1F5FA

Crystal structure of the n-terminal g-domain of shbg in complex with zinc
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
176
structure length
172
Chain Sequence
b'PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEX HORMONE-BINDING GLOBULIN
publication title Steroid-binding specificity of human sex hormone-binding globulin is influenced by occupancy of a zinc-binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 31
structure length 172
sequence length 176
ec nomenclature
pdb deposition date 2000-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1f5fA00
4M3CA 1SBDA 1LEDA 1QGLA 2CYFA 2A3XA 4XBQA 2R49A 3JUUA 5DZGA 4YM3A 1QDOA 1ULDA 5JOZA 2XB6C 1GANA 1BXHA 1N1TA 1UZYA 2JD4A 3N7LA 3NWKA 1W6MB 2YROA 3OGGA 4YGBA 1Z78A 4YG0A 4YGDA 3W59A 2ZGUA 1N3QA 3M3EA 1W6PB 2OW4A 1LOFC 3DGTA 5GZDA 1VAMA 2CNAA 4LBQD 1DBNA 3WZ1A 4BLJA 1DQ5A 4BQ1A 2EALA 3M3OA 3OYWB 4Y22A 3VKLA 1BZWA 5E88A 2OUHA 2GN3A 1WD4A 2ARXA 5IT6A 5GLTA 1LULA 1S0CA 1AXZA 1FAYA 3VKFC 2DVFA 1WW6A 4YZ5A 2P3JA 1IOAA 4PQ9A 3PVNA 1GZ9A 1AXKA 1BKZA 1IKPA 3POWA 4CTEA 3R4UA 4D69A 2WSUA 3T2TA 3QLQA 1LCLA 1LENA 2D7FA 5HCBA 2GNMA 1LOGA 2NM1A 2PHUA 2C5DA 1FV2A 3ZVXA 4FOYA 5IK7A 4DRRA 2DU0A 3O12A 3OBTA 2VY0A 3A0NA 4CZSA 3LSDA 1S0EA 2ZGPA 2ZGMA 1MVQA 2ZACA 3AZYA 4SLIA 3OY8A 2GN7A 3ZYRA 3AP9A 4AVTA 1OQ1A 2AYHA 2A70A 1D0HA 3BOPA 4K1ZA 4Y20B 5GM0A 5GZCA 1BQPA 4LBQB 4NOTA 5T54A 3AZXA 5AVAA 2ZMKA 1MS4A 5EWSA 1W6OA 1FATA 1EPWA 1NLSA 1URXA 1WW5A 4GALA 4Y1ZA 4K1YA 4PBOA 4XZPA 1UN1A 1JOJA 1N1VA 2JECA 4M3CE 3UJQA 2DV9A 5BYNA 5HCAA 2DVBA 4BMEA 1AX0A 1V6IA 3WNXA 1WCSA 2W39A 1LU2A 3R4SA 4GWMA 1W6NA 3D4KA 5CBLA 3B00A 1FNYA 3N36A 4Q1RA 2B7YA 1UKGA 4XYXA 1UMZA 2DVAA 4XJAA 1G9DA 2D44A 1BYHA 1FV3A 2DURA 2ZHMA 1QNWA 2P34A 3N7JA 1GYKA 1H30A 2ZZJA 5CA6A 1QOSA 1RITA 2EAKA 2VH9A 1LHUA 3ZXJA 3TAYA 3AZZA 1V6OA 3FLPA 4XXPA 3IN9A 4YZ4A 5H9QA 1FNZA 1WW7A 5DUXA 1Z0HA 3ZYPA 1GNHA 5GZFA 2VW1A 4XJZA 5L73A 4AGRA 3WHUA 1O4ZA 1NXD1 1Q8SA 3WHTA 2DU1A 2R1DA 3C2UA 1ULEA 1OKQA 3AZVA 1LGCA 5EYYA 4YFZA 2NMOA 1QDCA 1KDMA 4H55A 4XMIA 1VIWB 4AVSA 3RQ0A 4YFWA 3FLTA 2D3PA 1DQ1A 1CONA 2PHWA 2DVGA 4AVVA 4F83A 4UW5A 3V0BA 1SFYA 3RMYA 3NV2A 1UAIA 2E7QA 1JHNA 2WKKA 5E89A 4XDQA 3WLUA 2PHRA 1LOAA 4YW5A 4FPOB 2AREA 1MS5A 3B01A 1IS6A 3WDTA 2CWMA 2DUPA 2EXKA 2W68A 1QOOA 4BLIA 1LHWA 3SH4A 2ZGLA 3MW4A 1LGNA 5E8AA 4GXLA 1LHVA 4P9XA 2OVUA 3ILRA 3FBYA 4ATFA 5DZEA 1I3HA 1S0BA 1F31A 4ISRA 3AYEA 3D5OA 2PHFA 1CR7A 4LBJA 3ZSMA 1LHNA 4YZ1A 3AXDA 3OJBA 2UURA 1GV9A 2WSVA 4W65A 4YZ3A 2SLIA 1AF9A 1SLLA 2NZ9A 5DXDA 4C1WA 4FOQA 2GNBA 2R1BA 1FYUA 1W6QB 3INAA 1MS9A 4M3CF 4UW4A 1C1FA 1DQ6A 1SBEA 3M1HA 1ULFA 1ENRA 1S1AA 2A71A 3AK0A 4BPZA 3RSJA 2EIGA 4XJUA 3SNMA 3AYCA 1AVBA 4YG6A 1A8DA 2G4IA 2ZBJA 1XQNA 3Q9OA 1SLAA 5HCFA 1WUVA 1GLHA 3MPPG 1W0OA 3KM5A 2D6LX 1YI7A 4JRAA 4WZFA 2ARBA 4Y22B 1LEMA 4Q8KA 4FPEA 5EYXA 4FPGA 2E51A 3L2YA 3SH3A 5SV8A 1U0AA 4R9DA 3IPVA 2TEPA 1W6MA 3ZXLA 4XJ8A 1KRIA 1DYKA 5GZEA 2D6NA 2DTWA 2A6XA 3I8TA 1W6PA 2GMEA 3VUOA 3OYWA 2A6VA 2E53A 3ZSJA 1JW6A 1SCSA 1C1LA 2UWCA 3AZWA 2E7TA 5JMCA 1D2SA 2SBAA 4WVVA 3T1MA 4HL0A 3JU9A 2VXRA 3WG3A 5CAZA 2CY6A 1PZ7A 4YW1A 1DGLA 2GALA 1V6JA 1S0JA 2ZKNA 3NV1A 4Y26A 3A4UA 2ZAAA 2GNTA 1CN1A 1RIRA 2VUAA 1QF3A 4FPLA 1WBLA 1G86A 3PJQA 4FVVA 4BOWA 4UW6A 1S0DA 5JOXA 1MVEA 1WW4A 2EXIA 1YRZA 5T52A 3V0AB 3ASIA 4FPYA 1MZ6A 1CVNA 5H9SA 4GKYA 1N47A 1JBCA 5GLZA 4TZDA 3WDWA 2P3KA 5GLVA 4ZKTB 5GALA 1O4YA 4XJWA 1N3OA 1LODA 1IKQA 3AFKA 5LK5A 4Y20A 3DUIA 5IK4A 2A5ZA 2YV8A 2ZGTA 3I4IA 3LCPA 4LBQA 2GNDA 2ENRA 1KDKA 1HQLA 3WG1A 1GKBA 2GMMA 2DWRA 3QCWA 2ZGSA 1DFQA 1YO8A 2C9AA 3D6EA 5DZFA 3UL2A 1I1EA 2P37A 5KXEA 1A3KA 1IS3A 2W08A 3ILFA 1AJOA 1C57A 1GZWB 2A6YA 5EXOA 2UWAA 2DUQA 5H9PA 3AX4A 4Y1YA 5DUVA 3RG0A 2VW0A 4Q1PA 2PELA 1KQRA 4TYSA 1WLCA 4FPKA 4YG3A 3TB0A 1WD3A 3V64A 1ENQA 3AYDA 3PVEA 4Y1UA 3POSA 3PMEA 3GALA 3IM0A 4K21A 1LGBA 4PBPA 4XIOA 4MYEA 1LESA 2NMNA 2UU8A 3R05A 3HN1A 1MR5A 1IS5A 4HANA 2BQPA 3BTAA 4RL7A 5DUUA 1F5FA 3N7KA 4YW3A 1LECA 1Q8OA 1S0GA 2LALA 5F5QA 2WLQA 3USUB 3WCRA 1ENSA 4YW4A 4YW2A 4PF5A 4ISQA 5T5OA 3UK9A 3B3QE 5JVVA 5T5PA 2D3RA 1LHOA 5DG1A 1IS4A 4YLZA 4KBBA 3VKOA 1GZCA 1B09A 3O5SA 4K20A 1F9KA 2GMPA 1QNYA 1VLNA 5T5LA 3AJYA 1SCRA 3HMYA 3U4XA 1CQ9A 1VAVA 1YXWA 3FUQA 2P2KA 1V6MA 4R9BA 3SH5A 4DFSA 3CNAA 2FMDA 1Q8QA 2DUOA 1CJPA 1JXNA 1WLDA 3H0OA 2ZGOA 4FQZA 4AWDA 4YZ2A 4M01A 4Z8BA 3V65A 1AX2A 2ES3A 1LOFA 4FP2A 1S0IA 3HR9A 4M3CB 2A6WA 4XBNA 4XTMA 1ULGA 4JCKA 4UW3A 4LBOA 4FPJA 4PCRA 3M3QA 2HYKA 1MZ5A 2AENA 2P3IA 3MW3A 3O0XA 4DQAA 3AYAA 3SITA 1GNZA 1LU1A 2V5YA 4XXAA 5FREA 1UL9A 3ZPYA 4Q8LA 3ZXFA 2NYYA 3A0KA 2Z42A 1R1ZA 1N3PA 4YM0A 3ZXEA 1JYCA 2H0BA 4Y1VA 3SLIA 3WVJA 2ZGQA 1W6QA 1Y7BA 1ZM1A 2D43A 4FPCA 3AP5A 4RA0A 2NP0A 3N3HA 1MS0A 3FLRA 3AJZA 4FP3A 4M00A 4R9AA 1DYPA 1JN2P 4AGGA 4XTPA 1HQWA 5T5JA 2ZMNA 2CWSA 3IPVB 3VKMA 4BMBA 2YZ4A 1ULCA 4Q27A 3ZSLA 1CIWA 4XILA 3OBRA 5F9TA 1DZQA 1LOBA 2W52A 3WUDA 1DHKB 1LTEA 4YM1A 3ZXKA 4R9CA 4XHBA 4P14A 4YGEA 3ENRA 2LTNA 3PVOA 3WDXA 3VV1A 2ZHNA 2NN8A 4P9YA 3RRDA 1LOCA 5JOYA 1SBFA 3FFZA 1VALA 2DYCA 2E6VA 2VU9A 3BIWE 2PHXA 2UWBA 1ZA4A 3OY8B 1RINA 3T1LA 5JLVA 4GWNA 4FPFA 1N1SA 3WG2A 2YXSA 3WDUA 3N35A 1V6NA 5DG2A 1Q8VA 2A7AA 3VKNA 1AZDA 2ZHKA 1W6OB 4Q2FA 4ATEA 3AP7A 1G9FA 2DVDA 5KXDA 4U2AA 1YIFA 2V73A 1GBGA 2AH2A 2CTVA 1ONAA 3MW2A 1SLCA 2EXJA 4LBKA 5GJ6A 3FUOA 2R0FA 2YY1A 1G7YA 1QMJA 4IQPA 1GICA 2D3SA 3ILNA 2WT2A 1C4RA 3GNEA 4I30A 1AX1A 1SLIA 4DPNA 2ZA9A 1QU0A 3RS6A 4ASMB 1W6NB 3V0AA 2RHPA 2ZGRA 4ITCA 1V6LA 2PHTA 3APBA 3RMXA 1HKDA 2JJ6A 3WDYA 1UZZA 1KITA 4GA9A 1UPSA 1G9BA 1WLWA 2D6PA 4L8QA 1JUIA 3AXEA 4FOVA 2D6OX 1TEIA 2AUYA 2Q5TA 2ZGNA 3BODA 4XOGA 1DLLA 4YM2A 3WG4A 4BM8A 2WT0A 2ZMLA 3IKWA 3IMNA 1PZ9A 2GDFA 1Q56A 3AP4A 4GKXA 5GLWA 1KJRA 1A78A 3POYA 5T50A 1MS8A 3M2MA 1BJQA 2A3YA 3NV4A 4AGVA 4XE9A 4XIKA 3O0WA 5JDBA 4Q26A 3B9CA 4JC1A 5IK5A 4FPHA 5H9RA 3O0VA 3MEPA 1LOEA 1AJKA 1GSLA 2A75A 5GLUA 3WDVA 2WNEA 1GZWA 5FRAA 3WV6A 4DRVA 4DS0A 3W58A 1APNA 4AYUA 3V0BB 3LSEA 2WT1A 2I2SA 4WV8A 1CPNA 1J1TA 2AR6A 1SLBA 1DQ4A 1H9WA 2FHRA 2D6MA 1WBFA 3WOGA 5KXBA 4LBLA 4WVWA 1H9PA 1OFSA 5KXCA 2JDZA 4P9WA 2CL2A 2JKBA 2A3WA 3M3CA 2R16A 5T55A 4LBMA 2EF6A 3SISA 1V00A 3ZSKA 3N7MA 4U36A 1MACA 1G9AA 5JOWA 2WQZC 3USUA 1CPMA 2ZABA 3OPZA 5IUQA 1DIWA 1KJLA 1PZ8A 1MS1A 1CESA 4OZXA 2YMZA 4FOWA 3WUCA 1AXYA 4ZXKA 4Y24A 2ZHLA 5DUWA 3WCSA 2VW2A 1S0FA 2KM2A 2D6KA 2EXHA 3AP6A 1FX5A 3B69A 3NV3A 4LBNA 4Y1XA 4CRQA 1QKQA 4XHXA 1X50A 4FQ4A 2ERFA 5CNAA 4XMAA 1QOTA 1YYNA 1MS3A 2A6ZA 1SLTA 2WJSA 3ATGA 1UX6A 1V6KA 2JE9A 2XG3A 5CB7A 2OUJA 2DTYA 4XJ9A 1DQ0A 1DQ2A 2JE7A 1HLCA 1W0PA 1Q8PA 1G9CA 5GZGA 4XBLA 4C1XA 4YGCA 5IK8A 1G8WA 1N1YA 4NO4A 3UJOA 2ZGKA 1SACA 3KQRA 1JYIA 1LJ7A 2R0HA 1HDKA 2AGSA
chains in the Genus database with same CATH superfamily
4XW3A 4LHSA 1LEDA 1TQ5A 1QGLA 5E6HA 5BPXA 2A3XA 5JOZA 2VCCA 3AL5A 4BK5A 2NLRA 1AYN3 3LFIA 2XB6C 3C8XA 5BNOC 2GH2A 3N7LA 4N43B 4QHOA 4XC9A 2CHHA 1K3IA 2FMYA 3MIEA 3WZ1A 5GZDA 4BLJA 1VAMA 1GWMA 4JDMA 2JG8B 1DQ5A 1XNAA 2EALA 1UY3A 2HYXA 1F15A 3GDBA 2RM22 3MGUA 3KV9A 5IT6A 3SC7X 5C33A 1UKRA 1HB4A 5C4WA 4AI8A 1WW6A 1HRV1 5L36A 3CEWA 4PF1A 5JPNB 2O0OA 1BKZA 1IKPA 3POWA 2FDJA 3R4UA 4UI9L 5FMOS 2XOMA 3T2TA 1C5IA 4A7ZA 4LHNA 1LENA 3TYJA 3H8OA 3NAPC 3NMBA 4LLOA 1LOGA 4RYDA 4XVHA 4B8EA 4ZZ8A 1RUOA 5FQ0B 3NNFA 3L9JT 1JYXA 2X5IB 4FOYA 4DRRA 2ZOEB 3POJA 4P9LA 2VY0A 4IW3A 2B9UA 5IJRA 2ZGMA 1MVQA 1Y9QA 2Q4SA 1PNFA 4Y4RA 4Q4Y1 1EUUA 4E27A 5CFDC 1J83A 3E6DA 2HWC3 3VBHC 4CEWB 2BVVA 1EYBA 5JZGC 2DCJA 3DEMA 4K1ZA 2OA2A 4L11A 3BB6A 5GZCA 4AEDB 2VG9A 1BQPA 2X09A 3M7AA 4LBQB 2BVBA 2ZMKA 4JHZA 4MXVA 2ZJCA 5EWSA 5F6LB 5JIAA 5KHHA 1NLSA 4JZRA 1PNGA 2Q1MA 4LXLA 5D21A 2LM3A 4GAZA 1PVC1 4PBOA 2JECA 4URTA 1EV13 3CJIB 1HX6A 4PIZA 5A3OA 2DVBA 3E5UA 4F8AA 4LQRA 1QJZA 1XRUA 1K12A 1YLLA 2ARCA 1WCSA 3I59B 5DQ0A 2V72A 1U5IA 3J8F3 4INDA 3NO8A 2WZR1 5FO8B 2WNUC 4L97A 5FBJA 3BI3A 3H9AA 4XUTA 1A34A 1F2NA 2TBVA 1SFNA 3SKVA 2D44A 4L9BA 5JXHA 1FV3A 2DURA 2ZHMA 1QNWA 2BRTA 2P34A 3N7JA 1XE0A 4MZUA 4FSJA 2Y6KA 5I0SA 4FCAA 1AYM2 5CA6A 1QOSA 1RITA 1VBD3 2P3YA 5C9AB 4LULA 3ZXJA 2G9GA 4KU7A 4YZ4A 2C0ZA 3IN9A 1WW7A 3KT7A 3U14A 2H0VA 4Q4W1 4XFGA 1Z0HA 2YU1A 3ZYBA 1GNHA 2OZ6A 1W05A 4AGRA 4ZS2A 4KI5M 3MDPA 1NXD1 3WHTA 4MG2A 2VZTA 5JMOA 1REDA 4XAEA 1OFNA 3HVDA 5BNPC 3BOWA 4LITA 5JI9A 4KGQA 1LRHA 4WM7B 5JAXA 1KDMA 4H55A 4O9GA 4D8MA 3RQ0A 4JGZC 1YIPA 5K7PA 2VZVA 4YFWA 3S6PA 3ZFEB 4F83A 1CONA 1PMJX 1W06A 1E5HA 4UW5A 1UAIA 3OEBA 3ES4A 3ZO0B 2VBDA 3CO2A 1CIYA 3FC0A 5BNOB 1JZ4A 1CX4A 2AREA 3HT1A 2YGLA 4N9IA 1QOOA 3GBGA 3PUHA 4HETA 4Z07A 1FMD2 4FTEA 3FHAA 3WSOA 4F3JA 1Q3EA 4XDPA 1KFXL 4AI1A 2OVUA 2CGOA 5DZEA 2BFUL 5KR7A 4OI4A 4N9HA 4ISRA 1XOYA 3PUSA 3N4MA 3EMRA 1W2NA 1CR7A 3I3EA 4LORA 2OT7A 3OJBA 1UOFA 2XPJA 4YZ3A 3VD9A 5CG8A 5L9VA 1OKOA 3NJVA 2GNBA 2RS12 3G6JB 1W6QB 3INAA 3LQCA 1BK0A 3WNOA 1DQ6A 3KV6A 1OBNA 1SBEA 3TWIA 3VBRA 3I2GA 3WXPA 4E4SA 2WNVC 1CAVA 1H2NA 3KSCA 5EHDA 1RUH2 1WGPA 2RS53 5FY1A 4CCEA 4COYA 4XFIA 3D0SA 3AYCA 4W6YA 4YG6A 1SHWB 3SCGA 1MEC2 3Q9OA 4AFAA 1SLAA 2BOIA 3RYPA 1GLHA 4AHYA 1W0OA 1J3PA 4JRAA 2BZDA 3ZN6A 5J48A 1OC1A 3I3BA 4CDUC 4FPGA 2N7GA 3JD71 4QDRA 3VBHB 5FZGA 2BBVA 1U0AA 1ZREA 4JQRA 1ASJ1 2TEPA 3IPVA 4PIXA 1ENXA 1R093 1W6MA 4S2FA 5FP9A 4ES9A 4NR1A 4ZHNA 2B5HA 5KHKA 5KHGA 4C0BA 4FFIA 1QXRA 2WZPP 2WINB 1RMU2 2GMEA 2I74A 1W04A 4CCKA 3AMQA 3OD4A 1XBFA 3I3DA 2UWCA 4UF0B 4YVSC 1HQNA 3CF6E 1D2SA 1U12A 2SBAA 1HXS3 3WG3A 2GC0A 4V2WA 5ACA2 5CAZA 1PZ7A 4YW1A 1DGLA 2GALA 1OH4A 2WNUB 4MSVA 1S0JA 4AQSA 5IFTA 1BBT3 1VE0A 3GHMA 3WQ7A 1OD3A 5DAQA 3B93A 1H8TA 2HWB1 5C4WC 4DXTA 1PO11 2RS31 4FPLA 3ZIWA 4BJ0A 4BISA 2WYFA 4IGPA 2VC9A 3HOBA 3H1YA 1HRI1 4K8FA 5AC93 2OKXA 3ASIA 2W9XA 4FPYA 5LCWL 3KF5A 1JBCA 2QQWA 3KHBA 5GLZA 4CDWA 5E1RA 1JZ2A 3WDWA 3ZXAC 2P3KA 4ZKTB 4TZDA 1SZBA 2LRPA 5GALA 2QQPA 4QXKA 3ACHA 1OQDA 2Y6GA 1XYPA 3U11A 5IK4A 3I4IA 2VVFA 1KDKA 4XUNA 4V2VA 4QPIA 4QU1A 1KFUL 1GKBA 3H1WA 4PJYA 5LWBA 1FI2A 5EJ3A 2ZEXA 4DEVA 1E5RA 3FZ3A 3ACIA 2P37A 5FYBA 5C5TA 2W08A 5KXEA 3I49A 1VBA1 5F5AA 5J3UA 2VAUA 3AX4A 5A1LA 1L7RA 4W8JA 1NLQA 1BK1A 4Y1YA 2RJLA 5DUVA 3HNMA 1QJX2 2VJXA 5I0UA 1TZOA 2VVDA 1IPJA 5FXWA 4FPKA 3TB0A 3PVEA 3MLJA 4A45A 1K42A 4CCNA 3VDDC 2BPA2 3GALA 4GJYA 3WNNA 1W9SA 4MYEA 4JKMA 4G3YC 1XNDA 2RS13 3OF1A 1SQ4A 2L9LA 3R05A 4N53A 1MR5A 2Y0OA 3FHQA 2XH6A 4BCUA 2B8MA 2BQPA 3BTAA 4B3NA 1LECA 1OT5A 5FZAA 4E2SA 1ENSA 3T2QA 4IEZA 4J25A 4NHMA 3LD8A 2WNVB 4XFAA 2EVXA 2HWC1 1VBC2 3EHKA 4KWUA 4X8PA 5AFEA 1WA6X 4CUBA 1US3A 3MBWA 4M4RA 4COVA 1NLRA 1IS4A 4FXKB 3I2FA 3VKOA 1F9KA 2GMPA 5T5LA 3HMYA 5A3LA 5C3PA 2XL9A 3SCHA 4CDUB 5DAPA 2Y26A 1DG6A 3SH5A 1V6MA 3WF4A 4BWOA 3AMPA 3CNAA 1DZRA 3OTFA 4IEWA 1GMMA 4YW6A 3VBFC 3LPFA 1POQA 1RMU3 2WS92 4IE5A 5A33B 1J3QA 1S2KA 2BTVC 3C7GA 1ND3A 3V65A 1BEV3 1AX2A 1LOFA 2LS6A 3AMNA 3ZX7A 4XTMA 2PXJA 1ZYBA 5F32A 3WF3A 4UW3A 1X33A 4LBOA 3LKJA 4PCRA 2AACA 3WR0A 3M3QA 4B29A 2HYKA 3DYPA 2R062 2AENA 4NHXA 2J1UA 3AYAA 4ASKA 2BUKA 4RS5A 1RYYA 5DAXA 1HRV2 1R083 3ZPYA 2CAUA 4EV0A 4Q8LA 3A0KA 2Z42A 3WF0A 4FXGB 2QJVA 1CZVA 1ULPA 1HJGA 2VVEA 3ZXEA 3SLIA 3J26N 4Q4X2 5FY4A 5JXIA 1RUF1 1Y7BA 4FPCA 3RYKA 1PX3A 1X8EA 3AP5A 3O14A 2KA3A 2W47A 3ZDVA 1FOD2 5C4WB 3FLRA 4NWVA 3Q8EA 4FP3A 4AGGA 1JN2P 4N43A 5T5JA 2CWSA 3VKMA 3WQ0A 5J36A 1S2EA 3MPBA 2Z5WA 4K3UA 3MO4A 4FBFA 2FBEA 4GMP1 1O4TA 5A6ZA 3ACGA 2W52A 2WWJA 4RGGA 3GYDA 4LA2A 3OGSA 4GQ7A 2D40A 1K5MC 2R6QA 2WBKA 3CU7A 4P14A 2YHJA 2VNVA 4YGEA 4LJHA 3ZYIB 2LTNA 3AMHA 3VV1A 4JQTA 2TNFA 4P9YA 3RRDA 2JXAA 5DDJ3 4AI3A 5ANQA 2RM21 2FZ2A 2CDPA 1ZA4A 1RINA 4DEQA 4EN0A 2QQIA 3EO6A 4H2AA 2Q30A 3WG2A 3WDUA 4DZGA 4TN7A 5FUNA 3N35A 2X5IA 3VKNA 5CYYA 2VUJA 1QJX3 3PJYA 2B46X 3VZLA 3F95A 4ATEA 1FPN3 1G9FA 5KXDA 2WNOA 3KGZA 1YIFA 1GBGA 3HQXA 3E6CC 4J1XA 2W94A 1OVSA 2R0FA 5BUVA 2YY1A 2OPKA 1G7YA 1YFXA 3KCYA 3VDDB 3WW1A 4A7YA 4IQPA 1GICA 4A42A 2D3SA 4Y3OA 3DECA 2B45X 3IMMA 4RQPC 4I30A 4ASMB 5KHIA 4NPLA 2WABA 4OHVA 4IEYA 3NNLA 1XNCA 2RHPA 1XE8A 4Y5TA 1BCXA 2ZGRA 3SXWA 1VJ2A 2E9QA 3U37A 4I2OA 2VZ3A 4Q4W2 3RMXA 1HKDA 1HV0A 2J1RA 4NUBA 4AQ2A 4FTBA 1R1A2 3CJXA 3O1PA 1JODA 3BTZA 2D6PA 2D98A 3CJIA 4X8NA 2ZGNA 4S2HA 5HPOA 2CV6A 3BODA 4HOOA 1A8MA 2ZMLA 3RWKX 1ZBA3 4DUXA 2MEV2 1PZ9A 3TN93 1DLCA 3IWZA 2GC2A 3FE5A 4ARXA 3Q8FA 1UYZA 1KJRA 5T50A 4HFSA 1WA4A 1MS8A 3NV4A 1RUD2 2ZX0A 2DFCA 4EROA 5H9RA 3MEPA 4PDWA 3H3UA 3NVCA 4IV3A 5LBEA 2PQSA 4DS0A 3RZHA 2X53S 4DIQA 2RMU1 1APNA 3MV01 2YU2A 2WR9A 4EN7B 4AK3A 5K9YA 4XAAA 2AR6A 2ZAHA 5FYZA 2YBKA 2FHRA 1H9WA 3WOGA 2D6MA 3ZR5A 2Q0AA 5KXBA 3VL9A 5FJKA 4X6RB 1HRV3 3P6BA 2JDZA 1AYM1 5FLJA 4A7KA 4FAGA 4GJZA 4GD4A 2JDHA 4P9JA 1UCXA 1V9U2 4RHV2 4QX8A 3SEEA 1W8OA 1C3HA 2A3WA 1XSQA 2XL7A 3H8UA 4OHZA 3ZXGA 4ZU7A 4LBMA 1QXPA 2EF6A 4NIIA 3O1MA 3IAPA 3K75B 3KCCA 3TOJA 1W28A 2VMHA 4U36A 4Z92B 4KL1A 2WQZC 2WWSA 5C3RA 3N9MA 3AKQA 1CPMA 3OPZA 1ND2A 4QQOA 4FI9A 2K2SA 1DIWA 1KJLA 4OZXA 1MS1A 1CESA 4QMAA 5BNOA 2YMZA 1JZ3A 1RTVA 4FOWA 2K9ZA 3WUCA 1AXYA 1NAEA 4Y24A 1E5SA 4YNIA 2G19A 1CZSA 1DZTA 2KM2A 3NRUA 1W9WA 3L2HA 4CRQA 3ZN5A 4Y1XA 4ZXEA 3RPQA 4Q4Y3 4ASLA 2E7AA 3N9PA 4FQ4A 4HSLA 5I8SA 2JENA 3OUJA 4XMAA 1VRBA 2VNOA 3VBRB 4CPBA 1CAVB 2JIGA 5CB7A 2BNMA 3KF3A 1EAH1 1ZZBA 1UOBA 4XJ9A 1DQ0A 3DN7A 1W0PA 1FMD1 1RUC2 5GZGA 5IK8A 4JKKA 1G8WA 1PVC3 1OOPA 2E26A 4MO3M 3UJOA 2XGXA 3NAPA 3CHXA 4M3CA 1SBDA 1LAJA 2CYFA 3NJZA 1UZ0A 2R49A 2VCBA 3LEIA 2J22A 3MF9A 4QKDA 4NHLA 1GANA 2YFZA 4QB6A 1GP5A 2JD4A 5FYIA 3U10A 1W6MB 2IFRA 2YROA 3OGGA 4AHWA 4YGBA 4JTOA 4FO9A 4B1LA 1Z78A 1RUNA 2WZR3 1W99A 2ZGUA 1N3QA 1LOFC 3DGTA 1G9AA 4LBQD 4AFMA 3ZM8A 3M3OA 2D5HA 1I5ZA 3VKLA 1BZWA 4UAPA 5CFDA 2OUHA 2GN3A 1WD4A 2ARXA 3ZXDA 1RUH1 2HH9A 2HWB2 2LROA 1LULA 2P3JA 2K0GA 4JTNA 1C8M1 3JZVA 1MEC1 4Q4W3 4XF9A 4AAXA 4BIOA 4URAA 4HVOA 4D69A 2WSUA 2P5BA 3QLQA 1LCLA 3QBQA 4H7LA 4P9GA 4Y4YA 3ZR6A 4LIVA 1X82A 4AHZA 3ZOIA 1H8TB 3KV4A 1H2MA 1TNRA 2NM1A 2PHUA 2PN5A 4BE3A 4HPKA 4XF1A 5IK7A 1RUG1 3GBFA 3O12A 1L3JA 4NAMA 4Q0PA 2Q8DA 4AVAA 4AAPA 4DUVA 3LSDA 3VDCA 2ZGPA 3GZEA 3E97A 5BNNC 4LPLA 5FP7A 2GN7A 4AEJA 4BQWA 3T0BA 3AP9A 2IVJA 5ISLA 1OQ1A 1OH3A 2AYHA 4QGMA 2A70A 4XACA 2OYZA 3VB9A 5C8CC 3EQEA 3R4DB 2MHFA 4NOTA 2VOVA 3WQ1A 5ACA1 5DAWA 1RJ8A 4KMQA 1VBB2 3S7EA 1URXA 3GGLA 4QPIB 3UKNA 4I0AA 4MLOA 2XQRA 3CKHA 4HK8A 4XZPA 5DN2A 1W2OA 2A1XA 1UN1A 1TMF2 1AR82 3DYMA 2XXZA 3UJQA 5BNPA 1VBE2 1RXGA 4IEPA 4MOAA 5HCAA 3NJYA 1V6IA 2YYOA 3WNXA 2ADDA 5J09A 4JGZA 1HV1A 2JDAA 3R6SA 2Z4FA 3HJRA 3R4SA 1W6NA 3D4KA 5CBLA 5KWRA 1PM7A 3N36A 3PNAA 1F5JA 4HLTA 1DDLA 4XJAA 2DVAA 1G9DA 2FCVA 3ZKYA 4NJ4A 3S30A 1VB4A 1IQDC 4M0HA 5SV5A 2TUNA 4CU6A 4NRPA 4Q4V2 4CPBD 2EAKA 4N53B 3I2OA 1LHUA 3TAYA 3FLPA 1V6OA 4XXPA 5H9QA 2RR12 1STMA 3ETPA 1W8ZA 3JD73 3BGAA 3H1MA 2VW1A 5GZFA 1IGOA 1ASJ3 2ATFA 3C2UA 1OKQA 1RUC3 3AZVA 1LGCA 5EYYA 1UY0A 5FUPA 5L9BA 1KGYA 1QDCA 2RE9A 1RL3A 1PVXA 2W1WA 3JB4C 1VIWB 3RVHA 5J98B 4D94A 2D3PA 2WA4A 4UBGA 3PTYA 1POV1 2W92A 2NPIA 4DO0A 1L7QA 3D3AA 1UQXA 1VMHA 2E7QA 1YFWA 4EQVA 1JHNA 1WCKA 5E89A 4XDQA 3USSA 4NROA 3W21A 2PHRA 3AM2A 4PDWC 5HXMA 4LO8A 4O65A 5JSOA 4MXWB 1UYYA 2X8KA 2W1SA 2D93A 3B01A 3DF0A 3WDTA 5A7PA 4IXLA 2EXKA 4UFJA 1ND3B 3NJXA 1COV2 2WDBA 3MW4A 1UYXA 1CAXA 5E8AA 4GXLA 2HWB3 5FP8A 2WO1A 4OUMA 4AXOA 1PO13 2RS33 4KWKA 4GH4C 2IXIA 4O61A 1DF0A 5FY9A 1NE6A 3JBG2 1I3HA 1VBC1 5FFOC 1ZZ6A 1JU3A 3D5OA 1ZRFA 1HRI3 4RS5B 5A33A 4YZ1A 3AXDA 3ECQA 3M8LA 2UURA 1GV9A 4HKOA 4W65A 4WBBA 2SLIA 1AUYA 1O3QA 5J37A 2ZX4A 4FOQA 2BGOA 4CP0A 1H4GA 3BALA 4IUGA 4HMZA 5BXXA 5LEKA 1ND2C 4UW4A 4BU2A 3IIAA 2QVSB 3LWCA 3K48A 4YVSA 4H14A 5FYHA 1DCSA 1KS5A 1PK6C 2WS91 5F7UA 1OLRA 4BPZA 1D4M1 4L0PA 4PQQA 1XPWA 4IGQA 2IXKA 3QH7A 4OI2A 4FT8A 4KG8A 1AVBA 4MADA 2ZBJA 1XQNA 1WUVA 4OHYA 3KM5A 1YI7A 1HN1A 2ARBA 1LEMA 4FPEA 3U1XA 2R061 2WQ4A 5EYXA 1VBA3 2E51A 4LUMA 3SH3A 2PFWA 2V09A 3FN9A 4MGYE 5JSPA 4J6GA 3HAGA 2FCUA 4LK6A 4NN0A 4Q0UA 4F7ZA 3ZXLA 3IB3A 5GZEA 1RUJ2 1OOPC 3O1VA 2DCTA 4NVPA 1QQP2 2DTWA 4Q4X1 1REEA 2XMLA 5IHRA 2FQPA 3OCPA 1W6PA 3BTXA 3UKVA 3QOPA 4G4FA 1FOD1 3OYWA 2B39A 2A6VA 5FYVA 3ZSJA 1JW6A 4OHXA 1YNAA 3W20A 4EZHA 3AZWA 4COZA 2WAOA 4A2UA 2E32A 2VZQA 2ZPXA 3UKTA 2XJPA 2HWE2 1GFF2 5TSWA 3THCA 4WVVA 2JEMA 4GB32 5FMDA 2OX0A 3T1MA 3VZJA 4HL0A 2HEWF 2VXRA 5ABJA 2W0XA 4OULA 3POBA 1IPKA 1GU3A 1RVF2 3DPRA 1P8JA 3MFAA 3NNGA 2Y64A 4XETA 2ZKNA 5FR3A 2F17A 3AVRA 2ZAAA 2GNTA 4B4QA 5EZWA 1G86A 5FZ8A 4UW6A 1O5UA 4BDVB 2YFUA 1BLZA 1CAUA 4FFHA 5G04L 1WW4A 5LZ6A 3VD4A 4LLFA 1W2UA 1A6CA 2PQQA 5APAA 5FYCA 1REFA 2WFF2 3I54A 3PTRB 1OURA 4GKYA 4TTGA 4I09A 3VDDA 2VMIA 4M4PA 1F4AA 5HXVA 3HQUA 4EWDA 4JAAA 1PIV2 1N3OA 3KLSA 1GP6A 1IKQA 1LODA 3MFCA 2GSYA 5IVYA 2GNDA 2RMU2 4D0QA 1RHI2 5LRSA 4QXBA 5CG9A 3QCWA 5I0RA 3ZKUA 1DGRN 2ZGSA 3OPTA 1DGWX 4IE4A 3KB5A 4PDWB 3WNMA 2G9FA 1Q5OA 4IV3B 5CKQA 1NCRA 2W95A 5A3NA 4ZS3A 2RJ2A 5H9PA 1RUF3 5FMBA 2ILMA 2H6BA 1R1A1 3ACFA 4XFBA 3M4FA 5IVEA 5F5IA 4HVRA 1ENQA 3AYDA 1UU5A 3KV5A 3A7QA 4NRQA 5KHJA 2MEV1 3THPA 4PBPA 4KU8A 3GCWA 1RUI2 4GMP3 4IGOA 1LESA 4TLGA 3VBFA 5B4NA 3HN1A 1KD7A 1YQ2A 4I0BA 5FYYA 1RUD1 4MGIE 3NQHA 5FPUA 1F5FA 3HIFA 4YW3A 1S0GA 1H2LA 2LALA 2WLQA 4A3ZA 3MZHA 1ND2B 3U07A 4O9EA 3UK9A 3H42B 2Y6JA 1EAH2 2RM23 4BQ3A 1FXZA 4RSUA 1NE4A 4OQ9A 2IUWA 4CP2A 1QNYA 2VMEA 3VLBB 3AJYA 4CXWA 1CQ9A 4LEJA 1NQDA 2JDYA 4DFSA 2CDOA 1V9U1 2VZRA 4RHV1 4AQ6A 2PLV2 4NIAA 3W5NA 1CJPA 4FQZA 3H0OA 2ZGOA 4AWDA 1U5XA 5J1XA 4M01A 4P00B 3OD0A 2BFUS 1GOGA 1OOPB 1YHFA 4QU2A 5FZIA 4Z8BA 3KWVA 1UD1A 2ES3A 4PLOA 3NAPB 4M3CB 2A6WA 3GJAA 4XBNA 3T3YA 4DB5A 1ULGA 3RZZA 4FPJA 1NQJA 4Z2AA 1K5MA 1UF2C 5CU1A 3KGLA 5CIRA 1MZ5A 2P3IA 1Z7S2 4D6SA 2GC3A 1HW5A 4LO6B 4MGTA 5FREA 3UGFA 1C8M2 2NYYA 2X10A 3MIFA 4LA3A 4D6QA 1N3PA 3W5MA 5I93A 3B7MA 2H0BA 2BP6A 3B5LB 3I3QA 2HWD2 3AC0A 3ZSEA 3PURA 2FDHA 1YEWA 2D43A 5CFDB 4RA0A 5JXJA 3TEXA 3BKZA 4B7KA 2Y6LA 1RUC1 4XTPA 2R071 3FX3A 2QKDA 2ARAA 5A7OA 1RUG2 2AEYA 4FAHA 1H6YA 1JZ8A 1CIWA 4XILA 2BNOA 1QJU2 3AKSA 1LOBA 3WUDA 1JHJA 4YM1A 5F3GA 5A7WA 4R9CA 2D97A 4QD2A 5LY1A 3PDQA 2JB4A 1ZA7A 1YFYA 5FXZA 4HPKB 5E16A 2FCTA 4RQPA 3C7OA 5FDBA 2ZHNA 2RMU3 3KVBA 1DGWA 1LOCA 2EIDA 4Y33A 3T4HB 5JOYA 2QNKA 2VU9A 5DPNA 5K4LA 4DOUA 2VOWA 5JZGB 1OF3A 2W1QA 2VL4A 1AYM3 3CZUA 1ULOA 4B7EA 1N1SA 1KS4A 2GP3A 1V6NA 2BGPA 2I07B 2HWF2 2A7AA 2P4EA 1JS9A 3LDRA 2QQKA 2V4VA 4Q2FA 1NZCA 2DVDA 1NY71 2J1SA 3OUHA 1ONAA 3LA7A 1SLCA 2EXJA 5FIXA 4QPYA 5GJ6A 5KC6A 1ZZ9A 2XBO2 3KCXA 4DXZA 4E2QA 5BNPB 1RB8G 2XDVA 2ORZA 4UFLA 3NNJA 2XVLA 2WT2A 3ILNA 3GNEA 5FKCA 4DPNA 1GQGA 4JGZB 4UFMA 5ABJC 2XKPA 1JMUB 1W6NB 2QFEA 3V0AA 3DPRC 1V6LA 5I91A 5LA2A 4AR2A 5B2GB 5C70A 5HV4A 1KITA 2VOTA 1EAH3 1WLWA 4MUVA 4NIGA 1PO22 1JUIA 4ES8A 1FMD3 2D6OX 2AUYA 4XOGA 4BM8A 1DLLA 2JIJA 2WN3A 2VZPA 1VBB1 2VBPA 3IKWA 1W8UA 3HQRA 3WNLA 2GDFA 2VGDA 5F2WA 4RR3C 5L9RA 3RDIA 1QIQA 3AP4A 1A78A 2VZSA 5DABA 2ZS6B 1BJQA 1TMF1 1AR81 1UZVA 1UY4A 3O0WA 2Y34A 1VBE1 4DINB 3LIGA 4DY5A 4R8HA 3O0VA 4MH0E 4FFGA 3VZMA 3ZPOA 3PHMA 4R4ZA 2A75A 5A6YA 4EWAA 1GZWA 2LUWA 3WV6A 4DRVA 1UY1A 3W58A 2JG9C 1IG0A 3I2DA 5FJHA 3WP3A 1SPPB 3WF1A 4HN1A 5A80A 3LSEA 2WT1A 3ZYFA 1CPNA 1J1TA 1RUH3 5FPZA 1X7NA 4R4XA 1QEXA 3T30A 1OFSA 3Q8CA 1W2AX 1C8M3 1NCRC 4Q4V1 1MEC3 4P9WA 2JKBA 4BB3A 1T6GC 5FPLA 4NIHA 3AKPA 3FWEA 2RR11 3M3CA 5FZFA 4Y5SA 5IVBA 2Y0IA 3SISA 3ZSKA 4UFHA 1CAXB 3N7MA 5JOWA 3USUA 1J59A 2PMWB 2I45A 1PZ8A 1UY2A 1RUG3 4DNYA 3TRSB 4OCTA 1HB2A 1PGSA 4MXWA 3IT8A 2F4LA 2ZXQA 4AI9A 1D4M2 2ZHLA 4CCOA 3WCSA 3R0RA 3M3IA 3AKRA 3SKJE 3O1RA 3D0JA 3D8CA 1QKQA 3KZ4C 1QHDA 4XHXA 5CNAA 1QOTA 1MS3A 3BCWA 1SLTA 5F1RA 4HONA 1RJ7A 2VTXA 4YVSB 1UX6A 3TBDA 3CLPA 5ACA3 3IZOA 5J7MA 1OQEA 4G9SB 1UZWA 4FTSA 1ZZCA 1DQ2A 2JE7A 1HLCA 4QX7A 2XJVA 1COV1 4ET7A 3MIBA 4C1XA 4YGCA 2F4PA 1N1YA 5F3EA 1JYIA 3ACLA 5FWEA 2UY9A 3JBG1 4QQPA 3ORJA 1VR3A 4JKLA 1OPOA 1JUHA 3MYXA 3O7OA 4YM3A 2QQVA 2IC1A 3POFA 1BXHA 3NWKA 5A7NA 1QWRA 1AR62 2PHLA 4K8RB 4C91A 1AR92 3J7NA 4YGDA 2RDNA 3W59A 4OMCA 1GNYA 1W6PB 3M3EA 5CKNA 5ERLA 1H0BA 3LA3A 4BQ1A 1D0GA 5BNNA 2OIIA 3OYWB 2WIIB 2J1TA 2XLAA 2VTFA 5GLTA 3THDA 2YPDA 4YVWA 1W8NA 5C8CA 4OHWA 1UMIA 1S0CA 1FAYA 2W1UA 3VKFC 2PAEA 4YZ5A 4JV4A 4LKDA 4PQ9A 3PVNA 4K6BA 5ABJB 3WNPA 1AXKA 2IVIB 4UYBA 4AF9A 1ACCA 1VRH1 1XNKA 1Y4WA 3DPRB 4CTEA 5IAVA 2QQUA 2X05A 1YQCA 4PHZA 4P5YA 2VQAA 2D7FA 2E63A 5IVJA 4XEZA 4QQ2A 3P3NA 5A1FA 2XONA 1YFUA 4QXCA 4UWDA 1O8PA 1YI9A 5EPAA 3C7HA 1FV2A 3ZVXA 1CAUB 1RUJ1 2ZKLA 1X9TA 2DU0A 1QQP1 2R041 1POV3 3BTYA 4AE2A 3T0DA 2EA7A 4AG4A 1JU4A 4QX1A 4RR3B 2JD9A 1PHMA 4CZSA 2QQJA 5KC5A 3PUAA 2JX9A 4SLIA 3AZYA 2CGPA 2XJRA 3T2PA 5FZ7A 3OY8A 5LY2A 3ZYRA 2OZJA 2HWE1 4A6OA 3RZLA 1LNSA 1VAKA 1HJFA 1GR3A 4GB31 1D0HA 3E5QA 4TWTA 3K4DA 5G05L 2BGCA 5C3SA 3AZXA 5AVAA 1RVF1 3MV11 1W6OA 3TEYA 1HB1A 3DXUA 1MQTA 4QPWA 3SHRA 1OA2A 4Y1ZA 1VBC3 3J9SA 5F6KA 5EV7A 1VB2A 4IL7A 1JOJA 1CX1A 4M3CE 4XQDA 3MUZ1 4CEYA 2DV9A 2X29A 1NCRB 4RN5A 4CDQC 4CDXA 5BYNA 5FBZA 4IE0A 4S2GA 4BMEA 5C7GA 1AX0A 3CL1A 3LEMA 4N7UA 5EJZB 2W39A 4OI0A 2WFF1 4HKLA 4GWMA 2JICA 3B00A 4RFT0 1FNYA 2PYTA 5DAVA 2B7YA 3SQOA 1UKGA 1UMZA 2WS93 1U5ZA 3UETA 1D4M3 4E9KA 1PIV1 1BYHA 2PHDA 2IWGB 4NPRA 4OZOA 3VBFB 4LT5A 1H30A 2GU9A 2ZZJA 1UW8A 4JHTA 1RHI1 1VPHA 3AZZA 3QACA 5LEJA 1FNZA 4H3WA 5HV0A 1XNBA 2R063 3G7DA 3K3OA 4MHUA 5JR7B 3WW3A 4E8CA 2XHNA 4GH4A 4RD7A 5L73A 3S5QA 3WHUA 4E4DX 4IEUA 5IAXA 1Q8SA 1QJFA 2R1DA 4CU8A 5F8PA 1UOGA 3OB8A 4Q4X3 5FZOB 4XMIA 2Q1ZB 4I3PA 4AVSA 4IEVA 3RZKA 1FOD3 3FLTA 5BNQA 4UFKA 3RWNA 2DVGA 3ME2A 1SFYA 3NV2A 4W50A 4HT1T 3DV8A 2WKKA 1UXXX 2R7EB 1UU6A 3MF6A 4YW5A 1PK6A 1RUI1 3BVCA 5A3PA 3LB9A 2ZX2A 1ZRRA 1MS5A 5FKBA 1MPXA 1ODNA 2VNRA 4QB2A 2W68A 1LHWA 3HNBM 3K46A 4IEXA 2ZGLA 1LHVA 4P9XA 2WC2A 1GP4A 1K5MB 3FBYA 4GWIA 5K0UA 3AYEA 1QH7A 2PHFA 4HKWA 2OPWA 1IHMA 2Q8CA 2R072 3I7DA 2BBAA 3A21A 2OQ6A 3BYWA 1NXMA 2NZ9A 1IZ3A 1SLLA 4X6QB 3GCXA 4AVCA 4Z1VA 4MGKE 1M4WA 5JCTA 2XJSA 1WMEA 2FDFA 2PLV1 3M1HA 1ULFA 1ENRA 4MV2A 1W03A 3BU0A 2A71A 3C7FA 3AK0A 4GULA 1I6XA 2WLPA 3RSJA 2EIGA 4XQWA 2VQUA 4Q5OA 5CZKA 1KEXA 2Q1FA 4JGYC 3SNMA 3B9IA 5FZMA 2D6LX 5A7WB 4Y22B 3WY6A 5IFPA 3J4UH 1Z7S1 1UNBA 3L2YA 5SV8A 3VBUA 4LE4A 4RQPB 2WRAA 2PAKA 4L99A 5EFUA 3OBZA 2BW8A 1KRIA 4PLMA 4QQLA 1US2A 2Q8EA 3T09A 3WQBA 1R1A3 5JXGA 3MHZA 2HWD1 1YQ6A 2A6XA 3LDKA 5FK7A 1NY72 2RJKA 2DBIA 4AOCA 3VUOA 4QKFA 2BNNA 3KHCA 5I0DA 1SCSA 2MEV3 2E7TA 2XVKA 1O3SA 4OI1A 5JMCA 1RUD3 2RDQA 3FMGA 4IETA 3O1UA 1QJU1 2ZEWA 3WW2A 1ZX5A 1OLQA 2AEZA 1V6JA 2CGNA 4Y5Z0 1RUE1 3NKGA 2WZEA 2XJTA 3IDCB 4YVWC 1CN1A 2YB7A 1X8MA 1OUSA 1QF3A 3MUY1 4FVVA 2GC1A 5JOXA 1ZBE2 4EWEA 1MVEA 2EXIA 5FCCA 1YRZA 5T52A 3WT3A 3V0AB 1AYN2 4OVEA 1EUTA 2QCSB 3WF2A 5C5UA 1CVNA 2YC4A 5H9SA 1V9U3 4QGLA 2JG8C 4RHV3 1N47A 4BQ5A 3DCQA 5IWFA 4D7TA 1K45A 2HWF1 4OMDA 3TNQA 4CCCA 5GLVA 1SFPA 4ARYA 1W39A 1O4YA 3IBMA 3T2OA 3WD5A 1NT0A 5LK5A 2JDPA 3DUIA 4Y20A 3LCPA 4CE8A 2ENRA 3IAQA 3WP4A 2VZUA 5A1AA 5LK7B 2XBO1 1HQLA 3VGIA 2DWRA 3AKTA 2ORXA 5K8SA 3OGJA 1DFQA 1YO8A 3ZLIA 3UL2A 5IVVA 1A3KA 1IS3A 1V0AA 2VM9A 1AJOA 2A6YA 1GZWB 3FL7A 4KH9A 2UWAA 2DUQA 4OUEA 5GKAC 3VBOA 4A3XA 4AFDA 1PGL2 3FBMA 3D82A 1U5YA 1OXCA 1MQTC 3GXUA 1QJY1 4LKSA 3RG0A 3WINE 4DY3A 5BY5A 2VW0A 4Q1PA 2PELA 5F37A 1KQRA 1BVVA 4IDZA 4TYSA 4XF3A 1WLCA 1PO21 4I0WB 4YG3A 3V64A 4MHRA 1WCUA 4CEYC 2R073 5J96B 4Y1UA 3S0MA 4AVBA 3PMEA 4CDXC 3IM0A 5ANNA 1RC6A 3POIA 1B35A 1LGBA 2C26A 3OGVA 2NMNA 3B94A 2DF7A 3ZMNA 3ZFGA 2V5DA 1IS5A 5CFCC 1SPPA 4L2NA 4RL7A 5LA0A 4SBVA 5DMYA 3USUB 2QTWB 1AL21 2WO3A 3HN3A 4YW4A 3B02A 4YW2A 5FZBA 5D8AC 4WZCA 4XQ4A 5T5OA 4QKNA 3B3QE 5JVVA 2Z69A 1C28A 3UGHA 2OXBA 1UXZA 5T5PA 2D3RA 1LHOA 3K77A 5F2SA 5DG1A 2ZCWA 4KBBA 2O1QA 1B09A 1H1IA 1SCRA 3U4XA 5L7OA 3GZUC 5LB6A 3HBKA 3J8F2 5A3WA 2C24A 3WX5A 4AFCA 1Q8QA 2DUOA 4E4HA 1K5JA 2VOXA 3X29B 1WLDA 4CU9A 1O3RA 3LE0A 3GHNA 3WW4A 5LA1A 4YZ2A 4QX2A 1I5PA 4K9SA 5C9AC 3VL8A 3NW4A 1VMFA 5FZLA 4NHYA 4FP2A 1PGW2 1S0IA 3HR9A 1ALYA 3N9QA 5CKMA 1VBD2 1QY4A 1T6BX 3JB8A 2FD8A 4YRDA 2UY8A 3ZMOA 3MW3A 3O0XA 3SITA 1GNZA 1LU1A 2V5YA 1OD5A 3A22A 1UL9A 4IV1C 4XXAA 3ZXFA 4AZZA 4WM7C 1GOHA 2VQTA 4P02B 1VRH2 4YM0A 3JXSA 5BNNB 4Y1VA 3WVJA 1ZM1A 4DUWA 5JR2A 5K0UC 3ABZA 3DKQA 1TME1 4YVWB 1VBB3 4RGAA 5FP3A 1MS0A 4CYDA 5C8CB 3AJZA 4M00A 4R9AA 1DYPA 3FHIB 2YBPA 3OUIA 1HQWA 3KVAA 1W3XA 1H1AA 4BMBA 2R042 1NA1A 2YZ4A 1TMF3 1AR83 2IXJA 1QH6A 4Q27A 1VBE3 3OBRA 1UWWA 3HEIA 2J1EA 2ZX3A 5A3UA 1DHKB 1LTEA 4Q29A 4I3GA 4XCAA 1UOJA 3ZXKA 5C3OA 3GF6A 3S57A 4XHBA 3I2IA 2XHKA 4LTAA 1AR61 1HB3A 1AR91 3ENRA 4NE9A 3GBWA 3PVOA 4PIYA 1GZTA 5FMOL 2NN8A 4BK4A 5JPMB 2Y6FA 3MLKA 1C8NA 2FDIA 1CWPA 4LO7A 3FFZA 3JQWA 4QPGA 2RV9A 3IDAA 3BIWE 2C1FA 2YG0A 4W4ZA 1H8VA 3RGBA 1E57A 2GZWA 3OY8B 2QBXA 4Q4V3 3T1LA 5JLVA 4GWNA 4P5HA 3BUCA 5FZ3A 3VBUC 5CEHA 2YXSA 2RR13 1ODMA 3DKWA 4OYUA 5KBFA 5DG2A 4XCBA 4YWAA 1Q8VA 2XJUA 1NYWA 2DCKA 3BN6A 1AZDA 3PUIA 2HLEA 4RR3A 1W6OB 4CVUA 2W2IA 1MQTB 2EAAA 4E4ZA 4U2AA 3UNPA 2V73A 3P3PA 2AH2A 3PU3A 4NRMA 2RS52 3MW2A 4LBKA 4EN8B 4EYUA 3EXUA 4CEYB 1UO9A 4LO4B 4CDXB 1QMJA 1YJKA 5LBBA 1W9TA 4JDOA 2VZOA 3N9LA 1C4RA 1SLIA 1TVGA 2ZX1A 3H50A 1QU0A 1WZXA 2D5FA 3GM8A 2JG9A 3P5BA 1J84A 3BU7A 3NSTA 2ADEA 5CFCB 4ITCA 3APBA 3OBAA 5IW0A 4UBHA 1R092 4KNCA 3WDYA 4BHPA 5FLIA 2GP5A 4GA9A 1UPSA 4XF0A 1G9BA 4L8QA 3PUQA 5D8AB 1YWKA 1COV3 4LOTA 3VZOA 1ST8A 4COWA 4P08A 2WT0A 3UV9A 2WWUA 3IMNA 3RZGA 3JBG3 5FTTC 2P17A 1Q56A 4GKXA 5GLWA 4AI0A 1OF4A 3O1SA 3BIEA 2Y6HA 3M2MA 4GH4B 2A3YA 1BVP1 2YPJA 1VMJA 2YC0A 1NCQC 1AHSA 1HXS2 4LO5B 4XIKA 4HSJA 4Q26A 4XUOA 5A6QA 5JDBA 3B9CA 2IXHA 4L92A 5EP9A 5FZCA 3VZKA 4OLLA 1PMIA 4K40A 1LOEA 3RYRA 5C3QA 1XC6A 3WDVA 1BBT2 5GLUA 5FRAA 5LBCA 2W87A 3N9NA 4O7XA 2HEYF 5LASA 4AQTA 4QHZA 4Z2WA 3CZJA 4S2DA 3LEKA 5FY5A 3FJSA 4MGQA 3ITQA 4AYUA 4WV8A 2R30A 1SDWA 1JZ6A 1JYVA 1SLBA 4TXWA 3UGGA 1WBFA 3LOIA 4NMIA 4LBLA 5AC92 1H9PA 1PK6B 5KXCA 4XF4A 3UYJA 5FZOA 3VBOC 2QQOA 1VRH3 1JOBA 5FYMA 4IV1B 2R16A 4NPMA 1D4VB 2XR4A 1OUXA 2VXJA 1V00A 3OOXA 3MIHA 1UIKA 3VBSA 1EPZA 5I8YA 1MACA 1YCIA 2GH8A 2VCMA 1UX7A 2ZABA 5K0UB 2FDKA 1ZZ7A 5IUQA 4B4RA 1RUJ3 2EIBA 1QQP3 1F4HA 2R043 1XE7A 3E6BA 3JQXA 1B35C 1EY2A 2HJIA 2XWBB 2BV4A 3ZFGC 4E8DA 2PA7A 2VW2A 1S0FA 4KG0A 1WKYA 2D6KA 3AP6A 3B69A 3NV3A 5FLHA 2KD7A 2VOKA 1AR71 3KQ4B 1X50A 2HWE3 1TG7A 1YYNA 4GB33 1ZRCA 2A6ZA 2NQYA 1ZVFA 3HNYM 3LIHA 2O8QA 2XG3A 4IESA 4IE6A 3THTA 1WMDA 1RVF3 3H7JA 3J7MA 3HBZA 1Q8PA 4XBLA 1CAWA 1BHGA 2ZGKA 1SACA 3KQRA 4XPVA 4BQYA 3AFGA 3K51A 4A4AA 5L7OC 1HDKA 3K4ZA 3NL1A 2ZEZA 1QXJA 2ZTNA 4TLFA 4XBQA 3JUUA 1Y3TA 4Q0SA 1QDOA 1ULDA 2MNGA 5DZGA 3VBUB 4AHXA 1N1TA 3H8XA 2BU9A 1UZYA 4WVMA 2WFF3 5FOBB 5FZ9A 4YG0A 2PAMA 5CVRA 3W9AA 2OW4A 2CNAA 1Q43A 1DBNA 1PIV3 2A73B 3PIGA 2VBBA 4Y22A 2VNGA 4B1MA 4QWNA 1XU2A 1RUE2 5E88A 4K7JA 1IG3A 3LFMA 3ZFFC 5A70A 1OVPA 1AXZA 1RHI3 2G1MA 2B42B 2DVFA 4LMFA 5JI7A 4EN6B 1IOAA 1W8HA 2ID4A 5EQUA 4QT6A 1GZ9A 1C5HA 4H7MA 3HT2A 2MPFA 3RZJA 2P6HA 5BV6A 1JYNA 4XFCA 3RI8A 4UXAA 2ET1A 3ST7A 5HCBA 4HK9A 1NG0A 2GNMA 5FOJB 1SEFA 1BEV2 2IZWA 5FZ0A 4CDQA 2C5DA 2VUCA 1OMIA 3J7HA 1NA1C 3TNPB 2JB8A 3H3ZA 3OBTA 1ZZ8A 4BXSV 3A0NA 2VCAA 3J7LA 1S0EA 4CSWA 4I01A 2VO5A 1Y43B 2ZACA 3EB7A 4ZU5A 4J1WA 1R082 5CADA 1O5LA 1NCQB 1RUI3 3JCIA 4LHLA 1PX4A 3AVSA 3DL3A 2HBUA 1XXNA 2F6BA 4AVTA 3AL6A 3PLQA 4CXYA 2BWCA 5AFBA 1OHFA 1UPIA 3BOPA 4Y20B 5GM0A 2WAAA 5T54A 3NNMA 4QPGC 1MS4A 2WA3A 2XLGA 3H3LA 1FATA 1EPWA 1QJY2 1WW5A 2W3JA 1E5IA 4GALA 4LOSA 4K1YA 3F2ZA 4EE2A 5FZHA 1LKNA 1N1VA 5LATA 1X9PA 1ZBE1 2VE1A 2ET7A 5A32A 5F39A 3CQOA 1JZ5A 5FYUA 3EJKA 3VBOB 4JX0A 1AYN1 1LU2A 3PMSA 1BMV2 4LHKA 2WUHA 2PLV3 1VP6A 2K46A 4Q1RA 5F3CA 4YW7A 1Y9MA 2VMDA 1F8VA 5DDJ2 4XYXA 1XYNA 4QAWA 4CA9A 1AL22 3MIDA 5A6XA 1XJAA 4YARA 1B35B 1GYKA 1ZRIA 1W2TA 2BERA 3ZFGB 3WP6A 2VH9A 4N7IA 2CU5A 3ON7A 5FZKA 2JDUA 1W8FA 3PVBB 4CP9A 2IXLA 1LB2A 1Z7S3 1H6XA 3POEA 5DUXA 3ZYPA 2YDEA 1HIXA 4XJZA 1O3TA 1GWKA 1O4ZA 1FPN2 2DU1A 2QE3A 5FK8A 1ULEA 2WFPA 3FFQA 3UESA 5IYYA 1PGL1 2DCYA 4YFZA 2HWD3 2NMOA 4WVZA 4XURA 5FZ4A 1UMHA 3ETQA 2DBNA 4KWLA 2PHWA 1DQ1A 4AVVA 5FPAA 3RJ2X 3V0BA 4QDQA 3RMYA 5L7OB 4QX0A 4CUGA 3WLUA 1LOAA 2V4AA 2XUEA 4MGSA 4C90A 1QJU3 4FPOB 4UFIA 1IS6A 4IE7A 4JGYA 4LKEA 2CWMA 2DUPA 4KWJA 4RGKA 5AVPA 4BLIA 3SH4A 4DXRA 1RUE3 3N9OA 5FY8A 1LGNA 3IDEA 1YUDA 1R64A 4GMP0 1ZBA2 2DCZA 4M0NA 4OFGA 3ILRA 2FDGA 2JDNA 4WM8A 2WYSA 3TN92 2W5FA 1TME2 4ATFA 1W90A 5HCHA 1S0BA 1F31A 3ZFFB 2ZZQA 5C8WA 4TSVA 4LBJA 2YC2A 3ZSMA 1LHNA 1EV11 1UYPA 2JDMA 4COUA 2BEOA 4QXHA 3VHNA 5FAXA 4BZ4A 2WSVA 4CCJA 2J1VA 3DYOA 3E5XA 1AF9A 2UYAA 5DXDA 3VBSC 4C1WA 2VPVA 3S7IA 2HWF3 4QKBA 2HEVF 1FYUA 2R1BA 4HN0A 1WLTA 5JWPA 1MS9A 1UU4A 3IDBB 3J8F1 4M3CF 4XFFA 1C1FA 5HI0A 1S1AA 5FPBA 1AL0G 1TNFA 1RXFA 2WQ8A 4LKFA 1NA1B 1O8SA 2XBO3 4XJUA 1PGW1 1A8DA 1VBD1 2G4IA 5HCFA 3MPPG 2Z2SB 4GIQA 4WZFA 4QM9A 4Q8KA 1OPMA 5C71A 5FUIA 2P1BA 4BQ4A 1L7LA 1MZEA 1J1LA 5LW9A 4R9DA 5A7SA 1QJY3 2P6CA 4XJ8A 5FMCA 1D2QA 1DYKA 2D6NA 2OQ7A 4QPGB 5LBFA 1PO23 5JIUA 1CGPA 4XUQA 3I8TA 3GJBA 3VHOA 4AI2A 2JG8A 1OLME 4ORFA 3WEZA 4C8DA 5A3MA 1S2BA 2FZ1A 2E53A 1C1LA 1WCQA 4MX3A 4LE3A 4Q4Y2 3VBRC 4JVAA 4PT6A 3VDAA 1DU3D 1S55A 3VD3A 1CZTA 4GZ9A 3EBRA 1HN0A 5B4XA 5FXVA 1G6NA 3JU9A 3POGA 2Y8KA 5T3NA 2CY6A 4CUAA 1T2XA 1AL23 2QDNA 5JUVA 4BH9A 2CAVA 3NV1A 4Y26A 2YGMA 4YPJA 1LR5A 4Z82A 3A4UA 4D7YA 1PVC2 1DP0A 1RIRA 2VUAA 5FQ0A 1WBLA 3PJQA 4BOWA 4OUSA 1S0DA 3EYPA 5FO9B 4QX3A 1WMXA 3PU8A 2JG9B 4P9IA 2EIEA 2H6CA 2XJQA 4BXFA 2DFBA 1WWYA 1MZ6A 1MZFA 2B9VA 2WZR2 1UIJA 2W46A 4CEWA 4XJWA 4MVTA 3PL0A 3U78A 2BOJA 3AFKA 1O6UA 4QGNA 3KS7A 3TEZA 2A5ZA 4HBNA 2YV8A 2ZGTA 4LBQA 4AEDA 3KT1A 3S5AA 5CFCA 2RS51 4PI0A 2WN2A 1JI6A 2IFWA 3WG1A 2GMMA 1IPSA 5FZ6A 3MIGA 1XSRA 5D8AA 2C9AA 1O7FA 3D6EA 3QH6A 5DZFA 1YC61 1H8TC 2E31A 2ZEYA 3QD6A 3CBNA 3ILFA 3Q8BA 3WP5A 5EXOA 1C57A 1I1EA 2VD7A 2WL1A 3K4AA 3T4VA 2HKXA 1R091 3I59A 4DMIA 1TME3 1W0NA 3HPNA 2YBSA 3RNSA 2UYBA 1WD3A 1V70A 5A7QA 4HVQA 4BYYA 1D7PM 4CDWC 1OA4A 2B4KA 3POSA 3NKTA 3P1IA 4K21A 3ZYGA 5CISA 4XIOA 1XYOA 5FZEA 3SEPA 1ZNPA 2UU8A 2VZ1A 3V56A 5C9AA 4JDNA 1OLMA 3ROUA 3OSDA 3K3NA 3ZDSA 2J42A 4HANA 3OG2A 4HXCA 5DUUA 3VBSB 1AR72 4KBZA 1HXS1 1F35A 3N7KA 3URFA 4QPIC 1Q8OA 2QUOA 3O1TA 1AR63 5F5QA 3WCRA 1AR93 2YUEA 4XUPA 4AEKA 4A44A 4AW7A 4PF5A 1BBT1 4ISQA 2J1AA 1JYWA 2GAUA 2O8OA 3KD4A 4IV1A 4BIFA 2XUMA 3ALQA 4WM7A 2Y38A 1JOPA 4YLZA 1GZCA 3O5SA 3ZFEA 4K20A 1VLNA 2VECA 5A3TA 5FZ1A 5AC91 3LGRA 2PTMA 2XVGA 3ZN4A 4CCLA 4XDOA 4IEOA 1VAVA 4QQHA 4E2GA 1YXWA 2KR2A 2P2KA 3FUQA 3MICA 4Q0VA 4R9BA 4NHKA 1XB9A 2XQXA 2FMDA 3LF7A 1JZ7A 3TEWA 1DYOA 1J58A 1Y9GA 2DDUA 1JXNA 2RVAA 2W91A 4N90A 4QX5A 1O59A 5F5CA 1GQHA 2BJSA 4W6WA 4EN9B 2RG4A 1CAWB 3AMMA 4C0HA 4N53C 1JTZX 4Q0QA 5I0TA 2C9KA 4QHBA 5C6CA 1RGSA 3VHPA 3LOBA 5LA9A 2IXCA 4JCKA 1IQAA 4PI2A 4QDSA 2VR4A 4WVMB 5FPXA 4DQAA 3IIIA 4B4PA 3JD72 1PMHX 2QQMA 2QQLA 3KT4A 4W6XA 3VZNA 3WNKA 1NZIA 1OSGA 1ASJ2 3I2JA 2WZ8A 3RI9A 1R1ZA 3MI8A 1SMVA 4LK7A 1GQPA 3LA2A 3U0ZA 1JYCA 1JH5A 2ZGQA 5LRRA 2BDRA 1W6QA 1KXGA 1W8WA 4WM8C 3SCFA 1EP0A 3OPWA 3ZN6B 3I97A 3GZTB 2NP0A 3N3HA 3UT0A 4HG6B 4BQ2A 1JYTA 2VMFA 2ZMNA 3IPVB 2G9ZA 4LNVA 1M06G 5FYTA 5EJ1B 1ULCA 1GUIA 1X36A 1XU1A 3ZSLA 5L19A 4GWJA 2AZ5A 1ND3C 2RS11 2Y33A 3HD8B 5F9TA 4NIDA 1DZQA 4DXSA 2HBTA 2QQNA 4IERA 2C4XA 4QB1A 2OS2A 4CDQB 3T08A 4NAOA 1YQ5A 4NWWA 3VBHA 1YJLA 3WDXA 5JZGA 1PO12 2RS32 4RS5C 4XZUG 2R32A 2QZ2A 1SBFA 4OQ8A 1VALA 1CD3G 2DYCA 2E6VA 2VUDA 4KGGA 4BQXA 1HRI2 2PHXA 2UWBA 3H8RA 4AFBA 4KQ7A 2O14A 3CMGA 4CCMA 5EIYB 4EJRA 4FPFA 2JWPA 2BYVE 2VTXJ 4N8MA 2KXLA 1WMFA 4UF0A 4N43C 3ELNA 2RDSA 2Q8OA 2ZHKA 1I9RA 3CDZB 4META 3AP7A 3K2OA 1NOVA 1RMU1 2JDKA 1H4HA 5D1IA 2CTVA 5FY0A 4CCDA 1NCQA 2WNUA 1GWLA 4XFHA 5M0TA 3E1F1 1BEV1 4R52A 3FUOA 1OA3A 2J7MA 5A32B 3KMHA 4CDWB 3GZAA 1YQ8A 4UOJA 5FXXA 1AX1A 1AR73 3LZZA 2ZA9A 3RS6A 4AEMA 1VBA2 1W3VA 1OI6A 5HBAA 1R081 4HZFA 3ZYHA 4AL9A 2PHTA 5I8TA 3RFRA 2WO2A 2JJ6A 5F3IA 1UZZA 1POV0 3VN4A 1W9YA 5FZDA 2JKXA 1O91A 4MGZE 2VQ0A 4ZY9A 3AXEA 3A23A 4FOVA 3SMHA 4QM8A 1TEIA 4YM2A 2Q5TA 3OGRA 1WCDJ 3U4SA 3WG4A 2X5IC 4EZ4A 4ZZ5A 5FWJA 1ZRDA 4YYOA 1PM4A 2AC1A 2QZ3A 4A6SA 1GOFA 2VMGA 1W8TA 4CP9B 4D7SA 2JE8A 1W9FA 2XWJB 3POYA 1SG3A 3LAGA 2RDRA 4AGVA 3BPSA 4XE9A 3VHRA 4D3WA 4JC1A 5IK5A 4FPHA 2CSGA 2QDRA 4I02A 4CEWC 1TE1B 3ZYJB 5IVCA 5FPVA 1AJKA 1GSLA 3LDBA 2VULA 4V1PA 2WNEA 4ZONA 4AEDC 2HWC2 1BMV1 4IEQA 5DDJ1 1QJEA 4CP1A 3V0BB 2I2SA 3HWJA 5FP4A 1DQ4A 2ETEA 4WVWA 3T0AA 3RZMA 3CJIC 2Y60A 3C7EA 3VDBA 2CL2A 4BA6A 2C6SA 3DXTA 1EV12 4JGYB 5T55A 3LPGA 4LIUA 1CJDA 1NKGA 1NX9A 4LR4A 1FT9A 3O1OA 1QJX1 3PIJA 1J3RA 4D6RA 5IATA 3ES1A 3MLLA 1FPN1 1NUKA 4WM8B 4ONUA 3OEAA 2BWAA 4XABA 3H7YA 4PLNA 2WO7A 2WNVA 5FYSA 4ZXKA 4RFRB 4UT5A 5FY7A 3U75A 3I3MA 4IV3C 3CIHA 2VMCA 5DUWA 4CXXA 2EXHA 4LBNA 1FX5A 1S4CA 1XNTA 3C3VA 5FO7B 4FFFA 3VD5A 4A41A 4YSFA 2Z79A 2E33A 3Q8AA 4CU7A 3I2KA 4JRLA 3AB0A 2ERFA 5FV3A 2EICA 2XKOA 2WJSA 4CDUA 1RUF2 3ATGA 3LEGA 1V6KA 3I2HA 2JE9A 3ZFFA 4CUCA 1H1MA 2LW8A 2OUJA 2DTYA 4LUKA 2XLFA 1H2KA 1G9CA 4ZU4A 3ZIXA 5JSRA 3VD7A 1SDDB 3ZFEC 3M70A 4NO4A 4ZPIA 1ZBA1 3BPZA 1LJ7A 2R0HA 5D2AA 1DGRA 3RJRA 5IVFA 3TN91 1ZBE3 2AGSA
chains in the Genus database with same CATH topology
4XW3A 1LEDA 1TQ5A 1QGLA 5BPXA 2A3XA 5JOZA 2NLRA 1AYN3 2XB6C 5BNOC 2GH2A 3N7LA 4N43B 2FMYA 3MIEA 3WZ1A 5GZDA 4BLJA 1VAMA 4JDMA 2JG8B 1DQ5A 2EALA 2RM22 3MGUA 5IT6A 5C33A 1UKRA 5C4WA 4AI8A 1WW6A 1HRV1 5L36A 3CEWA 5JPNB 2O0OA 1BKZA 1IKPA 3POWA 3R4UA 5FMOS 3T2TA 4A7ZA 1C5IA 4LHNA 1LENA 3TYJA 3NAPC 4LLOA 1LOGA 4B8EA 1RUOA 5FQ0B 3L9JT 2X5IB 4FOYA 4DRRA 2ZOEB 4P9LA 2VY0A 2B9UA 2ZGMA 1MVQA 1Y9QA 2Q4SA 1PNFA 4E27A 4Q4Y1 5CFDC 3E6DA 2HWC3 3VBHC 4CEWB 2BVVA 1EYBA 5JZGC 2DCJA 4K1ZA 2OA2A 4L11A 3BB6A 5GZCA 4AEDB 2VG9A 1BQPA 3M7AA 4LBQB 2BVBA 2ZMKA 5JIAA 4MXVA 2ZJCA 5EWSA 5F6LB 5KHHA 1NLSA 1PNGA 2Q1MA 2LM3A 4PBOA 1PVC1 2JECA 4URTA 1EV13 3CJIB 1HX6A 4PIZA 2DVBA 3E5UA 4F8AA 1QJZA 1XRUA 1YLLA 1WCSA 3I59B 3J8F3 1U5IA 4INDA 3NO8A 2WZR1 5FO8B 2WNUC 4L97A 3H9AA 1F2NA 2TBVA 1SFNA 2D44A 4L9BA 1FV3A 2DURA 2ZHMA 1QNWA 2P34A 3N7JA 4MZUA 4FSJA 5I0SA 4FCAA 1AYM2 5CA6A 1QOSA 1RITA 1VBD3 5C9AB 4LULA 3ZXJA 2G9GA 4KU7A 4YZ4A 2C0ZA 3IN9A 1WW7A 3KT7A 2H0VA 4Q4W1 4XFGA 1Z0HA 1GNHA 2OZ6A 4AGRA 3MDPA 1NXD1 3WHTA 1REDA 1OFNA 5BNPC 3BOWA 5JI9A 4KGQA 1LRHA 4WM7B 5JAXA 1KDMA 4H55A 4O9GA 3RQ0A 4JGZC 1YIPA 5K7PA 4YFWA 3ZFEB 3S6PA 4F83A 1CONA 4UW5A 1UAIA 3ES4A 3ZO0B 3CO2A 3FC0A 5BNOB 1CX4A 2AREA 3HT1A 2YGLA 4N9IA 1QOOA 3GBGA 4HETA 4Z07A 1FMD2 4FTEA 4F3JA 1Q3EA 1KFXL 4AI1A 2OVUA 2CGOA 5DZEA 2BFUL 4OI4A 4N9HA 4ISRA 3N4MA 1CR7A 3OJBA 2XPJA 4YZ3A 5CG8A 2GNBA 2RS12 3G6JB 1W6QB 3INAA 1DQ6A 3TWIA 1SBEA 3WXPA 3VBRA 4E4SA 2WNVC 1CAVA 1H2NA 3KSCA 1RUH2 1WGPA 2RS53 4COYA 4XFIA 3D0SA 3AYCA 4W6YA 4YG6A 3SCGA 1MEC2 3Q9OA 4AFAA 1SLAA 3RYPA 1GLHA 4AHYA 1W0OA 1J3PA 4JRAA 3ZN6A 5J48A 4CDUC 4FPGA 2N7GA 3JD71 3VBHB 2BBVA 1U0AA 1ZREA 4JQRA 1ASJ1 2TEPA 3IPVA 4PIXA 1ENXA 1R093 1W6MA 4S2FA 4ES9A 4NR1A 2B5HA 5KHKA 5KHGA 4C0BA 1QXRA 2WZPP 2WINB 1RMU2 2GMEA 2I74A 3AMQA 3OD4A 2UWCA 4YVSC 1HQNA 3CF6E 1D2SA 1U12A 2SBAA 1HXS3 3WG3A 2GC0A 5CAZA 5ACA2 1PZ7A 4YW1A 1DGLA 2GALA 4MSVA 2WNUB 4AQSA 1S0JA 1BBT3 3GHMA 3WQ7A 3B93A 1H8TA 2HWB1 5C4WC 1PO11 2RS31 4FPLA 3ZIWA 3H1YA 1HRI1 4K8FA 5AC93 3ASIA 4FPYA 1JBCA 5GLZA 4CDWA 4TZDA 5E1RA 3WDWA 3ZXAC 2P3KA 4ZKTB 2QQPA 5GALA 4QXKA 1OQDA 1XYPA 3U11A 5IK4A 3I4IA 2VVFA 1KDKA 4QPIA 1KFUL 1GKBA 3H1WA 4PJYA 1FI2A 5EJ3A 3FZ3A 2P37A 5KXEA 2W08A 1VBA1 5J3UA 3AX4A 1BK1A 4Y1YA 2RJLA 5DUVA 1QJX2 5I0UA 2VVDA 1IPJA 4FPKA 3TB0A 3PVEA 3MLJA 3VDDC 2BPA2 3GALA 4MYEA 4G3YC 1XNDA 2RS13 3OF1A 1SQ4A 3R05A 4N53A 1MR5A 2Y0OA 2XH6A 4BCUA 2B8MA 2BQPA 3BTAA 4B3NA 1LECA 4E2SA 1ENSA 4IEZA 4NHMA 4XFAA 2WNVB 2EVXA 2HWC1 1VBC2 3EHKA 4X8PA 5AFEA 4COVA 1NLRA 1IS4A 4FXKB 3VKOA 1F9KA 2GMPA 5T5LA 3HMYA 5A3LA 2XL9A 3SCHA 4CDUB 2Y26A 1DG6A 3SH5A 1V6MA 4BWOA 3AMPA 3CNAA 1DZRA 3OTFA 4IEWA 3VBFC 1RMU3 2WS92 5A33B 1J3QA 1S2KA 2BTVC 1ND3A 3V65A 1BEV3 1AX2A 1LOFA 3AMNA 3ZX7A 4XTMA 1ZYBA 4UW3A 1X33A 4LBOA 3LKJA 4PCRA 3WR0A 4B29A 3M3QA 2HYKA 2R062 2AENA 3AYAA 2BUKA 4RS5A 1HRV2 1R083 3ZPYA 2CAUA 4EV0A 4Q8LA 3A0KA 2Z42A 4FXGB 2QJVA 2VVEA 3ZXEA 3SLIA 3J26N 4Q4X2 1RUF1 1Y7BA 4FPCA 3RYKA 1X8EA 3AP5A 3O14A 2KA3A 1FOD2 5C4WB 3FLRA 4NWVA 4FP3A 4AGGA 1JN2P 4N43A 5T5JA 2CWSA 3VKMA 3WQ0A 5J36A 3MPBA 2Z5WA 4K3UA 4FBFA 2FBEA 4GMP1 1O4TA 2W52A 4RGGA 3GYDA 4LA2A 4GQ7A 2D40A 1K5MC 2R6QA 3CU7A 4P14A 3ZYIB 2YHJA 4YGEA 2LTNA 3AMHA 3VV1A 4P9YA 2TNFA 3RRDA 2JXAA 5DDJ3 4AI3A 2RM21 2FZ2A 1ZA4A 1RINA 4EN0A 3EO6A 3WG2A 2Q30A 3WDUA 4DZGA 3N35A 2X5IA 3VKNA 2VUJA 1QJX3 3PJYA 2B46X 3VZLA 4ATEA 1FPN3 1G9FA 5KXDA 3KGZA 1YIFA 1GBGA 3HQXA 3E6CC 4J1XA 2R0FA 5BUVA 2YY1A 2OPKA 1G7YA 1YFXA 3KCYA 3VDDB 3WW1A 4A7YA 4IQPA 1GICA 2D3SA 2B45X 4RQPC 4I30A 4ASMB 5KHIA 4OHVA 4IEYA 3SXWA 1XNCA 2RHPA 1XE8A 1BCXA 2ZGRA 1VJ2A 2E9QA 4I2OA 4Q4W2 3RMXA 1HKDA 1HV0A 4AQ2A 4FTBA 1R1A2 3CJXA 2D6PA 2D98A 3CJIA 4X8NA 2ZGNA 4S2HA 2CV6A 3BODA 1A8MA 2ZMLA 1ZBA3 2MEV2 1PZ9A 3TN93 3IWZA 2GC2A 3FE5A 1KJRA 5T50A 4HFSA 1WA4A 1MS8A 3NV4A 1RUD2 2ZX0A 2DFCA 4EROA 5H9RA 3MEPA 4PDWA 3H3UA 3NVCA 4IV3A 4DS0A 2X53S 2RMU1 1APNA 4EN7B 4AK3A 2AR6A 2ZAHA 2FHRA 1H9WA 3WOGA 2D6MA 2Q0AA 5KXBA 3VL9A 4X6RB 1HRV3 2JDZA 1AYM1 5FLJA 4A7KA 4FAGA 4P9JA 1UCXA 1V9U2 4RHV2 2A3WA 1C3HA 3H8UA 2XL7A 3ZXGA 4OHZA 4ZU7A 4LBMA 1QXPA 2EF6A 3KCCA 3TOJA 2VMHA 4U36A 4Z92B 4KL1A 2WQZC 2WWSA 3AKQA 1CPMA 3OPZA 1ND2A 4QQOA 2K2SA 1DIWA 1KJLA 4OZXA 1MS1A 1CESA 4QMAA 5BNOA 2YMZA 1RTVA 4FOWA 2K9ZA 3WUCA 1AXYA 4Y24A 4YNIA 1DZTA 2KM2A 4CRQA 3L2HA 3ZN5A 4Y1XA 3RPQA 4Q4Y3 4ASLA 2E7AA 4FQ4A 4HSLA 5I8SA 2JENA 4XMAA 2VNOA 3VBRB 1CAVB 5CB7A 2BNMA 1EAH1 1ZZBA 4XJ9A 1DQ0A 3DN7A 1W0PA 1FMD1 1RUC2 5GZGA 5IK8A 1G8WA 1PVC3 1OOPA 3UJOA 2XGXA 3NAPA 4M3CA 1SBDA 2CYFA 3NJZA 2R49A 3MF9A 3U10A 4NHLA 1GANA 2JD4A 1W6MB 2IFRA 2YROA 3OGGA 4AHWA 4YGBA 4JTOA 4FO9A 1Z78A 2WZR3 2ZGUA 1N3QA 1LOFC 3DGTA 1G9AA 4LBQD 4AFMA 3M3OA 2D5HA 1I5ZA 3VKLA 1BZWA 5CFDA 2OUHA 2GN3A 1WD4A 2ARXA 3ZXDA 1RUH1 2HWB2 1LULA 2P3JA 2K0GA 4JTNA 1C8M1 3JZVA 1MEC1 4Q4W3 4XF9A 4BIOA 4HVOA 4D69A 2WSUA 3QLQA 1LCLA 3QBQA 4H7LA 4P9GA 4Y4YA 1X82A 4AHZA 1H8TB 1H2MA 1TNRA 2NM1A 2PHUA 2PN5A 4BE3A 4HPKA 4XF1A 5IK7A 1RUG1 3GBFA 3O12A 1L3JA 4Q0PA 4AVAA 3LSDA 2ZGPA 3E97A 5BNNC 2GN7A 4AEJA 3AP9A 1OQ1A 2AYHA 4QGMA 2A70A 2OYZA 5C8CC 3EQEA 3R4DB 2MHFA 4NOTA 2VOVA 3WQ1A 5ACA1 1RJ8A 1VBB2 3S7EA 1URXA 4QPIB 3UKNA 4I0AA 4MLOA 4HK8A 4XZPA 1UN1A 1TMF2 1AR82 3UJQA 5BNPA 1VBE2 4IEPA 5HCAA 1V6IA 2YYOA 3WNXA 5J09A 4JGZA 1HV1A 3R6SA 3R4SA 1W6NA 3D4KA 5CBLA 5KWRA 1PM7A 3N36A 3PNAA 1F5JA 4HLTA 1DDLA 4XJAA 2DVAA 1G9DA 3S30A 1VB4A 4M0HA 5SV5A 2TUNA 4Q4V2 2EAKA 4N53B 1LHUA 3TAYA 3FLPA 1V6OA 4XXPA 5H9QA 2RR12 3JD73 3H1MA 2VW1A 5GZFA 1IGOA 1ASJ3 2ATFA 3C2UA 1OKQA 1RUC3 3AZVA 1LGCA 5EYYA 1QDCA 2RE9A 1RL3A 1PVXA 3JB4C 1VIWB 4D94A 5J98B 2D3PA 2WA4A 4UBGA 3PTYA 1POV1 2NPIA 2E7QA 1YFWA 1JHNA 1WCKA 5E89A 4XDQA 3USSA 2PHRA 3AM2A 4PDWC 4LO8A 5JSOA 4MXWB 2X8KA 3DF0A 2D93A 3B01A 3WDTA 4IXLA 2EXKA 1ND3B 1COV2 3MW4A 1CAXA 5E8AA 4GXLA 2HWB3 4D7TA 4OUMA 4AXOA 1PO13 2RS33 4KWKA 4GH4C 2IXIA 1DF0A 1NE6A 3JBG2 1I3HA 1VBC1 5FFOC 1ZZ6A 1ZRFA 3D5OA 1HRI3 4RS5B 5A33A 4YZ1A 3AXDA 3ECQA 3M8LA 2UURA 1GV9A 4HKOA 4W65A 4WBBA 2SLIA 1AUYA 1O3QA 5J37A 2ZX4A 4FOQA 4CP0A 1H4GA 3BALA 4HMZA 5BXXA 5LEKA 1ND2C 4UW4A 3IIAA 2QVSB 3LWCA 3K48A 4YVSA 4H14A 1KS5A 1PK6C 2WS91 1OLRA 4BPZA 1D4M1 2IXKA 3QH7A 4OI2A 4FT8A 4KG8A 1AVBA 2ZBJA 1XQNA 1WUVA 4OHYA 3KM5A 1YI7A 2ARBA 1LEMA 4FPEA 2R061 2WQ4A 5EYXA 1VBA3 2E51A 4LUMA 3SH3A 2PFWA 2V09A 4MGYE 5JSPA 4J6GA 3HAGA 4NN0A 4Q0UA 4F7ZA 3ZXLA 5GZEA 1RUJ2 1OOPC 2DCTA 4NVPA 1QQP2 2DTWA 4Q4X1 1REEA 2FQPA 3OCPA 1W6PA 3UKVA 3QOPA 4G4FA 1FOD1 3OYWA 2B39A 2A6VA 3ZSJA 1JW6A 4OHXA 1YNAA 3AZWA 4COZA 4A2UA 2ZPXA 3UKTA 2XJPA 2HWE2 1GFF2 5TSWA 4WVVA 2JEMA 4GB32 3T1MA 3VZJA 4HL0A 2HEWF 2VXRA 5ABJA 2W0XA 4OULA 1IPKA 1RVF2 3MFAA 3DPRA 5KC6A 4XETA 2ZKNA 2ZAAA 2GNTA 4B4QA 5EZWA 1G86A 4UW6A 1O5UA 1CAUA 1WW4A 4LLFA 1W2UA 1A6CA 2PQQA 1REFA 2WFF2 3I54A 4GKYA 4I09A 3VDDA 2VMIA 5HXVA 4EWDA 4JAAA 1PIV2 1N3OA 3KLSA 1LODA 1IKQA 3MFCA 2GSYA 2GNDA 2RMU2 1RHI2 5LRSA 5CG9A 3QCWA 5I0RA 1DGRN 2ZGSA 1DGWX 3KB5A 4PDWB 2G9FA 1Q5OA 4IV3B 1NCRA 5H9PA 1RUF3 2ILMA 2H6BA 1R1A1 4XFBA 3M4FA 4HVRA 1ENQA 3AYDA 1UU5A 5KHJA 2MEV1 3THPA 4PBPA 4KU8A 3VBFA 1RUI2 4GMP3 1LESA 3HN1A 1KD7A 4I0BA 1RUD1 4MGIE 1F5FA 3HIFA 4YW3A 1S0GA 1H2LA 2LALA 2WLQA 3MZHA 1ND2B 3U07A 4O9EA 3UK9A 1EAH2 2RM23 1FXZA 4RSUA 1NE4A 4CP2A 1QNYA 3VLBB 3AJYA 1CQ9A 4LEJA 1NQDA 4DFSA 1V9U1 4RHV1 4AQ6A 2PLV2 1CJPA 4FQZA 3H0OA 2ZGOA 4AWDA 1U5XA 4M01A 5B2GB 3OD0A 2BFUS 1YHFA 1OOPB 4QU2A 4Z8BA 1UD1A 2ES3A 4PLOA 3NAPB 4M3CB 2A6WA 4XBNA 4DB5A 1ULGA 3RZZA 4FPJA 1NQJA 1K5MA 1UF2C 5CU1A 3KGLA 5CIRA 1MZ5A 2P3IA 1Z7S2 2GC3A 1HW5A 4LO6B 5FREA 1C8M2 2NYYA 3MIFA 4LA3A 1N3PA 5I93A 3B7MA 2H0BA 3B5LB 3ZSEA 2HWD2 2D43A 5CFDB 4RA0A 4B7KA 1RUC1 4XTPA 2R071 3FX3A 2QKDA