1F5FA

Crystal structure of the n-terminal g-domain of shbg in complex with zinc
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
176
structure length
172
Chain Sequence
PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Steroid-binding specificity of human sex hormone-binding globulin is influenced by occupancy of a zinc-binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords SEX HORMONE-BINDING GLOBULIN
total genus 31
structure length 172
sequence length 176
ec nomenclature
pdb deposition date 2000-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1f5fA00
2ZGKA 3ILRA 2CY6A 4L8QA 1UZYA 4Y24A 1YIFA 1UAIA 1V6LA 2E51A 2DVFA 3A4UA 3N7LA 1LCLA 1W0PA 5H9SA 2NP0A 4Y1VA 2ZKNA 4ZXKA 1DQ4A 3O5SA 2AR6A 4UW5A 1LU1A 2ZGNA 4GXLA 3PVOA 4R9BA 3N7JA 4KBBA 2NMNA 4JCKA 3ZYPA 3QCWA 1AVBA 4XXAA 2WNEA 3MW2A 1G9FA 4XJAA 1W6QB 2ZHLA 4FPLA 2A5ZA 5E89A 3VKOA 2D7FA 2EAKA 2I2SA 2KM2A 4FVVA 2GN3A 1MS8A 3D5OA 2B7YA 3OYWB 4GWMA 4YM0A 2R1BA 1G86A 1MS9A 1V6KA 2CWMA 3MEPA 1WLCA 1G8WA 3AP5A 3NV1A 1GZWA 1LESA 5E88A 3OYWA 1KJLA 2DU1A 4Q1RA 5H9PA 1WLWA 2ZGMA 1DQ0A 1GV9A 4YZ4A 2A6ZA 1BJQA 1WUVA 5IUQA 2P37A 4MYEA 5DG2A 2OUHA 3NV3A 3AZXA 1LHNA 4RA0A 5DZGA 4GWNA 3USUA 3ENRA 3AYAA 3ZXLA 4Q2FA 1ZA4A 3RQ0A 4YG3A 5HCBA 1HQWA 1WBLA 2P3IA 2AENA 4WZFA 5DZFA 3PMEA 2UWBA 2RHPA 1GANA 3V0AA 1LENA 3VKFC 2D3RA 2PELA 1S0DA 5EYXA 2VY0A 1LHUA 2JE7A 1D0HA 1HLCA 4ATEA 2PHWA 4XIOA 1LGCA 5T5PA 3ZXFA 3V0AB 1YRZA 2ZZJA 1LU2A 2YV8A 2A71A 5KXDA 3AP9A 1WW6A 4XTPA 1LJ7A 4FP3A 1ZM1A 1B09A 1N3PA 4AWDA 2R16A 3AK0A 3B69A 3ZSMA 4Y1ZA 1V6MA 3OJBA 1C1FA 2E6VA 3WCRA 4XXPA 3M3OA 4D69A 4DRVA 4F83A 3T2TA 5KXEA 5AVAA 2YXSA 4ATFA 1S0CA 1FNZA 4P9WA 3Q9OA 4PCRA 4IQPA 2V73A 1GZCA 2CWSA 1AZDA 2C9AA 3AYCA 4AVTA 3L2YA 1DIWA 1KITA 2DTYA 4XJ8A 2NZ9A 3BOPA 3FUOA 4BMBA 2ZBJA 1A78A 2SLIA 1W6MA 2DV9A 1VIWB 3WDWA 2UURA 5BYNA 1DQ6A 3WDVA 2JECA 5GZCA 3IM0A 3C2UA 1UZZA 1UPSA 2EXKA 3B01A 4FPFA 3H0OA 3NV2A 2A3YA 4BMEA 3ZVXA 1MVEA 2ZGTA 2VU9A 1GZWB 2GNTA 3GALA 4K20A 3WUCA 4YGEA 3AZWA 5T5OA 2G4IA 3O0XA 1LHWA 2PHTA 5DUVA 5H9RA 4XJWA 2WJSA 1QKQA 4JRAA 5GZGA 5JLVA 2H0BA 2FMDA 5DUWA 3SNMA 5IK7A 1GZ9A 3PVNA 1JOJA 3APBA 2A3WA 1RINA 1Q56A 3AZYA 3WDYA 5GLVA 2GNMA 1QGLA 2D6NA 1APNA 2TEPA 2W39A 3HR9A 5GZDA 2PHUA 1LOAA 1AJKA 4ISQA 1PZ8A 5GJ6A 2XB6C 4FPGA 1OQ1A 3VV1A 3POYA 1DYKA 4XILA 1CVNA 4XZPA 2R49A 1MZ5A 2GN7A 4Y22B 5T54A 5GLWA 5IT6A 1BKZA 4BLJA 1KQRA 1LGNA 2ZMKA 2DVDA 1JBCA 1QDOA 2UU8A 4XOGA 2GDFA 1G9BA 5LK5A 3OY8B 3M3QA 5KXBA 1ENQA 1DYPA 2NM1A 2VUAA 3RMXA 1KRIA 3JU9A 1VLNA 2ZGQA 3RS6A 4XMIA 3OY8A 1BZWA 1LTEA 4FPCA 3O0WA 3NWKA 1Z0HA 3FLRA 2WKKA 3UK9A 4DRRA 4YZ5A 2EALA 3N35A 4RL7A 4YGDA 2UWCA 1QOTA 1DQ2A 3SH5A 1H30A 4C1XA 5GM0A 4FOVA 4Y20A 5HCFA 1LECA 5IK5A 1OFSA 4YM2A 2ZACA 2GNBA 4ASMB 3B3QE 1F9KA 1WBFA 5GZEA 4BLIA 1CESA 1G9AA 5E8AA 4AVSA 3D4KA 2GALA 1SLAA 4YGCA 3WNXA 1GBGA 1QNWA 3AFKA 2FHRA 2VW1A 1WD4A 2ARBA 3M2MA 2DVAA 4XYXA 3WDXA 2VXRA 5CNAA 5KXCA 2PHXA 4LBOA 1ENRA 4XIKA 1W6QA 1U0AA 5GZFA 2WT1A 4M00A 3ZPYA 1RITA 3CNAA 4FQ4A 4LBMA 1G7YA 3SLIA 4U36A 3O0VA 4R9AA 4M01A 3V65A 1GYKA 5F5QA 2AUYA 2A6WA 4BQ1A 1MZ6A 1AX0A 2A6YA 4BPZA 2DVBA 2VW0A 2YMZA 4SLIA 2OUJA 1MS5A 4XHXA 3WDUA 2EXHA 3OBRA 3D6EA 5H9QA 1JYIA 2CYFA 1ULGA 4LBQB 1UKGA 2BQPA 1KDMA 2SBAA 1IKPA 3N7MA 4YZ2A 2AGSA 2EF6A 2ZAAA 4LBJA 3VKMA 5DUXA 1BQPA 1ONAA 1IS4A 1DBNA 2HYKA 3W59A 3WG3A 1JUIA 2VH9A 1LOGA 3R4SA 1LOEA 2ZGSA 3W58A 5T50A 3UJQA 1AX2A 1VAVA 2A75A 5GLUA 2ZABA 4Y26A 5CBLA 2NMOA 3SH3A 4Y1XA 1V6NA 1Q8QA 3IPVB 4DPNA 1D2SA 1F31A 2P3KA 5GLTA 1MS1A 3FBYA 1DQ1A 4XBQA 1SCRA 2EXIA 3A0KA 3FLPA 2PHRA 2WT0A 1LOFC 1R1ZA 5CA6A 1OKQA 2D44A 4DFSA 2ZHMA 1V6OA 4FPOB 5JDBA 1SLTA 3WHUA 3AYEA 4FPEA 4CRQA 3RMYA 2DUQA 3N3HA 1CONA 2WSUA 2DVGA 1AF9A 3RRDA 1SCSA 1HQLA 2PHFA 3AP4A 5FREA 3AJZA 4XE9A 4H55A 1V00A 1W6PB 3ZSJA 3R05A 1FYUA 3MW3A 1S1AA 3VKLA 4PQ9A 3LSDA 3ZXJA 2DYCA 4YFWA 2ZGUA 1IOAA 2D6PA 2ARXA 3ILFA 3OBTA 4HL0A 4XJ9A 1N1SA 4XTMA 3SITA 1CIWA 2DWRA 5L73A 1CPMA 1AX1A 3ATGA 2C5DA 1YXWA 1FV2A 1SFYA 2D6MA 2W68A 3SISA 2JE9A 2P2KA 2Q5TA 4FPJA 3WVJA 3B9CA 2ZGPA 1LHVA 4UW3A 3ZYRA 1JHNA 1UX6A 3N36A 3POSA 2D3SA 1WLDA 2ZGOA 2CNAA 3WG2A 1SLCA 3A0NA 4Q8LA 1GICA 4WVVA 1CJPA 1LULA 2ZA9A 5JOZA 4I30A 3V0BB 2CTVA 1BYHA 1Z78A 4DS0A 1J1TA 4YW5A 1W0OA 5IK4A 1MS3A 1N1TA 1C4RA 3AXEA 4M3CA 1YO8A 3OGGA 4TZDA 1Y7BA 3AP6A 4FOQA 1S0EA 4Y1YA 3USUB 1UN1A 1AXYA 4FOWA 2DUOA 1G9DA 5T5LA 1Q8SA 4YW3A 2V5YA 1W6NA 4YZ3A 4PBPA 1CR7A 4FQZA 4Y22A 3WG1A 1N3OA 3QLQA 1QOOA 3MW4A 4YG0A 1IS6A 2P3JA 2WLQA 2YZ4A 4Z8BA 4U2AA 3VKNA 4AGRA 4C1WA 1GSLA 3ZSKA 2GNDA 2GMPA 1GLHA 4ISRA 3KQRA 1LODA 1FV3A 1QOSA 1PZ7A 3PJQA 2LALA 4M3CF 1MS4A 1N3QA 4Y20B 1LHOA 3I4IA 3O12A 4PF5A 5GLZA 2ZHKA 1IS5A 2W52A 1G9CA 4LBKA 3RSJA 4LBNA 1ULFA 4K1ZA 4YGBA 3T1MA 3ZXKA 1DFQA 5FRAA 4Q8KA 3AZZA 3ZXEA 1X50A 4LBQD 1S0IA 1GNHA 5IK8A 4TYSA 2EIGA 2JDZA 4Q26A 1N1YA 1SBEA 1C57A 2YROA 3ASIA 5SV8A 3WG4A 1IKQA 2AREA 3ILNA 1F5FA 3BODA 4FP2A 4AGVA 1SLLA 1WD3A 2A3XA 3N7KA 4R9DA 1GNZA 2ZMLA 4XJZA 2P34A 3SH4A 4YG6A 4YW2A 5JVVA 4JC1A 4K1YA 4AGGA 5F9TA 2XG3A 1DLLA 4NO4A 4UW6A 1FATA 4YW4A 1S0FA 1LOCA 1DGLA 2EXJA 3AX4A 1FAYA 4WV8A 4YM3A 2D6LX 3WOGA 3WLUA 4LBQA 1DHKB 2R1DA 4GALA 4HANA 3WZ1A 4CZSA 3IPVA 1SLBA 1NLSA 5DUUA 4P9XA 3POWA 4WVWA 3AYDA 4FOYA 3IMNA 4XHBA 3VUOA 5DXDA 4YM1A 3GNEA 2DUPA 1MVQA 4YFZA 4ZKTB 1QU0A 1I1EA 3BIWE 1IS3A 1YI7A 3INAA 5T55A 1RIRA 4YZ1A 2R0FA 3IN9A 2ERFA 3PVEA 1MACA 1S0BA 1UMZA 2GMEA 3I8TA 3DUIA 1LGBA 2OVUA 3T1LA 1HKDA 3AXDA 4Y1UA 2A6XA 3BTAA 1PZ9A 2WSVA 2AYHA 1V6IA 3U4XA 3ZSLA 3M3CA 2CL2A 3WCSA 3AP7A 1O4ZA 3M3EA 4GKYA 2E53A 1W6MB 4BOWA 4CTEA 2E7QA 3LCPA 1I3HA 2W08A 4W65A 3HN1A 1W6OB 2Z42A 3JUUA 5DZEA 5CB7A 2A70A 1FX5A 1EPWA 1O4YA 4LBLA 1SLIA 5EWSA 1AXZA 3NV4A 2NYYA 1DQ5A 1QNYA 3AJYA 3B00A 1W6OA 5GALA 1S0JA 3WV6A 5DG1A 1Q8PA 5HCAA 1CQ9A 2ES3A 2LTNA 2ZMNA 1A3KA 2D43A 1Q8OA 3FFZA 4M3CE 4PBOA 4NOTA 3KM5A 2AH2A 3FLTA 3MPPG 3V64A 1LEDA 4P9YA 1W6PA 1AXKA 1WW7A 4XMAA 3FUQA 3R4UA 4XBLA 1QDCA 3V0BA 3M1HA 1QMJA 3WDTA 1HDKA 2DURA 1DZQA 1NXD1 1WW4A 5JOYA 1H9WA 1JXNA 1N1VA 3RG0A 2E7TA 1URXA 4R9CA 2WQZC 1ULDA 1Q8VA 1CN1A 3WUDA 1JN2P 1JW6A 4DQAA 5JOXA 2JJ6A 1S0GA 3AZVA 4FPHA 4XBNA 4XJUA 2ZGLA 3UL2A 1FNYA 1KJRA 2A6VA 5JOWA 4YLZA 2A7AA 2GMMA 2UWAA 3TAYA 5CAZA 2DU0A 3UJOA 1N47A 1LEMA 4BM8A 2ENRA 4ITCA 1TEIA 5T52A 1SBFA 1UL9A 1SACA 2R0HA 3HMYA 1BXHA 2VW2A 5T5JA 1MS0A 4FPKA 2D3PA 1JYCA 2JD4A 2OW4A 5JMCA 2ZGRA 4AVVA 4K21A 1CPNA 4Q27A 5EXOA 1MR5A 4GA9A 1LOFA 4YW1A 4AYUA 1QF3A 1SBDA 1LOBA 1WCSA 2NN8A 1GKBA 1WW5A 4M3CB 5EYYA 4OZXA 2D6KA 4GKXA 3TB0A 3IKWA 1V6JA 3OPZA 4UW4A 2D6OX 1VALA 1H9PA 4FPYA 2WT2A 1AJOA 4XDQA 4Q1PA 1ULCA 1ULEA 2JKBA 4P14A 1W6NB 2DTWA 2YY1A 2ZHNA 1A8DA 1ENSA 1VAMA 1XQNA 1YYNA 3WHTA 3LSEA 3DGTA 1KDKA 1C1LA
chains in the Genus database with same CATH superfamily
1VBD3 2ZGKA 3OD4A 5E1RA 1V6LA 1JZ8A 3A4UA 1XU1A 2PFWA 1NXMA 5A80A 2NP0A 4ZXKA 1DQ4A 3SXWA 4UI9L 4XDPA 3RJ2X 4LO6B 5AC92 3CU7A 3K48A 1YLLA 2VZUA 3ZLIA 4PT6A 3VDDC 2MEV2 4ZZ5A 3QCWA 4PDWC 2LM3A 2B9UA 2FDGA 3VBFC 1GZTA 2E32A 5FZOB 4EJRA 3OGJA 4FPLA 4LK7A 3C7HA 2KM2A 4D6SA 5FJKA 5FY7A 3ZMOA 2BBVA 5JZGB 4KMQA 5ACA3 1G86A 4QMAA 2Q8CA 4Q4V1 3TOJA 1G8WA 2VMFA 1JOBA 1PMHX 4KU7A 3OOXA 2RDNA 4FFGA 3S57A 4IUGA 2QQVA 4HBNA 4S2FA 4LR4A 5H9PA 4E9KA 1NA1A 2ZGMA 1DQ0A 3AKPA 5A3UA 1W8HA 4EYUA 1RJ8A 3USSA 4JGZC 4XF4A 4LPLA 2Y8KA 4K8RB 1OF4A 4LHNA 2CAUA 3P3PA 5DN2A 4TSVA 1D0GA 3AKQA 5FWJA 1B35A 3AZXA 1F8VA 4GWNA 2VG9A 1NLQA 1X9TA 2XHKA 4KNCA 2DCTA 1QXJA 4DO0A 3ZX7A 1ZA4A 2WN3A 2WNVC 1WBLA 5J3UA 2P3IA 5K0UB 3KV5A 4WM8A 1NCQB 1SPPB 3K77A 5DZFA 1UMIA 4M4RA 4PDWB 2NQYA 2D3RA 1S0DA 3GJAA 2JE7A 1WMFA 2B45X 1JU4A 2QJVA 3N9PA 3VD9A 4FTEA 1SDDB 4O9EA 4UWDA 5KXDA 3AP9A 3LB9A 1WW6A 3LPGA 3U10A 1XYOA 4XTPA 5IHRA 1ZM1A 1N3PA 1QJFA 4AWDA 2R16A 3AK0A 3ZN5A 4FAGA 3ZSMA 5K8SA 4FBFA 1C1FA 4D69A 1JUHA 3M3OA 4F83A 4ES9A 4E4DX 1W3VA 1PMIA 3DPRC 3HD8B 5CFDC 3I3QA 4P9WA 3WP3A 4B3NA 4PCRA 3DKWA 4IQPA 1GZCA 2WFF2 1UY0A 2FBEA 1KITA 3POJA 3FUOA 2RDSA 4BMBA 4CXXA 1W6MA 4YW6A 3WDWA 2ARAA 4OHZA 1GWKA 3KGLA 1I6XA 5FPVA 3NMBA 4GMP3 2VL4A 1UPSA 2EXKA 2JIGA 4PJYA 1GQHA 2RR11 4P5HA 1F4HA 4PLOA 5FYZA 4BMEA 3GZAA 4YPJA 2RR13 1X33A 4XFBA 2VU9A 1GZWB 4X6RB 4LITA 3WUCA 4OQ8A 5DPNA 4X6QB 1SEFA 3NL1A 4EE2A 1UOGA 3O0XA 1LHWA 2VOWA 2ATFA 5DUVA 1Z7S3 2BNNA 5H9RA 5CG8A 1XNCA 4QX0A 2WJSA 5LA0A 4NPMA 5GZGA 3NJVA 4P00B 1CAXB 2R062 5C4WC 2QFEA 2Y26A 1GZ9A 4AHYA 3ALQA 3APBA 2A3WA 5DDJ3 2O8QA 3ZIXA 2VECA 2ZEWA 4IV3A 3HT2A 3KCXA 2GNMA 1QGLA 3LA2A 4W8JA 2PHUA 1AJKA 3I2FA 4JGYA 1ND3B 4XPVA 2Q8EA 1OQ1A 2YYOA 1AR63 4UBHA 4XILA 1CVNA 3KT4A 4AAXA 2R49A 1MZ5A 2GN7A 4IV3C 1ZRDA 4AQ6A 1AHSA 4QPIA 3PUHA 2UY8A 1BVVA 3DKQA 1BEV3 1FPN1 3G6JB 4HSLA 3ZFFA 1AL23 3MF9A 5J98B 5JSRA 1QDOA 4Y5SA 1RUH3 1YJKA 1RUE2 5C5TA 2X10A 5D21A 4DY3A 1G9BA 1R093 2W94A 5C8WA 3RMXA 1NE6A 2VE1A 5A3TA 5F5IA 3S30A 2V09A 3CZJA 2JDPA 5FKCA 3U07A 2VQUA 2PHDA 3NAPA 3FN9A 2HLEA 2V4VA 1ZRIA 3GXUA 1ZA7A 4C1XA 1FOD1 5GM0A 5JXJA 1AR72 3GCWA 3NRUA 4Q0QA 4Y20A 1OFSA 4FI9A 5FZOA 4MZUA 2QQOA 1WCKA 3GJBA 3ZO0B 4EN8B 3KT7A 3PIJA 5J36A 1G9AA 2XKPA 4I2OA 2GU9A 2XUEA 1AYM2 4YGCA 3T4VA 2JEMA 5FY4A 4IEQA 5FPUA 2YPDA 3VZOA 2VZQA 5CEHA 3GDBA 4IE5A 4QGNA 3BVCA 2VZOA 4NWVA 3M2MA 5HBAA 1NQJA 2E33A 1JOPA 4MGZE 1RUD3 5FR3A 4QQLA 3IWZA 3POGA 4XIKA 1W6QA 1U0AA 2J1AA 4BDVB 1RITA 5FYMA 3GYDA 3O0VA 4L92A 4K40A 3ZFEC 3AVRA 3VBHA 4KL1A 1J1LA 5A32B 1MZ6A 4LQRA 3CBNA 2A6YA 2D5FA 3ZKUA 2BOIA 4BHPA 2VW0A 2YMZA 3JBG3 3KF5A 2K46A 3WDUA 1MS5A 3W5NA 1EAH2 2AZ5A 2HWF1 3LA7A 1JYIA 2VTXA 1ULGA 2JG9B 4NHXA 4LO7A 5SV5A 5KHGA 3RZMA 4CEYB 1W99A 5FCCA 1UY3A 2X5IA 5DUXA 4XF9A 5FLHA 4LKDA 3ZN6B 1AL0G 1TVGA 5JXHA 1STMA 3WG3A 4NVPA 3J7LA 1I5ZA 3CDZB 1LOGA 4COWA 2HJIA 3K3OA 4B7EA 1JHJA 5T50A 3UJQA 2XGXA 3DPRB 2DBNA 5FPXA 5JI9A 2ZABA 1PK6A 5FPBA 5KHKA 4PIZA 3ZDSA 1GP6A 2HEWF 4B1MA 5FPLA 3FBYA 4NRMA 1DQ1A 1SCRA 4QQPA 2EXIA 3H3ZA 4XUNA 2B39A 1RUI2 3FLPA 4X8PA 1LOFC 3C7EA 2XDVA 4L9BA 2WA4A 1POV0 2D44A 4DFSA 2ZHMA 2WA3A 3JXSA 5FUPA 5KHIA 4GMP0 2IFWA 2BBAA 2YUEA 5JDBA 5FYUA 3WHUA 2E31A 3E5QA 1VPHA 1VE0A 4G3YC 1SCSA 1HQLA 2Q1ZB 3AP4A 1ALYA 2GC2A 1W6PB 1ZBA1 3N9NA 2XQRA 5K9YA 3O1VA 5LA2A 1LRHA 3AFGA 1J58A 3TEXA 3AMQA 2YFUA 1YFYA 4MGYE 5F1RA 3ZXJA 2DYCA 2IXCA 2XL9A 4AXOA 4XF1A 1CJDA 1UOFA 3DF0A 4XJ9A 4YFWA 3OBTA 5FIXA 1H8TC 5DMYA 4JZRA 3GF6A 4MXWA 2KR2A 3ATGA 2C5DA 1WCDJ 4R8HA 1MEC2 3THPA 3OG2A 1H8VA 3LEMA 5F6LB 1NYWA 3T0AA 1XYNA 3LIGA 1HB3A 3RVHA 2HWC3 3H1MA 3WVJA 4KWLA 1NA1B 4HOOA 4UW3A 3ZYRA 1V9U3 3IIAA 5IFPA 3POSA 1DCSA 4BJ0A 1H4HA 1J3PA 1IGOA 3SKVA 2BGPA 1W8TA 2XJSA 1UYXA 3AMHA 4Q8LA 5FO7B 5FY5A 4CDWA 3WF2A 3OGVA 3KV4A 1CJPA 4QQOA 5CADA 4H2AA 2XJQA 1POQA 3IT8A 5BNNC 2QCSB 1K12A 3UV9A 5K0UA 5FZHA 2CTVA 1Z78A 1POV3 2W92A 3N9LA 4I3GA 3LFIA 1HRI2 4WM8B 3WW2A 1COV1 4TN7A 3T0DA 1W0OA 2Q0AA 2VTXJ 4CEWB 3T09A 1O8PA 2J42A 4N43B 3VDAA 2IC1A 4Y1YA 3M7AA 5FYIA 3POFA 1NX9A 4D8MA 1BK0A 5I8TA 1XNDA 1LB2A 3OB8A 1UZWA 3LQCA 2V5YA 1MQTA 2OA2A 4YZ3A 4WZCA 1OLQA 1Y43B 5FXVA 1CR7A 2QDNA 1TMF1 3R4DB 5FZFA 2WZR3 3WG1A 2XPJA 2P3JA 2YZ4A 4IEXA 1PMJX 4U2AA 3VKNA 5A7OA 1WA4A 1GSLA 3PUSA 2VMDA 2MEV3 4ISRA 3H9AA 2IFRA 4A7ZA 1R081 2RS53 3ZXGA 1ZZ9A 1OI6A 5GLZA 5CYYA 3LDKA 1IS5A 5F3GA 3K4AA 2DFCA 4E4SA 2RS12 4CYDA 4K1ZA 1NT0A 2R7EB 3LFMA 4JHZA 3T1MA 1DFQA 1ZYBA 5FRAA 3Q8BA 3AKRA 2R073 4AFMA 5JXGA 4LBQD 1S0IA 4AHXA 3W9AA 3MV01 4YNIA 3GZUC 3RYRA 5IK8A 2EIGA 3UGHA 2YC0A 3PU8A 3ASIA 2YROA 3ZFFC 3ZMNA 5SV8A 1HJGA 3POIA 1O59A 2F4LA 2TBVA 3ILNA 1F5FA 2HH9A 4HLTA 4SBVA 5LB6A 4AGVA 1XB9A 3KV6A 5JUVA 1WD3A 3SH4A 1RUD2 5DABA 1H1MA 3UGFA 2XVGA 1BVP1 2XG3A 4XFAA 5ACA1 1ZBE1 1W2UA 3S7EA 2Z4FA 3C7GA 5A7WB 2BYVE 3FE5A 1NAEA 4A44A 1DF0A 2ADEA 2FDHA 1GP4A 1OVPA 1S4CA 2RS32 4YW4A 4IETA 1EUUA 1TG7A 1DGLA 3VBUC 1CIYA 3ACIA 4YM3A 4QXHA 4CUBA 1IPSA 5LY1A 4DOUA 5FP3A 3T0BA 2F17A 5FXZA 1VRH1 4GALA 2Y0IA 4XFGA 1TNFA 4CZSA 3TN92 1NOVA 1NLSA 1YCIA 4XDOA 3AYDA 2VXJA 2WDBA 3IMNA 5LBFA 3SCFA 4JDMA 4KH9A 5CKMA 1NCQA 1SPPA 4PI2A 5LRSA 3QACA 1SHWB 1QU0A 1I1EA 4EN9B 3OUJA 3INAA 3IDCB 4TWTA 2Y6JA 3F2ZA 1RIRA 5FMOL 4CU7A 4YZ1A 3O1SA 2WC2A 3IN9A 2LROA 5BUVA 3PIGA 1W9SA 4DIQA 1LGBA 2VNRA 4MO3M 1ACCA 2R6QA 4QDSA 3FZ3A 4OQ9A 4NIIA 1FXZA 1NZCA 4UAPA 3RZJA 2A6XA 1QJU1 3BTAA 4XETA 4KWKA 1ZZ6A 3M3CA 3WCSA 3M3EA 2ZJCA 4GKYA 4W6WA 4BOWA 1RHI1 4AVBA 4ZONA 4CXYA 4RFRB 3WQ0A 3LWCA 3WW1A 5FY9A 5EV7A 1ZRRA 2W08A 2E63A 4QX8A 3JUUA 3JCIA 3HQUA 4NHKA 1UX7A 1O4YA 1RHI2 3K51A 3OSDA 3NO8A 1AXZA 4QXKA 2FDFA 3JBG2 3MI8A 5C3QA 1QNYA 3B00A 4Y4YA 4AFAA 1S0JA 2VCAA 1T2XA 1US3A 4NHLA 4QX2A 5CIRA 1H1IA 5DQ0A 1PGW1 1PNGA 1A3KA 1WMXA 2D43A 1Q8OA 3BPSA 4M3CE 3KM5A 3FLTA 1R64A 3NNGA 3V64A 4ZHNA 4CDQA 1Y9MA 3T2OA 3H1WA 4L97A 5IVEA 1AXKA 1WW7A 4LKEA 5A7SA 1IQDC 1D4M3 2IVJA 2YC2A 3MV11 4XMAA 3VBHB 4D3WA 4AVAA 4GZ9A 2IUWA 2WNOA 1HRV3 2QZ2A 1HDKA 5A3LA 5FY1A 1N1VA 2E7TA 2HWB1 3KCYA 1ULDA 4DQAA 4AL9A 2JJ6A 3PJYA 4BB3A 4FPHA 3UL2A 2Q30A 5IVVA 2XUMA 5GKAC 4YLZA 2ZEXA 3IZOA 4CPBA 2O8OA 3P3NA 1W05A 1HV1A 3ACHA 3MIDA 3UJOA 3WEZA 4QKFA 3VDCA 3TEZA 1VMFA 2JDAA 4DZGA 1SACA 4FCAA 3HMYA 5IWFA 2FZ1A 4A6SA 3KB5A 4FPKA 1NKGA 2D3PA 2JD4A 2OW4A 3DXTA 5FQ0A 1GR3A 4AVVA 2CDOA 4PDWA 1UNBA 2GP5A 3GHNA 1CGPA 2PLV1 3IMMA 4DINB 1X9PA 2VC9A 2Z2SB 4PQQA 2NN8A 2Z79A 3QBQA 4UXAA 1XC6A 3T2QA 2V5DA 4PLNA 4GAZA 2D6KA 5FZDA 3TB0A 4BU2A 3OPZA 1O3RA 2D6OX 2WWUA 2B9VA 1H9PA 4AI3A 3ZPOA 4RHV2 4YARA 1RUE3 2Z5WA 2VZRA 4CA9A 1BMV1 1RC6A 4A7YA 2RS11 4QDQA 4UFIA 1TE1B 4AEDB 5HI0A 1VAMA 3DGTA 1KDKA 4P9LA 4LUKA 4XAAA 3ILRA 4E2QA 3MGUA 1RUH2 2DVFA 3WF4A 1ULOA 5FZ1A 2ORXA 3KMHA 5LA9A 2QQPA 1A34A 5FK7A 5F5CA 3VD5A 4LO5B 2AR6A 2BP6A 4CVUA 2ZGNA 4L11A 1TME2 4MH0E 4FO9A 2QQNA 2YC4A 2ZEZA 4MXWB 5DDJ2 3CL1A 4KBBA 2NMNA 4GD4A 3ABZA 4B8EA 1F5JA 4MGKE 2HWD2 4XXAA 5IVFA 4E8CA 2ZTNA 3ETQA 1VBC3 1G9FA 5I8SA 4AG4A 1W6QB 3HN3A 4AI0A 3A21A 5A70A 5HV4A 5E89A 1NCRA 4ZXEA 2D7FA 3VKOA 2EAKA 4K6BA 4FVVA 1HJFA 4YSFA 1W9WA 5BNPC 1W8WA 3D5OA 2B7YA 3R6SA 3MIEA 4GWMA 4A45A 2R1BA 4JDOA 4QU1A 2CWMA 2QBXA 3AM2A 4Q5OA 3IB3A 1GZWA 3OYWA 1RUC1 2CAVA 1GV9A 3ZM8A 2A6ZA 3FWEA 1WUVA 4QX5A 4Z1VA 1JZ5A 1QY4A 3JB8A 3NKTA 5IUQA 5FUNA 1ZBE3 4MYEA 4NPRA 5DG2A 1REEA 4N43A 5DZGA 1RUNA 2VZ1A 4CXWA 1NCQC 1ZNPA 5FMBA 4DUVA 1O7FA 1W9YA 2OIIA 3RQ0A 4YG3A 2YGMA 1UYPA 1O91A 1YFXA 2J7MA 2WL1A 4JGZA 2EICA 1VR3A 1AYM1 3PMEA 2W1QA 1H8TA 3VBRB 3GGLA 1LENA 1YNAA 3KHCA 5IYYA 1RUF2 2VOVA 1OLRA 2R071 5KC6A 1D0HA 1OSGA 2XBO3 4ATEA 2PHWA 2HWC1 4Q0PA 5T5PA 4HVQA 3V0AB 4AEMA 2ZKLA 5L36A 1QIQA 4BA6A 1GFF2 3VHOA 4NPLA 3HNYM 5C4WA 1O8SA 1RUH1 1KEXA 5L7OB 2OZ6A 3EXUA 2BW8A 3OJBA 5F3EA 3WCRA 4BK4A 3THCA 3J26N 3BTXA 2HWB3 2JB4A 4ATFA 1FNZA 5ISLA 3RZKA 1D4M2 3VBOC 4XEZA 1CWPA 3BOPA 5FZLA 4ZPIA 1ZBA3 1C8M2 2DV9A 3S7IA 1RUI1 1D4M1 2UURA 5BYNA 1K5MB 5CU1A 1ZZ7A 5A33B 1DQ6A 3MFCA 2RJ2A 3WNOA 3IM0A 4EWAA 1WCQA 1E57A 1UZZA 3B01A 2VMEA 4QWNA 5L9RA 2A3YA 3CJIC 4CCDA 3MZHA 5FP4A 2PXJA 4JKMA 4MLOA 3ZVXA 4QKNA 2P1BA 5IVCA 2VUCA 5CFCA 5T5OA 2G4IA 1H2NA 1C3HA 2R072 2Y38A 2R30A 1QKQA 4JRAA 3LOIA 4LMFA 3FHIB 4XF3A 5JLVA 1NY72 2BOJA 5FP9A 2FMDA 3H3UA 2R061 2X05A 5DUWA 1OH3A 4C91A 5IK7A 5FQ0B 2B8MA 3PDQA 4RYDA 4IERA 4Q4X3 1RINA 4NUBA 2PA7A 3LIHA 2JDMA 3WDYA 5GLVA 4MADA 3ZYFA 2XJTA 5IAXA 4RFT0 3NAPC 1HX6A 2TEPA 2W39A 4O61A 4EN7B 4CEYA 3I49A 1IPKA 2QQIA 1HRI3 3OEBA 4HK8A 3FMGA 5GJ6A 4S2HA 3N9OA 3S6PA 4A42A 3B9IA 4XVHA 3VV1A 3POYA 3WQBA 4Y22B 1OD5A 3QD6A 3ELNA 1KQRA 3I2HA 2ZMKA 2ZS6B 4JGYC 4W6YA 4RSUA 1JBCA 1RMU2 2KA3A 2UU8A 4IEVA 4ZS2A 3FHAA 2Y64A 4MHRA 4MOAA 1AR81 3OY8B 3M3QA 5KXBA 1SZBA 4XFHA 2NM1A 3JU9A 3T30A 1ZRCA 4CEWC 2WZ8A 1TME3 4EZHA 2J1UA 4Z07A 1BZWA 1LTEA 2IXHA 2JICA 3ZYBA 2WS91 2PYTA 3O0WA 2WO2A 1Z0HA 3NWKA 2WKKA 5D8AB 4DRRA 4B7KA 1PGL1 1OOPB 4RL7A 1UYYA 3D3AA 4XFIA 3DXUA 1H30A 2EIBA 1AR71 1LNSA 1SFNA 3PU3A 1LECA 3HNMA 4ASMB 2ZACA 2GNBA 5GZEA 1F9KA 1WBFA 1KS5A 4IDZA 5C70A 1PO21 2XWBB 4DB5A 4E8DA 2XLAA 4NRPA 1LAJA 3VDDB 4AVSA 1REDA 2ADDA 2VM9A 5I0UA 1JZ4A 3WNXA 4IEWA 3HAGA 1OMIA 5LA1A 2VW1A 3ITQA 1HN0A 1BMV2 2BGOA 2YGLA 4IL7A 4KWUA 3WDXA 2Y6HA 4CDUC 2CDPA 5C9AA 2D97A 2WRAA 3DCQA 1ENRA 4LBOA 2VR4A 2W87A 3O1PA 4M00A 3CNAA 1GU3A 2BU9A 1GP5A 2YDEA 3KHBA 5J96B 1AR73 2XVKA 3OUIA 3V65A 1GYKA 2WNUA 3TEWA 2AUYA 4ASKA 2JDYA 1AX0A 5HCHA 4DXTA 4AOCA 4BPZA 1VBB3 1OPOA 2HWF3 2ZX3A 3ECQA 4Q29A 4XHXA 5H9QA 1SMVA 3PMSA 3POEA 4FFHA 4MXVA 1E5IA 1NUKA 3ZFEA 4NR1A 2QNKA 3N7MA 1BBT3 4LBJA 4OHVA 3VKMA 1BQPA 2HWD1 2RJKA 3HBZA 1ZBE2 1YFUA 2HYKA 4NROA 3EMRA 1JUIA 2VH9A 4QQHA 3AKSA 3R4SA 4IXLA 4CDWB 1LOEA 2WUHA 4RR3A 3BPZA 5J48A 4OYUA 4AFDA 2X5IC 4BZ4A 1VAVA 2A75A 4COVA 3RFRA 1UXZA 2MPFA 5CBLA 5A3OA 4D94A 1XE7A 4JHTA 2XBO1 3OPTA 1D2SA 1Z7S1 3UGGA 3BU0A 2PAEA 2VOKA 3PUAA 1ND2A 4XBQA 4LKFA 1H6YA 3MUY1 3U4SA 1R1ZA 4OUMA 5FYSA 1UIKA 4AHZA 5L19A 4DEVA 1PK6C 1U5IA 1ND3C 2R063 4HN0A 4JQTA 4P02B 4EN6B 2Q8DA 1OXCA 4FPOB 4IV1C 3THDA 4CP9A 2Z69A 1R082 4AVCA 4B4RA 5F37A 1UY1A 1K5MC 2DUQA 2WSUA 1H4GA 2DVGA 1UMHA 4UFMA 1VBE1 5F7UA 2QQKA 4H55A 2WLPA 3HQRA 3VZJA 4OI0A 4GJYA 3CHXA 5KHHA 4NIAA 4AFBA 4HVRA 4YWAA 1YQCA 4PQ9A 3VKLA 2WZPP 3NNFA 2BNOA 1DDLA 1BEV1 1FPN3 4UF0A 4XTMA 4WVMB 3SITA 5CKQA 4UFHA 2JENA 4AI2A 4V2VA 2DWRA 1L7QA 1RUI3 1W90A 4AQ2A 3OCPA 2V72A 4IGQA 2D6MA 1AR61 4WM7C 2OX0A 4D0QA 2JE9A 2P2KA 4BQ5A 1OPMA 2DBIA 3ZYIB 5C3PA 1M4WA 3PL0A 3AL6A 4COZA 1UOBA 1LHVA 1JHNA 3N36A 1WMDA 2G9ZA 3M3IA 3VBSB 2QE3A 1DGRA 1WLDA 3K4DA 2VJXA 2CGOA 3THTA 2XWJB 3KF3A 3A0NA 3WNLA 1LULA 3OBAA 5A1LA 2C1FA 2ZA9A 3I2IA 3E97A 4F8AA 2P17A 1BYHA 1QXPA 4CCNA 1OF3A 1UYZA 3WD5A 3E6BA 3BIEA 4QAWA 2IXIA 4LOSA 1N1TA 3SEEA 4URTA 4BK5A 4TZDA 3UT0A 4C90A 3MFAA 1HXS2 3AP6A 5C5UA 3O7OA 3JQXA 4ET7A 4GH4B 3RGBA 1NY71 4MUVA 1CZSA 3J8F2 2UY9A 4YW3A 3TEYA 4Q4V3 3SEPA 4DXRA 1F4AA 3CF6E 4LOTA 3EQEA 2VZSA 2RVAA 3ZN6A 4OZOA 4YG0A 5AC91 1GWLA 1SDWA 4I02A 2WAOA 5BXXA 4OMDA 3WNKA 1ZBA2 4AGRA 4C1WA 3ZSKA 4IEYA 2GNDA 1WA6X 1ULPA 1VBE2 1GLHA 4CSWA 3EJKA 5FAXA 1XOYA 3KQRA 1LODA 1FV3A 1QOSA 3PJQA 4JKLA 1YQ8A 2QQUA 4M3CF 1XE8A 1RJ7A 4N9IA 4NIGA 1LHOA 3O12A 3ON7A 1JYXA 1C8M1 2ZHKA 5JR7B 5JR2A 3LE0A 2W52A 4HPKA 4YVSA 4LBKA 4H3WA 5IATA 3RSJA 1RMU1 4RQPC 1W03A 5FLIA 3ZXKA 4K3UA 5C71A 2JB8A 3AZZA 4Q8KA 3ZXEA 1X50A 1Q3EA 1GNHA 3LPFA 5FZ9A 3Q8EA 4XFFA 4YW7A 3I59B 2I45A 3LDBA 1SBEA 1C57A 1ST8A 2ZX1A 4XCAA 4D6QA 3KZ4C 4HONA 1EPZA 2AREA 3KGZA 3BODA 4QHBA 4NIDA 1NG0A 4JTOA 2A3XA 3I3EA 2WZR1 3ZFEB 1UOJA 4YG6A 4JC1A 3OD0A 2HBTA 4AGGA 1W3XA 2NLRA 1IPJA 1DLLA 3DV8A 1RUF1 4XF0A 3BUCA 3EB7A 2AACA 2VQAA 4Y5Z0 2WR9A 3IIIA 5FP8A 3S5QA 2ORZA 3ACGA 3EHKA 2WABA 1JYWA 1W28A 5FKBA 4CCLA 3HIFA 4YYOA 2EXJA 4WV8A 5TSWA 3WOGA 3EO6A 4CDXC 3RDIA 2VOXA 3B5LB 3KS7A 4H7MA 4LBQA 4UOJA 2HWE1 1DHKB 3MIGA 1H0BA 2DF7A 1QXRA 3KCCA 3RWKX 4RS5B 1SLBA 4I09A 1UU6A 4MGSA 1PM7A 4NJ4A 3FHQA 4ZU4A 4XHBA 3WW4A 4FSJA 2CGPA 5C7GA 5DXDA 4YM1A 2CHHA 4JGZB 5FYHA 2ET7A 4YFZA 4V1PA 4CE8A 3BIWE 5DAWA 5I8YA 4N8MA 1YI7A 1OLMA 1VBA1 4EROA 2YHJA 1JMUB 1TNRA 2BGCA 3A23A 3H7YA 1W9FA 3I54A 4K9SA 1MACA 2ZAHA 1UMZA 3HQXA 3I8TA 2ZOEB 5CG9A 1PO13 3T1LA 1HKDA 3NNMA 3OEAA 1J59A 4Y1UA 5EJ1B 5FUIA 5A6QA 1DGRN 1V6IA 3ZSLA 3AP7A 4QGMA 2E53A 1KXGA 1W6MB 4ZY9A 2B4KA 3DL3A 4WVMA 2NPIA 1HRV1 3U75A 1AYN3 2X09A 1W39A 2Z42A 3HN1A 3R0RA 2WWSA 5CB7A 2A70A 4LBLA 4EN0A 4QGLA 1DG6A 1SLIA 1VBA3 2JG8C 3IDAA 1WLTA 3MYXA 5EWSA 2RDRA 3NV4A 3O1MA 1DQ5A 1W6OA 5GALA 4AEDA 3ORJA 2VBPA 2G19A 3IDBB 3LGRA 2VNGA 1CQ9A 2BV4A 2DCJA 2ES3A 3TBDA 1J3QA 2LTNA 3VBSA 2XJVA 5B2GB 5AC93 4UFKA 1RUOA 4NOTA 2AH2A 3MPPG 5LBEA 1PIV2 2K2SA 4BYYA 5A1FA 3RZZA 5F2SA 1NCRB 2LUWA 3R4UA 4XBLA 2XLFA 3VBSC 2EIEA 1ND2C 4AE2A 3M1HA 1RUC3 1M06G 1QMJA 3WDTA 1D2QA 1PGSA 2DURA 1NE4A 2PLV2 1WW4A 2RJLA 5FZMA 4JGYB 3A22A 2A1XA 4J25A 2YBKA 1URXA 2G9FA 2WQZC 4F3JA 4Q4Y2 4E4ZA 4CCEA 5ANNA 4CCOA 5LBCA 1JN2P 2P6CA 2VO5A 5B4NA 1UF2C 3MIFA 1S0GA 5JOXA 4XJUA 3ZFGC 4DNYA 4D7SA 1BCXA 2PAKA 4QPYA 1D4VB 4GB32 4ES8A 5JOWA 3K4ZA 2UWAA 2IVIB 1XNBA 1YWKA 5CAZA 1O5UA 2XKOA 4GB31 1N47A 4JDNA 4D6RA 3ZXDA 4BM8A 2ENRA 4ITCA 3JD73 5T52A 3T3YA 5J7MA 1ODMA 1SBFA 5FPZA 1R083 5LWBA 2FDIA 4N7UA 4BH9A 3HWJA 3GHMA 4X8NA 1MS0A 1TME1 4ARXA 1PVXA 3LOBA 4EV0A 2ZPXA 3LF7A 1QF3A 2VNOA 3NAPB 4HVOA 4P9JA 1TMF3 4ASLA 4LTAA 4A7KA 4D7YA 1GKBA 1UU5A 3POBA 4M3CB 1E5SA 4GKXA 1VRH3 1VALA 3MDPA 4OMCA 4Q4W2 3J7HA 4RQPB 2GH2A 4FPYA 4BE3A 5C3SA 3J7NA 4XDQA 4MGQA 2R32A 4Q1PA 4L0PA 1ULCA 2IZWA 5AVPA 2JKBA 1W6NB 3NKGA 3ZYGA 1R1A2 1XQNA 1YYNA 2EAAA 1AUYA 5JPNB 3U37A 1FT9A 2CY6A 4L8QA 4Y24A 5FMCA 4V2WA 5JSPA 1UAIA 3N7LA 1CAWB 3RNSA 1GOFA 2B42B 3OF1A 5L7OA 1UU4A 3M8LA 2VULA 4Y1VA 2ZKNA 2PLV3 3HNBM 2XJPA 4UW5A 1FOD3 5AFEA 2YG0A 4GXLA 5FYTA 3FJSA 4R9BA 4Q4X2 1UZ0A 3EBRA 4BXSV 3KQ4B 4JCKA 3RYPA 4RR3C 3TYJA 5IVYA 4OHXA 1OQEA 3WP6A 4XUPA 3H7JA 2JDNA 4QX3A 2UYBA 3LEGA 3MW2A 3J7MA 3L9JT 4KG0A 4KWJA 4XJAA 5IW0A 4MGTA 2I2SA 1MS8A 4XUQA 1NZIA 1RUG2 4G9SB 4YM0A 3KT1A 4A6OA 4BQ3A 1V6KA 1FPN2 3MEPA 1WLCA 3UKVA 3MF6A 1OVSA 2CU5A 2HWD3 3MUZ1 2YU2A 5J37A 2YBSA 1Q5OA 2DU1A 2WWJA 4Q1RA 4QDRA 1AYN2 4YRDA 4IV1A 3GZTB 5FK8A 3HEIA 1JZ2A 3WNPA 4YZ4A 4LLOA 5F3CA 1BJQA 1F2NA 4YVSC 1CAVB 4OUEA 1O5LA 2P37A 3DPRA 1X8EA 2XH6A 3NV3A 2WNVB 1LHNA 4I0AA 3LEKA 4RA0A 5IJRA 3ENRA 4FTBA 3NJXA 4Q2FA 2Q1FA 2OQ6A 5HCBA 3PTYA 4GJZA 2BERA 4BIFA 4WZFA 3O1UA 1UY4A 2RHPA 2H0VA 3VKFC 1OHFA 2PELA 5EYXA 1LHUA 1POV1 1HLCA 4XZUG 4OLLA 4K8FA 4XIOA 1LGCA 3D0SA 3WF3A 3ZXFA 1YRZA 1OD3A 2ZZJA 2HEYF 3RI9A 1MEC3 2A71A 5C8CB 1LJ7A 4FP3A 1QJY1 4L2NA 1B09A 2G9GA 4KQ7A 2E9QA 3B69A 4LLFA 1RUG3 4P9GA 4PF1A 4Y1ZA 1V6MA 4CDWC 2E6VA 2VCMA 5CVRA 5CZKA 1OOPA 1OKOA 1UZVA 2IXJA 2WYFA 2JG8A 4URAA 3TNPB 1S2BA 4E2SA 4RGGA 3PHMA 2CWSA 4AVTA 2C9AA 3KVBA 1DIWA 2J1VA 3L2YA 1YEWA 2NZ9A 3K46A 2WBKA 5FZKA 2ZBJA 1A78A 2SLIA 1VBA2 3PURA 1V0AA 1VIWB 2UYAA 2JECA 3SC7X 3C2UA 3NSTA 1YHFA 1SG3A 4CDQC 1O3TA 4FPFA 1QH6A 1W0NA 1WKYA 3H0OA 4IEPA 4WM8C 2VMIA 1QJEA 3NNLA 5ERLA 4KGGA 2VZVA 5FZ4A 2ZGTA 4Y4RA 3WNMA 1VBC1 2GNTA 3GALA 4BQ2A 1VMJA 4YGEA 3AZWA 3LDRA 4A3XA 1CAXA 4XJWA 4IEUA 1ASJ2 2Y60A 4XURA 4GH4C 3J8F1 2XLGA 5FPAA 2H0BA 2MNGA 3SNMA 3PVNA 1X8MA 1XXNA 1L7RA 4MSVA 1R1A3 3M70A 5C6CA 4FTSA 3AZYA 3M4FA 4BIOA 4BQXA 1GWMA 2D6NA 1D7PM 4HN1A 1XJAA 3HR9A 5FYBA 1JYNA 1HIXA 1LOAA 3B02A 3EYPA 4ISQA 4LHLA 4QPIB 2XB6C 4FPGA 2RR12 2WO7A 3ME2A 5DAVA 4OVEA 4XZPA 1XE0A 4COUA 2E26A 5E16A 5GLWA 1XNAA 4I0WB 4Y33A 5IT6A 2C9KA 4CP1A 2WO1A 1EY2A 5JZGC 1PM4A 1PX4A 1TQ5A 1LGNA 1WCUA 2RG4A 2DVDA 4LJHA 4N53B 4Q4V2 5BNOA 4QD2A 5DAQA 3B94A 4XOGA 1W8NA 2Y34A 3H8RA 2GDFA 4JTNA 3W5MA 3ZFFB 2ZCWA 2W1UA 3I97A 1KRIA 2QUOA 1VLNA 1C8NA 2ZGQA 3E6DA 2FQPA 1W8UA 4XMIA 4CUAA 2E7AA 4FAHA 2YFZA 4AEJA 3S0MA 2MEV1 2VZPA 3C8XA 3FLRA 3JBG1 4HK9A 3SMHA 1YQ2A 3UK9A 3UYJA 3N35A 4LO4B 2BFUS 2UWCA 3V56A 3SH5A 2QQWA 4FOVA 1EUTA 4XAEA 4JAAA 4YM2A 3DEMA 3GCXA 4QXBA 1ZVFA 4AZZA 5E8AA 3VZMA 1QJU2 4OUSA 3WP5A 3B7MA 4CDUB 1QNWA 3AFKA 3T4HB 5FBJA 2FHRA 3U1XA 5JIUA 1VBE3 1QJX1 4JRLA 1HRI1 3BTYA 5CNAA 5KXCA 2OT7A 3LKJA 3NVCA 5GZFA 2WT1A 1XU2A 4HFSA 3WQ7A 3ZPYA 3MLKA 4LBMA 5CISA 2GAUA 4IE7A 1C5HA 3SLIA 4U36A 3DECA 5LK7B 1QJY3 3D0JA 3WR0A 1ZRFA 4W6XA 2B46X 4QKDA 1UQXA 5FXXA 3RI8A 2OZJA 2A6WA 3VBOB 4AK3A 2PHLA 3BTZA 3JB4C 1RUJ3 5BNNA 5D1IA 1MZFA 3D6EA 3OBRA 2CYFA 4IW3A 4LBQB 5K0UC 1KFUL 4LE3A 2FCVA 5AFBA 1T6BX 1UKGA 2BQPA 2SBAA 3PVBB 4LORA 2WZEA 2AGSA 2P3YA 3JZVA 1PO12 4RS5A 3HBKA 4Q0UA 5ABJA 1ONAA 3MBWA 4NMIA 3PTRB 4LNVA 1IS4A 1RHI3 4JVAA 4NWWA 5C8CA 4F7ZA 4LUMA 4HT1T 4ZU5A 3RWNA 3W59A 1UW8A 4CDXB 4D7TA 5ACA2 2FDKA 1YI9A 1W2NA 2VPVA 1QJU3 4W50A 4FFFA 3W58A 4P08A 4Y5TA 2WZR2 2ILMA 4NHYA 1BBT1 1CZTA 2JG8B 5BPXA 3FBMA 1DU3D 3IAQA 4IEOA 2VGDA 4Y26A 2NMOA 4QX1A 5I91A 3E6CC 2TUNA 4Y1XA 1V6NA 2XQXA 5FY8A 1Q8QA 3IPVB 5FZ0A 2P3KA 4Q0VA 4JX0A 5GLTA 3VB9A 3NJZA 1PK6B 3A0KA 3VBFA 5HXMA 2RM22 1YQ5A 5CA6A 4A3ZA 1UY2A 3QOPA 1V6OA 5J09A 1GUIA 3O14A 5F32A 3ZXAC 4CRQA 3RMYA 1CONA 4XFCA 5FREA 4M4PA 2Y33A 3CO2A 1V00A 4CDQB 4OI2A 3ZSJA 2VCBA 2GH8A 1KGYA 3R05A 1FYUA 4META 4NAOA 3UNPA 1S1AA 3VD3A 2WIIB 5JCTA 2X53S 3LSDA 1S2KA 4QB2A 2HKXA 2WO3A 3I59A 3ILFA 1ODNA 1QQP2 2D6PA 4HL0A 3WW3A 1ZREA 1N1SA 1V70A 4Z92B 3FFQA 4CUCA 3P5BA 5JIAA 1AX1A 1QJX3 3LA3A 1FV2A 1SFYA 2W68A 3SISA 1UCXA 3CMGA 1NA1C 4GWIA 3ZR6A 3AMNA 4FPJA 2F4PA 4QPGB 3H8UA 5C3OA 3VDDA 2EA7A 1UPIA 2ZX2A 1JU3A 3H1YA 1IG3A 1UX6A 4H7LA 1EAH3 1US2A 5KR7A 4EWDA 1SFPA 2CNAA 2H6CA 1RTVA 3WG2A 1SLCA 4N53A 1GICA 2WNVA 1XNKA 4WVVA 5C9AB 3WXPA 4LHKA 2VD7A 3DN7A 2VMHA 2PN5A 3SQOA 3V0BB 4HMZA 1FI2A 1RB8G 1I9RA 4DS0A 4GULA 4YW5A 2WNUB 1JODA 5IK4A 4N53C 1C4RA 3AXEA 5FZ7A 1YO8A 5FO9B 2ZX4A 3USUB 4LIUA 1QH7A 1UN1A 4FOWA 2PAMA 3BOWA 1G9DA 5T5LA 1QQP1 1LR5A 1JH5A 2XVLA 4PBPA 4WM7B 4FQZA 4E27A 4Q4X1 2JDKA 4R4XA 1N3OA 3QLQA 4TLFA 1FOD2 3MW4A 4QM9A 4LHSA 1IS6A 4C8DA 5HV0A 2BEOA 5JI7A 1XSQA 4Q0SA 1COV3 2XR4A 5FZIA 1RVF3 1PIV3 4NIHA 4MGIE 2RDQA 4Q4W3 1PZ7A 5JPMB 1PVC3 1LKNA 1N3QA 3I4IA 1FMD2 1R1A1 3C3VA 5BNPB 4K7JA 3BKZA 5F3IA 1G9CA 1O3QA 2XJRA 4UFJA 1DZRA 1ULFA 1S2EA 2CGNA 3BYWA 1OLME 5FOJB 1FMD1 4Y3OA 1Q43A 1CZVA 2KD7A 1EYBA 5A7PA 1JYTA 1MQTC 5LASA 4TYSA 3K3NA 3TN93 3WG4A 2RS33 4XQDA 1OBNA 2DDUA 4FP2A 5KBFA 1QHDA 1SLLA 5KWRA 4R9DA 1GNZA 2ZMLA 4HKWA 5LEJA 4YW2A 2HWC2 3T2PA 3ZR5A 5F9TA 2O0OA 1OOPC 2JIJA 3VBUB 5FZBA 4UW6A 5A3MA 2VCCA 3Q8CA 2L9LA 1RMU3 1PO11 4QPWA 3SCGA 5I0RA 3LEIA 3IBMA 1S0FA 3C7OA 4TLGA 1FAYA 4DXZA 2D6LX 3I3BA 3WLUA 2HEVF 5DAPA 3ETPA 1XBFA 3LD8A 5FBZA 3SCHA 4BQ4A 2LRPA 3LZZA 2HWB2 5C8CC 5JMOA 4HANA 1ASJ3 3AMPA 1VB4A 1UWWA 3IPVA 3VN4A 3WF0A 4AEDC 4WVWA 4A41A 4FOYA 1RUC2 4BQYA 5BNOB 3GNEA 5F39A 1PVC1 2DUPA 2WN2A 4XUTA 1CD3G 1IS3A 1PIV1 1O3SA 3E1F1 4XQWA 5T55A 3RZGA 2R0FA 5G05L 2WFPA 2FCUA 2ERFA 1S0BA 4M0NA 3DUIA 4J6GA 5FZEA 3AXDA 1CAUB 1JZ3A 1W2OA 2F6BA 2W91A 3U4XA 1DGWA 2CL2A 3I2DA 3KWVA 5FZ6A 5FZ3A 1PO22 4AI8A 4CTEA 3ZKYA 1HB1A 5J1XA 2E7QA 1H1AA 2I74A 1I3HA 4TXWA 4LULA 2VAUA 1W9TA 2B5HA 1YC61 4PHZA 1HRV2 4IESA 2Q1MA 1U5ZA 3D82A 3PUQA 3MICA 1K5JA 1YQ6A 1TZOA 5CFDB 4CDUA 4RD7A 4QPGC 3O1RA 1KD7A 3MO4A 3WV6A 2X29A 1Q8PA 4MG2A 2ZX0A 2VMGA 1HW5A 4QKBA 2Y6KA 1U12A 4O65A 2ZMNA 3URFA 3QH6A 2XOMA 3FFZA 1HB2A 1OQDA 2RM21 1C8M3 1O4TA 1XNTA 3U14A 4P9YA 3ZYHA 1W6PA 5FZ8A 5FZAA 2XMLA 2C26A 3IDEA 3FUQA 4I0BA 4KBZA 1QDCA 3V0BA 5FYYA 4PLMA 2JX9A 3VGIA 1VJ2A 1UKRA 4P9IA 5JOYA 1JXNA 3ZFGB 2ZZQA 4LEJA 4R9CA 2HWE2 3WUDA 4AFCA 4NAMA 3H50A 3AZVA 1B35C 3CLPA 4XBNA 1U5XA 3B93A 5FLJA 4LT5A 1KJRA 2A6VA 5HPOA 2A7AA 2GMMA 4LIVA 3TAYA 3HT1A 2DU0A 1NQDA 2JKXA 1ASJ1 3H8XA 1TEIA 1C28A 3CKHA 5F6KA 5FWEA 2N7GA 3GZEA 4H14A 1OH4A 1RVF2 3I3MA 5T5JA 2BDRA 4AEKA 1JYCA 4BISA 5JMCA 4OHYA 1CPNA 4Q27A 2RM23 5EXOA 1YUDA 2G1MA 4AR2A 4KG8A 1LOFA 4Z82A 4AYUA 1SBDA 4KI5M 4QT6A 3BALA 1WCSA 2BWCA 4UW4A 1V6JA 2PQQA 4IE0A 3I7DA 5C3RA 4BXFA 2WT2A 3H42B 1DLCA 1DZTA 4P14A 1MQTB 2DTWA 1PX3A 2VVEA 2YY1A 3RPQA 3VDBA 2Y6FA 4RHV1 3ZSEA 4B1LA 1C1LA 2OXBA 2VMCA 2V4AA 2MHFA 1EV13 2W2IA 1UZYA 4MX3A 3U11A 1YIFA 3UETA 3VL8A 1Y3TA 2E51A 2FDJA 5ANQA 1LCLA 1UXXX 2D5HA 2OS2A 1W0PA 5H9SA 5ABJC 3O5SA 5EJZB 1Y9GA 2PMWB 1LU1A 1RXFA 1OA3A 1TMF2 4LKSA 1VB2A 3WQ1A 3PVOA 2W9XA 3N7JA 5A6XA 2ET1A 2D98A 3ZYPA 1AVBA 1JZ7A 2YU1A 3I2JA 3AVSA 1ENXA 2QDRA 2WNEA 3UKTA 4BQWA 3CJXA 2ZHLA 4PI0A 1HXS3 2A5ZA 2RV9A 3I2KA 4DUWA 2EIDA 3UESA 1ND3A 1REFA 2DCYA 2GN3A 3OYWB 1W8ZA 1MS9A 2W1WA 3Q8AA 1QQP3 1PO23 5LCWL 3AP5A 1L7LA 3NV1A 1LESA 3NW4A 3VD4A 5E88A 2BFUL 1KJLA 1W2AX 4CCJA 1AYN1 1WLWA 4PIXA 1IQAA 2HYXA 2GSYA 1X82A 3VHRA 2JDHA 2C24A 2K0GA 2RMU1 2TNFA 3O1TA 2GZWA 1VBD2 2XONA 4PIYA 1VBB2 2OUHA 5ABJB 2AEYA 3USUA 5IVBA 3AYAA 1ZZBA 4I3PA 3WP4A 5DAXA 3HPNA 3ZXLA 3VBRA 4B4PA 2WFF3 1WMEA 1HQWA 1AR93 5E6HA 1AR83 1J83A 1ND2B 2VZ3A 2AENA 3J4UH 4AQSA 2RS31 1JYVA 2UWBA 1GANA 5FDBA 2P5BA 3V0AA 4FXKB 2VY0A 1HV0A 3RYKA 4MV2A 3VBRC 1H8TB 5CFDA 3VZLA 1LU2A 2VUDA 5JWPA 2YV8A 2DCKA 1JZ6A 3AB0A 2AC1A 2XL7A 4R52A 2BVVA 4YVWB 4XXPA 4DRVA 2I07B 1V9U2 3T2TA 5KXEA 5AVAA 3MHZA 2YXSA 4BWOA 1S0CA 2HWE3 3Q9OA 1GQGA 2GC1A 2V73A 5I93A 1AZDA 3AYCA 5D2AA 4QU2A 1I5PA 4XJ8A 2DTYA 2WINB 5EZWA 3UKNA 4IGPA 4IE4A 1YJLA 1PHMA 2IXLA 2QKDA 3BB6A 1RL3A 2IXKA 4XABA 4KU8A 2YB7A 3WDVA 5A32A 1RUJ2 2ETEA 2JE8A 4ARYA 5GZCA 4B4QA 2BUKA 3NV2A 5JZGA 2BJSA 5CFCB 3MIHA 2ID4A 1QJY2 1GOHA 1MVEA 5T3NA 4GQ7A 1BBT2 3VBUA 5EHDA 4K20A 1AL21 3CJIB 1CAWA 2LS6A 5A7QA 3AL5A 3WT3A 5A6YA 2PHTA 2GC3A 2RS52 4AQTA 4Z2AA 1AR92 2WQ4A 4W4ZA 1OUSA 3GBWA 5FMOS 1JOJA 1Y4WA 1AR91 1RYYA 5FFOC 1K45A 2VVFA 4DEQA 1ZX5A 4L99A 2QTWB 4NHMA 1EAH1 1Q56A 3WF1A 3S5AA 5LATA 3OUHA 3VHPA 4GH4A 1APNA 1L3JA 5FZCA 1RUD1 4JV4A 5GZDA 1NLRA 5LRRA 2Y6LA 4TTGA 5FJHA 1PZ8A 2OPWA 1H2LA 4CDXA 3KVAA 5BNNB 3LAGA 1DYKA 2R042 5T54A 4QQ2A 2ARCA 4C0HA 1WGPA 1BKZA 5F2WA 4BLJA 3IAPA 1G6NA 4OFGA 1H6XA 1RUG1 1W8FA 5C33A 3X29B 3C7FA 3OPWA 5LK5A 5FXWA 1ENQA 1DYPA 2VUAA 1MEC1 1PGW2 4ORFA 4O7XA 3RS6A 2VZTA 1T6GC 1VRBA 2Q8OA 1V9U1 3OY8A 1W06A 4QXCA 1O6UA 4HKLA 4QB1A 3I2GA 4FPCA 3ZDVA 4YZ5A 2EALA 2VVDA 2WYSA 1JI6A 4YGDA 4CCKA 3ST7A 1QOTA 1DQ2A 5HCFA 5IK5A 1OUXA 2J1SA 1DP0A 3VBFB 2VQTA 3B3QE 4BLIA 3JD72 3RZLA 1CESA 4EQVA 3VD7A 5FZGA 1IG0A 2OKXA 1CX1A 5A3NA 3D4KA 2GALA 4CU9A 1SLAA 2OQ7A 3BN6A 1GBGA 3L2HA 1XPWA 4RHV3 1QJZA 1QWRA 2J22A 5A3PA 5FYCA 2R043 2ZEYA 1AR82 4QM8A 1COV2 1U5YA 1WD4A 2ARBA 2DVAA 4XYXA 2VXRA 3CQOA 3ROUA 2PHXA 1VBB1 4LA2A 2CSGA 5JAXA 1FMD3 3N9MA 3OTFA 4FQ4A 3CIHA 1G7YA 4RGAA 4EWEA 5F5AA 4RGKA 4R9AA 4M01A 4AF9A 5F5QA 3T08A 4CEWA 4BQ1A 2DVBA 4ZU7A 4A4AA 4SLIA 4Z2WA 2OUJA 4WBBA 1RVF1 2EXHA 3FX3A 5A3WA 5L9VA 4LE4A 4E2GA 1KDMA 4P5YA 1C5IA 1IKPA 2XJUA 3HJRA 4YZ2A 2EF6A 2ZAAA 5IFTA 2JG9C 1WWYA 2OPKA 4N9HA 1DBNA 3WX5A 1F35A 2QQMA 1H2KA 3NJYA 4GMP1 2HWF2 2VBBA 4AAPA 4FFIA 4DY5A 4Q4Y1 3ACFA 2ZGSA 5FTTC 3BU7A 1VBC2 4RS5C 1AX2A 1XSRA 2JXAA 1J84A 5GLUA 1W04A 3SH3A 4WM7A 3WY6A 1YIPA 4DPNA 4S2DA 1F31A 2KXLA 4GWJA 4OI1A 1MS1A 4QHOA 5FP7A 4FXGB 5LW9A 2D40A 5FOBB 1OT5A 3F95A 4AHWA 1Y9QA 5M0TA 2K9ZA 2PHRA 2WT0A 3VBHC 1KFXL 1OKQA 3RJRA 3AC0A 3CEWA 2WFF1 3FC0A 4XACA 3W21A 1X36A 1BK1A 2QQLA 3N4MA 1SLTA 3QH7A 3AYEA 5KHJA 4FPEA 2Y6GA 1HB4A 3MPBA 2VOTA 3N3HA 2JWPA 1AF9A 1RGSA 2W47A 3PUIA 2PHFA 3JD71 3RRDA 2RMU3 3AJZA 4XE9A 5BY5A 4I01A 3CZUA 4GB33 3VLBB 4DMIA 4KGQA 3WINE 5A7NA 3MW3A 3WSOA 3O1OA 5A7WA 1QEXA 4RN5A 4QX7A 4Q4Y3 1DYOA 2ZGUA 1IOAA 5BNPA 2ARXA 3K2OA 4UBGA 1PNFA 3AKTA 1CIWA 5L7OC 4R4ZA 5L73A 1J3RA 1X7NA 3D8CA 1CPMA 3ES1A 4XQ4A 4EZ4A 1YXWA 1HXS1 5A33A 4B29A 5I0SA 1UIJA 1OA2A 2Q5TA 5EQUA 1RUE1 5CKNA 3ES4A 3B9CA 3GBFA 3BI3A 1UO9A 4NE9A 2BPA2 2ZGPA 4A2UA 4OHWA 2D3SA 1PVC2 2O14A 2PQSA 5L9BA 4ZZ8A 2BWAA 2ZGOA 4LXLA 2D93A 3W20A 1R091 1NCRC 4OCTA 1VP6A 4UFLA 1BHGA 4COYA 4C0BA 1R092 4JKKA 1GNYA 1ZZ8A 2IWGB 4XC9A 3AMMA 5JOZA 4I30A 3PNAA 2WS93 3DYPA 1J1TA 2YPJA 3VBOA 1MS3A 2EVXA 3P1IA 1E5RA 4M3CA 5I0DA 3OGGA 1B35B 2VUJA 1Y7BA 4FOQA 1S0EA 4N7IA 3J9SA 4RQPA 1AXYA 4AI1A 2DUOA 4MVTA 1Q8SA 4ONUA 4CPBD 1W6NA 1BEV2 1W8OA 2RE9A 4G4FA 2P6HA 4Y22A 5DDJ1 3SHRA 3FL7A 4CUGA 1VMHA 1QOOA 5G04L 4LO8A 1OURA 2WLQA 4Z8BA 4XUOA 2Y0OA 4J1WA 2BZDA 1GQPA 4N90A 4XCBA 4CU8A 5FV3A 2GMPA 4LK6A 4AW7A 3NQHA 4CP2A 1RUJ1 1W2TA 3E5UA 2LALA 1MS4A 4MHUA 1A8MA 4Y20B 4PF5A 1AYM3 1IHMA 2FCTA 1CAUA 5F8PA 2XHNA 4HXCA 5A1AA 2H6BA 3JQWA 4LBNA 5D8AA 1KS4A 2ZXQA 4HG6B 4YGBA 5IAVA 3DYOA 5EJ3A 1EV12 3I2OA 4HPKB 4S2GA 4Q4W1 4YVSB 1Z7S2 1K3IA 2XBO2 2VQ0A 2JDZA 4Q26A 2BVBA 1N1YA 4OI4A 1GOGA 4UT5A 2HBUA 2W1SA 4ZS3A 1SQ4A 1IKQA 3ZN4A 2QVSB 3HOBA 3ZYJB 5D8AC 2VBDA 2GP3A 1UD1A 1JS9A 4XJZA 3N7KA 3OGSA 2W0XA 2P34A 4OULA 1F15A 5JVVA 1RUF3 4IV1B 4K1YA 3BGAA 4NO4A 4DUXA 5EIYB 1CAVA 2X8KA 3A7QA 4CEYC 1FATA 3ZFGA 1LOCA 3AX4A 2WAAA 3RZHA 5JXIA 1K42A 1EP0A 2XXZA 4FT8A 2RS51 2JG9A 4IE6A 4CCCA 4XW3A 2R1DA 5EFUA 5B4XA 1WZXA 3WZ1A 1AL22 3WNNA 2X5IB 4QPGA 5APAA 5LEKA 2RMU2 2O1QA 4P9XA 3I3DA 5DUUA 3POWA 3NNJA 5FYVA 4CP0A 2JD9A 2W46A 2C4XA 3VZKA 4IGOA 3GM8A 3VHNA 3VUOA 4O9GA 4NN0A 2DCZA 5I0TA 1MVQA 4ZKTB 2QQJA 4IEZA 2C6SA 4M0HA 1P8JA 3KLSA 2OYZA 3PVEA 2RS13 1OFNA 1OA4A 2GMEA 3TRSB 1AR62 1DGWX 2W3JA 1MPXA 2GC0A 2OVUA 5EP9A 4RR3B 5C9AC 1H2MA 1JTZX 1PZ9A 2AYHA 2WSVA 4QB6A 3SKJE 5K7PA 3N9QA 1O4ZA 4BCUA 2DFBA 1ZZCA 1RXGA 4WVZA 4YVWA 3LCPA 1E5HA 3HVDA 4W65A 5DZEA 1W6OB 3PLQA 3J8F3 2J1EA 1FX5A 1EPWA 1PGL2 3MLLA 2WS92 4NRQA 3KSCA 2NYYA 3AJYA 4YVWC 3H8OA 5IVJA 4CP9B 5DG1A 2J1TA 4CU6A 5HCAA 5BNOC 3H3LA 4HZFA 5K4LA 2WQ8A 1XRUA 3OBZA 2Q4SA 4PBOA 4QPIC 5LZ6A 1LEDA 3VL9A 1XYPA 3P6BA 5LY2A 2VTFA 1VBD1 5A6ZA 1YFWA 3CJIA 2A73B 3G7DA 3MIBA 1GMMA 2R041 3MLJA 4HKOA 3K75B 4J1XA 4UF0B 5CFCC 1DZQA 1NXD1 3TN91 5FMDA 2FMYA 1H9WA 3ACLA 3RG0A 1IZ3A 3TWIA 2JDUA 1Q8VA 3ZIWA 1CN1A 2FZ2A 2LW8A 1VRH2 1JW6A 4N43C 4AI9A 2ZGLA 2J1RA 4GIQA 1FNYA 2WNUC 2PTMA 4DXSA 1HQNA 3U0ZA 2VNVA 2BNMA 5BNQA 2BTVC 3Q8FA 5HXVA 1LEMA 2AEZA 4QHZA 2FD8A 2W95A 3GBGA 1UL9A 2R0HA 1BXHA 2VW2A 3BCWA 5C4WB 3TNQA 1MZEA 2ZGRA 4CCMA 4JQRA 4K21A 5KC5A 1BLZA 4IV3B 1MR5A 4GA9A 4HETA 3KV9A 4UYBA 4YW1A 4LA3A 5FO8B 1LOBA 3KD4A 2QZ3A 5LBBA 4INDA 2BRTA 3ZOIA 1WW5A 2W5FA 5EPAA 5EYYA 2C0ZA 1VAKA 4OZXA 4E4HA 3OGRA 2CV6A 3IKWA 1EV11 2P4EA 1OC1A 3DYMA 1S55A 5BV6A 1K5MA 3E5XA 5JSOA 1AJOA 3U78A 1QJX2 1A6CA 1ULEA 4HSJA 2ZHNA 1HN1A 1A8DA 1ENSA 2YBPA 5FY0A 1CX4A 3VZNA 3WHTA 3LSEA
chains in the Genus database with same CATH topology
1VBD3 2ZGKA 3OD4A 5E1RA 1V6LA 3A4UA 1XU1A 2PFWA 1NXMA 2NP0A 4ZXKA 1DQ4A 3SXWA 3RJ2X 4LO6B 5AC92 3CU7A 3K48A 1YLLA 3VDDC 2MEV2 3QCWA 4PDWC 2LM3A 2B9UA 3VBFC 4EJRA 3OGJA 4FPLA 2KM2A 3ZMOA 2BBVA 5JZGB 5ACA3 1G86A 4QMAA 3TOJA 4Q4V1 1G8WA 4KU7A 4S2FA 4HBNA 4E9KA 4LR4A 5H9PA 1NA1A 2ZGMA 1DQ0A 3AKPA 1RJ8A 3USSA 4JGZC 4XF4A 4LHNA 2CAUA 3P3PA 4TSVA 1D0GA 3AKQA 1B35A 3AZXA 1F8VA 4GWNA 2VG9A 2XHKA 4KNCA 2DCTA 1QXJA 3ZX7A 1ZA4A 2WNVC 1WBLA 5J3UA 2P3IA 5K0UB 4WM8A 1NCQB 5DZFA 4PDWB 2NQYA 2D3RA 1S0DA 2JE7A 1WMFA 2B45X 2QJVA 4FTEA 4O9EA 5KXDA 3AP9A 3LB9A 1WW6A 3U10A 1XYOA 4XTPA 1ZM1A 1N3PA 4AWDA 2R16A 3AK0A 3ZN5A 4FAGA 3ZSMA 5K8SA 4FBFA 1C1FA 4D69A 1JUHA 3M3OA 4F83A 4ES9A 4E4DX 5CFDC 1PMIA 3DPRC 3HD8B 4P9WA 4B3NA 3WP3A 4PCRA 3DKWA 4IQPA 1GZCA 2WFF2 2FBEA 1KITA 3FUOA 4BMBA 1W6MA 3WDWA 4OHZA 3KGLA 1I6XA 4GMP3 1UPSA 2EXKA 4PJYA 1GQHA 2RR11 4P5HA 4PLOA 4BMEA 3GZAA 2RR13 1X33A 4XFBA 2VU9A 1GZWB 4X6RB 3WUCA 4X6QB 1SEFA 3NL1A 3O0XA 1LHWA 2VOWA 2ATFA 5DUVA 1Z7S3 2BNNA 5H9RA 5CG8A 1XNCA 2WJSA 5GZGA 1CAXB 2R062 5C4WC 2QFEA 2Y26A 1GZ9A 4AHYA 3APBA 3ALQA 2A3WA 5DDJ3 2O8QA 3ZIXA 2VECA 4IV3A 3HT2A 3KCXA 2GNMA 1QGLA 3LA2A 2PHUA 1AJKA 4JGYA 1ND3B 4XPVA 1OQ1A 2YYOA 1AR63 4UBHA 4XILA 1CVNA 3KT4A 2R49A 1MZ5A 2GN7A 4IV3C 1ZRDA 4AQ6A 1AHSA 4QPIA 2UY8A 1BVVA 1BEV3 1FPN1 3G6JB 4HSLA 3ZFFA 1AL23 3MF9A 5J98B 5JSRA 1QDOA 1RUH3 1YJKA 1RUE2 4DY3A 1G9BA 1R093 5C8WA 3RMXA 1NE6A 3S30A 2V09A 3U07A 2PHDA 3NAPA 4C1XA 1FOD1 5GM0A 1AR72 4Q0QA 4Y20A 1OFSA 4MZUA 3ZO0B 1WCKA 4EN8B 3KT7A 5J36A 1G9AA 2XKPA 4I2OA 2GU9A 1AYM2 4YGCA 2JEMA 4IEQA 3VZOA 4QGNA 4NWVA 3M2MA 5HBAA 1NQJA 4MGZE 1RUD3 4QQLA 3IWZA 4XIKA 1W6QA 1U0AA 1RITA 3GYDA 3O0VA 4L92A 4K40A 3ZFEC 3VBHA 4KL1A 1J1LA 5A32B 1MZ6A 4BHPA 2A6YA 2D5FA 2VW0A 2YMZA 3JBG3 3WDUA 1MS5A 1EAH2 2AZ5A 2HWF1 3LA7A 1JYIA 1ULGA 2JG9B 4LO7A 5SV5A 5KHGA 4CEYB 5FCCA 2X5IA 5DUXA 4XF9A 5FLHA 3ZN6B 1AL0G 3WG3A 4NVPA 1I5ZA 1LOGA 4COWA 2HJIA 4B7EA 5T50A 3UJQA 2XGXA 3DPRB 5FPXA 5JI9A 2ZABA 1PK6A 5KHKA 4PIZA 3ZDSA 2HEWF 3FBYA 1DQ1A 1SCRA 4QQPA 2EXIA 3H3ZA 2B39A 1RUI2 3FLPA 4X8PA 1LOFC 4L9BA 2WA4A 1POV0 2D44A 4DFSA 2ZHMA 2WA3A 5KHIA 4GMP0 2IFWA 2YUEA 5JDBA 3WHUA 3E5QA 4G3YC 1SCSA 3AP4A 1HQLA 2Q1ZB 1ALYA 2GC2A 1W6PB 1ZBA1 5K9YA 1LRHA 3AFGA 1J58A 3AMQA 1YFYA 4MGYE 5F1RA 3ZXJA 2DYCA 2IXCA 2XL9A 4AXOA 4XF1A 1CJDA 3DF0A 4YFWA 4XJ9A 3OBTA 1H8TC 3GF6A 4MXWA 3ATGA 2C5DA 1WCDJ 4R8HA 1MEC2 3THPA 1H8VA 5F6LB 1NYWA 1XYNA 2HWC3 3H1MA 3WVJA 4KWLA 1NA1B 4UW3A 3ZYRA 1V9U3 3IIAA 3POSA 1H4HA 1J3PA 1IGOA 2XJSA 5FO7B 3AMHA 4Q8LA 4CDWA 5CADA 1CJPA 4QQOA 2XJQA 3IT8A 5BNNC 2QCSB 3UV9A 5K0UA 2CTVA 1Z78A 1POV3 4I3GA 4WM8B 1HRI2 3WW2A 1COV1 1W0OA 2Q0AA 4CEWB 4N43B 2IC1A 4Y1YA 3M7AA 5I8TA 1XNDA 1LB2A 2V5YA 1MQTA 2OA2A 4YZ3A 4WZCA 1OLQA 1Y43B 1CR7A 2QDNA 1TMF1 3R4DB 3WG1A 2WZR3 2XPJA 2P3JA 2YZ4A 4IEXA 4U2AA 3VKNA 1WA4A 1GSLA 2MEV3 4ISRA 3H9AA 2IFRA 4A7ZA 1R081 2RS53 3ZXGA 1ZZ9A 1OI6A 5GLZA 1IS5A 2DFCA 4E4SA 2RS12 4CYDA 4K1ZA 3T1MA 1DFQA 1ZYBA 5FRAA 3AKRA 2R073 4AFMA 4LBQD 1S0IA 4AHXA 3W9AA 4YNIA 3RYRA 3GZUC 5IK8A 2EIGA 2YC0A 3ASIA 2YROA 3ZFFC 3ZMNA 5SV8A 2TBVA 3ILNA 1F5FA 4HLTA 4SBVA 4AGVA 1WD3A 3SH4A 1RUD2 1H1MA 2XVGA 1BVP1 2XG3A 4XFAA 5ACA1 1ZBE1 1W2UA 3S7EA 2BYVE 3FE5A 1DF0A 2RS32 4YW4A 4IETA 3VBUC 1DGLA 4YM3A 4DOUA 1VRH1 4GALA 2Y0IA 4XFGA 1TNFA 4CZSA 3TN92 1NOVA 1NLSA 1YCIA 3AYDA 3IMNA 3SCFA 4JDMA 4KH9A 1NCQA 5LRSA 3QACA 1QU0A 1I1EA 4EN9B 3INAA 3IDCB 4TWTA 5FMOL 1RIRA 4YZ1A 2WC2A 3IN9A 5BUVA 1LGBA 2VNRA 2R6QA 3FZ3A 1FXZA 1NZCA 2A6XA 1QJU1 3BTAA 4XETA 4KWKA 1ZZ6A 3M3CA 3WCSA 3M3EA 2ZJCA 4GKYA 4W6WA 4BOWA 1RHI1 4AVBA 3WQ0A 3LWCA 3WW1A 5EV7A 1ZRRA 2W08A 2E63A 3JUUA 3JCIA 4NHKA 1O4YA 1RHI2 3K51A 3NO8A 1AXZA 4QXKA 3JBG2 3MI8A 1QNYA 3B00A 4Y4YA 4AFAA 1S0JA 4NHLA 5CIRA 1H1IA 1PGW1 1PNGA 1A3KA 2D43A 1Q8OA 4M3CE 3KM5A 3FLTA 3V64A 4CDQA 3H1WA 4L97A 1AXKA 1WW7A 1D4M3 4XMAA 3VBHB 4D3WA 4AVAA 1HRV3 2QZ2A 1HDKA 5A3LA 1N1VA 2E7TA 2HWB1 3KCYA 1ULDA 4DQAA 2JJ6A 3PJYA 4FPHA 3UL2A 2Q30A 2XUMA 5GKAC 4YLZA 2O8OA 3P3NA 3UJOA 1HV1A 3MIDA 4DZGA 1SACA 4FCAA 3HMYA 2FZ1A 3KB5A 4FPKA 2D3PA 2JD4A 2OW4A 5FQ0A 1GR3A 4AVVA 4PDWA 3GHNA 1CGPA 2PLV1 4DINB 2Z2SB 4UXAA 2NN8A 2Z79A 3QBQA 4PLNA 2D6KA 3TB0A 1O3RA 3OPZA 2D6OX 1H9PA 4AI3A 4RHV2 4YARA 1RUE3 2Z5WA 1BMV1 1RC6A 4A7YA 2RS11 4AEDB 1TE1B 5HI0A 1VAMA 3DGTA 1KDKA 4P9LA 4LUKA 3ILRA 4E2QA 3MGUA 1RUH2 2DVFA 3KMHA 2QQPA 4LO5B 2AR6A 2ZGNA 4L11A 1TME2 4MH0E 4FO9A 5DDJ2 4MXWB 3CL1A 4KBBA 2NMNA 4B8EA 1F5JA 4MGKE 2HWD2 4XXAA 2ZTNA 3ETQA 1VBC3 1G9FA 5I8SA 4AG4A 1W6QB 4AI0A 5E89A 1NCRA 3VKOA 2D7FA 2EAKA 4K6BA 4FVVA 4YSFA 5BNPC 3D5OA 2B7YA 3R6SA 3MIEA 4GWMA 2R1BA 4JDOA 2CWMA 3AM2A 1GZWA 3OYWA 1RUC1 2CAVA 1GV9A 2A6ZA 3FWEA 1WUVA 4QX5A 4Z1VA 1QY4A 3JB8A 3NKTA 5IUQA 1ZBE3 4MYEA 4NPRA 5DG2A 1REEA 4N43A 5DZGA 1RUNA 1NCQC 1ZNPA 1O7FA 2OIIA 3RQ0A 4YG3A 2YGMA 1O91A 1YFXA 2WL1A 4JGZA 1VR3A 1AYM1 3PMEA 1H8TA 3VBRB 1LENA 1YNAA 1RUF2 2VOVA 1OLRA 2R071 5KC6A 1D0HA 1OSGA 2XBO3 4ATEA 2PHWA 2HWC1 4Q0PA 5T5PA 4HVQA 3V0AB 4AEMA 2ZKLA 5L36A 4BA6A 1GFF2 3VHOA 5C4WA 1RUH1 5L7OB 2OZ6A 3EXUA 2BW8A 3OJBA 3WCRA 3J26N 2HWB3 4ATFA 1FNZA 1D4M2 3VBOC 4XEZA 3BOPA 1ZBA3 1C8M2 2DV9A 3S7IA 1RUI1 1D4M1 2UURA 5BYNA 1K5MB 5CU1A 1ZZ7A 5A33B 1DQ6A 3MFCA 3IM0A 4EWAA 1E57A 1UZZA 3B01A 2A3YA 3CJIC 3MZHA 3ZVXA 4MLOA 5CFCA 5T5OA 2G4IA 1H2NA 1C3HA 2R072 2Y38A 2R30A 1QKQA 4JRAA 3LOIA 5JLVA 3FHIB 4XF3A 1NY72 2FMDA 3H3UA 2R061 5DUWA 4C91A 5IK7A 5FQ0B 2B8MA 4IERA 4Q4X3 1RINA 2PA7A 3WDYA 5GLVA 2XJTA 4RFT0 3NAPC 1HX6A 2TEPA 2W39A 4EN7B 4CEYA 1IPKA 1HRI3 4HK8A 3FMGA 5GJ6A 4S2HA 3S6PA 3B9IA 3VV1A 3POYA 4Y22B 1OD5A 3QD6A 3ELNA 1KQRA 2ZMKA 2ZS6B 4JGYC 4W6YA 4RSUA 1JBCA 1RMU2 2KA3A 2UU8A 4IEVA 1AR81 3OY8B 3M3QA 5KXBA 4XFHA 2NM1A 3JU9A 1ZRCA 4CEWC 1TME3 4Z07A 1BZWA 1LTEA 2IXHA 2JICA 2WS91 2PYTA 3O0WA 3NWKA 1Z0HA 5D8AB 2WKKA 4DRRA 1PGL1 4B7KA 1OOPB 4RL7A 4XFIA 1H30A 1AR71 1SFNA 1LECA 4ASMB 2ZACA 2GNBA 5GZEA 1F9KA 1WBFA 1KS5A 1PO21 2XWBB 4DB5A 2XLAA 3VDDB 4AVSA 1REDA 5I0UA 3WNXA 4IEWA 3HAGA 1OMIA 2VW1A 1BMV2 4IL7A 2YGLA 3WDXA 4CDUC 5C9AA 2D97A 4LBOA 1ENRA 4M00A 3CNAA 2YDEA 5J96B 1AR73 2XVKA 3V65A 1GYKA 2WNUA 2AUYA 1AX0A 4BPZA 1VBB3 1OPOA 2HWF3 2ZX3A 3ECQA 4Q29A 4XHXA 5H9QA 1SMVA 3PMSA 4MXVA 3ZFEA 4NR1A 2QNKA 3N7MA 1BBT3 4LBJA 4OHVA 3VKMA 1BQPA 2HWD1 2RJKA 3HBZA 1ZBE2 1YFUA 2HYKA 1JUIA 2VH9A 4QQHA 3AKSA 3R4SA 4IXLA 4CDWB 1LOEA 4RR3A 3BPZA 5J48A 4AFDA 2X5IC 4BZ4A 1VAVA 2A75A 4COVA 5CBLA 2MPFA 4D94A 1XE7A 2XBO1 1D2SA 1Z7S1 2PAEA 2VOKA 4XBQA 1ND2A 1R1ZA 4OUMA 4AHZA 1UIKA 5L19A 1PK6C 1U5IA 1ND3C 2R063 4HN0A 4EN6B 4FPOB 4IV1C 2Z69A 1R082 4AVCA 4B4RA 1K5MC 2DUQA 2WSUA 1H4GA 2DVGA 1VBE1 4H55A 3VZJA 2WLPA 4OI0A 5KHHA 4AFBA 4HVRA 3VKLA 4PQ9A 2WZPP 2BNOA 1DDLA 1BEV1 1FPN3 3SITA 4XTMA 4WVMB 2JENA 4AI2A 2DWRA 1RUI3 4AQ2A 3OCPA 2D6MA 1AR61 4WM7C 2JE9A 2P2KA 1OPMA 3ZYIB 1M4WA 4COZA 1LHVA 1JHNA 3N36A 1WMDA 3VBSB 3M3IA 2QE3A 1DGRA 1WLDA 3THTA 2CGOA 2XWJB 3A0NA 1LULA 2C1FA 2ZA9A 3E97A 4F8AA 2P17A 1BYHA 1QXPA 3WD5A 3E6BA 2IXIA 4TZDA 1N1TA 4URTA 4C90A 3MFAA 1HXS2 3AP6A 3O7OA 3JQXA 4GH4B 1NY71 4MUVA 3J8F2 2UY9A 4YW3A 4Q4V3 3CF6E 3EQEA 3ZN6A 4YG0A 5AC91 1SDWA 4I02A 5BXXA 1ZBA2 4AGRA 4C1WA 3ZSKA 4IEYA 2GNDA 1VBE2 1GLHA 3EJKA 5FAXA 3KQRA 1LODA 1FV3A 1QOSA 3PJQA 4M3CF 4N9IA 1XE8A 1RJ7A 1LHOA 3O12A 1C8M1 2ZHKA 5JR7B 2W52A 4HPKA 4YVSA 4LBKA 4H3WA 3RSJA 1RMU1 4RQPC 5FLIA 3ZXKA 4K3UA 4Q8KA 3AZZA 3ZXEA 1X50A 1Q3EA 1GNHA 4XFFA 3I59B 2I45A 1SBEA 1C57A 2ZX1A 3KZ4C 1EPZA 2AREA 3KGZA 3BODA 4QHBA 1NG0A 4JTOA 2A3XA 2WZR1 3ZFEB 4YG6A 4JC1A 3OD0A 4AGGA 2NLRA 1IPJA 1DLLA 3DV8A 1RUF1 4XF0A 2VQAA 4Y5Z0 3EHKA 3HIFA 4YYOA 2EXJA 4WV8A 5TSWA 3WOGA 3EO6A 4CDXC 3RDIA 2VOXA 3B5LB 3KS7A 4H7MA 4LBQA 2HWE1 1DHKB 3MIGA 1H0BA 2DF7A 1QXRA