2VUJA

Environmentally isolated gh11 xylanase
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
195
structure length
195
Chain Sequence
QTCLTSSQTGTNNGFYYSFWKDSPGTVNFCLQSGGRYTSNWSGINNWVGGKGWQTGSRRNITYSGSFNSPGNGYLALYGWTTNPLVEYYVVDSWGSWRPPGSDGTFLGTVNSDGGTYDIYRAQRVNAPSIIGNATFYQYWSVRQSKRVGGTITTGNHFDAWASVGLNLGTHNYQIMATEGYQSSGSSDITVSEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GH11 XYLANASE
publication title Engineering Hyperthermostability Into a Gh11 Xylanase is Mediated by Subtle Changes to Protein Structure.
pubmed doi rcsb
source organism Escherichia coli
total genus 55
structure length 195
sequence length 195
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2008-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vujA00
4NPRA 5EJ3A 1BCXA 4XPVA 2NQYA 1OLRA 2D97A 4HKOA 3WQ7A 3WP5A 3VL8A 5K9YA 4HKLA 2QZ3A 1XNDA 3O7OA 1H4HA 4HK9A 4S2DA 1UU5A 1TE1B 1UU4A 2D98A 2JENA 2DCZA 2QZ2A 1REEA 3HD8B 4IXLA 1OA2A 4XQDA 3WP4A 3MF9A 4S2GA 1OA4A 3ZSEA 2VUJA 3B5LB 3VZMA 1C5IA 4XQ4A 1HV0A 2DCYA 1T6GC 3RI8A 4H7MA 1OA3A 3VHOA 3WQ1A 2VG9A 1XYNA 3VZOA 3WXPA 3VZLA 1UU6A 3AKPA 2Z79A 1REDA 3EXUA 4HKWA 3VZNA 1YNAA 2BWCA 1C5HA 2VULA 3AKRA 1H8VA 1XNKA 1XNBA 3AMMA 1PVXA 2B46X 2BWAA 2DCJA 2DCKA 3VZJA 1REFA 1HIXA 3AMHA 3WR0A 1BVVA 4XQWA 1F5JA 1XXNA 2C1FA 3MFCA 3VGIA 3WT3A 1XNCA 1AXKA 1H1AA 1ENXA 3AMQA 1BK1A 1HV1A 3WP3A 3VLBB 1KS5A 2VGDA 1H4GA 3AKSA 2BVVA 3WQ0A 3VL9A 1W2UA 2F6BA 3LGRA 3RI9A 1XYPA 1UKRA 3WX5A 1H0BA 2DFBA 3VHPA 2BW8A 1KS4A 3WP6A 5K7PA 1OLQA 3VZKA 1XYOA 4S2FA 3AKTA 3AMPA 3LB9A 3M4FA 3AKQA 4S2HA 3WY6A 3MFAA 3B7MA 1IGOA 1QH6A 4HK8A 2DFCA 2JEMA 3MF6A 1M4WA 2NLRA 2B42B 2B45X 1QH7A 5HXVA 3VHNA 1NLRA 2JICA 3AMNA
chains in the Genus database with same CATH superfamily
4GJZA 4RS5B 1PO21 3M3IA 3NMBA 4M3CE 3JD72 2D97A 5IUQA 3VHRA 1AX2A 1NA1B 4YZ3A 3VKNA 5C9AA 2PHWA 3QD6A 5K9YA 5GLTA 1CESA 1US3A 4HKLA 5CFCB 5JOZA 3CF6E 3VKMA 2C4XA 1RUF1 2ZAHA 3AP4A 2RS12 3A23A 1NE4A 4HG6B 4HN1A 5F2WA 5FFOC 4BMBA 1ZRDA 3O7OA 4UXAA 3H1MA 4Y1XA 2E7AA 5JCTA 2TNFA 3KD4A 2CDPA 1PO11 4AFDA 2RS53 2VUCA 4NN0A 1AR83 1OPOA 4WM8B 4YVSA 4NRPA 3QH6A 4QAWA 1POQA 2ET1A 1UY0A 3MF9A 4LHLA 3ZOIA 4AOCA 4CXYA 1XBFA 3ZM8A 5A3LA 2GU9A 2WS92 2V5YA 1W6OA 4W6XA 3P5BA 1GNHA 1SFNA 3POGA 1QWRA 2E26A 4QX7A 1RL3A 1HB2A 1W28A 2BGPA 1MS0A 1DZRA 5T5JA 5LB6A 4MG2A 5DUWA 4RA0A 4LO7A 2WFPA 1PVC2 4LHNA 3MBWA 5FMDA 3DKQA 3WUCA 4BQ5A 2J1VA 1N1SA 1JYIA 4DINB 1UOBA 3T2PA 4HKWA 4Y20A 5GM0A 4LQRA 1OOPA 3POYA 2BWCA 1ULFA 2HWB3 2K46A 2FCTA 1X36A 4CDUC 4I3PA 2PQSA 4UFHA 1R64A 2DCKA 2C0ZA 1RUG1 5LW9A 2IXCA 5FYHA 1VPHA 2JB8A 5SV8A 4M01A 4AGGA 3C7HA 4OULA 3HN1A 3OGJA 4K7JA 5DZGA 1WUVA 2DUQA 1JI6A 2BEOA 4K8FA 4NJ4A 4KWLA 1F15A 5F3IA 2GNBA 4L9BA 1VIWB 5FXZA 2P37A 5CNAA 4A3ZA 4KBBA 1EP0A 2WABA 4CCJA 2R063 2VGDA 3ZXDA 2P2KA 4CDUB 2F17A 5HI0A 4GQ7A 2VZSA 3I2GA 1YI9A 4W8JA 3ATGA 2Y26A 1W6PA 3N4MA 2QQWA 1ZRIA 2JD4A 4FFHA 4IEPA 1C3HA 1SLIA 3G7DA 1STMA 1QDOA 2A6XA 1RUOA 4EV0A 4K9SA 3FHAA 1H0BA 3DL3A 1YEWA 2ZEWA 4E4ZA 1GP6A 1VAVA 1W0NA 2VAUA 1CPMA 2Y33A 3NNMA 1WD3A 4IETA 5FZ1A 1XYOA 1GYKA 4ZZ5A 3AYAA 2AZ5A 3PIGA 4LR4A 4LUMA 3GBWA 4CU8A 3HQRA 2E32A 3VV1A 4PJYA 1VBA2 1RIRA 2G9ZA 2ZBJA 4MGYE 2XG3A 4QPIA 1J58A 3POSA 3Q8EA 3AVSA 1WWYA 4AAXA 5B4NA 1CJPA 4HANA 3BPSA 4N9HA 3JBG3 1K12A 4IDZA 2A70A 2Z5WA 3MEPA 2XL7A 1BZWA 1OUSA 3BODA 3M2MA 3PVEA 4X8NA 5GLZA 3H1YA 4B7KA 5BNPA 1ENRA 2DVAA 3CDZB 5A7OA 5FUPA 2NM1A 3HWJA 1JBCA 3H8UA 3LDRA 4MGIE 1GU3A 1QQP1 3Q8BA 2VNOA 2WZ8A 4MGSA 4CPBD 1UZ0A 1VBB2 3ZR6A 2LALA 2RHPA 1W0OA 1TMF2 5FIXA 5BUVA 4LUKA 1PHMA 5FWEA 1GKBA 1GZCA 4CUGA 1ACCA 3K3NA 3NJYA 3KZ4C 1ZBA2 5EV7A 2BPA2 2JG8C 5HXMA 1OFNA 3LKJA 4E9KA 4Y24A 1Q5OA 2VOVA 1RUI1 5DZEA 2AH2A 2F4LA 3N7KA 1AR73 1VBC1 4LO4B 4NHLA 1W8ZA 3N3HA 2J1EA 1UOJA 4JDMA 2HWE1 5IWFA 3E1F1 1FYUA 1EUTA 1W8UA 2KXLA 4XFFA 1LESA 2K9ZA 2JG8B 3I97A 4RYDA 2AACA 2PELA 3MYXA 1RUJ3 4LIVA 4ZS3A 5IAVA 2B9UA 4YG3A 3K4ZA 3DXTA 3KCCA 3PUQA 5FYYA 5FLIA 1W8WA 1Y7BA 4RR3A 1HW5A 2V09A 4B4RA 2WO7A 4JDOA 4IW3A 1FT9A 1UY1A 1NQJA 4UF0B 2XJPA 1IHMA 3TAYA 5CZKA 2JG9C 1W03A 2QQKA 5EWSA 2RS51 1KJLA 2P3JA 3LF7A 5J36A 3D0SA 3BOWA 3TYJA 4ASMB 1AR81 5FZIA 3D3AA 5F5QA 2KA3A 2CAUA 1S0FA 5BV6A 3U78A 1RUC2 2VQAA 4YFWA 5EZWA 3TN93 4AEDC 1T2XA 1WCDJ 2LROA 2C1FA 4Q0SA 4V2WA 4QX2A 5DZFA 2IXHA 3U11A 5FUIA 1UX6A 1PZ7A 1SDWA 3FN9A 5F5CA 3OGVA 2JDYA 4OVEA 3KV4A 4L92A 3NRUA 2I07B 2JG9B 2HWC2 3RWKX 4FAGA 2WZR3 4N43A 2ZX3A 3WF2A 3AP6A 2AC1A 1KDMA 2JDPA 2VMDA 1G8WA 1QJX3 3H0OA 2HWB1 4AEDB 5C8CA 2VOKA 4CTEA 1DIWA 2MEV3 1GANA 1U0AA 1OMIA 5A3OA 1GWMA 1LOCA 1Q8QA 2X05A 1UYYA 4E4SA 4BISA 1OLQA 1HXS2 1G86A 4RHV3 2NMNA 5ANNA 4PDWC 1H8TB 5FLJA 3U75A 3T4HB 5FZDA 1FOD3 4XTMA 1G9AA 4PHZA 1WD4A 3OUHA 4P9GA 4ZHNA 1CN1A 4L11A 4GH4C 2A7AA 4LE4A 1LHUA 1SCRA 2WFF3 3HNMA 1DFQA 5CKMA 3SH4A 3SKJE 2BDRA 1U5IA 3I2JA 3LA7A 4Q0QA 3WOGA 2HYXA 3RGBA 4ZU4A 4FTEA 3LZZA 2R061 2BFUS 3SH5A 3CLPA 3CL1A 4ASLA 3GM8A 1I1EA 1GZ9A 1M4WA 1X7NA 2YV8A 4YG6A 5FV3A 1ZX5A 3C8XA 4MGKE 4BLJA 4NOTA 4QKFA 2A71A 1OF4A 4FOVA 3VHNA 4PDWB 1N3OA 4ASKA 1PK6A 3SISA 4FPYA 4A6OA 1JZ2A 2VW2A 1OLRA 3I2OA 1NCQC 3M3QA 4BE3A 5FP7A 4QB2A 4GH4B 2A3YA 3OPZA 4BM8A 4EZ4A 1Q3EA 1UO9A 2W2IA 2Z2SB 5DQ0A 3ZFGA 3WW1A 4H55A 5FZ0A 3TWIA 4FOQA 5JMCA 1YUDA 3VDDA 3WINE 4E2QA 5JLVA 3VBRA 3WVJA 1JYCA 2WO1A 3PVOA 4BQ2A 1VBD3 2O1QA 2AGSA 4HPKB 1DQ4A 2PN5A 4LKEA 5H9RA 3WF0A 1UYPA 2D6MA 1SPPB 1K5MA 2QZ2A 3JBG1 5GKAC 2JIJA 1O59A 3ECQA 5HCBA 4AVVA 3WNLA 1P8JA 3L2HA 2CGNA 3WP4A 1MVEA 2AEZA 1C8NA 4K6BA 5T5PA 2HWD2 2BNOA 4P14A 1RHI2 1SLBA 4B3NA 1NCQB 5C3RA 1FPN2 1HV0A 3U4SA 1H30A 2R6QA 1KFXL 1SEFA 1XE8A 2WNUC 3OCPA 4W6WA 2JKXA 4CEWB 5F1RA 2WR9A 4H7MA 3O1VA 2B8MA 2IFWA 2PHFA 2VQTA 2YBSA 4GWJA 4YM1A 4DXSA 2VO5A 4CSWA 4YZ5A 3H9AA 1IZ3A 3RZJA 4CU7A 3I2FA 4NO4A 4Q0UA 1YJLA 3M7AA 3OBAA 5FMBA 1KRIA 1GWLA 4WM7A 2VH9A 3LFMA 1YNAA 2RS33 4W50A 4Z92B 2GH8A 5FKBA 3ZSKA 5D1IA 1AR71 2V5DA 3LEMA 4F83A 5FMOL 4OI1A 2YB7A 4LK6A 5FKCA 4ZU7A 1O4ZA 1HIXA 5DUUA 4RQPC 1XSRA 2ZCWA 2WNUB 2VMFA 3ACHA 1XXNA 2RR13 4X6QB 1MS8A 3WNNA 1UZWA 2HKXA 3RZGA 1POV3 2TUNA 1OD5A 4RFRB 2YYOA 4CU6A 2NMOA 1ZBE3 1NX9A 1ENXA 5A70A 1RUJ1 5FP8A 3OYWB 1A34A 2PLV2 2Q30A 1UN1A 1RUE3 2JJ6A 2G1MA 4MX3A 3ZIXA 1XU1A 4K1ZA 2IUWA 3N36A 2DUOA 4CDWC 4QM9A 2W46A 1KGYA 1BEV3 1WMFA 4RQPB 4QKDA 5E16A 1SBFA 3HPNA 2D5HA 1N1TA 1GZWB 5KHGA 5FYIA 4BCUA 4XCAA 4EN8B 2MPFA 1WLDA 4NWWA 5BPXA 3A0NA 1LEDA 3TN91 3UJQA 4B29A 4B4QA 3MLLA 1QXRA 3AKTA 2IZWA 3ZKUA 3AMPA 2WAOA 3KQ4B 4GB32 1H6YA 1AXYA 2GC0A 3HQXA 2ZGOA 3AM2A 4K3UA 3WUDA 3M4FA 1YJKA 1QJY3 4ORFA 3AKQA 4NE9A 4CDWB 2WN2A 1X8MA 4CCKA 3KM5A 1E57A 2R042 3ES1A 2WZR1 4KU7A 1ZM1A 2OYZA 5IK8A 1AYM3 2VCMA 5I0UA 3Q8AA 4CCNA 4WZCA 2XKPA 5FK7A 3T2TA 1WA6X 5E89A 1HQNA 1QH7A 3VBOC 4D6RA 1JU4A 4DEQA 1QJX1 1PGSA 2VQ0A 1GUIA 1OI6A 5FZCA 3ZFFA 2ORZA 4YWAA 4NPRA 2MEV1 4Y1VA 5DAWA 5K4LA 2XJVA 2PHDA 4GZ9A 2Q1MA 4O65A 4RHV1 3CJIA 1FOD1 1CZTA 3B9CA 3KLSA 1BJQA 5FY1A 3UETA 4KWKA 2C5DA 5E88A 4JKMA 4AI1A 4AVAA 1H2MA 2WFF1 3FE5A 3ZYFA 2QFEA 3BU0A 3BVCA 3MIHA 3M3EA 2VTXJ 3VBOB 5IJRA 2D6LX 3SNMA 4XF3A 5L9VA 1UNBA 1WLCA 3E97A 1A3KA 3IDAA 1DQ5A 1BBT3 3BTAA 1DDLA 3WD5A 3OUIA 3T4VA 4OMDA 1D2SA 4GA9A 1OA4A 3SXWA 1YO8A 2XHKA 2UWCA 1PM4A 3J8F2 3OG2A 3C7OA 4QX1A 4WV8A 4XJUA 3CIHA 1J83A 2BERA 3RI8A 5FJKA 1O91A 3ZN5A 2GMEA 2W68A 3I59B 1UXXX 1J3PA 2ILMA 2CU5A 5C9AC 2RDQA 2QQJA 1SZBA 2I74A 3DPRB 3OGSA 3V65A 1LCLA 2J1RA 3NV1A 2XR4A 4B7EA 3C7FA 3LE0A 2X8KA 2VL4A 4PLOA 2WWJA 2BFUL 5J1XA 1LHVA 1SMVA 3W5NA 2GC3A 4XDQA 5DG2A 1VBD1 1ULCA 1NE6A 5A3TA 5C8WA 2GAUA 1XNKA 1R082 4YVSC 1FMD2 3POJA 1Y9QA 3OBZA 3F2ZA 2DVFA 3GCWA 2ZGNA 1YXWA 4GWMA 1NZCA 5F7UA 3K75B 1F5JA 5H9PA 5IVCA 4IL7A 4JAAA 4Q4V1 4DOUA 4IEWA 5A6ZA 4MGZE 2UURA 5FZHA 1HN0A 4MVTA 4AR2A 5L7OA 4PI2A 2ZAAA 2ZHKA 3LD8A 5EJ1B 1H4GA 2Y6HA 4XAAA 2V73A 4BLIA 5JDBA 2QQPA 2HEVF 3BU7A 4YVSB 1OOPC 4BQ4A 5J48A 1R1A3 5FQ0A 2ATFA 4GULA 3U37A 2GNTA 4Q8KA 2RS31 4QB6A 1JODA 1W6OB 1V6JA 3RI9A 4WVWA 1CZSA 2DCTA 3GNEA 3DUIA 1DGRA 2ZX1A 4NHYA 3K2OA 1UKRA 4IEUA 3HOBA 5C5TA 1PZ8A 1YRZA 4IESA 4Q0PA 4A45A 2E6VA 3OBTA 2WO3A 3WG1A 4LBQB 3WP6A 1DQ0A 2EIDA 4FFIA 2OT7A 1W6MB 2RR11 1CAVA 2OUJA 4KU8A 1H2NA 4P9JA 2JX9A 5FPUA 1POV1 1MEC2 1LNSA 4EWAA 5D8AA 1IQAA 1ZBE1 5A3PA 4Y20B 3PNAA 3UGFA 1OOPB 1VRH2 1SBDA 4LOSA 3JU9A 1S2KA 3U07A 4QPYA 1IGOA 1RUE1 1HB4A 2HEWF 2ZEYA 3AP9A 4I0AA 4E27A 3MGUA 5BY5A 1BEV1 1AL0G 1KS5A 1WKYA 2XLGA 4Q26A 1AL23 4J6GA 3RVHA 3VUOA 4I0BA 2R072 1E5SA 1FATA 4ATFA 4MZUA 1H9PA 4CPBA 4K8RB 2LM3A 4NRMA 2DU1A 4QXKA 2EXHA 3ZMOA 1YIPA 1DYOA 2D93A 2W95A 2E53A 3FHQA 1Z7S2 1NY72 4QPIC 4BXFA 3ZN6A 4JHZA 3J7LA 3JD73 3ZYGA 1UU4A 1QJY1 5LBEA 1C1FA 3ORJA 3PLQA 3E6DA 3PJQA 1XB9A 5JI7A 4JGYA 2OW4A 2X29A 5BNPC 1EAH2 4BHPA 4JQTA 1VAMA 4AAPA 3GF6A 1PGW1 2RMU2 2RS13 1AYM1 4HXCA 1ND3A 5GZEA 4FPFA 3ZSEA 4FQZA 5FPVA 1JZ5A 3LEKA 4B1MA 3O1UA 2Y60A 3T2QA 3IPVA 1E5HA 1FNYA 4KNCA 4Q1PA 4NIIA 3VD3A 1Y9GA 1URXA 3PIJA 4QPIB 1ZZCA 2QVSB 2WAAA 3IM0A 4EE2A 4N53C 1TQ5A 3NNJA 3NKGA 4HZFA 4QGNA 2WLPA 1QHDA 1VBE2 3I4IA 3WCSA 2B39A 4G4FA 1UY3A 2ORXA 2PMWB 4NAOA 2XUMA 1JYTA 3S57A 1DQ6A 1APNA 2ETEA 2XBO2 1UL9A 3MIEA 4CA9A 4JC1A 3J7HA 5FOBB 2P6CA 1V6MA 2YROA 4XF9A 1PVC3 4AFCA 4IV3A 4L97A 3CJXA 5FP3A 3MHZA 2JDNA 2OQ7A 1BBT1 4FI9A 4OI2A 1VRBA 1LGBA 4Q27A 2ENRA 1A8DA 4R8HA 1V70A 3D4KA 5A80A 1XPWA 5A3WA 4BXSV 4N53B 1CGPA 3T30A 4NIHA 2MHFA 3GYDA 4OZOA 1GOGA 4RR3C 2VVDA 5J09A 3BCWA 4DY3A 5FPAA 1JN2P 3QLQA 5JZGA 1W9TA 2ERFA 3FUOA 4M4RA 3LEIA 2W92A 1ZRCA 2TEPA 3GDBA 3OSDA 5LK5A 4JDNA 3ZIWA 2V72A 1NZIA 4M3CA 4DUXA 5KXDA 4P08A 2HBTA 2BTVC 3I49A 1LOAA 4JKLA 5JOWA 2EF6A 3IT8A 2YXSA 5GZDA 5LRSA 2VVEA 4NWVA 1LHNA 1BK0A 1WW4A 2R1BA 3FWEA 4RR3B 1JZ7A 5E1RA 4NPLA 3O1SA 5FLHA 4ZKTB 1UMZA 1DQ1A 3AP5A 2A1XA 4Q0VA 2X09A 2BNMA 2YU2A 3GCXA 4XJ8A 4AFMA 4N43C 2YPDA 5G05L 4E8DA 1W06A 3I2KA 2WNVB 5FY8A 4COZA 3GGLA 4AWDA 2DURA 1R1A1 1O5LA 2B42B 1HRI2 1VBA3 4HVRA 5C8CC 4N90A 2WT1A 3RJRA 4FPCA 3JXSA 1JH5A 1HQLA 3AZVA 4XPVA 4R4ZA 4OUEA 5ABJA 4BMEA 2CTVA 3I3EA 5FYSA 3WP5A 5B4XA 2ARCA 3UYJA 1MACA 3ZXLA 3IKWA 1VBB3 4L8QA 4QKBA 3DECA 4N43B 4XFIA 1TMF3 4WVMA 2CWMA 3EHKA 3N9LA 4I2OA 5DXDA 1Q8OA 3K46A 4MLOA 3ZXAC 1VB4A 1YIFA 1O7FA 1RUD2 1ZBA3 3NV2A 4LNVA 4QQOA 3T0AA 1CZVA 1D0GA 3LIHA 1W05A 3BTZA 1REEA 2ZACA 1C8M1 1LB2A 2PTMA 1ZRRA 3KT7A 3I8TA 2WYFA 4AVBA 4NIAA 1PK6C 2V4VA 2DCYA 3WDUA 5A3NA 1GQHA 1AL21 3MV01 5A7QA 4FPEA 1POV0 5A7WA 2JB4A 3ZFGC 1LHWA 1TEIA 2W91A 3BIWE 3POIA 4HN0A 4LK7A 5EYXA 3THTA 1PO22 3VDDC 3CMGA 4Z1VA 4K1YA 4LBMA 2VW0A 4Z07A 4QM8A 3VBRC 1LAJA 1J84A 4XF4A 3VZNA 1CAWB 4IE7A 1C5HA 3B02A 4FOWA 4A6SA 1ST8A 3JD71 4AI8A 2GN3A 1AR91 3PUSA 1RUF2 1Y4WA 1OVSA 2D6OX 2BWAA 3VD9A 1PK6B 1LULA 4QWNA 1OT5A 1QKQA 1W04A 1WMXA 4Y1YA 3SC7X 3LPGA 1KXGA 1DLLA 1OQDA 1ZZ7A 2RS11 4XXPA 3ALQA 5FZKA 1F4AA 5CB7A 3EYPA 4FVVA 4XIOA 4EN0A 2A3XA 2BYVE 3LSDA 4C90A 1S0BA 3JQWA 2OXBA 5AVPA 3UGHA 1X50A 3WT3A 1B35A 3ZFGB 4AE2A 2JDMA 3TEYA 3VDDB 3ZFEA 3VBRB 5CFDA 2VZUA 1BK1A 4XFBA 1MS1A 2XJTA 4FPHA 5EYYA 2EIGA 3RZZA 1YI7A 4M00A 1F31A 5E8AA 4WM7C 4LBOA 4ZXKA 3UT0A 5C3QA 2WZPP 5GJ6A 3LFIA 4KG0A 4QPGA 4U36A 3SH3A 1IKPA 3QH7A 3DEMA 3M8LA 1LEMA 4K40A 2HWC3 4OHYA 1PVC1 2OS2A 3I3BA 4Y5Z0 5D2AA 2WA4A 5JR2A 3DV8A 4IE6A 3MLKA 2YY1A 4PIYA 2XB6C 1G7YA 1PNGA 5I0DA 2RJ2A 4JGZA 4UOJA 2HYKA 3ZSMA 4BQ3A 5JOXA 2KD7A 2YC4A 3VBHA 3BB6A 2GN7A 3LB9A 1I6XA 1FNZA 1GLHA 4XURA 3W9AA 3H3UA 4BK4A 3W58A 3N7MA 2XJUA 4DNYA 1IS6A 1OQEA 1MPXA 2JE7A 4LBNA 3J4UH 1YCIA 4DPNA 1SHWB 5JVVA 1RINA 1BLZA 1UYXA 4ZXEA 1KITA 4XF0A 2WNEA 4XDOA 3ZYPA 2GALA 3RMYA 1QIQA 2QQMA 3DYMA 4OMCA 2EVXA 3AC0A 2D6KA 5FZ4A 3HNYM 1H2LA 1HB3A 4I01A 4AEJA 3CHXA 1G9FA 3ABZA 1F2NA 2W1UA 3R4UA 2N7GA 1S0CA 4XOGA 4COYA 2ARAA 2GMPA 2GH2A 2HWF3 4P9LA 2W1WA 1XNDA 4YRDA 1EPWA 1NLQA 5F5AA 4DS0A 4IEYA 3WNPA 4FPOB 5CIRA 5FK8A 5LBFA 3ROUA 1JTZX 2VY0A 4CCOA 3B94A 3O1PA 4XQDA 2VBDA 2Y6GA 5H9SA 4XUNA 4AI9A 1D4VB 2X5IA 2BU9A 3ZFFC 1VBA1 2FMYA 5CEHA 4YW2A 4A42A 1C5IA 1J3QA 3WLUA 3PVBB 4LLFA 3C7GA 4Y5TA 1L7LA 4GWNA 2FDIA 3N35A 2H6BA 4AQTA 5L9BA 4HVQA 2I2SA 2W52A 3POWA 5FBJA 3CJIC 2C24A 3WQ1A 1COV2 1J3RA 2HWD3 4LMFA 1PGL1 1DGWX 5IVFA 4XVHA 3VZOA 3WXPA 1LU2A 2WDBA 4I3GA 3ZSLA 1FPN3 2WIIB 4YZ2A 1VBB1 3AKPA 3VKLA 1GMMA 1TMF1 4UW3A 1MQTA 1M06G 3AKRA 4HFSA 3URFA 3KF3A 1ZBA1 1QEXA 4YFZA 1XNBA 1UKGA 3ZFFB 3EQEA 3KB5A 4OCTA 3NAPA 5DDJ2 1XSQA 3PL0A 4NR1A 3FBYA 3KT1A 2WJSA 3WF1A 3AJYA 2C6SA 3FLTA 4A4AA 2VCAA 5F6LB 2VD7A 4P9YA 4XQWA 5FZOA 5L9RA 1GOHA 1NXMA 3OPWA 2MNGA 3IIIA 4QMAA 5C5UA 1ZZ9A 4Y22A 3S0MA 2YBPA 1EV12 2NYYA 3AMQA 2X10A 3R4SA 4QPWA 3ZXFA 5KHJA 4XUOA 4MO3M 1CPNA 1L7RA 2ZGKA 1R093 4F3JA 3FJSA 2AR6A 3D5OA 3BUCA 4H2AA 4CP9A 3BN6A 4D6SA 2QBXA 5JIAA 4HMZA 1W90A 5FO8B 2XKOA 4BA6A 1RXGA 3TNPB 4DXTA 4YZ4A 3POEA 2K0GA 2F6BA 5T55A 4ARYA 4ONUA 1HDKA 2FDGA 2WWSA 2PLV3 3O12A 3W20A 4R4XA 1JZ6A 2R49A 3ACGA 5FY7A 2ZTNA 2QQIA 4ARXA 5K7PA 2PHXA 3T3YA 2YHJA 4CCCA 3WR0A 4PLMA 2XONA 5L7OC 1HJFA 1GNZA 2ARBA 5CADA 3CZJA 1U12A 1D2QA 1EY2A 3POBA 3I3QA 3IN9A 1TME3 4OLLA 3R6SA 2JECA 3QCWA 1NAEA 2XOMA 3AJZA 1I5PA 5A7SA 4LOTA 4AQ6A 3N7JA 2FQPA 3UK9A 3KCXA 2GP3A 1BQPA 2VZPA 4GB33 1QU0A 4TXWA 3UESA 3VBFA 1SLLA 3R0RA 4QU2A 1BKZA 2PAKA 1PZ9A 5FBZA 5HXVA 4MADA 3KWVA 2VU9A 4ZONA 2HWC1 5HBAA 2R043 3BGAA 4JRLA 2VMGA 3LA2A 3ZXEA 1OPMA 4YG0A 3Q9OA 2BOIA 1VP6A 2K2SA 2RE9A 3LEGA 5D8AC 1CAUA 4EWEA 2ET7A 3AZWA 4XDPA 4FP3A 5BNOA 4W65A 2W5FA 3P6BA 1WBLA 1MZ6A 1NXD1 2ZA9A 2VOWA 3EMRA 5FQ0B 4AEMA 4ES8A 2D98A 1G9DA 3I7DA 1XJAA 4BH9A 1J59A 1JOPA 3AFKA 4H7LA 5FZGA 3MV11 4XILA 5CKQA 4UFKA 4HETA 4CZSA 4ZS2A 4GAZA 2LS6A 2DWRA 1VR3A 2BUKA 4Q8LA 1OBNA 2XJQA 5CKNA 3W21A 2WSVA 2BBAA 3AX4A 1T6GC 4W4ZA 5L19A 1W3XA 2OPKA 4XABA 4Y4RA 5D8AB 4Q4W3 5FOJB 1XQNA 3RYRA 2QQLA 5IAXA 3VHOA 3USSA 1TNRA 1UZZA 2OPWA 3OTFA 3J8F3 4MSVA 5CFCA 5JOYA 3Q8CA 2HWF1 3FHIB 1JHNA 4DQAA 5C4WA 1PM7A 4Y1UA 1LJ7A 4INDA 1LHOA 1JYNA 4TTGA 2VULA 3GZAA 1N3PA 1YQ8A 2WN3A 4JGYC 5T5OA 3THCA 2R0HA 3GBFA 1KEXA 2G9GA 4RGAA 3RFRA 1UIKA 1ND3C 1YWKA 2VVFA 3H7YA 1RTVA 3SCHA 2P34A 5KC5A 1OC1A 4TZDA 3MLJA 1ND2A 4YM0A 4B1LA 4B4PA 5CG9A 2YUEA 1X9TA 3HIFA 1OURA 3OUJA 4JQRA 1R083 3K3OA 3GZEA 5FPLA 5FZ6A 5GZFA 4E4DX 1IG0A 4M4PA 3VKFC 4EROA 3NV4A 4DUWA 4EN6B 1WCSA 2RV9A 5FWJA 1HV1A 1S55A 3WP3A 3QOPA 1NT0A 3ZN6B 2G19A 1HJGA 4JTOA 2VOTA 4LPLA 4OQ9A 1CIYA 1US2A 2HWD1 4JGYB 4K20A 3SEEA 1UOFA 1X82A 2OZ6A 1FPN1 4LJHA 4U2AA 3WQ0A 1LU1A 3KV6A 4AQ2A 1NQDA 3K51A 5BXXA 1ND3B 2HBUA 2EAAA 3B69A 4CP1A 4WVVA 4AF9A 3ON7A 4EYUA 2A6VA 3SQOA 4BU2A 4IV3C 2XHNA 1NG0A 2DYCA 2G4IA 3IPVB 1RJ8A 2KR2A 3JQXA 1V9U2 4YM2A 3H3LA 1PIV3 3WNOA 1WW5A 5A32B 1AR72 4UT5A 4X6RB 3IIAA 1XU2A 1CX1A 5E6HA 5FY0A 4BB3A 1ASJ2 1AUYA 4CXWA 4KWUA 4ZPIA 1L7QA 4CVUA 1IS3A 1WLTA 2E33A 1RMU2 2JDUA 1IOAA 3BI3A 1RUNA 2VR4A 3IAQA 1LGCA 4YW1A 5JZGC 2VOXA 1R091 1QY4A 1QH6A 2YPJA 2CYFA 4MXWB 2BP6A 1RUJ2 1MEC3 3I3MA 2OUHA 5JXIA 4I09A 1QJZA 4I0WB 1VRH3 3WDTA 5IK5A 4C1WA 1BMV2 5EXOA 2BJSA 2PLV1 4YW7A 5C3SA 1CJDA 2RM22 5EJ3A 1ZRFA 5HV4A 4XHXA 1IPJA 1UZYA 2VXJA 3AL6A 4HKOA 5JWPA 2PA7A 1PNFA 5JPNB 1AR62 1IPSA 5AC92 1YHFA 5JZGB 4CP2A 1UMHA 3NKTA 3BPZA 3B01A 1SACA 3EBRA 2WQ8A 3E5XA 3GHNA 1UAIA 3QBQA 4UFMA 1V6OA 4M0NA 4CEYA 5A6QA 2R073 4HOOA 4JV4A 2ZZJA 1TME1 3ENRA 5H9QA 1VMFA 4CUBA 5FZEA 3WDYA 3IMMA 3KV5A 1JMUB 3ZKYA 1Z7S3 3O0XA 4C91A 2EIEA 2G9FA 4GB31 4META 2GZWA 3ITQA 5FCCA 5IYYA 1WMEA 2XH6A 4XQ4A 3SCGA 2Q8EA 1JXNA 1EPZA 4DXRA 2YFUA 5ABJC 1K5JA 2LUWA 2GSYA 2Q0AA 2D6PA 1EAH3 2FMDA 2GNMA 2R041 2WSUA 2Y34A 2VMHA 3KS7A 3RNSA 1DGWA 2QJVA 1O3SA 1UOGA 2WT2A 2Y0OA 1GP4A 4LORA 1JZ8A 2Q4SA 1MS3A 3IDBB 4PIXA 2Z79A 1WBFA 4RFT0 3JB8A 2VBBA 2VZVA 3NO8A 4TN7A 3LPFA 1MZ5A 1U5XA 1FOD2 2IVIB 3LSEA 3ZYBA 2E7TA 4D0QA 5L73A 2PFWA 1RITA 4DRVA 2VZOA 2XGXA 5ABJB 4QDQA 2PHTA 4R9AA 2XBO3 3FFQA 4Y33A 3VGIA 1XE0A 4ZZ8A 1VMHA 1J1LA 1W8TA 4XC9A 3SMHA 2EICA 3GXUA 2Y38A 3AFGA 4UFLA 4GMP3 4Q4W1 4ES9A 2W0XA 3W59A 3TEZA 2QDNA 3D8CA 4AI3A 3OD0A 4OHWA 4W6YA 4FPKA 1QJU3 2QQVA 4DY5A 3J8F1 5J3UA 2ZKNA 4FOYA 5APAA 1JOBA 4RL7A 2VMCA 1UYZA 4Q5OA 5CG8A 1GWKA 1O8PA 1RUH3 2A6WA 2P6HA 1F5FA 4ISQA 5CISA 1AVBA 4BIOA 5FJHA 3DKWA 3H1WA 3VDBA 1UZVA 4L99A 5A1LA 2IXJA 4UW5A 2E7QA 1OSGA 1KS4A 3RS6A 3THDA 5C9AB 5JR7B 3VKOA 2XL9A 5KHKA 1B35C 1UY4A 3PTYA 4JTNA 2VBPA 4YSFA 5LEJA 5A6XA 2RG4A 2P4EA 4AVCA 3KQRA 3ZFEC 2V4AA 4NHKA 1R081 1U5YA 5SV5A 2XMLA 2PXJA 3J7MA 1KFUL 5LASA 3V0AA 4Q4V2 1LODA 3MFAA 1JU3A 4PF5A 3JZVA 2QQNA 1GQGA 5DAXA 3FLPA 2F4PA 4QQHA 4FSJA 3OB8A 4QPGC 4EWDA 1OF3A 5GZGA 5AFBA 4XJWA 1WA4A 4N9IA 3USUA 4DO0A 3HMYA 3AMNA 2JDKA 2W47A 1QOTA 1BCXA 5F8PA 1PIV1 2NQYA 3P3NA 3ZFEB 4JGZC 4OHXA 2UU8A 3ASIA 2OZJA 3O5SA 3ZDSA 3AL5A 1H8TA 1HRI3 4FFFA 3VBHC 5HCHA 1YLLA 1QXPA 3OGRA 2QZ3A 1OLME 4FCAA 1JYXA 2JDAA 1SCSA 2YG0A 5DUVA 2Y0IA 5EJZB 3WNMA 4D3WA 4NIGA 4QX3A 2RVAA 1CIWA 2RR12 4QPGB 2VM9A 2VNVA 1UMIA 4LXLA 1DYKA 2W1SA 3OD4A 2IVJA 3H7JA 4H14A 4A7KA 2GDFA 3HD8B 2CNAA 5LBBA 4HSLA 3MZHA 2Y6FA 3ES4A 4S2GA 1MEC1 2P3KA 1PMJX 2PHRA 1SFYA 3E5UA 2D6NA 5ACA2 4JGZB 1RUE2 5LWBA 1RUD3 1YQ2A 1VRH1 4JZRA 4QX8A 1HRV3 2OVUA 3VBHB 5LEKA 2XVLA 4AL9A 3HJRA 4BQWA 4MYEA 1F4HA 1S0DA 4LLOA 3FZ3A 5CVRA 4GH4A 4SLIA 2JD9A 3EB7A 2DDUA 3N9NA 2CGOA 1NKGA 3VZLA 2QUOA 4BJ0A 3GJBA 3LCPA 1H6XA 4IUGA 3O0WA 1LGNA 1W6PB 4LA2A 2ZHNA 2O14A 3VBUA 3S30A 4V1PA 1TG7A 1UX7A 4MH0E 4AG4A 5DUXA 4HPKA 1QF3A 2R071 4BQYA 4XF1A 2DCJA 3WW4A 1REFA 3KVBA 2X5IC 3A0KA 4NUBA 1QJY2 1Z7S1 2J1SA 1AX1A 1RJ7A 5FO9B 3LOIA 3PU3A 1A8MA 3DF0A 1MS5A 4XFHA 1DCSA 4L0PA 4OI0A 4FTBA 2AEYA 2BRTA 4IGQA 4CEWA 4WVZA 4YZ1A 4XJ9A 4ZU5A 1EAH1 1CAXA 2ZHLA 4A7YA 2VCCA 1FAYA 4Q4Y2 4AGRA 2WS93 4AHYA 4XHBA 1OQ1A 1N1VA 5T50A 1EUUA 2WBKA 1ZZBA 3AYEA 1E5RA 1MQTC 2WQ4A 5ANQA 3X29B 2Y64A 4TYSA 2FD8A 1W6QA 1Q56A 1OH4A 1PMHX 4FO9A 2A75A 2X5IB 2ZGSA 3MIGA 4I02A 4IEZA 4PI0A 4A2UA 3NAPC 3PVNA 3KV9A 1G9BA 2O8OA 2YFZA 1VLNA 2WL1A 2PAMA 1ZYBA 4ATEA 2QCSB 4QKNA 3IMNA 3WG3A 4GKXA 2W3JA 2XBO1 5FR3A 4K21A 3WG4A 1O4TA 2EALA 4BYYA 3ILFA 3CKHA 4IERA 5A6YA 1BBT2 1WZXA 3T0BA 2LRPA 2YBKA 2ADEA 3E6CC 4COWA 3VDCA 5C71A 1GZTA 1MQTB 4GMP1 3OYWA 1AZDA 5IVYA 4Y5SA 1ZA4A 3RZLA 4FP2A 5BNNA 3IB3A 4N7UA 4HK8A 5JXJA 1QJU1 2FDKA 2XXZA 2JEMA 3KSCA 3NAPB 4FBFA 5FRAA 3GJAA 3RMXA 3RPQA 3NV3A 2B45X 3D82A 4LBJA 4UFIA 5FZOB 1W39A 3S5AA 2Q8CA 2FDJA 1RUH1 2OA2A 4C0BA 1GZWA 4XZUG 1UPSA 5I0SA 2B4KA 4PF1A 3KGLA 4Y22B 1S0JA 2UWAA 2QTWB 1W2TA 3WCRA 1AXZA 4Q4X2 3RZKA 4LO8A 4XYXA 4MOAA 2ZX0A 1AYN2 1C1LA 1W8FA 4A7ZA 3T1MA 1UQXA 4QQLA 3MUY1 1JZ4A 2VNRA 2XPJA 2P17A 3ZSJA 2SLIA 3U0ZA 1V6KA 5HV0A 3ACFA 1S0GA 4Q2FA 1JYWA 1H1MA 3U4XA 2P1BA 2QNKA 1OA2A 3VBFC 5F2SA 4YM3A 5KWRA 2FCUA 1NUKA 3H50A 3HN3A 2VUJA 3IDCB 3VZMA 5HCAA 4N7IA 4FQ4A 5KXEA 4OQ8A 2QKDA 2R1DA 3WQBA 3ZDVA 1R1A2 3RSJA 4AK3A 3N9MA 4J1WA 3I2HA 5T52A 1W3VA 3CO2A 1F9KA 4Y4YA 1W99A 1HRI1 1SLAA 5BNOC 5F9TA 1S0EA 5DMYA 2ZKLA 3ME2A 4CDQA 4D8MA 3C2UA 2FZ1A 1PX4A 3HBZA 3VBFB 4PLNA 1D4M2 5JUVA 2ZGRA 1GBGA 1H8VA 4PQQA 4XFAA 1LRHA 1COV3 5C8CB 5FPZA 4GKYA 1RVF1 3VBOA 5CA6A 2QDRA 3IAPA 4D7SA 3U14A 1DU3D 1R1ZA 1GR3A 4IV1A 5ERLA 2ZZQA 4JVAA 2VTFA 1DLCA 1YFXA 4LITA 2VUAA 5DG1A 4LKDA 3D6EA 5LY1A 2BBVA 1N3QA 3EO6A 1C8M2 4UI9L 1RUD1 1Q8PA 2ZGTA 1HRV1 5BNPB 2LW8A 3I59A 1TZOA 5DDJ3 5BNOB 1UCXA 5JSPA 4DUVA 1RVF2 4P5YA 4FXGB 4HVOA 3DPRA 4YNIA 5CFCC 3M3OA 3CNAA 4ET7A 1AL22 1Y43B 5C4WC 5B2GB 4LKFA 4PBOA 3FX3A 4QT6A 5GLVA 4KGGA 1EV13 2JE9A 2VJXA 1K5MC 4XJAA 1CR7A 1GQPA 4EN9B 2KM2A 2ZX4A 2D3SA 4O7XA 3B3QE 2WKKA 4ZY9A 2H6CA 1Y3TA 1A6CA 2AREA 1ND2C 1PO12 2DFBA 5I91A 5KHIA 4GWIA 5K0UA 4UAPA 1AR92 4GIQA 1W2OA 2VPVA 1ZA7A 3VZKA 1H2KA 2ZMLA 4S2FA 3NSTA 4YVWA 5A7PA 3LDKA 1SLTA 3LQCA 1RYYA 1SFPA 4XJZA 4O9EA 3TEWA 1EYBA 3LIGA 1VJ2A 2ZX2A 4XAEA 1YFWA 1UWWA 5C4WB 1VALA 3ETQA 1RUC3 2YDEA 1FV3A 4IEOA 1UW8A 1BYHA 2WA3A 2WS91 3B7MA 3H3ZA 2A6ZA 1K5MB 4XZPA 1E5IA 4AHWA 3I2DA 3NWKA 2ZGPA 3DYPA 1Q8VA 3WZ1A 3MW3A 3ZYRA 1S1AA 1SG3A 3HQUA 3MIDA 5C70A 5FXWA 1ND2B 4EQVA 5C6CA 1OUXA 5IVBA 1KD7A 2ZMKA 1OVPA 1K3IA 4ISRA 2EIBA 3EJKA 3WF4A 4UFJA 4NMIA 1RGSA 5KR7A 2CY6A 3HEIA 1I3HA 4JKKA 4LBQA 4QX0A 3T1LA 2D5FA 3OY8A 1RUG2 1W6MA 5JXGA 4URAA 4TWTA 1JUHA 1N1YA 3ZYJB 2UY9A 4GJYA 3PMSA 4WM7B 1S0IA 4IEQA 4S2DA 4CE8A 1XC6A 1HXS3 4O61A 3I2IA 4XBQA 1OH3A 4Z2WA 1SDDB 3VBSA 4M3CF 2VCBA 1ENQA 5CAZA 4IXLA 5FYZA 4C0HA 2RDNA 3DXUA 3PUIA 4MXVA 1HQWA 2IXKA 5FMCA 2B9VA 3ETPA 1ULOA 4MGTA 3O1OA 3MUZ1 4NHMA 3VD4A 5FZ7A 5KC6A 1XNTA 2VXRA 1JOJA 3TNQA 2R16A 1AF9A 4IQPA 2CL2A 5A7NA 5FYVA 3RZMA 2PQQA 2W87A 4L2NA 3MPBA 3K4DA 3NL1A 2PAEA 1WLWA 4GMP0 2VZTA 4X8PA 4QGMA 3ZXGA 2EXKA 4CEYC 4GD4A 1IS4A 3ZYIB 1LR5A 2FBEA 2XWBB 3CQOA 3ZPOA 3PMEA 1LOEA 5FYCA 4M0HA 4BWOA 1GSLA 2B46X 1W2NA 2ZXQA 4E8CA 4Y26A 3OEBA 3TBDA 1NCRA 2ZMNA 1GFF2 3RWNA 5IHRA 1W8NA 5HPOA 2CHHA 2GMMA 4EN7B 1UPIA 3S7EA 4CDXA 2PHUA 3WW2A 4G3YC 1XNCA 1SQ4A 3WHUA 2I45A 1QJFA 3KHBA 4LE3A 1QQP2 4Q29A 4I30A 4YGDA 3V56A 2ZEZA 4CEYB 2QQOA 1RHI3 1MS9A 4ITCA 4QHOA 2DU0A 1HB1A 1IS5A 1SLCA 3ILNA 4Z82A 3TOJA 2OKXA 2WYSA 3UKVA 1J1TA 3FC0A 3ZPYA 4KGQA 1YFYA 1DQ2A 1PGL2 5FMOS 2VTXA 2Q8OA 3V0BA 4QXCA 5A33A 1COV1 1RUI2 2ZGLA 4SBVA 4XFGA 3U1XA 4AW7A 1W8HA 5L36A 1VBC2 5FZ8A 2Q5TA 2HWE2 2IXIA 2UWBA 3AP7A 1MS4A 3CJIB 3QACA 3BTXA 4XACA 3AZZA 4YLZA 3FBMA 4LO5B 2WO2A 4N53A 3V64A 1V9U3 1D0HA 1GNYA 5DDJ1 3VD7A 4IGOA 4HBNA 4H3WA 2R0FA 4LT5A 3ZMNA 1O8SA 2XJSA 3WG2A 2IXLA 2Q8DA 1ASJ3 3TRSB 1QOSA 2GP5A 4IE0A 2NLRA 1ULEA 5C3OA 5FP4A 3FLRA 4P02B 1O3QA 3ZX7A 3PJYA 1EV11 4BPZA 2WNOA 1RMU3 2GC2A 3TB0A 1XRUA 4XCBA 2JICA 5FY5A 4QQPA 2YC0A 5FO7B 4GXLA 3WQ7A 3VL8A 2RS52 1DHKB 4R9BA 4MV2A 2BZDA 3P1IA 1RXFA 1AR82 2FHRA 3OEAA 5F5IA 2W39A 3UKTA 1CQ9A 1C57A 2JWPA 2R7EB 4QU1A 5DN2A 3FMGA 4AYUA 2RM23 2YU1A 4IGPA 1X9PA 3C3VA 5AVAA 1Q8SA 2DTWA 1H4HA 2R30A 3PUHA 4QHZA 3SCFA 3T2OA 1TE1B 3PU8A 2DVDA 1RUC1 5FYBA 3WEZA 4XUPA 1AR63 2DCZA 3MI8A 5AC93 3IBMA 3RQ0A 2WNVA 3N9OA 2YGLA 4RGGA 2AUYA 2WQZC 4XUQA 1W6NA 3B5LB 3NJXA 5I8SA 3WDXA 1WGPA 1X8EA 3KHCA 4BOWA 3B93A 1ENSA 5J96B 5C7GA 5IVEA 4KQ7A 3K48A 2BGCA 5L7OB 1FV2A 1LOFA 2HWB2 1H8TC 4IE4A 3NNFA 1ZNPA 4A3XA 5JSOA 3V0AB 1O3RA 2C9KA 5J37A 3FFZA 1UU6A 3EXUA 3WV6A 2Z4FA 3N9QA 2SBAA 3P3PA 1HXS1 5DABA 2RJKA 3USUB 4YGBA 4V2VA 4XMAA 4WBBA 4CU9A 1CWPA 2NP0A 1OFSA 3AMHA 5FXXA 1ZZ8A 3WDVA 2DF7A 3NW4A 3NQHA 4OUSA 3ST7A 2R062 4N8MA 4P00B 4YGEA 5FXVA 1CAVB 4XIKA 4AI2A 3LOBA 2OX0A 3ELNA 1AX0A 2NPIA 4RS5A 1Z0HA 3GBGA 1X33A 2FDFA 4C8DA 1MZFA 1NA1A 1ONAA 2B7YA 3VLBB 3OJBA 4OUMA 3DGTA 3AXDA 1TVGA 5LZ6A 3B00A 1QXJA 3VD5A 4C1XA 4D94A 3OGGA 4KI5M 3VBUC 4F8AA 5IK7A 4DRRA 4BDVB 4UWDA 5FY4A 1CAWA 1CD3G 3LGRA 3AK0A 3B9IA 4XMIA 2HWF2 1NOVA 2XQXA 5CBLA 3O1RA 3O1TA 4WM8A 3BIEA 4R9DA 2OQ6A 3T08A 5HCFA 3HT2A 4D6QA 2ARXA 5FZ3A 3VB9A 3ZVXA 4FAHA 1JW6A 3JBG2 1DGRN 4D7YA 3S7IA 3IDEA 3DCQA 1H1IA 1VAKA 4CEWC 2RDRA 4YW5A 1FMD3 1QJEA 4P9IA 4XFCA 2Z69A 3FL7A 5LRRA 3VBUB 4QQ2A 3WW3A 1RHI1 4BK5A 5BNQA 2ZHMA 2J7MA 4AXOA 5A3UA 4XE9A 3BKZA 5KXBA 1ZZ6A 4QGLA 2O0OA 1V6IA 2C9AA 5FPXA 1K45A 2BVBA 2JKBA 3RZHA 1O6UA 1V6NA 4Q4V3 2C26A 2ZOEB 5LY2A 4LO6B 1ODMA 3W5MA 4D69A 5IVVA 2YGMA 3JUUA 5IATA 4MGQA 2OIIA 1GP5A 2WWUA 2CDOA 3N7LA 1CAXB 2NN8A 1K42A 3A7QA 3O0VA 3T09A 1MVQA 2B5HA 1AJOA 3CU7A 3JB4C 2XUEA 3SEPA 3POFA 1O5UA 3MO4A 5FZ9A 3KCYA 5T3NA 5A1AA 2J1UA 1V9U1 1W6QB 3APBA 1UU5A 5BNNC 3AB0A 3WSOA 1OD3A 2E9QA 2JENA 2O8QA 4AHXA 5FREA 4E2GA 4CDUA 4IV3B 5DAPA 3HR9A 2VZQA 5FAXA 1ASJ1 2ID4A 1YYNA 3KGZA 4LBQD 4LTAA 2J1TA 2CV6A 2XVGA 4DXZA 5LK7B 1R092 1W9YA 2JDHA 2VQUA 3ZLIA 3UJOA 4RN5A 2VZ3A 3TEXA 1RMU1 2D40A 2HH9A 2WT0A 4DMIA 2WLQA 4BQ1A 2L9LA 4P9WA 5JSRA 3DYOA 1GICA 5F32A 1OA3A 3UGGA 3C7EA 1ODNA 3AYDA 4BZ4A 3AXEA 1XYNA 1YQ5A 5ACA3 5BNNB 1C4RA 1WW7A 2UYBA 5DAVA 1NYWA 4AEKA 1BMV1 4LBLA 5F6KA 5EIYB 3TN92 3G6JB 4Z2AA 1NLSA 2RM21 5LA2A 5JIUA 5M0TA 1YFUA 4M3CB 4CP0A 1MR5A 3AMMA 5LATA 2WUHA 3ACIA 1AJKA 1AR61 5AC91 1C28A 5FY9A 1H9WA 4FPJA 3T0DA 3J7NA 1WCKA 3IWZA 5FYUA 3MW2A 4HSJA 1TME2 4IEVA 4AVTA 4COVA 2WZR2 1I5ZA 2EXIA 3WF3A 2H0VA 2EXJA 3LAGA 4PT6A 4CYDA 2FDHA 2ZS6B 3ZXJA 2RMU3 3SLIA 1QJX2 4YYOA 4LKSA 1DBNA 4AVSA 3Q8FA 5EPAA 3MDPA 4XXAA 2MEV2 1BVP1 3M1HA 4CUCA 5LA9A 4CDQC 4QXHA 1OKQA 4UYBA 2JXAA 4QHBA 5J98B 2Q1ZB 3AYCA 3ZO0B 4RHV2 5K8SA 4Q1RA 5IFPA 2E31A 1QNWA 1W2UA 1IQDC 1GV9A 3K77A 3K4AA 3NJZA 4Q4Y3 5I93A 3CZUA 2CSGA 4Y1ZA 1ZVFA 1G6NA 4IV1C 1V0AA 1Y9MA 2RJLA 2WFF2 1F35A 3PDQA 1VBE3 5ISLA 1LTEA 2BW8A 3H8RA 1O4YA 3WDWA 1OLMA 2VNGA 5I8YA 1TNFA 1WMDA 4JHTA 4F7ZA 4KG8A 1JUIA 1RC6A 4YGCA 2JG8A 5DPNA 5IT6A 3PUAA 1O3TA 4LBKA 2BOJA 4FPGA 1HN1A 4HLTA 5T54A 3VN4A 2P3YA 1U5ZA 4WVMB 4CDQB 5JMOA 4CUAA 2PHLA 3DPRC 1CX4A 3WNXA 1OXCA 5C33A 2W94A 5DAQA 4E2SA 1DGLA 3LWCA 4TSVA 2DFCA 3ZN4A 4Q4W2 4AI0A 4PIZA 4UF0A 3MF6A 4IE5A 4P9XA 4IV1B 1ULDA 1Q43A 1W8OA 4GALA 3I3DA 2BV4A 5F3EA 1S2BA 3A4UA 2XLFA 3J9SA 1Z78A 4HONA 5JPMB 5KBFA 4QDSA 1LECA 1V00A 4AGVA 1VBD2 5K0UC 2EAKA 1QGLA 2GNDA 1F8VA 2E51A 5A1FA 5A7WB 1T6BX 1QOOA 4YVWC 3RYKA 2A3WA 5IVJA 1IPKA 1W9WA 4FXKB 3PURA 2H0BA 2VUDA 5CFDC 5LA0A 3LA3A 1FMD1 3SITA 4R9CA 1LOGA 5GLWA 4LA3A 1QNYA 3MW4A 4CCDA 5IK4A 5EQUA 2JG9A 1V6LA 3MIBA 5JAXA 4Q4X3 4YW6A 1SBEA 2LTNA 1AHSA 2P3IA 4TLFA 1AYN3 4B8EA 4XW3A 2VECA 2BQPA 3GALA 4FPLA 2A5ZA 1S2EA 3SHRA 5K0UB 2E63A 2Y8KA 4AEDA 4YVWB 4NROA 3GZTB 1B35B 1OKOA 1FI2A 3BYWA 5F39A 3S6PA 1W0PA 4KBZA 2RS32 5CFDB 3J26N 5FDBA 4RGKA 3RDIA 3WHTA 2VG9A 1IG3A 2A6YA 3UV9A 2ZGQA 4NRQA 2J22A 2R32A 2FCVA 1PIV2 2Y6KA 3KF5A 1DG6A 4LIUA 4XEZA 1REDA 1W9SA 3UL2A 5F3CA 1WCQA 1ALYA 2EA7A 4PCRA 2JIGA 3VBSC 3RG0A 3M3CA 2J42A 1ZBE2 1ULPA 2DUPA 4FT8A 3H42B 3IZOA 4UW6A 1LENA 4MHUA 1DZTA 5LCWL 3CBNA 2D3RA 1VE0A 3ILRA 2VZRA 5FZMA 3OY8B 4XBNA 3HVDA 1D4M3 3MFCA 2J1AA 4PDWA 2RDSA 4PQ9A 1JS9A 2CGPA 1DP0A 5I0RA 2VMIA 4OI4A 4G9SB 5GLUA 1H1AA 1BEV2 1MZEA 1XE7A 2YZ4A 1PX3A 3GHMA 4LHKA 1HLCA 4NVPA 4UW4A 1W2AX 3UNPA 3AZXA 4PBPA 5GZCA 3VBSB 1OHFA 5ACA1 1C8M3 4QXBA 4YW3A 2BVVA 3AZYA 4CCMA 2UYAA 3VL9A 4AHZA 1DYPA 4OHZA 5BYNA 1RVF3 4KH9A 2AYHA 4COUA 1SPPA 5GALA 4J1XA 1NCRC 4WZFA 5T5LA 5LA1A 2BGOA 1PO23 3DN7A 2ZGMA 4KMQA 4FFGA 1IKQA 1YQ6A 5FYMA 2ES3A 5I8TA 4FTSA 1NY71 4HT1T 3SKVA 3NNLA 4CDXC 1NCQA 2AENA 2FZ2A 1RUF3 1PGW2 5FZFA 5I0TA 1AYM2 2A73B 3A21A 4AQSA 4CRQA 3CEWA 4EJRA 4YW4A 1KJRA 1PO13 4KWJA 3VDAA 2RMU1 4Z8BA 3WY6A 5JXHA 1AR93 3INAA 5KHHA 3S5QA 1G9CA 2VMEA 3NVCA 5EP9A 1FXZA 2JE8A 1NCRB 2DBNA 4QD2A 4AZZA 2CWSA 4IEXA 2DVBA 2TBVA 4TLGA 1BHGA 3M70A 2ADDA 3OPTA 4CDXB 4Q4Y1 4NPMA 3BALA 3UKNA 3R05A 2YMZA 3MICA 1DZQA 1UXZA 2WNUA 3OF1A 4LULA 1VBE1 4DEVA 3OBRA 5A32A 3O1MA 1L3JA 4J25A 5F37A 4OFGA 4OYUA 3RYPA 4QX5A 2D7FA 3R4DB 2WZEA 5FZBA 3A22A 3KMHA 3HT1A 5TSWA 2VW1A 2XJRA 3BOPA 1W9FA 3NNGA 4CCLA 4HK9A 3ZYHA 4D7TA 1PMIA 1VB2A 4HL0A 3RRDA 1BXHA 4URTA 4EZHA 3V0BB 1RUG3 1UF2C 5A33B 5EHDA 2W08A 4MXWA 4MHRA 3BTYA 3HNBM 2P5BA 4RQPA 4Y3OA 4KL1A 1B09A 1D7PM 2Y6LA 1QJU2 2ZGUA 4UBHA 5KXCA 1ZREA 4A44A 3GZUC 1KQRA 3HAGA 1WCUA 4QB1A 4CCEA 2IC1A 4XUTA 3ZXKA 5C3PA 1RUH2 2Z42A 3L9JT 3O14A 2GC1A 5CYYA 3WNKA 3U10A 1I9RA 4CP9B 5JI9A 4DB5A 3ACLA 5J7MA 1JHJA 1XOYA 4UBGA 4E4HA 4LEJA 1A78A 4RSUA 4CDWA 1CVNA 2WRAA 2DV9A 2Y6JA 4JCKA 4NIDA 3H8OA 1PVXA 4YARA 2VC9A 1QDCA 2WNVC 1KDKA 3I54A 3NJVA 3PHMA 4Q4X1 3ZR5A 1AYN1 3KVAA 2Q1FA 3VZJA 5FPBA 4CXXA 3D0JA 2VZ1A 4LHSA 2UY8A 1UIJA 4MUVA 1BVVA 1N47A 2X53S 2DVGA 5FZLA 4NHXA 5G04L 5AFEA 1QMJA 4JRAA 4O9GA 5D21A 2IWGB 1GOFA 2D44A 1AXKA 4OHVA 5IW0A 1LOFC 4QDRA 2HJIA 2XLAA 3LDBA 2ZPXA 4JX0A 2WC2A 1VMJA 3F95A 2BNNA 5FP9A 5FYTA 2IFRA 2YC2A 1LKNA 3AVRA 3MIFA 3MPPG 5F3GA 3THPA 4NAMA 1RB8G 1XNAA 4DIQA 3AKSA 4AFAA 2ZJCA 4RD7A 2D43A 1HKDA 2DTYA 5FTTC 1JYVA 3PTRB 3JCIA 5FUNA 2D3PA 1QQP3 2XVKA 4AFBA 2WINB 1W6NB 4BIFA 3E6BA 2XDVA 2W9XA 3HBKA 1XYPA 2VE1A 5LBCA 1JZ3A 1HX6A 5CU1A 2HEYF 1S4CA 3RJ2X 3WX5A 1YQCA 4A41A 1LOBA 4R52A 3VHPA 5A3MA 5IFTA 5EFUA 1CONA 4RS5C 3FUQA 1D4M1 2XQRA 1CAUB 3E5QA 4OZXA 1FX5A 3KT4A 1RUI3 4DFSA 1NA1C 2PYTA 2W1QA 2ZABA 1VBC3 4XTPA 3OOXA 2QQUA 4S2HA 2DBIA 2HWE3 3H8XA 1UY2A 1HRV2 1ULGA 2NZ9A 4P5HA 1YC61 1UD1A 2HLEA 2XWJB 5FZAA 1DF0A 2CAVA 4BQXA 2ZEXA 3N9PA 2QE3A 4YPJA 3L2YA 4XBLA 4WM8C 2JDZA 4XETA 1WW6A 4DZGA 1NLRA
chains in the Genus database with same CATH topology
4RS5B 1PO21 3M3IA 4M3CE 3JD72 2D97A 5IUQA 3VHRA 1AX2A 1NA1B 4YZ3A 3VKNA 5C9AA 2PHWA 3QD6A 5K9YA 5GLTA 1CESA 4HKLA 5JOZA 5CFCB 3CF6E 3VKMA 1RUF1 2ZAHA 3AP4A 2RS12 5FFOC 1NE4A 4HN1A 4BMBA 1ZRDA 3O7OA 4UXAA 3H1MA 4Y1XA 2E7AA 2TNFA 3KD4A 4AFDA 1PO11 2RS53 4NN0A 1AR83 1OPOA 4WM8B 4YVSA 3QH6A 2ET1A 3MF9A 4LHLA 5A3LA 2GU9A 2WS92 2V5YA 1W6OA 4W6XA 1GNHA 1SFNA 1QWRA 1RL3A 1MS0A 1DZRA 5T5JA 5DUWA 4RA0A 4LO7A 2WFPA 1PVC2 4LHNA 3WUCA 1N1SA 1JYIA 4DINB 4HKWA 4Y20A 5GM0A 1OOPA 3POYA 2BWCA 1ULFA 2HWB3 1X36A 4CDUC 4I3PA 2DCKA 2C0ZA 1RUG1 2IXCA 5SV8A 4M01A 4AGGA 4OULA 3HN1A 3OGJA 4K7JA 5DZGA 1WUVA 2DUQA 2BEOA 4K8FA 4KWLA 2GNBA 4L9BA 1VIWB 2P37A 5CNAA 4KBBA 1EP0A 2R063 2VGDA 3ZXDA 2P2KA 4CDUB 5HI0A 4GQ7A 1YI9A 3ATGA 2Y26A 1W6PA 3N4MA 2JD4A 4IEPA 1C3HA 1SLIA 3G7DA 1QDOA 2A6XA 1RUOA 4EV0A 4K9SA 1H0BA 3DL3A 4E4ZA 1VAVA 1CPMA 4IETA 1WD3A 1XYOA 1GYKA 3AYAA 2AZ5A 4LUMA 4LR4A 3GBWA 3VV1A 4PJYA 1VBA2 1RIRA 2ZBJA 4MGYE 4QPIA 2XG3A 1J58A 3POSA 1CJPA 4HANA 4N9HA 3JBG3 2A70A 2Z5WA 3MEPA 2XL7A 1BZWA 3BODA 3M2MA 3PVEA 4X8NA 5GLZA 4B7KA 3H1YA 5BNPA 5JCTA 1ENRA 2DVAA 2XPJA 2NM1A 3HWJA 1JBCA 3H8UA 4MGIE 1QQP1 2VNOA 1VBB2 2LALA 2RHPA 1W0OA 1TMF2 5BUVA 4LUKA 1PHMA 1GKBA 1GZCA 3KZ4C 1ZBA2 5EV7A 2BPA2 2JG8C 1OFNA 3LKJA 4E9KA 4Y24A 1Q5OA 2VOVA 1RUI1 5DZEA 2AH2A 3N7KA 1AR73 1VBC1 4LO4B 4NHLA 3N3HA 4JDMA 2HWE1 1FYUA 2KXLA 4XFFA 1LESA 2K9ZA 2JG8B 2PELA 3MYXA 1RUJ3 2B9UA 4YG3A 3KCCA 5FLIA 1Y7BA 4RR3A 1HW5A 2V09A 4B4RA 4JDOA 1FT9A 1NQJA 2XJPA 1IHMA 3TAYA 2JG9C 5EWSA 2RS51 1KJLA 2P3JA 5J36A 3D0SA 3BOWA 3TYJA 4ASMB 1AR81 5F5QA 2KA3A 2CAUA 1S0FA 5BV6A 1RUC2 2VQAA 4YFWA 5EZWA 3TN93 4AEDC 4Q0SA 1WCDJ 2C1FA 5DZFA 2IXHA 3U11A 1UX6A 1PZ7A 1SDWA 4OVEA 4L92A 2I07B 2JG9B 2HWC2 4FAGA 2WZR3 4N43A 2ZX3A 3AP6A 1KDMA 1G8WA 1QJX3 3H0OA 2HWB1 4AEDB 5C8CA 2VOKA 4CTEA 1DIWA 2MEV3 1GANA 1U0AA 1OMIA 1LOCA 1Q8QA 4E4SA 1OLQA 1HXS2 1G86A 4RHV3 2NMNA 4PDWC 1H8TB 5FLJA 1FOD3 4XTMA 1G9AA 1WD4A 4P9GA 1CN1A 4L11A 4GH4C 2A7AA 4LE4A 1LHUA 1SCRA 2WFF3 1DFQA 3SH4A 3LA7A 1U5IA 4Q0QA 3WOGA 4ZU4A 4FTEA 3LZZA 2R061 2BFUS 3SH5A 3CLPA 3CL1A 4ASLA 1I1EA 1GZ9A 1M4WA 1X7NA 2YV8A 4YG6A 1ZX5A 4MGKE 4BLJA 4NOTA 2A71A 4FOVA 3VHNA 4PDWB 1N3OA 1PK6A 3SISA 4FPYA 2VW2A 1OLRA 1NCQC 3M3QA 4BE3A 4GH4B 2A3YA 3OPZA 4BM8A 1Q3EA 2Z2SB 2NP0A 3ZFGA 5JMCA 3WW1A 4H55A 3TWIA 4FOQA 1YUDA 3VDDA 3WINE 4E2QA 5JLVA 3VBRA 3WVJA 1JYCA 3PVOA 1VBD3 2O1QA 2AGSA 4HPKB 1DQ4A 2PN5A 5H9RA 2D6MA 1K5MA 2QZ2A 3JBG1 5GKAC 3ECQA 5HCBA 4AVVA 3L2HA 2CGNA 3WP4A 1MVEA 1C8NA 4K6BA 5T5PA 2HWD2 2BNOA 4P14A 1RHI2 1SLBA 4B3NA 1NCQB 1FPN2 1HV0A 1H30A 2R6QA 1KFXL 1SEFA 1XE8A 2WNUC 3OCPA 4W6WA 4CEWB 5F1RA 4H7MA 2B8MA 2IFWA 2PHFA 4YM1A 4YZ5A 3H9AA 1IZ3A 4NO4A 4Q0UA 1YJLA 3M7AA 1KRIA 4WM7A 2VH9A 1YNAA 2RS33 4Z92B 2GH8A 3ZSKA 5D1IA 1AR71 4F83A 5FMOL 4OI1A 4ZU7A 1O4ZA 1HIXA 5DUUA 4RQPC 2ZCWA 2WNUB 1XXNA 2RR13 4X6QB 1MS8A 2HKXA 1POV3 2TUNA 1OD5A 2YYOA 2NMOA 1ZBE3 1ENXA 1RUJ1 3OYWB 2PLV2 2Q30A 1UN1A 1RUE3 2JJ6A 4MX3A 3ZIXA 1XU1A 4K1ZA 3N36A 2DUOA 4CDWC 4QM9A 1BEV3 1WMFA 4RQPB 5E16A 1SBFA 2D5HA 1N1TA 1GZWB 5KHGA 4BCUA 4EN8B 2MPFA 1WLDA 4NWWA 5BPXA 3A0NA 1LEDA 3TN91 3UJQA 4B29A 4B4QA 3MLLA 1QXRA 3AKTA 2IZWA 3AMPA 4GB32 3HQXA 1AXYA 2GC0A 2ZGOA 3AM2A 4K3UA 3WUDA 3M4FA 1YJKA 1QJY3 4ORFA 3AKQA 4CDWB 1X8MA 3KM5A 1E57A 2R042 3ES1A 2WZR1 4KU7A 1ZM1A 2OYZA 5IK8A 1AYM3 5I0UA 4WZCA 2XKPA 3T2TA 3VBOC 5E89A 1HQNA 1QH7A 1QJX1 1PGSA 2VQ0A 1OI6A 3ZFFA 4NPRA 2MEV1 4Y1VA 2XJVA 2PHDA 2Q1MA 4RHV1 3CJIA 1FOD1 3B9CA 3KLSA 1BJQA 4KWKA 2C5DA 5E88A 4AI1A 4AVAA 1H2MA 2WFF1 3FE5A 2QFEA 3MIHA 3M3EA 3VBOB 3SNMA 2D6LX 4XF3A 1WLCA 3E97A 1A3KA 1DQ5A 1BBT3 3BTAA 1DDLA 3WD5A 1D2SA 4GA9A 1OA4A 3SXWA 1YO8A 2XHKA 2UWCA 3J8F2 4XJUA 4WV8A 4D7YA 3RI8A 1O91A 3ZN5A 2GMEA 2W68A 3I59B 1J3PA 2ILMA 5C9AC 2I74A 3DPRB 3V65A 1LCLA 3NV1A 4B7EA 2X8KA 4PLOA 2BFUL 1LHVA 1SMVA 2GC3A 4XDQA 5DG2A 1VBD1 1ULCA 1NE6A 2GAUA 1XNKA 1R082 4YVSC 1FMD2 1Y9QA 2DVFA 2ZGNA 1YXWA 4GWMA 1NZCA 1F5JA 5H9PA 4IL7A 4JAAA 4Q4V1 4DOUA 4IEWA 4MGZE 2UURA 4MVTA 5L7OA 2ZAAA 2ZHKA 1H4GA 4BLIA 2V73A 5JDBA 2QQPA 2HEVF 3BU7A 4YVSB 1OOPC 5J48A 1R1A3 5FQ0A 2ATFA 4GULA 2GNTA 4Q8KA 2RS31 1W6OB 1V6JA 3RI9A 4WVWA 2DCTA 3GNEA 3DUIA 1DGRA 2ZX1A 1UKRA 4IEUA 1PZ8A 1YRZA 4IESA 4Q0PA 2E6VA 3OBTA 3WG1A 3WP6A 4LBQB 1DQ0A 1W6MB 2RR11 1CAVA 2OUJA 4KU8A 1H2NA 4P9JA 2JX9A 1POV1 1MEC2 4EWAA 5D8AA 1IQAA 1ZBE1 4Y20B 3PNAA 1OOPB 1VRH2 1SBDA 3JU9A 1S2KA 3U07A 4QPYA 1IGOA 1RUE1 2HEWF 3AP9A 4I0AA 4E27A 3MGUA 5BY5A 1BEV1 1AL0G 1KS5A 2XLGA 4Q26A 1AL23 4J6GA 3VUOA 4I0BA 2R072 1FATA 4ATFA 4MZUA 1H9PA 2LM3A 2DU1A 4QXKA 2EXHA 3ZMOA 1YIPA 2D93A 2E53A 1Z7S2 1NY72 4QPIC 3ZN6A 3JD73 3ZYGA 1UU4A 1QJY1 3S30A 1C1FA 3PLQA 3E6DA 3PJQA 5JI7A 4JGYA 2OW4A 2X29A 5BNPC 1EAH2 4BHPA 1VAMA 3GF6A 1PGW1 2RMU2 2RS13 1AYM1 1ND3A 5GZEA 4FPFA 3ZSEA 4FQZA 3IPVA 1FNYA 4KNCA 4Q1PA 1URXA 4QPIB 1ZZCA 2QVSB 3IM0A 4N53C 1TQ5A 3NKGA 4HZFA 4QGNA 2WLPA 1QHDA 1VBE2 3I4IA 3WCSA 2B39A 4G4FA 2XUMA 1DQ6A 1APNA 2ETEA 2XBO2 1UL9A 3MIEA 4JC1A 5FOBB 2YROA 1V6MA 4XF9A 1PVC3 4AFCA 4IV3A 4L97A 3CJXA 1BBT1 4OI2A 1LGBA 4Q27A 2ENRA 1A8DA 4R8HA 1V70A 3D4KA 4N53B 1CGPA 2MHFA 3GYDA 4RR3C 2VVDA 5J09A 3BCWA 4DY3A 1JN2P 3QLQA 5JZGA 2ERFA 3FUOA 1ZRCA 2TEPA 5LK5A 4JDNA 3ZIWA 4M3CA 5KXDA 2BTVC 1LOAA 5JOWA 2EF6A 3IT8A 2YXSA 5GZDA 5LRSA 2VVEA 4NWVA 1LHNA 1WW4A 2R1BA 3FWEA 4RR3B 5E1RA 5FLHA 4ZKTB 1UMZA 1DQ1A 3AP5A 4Q0VA 2BNMA 4XJ8A 4AFMA 4N43C 2WNVB 4COZA 4AWDA 2DURA 1R1A1 1O5LA 2B42B 1HRI2 1VBA3 4HVRA 5C8CC 4N90A 2WT1A 3RJRA 4FPCA 1JH5A 1HQLA 3AZVA 4XPVA 4R4ZA 5ABJA 4BMEA 2CTVA 3WP5A 1MACA 3ZXLA 3IKWA 1VBB3 4L8QA 4N43B 4XFIA 1TMF3 4WVMA 2CWMA 3EHKA 4I2OA 5DXDA 1Q8OA 4MLOA 3ZXAC 1VB4A 1YIFA 1O7FA 1RUD2 1ZBA3 3NV2A 4LNVA 4QQOA 1D0GA 1REEA 2ZACA 1C8M1 1LB2A 2PTMA 1ZRRA 3KT7A 3I8TA 4AVBA 1PK6C 2DCYA 3WDUA 1GQHA 1AL21 4FPEA 1POV0 3ZFGC 1LHWA 1TEIA 3BIWE 4HN0A 5EYXA 3THTA 3VDDC 4Z1VA 5C8WA 1PO22 4K1YA 4LBMA 2VW0A 4Z07A 4QM8A 3VBRC 4XF4A 3VZNA 1CAWB 1C5HA 3B02A 4FOWA 3JD71 4AI8A 2GN3A 1AR91 1RUF2 2D6OX 2BWAA 1PK6B 1LULA 1QKQA 4Y1YA 1KXGA 1DLLA 1OQDA 1ZZ7A 2RS11 4XXPA 3ALQA 5CB7A 4FVVA 4XIOA 4EN0A 2A3XA 2BYVE 3LSDA 4C90A 1S0BA 3JQWA 5AVPA 3WT3A 3ZFGB 1X50A 1B35A 4AE2A 3VDDB 3ZFEA 3VBRB 5CFDA 4XFBA 1BK1A 1MS1A 2XJTA 4FPHA 5EYYA 2EIGA 3RZZA 1YI7A 4M00A 1F31A 5E8AA 4WM7C 4LBOA 4ZXKA 2WZPP 5GJ6A 4KG0A 4QPGA 4U36A 3SH3A 1IKPA 3QH7A 3M8LA 1LEMA 4K40A 2HWC3 4OHYA 1PVC1 4Y5Z0 2WA4A 3DV8A 3MLKA 2YY1A 4PIYA 2XB6C 1G7YA 1PNGA 4JGZA 2HYKA 3ZSMA 5JOXA 3VBHA 3BB6A 2GN7A 3LB9A 1I6XA 1FNZA 1GLHA 3W9AA 3H3UA 3W58A 3N7MA 2XJUA 4DNYA 1IS6A 1OQEA 2JE7A 4LBNA 3J4UH 1YCIA 4DPNA 5JVVA 1RINA 1KITA 4XF0A 2WNEA 3ZYPA 2GALA 3RMYA 2EVXA 2D6KA 1H2LA 4I01A 4AEJA 1G9FA 1F2NA 3R4UA 2N7GA 1S0CA 4XOGA 4COYA 2GMPA 2GH2A 2HWF3 4P9LA 1XNDA 4YRDA 1EPWA 4DS0A 4IEYA 4FPOB 5CIRA 3ROUA 1JTZX 2VY0A 3B94A 4XQDA 5H9SA 1D4VB 2X5IA 3ZFFC 1VBA1 2FMYA 4YW2A 1C5IA 1J3QA 3WLUA 3PVBB 4LLFA 4GWNA 3N35A 2H6BA 4AQTA 4HVQA 2I2SA 2W52A 3POWA 3CJIC 3WQ1A 1COV2 1J3RA 2HWD3 1PGL1 1DGWX 3VZOA 3WXPA 1LU2A 4I3GA 3ZSLA 1FPN3 2WIIB 4YZ2A 1VBB1 3AKPA 3VKLA 4UW3A 1TMF1 1MQTA 1M06G 3AKRA 4HFSA 3URFA 1ZBA1 4YFZA 1XNBA 1UKGA 3ZFFB 3EQEA 3KB5A 5DDJ2 3NAPA 4NR1A 3FBYA 3KT1A 2WJSA 3AJYA 3FLTA 5F6LB 4P9YA 4XQWA 1NXMA 2MNGA 4QMAA 1ZZ9A 4Y22A 3S0MA 3AMQA 1EV12 2NYYA 3R4SA 3ZXFA 5KHJA 1CPNA 2ZGKA 1R093 4F3JA 3FJSA 2AR6A 3D5OA 5JIAA 4HMZA 5FO8B 2XKOA 4BA6A 3TNPB 4YZ4A 2K0GA 2F6BA 5T55A 4ONUA 1HDKA 2WWSA 2PLV3 3O12A 4R4XA 2R49A 2ZTNA 5K7PA 2PHXA 2YHJA 4PLMA 5L7OC 1GNZA 2ARBA 5CADA 1U12A 1D2QA 1EY2A 4OLLA 3IN9A 1TME3 3R6SA 2JECA 3QCWA 3AJZA 4AQ6A 3N7JA 2FQPA 3UK9A 3KCXA 4GB33 1BQPA 3VBFA 1QU0A 1SLLA 3R0RA 4QU2A 1BKZA 2PAKA 1PZ9A 5FBZA 5HXVA 2VU9A 2HWC1 5HBAA 2R043 4JRLA 2VMGA 3LA2A 3ZXEA 1OPMA 4YG0A 3Q9OA 1VP6A 2K2SA 2RE9A 5D8AC 1CAUA 4EWEA 2ET7A 3AZWA 4FP3A 5BNOA 4W65A 1WBLA 1MZ6A 1NXD1 2ZA9A 2VOWA 5FQ0B 4AEMA 4ES8A 2D98A 1G9DA 3I7DA 4BH9A 1J59A 3AFKA 4H7LA 4XILA 4HETA 4CZSA 2DWRA 1VR3A 2BUKA 4Q8LA 2XJQA 2WSVA 3AX4A 5L19A 1T6GC 2OPKA 5D8AB 4Q4W3 5FOJB 1XQNA 3RYRA 3VHOA 3USSA 1TNRA 1UZZA 3OTFA 3J8F3 4MSVA 5CFCA 5JOYA 2HWF1 3FHIB 1JHNA 4DQAA 5C4WA 1PM7A 4Y1UA 1LJ7A 4INDA 1LHOA 2VULA 3GZAA 1N3PA 4JGYC 5T5OA 2R0HA 3GBFA 2G9GA 4RGAA 1UIKA 1ND3C 1YWKA 2VVFA 3H7YA 1RTVA 3SCHA 2P34A 5KC5A 4TZDA 3MLJA 1ND2A 4YM0A 4B4PA 5CG9A 2YUEA 3HIFA 4JQRA 5GZFA 1R083 4E4DX 4EROA 3VKFC 3NV4A 4EN6B 1WCSA 1HV1A 1S55A 3WP3A 3QOPA 3ZN6B 4JTOA 2HWD1 4JGYB 4K20A 1X82A 4U2AA 2OZ6A 1FPN1 3WQ0A 1LU1A 4AQ2A 1NQDA 3K51A 5BXXA 1ND3B 2EAAA 3B69A 4CP1A 4WVVA 4AF9A 2A6VA 4IV3C 3IPVB 1NG0A 2DYCA 2G4IA 3JQXA 1RJ8A 4YM2A 1V9U2 1PIV3 1WW5A 5A32B 1AR72 4X6RB 3IIAA 1XU2A 1ASJ2 1AUYA 1IS3A 1WLTA 1RMU2 1IOAA 1RUNA 5JZGC 4YW1A 1LGCA 2VOXA 1R091 1QY4A 1QH6A 2YPJA 2CYFA 4MXWB 1RUJ2 1MEC3 2OUHA 4I09A 1QJZA 4I0WB 1VRH3 3WDTA 5IK5A 4C1WA 1BMV2 5EXOA 2PLV1 1CJDA 2RM22 5EJ3A 1ZRFA 4XHXA 1IPJA 1UZYA 4HKOA 5JWPA 2PA7A 1PNFA 5JPNB 1AR62 5AC92 1YHFA 5JZGB 4CP2A 3NKTA 3BPZA 3B01A 1SACA 3EBRA 3E5XA 3GHNA 1UAIA 3QBQA 1V6OA 4M0NA 4CEYA 2R073 4JV4A 2ZZJA 1TME1 3ENRA 5H9QA 3WDYA 1Z7S3 3O0XA 4C91A 4GB31 2G9FA 4META 2GZWA 5FCCA 1WMEA 2XH6A 4XQ4A 3SCGA 1JXNA 1EPZA 5ABJC 2LUWA 2GSYA 2Q0AA 2D6PA 1EAH3 2FMDA 2GNMA 2R041 2WSUA 3KS7A 2VMHA 3RNSA 1DGWA 2QJVA 1O3SA 2WT2A 2Y0OA 2Q4SA 1MS3A 3IDBB 4PIXA 2Z79A 1WBFA 4RFT0 3JB8A 3NO8A 1MZ5A 1U5XA 1FOD2 3LSEA 2E7TA 5L73A 2PFWA 1RITA 4DRVA 2XGXA 5ABJB 2PHTA 4R9AA 2XBO3 3FFQA 3VGIA 1J1LA 3SMHA 2Y38A 3AFGA 4ES9A 4GMP3 4Q4W1 2W0XA 3W59A 2QDNA 3D8CA 4AI3A 3OD0A 4OHWA 4W6YA 4FPKA 1QJU3 4DY5A 3J8F1 5J3UA 2ZKNA 4FOYA 4RL7A 5CG8A 1RUH3 2A6WA 1F5FA 4ISQA 1AVBA 4BIOA 3DKWA 3H1WA 4L99A 2IXJA 4UW5A 2E7QA 1OSGA 1KS4A 3RS6A 5C9AB 5JR7B 3VKOA 2XL9A 5KHKA 1B35C 5LEJA 3PTYA 4JTNA 4YSFA 4AVCA 3KQRA 3ZFEC 4NHKA 1R081 1U5YA 5SV5A 1KFUL 3V0AA 4Q4V2 1LODA 3MFAA 4PF5A 3JZVA 1GQGA 3FLPA 2F4PA 4QQHA 4FSJA 4QPGC 4EWDA 5GZGA 5AFBA 4XJWA 1WA4A 4N9IA 3USUA 3HMYA 3AMNA 1QOTA 1BCXA 1PIV1 2NQYA 3P3NA 3ZFEB 4JGZC 4OHXA 2UU8A 3ASIA 2OZJA 3O5SA 3ZDSA 1H8TA 1HRI3 3VBHC 1YLLA 1QXPA 2QZ3A 4FCAA 1SCSA 5DUVA 2Y0IA 4D3WA 1CIWA 2RR12 4QPGB 1DYKA 3OD4A 3H7JA 4H14A 4A7KA 2GDFA 3HD8B 2CNAA 4HSLA 3MZHA 3ES4A 4S2GA 1MEC1 2P3KA 2PHRA 1SFYA 3E5UA 2D6NA 5ACA2 4JGZB 1RUE2 1RUD3 1VRH1 1HRV3 2OVUA 3VBHB 5LEKA 2XVLA 4MYEA 1S0DA 4LLOA 3FZ3A 5CVRA 4GH4A 4SLIA 2CGOA 3VZLA 2QUOA 3LCPA 3O0WA 1LGNA 1W6PB 4LA2A 2ZHNA 3VBUA 4AG4A 4V1PA 4MH0E 5DUXA 4HPKA 1QF3A 2R071 4XF1A 2DCJA 3WW4A 1REFA 2X5IC 3A0KA 1QJY2 1Z7S1 1AX1A 1RJ7A 5FO9B 3LOIA 4XFHA 1A8MA 3DF0A 1MS5A 4OI0A 4FTBA 4CEWA 4YZ1A 4WVZA 4XJ9A 4ZU5A 1EAH1 1CAXA 2ZHLA 4A7YA 1FAYA 4Q4Y2 4AGRA 2WS93 4AHYA 4XHBA 1OQ1A 1N1VA 5T50A 5BNPB 1ZZBA 3AYEA 1MQTC 2WQ4A 3X29B 4TYSA 1W6QA 1Q56A 4FO9A 2A75A 2X5IB 2ZGSA 3MIGA 4I02A 4IEZA 4A2UA 3NAPC 3PVNA 1G9BA 2O8OA 1VLNA 2WL1A 2PAMA 1ZYBA 4ATEA 2QCSB 3WG3A 3IMNA 4GKXA 2XBO1 4K21A 3WG4A 1O4TA 2EALA 4BYYA 3ILFA 4IERA 1BBT2 3E6CC 4COWA 1MQTB 4GMP1 3OYWA 1AZDA 1ZA4A 4FP2A 5BNNA 4N7UA 4HK8A 1QJU1 4FBFA 2JEMA 3KSCA 3NAPB 5FRAA 3RMXA 3RPQA 3NV3A 2B45X 3D82A 4LBJA 1W39A 1RUH1 2OA2A 4C0BA 1GZWA 5I0SA 1UPSA 3KGLA 4Y22B 1S0JA 2UWAA 3WCRA 1AXZA 4Q4X2 4LO8A 4XYXA 2ZX0A 1AYN2 1C1LA 4A7ZA 3T1MA 4QQLA 2VNRA 2P17A 3ZSJA 2SLIA 3U0ZA 1V6KA 1S0GA 4Q2FA 1H1MA 3U4XA 2QNKA 1OA2A 3VBFC 4YM3A 5KWRA 3H50A 2VUJA 3IDCB 3VZMA 5HCAA 4N7IA 4FQ4A 5KXEA 2QKDA 2R1DA 1R1A2 3RSJA 4AK3A 4J1WA 5T52A 3CO2A 1F9KA 4Y4YA 1HRI1 1SLAA 5BNOC 5F9TA 1S0EA 2ZKLA 3ME2A 4CDQA 3C2UA 2FZ1A 3HBZA 3VBFB 4PLNA 1D4M2 2ZGRA 1GBGA 1H8VA 4XFAA 5C8CB 1LRHA 1COV3 5FPZA 4GKYA 1RVF1 3VBOA 5CA6A 2QDRA 4D7SA 1DU3D 1R1ZA 1GR3A 4IV1A 3WR0A 2ZZQA 4JVAA 1YFXA 5DG1A 2VUAA 3D6EA 2BBVA 1N3QA 3EO6A 1C8M2 1RUD1 1Q8PA 2ZGTA 1HRV1 3I59A 5DDJ3 5BNOB 1UCXA 5JSPA 1RVF2 4FXGB 4HVOA 3DPRA 4YNIA 5CFCC 3M3OA 3CNAA 1AL22 1Y43B 5C4WC 5B2GB 4PBOA 3FX3A 4QT6A 5GLVA 4KGGA 1EV13 2JE9A 1K5MC 4XJAA 1CR7A 4EN9B 2KM2A 2ZX4A 2D3SA 3B3QE 2WKKA 2H6CA 1Y3TA 1A6CA 2AREA 1ND2C 1PO12 2DFBA 5I91A 5KHIA 5K0UA 1AR92 4GIQA 2VPVA 3VZKA 1H2KA 2ZMLA 4S2FA 3NSTA 4YVWA 1SLTA 4XJZA 4O9EA 1EYBA 1VJ2A 2ZX2A 5C4WB 1YFWA 1VALA 3ETQA 1RUC3 2YDEA 1FV3A 4IEOA 1UW8A 1BYHA 2WA3A 2WS91 3B7MA 3H3ZA 2A6ZA 1K5MB 4XZPA 4AHWA 3I2DA 3NWKA 2ZGPA 3WZ1A 1Q8VA 3MW3A 3ZYRA 1S1AA 3MIDA 1ND2B 5C6CA 1KD7A 2ZMKA 4ISRA 3EJKA 1RGSA 2CY6A 1I3HA 4LBQA 3T1LA 2D5FA 3OY8A 1RUG2 1W6MA 4TWTA 1JUHA 1N1YA 3ZYJB 2UY9A 3PMSA 4WM7B 1S0IA 4IEQA 4S2DA 1HXS3 4XBQA 4Z2WA 3VBSA 4M3CF 5CAZA 1ENQA 4IXLA 4C0HA 4MXVA 1HQWA 2IXKA 4NHMA 5KC6A 2VXRA 1JOJA 3TNQA 2R16A 1AF9A 4IQPA 2CL2A 2PQQA 4L2NA 3MPBA 3NL1A 2PAEA 1WLWA 4GMP0 4X8PA 4QGMA 3ZXGA 2EXKA 4CEYC 1IS4A 3ZYIB 1LR5A 2FBEA 2XWBB 3PMEA 1LOEA 4M0HA 4BWOA 1GSLA 2B46X 4Y26A 3TBDA 1NCRA 2ZMNA 1GFF2 3RWNA 2GMMA 4EN7B 1UPIA 3S7EA 4CDXA 2PHUA 3WW2A 4G3YC 1XNCA 1SQ4A 3WHUA 2I45A 4LE3A 1QQP2 4Q29A 4I30A 4YGDA 3V56A 4CEYB 1RHI3 1MS9A 4ITCA 2DU0A 1IS5A 1SLCA 3ILNA 4Z82A 3TOJA 3UKVA 1J1TA 3FC0A 3ZPYA 4KGQA 1YFYA 1DQ2A 1PGL2 5FMOS 2Q8OA 3V0BA 5A33A 1COV1 1RUI2 2ZGLA