2IZWA

Crystal structure of ryegrass mottle virus
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
178
structure length
178
Chain Sequence
QYGDITPAKNSGSLVRVTSSATAGTEVSGTVLFNVRNATELPWLSGQGSRYSKYRVRYAHFTWEPIVGSNTNGEVAMAMLYDVADVTSITIERLMQTRGGTWGPIWSPTRKRLSYDPEHASLPWYLSGVSSGAAAGNIQTPFQIAWAAQSSLVSTTLGRIMAEYLVELTDPVDVTINQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords RYEGRASS MOTTLE VIRUS COAT PROTEIN
publication title The Three-Dimensional Structure of Ryegrass Mottle Virus at 2.9 A Resolution.
pubmed doi rcsb
total genus 44
structure length 178
sequence length 178
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2izwA00
5CFDB 1ZBA2 4N53C 1COV2 1AL22 2VQ0A 2HWF2 2R063 1ZBE3 4CEYA 1QQP1 1PIV2 3JD72 5BNOB 5BNNA 1TMF3 1RUC3 5BNPC 2RS51 1A6CA 1V9U3 1RUF3 1RUD1 5C9AA 3TN91 5C4WC 3VBRC 2PLV3 4Y4YA 4QPGA 5DDJ1 1EAH1 1VAKA 2GSYA 3VBHC 1F2NA 2TBVA 1POV3 1RUH3 1NCQA 5D8AB 1ZBA1 4Q4W2 1AR93 1COV1 1AL21 1QJX2 5FMOL 1C8NA 1FOD3 1MQTC 2HWF1 4CDWA 3NAPA 1PIV1 3JD71 2DF7A 4Q4X3 1Z7S1 3VBFA 2HWE2 3DPRC 1QQP3 3ZFGB 4RQPB 3ZFFB 1VBE1 3VBOA 2HWC2 1R092 5C8CA 4Q4W1 1B35A 5DDJ3 1EAH3 1QJX1 1R083 1BMV2 4FSJA 4YVWC 1COV3 1AL23 4CDUB 4GB33 2HWE1 1CJDA 1OOPB 3JD73 1Z7S3 4CEYC 1TMF2 5BNNC 1HRI2 1RUC2 3VDDB 3CJIB 2BBVA 4CEWB 5CFCB 1RUF2 2HWC1 1PO13 1R091 1K5MA 1C8M3 1POV0 4GH4A 5C9AC 1BMV1 2PLV2 1VBE3 4RS5A 4WM8A 4QPGC 1E57A 1VRH3 4WM7B 2RM21 2RMU3 4Q4W3 2FZ2A 1NA1B 1PGW2 2RS33 4Y5Z0 1NCQC 2RR13 1HQNA 1FMD3 1FOD2 4CDWC 2WZR2 4JGZB 2HWE3 5ABJB 1TMF1 3NAPC 3FBMA 1HRI1 4Q4X2 1RUF1 1BEV3 3VBFC 4RR3A 5JZGB 1WCDJ 2X5IB 2HWC3 1R093 1HXS3 1AR63 4Q4V2 1M06G 1ND3B 1H8TA 1PGW1 2R042 3VBOC 3ZFEA 3LOBA 5C8CC 1AL0G 1B35C 1R082 1FOD1 2RM23 4GMP3 4N53B 2WZR1 4IV1A 1MEC2 4GB32 4JGYB 4EJRA 4Q4X1 1RUJ2 5BNPB 1TME3 5FOJB 1HRI3 5C4WB 1Z7S2 3VBRB 4CDXA 4Q4V1 4Z92B 3VBHB 2R041 4CDQA 1PO12 1X36A 4FTEA 1C8M2 1K5MC 1R081 4GH4C 1VBE2 1HX6A 1AYN3 1MQTB 1MEC1 1SMVA 1VRH2 4RS5C 4WM8C 5A32A 4NWVA 2RMU2 3JB8A 1RUE2 4AEDA 4GB31 3JBG2 1W39A 2BUKA 2RS32 4PDWA 1RUJ1 2WZR3 2RR12 4RFT0 1FMD2 3DPRB 5A33B 2R072 1BEV2 1PO11 1PO22 5FMOS 1BBT3 1C8M1 2WS92 3J8F2 1R1A3 4Q4V3 1VRH1 2R043 4RR3C 3VBSA 1HXS2 2RMU1 1AR62 2GH8A 1RUE1 5K0UA 1NCRA 3JBG1 2RS31 1H8TC 1VBB3 1MEC3 2RR11 2RS13 3ZFEC 1FMD1 2RM22 4N43A 1AYM3 4IV3A 1VBC2 4IV1C 1RUJ3 3VBUA 1ND2A 1DDLA 4CEYB 5BNNB 2R071 1BEV1 1PO21 5AC93 1AR72 1TME2 2WS91 3J8F1 5L7OA 4QPIA 4YVSA 1AR82 4CDXC 4FTSA 1AUYA 1HXS1 1AR61 4QPGB 2XPJA 1F8VA 5CFDA 1RMU2 4CDQC 1FPN3 4GMP1 4JGYA 1NCQB 5GKAC 1RUE3 3JBG3 1AYN2 1NG0A 1VBC1 4CDWB 5BNOA 4AEDC 3NAPB 2IZWA 4PDWC 2QQPA 1AR71 1TME1 3VBFB 2HWD3 1AR81 1PGL2 2BFUL 2R073 1PO23 2WS93 3J8F3 2ZAHA 1RMU1 5D8AA 1BBT2 1QJY2 3VBOB 1R1A2 5C8CB 1B35B 1AYN1 1EV12 4Q4Y2 5J98B 3VBSC 5K0UC 1NCRC 2WLPA 1VBB2 2ZTNA 1VBD2 1VB2A 1VBC3 2RS12 1AYM2 3ZFGA 5J96B 4N43C 4RQPA 1PGL1 4IV3C 1AR73 3VBUC 3ZFFA 2HWB2 2XBO3 1ND2C 1AR83 5AC92 1RUI3 1BBT1 1QJY1 2ZZQA 1R1A1 5L7OC 1K5MB 4GH4B 4QPIC 2WFF3 4YVSC 1EV11 1RMU3 1VBA3 4Q4Y1 4WM8B 4RS5B 4CDUA 5ACA3 5CFDC 1VBB1 1RUG3 1VBD1 1HRV2 1FPN2 2RS11 1OOPA 1VB4A 1AYM1 1CD3G 4JGYC 1X33A 2MEV3 1NY72 2HWB1 5BNOC 3VDDA 3CJIA 1PVC2 4CEWA 5CFCA 5AC91 4RHV3 1RHI3 2HWD2 1QJZA 2FZ1A 2BPA2 5LK7B 4WM7A 1QJY3 4RR3B 1NA1A 1NOVA 1IHMA 1HRV1 1FPN1 1EV13 1H8TB 4GMP0 5D8AC 4YVWB 1D4M2 1RVF2 4Q4Y3 3ZFEB 1OHFA 4JGZA 1VBD3 5ABJA 1NY71 4IV1B 3IDEA 1PVC1 2RS53 2HWD1 2HWB3 3ZFGC 5JZGA 1RUD3 1ASJ2 4RQPC 3TN93 2X5IA 3ZFFC 4CDXB 1GFF2 2XBO2 1ND3A 5C9AB 1RUI2 4CDQB 1D4M1 1RVF1 4N53A 1QJU2 1ZBA3 2WFF2 2WWSA 3M8LA 1VBA2 1RB8G 2HWF3 1HRV3 3JB4C 5ACA2 5A32B 4CDUC 1PIV3 1RUG2 5BNPA 4SBVA 4AEDB 4PDWB 2R062 1ZBE2 1OOPC 4NWWA 2Y26A 5C4WA 3VBRA 1ASJ1 1PVC3 3ZXAC 1V9U2 2MEV2 3HAGA 2XBO1 3VDDC 3VBHA 3CJIC 1RUI1 4RHV2 1RHI2 5CFCC 4CEWC 1QJU1 4FTBA 2WFF1 1QJX3 1MQTA 1RUH2 1VBA1 4WM7C 1AR92 1D4M3 1RVF3 5ACA1 3VBSB 1NA1C 1RUG1 4LLFA 5K0UB 1NCRB 2R061 1ZBE1 3DPRA 3S6PA 5A33A 2BFUS 1RUC1 4N43B 1V9U1 4JGZC 2MEV1 4IV3B 5ABJC 1QQP2 3VBUB 1ND2B 2PLV1 4RHV1 1ASJ3 1RHI1 2RS52 1OPOA 1RUD2 3TN92 5JZGC 5L7OB 1POV1 1RUH1 2X5IC 4QPIB 4YVSB 4YVWA 4BCUA 1AR91 5DDJ2 1EAH2 1ND3C 1QJU3
chains in the Genus database with same CATH superfamily
2WAOA 1ZZ9A 2Y33A 3VKMA 1CZVA 1JMUB 4K9SA 1YI9A 2AR6A 3I3BA 1OD5A 2IXCA 5LY2A 5FZBA 1S1AA 2OVUA 3U10A 1OVPA 4F8AA 5A7NA 1JOPA 1OC1A 2PQSA 5FZ3A 4ITCA 1YJLA 5CG8A 5E88A 3S7IA 3JD72 2ZX2A 4EE2A 1RUC3 2Y6LA 2CU5A 1TNFA 1X9TA 5BNPC 2PAKA 1V9U3 2ZABA 4I0AA 1SCRA 3CEWA 1V6KA 4UW6A 5IK5A 5C9AA 5C4WC 2C26A 1RYYA 3G7DA 5EIYB 3DYPA 2PLV3 4Y4YA 4PLOA 4EV0A 1VAKA 1UOFA 4DO0A 4Q5OA 4ES8A 4BLIA 2CSGA 2LUWA 2TBVA 4RGGA 1MS9A 3ACGA 1RUH3 5EJ1B 4EWAA 3GHNA 3UKNA 3WUDA 2WBKA 4CP9B 1PK6B 1AR93 1COV1 1TZOA 1AL21 2WT0A 1CR7A 5C3PA 1VPHA 3LAGA 1HB1A 2BDRA 4CDWA 1VIWB 5FMBA 1W2OA 5C5TA 4D6RA 3OPTA 3RYRA 1Z0HA 2ZA9A 1UF2C 4E27A 4KG8A 3VHPA 4BU2A 4CU6A 1NAEA 2VOWA 2K46A 3NV1A 1QQP3 3P3PA 1OQ1A 2N7GA 1XYOA 3WV6A 3W59A 3APBA 5FPAA 1PMJX 4RQPB 2VCCA 4K40A 5JXHA 5E89A 4UXAA 4MXWB 4KI5M 5T5PA 3AVSA 4MGTA 3AXEA 5IAXA 1GP5A 4CE8A 2SLIA 4AAXA 1JOBA 2XB6C 1OF3A 1SLCA 1N3PA 1BVVA 4QX3A 4FPCA 1H0BA 2JG8A 3VBOA 1A78A 3E6BA 2JDHA 4R9BA 3WDVA 4YFZA 1BQPA 3T1MA 4BQ5A 3AX4A 2X53S 1D7PM 2Q1MA 3H1WA 2Y34A 4P9YA 1X7NA 3HN3A 3LQCA 1JYVA 3H8XA 4QKFA 1LGNA 5FV3A 3LGRA 2JJ6A 3ACLA 4GB33 2ZXQA 3R6SA 3H9AA 1LOBA 3FBYA 5A6ZA 3T0DA 2VW1A 3WG2A 3ZSJA 2FDGA 3BTZA 3RYPA 5CISA 4Z07A 4YFWA 1GOFA 2XDVA 4D94A 5B4NA 2YHJA 5DAQA 1TMF2 3RGBA 4A2UA 3MIHA 3WP4A 4PIZA 4Q0UA 4LQRA 1RIRA 2QDNA 4ARYA 2BBVA 2HWC1 3ZXLA 4AI3A 3PIJA 1R091 4FQ4A 3HN1A 2VY0A 5C3RA 1DZRA 1JUHA 1YWKA 3B01A 2IWGB 2WJSA 1VR3A 2YV8A 3GJAA 3K4ZA 2I74A 1DBNA 1NQJA 1QJEA 2EXJA 3OD0A 4MXVA 4A3ZA 4QPGC 3ZMOA 4CUAA 4WM7B 2QFEA 4W4ZA 1ODMA 2RM21 1LJ7A 2FCTA 3FZ3A 1NA1B 3KF5A 1UIKA 2PHTA 4CP1A 4Y5Z0 2ARBA 1CAWB 1NCQC 4TSVA 5JXGA 2OX0A 3OF1A 2GNDA 3CHXA 3RWNA 1ZZ6A 3VDBA 4XAAA 2HWE3 2W46A 1LHOA 3I59A 3GALA 4Q4X2 3LD8A 1H8VA 3AMQA 1RUF1 3VBFC 4Y20A 1S2KA 2D6KA 2XL7A 5CKNA 4WZCA 4HVQA 3K77A 2VMCA 1OLRA 5A7QA 2X5IB 3I97A 4QB2A 1BKZA 1HXS3 1DLCA 2H0BA 1H8TA 5BYNA 1PGW1 2R042 2E33A 1I3HA 4JVAA 1B35C 4ZPIA 1VLNA 2VUAA 1FOD1 4AQ2A 2O1QA 1J3QA 1LU1A 3SCFA 5FMCA 1C3HA 2WZR1 4IV1A 4CU7A 1GP4A 3BOWA 1H9WA 2FBEA 2WNUC 4PI0A 4EN6B 2GDFA 2R1DA 4W6XA 2D40A 5I8TA 2HKXA 5FUPA 5B4XA 2JDAA 4CYDA 1MZ5A 5CU1A 3N9LA 2D97A 2UWCA 3A21A 1Z7S2 2VVFA 1MR5A 2GC2A 1G7YA 4FO9A 1O7FA 4JKMA 4Q4V1 3LA2A 3K3OA 2JWPA 3BIWE 1W03A 1BZWA 2GN3A 2EAKA 4FTEA 4A41A 5A1AA 1WZXA 3LDKA 4OI1A 2V4VA 4GH4C 3B94A 3IDCB 1T2XA 1UIJA 2GAUA 4OHZA 4AI9A 5FY4A 2RDQA 1MQTB 1MEC1 2OZJA 1A8DA 2ATFA 2VU9A 4RS5C 1LAJA 5A32A 4XIOA 4NWVA 1W6PB 2VJXA 4BQ1A 1CPMA 4AEDA 3O1OA 2BUKA 2RS32 3MIBA 4PDWA 5LCWL 4KU8A 2JG9C 3IWZA 3AYAA 3JCIA 5KXBA 3I49A 4RFT0 1JXNA 5K9YA 1FMD2 2JB8A 3GJBA 4XXAA 4OI0A 1V00A 4Q0PA 5A33B 2VOTA 2ZGKA 3ACHA 3EB7A 4KWKA 3ZDVA 5A3OA 2IXHA 2VW2A 3ZSLA 3U37A 4IESA 1WCKA 1TG7A 1U12A 3O0VA 4BK4A 5DPNA 5FCCA 1UKGA 4KMQA 3ZXEA 3POBA 1PO11 2V5DA 1ULPA 5AFEA 3DXUA 4QQLA 4DXTA 2WLQA 4M3CE 4Y22A 2J1EA 3ZYRA 5KC6A 4OFGA 3A4UA 1QOSA 2E7TA 3MV01 2QQIA 3LE0A 5CIRA 3RQ0A 1OD3A 3VBSA 3CO2A 2J7MA 1AR62 4LHSA 5K0UA 4EN7B 2B46X 1NCRA 2LTNA 4UF0B 3OUIA 3GNEA 2NN8A 3PJQA 4KGQA 1AYM3 2ZX3A 2I45A 3OBZA 4IV3A 4AGGA 4WVMA 2OIIA 2A70A 3DECA 3TOJA 1RUJ3 2W92A 3MI8A 1D0GA 3VKLA 1JHJA 2C1FA 1TQ5A 2NLRA 3SCGA 2WO3A 5GLZA 4AHYA 4CEYB 5GZFA 1IQAA 3NMBA 4WVZA 2R071 4I2OA 4FPLA 2JD4A 1PO21 1CWPA 1TME2 2JDZA 2Y64A 4GWMA 4AFBA 5L36A 3AYEA 4R9CA 4BB3A 3J8F1 4EROA 3PUHA 4QPIA 1SBDA 3ZSMA 1OH3A 1S0JA 4CDXC 2BERA 1OLQA 1U5IA 3BTYA 1ULGA 1OUXA 1NLRA 2P4EA 4LPLA 2ZX0A 1RMU2 2EIDA 4FPFA 4Q1RA 1W8FA 5JLVA 4AW7A 3M2MA 4XJZA 4FAHA 4JGYA 3TB0A 1GUIA 3AKSA 5F5AA 5A1LA 3JBG3 1AYN2 1BK1A 5F39A 1UPIA 1GWKA 3MICA 1BYHA 4BIOA 1YJKA 3B02A 4C8DA 4E4HA 3NAPB 5KC5A 3GM8A 2VMHA 2PN5A 4XYXA 1DYKA 4XMAA 5FYCA 2GP5A 2A1XA 4LUKA 4MGQA 5JOYA 3BYWA 1RXGA 1AR81 3LPFA 2BFUL 2VMGA 2WKKA 4K20A 1G9AA 2UWAA 4LXLA 3UJOA 2JKXA 2WS93 2Q8OA 1RITA 3SEEA 1RL3A 1OA2A 3GDBA 4AHWA 4DUXA 4D6QA 4CP9A 2DVFA 1BBT2 1PK6A 1TNRA 4I0WB 4OQ9A 3CL1A 2XH6A 1CAUB 2XONA 2OT7A 3BGAA 1F4HA 2C4XA 4IEYA 4XE9A 5EP9A 3SISA 4AI8A 3FHQA 3POEA 1REFA 4DUVA 4UW4A 1FNYA 5LASA 4H7MA 5J98B 3BPSA 2W9XA 2VVEA 3WINE 1W0OA 1XPWA 3ES4A 3PU3A 1HQLA 1OI6A 2ZTNA 1VBC3 2FHRA 2WN2A 2Z42A 4JC1A 3J26N 4L97A 4N43C 4XEZA 3TRSB 4RQPA 4XQ4A 4LBQB 4MXWA 2CGOA 2E51A 4A42A 1AR73 2VCBA 1F9KA 3NRUA 1XYNA 4AEJA 2EXHA 1ND2C 1X9PA 1GU3A 3O1PA 4HXCA 4IEWA 4DS0A 5AC92 4KWUA 3PDQA 3WHTA 5CBLA 3HT1A 5A7SA 1R1A1 2LM3A 1GOGA 4QHZA 2DVDA 1SFYA 2P5BA 4JHTA 1C5HA 2FMYA 3LDRA 1EYBA 4WM8B 5FZ4A 5CKMA 3PUQA 3UNPA 3J7LA 2UYBA 3ITQA 5CFDC 1VBB1 4QX8A 1LCLA 1RUG3 1VBD1 4LK7A 1FPN2 3VDAA 4A45A 2RS11 4K8RB 2FDHA 3SKVA 5A3PA 4QU2A 5FP8A 1W6NB 1J59A 4ZS2A 1LRHA 3MPBA 3OUJA 4Q1PA 2CYFA 1XYPA 4JCKA 3OB8A 1OBNA 1UOGA 3J7HA 3MDPA 4XABA 5GJ6A 2VNOA 5IK4A 1NY72 1XOYA 1WW6A 2Z69A 4ISRA 2HWB1 3WNNA 4SLIA 4YZ4A 3WLUA 4HZFA 4CZSA 1IKPA 3POIA 1G8WA 4V2WA 5JSOA 1OT5A 1DQ1A 4UFKA 2NMNA 4N90A 1QJZA 3DN7A 4WM7A 4K7JA 4GXLA 4EQVA 4XURA 4RR3B 5EPAA 4OMDA 2Z4FA 3PVBB 1NA1A 3WEZA 4ASKA 4RGKA 3N7LA 4RN5A 1MACA 2WO2A 4INDA 1CAWA 2Q5TA 3MFCA 4Q27A 5D8AC 5FMDA 3VZLA 3MHZA 4CVUA 4NMIA 4YVWB 3ZMNA 1RVF2 4Q4Y3 2O8OA 1CX1A 4ET7A 1T6GC 1W90A 2Z2SB 1O5UA 3FX3A 4IEVA 5C33A 3T4HB 3VD9A 3WG4A 4AVSA 1RUOA 2IVIB 2W1SA 4LTAA 3AMNA 3IDEA 1B09A 1X8MA 2PHDA 3ILFA 1J1TA 2XMLA 3ETQA 1FXZA 5T50A 2RS53 2HWD1 1SHWB 1UYYA 3H3UA 5BXXA 4EZHA 4OUSA 5L9BA 4KNCA 1XBFA 3ENRA 4BDVB 4CXYA 2X5IA 5ABJA 1W6MA 3ZFFC 4HSJA 1GFF2 3WNMA 2WSUA 4DQAA 2EIEA 2JDYA 2RJLA 3VHNA 5C9AB 1DF0A 3HMYA 4IXLA 4RSUA 3KVBA 4CDQB 4FQZA 2VXRA 3B93A 5F3EA 4BQ3A 3OBAA 5L9VA 4FPHA 2DVBA 4HK9A 1IOAA 1AX1A 2VZQA 4PF5A 1RB8G 1HRV3 4G3YC 1OLME 1ULOA 1S0FA 3HNMA 2OPKA 3Q8BA 2BP6A 3A7QA 3JB4C 5FK8A 3N9QA 4CDUC 5A80A 4SBVA 5I0SA 4YW1A 3R4DB 1W9FA 2JIGA 1EP0A 4JRAA 2Y26A 2VXJA 4Y1VA 4H14A 4NOTA 2ZGOA 1PVC3 4YYOA 4FCAA 4P5YA 2MEV2 3HAGA 2CWMA 2XBO1 5KXDA 2J22A 3LWCA 4LHLA 1NE4A 1LECA 4RHV2 3ZVXA 3BU0A 3DF0A 4YW5A 2RVAA 4MG2A 3CZUA 3U0ZA 1NYWA 2HEYF 1UL9A 1QJU1 2D3PA 2RG4A 2F4PA 3MYXA 1GANA 4HSLA 3HWJA 4FPEA 5F32A 3SEPA 1MQTA 3WF0A 4E4SA 4NPMA 3TEXA 1W8TA 1W6PA 5C8WA 1WBLA 1ZRIA 4NRMA 3UL2A 1QKQA 4LLFA 2JD9A 3RMYA 3H3LA 4Z8BA 2P2KA 2XQXA 3BB6A 4YZ2A 4YARA 5A33A 3RVHA 3KT1A 1JZ6A 2RDNA 5J09A 1RUC1 1OFSA 2QKDA 3OJBA 1V9U1 5SV8A 4E8CA 4JGZC 4FAGA 4ZZ5A 4UI9L 1JYNA 3H1MA 3V0AB 3VGIA 3VBUB 2Y6KA 2PLV1 1ZNPA 1Y3TA 4K8FA 1OPOA 2B7YA 1NQDA 1PZ7A 2W91A 3BODA 4P14A 4N7IA 3B9CA 3MLLA 4QM9A 1O8SA 2JENA 1HDKA 3KF3A 5L7OB 1RUH1 2ARCA 2ZACA 3RI8A 4AK3A 4YW2A 4FFIA 4PIXA 5A3UA 5APAA 4BCUA 1AR91 1JBCA 3KCCA 3KCXA 4GAZA 4M3CF 1UOJA 1ND3C 2VQUA 1QXJA 1H9PA 2AGSA 2F4LA 4L11A 4PCRA 5T3NA 1O3SA 5FP9A 4LOTA 1ENQA 3ROUA 5IJRA 3B3QE 4CCCA 4FOYA 4N53C 4NRPA 1COV2 2D7FA 4OI4A 1AL22 5E1RA 4OQ8A 4YWAA 3KB5A 4IEPA 1XE0A 4TYSA 4I01A 3MEPA 1QQP1 2P6CA 2DUQA 3WG3A 4CEYA 3BKZA 3LFIA 4CCDA 5BNOB 1KRIA 1TMF3 5EYYA 5FYYA 1ALYA 4BYYA 2ZJCA 4O7XA 4C1WA 4A6OA 3ZM8A 5LA2A 3ZN6B 3QCWA 3AC0A 3VD3A 4YZ5A 1RUD1 2K9ZA 3TN91 2XVLA 3QOPA 4HANA 3VBRC 5FP4A 3ZYIB 4YZ1A 2VC9A 3C7GA 5EFUA 4AF9A 3A23A 4Y33A 2GSYA 4Q0QA 4Y20B 1RXFA 4E9KA 3VBHC 2B42B 3BTAA 5FZ1A 1W2NA 3WR0A 5I8YA 5KXCA 1X50A 2BYVE 3OEAA 4OCTA 2QQKA 5D2AA 4U36A 3D4KA 3P3NA 4B1MA 1BHGA 1OA3A 1XXNA 1PHMA 2HWF1 3CBNA 5FY9A 5L9RA 1LB2A 4IETA 1POQA 4HVRA 3BUCA 4NIGA 3ZYPA 3NAPA 2DVGA 3T2QA 3D3AA 1XNAA 4Q4X3 2WO1A 2J1TA 4QHOA 3UGFA 1CPNA 4JQTA 4LBJA 1UXZA 1YIPA 3IDBB 2EIGA 2VPVA 4LBKA 2DU1A 4LR4A 3AYDA 2QQUA 3ZXDA 4ZZ8A 1QHDA 3VD4A 1XNTA 3ELNA 1UMHA 2JICA 2VTXA 3PJYA 4J25A 4OUEA 3VZNA 5A3NA 3M1HA 2CL2A 4YRDA 4AG4A 4V2VA 1DGRA 2CTVA 1CAUA 2HWC2 4XF3A 3AKQA 4WBBA 5A3WA 1R092 4D7YA 1EAH3 4NE9A 2DCZA 4K1ZA 4I3PA 3AZVA 1J84A 1BMV2 2D6MA 1LU2A 1GNYA 4FSJA 1W2TA 3ZN4A 4L99A 1ACCA 3ZIWA 1XSQA 2DDUA 4XUPA 1GQPA 2DBNA 2OA2A 4MO3M 1QDOA 3PHMA 4BWOA 3BI3A 3KLSA 4IQPA 4MADA 2HWE1 3MF6A 5DAWA 4ZS3A 3K4AA 1MS1A 2Y38A 4ONUA 2D98A 1J1LA 4GD4A 2Y6HA 4LBQA 3WVJA 4DXRA 2VULA 1Z7S3 4F83A 1GOHA 1W8HA 1QXRA 4QQ2A 1PMHX 4FFGA 2FCVA 5BNNC 3VDDB 3FUOA 1DGWA 1AXKA 3CJIB 4LKDA 1JN2P 2VQAA 4OYUA 3VD5A 1P8JA 1RUF2 2A6YA 4CEWB 5CFCB 4GKXA 4P9GA 1SFNA 3O1RA 1IG0A 1PNFA 1SLTA 4WVWA 2PYTA 5T5JA 3WP3A 3K2OA 5CVRA 4GZ9A 5F3CA 4ASLA 3OUHA 4WM8A 3Q8FA 1Q8PA 2WNVB 4QB6A 1DGLA 2ZZJA 4QXBA 3IDAA 4Q4W3 2A3WA 3KSCA 4P08A 1STMA 1PGW2 2B9UA 2RS33 5LB6A 2AZ5A 3WNOA 1G9CA 5FZ8A 1W6NA 3WQBA 2B4KA 3RMXA 1O4TA 1FMD3 1FOD2 5LBFA 3HR9A 2WZR2 4QX7A 1XJAA 2VVDA 2JECA 5CB7A 1UY1A 3FN9A 3WF2A 3FBMA 2WQZC 5CZKA 5A3LA 1W9WA 2ZBJA 2VO5A 2VNRA 3WP6A 3WDTA 4EZ4A 3Q8AA 2OPWA 3T2PA 4Z1VA 4HOOA 5LATA 1CQ9A 2G4IA 5KHJA 2J1AA 3IMMA 3ON7A 4RR3A 1WCDJ 4HBNA 5GLWA 4GQ7A 3H8RA 4NVPA 3R0RA 4QXCA 4XUQA 1N1YA 3V0BB 3UT0A 1AR63 1N1SA 4Q4V2 3QH7A 1MS3A 3WQ7A 3WW2A 2YZ4A 2ZGPA 2GMEA 3LEGA 1REEA 4YGDA 4C90A 3LOBA 5C8CC 1AL0G 1YYNA 4L0PA 1NKGA 4JTNA 5LA9A 3IAQA 1MEC2 4NROA 2FDFA 2YC2A 3HQRA 4H2AA 2ID4A 3JQXA 2EIBA 1AHSA 4FPOB 3ZN5A 3BVCA 4XDOA 2XJQA 3OGVA 4JGYB 1NUKA 3THCA 3WDXA 1XE7A 2G19A 1UN1A 5BNPB 1TME3 2YPJA 2XJSA 4JRLA 1OSGA 5FOJB 3FUQA 3L2HA 1HRI3 5C4WB 1IS5A 2XL9A 3JU9A 2ES3A 1ST8A 4XFBA 1YNAA 2JDPA 3A22A 1GZ9A 2YY1A 5HV4A 4W8JA 5FOBB 1I1EA 3NW4A 1I5ZA 4CDQA 2ZGNA 1PO12 1X36A 3KV6A 3UGGA 3EYPA 4BQ4A 5G05L 1K5MC 1R081 1QGLA 1ZX5A 4QKNA 2QDRA 3PUIA 3JUUA 3K75B 3K3NA 1VBE2 4RYDA 1HX6A 3WG1A 5T5LA 1AYN3 4XZPA 1LOEA 4IEOA 5GLUA 1X8EA 2QZ3A 5LZ6A 1JYIA 1I5PA 1SEFA 2P37A 4COZA 1W39A 3GCXA 1C57A 4WV8A 1Q5OA 1RUJ1 1C28A 1OMIA 2W39A 4QT6A 3N3HA 1V6IA 2GN7A 3CZJA 1CONA 4Y26A 2YYOA 3OD4A 1ZA4A 5J36A 4EN8B 4LT5A 4HN1A 5FJKA 1HB3A 2VH9A 1YHFA 1VE0A 1C1LA 2R072 4LBLA 4HFSA 2P1BA 1PO22 5C70A 3CIHA 1JOJA 1BBT3 1C8M1 4CUGA 4NHXA 3OY8A 2WQ4A 3J8F2 4UW3A 3KGLA 4X6RB 4BMBA 4ATEA 5A3MA 3VZMA 4EN0A 5EXOA 4META 3PUSA 4L8QA 1VRH1 5LWBA 1UQXA 2OQ6A 4OHYA 2AEYA 2RMU1 4DRRA 5FYHA 3DEMA 5F37A 1PX4A 1H4GA 1XNBA 2LW8A 3H50A 3JBG1 5GZDA 5F3GA 4BPZA 3OBTA 4YGCA 3N7MA 2RR11 3WHUA 2TEPA 3NNLA 3ZFEC 5JIUA 2G9GA 1IGOA 4MZUA 3UESA 4CA9A 4UT5A 4NN0A 3OOXA 4N7UA 1MS8A 2DBIA 2XHNA 5M0TA 3V0AA 2JEMA 3VBUA 4AFDA 3RPQA 3LF7A 1S0BA 1DDLA 4MOAA 3KM5A 4YG0A 1BEV1 5AC93 5IVBA 5FP7A 1YQ5A 2WS91 4N9IA 1HKDA 5L7OA 2OUHA 4I30A 1AR82 3LOIA 4I0BA 3OTFA 2WZ8A 2ORXA 5DMYA 4QPGB 1BK0A 2XPJA 1J3PA 5HBAA 2Q8EA 2GNBA 5A3TA 5FZIA 1WCQA 2WWUA 2ZGUA 1FPN3 3ZPOA 4B7KA 3N9OA 2R49A 3MPPG 2WYSA 1HN0A 2VUDA 4GMP1 1NCQB 5IFTA 5GKAC 1RUE3 5BUVA 1ZREA 2ZEZA 4E4ZA 3V65A 1NG0A 1VBC1 4MLOA 1H30A 1XSRA 2D5FA 2VQTA 3CQOA 5BNOA 2Q30A 3VDCA 2HYKA 2GU9A 3FLRA 1URXA 2YDEA 3O1TA 4KBBA 3WCSA 1D4VB 1GR3A 2VR4A 3ZIXA 3ZN6A 2QQPA 1AR71 4HKLA 3V64A 3TYJA 3LA7A 1PZ8A 3VBFB 5FTTC 4OHVA 3LZZA 4JDMA 4QGMA 2BGOA 4XQDA 2D93A 4IGOA 3WSOA 5CYYA 5EWSA 4QD2A 1CIYA 4QQPA 4LE4A 2VM9A 3ZYHA 4RGAA 5FLIA 4OZXA 1XRUA 2ZAHA 3DCQA 4XF4A 5FPZA 5CAZA 5KHHA 5JXJA 2JKBA 1YQ6A 1UU6A 1JI6A 4LOSA 1KJLA 1REDA 2ZMKA 1W6MB 3SMHA 1R1A2 5J48A 1B35B 3ST7A 2PA7A 2MPFA 3POYA 3U1XA 3HT2A 2VUJA 2WNUB 4M00A 2D3RA 3WZ1A 3IKWA 1VBB2 5CG9A 5LBBA 3UGHA 1VBD2 1VB2A 4BZ4A 2FDKA 2RS12 3NNGA 2Y6GA 1LESA 1O6UA 2PHFA 3ZSKA 5JSRA 1GKBA 2BVVA 5DAVA 4YLZA 3SKJE 5C71A 2QQNA 1K3IA 2HWB2 5I0UA 4QHBA 4M3CB 5LRRA 1SLAA 5FY0A 2XJPA 1DU3D 2BOJA 1DP0A 5EJ3A 4IERA 2FDJA 3KQRA 2OKXA 4GH4B 4YVSC 1UYPA 2BW8A 2Y0IA 3FJSA 5J3UA 4DPNA 1E5SA 4H7LA 2VZ1A 3ETPA 4Q4Y1 5HXVA 1G86A 4RS5B 3RJRA 4NHYA 2YB7A 2ZHNA 4QXHA 4HN0A 2JIJA 4IE5A 1DYOA 3C3VA 3OGRA 4K21A 3B00A 2JG9B 2PAMA 3T30A 3WP5A 1CD3G 2PHXA 1LHNA 3SCHA 2Y60A 4XXPA 4BQXA 3HD8B 3U11A 4S2GA 1GNHA 1GZTA 4DMIA 1RINA 2VZUA 5DG1A 3HVDA 2W87A 1QH6A 2MEV3 3IZOA 3WNPA 4R8HA 5C7GA 1DCSA 4KBZA 3RDIA 3OGJA 4XMIA 3VDDA 3CJIA 4MGKE 4CEWA 5CFCA 3T3YA 4RHV3 4X8NA 5FDBA 4OZOA 4QX1A 2DFCA 4Y1UA 2HWD2 3GBGA 3RZHA 3AKPA 4ATFA 3TNPB 2WA4A 2VTFA 2FZ1A 5EZWA 2BPA2 2WNVA 2WR9A 4J1XA 1QJY3 5IVJA 1CZTA 1DGWX 3O1UA 3BOPA 3VD7A 1WLTA 4DB5A 2QZ2A 4LBQD 4XUTA 1HRV1 4ZY9A 1EV13 1FT9A 4GMP0 3I2HA 5AVPA 2RJ2A 3ILRA 1WKYA 4MSVA 3PVOA 5FZEA 5F3IA 1UMZA 5GZEA 4CPBA 3P6BA 4QDSA 4LHKA 3UJQA 1H6YA 3VUOA 1OHFA 1LOAA 2D6NA 4S2HA 3POWA 3ZX7A 4NIHA 5FZGA 1JUIA 2YBPA 1QH7A 1PVC1 1LKNA 5J1XA 3N4MA 2YROA 2KM2A 2ZKLA 2XR4A 3MW2A 5JR7B 2CHHA 3EXUA 4YW4A 3ZPYA 5IVCA 3ZFGC 4XCAA 3V0BA 2RHPA 2C24A 4CDXB 2DVAA 2XBO2 1UO9A 1IS3A 4CTEA 2P3JA 1TVGA 4IEUA 5KHKA 1G9DA 2E63A 4PLMA 5FXVA 4BXFA 2WABA 4B4PA 2KA3A 1WLCA 3HOBA 5GM0A 4COVA 5F8PA 1GZWB 3RWKX 3EBRA 1QJU2 2R0FA 1XB9A 2H0VA 5GZGA 2XJRA 4QQOA 3E5XA 1H2KA 5BY5A 2CAVA 1DG6A 1AVBA 2ZGQA 3R05A 4COUA 3WCRA 2WFPA 3LDBA 1XE8A 4ISQA 5BNPA 4N8MA 4KWJA 1GSLA 4UFIA 1CZSA 4LLOA 4AGRA 1OOPC 3A0KA 5FZDA 5HV0A 3QD6A 4I09A 5AFBA 2HLEA 5C4WA 1PMIA 1DQ2A 5E6HA 3BTXA 2B39A 4UFLA 5LW9A 1ZRDA 1V9U2 4AI2A 5FK7A 1F31A 1WUVA 3GZEA 2IXJA 1Z78A 3LB9A 5JCTA 1WLWA 2IC1A 5FIXA 2FCUA 3KGZA 2EF6A 1N47A 1UU4A 2L9LA 3LSDA 1RUI1 4LJHA 3WY6A 3U4XA 4YM0A 4RA0A 1LOFC 1SACA 2J1VA 2YGLA 3TNQA 3IPVB 1WW7A 2ZS6B 2VZRA 1GQHA 4DY3A 1O4YA 1E5RA 4P9LA 4NUBA 1FV2A 1Q8VA 2WFF1 1RUH2 4HL0A 1XC6A 5ANNA 1VBA1 3RG0A 1J58A 4DEQA 1AR92 1D4M3 2WAAA 5ACA1 4ZKTB 2Z79A 4JQRA 5DABA 5DZFA 4BISA 2ZGTA 1Y43B 4IEQA 1K5JA 4YW3A 3BALA 4ZXKA 2ZHKA 3S6PA 4LO8A 3M7AA 1GYKA 2P3YA 3J4UH 1UY3A 2BFUS 4G9SB 4GWNA 4XW3A 4AAPA 4QKDA 1FATA 1W3XA 3E5QA 4N43B 1FYUA 1W28A 3BIEA 4HG6B 5ABJC 2AACA 2VOVA 3U14A 1QQP2 2GZWA 1ZRCA 4XIKA 4GJZA 3V56A 2C0ZA 4I3GA 2W1QA 1ND2B 1VALA 1JZ2A 1ASJ3 1RHI1 3EHKA 4XUNA 1MPXA 3EQEA 4PBOA 2JE9A 3GZAA 5FYTA 2OS2A 1RUD2 3KV9A 3TN92 3CJXA 5JZGC 2A6XA 1LHWA 1O3RA 1V70A 2HBUA 3ES1A 4FXKB 2WN3A 5FY5A 1GWLA 4QX0A 3H7JA 2QQWA 5JOZA 4FP3A 5CFDB 1MS4A 2RE9A 3WDWA 4DXSA 5C5UA 3MUZ1 4MGZE 4IL7A 3IN9A 2JDNA 4E2GA 5LEKA 2HWF2 2RDRA 3INAA 5LBCA 4OULA 3H42B 2NYYA 3MIDA 2R063 1VMJA 1ZBE3 2BV4A 2E53A 3S0MA 5FPXA 3NJXA 4XZUG 5FYSA 1A6CA 1GQGA 2VW0A 1WMXA 2OQ7A 2ZX1A 1YC61 1RUF3 4XFGA 4Y24A 2V5YA 2PHRA 1HJFA 1NZIA 1K42A 2CWSA 1Y9GA 2YG0A 4HONA 3I54A 4TLGA 1WA4A 3W20A 4QPGA 5KHIA 5FPUA 1EAH1 5F5QA 1BMV1 2TUNA 2QVSB 3H1YA 4M0HA 4NHLA 4Q0SA 5HCBA 5DZGA 3RS6A 4AQTA 1NZCA 1POV3 3WXPA 2GALA 3B5LB 2EXIA 1NCQA 3PU8A 1ZBA1 3ABZA 3GHMA 1YRZA 3JZVA 3E5UA 4NAMA 4HLTA 5FMOL 4JDNA 4AWDA 3VN4A 1KS5A 2GC0A 3TBDA 1FOD3 2E31A 4XVHA 4YG6A 2WA3A 3I8TA 3VL8A 1HLCA 4B4QA 1KGYA 1GWMA 2D6LX 1PIV1 4LKFA 5GALA 4BMEA 1U0AA 4IDZA 1Z7S1 3VBFA 2HWE2 3DPRC 2VZVA 3JQWA 3PVNA 3WUCA 1O4ZA 2D43A 3IAPA 5DQ0A 2EA7A 2UY8A 1UD1A 1S0DA 2C6SA 4XC9A 3ZYFA 1HV0A 4YG3A 5BV6A 2PFWA 4KG0A 1A34A 1ZZ7A 2XHKA 1V6JA 3ZFFB 1N1VA 1ULCA 4BHPA 1NXD1 2AUYA 1US3A 3NL1A 2J42A 4AFCA 1N3QA 3OSDA 4Q4W1 1B35A 1H6XA 5DDJ3 4OHXA 1ZA7A 1QJX1 4FPKA 5FZLA 5KHGA 1A8MA 1SQ4A 2BWAA 2ZCWA 2ZEWA 3ALQA 2VZTA 4YVWC 5IK7A 3LCPA 2WNUA 4LIUA 4R52A 4CDUB 2EXKA 3ZXJA 2ZX4A 5F5CA 4XJAA 2BJSA 3FLTA 3WQ1A 4AYUA 4P00B 2H6CA 5KWRA 3DKWA 5A7PA 1JZ7A 3JD73 5H9SA 3JXSA 1MS0A 2W47A 2WQ8A 5J7MA 2X8KA 3AP4A 4PQQA 5H9RA 1W9SA 3Q9OA 1NE6A 3I3MA 4M3CA 1Y9QA 4GKYA 1JYXA 1UYXA 2F6BA 4OI2A 1VAVA 3HQUA 3D5OA 2E9QA 3ZDSA 2HYXA 5A1FA 1PO13 4AVBA 3B69A 4GH4A 1RJ8A 1GZCA 3GGLA 1KEXA 5C9AC 3FL7A 3HBKA 4B8EA 1W8WA 5E8AA 1VBE3 4RS5A 4D0QA 1SG3A 1E57A 4LO6B 2BTVC 3HQXA 4XFIA 3TEYA 4NIIA 3VKNA 2EALA 3CKHA 4B1LA 5KBFA 2FZ2A 3OY8B 1UX7A 5FREA 2WO7A 1LODA 2JG9A 3BN6A 4AHZA 3WDYA 4NPLA 1HQNA 2XVKA 2HEWF 2VNGA 4LA2A 2VG9A 4O9GA 4CDWC 1YFUA 3PIGA 4XDQA 4JGZB 5ISLA 4COWA 4LE3A 4OLLA 4YPJA 3MUY1 1GBGA 3AMMA 3KCYA 3PURA 1HRI1 5KR7A 5I0TA 4IUGA 3PTYA 1LGBA 2HBTA 2V4AA 1IPKA 5FZHA 5IUQA 1YLLA 2R32A 4IGPA 5DAXA 2BOIA 5DAPA 3OGSA 3AL6A 4W50A 2R16A 3LA3A 1YFXA 1AJKA 1U5YA 3PL0A 4BQWA 1T6BX 1O3QA 1ND3B 1M06G 2ZEYA 3KWVA 3DKQA 1I6XA 3AKRA 2JG8C 5BPXA 1NXMA 4L92A 3VBOC 4XF0A 3ZKUA 1UY0A 2XWBB 1R082 4N53B 4EN9B 1W8ZA 3AYCA 2K0GA 3ZSEA 4TN7A 3MIGA 2D44A 3OYWB 4ZXEA 4A3XA 4M4RA 2SBAA 2ADDA 2Y0OA 4QXKA 4EJRA 5FPLA 3VLBB 3OBRA 1RUJ2 3E6DA 3D0JA 4QMAA 3ATGA 1KDKA 3VKOA 4DEVA 2EAAA 4P9WA 3OPZA 4Z82A 2XLAA 4XHXA 3VBRB 4CDXA 5FZCA 4FOQA 4CPBD 3ORJA 3UKTA 1VAMA 4AXOA 1IZ3A 3O1MA 4Z92B 1RJ7A 2YGMA 3VBHB 5EHDA 1GZWA 1ZRRA 1QMJA 1HQWA 2IXIA 2DURA 1C8M2 3QACA 4YW6A 1BCXA 1CX4A 4BK5A 3RNSA 5JPMB 3IT8A 3T4VA 5JOWA 1VRH2 1SFPA 4HT1T 3U78A 2RMU2 4C1XA 4GB31 3JBG2 1VMHA 4Z2AA 3D6EA 4TXWA 3O0XA 2RR12 3IBMA 4COYA 2WNEA 5DUXA 1CN1A 2BQPA 4A7YA 5JWPA 5FXZA 1UMIA 4M0NA 1Q56A 4FVVA 2MHFA 3D8CA 2P17A 2IUWA 3IPVA 1BEV2 1XNCA 2OUJA 2VZPA 4C0BA 2WS92 4YNIA 1QEXA 5F7UA 1R1A3 4R4XA 3CNAA 1K45A 2XOMA 2R043 3WW4A 2A6VA 5F5IA 4B4RA 3GXUA 2NP0A 4CCOA 2QUOA 2Q4SA 1CJPA 1RUE1 4YGEA 4D3WA 3RYKA 2CV6A 1H8TC 1VBB3 2R1BA 3AL5A 4BH9A 1DQ5A 1WW4A 2RV9A 4NPRA 4B3NA 2RS13 2NM1A 3D82A 4CCKA 5C3SA 1HW5A 2RM22 3ECQA 1HJGA 4N43A 5JOXA 1LGCA 1PZ9A 1S55A 1VBC2 1CVNA 4IV1C 4IE7A 3R4SA 2YXSA 3N7JA 5K7PA 5T52A 3I3EA 1ND2A 4LKEA 2CGPA 2W95A 2BNMA 2GH2A 4GWIA 4LKSA 5JAXA 1JZ3A 4YM3A 3OG2A 5BNNB 2VL4A 3KV5A 1AR72 4CUBA 4BOWA 2HH9A 3WOGA 4D7SA 3LIHA 4Q0VA 2E32A 3B9IA 3ZYBA 1L7LA 2WC2A 4DY5A 3N7KA 4FTSA 1SCSA 2VMFA 3MGUA 1HXS1 2QQLA 3BPZA 5C6CA 1F8VA 3O7OA 5CFDA 1XQNA 2ZMNA 4IEXA 4AQ6A 5FY1A 1YUDA 5JMCA 3SXWA 3EJKA 2NPIA 4AVCA 2YFUA 1H2MA 4MVTA 2W0XA 3I2JA 3WNKA 5I0RA 1OQDA 4P9IA 3FWEA 3S57A 2FMDA 2LROA 3LSEA 5FUIA 5FYZA 4AEDC 3RZKA 2XUMA 5F2WA 4PDWC 3ILNA 3O14A 4A6SA 4CRQA 2QJVA 1G6NA 1JS9A 5JR2A 1UOBA 1WD3A 1DLLA 2HWD3 4HK8A 1F5FA 1H2LA 3N9MA 4Y1ZA 1CGPA 2H6BA 5FO9B 2E7AA 3VB9A 3AFKA 5AVAA 1QU0A 3ZXKA 1S0GA 4O9EA 5FBJA 1WGPA 2W52A 5D8AA 1OLMA 4QGLA 1EY2A 1W8OA 1IQDC 1DQ0A 1DQ4A 5DG2A 4PLNA 5C8CB 2A7AA 4LO7A 4M4PA 3THPA 5IT6A 1CAXB 1V6OA 4Q4Y2 1IPJA 1OQEA 3VBSC 3W5NA 1D2SA 2BGCA 5CA6A 5K0UC 2WNOA 1NCRC 5T5OA 3USUB 1OUSA 2ZKNA 1D0HA 3HNBM 3PUAA 5HCAA 2X09A 4DINB 1SPPB 3WF4A 3T0BA 2B5HA 1UZVA 2JB4A 2QQVA 5F1RA 1PGL1 4IV3C 2IFRA 3RSJA 3ZFFA 4NJ4A 3U75A 3POSA 4UFJA 2XBO3 4XJ8A 2E26A 4DFSA 5IYYA 1ZRFA 3O12A 2WZPP 2DWRA 1JODA 1I9RA 3DV8A 1QJY1 2ZZQA 4YW7A 3DYOA 4GIQA 2IXLA 3THTA 4GWJA 2DTYA 5I93A 2A71A 3PMSA 1K5MB 4QPIC 4X8PA 1EV11 1RMU3 2Q0AA 2J1UA 2QE3A 5F2SA 4CDUA 2NQYA 4EWDA 1UPSA 1HRV2 1DQ6A 4HVOA 4LUMA 5G04L 1AYM1 4JGYC 1YQ2A 4MHUA 4DUWA 1MS5A 1SDWA 2PAEA 4CXWA 4DNYA 5IVEA 1S0IA 2VOXA 3AFGA 3PMEA 4Z2WA 2Q1FA 4BLJA 3SC7X 4XCBA 1PVC2 5B2GB 3AP9A 2ERFA 3NV2A 5IVVA 5ANQA 2D5HA 4BE3A 1LENA 3H7YA 3WF1A 2QQJA 3N9NA 1DYPA 2D6OX 5CKQA 3ZXFA 1HB4A 5LK7B 3R4UA 1LHUA 4E8DA 3VKFC 4MUVA 1NOVA 2I2SA 3WNXA 4KWLA 4A44A 4UAPA 1H1AA 3UKVA 1S4CA 3ACFA 1PK6C 2E7QA 5A7WB 2QCSB 3ZKYA 4DZGA 2AH2A 3ZFEB 1KJRA 5FZMA 4TTGA 4H55A 4IE6A 2ZEXA 4LITA 4AI0A 1LEMA 4JGZA 4NR1A 4QPYA 1H2NA 2AREA 2XJVA 3CF6E 5DUUA 5FZOB 5H9QA 5LRSA 1WMFA 1UZWA 4UW5A 4B29A 3FHIB 3C2UA 2B8MA 5EYXA 4C91A 2AC1A 1HN1A 3KD4A 4KQ7A 5FO8B 2QQOA 4ES9A 1APNA 1KFUL 1LOGA 1YXWA 4W65A 2VBDA 4KGGA 1RUD3 4RQPC 3TN93 4OHWA 2P3IA 4LBNA 1KFXL 1GP6A 2JXAA 5A6XA 4HKWA 5D8AB 1UU5A 2B9VA 2OXBA 4D7TA 1ND3A 2KD7A 3TWIA 2CNAA 2A5ZA 1RUI2 3DXTA 2WINB 1R1ZA 1ULDA 1D4M1 5JI7A 2LS6A 4N53A 3T09A 1UNBA 5E16A 2WFF2 2A6ZA 2WWSA 3M8LA 1L7QA 1PNGA 3GCWA 2ARAA 1VP6A 3OYWA 1VBA2 1XNKA 2HWF3 1QF3A 2WDBA 2DYCA 2X29A 5ACA2 5EJZB 4QDQA 2YPDA 1W6OB 2F17A 3QH6A 4FI9A 4GULA 4Y5TA 4NWWA 2ADEA 1SBFA 2G1MA 3S30A 1WLDA 4XTPA 4E2QA 4HPKB 1ASJ1 3VBRA 3IM0A 4BM8A 4LK6A 2WRAA 1H1MA 5FXWA 4ZU7A 4QPWA 1F5JA 5FWEA 5IK8A 3T0AA 2DCJA 3VBHA 2CDPA 2PXJA 4NO4A 5FO7B 1RHI2 2X05A 1OVSA 1XNDA 2XLFA 5LA1A 1JYCA 4PBPA 1F15A 3UK9A 5FPBA 5A6YA 5FZFA 2VMDA 4MHRA 4W6YA 1W9TA 1JZ8A 1QNYA 3SH4A 4WM7C 4BXSV 2YU1A 4LO4B 1RVF3 3VHRA 1WWYA 3IIIA 1NA1C 2WWJA 4JV4A 1RUG1 2GC1A 2PHWA 2VZSA 3HJRA 3AZYA 2R061 1ZBE1 3GBFA 4LIVA 2A3YA 4L2NA 4Q8KA 4AZZA 4MV2A 4LEJA 3I2OA 2RJKA 3RZGA 3O0WA 1AJOA 3E1F1 1JYWA 2GMMA 4LO5B 3I3DA 4FFFA 4K1YA 4LA3A 1FX5A 4R9AA 1JW6A 3PTRB 3FFQA 3ACIA 1QDCA 5FLJA 4A4AA 4HKOA 5HI0A 1POV1 1LULA 2BBAA 3KZ4C 4XACA 2X5IC 2I07B 2J1SA 4IGQA 4XDPA 4YVSB 4Y5SA 3NV3A 1EAH2 4DIQA 3I2KA 3CU7A 2CAUA 1PX3A 4P9XA 5CNAA 2PQQA 3RZMA 1YO8A 2ZOEB 5IWFA 1C5IA 3NO8A 4MH0E 1V0AA 4CCJA 3AP6A 1OH4A 1ULFA 2KR2A 1ZBA2 2E6VA 1ONAA 2FD8A 2VQ0A 2XXZA 1SLLA 1H1IA 5HCHA 1UY4A 2JDKA 1US2A 1ZZCA 3WW3A 4XFCA 4Q29A 3AZWA 5FZKA 1PIV2 3I7DA 4JHZA 5BNNA 1YCIA 1C1FA 4AEKA 5A70A 1YQ8A 3B7MA 2RS51 3DUIA 5I91A 4HMZA 2QNKA 3SITA 4JX0A 3AKTA 4DOUA 2DU0A 2OYZA 2XKOA 5F6KA 5LEJA 2O14A 4RFRB 1NT0A 1QXPA 3C7EA 3CMGA 5DDJ1 5JIAA 5FYUA 1F2NA 5JXIA 4FPJA 1KD7A 3WX5A 3FLPA 4FPGA 5FZ6A 4Q4W2 1E5IA 2WL1A 1W0NA 2W1WA 3ZR5A 3E6CC 1QJX2 3ASIA 5EV7A 1C8NA 1MQTC 1UWWA 5DXDA 1AF9A 1AX0A 1NLQA 5FAXA 3S7EA 4Y4RA 1UW8A 1V6MA 3JD71 3POJA 5FY8A 2DF7A 1OA4A 1WD4A 5KXEA 5FYIA 1WCUA 2A75A 1S0CA 3MW4A 4LORA 4XETA 4NIAA 5K8SA 3ZFGB 2BGPA 3RRDA 5F6LB 3PVEA 2XGXA 5IVYA 3KT7A 2ILMA 2PHLA 3HBZA 4IE0A 5GLVA 1VBE1 3LKJA 5FPVA 1JZ4A 2ZGLA 5D1IA 1FV3A 2ZHMA 4JKKA 5C8CA 5HPOA 1EPZA 5IHRA 5IVFA 2FQPA 1R083 1CAXA 2Y6JA 1O8PA 2C9AA 4TWTA 2Z5WA 5IFPA 3NJZA 3USUA 3SNMA 1COV3 2Y6FA 1AL23 2FDIA 4Y1YA 1UCXA 2W5FA 3DGTA 3NJVA 1SPPA 2JDMA 4J6GA 1J3RA 1RUNA 5FZ7A 1VRBA 1CJDA 1W0PA 2XWJB 4I02A 1U5ZA 4N9HA 4CCMA 1OOPB 2UURA 1QIQA 4R9DA 2W2IA 1JTZX 4CUCA 4XJWA 2C5DA 4P02B 2DCTA 4JZRA 1YFWA 1UKRA 4CEYC 3POFA 4LMFA 4BA6A 1HRI2 1RUC2 4Q8LA 4LBOA 4L9BA 2VCMA 5IW0A 3GBWA 2AYHA 2Q8CA 4XJ9A 3TEWA 1K5MA 1C8M3 1POV0 2P34A 1Q8OA 4WZFA 3URFA 4TZDA 4AQSA 3AJZA 2PLV2 1DZTA 2R30A 4YM2A 4AGVA 3K51A 1BLZA 2V73A 1Q8QA 4URAA 1VRH3 3IB3A 1MVQA 2RMU3 2UWBA 4MX3A 2R6QA 3I3QA 4ZU5A 3MIFA 4ARXA 1IS4A 2VECA 3LEIA 2WSVA 3RI9A 4F3JA 1LR5A 4KH9A 2OW4A 2RR13 4LBMA 4IW3A 1MZEA 5FQ0B 4UOJA 5CADA 2WUHA 4CP0A 3MLJA 1AX2A 5ABJB 1EUTA 1TMF1 2DUOA 2ET1A 3NAPC 4BQ2A 4Q2FA 2GNTA 2VTXJ 3M3CA 4CCEA 2DUPA 4AE2A 1BEV3 5DN2A 4JDOA 4J1WA 3AB0A 1QNWA 3MV11 2A73B 5LBEA 3DYMA 1CIWA 1JZ5A 2BEOA 1KDMA 3QBQA 4M01A 3BU7A 5C3QA 5JZGB 4OUMA 4PQ9A 3ZYJB 3MW3A 2HWC3 2XVGA 1R093 4CCNA 5C3OA 5IATA 5FYVA 4OVEA 2VZOA 3OCPA 3ME2A 1FAYA 2ETEA 2PTMA 3AXDA 4MGSA 2AEZA 5A7WA 1CESA 2XJTA 2VBPA 5JI9A 1LTEA 3ZFEA 1JU4A 1HB2A 1ZZ8A 4YZ3A 3M3QA 1L3JA 2RM23 2JE7A 4GMP3 5FWJA 1W8NA 3WF3A 5GZCA 1S2EA 4G4FA 3I4IA 2VOKA 3D0SA 2DCYA 2YC0A 3DL3A 5FZOA 3O1SA 2QBXA 4AOCA 4D69A 3T1LA 4GB32 4QKBA 4Q4X1 1DIWA 4QU1A 1W05A 4ASMB 4XQWA 1W2UA 2A6WA 3VZJA 4PI2A 2ZGSA 2B45X 2CGNA 2YC4A 4CU9A 1GICA 3F95A 4K3UA 2BZDA 4XFHA 3N35A 3RJ2X 4BIFA 4XBQA 3KV4A 1FNZA 4AEMA 1HIXA 2DTWA 4FXGB 2R041 1S2BA 1W99A 4XOGA 2W68A 4DRVA 3GZTB 4B7EA 1TE1B 4A7ZA 1ODNA 3U07A 2HJIA 5FXXA 4WM8C 1SMVA 3AM2A 3MBWA 3ZLIA 4LHNA 1ZYBA 3JB8A 1PGSA 1UZ0A 4FT8A 1RUE2 2C9KA 1FI2A 1W6OA 2XLGA 4JKLA 5A6QA 2WZR3 3VV1A 2KXLA 3RZJA 1Q43A 2YFZA 4HPKA 3DPRB 2WT1A 3J9SA 1IPSA 1GV9A 4O65A 3F2ZA 3OPWA 5FYMA 1D2QA 2W1UA 2ZPXA 1CAVB 1W2AX 4RL7A 5ERLA 4NAOA 5FUNA 4CU8A 3GYDA 2PHUA 4CCLA 3C8XA 3WT3A 5FZ0A 3FE5A 3Q8EA 1UX6A 1GNZA 3PNAA 5FMOS 3W5MA 4WVVA 3MF9A 1F35A 2R7EB 4UFHA 3O1VA 4Q4V3 1LNSA 3T2TA 2W94A 2X10A 3N36A 2XQRA 4RR3C 4W6WA 3T2OA 3T08A 1HXS2 1W8UA 3AMHA 2GH8A 1BJQA 1GLHA 1XU1A 3AZZA 4QQHA 4EWEA 1R64A 2RS31 2CDOA 3M70A 4GA9A 1N1TA 1W6QB 3NQHA 4XPVA 5D21A 2A3XA 3UETA 1MEC3 2VCAA 2MNGA 4JAAA 5FLHA 4PIYA 1FMD1 1MVEA 1OXCA 1UAIA 3AP7A 5JMOA 2G9ZA 1OF4A 2UU8A 1W9YA 3NNMA 4BQYA 2IFWA 3I2DA 1SBEA 2VD7A 5FRAA 5K4LA 4XTMA 1JH5A 1DHKB 1LHVA 2VUCA 2ZAAA 4YSFA 1W3VA 2BNOA 4D8MA 3LFMA 4F7ZA 4XHBA 4X6QB 2ZMLA 4YVSA 1PVXA 1RC6A 4UBGA 1AUYA 1V6LA 1AR61 1O59A 4A7KA 1AZDA 3HNYM 1MZ6A 1N3OA 1C4RA 4CDQC 5J37A 3ZR6A 1S0EA 3J7MA 4MGYE 1UZZA 3ZOIA 3HIFA 3ZO0B 2P6HA 3A0NA 1Y7BA 4QWNA 1YIFA 3POGA 1DZQA 3CLPA 4IE4A 5JVVA 4KL1A 4CDWB 3AZXA 4IEZA 4XFAA 5HXMA 1KS4A 4Y1XA 3MZHA 1QJFA 2IZWA 4YGBA 3ZXGA 2ARXA 1MZFA 4GJYA 1LEDA 2HEVF 3FHAA 5JUVA 1PM7A 1TME1 1Q8SA 5FJHA 2LRPA 1EUUA 5FKBA 2BVBA 5FZAA 4E2SA 3RZZA 3VZOA 2GNMA 3IIAA 1PGL2 2BRTA 2DCKA 2R073 1PO23 3P5BA 4AL9A 5FZ9A 3WNLA 2ZGMA 2WYFA 2IXKA 3J8F3 3KS7A 2DV9A 3PLQA 3SH5A 1RMU1 1VJ2A 3H8UA 5T55A 1L7RA 3LEKA 3SH3A 1QJY2 3C7HA 5EQUA 2V09A 4EYUA 4NRQA 2JG8B 3VBOB 4Y3OA 1O3TA 3EO6A 2VGDA 2Q1ZB 1AYN1 1UXXX 4QX5A 1EV12 4Q26A 1YQCA 4XF9A 3NWKA 2NMOA 1NLSA 3NKTA 4UFMA 3AVRA 2WLPA 3OGGA 2EVXA 4LULA 2K2SA 4QB1A 1U5XA 1LOCA 1AYM2 4GALA 4CXXA 3ZFGA 1QWRA 5J96B 2O8QA 4TLFA 1GMMA 4XJUA 1NX9A 3K46A 2Q8DA 3VBUC 3W58A 5T54A 4OMCA 4K6BA 5FP3A 1XU2A 1AR83 2YUEA 1RUI3 1K12A 1BBT1 2QTWB 1TEIA 3AP5A 4RD7A 4BJ0A 4CP2A 2UYAA 2YBKA 4AVVA 4UF0A 5L7OC 2BWCA 3MLKA 4HETA 4R4ZA 3KHCA 2PMWB 2WFF3 2XG3A 1Y4WA 3O5SA 2ENRA 3X29B 1VBA3 2J1RA 1WCSA 3SLIA 2BU9A 1ZM1A 5HCFA 3H3ZA 1BXHA 5FYBA 5TSWA 5ACA3 1G9BA 4ZU4A 3E97A 1E5HA 3EMRA 1F4AA 1OOPA 1OKQA 1RGSA 2W3JA 1UYZA 1VB4A 3G6JB 3NNJA 4XILA 3WQ0A 2PELA 2Y8KA 4PT6A 1ULEA 2EICA 3USSA 4ZONA 1J83A 4U2AA 3TEZA 1X33A 5FBZA 1YEWA 3W21A 1WMDA 4QM8A 4QDRA 1RTVA 5I8SA 2GC3A 3OEBA 4FPYA 3VZKA 5BNOC 5GLTA 4AFAA 3KHBA 4H3WA 4MYEA 5FY7A 1UZYA 4CSWA 3WW1A 3I59B 3TAYA 5AC91 3Q8CA 2O0OA 1LOFA 1RHI3 2YBSA 3THDA 4AVAA 4PJYA 3MIEA 3VHOA 3S5AA 2IVJA 3AJYA 1OKOA 5FKCA 3U4SA 2WIIB 2VMIA 3I2FA 5BNQA 1ZVFA 3NKGA 3LIGA 1OFNA 3KQ4B 3AMPA 4JTOA 1OURA 1W04A 5JSPA 3KT4A 4E4DX 1OPMA 3NV4A 1ENXA 3UYJA 1IHMA 4NIDA 2UY9A 2ET7A 1FPN1 4O61A 1H8TB 3K4DA 1X82A 3IMNA 4ZHNA 1V6NA 3KVAA 3VL9A 1D4M2 2WT2A 2OZ6A 5FQ0A 2BNNA 5SV5A 2XKPA 4AI1A 5I0DA 1M4WA 1VBD3 4FOVA 4FOWA 4QX2A 1WA6X 2VZ3A 1NY71 1HV1A 1IS6A 4IV1B 2CY6A 2D3SA 3C7FA 3GZUC 3SHRA 4AR2A 2JE8A 1JHNA 2VBBA 4P5HA 1UY2A 2W08A 1QOTA 3H8OA 1JYTA 1YI7A 1IKQA 3S5QA 4MGIE 3QLQA 1ZZBA 4AHXA 2HWB3 5LY1A 4QGNA 5IAVA 5JZGA 5F9TA 1ASJ2 1WBFA 4D6SA 3NSTA 1WMEA 3W9AA 3WDUA 3SQOA 4UBHA 3C7OA 3MO4A 3N9PA 4FBFA 1O91A 1RVF1 2V72A 4LNVA 1YFYA 3AK0A 1ZBA3 4YM1A 4XBNA 2NZ9A 4S2FA 1A3KA 1SDDB 3LEMA 2R0HA 3HPNA 4P9JA 3H0OA 1AXYA 5A32B 1PIV3 5L19A 1RUG2 1QOOA 4AEDB 2ZHLA 4PDWB 2R062 1ZBE2 2TNFA 3L9JT 1G9FA 3LPGA 4UWDA 2XJUA 4XBLA 5LA0A 5L73A 5FFOC 1DGRN 5LK5A 1KXGA 2VE1A 2LALA 3ZXAC 3UV9A 3J7NA 1AXZA 4PHZA 2AENA 1BVP1 4UYBA 5JDBA 2VNVA 3FC0A 1IG3A 3VDDC 4ORFA 4NHMA 3CJIC 4XUOA 4C0HA 1QY4A 1DFQA 4FP2A 5CFCC 2VMEA 4CEWC 2GP3A 2JX9A 1Y9MA 5DUWA 1O5LA 4S2DA 5CEHA 4XAEA 4FTBA 3NVCA 1JU3A 1EPWA 4Y22B 4V1PA 1ENSA 1QJX3 5DUVA 5A7OA 1H4HA 4AFMA 1SZBA 1VMFA 2WNVC 4PF1A 3RZLA 2QQMA 3CDZB 4QAWA 1PM4A 3ZYGA 3VBSB 3M3OA 3RFRA 5JPNB 5K0UB 3I2GA 1NCRB 3KMHA 3GF6A 3DPRA 4AVTA 3P1IA 3FFZA 1ENRA 2P3KA 3NJYA 1WW5A 4FFHA 1KQRA 3K48A 1CAVA 2G9FA 3BCWA 2MEV1 4IV3B 4NHKA 3M3EA 2GMPA 2ORZA 3M4FA 3MFAA 1KITA 4WVMB 4XFFA 1W06A 4DXZA 2YMZA 3WD5A 2XUEA 1Q3EA 1SLBA 4RHV1 4XF1A 3NNFA 2JDUA 4URTA 2RS52 2YU2A 5FR3A 5DZEA 3FMGA 2VAUA 2D6PA 5H9PA 2DFBA 2ZGRA 3HEIA 4QPIB 2RDSA 4YVWA 4KU7A 1SLIA 3L2YA 3M3IA 2WZEA 5DDJ2 3I2IA 1QJU3 1W6QA
chains in the Genus database with same CATH topology
1ZZ9A 3VKMA 4K9SA 1YI9A 2AR6A 1OD5A 2IXCA 1S1AA 2OVUA 3U10A 4F8AA 4ITCA 1YJLA 5CG8A 5E88A 3S7IA 3JD72 2ZX2A 1RUC3 5BNPC 1TNFA 2PAKA 1V9U3 2ZABA 4I0AA 1SCRA 3CEWA 1V6KA 4UW6A 5IK5A 5C9AA 5C4WC 3G7DA 2PLV3 4Y4YA 4PLOA 4EV0A 1VAKA 4ES8A 4BLIA 2LUWA 2TBVA 4RGGA 1MS9A 4EWAA 1RUH3 3GHNA 3UKNA 3WUDA 1PK6B 1AR93 1COV1 1AL21 2WT0A 1CR7A 3LAGA 4CDWA 1VIWB 3RYRA 1Z0HA 2ZA9A 1UF2C 4E27A 4KG8A 3VHPA 2VOWA 3NV1A 1QQP3 3P3PA 1OQ1A 2N7GA 1XYOA 3WV6A 3W59A 3APBA 4RQPB 4K40A 5E89A 4UXAA 4MXWB 5T5PA 3AXEA 2SLIA 2XB6C 1SLCA 1N3PA 1BVVA 4FPCA 1H0BA 2JG8A 3VBOA 1A78A 3E6BA 4R9BA 3WDVA 4YFZA 1BQPA 3T1MA 3AX4A 2X53S 2Q1MA 3H1WA 4P9YA 1X7NA 1LGNA 3LGRA 2JJ6A 3ACLA 4GB33 3R6SA 3H9AA 1LOBA 3FBYA 2VW1A 3WG2A 3ZSJA 3RYPA 4Z07A 4YFWA 2YHJA 1TMF2 4A2UA 3MIHA 3WP4A 4PIZA 4Q0UA 1RIRA 2QDNA 2BBVA 2HWC1 3ZXLA 4AI3A 1R091 4FQ4A 3HN1A 2VY0A 1DZRA 1JUHA 1YWKA 3B01A 2IWGB 2YV8A 1VR3A 2WJSA 5GALA 4MXVA 2I74A 1DBNA 1NQJA 2EXJA 3OD0A 1BMV1 4QPGC 3ZMOA 4WM7B 2QFEA 2RM21 1LJ7A 3FZ3A 1NA1B 1UIKA 2PHTA 4CP1A 4Y5Z0 2ARBA 1CAWB 1NCQC 4TSVA 3OF1A 2GNDA 3RWNA 1ZZ6A 2HWE3 1LHOA 3I59A 3GALA 4Q4X2 1H8VA 3AMQA 1RUF1 3VBFC 4Y20A 1S2KA 2D6KA 2XL7A 4WZCA 4HVQA 1OLRA 2X5IB 1BKZA 1HXS3 2H0BA 1H8TA 5BYNA 1PGW1 2R042 1I3HA 4JVAA 1B35C 1VLNA 2VUAA 1FOD1 4AQ2A 2O1QA 1J3QA 1LU1A 3SCFA 1C3HA 2WZR1 4IV1A 3BOWA 1H9WA 2FBEA 2WNUC 4EN6B 2GDFA 2R1DA 4W6XA 2D40A 5I8TA 2HKXA 4CYDA 1MZ5A 5CU1A 2D97A 2UWCA 1Z7S2 2VVFA 1MR5A 2GC2A 1G7YA 4FO9A 1O7FA 4Q4V1 3LA2A 3BIWE 2EAKA 1BZWA 2GN3A 4FTEA 4OI1A 4GH4C 3B94A 3IDCB 4OHZA 1UIJA 2GAUA 1MQTB 1MEC1 2OZJA 1A8DA 2ATFA 2VU9A 4RS5C 5A32A 4XIOA 4NWVA 1W6PB 4BQ1A 1CPMA 4AEDA 2BUKA 2RS32 3MIBA 4PDWA 4KU8A 2JG9C 3IWZA 3AYAA 3JCIA 5KXBA 4RFT0 1JXNA 5K9YA 1FMD2 4XXAA 4OI0A 1V00A 4Q0PA 5A33B 2ZGKA 4KWKA 2IXHA 2VW2A 3ZSLA 4IESA 1WCKA 1U12A 3O0VA 5FCCA 1UKGA 3ZXEA 1PO11 5AFEA 4QQLA 2WLQA 4M3CE 4Y22A 3ZYRA 5KC6A 4OFGA 3A4UA 1QOSA 2E7TA 5CIRA 3RQ0A 3VBSA 3CO2A 1AR62 5K0UA 4EN7B 2B46X 1NCRA 2LTNA 3GNEA 2NN8A 3PJQA 4KGQA 1AYM3 2ZX3A 2I45A 4IV3A 4AGGA 4WVMA 2OIIA 2A70A 3TOJA 1RUJ3 3MI8A 1D0GA 3VKLA 2C1FA 2NLRA 1TQ5A 3SCGA 4AHYA 5GLZA 4CEYB 5GZFA 1IQAA 4WVZA 2R071 4I2OA 4FPLA 2JD4A 1PO21 1TME2 2JDZA 4GWMA 4AFBA 5L36A 3AYEA 4R9CA 3J8F1 4EROA 4QPIA 1SBDA 3ZSMA 1S0JA 4CDXC 1OLQA 1U5IA 1ULGA 1NLRA 2ZX0A 1RMU2 4FPFA 4Q1RA 5JLVA 4AW7A 3M2MA 4XJZA 4FAHA 4JGYA 3TB0A 3AKSA 3JBG3 1AYN2 1BK1A 1UPIA 3MICA 1BYHA 4BIOA 1YJKA 3B02A 3NAPB 5KC5A 2VMHA 2PN5A 4XYXA 1DYKA 4XMAA 5JOYA 4LUKA 1AR81 2BFUL 2VMGA 2WKKA 4K20A 1G9AA 2UWAA 3UJOA 2WS93 2Q8OA 1RITA 1RL3A 1OA2A 4AHWA 2DVFA 1BBT2 1PK6A 1TNRA 4I0WB 3CL1A 2XH6A 1CAUB 4IEYA 4XE9A 3SISA 4AI8A 1REFA 4UW4A 1FNYA 4H7MA 5J98B 3WINE 2VVEA 1W0OA 3ES4A 1HQLA 1OI6A 2ZTNA 1VBC3 2FHRA 2Z42A 4JC1A 3J26N 4L97A 4N43C 4XEZA 3TRSB 4RQPA 4XQ4A 4LBQB 4MXWA 2CGOA 2E51A 1AR73 1F9KA 1XYNA 4AEJA 2EXHA 1ND2C 4IEWA 4DS0A 5AC92 3WHTA 5CBLA 3HT1A 1R1A1 2LM3A 2DVDA 1SFYA 1C5HA 2FMYA 4WM8B 1EYBA 2UYBA 5CFDC 1VBB1 1LCLA 1RUG3 1VBD1 1FPN2 2RS11 4QU2A 1J59A 1W6NB 1LRHA 3MPBA 4Q1PA 2CYFA 1XYPA 4JCKA 3MDPA 5GJ6A 2VNOA 5IK4A 1NY72 1WW6A 2Z69A 4ISRA 2HWB1 4SLIA 4YZ4A 3WLUA 4HZFA 4CZSA 1IKPA 1G8WA 5JSOA 1DQ1A 2NMNA 4N90A 1QJZA 3DN7A 4WM7A 4K7JA 4GXLA 4RR3B 3PVBB 1NA1A 3N7LA 1MACA 4INDA 4Q27A 1CAWA 2Q5TA 3MFCA 3VZLA 5D8AC 5JPMB 4YVWB 3ZMNA 1RVF2 4Q4Y3 2O8OA 1T6GC 2Z2SB 1O5UA 3FX3A 4IEVA 5C33A 3WG4A 4AVSA 1RUOA 4LTAA 3AMNA 3IDEA 1B09A 1X8MA 2PHDA 3ILFA 1J1TA 3ETQA 1FXZA 5T50A 2RS53 2HWD1 3H3UA 5BXXA 4OUSA 4KNCA 3ENRA 2X5IA 1W6MA 3ZFFC 4HSJA 1GFF2 4DQAA 2WSUA 2RJLA 3VHNA 5C9AB 1DF0A 3HMYA 4IXLA 4RSUA 4CDQB 4FQZA 2VXRA 3B93A 4FPHA 2DVBA 4HK9A 1IOAA 1AX1A 4PF5A 1RB8G 1HRV3 4G3YC 1S0FA 2OPKA 3JB4C 4CDUC 4SBVA 5I0SA 4YW1A 3R4DB 1EP0A 4JRAA 2Y26A 4Y1VA 4H14A 4NOTA 2ZGOA 1PVC3 4YYOA 4FCAA 2MEV2 3HAGA 2CWMA 2XBO1 5KXDA 3LWCA 4LHLA 1NE4A 1LECA 4RHV2 3ZVXA 3DF0A 4YW5A 3U0ZA 1NYWA 2HEYF 1UL9A 1QJU1 2D3PA 2F4PA 3MYXA 1GANA 4HSLA 3HWJA 4FPEA 4E4SA 1MQTA 1W6PA 5C8WA 1WBLA 3UL2A 1QKQA 4LLFA 3RMYA 4Z8BA 2P2KA 3BB6A 4YZ2A 4YARA 5A33A 3KT1A 5J09A 1RUC1 1OFSA 2QKDA 3OJBA 1V9U1 5SV8A 4JGZC 4FAGA 3V0AB 3H1MA 3VGIA 3VBUB 2PLV1 1ZNPA 1Y3TA 4K8FA 1OPOA 2B7YA 1NQDA 1PZ7A 3BODA 4P14A 4N7IA 3B9CA 3MLLA 4QM9A 2JENA 1HDKA 5L7OB 1RUH1 2ZACA 3RI8A 4AK3A 4YW2A 4PIXA 4BCUA 1AR91 1JBCA 3KCCA 3KCXA 5BV6A 4M3CF 1ND3C 1O3SA 1QXJA 1H9PA 2AGSA 4L11A 5T3NA 4PCRA 1ENQA 3ROUA 3B3QE 4FOYA 4N53C 1COV2 2D7FA 4OI4A 1AL22 5E1RA 3KB5A 4IEPA 4TYSA 4I01A 3MEPA 1QQP1 3WG3A 2DUQA 4CEYA 1KRIA 5BNOB 1TMF3 5EYYA 4BYYA 1ALYA 4C1WA 2ZJCA 3ZN6B 3QCWA 4YZ5A 1RUD1 2K9ZA 3TN91 2XVLA 3QOPA 4HANA 3VBRC 3ZYIB 4YZ1A 5EFUA 4AF9A 2GSYA 4Q0QA 4Y20B 4E9KA 3VBHC 2B42B 3BTAA 3WR0A 5I8YA 5KXCA 1X50A 2BYVE 4U36A 3D4KA 3P3NA 1OA3A 1XXNA 2HWF1 1PHMA 1LB2A 4IETA 4HVRA 3ZYPA 3NAPA 2DVGA 4Q4X3 1CPNA 4LBJA 1YIPA 3IDBB 2EIGA 2VPVA 4LBKA 2DU1A 4LR4A 3AYDA 3ZXDA 1QHDA 3ELNA 2JICA 3PJYA 3VZNA 3M1HA 2CL2A 4YRDA 4AG4A 1DGRA 2CTVA 1CAUA 2HWC2 4XF3A 3AKQA 4WBBA 4D7YA 1R092 1EAH3 2DCZA 4K1ZA 4I3PA 3AZVA 1BMV2 2D6MA 1LU2A 4FSJA 3ZN4A 4L99A 3ZIWA 2OA2A 4BWOA 1QDOA 3PHMA 3KLSA 4IQPA 2HWE1 3MF6A 1MS1A 2Y38A 4ONUA 2D98A 1J1LA 4LBQA 3WVJA 2VULA 1Z7S3 4F83A 1QXRA 4QQ2A 5BNNC 3VDDB 3FUOA 1DGWA 1AXKA 3CJIB 1JN2P 2VQAA 4CEWB 5CFCB 1RUF2 2A6YA 4GKXA 4P9GA 1SFNA 1PNFA 1SLTA 4WVWA 2PYTA 5T5JA 3WP3A 5CVRA 4ASLA 4WM8A 1Q8PA 2WNVB 1DGLA 2ZZJA 4Q4W3 2A3WA 3KSCA 1PGW2 2B9UA 2RS33 1G9CA 2AZ5A 1W6NA 3RMXA 1O4TA 1FMD3 1FOD2 3HR9A 2WZR2 2VVDA 2JECA 5CB7A 3FBMA 2WQZC 5A3LA 2ZBJA 2VNRA 3WP6A 3WDTA 4Z1VA 5KHJA 1CQ9A 2G4IA 4RR3A 1WCDJ 4HBNA 5GLWA 4GQ7A 4NVPA 3R0RA 3V0BB 1N1YA 1AR63 1N1SA 4Q4V2 3QH7A 1MS3A 3WQ7A 3WW2A 2YZ4A 2ZGPA 2GMEA 1REEA 4YGDA 4C90A 3LOBA 5C8CC 1AL0G 1YYNA 4JTNA 1MEC2 3JQXA 1AHSA 4FPOB 3ZN5A 2XJQA 4JGYB 3WDXA 1XE7A 1UN1A 5BNPB 1TME3 2YPJA 2XJSA 4JRLA 1OSGA 5FOJB 3FUQA 3L2HA 1HRI3 5C4WB 1IS5A 2XL9A 3JU9A 2ES3A 4XFBA 1YNAA 1GZ9A 2YY1A 5FOBB 1I1EA 3NW4A 1I5ZA 4CDQA 2ZGNA 1PO12 1X36A 1K5MC 1R081 1QGLA 1ZX5A 2QDRA 3JUUA 1VBE2 1HX6A 3WG1A 5T5LA 1AYN3 4XZPA 1LOEA 4IEOA 5GLUA 1X8EA 2QZ3A 1JYIA 1SEFA 2P37A 4COZA 1W39A 1C57A 4WV8A 1Q5OA 1RUJ1 1C28A 1OMIA 2W39A 4QT6A 3N3HA 1V6IA 2GN7A 1CONA 4Y26A 2YYOA 3OD4A 1ZA4A 5J36A 4EN8B 4LT5A 4HN1A 2VH9A 1YHFA 1C1LA 2R072 4LBLA 4HFSA 1PO22 1JOJA 1BBT3 1C8M1 3OY8A 2WQ4A 3J8F2 4UW3A 3KGLA 4X6RB 4BMBA 4ATEA 5A3MA 3VZMA 4EN0A 5EXOA 4META 4L8QA 1VRH1 4OHYA 2RMU1 4DRRA 1XNBA 1H4GA 3H50A 3JBG1 5GZDA 4BPZA 3OBTA 4YGCA 3N7MA 2RR11 3WHUA 2TEPA 3ZFEC 5JIUA 2G9GA 1IGOA 4MZUA 4NN0A 4N7UA 1MS8A 3V0AA 2JEMA 3VBUA 4AFDA 3RPQA 1S0BA 1DDLA 3KM5A 4YG0A 1BEV1 5AC93 2WS91 4N9IA 1HKDA 5L7OA 2OUHA 4I30A 1AR82 3LOIA 4I0BA 3OTFA 4QPGB 2XPJA 1J3PA 5HBAA 2GNBA 2ZGUA 1FPN3 4B7KA 2R49A 3MPPG 4GMP1 1ZREA 1NCQB 5GKAC 1RUE3 5BUVA 4E4ZA 3V65A 1NG0A 1VBC1 4MLOA 1H30A 2D5FA 5BNOA 2Q30A 2HYKA 2GU9A 3FLRA 1URXA 2YDEA 4KBBA 3WCSA 1D4VB 1GR3A 3ZIXA 3ZN6A 2QQPA 1AR71 4HKLA 3V64A 3TYJA 3LA7A 1PZ8A 3VBFB 5FTTC 4OHVA 3LZZA 4JDMA 4QGMA 4XQDA 2D93A 5EWSA 4QD2A 4QQPA 4LE4A 4RGAA 5FLIA 4OZXA 1XRUA 2ZAHA 4XF4A 5FPZA 5CAZA 5KHHA 2JKBA 1UU6A 1KJLA 1REDA 2ZMKA 1W6MB 3SMHA 1R1A2 5J48A 1B35B 3ST7A 2PA7A 2MPFA 3POYA 3HT2A 2VUJA 2WNUB 4M00A 2D3RA 3WZ1A 3IKWA 1VBB2 5CG9A 1VBD2 1VB2A 4BZ4A 2RS12 3ZSKA 1LESA 2PHFA 5JSRA 1GKBA 2BVVA 4YLZA 2HWB2 5I0UA 4QHBA 4M3CB 5LRRA 1SLAA 2XJPA 1DU3D 5EJ3A 4IERA 3KQRA 4GH4B 4YVSC 5J3UA 2BW8A 2Y0IA 3FJSA 4DPNA 4H7LA 3RJRA 4Q4Y1 5HXVA 1G86A 4RS5B 2ZHNA 4HN0A 3C3VA 4K21A 3B00A 2JG9B 2PAMA 3WP5A 1CD3G 2PHXA 1LHNA 3SCHA 4XXPA 3HD8B 3U11A 4S2GA 1GNHA 4DMIA 1RINA 5DG1A 1QH6A 2MEV3 4R8HA 3RDIA 3OGJA 4XMIA 3VDDA 3CJIA 4MGKE 4CEWA 5CFCA 4RHV3 4X8NA 5FDBA 4Y1UA 2DFCA 2HWD2 3GBGA 3AKPA 4ATFA 3TNPB 2WA4A 2FZ1A 5EZWA 2BPA2 2WNVA 4J1XA 1QJY3 1DGWX 3BOPA 1WLTA 4DB5A 2QZ2A 4LBQD 1HRV1 1EV13 1FT9A 4GMP0 5AVPA 3ILRA 4MSVA 5GZEA 3PVOA 1UMZA 4LHKA 3UJQA 3VUOA 1OHFA 1LOAA 2D6NA 4S2HA 3POWA 3ZX7A 1JUIA 1QH7A 1PVC1 1LKNA 3N4MA 2YROA 2KM2A 2ZKLA 3MW2A 5JR7B 3EXUA 4YW4A 3ZPYA 3ZFGC 3V0BA 2RHPA 4D94A 4CDXB 2DVAA 2XBO2 4CTEA 1IS3A 1G9DA 2P3JA 4IEUA 5KHKA 2E63A 4PLMA 4B4PA 2KA3A 1WLCA 5GM0A 4COVA 1GZWB 3EBRA 1QJU2 2R0FA 2H0VA 5GZGA 2XJRA 4QQOA 3E5XA 1H2KA 5BY5A 2CAVA 1DG6A 1AVBA 2ZGQA 3R05A 4COUA 3WCRA 2WFPA 1XE8A 4ISQA 5BNPA 4KWJA 1GSLA 4LLOA 4AGRA 1OOPC 3A0KA 3QD6A 4I09A 5AFBA 5C4WA 1PMIA 1DQ2A 1ZRDA 2B39A 1V9U2 4AI2A 1F31A 1WUVA 2IXJA 1Z78A 3LB9A 5JCTA 1WLWA 2IC1A 3KGZA 2EF6A 1N47A 1UU4A 3LSDA 3U4XA 1RUI1 4YM0A 4RA0A 1LOFC 1SACA 2YGLA 3TNQA 3IPVB 1WW7A 2ZS6B 4DY3A 1GQHA 1O4YA 4P9LA 1FV2A 1Q8VA 2WFF1 1RUH2 4HL0A 3RG0A 1VBA1 1J58A 1AR92 1D4M3 5ACA1 4ZKTB 2Z79A 4JQRA 5DZFA 2ZGTA 1Y43B 4IEQA 4YW3A 3BALA 4ZXKA 2ZHKA 3S6PA 4LO8A 3M7AA 1GYKA 3J4UH 4G9SB 4GWNA 2BFUS 4XW3A 1FATA 3E5QA 4N43B 1FYUA 5ABJC 2VOVA 1QQP2 2GZWA 1ZRCA 4XIKA 3V56A 2C0ZA 4I3GA 1ND2B 1VALA 1ASJ3 1RHI1 3EHKA 3EQEA 4PBOA 2JE9A 3GZAA 1RUD2 3TN92 3CJXA 5JZGC 2A6XA 1LHWA 1O3RA 1V70A 3ES1A 4FXKB 3H7JA 5JOZA 4FP3A 5CFDB 1MS4A 2RE9A 3WDWA 4MGZE 4IL7A 3IN9A 4E2GA 5LEKA 2HWF2 3INAA 4OULA 2NYYA 3MIDA 2R063 1ZBE3 2E53A 3S0MA 5FPXA 1A6CA 1GQGA 2VW0A 2ZX1A 1RUF3 4XFGA 4Y24A 2V5YA 2PHRA 2CWSA 3I54A 1WA4A 5KHIA 4QPGA 1EAH1 5F5QA 2TUNA 2QVSB 3H1YA 4M0HA 4NHLA 4Q0SA 5HCBA 5DZGA 3RS6A 4AQTA 1NZCA 1POV3 3WXPA 2GALA 3B5LB 2EXIA 1NCQA 5D8AB 1ZBA1 3GHMA 3JZVA 1YRZA 4AWDA 3E5UA 4HLTA 5FMOL 4JDNA 3VN4A 1KS5A 2GC0A 3TBDA 1FOD3 4YG6A 2WA3A 3I8TA 3VL8A 1HLCA 4B4QA 2D6LX 1PIV1 4BMEA 1U0AA 1Z7S1 3VBFA 2HWE2 3DPRC 3JQWA 3PVNA 3WUCA 1O4ZA 2D43A 2EA7A 2UY8A 1UD1A 1S0DA 1HV0A 4YG3A 2PFWA 4KG0A 1ZZ7A 2XHKA 1V6JA 3ZFFB 1N1VA 1ULCA 4BHPA 1NXD1 2AUYA 3NL1A 4AFCA 1N3QA 4Q4W1 1B35A 5DDJ3 4OHXA 1QJX1 4FPKA 5KHGA 1A8MA 1SQ4A 2BWAA 2ZCWA 3ALQA 5IK7A 4YVWC 3LCPA 2WNUA 4R52A 4CDUB 2EXKA 3ZXJA 2ZX4A 4XJAA 3FLTA 3WQ1A 4AYUA 2H6CA 5KWRA 3DKWA 3JD73 5H9SA 1MS0A 5J7MA 2X8KA 3AP4A 5H9RA 3Q9OA 1NE6A 4M3CA 1Y9QA 4GKYA 2F6BA 4OI2A 1VAVA 3D5OA 2E9QA 3ZDSA 1PO13 4AVBA 3B69A 4GH4A 1RJ8A 1GZCA 5C9AC 4B8EA 5E8AA 1VBE3 4RS5A 1E57A 4LO6B 2BTVC 3HQXA 4XFIA 3VKNA 2EALA 5KBFA 2FZ2A 3OY8B 5FREA 1LODA 2JG9A 4AHZA 3WDYA 1HQNA 2XVKA 2HEWF 2VNGA 4LA2A 2VG9A 4O9GA 4CDWC 1YFUA 4XDQA 4JGZB 4COWA 4LE3A 4OLLA 1GBGA 3AMMA 3KCYA 1HRI1 5I0TA 3PTYA 1LGBA 1IPKA 5IUQA 1YLLA 2R32A 2R16A 3LA3A 1YFXA 1AJKA 1U5YA 1O3QA 1M06G 1ND3B 1I6XA 3AKRA 2JG8C 5BPXA 1NXMA 4L92A 3VBOC 4XF0A 2XWBB 1R082 4N53B 4EN9B 3AYCA 2K0GA 3ZSEA 3MIGA 2D44A 3OYWB 4A3XA 2SBAA 2Y0OA