1F5FA

Crystal structure of the n-terminal g-domain of shbg in complex with zinc
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
176
structure length
172
Chain Sequence
PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords SEX HORMONE-BINDING GLOBULIN
publication title Steroid-binding specificity of human sex hormone-binding globulin is influenced by occupancy of a zinc-binding site.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 172
sequence length 176
ec nomenclature
pdb deposition date 2000-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1f5fA00
1FYUA 1MR5A 2HYKA 2ZMNA 2KM2A 1CESA 4K1YA 1Z78A 3N7LA 4AVTA 2FHRA 4TZDA 1YYNA 5DZFA 1WD3A 4AGRA 3VUOA 1N1TA 1QU0A 1SLIA 2GNDA 4XMAA 4Y1ZA 5CB7A 3B3QE 1OQ1A 1GANA 4FPHA 1MACA 2P3KA 3ZSMA 1W6OA 2P2KA 3AJYA 3MW3A 3M1HA 3ZXEA 1W6NB 4XJUA 4LBQD 2VU9A 1LOFC 1UAIA 3ILNA 4GA9A 4GXLA 1APNA 2EXHA 3AXDA 5IK5A 1LOGA 1GZ9A 2WLQA 3SH5A 5JOYA 1DLLA 4HANA 4XXPA 3USUA 1CPNA 1H30A 4XTMA 1D2SA 1Q8VA 3AZWA 3FLRA 4FP3A 1WBFA 1DYKA 1IOAA 2VW0A 2Z42A 4Q27A 3WG2A 1Z0HA 2NM1A 2GMMA 1MZ6A 1SBEA 1CQ9A 4K1ZA 1V6OA 3MW2A 1CR7A 3A0NA 2ZAAA 2DYCA 4WV8A 3OY8B 2A5ZA 4Y20A 4YG0A 5GLVA 2ZGTA 1MS5A 1A3KA 3ZYPA 2A6VA 2ZMKA 2SLIA 3V0BA 4FPFA 1DGLA 2W08A 4FPOB 4FPYA 1G9DA 1DZQA 4FOVA 4FPLA 3JUUA 4XBQA 2GMEA 2DTWA 1AXYA 1LOAA 1QOTA 2D3RA 3M3QA 4BLJA 5DG1A 1G9BA 5T5JA 3N7JA 2ZHMA 3UJQA 3APBA 1GV9A 1C57A 1LOCA 1VLNA 5F9TA 2AENA 1DQ4A 4R9CA 3WDYA 3BIWE 1KRIA 1LEMA 2CWSA 2DV9A 3AP4A 4ISQA 4YZ3A 1DQ6A 2R0FA 1QKQA 1J1TA 2GN7A 4ZKTB 3L2YA 1MS4A 1G86A 3AP5A 3RS6A 5BYNA 2R16A 5DUVA 3FUOA 3UJOA 3NV2A 1GNZA 4LBMA 3OYWB 3V0AA 1GYKA 5GJ6A 4PQ9A 2D6MA 4Q26A 4XILA 5JDBA 1TEIA 5GALA 3I8TA 1ENSA 1C4RA 2ERFA 5GZEA 4DPNA 2OUHA 3ZXJA 5KXBA 1G9CA 5FRAA 1UX6A 3AP9A 4YLZA 1EPWA 3ZPYA 2PHXA 5JLVA 2G4IA 4BOWA 1FNZA 3AZXA 1SLLA 3B69A 2A6XA 3R05A 1OKQA 2ZGMA 3NV1A 3NV3A 1RINA 1WUVA 3N36A 2YXSA 2OUJA 4U2AA 4P9XA 1LHNA 3VKFC 1LENA 1W6QB 1AVBA 3KQRA 4YZ4A 3O0VA 1F9KA 1IS4A 1MS9A 4Y1XA 5JVVA 4XE9A 1XQNA 1DFQA 3B01A 3RSJA 4WVVA 1BJQA 3M3OA 2WKKA 2EF6A 5EYYA 3CNAA 4M3CA 4YZ1A 3N7KA 4YFZA 4AGVA 3AP7A 5H9PA 4FOQA 1W0OA 1WW6A 1GICA 2ARBA 2ENRA 4JRAA 5EWSA 2ZGSA 4YGBA 2CYFA 5DZEA 1CJPA 4YG6A 1S0IA 2A3XA 1N3QA 1SCSA 4FQZA 2CY6A 1QOSA 2UWBA 3DUIA 1AJOA 4MYEA 2AR6A 5KXCA 3WV6A 2GNMA 4BM8A 2DWRA 4WZFA 1S0CA 1GZCA 4YW5A 1KJRA 3ATGA 4YGCA 1BQPA 3AYCA 2OW4A 5EYXA 1A8DA 4I30A 2GALA 2XG3A 4D69A 4XIKA 3AYEA 4Y1YA 3FFZA 5DG2A 5T50A 4CZSA 3M2MA 4AVSA 3O0XA 4M3CF 2D43A 1AZDA 2YZ4A 3AK0A 1KDKA 1W6QA 3V64A 2CTVA 2EXJA 2PHUA 4FPGA 4Y1UA 2GDFA 3VKNA 1I3HA 1S0BA 3SNMA 2C5DA 4LBLA 1VALA 2GNBA 1FNYA 4XYXA 1DYPA 2SBAA 3ZSJA 1DBNA 2D44A 5KXEA 5JOZA 1JYCA 1LHWA 3D4KA 1AX0A 2ZGNA 3M3CA 1BZWA 1CIWA 2DURA 3WG3A 2NYYA 1HKDA 3AP6A 3C2UA 1ZA4A 5E89A 1BXHA 2ZGKA 2WT1A 2B7YA 2WQZC 1FV3A 4PBOA 1LTEA 2DVBA 1BKZA 4P14A 1FX5A 5H9QA 1HDKA 1S0JA 2VW2A 3AFKA 4FPKA 3TAYA 5IK4A 4ISRA 1QOOA 5JOWA 3PMEA 3OBTA 1AX1A 2PELA 4XHBA 1YIFA 3ILRA 3PVNA 3D6EA 1WLWA 5JMCA 1JW6A 1LOFA 1WW4A 2EXIA 3ILFA 4OZXA 3QCWA 5GZCA 5IT6A 3RQ0A 1LESA 3ZXFA 1SCRA 4XDQA 4F83A 4YZ2A 4Q2FA 1UL9A 5IUQA 1S0FA 1LGCA 1DQ1A 1WD4A 3U4XA 3WDTA 2NMNA 2VH9A 1V6MA 3WHUA 4YW1A 1SLCA 1G8WA 3R4UA 1V6KA 1C1LA 5CAZA 3HMYA 2R49A 1V6IA 4WVWA 1N3OA 3T1MA 4Q8LA 5DUUA 4TYSA 1LOEA 3N35A 4UW4A 4BMEA 1DQ2A 4UW3A 1GZWB 4R9BA 2LTNA 1QF3A 4XIOA 1WLDA 1SLBA 1LECA 1CN1A 1N47A 4YW2A 3VKMA 1AXKA 4BPZA 1WLCA 4BLIA 3SH3A 4FOYA 4FPJA 4XXAA 1JOJA 4DS0A 4LBQB 5F5QA 2NP0A 4XBNA 1W6NA 1UPSA 2DVDA 2DUQA 1GNHA 2A75A 1AJKA 1V00A 2JECA 2JKBA 1N1SA 5HCBA 4GKXA 2JDZA 4PF5A 1SFYA 3WUCA 1LGBA 1MVQA 4CTEA 2W68A 4GKYA 3POWA 4YFWA 2A6YA 2VXRA 5GLTA 3A0KA 2P37A 4GALA 5T5LA 2P3JA 3AZVA 2W52A 4U36A 1LGNA 1FAYA 3OY8A 3POYA 2ARXA 1JUIA 2ZGQA 3ZXLA 1DHKB 1LCLA 3TB0A 4CRQA 3H0OA 3RMXA 3W59A 4DFSA 1HLCA 2D6LX 5CNAA 3WDUA 5GLZA 1HQWA 2EIGA 3SITA 3LCPA 3T1LA 1QDCA 5EXOA 2E53A 3IPVB 1I1EA 4YW3A 1LHVA 4SLIA 4Y22B 4GWMA 2DVGA 3ENRA 3O5SA 3ASIA 2UWCA 4XZPA 3NWKA 2JE7A 3WLUA 2P34A 3VKOA 1AX2A 4LBQA 2AYHA 5HCAA 1IKPA 2I2SA 1OFSA 1VAMA 3AYDA 3BOPA 1LU2A 3POSA 4FOWA 1LHUA 2ZHNA 1N3PA 1MS1A 3RRDA 1MVEA 2DVFA 2DVAA 4DRVA 1LU1A 4JC1A 2A7AA 3B9CA 3OYWA 2D6PA 5GLUA 1PZ9A 1PZ8A 1RIRA 1QDOA 1AXZA 4W65A 2R0HA 3NV4A 4YGEA 5T55A 3BODA 4RA0A 1YO8A 2ZKNA 2YROA 1SBDA 2A6WA 4K21A 4NOTA 4YM2A 1YRZA 4FQ4A 4UW5A 5E88A 1JBCA 1GLHA 1Y7BA 4XHXA 2H0BA 1G9FA 3BTAA 1H9PA 1ZM1A 2PHRA 1UKGA 1ULGA 3W58A 2D7FA 2D6KA 1CPMA 1S1AA 1ULDA 4PBPA 1YXWA 5SV8A 3SISA 2EXKA 2WSVA 4XOGA 1O4YA 2NZ9A 1ULCA 2R1DA 2VUAA 4Y24A 2UWAA 4FPEA 3WOGA 2VW1A 5T5PA 2C9AA 5FREA 3ZYRA 5T52A 1G9AA 1GKBA 2AREA 2WJSA 4Y1VA 5CBLA 4ATFA 1GSLA 2ZACA 1LOBA 3WDVA 3OGGA 2ZGUA 1S0GA 2CL2A 5T54A 3VV1A 3A4UA 4LBNA 4P9YA 1YI7A 3DGTA 5GZDA 5DXDA 2OVUA 1O4ZA 3MW4A 4FPCA 3WVJA 3M3EA 1JN2P 1WBLA 1D0HA 3IKWA 4GWNA 1UZZA 1JHNA 1Q8PA 1F31A 4XBLA 1S0EA 1B09A 4Y26A 2GN3A 4K20A 1RITA 1ULFA 2BQPA 1W6PB 1R1ZA 1WW7A 2UURA 3RG0A 2Q5TA 2EALA 1MS0A 3JU9A 4XJ8A 1LHOA 4M01A 5T5OA 1QMJA 2DU0A 1U0AA 2FMDA 3WDXA 2DUOA 2D6OX 3IN9A 5AVAA 4FVVA 2P3IA 1FV2A 1LEDA 2ES3A 4DRRA 5L73A 2A3YA 4C1WA 3N7MA 3V0AB 3GNEA 1CONA 1F5FA 1ENRA 2E51A 4FP2A 4YM3A 2E7TA 1A78A 1GBGA 1ONAA 2UU8A 2TEPA 4ZXKA 5LK5A 2D6NA 3ZVXA 2AGSA 2ZZJA 5DUXA 2WT0A 5GM0A 2WSUA 1UN1A 3V65A 2V73A 3T2TA 1H9WA 1UZYA 2WNEA 3OJBA 1Q8SA 1IS5A 1DQ5A 4YGDA 3AXEA 3GALA 3FUQA 5H9SA 5IK7A 2JJ6A 1BYHA 4M00A 1WW5A 2DTYA 3WNXA 4Q1RA 1W6PA 3AYAA 4BMBA 1JYIA 3MPPG 3OPZA 5HCFA 2A3WA 5GZFA 1W0PA 2ZGOA 2AH2A 2NN8A 4YW4A 3WG4A 1LJ7A 4DQAA 2ZBJA 3IM0A 5GZGA 4XJ9A 4HL0A 4M3CB 2PHWA 3WCSA 1NXD1 4AGGA 4YZ5A 4IQPA 2ZGRA 1W6MB 5DUWA 1QGLA 4Z8BA 5E8AA 4PCRA 1URXA 1ENQA 1Q8QA 3O12A 3AZZA 3R4SA 3HR9A 4R9DA 1Q8OA 3AZYA 3PJQA 5JOXA 1GZWA 3VKLA 2E7QA 3FLTA 3SLIA 1PZ7A 2ZGLA 4XJZA 2ZGPA 2YY1A 1Q56A 1AF9A 1S0DA 1QNYA 1SLTA 1LULA 1N1YA 5KXDA 2D3SA 1V6JA 4XTPA 5DZGA 2CNAA 1VIWB 1MS8A 4BQ1A 1WCSA 2D3PA 2WT2A 2A70A 4XJWA 4LBOA 1SACA 1KQRA 2VY0A 4KBBA 4LBKA 4R9AA 4RL7A 5CA6A 3KM5A 3SH4A 4AVVA 3UK9A 4AYUA 2A71A 1JXNA 5GLWA 3O0WA 2YMZA 2NMOA 4Q8KA 3UL2A 1C1FA 1NLSA 2ZABA 3LSDA 4NO4A 2XB6C 3I4IA 1UMZA 1KITA 1MS3A 3N3HA 2AUYA 4UW6A 1V6LA 4XMIA 1FATA 1MZ5A 1LODA 3WZ1A 1KJLA 4L8QA 2V5YA 1N1VA 2ZMLA 3D5OA 1W6MA 3AX4A 1DIWA 4ITCA 4H55A 4AWDA 1W6OB 1DQ0A 2ZHLA 3PVEA 3WUDA 1VAVA 3B00A 2R1BA 1ULEA 2YV8A 3WDWA 3WHTA 3AJZA 2DU1A 3Q9OA 2GNTA 1X50A 2EAKA 2PHFA 3IPVA 1KDMA 1CVNA 2E6VA 4Q1PA 4Y22A 3HN1A 2JE9A 3OBRA 4LBJA 4YG3A 2LALA 3RMYA 3ZXKA 1IS3A 1QNWA 3FLPA 4P9WA 5IK8A 4JCKA 3PVOA 3USUB 3ZSKA 4ASMB 2A6ZA 4XJAA 4M3CE 2CWMA 1IS6A 3WG1A 3LSEA 3ZSLA 1SLAA 3IMNA 3INAA 1G7YA 2DUPA 2ZHKA 3MEPA 1HQLA 3WCRA 2RHPA 2PHTA 4Y20B 4ATEA 3FBYA 4YM0A 4C1XA 1SBFA 3V0BB 1IKQA 3QLQA 5H9RA 1V6NA 2JD4A 2W39A 2GMPA 4YM1A 2ZA9A
chains in the Genus database with same CATH superfamily
1MR5A 2RS11 5A3WA 1Z78A 2JB8A 4EJRA 4AVTA 4TZDA 2FHRA 1HRI2 5F3IA 4RGKA 4Y1ZA 1ENXA 2GNDA 3N9NA 4XF1A 1OQ1A 5FZDA 1JI6A 3T0DA 2WZEA 2P2KA 5C5UA 4IEVA 2P5BA 1GP5A 3K48A 2Z2SB 4MX3A 4XJUA 3PLQA 1MPXA 2VU9A 2XL9A 1LOFC 4AI2A 1GP6A 3M3IA 4DIQA 4Q0UA 3LOIA 3LEMA 2VBPA 4Q4W3 3ZKUA 4L11A 4BQ5A 2GH2A 2HKXA 3KB5A 3KSCA 1DLLA 5FPUA 1GOFA 2WYFA 1CPNA 1H30A 4QB1A 1D2SA 4Q27A 2XLGA 1VBB1 2VW0A 1IGOA 1W8FA 3E5UA 1Z0HA 3X29B 3MDPA 4E4SA 1EPZA 5IW0A 1ZYBA 1SBEA 1CQ9A 2QQMA 4K1ZA 5JXGA 1CR7A 2QUOA 2ZAAA 3GZUC 3LDRA 1NA1C 1R091 3OY8B 2A5ZA 4Y20A 4YG0A 1W39A 3I3DA 4Q4V2 2XJQA 4HPKB 3FFQA 3ZYPA 5A32B 2SLIA 5HV4A 5A6YA 1OOPC 4FFIA 1QWRA 4HVOA 1VBE2 1ZX5A 3KCYA 1OLME 1AXYA 2D3RA 3GYDA 5DG1A 1QJU1 4SBVA 5T5JA 4Q4X1 4NE9A 5FY8A 3APBA 1FPN3 5FPAA 1XNDA 4RD7A 3CIHA 4R9CA 4GH4B 5JZGC 3VBSC 1PO11 1J1TA 1GOHA 1SPPB 1TMF2 1C8M1 2KXLA 4TSVA 3ZFFB 3L2YA 4OQ9A 3AP5A 3J26N 4PIYA 2P1BA 2DFBA 4JGYA 5BYNA 4FTEA 4CDUC 1WMFA 3DYMA 1XE7A 1NQDA 3S5AA 2J1UA 3EXUA 1YFUA 4LBMA 4QGNA 5FPZA 1U5IA 1JZ8A 3KQ4B 3V0AA 2DFCA 1HB4A 2Z69A 5FXWA 3THDA 5JDBA 1ZBA3 3TOJA 1X9TA 1JU3A 3PUAA 2VQTA 3PIJA 4AEDA 4L92A 2R7EB 4BOWA 1HJGA 2QQKA 3QD6A 2RR13 1D4M1 5ANQA 1ZRRA 3OUIA 1D4VB 1H2NA 4XFCA 1RUG1 4U2AA 1UNBA 4QGLA 3BPSA 4BA6A 4CEWB 3O0VA 1ZZ8A 2QBXA 4GD4A 1IS4A 2GP5A 5FMCA 1UIJA 3VB9A 2I07B 2WWUA 2XR4A 4KL1A 2VVEA 5CKNA 4CPBD 4WVVA 4S2HA 3M3OA 4BYYA 4ZS2A 1OA4A 1UY0A 3DPRB 4QU1A 4Y5SA 4BJ0A 1KFXL 4AGVA 1AYN1 5A3OA 1W0OA 4OUSA 2YU1A 1QY4A 1WW6A 2ZCWA 1JMUB 1GICA 1KEXA 2ARBA 4Q0VA 4CCCA 5J7MA 2YB7A 3HEIA 4IE6A 1CJPA 1LAJA 4OMDA 5ACA2 4OI2A 2VOVA 2YBPA 4UFKA 1NAEA 3LGRA 4LIVA 2YGMA 2GNMA 2XMLA 3JZVA 4BM8A 3GBWA 3VBOA 5CG9A 3CO2A 1JUHA 1BQPA 1W2AX 3H1WA 1W2TA 3VBHC 1X9PA 2OW4A 4IEWA 5A1AA 5FZAA 3PMSA 3GZAA 4D69A 5T50A 1Y3TA 5DG2A 1VAKA 2B45X 2FBEA 3AB0A 2R071 2FDGA 3KF3A 3VN4A 3B02A 3CBNA 4QM8A 1KDKA 3J7MA 3K3NA 5JIUA 2CTVA 1RUH3 1W8WA 3CF6E 5FP9A 3SKVA 4I0BA 1S0BA 4CE8A 2RVAA 3ZFGB 3ES1A 3BKZA 2FD8A 4D7YA 1NA1B 4QX2A 5EHDA 4XEZA 1DBNA 4MGZE 3ZO0B 2W1SA 2GC0A 5FDBA 5LBEA 1LHWA 5JOZA 5LA9A 1CIWA 3OUJA 1H8TC 1OOPB 2DURA 5K0UC 3C2UA 3BU0A 2W1WA 5E89A 1UOGA 3ES4A 4QGMA 2ZGKA 2WT1A 1R092 4PJYA 1X7NA 1REDA 2B7YA 1BEV3 2WQZC 2DVBA 2ADDA 2QNKA 3JD71 1TME3 3RNSA 1FMD1 1FX5A 1IPSA 2RM22 2VTXJ 1HDKA 3HD8B 4N43C 2ZAHA 4R4XA 5FXXA 5L7OA 4RQPA 5JOWA 1DGRN 3SMHA 1AX1A 4N9IA 5JZGB 5LRSA 2IWGB 1T6BX 3FC0A 3VBSB 3D6EA 3R0RA 1WLWA 4Q4X2 3SCFA 5BY5A 2AZ5A 4QX5A 5GZCA 2EXIA 4CDUB 4G3YC 3PL0A 3RQ0A 4KU8A 1CAUB 3AMHA 4F83A 1KFUL 2VULA 3GZEA 4YZ2A 2RDSA 3EO6A 1PO12 1AYM3 3N9MA 5FK7A 5IUQA 1C8M2 1S0FA 3U78A 1LGCA 4K6BA 1IQAA 4H7MA 3U4XA 3WDTA 2WYSA 3ZX7A 2VH9A 4MLOA 3WHUA 4XUQA 1AR63 1V6KA 5CAZA 2R49A 1C8NA 1V6IA 3I2HA 3VDAA 3GCXA 2B5HA 3D3AA 4Q8LA 4QQ2A 5DUUA 4RHV1 4B4QA 4BDVB 4BMEA 4E9KA 2HWC3 2ZOEB 4R9BA 1RUI1 1F4HA 5HXMA 4XIOA 1RUD1 1WLDA 4YWAA 1LECA 4BPZA 4ES8A 4YW2A 5IVVA 3QOPA 4FOYA 2GC1A 2R30A 2DBIA 1I5ZA 4IEXA 3LIGA 1PNFA 1QJY1 4DS0A 5F5QA 4ET7A 1J1LA 3MPBA 1R1A1 5IAVA 2NP0A 1RGSA 5CADA 4MOAA 1WCKA 3AKRA 1D4M2 4L0PA 1GNHA 3W9AA 2A75A 1V00A 1RMU1 3NO8A 1N1SA 1RUG2 4K40A 1JZ6A 5C8CB 4GQ7A 3WUCA 1SFYA 2HWE2 1OSGA 4W6XA 4YFWA 5FYCA 5LATA 2AEYA 1W8NA 3P6BA 1W2NA 3D8CA 3DKQA 3MIEA 4I02A 2XDVA 1ZZCA 2W87A 4HKOA 1J59A 1QQP3 2P3JA 2EA7A 4K8RB 4X8NA 3OY8A 5FLIA 1W9WA 1RVF1 1AYN2 1DHKB 1LCLA 3CDZB 3TB0A 5A32A 2HWB1 3W59A 5B2GB 2VO5A 4BQYA 4CDXC 4DFSA 3OTFA 4CP2A 3VBHB 2WA3A 4KBZA 2JDUA 5FTTC 4AHZA 5FFOC 4IE0A 4P08A 1QJEA 1QDCA 1ZVFA 1CAVB 5F5AA 3GJBA 1L7LA 1UOFA 4H3WA 1ZZBA 1RUC3 3ENRA 2HEVF 3O5SA 3BU7A 3THPA 2BBVA 3RYKA 2W5FA 4TXWA 3AMNA 1PHMA 3M4FA 4LNVA 2R041 4BQWA 2VMIA 1IKPA 3ZFFA 2I2SA 3BOPA 3POSA 5CFCC 1MQTC 5F8PA 1LNSA 4FOWA 1LHUA 4YW7A 5ISLA 2R072 2OX0A 1QJZA 4V2VA 4DRVA 4PI2A 3IBMA 4I3PA 4A3XA 1PZ8A 3H8XA 1HXS2 1H1IA 1QDOA 1H8TB 1AXZA 2WA4A 4LK7A 1OVPA 5T55A 3SCGA 4QXBA 2Y6LA 1GU3A 4LA3A 4D6RA 1F35A 2OZ6A 4BQ2A 4K21A 1DCSA 3K4DA 1YRZA 4YM2A 4N43B 3TAYA 5FYMA 4FAHA 1A6CA 2WS93 3WQ7A 1Y7BA 4XHXA 1J3PA 2H0BA 3JCIA 5LEJA 3POEA 3RZKA 4IEZA 3JD72 1CIYA 4F8AA 4F7ZA 5FYHA 1FMD2 2XOMA 2G19A 4MGSA 4CEWA 1LB2A 4QDQA 4IGPA 1UOJA 3CHXA 1VBE3 3T08A 4ZU7A 3TN92 2J1SA 1VE0A 2R1DA 2VUAA 3N4MA 2J7MA 1FPN1 1QXPA 1VBC2 4DXTA 2C9AA 5FREA 1G9AA 4AEMA 3HAGA 1GKBA 2AREA 3KVBA 5D8AC 3T0AA 2IXLA 5CBLA 2OT7A 4ATFA 4ES9A 2JG8A 1TMF3 5IHRA 1UZWA 1GQGA 1OQDA 1EAH2 3NKTA 5LW9A 1PMJX 4Y5Z0 3F95A 1ZRIA 4JTNA 5FPBA 5LEKA 1O4ZA 2Y33A 3M3EA 3OD0A 4LT5A 2OS2A 1JN2P 4RHV2 5J48A 1Q8PA 3T4VA 1ZBA1 2GN3A 5ABJB 4K20A 3H8RA 2B9UA 1R1ZA 1K5JA 1RUD2 5DAPA 4FFFA 2BNOA 3A22A 4HXCA 2PLV3 1LHOA 4M01A 1QMJA 4KG0A 3C7EA 3QH7A 2RR11 1VRH2 4NHMA 2DUOA 1R1A2 3TBDA 3BYWA 1W99A 2VCMA 5L9VA 2JDAA 3ZIXA 2C4XA 4OLLA 4BIFA 2JENA 1RMU2 2ES3A 5DQ0A 1OT5A 5L73A 1FT9A 3K4ZA 2WO7A 3ZFGA 4IUGA 1NA1A 4YM3A 1M06G 5FYZA 4DUWA 1GBGA 1A78A 3J8F2 4IEOA 2Q8DA 4CDXB 3GBFA 2VCCA 2YC4A 1OOPA 2OPKA 2D6NA 1GWMA 2ZZJA 2W92A 5GM0A 1RVF2 1UY4A 1VR3A 1UZYA 2WFF1 3OJBA 4NHYA 1YI9A 3USSA 4CCEA 3KV9A 1GFF2 4DUXA 1Q3EA 1K12A 1NKGA 5A6ZA 4Z82A 1K5MA 4LK6A 2BDRA 3FL7A 1ASJ3 2B42B 3B5LB 1WW5A 2DTYA 2EAAA 4AOCA 4AI9A 1W6PA 1JYIA 4XQDA 3OPZA 2O8OA 3VL9A 4S2GA 4JGYC 3DYPA 4WM7A 1S4CA 4UAPA 5JI9A 2R042 2BWCA 2X10A 2BGOA 2VMEA 4M3CB 3WCSA 3Q8FA 3WNNA 4YZ5A 4IQPA 4XFGA 3ZFEA 5KWRA 5AFBA 3LAGA 1FOD2 4JHZA 3ZYBA 3HQRA 1RUH1 4AEDC 1PGL1 1H8VA 4GJZA 2QQIA 4R9DA 1Q8OA 3PJQA 3MFAA 2WZR3 2ZGLA 4M4RA 3RVHA 3AFGA 2YY1A 4KWJA 3WNKA 1BK1A 1QNYA 4COYA 2WQ8A 2W1QA 2P17A 4LA2A 4P5YA 2YC2A 4E4HA 1XSQA 4EN7B 1OA2A 4L97A 4JZRA 1BEV1 4R9AA 3O7OA 4W6WA 1DF0A 1TME1 4E2QA 3NNFA 1HN0A 2PQSA 5J36A 2A71A 2RM23 2UY8A 2VZQA 3LA7A 3MV11 4CA9A 5C8CA 3O0WA 3ME2A 5D8AB 3KHBA 2AC1A 1OI6A 4Q8KA 2ZABA 2XB6C 2RV9A 2E63A 4PDWC 2C6SA 1UMZA 1KITA 2RE9A 2ZPXA 3IAPA 3HWJA 4UW6A 1NCRC 4NRQA 4XMIA 3BTZA 4FFHA 5JR7B 2CSGA 1RYYA 1Y9QA 2BOIA 3DN7A 1O5UA 4JKLA 4PT6A 1AYM1 1O3SA 3D5OA 4GULA 2ET7A 3BOWA 2W94A 2DCJA 1DIWA 1H4GA 2WABA 3PVEA 1VAVA 4AXOA 4S2FA 4RFT0 2YV8A 1JTZX 3J7NA 4KWUA 2DU1A 4O65A 2GNTA 5FYIA 1X50A 4UF0B 3CQOA 5L9RA 3SKJE 3U0ZA 1ZREA 3GBGA 1LR5A 4JDOA 3VD9A 2JE9A 4KWLA 1OBNA 4Y4RA 4JCKA 1DZTA 3VHOA 4M3CE 4IE7A 3E5QA 1YC61 2RR12 3WG1A 3LSEA 2WN3A 1SLAA 3IDBB 3IMNA 1UZVA 3H8UA 3CLPA 2VUJA 3LQCA 3WCRA 4Y20B 3WF4A 5HPOA 3UGGA 5JCTA 4YM0A 1J58A 3EQEA 4YSFA 2VM9A 5LASA 3GZTB 4BH9A 5LBBA 5HI0A 2LRPA 2HWE3 3QLQA 4C0HA 1V6NA 4CP9A 3I97A 4QD2A 3URFA 1FYUA 4KU7A 4B4PA 3ZN6A 1CESA 4K1YA 3PUHA 4Y33A 2FDIA 1ZZ7A 4BXSV 2ZEXA 4XABA 1W2OA 3WNMA 2V72A 4KGQA 4AGRA 5L7OC 3VUOA 1YJKA 2W2IA 4O7XA 1QQP1 4RQPC 1IPKA 3B3QE 4XMAA 4XVHA 1TE1B 4FPHA 3ZSMA 4IV3A 3AJYA 5FZLA 1W6NB 2WFF2 1T6GC 4G9SB 4LBQD 3P3PA 4JGYB 2IXIA 1VMHA 4CDQA 3ZKYA 1BCXA 4EWAA 1O6UA 3ECQA 4LOSA 3KHCA 3OUHA 3POGA 4YPJA 4KWKA 4A3ZA 1RUC1 5JOYA 2PQQA 4HANA 2WR9A 3BTXA 2D5FA 3OGJA 1Q8VA 4FP3A 1DYKA 2Z42A 3WG2A 4AEDB 1WCQA 2WUHA 1MZ6A 5F3CA 2YPJA 4F3JA 4B8EA 4QM9A 4N7IA 5A6XA 2DYCA 1V70A 4WV8A 3U4SA 4AFCA 5GLVA 2ZGTA 2VUDA 1A3KA 3CJIA 2A6VA 1F8VA 1OUSA 4BK4A 4FPFA 1PGL2 1G9DA 4Q0PA 1HXS3 1Y9GA 4XBQA 3AMMA 2VBBA 5ABJA 1T2XA 1NZCA 1QJFA 4M0HA 3RYRA 5IVBA 1C57A 4UXAA 2AENA 1GMMA 2QQVA 2WNUC 3BIWE 4HBNA 4OHVA 1LEMA 4YZ3A 3O1RA 1NOVA 2WS91 2EICA 3DF0A 4W50A 2R0FA 3KVAA 2GN7A 1XXNA 4XF4A 5FYTA 5I91A 3DECA 3RS6A 4PDWB 4MUVA 2R16A 1W9FA 5DUVA 1TME2 3FUOA 2XJVA 1HB1A 3KCCA 1NCRB 3OYWB 4HSLA 1GYKA 4W6YA 5GJ6A 4PQ9A 5J37A 2BGCA 4Q26A 2CV6A 1TEIA 3TN93 3TYJA 1IG0A 2XVGA 5FYSA 3ZMOA 2ERFA 2WLPA 4JTOA 1VBC3 5K9YA 1G9CA 2JDYA 4YLZA 4AF9A 5F5CA 2IXKA 1REFA 2D40A 2QQWA 4BB3A 4E27A 2PHXA 5KBFA 2VTFA 1TMF1 3AZXA 3B69A 1AYM2 1OKQA 1EAH3 1YQ2A 4ZU5A 2WAAA 1QXJA 2WZ8A 1REEA 4XAEA 2YXSA 4P9JA 4HK9A 1LENA 4YZ4A 5FV3A 4QKNA 5BXXA 2EIBA 3ZFFC 3I3MA 4Y1XA 5JVVA 5FY7A 1IQDC 3EMRA 1H1MA 4CXYA 1DFQA 3DEMA 3CZUA 3ACGA 4QB6A 3RSJA 4NWVA 4OHXA 1BJQA 4A41A 5EYYA 1RJ8A 2PLV1 3CNAA 2XUEA 4AK3A 5FCCA 4ORFA 3DKWA 2ZKLA 4M3CA 3TNQA 1O3TA 3N7KA 1VRH3 3MI8A 2E33A 2HWD3 2VCAA 4JRAA 4PLNA 1GNYA 1RMU3 5DZEA 5IFPA 1S0IA 2MEV3 5L7OB 1SEFA 2CY6A 3ZR6A 3RZJA 3RZHA 1YLLA 2VTXA 4QT6A 3UKVA 1KJRA 4QX0A 2VPVA 3WT3A 3RZMA 3J8F3 1X82A 2LM3A 2GALA 4QQHA 4E4DX 4CEWC 2X5IB 2XJPA 2G9GA 5F37A 1QQP2 3GF6A 1XRUA 3HQXA 2OXBA 5FZCA 5DAXA 3H8OA 4HK8A 3MUY1 5FWJA 5FP8A 2BEOA 4M3CF 4QDRA 5EV7A 4GZ9A 2IUWA 5IVEA 2OQ6A 3AK0A 1OFNA 2GU9A 5D8AA 3U11A 2EXJA 2B39A 2PHUA 1ASJ1 2GDFA 4FPGA 4JKMA 4WBBA 4Y1UA 2JG8C 1EUTA 2C5DA 4A6SA 1J3RA 2J42A 2RDNA 1SHWB 1FNYA 1RUC2 1V9U2 4XYXA 5C3RA 1DYPA 3FHAA 3O1TA 3WP4A 2H6BA 3VZOA 2D44A 2PA7A 1QIQA 3B9IA 4XFAA 5E6HA 2DBNA 1JYCA 5LWBA 1K45A 2ZGNA 3M3CA 4EZ4A 1TNFA 1BZWA 2R043 5AFEA 2NYYA 2IFRA 4EQVA 5FK8A 1ZA4A 4META 3LPFA 4NROA 4B3NA 1UD1A 2RS53 1U12A 1UPIA 3ORJA 2LS6A 4HT1T 4MH0E 4PBOA 5JXJA 3N9OA 1YWKA 1FOD3 5H9QA 1S0JA 5IK4A 1GP4A 4UF0A 1EY2A 2WNUB 3N9QA 4LO8A 4XC9A 2PELA 4XHBA 2WZR1 4M4PA 4A7ZA 1YIFA 3ILRA 3PVNA 4Q29A 4EZHA 3EBRA 2HH9A 5JMCA 1JW6A 3ILFA 1D0GA 1LESA 2A1XA 2F17A 3BN6A 2NQYA 2WWSA 3FHIB 2WS92 2NPIA 1UL9A 3ZFGC 5FLJA 4TN7A 3JQXA 2WBKA 3T2PA 5T3NA 3EYPA 5F32A 2YUEA 4YRDA 4YW1A 1KS5A 2RM21 5JI7A 3R4UA 4X6QB 2QQPA 1C1LA 3POBA 4IGOA 4KQ7A 2LW8A 4I09A 3O14A 2TBVA 4COWA 4TYSA 3ZDVA 1AR92 3W20A 1SDDB 2XVLA 1DQ2A 2BPA2 2OIIA 3LZZA 2RS33 5JXHA 2LTNA 3UGHA 1SLBA 5K7PA 1CN1A 3VKMA 4LOTA 5FXVA 4AW7A 1JH5A 1WLCA 4BLIA 4XXAA 3T4HB 1JOJA 4YVSA 2G1MA 3ZMNA 1K5MC 3D0SA 3GJAA 2R32A 2HYXA 4B7EA 1W6NA 3NJYA 2DVDA 1W8TA 2DUQA 3OBZA 1ST8A 4HVQA 1NX9A 4QPGA 3AVSA 4WM7C 4PF5A 1OURA 1LGBA 3KV5A 2Z79A 2W68A 4GKYA 2JDMA 4I3GA 2WNVB 3ACIA 3WEZA 5LB6A 5F3GA 3ZFEC 2IFWA 2VXRA 5FMBA 2P37A 4AVCA 2PLV2 2VZRA 4MGQA 4MHRA 2CHHA 2FMYA 4QX3A 4U36A 4JRLA 1NLRA 4D6QA 2ARXA 1JUIA 1W9YA 2ZGQA 3IWZA 5FY0A 4O61A 3RMXA 1I5PA 1UW8A 1AR82 4XURA 1YQCA 3WDUA 3P1IA 5LY1A 1HQWA 2HWE1 3E97A 3LCPA 3SITA 3TRSB 2E53A 3LPGA 4PIZA 1I1EA 2PAEA 4GMP0 4GWMA 4EWEA 1JOBA 2PMWB 5C3OA 3ASIA 3U10A 2UWCA 3U75A 4CCDA 3NWKA 1BVVA 1UMIA 4MZUA 1LRHA 5C8CC 1JZ2A 5FKBA 1VRBA 4RS5C 4LBQA 3IB3A 4Z2AA 2L9LA 4AI3A 1OFSA 3AYDA 2JG8B 4PDWA 4CCMA 1RTVA 3IT8A 3RRDA 1MVEA 2DVFA 2WFF3 5EIYB 1OKOA 1NCRA 4JC1A 2A7AA 3B9CA 1XYOA 3OYWA 2QE3A 2QQJA 1JOPA 1NCQA 2WO1A 5GLUA 1ASJ2 1RIRA 3POFA 5IVJA 1QXRA 3NKGA 1JYVA 3MYXA 4IW3A 4RA0A 4LLFA 5FUNA 2ETEA 1YO8A 1DDLA 2YPDA 4M0NA 1WGPA 4B1MA 1UU5A 4FQ4A 4KMQA 1HV1A 1JBCA 4IXLA 2BFUS 3WP3A 1WLTA 4LITA 3RJRA 1H9PA 4QPYA 1UY1A 1UKGA 1ULGA 1YQ8A 2VMFA 2D6KA 4QX1A 2KR2A 2ZXQA 1ULDA 2VMDA 3H3UA 1HXS1 3I2DA 1YXWA 3LA2A 4XF0A 4EROA 1RUNA 3OG2A 5C8WA 1AR72 1O4YA 2WZR2 5FLHA 1ULCA 4Y24A 3M70A 2UWAA 2VOKA 3DXUA 2WIIB 1QEXA 5A70A 3AKSA 3PUQA 2XH6A 3NMBA 4XAAA 4Y1VA 3VZMA 1NZIA 4AE2A 2K2SA 1O3RA 1WA4A 5FJHA 1JZ3A 5T54A 3VV1A 2BP6A 5FUPA 2W9XA 3U1XA 2OVUA 1PO22 3MW4A 3DL3A 4FPCA 5FMDA 3BTYA 4GWNA 3IKWA 5FPVA 2CGNA 1K5MB 1UZZA 1VPHA 1PVXA 3NNJA 4K8FA 4L99A 1S0EA 4IV3C 3HBKA 5F2SA 3TN91 4XFFA 1H2MA 2O8QA 3VBUA 1RITA 4AI0A 4V1PA 2GZWA 1W6PB 1VBC1 3ELNA 2ARCA 1PM7A 5KHHA 2X5IA 1UYXA 4YVWA 2Q30A 4FXKB 1MS0A 4CDQC 4WM7B 5FYBA 1L3JA 3AMQA 2DU0A 1DYOA 2FMDA 4XZUG 1EAH1 1IHMA 3B94A 3MBWA 5I0SA 3IN9A 5EJ1B 5FIXA 3ZFEB 3VBRB 3UGFA 3LDBA 5LBCA 1FV2A 1COV1 2A3YA 4NPMA 4HVRA 4IESA 1XE8A 3ST7A 4PF1A 1YNAA 2KD7A 2XJUA 3CJIC 4XCBA 5LK5A 1VJ2A 2AGSA 5DUXA 2WT0A 1VRH1 1PVC3 5ABJC 2JICA 1MZFA 1HQNA 2V73A 1P8JA 2HWD1 2WNEA 4CSWA 1BHGA 2GAUA 2ZJCA 1OQEA 2IXHA 4N53A 4O9EA 4I01A 4YGDA 2CAUA 2WNUA 3AXEA 4UBGA 2MEV1 4OULA 4RS5B 3PJYA 5IWFA 4A7KA 3HPNA 5FZGA 1W3VA 4AQ6A 4COZA 3R6SA 2MNGA 3AYAA 5K8SA 3GDBA 4OI4A 2VOTA 3EB7A 5I93A 2WN2A 2GH8A 3C7FA 3J8F1 1W2UA 1W0PA 3R4DB 5D1IA 2JEMA 4QHOA 2AH2A 3WD5A 3ZOIA 4DZGA 3LKJA 4DQAA 5HV0A 2ZBJA 4AGGA 5DAVA 3ZN4A 5J96B 3FBMA 3BI3A 2D97A 5FZHA 5E8AA 4MV2A 2QQOA 1URXA 1GQPA 4DXRA 4TLGA 3AZZA 4XUPA 3C8XA 5IAXA 2CGPA 5DN2A 4MXWB 5FZKA 1YQ5A 5LCWL 2E7QA 2ZX3A 1ZBE3 2Y0IA 1O8SA 1Z7S3 1C5HA 3HIFA 3OEAA 4MGYE 2BZDA 1V9U3 4GMP3 2BU9A 1G6NA 4MVTA 1AF9A 4X8PA 3K3OA 3OD4A 1UYPA 2X29A 1F5JA 4UI9L 4YYOA 2D3SA 2J22A 3FWEA 2CNAA 3HOBA 3OOXA 2BFUL 4BQ1A 4AVAA 2ZX1A 3ALQA 4QPWA 3BUCA 4XJWA 2RS51 1SACA 1NE4A 5JSPA 1WMEA 4LBKA 3H1YA 1PM4A 4RL7A 2Y26A 3UK9A 1FOD1 4AYUA 1JXNA 1U5ZA 3H7YA 3VBFA 4NIAA 3I7DA 1PIV3 1YJLA 3MIDA 3PURA 4NHXA 4IE4A 1NLSA 1I9RA 4NO4A 2WNVA 3RDIA 3SEEA 4CP9B 4MXVA 3ABZA 1UZ0A 3ZN6B 2VUCA 2VXJA 2Q0AA 3I4IA 3ZSJA 5HBAA 1W03A 1TQ5A 1FATA 4IEQA 1HIXA 3UETA 1K42A 2F4LA 4CU7A 1N1VA 2ZMLA 1DG6A 1W6MA 2JDPA 3CU7A 2RDRA 2XJSA 2YHJA 4IV3B 3WUDA 2ZHLA 1O5LA 5LRRA 5FQ0A 2VGDA 1NT0A 1OF3A 5A80A 5LZ6A 3WDWA 2VCBA 4CDQB 4DNYA 2Y34A 1AR93 1KDMA 5F2WA 3OBRA 5AVPA 2RS31 3C7GA 1QNWA 4LKFA 1H0BA 3Q8CA 4P5HA 2VOXA 4QQOA 3LF7A 2Q8CA 2A6ZA 4XJAA 2XVKA 2CWMA 3E5XA 3HT2A 3O1PA 1IS6A 1Y43B 1ZZ6A 4XQWA 4K9SA 1TZOA 1POV0 4DY5A 2DCZA 2F6BA 3ACFA 3MEPA 1RUJ3 4K3UA 4NWWA 4I0WB 3FBYA 3CJIB 4IDZA 1GZTA 1F15A 2B46X 4LR4A 4P9IA 1COV2 5KC6A 3H50A 1UOBA 4NHKA 4GIQA 5EQUA 4BK5A 2VVFA 4YM1A 4UBHA 2RJ2A 2ZA9A 3PVBB 5I0DA 3KD4A 5D2AA 1YYNA 5L36A 1WD3A 3IDAA 5F6LB 1N1TA 1SLIA 1XSRA 4URAA 3BALA 1DP0A 1MACA 2P3KA 3MW3A 1W04A 5EJ3A 3ZXEA 2JXAA 2VZ3A 4JV4A 2HWD2 4NIIA 4URTA 2XL7A 1J84A 1AR83 3KCXA 1UAIA 3ILNA 4GA9A 3I2OA 4CPBA 1APNA 2MEV2 5JR2A 2EXHA 3C7OA 3AXDA 5IK5A 3MZHA 1FXZA 3E6CC 4LE4A 2WLQA 1UU6A 1UQXA 3JBG3 4AI8A 3ZYHA 5A3MA 3FLRA 1WBFA 1ZRCA 3AL5A 5F6KA 1STMA 4FXGB 2GMMA 3LWCA 5J98B 2XHNA 3Q8AA 4LHKA 1CGPA 4R4ZA 2ID4A 3C3VA 1XE0A 5JXIA 1RUE3 1SG3A 3UV9A 1MS5A 5C3SA 3IMMA 4ZXEA 3V0BA 4XFBA 1DGLA 3TNPB 4FPYA 4YVSC 4JGZA 5LA1A 4XQ4A 2FDFA 2ATFA 2HWF3 2DTWA 1LOAA 4BLJA 2E31A 3GM8A 3N7JA 2JG9A 5FZOA 2XQRA 3OGRA 1GV9A 1RC6A 3CEWA 3S6PA 1LOCA 3T0BA 3T2QA 4CCNA 5F9TA 3WDYA 4TWTA 3ZN5A 4CCOA 4QPGC 1KRIA 2DCYA 2DV9A 4DXSA 5I0TA 1DQ6A 2UYAA 1HW5A 1QKQA 5A7PA 4ZKTB 3LFIA 1MS4A 1G86A 2RS52 3ETPA 3MF6A 4KNCA 4XCAA 3VD5A 3VBRA 1WKYA 4LO7A 4QXHA 3NV2A 1ALYA 2FZ1A 1GNZA 5BPXA 4B4RA 3O1MA 4LJHA 5A1LA 2WL1A 4LORA 4D7TA 2D6MA 1AR73 5GALA 1X33A 3I8TA 1ENSA 1C4RA 3MLLA 3OGVA 2JE8A 1UY2A 4IGQA 4BQ4A 4DPNA 1OMIA 5FRAA 3SC7X 5KXBA 3NW4A 4YARA 4AEJA 1KGYA 1L7QA 1EPWA 4QKFA 5A1FA 3ZPYA 4B1LA 3VD3A 1D7PM 2BRTA 4CDWA 4LO5B 2X05A 4IEUA 2A6XA 1KS4A 2ZGMA 3NV1A 3POIA 3R05A 5FZIA 3N9LA 4JVAA 5F1RA 5C6CA 2ORZA 1RINA 1HX6A 1WUVA 3L2HA 3OB8A 1PO23 1XPWA 2BYVE 2ZX0A 4LHSA 1LHNA 4RS5A 3NJVA 4NRMA 3K51A 4Q0SA 1F9KA 3J7HA 1ZRFA 1E5IA 2VZOA 1XQNA 2RS32 3T30A 3B01A 5FOJB 2WWJA 1NUKA 4XF3A 4IERA 4UWDA 2RG4A 1NCQC 5DABA 2OQ7A 2B4KA 4YW6A 4YZ1A 1GUIA 1OUXA 1XBFA 3JB4C 1PGW1 1Y4WA 2K0GA 3AP7A 4IEPA 5H9PA 4CP0A 4LKSA 4UFLA 4CUCA 5KHGA 1UMHA 2ENRA 5EWSA 2ZGSA 1JYXA 4YGBA 4CXXA 4OQ8A 3I3BA 2O14A 4YG6A 3FHQA 5BNOA 4MXWA 2Z4FA 2V4AA 3J7LA 3KZ4C 2UWBA 5FY9A 1CAWB 4UFJA 3AVRA 1AJOA 1R083 1NG0A 3ITQA 4GWJA 2FCVA 2QVSB 4UFIA 2DWRA 4HMZA 4WZFA 1S0CA 1J3QA 4BQ3A 3WW2A 4WVMA 2FDHA 3ATGA 4YGCA 4FI9A 2VNOA 1RL3A 1A8DA 2XBO2 2XLFA 4I30A 4LTAA 4ARXA 3FJSA 4P02B 4WM8A 4MGTA 2XG3A 2EIDA 4CCKA 4XIKA 1H6YA 1PVC1 2IXJA 2VOWA 4Y1YA 4EN6B 3M2MA 3LIHA 4AVSA 5CYYA 2B9VA 1POQA 3O0XA 1CX4A 4HZFA 2BV4A 2W91A 2D43A 2VZ1A 5KHKA 1AZDA 2HLEA 4CYDA 1W6QA 3SCHA 1XYNA 1GWKA 4JHTA 2XWJB 4NIDA 2PFWA 1O3QA 4LKDA 3B7MA 4EV0A 2Q4SA 3SNMA 2Q1FA 3ACLA 5FZ1A 4LKEA 2GNBA 5FZ0A 4OI1A 4COUA 5KXEA 5FZFA 3WSOA 4HSJA 1GOGA 1OD3A 2R063 4D7SA 4DB5A 4BIOA 2D5HA 3WG3A 1HKDA 4YVSB 2Y60A 3MO4A 5CIRA 1A8MA 3VBUC 2OA2A 1BXHA 5A6QA 1FV3A 1E57A 1BKZA 4P14A 1H4HA 1WWYA 5I8SA 3VDCA 1CWPA 3AFKA 3I3QA 2X5IC 2XKOA 4FPKA 4XETA 4YVWC 1OH4A 4ISRA 1QOOA 2OKXA 4OCTA 1YFXA 3HNBM 3OBTA 3PMEA 4QPGB 2XPJA 5IFTA 1ZBE1 1Z7S1 3MFCA 2FCUA 1BVP1 2WC2A 4GMP1 1V9U1 2VBDA 2MPFA 2VZVA 4BQXA 3RWKX 3PU8A 5C5TA 1WW4A 1RUF3 2V5DA 4OZXA 3QCWA 5IT6A 1ZNPA 4QPIA 3ZXFA 2ZS6B 3TEZA 2QDRA 1XB9A 2HBTA 4ZPIA 5FP7A 3HNMA 3NNLA 1DQ1A 5FZEA 5FY5A 2NMNA 1V6MA 3W21A 3HQUA 1SLCA 3NJXA 4N9HA 4UFMA 3HMYA 1PIV1 2QZ2A 4WVWA 3T1MA 3VGIA 3BVCA 5KC5A 2XUMA 3W5MA 1LOEA 3N35A 3RWNA 1GQHA 4QKBA 4RFRB 1MEC3 1M4WA 1DU3D 1N47A 4N53C 1UWWA 2GP3A 2BUKA 3P5BA 3SH3A 1W0NA 4LBQB 3QBQA 4P9GA 3NJZA 3NNMA 4OHWA 4XBNA 1I6XA 1UPSA 1AJKA 2JECA 4H14A 1SQ4A 2JKBA 5HCBA 4GKXA 2JDZA 4QQLA 1YUDA 1AR91 1NCQB 4HN1A 1JS9A 4GB32 1PMHX 1OA3A 5KHJA 1QJX3 3POWA 3UKTA 3U07A 3VZJA 2WRAA 2HEYF 4QQPA 2WDBA 3AKQA 5CKQA 5TSWA 4GALA 1CAXB 5EPAA 3M8LA 1QH7A 3AZVA 4HG6B 1ULOA 1LGNA 3MLKA 5DDJ2 3POYA 3WF2A 2YDEA 3VDDA 1PGW2 5AC93 1Y9MA 4CRQA 1JZ4A 1RUJ1 4A44A 1IZ3A 4OHYA 1HLCA 3ZPOA 2LUWA 2WO2A 4NJ4A 5GLZA 3IDCB 4CEYB 1COV3 1K3IA 4QX7A 2QQNA 4Q0QA 1TNRA 2RJLA 2C26A 5FPLA 4LIUA 4SLIA 4Y22B 5JUVA 1O59A 4XZPA 5C4WC 4LMFA 4MO3M 3WLUA 4AG4A 2P34A 1AX2A 2UY9A 3VBFC 5K4LA 1PVC2 2F4PA 2WNVC 3WP5A 3O1VA 1N3PA 5J1XA 2DVAA 1LU1A 1AR81 2HBUA 2JKXA 3EJKA 5I8YA 3KMHA 1C5IA 2D6PA 3ZLIA 5JIAA 3PTRB 4ASKA 3CZJA 1VBA2 2R0HA 4W65A 2VZTA 1WZXA 4YGEA 1NYWA 1ND3C 1GR3A 3BODA 3IAQA 4AAXA 3RI9A 3JBG1 3VBUB 3ZXGA 4ZZ5A 3WQBA 2Y38A 2ZKNA 4QXCA 3VZNA 4QDSA 1JZ7A 2A6WA 4HKLA 3I2KA 4AHYA 1WMXA 1Q5OA 2C24A 3BB6A 3FE5A 4RYDA 4YVWB 4KG8A 4UW5A 5JLVA 1ZA7A 2VAUA 3NNGA 1RUE1 1PMIA 3FZ3A 1G9FA 2BOJA 1ZM1A 2PHRA 3AKPA 3BTAA 3O1SA 3W58A 4ARYA 4MADA 1S55A 3S7EA 4QU2A 1CPMA 1EP0A 3KLSA 3LE0A 3HJRA 5FMOL 2HWF1 2WSVA 3I2FA 1OPMA 1ZBE2 1Z7S2 2JX9A 2Q1MA 2NZ9A 4DO0A 1OVSA 3BIEA 1ODMA 2VW1A 4NPLA 5JPNB 3ZYRA 5T52A 2DDUA 2WAOA 5G04L 2H0VA 4OZOA 3I2JA 3RI8A 3SQOA 2IZWA 3WDVA 2ZGUA 2VZUA 3VDBA 2CL2A 3VD4A 2OPWA 3A4UA 4HONA 4LBNA 1B35B 4P9YA 3DGTA 4N53B 1XOYA 4FCAA 3T09A 3BCWA 3MIFA 1CAWA 1PIV2 3B93A 2Y6KA 2QZ3A 4J1XA 4RGAA 1WBLA 2YC0A 1AR71 1F31A 4XBLA 1B09A 4Z2WA 4BWOA 1AL22 2DCKA 2UURA 1Q43A 2XQXA 3RG0A 2Y6HA 3JU9A 3OPTA 5LY2A 5B4NA 4XDPA 4XJ8A 5T5OA 3WDXA 4AVBA 2D93A 2P6HA 1DGWX 5A7SA 4E8DA 1U5XA 2XLAA 1RHI3 3HNYM 4JQRA 4LO6B 5AVAA 1PO21 2P3IA 4Q4Y3 3KV6A 3GHNA 5FO7B 4QHZA 4CCLA 4NIGA 3WQ1A 4DRRA 5I8TA 1BMV2 3GNEA 1CONA 3E6BA 2VNVA 4FP2A 1E5SA 4S2DA 1UIKA 2E7TA 4L2NA 1EV13 1ONAA 2UU8A 1OPOA 2O0OA 2TEPA 3PUIA 3S57A 2XONA 2V4VA 2YYOA 4JGZC 3ZVXA 3MICA 4WVZA 1YHFA 2Q1ZB 5IATA 2WSUA 1UN1A 3V65A 5A3TA 4BZ4A 5J3UA 4RSUA 2JG9C 4FO9A 1RUJ2 1Q8SA 4IEYA 4HETA 1IS5A 1DQ5A 5D21A 4QAWA 1TG7A 3GALA 4ZY9A 5C4WB 4ZU4A 3KT4A 3NAPB 2X8KA 1S2EA 4H2AA 4TTGA 3VBFB 1R081 1BYHA 2X09A 4M00A 1VP6A 2VG9A 3WNXA 1W90A 3RYPA 4BMBA 3MPPG 5HCFA 2XHKA 3I59B 5FKCA 1US2A 3VBRC 4FT8A 2BBAA 2XBO3 4DY3A 2NN8A 1DGWA 3GGLA 5C9AC 2RMU3 2CDOA 1UX7A 3IM0A 4XJ9A 1NY72 4RR3C 4JAAA 2PHWA 1UKRA 2ZGRA 1ND3B 1W6MB 1HRV1 1KXGA 1QGLA 1POV1 2JDKA 4Q5OA 4Z8BA 4KH9A 3ACHA 2OYZA 3QACA 3OBAA 4PCRA 4DINB 5L9BA 2WINB 5FQ0B 5KR7A 5A3PA 3O12A 5BNPA 3KGLA 3AZYA 4CDWC 2P3YA 1SDWA 4NR1A 3VKLA 3SLIA 3M7AA 3TEYA 1PZ7A 1R64A 4AHWA 3BPZA 3L9JT 2ZGPA 3JBG2 1Q56A 1W28A 3LOBA 3HBZA 1S0DA 2R061 4R52A 5KXDA 1V6JA 2XWBB 1VIWB 1MS8A 2VNGA 2D3PA 5I0UA 3CL1A 2WT2A 3WR0A 2A70A 5CU1A 1JU4A 2GC3A 1KQRA 4KBBA 5CA6A 1RUE2 3G6JB 3KM5A 2YU2A 3SH4A 2FQPA 4AVVA 4IV1B 3MGUA 5APAA 5GLWA 4BHPA 5J09A 1YCIA 2NMOA 3UL2A 3GCWA 5LA2A 3LSDA 2BWAA 2HWF2 2ZEYA 2ZX4A 1F2NA 4AZZA 1MS3A 1RUF1 2YBSA 2AUYA 5E1RA 5FP4A 3UT0A 1MZ5A 1CAXA 1YEWA 3WXPA 5C70A 3WZ1A 5BNOC 1CJDA 4L8QA 2V5YA 5ERLA 4CP1A 4BU2A 1QH6A 3I2GA 2JDNA 4QMAA 4ITCA 4EWDA 4H55A 1DQ0A 3TEWA 1UO9A 5BNNA 4PHZA 4OVEA 3LA3A 4P00B 5E16A 4OUMA 1ULEA 4QXKA 4CEYA 4NPRA 3K4AA 3WHTA 3AJZA 4WM8C 3WNOA 3WP6A 4XUTA 1CVNA 4YG3A 4Y22A 3VZLA 3ZXKA 3RMYA 2LALA 1UXZA 3W5NA 3FLPA 1MEC1 4EN0A 2RS12 2XJTA 4O9GA 1LKNA 1ZZ9A 3PVOA 5DPNA 3ZSKA 2J1TA 4ASMB 1HB3A 1W8HA 1W8ZA 3ROUA 1ACCA 1HJFA 2BVBA 4NN0A 3LD8A 1W9TA 1OLRA 3IZOA 3WW3A 5JWPA 1HQLA 2RHPA 2PHTA 5DAQA 5FY1A 4ATEA 4C1XA 1WMDA 3SEPA 3RZLA 1SBFA 4CU6A 2W95A 3NQHA 1IKQA 1YIPA 3V0BB 5H9RA 4JGZB 2JD4A 4NMIA 1QJX1 2GMPA 2VNRA 4GB33 3J4UH 5A33A 5A3UA 2HYKA 2ZMNA 2KM2A 3AKTA 4CVUA 5F3EA 3HT1A 4CUAA 3N7LA 2JG9B 5FOBB 5FZOB 5EFUA 1VBB2 5DZFA 4DUVA 1HB2A 1QU0A 3THCA 2Y6GA 1VMJA 4DEVA 1H6XA 5CB7A 2ADEA 2FZ2A 2K46A 3CJXA 1GANA 1OH3A 4LUKA 5DDJ3 5AC91 2YGLA 4P9LA 1W6OA 3AC0A 3IDEA 2VZSA 3M1HA 5FBJA 3N9PA 4Y3OA 1RJ7A 3AM2A 4GXLA 5FYUA 4QPIC 3TEXA 2TNFA 3AMPA 5C9AB 1R082 1LOGA 1GZ9A 4RR3B 1OLMA 3SH5A 2ZTNA 1QJU2 4XXPA 3USUA 4XTMA 1VBD3 3AZWA 1AL0G 1IOAA 5IVYA 2D98A 2NM1A 4HLTA 1BBT3 1V6OA 2VMHA 3MW2A 3A0NA 3H42B 4CDWB 2PXJA 1CD3G 1B35A 4COVA 4HKWA 2HJIA 1HRV2 1WCDJ 3IIAA 1PK6A 2ZMKA 3P3NA 2JWPA 2CAVA 2W08A 2KA3A 2ZEWA 4FPOB 1DZQA 4FOVA 4FPLA 3JUUA 5EJZB 2JIGA 4NRPA 2OZJA 3EHKA 1VBA3 2GMEA 4FTBA 1OD5A 5FUIA 1QOTA 3M3QA 3VHPA 4CUGA 4EN9B 5I0RA 2PAKA 2ORXA 2QQUA 2Y6JA 3RJ2X 2ZHMA 1G9BA 4Z92B 2BNNA 3MF9A 3K2OA 1VLNA 2R062 1DQ4A 2G9ZA 2BNMA 3VLBB 3AP4A 2CWSA 4ISQA 4MHUA 2Y64A 2MHFA 4OMCA 1CZTA 2Y8KA 1SFPA 1DLCA 2VMGA 5FYYA 3THTA 3ZYIB 4XACA 5L19A 4R8HA 3S30A 4DEQA 4FSJA 3UJOA 4IETA 2AEZA 5A3NA 3OSDA 5CVRA 5B4XA 4D8MA 5BNOB 4UYBA 1NQJA 2WFPA 4NUBA 4XILA 3Q8BA 3VDDC 1JZ5A 1OXCA 5GZEA 1RB8G 2OUHA 3ZXJA 4WVMB 1NXMA 1UX6A 1RUF2 3AP9A 2RJKA 1F4AA 2G4IA 4WM8B 4W8JA 1FNZA 5FYVA 1SLLA 3T3YA 4AHXA 1OF4A 3G7DA 5DMYA 3NV3A 4QX8A 5FZ4A 1JYNA 5HCHA 4HPKA 2VD7A 3DV8A 5CFDC 3E1F1 3ZIWA 2XJRA 2PHLA 3N36A 5C4WA 2OUJA 3NAPA 4NVPA 4P9XA 3VKFC 1O8PA 5C3QA 1W6QB 3K75B 1AVBA 3KQRA 4AQ2A 1XU1A 1MS9A 3LEIA 2PN5A 4XE9A 3I59A 1AL23 1MEC2 4JX0A 1H1AA 1UF2C 4JDNA 5FAXA 3SHRA 1HRI3 4GH4A 2WKKA 4EE2A 2EF6A 2QQLA 3F2ZA 4OI0A 4TLFA 1SPPA 2VQ0A 2VVDA 2C9KA 4CUBA 5CEHA 3ETQA 4YFZA 1ND3A 1O7FA 4FOQA 1C3HA 4LHNA 1HN1A 1RHI1 4OHZA 1YQ6A 2E7AA 1BLZA 2J1RA 4Q4Y1 2CYFA 4DOUA 2A3XA 4Q4W1 1N3QA 1SCSA 2E26A 4FQZA 1QOSA 3DUIA 5K0UB 1VB2A 2P4EA 1NE6A 2QTWB 2AR6A 2O1QA 4MYEA 5KXCA 1UY3A 1QJX2 3WV6A 3I49A 1GZCA 4YW5A 1L7RA 2EVXA 1EV11 2JIJA 2VC9A 3AYCA 1W9SA 5EYXA 3ZYJB 4ASLA 5C33A 3AL6A 1ND2C 3PNAA 3AYEA 3PTYA 3FFZA 4QPIB 3KF5A 4CZSA 4LEJA 4ONUA 3UESA 4AL9A 5AC92 5FXZA 4HFSA 4A45A 4J6GA 4IV1A 4Q4V3 4L9BA 1IPJA 2YZ4A 5FZ9A 5JMOA 3V64A 2B8MA 4QWNA 3VKNA 1I3HA 4LBLA 5CKMA 1W8UA 3MIBA 4E4ZA 1VALA 2X53S 3NRUA 3PU3A 4K7JA 2SBAA 2DF7A 4HN0A 2XBO1 3DPRA 3FMGA 3D4KA 1AX0A 3IIIA 2RMU1 1OC1A 3U37A 1XNCA 3AP6A 4LULA 3PUSA 1PX3A 5IVFA 1S2KA 4FAGA 2PTMA 5A7WB 5A3LA 5JSRA 1LTEA 3MIHA 2Y6FA 2VW2A 2FCTA 3KS7A 1U5YA 3ZM8A 4C90A 1UU4A 1X8EA 4Z07A 5JAXA 3WQ0A 3H9AA 4B7KA 5FR3A 1RUI2 4Y5TA 1XJAA 4DMIA 1LOFA 2XKPA 2I74A 4XPVA 2AACA 2VL4A 2CDPA 4LPLA 1SCRA 2Q8EA 4XDQA 4ZZ8A 1QJY2 5BV6A 4Q2FA 4V2WA 4AI1A 1XNTA 3VDDB 1WD4A 2PYTA 3VD7A 2C0ZA 1G8WA 1XYPA 5C71A 5LA0A 3POJA 4JKKA 1N3OA 5LK7B 1EUUA 1H2KA 2VE1A 4N7UA 4UW4A 3ON7A 3DXTA 5FP3A 4UW3A 1GZWB 5A7QA 3RPQA 3TWIA 1QF3A 2XGXA 5CFDB 3T2OA 1KD7A 4XW3A 4NHLA 1AXKA 1SZBA 3VZKA 4FPJA 3GHMA 4XDOA 4DXZA 2RDQA 4Y4YA 3I3EA 3D0JA 1DZRA 2GC2A 3GXUA 3LDKA 1ZRDA 4BE3A 2HWB2 3RZZA 3JXSA 3HN3A 1AHSA 5JZGA 2FDJA 5C9AA 5FO8B 5ACA3 3VBSA 5EZWA 2QJVA 4RR3A 5JSOA 4FFGA 1MVQA 4CTEA 5CFCB 1MQTB 1X8MA 2A6YA 2RS13 2V09A 4CDUA 3JQWA 5GLTA 2JD9A 3A0KA 4I0AA 1CAUA 3FX3A 1W06A 2K9ZA 5T5LA 4Z1VA 5BNPC 1IG3A 2W52A 1FAYA 4QB2A 3ZXLA 3A7QA 4OFGA 5CISA 4EYUA 2Y0OA 3H0OA 3KT1A 1RHI2 4D6SA 1J83A 5CNAA 2D6LX 4Q4Y2 3U14A 3HVDA 2ZZQA 3KV4A 2E32A 4Q4W2 2EIGA 4UT5A 5FPXA 3T1LA 4BISA 1ND2B 4GB31 5EXOA 3IPVB 2BW8A 2WO3A 4YW3A 4I2OA 1LHVA 1O4TA 2DVGA 3WINE 1JYTA 3PDQA 1XNAA 4QHBA 4QKDA 1O91A 2IXCA 1EV12 2JE7A 3ZXAC 1VBB3 3RFRA 3VKOA 2AYHA 5HCAA 2YFZA 5G05L 2IC1A 1D2QA 2WZPP 1VAMA 5DDJ1 2H6CA 1LU2A 1DGRA 3JB8A 1E5RA 3QH6A 4GWIA 5FY4A 1R093 2ZHNA 1MS1A 3OCPA 2NLRA 3D82A 3NVCA 4IE5A 3WX5A 3ZXDA 1PZ9A 3LEGA 4NAOA 3NV4A 1HV0A 1WCUA 4GJYA 4B29A 1QJU3 2HEWF 1VBD1 3H3LA 4J1WA 2GSYA 2YROA 4Q4X3 1FPN2 5FZBA 1SBDA 5BNNC 4NOTA 3BGAA 2TUNA 2J1AA 2LROA 4ZONA 1XU2A 2JDHA 4CEYC 4A4AA 1BBT1 2QKDA 2RMU2 2ZEZA 2VQAA 1CX1A 2A73B 3CKHA 5E88A 3VL8A 4G4FA 1PO13 1GLHA 5JPMB 1C8M3 2JB4A 2VQUA 1XNKA 2VR4A 4D94A 3O1OA 3VBOC 1H2LA 1HRV3 3S7IA 1POV3 3VBHA 1AR61 4INDA 4UOJA 2D7FA 3WNLA 5IYYA 2QCSB 2W0XA 4JQTA 5FZ6A 4ZS3A 1S1AA 1JHJA 4PBPA 3MUZ1 5SV8A 5FZ8A 1C28A 1CAVA 4AR2A 1VBA1 1X36A 2WNOA 2HWC1 2EXKA 3SISA 4XOGA 1NLQA 1ULPA 1ZBA2 4EN8B 4UFHA 1E5HA 4FPEA 3WOGA 3DCQA 4PI0A 1YFWA 5T5PA 5BNQA 5M0TA 4LXLA 2WJSA 3H7JA 3S5QA 1GSLA 2ZACA 1LOBA 3J9SA 3WNPA 2ET1A 3S0MA 4MG2A 3OGGA 4RN5A 1S0GA 4A6OA 2QDNA 1D4M3 3LEKA 2P6CA 1YI7A 5GZDA 5DXDA 3WVJA 1RUG3 3OGSA 2CGOA 3H3ZA 1H8TA 5HXVA 5K0UA 1AUYA 2R6QA 1D0HA 2BVVA 3VHNA 3WW1A 1JHNA 1OLQA 4RGGA 4Y26A 5FMOS 5A7NA 1ULFA 2BQPA 4PLOA 1WW7A 4X6RB 2Q5TA 3A21A 1CZVA 1MZEA 2EALA 2I45A 2DCTA 4N43A 2C1FA 4AFBA 3ZR5A 2W3JA 1RXGA 1U0AA 5IJRA 1UXXX 1JODA 3NSTA 2D6OX 1AYN3 3KGZA 3KT7A 5F39A 1VB4A 3MHZA 4AQTA 2J1VA 1JYWA 5FWEA 3DYOA 4FVVA 5A7OA 1XNBA 2PHDA 3PHMA 1LEDA 3I2IA 4C8DA 4A7YA 4LQRA 4C1WA 3N7MA 5BNPB 3V0AB 4PLMA 1F5FA 1ENRA 2E51A 4D0QA 1B35C 1AL21 2YBKA 4PIXA 1EYBA 1PK6C 1HRI1 4AFAA 3UKNA 5IVCA 4XFIA 4ZXKA 2G9FA 4OUEA 1PGSA 1RXFA 4E2SA 3OF1A 3OPWA 3RGBA 5LBFA 2W1UA 5A7WA 3T2TA 2R073 5DAWA 1H9WA 4AQSA 1SFNA 3SXWA 5H9SA 3UYJA 3FUQA 1RUH2 5GKAC 5IK7A 4CU8A 3FN9A 2FDKA 2E9QA 2JJ6A 1BMV1 4E2GA 4YNIA 3LB9A 3ZYFA 2W46A 4Q1RA 4D3WA 5KHIA 4NIHA 3O1UA 1VMFA 4PQQA 2A3WA 5GZFA 4AFDA 5FJKA 2ILMA 4AFMA 3A23A 1UYZA 2ZGOA 4YW4A 4C0BA 3WG4A 1LJ7A 1BK0A 4XFHA 4CCJA 5GZGA 4XUOA 4LO4B 4HL0A 1NXD1 2PAMA 5DUWA 4Q4V1 3PIGA 1BEV2 3JD73 2WQ4A 5ANNA 1FMD3 4AEKA 5BNNB 1ENQA 1Q8QA 2J1EA 3R4SA 1VBE1 3HR9A 4C91A 5JOXA 1GZWA 1W8OA 3FLTA 5C3PA 4ZHNA 5CFDA 4XJZA 3MLJA 4CDXA 1VBD2 5FZMA 3VBOB 5F5IA 1SLTA 1LULA 1N1YA 3NAPC 4KI5M 4XTPA 2W47A 4W4ZA 3WW4A 4LHLA 5DZGA 2N7GA 1YFYA 1BBT2 1US3A 1WCSA 2VJXA 5FBZA 1NY71 4WZCA 1ODNA 3WF0A 3H1MA 4LBOA 1XC6A 2VY0A 1PNGA 1V0AA 2YG0A 4OYUA 1UCXA 3OEBA 3NL1A 1AR62 4GH4C 2UYBA 5EP9A 1GWLA 5F7UA 2YMZA 4JDMA 1C1FA 5CFCA 4RHV3 1MQTA 2YFUA 4CXWA 2HWC2 4HOOA 4MGKE 2VZPA 4E8CA 3WF1A 4A42A 2ZX2A 1W3XA 3MIGA 1RUI3 5A33B 1UYYA 4N90A 5BUVA 3CMGA 3KWVA 1RUD3 4NAMA 3V56A 2BJSA 4AAPA 3N3HA 4LE3A 5C7GA 1V6LA 5FO9B 2VMCA 1LODA 2ARAA 4LUMA 1KJLA 3E6DA 4XF9A 4FTSA 3ZDSA 4XUNA 4MGIE 1QJY3 4LLOA 3K46A 1R1A3 2QFEA 4BCUA 1SMVA 3AX4A 3ZSEA 4AWDA 4H7LA 1W6OB 2IVJA 3K77A 3B00A 5CZKA 2R1BA 4GAZA 4J25A 5FZ7A 3Q9OA 4FBFA 1ND2A 2EAKA 2PHFA 3IPVA 3LFMA 1S2BA 2XXZA 2E6VA 4RQPB 4Q1PA 1QHDA 3HN1A 1FI2A 1OHFA 4LBJA 1IS3A 4P9WA 5CG8A 1A34A 3RZGA 5IK8A 2IVIB 4IV1C 3C7HA 3USUB 3ZYGA 2Q8OA 4N8MA 4KGGA 1WA6X 1RUOA 1CZSA 1PX4A 4A2UA 3MV01 4MSVA 2Z5WA 2BGPA 2VECA 3ZSLA 3UNPA 3INAA 1RVF3 1G7YA 2DUPA 2ZHKA 2BERA 4CU9A 2EIEA 2HWB3 3WF3A 4BXFA 1PK6B 1TVGA 2CU5A 4IL7A 5FZ3A 3DPRC 3Q8EA 5ACA1 1W05A 3WY6A 2BTVC 3VHRA 2W39A 3I54A 3UJQA 5SV5A
chains in the Genus database with same CATH topology
1MR5A 2RS11 1Z78A 4EJRA 4AVTA 4TZDA 2FHRA 1HRI2 4Y1ZA 1ENXA 2GNDA 4XF1A 1OQ1A 2P2KA 4IEVA 3K48A 2Z2SB 4MX3A 4XJUA 3PLQA 2XL9A 2VU9A 1LOFC 4AI2A 3M3IA 4Q0UA 3LOIA 4Q4W3 4L11A 2GH2A 2HKXA 3KB5A 3KSCA 1DLLA 1CPNA 1H30A 1D2SA 4Q27A 2XLGA 1VBB1 2VW0A 1IGOA 3E5UA 1Z0HA 3X29B 3MDPA 4E4SA 1EPZA 1ZYBA 1SBEA 1CQ9A 4K1ZA 1CR7A 2QUOA 2ZAAA 3GZUC 1NA1C 1R091 3OY8B 2A5ZA 4Y20A 4YG0A 1W39A 4Q4V2 2XJQA 4HPKB 3FFQA 3ZYPA 5A32B 2SLIA 1OOPC 1QWRA 4HVOA 1VBE2 1ZX5A 3KCYA 1AXYA 2D3RA 3GYDA 5DG1A 1QJU1 4SBVA 5T5JA 4Q4X1 3APBA 1FPN3 1XNDA 4RD7A 4R9CA 4GH4B 5JZGC 3VBSC 1PO11 1J1TA 1TMF2 2KXLA 3ZFFB 1C8M1 4TSVA 3L2YA 3AP5A 3J26N 4PIYA 5BYNA 2DFBA 4JGYA 4FTEA 4CDUC 1WMFA 1XE7A 1NQDA 4LBMA 3EXUA 1YFUA 4QGNA 5FPZA 3V0AA 1U5IA 2DFCA 2Z69A 5JDBA 1ZBA3 3TOJA 4AEDA 4L92A 4BOWA 3QD6A 2RR13 1D4M1 1ZRRA 1D4VB 1H2NA 4XFCA 1RUG1 4U2AA 4QGLA 4CEWB 4BA6A 3O0VA 1ZZ8A 1IS4A 1UIJA 2I07B 4KL1A 2VVEA 4WVVA 4S2HA 3M3OA 4BYYA 1OA4A 3DPRB 1KFXL 4AGVA 1AYN1 1W0OA 4OUSA 2ZCWA 1QY4A 1WW6A 4Q0VA 1GICA 2ARBA 5J7MA 1CJPA 5ACA2 4OI2A 2VOVA 3LGRA 2YGMA 2GNMA 3JZVA 4BM8A 3GBWA 3VBOA 5CG9A 3CO2A 1JUHA 1BQPA 3H1WA 3VBHC 2OW4A 4IEWA 3PMSA 3GZAA 4D69A 5T50A 1Y3TA 5DG2A 1VAKA 2B45X 2FBEA 3AB0A 2R071 3VN4A 3B02A 4QM8A 1KDKA 5JIUA 2CTVA 1RUH3 3CF6E 4I0BA 1S0BA 3ZFGB 3ES1A 4D7YA 1NA1B 4XEZA 1DBNA 4MGZE 3ZO0B 2GC0A 5FDBA 5JOZA 1LHWA 1CIWA 1H8TC 1OOPB 2DURA 5K0UC 3C2UA 5E89A 3ES4A 4QGMA 2ZGKA 2WT1A 1R092 4PJYA 1X7NA 1REDA 2B7YA 1BEV3 2WQZC 2DVBA 3JD71 2QNKA 3RNSA 1TME3 3VLBB 1FMD1 1FX5A 2RM22 4R4XA 1HDKA 3HD8B 4N43C 2ZAHA 5L7OA 4RQPA 5JOWA 1DGRN 3SMHA 1AX1A 4N9IA 5JZGB 5LRSA 2IWGB 3VBSB 3FC0A 3D6EA 3R0RA 1WLWA 4Q4X2 3SCFA 5BY5A 2AZ5A 4QX5A 5GZCA 2EXIA 4CDUB 4G3YC 3RQ0A 4KU8A 1CAUB 3AMHA 4F83A 1KFUL 2VULA 4YZ2A 3EO6A 5IUQA 1PO12 1AYM3 1C8M2 1S0FA 1LGCA 4K6BA 1IQAA 4H7MA 3U4XA 3WDTA 3ZX7A 2VH9A 4MLOA 3WHUA 1AR63 1V6KA 5CAZA 2R49A 1C8NA 1V6IA 4B4QA 4QQ2A 2B5HA 4Q8LA 5DUUA 4RHV1 4BMEA 4E9KA 2HWC3 2ZOEB 4R9BA 1RUI1 4XIOA 1RUD1 1WLDA 4ES8A 1LECA 4BPZA 4YW2A 3QOPA 4FOYA 2GC1A 2R30A 4IEXA 1I5ZA 1PNFA 1QJY1 4DS0A 5F5QA 2NP0A 1J1LA 3MPBA 1R1A1 1RGSA 5CADA 1WCKA 3AKRA 1D4M2 1GNHA 3W9AA 2A75A 1V00A 1RMU1 3NO8A 1N1SA 1RUG2 4K40A 5C8CB 4GQ7A 3WUCA 1SFYA 2HWE2 1OSGA 4W6XA 4YFWA 3D8CA 3MIEA 4I02A 1ZZCA 4HKOA 1J59A 1QQP3 2P3JA 2EA7A 4X8NA 3OY8A 5FLIA 1RVF1 1AYN2 1DHKB 1LCLA 3TB0A 5A32A 2HWB1 3W59A 5B2GB 4CDXC 4DFSA 3OTFA 4CP2A 3VBHB 2WA3A 4AHZA 5FTTC 5FFOC 1QDCA 1ZVFA 1CAVB 4H3WA 1ZZBA 1RUC3 3ENRA 2HEVF 3O5SA 3BU7A 3THPA 2BBVA 3RYKA 3AMNA 1PHMA 3M4FA 4LNVA 2R041 2VMIA 1IKPA 3ZFFA 2I2SA 3BOPA 3POSA 5CFCC 1MQTC 4FOWA 1LHUA 2R072 1QJZA 4DRVA 3IBMA 4I3PA 4A3XA 1PZ8A 1HXS2 1H1IA 1QDOA 1H8TB 1AXZA 2WA4A 5T55A 3SCGA 4LA3A 2OZ6A 4K21A 4YM2A 1YRZA 4N43B 4FAHA 1A6CA 2WS93 3WQ7A 1Y7BA 4XHXA 1J3PA 2H0BA 3JCIA 4IEZA 3JD72 4F8AA 4F7ZA 1FMD2 4CEWA 1LB2A 1VBE3 4ZU7A 3TN92 2R1DA 2VUAA 3N4MA 1FPN1 1QXPA 1VBC2 2C9AA 5FREA 1G9AA 4AEMA 3HAGA 1GKBA 2AREA 5D8AC 5CBLA 2IXLA 4ATFA 4ES9A 2JG8A 1TMF3 1GQGA 1OQDA 1EAH2 3NKTA 4Y5Z0 4JTNA 5LEKA 1O4ZA 3M3EA 3OD0A 4LT5A 1JN2P 4RHV2 5J48A 1Q8PA 1ZBA1 2GN3A 5ABJB 4K20A 2B9UA 1R1ZA 1RUD2 2BNOA 2PLV3 1LHOA 4M01A 1QMJA 4KG0A 3QH7A 2RR11 1VRH2 4NHMA 2DUOA 1R1A2 3TBDA 3ZIXA 4OLLA 4BIFA 2JENA 1RMU2 2ES3A 5L73A 1FT9A 3ZFGA 1NA1A 4YM3A 1M06G 1GBGA 1A78A 3J8F2 4IEOA 4CDXB 3GBFA 1OOPA 2OPKA 2D6NA 2ZZJA 5GM0A 1RVF2 1VR3A 2WFF1 1UZYA 3OJBA 3USSA 1YI9A 1GFF2 1Q3EA 4Z82A 1K5MA 1ASJ3 2B42B 3B5LB 1WW5A 2DTYA 2EAAA 1W6PA 1JYIA 4XQDA 3OPZA 2O8OA 3VL9A 4S2GA 4JGYC 4WM7A 5JI9A 2R042 2BWCA 4M3CB 3WCSA 4YZ5A 4IQPA 4XFGA 3ZFEA 5KWRA 5AFBA 3LAGA 1FOD2 4AEDC 1RUH1 1PGL1 1H8VA 4R9DA 1Q8OA 3PJQA 3MFAA 2WZR3 2ZGLA 3AFGA 2YY1A 4KWJA 1BK1A 1QNYA 4COYA 2P17A 4LA2A 4EN7B 1OA2A 4L97A 4R9AA 1BEV1 3O7OA 4W6WA 1DF0A 1TME1 4E2QA 5J36A 2A71A 2RM23 2UY8A 3LA7A 5C8CA 3O0WA 3ME2A 5D8AB 4Q8KA 1OI6A 2ZABA 2XB6C 2E63A 4PDWC 1UMZA 1KITA 2RE9A 2ZPXA 4UW6A 3HWJA 4XMIA 1NCRC 5GZDA 5JR7B 1O3SA 1Y9QA 3DN7A 1O5UA 1AYM1 3D5OA 4GULA 2ET7A 3BOWA 2DCJA 1DIWA 1H4GA 3PVEA 1VAVA 4AXOA 4S2FA 4RFT0 2YV8A 1JTZX 2DU1A 3U0ZA 2GNTA 1ZREA 1X50A 3GBGA 1LR5A 4JDOA 2JE9A 4KWLA 4JCKA 1DZTA 3VHOA 4M3CE 3E5QA 2RR12 3WG1A 3LSEA 1SLAA 3IDBB 3IMNA 3H8UA 3CLPA 2VUJA 3WCRA 4Y20B 5JCTA 4YM0A 1J58A 3EQEA 4YSFA 3GZTB 4BH9A 5HI0A 2HWE3 3QLQA 4C0HA 1V6NA 4QD2A 3URFA 1FYUA 4KU7A 4B4PA 3ZN6A 1CESA 4K1YA 1ZZ7A 4KGQA 4AGRA 5L7OC 3VUOA 1YJKA 1QQP1 4RQPC 1IPKA 3B3QE 4XMAA 1TE1B 4FPHA 3ZSMA 4IV3A 3AJYA 1W6NB 2WFF2 1T6GC 4G9SB 4LBQD 3P3PA 4JGYB 2IXIA 4CDQA 1BCXA 4EWAA 3ECQA 4KWKA 5JOYA 1RUC1 2PQQA 4HANA 2D5FA 3OGJA 1Q8VA 4FP3A 1DYKA 2Z42A 3WG2A 4AEDB 1MZ6A 2YPJA 4F3JA 4B8EA 4QM9A 4N7IA 2DYCA 1V70A 4WV8A 4AFCA 5GLVA 2ZGTA 1A3KA 3CJIA 2A6VA 1F8VA 4FPFA 1PGL2 1G9DA 4Q0PA 1HXS3 4XBQA 3AMMA 5ABJA 1NZCA 4M0HA 3RYRA 1C57A 4UXAA 2AENA 4HBNA 2WNUC 4OHVA 3BIWE 1LEMA 4YZ3A 1NOVA 2WS91 3DF0A 4XF4A 2R0FA 2GN7A 1XXNA 5I91A 3RS6A 4PDWB 4MUVA 2R16A 5DUVA 1TME2 3FUOA 2XJVA 3KCCA 1NCRB 3OYWB 4HSLA 1GYKA 4W6YA 5GJ6A 4PQ9A 5J37A 2BGCA 4Q26A 2CV6A 1TEIA 3TN93 3TYJA 2XVGA 3ZMOA 2ERFA 2WLPA 4JTOA 1VBC3 5K9YA 1G9CA 4YLZA 4AF9A 2IXKA 1REFA 2D40A 4E27A 2PHXA 5KBFA 1TMF1 3AZXA 3B69A 1AYM2 1OKQA 1EAH3 4ZU5A 1QXJA 1REEA 2YXSA 4P9JA 4HK9A 1LENA 4YZ4A 3ZFFC 5BXXA 4Y1XA 5JVVA 1H1MA 1DFQA 3RSJA 4NWVA 4OHXA 1BJQA 5EYYA 1RJ8A 2PLV1 3CNAA 4AK3A 5FCCA 4ORFA 3DKWA 2ZKLA 4M3CA 3TNQA 1O3TA 3N7KA 1VRH3 3MI8A 2HWD3 4JRAA 4PLNA 1RMU3 5DZEA 1S0IA 2MEV3 5L7OB 1SEFA 2CY6A 1YLLA 4QT6A 3UKVA 1KJRA 2VPVA 3WT3A 3J8F3 1X82A 2LM3A 2GALA 4QQHA 4E4DX 4CEWC 2X5IB 2XJPA 2G9GA 1QQP2 3GF6A 1XRUA 3HQXA 4HK8A 2BEOA 4M3CF 5EV7A 3AK0A 1OFNA 2GU9A 5D8AA 3U11A 2EXJA 2B39A 2PHUA 1ASJ1 2GDFA 4FPGA 4WBBA 4Y1UA 2JG8C 2C5DA 1J3RA 1FNYA 1RUC2 1V9U2 4XYXA 1DYPA 3WP4A 2H6BA 3VZOA 2D44A 2PA7A 3B9IA 4XFAA 1JYCA 3M3CA 2ZGNA 1TNFA 1BZWA 2R043 5AFEA 2NYYA 2IFRA 1ZA4A 4META 4B3NA 1UD1A 2RS53 1U12A 1UPIA 4HT1T 4MH0E 4PBOA 1YWKA 1FOD3 5H9QA 1S0JA 5IK4A 1EY2A 2WNUB 4LO8A 2PELA 4XHBA 2WZR1 4A7ZA 1YIFA 3ILRA 3PVNA 4Q29A 3EBRA 5JMCA 1JW6A 3ILFA 1D0GA 1LESA 2NQYA 2WWSA 3FHIB 2WS92 2NPIA 1UL9A 3ZFGC 5FLJA 3JQXA 5T3NA 2YUEA 4YRDA 4YW1A 1KS5A 2RM21 5JI7A 3R4UA 4X6QB 2QQPA 1C1LA 4KQ7A 4I09A 3O14A 2TBVA 4COWA 4TYSA 1AR92 2XVLA 1DQ2A 2BPA2 2OIIA 3LZZA 2RS33 2LTNA 1SLBA 5K7PA 1CN1A 3VKMA 4AW7A 1JH5A 1WLCA 4BLIA 4XXAA 1JOJA 4YVSA 3ZMNA 1K5MC 3D0SA 2R32A 4B7EA 1W6NA 2DVDA 2DUQA 4HVQA 4QPGA 4WM7C 4PF5A 1LGBA 2Z79A 2W68A 4GKYA 4I3GA 2WNVB 3ZFEC 2IFWA 2VXRA 2P37A 4AVCA 2PLV2 2FMYA 4U36A 4JRLA 1NLRA 2ARXA 1JUIA 2ZGQA 3IWZA 3RMXA 1UW8A 1AR82 3WDUA 1HQWA 2HWE1 3E97A 3LCPA 3SITA 3TRSB 2E53A 4PIZA 1I1EA 2PAEA 4GMP0 4GWMA 4EWEA 3ASIA 3U10A 2UWCA 3NWKA 1BVVA 4MZUA 1LRHA 5C8CC 4RS5C 4LBQA 4AI3A 1OFSA 3AYDA 2JG8B 4PDWA 1RTVA 3IT8A 3RRDA 1MVEA 2DVFA 2WFF3 1NCRA 4JC1A 2A7AA 3B9CA 1XYOA 3OYWA 2QE3A 1NCQA 5GLUA 1ASJ2 1RIRA 1QXRA 3NKGA 3MYXA 4RA0A 4LLFA 2ETEA 1YO8A 1DDLA 4M0NA 1WGPA 1UU5A 4FQ4A 1HV1A 1JBCA 4IXLA 2BFUS 3WP3A 1WLTA 3RJRA 1H9PA 4QPYA 1UKGA 1ULGA 2D6KA 1ULDA 3H3UA 1HXS1 3I2DA 1YXWA 3LA2A 4XF0A 4EROA 1RUNA 5C8WA 1AR72 1O4YA 2WZR2 5FLHA 1ULCA 4Y24A 3M70A 2UWAA 2VOKA 2WIIB 3AKSA 2XH6A 4Y1VA 3VZMA 4AE2A 2K2SA 1O3RA 1WA4A 5T54A 3VV1A 2OVUA 1PO22 3MW4A 3DL3A 4FPCA 4GWNA 3IKWA 2CGNA 1K5MB 1UZZA 4K8FA 1PVXA 4L99A 3TN91 1S0EA 4IV3C 3VBUA 4AI0A 4XFFA 1H2MA 2O8QA 1RITA 4V1PA 2GZWA 1W6PB 1VBC1 3ELNA 5KHHA 1PM7A 2X5IA 4YVWA 2Q30A 4FXKB 1MS0A 4CDQC 4WM7B 1L3JA 3AMQA 2DU0A 2FMDA 1EAH1 1IHMA 3B94A 5I0SA 3IN9A 3ZFEB 3VBRB 1FV2A 1COV1 2A3YA 4HVRA 4IESA 1XE8A 3ST7A 1YNAA 2XJUA 3CJIC 5LK5A 1VJ2A 2AGSA 5DUXA 2WT0A 1VRH1 1PVC3 5ABJC 2JICA 1MZFA 1HQNA 2V73A 2HWD1 2WNEA 2GAUA 2ZJCA 4N53A 1OQEA 2IXHA 4O9EA 4I01A 4YGDA 2CAUA 2WNUA 3AXEA 4UBGA 2MEV1 4OULA