A 5IK7A 5GM0A 1H1MA 3IKWA 4AWDA 1GLHA 1QJY1 1MQTB 4QU2A 1CVNA 4XBLA 4IETA 1LRHA 2UURA 1KD7A 2BWCA 5CA6A 3GZTB 5KHIA 5L7OC 4DPNA 5I8TA 5JWPA 3D82A 1UZYA 3WT3A 2YC0A 3VBRC 2DUPA 2AGSA 2UWAA 3P3PA 2EAKA 3E5QA 3V56A 4OI2A 3CJIC 1H8VA 2HYKA 2Y0IA 3LGRA 4QPGC 3HWJA 3WP3A 4E9KA 2Q1MA 1Q43A 2A3XA 4LBQB 2JX9A 1WW6A 5FREA 3VDDB 2VOXA 1YJLA 1POV1 1SDWA 1U12A 2PA7A 4YW1A 5FO8B 2GC0A 2ZCWA 2WNUB 5EFUA 4EJRA 4QPGA 3NW4A 1DGLA 2ZGTA 2ZX4A 1O3QA 5I93A 2VNOA 1FT9A 2A7AA 1EAH1 4K9SA 3R4SA 1JN2P 2YYOA 3L2HA 2HWD2 5H9PA 5FDBA 1TME1 4RD7A 3TAYA 3S7IA 3WX5A 4K3UA 4EN8B 2YUEA 3VBFA 3DV8A 4CP2A 4ES8A 5I0SA 1EV13 2BFUS 3WZ1A 2RMU3 1D4M3 2E7AA 3HQXA 4WM8C 1WLWA 4XMAA 2VU9A 4FCAA 4MGYE 4QGNA 1RJ7A 4AVVA 2R061 3HN1A 2PN5A 1MQTC 4S2DA 1BQPA 1N3PA 1RUI3 1ASJ2 4YVWC 4MV2A 4WV8A 5L73A 1SQ4A 3SLIA 4I0WB 3NKGA 4IEWA 3KT1A 2HWD1 4LO7A 4Q0PA 1QMJA 3NL1A 3WDXA 1MS4A 4OLLA 2DWRA 1CGPA 1BVVA 3M3IA 1RC6A 3OTFA 1AR73 1LOGA 3MF9A 1SFYA 5AVAA 4L11A 1W6PB 3SH4A 2GMEA 1NCQA 2PAEA 4OULA 2ZGNA 3DPRA 1W6MB 1ENXA 4OZXA 4TSVA 3LSEA 1BEV2 4DB5A 4COVA 2F4PA 4KGGA 1ZZ9A 4GH4C 1RUG3 2PHDA 2ERFA 3JBG1 2WFPA 3FFZA 1Y9QA 2JDZA 1HQLA 1RITA 4Q4X2 1LU1A 3LA7A 2R072 1HQNA 2MHFA 1Q8PA 4BWOA 4LTAA 3ACLA 1X33A 2OVUA 1LGNA 1S0GA 3VL8A 1RHI1 2BYVE 3MPBA 1VLNA 3I59B 3E97A 4OVEA 1BMV2 5AC91 4XFCA 4I0AA 2HWE1 5F6KA 1N47A 3ETQA 2I45A 5GALA 1RUOA 5B2GB 3J8F2 3ZXGA 5FBZA 3MFCA 1LOCA 1MQTA 4YFWA 4FPKA 1R093 2VQ0A 3WW3A 1UAIA 1C8M1 3RPQA 2ARXA 4LEJA 2EA7A 3PMSA 4J1WA 1ZZ7A 3OCPA 3WP6A 4BLJA 3VBOC 3QD6A 4K7JA 2DVDA 1AX0A 1VBE2 2UWBA 1RMU1 1V70A 1S0IA 1D2SA 3OGJA 3B9IA 1Q8SA 1IPJA 2HWC2 3B7MA 5L19A 1VP6A 4Q26A 1PO11 3MICA 3QH6A 1RJ8A 1HXS1 1UD1A 4Q4V1 1DG6A 1BEV1 5CG8A 1UZZA 4CDQB 4JRLA 1AL0G 3BB6A 1XE7A 1VAKA 4KU8A 1O5UA 4Q4W3 2BVBA 3D8CA 5KBFA 1XNCA 3LSDA 2ZGKA 3HT2A 3RDIA 4FPYA 4I3GA 4P9IA 3ES1A 5KXDA 1BXHA 4BMEA 2PFWA 1F8VA 2GN7A 1OKQA 1AXYA 1CJDA 3CL1A 2OUJA 2R16A 4IEVA 1RUE3 1WCDJ 1C8M3 4U36A 1H2NA 4P9WA 3AZVA 3M3CA 1V9U1 2R041 2MEV1 4AVCA 4G9SB 2WS91 2XJUA 5JI7A 1AL23 1CQ9A 5CADA 3PMEA 1W0OA 2R30A 2UWCA 3OYWB 4LO6B 2JE9A 2PAKA 1KS4A 1D2QA 2X5IA 4PIXA 2D6NA 2EXHA 3H8UA 3FLPA 4XBQA 4R9CA 4XHXA 1PK6B 4ATEA 1QOOA 5E1RA 4TZDA 3ILRA 3S6PA 4HBNA 4XQ4A 1GBGA 1OQEA 1V9U2 2R042 1DQ2A 4Q0UA 4OI0A 2W39A 3NV4A 5CAZA 2ET7A 3UL2A 4Y5Z0 5FO9B 2Q8OA 2R062 5BXXA 2XUMA 5GLZA 2GNBA 3MLKA 1V00A 4Q27A 1FNZA 2RS53 3LA3A 5JIAA 1S0DA 2JEMA 4BH9A 1COV3 1O7FA 2WA4A 2GC2A 1QJX3 5ABJA 4R8HA 1B35C 1KFXL 4Y1UA 4HN1A 2D43A 4WM8A 3WR0A 3E5UA 5KHGA 3D0SA 4HVRA 2RS33 1WD3A 2P3JA 2BNMA 1WW5A 3ZDSA 2A5ZA 3WLUA 2YHJA 4AVSA 1EAH2 3ZFEC 1MR5A 2VECA 4F83A 2WNUC 4PBPA 3RMYA 2N7GA 2XJTA 2A3YA 3FLRA 4Q4X1 2ZGPA 2GALA 3A0KA 2R1BA 1QWRA 3NSTA 2KA3A 3PJYA 4CDUC 1ZA4A 5BNOC 3SHRA 3AZYA 1H9PA 1PZ8A 5K8SA 4GMP1 3MIGA 3USUB 5LRRA 2JKBA 2Q4SA 5K0UB 4OHZA 1XNKA 3ZFEB 4LNVA 1F2NA 4CDWA 1M4WA 3KD4A 4DOUA 4RQPB 2Y26A 3J9SA 4L99A 1DGRA 4LHNA 4JGYC 2CV6A 2D93A 3BALA 4MLOA 3WDWA 3OD0A 1IS6A 1SCRA 1LOBA 1OA3A 1KQRA 1LHWA 2CAVA 4N43C 4Q0SA 5SV8A 4N7UA 2VGDA 1BMV1 1NA1C 4HETA 2GU9A 3VBSA 4H14A 1OFSA 2WLQA 1W6OB 1ZYBA 4GXLA 4N7IA 1IKQA 1I5ZA 1PZ7A 5CFCC 4UBGA 2BTVC 4Q8LA 3FUQA 4AFCA 2W52A 1MS0A 1I9RA 1PGSA 1TNFA 1AJKA 4IV3A 1W6QB 2DF7A 3AJZA 3GF6A 2A6XA 5H9SA 2P3IA 3JB4C 2IWGB 5EYYA 1HIXA 4ORFA 3JB8A 5JMCA 5GZFA 2A6WA 1QOTA 1LOAA 3AX4A 4LULA 1LU2A 5CNAA 5J36A 4L97A 2HKXA 1DDLA 4SLIA 5HXVA 1Z0HA 1VALA 3NV2A 1MZ5A 5IK5A 2ZPXA 3H50A 1WGPA 4EN9B 3FZ3A 3WHTA 3ZSLA 4RS5C 3U4XA 2Q1ZB 5DUWA 1OLQA 4OFGA 3N4MA 3V0BA 1AR93 4FAHA 1Q5OA 3AMPA 2GSYA 5BNNA 4YW3A 2WT1A 4AHYA 1SLCA 1FPN3 2JG9A 4PF5A 5JDBA 4LE3A 4FPFA 2I2SA 3VBHA 4FAGA 1CR7A 1NLRA 1DQ1A 2VUAA 5HCAA 4UBHA 4IV1B 4DFSA 1G9BA 3WDUA 4FSJA 1KITA 2GC1A 2JG9C 5E88A 4EWAA 1HV0A 3B01A 1LODA 4S2FA 4MXVA 1PVXA 1OOPA 3ZN6A 1C3HA 4DQAA 3USSA 1MVEA 5CBLA 2HWF1 1QJX2 3QACA 1VAVA 3ME2A 2DCYA 1VBB2 4RR3B 3NJZA 2ZACA 3R6SA 2XL7A 3HBZA 2OUHA 3PLQA 4ZU5A 2OIIA 3I8TA 3FE5A 1LHUA 3LCPA 4HN0A 1LOFC 3RJRA 1QY4A 4M3CB 5KC6A 3KQRA 2JG8A 3VN4A 1G9AA 5J3UA 3POWA 5K0UA 1MS1A 2PHRA 2CNAA 4EROA 5LRSA 1O3TA 1VIWB 5KXCA 1GZ9A 5KWRA 4N9HA 1J59A 1Z78A 5J48A 2F6BA 1UPIA 1EPWA 3VKLA 4RR3C 2JD4A 4YZ3A 2BQPA 2QQPA 4PBOA 5DDJ1 3EXUA 2QZ3A 1AR83 4XILA 1NOVA 4HKOA 2A6VA 2HWB2 3APBA 2D40A 2XKPA 1GV9A 4IXLA 3ZYRA 3LWCA 2BFUL 4JRAA 3IDCB 4YM2A 1SMVA 3GALA 1MS8A 1FAYA 5K0UC 2A75A 3ZSMA 1FXZA 5BV6A 2VW2A 1LULA 1RINA 3G6JB 4Z92B 3KGZA 3CLPA 4FO9A 2E51A 4MYEA 5DZFA 3O7OA 4C1WA 1YHFA 4WZCA 2RS52 4GWMA 1RHI3 3RMXA 5JLVA 1LHNA 2H6CA 4FOYA 4JTOA 5T5OA 4Q29A 1YYNA 2PHFA 4CDUA 4IEZA 1RUF1 4IEOA 3C2UA 1IZ3A 2P3KA 2R49A 4UW6A 4YZ4A 5BNPB 1C1LA 3V65A 4XJ9A 1AXKA 3L9JT 4L92A 2WT0A 1CONA 3VBOB 3AKQA 1RUJ1 3M7AA 3ZYIB 2RM23 1F5JA 2Z79A 1WMDA 2HWD3 5E16A 1F9KA 2R0HA 4AFBA 3SXWA 2ZGRA 2RHPA 5FLHA 4WBBA 4B4QA 1HRI1 5JZGB 4HMZA 3QBQA 4JGZC 3WVJA 3B5LB 5C9AC 3VHRA 1XRUA 1MS5A 2ZGSA 3VZNA 1LCLA 2DFCA 1B09A 1ZVFA 2ET1A 2C1FA 1GANA 1Y3TA 1GQHA 3AXEA 4XPVA 5BNPC 3SH5A 4D69A 2DUQA 4DS0A 3GBFA 2I07B 1Q8QA 1H2KA 1KXGA 1D4M1 1JH5A 4LLFA 4CEYB 1EYBA 2DURA 4YM0A 1PIV3 4KQ7A 4H3WA 2A71A 4W6XA 4Y24A 3VHPA 2QCSB 1W6NA 1UKGA 4QGLA 4YG3A 2D3PA 4K20A 2OA2A 4RHV2 1ULGA 1K5MA 2A73B 5GLVA 4GB32 3VLBB 2WSUA 4ITCA 4CYDA 1DYKA 1ND3B 4FOVA 4FP2A 4LBOA 2GN3A 4DRRA 1IHMA 1F31A 3VBUC 5FQ0A 1SBEA 5C8CB 1OD5A 4YVWA 2IXKA 1VBB3 2TNFA 1QJZA 5GKAC 2DCTA 3ZVXA 1SBDA 1JXNA 1RUC3 3I59A 3I7DA 2XKOA 4A2UA 4AI3A 3CJXA 2D5FA 4JQRA 4V1PA 1W6NB 1GZWB 1UCXA 4FPJA 1RVF1 3KZ4C 2XGXA 1WW7A 4XIOA 4HANA 2XG3A 4KWKA 4MZUA 1PK6A 2DVAA 3UKTA 1DBNA 3RJ2X 1O3SA 2ZAAA 4OI1A 3H9AA 3ZO0B 2AYHA 1QJY2 3ELNA 4RSUA 4XJAA 5J96B 5JSOA 2JG8C 4WM7C 2ZGMA 2RS13 5A32B 1CAXB 1OOPC 4CRQA 3FBYA 1VBC2 3KMHA 3HAGA 1VBC3 4JGYA 1S2KA 1H4GA 1YRZA 4F7ZA 1GNHA 1O4TA 2UY8A 3QH7A 3UJQA 4GALA 2GNDA 2RS12 3ZN5A 4I01A 1YUDA 5FFOC 1XQNA 2GH8A 3UK9A 1J1TA 4HK9A 2CYFA 3RG0A 1TNRA 4I09A 3ZYPA 1OQDA 4LO8A 1QJU3 3VBOA 2P17A 3AKTA 3NKTA 5BNNC 4XYXA