2IZWA

Crystal structure of ryegrass mottle virus
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
178
structure length
178
Chain Sequence
b'QYGDITPAKNSGSLVRVTSSATAGTEVSGTVLFNVRNATELPWLSGQGSRYSKYRVRYAHFTWEPIVGSNTNGEVAMAMLYDVADVTSITIERLMQTRGGTWGPIWSPTRKRLSYDPEHASLPWYLSGVSSGAAAGNIQTPFQIAWAAQSSLVSTTLGRIMAEYLVELTDPVDVTINQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RYEGRASS MOTTLE VIRUS COAT PROTEIN
publication title The Three-Dimensional Structure of Ryegrass Mottle Virus at 2.9 A Resolution.
pubmed doi rcsb
molecule tags Virus
total genus 44
structure length 178
sequence length 178
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2izwA00
5DDJ3 1F2NA 5AC91 3VBRB 2MEV2 2HWC1 1X36A 1MQTC 2ZAHA 5FMOL 1EAH2 1R091 1MEC1 1NCQB 4Q4W3 5JZGA 4RHV2 4CEYA 1COV2 1D4M1 1ASJ2 1PIV1 3CJIB 1QJU3 1AL21 1OOPA 1RUI3 3ZFFC 5AC93 5K0UA 1RUG1 1RHI3 1RUD2 1V9U3 1X33A 1QJX2 3VBUC 1RUJ3 2HWF3 4CDQA 1CD3G 1VRH2 1QQP2 4IV1A 1HXS3 1D4M3 2RS13 1AR61 3JBG1 1VBA2 1RMU1 3ZFGB 1RUG3 1NG0A 5D8AC 2WZR3 1SMVA 1W39A 4Q4V3 1B35C 3JD72 2HWB3 2PLV2 5LK7B 1RVF1 4JGZC 4RR3B 4JGYA 4WM7B 1AR71 5BNOC 1H8TB 2Y26A 1EV11 1BEV1 1R1A1 1QJY3 5AC92 4WM8B 2HWE1 4Q4X3 2HWC2 2RR13 4PDWC 4CEWB 5C9AC 3NAPA 1AYM3 1PVC1 1D4M2 1ND2B 1TMF1 1AL22 2RS12 5ACA1 2GH8A 3JB4C 4IV3A 4YVSA 1HRI3 1K5MA 1RUG2 4RQPA 1ND3A 1PO21 4QPGA 3VBFA 2RS31 4CDXC 1MQTB 2MEV3 2WZR2 1VBD1 1HRV3 3ZFEC 3M8LA 2X5IC 1FPN1 1EAH3 4QPIC 1AR62 1R081 3JBG2 4RR3C 1RMU2 4WM7C 5BNNC 4CDWA 4NWVA 4RHV3 1VBE1 3ZFFB 1COV3 1VBB1 5C4WA 4CDUA 2RR12 5L7OA 4Y4YA 1NA1C 1VB2A 4YVWA 3VBHC 5BNPC 3VBUB 4CEWA 1RVF2 1AYM2 1QJX3 4N43C 1AR72 1C8M1 1BEV2 1VRH3 2R061 1QQP3 1R1A2 1RUE1 4GMP1 4RS5C 1VBA3 5D8AB 5C8CA 2WFF1 2GSYA 3VDDA 1AR93 1B35B 2RS51 1HRV2 1PVC2 3J8F1 2WLPA 1POV3 3JD73 4JGZB 2RM21 4BCUA 1TMF2 5CFDA 5ACA2 2PLV3 5BNOB 4GMP3 2HWD1 3DPRC 3HAGA 5FMOS 1FOD1 2RS32 5CFCC 1BMV2 1A6CA 1E57A 4PDWB 4FTBA 4SBVA 1VBD2 2HWC3 5C9AB 1FMD1 3ZXAC 1FPN2 4NWWA 5A32A 1R093 4GH4A 3VBSA 1HX6A 1MEC3 4Q4Y1 1R082 1PGL1 2RMU1 1VBE2 2FZ2A 1PIV3 1WCDJ 5JZGC 1NY71 4N53A 1AL23 1AUYA 4CEYC 1OPOA 1NCRC 2BBVA 1OOPC 2QQPA 3VBOA 4CDXB 5A33B 1AR92 4AEDB 1AR81 3ZFEB 4RFT0 2X5IB 3VBRA 1C8NA 2R062 2RMU3 4QPIB 4CDQC 1RUE2 1PO11 5BNNB 2BFUL 1AR63 3JBG3 1RMU3 1RUH1 1NCQA 2WFF2 2XBO1 1BBT1 3CJIA 1NA1B 2RS52 2BFUS 4LLFA 1RUF1 3VBHB 5BNPB 1TME1 1RB8G 2RM22 1R092 4N43B 2WS91 1MEC2 1RVF3 1AR73 1ZBA1 2HWD2 1EV13 1BEV3 1Z7S1 4JGYC 4Y5Z0 1PIV2 1FOD2 4GB31 1R1A3 5ABJB 1VBC1 2HWE3 4RS5B 1FMD2 2ZTNA 1POV0 3ZFGA 1HQNA 4AEDC 1PVC3 3NAPC 1PGL2 2RMU2 4GB33 1NY72 1VB4A 1TMF3 5ACA3 3DPRB 4RR3A 4WM7A 2R041 4IV3C 4YVSC 1H8TA 1K5MC 1PO23 5CFCB 4RQPC 1ND3C 2RS33 1AR82 4QPGC 1ASJ1 3VBFC 4WM8A 1VBD3 1NA1A 1FPN3 3S6PA 1PO12 3TN91 1R083 1EV12 5JZGB 2R043 1AYN1 1RUH2 4CEYB 1VBE3 1OHFA 2XBO2 1NCRB 1VBB3 1OOPB 2HWE2 1ND2A 1ZBE1 5ABJC 5K0UB 4CDUC 5C4WC 1RUF2 5L7OC 4FTSA 4FTEA 5DDJ1 4YVWC 1MQTA 1C8M3 4CDQB 1ZBA2 1Z7S2 2R063 4GB32 3IDEA 1RUE3 1VBC2 2R071 1PO22 3DPRA 2IZWA 1VAKA 4Q4W1 2WFF3 3ZFFA 1QJU1 5C8CC 1RUI1 2RS53 3VDDC 3J8F3 3LOBA 1RHI1 1IHMA 2RM23 1V9U1 2R073 3VBUA 5CFDC 4JGYB 4EJRA 5J96B 1RUJ1 2HWF1 2HWD3 2R042 1FOD3 1QJZA 1VBB2 1HXS1 5GKAC 1NCRA 2RS11 2ZZQA 5K0UC 1FMD3 5D8AA 3TN92 3NAPB 1C8M2 4GH4C 4Q4Y3 1B35A 3VBSC 2WZR1 4FSJA 1RUC1 4Q4V1 1AYN2 2WWSA 4IV1C 3FBMA 2HWB1 4JGZA 1ZBE2 4N53C 4IV3B 4YVSB 5BNOA 1K5MB 4RQPB 1GFF2 1ND3B 4QPGB 3VBFB 3VBOC 5DDJ2 1AR83 1QJY1 1M06G 3J8F2 2BUKA 4PDWA 4Q4X1 2RR11 3VBRC 1RUC3 5C9AA 1PO13 2BPA2 2R072 2VQ0A 1AYM1 4CDWB 1RUH3 4Q4W2 2XBO3 2DF7A 1BBT3 4CDUB 1NCQC 5C4WB 1QJU2 5L7OB 1RUI2 3CJIC 1RUF3 1HRI1 1TME3 1PGW1 1RHI2 4YVWB 5A33A 4CDXA 2WS93 1V9U2 1AL0G 4GMP0 4Q4Y2 4AEDA 5FOJB 2MEV1 3ZFEA 1CJDA 2X5IA 1ZBA3 1RUJ2 2HWF2 1HRV1 1Z7S3 4QPIA 1HXS2 1EAH1 1VBC3 5BNNA 4RHV1 5C8CB 1COV1 3VDDB 3ZFGC 1BMV1 1RUC2 4Q4V2 1F8VA 3VBHA 5BNPA 1RUD1 5CFDB 2HWB2 4N43A 1NOVA 2XPJA 1QJX1 4CDWC 1VRH1 1BBT2 1QQP1 1H8TC 1QJY2 1ASJ3 5ABJA 4Q4X2 4RS5A 4WM8C 1TME2 1VBA1 2WS92 5A32B 1RUD3 4GH4B 3TN93 3VBSB 2FZ1A 4CEWC 1AR91 5J98B 4Z92B 4IV1B 2TBVA 1AYN3 1POV1 4N53B 3JD71 1ZBE3 2PLV1 1ND2C 1DDLA 1HRI2 3VBOB 1PGW2 3JB8A 5CFCA
chains in the Genus database with same CATH superfamily
1F2NA 2ID4A 3HBKA 1OFSA 1W0PA 3DCQA 1GQHA 5CVRA 1N1VA 2HWC1 4Y1XA 3MV11 1QF3A 4FT8A 5DUVA 2ZAHA 3P3NA 5FMOL 4NPLA 5FY7A 4XAAA 5I0TA 2DTYA 3WP6A 5JOYA 4QM9A 2G1MA 1W2OA 5DAQA 2TNFA 4JC1A 4XBLA 2Q8EA 1XNBA 4PBOA 3ZXEA 4ZPIA 1LOFC 3MW4A 2OUJA 2VW2A 2QKDA 2XKPA 2D40A 1ASJ2 3B7MA 5LBFA 4COVA 1RUI3 3C7OA 1DZRA 4NRMA 3S5AA 5K0UA 3T0AA 3P5BA 3I2IA 3N9OA 1JW6A 1RHI3 1ZRIA 2ZGKA 4XEZA 2A6VA 3PVEA 3M7AA 4A3ZA 4ES8A 1ZRCA 2X29A 3R4UA 4CVUA 4LUMA 4URTA 1QJX2 3Q8AA 3SQOA 4YZ4A 4AVAA 3BTYA 3B3QE 1IS5A 4AYUA 3KCXA 1Q8QA 1SFYA 4E8CA 1CD3G 3EMRA 1JH5A 4XZUG 4IV1A 2XJTA 1H1AA 4WZCA 3AKRA 2E7QA 4SLIA 3JBG1 1VBA2 2YGMA 5IAVA 2QE3A 3AKTA 5IYYA 3SXWA 2G4IA 4LKFA 4RA0A 1AJKA 3OUJA 1AZDA 4KG0A 5FP7A 3VDAA 2OX0A 3OB8A 2O1QA 5BNQA 3FLRA 4QHBA 4FP3A 3ST7A 2OZJA 1YC61 1H4GA 3USSA 3MEPA 4I30A 1FATA 3QH6A 2VULA 2VOVA 1OA2A 3ZXJA 5LK5A 4N9HA 1RVF1 3D8CA 1SDDB 1GKBA 3I3DA 3LSEA 4W6YA 4WM7B 3S5QA 4A45A 1M4WA 4A41A 1O3RA 5A3OA 3RNSA 1LHUA 2N7GA 1EV11 2UWAA 5FPXA 2D44A 3VDBA 4UW6A 1DIWA 1WKYA 3IN9A 3NJZA 4CXXA 4DFSA 1WMXA 1UU4A 4WM8B 4YGCA 4Q4X3 3GJAA 2DVBA 4H3WA 2CL2A 4XF0A 1JYVA 4KU7A 1AX1A 1RGSA 2O14A 4LO6B 1OA4A 2W1SA 3T1MA 4AL9A 3NAPA 5LB6A 3TRSB 2YMZA 2ZGLA 3POFA 3O1MA 5GZDA 1MS4A 4JZRA 4XIOA 1IOAA 5BUVA 5I0SA 2D6MA 2R1BA 4M4RA 1I1EA 1W6PB 2A71A 2GH8A 3JB4C 4B1MA 1OT5A 4K20A 4YVSA 1HRI3 3FX3A 1RUG2 1Y7BA 5J36A 3B93A 4RQPA 3MI8A 2WO2A 2XMLA 3HJRA 2WQZC 2FDGA 3VBFA 4D0QA 2YU1A 1JYNA 5FZAA 1LOEA 4BK5A 1MQTB 2WZR2 1UF2C 4LE3A 3L2YA 3BOPA 3IIIA 2B42B 2WNUB 2IXKA 2X5IC 4MXWB 1XE8A 3KCCA 4FPGA 1GNHA 3I2FA 1S2BA 4LIVA 5CEHA 2VOWA 3H8UA 5LEKA 4D7SA 5DZGA 2PMWB 4D6QA 4ZXKA 4NPMA 4I3GA 3SCFA 4HZFA 1DG6A 3T09A 1VBB1 1DU3D 4Q1PA 3SISA 2RR12 5L7OA 4EZHA 4Z2AA 5GZEA 5JR7B 2PAKA 4LITA 2J1AA 3O1PA 2O8QA 1S0GA 3O1TA 5FZMA 2D3PA 1YJKA 3WHTA 5GZGA 5BNPC 1SPPB 3VBUB 3OD0A 4CEWA 1VLNA 4PHZA 1QJX3 5FBZA 4XQ4A 1AR72 2YYOA 3P1IA 4JAAA 4UI9L 4Z07A 2XKOA 2R061 5LA1A 5FIXA 4BQ5A 1R1A2 2W47A 4FPLA 5EPAA 5E8AA 3AMMA 3CZJA 4O61A 5JMOA 2QUOA 1VBA3 2A75A 5D8AB 3LEMA 1OQEA 1N1TA 1WD4A 5T50A 1QOSA 5DAVA 5EWSA 3VDDA 2D6KA 5T5JA 2VZVA 1HRV2 2ZX4A 4M3CB 2D6LX 3FC0A 4LO8A 4LHLA 5JPMB 1OLQA 4Q1RA 5IVJA 3UJOA 4HBNA 1XNTA 4H55A 4JGZB 3VUOA 1TMF2 5CFDA 4DUXA 2ZHMA 1H9WA 4RSUA 1LNSA 2XJVA 3AYCA 4D7YA 2X53S 4CU8A 1GQGA 4NHMA 3DPRC 5FKCA 2BOIA 2VAUA 1YIFA 4PF5A 2UURA 3ZN6B 3RRDA 4KH9A 5DZFA 5FWEA 3ZN4A 4DEVA 4QKNA 1Z78A 1BMV2 1AVBA 3J4UH 1W3VA 2OW4A 4M0NA 2QCSB 3BU0A 4DEQA 5I8YA 1RXGA 4HPKB 3ACFA 1R093 1SLCA 2VOTA 4UWDA 1HDKA 2E31A 3OUIA 3T2OA 1R082 2QNKA 1SLTA 2RG4A 2P34A 4I0AA 3WNOA 2RMU1 2YC4A 1H9PA 1YQ5A 5FYSA 2DCJA 5LA2A 1ZZCA 2XH6A 1AUYA 3WW2A 1JS9A 3N7MA 4CEYC 3H8OA 1JUHA 4C8DA 1X50A 1OOPC 2Z4FA 4UYBA 4A42A 2P6HA 4EROA 1P8JA 4A3XA 5DG1A 4CU9A 1CPMA 3WVJA 1AR81 4AI2A 1UY4A 1GWLA 4LA2A 4XTPA 3GXUA 4XJZA 4AFBA 2H0BA 1QIQA 4D8MA 5FYBA 1Q5OA 4DRRA 5F37A 4I02A 3BOWA 4P5HA 4QPIB 4COUA 2D7FA 1DGLA 4YM3A 5KHGA 1RUE2 2D6PA 2HKXA 1UU5A 1V6NA 1CESA 2VU9A 1ZZ6A 2LROA 1OLRA 1S0EA 4CP9B 1DZQA 4OHXA 1NCQA 2JG9B 2QQIA 2WFF2 2VZPA 1OD5A 4KWLA 3RMXA 1NA1B 2RS52 2PQSA 2BFUS 4OHWA 1O4TA 3RFRA 3G6JB 2BQPA 1LEMA 1TME1 3POIA 2ZX3A 4NHLA 2RM22 4AGGA 1MS5A 2JD9A 2WT0A 4X8PA 4XCBA 1S0DA 3BALA 5A1FA 1AR73 2W87A 3GZEA 3J7HA 2HWD2 4JGYC 1YFXA 4QAWA 1L7QA 1UOBA 2Q30A 1XPWA 1R1A3 1E5IA 5ABJB 2NLRA 2WUHA 2HWE3 3OY8A 1HJFA 1UX6A 3OTFA 3RGBA 2XLFA 3A0KA 3WLUA 2VVDA 1NLRA 1OQ1A 4N9IA 1STMA 4XE9A 4YYOA 1SACA 4PLOA 5DABA 3M3EA 1OUSA 3WNKA 1LOAA 3IMMA 5FPZA 4D6SA 3ME2A 5F39A 2D43A 1PGL2 1QHDA 1UZVA 4OVEA 1NY72 4K21A 1TMF3 4B29A 5HXMA 1IZ3A 2IUWA 5J3UA 1UIKA 1UPIA 1IKPA 2VVFA 1NKGA 5T5LA 2EXKA 2ZEWA 4QXHA 4NHKA 3O1SA 1X9TA 4IEUA 1ALYA 1H8TA 1PO23 2MNGA 2ZX1A 1S2KA 2J1VA 3R4DB 4P08A 1I3HA 1CJPA 2VUAA 4PLNA 3WUCA 4Y3OA 2E7AA 3TEYA 3UGGA 4QPGC 4OUSA 4GD4A 5H9RA 3USUA 2VOXA 4LO7A 4XOGA 3QOPA 4Y1YA 4QGNA 2VE1A 2XVGA 5FP3A 4ONUA 1W8UA 2CY6A 4LBNA 2JG8C 3POYA 5IVBA 5K7PA 5JMCA 1R083 1EV12 4N7UA 3ZR6A 1PVXA 4LA3A 2B9VA 4I0BA 2R043 4BOWA 1RUH2 3SITA 3VKOA 3ACLA 3JXSA 1F9KA 1NCRB 5FZKA 3T3YA 2EXHA 2W52A 3BIWE 3ZX7A 1JZ6A 1X82A 2HYKA 5K0UB 5F6KA 4CDUC 5C4WC 1HN0A 4AVCA 2FDFA 2JDAA 1IKQA 4F3JA 1WBLA 2W2IA 2I07B 4YRDA 1O59A 5DAXA 1XRUA 4BQ4A 4FTEA 4FFGA 1GSLA 1V0AA 1CONA 4LKDA 3U10A 3B9IA 2P4EA 2EF6A 4LK6A 3FHQA 3QD6A 5A6XA 1ZBA2 2EAKA 3OBAA 2AACA 1Z7S2 3MIGA 4XACA 4GB32 2A5ZA 3N7JA 3SMHA 3IDEA 1RUE3 3ACIA 3HVDA 1JTZX 4MUVA 5FKBA 3WP4A 2ZGNA 1UXZA 2Y6KA 3ZSKA 4OCTA 3DEMA 3DPRA 2IZWA 2WABA 4LO5B 5A1AA 2VVEA 1W9FA 1XE7A 2CGOA 2ZA9A 1SBFA 2WFF3 4IETA 4L8QA 5GALA 5F2SA 3AXEA 3LDKA 3UNPA 5C8CC 1RUI1 2RS53 4NO4A 3OBRA 3J8F3 1HB4A 1SDWA 3IB3A 1UY1A 3W21A 1ZRFA 4LO4B 4YG3A 3AKPA 1LAJA 1CAXA 1RHI1 3VKFC 1ZNPA 1EPZA 2RM23 2YB7A 2V09A 3BTXA 1MVQA 3FL7A 5C3OA 2D98A 1V6OA 5C5TA 1VMFA 3LEIA 5CG9A 4IEXA 2HWD3 4GKXA 3AZZA 5JSOA 2EXIA 5A7WA 2BP6A 2ZHKA 3B69A 1VBB2 4LQRA 1YFWA 2PHLA 3N7KA 3DYOA 3LGRA 4JTNA 4HG6B 4UFHA 5GKAC 4I09A 4LKSA 2WINB 1MZ6A 4BZ4A 1BQPA 3U78A 5F8PA 4QKDA 5EHDA 3RWNA 4OI0A 4UF0A 1YFUA 1DBNA 4R4XA 1YRZA 2ZGMA 4F7ZA 3VL8A 3NAPB 5DZEA 3T4VA 4XQWA 5JXIA 3VBSC 1VP6A 1RJ7A 4CA9A 3LA3A 4CCKA 1W8ZA 1SLBA 2WWSA 5IK8A 2QZ2A 3NNJA 5AFEA 1BLZA 1ZBE2 2VMDA 3CBNA 1MACA 2OS2A 4QB2A 4V2VA 2XLAA 4YVSB 5BNOA 1G9CA 4RQPB 3BVCA 4N7IA 3K4ZA 4YM2A 5FWJA 3VBFB 4HXCA 4IUGA 1YNAA 3A21A 5DDJ2 4F8AA 4W65A 1YEWA 1HB1A 4GA9A 4Q4X1 1KGYA 4QHZA 1W06A 2XOMA 3OUHA 3BIEA 1F4AA 5C9AA 2OXBA 4RGKA 2AEYA 2WNVA 4BQ2A 2EXJA 2P37A 4PIXA 3AZYA 4CP2A 2BPA2 2Y6HA 2VQUA 3GHMA 2W08A 1N3OA 1WLCA 1C5HA 1AHSA 2VO5A 4YFZA 5C3RA 2ARBA 4XJUA 3W58A 1RUH3 5DXDA 2CHHA 1JODA 4Q0QA 4YZ2A 4AHXA 5CAZA 5L7OB 3RWKX 4NIHA 3VD7A 3O5SA 3VD3A 4LULA 1GOHA 1UZZA 2GALA 1HRI1 3ASIA 5GM0A 5FOBB 4YM0A 3I7DA 1UD1A 1UYYA 2X10A 1HKDA 3HNMA 3NV1A 4NRQA 5FOJB 3C8XA 1FYUA 1CJDA 3FLTA 4NMIA 4LK7A 1ZBA3 3E97A 2VCMA 1Z7S3 4BLIA 4LXLA 3VD9A 2O8OA 1GZ9A 4AQ6A 2LTNA 3UESA 5FDBA 3N3HA 5JOWA 5BNNA 1NZIA 2JICA 4LOTA 4GWMA 4A6SA 3POEA 1CZVA 3VDDB 2JECA 4FPEA 4Q4V2 1F8VA 3AMNA 2YC2A 2WA3A 1YCIA 2VZQA 5CFDB 1H0BA 4BM8A 4KBBA 4N43A 2JXAA 1OXCA 4LHKA 3LQCA 3ZYBA 4RGAA 3ORJA 1JXNA 1QJX1 2XJUA 4YW6A 5FQ0A 4P9JA 1VAVA 3BB6A 3Q8FA 1OQDA 1KJLA 2IXIA 4ZU5A 4CDWC 5FREA 2I2SA 3O1RA 2IVJA 4C90A 2ZGSA 1QJY2 2BGPA 2GMMA 3MHZA 4CYDA 3GNEA 4RS5A 1GUIA 5HCHA 1TME2 4XFAA 4QQPA 1VBA1 2BJSA 1JZ4A 4O9EA 5J09A 2VC9A 2OQ6A 3CZUA 1UO9A 4QGMA 1WLTA 1FNZA 4QWNA 2NYYA 1IGOA 5FK8A 3TYJA 1QY4A 1Y4WA 4OUEA 2RVAA 4Z92B 1UAIA 1OKQA 4EWDA 2B9UA 2JE7A 1W6QB 4CUAA 1ZYBA 1ZBE3 4CUCA 4AFAA 1U5YA 1ND2C 4ZS2A 1DDLA 1IQDC 3ON7A 1KRIA 1PGW2 3ZDVA 3MFCA 2GC3A 3TOJA 1W6OA 4K7JA 3A22A 1X8MA 5DDJ3 3KV4A 4YNIA 5FXWA 3RYKA 1W9TA 4A2UA 3V64A 1Y9QA 2C1FA 2WIIB 2ORXA 2P17A 2BWCA 5AVPA 2WL1A 4X6RB 5JSRA 3N9QA 5ANNA 2UYAA 1J59A 1R091 2Q1FA 1S1AA 4UAPA 2JJ6A 5FZ3A 2ETEA 4L0PA 5C8WA 5IUQA 1US3A 3VHPA 1HQWA 3ZYPA 1NCQB 4AI1A 5EYXA 2ILMA 3NL1A 2IXLA 3VZKA 3WNXA 1COV2 5IFPA 5JCTA 5KC6A 1LU1A 1CAWA 1UY3A 3I97A 5KR7A 3ZFFC 5AC93 1GV9A 2W94A 2CNAA 2HYXA 1RUG1 3ZYJB 3IWZA 5A7OA 1RUD2 3DYPA 2VNRA 1O5UA 1GZTA 4DY5A 4LBMA 3MF9A 1X33A 2GC1A 4KWJA 4CCEA 5J7MA 3V56A 5C70A 1DQ4A 2JKXA 3KD4A 3O14A 5H9SA 4W4ZA 2BNOA 4S2HA 2E33A 4NUBA 4OMCA 5JXJA 1D4M3 2DVFA 3OY8B 2QQVA 2RS13 2XJSA 3PUAA 4UFLA 2PTMA 3AXDA 3V0AA 4Q0SA 1GNZA 4OFGA 2BW8A 3RI9A 4K9SA 1LOGA 1WW6A 3AP4A 1DGWA 3OCPA 3OYWA 2NM1A 3LPFA 2YDEA 4RL7A 5DUWA 1NG0A 5FZEA 1A8DA 3P6BA 5FYCA 4QD2A 1PMJX 2J7MA 3PURA 4FPCA 4MXVA 4P9LA 2EALA 1W39A 4Q4V3 1B35C 1PX3A 4UW3A 3WNMA 3JD72 3R4SA 3HN1A 3BKZA 1X9PA 5LK7B 2HEYF 4WBBA 1RC6A 2LRPA 3O0VA 4XF4A 4ZHNA 1AR71 4GJZA 1H8TB 4Q0VA 4KGQA 3N9NA 5TSWA 4QXKA 1Y43B 2JIJA 3ZXGA 1R1A1 1QJY3 4HLTA 2XLGA 5FLIA 4META 4OHZA 1ODNA 4HVRA 1I9RA 3USUB 2HWE1 5FO9B 1CR7A 1QDCA 3E5QA 4PDWC 1OD3A 3LIHA 4YPJA 3RPQA 3U07A 2ZOEB 1DQ2A 1EYBA 5FYHA 3VZMA 3KV9A 2R16A 3UKTA 4DXTA 1O3QA 3APBA 5FPLA 3S0MA 5JIAA 2ES3A 1QNYA 1PX4A 1UZ0A 2ATFA 2GDFA 1J3PA 4WZFA 1UMZA 1TMF1 5F3GA 1F5FA 4LIUA 1ZZBA 4EZ4A 2JD4A 3AMHA 4AI3A 3D3AA 2DURA 4LBQA 3SEPA 1A8MA 3DL3A 1PO21 3H42B 1C1LA 2Q8OA 3B94A 4CDXC 3H3ZA 5JAXA 1IS3A 4OLLA 1KD7A 4TSVA 1D2SA 3ZFEC 3CL1A 5C6CA 3E5XA 4Q0UA 2JKBA 4ZONA 2P2KA 3LA2A 3FJSA 3T08A 1XNAA 4LTAA 4U2AA 5I91A 3DN7A 4AFMA 4YGEA 4KNCA 1R081 4RR3C 4ARYA 1RMU2 4CDWA 2DBIA 4RFRB 1ZRDA 4NWVA 3UKNA 4Y24A 4BA6A 3KWVA 1COV3 3VHRA 3MIDA 1UWWA 4DXRA 2ARXA 2ORZA 5CYYA 2A1XA 3CMGA 4LMFA 1VIWB 1QGLA 1SFPA 3GHNA 4Y4YA 3IKWA 1UKRA 3WD5A 3M3OA 1CAXB 4I3PA 3M1HA 2VZOA 3X29B 2WNEA 2DCYA 4Z82A 1VB2A 3MPPG 2JDPA 4YVWA 3VBHC 4R9BA 2GNMA 5I0RA 4RGGA 4AEKA 4IEVA 4UW4A 2DTWA 2CAVA 1T6BX 5A7WB 1JI6A 2YZ4A 5LY2A 3ZOIA 2P6CA 5C71A 1CGPA 1YJLA 5H9PA 1RUE1 2DVGA 4NAMA 1WW5A 4ISRA 5FR3A 4GMP1 3WNLA 2Y6FA 5FZ8A 1S0IA 4IE0A 5D21A 1GR3A 5A70A 5B4NA 3NNMA 1UXXX 3N9LA 4R8HA 4UF0B 3A7QA 2P3IA 2VZUA 1V6LA 3OEAA 4OHVA 2WFF1 4E4SA 3WF0A 2AENA 1MS3A 2RS51 1PVC2 3M3IA 2PHFA 3FHIB 3J8F1 1KJRA 2G9ZA 4QX8A 2RE9A 2W92A 1OVSA 2WAOA 3WW4A 3JD73 2RM21 1W0NA 3ETQA 2DU1A 3LWCA 4OYUA 5BNOB 5FJKA 5C3SA 5FV3A 2YUEA 3E5UA 2HWD1 1S0CA 5EJZB 3PUIA 1JUIA 5FXZA 3ZO0B 5F32A 4LBOA 5CFCC 1E57A 4NR1A 4DXZA 4MO3M 5C9AB 2WNVB 3C7FA 2WZ8A 2WN2A 3ZXDA 5KXCA 5A32A 1HN1A 1XNKA 1TE1B 3JQXA 3LE0A 3ZXFA 5FBJA 4H7LA 1PGL1 3D4KA 1OH3A 4MSVA 5D2AA 2K9ZA 1VBE2 2YG0A 3WEZA 5FZGA 1PIV3 5JZGC 2FZ2A 1NY71 2QDNA 2A3YA 2D6OX 1OPOA 2BBVA 1FAYA 3SEEA 3IZOA 1QXRA 2HH9A 2WNOA 1C28A 2WT1A 5FUPA 3TNQA 3UV9A 4QDQA 4QB6A 1O4ZA 3VBOA 1I6XA 4EE2A 1OLME 5APAA 4P9WA 2QQKA 2ZZJA 5CKQA 2XUEA 1A78A 2KM2A 1O3TA 2DU0A 4OHYA 3GZTB 3VBRA 3ES1A 1I5PA 1U12A 3MUZ1 1UIJA 1BK1A 1BYHA 4JX0A 3O1OA 1REFA 3KV6A 4CDQC 2VZRA 5HPOA 3ZYRA 5FPAA 3J26N 4AAPA 2C4XA 2UY9A 5BNNB 3PDQA 4PCRA 1UKGA 4ZZ5A 1WLWA 2VMEA 1RMU3 3I3EA 4IDZA 3PTRB 1RUH1 2VD7A 1KDMA 4UFJA 3WF4A 2VQAA 3WQBA 2PHWA 3CJIA 1QXPA 1ZZ8A 3ENRA 4IE6A 4XFBA 4DOUA 1UW8A 2JWPA 4MGZE 1H8VA 1FV2A 4XJ8A 2AYHA 1RB8G 2W3JA 1R092 2VCBA 1TG7A 4N43B 4HFSA 4RN5A 3GGLA 5FY5A 4CCMA 5FQ0B 4RYDA 2XXZA 4AW7A 4XTMA 3TEWA 1ZBA1 1LB2A 3ZIWA 1Z7S1 4COZA 5A6YA 2BVVA 5A3NA 3KF3A 4GB31 1SBEA 1XJAA 4K40A 3U4XA 4RS5B 3AYAA 3TB0A 4BXFA 2V4AA 5L9RA 3KGLA 2XDVA 2ZTNA 1POV0 2YBPA 1W9WA 4Y1UA 5FY0A 3ZFGA 4V2WA 1HQNA 3RVHA 4HOOA 4NHXA 1LENA 4AEDC 4O7XA 1PVC3 5IVYA 3ZSJA 2QQUA 2B7YA 1R64A 4GXLA 1EP0A 4C91A 5T54A 2BBAA 1CZTA 5JI7A 2DUQA 4AHWA 1OLMA 2R6QA 4RR3A 4IV3C 3KCYA 3BN6A 1JZ3A 1GNYA 1K5MC 1W6OB 2B4KA 2C9AA 5FZOA 3T2TA 1ND3C 5CADA 3F2ZA 1REDA 1J83A 3PVBB 4XUNA 1WCQA 4YW5A 4MX3A 4IE4A 4L99A 1CPNA 1Q56A 4Q5OA 1LULA 3CDZB 4EN8B 4QQLA 4IQPA 3Q8EA 3MLJA 1E5SA 4ATFA 2MPFA 5FZCA 3N36A 1W2TA 4CCDA 1BK0A 1PK6C 4W50A 3ETPA 4XF3A 1VBE3 3OG2A 1CAWB 1O7FA 2HWE2 5F3IA 4BJ0A 1ZBE1 1KQRA 5F5QA 3LA7A 1G9FA 4S2FA 1QJFA 1S0FA 2VL4A 4HMZA 1O91A 4YM1A 1J58A 2O0OA 5DDJ1 3D5OA 3OBZA 3WP5A 3WOGA 4CTEA 5F5IA 2FQPA 1C8M3 1N47A 2H6BA 3E1F1 3RZHA 4NIGA 4IE5A 1SQ4A 2J1RA 5FXXA 3ZLIA 1WD3A 4AVVA 2R0HA 2DUOA 4FCAA 5F1RA 5FJHA 2JDKA 4X6QB 2QVSB 2WBKA 2EVXA 3CO2A 4H2AA 3V0AB 1L3JA 1XYNA 1LOFA 4XXAA 1DQ0A 5C33A 1K3IA 1PO22 3OYWB 1YIPA 2PHDA 4JKMA 2OA2A 5M0TA 2CAUA 2CGNA 3LB9A 4XAEA 1UYXA 5C3QA 3I3QA 2YHJA 3LOBA 4P5YA 2HBTA 4FQ4A 3JZVA 2XHNA 2C26A 2VH9A 5FZDA 1IHMA 3GYDA 2LS6A 3OSDA 4JCKA 1BZWA 1DGRN 2R073 5E16A 1RINA 3MYXA 3U11A 2WR9A 1PZ7A 3AL5A 1XSRA 2R042 1H2NA 3J7LA 4DMIA 4ZU7A 3OPZA 2JB8A 5FYYA 3VZJA 2J1SA 1DCSA 4MGIE 4FP2A 2RS11 4NIIA 3WV6A 5A1LA 5AVAA 2VY0A 3HD8B 3GCXA 4M00A 1SG3A 2PYTA 2VMHA 3WDWA 1C5IA 1CN1A 4K8RB 3TN92 2D3SA 5L9VA 1AJOA 4GH4C 1LOCA 3SKVA 5C3PA 1HV1A 4FSJA 1RYYA 1Z0HA 2B45X 1HW5A 4Q4V1 5K4LA 3LDBA 1WCUA 5ERLA 4DPNA 4FFFA 4A7KA 3K75B 3MGUA 3EHKA 4UW5A 3KGZA 3OGSA 5A3LA 4N53C 4QX2A 1H30A 3ZM8A 2ZEYA 3AZWA 1O4YA 4LBQB 2VUCA 3GM8A 4ITCA 4HKOA 1UNBA 2Y64A 5LZ6A 3H1YA 4Y5SA 2NN8A 3WG2A 1QJY1 1C3HA 1PZ8A 2DUPA 3J8F2 2BUKA 3KZ4C 3P3PA 3VHOA 3WW3A 3ZXLA 2Y6JA 3PU8A 4FOQA 1UZYA 3WX5A 1RUC3 2GC0A 2EIEA 1W28A 3CF6E 4XURA 5DUXA 2EAAA 5KXBA 5LW9A 2KD7A 3JU9A 2W1WA 4P9XA 2Q1ZB 1DHKB 1F35A 2VQTA 2A3XA 1QJEA 4CDWB 3AJYA 3VKNA 2W46A 3CIHA 1CWPA 1J1LA 3LFIA 1JBCA 4YWAA 5T55A 2DF7A 1BBT3 2WSVA 3H50A 5GJ6A 3RYPA 5KXDA 1QJU2 1K42A 3MFAA 2Q8CA 3DXTA 5FRAA 5FYIA 4MGSA 2YPJA 3HQRA 4YGDA 3QLQA 1PGW1 3IAPA 4YVWB 5A33A 5L19A 3RDIA 1OFNA 1W9YA 5T3NA 4AEDA 4BH9A 1NE4A 1LESA 1WLDA 2X5IA 4ORFA 5CA6A 5FO8B 2WWUA 2C0ZA 2ZXQA 1HXS2 5F3CA 2ENRA 2XVLA 5J37A 4J1WA 1DYKA 4Q8LA 2JIGA 2GP5A 3MLLA 4ZXEA 1LOBA 3VL9A 4HVQA 5KHHA 2YFUA 5DUUA 4LBLA 5A3TA 4J1XA 5A6QA 3ZN5A 4DIQA 4E4HA 1COV1 1W8OA 2W1QA 1TZOA 1OF3A 3CJXA 3MW2A 3UK9A 3CU7A 2E6VA 1VJ2A 5FTTC 3T2QA 3MO4A 4L2NA 1MS9A 4QHOA 1ST8A 2OQ7A 4K3UA 3C2UA 5FP4A 5BNPA 1RUD1 2HWB2 4FOWA 4OI2A 4IL7A 1NOVA 1NE6A 2YBSA 4CU7A 4EWEA 2XPJA 1R1ZA 3PUSA 2VMCA 1DYPA 4D7TA 3HNBM 1PM7A 1LJ7A 1YQCA 2ZGTA 3D0SA 4HANA 2CYFA 1AXZA 4JDNA 3U0ZA 3LIGA 5FPVA 4WM8C 3I59A 2PHTA 3I2OA 3UL2A 1GZWA 3LD8A 5A32B 5KXEA 1OVPA 3TN93 1W2NA 2GNTA 3NKGA 4NE9A 3POGA 3LAGA 4Z1VA 4IV1B 2TBVA 3T1LA 2WYFA 3J7NA 3JD71 1EUTA 1V00A 5FY4A 2Z69A 3VN4A 1H2KA 1UOFA 4IGPA 3HPNA 4GAZA 1CAUA 4Y33A 5DAWA 1CZSA 1O5LA 4IW3A 3VBOB 2W0XA 2R32A 1GZCA 3ILFA 1D0HA 2OUHA 4Q0PA 2XWJB 2ZX0A 3IPVA 3PLQA 4FPYA 2MEV2 4UT5A 4UXAA 5GZFA 3VBRB 4FFHA 5FPUA 4YW3A 3HWJA 1X36A 1MQTC 2XVKA 4I2OA 4E9KA 1RITA 4MG2A 1MZEA 1EAH2 2WNUC 3ALQA 4OMDA 4BIOA 3O1UA 4TLGA 5J48A 5JOZA 5CNAA 5FLHA 5JXGA 5I8TA 5A3WA 2R7EB 2QQLA 1TNRA 4A44A 4CEYA 3ROUA 3CJIB 1PIV1 3GBWA 1QJU3 2FDHA 3D0JA 1OOPA 2XGXA 5T5OA 3N7LA 5EZWA 2X05A 4M4PA 4KL1A 3FN9A 3FE5A 3H0OA 4XPVA 3H7JA 3TEXA 4YZ3A 3Q8CA 2VBBA 3VBUC 1U5IA 3NJVA 3AM2A 2YY1A 3L2HA 5IJRA 4GWIA 2GP3A 1JOJA 4GKYA 1QQP2 1HXS3 3RJRA 1D7PM 2P3JA 5IVVA 1NLSA 3WCRA 4I01A 1W2UA 5A7SA 2ZGUA 1RMU1 3ZFGB 1U5XA 4XIKA 3ZYGA 4WVZA 5FUIA 5D8AC 2QZ3A 2BEOA 4CXWA 3URFA 3JCIA 2ZCWA 5GZCA 3RZJA 2VECA 4B4PA 4QX0A 2WO1A 1BVP1 2DFCA 2E7TA 3VLBB 2HWB3 2FBEA 5J1XA 4Q26A 1BXHA 3OOXA 1BCXA 4JGZC 2OPWA 4JGYA 4K8FA 4RR3B 2Y6LA 4BQ3A 2VNGA 1GBGA 5FZOB 5AFBA 4AVSA 1K5JA 3FZ3A 5AC92 3INAA 3ES4A 3J9SA 1D4VB 3AMPA 4NAOA 4WVWA 2Y60A 3WINE 4COWA 5BV6A 2FDKA 1H1MA 4Q27A 3N9PA 1OMIA 2WSUA 4CEWB 3RZMA 2F4PA 3RS6A 3FUQA 4R9DA 5IATA 3RZGA 3DXUA 3PUHA 3AMQA 1AYM3 1PVC1 4P00B 1Y9MA 4YG6A 3SNMA 3ZSEA 3QH7A 1CX1A 3B01A 1XU2A 3MICA 1D4M2 2OKXA 4ES9A 2AGSA 2RS12 1AL22 3TWIA 4FPKA 1JU4A 4KU8A 2ZHNA 2GAUA 4LNVA 1G8WA 4G3YC 3ZYHA 2NPIA 1XXNA 4XQDA 4I0WB 2W95A 4QPGA 2B8MA 3QCWA 4PI2A 2EIDA 5CKNA 2YPDA 3H9AA 2MEV3 3VZNA 1J1TA 2FCTA 4K1ZA 3MIEA 1YWKA 1TNFA 1LHVA 1POQA 4ASKA 2QQNA 3M8LA 3KS7A 2AR6A 1YQ6A 1EAH3 1VPHA 2JG8A 4QPIC 1GICA 1WCKA 3IDBB 3VD4A 1QMJA 4R52A 1LHNA 4LKEA 1AR62 3PJQA 2Y34A 4TXWA 4AXOA 2W5FA 3ECQA 3BTZA 1VBE1 2IFRA 5F2WA 1GWKA 3S30A 4AQ2A 2ZACA 5LRRA 4FXGB 5C4WA 2R0FA 3KT7A 3I2GA 2JG9C 4GWJA 4CDUA 1NXD1 1VE0A 3DECA 5FMCA 4G9SB 4MHUA 1NA1C 5EXOA 4AZZA 2ERFA 1UZWA 5D1IA 1VMHA 2RV9A 2Z2SB 5CKMA 3GJBA 2R1DA 4EN7B 1OA3A 2JDYA 2BU9A 5BY5A 4QMAA 2X8KA 3H8XA 2VBDA 2R30A 2Y0IA 2YFZA 3AX4A 3K46A 4WV8A 2ZAAA 3L9JT 4XUTA 3ZPOA 1C8M1 1CIYA 1CAVA 1BEV2 2VTFA 1PNFA 2UU8A 1QQP3 3LEGA 3NMBA 1L7LA 3I49A 5FZIA 1LRHA 1JMUB 3PJYA 4XBQA 5FMDA 4NVPA 3VKMA 2IC1A 5EIYB 4MGKE 5CU1A 3OGGA 1NT0A 5FP8A 5ISLA 5C8CA 4KGGA 4PIZA 5B2GB 1AR93 1MS0A 5LBCA 2DWRA 4E2GA 3KQ4B 3SKJE 2CDOA 5C7GA 1UMHA 1POV3 1JYWA 4DO0A 3B9CA 5FP9A 4BCUA 1E5RA 1YQ8A 5ACA2 1B09A 4Z2WA 3NWKA 3WF2A 2LW8A 3M2MA 4BPZA 1OC1A 3H1MA 1MR5A 3PMEA 2CGPA 5FMOS 1HB3A 1BVVA 4YLZA 1J84A 2RS32 2E53A 1QEXA 2EIGA 4HSLA 2WQ8A 1A6CA 4FTBA 1VBD2 1RIRA 1WMFA 1W6MA 3I4IA 1IS4A 4QXCA 1UYZA 3M3QA 4XETA 1FPN2 3GBFA 4NWWA 4QKBA 4CXYA 4Y4RA 4AHYA 2YGLA 3FHAA 2HEWF 3QACA 4RD7A 3T2PA 3VBSA 1DF0A 5LA0A 1HQLA 1MEC3 3AFKA 3UKVA 3ZYIB 1DLLA 3MIFA 4E2SA 5L9BA 1RTVA 1JOBA 1S0JA 5E1RA 4E4DX 4XUQA 4DUWA 3E6CC 1V70A 4U36A 2PXJA 4EQVA 5KHIA 1AL23 3S7IA 2DFBA 5H9QA 1NCRC 4QX1A 1NYWA 2J1EA 4O65A 2RDQA 2G9FA 3LZZA 1GLHA 1W90A 2I45A 2QQOA 4FPHA 5A33B 2VR4A 4INDA 4AEDB 1U5ZA 2K2SA 2YU2A 3M70A 4BHPA 5JWPA 3VGIA 2X5IB 1G7YA 4CUGA 1W05A 4LORA 3IT8A 1JHNA 2A6YA 2UYBA 2Z79A 1C8NA 1TQ5A 1WBFA 4P9GA 2RMU3 2XHKA 3NRUA 1ULEA 4BIFA 4XF9A 1MVEA 3A4UA 3I2KA 4NHYA 3MPBA 5FZHA 3HBZA 3K51A 1AR63 3N35A 4OQ9A 1IG3A 1QOTA 4CPBD 4EV0A 3NJYA 3WQ0A 1BBT1 2W68A 4ASMB 1XYPA 3WNPA 4XUPA 2IWGB 3D82A 1J3QA 3E6DA 3M4FA 1DLCA 3GF6A 5BNPB 1UQXA 2F6BA 2NQYA 5JSPA 3POJA 1RXFA 4FAHA 3BCWA 3NV2A 3E6BA 5FPBA 1J3RA 3N4MA 4Q2FA 1LGBA 4XDOA 2VTXA 3D6EA 2WRAA 1BEV3 2ZX2A 5IFTA 4Y5Z0 1PIV2 1FOD2 4CCLA 2DVAA 4XDPA 1PHMA 4C0BA 3I59B 2D5FA 2RDSA 1FMD2 1Q3EA 4K6BA 4AF9A 1GZWB 2XQXA 3IM0A 4P9IA 2Q1MA 2DVDA 2V5YA 1GMMA 2VPVA 3NAPC 3RYRA 3UGHA 4C1XA 2BGOA 3Q9OA 2BOJA 3MDPA 3ZMNA 5GLVA 3RG0A 4QU1A 1JYIA 2VCAA 1AXKA 1VB4A 4X8NA 1PM4A 5E6HA 1CAUB 4UFMA 2GH2A 4E8DA 5ACA3 3DPRB 3SHRA 1DGRA 4Z8BA 3ELNA 4XABA 4AVBA 2R041 2Y6GA 1DP0A 4YVSC 4ASLA 2AUYA 4RQPC 4CSWA 2RS33 3IPVB 1G9DA 2WKKA 3SC7X 3VBFC 3H7YA 1ZZ7A 1MZ5A 5DMYA 5HI0A 1VBD3 5LA9A 1NA1A 2CTVA 1PGSA 1GANA 1OPMA 2QQJA 4WVMA 1FPN3 2ZS6B 4HL0A 4MH0E 1PO12 3TN91 2VW1A 1Y9GA 4IGQA 4R9AA 4BLJA 1H2MA 1XOYA 1W8HA 4CEYB 1OHFA 2NMOA 2AC1A 2XBO2 2PHRA 2XJPA 2ZBJA 3DV8A 1OOPB 4LOSA 1ND2A 4KMQA 5HCFA 4D6RA 2D3RA 5DN2A 1LGNA 4AI8A 1LODA 1RUF2 2JDNA 5L7OC 4ZKTB 4YG0A 2D93A 4FTSA 5FAXA 5FUNA 5KHJA 4BB3A 1WW4A 2ZEXA 1LCLA 1GQPA 2BV4A 3ILNA 5BYNA 5IK4A 5FZLA 3KVBA 4OUMA 1FT9A 4QB1A 4UBGA 1GP6A 4BK4A 1WUVA 3RZLA 1VBC2 5BXXA 4XW3A 3VHNA 1WA6X 4XFIA 4H7MA 4QKFA 1W0OA 4GQ7A 5T5PA 4BQ1A 1W8FA 2ZMKA 1K45A 3EJKA 4ZU4A 3AKQA 3ZFFA 5K8SA 1MZFA 1QJU1 4LUKA 3PMSA 2LUWA 4MLOA 3WF3A 3VDDC 1FNYA 4GJYA 3DYMA 4TYSA 3R05A 3UYJA 3TEZA 1V6KA 2VXRA 3I54A 4XF1A 1ZZ9A 2WC2A 3VB9A 4JTOA 3A0NA 3WT3A 3ZKYA 5CFDC 4JGYB 1OH4A 1YI7A 4A7ZA 2RDRA 2NMNA 2L9LA 2OIIA 4NPRA 1GWMA 4EJRA 5F6LB 2C5DA 4AR2A 1ZA4A 3LKJA 4YW4A 3WQ1A 1FOD3 1GOGA 2NZ9A 4QQ2A 3ZPYA 1HXS1 1XNDA 2XL7A 4KG8A 1NCRA 4A6OA 2J1TA 1JYCA 2ZZQA 3ILRA 2B5HA 1DQ1A 5EYYA 4W6WA 1FMD3 3HQUA 1SLLA 1SFNA 3KB5A 4LEJA 2VMFA 4UBHA 1FXZA 5JIUA 4TTGA 2Y0OA 2VMGA 4AHZA 5A7NA 4PLMA 4JRAA 4CP0A 3LEKA 4ET7A 5I0DA 1C8M2 4Q4Y3 1CIWA 1B35A 2CV6A 1YXWA 5DQ0A 3K2OA 5FYZA 4JV4A 1AYN2 2Y38A 3RZKA 2ET1A 4FOVA 3WCSA 2YC0A 4M01A 4G4FA 2BNNA 2BVBA 2HWB1 2ZABA 4IE7A 3FBYA 4DRVA 2XG3A 4Y5TA 1ZA7A 2CSGA 2GN3A 1GFF2 2V72A 3I3BA 1KDKA 4UFKA 1ACCA 4QPGB 2ZMNA 4D94A 1N3QA 3C7EA 1M06G 1X7NA 2KA3A 3AP9A 1ULFA 4PDWA 3KT4A 1H2LA 5A80A 1LTEA 4D3WA 3AFGA 4D69A 2JX9A 3K3NA 2JG8B 1PO13 2XJRA 3A23A 3RMYA 2R072 4MGYE 5IWFA 5LY1A 1SHWB 2ZEZA 1W6NA 3H3LA 4W6XA 3U4SA 1AYM1 2MHFA 4Q4W2 1MS8A 2XBO3 2C9KA 4CDUB 4DNYA 2VW0A 1NCQC 5C4WB 4NJ4A 4JQTA 1O8PA 2DYCA 3OPTA 1HV0A 4FPJA 4Y20A 4Y1VA 1RUF3 2VZ3A 2VZSA 1V6JA 4ZY9A 1AX0A 4P9YA 4HONA 2XONA 3WHUA 4CDXA 2WS93 3ZDSA 4OQ8A 1V9U2 3LCPA 4DZGA 2MEV1 3ZFEA 1UN1A 3IAQA 1CAVB 1RUJ2 2E63A 2HEVF 2ARCA 2HWF2 3FUOA 4PIYA 3BYWA 3WZ1A 1HB2A 3SH4A 2J1UA 3KM5A 5HV4A 4OI4A 3C7HA 5CG8A 1EAH1 3CKHA 1VBC3 5F9TA 3K48A 1I5ZA 5SV5A 1Q8SA 1UY0A 5E89A 3W20A 3NV4A 5C8CB 1AXYA 3AYDA 4URAA 1KXGA 2V5DA 4JVAA 2A6XA 3S57A 3MIBA 4QQOA 1ODMA 4W8JA 4B7KA 1RUC2 4TLFA 5CZKA 4MGQA 4NRPA 3TAYA 2E9QA 3VBHA 3K3OA 3IBMA 2UWCA 1C1FA 1IPSA 3C7GA 3K4DA 3SH5A 4HT1T 2GU9A 4Q8KA 3EO6A 5HBAA 1LKNA 3OGVA 1YFYA 3PUQA 1BBT2 1LECA 2QQWA 1QQP1 3T0BA 1H8TC 2W1UA 3R0RA 3RSJA 5FYVA 3ZR5A 4AEMA 1ASJ3 4E2QA 2RJKA 2I74A 1W8WA 1AX2A 2QFEA 4CU6A 1W6MB 5IT6A 3EQEA 4CCOA 4FQZA 4OI1A 4CE8A 2QQMA 4QX5A 5FY9A 4DXSA 3GZUC 3NV3A 4ARXA 3VBSB 2FZ1A 2WO7A 5FYUA 1LGCA 1AR91 3EB7A 5J98B 4FI9A 4JRLA 4FPOB 3DUIA 2OPKA 5I8SA 5LBEA 3FLPA 1AYN3 4FBFA 1POV1 3TNPB 1ULDA 4B3NA 5GLWA 4CCCA 5IVFA 1QNWA 4Q29A 3NSTA 4YFWA 3ZKUA 1UX7A 2UWBA 5CB7A 2GMEA 2AH2A 1CQ9A 5FZ4A 3JB8A 2RHPA 5L73A 5CFCA 4XBNA 4CUBA 5F7UA 4QGLA 2ZGOA 5AC91 1Q8PA 4LHNA 1GOFA 1W04A 2TEPA 4JKLA 5HV0A 2X09A 1N1SA 2RDNA 4Y1ZA 5FY8A 3WDTA 4IXLA 1JZ8A 5IK7A 1SBDA 1XNCA 5FK7A 2DCTA 4HSJA 2WZEA 4QXBA 1D0GA 3AP7A 4LPLA 1AF9A 1UCXA 3BGAA 1MEC1 2ZHLA 4AOCA 1LEDA 4YW2A 4XILA 1ENSA 1JN2P 4Q4W3 5JZGA 4RHV2 4DB5A 1G6NA 1D4M1 1C4RA 5FCCA 2VNOA 1AL21 1PZ9A 1Y3TA 1SZBA 4XZPA 2F4LA 3NQHA 3KLSA 3WDYA 3KVAA 2BWAA 3KHBA 5B4XA 3IMNA 2VUJA 3UJQA 3QBQA 3THCA 4P14A 2PAMA 1G9AA 1NX9A 1V9U3 1LR5A 3OEBA 3R6SA 3RI8A 3KSCA 3AL6A 3OGJA 1RUJ3 1W03A 2HWF3 3ZMOA 4CDQA 4CRQA 3LDRA 5DAPA 1VRH2 2JDMA 4IEPA 4R4ZA 1W6QA 5A3PA 4TZDA 1JYXA 4MOAA 5FXVA 1QXJA 3LOIA 1AR61 3WY6A 1NLQA 3MUY1 2Q0AA 2P5BA 4HN0A 1RUG3 2E51A 3ACHA 4N90A 4QU2A 3C3VA 4YW1A 4AG4A 1JHJA 2DDUA 1RL3A 3BPZA 2A73B 4BQXA 2Z5WA 3OD4A 3BU7A 2VM9A 2WZR3 1SMVA 1JZ2A 3MV01 4IERA 1WCSA 2XQRA 1UOJA 4LBJA 3WUDA 4FAGA 2HLEA 4ATEA 4XHBA 2XR4A 2PHXA 3B02A 2PLV2 1S4CA 3F95A 2F17A 4K1YA 4Y22A 1CVNA 5BNOC 2Y26A 1IS6A 1G9BA 1BEV1 1H6XA 4DS0A 3THPA 3BI3A 1NUKA 1UYPA 1WW7A 2PFWA 5EFUA 3RJ2X 4J25A 3VV1A 5EP9A 2VJXA 1T6GC 3U1XA 3PHMA 3POSA 4XMAA 1EY2A 2HWC2 2RR13 3TBDA 2KR2A 3K4AA 4R9CA 3WR0A 3V0BA 4JDMA 4WVMB 5FZ0A 1BKZA 2FDJA 5ANQA 5C9AC 1D2QA 5FZ9A 1HIXA 2WNVC 2XB6C 3PIGA 3HN3A 2EIBA 4AFCA 4B1LA 3MLKA 4KBZA 1RJ8A 4Y26A 4BU2A 3PNAA 1OURA 4DUVA 1ND2B 1APNA 2WYSA 1KITA 5ACA1 5KC5A 4N8MA 1GYKA 1TVGA 1NQJA 2Y8KA 4FVVA 4IV3A 4JHZA 3UGFA 3WG3A 3SLIA 3I8TA 1K5MA 2VUDA 5EQUA 1ND3A 3AKSA 4M3CF 4YZ1A 2YROA 2RS31 5JI9A 2JDUA 4MADA 1A34A 3CQOA 2V73A 1W3XA 4L11A 1VBD1 3JQWA 2PN5A 1HRV3 3JUUA 1C57A 3ZXKA 2R49A 3NKTA 3MZHA 2WO3A 1RUOA 4P02B 3LF7A 1FPN1 4LE4A 2EA7A 3MIHA 3KT1A 5CBLA 4XJWA 3CNAA 1PK6A 1WMDA 5FMBA 5LATA 2P3KA 1F15A 3AVRA 1UU6A 3JBG2 4WM7C 4NIAA 3EXUA 3THTA 3NNFA 3GALA 2FMDA 4RHV3 3WG1A 3ZFFB 2A70A 2JEMA 3B00A 5JVVA 4PI0A 2OZ6A 4GALA 3LSDA 2VZ1A 2ZGRA 1ULGA 2IXHA 3FFQA 2IFWA 4NOTA 2JDZA 3HMYA 1DFQA 4YW7A 1ENQA 3VZOA 3OJBA 2QBXA 1NQDA 2AEZA 2G9GA 1XQNA 2A6WA 5IVCA 2IXJA 5F5AA 1RVF2 1AYM2 4AI9A 4MVTA 4N43C 5FZ7A 4BMEA 2TUNA 2DV9A 2Z42A 4GZ9A 1VRH3 3WP3A 1F5JA 4DINB 2BYVE 4BXSV 5FZ1A 5A7PA 2VGDA 4AAXA 4BYYA 1YO8A 1JU3A 2WDBA 1QU0A 4RS5C 3VD5A 3IDAA 1EPWA 3DGTA 4TN7A 3O12A 1U0AA 3AK0A 3SH3A 2GMPA 2GSYA 2PA7A 1B35B 5G05L 4CP1A 2JENA 4QT6A 2WLPA 2H6CA 3IDCB 3S7EA 3HQXA 2D6NA 4MHRA 3O7OA 3ATGA 3VZLA 4C1WA 3O1VA 1CX4A 5CIRA 3BUCA 5IAXA 5I0UA 3I3MA 2PLV3 4HK9A 2ZKLA 4GMP3 1REEA 4BE3A 1PMHX 1NXMA 4EWAA 5JR2A 2AZ5A 3G7DA 3HAGA 4FOYA 1VAMA 1YHFA 2VOKA 1FOD1 3HEIA 3WW1A 1S55A 1WZXA 3M3CA 4OULA 4PDWB 1RUNA 4SBVA 2HWC3 1OBNA 2WQ4A 1FMD1 3U37A 1PMIA 2PELA 3BPSA 3ZXAC 1XE0A 4NN0A 3THDA 4H14A 4CCNA 4KWKA 4ZZ8A 1QOOA 1W99A 2IVIB 4GH4A 1HX6A 2BRTA 1W6NB 3DF0A 4L97A 4Q4Y1 1US2A 3ZVXA 5IHRA 5JUVA 3VDCA 1DZTA 2GZWA 5KWRA 2G19A 3AYEA 1H4HA 1SEFA 1WCDJ 5HCAA 1ZM1A 2KXLA 4N53A 4FFIA 4Y20B 3WSOA 3W59A 3ZYFA 3NW4A 3W9AA 3FMGA 2XWBB 2QQPA 5SV8A 4CDXB 1ENXA 2Q4SA 4XVHA 3AZXA 1AR92 5FYTA 4FXKB 2WJSA 3ZFEB 4RFT0 4ZS3A 3O0WA 3ITQA 1QH6A 1VMJA 4JKKA 2ARAA 2IXCA 4B8EA 2R062 2ZJCA 3HIFA 2FMYA 3GBGA 2HJIA 4OZOA 1PO11 2WAAA 1JYTA 2BFUL 1LHOA 3H3UA 2FDIA 1ONAA 3JBG3 1W8TA 5LASA 1OSGA 2DCZA 4EN6B 4JDOA 2BTVC 2PHUA 2XBO1 3RQ0A 4E27A 1YUDA 5EJ1B 4IEWA 4L9BA 1HJGA 3WF1A 4QDSA 4LLFA 2CWMA 2VNVA 1IPKA 1H6YA 1RUF1 1W9SA 2GNBA 1S0BA 2WN3A 2C6SA 3HOBA 3CLPA 3RZZA 1F4HA 1MPXA 3VBHB 1H1IA 3BODA 1W8NA 4AEJA 3Q8BA 1KEXA 2WS91 5FZBA 3AZVA 3DKQA 1MEC2 1RVF3 1YYNA 3WDUA 5EJ3A 3W5MA 3H8RA 4O9GA 4TWTA 1MS1A 3MF6A 5G04L 1EV13 3OBTA 1VR3A 2CDPA 3EYPA 2Y33A 5T52A 2VZTA 2W91A 2J42A 4WVVA 1VBC1 2A7AA 2W39A 5A3UA 2PAEA 2ZGQA 1QKQA 4S2DA 1LHWA 4GIQA 4QM8A 4CZSA 1VRBA 3T30A 2FD8A 1V6IA 2WWJA 2WZPP 4YSFA 5KHKA 3AJZA 5BPXA 4QDRA 1YLLA 2JDHA 2RMU2 3FFZA 2P1BA 3KMHA 5C5UA 3H1WA 4GB33 1WMEA 3NNGA 1JZ5A 3WG4A 5JPNB 3WQ7A 2GN7A 1KFXL 4WM7A 5CFCB 1O6UA 4XC9A 4A7YA 4PBPA 4CCJA 1AR82 1ASJ1 5E88A 2ADDA 1XU1A 4WM8A 1SLAA 1XC6A 4XCAA 5BNNC 4XXPA 3PU3A 4IEZA 4XFCA 4QQHA 1BJQA 4A4AA 1SLIA 2OVUA 3GCWA 3HT1A 3DKWA 3O0XA 3S6PA 2A3WA 1QDOA 3MW3A 3WXPA 3VKLA 4YGBA 4AFDA 5FO7B 1JZ7A 1N1YA 4HVOA 5A3MA 5JZGB 3SCHA 5LBBA 1AYN1 1JOPA 3ZSMA 4M3CE 4MZUA 1UY2A 1A3KA 1VBB3 4HETA 4HKWA 4DQAA 4ISQA 5ABJC 1W6PA 1BHGA 2RJ2A 4KI5M 4XDQA 3KHCA 2XJQA 2CWSA 3PL0A 1URXA 1PNGA 2QTWB 4QPYA 4XFHA 1O8SA 4LBKA 5FFOC 4XHXA 1SCRA 1XB9A 3V65A 1UL9A 4YVWC 5FZFA 4IESA 1MQTA 4QX3A 4CDQB 1ZRRA 1GP5A 4XJAA 3NVCA 4F83A 2R063 4BMBA 4C0HA 2WNUA 2ADEA 3POBA 2DBNA 3I2DA 2BZDA 4HN1A 4MXWA 4YZ5A 5IK5A 5IW0A 2SLIA 2R071 1OI6A 3ABZA 2B46X 2ZKNA 4MYEA 4XYXA 3LFMA 5HCBA 4PJYA 2BNMA 4LT5A 2EICA 1DYOA 1VAKA 1IG0A 4Q4W1 4UFIA 2PQQA 2SBAA 4S2GA 3GZAA 4E4ZA 2DCKA 1F31A 1IPJA 1ZREA 4GULA 2JE9A 5DPNA 4AE2A 1OKOA 2H0VA 2YXSA 1IQAA 2WT2A 1V9U1 1SPPA 3VBUA 1V6MA 3ZSLA 4B4QA 4Y22B 4B7EA 3AVSA 4YARA 2D97A 5J96B 1RUJ1 2HWF1 4FPFA 4HKLA 4UOJA 4FO9A 1ZVFA 2VMIA 1QJZA 5F5CA 4BISA 3PVNA 4LR4A 4XMIA 3I2JA 5K0UC 2JE8A 2XL9A 3V0BB 2WA4A 3POWA 2VTXJ 5D8AA 4XFFA 1TEIA 4LLOA 3OPWA 2XUMA 3OGRA 3WDVA 4IEOA 5JLVA 3CHXA 2D5HA 2NP0A 2WZR1 1KS4A 4M3CA 1RUC1 4JQRA 3WDXA 2FHRA 4M0HA 2WFPA 1FI2A 4IV1C 3T0DA 3FBMA 4JGZA 2JB4A 4GWNA 4IV3B 3PTYA 4QX7A 2C24A 2YBKA 3BTAA 1K5MB 3U75A 1ND3B 1YI9A 1FV3A 1GP4A 3FWEA 3HR9A 5JXHA 1XSQA 2OT7A 3VBOC 3HT2A 1AR83 3J7MA 1LU2A 4HK8A 3ZN6A 4CPBA 2K0GA 4BQWA 5DG2A 2HBUA 5LCWL 2RR11 3UT0A 2RJLA 3AP5A 3VBRC 4NIDA 5KBFA 1T2XA 4V1PA 1SCSA 3ACGA 3WNNA 3NO8A 1WGPA 4IEQA 4PQ9A 4HPKA 1PK6B 2AREA 2VQ0A 2VXJA 3T4HB 1ULOA 3N9MA 2FCVA 3UETA 4AGVA 4B4RA 5GLTA 1L7RA 1O3SA 3I2HA 5GLUA 5IVEA 1ZX5A 3U14A 4EN0A 1G86A 1FX5A 2CU5A 5I93A 2LALA 4AWDA 1Q43A 1RUI2 5L36A 2FCUA 3CJIC 1QH7A 4AQSA 1DQ5A 5LEJA 1XBFA 4XFGA 2W9XA 1DQ6A 2ZPXA 1TME3 3AC0A 4PF1A 1RHI2 4IEYA 5FY1A 2Q8DA 5HXVA 5CISA 2BERA 2ET7A 4XJ9A 1AL0G 4GMP0 4Q4Y2 2ZGPA 5A7QA 2YV8A 1K12A 4JHTA 3PVOA 1HRV1 5JDBA 4AGRA 1Q8OA 3AB0A 4QPIA 4LBQD 4COYA 1ENRA 1OF4A 5LRSA 2J22A 3K77A 1ULCA 1S2EA 4NROA 2A6ZA 3KF5A 3PIJA 4BWOA 1QWRA 4CP9A 4RHV1 4IGOA 2JG9A 3ZFGC 2E26A 5F3EA 2Q5TA 2UY8A 5A6ZA 4L92A 5K9YA 1BMV1 5EV7A 1WA4A 3W5NA 4EN9B 1W2AX 2VG9A 2QDRA 4KWUA 5GLZA 4BDVB 4MGTA 2BGCA 3KQRA 5FZ6A 2VCCA 1N3PA 5FLJA 4PQQA 3KV5A 3NNLA 1VRH1 1UOGA 3NJXA 2GC2A 2VBPA 3MBWA 1HLCA 1Q8VA 5ABJA 4MV2A 4Q4X2 4PT6A 4LHSA 1EUUA 5JOXA 1YQ2A 4XUOA 4KQ7A 3HNYM 4AK3A 1XYOA 3SCGA 2WS92 5FYMA 2GNDA 2P3YA 1RUD3 4GH4B 2OYZA 3AP6A 1X8EA 4LJHA 4CEWC 2B39A 3LPGA 2E32A 2ZMLA 3IIAA 4OZXA 4DY3A 4BQYA 2QJVA 2BDRA 1OUXA 1ULPA 1UPSA 1VALA 2K46A 2LM3A 2V4VA 3OF1A 1NAEA 4N53B 4AI0A 1UMIA 1KS5A 2WLQA 3CEWA 4AQTA 1WWYA 4AVTA 4EYUA 3GDBA 1GU3A 2PLV1 5LWBA 3EBRA 4QPWA 1HRI2 4J6GA 1KFUL 3ZIXA 1NZCA 1DGWX 1E5HA 3B5LB
chains in the Genus database with same CATH topology
1F2NA 1OFSA 1W0PA 5CVRA 1GQHA 1N1VA 2HWC1 4Y1XA 1QF3A 4FT8A 5DUVA 2ZAHA 3P3NA 5FMOL 5I0TA 3WP6A 2DTYA 5JOYA 4QM9A 2TNFA 4JC1A 4XBLA 1XNBA 4PBOA 3ZXEA 1LOFC 3MW4A 2OUJA 2VW2A 2QKDA 2XKPA 2D40A 1ASJ2 3B7MA 4COVA 1RUI3 1DZRA 5K0UA 1JW6A 1RHI3 2ZGKA 4XEZA 2A6VA 3PVEA 3M7AA 4ES8A 1ZRCA 2X29A 3R4UA 4LUMA 4URTA 1QJX2 4YZ4A 4AVAA 3B3QE 1IS5A 4AYUA 3KCXA 1Q8QA 1SFYA 1CD3G 1JH5A 4IV1A 2XJTA 1H1AA 4WZCA 3AKRA 2E7QA 4SLIA 3JBG1 1VBA2 2YGMA 2QE3A 3AKTA 3SXWA 2G4IA 4RA0A 1AJKA 1AZDA 4KG0A 2O1QA 5BNQA 3FLRA 4QHBA 4FP3A 3ST7A 2OZJA 1H4GA 3USSA 3MEPA 4I30A 1FATA 3QH6A 2VULA 2VOVA 1OA2A 3ZXJA 5LK5A 4N9HA 1RVF1 3D8CA 4W6YA 1GKBA 3LSEA 4WM7B 1O3RA 1M4WA 3RNSA 1LHUA 2N7GA 1EV11 2UWAA 5FPXA 2D44A 4UW6A 1DIWA 3IN9A 3NJZA 4DFSA 1UU4A 4WM8B 4YGCA 4Q4X3 2DVBA 4H3WA 2CL2A 4XF0A 4KU7A 1AX1A 1RGSA 4LO6B 1OA4A 3T1MA 3NAPA 3TRSB 2YMZA 2ZGLA 5GZDA 1MS4A 4XIOA 1IOAA 5BUVA 5I0SA 2D6MA 2R1BA 1I1EA 1W6PB 2A71A 2GH8A 3JB4C 4K20A 4YVSA 1HRI3 3FX3A 1RUG2 1Y7BA 5J36A 3B93A 4RQPA 3MI8A 2WQZC 3VBFA 1LOEA 1MQTB 2WZR2 1UF2C 4LE3A 3L2YA 3BOPA 2B42B 2WNUB 2IXKA 2X5IC 4MXWB 1XE8A 3KCCA 4FPGA 1GNHA 1S2BA 2VOWA 3H8UA 5LEKA 4D7SA 5DZGA 4ZXKA 4I3GA 3SCFA 4HZFA 1DG6A 1VBB1 1DU3D 4Q1PA 3SISA 2RR12 5L7OA 5GZEA 5JR7B 2PAKA 2O8QA 1S0GA 2D3PA 1YJKA 3WHTA 5GZGA 5BNPC 3VBUB 3OD0A 4CEWA 1VLNA 1QJX3 5FBZA 4XQ4A 1AR72 2YYOA 4JAAA 4Z07A 2XKOA 2R061 1R1A2 4FPLA 5E8AA 3AMMA 2QUOA 1VBA3 2A75A 5D8AB 1OQEA 1N1TA 1WD4A 5T50A 1QOSA 5EWSA 3VDDA 2D6KA 5T5JA 1HRV2 2ZX4A 4M3CB 2D6LX 3FC0A 4LO8A 4LHLA 5JPMB 1OLQA 4Q1RA 3UJOA 4HBNA 3VUOA 4H55A 4JGZB 1TMF2 5CFDA 2ZHMA 1H9WA 4RSUA 3AYCA 2XJVA 4D7YA 2X53S 1GQGA 4NHMA 3DPRC 1YIFA 4PF5A 2UURA 3ZN6B 3RRDA 4KH9A 5DZFA 3ZN4A 1BMV2 1Z78A 1AVBA 3J4UH 2OW4A 4M0NA 2QCSB 5I8YA 4HPKB 1R093 1SLCA 1HDKA 1R082 2QNKA 1SLTA 2P34A 4I0AA 2RMU1 1H9PA 2DCJA 1ZZCA 2XH6A 1AUYA 3WW2A 3N7MA 4CEYC 1JUHA 1X50A 1OOPC 4EROA 4A3XA 5DG1A 1CPMA 3WVJA 1AR81 4AI2A 4LA2A 4XTPA 4XJZA 4AFBA 2H0BA 4DRRA 1Q5OA 4I02A 3BOWA 4P5HA 4QPIB 4COUA 2D7FA 1DGLA 4YM3A 5KHGA 1RUE2 2D6PA 2HKXA 1UU5A 1V6NA 1CESA 2VU9A 1ZZ6A 1OLRA 1S0EA 1DZQA 4OHXA 1NCQA 2JG9B 2WFF2 1OD5A 4KWLA 3RMXA 1NA1B 2RS52 2BFUS 4OHWA 1O4TA 3G6JB 2BQPA 1LEMA 1TME1 2ZX3A 4NHLA 2RM22 4AGGA 1MS5A 2WT0A 4X8PA 1S0DA 3BALA 1AR73 2HWD2 4JGYC 1YFXA 2Q30A 1R1A3 5ABJB 2NLRA 2HWE3 3OY8A 1UX6A 3OTFA 2XLFA 3A0KA 3WLUA 2VVDA 1NLRA 1OQ1A 4N9IA 4XE9A 4YYOA 1SACA 4PLOA 3M3EA 1LOAA 1PGL2 5FPZA 3ME2A 2D43A 1QHDA 4OVEA 1NY72 4K21A 1TMF3 4B29A 1IZ3A 5J3UA 1UIKA 1UPIA 1IKPA 2VVFA 5T5LA 2EXKA 4NHKA 4IEUA 1ALYA 2MNGA 1H8TA 1PO23 2ZX1A 1S2KA 3R4DB 4PLNA 3WUCA 1I3HA 1CJPA 2VUAA 2E7AA 4QPGC 4OUSA 3USUA 5H9RA 2VOXA 4LO7A 3QOPA 4Y1YA 4QGNA 2XVGA 4ONUA 2CY6A 4LBNA 2JG8C 3POYA 5K7PA 5JMCA 1R083 1EV12 4N7UA 1PVXA 4LA3A 4I0BA 2R043 4BOWA 1RUH2 3SITA 3VKOA 3ACLA 1F9KA 1NCRB 3ZX7A 2EXHA 2W52A 3BIWE 1X82A 2HYKA 5K0UB 5F6KA 4CDUC 5C4WC 4AVCA 1IKQA 4F3JA 1WBLA 2I07B 4YRDA 1XRUA 4FTEA 1GSLA 1CONA 3U10A 3B9IA 2EF6A 3QD6A 1ZBA2 2EAKA 1Z7S2 3MIGA 4GB32 2A5ZA 3N7JA 3SMHA 3IDEA 1RUE3 4MUVA 1JTZX 3WP4A 2ZGNA 3ZSKA 3DPRA 2IZWA 4LO5B 2VVEA 4IETA 1XE7A 2CGOA 2ZA9A 1SBFA 2WFF3 4L8QA 5GALA 3AXEA 5C8CC 1RUI1 2RS53 4NO4A 3OBRA 3J8F3 1SDWA 1ZRFA 4LO4B 4YG3A 3AKPA 1CAXA 1RHI1 3VKFC 1ZNPA 1EPZA 2RM23 2V09A 1MVQA 2D98A 1V6OA 5CG9A 4IEXA 2HWD3 4GKXA 3AZZA 5JSOA 2EXIA 2ZHKA 3B69A 1VBB2 1YFWA 2PHLA 3N7KA 3LGRA 4JTNA 5GKAC 4I09A 2WINB 1MZ6A 4BZ4A 1BQPA 3RWNA 4OI0A 1YFUA 1DBNA 4R4XA 1YRZA 2ZGMA 4F7ZA 3VL8A 3NAPB 5DZEA 4XQWA 3VBSC 1VP6A 1RJ7A 3LA3A 2WWSA 1SLBA 5IK8A 2QZ2A 5AFEA 1ZBE2 1MACA 4YVSB 5BNOA 2XLAA 1G9CA 4RQPB 4N7IA 4YM2A 3VBFB 1YNAA 4F8AA 5DDJ2 4W65A 4GA9A 4Q4X1 5C9AA 2WNVA 2EXJA 2P37A 4PIXA 3AZYA 4CP2A 2BPA2 3GHMA 2W08A 1N3OA 1WLCA 1C5HA 1AHSA 4YFZA 2ARBA 4XJUA 3W58A 1RUH3 5DXDA 4Q0QA 4YZ2A 4AHXA 5CAZA 5L7OB 3O5SA 4LULA 1UZZA 2GALA 1HRI1 3ASIA 5GM0A 5FOBB 4YM0A 3I7DA 1UD1A 1HKDA 3NV1A 5FOJB 1FYUA 1CJDA 3FLTA 1ZBA3 3E97A 1Z7S3 4BLIA 2O8OA 1GZ9A 2LTNA 5FDBA 3N3HA 5JOWA 5BNNA 2JICA 4GWMA 3VDDB 2JECA 4FPEA 4Q4V2 1F8VA 3AMNA 2WA3A 1YCIA 5CFDB 1H0BA 4BM8A 4KBBA 4N43A 2JXAA 4LHKA 4RGAA 5FQ0A 1JXNA 1QJX1 2XJUA 4P9JA 1VAVA 3BB6A 1OQDA 1KJLA 2IXIA 4ZU5A 4CDWC 5FREA 2I2SA 4C90A 2ZGSA 1QJY2 2GMMA 4CYDA 3GNEA 4RS5A 1TME2 4XFAA 4QQPA 1VBA1 4O9EA 5J09A 4QGMA 1WLTA 1FNZA 2NYYA 1IGOA 3TYJA 1QY4A 4Z92B 1UAIA 1OKQA 4EWDA 2B9UA 2JE7A 1W6QB 1ZYBA 1ZBE3 4AFAA 1U5YA 1ND2C 1DDLA 1KRIA 1PGW2 3MFCA 2GC3A 3TOJA 1W6OA 4K7JA 5DDJ3 1X8MA 4YNIA 3RYKA 4A2UA 3V64A 1Y9QA 2C1FA 2WIIB 2P17A 2BWCA 5AVPA 2WL1A 4X6RB 5JSRA 2UYAA 1J59A 1R091 1S1AA 5C8WA 2JJ6A 2ETEA 5IUQA 3VHPA 1HQWA 3ZYPA 1NCQB 4AI1A 5EYXA 2ILMA 3NL1A 2IXLA 3VZKA 3WNXA 1COV2 5JCTA 5KC6A 1LU1A 1CAWA 3ZFFC 5AC93 1GV9A 2CNAA 1RUG1 3ZYJB 3IWZA 1RUD2 2VNRA 1O5UA 4DY5A 4LBMA 3MF9A 1X33A 2GC1A 4KWJA 5J7MA 3V56A 1DQ4A 3KD4A 3O14A 5H9SA 2BNOA 4S2HA 1D4M3 2DVFA 3OY8B 2RS13 2XJSA 2PTMA 3AXDA 3V0AA 4Q0SA 1GNZA 4OFGA 2BW8A 3RI9A 4K9SA 1LOGA 1WW6A 3AP4A 1DGWA 3OCPA 3OYWA 2NM1A 4RL7A 2YDEA 5DUWA 1NG0A 1A8DA 4QD2A 4FPCA 4MXVA 4P9LA 2EALA 1W39A 4Q4V3 1B35C 4UW3A 3JD72 3R4SA 3HN1A 5LK7B 2HEYF 4WBBA 1RC6A 3O0VA 4XF4A 1AR71 4Q0VA 1H8TB 4KGQA 5TSWA 4QXKA 1Y43B 3ZXGA 1R1A1 1QJY3 4HLTA 2XLGA 5FLIA 4META 4OHZA 4HVRA 1I9RA 3USUB 2HWE1 5FO9B 1CR7A 1QDCA 3E5QA 4PDWC 3RPQA 3U07A 2ZOEB 1DQ2A 1EYBA 3VZMA 2R16A 3UKTA 1O3QA 3APBA 3S0MA 5JIAA 2ES3A 1QNYA 2ATFA 2GDFA 1J3PA 4WZFA 1UMZA 1TMF1 1F5FA 1ZZBA 2JD4A 3AMHA 4AI3A 2DURA 4LBQA 1A8MA 3DL3A 1PO21 1C1LA 2Q8OA 3B94A 4CDXC 3H3ZA 5JAXA 1IS3A 4OLLA 1KD7A 4TSVA 1D2SA 3ZFEC 3CL1A 5C6CA 3E5XA 4Q0UA 2JKBA 2P2KA 3LA2A 3FJSA 4LTAA 4U2AA 5I91A 3DN7A 4AFMA 4YGEA 4KNCA 1R081 4RR3C 1RMU2 4CDWA 1ZRDA 4NWVA 3UKNA 4Y24A 4BA6A 1COV3 3VHRA 3MIDA 2ARXA 1VIWB 1QGLA 3GHNA 4Y4YA 3IKWA 1UKRA 3WD5A 3M3OA 1CAXB 4I3PA 3M1HA 3X29B 2WNEA 2DCYA 4Z82A 1VB2A 3MPPG 4YVWA 3VBHC 4R9BA 2GNMA 5I0RA 4RGGA 4AEKA 4IEVA 4UW4A 2DTWA 2CAVA 2YZ4A 1CGPA 1YJLA 5H9PA 1RUE1 2DVGA 1WW5A 4ISRA 4GMP1 1S0IA 1GR3A 4R8HA 4OHVA 2P3IA 1V6LA 4E4SA 2WFF1 2AENA 1MS3A 2RS51 1PVC2 3M3IA 2PHFA 3FHIB 3J8F1 1KJRA 2RE9A 3WW4A 3JD73 2RM21 3ETQA 2DU1A 3LWCA 5BNOB 2YUEA 3E5UA 2HWD1 1S0CA 1JUIA 3ZO0B 4LBOA 5CFCC 1E57A 4NR1A 4DXZA 5C9AB 2WNVB 3ZXDA 5KXCA 5A32A 1XNKA 1TE1B 3JQXA 3ZXFA 4H7LA 1PGL1 3D4KA 4MSVA 2K9ZA 1VBE2 2FZ2A 1PIV3 5JZGC 1NY71 2QDNA 2A3YA 2D6OX 1OPOA 2BBVA 1FAYA 1QXRA 1C28A 2WT1A 3TNQA 3UV9A 3VBOA 1O4ZA 1I6XA 4P9WA 2ZZJA 1A78A 2KM2A 1O3TA 2DU0A 4OHYA 3GZTB 3VBRA 3ES1A 1U12A 1UIJA 1BK1A 1BYHA 1REFA 4CDQC 3ZYRA 3J26N 2UY9A 5BNNB 4PCRA 1UKGA 1WLWA 1RMU3 1RUH1 1KDMA 2VQAA 2PHWA 3CJIA 1QXPA 1ZZ8A 3ENRA 4XFBA 4DOUA 1UW8A 4MGZE 1H8VA 1FV2A 4XJ8A 2AYHA 1RB8G 1R092 4N43B 4HFSA 5FQ0B 4AW7A 4XTMA 1ZBA1 1LB2A 3ZIWA 1Z7S1 4COZA 2BVVA 4GB31 1SBEA 4K40A 3U4XA 4RS5B 3AYAA 3TB0A 3KGLA 2ZTNA 1POV0 4Y1UA 3ZFGA 1HQNA 1LENA 4AEDC 3ZSJA 1PVC3 2B7YA 4GXLA 1EP0A 4C91A 5T54A 5JI7A 2DUQA 4AHWA 2R6QA 4RR3A 4IV3C 3KCYA 1K5MC 1W6OB 2C9AA 3T2TA 1ND3C 5CADA 1REDA 3PVBB 4YW5A 4MX3A 4L99A 1CPNA 1Q56A 1LULA 4EN8B 4QQLA 4IQPA 3MLJA 4ATFA 2MPFA 3N36A 1PK6C 4XF3A 1VBE3 1CAWB 1O7FA 2HWE2 1ZBE1 1KQRA 5F5QA 3LA7A 1G9FA 4S2FA 1S0FA 4AQ6A 4HMZA 1O91A 4YM1A 1J58A 2O0OA 5DDJ1 3D5OA 3WP5A 4CTEA 3WOGA 2FQPA 1C8M3 1N47A 2H6BA 1SQ4A 4AVVA 1WD3A 2R0HA 2DUOA 4FCAA 5F1RA 4X6QB 2QVSB 3CO2A 2EVXA 3V0AB 1L3JA 1XYNA 1LOFA 4XXAA 1DQ0A 5C33A 1PO22 3OYWB 1YIPA 2PHDA 2OA2A 2CAUA 2CGNA 3LB9A 2YHJA 3LOBA 4FQ4A 3JZVA 2VH9A 1IHMA 3GYDA 4JCKA 1BZWA 1DGRN 2R073 5E16A 1RINA 3MYXA 3U11A 1PZ7A 2R042 1H2NA 4ZU7A 4DMIA 3OPZA 3VZJA 4MGIE 4FP2A 2RS11 3WV6A 5AVAA 2VY0A 3HD8B 4M00A 2PYTA 2VMHA 3WDWA 1C5IA 1CN1A 3TN92 2D3SA 1AJOA 4GH4C 1LOCA 1HV1A 4FSJA 1Z0HA 2B45X 1HW5A 4Q4V1 4A7KA 3MGUA 3EHKA 4UW5A 3KGZA 5A3LA 4N53C 1H30A 3AZWA 1O4YA 4LBQB 4ITCA 4HKOA 3H1YA 2NN8A 3WG2A 1QJY1 1C3HA 1PZ8A 2DUPA 3J8F2 2BUKA 3KZ4C 3P3PA 3VHOA 3WW3A 3ZXLA 4FOQA 3WX5A 1UZYA 1RUC3 2GC0A 3CF6E 5DUXA 2EAAA 5KXBA 3JU9A 4P9XA 2Q1ZB 1DHKB 2A3XA 4CDWB 3AJYA 3VKNA 1J1LA 1JBCA 5T55A 3RYPA 2DF7A 1BBT3 2WSVA 3H50A 5GJ6A 5KXDA 1QJU2 3MFAA 5FRAA 2YPJA 4YGDA 3QLQA 1PGW1 4YVWB 5A33A 5L19A 3RDIA 1OFNA 5T3NA 4AEDA 4BH9A 1NE4A 1LESA 1WLDA 2X5IA 4ORFA 5CA6A 5FO8B 2C0ZA 1HXS2 2ENRA 2XVLA 5J37A 4J1WA 1DYKA 4Q8LA 3MLLA 3VL9A 1LOBA 4HVQA 5KHHA 5DUUA 4LBLA 4J1XA 3ZN5A 1COV1 3CJXA 3MW2A 3UK9A 3CU7A 2E6VA 1VJ2A 5FTTC 4L2NA 1MS9A 4K3UA 3C2UA 5BNPA 1RUD1 2HWB2 4FOWA 4OI2A 4IL7A 1NOVA 1NE6A 4EWEA 2XPJA 1R1ZA 1DYPA 4D7TA 1PM7A 1LJ7A 2ZGTA 3D0SA 4HANA 2CYFA 1AXZA 4JDNA 3U0ZA 4WM8C 3I59A 2PHTA 3UL2A 1GZWA 5A32B 5KXEA 3TN93 3NKGA 2GNTA 3LAGA 4Z1VA 4IV1B 2TBVA 3T1LA 3JD71 1V00A 2Z69A 3VN4A 1H2KA 1CAUA 1O5LA 3VBOB 2W0XA 2R32A 1GZCA 3ILFA 2OUHA 1D0HA 4Q0PA 2XWJB 2ZX0A 3IPVA 3PLQA 4FPYA 2MEV2 5GZFA 4UXAA 3VBRB 4YW3A 3HWJA 1X36A 1MQTC 2XVKA 4I2OA 4E9KA 1RITA 1MZEA 1EAH2 2WNUC 3ALQA 4BIOA 5J48A 5JOZA 5FLHA 5I8TA 1TNRA 4CEYA 3ROUA 3CJIB 1PIV1 3GBWA 1QJU3 3D0JA 1OOPA 2XGXA 5T5OA 3N7LA 5EZWA 4KL1A 3FE5A 3H0OA 4XPVA 3H7JA 4YZ3A 3VBUC 1U5IA 3AM2A 2YY1A 3L2HA 1JOJA 4GKYA 1QQP2 1HXS3 3RJRA 2P3JA 1NLSA 3WCRA 4I01A 1W2UA 2ZGUA 1RMU1 3ZFGB 1U5XA 4XIKA 3ZYGA 4WVZA 5D8AC 2QZ3A 2BEOA 3URFA 3JCIA 2ZCWA 5GZCA 2VECA 4B4PA 1BVP1 2DFCA 2E7TA 3VLBB 2HWB3 2FBEA 4Q26A 1BXHA 1BCXA 4JGZC 4RR3B 4JGYA 4K8FA 2VNGA 1GBGA 5AFBA 4AVSA 3FZ3A 5AC92 3INAA 3ES4A 3J9SA 1D4VB 3AMPA 4WVWA 4COWA 3WINE 5BV6A 1H1MA 4Q27A 1OMIA 2WSUA 4CEWB 2F4PA 3RS6A 3FUQA 4R9DA 3AMQA 1AYM3 1PVC1 4YG6A 3SNMA 3ZSEA 3QH7A 3B01A 1XU2A 3MICA 1D4M2 4ES9A 2AGSA 2RS12 1AL22 3TWIA 4FPKA 4KU8A 2ZHNA 2GAUA 4LNVA 1G8WA 4G3YC 2NPIA 1XXNA 4XQDA 4I0WB 4QPGA 2B8MA 3QCWA 3H9AA 2MEV3 3VZNA 1J1TA 4K1ZA 3MIEA 1YWKA 1TNFA 1LHVA 3M8LA 3KS7A 2AR6A 1EAH3 2JG8A 4QPIC 1GICA 1WCKA 3IDBB 1QMJA 4R52A 1LHNA 1AR62 3PJQA 4AXOA 3ECQA 1VBE1 2IFRA 3S30A 4AQ2A 2ZACA 5LRRA 4FXGB 5C4WA 2R0FA 3KT7A 4CDUA 2JG9C 1NXD1 4G9SB 5EXOA 1NA1C 2ERFA 5D1IA 2Z2SB 4EN7B 2R1DA 1OA3A 5BY5A 4QMAA 2X8KA 2R30A 2Y0IA 3AX4A 4WV8A 2ZAAA 3L9JT 1C8M1 1CAVA 1BEV2 1PNFA 2UU8A 1QQP3 1LRHA 3PJYA 4XBQA 3VKMA 4NVPA 2IC1A 4MGKE 5CU1A 3OGGA 5C8CA 4KGGA 4PIZA 5B2GB 1AR93 1MS0A 4E2GA 2DWRA 1POV3 3B9CA 4BCUA 5ACA2 1B09A 4Z2WA 3NWKA 3M2MA 4BPZA 2CGPA 3H1MA 1MR5A 3PMEA 5FMOS 1BVVA 4YLZA 2RS32 2E53A 2EIGA 4HSLA 1A6CA 4FTBA 1VBD2 1RIRA 1WMFA 1W6MA 3I4IA 1IS4A 3M3QA 4XETA 1FPN2 3GBFA 4NWWA 4AHYA 2YGLA 3QACA 2HEWF 4RD7A 3VBSA 1DF0A 1HQLA 1MEC3 3AFKA 3UKVA 3ZYIB 1DLLA 3MIFA 4E2SA 4E4DX 1RTVA 1S0JA