1F5FA

Crystal structure of the n-terminal g-domain of shbg in complex with zinc
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
176
structure length
172
Chain Sequence
PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEX HORMONE-BINDING GLOBULIN
publication title Steroid-binding specificity of human sex hormone-binding globulin is influenced by occupancy of a zinc-binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 31
structure length 172
sequence length 176
ec nomenclature
pdb deposition date 2000-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1f5fA00
1W6MA 1H9WA 1Q8QA 2Q5TA 3KM5A 5H9PA 3FUOA 3A0NA 1SBEA 1WLWA 4CTEA 2UWAA 2R1BA 1QMJA 3ILFA 4LBNA 1G9AA 1N1TA 1JBCA 1X50A 2A6VA 4K1ZA 3V64A 2PHWA 1KJLA 1VAMA 5HCAA 3B00A 2ZGMA 2A6XA 5DZEA 1IS6A 2ZGNA 2ZGUA 1DIWA 3WOGA 1BJQA 1S0IA 1WBLA 5GLVA 1OKQA 4KBBA 3ATGA 3ZXJA 4FPCA 5JOWA 2NP0A 5E88A 3D5OA 3PJQA 5JOXA 1AF9A 4XIOA 1IS4A 1HQLA 2ZGTA 3WDYA 2FMDA 1G9CA 4YM1A 2ZGOA 1WBFA 1WCSA 4F83A 4FPFA 2JE9A 4ITCA 4TZDA 1AXYA 4K20A 4YZ5A 2VY0A 2DUOA 3D4KA 4XE9A 1JOJA 1DBNA 1QOTA 2ZBJA 4LBOA 4P9WA 1GSLA 2GMMA 2ZGQA 3M3EA 1IS5A 3IKWA 3AZXA 3N36A 1YXWA 3WZ1A 5F9TA 1HQWA 1W6PB 1N47A 2ZGPA 5CNAA 1KITA 3V0AB 1BXHA 5JOZA 2CY6A 4DPNA 3TB0A 3VKOA 4R9CA 2W52A 4AGRA 2JKBA 1W6OA 3AP4A 3NV1A 1BKZA 1ULDA 2DTWA 2JE7A 4FPEA 2EALA 2CTVA 3A0KA 3WDUA 4BMBA 1JUIA 2ZZJA 5T5JA 1VALA 2NM1A 3WDTA 3AP9A 2E6VA 2WT1A 1CIWA 4FPOB 4DFSA 5H9SA 2GN3A 4YW5A 4UW3A 2A6YA 4YW2A 2V73A 1AX2A 1SBDA 2EAKA 1GYKA 1CN1A 3IPVB 1W6QB 5DUVA 1SLTA 2DV9A 3M1HA 2E7TA 5T5LA 1DQ5A 4M3CA 5GM0A 1ULCA 1AX1A 3MEPA 2GNBA 3AX4A 1AX0A 2GMEA 1LGNA 4HANA 1LECA 2E53A 1G9BA 4Q8LA 4XILA 1ZA4A 2PHRA 3PVEA 1FAYA 1LCLA 1QDOA 1S0FA 4DS0A 3R4UA 3ZSKA 3SISA 1ONAA 2AUYA 3AZZA 1SLLA 2A3YA 4M00A 4AVSA 2I2SA 1XQNA 4LBJA 4Y1ZA 4R9BA 5SV8A 5CAZA 1W6PA 1VIWB 5JDBA 2ZMLA 4XIKA 3Q9OA 2ES3A 3MW4A 4GALA 5T52A 2UU8A 1OFSA 1LULA 4AGVA 1SLBA 2A71A 3V0BB 4YZ1A 3OPZA 1JYCA 1LHUA 3V65A 4ISQA 1RITA 2YY1A 2D6NA 1URXA 1ULEA 1LESA 4LBQB 5AVAA 4RL7A 3AYDA 4PF5A 1WLCA 1N3PA 2EIGA 4GXLA 2D3SA 4UW5A 4R9AA 5GZGA 4XJZA 2ARXA 1BQPA 4XTMA 1IOAA 4XHXA 1APNA 3RMYA 1N1VA 3T1MA 4FP2A 1C1LA 3NWKA 5KXCA 1KRIA 3O0XA 1JN2P 1N3QA 4ASMB 4YW4A 2A3XA 3ZXFA 2Z42A 3ZSMA 4YM0A 4XBQA 1MR5A 1VAVA 4YGDA 2B7YA 5CB7A 1EPWA 3SH4A 1LU1A 1WW6A 1BZWA 1SBFA 4DQAA 3U4XA 2D44A 1VLNA 2WQZC 3WDVA 3BODA 2WT0A 3VKNA 5IK8A 2ZGSA 1A78A 5DXDA 2A7AA 3GALA 1LODA 2ZA9A 5DUUA 5HCBA 1KDMA 3V0AA 4PQ9A 1MS0A 1LOBA 2A75A 3ZSJA 4GWMA 2WNEA 3APBA 1HDKA 2DWRA 2VU9A 2WSUA 1MVEA 1HKDA 1UKGA 3VUOA 1S0EA 1LHNA 2CWSA 2CYFA 2LTNA 3O0WA 5T55A 1ULFA 4LBQA 4Y20B 1WUVA 1MS5A 3N3HA 1CR7A 2EXHA 2GALA 2D6LX 2EF6A 4XJWA 3UJOA 3WG4A 4XXPA 2DVDA 1AXZA 1MVQA 3DGTA 1DYPA 2A5ZA 1F31A 1U0AA 2VH9A 3BTAA 2YV8A 3M2MA 1V6OA 3POWA 2HYKA 4FOWA 4LBQD 4DRRA 1GZWB 4P9XA 5IT6A 3AP5A 2V5YA 3B3QE 4BMEA 4YG3A 3WDXA 3WDWA 4H55A 1DQ1A 5LK5A 5T5PA 1LENA 4BQ1A 1S0JA 1UAIA 3WVJA 3RRDA 4K21A 3ILRA 4YZ2A 1SLCA 5EYXA 5F5QA 4LBLA 4Y24A 4MYEA 3AZWA 1QU0A 1FX5A 1DFQA 1V6NA 3M3QA 1A8DA 2ZHLA 3OYWB 3RSJA 3ASIA 1Z78A 1S0CA 3QLQA 4FVVA 2YZ4A 1SFYA 3AYEA 3OBRA 2RHPA 4WVWA 3WV6A 5EYYA 4FQ4A 3NV2A 5GLUA 1Q8VA 3OY8B 1Q8OA 5DUWA 2D7FA 1DLLA 2ZABA 2R0FA 5GLTA 3UJQA 1SCRA 3N7LA 3D6EA 1LTEA 1IS3A 1W0OA 4C1WA 3AJZA 2P37A 4XZPA 2ZGLA 3ZSLA 1LU2A 3ZXLA 1FATA 1GZ9A 2OVUA 2DVGA 4YFWA 1G7YA 3UK9A 3IN9A 1GZCA 1Y7BA 3N35A 1UPSA 2DUPA 1LEMA 1LOFA 4GKYA 1B09A 3VV1A 4WZFA 5DZFA 1F9KA 1NLSA 1YIFA 1NXD1 1ENSA 5GLWA 3MW2A 4XHBA 5IK7A 4PBOA 2ZACA 1WW4A 5DG1A 3AFKA 2ARBA 4AVTA 2R16A 3O0VA 2VW0A 4XDQA 1LOFC 2H0BA 1QNWA 4ZXKA 1CQ9A 2E51A 3KQRA 3PVOA 1LEDA 3B69A 1AJKA 3FFZA 4XJUA 4ATFA 1F5FA 4ATEA 3OYWA 4FPJA 4M3CE 3ILNA 2VXRA 2G4IA 2SBAA 3AXDA 1R1ZA 1WW7A 3RMXA 3RQ0A 3TAYA 3SLIA 1MS9A 3CNAA 3SH5A 1W6NB 1SCSA 3RS6A 2PELA 2GMPA 5T5OA 1UZYA 1LGCA 3N7MA 1GV9A 1FNZA 3AZYA 3I4IA 3RG0A 3POYA 4GKXA 1W6MB 1QNYA 5GZCA 4Y1UA 3SH3A 2W08A 3AJYA 5KXDA 2WT2A 4CRQA 1CONA 1SLAA 3WLUA 4CZSA 1FYUA 1LHWA 2ZGRA 2D6MA 1RIRA 1YO8A 3IPVA 2YMZA 4BOWA 2PHUA 3M3OA 1AZDA 3GNEA 1W6QA 1CPMA 1CJPA 5T50A 2D3PA 2DTYA 5GLZA 2AREA 4YZ3A 4Q1RA 3L2YA 3WUCA 3ZPYA 3SITA 5CA6A 3QCWA 2GNMA 4IQPA 2VW1A 3INAA 2WLQA 4RA0A 2TEPA 1A3KA 5EWSA 3FUQA 1DQ6A 2D3RA 4Q8KA 1N3OA 1OQ1A 2DUQA 3T1LA 4FPLA 1WLDA 3ZXKA 3C2UA 4LBMA 5IUQA 3VKFC 3BOPA 4FP3A 5KXBA 1UN1A 1DGLA 1CVNA 4HL0A 4Y22B 1O4YA 1DHKB 5L73A 2ENRA 3HR9A 2W68A 3LSDA 2PHXA 1ENRA 3V0BA 2JECA 1GLHA 2DU0A 2NN8A 5E89A 2VUAA 2P34A 3AP7A 1Q56A 2GDFA 5GZEA 1H9PA 1J1TA 1V00A 1Q8SA 2D6KA 2AYHA 2ZMKA 1Q8PA 1S1AA 3JU9A 5DG2A 2ZHMA 1AVBA 5GZFA 3R4SA 2ZHKA 4Y1YA 1G9FA 4U2AA 2ZKNA 1G8WA 1N1YA 4Q27A 1N1SA 4XJAA 5T54A 1MS1A 5EXOA 4K1YA 4PCRA 1W6OB 5H9RA 3WG1A 3IMNA 1Z0HA 3FLTA 3LSEA 4YG6A 3AK0A 2P3JA 1KJRA 5E8AA 2DURA 4NOTA 4Y1XA 4P14A 1MACA 3FLPA 4YM3A 1C1FA 4D69A 3NV3A 2C9AA 4FPKA 5IK4A 1DQ0A 4XOGA 4YGEA 2A70A 3MPPG 4JC1A 5DUXA 2GNDA 3FBYA 1V6LA 2NMNA 1I3HA 1LHVA 2W39A 3AYAA 4GA9A 3N7KA 4YW1A 2OUJA 2E7QA 5GZDA 4M3CB 3OJBA 1D0HA 1QOSA 3IM0A 1DYKA 1JXNA 3I8TA 4UW6A 2A3WA 4XMIA 1PZ7A 5JOYA 2FHRA 2JDZA 4YW3A 4Y22A 2PHFA 1DQ4A 1UL9A 3JUUA 1W0PA 3ZYRA 1BYHA 4YGBA 1UMZA 4PBPA 2R49A 3ZXEA 5FRAA 1AXKA 1QDCA 1YYNA 1KDKA 3PMEA 1ZM1A 3M3CA 4JCKA 3VKMA 1JW6A 3W58A 2A6ZA 4Y20A 5IK5A 4AWDA 4JRAA 2JJ6A 1MS3A 3HMYA 3R05A 4L8QA 4Q1PA 1ULGA 2OUHA 2WSVA 3B9CA 2R1DA 3USUB 2WKKA 3FLRA 3WHUA 4AVVA 1GZWA 2AR6A 3LCPA 3AXEA 1TEIA 2UURA 3B01A 1C57A 4FQZA 4YZ4A 1LOEA 4Z8BA 2SLIA 1UZZA 4XJ9A 2A6WA 4W65A 2KM2A 1D2SA 2UWBA 3AP6A 4XYXA 4YLZA 1HLCA 1LHOA 4YGCA 3SNMA 3DUIA 1QOOA 1ENQA 1V6MA 4BM8A 1FV3A 1YI7A 2DVBA 1FNYA 2DVAA 2ZHNA 1UX6A 3ENRA 1IKQA 3UL2A 4C1XA 3N7JA 4XTPA 5JVVA 1WD4A 3OGGA 2ERFA 4UW4A 2D6OX 1YRZA 1CPNA 1GNZA 2OW4A 3OY8A 4LBKA 5KXEA 2GN7A 4FOYA 4YG0A 2GNTA 2CNAA 3A4UA 4SLIA 2AGSA 2VW2A 4AYUA 4WV8A 1IKPA 5FREA 1JYIA 3BIWE 2JD4A 2EXJA 4FOQA 2R0HA 4FPGA 4NO4A 3HN1A 1QF3A 3W59A 1QKQA 4ISRA 4BPZA 3POSA 1O4ZA 2NZ9A 3MW3A 1MZ5A 2PHTA 4OZXA 4R9DA 3WG3A 5JMCA 4U36A 2AENA 4M01A 4ZKTB 3AZVA 1GANA 1V6KA 2BQPA 4Y1VA 2EXIA 2ZAAA 2P2KA 4AGGA 1S0BA 1S0GA 3OBTA 1DQ2A 1LOCA 3USUA 1FV2A 1AJOA 1G9DA 4XMAA 4P9YA 4XBNA 2DU1A 3WCSA 2YROA 4Y26A 5H9QA 1WD3A 4FOVA 1I1EA 1G86A 5GJ6A 2P3IA 4BLIA 1LOGA 1MS4A 2EXKA 1C4RA 4FPHA 1MZ6A 2C5DA 2CL2A 2D43A 2XB6C 2XG3A 2ZMNA 4Q26A 4XBLA 5DZGA 1H30A 2AH2A 4YFZA 1S0DA 3WUDA 1JHNA 3WHTA 1GKBA 1GNHA 1SLIA 1PZ9A 3WCRA 3WNXA 5GALA 3T2TA 1GBGA 1GICA 5BYNA 4XXAA 2WJSA 2YXSA 3NV4A 1LJ7A 1PZ8A 3O5SA 1CESA 4I30A 2CWMA 3VKLA 5JLVA 4BLJA 1MS8A 4FPYA 1DZQA 3H0OA 1W6NA 4GWNA 1LGBA 1V6JA 2NMOA 1V6IA 4TYSA 4XJ8A 2UWCA 3O12A 2ZGKA 1WW5A 4WVVA 3WG2A 3AYCA 3ZVXA 2DYCA 3ZYPA 2P3KA 2D6PA 4YM2A 3PVNA 4M3CF 1QGLA 1RINA 2LALA 5HCFA 1SACA 4Q2FA 1KQRA 2DVFA 2NYYA 4DRVA 1LOAA 5CBLA
chains in the Genus database with same CATH superfamily
3KM5A 1ALYA 5H9PA 3FUOA 3SKVA 4RHV1 2R1BA 1MZEA 3ES4A 3WP5A 3LA2A 4XAEA 1ZZCA 2PHWA 2JDMA 1OOPB 2FDGA 2ZGMA 2Q8DA 5JR2A 4QQPA 1W2TA 2ZGUA 4MSVA 2PA7A 1W04A 4NRMA 1RMU2 1S0IA 1WBLA 5FIXA 1WWYA 2WN2A 5GLVA 1UWWA 3JB4C 4Q0QA 4YVSA 1ODNA 3ZDSA 3ZXJA 3VHPA 2QJVA 2NP0A 1HIXA 5C3SA 2ZEZA 2YPJA 1WA4A 5JOXA 2VOXA 2C0ZA 2FMDA 4QQLA 2VCAA 3I2GA 4UBGA 5IAVA 4YM1A 3H3LA 2ZGOA 3VLBB 1WCSA 4LOTA 3E6DA 1NG0A 3CU7A 4IGOA 5FY9A 4TZDA 1QJY2 5DAVA 2P6HA 4EZ4A 2VCCA 4CXYA 1H6YA 3ZYFA 3V56A 1AHSA 1UIKA 2VMEA 4PI0A 3H8XA 4LBOA 4P9WA 4R4XA 1CWPA 4XFHA 4BQWA 3I3BA 1IS5A 1HRI1 2IXIA 4BQ5A 4CP9A 3J26N 1RUD1 3WW3A 1R093 3WZ1A 2X5IC 5BNPA 3DYMA 5CNAA 1PM4A 5C9AC 3PJYA 1W3VA 2CY6A 4EROA 4NIDA 5A6ZA 1XBFA 4PIYA 2QE3A 1OURA 2W52A 2LROA 2WS91 4JVAA 3VB9A 1W6OA 3AP4A 4AHXA 5AFBA 3NRUA 1UY3A 3EYPA 4FPEA 1OMIA 3I49A 1DGWX 2RM21 3DYPA 4Q4Y2 4QD2A 5T5JA 3AP9A 2E6VA 3KQ4B 2IXCA 4FPOB 4MHRA 5FYHA 4CEYC 4YW5A 1XB9A 2BFUS 4XW3A 4UAPA 4YYOA 3P3NA 2Q1ZB 1DCSA 1SBDA 2EAKA 2HWC3 4BDVB 2RDRA 4IUGA 4EN0A 2DCYA 1VBD1 3N9LA 1SLTA 1NKGA 4AHWA 5C5TA 5J1XA 1KXGA 1DQ5A 1HB3A 2YC0A 5E6HA 2BZDA 1R1A2 4ASLA 4RYDA 1VB4A 1ZBE3 1HB1A 2GNBA 3AX4A 4ZU5A 2GMEA 3NMBA 4KMQA 1LECA 3KLSA 1VBA3 4Q8LA 4XILA 2PHRA 2TUNA 3ZFEA 1G9BA 1ACCA 1S2EA 1FAYA 1QDOA 3LDBA 1S0FA 3LEGA 5IATA 2LRPA 4Y5Z0 3ZPOA 3JD71 1CIYA 3AZZA 4RS5B 4M00A 2RS32 5DDJ3 1VBE3 2JWPA 1UY4A 1ENXA 2ETEA 5SV8A 5FO7B 3ZKYA 5BXXA 1CAVB 1DYOA 4GH4C 2OYZA 3RZMA 1CZVA 4OI4A 3V0BB 2A71A 2Y6KA 5FZIA 3O1VA 2D5FA 1PHMA 2WZR3 1B35C 1LHUA 3V65A 2ORXA 3GCWA 5APAA 1ULEA 4JTOA 3WW4A 4RL7A 4D3WA 1D2QA 2YHJA 4PF5A 5GLZA 1EAH1 2VCMA 2VVDA 3KV4A 3OUHA 4XTMA 2IC1A 3ZN4A 2BBAA 1STMA 5C71A 1ZX5A 3A7QA 4YWAA 1H8TC 4FCAA 2E7AA 4QPIC 1PGSA 2VULA 5DQ0A 1DDLA 1R092 2Y0IA 4BU2A 4B3NA 5KXCA 3U1XA 2GH8A 3ES1A 5CG9A 2XHNA 1AYM3 2EIEA 3IIAA 4XBQA 2XQRA 4JGZC 1VAVA 3ZN6B 4ZONA 1OF3A 4A6SA 5CB7A 1OLMA 3J7MA 5FY1A 5IVCA 1SMVA 5A3UA 4DQAA 3Q8AA 3ZSEA 2VUJA 2K9ZA 2D40A 1WCKA 5A6QA 3VKNA 2ZGSA 3OD4A 2A7AA 1LODA 4MGTA 2KXLA 4X6QB 3VN4A 4AVAA 3LOBA 4FSJA 4AFCA 5HCBA 1KDMA 2HWC2 2RR11 2XJRA 1MS0A 4GMP1 2RG4A 3V0AA 2A75A 3NSTA 3VHRA 1CAVA 2WNUC 2Q8CA 1S2KA 3MZHA 3HEIA 1UKGA 3IAPA 5KBFA 3EQEA 2DCTA 4FTBA 4AAXA 4B1LA 5JWPA 2CYFA 2LTNA 5FZGA 1QEXA 4A3XA 1VBA2 2Y6HA 4JRLA 2XLGA 3B9IA 4XXPA 1UZWA 2YGMA 1MVQA 1RUH1 4QB1A 1NE6A 5FMBA 1F31A 5CFCC 2VH9A 3BTAA 2YV8A 4FOWA 3LIHA 5DDJ2 1VBE2 1OVSA 3WINE 3DKQA 1ZA7A 2Z5WA 1CAWB 1LENA 2O8OA 3ZN6A 4G9SB 1A6CA 4MX3A 3WVJA 3RRDA 3I97A 3H1WA 3FHAA 3U11A 2VR4A 5F5QA 1BLZA 4Y24A 2WZR2 3CMGA 1OA3A 5BNQA 1QU0A 1FX5A 1RVF3 4HLTA 2PFWA 3ZSLA 5C8CC 3RSJA 2XHKA 1EV13 2VOWA 2YZ4A 4QDRA 4NR1A 1NCRA 2L9LA 3KVAA 3VD9A 4WVWA 1C5HA 3BPZA 4BQ4A 1Q8VA 5ACA1 4K3UA 5B4XA 4Y5TA 1UYXA 5DUWA 4F8AA 5BNPC 2D7FA 3OPWA 2VZVA 1RHI1 2CAUA 2R0FA 1AR83 4GJYA 5GLTA 1YFWA 2WFF1 1W0OA 1XNCA 1YCIA 4IE0A 4XQWA 5FZKA 4C1WA 1AYM2 4DOUA 1O91A 3H9AA 2DBNA 1FATA 3TYJA 1OOPC 2DVGA 4S2HA 5JZGA 1G7YA 3UK9A 2XPJA 2VZUA 1VPHA 3ZX7A 4BK5A 1UPSA 4JGYB 2DUPA 2XJTA 5FPUA 1LOFA 3S57A 5JCTA 4QQOA 4E2SA 1F9KA 3SEEA 1NLSA 1WGPA 1YIFA 3IDEA 5GLWA 5FP4A 5FYVA 5BY5A 1WW4A 3AFKA 4RGKA 1XJAA 3S5QA 5LEKA 5LZ6A 1PK6A 4Q4W1 2VJXA 1CAWA 2WLPA 3KV9A 4OYUA 4DXRA 1RUJ2 2W1SA 4ZXKA 3RJRA 4EYUA 4ATFA 4XJUA 3PTRB 5B4NA 2VTFA 4OMDA 4CA9A 3S5AA 4FPJA 4M3CE 2VMCA 1V9U3 3AXDA 2SBAA 4Q4V1 1R1ZA 3RQ0A 3TAYA 3SLIA 3GBFA 3JBG3 4DB5A 5IFPA 3VBOA 1SCSA 3WF0A 1TMF1 1HB2A 1YC61 2IXKA 4JKMA 4S2DA 3N7MA 2JKXA 3DXUA 3E6BA 5FYBA 2HJIA 1AR71 3I4IA 3GBWA 1HXS2 2RDSA 1QNYA 1X33A 3POEA 1OC1A 3D3AA 5KXDA 4OFGA 1LHWA 1RUI2 1W28A 4AFBA 2B42B 1W6QA 1UZ0A 1RVF2 2HWB1 3WW1A 2H6BA 2AREA 2QVSB 1C8M3 4YZ3A 2R073 2C4XA 2XOMA 3L2YA 1EV12 5BUVA 1UF2C 1K5MB 4DUXA 1JZ3A 1OSGA 3QCWA 3MI8A 2CV6A 4GIQA 5D2AA 3WY6A 2BGPA 3WP6A 4QX1A 1JYTA 5FFOC 4XETA 5FMOL 1JZ6A 4XFGA 5A80A 3GHNA 3NNJA 4HSJA 4UOJA 4YNIA 2HEWF 4LORA 4CCDA 4KWJA 1AR82 1WLDA 5KR7A 1WMXA 1OT5A 2WWJA 2XVGA 4LBMA 4OVEA 4D7YA 5A1FA 4PT6A 1J83A 5A3MA 1W9SA 3WNOA 3C3VA 2CGNA 3VBFB 1W8ZA 5A7OA 4MO3M 2C1FA 3ZYHA 2W68A 3LSDA 4RS5C 2BWCA 2PHXA 3VD5A 4E9KA 2JECA 1J3QA 4PHZA 1C28A 1XOYA 2EAAA 1OA4A 4I0AA 3T09A 3AP7A 2P34A 5ABJB 4YPJA 1QXPA 4BH9A 1W39A 2ORZA 2VZ1A 1Q8PA 1UY1A 3JU9A 1C3HA 2XGXA 1WCQA 2E33A 1VAKA 3GCXA 4A4AA 1G9FA 1Q3EA 4KGQA 4NMIA 5T54A 1G8WA 4DY5A 4J1XA 2P6CA 4Z1VA 1CZSA 2W87A 1D4M3 5FDBA 4N9HA 4NUBA 1Z0HA 2YBKA 4QM8A 4WVZA 3UKTA 1CX1A 2B5HA 2P3JA 5I8SA 4Y1XA 3UV9A 3HT2A 1C1FA 4QX7A 1ASJ2 1K5MA 3JBG2 2VMGA 4FPKA 3S6PA 4A44A 4EN6B 4XF3A 3MIEA 4RQPB 1FMD1 1VJ2A 2BUKA 4R4ZA 2BP6A 1PGL2 3HQUA 3MPPG 5DUXA 1RUE1 3FBYA 4MGIE 3EHKA 1XPWA 4GA9A 5LBCA 4YW1A 2HWD1 3MIGA 5GZDA 2JDUA 1L7RA 1QOSA 4LO8A 4B1MA 4IE5A 3VHOA 4RD7A 2JX9A 4NHKA 1TG7A 3MYXA 5FZHA 3A22A 3PU8A 3SQOA 3WF2A 2CAVA 5JOYA 1OKOA 3OUIA 1YQ2A 5DAQA 3JUUA 4YGBA 3BIEA 2R072 1NCRC 3GJAA 4PBPA 2R49A 4DUWA 2VL4A 5C8WA 3K4ZA 5HV0A 4HKWA 1HRV1 5CFDA 1ZZ7A 5IK5A 2EICA 4L11A 3ZYIB 1F15A 4K40A 5JSPA 1SPPB 4OI1A 3LGRA 3KD4A 1PNFA 3OOXA 1PM7A 3POBA 4OUEA 3VBUB 4NVPA 4ZZ8A 3ON7A 1O3TA 1GZWA 1RUD3 1Z7S1 4I09A 4AI2A 4BXSV 4E27A 1W0NA 1C57A 1UPIA 1LOEA 3MV11 2Z69A 3I2JA 2A6WA 1QQP2 2BOIA 4W65A 3S7IA 2AC1A 5A32B 4BA6A 1IPJA 3AP6A 3FC0A 1XYNA 2O8QA 1W9TA 4DXTA 1VRH2 3DUIA 1JHJA 1W05A 1FV3A 4TN7A 3DN7A 4HOOA 2QUOA 1UX6A 4LK7A 3ZDVA 1HN0A 5JVVA 1WD4A 3IDAA 2G19A 2Y0OA 4JTNA 4DZGA 2ERFA 3GZAA 1D4M2 4UW4A 3R6SA 2OW4A 2AEYA 2XJVA 3U75A 3VL8A 1PMJX 2GN7A 4FOYA 4YG0A 1VBD3 2A1XA 2CNAA 3S30A 2WL1A 3P5BA 2JENA 4LK6A 4J1WA 1O59A 2FCVA 3SCFA 1F8VA 5FREA 2VZPA 1RUC3 1JYNA 1JYIA 2BVBA 2R0HA 4XFBA 3HN1A 4FT8A 4CDXA 2R6QA 4QX8A 3W59A 4ISRA 5L36A 2JG9B 2V72A 4OZXA 1Y43B 3PUAA 5JMCA 1XSRA 4FXKB 1RL3A 3KHCA 1GANA 1PVC1 4HSLA 2VMFA 2C9KA 4AGGA 4ZXEA 4LO6B 4QHBA 5I0TA 3W9AA 1LOCA 1GQHA 1ZRCA 3NQHA 1WMEA 4P9YA 4XMAA 3WCSA 2YROA 2K46A 3M70A 3OF1A 3KVBA 4LXLA 2QQOA 3ACGA 1I1EA 1G86A 3ACFA 3CIHA 4JGYC 5GJ6A 2ZXQA 2J1TA 2EXKA 3EJKA 2F4LA 4Q0VA 1VBB2 2XB6C 1W2OA 2P4EA 5DZGA 5FP7A 5JSOA 4Y3OA 4C0BA 1TNFA 5A32A 1S0DA 4CUGA 1RUG2 5C3QA 3I59B 2VNRA 1GBGA 4N43A 4AI3A 4NIAA 1K5JA 1PO23 2WJSA 5C3OA 1LJ7A 1PZ8A 4AI8A 2V09A 2VBDA 2CWMA 3UESA 5JLVA 1F35A 3FFQA 1DZQA 1W2AX 4UXAA 1V6JA 3PHMA 3JCIA 3O12A 2DF7A 5CVRA 3NO8A 5J09A 3ZMOA 3RYPA 4CDQB 4YM2A 3PVNA 1QGLA 4WM7B 5HCFA 5AC92 2XKOA 5KHKA 3A21A 4OHWA 4CDUB 4D6QA 5JXJA 1HV1A 4FAHA 1YQ8A 4IEOA 2X05A 2VTXJ 1SBEA 1WLWA 2B39A 4XCBA 5I0UA 4CCMA 4CTEA 5IVEA 5FLIA 5FZ9A 2JG9A 1JBCA 1H2LA 5LK7B 2WZ8A 2XLAA 1VMJA 3B00A 3N9PA 1EPZA 4AL9A 2YU1A 3QOPA 4XABA 4LHSA 1W8HA 4P5HA 4IL7A 3FJSA 4GAZA 2VZRA 3KMHA 3RZKA 3LE0A 4NHMA 3KT1A 5CISA 5JOWA 4YSFA 2RS53 3N9NA 2ZEYA 5E88A 3PJQA 5LRSA 4BB3A 5ANQA 3DL3A 5LA2A 1AF9A 4HMZA 1IS4A 5F2SA 4NIIA 3LFMA 3OGSA 5HI0A 1GU3A 1K5MC 4OCTA 2VQTA 5FPZA 4PLNA 1RUC2 3I59A 3NAPB 3ZIXA 3J8F3 2WINB 5D8AB 3TBDA 5FLHA 5F39A 4QKFA 1AXYA 1W8UA 2W47A 1FPN1 2VY0A 2DUOA 4XE9A 4CU8A 1JOJA 1AYN2 1DBNA 1RUH3 5IVYA 1GSLA 4CUAA 2GMMA 1QJX1 3K3OA 4CDQA 1MQTB 3IKWA 3KT4A 2J1AA 3AZXA 3AL6A 4WM7A 1XE7A 4NIGA 1TME1 2BU9A 3VBFC 4CDUA 2Y34A 2ZGPA 4CU6A 3U07A 4CYDA 4DPNA 2KA3A 3D8CA 3MFAA 4R9CA 4CEYA 2JKBA 5F37A 3ME2A 3HQRA 2XWBB 1BKZA 5ABJC 2DTWA 1ZBA2 3WDUA 2CTVA 3ZFGB 4S2FA 2ZZJA 2X09A 1BHGA 5LA0A 4MV2A 5FY7A 3RZZA 1PO22 2IXJA 1UYZA 4DFSA 2GN3A 3NJYA 2BBVA 4J25A 3MICA 2A6YA 4UW3A 5FOJB 4OQ8A 1SEFA 1GYKA 3WNMA 3O1RA 2IZWA 2QQLA 5FK8A 5FZOB 5DUVA 3Q8FA 3WSOA 4A7KA 5C33A 3M1HA 5T5LA 2RDNA 3OEBA 4MXWB 2WFF3 1YEWA 4LKSA 4C8DA 1ULCA 2PYTA 4RQPC 4CCLA 2ATFA 2ZZQA 5D8AA 2MNGA 1VMFA 2BYVE 3OTFA 4K7JA 3UKVA 2BFUL 1FOD1 5BNNB 5CU1A 1H1MA 4INDA 1VB2A 2JIGA 2R061 4EN9B 1TNRA 2K0GA 3GBGA 3R4UA 3VD3A 3ZSKA 3SISA 1WKYA 2R32A 3E1F1 3VL9A 3I3EA 1SLLA 1LKNA 2MEV3 4W6YA 2WO7A 4Y1ZA 2YDEA 4Q4X3 4CVUA 4R9BA 1X82A 4AQSA 2RS52 4UI9L 2ZMLA 1XNDA 4Q4W3 4QQ2A 3MW4A 5ERLA 5A3OA 2UU8A 1NY72 5FOBB 5I0SA 2VVEA 3PUSA 1SLBA 3P3PA 4XFIA 3VBHB 3OPZA 5FP8A 3ZFGA 1RITA 2W2IA 1URXA 3J8F2 1LESA 5AVAA 5F1RA 5JMOA 1OLQA 5M0TA 2W3JA 3CEWA 3JXSA 4Y4YA 3K75B 2D5HA 2D3SA 3ZMNA 5GZGA 1D0GA 3VBUC 3AMPA 3WD5A 3ITQA 3DECA 4JGZA 1BCXA 1Y9MA 1IOAA 5K9YA 1APNA 4PDWB 2I07B 3BKZA 3F95A 1JZ8A 1HX6A 5FZOA 1JYXA 2WA3A 3T2PA 5A1AA 1SHWB 1H1AA 1N3QA 3O0XA 4MXWA 2Z42A 1I5ZA 1AR61 1R081 4GZ9A 2CGOA 1COV1 3H1MA 4YGDA 4A6OA 2QQKA 2XJUA 5DAXA 3POGA 3SH4A 1LU1A 3TN93 1AR93 3K51A 1SBFA 4MXVA 4JQTA 2D44A 1VLNA 2HWB3 2OX0A 4IW3A 3WDVA 1GQPA 1DF0A 4CCNA 1UU5A 2WT0A 2G9ZA 2XBO1 1A78A 5DXDA 5FQ0A 4NN0A 1NQDA 3ELNA 4TLFA 1XNTA 4G4FA 4QKNA 4DEQA 4UYBA 1SFPA 3UGHA 4DEVA 1LOBA 5FYTA 1ND2B 2WNEA 4AZZA 5C5UA 3APBA 1IPKA 2JB8A 4XZUG 1HDKA 2WSUA 1MVEA 3PMSA 4BYYA 3VBHA 3W20A 4HN0A 5EHDA 5CFCA 3CZJA 3NNFA 2CWSA 3O0WA 2JG9C 3OGJA 1E5SA 4HVOA 2EXHA 1QJU1 1RC6A 2D6LX 2EF6A 2HYXA 2WQ4A 3DPRB 4L92A 4UFMA 4D0QA 1AL21 5IVVA 3LPFA 1AXZA 4XF0A 4XAAA 1U0AA 2VMDA 3POWA 2MEV2 4PDWA 3WP3A 4SBVA 5KHIA 5IT6A 1UYYA 3B3QE 5FCCA 2Y6FA 4Q4X2 4YG3A 1J3PA 1RJ7A 3IDBB 3T2OA 3WDXA 2JDHA 3WDWA 3LAGA 4IV1B 5C8CA 5LK5A 3I2IA 4H3WA 1YFYA 4P08A 2VPVA 1W06A 1UMHA 3VD7A 4LITA 3ILRA 1EYBA 1R64A 1YIPA 2J1SA 2LW8A 3D0SA 3ACHA 4HBNA 4BCUA 5J96B 3WF4A 3W21A 3OYWB 1ZNPA 3J7LA 2XVLA 4XFAA 5EFUA 2BGOA 3CKHA 3B5LB 1S0CA 3QLQA 2H0VA 2XQXA 1MEC1 1W8OA 1REEA 3UNPA 1SFYA 2CDPA 1M06G 4CDQC 1FMD3 4D7SA 3UKNA 4FQ4A 3NV2A 4LHLA 1IQAA 1H8VA 4WM7C 3F2ZA 4OHYA 3OY8B 4KQ7A 1OOPA 4CDUC 2AEZA 1ND2A 5DAPA 2ZABA 3PTYA 4NWVA 4QX5A 2IUWA 1E5RA 1SCRA 3N7LA 4A7YA 4E2QA 2ZX2A 3I3QA 1LTEA 2C24A 2WBKA 5LBEA 5A70A 5C70A 2ZGLA 2ET7A 3RI8A 1S55A 4N9IA 5IHRA 1E5IA 3X29B 3WP4A 2ZX1A 2XL7A 3ZXLA 3TN92 2R043 1AR92 1YNAA 1YQ5A 2RDQA 3J7HA 1KFUL 1BEV1 3M3IA 5J7MA 2Q1FA 5FJKA 3HN3A 4GKYA 4CCKA 3L9JT 2RE9A 5DZFA 2WAAA 3MUZ1 3W5NA 2PTMA 4LO5B 4YRDA 1ENSA 3RYKA 3MW2A 5JUVA 5IK7A 4I01A 5FBJA 4BZ4A 2Q8EA 4KU8A 5DG1A 4YW6A 2ARBA 2X10A 5DN2A 3MIBA 2FZ1A 4I0BA 4IV1A 2VW0A 5J3UA 1JZ2A 4XQ4A 5IYYA 1QNWA 4JQRA 2PLV3 2E51A 3PVOA 4KU7A 4D94A 1LEDA 3AC0A 1AJKA 3B69A 3NAPC 1F5FA 4HG6B 2QQUA 2VQ0A 5D8AC 3S0MA 2YB7A 4PI2A 3OYWA 3WLUA 5LEJA 3ILNA 2VXRA 1DZRA 1C8NA 5LY1A 3E5UA 3E6CC 4I02A 3TEZA 2RMU3 4UF0B 3SH5A 2K2SA 5FO8B 5HCHA 1JI6A 1MQTC 5T5OA 5FBZA 3ZXGA 2YU2A 4COZA 2ARAA 1GV9A 5HPOA 3AZYA 3RG0A 1NT0A 4HPKB 1PIV1 3AKRA 2DDUA 5L9VA 1W6MB 2ZX0A 5FZ4A 3SH3A 2IXLA 1NX9A 2QDRA 2WT2A 2HEYF 3DEMA 4CRQA 3C7FA 1SLAA 2YBPA 3LKJA 1W9YA 4ZU7A 1BMV2 1FYUA 4LNVA 4W4ZA 3ZFGC 1RIRA 3BTYA 4BOWA 1ST8A 3ALQA 4ZZ5A 5T50A 2D3PA 4NIHA 3NW4A 3BVCA 4Q1RA 2VE1A 4AEMA 3WUCA 4QKDA 3ZPYA 5CG8A 1XNBA 3UGFA 2XWJB 5FYUA 2VW1A 3INAA 2WLQA 4IEXA 5FYSA 2FDHA 2R30A 4QPYA 2YPDA 5LY2A 1RUF1 4HKLA 1PO13 1QXJA 4DXZA 2FZ2A 1PVC3 2YFZA 5DAWA 4Q8KA 2WO1A 1NQJA 1WLTA 1ND3B 1OQ1A 3WF3A 1VRBA 4FPLA 4L0PA 2B4KA 3CQOA 4RS5A 5L19A 3ZXKA 3C2UA 5A7WB 4OQ9A 2ZOEB 2X29A 5IUQA 5FZFA 3VKFC 1J1LA 3BOPA 4JHTA 5CFDB 1U5YA 5BNNC 5KXBA 1UN1A 2R042 2WDBA 3T0BA 4QB2A 1W90A 4Z2AA 3N4MA 4GB33 3K77A 5L73A 3HR9A 3ZN5A 3V0BA 3H7JA 2DU0A 1ZBE2 5E89A 1ZRIA 4HT1T 2HWF1 1QHDA 2VUAA 5L9RA 4IE6A 4HVQA 1H2NA 2RVAA 1H9PA 5FV3A 1V00A 5K8SA 3UETA 4HPKA 3OBZA 1S1AA 1JZ4A 2ZHKA 1NZCA 1PGW2 4S2GA 4TXWA 4FTEA 3LFIA 2ZKNA 4U2AA 1N1YA 4XJAA 1N1SA 3VBHC 5I93A 2PLV2 4K1YA 3J7NA 5FXXA 2Q8OA 5FWEA 4QU2A 3WG1A 4COYA 4LA2A 5L9BA 4P14A 5BNOB 1JODA 3TRSB 3Q8EA 4YM3A 4D69A 3P6BA 3PUIA 2RMU2 1YJLA 4XOGA 2ZPXA 4PDWC 3H3ZA 4K8RB 1CAUB 4ZHNA 2A70A 3TNPB 2HWE1 1V6LA 1I3HA 2W39A 3POJA 3BN6A 3N7KA 1ODMA 5F2WA 1ND3A 4B29A 1SG3A 2IFRA 4M3CB 3OJBA 3D82A 1K45A 5A7WA 2JDAA 2A3WA 3K4DA 3KF5A 5IJRA 3K4AA 4UBHA 4FAGA 2JDZA 4YW3A 5FZBA 5CKMA 4R52A 3RDIA 4LR4A 4EE2A 5K0UB 1ULOA 1SDDB 4QMAA 2FD8A 5DMYA 2WR9A 1BYHA 2QQNA 3URFA 3PU3A 3U10A 1AXKA 4L99A 1X36A 1YYNA 1ZM1A 3M3CA 4V2VA 1Q5OA 1VBC3 2A6ZA 1UOBA 1VE0A 3MLKA 5LW9A 4DINB 1ND2C 2WIIB 4QXCA 1MS3A 1PO12 2QQVA 3R05A 1MZFA 5L7OB 2QQPA 2WSVA 1CZTA 4IV3B 1T2XA 1GOFA 4ZPIA 1UY0A 5FZMA 5FY4A 4GJZA 4FQZA 5BNOA 4UFKA 4AEKA 3DCQA 4Z8BA 1JH5A 1CX4A 1RMU1 1K3IA 1PNGA 2WRAA 4EWAA 4FBFA 4BE3A 5BPXA 2BTVC 4O9EA 5K7PA 5FO9B 1NE4A 1CAUA 3GJBA 1D2SA 4LKEA 4OULA 4XYXA 2W1QA 3C7GA 2XH6A 2WQ8A 4IV1C 1I5PA 3MUY1 4IE7A 2RS13 1EUUA 2DVBA 2QNKA 2ZHNA 4XPVA 3IZOA 3N7JA 3OGGA 4AI0A 1BBT3 3W5MA 1QJY1 2GP3A 1DGRA 4LBKA 1GNZA 5KXEA 2VMHA 2QQJA 1DG6A 3C7HA 1EP0A 4I3GA 4KWLA 4N8MA 4AOCA 4EJRA 1X9TA 2VG9A 4HK9A 4CDWB 4Z2WA 1DGWA 5LA9A 2QTWB 3SCGA 3T08A 2WO2A 4WV8A 4AYUA 5F8PA 4LQRA 1W2UA 1BVVA 1JOBA 1QF3A 1QKQA 2FDJA 1WA6X 2XJQA 1HV0A 1O4ZA 3MW3A 1FOD3 4LO4B 3WG3A 4U36A 4ZKTB 1X7NA 5JI9A 1O3RA 1V6KA 2BQPA 4JGYA 3OCPA 2ZAAA 5L7OA 1S0GA 4QDSA 2VECA 2OS2A 3ZFFB 4IV3A 3POFA 1WZXA 2QFEA 4FOVA 4Q4Y1 5FJHA 3O1MA 2WZPP 2FDIA 2JB4A 1XU1A 5DABA 1YHFA 4BLIA 3KZ4C 1C4RA 2XG3A 4XBLA 2IVJA 1AL0G 2JEMA 2OZ6A 1H30A 4DO0A 3NNMA 1GKBA 3WCRA 1LR5A 3WNXA 5GALA 2PXJA 4XXAA 4OMCA 1VBC2 3NV4A 3BPSA 2BPA2 3HPNA 2Y26A 1R1A1 4NHXA 4OZOA 1LGBA 3LEMA 4Z07A 3QD6A 4XJ8A 3ZVXA 1UD1A 4WVVA 1NYWA 3U78A 2ZJCA 4N7IA 5T3NA 4O61A 5FYCA 1KQRA 4LLFA 2DFCA 2YGLA 2NYYA 2WNUA 3H7YA 3WQ0A 3GM8A 4D6SA 1GOGA 4B4RA 4DRVA 5CBLA 5LWBA 1NCQB 2RS31 1COV3 3ZO0B 3SMHA 4KI5M 4LBNA 3ILFA 1G9AA 2WO3A 1XNKA 4CU7A 3V64A 3HVDA 1KJLA 1VAMA 3OB8A 4MGZE 2W94A 5HCAA 2A6XA 1V9U2 4LMFA 5DZEA 1IS6A 5LRRA 2VMIA 1QIQA 2XBO3 1DIWA 2XUMA 5FMDA 1BJQA 3MLJA 2RS12 3RI9A 3O1UA 2GAUA 4N7UA 3BALA 2ET1A 4RHV3 1OKQA 4KBBA 4L9BA 3FMGA 4QDQA 5CZKA 1BBT2 4BIOA 4FPCA 4QM9A 2FQPA 1V0AA 1U12A 2ZEWA 3VBSB 1HQLA 1X8MA 4RSUA 4BIFA 3WDYA 1XRUA 4NRPA 3N9QA 2C6SA 4A42A 2C26A 4AHYA 4CCOA 5JPMB 1G9CA 1RUOA 4F83A 2J7MA 2ZCWA 1JS9A 3THPA 1R091 3WX5A 1OA2A 1QJU3 4YZ5A 4K20A 4ET7A 5F3CA 3VBFA 1ND3C 4HETA 4QAWA 3U0ZA 3T4VA 3PIGA 4ASKA 5C7GA 1Y4WA 1QOTA 1C8M2 2ZBJA 1O3SA 2ZGQA 3M3EA 4WM8B 2IVIB 4KGGA 1LB2A 4GQ7A 5ABJA 1YXWA 5AVPA 1HQWA 1N47A 1KITA 4BQXA 1BXHA 1NCQA 2WC2A 3B02A 1UCXA 2VZTA 2VUDA 4NE9A 5JOZA 4PLOA 3TB0A 4N53B 2G1MA 3J9SA 5JAXA 2F4PA 1HRI3 2PQSA 2HWC1 1O8PA 1WCDJ 2JE7A 3FBMA 3NJXA 3A0KA 1EY2A 2BNMA 2O1QA 1OFNA 3B93A 3E97A 4BMBA 1I9RA 1WMFA 3WDTA 3NKGA 1CIWA 4M0HA 1MEC3 4PIZA 3WQ1A 5H9SA 2GC2A 4QGLA 2WS93 2I45A 4YW2A 2V73A 1AX2A 4RQPA 3I3DA 1POQA 2Y6GA 2MPFA 3IPVB 1VBA1 3CHXA 5BNOC 3N9OA 4CP1A 2RM23 4E4SA 3KS7A 3HBZA 2DV9A 2PAKA 1OXCA 3VBSA 2E7TA 1U5XA 5GM0A 4ZS2A 2JG8B 1YFXA 1AX1A 2MHFA 4B7KA 1IHMA 3MEPA 4W8JA 5DDJ1 1AX0A 1LGNA 1VBE1 1OUSA 4LKDA 4CCCA 1CGPA 4TTGA 2E53A 4NHLA 4AI1A 3K48A 1M4WA 1BEV3 1SDWA 1X8EA 1LCLA 4DS0A 2HBTA 4K6BA 5FZ1A 1VR3A 5FY5A 2AUYA 4WM8A 2A3YA 2WAOA 2ZTNA 4BXFA 2WZR1 4AVSA 5A3WA 2I2SA 1XQNA 2V4AA 4P00B 4RHV2 2ADEA 2B8MA 3KV6A 5CAZA 5HXMA 1VIWB 5JDBA 1RYYA 1SPPA 2FCTA 5JXHA 3Q9OA 5T52A 1OBNA 3AKTA 3CJXA 3I54A 3JD73 1LULA 3ABZA 3EBRA 3HNMA 2JD9A 4N53A 3VBUA 2ZX4A 2BW8A 4RFRB 4ISQA 2D6NA 5FP3A 2VGDA 5JXGA 3GYDA 4IEWA 3AYDA 4C91A 2Q30A 4XEZA 2VVFA 2EIGA 4UT5A 2NLRA 4RGAA 2VM9A 4UW5A 5G04L 4R9AA 4QPGB 4E8CA 4XJZA 1JTZX 1AYM1 1TE1B 2ZS6B 2QZ3A 4O65A 4IV3C 2JICA 4GMP0 2ARXA 4XHXA 3RMYA 1JYWA 1N1VA 2CDOA 3T1MA 4FP2A 1C1LA 2YBSA 3NWKA 1Y3TA 4D7TA 2XKPA 4AE2A 1KRIA 2B9UA 5FUNA 4KG8A 4ASMB 3CJIB 1EAH3 2XL9A 4UWDA 3ZSMA 1T6GC 3WW2A 1MR5A 4J6GA 2BEOA 3ZXAC 4XDPA 1SFNA 1W99A 2RJ2A 4O9GA 1HRI2 2XJSA 1BZWA 1HJGA 4N90A 1RUD2 3MIFA 3I2FA 3MIDA 4LT5A 1RUJ1 1YWKA 1HJFA 4LOSA 1RGSA 4X8PA 5FUIA 3GALA 1W3XA 5J36A 1UW8A 2QKDA 2WS92 2ZA9A 2OQ6A 4IEYA 1RUF3 2J22A 4H7LA 2AACA 4TLGA 4GWMA 4CDWC 1P8JA 2RM22 3OGRA 4P9GA 1JZ7A 2V4VA 1HKDA 3VUOA 4XQDA 1S0EA 1LHNA 1WCUA 2KD7A 3DKWA 4WBBA 1W8TA 4Y20B 1MS5A 4GMP3 1CR7A 2RR13 3VGIA 1ZRFA 1KS5A 1HXS1 2JDKA 2W1WA 3JQXA 4Y5SA 1VBD2 2VOVA 4QPGA 3NKTA 4HZFA 3DGTA 3WNNA 1POV1 4HXCA 2A5ZA 4MADA 2PHDA 4FFIA 5HV4A 5I0RA 3I2KA 3M8LA 1ZZ6A 1RUI1 4XVHA 3FL7A 3OPTA 3C7OA 2VNOA 3PDQA 4LJHA 4CPBA 1OPMA 4DRRA 1PMIA 2V5YA 3GZEA 4NAOA 1RVF1 4BMEA 2G9FA 1T6BX 5FYMA 1EV11 3CJIA 1DQ1A 1RJ8A 4FFGA 3GDBA 4H55A 5T5PA 5K4LA 1W8WA 2UY8A 1UAIA 3RJ2X 4H2AA 3JD72 4PLMA 4CPBD 4YZ2A 2VZSA 1J58A 1YJKA 4LE4A 5EYXA 5FZ3A 4E4ZA 1JYVA 3M3QA 1DFQA 1L3JA 2OPKA 4A3ZA 3MGUA 4QPWA 1Z78A 1AR81 2Y6JA 3IIIA 4DXSA 3HWJA 3AYEA 3LDRA 5EYYA 1V70A 3Q8CA 2HWE3 5GLUA 5EJ1B 1Q8OA 2Y6LA 3VDDB 1DLLA 4HKOA 3UJQA 1NCQC 2VNVA 2ZEXA 3CBNA 5HXVA 1EAH2 1IS3A 3SKJE 5F3EA 1YUDA 3T4HB 1LU2A 3BU7A 4AFMA 4GWIA 5SV5A 1H0BA 1GZ9A 2OVUA 5ACA3 4AFDA 3IN9A 1GZCA 1Y7BA 1RHI3 1IGOA 2Z4FA 3EMRA 5LBFA 3AVRA 4BJ0A 2XDVA 1A34A 5FZDA 1B09A 1DU3D 1O7FA 1XC6A 3ZYGA 2Y60A 3NAPA 3SC7X 1NXD1 2ZAHA 4XFCA 4XHBA 4PBOA 2ZACA 1YQ6A 3VBRB 4AF9A 1S4CA 3O0VA 4XDQA 1JU3A 3VBSC 1ASJ1 3JBG1 2H0BA 5FY0A 5F32A 3TNQA 3KQRA 1H6XA 2WFPA 2X53S 1PGL1 1MQTA 4IGQA 4ATEA 3BTXA 4URAA 1RB8G 4COVA 2G4IA 1WW7A 3RMXA 2RR12 3P1IA 4KBZA 3NJZA 1MS9A 1UOJA 4KWUA 4QXBA 3CNAA 1RMU3 5KC5A 1W6NB 4LLOA 4QGNA 3RS6A 2PELA 2GMPA 4IERA 4WM8C 1PX3A 1UZYA 3S7EA 5BV6A 3DV8A 1LGCA 4COUA 3VDDA 2VNGA 4Q4V3 1FNZA 3TEWA 1Q43A 3POYA 4GWJA 2R071 2GC0A 2YYOA 4GKXA 2CGPA 3ECQA 4N53C 4Y1UA 5GZCA 2W08A 2W91A 1TMF3 5JI7A 1RUH2 3O1PA 3K2OA 4CZSA 2ZGRA 1W2NA 3ZYJB 2D6MA 1YO8A 2PHUA 1GZTA 4KH9A 5CADA 1AZDA 1AR73 5J48A 1CJPA 2H6CA 1US3A 2DTYA 2OXBA 4PJYA 4X6RB 3IWZA 5EPAA 3T0DA 5F3GA 5E16A 2QQMA 2RJKA 3SITA 4IQPA 2JXAA 4LE3A 2TEPA 2VQUA 4YVSB 5EWSA 2BJSA 4ZS3A 3FUQA 1HB4A 5EP9A 3JQWA 1OUXA 5BNNA 4NRQA 1W03A 2WA4A 4QB6A 4URTA 5A3NA 3TEXA 3O7OA 2DUQA 5FAXA 1QQP1 1UYPA 2IXHA 3T30A 4FP3A 1VRH1 3VZOA 5D21A 3RZLA 5FLJA 4W6WA 1DGLA 4Y22B 5ACA2 3POIA 1O4YA 4CP0A 1DHKB 4DIQA 3NNLA 1RHI2 3BU0A 2E26A 3WQBA 2WFF2 2HKXA 2WYSA 1D4M1 4JKLA 5GZEA 3T2TA 1Q56A 2D6KA 5FZAA 2ZMKA 2AYHA 2HLEA 4OHZA 3R4SA 4MOAA 4Y1YA 2G9GA 3RGBA 3I2HA 4Q27A 4YARA 2YC2A 1MS1A 1W6OB 4QT6A 4OHXA 3IMNA 4NPMA 2J1RA 3NNGA 4YG6A 3I3MA 3AK0A 3A23A 5A6YA 1KJRA 5E8AA 4NOTA 3ZIWA 3K46A 3FLPA 3NL1A 1EUTA 3WT3A 4QPGC 4XACA 5C4WB 4Q4W2 2OZJA 2GC1A 2RS33 2C9AA 2WN3A 5IK4A 1DQ0A 4YGEA 1CJDA 2ZKLA 5FPVA 3K3NA 4ARYA 4BQ2A 4B8EA 4EN7B 4P02B 1UXXX 2ID4A 2GNDA 4WVMB 1MPXA 5A3TA 1LHVA 3AYAA 3H8UA 1F4HA 3H8OA 4Q4V2 3CJIC 3VZLA 1VBB1 1UOFA 2OUJA 4PQQA 3ZOIA 1DYKA 2DCJA 3I8TA 4UW6A 5FTTC 1RUG1 3R0RA 2BERA 1H4HA 1TMF2 3U14A 4YW7A 3MV01 1OLRA 4QXKA 4K8FA 2BNNA 1RUE3 2FHRA 4MGSA 4L97A 2PHFA 4Y22A 1GUIA 3ZFEB 1DQ4A 1UL9A 5CEHA 2FDFA 1AR72 1F2NA 1FT9A 2HWD3 5JR7B 4AVBA 5FZEA 1UU4A 4IEQA 1UQXA 3LOIA 1DZTA 5FRAA 3ZXEA 2QZ2A 3PMEA 5I8YA 3W58A 5AC91 4E4DX 4ZY9A 5J98B 4P9JA 3WNKA 4IEVA 1SZBA 2BVVA 5FZLA 3DPRA 3HQXA 4JRAA 2JJ6A 4OUMA 3HMYA 4Q1PA 3HT1A 2XXZA 4CE8A 2HWB2 1ULGA 4QGMA 1OD5A 1BVP1 1LRHA 2R1DA 2F6BA 3IAQA 5FWJA 3HIFA 3FLRA 4HONA 3AMQA 2GSYA 2AR6A 3M4FA 1HRV3 1UZVA 4ONUA 1WMDA 4W6XA 4C0HA 2UURA 4YZ4A 1UOGA 2SLIA 1UZZA 5C4WA 3R4DB 4XURA 4FFHA 2HH9A 2VQAA 3DF0A 5CYYA 1ZRRA 3HNYM 1DLCA 3RWNA 2GC3A 3AVSA 5FUPA 2UWBA 2CU5A 4BHPA 1PMHX 1Z7S3 3J4UH 4WVMA 4NPLA 1XYOA 3SNMA 4CUCA 1QOOA 4AEJA 3DYOA 3H8RA 2W95A 4DMIA 1OQDA 3H50A 4BM8A 5I8TA 1YI7A 3KV5A 3ENRA 1IKQA 1RUC1 4LO7A 4XTPA 3UL2A 4C1XA 1OPOA 3B94A 1GP5A 4Q0SA 3AB0A 5CIRA 1CPNA 1GWKA 3OY8A 2GNTA 4IE4A 4NWWA 3A4UA 4HVRA 4QXHA 3JB8A 5EV7A 1AYN1 4QHZA 1NOVA 2AGSA 2VXJA 2W92A 2VW2A 4JKKA 5A3LA 3LZZA 2E32A 1SQ4A 2DCZA 1D4VB 2BRTA 4FOQA 4CXXA 2PQQA 2QDNA 3POSA 4R9DA 3VDDC 1MZ5A 3V0AB 4LULA 2AENA 1OH4A 2O14A 4M01A 4YVWB 1XNAA 4Y1VA 1ZYBA 2E63A 4XC9A 1S0BA 1FV2A 4LHNA 2LM3A 4XBNA 5JPNB 1ZBA1 2DU1A 4Y26A 1FMD2 1ZZBA 1PO21 1GOHA 1RUE2 2P3IA 1MS4A 4AQ6A 4FPHA 1MZ6A 1W8FA 2CL2A 2D43A 2HWD2 2YG0A 3OSDA 3MFCA 1NLQA 3WUDA 5FMCA 1GNHA 4RR3B 5IFTA 1YI9A 3BOWA 4IEZA 5BYNA 3VBRC 3O5SA 4Y33A 5IAXA 5FZ7A 5LBBA 4HN1A 4G3YC 4I30A 3KHBA 4CUBA 3H0OA 4GWNA 3HD8B 4TYSA 1IG0A 4UF0A 1OLME 1QJEA 1V6IA 2EA7A 2GU9A 3VZMA 2UWCA 3WF1A 2ZGKA 3VZKA 3ZYPA 3WG2A 3AYCA 2OQ7A 1UY2A 1CAXB 4M0NA 4AR2A 2D6PA 1J3RA 1S2BA 2WWSA 2Y38A 4M3CF 2LALA 1HRV2 1POV0 3FZ3A 4Q2FA 2P3YA 3RFRA 3WXPA 4EQVA 2DVFA 5C6CA 3KGLA 3L2HA 5LATA 1GFF2 1O3QA 4H7MA 1W6MA 1H9WA 1Q8QA 2Q5TA 1L7QA 5FPBA 3SXWA 1ZRDA 1NCRB 2VO5A 3A0NA 4OHVA 1GP4A 3OBAA 2UWAA 1JOPA 1QMJA 5FPXA 3BTZA 2I74A 1N1TA 1X50A 2A6VA 4K1ZA 2RS51 2UYBA 1UIJA 1Z7S2 4QHOA 4YVWA 5KC6A 1RUJ3 1NY71 4XFFA 2ZGNA 3VDCA 2YFUA 3WOGA 3MPBA 4QKBA 2BNOA 2D93A 5FYZA 1QXRA 3CZUA 1RUNA 2J1UA 4IESA 3ATGA 3J8F1 4EWDA 4PF1A 3THDA 4NROA 4GULA 5JZGB 3D5OA 4B7EA 5TSWA 2P5BA 3H1YA 4XIOA 1XU2A 5FKBA 4COWA 2ZGTA 3BCWA 3ETPA 5C3PA 4TWTA 4F7ZA 2W1UA 2JDPA 3H42B 1KEXA 1IPSA 1WBFA 2J42A 4RR3A 4YVSC 5F6LB 4FPFA 2JE9A 4ITCA 4JDMA 1HXS3 2LUWA 2Y8KA 2QBXA 1OF4A 3D4KA 1PK6B 3RVHA 4XDOA 4NJ4A 4JX0A 3RPQA 1ZREA 4IDZA 5LB6A 1POV3 4AAPA 1XE8A 1CAXA 1UKRA 1RUI3 2WYFA 2YC4A 4H14A 1JZ5A 3AMNA 4BQYA 2EVXA 3N36A 4AG4A 3H3UA 4LUMA 5F6KA 5F9TA 1H2KA 1W6PB 1UMIA 1FPN3 2W9XA 3IB3A 4CP2A 4AK3A 4LEJA 1PVC2 1W9WA 3ACIA 3G6JB 3LIGA 3PVBB 3VBOB 1NA1B 3VKOA 3MF9A 1QJX3 2XLFA 4RN5A 4AGRA 4ARXA 3LA7A 3NV1A 4AEDB 1ULDA 4EWEA 5F3IA 2EALA 4ES8A 4Z82A 1JUIA 3DPRC 3UYJA 1TME3 4Q29A 1VALA 2NM1A 5ANNA 2JDYA 2WT1A 3ZM8A 3N9MA 3FN9A 2HEVF 1REFA 1HQNA 4GB32 1U5ZA 2WNVB 4MVTA 4I0WB 4ZU4A 4IGPA 5FY8A 2Z2SB 4AQTA 5I0DA 2J1VA 1CN1A 3AL5A 3PNAA 1W6QB 4MGKE 3UGGA 4L2NA 2PAEA 3AKQA 5C4WC 2OT7A 4M3CA 5A7PA 5FR3A 4RGGA 2VC9A 2MEV1 5EZWA 3TOJA 4XUTA 3BYWA 4HANA 4Q4X1 4Q0UA 1ZA4A 3ORJA 3PVEA 5K0UA 4PIXA 1NXMA 2QCSB 5FPAA 3I2OA 4AHZA 1J59A 1ZZ8A 1ONAA 2FBEA 1G6NA 5LCWL 3LQCA 3THCA 3KCCA 3IMMA 3LEIA 5F5IA 5KHGA 3USSA 4LBJA 5D1IA 1LAJA 3ZFEC 3G7DA 1W6PA 1BK0A 3VD4A 4MUVA 4XIKA 1ASJ3 4QQHA 1E5HA 2ES3A 2R063 4GALA 4FFFA 4CU9A 3MBWA 1NA1A 1OFSA 3FHIB 3OG2A 4AGVA 5KWRA 4OI0A 4YZ1A 2AZ5A 1DP0A 3ZR5A 1UU6A 2ILMA 1JYCA 4AEDA 3JZVA 5IVFA 2YY1A 3T0AA 4CEWB 4LBQB 5FYYA 1OHFA 2IFWA 4C90A 4CCEA 4QX0A 2NPIA 1WLCA 1N3PA 2OA2A 4GXLA 1ULPA 2E9QA 3ZLIA 1GWLA 2BWAA 2WNVA 1QJFA 5F7UA 1BQPA 2VZOA 3TN91 5C3RA 1AR91 1JUHA 2VBPA 3I2DA 3VZJA 1C5IA 1TVGA 2FMYA 1JN2P 1QY4A 4YW4A 2A3XA 3M7AA 3ZXFA 1FPN2 1X9PA 5IVBA 2P1BA 4YM0A 2B7YA 1QJX2 4XUOA 1EPWA 5FZ0A 4MG2A 1WW6A 4LKFA 3U4XA 2VOTA 4JDOA 4Q0PA 2WQZC 5FXZA 1JU4A 3IBMA 1TME2 3BODA 3AFGA 1A8MA 4CDWA 4FTSA 2VAUA 1K12A 3E5XA 4WZCA 1AR63 3O14A 1R083 5JIUA 2A73B 4GD4A 3RWKX 1PVXA 3D0JA 4QWNA 5DUUA 2QQIA 2W46A 4PQ9A 4AVCA 1F5JA 4XUQA 3ZSJA 3OUJA 3HAGA 3MLLA 3PIJA 3E5QA 1O5LA 4D8MA 2DWRA 1QQP3 2VU9A 2VZQA 3FWEA 1OQEA 2JE8A 2VD7A 3GHMA 3ZFFA 2GH2A 2F17A 4M4RA 2DBIA 3RZJA 4CEWA 1VRH3 1ULFA 4LBQA 5G05L 1WUVA 2NQYA 5T55A 4AI9A 3N3HA 1XYPA 2GALA 2RJLA 3HBKA 4YVWC 4UFLA 3VDAA 1KD7A 4OI2A 4XJWA 3UJOA 4X8NA 3WG4A 2XR4A 1AUYA 3KWVA 2DVDA 2W5FA 4KNCA 3WNLA 3WQ7A 1DYPA 5FXWA 1BMV1 3GXUA 3KB5A 3M2MA 4B4QA 1V6OA 5F5AA 2HYKA 4LBQD 1GZWB 4P9XA 3AP5A 3SCHA 5LA1A 2CHHA 3ZKUA 1FOD2 1NUKA 2VTXA 1AL23 4BQ1A 2CSGA 1S0JA 2R062 3IDCB 4F3JA 5A7QA 5FZCA 4K21A 4EN8B 5EIYB 4RR3C 1SLCA 2IWGB 4LBLA 5I91A 3PLQA 1RXGA 5IWFA 4MYEA 3AZWA 5EXOA 1V6NA 1A8DA 2N7GA 2ZHLA 1UXZA 2KR2A 2XUEA 3ASIA 4UFIA 2OKXA 4EV0A 4FVVA 4MZUA 1ZVFA 1O6UA 3FE5A 5FK7A 1O5UA 3ST7A 3ETQA 3OBRA 2RHPA 3LWCA 3WV6A 4UFJA 4MGYE 2R041 3AKSA 1TQ5A 4UFHA 2DFBA 1VBB3 2WWUA 2PN5A 2Q4SA 1BK1A 3D6EA 3C7EA 1NAEA 2FCUA 3AJZA 2P37A 1RUG3 4M4PA 4TSVA 1ZBE1 1D7PM 4XZPA 3GZUC 3RYRA 3THTA 1REDA 3PL0A 2P17A 4CDXB 2ARCA 4V1PA 1IZ3A 4YFWA 5J37A 3DXTA 5CKQA 5HBAA 1PGW1 1Y9QA 3N35A 4P9IA 5GKAC 2X8KA 1LEMA 1KS4A 4V2WA 2PLV1 3VV1A 2O0OA 2VZ3A 1E57A 1R082 4WZFA 1AR62 1COV2 2JDNA 4KG0A 5AC93 3PURA 2B45X 3NVCA 5JZGC 3T2QA 3MDPA 3VHNA 4E4HA 1W8NA 4AVTA 5IVJA 2R16A 1LOFC 2RMU1 5JIAA 3KCYA 4BISA 3AMMA 1CQ9A 2XBO2 3QH7A 3FFZA 4LUKA 4XUPA 1I6XA 3LD8A 5FXVA 1O8SA 3MIHA 4N43B 5K0UC 1PK6C 4E8DA 4AW7A 4A7ZA 2PMWB 4KWKA 1QH7A 4XF9A 2B46X 1LNSA 5IW0A 4OLLA 1FXZA 3OEAA 4CCJA 4OUSA 4QX3A 1QJU2 3VBOC 1F4AA 1US2A 1NA1C 4W50A 5E1RA 1K42A 5KHJA 1AL22 1XE0A 3AJYA 3TWIA 1J84A 2R7EB 5FMOS 1CONA 2EIDA 3ACLA 4AEDC 2VBBA 3IPVA 2YMZA 4JV4A 3KF3A 3M3OA 1OH3A 1PO11 3GNEA 1CPMA 1GMMA 3QBQA 1AYN3 1PIV3 5B2GB 4FI9A 1OVPA 5L7OC 3Q8BA 2WNVC 3WEZA 4ES9A 2JG8A 2RV9A 5CA6A 2GNMA 4BWOA 4RA0A 1HN1A 1A3KA 2WABA 1H2MA 3CO2A 1W9FA 2XONA 1DQ6A 1OD3A 1YLLA 2D3RA 1L7LA 4GB31 1N3OA 1YFUA 4MH0E 3T1LA 2PAMA 3HJRA 3TEYA 4LHKA 1MEC2 2GP5A 1ZBA3 4JDNA 3IT8A 1U5IA 3QH6A 4HL0A 1CVNA 3WNPA 3LB9A 2X5IB 4JHZA 4JZRA 4QU1A 3SEPA 3RZHA 2ENRA 5C9AB 1QJZA 1ENRA 3KGZA 1NLRA 1GLHA 1GWMA 1UNBA 3ZR6A 2NN8A 2E31A 2GDFA 1J1TA 4AFAA 1Q8SA 3BGAA 5DG2A 4A2UA 1H4GA 1AVBA 2ZHMA 1BEV2 5GZFA 1QH6A 3HNBM 3LF7A 2GZWA 4I3PA 5IK8A 3U4SA 3ZFFC 4CSWA 1PX4A 4DY3A 3KCXA 4O7XA 4PCRA 4CEYB 3MF6A 4I2OA 2ZX3A 5H9RA 3SHRA 4CEWC 2HWF3 2EIBA 3FLTA 3LSEA 4XF4A 4DUVA 3U37A 2DURA 1IQDC 1ZZ9A 4K9SA 1MACA 3PUHA 2VOKA 3NV3A 3BB6A 1Y9GA 5F5CA 3GGLA 2V5DA 5EJZB 1NZIA 1RTVA 4LIUA 5AFEA 4P5YA 4XUNA 5DPNA 4JC1A 2NMNA 3AKPA 3VDBA 1GNYA 1KGYA 2E7QA 3GZTB 1D0HA 3O1TA 3IM0A 1GP6A 3NJVA 4FO9A 1JXNA 5A33B 5FZ8A 4XF1A 1VBC1 4XMIA 1PZ7A 2WZEA 2Y64A 3BUCA 1CD3G 2X5IA 4BK4A 3OGVA 4LPLA 1W0PA 2YUEA 3ZYRA 5C9AA 1PIV2 1UMZA 4GH4B 1O4TA 1TZOA 2UYAA 1QDCA 5LASA 1KDKA 4JCKA 3KSCA 3VKMA 1JW6A 1B35B 1KFXL 2TNFA 2WUHA 4Y20A 4ORFA 4XCAA 4AQ2A 5ISLA 4AWDA 2XVKA 5EJ3A 4L8QA 2D98A 3GF6A 3HOBA 5A6XA 3LEKA 1VP6A 2OUHA 3VZNA 3B9CA 3FX3A 3USUB 2WKKA 4IEPA 5A3PA 3WHUA 1OI6A 3AM2A 4AVVA 4MGQA 5CFDC 3LCPA 1H1IA 3AXEA 1TEIA 3B01A 1V9U1 1H8TB 3MO4A 4QPIB 1RUF2 3PUQA 2RS11 3ZYBA 4XJ9A 4QX2A 1UO9A 4DNYA 3C8XA 4IEUA 5KHHA 4JGZB 5FKCA 2KM2A 1BBT1 2FDKA 2DCKA 2HBUA 4MHUA 1VMHA 4YLZA 1HLCA 1LHOA 3EXUA 4YGCA 5CKNA 3FHQA 4Y4RA 2BV4A 2VCBA 1ENQA 4A41A 1V6MA 2JIJA 3OD0A 4RFT0 3O1SA 1FNYA 2DVAA 2B9VA 3CDZB 4LA3A 5A33A 4E2GA 3QACA 5JSRA 4FXGB 2Y33A 2XJPA 5JXIA 2D6OX 1IG3A 1YRZA 4B4PA 2BDRA 2XMLA 4META 4R8HA 4P9LA 2HWF2 2Q1MA 3ZXDA 3RZGA 4NHYA 4SLIA 3CLPA 1C8M1 2WNUB 1XSQA 1HW5A 2Q0AA 3EO6A 4GH4A 3CF6E 5FQ0B 1IKPA 1GQGA 1QWRA 2PHLA 3UT0A 3BIWE 2JD4A 2D97A 2EXJA 5FPLA 4FPGA 4NO4A 1B35A 1QJY3 4BQ3A 4BPZA 4D6RA 2NZ9A 3MHZA 1UX7A 2PHTA 2QQWA 3LDKA 2VUCA 1RXFA 3AZVA 3LPGA 2BGCA 2EXIA 4NPRA 2P2KA 3OBTA 1DQ2A 3EB7A 4KL1A 3RNSA 3USUA 3CL1A 1AJOA 4LIVA 4NAMA 5CFCB 4IXLA 2TBVA 4CDXC 4HFSA 4MLOA 1G9DA 4HK8A 3LA3A 5H9QA 1FI2A 1WD3A 5A7SA 1H8TA 4QPIA 2HWE2 2LS6A 4IETA 3VBRA 3BI3A 4AXOA 4Z92B 5FZ6A 1LOGA 3I7DA 2C5DA 2ADDA 2JG8C 2ZMNA 1XXNA 4Q26A 4YFZA 2W0XA 2AH2A 3O1OA 3KT7A 4Q5OA 1JHNA 5A7NA 2WNOA 1SLIA 3B7MA 3WHTA 1GR3A 1PZ9A 4EZHA 4A45A 1GICA 5FYIA 4Q4Y3 2BOJA 4CXWA 2YXSA 3VKLA 1CESA 2OIIA 4BLJA 1MS8A 4FPYA 5C8CB 1W6NA 2NMOA 1YQCA 3WR0A 1WW5A 2Z79A 4JAAA 2DYCA 3ROUA 2P3KA 4LTAA 5EQUA 2OPWA 3AMHA 5FP9A 4N43C 4CP9B 1RINA 1DGRN 1SACA 2UY9A 5A1LA 5BNPB 3T3YA 2J1EA 1R1A3 1JMUB 1LOAA
chains in the Genus database with same CATH topology
3KM5A 1ALYA 5H9PA 3FUOA 4RHV1 2R1BA 1MZEA 3ES4A 3WP5A 3LA2A 1ZZCA 2PHWA 1OOPB 2ZGMA 4QQPA 2ZGUA 4MSVA 2PA7A 1RMU2 1S0IA 1WBLA 5GLVA 3JB4C 4Q0QA 4YVSA 3ZDSA 3ZXJA 3VHPA 2QJVA 2NP0A 1HIXA 2YPJA 1WA4A 5JOXA 2VOXA 2C0ZA 2FMDA 4QQLA 4UBGA 4YM1A 3VLBB 2ZGOA 1WCSA 3E6DA 1NG0A 3CU7A 4TZDA 1QJY2 3V56A 1AHSA 1UIKA 4LBOA 4P9WA 4R4XA 4XFHA 1IS5A 1HRI1 2IXIA 3J26N 1RUD1 3WW3A 1R093 3WZ1A 2X5IC 5BNPA 5CNAA 5C9AC 3PJYA 2CY6A 4EROA 4PIYA 2QE3A 2W52A 2WS91 4JVAA 4AHXA 1W6OA 3AP4A 5AFBA 4FPEA 1OMIA 1DGWX 2RM21 4Q4Y2 4QD2A 5T5JA 3AP9A 2E6VA 2IXCA 4FPOB 4CEYC 4YW5A 2BFUS 4XW3A 4YYOA 3P3NA 2Q1ZB 1SBDA 2EAKA 2HWC3 4EN0A 2DCYA 1VBD1 4AHWA 1SLTA 1KXGA 1DQ5A 2YC0A 1R1A2 4ASLA 1VB4A 1ZBE3 2GNBA 3AX4A 4ZU5A 2GMEA 1LECA 3KLSA 1VBA3 4Q8LA 4XILA 2PHRA 2TUNA 3ZFEA 1G9BA 1FAYA 1QDOA 1S0FA 4Y5Z0 3JD71 3AZZA 4RS5B 4M00A 2RS32 5DDJ3 1VBE3 1ENXA 2ETEA 5SV8A 5FO7B 5BXXA 1CAVB 4GH4C 2OYZA 4OI4A 3V0BB 2A71A 2D5FA 1PHMA 2WZR3 1B35C 1LHUA 3V65A 1ULEA 4JTOA 3WW4A 4RL7A 4D3WA 1D2QA 2YHJA 4PF5A 1EAH1 2VVDA 4XTMA 2IC1A 3ZN4A 1ZX5A 1H8TC 4FCAA 2E7AA 4QPIC 1PGSA 2VULA 1DDLA 1R092 2Y0IA 5KXCA 4B3NA 2GH8A 3ES1A 5CG9A 1AYM3 3IIAA 4XBQA 4JGZC 3ZN6B 1VAVA 5CB7A 1SMVA 4DQAA 3ZSEA 2VUJA 2K9ZA 2D40A 1WCKA 3VKNA 2ZGSA 3OD4A 2A7AA 1LODA 2KXLA 4X6QB 3VN4A 4AVAA 3LOBA 4FSJA 4AFCA 5HCBA 1KDMA 2HWC2 2RR11 2XJRA 1MS0A 4GMP1 3V0AA 2A75A 3NSTA 3VHRA 1CAVA 2WNUC 1S2KA 3MZHA 5KBFA 1UKGA 3EQEA 2DCTA 4FTBA 5JWPA 2CYFA 2LTNA 4A3XA 1VBA2 4JRLA 2XLGA 3B9IA 4XXPA 2YGMA 1MVQA 1RUH1 1NE6A 5CFCC 1F31A 2VH9A 3BTAA 2YV8A 4FOWA 5DDJ2 1VBE2 3WINE 2Z5WA 1CAWB 1LENA 2O8OA 3ZN6A 4G9SB 1A6CA 4MX3A 3WVJA 3RRDA 3H1WA 3U11A 5F5QA 4Y24A 2WZR2 1OA3A 5BNQA 1QU0A 1FX5A 1RVF3 4HLTA 2PFWA 5C8CC 3RSJA 2XHKA 1EV13 2VOWA 2YZ4A 4NR1A 1NCRA 4WVWA 1C5HA 3BPZA 1Q8VA 5ACA1 4K3UA 5BNPC 5DUWA 4F8AA 2D7FA 1RHI1 2CAUA 2R0FA 1AR83 5GLTA 1YFWA 2WFF1 1W0OA 1XNCA 1YCIA 4XQWA 4C1WA 1AYM2 4DOUA 1O91A 3H9AA 1FATA 3TYJA 1OOPC 2DVGA 4S2HA 5JZGA 1G7YA 3UK9A 2XPJA 3ZX7A 1UPSA 4JGYB 2DUPA 2XJTA 1LOFA 5JCTA 4QQOA 4E2SA 1F9KA 1NLSA 1WGPA 1YIFA 3IDEA 5GLWA 5BY5A 1WW4A 3AFKA 5LEKA 1PK6A 4Q4W1 2WLPA 1CAWA 1RUJ2 4ZXKA 3RJRA 4ATFA 4XJUA 4FPJA 4M3CE 1V9U3 3AXDA 2SBAA 4Q4V1 1R1ZA 3RQ0A 3TAYA 3SLIA 3GBFA 3JBG3 4DB5A 3VBOA 1SCSA 1TMF1 2IXKA 4S2DA 3N7MA 3E6BA 2HJIA 1AR71 3I4IA 3GBWA 1HXS2 1QNYA 1X33A 5KXDA 4OFGA 1LHWA 1RUI2 4AFBA 1W6QA 2B42B 1RVF2 2HWB1 3WW1A 2H6BA 2AREA 2QVSB 1C8M3 4YZ3A 2R073 5GLZA 5BUVA 3L2YA 1EV12 1UF2C 1K5MB 1OSGA 3QCWA 3MI8A 2CV6A 4GIQA 3WY6A 3WP6A 5FFOC 4XETA 5FMOL 4XFGA 3GHNA 4HSJA 4YNIA 2HEWF 4KWJA 1AR82 1WLDA 2XVGA 4LBMA 4OVEA 4D7YA 5A3MA 3C3VA 2CGNA 3VBFB 2C1FA 2W68A 3LSDA 4RS5C 2BWCA 2PHXA 4E9KA 2JECA 1J3QA 1C28A 2EAAA 1OA4A 4I0AA 3AP7A 2P34A 5ABJB 4BH9A 1QXPA 1W39A 1Q8PA 3JU9A 1C3HA 2XGXA 1VAKA 1G9FA 1Q3EA 4KGQA 4DY5A 5T54A 1G8WA 4Z1VA 4J1XA 1D4M3 5FDBA 4N9HA 1Z0HA 4WVZA 4QM8A 3UKTA 2B5HA 2P3JA 5I8SA 4Y1XA 3UV9A 3HT2A 1C1FA 1ASJ2 1K5MA 3JBG2 2VMGA 4FPKA 3S6PA 4EN6B 4XF3A 3MIEA 4RQPB 1FMD1 1VJ2A 2BUKA 4R4ZA 1PGL2 3MPPG 5DUXA 1RUE1 3FBYA 4MGIE 3EHKA 4GA9A 4YW1A 2HWD1 3MIGA 5GZDA 1QOSA 4LO8A 3VHOA 4RD7A 2JX9A 4NHKA 3MYXA 2CAVA 5JOYA 3JUUA 4YGBA 2R072 1NCRC 4PBPA 2R49A 5C8WA 4HKWA 1HRV1 5CFDA 1ZZ7A 5IK5A 3ZYIB 4L11A 4K40A 5JSPA 4OI1A 3LGRA 3KD4A 1PNFA 1PM7A 3VBUB 4NVPA 1O3TA 1GZWA 1RUD3 1Z7S1 4I09A 4AI2A 4E27A 1C57A 1UPIA 1LOEA 2Z69A 2A6WA 1QQP2 4W65A 3S7IA 5A32B 4BA6A 1IPJA 3AP6A 3FC0A 1XYNA 2O8QA 1VRH2 3DUIA 1FV3A 3DN7A 2QUOA 1UX6A 5JVVA 1WD4A 4JTNA 2Y0OA 4DZGA 2ERFA 3GZAA 1D4M2 4UW4A 3R6SA 2OW4A 2XJVA 3VL8A 2GN7A 4FOYA 4YG0A 1VBD3 2CNAA 3S30A 2WL1A 2JENA 4J1WA 3SCFA 1F8VA 5FREA 1RUC3 1JYIA 2BVBA 2R0HA 4XFBA 3HN1A 4FT8A 4CDXA 2R6QA 3W59A 4ISRA 5L36A 2JG9B 4OZXA 1Y43B 5JMCA 4FXKB 1RL3A 1GANA 1PVC1 4HSLA 4AGGA 4LO6B 4QHBA 5I0TA 3W9AA 1LOCA 1GQHA 1ZRCA 1WMEA 4P9YA 4XMAA 3WCSA 2YROA 3M70A 3OF1A 1I1EA 1G86A 5GJ6A 4JGYC 2EXKA 3EJKA 4Q0VA 1VBB2 2XB6C 5DZGA 5JSOA 4C0BA 1TNFA 5A32A 1S0DA 1RUG2 3I59B 2VNRA 1GBGA 4N43A 4AI3A 1PO23 2WJSA 1LJ7A 1PZ8A 5JLVA 2V09A 2CWMA 3FFQA 1DZQA 4UXAA 1V6JA 3PHMA 3JCIA 3O12A 2DF7A 5CVRA 3NO8A 5J09A 3ZMOA 3RYPA 4CDQB 4YM2A 3PVNA 1QGLA 4WM7B 5HCFA 5AC92 2XKOA 5KHKA 4OHWA 4CDUB 1HV1A 4FAHA 4IEOA 5I0UA 1SBEA 1WLWA 2B39A 4CTEA 5FLIA 2JG9A 1JBCA 1H2LA 5LK7B 3B00A 2XLAA 1EPZA 3QOPA 4P5HA 4IL7A 3FJSA 3KMHA 4NHMA 3KT1A 5JOWA 4YSFA 2RS53 5E88A 3PJQA 3DL3A 1AF9A 4HMZA 1IS4A 5HI0A 1K5MC 5FPZA 4PLNA 1RUC2 3I59A 3NAPB 3ZIXA 3J8F3 2WINB 5D8AB 3TBDA 5FLHA 1AXYA 1FPN1 2VY0A 2DUOA 4XE9A 1JOJA 1AYN2 1DBNA 1RUH3 1GSLA 2GMMA 1QJX1 4CDQA 1MQTB 3IKWA 3KT4A 3AZXA 4WM7A 1XE7A 1TME1 3VBFC 4CDUA 2ZGPA 3U07A 4CYDA 4DPNA 2KA3A 3D8CA 3MFAA 4R9CA 4CEYA 2JKBA 3ME2A 2XWBB 1BKZA 5ABJC 2DTWA 1ZBA2 3WDUA 2CTVA 3ZFGB 4S2FA 2ZZJA 4MV2A 3RZZA 1PO22 2IXJA 4DFSA 2GN3A 2BBVA 4UW3A 3MICA 2A6YA 5FOJB 1SEFA 1GYKA 2IZWA 5DUVA 4A7KA 5C33A 3M1HA 5T5LA 4MXWB 2WFF3 1ULCA 2PYTA 4RQPC 2ATFA 2ZZQA 5D8AA 2MNGA 2BYVE 3OTFA 4K7JA 3UKVA 2BFUL 1FOD1 5BNNB 5CU1A 1H1MA 4INDA 1VB2A 2R061 4EN9B 1TNRA 2K0GA 3GBGA 3R4UA 3ZSKA 3SISA 3VL9A 2R32A 1SLLA 1LKNA 2MEV3 4W6YA 4Y1ZA 2YDEA 4Q4X3 4R9BA 1X82A 4AQSA 2RS52 2ZMLA 1XNDA 4Q4W3 4QQ2A 3MW4A 2UU8A 1NY72 5FOBB 5I0SA 2VVEA 1SLBA 3P3PA 4XFIA 3VBHB 3OPZA 3ZFGA 1RITA 1URXA 3J8F2 1LESA 5AVAA 5F1RA 1OLQA 4Y4YA 3CEWA 2D5HA 2D3SA 3ZMNA 5GZGA 1D0GA 3VBUC 3AMPA 3WD5A 4JGZA 1BCXA 1IOAA 5K9YA 1APNA 4PDWB 2I07B 1HX6A 2WA3A 3O0XA 1H1AA 1N3QA 4MXWA 2Z42A 1I5ZA 1AR61 1R081 2CGOA 1COV1 3H1MA 4YGDA 2XJUA 3SH4A 1LU1A 3TN93 1AR93 3K51A 1SBFA 4MXVA 2D44A 1VLNA 2HWB3 3WDVA 1DF0A 1UU5A 2WT0A 2XBO1 1A78A 5DXDA 5FQ0A 4NN0A 1NQDA 3ELNA 4TLFA 4G4FA 1LOBA 1ND2B 2WNEA 3APBA 1IPKA 1HDKA 2WSUA 1MVEA 3PMSA 4BYYA 3VBHA 4HN0A 5CFCA 2CWSA 3O0WA 2JG9C 3OGJA 4HVOA 2EXHA 1QJU1 1RC6A 2D6LX 2EF6A 2WQ4A 3DPRB 4L92A 1AL21 1AXZA 4XF0A 1U0AA 3POWA 2MEV2 4PDWA 3WP3A 4SBVA 5KHIA 5IT6A 3B3QE 5FCCA 4Q4X2 4YG3A 1J3PA 1RJ7A 3IDBB 3WDXA 3WDWA 3LAGA 4IV1B 5C8CA 5LK5A 4H3WA 1YFYA 2VPVA 3ILRA 1EYBA 5J96B 1YIPA 4BCUA 3D0SA 4HBNA 3OYWB 1ZNPA 4XFAA 2XVLA 5EFUA 3B5LB 1S0CA 3QLQA 2H0VA 1MEC1 1REEA 1SFYA 1M06G 4CDQC 1FMD3 4D7SA 3UKNA 4FQ4A 3NV2A 4LHLA 1IQAA 1H8VA 4WM7C 4OHYA 3OY8B 4KQ7A 1OOPA 4CDUC 1ND2A 2ZABA 3PTYA 4NWVA 4QX5A 1SCRA 3N7LA 4E2QA 2ZX2A 1LTEA 2ZGLA 2ET7A 3RI8A 1S55A 4N9IA 3X29B 3ZXLA 3WP4A 2ZX1A 2XL7A 3TN92 2R043 1AR92 1YNAA 3M3IA 1KFUL 1BEV1 5J7MA 4GKYA 3L9JT 2RE9A 5DZFA 2PTMA 4LO5B 4YRDA 1ENSA 3RYKA 3MW2A 5IK7A 4I01A 4BZ4A 4KU8A 5DG1A 2ARBA 3MIBA 2FZ1A 4I0BA 4IV1A 2VW0A 5J3UA 4XQ4A 1QNWA 4JQRA 2PLV3 2E51A 3PVOA 4KU7A 4D94A 1LEDA 3B69A 1AJKA 3NAPC 1F5FA 3S0MA 5D8AC 2VQ0A 5LEJA 3OYWA 3WLUA 3ILNA 2VXRA 1DZRA 1C8NA 3E5UA 3E6CC 4I02A 2RMU3 3SH5A 5FO8B 2K2SA 1MQTC 5T5OA 5FBZA 3ZXGA 4COZA 1GV9A 3AZYA 3RG0A 4HPKB 1PIV1 3AKRA 1W6MB 2ZX0A 3SH3A 2IXLA 2QDRA 2WT2A 2HEYF 4CRQA 4ZU7A 1SLAA 3LKJA 1BMV2 1FYUA 4LNVA 3ZFGC 1RIRA 4BOWA 3ALQA 5T50A 2D3PA 3NW4A 4Q1RA 4AEMA 3WUCA 3ZPYA 5CG8A 1XNBA 2XWJB 2VW1A 3INAA 2WLQA 4IEXA 2R30A 1RUF1 4HKLA 1PO13 1QXJA 4DXZA 2FZ2A 1PVC3 4Q8KA 1NQJA 1WLTA 1ND3B 1OQ1A 4FPLA 4RS5A 5L19A 3ZXKA 3C2UA 2ZOEB 2X29A 5IUQA 3VKFC 1J1LA 3BOPA 1U5YA 5BNNC 5KXBA 1UN1A 2R042 3N4MA 4GB33 5L73A 3HR9A 3ZN5A 3V0BA 3H7JA 2DU0A 1ZBE2 5E89A 4HT1T 2HWF1 1QHDA 2VUAA 5K8SA 4HVQA 1H2NA 1H9PA 1V00A 4HPKA 1S1AA 2ZHKA 1NZCA 1PGW2 4S2GA 4FTEA 4U2AA 2ZKNA 1N1YA 4XJAA 1N1SA 3VBHC 5I93A 2PLV2 4K1YA 2Q8OA 4QU2A 3WG1A 4COYA 4LA2A 4P14A 5BNOB 3TRSB 4YM3A 4D69A 2RMU2 1YJLA 4XOGA 2ZPXA 4PDWC 3H3ZA 1CAUB 2A70A 3TNPB 2HWE1 1V6LA 1I3HA 2W39A 3N7KA 1ND3A 4B29A 2IFRA 4M3CB 3OJBA 3D82A 2A3WA 4UBHA 4FAGA 2JDZA 4YW3A 3RDIA 4R52A 5K0UB 4LR4A 4QMAA 1BYHA 3URFA 3U10A 1AXKA 4L99A 1X36A 1YYNA 1ZM1A 3M3CA 1Q5OA 1VBC3 2A6ZA 3MLKA 4DINB 1ND2C 2WIIB 1MS3A <