2IZWA

Crystal structure of ryegrass mottle virus
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
178
structure length
178
Chain Sequence
QYGDITPAKNSGSLVRVTSSATAGTEVSGTVLFNVRNATELPWLSGQGSRYSKYRVRYAHFTWEPIVGSNTNGEVAMAMLYDVADVTSITIERLMQTRGGTWGPIWSPTRKRLSYDPEHASLPWYLSGVSSGAAAGNIQTPFQIAWAAQSSLVSTTLGRIMAEYLVELTDPVDVTINQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RYEGRASS MOTTLE VIRUS COAT PROTEIN
publication title The Three-Dimensional Structure of Ryegrass Mottle Virus at 2.9 A Resolution.
pubmed doi rcsb
molecule tags Virus
total genus 44
structure length 178
sequence length 178
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2izwA00
5DDJ2 4YVWA 2RM21 5DDJ1 3VBHC 2R062 2HWB2 2R061 2HWB1 4CEYA 4IV3A 1HXS3 5BNOC 4GB33 2RS12 4FTSA 2RS11 2X5IA 5A33B 3M8LA 2RR12 2RR11 5LK7B 1AR93 1DDLA 5ABJB 3JD73 1ASJ2 1ASJ1 1NG0A 1RUD3 4CEWB 3DPRA 2XBO3 1AR71 4PDWC 2HWC3 5A32B 4FTEA 4N43B 3J8F1 1QQP2 1QQP1 2DF7A 1R093 1VAKA 4YVSB 2GH8A 4Q4Y3 4WM7B 4WM8A 4Q4X2 4Q4X3 5AC93 2WZR3 1AYM3 1Z7S2 1BMV2 1Z7S1 1RVF1 1BMV1 1COV3 1COV2 1RUJ3 2ZAHA 1QJX3 1QJX2 1EV12 1BBT3 1EV13 1VBE3 5A33A 1CD3G 3HAGA 1TME3 1K5MC 2WS91 4WM8B 3JB8A 4QPGA 4Q4W2 4Q4W1 4RQPB 1VBB3 1NA1B 1RMU2 1RMU1 2MEV2 2RMU3 2MEV1 4CEWA 4PDWB 1POV1 3ZFEC 1R1A3 3ZFFC 2WWSA 5A32A 4N43A 1VBD3 2GSYA 1FMD2 1FMD3 1R083 4RHV2 4RHV3 4YVSA 4N53B 4GH4B 3ZFGC 4IV1B 1AR83 4WM7A 5K0UA 1AUYA 1VRH3 1ZBE2 4EJRA 3VDDC 1ZBE1 1VBA2 1K5MB 1RUF1 3TN93 1PO13 1PO12 1ZBA3 1ZBA2 1VBC2 1VBC1 5JZGC 1A6CA 5ACA3 4RQPA 1NA1A 1F8VA 5CFCC 2HWD1 1RHI2 1B35C 1RHI1 3ZFFB 1VB2A 3IDEA 4PDWA 5FMOS 1QJU2 1QJU1 2WLPA 4Q4V2 3VBRC 4Q4V1 1HRV3 1QJY3 5C9AC 1C8M3 4AEDC 2PLV3 2PLV2 3S6PA 1PIV3 1ND3C 1AR63 1MEC3 3VBFC 1FPN2 1FPN3 4N53A 2RM23 2RM22 5DDJ3 2R063 2HWB3 4GH4A 5L7OA 5C4WC 4IV1A 3VDDB 3VBUB 1EAH2 1EAH1 2RS13 3VBSC 1AL0G 5BNPC 5D8AC 5CFDB 2RR13 1K5MA 1V9U2 1V9U1 5JZGB 1RUG2 1M06G 1RUG1 5BNNA 1ASJ3 4CDXC 1FOD2 3NAPC 1X33A 1FOD1 1AR73 1AR72 4CDWC 4GMP1 1RUC1 3VBRB 3ZFFA 4GB31 3J8F3 3J8F2 1QQP3 4AEDB 1OOPB 3CJIC 4RR3B 1ND2C 1BEV2 4RS5A 1D4M2 1BEV1 2HWF1 3VBHB 1D4M1 1H8TC 1RUD1 5C4WB 2HWE3 3JBG1 5BNOB 1Z7S3 4JGYC 1MQTC 1RVF2 4CDUC 3VDDA 3VBUA 1VB4A 5D8AB 2QQPA 1HRI2 3FBMA 1HRI1 1AL22 2WS93 1AL21 2WS92 1R091 5CFDA 4Q4W3 1CJDA 5JZGA 4CDXB 5ABJA 1RMU3 2MEV3 1POV0 4YVWC 4JGZC 4CEYC 2R072 2R071 1POV3 4IV3C 3VBOC 2Y26A 2X5IC 3VBRA 3ZXAC 4FTBA 4AEDA 1OOPA 1TME1 4RR3A 1ND2B 1OHFA 2WFF2 1H8TB 1PO21 2WFF1 1NY72 1PVC2 3DPRC 1NY71 1PVC1 3VBHA 2BFUS 5C4WA 2FZ2A 1ZBE3 5BNOA 2RS52 2RS51 1VBD1 4CDQC 1VBA3 2RS32 2RS31 5D8AA 1PGL1 1RUF2 1VBC3 4JGZB 2ZTNA 1NOVA 4WM8C 4CDXA 5J98B 2HWD2 2HWD3 1RHI3 3VBOB 1RUI2 3ZFEB 1RUI1 1GFF2 4NWWA 1QJU3 4Q4V3 2BUKA 1RUH2 1RUH1 5C8CC 4NWVA 4BCUA 1AYN2 1AYN1 1ND2A 3LOBA 3ZFGB 1PGW2 1PGW1 1TMF2 4CEWC 1TMF1 1EAH3 4N43C 4CDQB 1RUE2 1RUE1 1C8M1 1PIV1 1V9U3 1C8NA 1RUG3 2R042 2R041 1MEC1 1NCRC 5FOJB 4GMP0 2HWE1 5CFCB 2FZ1A 1B35B 1FOD3 4JGZA 4WM7C 4GMP3 5K0UC 1RUC2 1RUC3 3VBOA 1HXS2 1W39A 3ZFEA 1HXS1 4GB32 1IHMA 2ZZQA 2BFUL 5C9AB 5C8CB 2IZWA 1ND3B 1AR92 1AR91 3VBFB 3JD72 3JD71 2HWF3 1BEV3 2HWF2 4RQPC 1D4M3 1NA1C 1RUD2 3ZFGA 2XBO2 2XBO1 4Y4YA 3JBG3 2HWC2 3JBG2 2HWC1 3VBSB 1RVF3 1E57A 5BNPB 4QPIC 1HRI3 4CDQA 5FMOL 2VQ0A 1F2NA 1AL23 1R092 1RB8G 1QJZA 1NCRB 4Q4Y2 1NCQC 4Q4Y1 4N53C 2TBVA 4QPGC 3NAPB 4CDWB 4GH4C 5CFCA 5K0UB 1SMVA 1HQNA 5AC92 4IV1C 1B35A 2R073 4Q4X1 5AC91 5L7OC 2WZR2 1AYM2 2WZR1 1AYM1 1RUJ2 1COV1 1RUJ1 1QJX1 5GKAC 1BBT2 3CJIB 1VBE2 1EV11 1BBT1 5C9AA 1VBE1 2XPJA 5C8CA 1TME2 1ND3A 4Y5Z0 1PO23 1PO22 1VBB2 2WFF3 3JB4C 3VBFA 1VBB1 5BNNC 1PVC3 2RMU2 2RMU1 4JGYB 1MQTB 4CDUB 1R1A2 1R1A1 4QPIB 2RS53 3VBSA 1OPOA 1VBD2 5BNPA 2RS33 1PGL2 1FMD1 1RUF3 1R082 1R081 1X36A 4RHV1 1NCQB 1WCDJ 4QPGB 2BBVA 1NCRA 4RS5C 4YVWB 5L7OB 4CEYB 1AR82 3NAPA 1AR81 4RFT0 4IV3B 4CDWA 1RUI3 1VRH2 1VRH1 2X5IB 3VBUC 1RUH3 1VBA1 4FSJA 3CJIA 5CFDC 3TN92 3TN91 4SBVA 1PO11 1ZBA1 5BNNB 1AYN3 5ABJC 3DPRB 5ACA2 5J96B 5ACA1 1H8TA 1TMF3 2BPA2 4LLFA 1HX6A 1MQTA 4JGYA 4CDUA 1RUE3 1HRV2 4QPIA 1HRV1 1QJY2 1C8M2 1QJY1 1OOPC 2PLV1 1PIV2 4Z92B 4RR3C 4YVSC 1AR62 2R043 1MEC2 1AR61 4RS5B 1NCQA 1FPN1 2HWE2
chains in the Genus database with same CATH superfamily
1US3A 1YJLA 3CL1A 5DXDA 3FX3A 3MPPG 3QCWA 4WV8A 4YVWA 5FLJA 3OGJA 4W8JA 3VBHC 1U5XA 2R062 3I3BA 5AVAA 1KJRA 2HWB1 2NQYA 1KGYA 3KB5A 4LO4B 2PXJA 5DAWA 4D6QA 3IM0A 1UZZA 4IL7A 4M01A 5DUXA 3GHNA 4Y20A 5BNOC 5KBFA 4FTSA 2EIGA 4QXKA 1YFUA 5FYVA 4QQ2A 3HQUA 4QX1A 4BIFA 3WW1A 5LK7B 2LUWA 1AR93 1DZQA 3WNNA 2FCVA 2ZGTA 1EUTA 3OOXA 4YG3A 5FZ0A 5FZCA 3ACFA 1IKPA 4ORFA 3GALA 3SCGA 2SLIA 3SH3A 4YG0A 3NMBA 1ZRRA 2XBO3 5L73A 3UGFA 3CJXA 5I0UA 1S0DA 4FTEA 5LA1A 1XYNA 4N43B 1JU4A 2ZZJA 4URAA 2WR9A 5LEJA 1S2EA 2JE7A 4M3CE 3T4HB 3V56A 1ZRCA 1QQP1 3WUCA 5C3RA 2NP0A 3WQ0A 5GLTA 5A7WB 3KT1A 4QX5A 2BWCA 5FPLA 3WV6A 2GH8A 2A75A 4AVAA 1OPMA 2W46A 5EXOA 1A34A 2XVGA 4HBNA 4HVQA 3WNKA 2EICA 2OX0A 1HLCA 1S0JA 1LHWA 4JQTA 1NZCA 1KDMA 1KD7A 2ARBA 2ARXA 1AYM3 4Q27A 4XF1A 2XJQA 2HJIA 1BMV1 1COV3 1COV2 1RUJ3 1YUDA 2BW8A 3RZJA 1JZ8A 1QJX3 1QJX2 4DS0A 1GQGA 1EV12 1EV13 4KWLA 5EJ3A 1BKZA 1DQ5A 4KNCA 2Y6JA 3DL3A 3OGGA 1XJAA 4YRDA 1V6KA 1TME3 2YHJA 5FYUA 3ILRA 4P9LA 2P6HA 3U07A 1OI6A 1W9SA 2V72A 1WD4A 2JDUA 1LB2A 3H50A 1JI6A 2ZA9A 4YSFA 3B5LB 2JG9A 2WWUA 2PHTA 4QX3A 4XCAA 1KXGA 3T3YA 4CEWA 2YFUA 1PMIA 1J1TA 2H0VA 4QGNA 4XXPA 2XOMA 2J1SA 2JDKA 4YNIA 5A32A 5T52A 2ZX4A 2VTXA 1VBD3 2GSYA 1OF4A 3NL1A 4FXGB 2DVBA 4KWKA 2AUYA 4OLLA 1GOGA 3D8CA 1MVEA 3VDBA 1W2AX 3KSCA 3GZTB 5G04L 3PIGA 3THCA 4UFLA 2H6BA 3QH6A 1RXGA 3CU7A 4QQPA 2DVAA 4FP3A 3ZFGC 4IV1B 3JQXA 3LF7A 1C4RA 3AVSA 1U5IA 4IQPA 4WM7A 5LZ6A 3HBKA 1VRH3 3OGSA 1D0GA 4Y24A 5IVFA 4XFFA 3ZKYA 3THPA 1IGOA 2WNUB 2K46A 2AACA 1N3PA 2ID4A 3OYWA 4XURA 4LQRA 4YW3A 2ZEYA 3IWZA 3VKNA 1ZBA3 1ZBA2 4HSJA 2B4KA 1MZ6A 3CNAA 3AKPA 2JIGA 1VBC1 3KLSA 4N9HA 1GQHA 3WF3A 2Q1FA 2ZEWA 1NA1A 2WNVC 5FZ3A 3WINE 2HWD1 5EV7A 4ITCA 4KL1A 4JDOA 4CYDA 2C9KA 2GNBA 4PCRA 1OA4A 3ZFFB 1AXZA 3V0AA 1QJU2 1LHOA 1NKGA 3IB3A 3H8XA 5LA2A 3HQXA 1S2KA 4Q4V1 5A3PA 1PZ9A 1FXZA 2Y6GA 4FPCA 4B1MA 3H8OA 4AW7A 4AEKA 2PQSA 4NHMA 1QEXA 4CCCA 4ET7A 5A6YA 2W47A 4KH9A 3S6PA 4BDVB 1PIV3 3NNFA 5FY7A 2FDKA 1ND3C 1AVBA 4MSVA 2RDQA 4Y5SA 3VBFC 1XPWA 3W5NA 2J1AA 2DWRA 2HYKA 3RPQA 2RM23 2RM22 4XQWA 3WP6A 4A4AA 2RVAA 4JHTA 2VMGA 2DVDA 3AMMA 3I2DA 4W6XA 5EYXA 3ROUA 4HKOA 4CCEA 3VDDB 1OC1A 3WF1A 5FJKA 4W50A 1SZBA 3NVCA 3X29B 5CB7A 1Q43A 4QX8A 1QGLA 2ZHLA 5D8AC 3VGIA 2YGMA 3T0DA 1W8OA 1V9U2 3MBWA 5JR2A 1PVXA 5GZFA 2D6LX 1CZSA 1RUG1 3URFA 2WINB 3RGBA 5BNNA 5J1XA 2PELA 5FZIA 3MEPA 5A7SA 1Q56A 5E6HA 2ZAAA 4OZXA 1BK0A 3E97A 3FHAA 5LBEA 4TWTA 3KV6A 4TLGA 3AXDA 1XU1A 3USUA 3VBRB 1KRIA 4NROA 4OI4A 4RSUA 2V4VA 1BYHA 3NV2A 2Y33A 1OOPB 5FK7A 3WNXA 3OUIA 5IK8A 4S2HA 4TSVA 5IAVA 3AKTA 3LZZA 1ZYBA 1P8JA 3DGTA 2VM9A 2RDRA 4L97A 4QD2A 1PK6C 2R1BA 4E8CA 4EWDA 2Y0IA 4LNVA 3O1TA 1FV3A 3J26N 3AZVA 2HWF1 3VBHB 4HVRA 1D4M1 3AMPA 5EQUA 1IPKA 5FO8B 4EROA 4F83A 1CPMA 4W6YA 5HI0A 3PLQA 2VJXA 4JKKA 1KDKA 1Z7S3 3NKGA 5BNOB 5HXMA 2NZ9A 4CP1A 3VBUA 2JWPA 3ON7A 1JHJA 2PHDA 4K3UA 5E1RA 3ZX7A 5A1LA 3FBMA 4LLOA 1AL22 1UXZA 4AQ6A 1NZIA 2PTMA 2KM2A 3WUDA 1QY4A 4Q1PA 4B4RA 1O91A 2E33A 3CO2A 5BXXA 4Y22A 3AYEA 4GD4A 2MEV3 3BU7A 3WNOA 1J1LA 1LHVA 3KF5A 2R072 2VY0A 4QDRA 3V65A 1RC6A 4IV3C 2C0ZA 3VBOC 4DRRA 3T2PA 1UOJA 1NLSA 4L99A 4OUEA 2AGSA 5FTTC 4LBOA 4COVA 1NXMA 3GBWA 2VG9A 4X8NA 2ES3A 2GC3A 5J09A 3K3NA 1I1EA 2ZGUA 1GNZA 5FJHA 1TME1 1T6GC 4FQZA 4UT5A 4J6GA 3ZDVA 2GC0A 1W8TA 1Q3EA 4S2FA 4NIGA 2WFF2 4AI9A 3LDBA 4HXCA 2ORXA 4OMCA 5FO7B 2BERA 1OUSA 1XU2A 2BFUS 3OPTA 4D0QA 2ARCA 3LFIA 4OMDA 2C9AA 1QOTA 4A2UA 4QU1A 4DY3A 1WBLA 4HONA 1C3HA 5E8AA 1RUOA 2RV9A 3O5SA 3Q9OA 1A8MA 1XBFA 1VBD1 1DZRA 4LULA 2QZ2A 1LOFC 5D8AA 5FP4A 4D7SA 4BA6A 5JPNB 1RUF2 5ERLA 3VZOA 3HD8B 2QJVA 2ATFA 5DPNA 5ISLA 1OQEA 3ATGA 2XLFA 3ZN6B 2ZTNA 3AXEA 4WM8C 4ARYA 4MHUA 3ZXJA 5A6ZA 1MZEA 1RHI3 4Y1XA 4CP9B 3H8RA 1GZWB 1A8DA 2WNEA 3K3OA 3PUQA 4NWWA 4A6SA 4COYA 1LEDA 2I2SA 5LATA 3ZPOA 2EIEA 5J7MA 5FFOC 4JX0A 5L9RA 4YZ1A 5A70A 5EJZB 1RUH1 2QQIA 3Q8CA 3FUOA 3BYWA 3BN6A 2W52A 2HKXA 2X8KA 1YI7A 4BCUA 2K0GA 3WW4A 2Y6FA 1Y4WA 3PVOA 4QDQA 5SV8A 2Q5TA 3ZFGB 2QQVA 1PGW2 2X29A 5CVRA 3AKSA 3R05A 4B1LA 4PBOA 2XXZA 1JH5A 5FP9A 2BVBA 1EAH3 3N9QA 2R0FA 3ASIA 3E5QA 3DV8A 5LBCA 3EJKA 2AENA 2ZGLA 1J58A 2BU9A 4R9DA 4Q0PA 1YWKA 5CIRA 1WLWA 1FT9A 1ZZCA 2YBSA 1W0OA 2NMNA 4G4FA 1YQCA 1PIV1 1BK1A 2ZHKA 2VXRA 5I0TA 3HR9A 4OYUA 1NLRA 4E4ZA 4LOTA 2DCZA 1XE8A 2WNVB 1LGBA 1FOD3 1CAUB 4QXBA 1S0GA 3RWKX 2IXKA 3WCRA 2EA7A 5BUVA 3VBOA 1HXS2 3I59A 4P9IA 4UFMA 4XUPA 2HBTA 3BALA 5FPVA 3BU0A 3WT3A 1YEWA 3L9JT 1I5ZA 3Q8EA 1H0BA 3LB9A 1QXPA 1HV1A 3OSDA 4WZCA 3MF9A 4CU8A 5KXEA 1ND3B 4LBJA 3B00A 3U11A 1UY0A 5KHHA 3U4SA 1I6XA 3ELNA 3J7NA 5FPAA 4LBQD 3VBFB 2E31A 2H0BA 4Z2AA 1CAWA 1YI9A 4PI0A 3LSEA 1LKNA 1BEV3 4RQPC 4BQ3A 3K77A 4OVEA 4ATEA 4DUXA 2VL4A 2MNGA 4EE2A 3IAQA 4QDSA 5K4LA 4Y4RA 2O0OA 1GZCA 4OHVA 2HEYF 3JBG3 3JBG2 3VKLA 1RVF3 1UN1A 2EXHA 3LEMA 4XJ8A 1JHNA 1PX4A 1V0AA 1NAEA 4QPIC 1HRI3 2W39A 4CU6A 2VUCA 4PF1A 1LOFA 5IAXA 2DCYA 2FMYA 3DKWA 2LW8A 1OLMA 3UETA 2IUWA 1QJZA 3A23A 5KWRA 3O1VA 1PX3A 5C3OA 5I93A 4K6BA 2WUHA 1NCRB 3MDPA 3P1IA 1PNFA 2TBVA 4QPGC 5HCHA 2FBEA 3WG4A 2LRPA 3RDIA 3FZ3A 3KZ4C 4GH4C 4YGCA 3B01A 1HQNA 3K2OA 4Q4X1 5AC91 4F8AA 1H6XA 2V5YA 2N7GA 2G9FA 1W6QA 3NV1A 2EXKA 4XFCA 5EZWA 2F4LA 4XETA 3V0BB 2GZWA 4LA3A 3WVJA 5GKAC 1VBE2 4AFDA 3MLKA 4M3CB 4FI9A 2DTYA 2BVVA 3ZPYA 1XNBA 1PK6B 2WT0A 3IPVA 1URXA 3MUZ1 5T5LA 3SISA 3A22A 3ZLIA 1OF3A 5CYYA 4E8DA 3W59A 4C90A 1HN0A 4OI0A 1JZ7A 2YV8A 4XJWA 1ENQA 5FQ0A 1F4HA 2QQKA 4NRMA 1X7NA 1GSLA 1V00A 1OQ1A 1OPOA 1OLRA 3VKMA 2RS33 3WG3A 5BNPA 2ZGOA 1FMD1 5I91A 1L7QA 4R9BA 2FDJA 2Q1ZB 1R081 1VIWB 4RHV1 4A7ZA 4PT6A 1NCQB 2BOIA 5CEHA 1I5PA 1YQ6A 1ENSA 1UZ0A 4DRVA 5L7OB 2QQMA 5FBZA 1CZVA 1MZ5A 3SEEA 1AR81 4IV3B 2J1RA 5FLIA 2BDRA 1SPPA 2VOXA 4KU7A 4AEJA 3AP4A 3K48A 4Y5TA 1GP4A 4QGMA 5A80A 2Y6LA 5FCCA 3M3OA 1RL3A 2HYXA 4E27A 3PJQA 5CFDC 4WVZA 3TN92 1WKYA 5T54A 1AXKA 2BGCA 1XRUA 3P3PA 4MHRA 4SBVA 3H1YA 5IUQA 1UPSA 2XUEA 4Y1VA 3M2MA 3VD4A 3PVNA 1AYN3 3ZYRA 3M70A 3PUIA 1NT0A 5ACA2 3I2HA 3ZSLA 5KXCA 4N9IA 1H8TA 3FHIB 4L2NA 2X09A 2W0XA 4LLFA 1QKQA 3ACLA 3WDTA 4BB3A 4BXSV 5FUPA 4CZSA 1H2NA 3TYJA 1W6OA 4I3PA 4DFSA 1OBNA 4I09A 1HRV2 4QPIA 4BQ1A 3N9OA 3KM5A 3OGRA 3VZMA 4EN7B 4LOSA 5C71A 3VD9A 2PLV1 4UWDA 4R4XA 4GWMA 4AHXA 4Z92B 4RR3C 5G05L 3T1MA 4XUNA 3O1SA 1DG6A 3WG2A 4LMFA 2Y38A 1AR62 2R043 1MEC2 1LHUA 1SLIA 3KGZA 4RS5B 4WM8B 4QPGA 5FYMA 3QH7A 4LKSA 5EHDA 1NX9A 1Q8QA 1L7RA 3CDZB 4PLOA 5DDJ1 4AWDA 2HWB2 3APBA 2PN5A 2WYSA 4CEYA 2KR2A 5E16A 1G8WA 2HBUA 2QQWA 4BE3A 1H6YA 2VCAA 4GB33 2XLGA 4YW7A 1V70A 2GDFA 2RS11 2VUDA 1WZXA 2X5IA 3KT4A 5A33B 2WQZC 4EQVA 3K51A 5HBAA 4H7LA 1CN1A 2O8OA 1ODMA 1H1IA 2RR11 2WZEA 1W8WA 1OURA 1W9FA 1VLNA 4NIHA 2VR4A 3SCFA 1S0EA 2JB4A 4O9GA 2VO5A 4CPBA 2RJKA 3JD73 5ABJB 3NSTA 3FWEA 5HV4A 1RJ8A 3OJBA 4YFZA 1ASJ1 2DFBA 4A44A 2JX9A 1KS4A 4E2SA 4LHKA 1Q8SA 1WD3A 2HWC3 4KGGA 5JSRA 1X9TA 1SCRA 1ZREA 3FLRA 1PMHX 1ONAA 4XW3A 5FDBA 2WWJA 3L2HA 1GOHA 3J8F1 1QQP2 2ILMA 2OYZA 4QQHA 4B3NA 1N3OA 4C8DA 3RZMA 2DF7A 1SCSA 3PTRB 3VHOA 5IATA 1R093 1VAKA 2VW2A 4AHWA 1DYKA 4LEJA 3C7FA 1DF0A 1MS1A 3I8TA 2JEMA 4XZUG 4Q4Y3 2IVIB 4XVHA 4LKEA 1KS5A 3R4DB 3AL6A 3RI8A 1N1SA 4AVSA 4W65A 2EAAA 2PHRA 4FPKA 1LODA 2OZ6A 3GNEA 2VD7A 2WZR3 4XZPA 2Q8EA 4GA9A 1BMV2 5CKNA 1RVF1 3POGA 1K12A 4HLTA 4ZKTB 3BKZA 2KA3A 1BBT3 1AX2A 1CD3G 2VC9A 3O1RA 3HAGA 5JPMB 1UX7A 3RYPA 4FFFA 2WS91 4IERA 3JB8A 2WO3A 1E5HA 4Q4W1 1AJKA 3ZR5A 4RQPB 2D6NA 1VBB3 2QVSB 2CV6A 3PUHA 4QKBA 3WNLA 2QQJA 1YJKA 4QB6A 2UURA 1RMU1 2RMU3 3A0KA 3I7DA 4NAOA 1N3QA 1ULCA 5FP3A 1NE6A 3ACGA 1DYOA 3HN3A 1DIWA 2GC1A 1UMHA 2VW1A 1R1A3 1EUUA 3WW2A 3ZFFC 2NYYA 2WWSA 2IWGB 2P6CA 4N43A 5CISA 4NAMA 3I3QA 1DHKB 4NUBA 5FZOA 3IAPA 1Z0HA 2ZJCA 3IN9A 1AHSA 1V6LA 3AZZA 5FYZA 1WCKA 2YBKA 5A7WA 2VU9A 2P34A 4P9WA 3THTA 3WDWA 3A4UA 4BH9A 3R0RA 4BK4A 4OULA 4CP2A 2IFWA 3HNMA 4FO9A 4GH4B 1V6OA 5FPUA 1SBFA 3UGHA 4MGKE 1OFSA 3QBQA 1EY2A 4Q0SA 1JXNA 4XMIA 5K0UA 3ZR6A 3TEZA 2D44A 2F6BA 1AUYA 2ZGPA 5LRSA 5LRRA 1OH4A 4UFJA 4NRPA 3VDDC 1ZBE1 2Z2SB 4NR1A 2DCJA 2WJSA 2IXIA 5FXVA 4BXFA 1K5MB 4E2QA 2W08A 3KT7A 3FC0A 4DUVA 1J3QA 1XE7A 1GR3A 2LALA 1VBC2 3U37A 1QXJA 2RDSA 4IEUA 4YFWA 5EWSA 4OZOA 5FZKA 3SITA 4PQ9A 3VD7A 3WQBA 4YM2A 4P9JA 4OI1A 3KMHA 4META 5CFCC 1F8VA 1POQA 4CCKA 1B35C 2Z42A 1DU3D 5J3UA 1SACA 1W9YA 2CNAA 2WRAA 2GMEA 4GWIA 4IEQA 2Q0AA 1ULPA 4Q4V2 4TXWA 4XAAA 3L2YA 5F32A 1QJY3 1C8M3 1VP6A 2AYHA 4I0AA 4XQDA 3POBA 1GNHA 2CL2A 2VOKA 2L9LA 3GF6A 2BYVE 4HN1A 4XABA 3WF0A 2OZJA 4C0BA 4Z8BA 1SLTA 1LULA 4CXYA 2QQOA 3ZXGA 4R9CA 4A42A 2GP5A 4GKXA 2R063 5FLHA 4IV1A 4M0NA 3T09A 5DG2A 5FZ8A 3WDVA 4CUCA 3VBSC 3K75B 1AL0G 4LO8A 2E51A 3W58A 5GLVA 4EN8B 5CFDB 1RIRA 2NPIA 2WNUA 2E26A 4AZZA 2BOJA 1IS4A 4XFBA 4QKFA 3O1UA 3C2UA 3RYKA 1RUG2 2PHLA 2BBAA 1UOFA 2B9VA 1CQ9A 1N47A 3UGGA 2XWBB 3NAPC 1X33A 3MF6A 4GWJA 4CCNA 1OA3A 1AR73 1AR72 4CDWC 5I0SA 4GMP1 2CWMA 3AP6A 3E1F1 1A3KA 4HKWA 4JTNA 3P5BA 2D3SA 3ZFFA 1JOJA 4FFGA 4GB31 2ZXQA 3VZNA 2DBIA 2ZGNA 5IWFA 4I02A 5CU1A 3CJIC 4RR3B 2IXJA 4GZ9A 3VKFC 1BCXA 3NWKA 2HLEA 2Y0OA 5FP7A 1W8UA 2YFZA 1S1AA 1BHGA 1ZX5A 1EYBA 1D4M2 2G9GA 3B02A 5C4WB 4LHLA 3RJ2X 4AFBA 4DINB 4NO4A 5GLWA 3VLBB 3KVBA 1GP5A 1QDOA 4BHPA 2D6KA 1MQTC 4LIVA 4QM8A 2EIDA 3W20A 4X6QB 2J22A 3Q8FA 1SDDB 1MS0A 1MS9A 1O5UA 3VDDA 1VB4A 4D7YA 5KHIA 2QQPA 2XH6A 4OUMA 1DQ0A 1HKDA 4JHZA 4N8MA 1UMZA 1XSRA 2ET1A 1JN2P 5LASA 1R091 3TNPB 5IFPA 1ZA7A 5F3GA 1YHFA 3TB0A 4DB5A 2GN7A 4A3ZA 3EYPA 3JUUA 3AZWA 1SFNA 3A21A 4LXLA 1DFQA 2WSVA 4K7JA 3UNPA 3PURA 5F3CA 4XF0A 4XHXA 3E6BA 3SNMA 1GANA 1UYYA 1ACCA 2ZOEB 1OLQA 1F5FA 1POV3 1YCIA 4UW3A 5FUNA 1LU2A 3HPNA 4CCOA 4XJUA 1LOEA 3VBRA 2Y34A 3B69A 4LBMA 3B9CA 3ZXAC 1ALYA 1UY1A 3VZJA 4WZFA 4GAZA 3ZMOA 1OOPA 1R1ZA 2C24A 3HNYM 1BVP1 2Y8KA 2BNMA 2VVEA 3JZVA 3NNLA 3MIEA 3S5QA 5CAZA 1SHWB 4Y26A 4BQ5A 2YPJA 1PO21 5FIXA 2BZDA 1J84A 3NV4A 3DPRC 1NY71 1PVC1 4A3XA 3OBAA 1WUVA 2ZGMA 3KV9A 3VBHA 1W8ZA 4L8QA 3S7IA 5F7UA 1S0IA 2ADEA 2NN8A 5DAXA 1VAMA 4IGQA 3ZXDA 3FN9A 4XUQA 4LBLA 3HWJA 2OPKA 5BNOA 1O3TA 1ULEA 2RS51 1UXXX 4AHYA 3OY8B 4AHZA 4DXSA 4DXTA 4N7IA 2OVUA 2H6CA 3T2QA 2OQ7A 3GDBA 4FOWA 2QDNA 4QB1A 2Q8OA 4LT5A 3VL8A 3QOPA 5FZ4A 3OPZA 5GLUA 4O9EA 2YYOA 2ADDA 1QJEA 2W91A 3ME2A 3C7GA 2JDPA 2ZGKA 4JRAA 5FMBA 3T2TA 3ZO0B 4EYUA 1YYNA 2JDZA 5HCBA 5C70A 4EN9B 4AR2A 5DAPA 1RUI1 4XILA 1QJU3 4UXAA 5JAXA 2D5HA 4OHXA 4ATFA 3LKJA 4DY5A 5EFUA 1Q8VA 2VZPA 2OIIA 3ETQA 4IUGA 4DO0A 3WF4A 1DQ1A 1RUH2 2VBBA 2W1SA 2FDHA 3M3QA 3GZEA 5FMDA 2A6YA 3AMNA 2C6SA 4EZ4A 2CGPA 3H3ZA 4IGOA 2I45A 1NE4A 4OUSA 2WN2A 4UFIA 4LUKA 1J3RA 2XONA 5FY1A 4YARA 1C5HA 1IQAA 1I9RA 4MV2A 4XCBA 2WL1A 3BIWE 3AMQA 2CDPA 1G9FA 4CUBA 3ITQA 5JOWA 5H9QA 3PNAA 1TMF1 4QQOA 5FY0A 5LBFA 4XHBA 5EJ1B 5I0DA 4R8HA 1YIFA 3AMHA 3I3EA 4LPLA 1Y3TA 4QXHA 3UESA 3ZYPA 1OKOA 5FYCA 1RUE1 3CBNA 2GALA 4GULA 1C8M1 4I30A 1EP0A 4WVWA 3U10A 1ZM1A 2VOVA 3W21A 2CWSA 4EWEA 1V9U3 1W3XA 3VD5A 3VL9A 2OUJA 4W4ZA 4AAXA 5BY5A 2XUMA 1NCRC 3P6BA 5FOJB 2WA3A 4GMP0 2OW4A 5CFCB 3DUIA 1B35B 1H9WA 3ZN6A 2ZHMA 4Q0UA 2C5DA 4KG0A 4YGBA 1RUC2 1RUC3 3RMYA 5FOBB 4CP9A 2ZACA 2VVDA 3KQ4B 4A45A 1H4GA 1GZWA 4Y1ZA 4YG6A 4B4QA 3GHMA 4OHWA 1O3SA 4ZU4A 4AYUA 3FHQA 1GZ9A 1VAVA 3KHBA 5L36A 2AEZA 3AYAA 1OXCA 2ZMNA 3ZMNA 2DUPA 3ACIA 3IMMA 1CESA 1GOFA 1AR91 4MXVA 2PMWB 4O7XA 4RD7A 2ZX1A 4I2OA 2RHPA 5FUIA 2Q1MA 3O0XA 5I8YA 2BNOA 1RUD2 2X05A 5IJRA 3IMNA 3ZFGA 2WT2A 1AX0A 2XBO1 4BQ4A 1G9CA 3OG2A 4UF0B 3VBSB 4GJZA 1GQPA 5LW9A 4E4DX 4OCTA 1QNWA 4IEOA 4P08A 1FX5A 2BGPA 2VMHA 4LORA 4JVAA 4JCKA 3NJYA 5FMOL 5AFEA 2YC0A 4FXKB 3TAYA 1F2NA 4FFIA 1AL23 1DP0A 4H14A 3LWCA 5ANQA 5F6KA 4LUMA 3LIGA 1DYPA 4OQ9A 1NCQC 1RXFA 1WMDA 3FFZA 4N53C 4WVVA 2D6OX 4Z82A 5GM0A 4K9SA 3NAPB 3C7OA 1GWLA 2WNOA 4NPRA 3H3UA 3N7JA 3OF1A 4TN7A 2WNVA 1CAVB 1G6NA 3WLUA 4CDWB 5L7OC 5AC92 1ZZ6A 2R073 1CAUA 4DNYA 1VRBA 3ILNA 2JDAA 4BLIA 1CONA 1AYM1 4MGIE 3EXUA 4D6RA 3M4FA 1COV1 1NQDA 1RUJ1 5C3QA 3OYWB 1L7LA 1QJX1 3CJIB 1EV11 2JJ6A 3BPZA 5IHRA 4FPGA 4N7UA 4PIXA 5IK5A 1UW8A 4A6OA 1KEXA 5JOYA 1GYKA 1ND3A 1LTEA 1E5RA 1SFPA 3I2IA 5LBBA 1OMIA 3ZXLA 3H8UA 2WFF3 4HG6B 3VBFA 3WP5A 3ZSMA 3W5MA 3S57A 4FPYA 5IVCA 4URTA 1C1FA 4M3CF 2YUEA 2F17A 2R16A 1MQTB 4AGVA 2GMPA 3F95A 5KHGA 1N1YA 2R30A 5A1AA 4CUGA 4H7MA 1CGPA 4YM1A 1PGL2 1JZ4A 1LESA 4NVPA 4UBGA 1RUF3 1DGWA 1R082 1CPNA 4D94A 2QDRA 3AZXA 2CDOA 4QX0A 1JUHA 4IE4A 1UNBA 3U78A 1UU4A 2A7AA 1NCRA 4RS5C 4AI3A 1W06A 2GC2A 1AR82 5T5OA 4Q29A 4RFT0 4NHXA 1UX6A 3DYPA 3FL7A 2O1QA 2XJUA 3CZUA 5FZ7A 1O4YA 4PF5A 1CAXB 1K45A 1VRH1 3BGAA 5T5PA 5LEKA 5IT6A 4FPFA 5FKBA 4I3GA 5FPZA 3V0BA 3N9MA 3DECA 4LBQB 1QXRA 4ASMB 2C1FA 3B94A 5F3EA 4ASKA 3VN4A 2W5FA 1GV9A 1ULDA 1GBGA 4CUAA 1H9PA 1U0AA 5I8TA 4M3CA 4HK9A 4W6WA 3POIA 2UYAA 4WVMB 5JXIA 1ZBA1 5BNNB 3D0SA 1PK6A 1YXWA 3WDYA 3H9AA 2AC1A 5ABJC 4AI2A 3DPRB 3N7LA 5J96B 3K4ZA 3NV3A 5HV0A 1TQ5A 4LITA 3AP7A 2CGOA 3R4UA 4G3YC 2Q8CA 3S0MA 2VGDA 1HX6A 1UY3A 4B7EA 2VZTA 3FLPA 4ISQA 2VMIA 1VE0A 4CU7A 2G4IA 1E5IA 1GP6A 4FPEA 4PIYA 4CTEA 1W6MB 1W2OA 2ZKNA 2PQQA 4IEZA 2DVFA 5C6CA 2JG8B 3SCHA 1CJPA 4Q26A 1NCQA 3NJVA 2PYTA 2HWE2 2HWE3 3FBYA 3OD4A 5FZAA 1D4VB 5J48A 5DDJ2 1SLAA 3BTAA 2RM21 2Z4FA 2VNGA 4B8EA 4CCDA 1Y9QA 2VNVA 3O1PA 4YGDA 1ODNA 5FK8A 2ZGSA 4IV3A 1HXS3 1AZDA 4BZ4A 1QMJA 2DUOA 2RS12 3J7MA 2ETEA 4ZPIA 4DIQA 3MHZA 5HPOA 5FAXA 4L0PA 3M8LA 4AQTA 2E32A 2RR12 4ZS3A 5FZHA 1DQ2A 1LR5A 2QKDA 3EB7A 2D40A 4EN0A 1FNYA 3NJZA 2YBPA 4P9YA 3WHUA 1DDLA 5EYYA 1CWPA 4CXWA 3DCQA 1ASJ2 5C5TA 1NG0A 3RZKA 3WQ7A 5IVEA 5JIUA 3E5XA 2PA7A 5LY1A 3GCXA 1H4HA 4QB2A 2FDIA 4RN5A 4Y1YA 3LAGA 4Q1RA 4BM8A 3AJZA 3ALQA 2VMFA 3WP3A 4FFHA 2VTFA 2ET7A 1IG3A 3FUQA 1X82A 1G86A 3HT2A 1DBNA 4YVSB 2XJPA 1KJLA 3WDUA 1MACA 3OCPA 2XR4A 5FZ6A 4IESA 2ZABA 1YQ8A 2W87A 4WM8A 2RE9A 1CR7A 2B5HA 3HT1A 3NO8A 1Z7S1 1XYPA 4BOWA 2QQUA 3T30A 1Q8OA 4LHSA 4B4PA 2BRTA 3CIHA 3K4DA 3OBTA 5A33A 1VBE3 3QLQA 4DPNA 3LDRA 4RL7A 3UKVA 5I0RA 3W9AA 1ZRDA 1K5MC 3LPGA 1S4CA 4LKDA 3F2ZA 3SC7X 4Q4W2 3ZYIB 1JZ6A 5IYYA 4MZUA 1RMU2 1LOBA 2MEV1 4COWA 3H0OA 2LTNA 3POJA 4PDWB 2P3YA 3U75A 5F37A 3AX4A 2BJSA 5KXBA 1RINA 5A6XA 5JVVA 3ZFEC 4TTGA 3IDAA 4Y3OA 2WZ8A 4OI2A 3LPFA 4OFGA 4RA0A 1ZRIA 2B7YA 4PJYA 3I2OA 3KGLA 4MGZE 3BODA 4FOVA 1OD3A 1XB9A 5C5UA 1SEFA 2ZMLA 4IETA 1DQ6A 3DYOA 5CG9A 5FY9A 2WDBA 3RSJA 3RYRA 3GBFA 5BYNA 4IEWA 4K20A 4N53B 3NRUA 3JXSA 3AB0A 3ORJA 1WMFA 4L92A 1MZFA 3NNMA 1UWWA 5LA0A 4GALA 2DCTA 5FZBA 1JYTA 3WNPA 1GZTA 4U2AA 1Y7BA 1YRZA 3RQ0A 3HMYA 3HBZA 1YFWA 3HN1A 5DABA 4Z07A 3MV11 1ZBE2 4JKLA 4EJRA 4NIAA 1MVQA 3AYCA 1UZYA 3GZAA 5F5IA 5IVYA 1HDKA 1VBA2 5BNQA 1XYOA 2Z69A 2TNFA 3I2FA 4FOQA 1W04A 1WW7A 1JMUB 1RUF1 3TN93 3ZKUA 5JXJA 1V6NA 5J37A 2F4PA 1PO13 1PO12 1UD1A 3N9PA 1OUXA 4L11A 1X50A 1SBDA 3D3AA 5IW0A 5FZFA 4RQPA 5ACA3 2XHNA 1V6JA 3CLPA 3RG0A 2WYFA 2VH9A 1H2LA 3RMXA 1TVGA 2MPFA 2JECA 1RHI1 2E7TA 1UYPA 3AL5A 5DN2A 3BVCA 1VB2A 4ES8A 5EIYB 5FMOS 1IS3A 2WLPA 2XMLA 1HRV3 1BXHA 3J4UH 5F3IA 1DGWX 4CSWA 1S2BA 2BNNA 5C9AC 2YC2A 4ASLA 3KCYA 2GAUA 1AXYA 2WKKA 2EVXA 3EO6A 5IVVA 5FZ1A 1VR3A 1W8NA 5A7PA 4LA2A 3ZOIA 3ABZA 1W6NB 2V4AA 1AR63 4C91A 1C1LA 1MEC3 1FPN2 1FPN3 2ERFA 4FAHA 3MUY1 4MGYE 2DFCA 3ZSJA 4INDA 4GH4A 2HWB3 5C4WC 2P3KA 4JTOA 2X53S 4NN0A 3Q8AA 2XJTA 2JE9A 4ZHNA 4IXLA 1EAH1 2OPWA 5FO9B 1ULFA 1FI2A 3IZOA 3PJYA 4JRLA 3MIHA 5K9YA 3DXTA 3I4IA 4KI5M 1JYWA 3MO4A 3AZYA 4XDPA 5F5CA 1SLBA 3AJYA 3N9NA 2ORZA 1K5MA 2V73A 4BK5A 3RNSA 2YMZA 3INAA 3MIDA 1ST8A 4NE9A 4O61A 4XF3A 4XOGA 4YWAA 5FYHA 1YQ2A 5JZGB 2WQ8A 1M06G 1F35A 5F5QA 3M3CA 3JCIA 4BPZA 2K2SA 1LENA 2A6XA 1WMXA 1FOD1 2WIIB 4QX7A 2WC2A 4K1YA 4HETA 4XIOA 4F3JA 1H2KA 3FFQA 3MV01 3OUJA 2IFRA 2WBKA 3PVBB 5JR7B 1U5YA 5FY5A 3WD5A 1W2NA 1QQP3 5C33A 2W2IA 3NNGA 4AEDB 2XL7A 2W3JA 2ZHNA 1SLCA 5CKMA 3LEGA 5GJ6A 4MYEA 3RZZA 1H8VA 5BPXA 3MIFA 4D69A 4H2AA 2BWAA 2XVKA 4P00B 5DMYA 1VPHA 3GZUC 4IE6A 2DURA 1IOAA 1PMJX 1BEV1 3MI8A 4AF9A 4HFSA 2D6MA 3LA3A 3J7LA 4BQWA 1QF3A 4HN0A 4XPVA 5HXVA 3JBG1 1QNYA 1EPZA 3AKRA 3LCPA 4JGYC 4CDUC 3HOBA 2I07B 3MZHA 4Z1VA 2EXIA 4ZZ8A 4GJYA 1HRI1 1W8FA 2JKXA 3N35A 2HEVF 5CFDA 1NUKA 1YFXA 5DQ0A 3T0BA 1GWMA 1LOAA 1YNAA 4FT8A 2YGLA 2WO7A 1JTZX 2R1DA 1CJDA 4CDXB 1CVNA 3KV5A 4YVWC 1UU5A 1W6PB 4JC1A 4RGAA 1FV2A 4YGEA 5JI9A 4MO3M 5L9VA 2GNDA 3ZYHA 2HEWF 2OUHA 2PAEA 4QHBA 4IDZA 1OD5A 1C28A 4XE9A 4SLIA 2Y26A 2VAUA 3ES1A 2WZPP 1U12A 5CZKA 2BP6A 4FTBA 1LHNA 3I2JA 2YPDA 5F6LB 1XQNA 5A7OA 5KXDA 1TZOA 1N1TA 4RR3A 1G9AA 2UU8A 3CZJA 1OSGA 5F2SA 1ND2B 5L19A 3VB9A 2JXAA 1OHFA 1GMMA 4CCLA 3BIEA 2PHXA 1H8TB 1OFNA 5JXGA 5JMCA 1NY72 1PVC2 4XFGA 5TSWA 2XJVA 4UYBA 4CE8A 4DXZA 4R52A 5JLVA 3WQ1A 1JW6A 4MG2A 2J42A 5JDBA 2JDYA 4MH0E 5C4WA 4FVVA 2FZ2A 1QU0A 1Z78A 3SH4A 4D6SA 1SBEA 2XKPA 2RS52 5T50A 3WF2A 1UMIA 4XYXA 1IPJA 3N7MA 2RS31 3CF6E 4J25A 1HV0A 3AKQA 4P9XA 5FPBA 4AGGA 2AREA 3O1MA 4QKDA 5T55A 2ZS6B 2D5FA 3ES4A 1GKBA 2ZKLA 1VBC3 3FMGA 4FP2A 5A3LA 4O65A 1W2UA 2YY1A 4XDOA 4JGZB 1D7PM 2Q4SA 5T3NA 1RYYA 2HWD2 2HWD3 4BQYA 3ZM8A 2C26A 2CAVA 4I01A 1RUI2 3ZFEB 1TEIA 3LFMA 1GFF2 4FPLA 1NQJA 3WG1A 4GWNA 2RG4A 5JWPA 4Q4V3 3OB8A 3AYDA 1WA6X 2V5DA 1IG0A 1VMHA 3RRDA 4XMAA 3BPSA 3RS6A 2JE8A 4LKFA 2PAKA 5FREA 1US2A 1XNAA 3ZN5A 3VZLA 1QHDA 4L9BA 3SQOA 5JIAA 3IBMA 1SFYA 1KFXL 4JZRA 3OEBA 1SQ4A 2VMEA 1DGRN 1WGPA 3VD3A 4LBNA 5GZDA 3ACHA 1AYN1 3WP4A 1UO9A 2D3PA 2D7FA 2FHRA 1K3IA 2JG9C 2W94A 4AFAA 4R4ZA 1O6UA 1TMF2 4CEWC 3JQWA 1K5JA 1OT5A 3S7EA 1G9BA 4H55A 1O8PA 1LAJA 4HVOA 3LDKA 2FD8A 3WXPA 2XDVA 2B8MA 1XE0A 4LTAA 3SLIA 4CDQB 2LM3A 1RUE2 5A3TA 1TNRA 4C0HA 4LK6A 3BOWA 1HJFA 4TYSA 5A1FA 1SDWA 3H42B 3K4AA 3OY8A 3LGRA 4QM9A 2TUNA 1Y43B 2ZGRA 1RITA 1C8NA 2B42B 1WBFA 5LA9A 5BV6A 1RUG3 4PI2A 2R041 1MEC1 4E4HA 2XQXA 3J7HA 1JYNA 3MFAA 4XC9A 2WQ4A 2J7MA 1UOBA 4U36A 4ES9A 4M4PA 5FZ9A 1WW6A 5D2AA 4WM7C 1QDCA 2YROA 1IQDC 3POYA 4LIUA 4LK7A 1QIQA 1FAYA 1W39A 2A3WA 3LEKA 2PFWA 4AAPA 1IHMA 1REFA 4XBLA 2ZZQA 5GLZA 5CA6A 2BGOA 2BFUL 5C9AB 2VE1A 4CVUA 2WN3A 3GBGA 4IEYA 5C8CB 2IZWA 4J1XA 3ZYJB 3BCWA 1AR92 5F39A 1CIWA 3TBDA 5FY4A 4AI8A 3BOPA 2EAKA 4HK8A 1OVPA 5H9RA 3JD71 1BJQA 3S5AA 2HWF3 2HWF2 1D4M3 4CPBD 1NA1C 1MS3A 4F7ZA 3T08A 2XBO2 2VULA 4Y4YA 1YIPA 2HH9A 5F2WA 2DTWA 2B9UA 2HWC1 2W1UA 1VALA 3KD4A 1G7YA 1TG7A 1E57A 1UIKA 4TLFA 2B46X 3OEAA 5FZOB 2R0HA 3BB6A 2EXJA 5GALA 4V2WA 1DQ4A 1MPXA 3POEA 3VZKA 1F5JA 2QBXA 1WW5A 4MXWB 2IVJA 5CBLA 5KHJA 4NPMA 2QZ3A 1WLCA 1W3VA 1UKRA 1YQ5A 4YZ3A 4Q4Y1 1S55A 4Z2WA 3KV4A 3DN7A 2AR6A 1NYWA 2QFEA 4GQ7A 3UJQA 5IK7A 5CFCA 5K0UB 5JUVA 3GJBA 1B35A 2YU1A 1AYM2 1LOGA 2WZR1 3LA7A 3AK0A 2CU5A 2GNMA 1RUJ2 3PUSA 4HPKB 5KR7A 4S2GA 4Y1UA 3NKTA 5FPXA 1BBT1 2IXHA 2ZX3A 4K21A 2DBNA 4YLZA 1TME2 1ENXA 3SH5A 3VDAA 2FCUA 3CKHA 1HW5A 2PHUA 2VW0A 4HT1T 4Y33A 3CEWA 4Y5Z0 3JB4C 2P5BA 5BNNC 1H30A 2AZ5A 1VBB1 2RJLA 5DZGA 2VXJA 4FAGA 5M0TA 4XF4A 5F5AA 3RJRA 2RMU1 2UWAA 5A7QA 2A3YA 2XQRA 4PQQA 4JGYB 4CDUB 2VZOA 3SEPA 4AVBA 3WDXA 1R1A1 4UF0A 2DVGA 5DAVA 3VBSA 4MADA 1VBD2 3B9IA 2W1QA 2XWJB 3FE5A 2P17A 5FZLA 5C7GA 2Y60A 1QH6A 3KF3A 1DGLA 1UU6A 2P4EA 3MW3A 1SG3A 3MIBA 5IVBA 2OS2A 1TE1B 4ZXEA 1LOCA 4PIZA 3PTYA 4CXXA 1WCDJ 3LE0A 2VZRA 2VQAA 2JG8C 4XJ9A 5JMOA 3E6CC 2GP3A 4YVWB 3O0WA 2VNRA 4NPLA 1WA4A 2D98A 2E63A 2PAMA 5CG8A 3NAPA 3NNJA 4CDWA 1CAVA 2A3XA 1MS5A 4Y20B 5GZEA 1W9WA 1VRH2 5FWJA 2A70A 3VBUC 1DLCA 1OLME 2E6VA 5GZCA 3H7YA 4AG4A 2WFPA 3D0JA 3S30A 1XNCA 2R6QA 5JI7A 1RUH3 2W68A 5D21A 3A0NA 4CP0A 4FSJA 3CJIA 5DZFA 1V6MA 3BTYA 2VTXJ 1JODA 1O59A 1TNFA 3WX5A 3WR0A 3OD0A 3I3DA 1SLLA 1LRHA 4QMAA 5AFBA 3THDA 3PDQA 5FYYA 4ZZ5A 1S0CA 2UY8A 3RWNA 3UJOA 3MYXA 3POSA 2BPA2 3G6JB 1XXNA 3VBRC 3SKVA 1RJ7A 1MQTA 4D7TA 1HQWA 3IT8A 4E9KA 1UAIA 5APAA 1Y9MA 3PMSA 4KBBA 3PUAA 5A6QA 5K8SA 1QJY1 1O7FA 4OHYA 3Q8BA 2W1WA 2FCTA 1PIV2 3LEIA 4JDMA 3AC0A 4PLNA 1XOYA 4QU2A 4YVSC 4NRQA 4HMZA 1JUIA 1O8SA 4ZS2A 4DOUA 3UYJA 4AXOA 3I49A 1W2TA 2Z5WA 4XFAA 3GGLA 2OKXA 4YM3A 1OH3A 3TEXA 1X8EA 2R061 3C7EA 3MLJA 3KS7A 3PVEA 4FOYA 3D6EA 3CMGA 1UPIA 5LY2A 1AX1A 3UKTA 1CAXA 1ULOA 4P02B 2GU9A 4XIKA 4UW5A 1BZWA 1B09A 4JV4A 5JOZA 3HIFA 3WOGA 5LWBA 4LBQA 3GYDA 2PHWA 5JSOA 3SXWA 3TOJA 3QD6A 2NMOA 1D0HA 4RYDA 1HN1A 4XBNA 1WLTA 1JS9A 1JU3A 4WVMA 1J3PA 2JG9B 4Q8LA 4X6RB 2CTVA 5A7NA 1H2MA 2QE3A 1RUD3 4CEWB 3DPRA 2CAUA 4QPYA 4AGRA 3B93A 2IXLA 2YU2A 3PL0A 1AR71 3ZSKA 4AQ2A 2DU1A 1UIJA 3AP5A 4KWJA 4PDWC 4AVVA 2Q30A 2ZEZA 5A32B 5A3WA 2RJ2A 4Q0VA 1JZ5A 4V1PA 5FZMA 4BISA 1WCQA 5KC6A 2PHFA 1W0NA 2YXSA 3EQEA 2VQTA 3WY6A 5FMCA 2CY6A 2WABA 1ZZ8A 3SKJE 2OT7A 5I8SA 3BUCA 2G1MA 5FXZA 4PLMA 1W6MA 2J1EA 5FZDA 4MGSA 5A3MA 2D3RA 1J59A 2JG8A 3VKOA 1FNZA 2XL9A 3MFCA 4WM7B 3BI3A 5E88A 5JSPA 3CHXA 4K8RB 2XKOA 4Q4X2 4Q4X3 5AC93 2GNTA 5FBJA 1Z7S2 4HANA 1PHMA 5CADA 1O3QA 2ZAHA 3ZYBA 4AFCA 1WMEA 3D82A 1HQLA 4UFKA 4Q8KA 1VJ2A 2P3IA 3EBRA 3JU9A 5IK4A 1ENRA 1GNYA 2Y64A 4LHNA 3RZLA 2P37A 4LO7A 3MIGA 1R64A 3UT0A 2ZBJA 2O14A 3VUOA 3O12A 1NA1B 4QPWA 4RGGA 3I3MA 4KBZA 2VMDA 2BV4A 2MEV2 4C1XA 2YB7A 1ZZ7A 1H1AA 1ZVFA 2VPVA 3V0AB 4AEMA 4MLOA 1LEMA 3NJXA 2DDUA 4QKNA 5B2GB 4GXLA 1POV1 4P9GA 2JIJA 2J1UA 4GIQA 4YZ5A 2VZUA 3OBRA 3KCXA 5KC5A 3ZVXA 4QQLA 1IZ3A 5FP8A 1J83A 1FMD2 1FMD3 2DUQA 1HIXA 4NOTA 1IS6A 4XFHA 1R083 3ENRA 4RHV2 1Q8PA 4RHV3 3VDCA 4N90A 5DUUA 2V09A 4YVSA 3KQRA 2JENA 3RZHA 4MUVA 5FRAA 1Y9GA 3UL2A 2D97A 4LR4A 3ZDSA 1AR83 2FMDA 2XPJA 2E53A 1HB1A 3PMEA 3KWVA 4YZ4A 2VNOA 3ECQA 5EPAA 5JXHA 3MPBA 4EV0A 3T1LA 1WW4A 2VVFA 2XJRA 1GLHA 3B3QE 4GKYA 4C1WA 3SMHA 4EN6B 4YYOA 1XC6A 4I0BA 1H1MA 3I2KA 4QAWA 4QHOA 4CRQA 3LOIA 1BVVA 1UOGA 4BYYA 2E9QA 1XNKA 4YW6A 2IC1A 4ZY9A 4DMIA 3WSOA 3TWIA 5JZGC 2EF6A 1A6CA 1LNSA 2JD4A 1FATA 4UW4A 1PZ8A 5H9SA 1RHI2 4KQ7A 3N36A 2ZX2A 5FYSA 4HKLA 4UI9L 3USUB 3IDEA 4PDWA 5DAQA 1LJ7A 2JICA 1QJU1 4V2VA 5FWEA 4BQXA 2ZX0A 3H1WA 2R49A 3GXUA 3PIJA 4XUTA 5FYIA 2R32A 2J1VA 3R6SA 3IDBB 1F15A 1MS8A 4AEDC 2JB8A 2PLV3 2PLV2 2B45X 4LO5B 4M00A 1HJGA 3PU8A 5C3SA 2VBDA 3ZIWA 2UY9A 2Z79A 4BQ2A 1GU3A 4N53A 2UWBA 2ZGQA 4DUWA 3AP9A 2VQUA 2B39A 5DDJ3 1JBCA 2G19A 4MX3A 2W92A 3M7AA 1ZNPA 1ZZ9A 4EWAA 4QX2A 3IKWA 4XJZA 1LU1A 4A41A 5L7OA 3E5UA 1ZA4A 1MS4A 2EALA 4MOAA 3VBUB 1EAH2 2XGXA 2RS13 1CX1A 2XB6C 4KWUA 2YG0A 1F9KA 3U1XA 5F1RA 5BNPC 5A3OA 4XXAA 1C57A 4P14A 4YW5A 3WCSA 2RR13 1HB2A 2VUJA 3WEZA 1UL9A 1F4AA 2A6VA 2YC4A 1V9U1 1EPWA 2BQPA 4AI1A 2GMMA 4NHKA 4Y22B 1FYUA 2VECA 4B29A 1OQDA 4MGQA 4CCMA 1IKQA 2O8QA 1ASJ3 3TRSB 2YDEA 4NHYA 4UFHA 4XTPA 4CDXC 4DQAA 3RZGA 1FOD2 4IE5A 3FJSA 3OPWA 3DF0A 3OUHA 4ZXKA 1RUC1 2CGNA 3AM2A 3J8F3 3J8F2 1VMJA 1W0PA 1GUIA 3U4XA 3O0VA 4XTMA 1A78A 2K9ZA 2IXCA 3MGUA 2CYFA 3I97A 4H3WA 4JAAA 3C3VA 4IE0A 2P1BA 2DU0A 4XDQA 1L3JA 5FZGA 1ND2C 1W6NA 2JD9A 1BEV2 4RS5A 3RFRA 3USSA 1H8TC 4LO6B 1STMA 1RUD1 2ZEXA 2C4XA 3DKQA 1HB3A 2FDFA 1CIYA 4XQ4A 4Q2FA 2X10A 1RVF2 3ZYFA 1LECA 3ZYGA 3IIAA 3NW4A 2FQPA 5D8AB 1W03A 4JKMA 1XNDA 1HRI2 3K46A 4UOJA 1UY4A 3M1HA 1N1VA 1OVSA 2A71A 1AL21 2WS93 2WS92 4S2DA 5DUWA 1UY2A 2E7AA 2J1TA 4JQRA 4NHLA 4Q4W3 2VCBA 5JZGA 2VZVA 5ABJA 2NLRA 1DZTA 1RMU3 1U5ZA 5FXWA 1POV0 3C7HA 1JOBA 5FY8A 1APNA 4JGZC 4AL9A 4ISRA 1RTVA 4CEYC 1QH7A 4COZA 2R071 1O3RA 4OQ8A 3POFA 5C3PA 3GJAA 5IFTA 4QGLA 3ZSEA 2OXBA 2X5IC 4FPJA 2VZ1A 1IPSA 3U0ZA 3BTXA 1RGSA 2VCMA 5H9PA 3BTZA 4M4RA 3M3EA 4AEDA 2LS6A 5JCTA 3KVAA 1ZRFA 2AH2A 1C5IA 1KITA 3HVDA 4ZONA 1F31A 3O7OA 5D1IA 4ZU7A 1GWKA 1YO8A 2I74A 2WFF1 1YFYA 3GM8A 4XF9A 2D6PA 2FDGA 1M4WA 1W05A 2D93A 3IDCB 3SHRA 2RDNA 1IS5A 4LE4A 2KXLA 2WAAA 1ZZBA 2GN3A 3M3IA 2XHKA 4MGTA 3EMRA 4HSLA 5CNAA 1UF2C 1ZBE3 4KG8A 3AVRA 2JKBA 4AVTA 3N9LA 3ZXKA 1PM7A 4IEVA 1W99A 3WHTA 2YZ4A 1NXD1 1VBA3 2RS32 3MW2A 4CDQC 2Y6HA 2WLQA 1PGL1 1W90A 4FPHA 3I2GA 5FZEA 2VOWA 5E89A 3ZIXA 1PGSA 3C8XA 1JYIA 1K42A 4IEPA 3VHRA 2WA4A 2UWCA 4XACA 1D2QA 1NOVA 4CDXA 4XEZA 5J98B 1V6IA 3DEMA 4UW6A 2UYBA 4BWOA 1W6PA 3VBOB 3I59B 3LIHA 4XFIA 2XLAA 2XG3A 1UYXA 2BUKA 5HCAA 5IVJA 3IIIA 3UKNA 4YZ2A 4BJ0A 4AFMA 4AQSA 4DXRA 3G7DA 4NIIA 4NWVA 2QQLA 5LB6A 2QTWB 2ZPXA 5C8CC 3TEWA 2OQ6A 1DGRA 4IGPA 1OA2A 4K8FA 1CAWB 4XUOA 2W95A 1X8MA 3HQRA 4Q5OA 1AYN2 4NJ4A 1D2SA 1HB4A 1ND2A 3LOBA 1O5LA 3MICA 1PGW1 4P5HA 5K7PA 2VZ3A 1RUNA 2BEOA 1S0FA 1KFUL 2AEYA 2G9ZA 2JDMA 4ZU5A 5CKQA 4N43C 3D5OA 4YW4A 3DYMA 3WZ1A 3KHCA 1I3HA 1KQRA 4CCJA 3AFGA 1OKQA 3N3HA 3ILFA 4FPOB 3VV1A 4M0HA 1W9TA 1G9DA 4ARXA 4HL0A 5L9BA 2R042 2EIBA 5FYBA 3ETPA 3E6DA 2HWE1 4KU8A 5J36A 2FZ1A 3ZXEA 2P3JA 4JGZA 4P5YA 3NQHA 1UZVA 4GMP3 5K0UC 4J1WA 2VBPA 3GCWA 2QNKA 3LA2A 1W6QB 5DUVA 4COUA 3ZFEA 4EZHA 1HXS1 4D8MA 5A3UA 3TEYA 3LQCA 4GB32 4QWNA 1QWRA 4AVCA 4B7KA 5GZGA 4LJHA 2VUAA 4AI0A 1PM4A 1REEA 2E7QA 1UZWA 1WCUA 5T5JA 3VHNA 3ZN4A 4BU2A 3H3LA 4XJAA 1JYVA 2BTVC 3ST7A 1AF9A 3IPVB 2SBAA 3MLLA 4FQ4A 3LD8A 4NIDA 2Y6KA 3POWA 3KCCA 3JD72 3H1MA 1VMFA 4HZFA 5FQ0B 4BMEA 2DV9A 2JDNA 4R9AA 5FXXA 4PHZA 1BLZA 1LGNA 1DCSA 2HWC2 3J9SA 3N4MA 4FBFA 2A1XA 1XNTA 4YW2A 1QJFA 1JOPA 3H7JA 5DZEA 5BNPB 3QACA 1UQXA 4AE2A 4ONUA 3PHMA 1X9PA 2JDHA 2VQ0A 4JDNA 3B7MA 3T2OA 4CDQA 4YPJA 3T0AA 1R092 5DG1A 1RB8G 4MVTA 3OGVA 3HNBM 1LGCA 3I54A 1UYZA 2WT1A 1JZ3A 2VZSA 3UV9A 4Q4Y2 1T6BX 4RGKA 1O4ZA 2P2KA 4DZGA 2A6WA 1AJOA 4PBPA 1SMVA 4IV1C 1SPPB 1S0BA 1QOSA 2WZR2 4WBBA 3EHKA 3AFKA 4K1ZA 1YLLA 2GH2A 1WLDA 4KMQA 4HOOA 1ULGA 4YM0A 5EP9A 5B4NA 1BBT2 2DYCA 4QHZA 3VHPA 3ZXFA 2WNUC 1VBE1 5C9AA 1T2XA 1UCXA 3U14A 1GICA 4BMBA 5C8CA 5LCWL 3HJRA 3R4SA 5LK5A 3FLTA 4IW3A 4UBHA 1Q5OA 4XAEA 1PO23 1PO22 1VBB2 3DXUA 4A7KA 3O1OA 1PZ7A 1CZTA 2ENRA 1CX4A 1PVC3 2RMU2 1REDA 2VMCA 2QUOA 5F9TA 1JZ2A 4UAPA 1W28A 4KGQA 1NLQA 1UKGA 3UK9A 1R1A2 1W6OB 4QPIB 2CHHA 1PNGA 2RS53 5FV3A 5F8PA 4OHZA 2TEPA 2W9XA 1LCLA 3TNQA 2DCKA 2Q8DA 1JYCA 2VCCA 4IEXA 3V64A 3D4KA 4K40A 1X36A 5ANNA 4MXWA 4AOCA 1QOOA 4QPGB 2BBVA 2R7EB 4BLJA 3RI9A 2KD7A 4XBQA 5KHKA 4CEYB 2LROA 4YW1A 4E2GA 3MW4A 1RUI3 1BQPA 2XVLA 5JOXA 2QQNA 2QCSB 1WCSA 2WO2A 2X5IB 2ZMKA 3RVHA 2MHFA 3N7KA 2A6ZA 3A7QA 4RFRB 4HPKA 4DEQA 4Q0QA 3HEIA 1VBA1 3LSDA 3WNMA 2XJSA 5FKCA 4CU9A 4X8PA 3TN91 2WO1A 2ZCWA 2NM1A 1PO11 4CA9A 4LE3A 3P3NA 1MR5A 3O14A 4BIOA 1E5SA 4I0WB 3WW3A 2D43A 3OTFA 4NMIA 5ACA1 1YC61 1TMF3 5A3NA 4FCAA 4QT6A 1WWYA 4DEVA 5C8WA 4JGYA 5FYTA 5B4XA 4CDUA 4E4SA 2WSUA 2VOTA 4LBKA 4IE7A 2A73B 3PU3A 4QXCA 1RUE3 2ARAA 1HRV1 1O4TA 1QJY2 4AK3A 1C8M2 1XSQA 2CSGA 4A7YA 4G9SB 1DLLA 1OOPC 2WAOA 4TZDA 3OBZA 5AVPA 1W8HA 5SV5A 5FR3A 2OA2A 2A5ZA 1AR61 3CQOA 2VZQA 1JYXA 3T4VA 1FPN1 4D3WA 5HCFA
chains in the Genus database with same CATH topology
1YJLA 3CL1A 5DXDA 3FX3A 3MPPG 3QCWA 4WV8A 4YVWA 5FLJA 3OGJA 3VBHC 5IK8A 1U5XA 2R062 5AVAA 1KJRA 2HWB1 2NQYA 3KB5A 4LO4B 3IM0A 1UZZA 4IL7A 4M01A 5DUXA 3GHNA 4Y20A 5BNOC 5KBFA 4FTSA 2EIGA 4QXKA 1YFUA 4QQ2A 4BIFA 3WW1A 5LK7B 2LUWA 1AR93 1DZQA 2ZGTA 4YG3A 1IKPA 4ORFA 3GALA 3SCGA 2SLIA 3SH3A 4YG0A 5L73A 1ZRRA 2XBO3 3CJXA 5I0UA 1S0DA 4FTEA 1XYNA 4N43B 2ZZJA 5LEJA 2JE7A 4M3CE 3V56A 1ZRCA 1QQP1 3WUCA 2NP0A 3WQ0A 5GLTA 3KT1A 4QX5A 2BWCA 3WV6A 2GH8A 2A75A 4AVAA 1OPMA 5EXOA 2XVGA 4HBNA 4HVQA 1HLCA 1S0JA 1LHWA 1NZCA 1KDMA 1KD7A 2ARBA 2ARXA 1AYM3 4Q27A 4XF1A 2XJQA 2HJIA 1BMV1 1COV3 1COV2 1RUJ3 1YUDA 2BW8A 1QJX3 1QJX2 4DS0A 1GQGA 1EV12 1EV13 4KWLA 5EJ3A 1BKZA 1DQ5A 4KNCA 3DL3A 3OGGA 4YRDA 1V6KA 1TME3 2YHJA 3ILRA 4P9LA 3U07A 1OI6A 1WD4A 1LB2A 3H50A 2ZA9A 4YSFA 3B5LB 2JG9A 2PHTA 1KXGA 4CEWA 1PMIA 1J1TA 2H0VA 4QGNA 4XXPA 4YNIA 5A32A 5T52A 2ZX4A 1VBD3 2GSYA 3NL1A 4FXGB 4KWKA 2DVBA 2AUYA 4OLLA 3D8CA 1MVEA 3KSCA 3GZTB 2H6BA 3QH6A 4QQPA 3CU7A 2DVAA 4FP3A 3ZFGC 4IV1B 3JQXA 1C4RA 4IQPA 1U5IA 4WM7A 1VRH3 1D0GA 4Y24A 4XFFA 3THPA 1IGOA 2WNUB 1N3PA 3OYWA 4YW3A 3IWZA 3VKNA 1ZBA3 1ZBA2 4HSJA 1MZ6A 3CNAA 3AKPA 4N9HA 1VBC1 3KLSA 1GQHA 1NA1A 2WNVC 3WINE 2HWD1 5EV7A 4ITCA 4KL1A 4JDOA 4CYDA 2GNBA 3ZFFB 4PCRA 1OA4A 3V0AA 1AXZA 1QJU2 1LHOA 3HQXA 1S2KA 4Q4V1 1PZ9A 1FXZA 4FPCA 4AW7A 4AEKA 4NHMA 4KH9A 3S6PA 1PIV3 1ND3C 1AVBA 4MSVA 3VBFC 2DWRA 2HYKA 3RPQA 2RM23 2RM22 4XQWA 3WP6A 2VMGA 2DVDA 3AMMA 3I2DA 4W6XA 5EYXA 3ROUA 4HKOA 3VDDB 3NVCA 3X29B 5CB7A 1Q43A 1QGLA 2ZHLA 5D8AC 3VGIA 2YGMA 1V9U2 1PVXA 5GZFA 2D6LX 1RUG1 3URFA 2WINB 5BNNA 2PELA 3MEPA 1Q56A 2ZAAA 4OZXA 3E97A 4TWTA 3AXDA 1XU1A 3USUA 3VBRB 1KRIA 4OI4A 4RSUA 1BYHA 3NV2A 1OOPB 3WNXA 4S2HA 4TSVA 3AKTA 3LZZA 1ZYBA 3DGTA 4L97A 4QD2A 1PK6C 2R1BA 4EWDA 2Y0IA 4LNVA 1FV3A 3J26N 3AZVA 2HWF1 3VBHB 4HVRA 1D4M1 3AMPA 1IPKA 5FO8B 4EROA 4F83A 1CPMA 4W6YA 5HI0A 3PLQA 5BNOB 1KDKA 1Z7S3 3NKGA 2NZ9A 4CP1A 3VBUA 2PHDA 4K3UA 5E1RA 3ZX7A 3FBMA 4LLOA 1AL22 4AQ6A 2PTMA 2KM2A 3WUDA 1QY4A 4Q1PA 4B4RA 1O91A 3CO2A 5BXXA 4Y22A 3AYEA 2MEV3 3BU7A 1J1LA 1LHVA 2R072 2VY0A 3V65A 1RC6A 4IV3C 2C0ZA 3VBOC 4DRRA 1NLSA 4L99A 2AGSA 5FTTC 4LBOA 4COVA 1NXMA 3GBWA 2VG9A 4X8NA 2ES3A 2GC3A 5J09A 1I1EA 2ZGUA 1GNZA 1TME1 1T6GC 4FQZA 4J6GA 2GC0A 1Q3EA 4S2FA 2WFF2 5FO7B 1XU2A 2BFUS 2C9AA 1QOTA 4A2UA 4DY3A 1WBLA 5E8AA 1C3HA 1RUOA 3O5SA 3Q9OA 1A8MA 1VBD1 1DZRA 4LULA 2QZ2A 1LOFC 5D8AA 4D7SA 4BA6A 5JPNB 1RUF2 3VZOA 3HD8B 2QJVA 2ATFA 1OQEA 3ATGA 2XLFA 3ZN6B 2ZTNA 3AXEA 4WM8C 3ZXJA 1MZEA 1RHI3 4Y1XA 1GZWB 1A8DA 2WNEA 4NWWA 4COYA 1LEDA 2I2SA 5J7MA 5FFOC 4YZ1A 1RUH1 3FUOA 2W52A 2HKXA 2X8KA 1YI7A 4BCUA 2K0GA 3WW4A 3PVOA 5SV8A 2Q5TA 3ZFGB 1PGW2 2X29A 5CVRA 3AKSA 3R05A 4PBOA 1JH5A 2BVBA 1EAH3 2R0FA 3ASIA 3E5QA 3DV8A 3EJKA 2AENA 2ZGLA 1J58A 4R9DA 4Q0PA 1YWKA 5CIRA 1WLWA 1FT9A 1ZZCA 1W0OA 2NMNA 4G4FA 1PIV1 1BK1A 2ZHKA 2VXRA 5I0TA 3HR9A 1NLRA 4E4ZA 2DCZA 1XE8A 2WNVB 1LGBA 1FOD3 1CAUB 1S0GA 2IXKA 3WCRA 2EA7A 5BUVA 3VBOA 1HXS2 3I59A 4P9IA 3BALA 3WT3A 3L9JT 1I5ZA 1H0BA 3LB9A 1QXPA 1HV1A 4WZCA 3MF9A 5KXEA 1ND3B 4LBJA 3B00A 3U11A 5KHHA 1I6XA 3ELNA 4LBQD 3VBFB 2H0BA 1CAWA 1YI9A 3LSEA 1LKNA 1BEV3 4RQPC 4OVEA 4ATEA 2MNGA 3VKLA 2O0OA 1GZCA 4OHVA 2HEYF 3JBG3 3JBG2 1RVF3 1UN1A 2EXHA 4XJ8A 1JHNA 4QPIC 1HRI3 2W39A 1LOFA 2DCYA 2FMYA 3DKWA 5KWRA 1QJZA 5I93A 4K6BA 1NCRB 3MDPA 1PNFA 2TBVA 4QPGC 2FBEA 3WG4A 3RDIA 3FZ3A 3KZ4C 4GH4C 4YGCA 3B01A 1HQNA 4Q4X1 5AC91 4F8AA 2V5YA 2N7GA 2G9FA 1W6QA 3NV1A 2EXKA 4XFCA 5EZWA 4XETA 3V0BB 2GZWA 4LA3A 3WVJA 5GKAC 1VBE2 4AFDA 3MLKA 4M3CB 2DTYA 2BVVA 3ZPYA 1XNBA 1PK6B 2WT0A 3IPVA 1URXA 5T5LA 3SISA 3W59A 4C90A 4OI0A 2YV8A 4XJWA 1ENQA 5FQ0A 1X7NA 1GSLA 1V00A 1OQ1A 1OPOA 1OLRA 3VKMA 2RS33 3WG3A 5BNPA 2ZGOA 1FMD1 5I91A 4R9BA 2Q1ZB 1R081 1VIWB 4RHV1 4A7ZA 1NCQB 1ENSA 4DRVA 5L7OB 5FBZA 1MZ5A 1AR81 4IV3B 5FLIA 2VOXA 4KU7A 4AEJA 3AP4A 3K48A 4QGMA 5FCCA 3M3OA 1RL3A 4E27A 3PJQA 5CFDC 4WVZA 3TN92 5T54A 1AXKA 2BGCA 1XRUA 3P3PA 4SBVA 5IUQA 3H1YA 1UPSA 4Y1VA 3M2MA 3PVNA 1AYN3 3ZYRA 3M70A 5ACA2 3ZSLA 5KXCA 4N9IA 1H8TA 3FHIB 4L2NA 2W0XA 4LLFA 1QKQA 3ACLA 3WDTA 4CZSA 1H2NA 3TYJA 1W6OA 4I3PA 4DFSA 4I09A 1HRV2 4QPIA 4BQ1A 4EN7B 3KM5A 3VZMA 2PLV1 4R4XA 4GWMA 4AHXA 4Z92B 4RR3C 3T1MA 1DG6A 3WG2A 2Y38A 1AR62 2R043 1MEC2 1LHUA 1SLIA 3KGZA 4RS5B 4WM8B 4QPGA 3QH7A 1Q8QA 4PLOA 5DDJ1 4AWDA 2HWB2 3APBA 2PN5A 4CEYA 5E16A 4BE3A 1G8WA 4GB33 2XLGA 1V70A 2GDFA 2RS11 3KT4A 2X5IA 5A33B 2WQZC 3K51A 5HBAA 4H7LA 1CN1A 2O8OA 1H1IA 2RR11 1VLNA 3SCFA 1S0EA 4O9GA 5ABJB 2RJKA 3JD73 3NSTA 3FWEA 1RJ8A 3OJBA 4YFZA 1ASJ1 2DFBA 2JX9A 1KS4A 4E2SA 4LHKA 1Q8SA 1WD3A 2HWC3 4KGGA 5JSRA 1SCRA 1ZREA 3FLRA 1ONAA 4XW3A 5FDBA 3L2HA 3J8F1 1QQP2 2ILMA 2OYZA 4QQHA 4B3NA 1N3OA 2DF7A 1SCSA 3VHOA 1R093 1VAKA 2VW2A 4AHWA 1DYKA 4LEJA 1DF0A 1MS1A 3I8TA 2JEMA 4Q4Y3 1KS5A 3R4DB 3RI8A 1N1SA 4AVSA 4W65A 2EAAA 2PHRA 4FPKA 1LODA 2OZ6A 3GNEA 2WZR3 4XZPA 4GA9A 1BMV2 1RVF1 4HLTA 4ZKTB 2KA3A 1BBT3 1AX2A 1CD3G 3HAGA 5JPMB 3RYPA 2WS91 4IERA 3JB8A 4Q4W1 1AJKA 4RQPB 2D6NA 1VBB3 2QVSB 2CV6A 1YJKA 2UURA 1RMU1 2RMU3 3A0KA 3I7DA 1N3QA 1ULCA 1NE6A 1DIWA 2GC1A 2VW1A 1R1A3 3WW2A 3ZFFC 2NYYA 2WWSA 2IWGB 4N43A 1DHKB 1Z0HA 2ZJCA 3IN9A 1AHSA 1V6LA 3AZZA 1WCKA 2VU9A 2P34A 4P9WA 3THTA 3WDWA 3A4UA 4BH9A 3R0RA 4CP2A 4OULA 2IFWA 4FO9A 4GH4B 1V6OA 1SBFA 4MGKE 1OFSA 3QBQA 1EY2A 4Q0SA 1JXNA 4XMIA 5K0UA 2D44A 2F6BA 1AUYA 2ZGPA 5LRSA 5LRRA 3VDDC 1ZBE1 2Z2SB 4NR1A 2DCJA 2WJSA 2IXIA 1K5MB 4E2QA 2W08A 3KT7A 3FC0A 1J3QA 1XE7A 1GR3A 2LALA 1VBC2 1QXJA 4YFWA 4IEUA 5EWSA 3SITA 4PQ9A 4YM2A 4P9JA 4OI1A 3KMHA 4META 5CFCC 1F8VA 1B35C 2Z42A 1DU3D 5J3UA 1SACA 4IEQA 2CNAA 4Q4V2 2GMEA 3VBRC 2Q0AA 3L2YA 1QJY3 1C8M3 1VP6A 2AYHA 4I0AA 4XQDA 1GNHA 2CL2A 2VOKA 3GF6A 2BYVE 4HN1A 4C0BA 2OZJA 4Z8BA 1SLTA 1LULA 3ZXGA 4R9CA 4GKXA 2R063 5FLHA 4IV1A 4M0NA 5DG2A 3WDVA 3VBSC 1AL0G 4LO8A 2E51A 3W58A 5GLVA 4EN8B 5CFDB 1RIRA 2NPIA 2WNUA 1IS4A 4XFBA 3C2UA 3RYKA 1RUG2 2PHLA 1CQ9A 1N47A 2XWBB 3NAPC 1X33A 3MF6A 5I0SA 1OA3A 1AR73 1AR72 4CDWC 4GMP1 2CWMA 3AP6A 4HKWA 1A3KA 4JTNA 2D3SA 3ZFFA 1JOJA 4GB31 3VZNA 2ZGNA 4I02A 5CU1A 3CJIC 4RR3B 2IXJA 3VKFC 1BCXA 3NWKA 2Y0OA 1S1AA 3B02A 1ZX5A 1EYBA 1D4M2 2G9GA 5C4WB 4LHLA 3RJ2X 4AFBA 4DINB 4NO4A 5GLWA 3VLBB 1QDOA 4BHPA 2D6KA 1MQTC 4QM8A 4X6QB 3VDDA 1MS0A 1MS9A 1O5UA 1VB4A 4D7YA 5KHIA 2QQPA 2XH6A 4OUMA 1DQ0A 1HKDA 1UMZA 3TNPB 1JN2P 2ET1A 1R091 1YHFA 3TB0A 4DB5A 2GN7A 3JUUA 3AZWA 1SFNA 1DFQA 2WSVA 4K7JA 4XF0A 4XHXA 3E6BA 3SNMA 1GANA 2ZOEB 1OLQA 1F5FA 1POV3 1YCIA 4UW3A 1LU2A 4XJUA 1LOEA 3VBRA 3B69A 4LBMA 3B9CA 3ZXAC 1ALYA 3VZJA 4WZFA 3ZMOA 1OOPA 1R1ZA 1BVP1 2BNMA 2VVEA 3JZVA 3MIEA 5CAZA 4Y26A 2YPJA 1PO21 3NV4A 3DPRC 1NY71 1PVC1 4A3XA 3VBHA 1WUVA 2ZGMA 4L8QA 3S7IA 1S0IA 2NN8A 1VAMA 3ZXDA 4LBLA 3HWJA 2OPKA 5BNOA 1O3TA 1ULEA 2RS51 4AHYA 3OY8B 4AHZA 4N7IA 2OVUA 2H6CA 4FOWA 2QDNA 2Q8OA 4LT5A 3VL8A 3QOPA 3OPZA 5GLUA 4O9EA 2YYOA 3ME2A 4JRAA 2ZGKA 3T2TA 3ZO0B 1YYNA 2JDZA 5HCBA 4EN9B 1RUI1 4XILA 1QJU3 4UXAA 5JAXA 2D5HA 4OHXA 4ATFA 3LKJA 4DY5A 5EFUA 1Q8VA 2OIIA 3ETQA 1DQ1A 1RUH2 3M3QA 2A6YA 3AMNA 2CGPA 3H3ZA 2I45A 1NE4A 4OUSA 4LUKA 1J3RA 4YARA 1C5HA 1IQAA 1I9RA 4MV2A 2WL1A 3BIWE 3AMQA 1G9FA 5JOWA 5H9QA 3PNAA 1TMF1 4QQOA 4XHBA 4R8HA 1YIFA 3AMHA 1Y3TA 3ZYPA 1RUE1 2GALA 4GULA 1C8M1 4I30A 1EP0A 4WVWA 3U10A 1ZM1A 2VOVA 4EWEA 2CWSA 1V9U3 3VL9A 2OUJA 5BY5A 2XUMA 1NCRC 5FOJB 2WA3A 4GMP0 2OW4A 5CFCB 3DUIA 1B35B 1H9WA 3ZN6A 2ZHMA 4Q0UA 2C5DA 4KG0A 4YGBA 1RUC2 1RUC3 3RMYA 5FOBB 2ZACA 2VVDA 4B4QA 1H4GA 1GZWA 4Y1ZA 4YG6A 3GHMA 4OHWA 1O3SA 4ZU4A 4AYUA 1GZ9A 1VAVA 5L36A 3AYAA 2ZMNA 3ZMNA 2DUPA 1CESA 1AR91 4MXVA 4RD7A 2ZX1A 4I2OA 2RHPA 2Q1MA 3O0XA 5I8YA 2BNOA 1RUD2 3IMNA 3ZFGA 2WT2A 1AX0A 2XBO1 1G9CA 3VBSB 4E4DX 1QNWA 4IEOA 1FX5A 2VMHA 4JVAA 4JCKA 5FMOL 5AFEA 2YC0A 4FXKB 3TAYA 1F2NA 1AL23 4H14A 3LWCA 5F6KA 4LUMA 1DYPA 1NCQC 1WMDA 3FFZA 4N53C 4WVVA 4Z82A 2D6OX 5GM0A 4K9SA 3NAPB 4NPRA 3H3UA 3N7JA 3OF1A 3WLUA 2WNVA 1CAVB 1G6NA 4CDWB 5L7OC 5AC92 1ZZ6A 2R073 1CAUA 4DNYA 3ILNA 4BLIA 1CONA 1AYM1 4MGIE 3EXUA 3M4FA 1COV1 1NQDA 1RUJ1 3OYWB 1QJX1 3CJIB 1EV11 2JJ6A 3BPZA 4FPGA 4N7UA 4PIXA 5IK5A 1UW8A 5JOYA 1GYKA 1ND3A 1LTEA 1O3RA 1OMIA 3ZXLA 3H8UA 2WFF3 3VBFA 3WP5A 3ZSMA 4FPYA 4URTA 1C1FA 4M3CF 2YUEA 2R16A 1MQTB 4AGVA 2GMPA 5KHGA 1N1YA 2R30A 4H7MA 1CGPA 4YM1A 1PGL2 1LESA 4NVPA 4UBGA 1RUF3 1DGWA 1R082 1CPNA 4D94A 2QDRA 3AZXA 1JUHA 1UU4A 2A7AA 1NCRA 4RS5C 4AI3A 2GC2A 1AR82 5T5OA 4Q29A 4RFT0 1UX6A 2O1QA 2XJUA 1O4YA 4PF5A 1CAXB 1VRH1 5T5PA 5LEKA 5IT6A 4FPFA 4I3GA 5FPZA 3V0BA 4LBQB 1QXRA 4ASMB 2C1FA 3B94A 3VN4A 1GV9A 1ULDA 1GBGA 1H9PA 1U0AA 5I8TA 4M3CA 4HK9A 4W6WA 2UYAA 4WVMB 1ZBA1 5BNNB 3D0SA 1PK6A 1YXWA 3WDYA 3H9AA 5ABJC 4AI2A 3DPRB 3N7LA 5J96B 3NV3A 1TQ5A 3AP7A 2CGOA 3R4UA 4G3YC 3S0MA 2VGDA 1HX6A 4B7EA 3FLPA 4ISQA 2VMIA 2G4IA 4FPEA 4PIYA 4CTEA 1W6MB 2ZKNA 2PQQA 4IEZA 2DVFA 5C6CA 2JG8B 3SCHA 1CJPA 4Q26A 1NCQA 2PYTA 2HWE2 2HWE3 3FBYA 3OD4A 5J48A 1D4VB 5DDJ2 1SLAA 3BTAA 2RM21 2VNGA 4B8EA 1Y9QA 4YGDA 2ZGSA 4IV3A 1HXS3 1AZDA 4BZ4A 1QMJA 2DUOA 2RS12 2ETEA 5FAXA 3M8LA 4AQTA 2RR12 1DQ2A 1LR5A 2QKDA 4EN0A 2D40A 1FNYA 3NJZA 3WHUA 4P9YA 1DDLA 5EYYA 1ASJ2 1NG0A 3WQ7A 5JIUA 3E5XA 2PA7A 1H4HA 4Y1YA 3LAGA 4Q1RA 4BM8A 3AJZA 3ALQA 3WP3A 2ET7A 3FUQA 1X82A 1G86A 3HT2A 1DBNA 4YVSB 2XJPA 1KJLA 3WDUA 1MACA 3OCPA 4IESA 2ZABA 4WM8A 2RE9A 1CR7A 2B5HA 3HT1A 3NO8A 1Z7S1 1XYPA 4BOWA 1Q8OA 4B4PA 3OBTA 5A33A 1VBE3 3QLQA 4DPNA 4RL7A 3UKVA 5I0RA 3W9AA 1ZRDA 1K5MC 4Q4W2 3ZYIB 4MZUA 1RMU2 1LOBA 2MEV1 4COWA 3H0OA 2LTNA 4PDWB 3AX4A 5KXBA 1RINA 5JVVA 3ZFEC 4OI2A 4OFGA 4RA0A 2B7YA 4PJYA 3KGLA 4MGZE 3BODA 4FOVA 1SEFA 2ZMLA 4IETA 1DQ6A 5CG9A 3RSJA 3RYRA 5BYNA 3GBFA 4IEWA 4K20A 4N53B 3AB0A 4L92A 1WMFA 1MZFA 4GALA 2DCTA 4U2AA 1Y7BA 1YRZA 3RQ0A 3HMYA 3HBZA 1YFWA 3HN1A 4Z07A 1ZBE2 4EJRA 1MVQA 3AYCA 1UZYA 3GZAA 1HDKA 1VBA2 5BNQA 1XYOA 2Z69A 2TNFA 4FOQA 1WW7A 1RUF1 3TN93 5J37A 1V6NA 2F4PA 1PO13 1PO12 1UD1A 4L11A 1X50A 1SBDA 5ACA3 4RQPA 3RG0A 1V6JA 3CLPA 2VH9A 1H2LA 3RMXA 2MPFA 2JECA 1RHI1 2E7TA 4ES8A 1VB2A 5FMOS 1IS3A 2WLPA 1HRV3 1BXHA 3J4UH 1DGWX 1S2BA 2BNNA 5C9AC 4ASLA 3KCYA 2GAUA 1AXYA 2WKKA 2EVXA 3EO6A 1VR3A 4LA2A 1W6NB 1AR63 4C91A 1C1LA 1MEC3 1FPN2 1FPN3 2ERFA 4FAHA 4MGYE 2DFCA 3ZSJA 4INDA 4GH4A 2HWB3 5C4WC 2P3KA 4JTOA 2X53S 4NN0A 2XJTA 2JE9A 4IXLA 1EAH1 5FO9B 1ULFA 1FI2A 3PJYA 4JRLA 5K9YA 3MIHA 3I4IA 3AZYA 1SLBA 3AJYA 1K5MA 2V73A 3RNSA 2YMZA 3INAA 3MIDA 4XF3A 4XOGA 5JZGB 1M06G