3FWEA

Crystal structure of the apo d138l cap mutant
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
202
structure length
202
Chain Sequence
b'QTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLLVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Structure of apo-CAP reveals that large conformational changes are necessary for DNA binding
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transcription regulator
total genus 56
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fweA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3fweA01
1HXDA 4ETSA 3WGIA 1XDSA 4D7TA 4XRFA 2RQPA 3C3VA 3BROA 4D7SA 1TQ5A 2R3SA 3TO7A 5E1RA 4S04A 4HLYA 3ETQA 2FQ3A 5L3EA 4O3MA 4UV9A 2VE9A 1YIOA 4HVQA 3ZMZA 2RNJA 1ZLKA 3HYIA 4G7HF 1IAWA 1AOYA 3CO6C 2GC3A 1KU9A 5DUKA 1BC8C 4A5NA 5DCMA 2MH2A 2PQ8A 2D2WA 1F5TA 4LG0A 3BPVA 5HI0A 3HT2A 2QYOA 2LNBA 4KWLA 2IT0A 1USSA 4IERA 2XLFA 3FHIB 4L9VA 3M3IA 3F6VA 4IVNA 3WTYC 4A5MA 2IA2A 3D0JA 2P17A 2DFIA 4P55A 2OU2A 4EWAA 5LBQA 5E1ZB 3E5UA 1ON1A 2O03A 2Q30A 1B4AA 1T38A 5BQTA 4F7ZA 1J5YA 1X8MA 2PN6A 3DF8A 1LDJA 3HHHA 3IDCB 1BC7C 4LTAA 2PAKA 2PMHA 4ZU7A 1DUXC 4OOIA 3SMHA 3KP6A 3WE2A 2HYGD 1BM9A 4NB5A 4LA3A 4DNCA 1EY2A 1IN5A 1XGMA 3GXOA 1OPCA 1P4WA 2XLAA 1HQCA 2Q8KA 1SD6A 4U0YA 4KU8A 4HLXA 3RYPA 2GC1A 4YFXF 2V79A 2Q1ZB 1ZGAA 1H9TA 3KP3A 3TNQA 2NS0A 3FXUA 3ROUA 3RIRA 4OU0A 1U78A 5KBFA 4XF9A 1UCXA 5E8IA 4KT5C 3TOBA 3GEZA 2STTA 1V70A 2DI3A 5DYMA 3ES1A 4ON0A 5FLXZ 3BJ6A 3FXRA 3QRFF 2VT3A 3GO5A 1ZAOA 4PGGA 3ERED 2KRFA 3B02A 2VECA 1X7NA 3IHUA 3JZVA 3QPHA 2DBBA 4XFCA 4E2GA 4XSXF 4EGYA 1FLIA 1TBXA 1ZYRF 1EV7A 5JAXA 3CUQC 2UYAA 2JTVA 2PLYA 3M70A 2VC1A 3H7JA 2EJRA 3OF1A 3M8FA 5DV5A 3EQLF 1Z6RA 2A6EF 3HHGA 4WBBA 4EM0B 3MPBA 4XF1A 2KKOA 1H0MA 3M8EA 1OYYA 2NNNA 3BPXA 3FHZA 4YYOA 4IRHA 3TKYA 1TQIA 1AWCA 1P4AA 1IPJA 5HS8A 2R7DA 3SFZA 1FBQA 1ZZ8A 3IC7A 3F8CA 1XSDA 1I27A 2MH9A 4MZUA 2F2EA 4L5JA 1XN7A 1SQ4A 3SZPA 3NRVA 4N9HA 5LHHA 3VEPA 3BJOA 1RGSA 3RKYA 1H1IA 1YFXA 5ILVA 1W7PA 1D8KA 2A6HF 1OR7A 4MEXF 1BIBA 1KU2A 2GWRA 3UKVA 1GXPA 1CAVA 2HKXA 2DK5A 2B9UA 1FYKA 1SD5A 1SFNA 2E7WA 4EQQA 4ZZLA 1UHWA 5CADA 3MDPA 1ZZ7A 2L01A 4XEZA 2K02A 3IIAA 4XFIA 5I8TA 1FWZA 4MH0E 1U5TA 4EJOA 2FXAA 1ZREA 2ISZA 4OMYA 1JHFA 2RC4A 4I01A 2FEZA 3T0YA 1UFMA 2Z69A 1YYVA 2YSRA 4WXDA 2PMUA 1G3TA 1BI1A 1MDMA 4HX4A 2JPBA 1VP6A 2OPKA 4G94A 3CO7C 1YS6A 3HOTA 1OKRA 1FOKA 4L0ZB 3BY6A 5AIPA 1ZARA 2PHLA 3F8BA 1JGSA 1XB4A 4KWKA 5LRSA 1Z05A 4G7ZF 4HW0A 2D93A 5E20A 2XVCA 1CAXB 1MGTA 5FPZA 1BIAA 3MZHA 2DQRA 5J6XA 2L4MA 3HRSA 2WWYA 4ZYEA 4R52A 1UHMA 2P4WA 1JUHA 4WF2A 4Q47A 3F72A 3NW4A 1H1MA 1J0RA 1ZHFA 1W4MA 1CAWB 1B1BA 3H1WA 5KHGA 2ETEA 5CLSA 2DQLA 4UBGA 3NSTA 3NL1A 4PGHA 4AIJA 2K7LA 1VR3A 5KHKA 4MGKE 2Q0AA 4IESA 4LLOA 2JRTA 2XAHA 3ZMSA 2VXZA 1RUNA 5E16A 5L3FA 4WCGA 5HLGA 3NEUA 4ASNA 1J1LA 4HYEA 3GF2A 3FJSA 2BV6A 1KU7A 2WFPA 4NQWA 4Q0SA 4OIOF 2OBPA 1IRFA 1SD7A 2IPQX 3J80K 4IETA 5CJ9A 2ZJ2A 4CICA 1G4DA 3S7EA 3DXJF 1BI2A 3G73A 1EPZA 3IRRA 3ZMTA 2IVMA 1FP2A 4ESJA 3H1MA 1S7AA 4QM8A 5D5XB 1IXSB 2P8TA 3FFQA 1HKTA 3KP2A 2KIMA 1W7PD 2FMLA 2PFBA 1HW2A 4HN0A 3EO6A 5F1RA 5HOOA 4KFCA 5H6QA 3H50A 1BJAA 2LKPA 5DEQA 2A5YB 2QUFA 5F6FA 3DL3A 4L0YB 4K8FA 4PIYA 2IC1A 2FBHA 4BIFA 1KGSA 2VN2A 2K86A 4MQ9F 1USTA 1OYIA 4IEYA 5BPIA 3LQQA 2IXCA 1OYWA 2CSOA 1FT9A 4U88A 1LEAA 1TQMA 2CWEA 4HA8A 4LUMA 5I8SA 2MD5A 1R5HA 2XV4S 1GQHA 4RGUA 3CF6E 2FNAA 3AAFA 3EQEA 2ESNA 2X0LA 3LWCA 4IF4A 4WXHA 3SHFA 1QO0D 4M71A 2Y0MA 3SCFA 5A2QZ 2FBIA 3L00A 4UVCA 3GYHX 4ZH4F 1F9NA 2ZMEA 1LEBA 2XUBA 1YW8A 2FBKA 5EEHA 1XD7A 5FO5A 1DGRA 1SMTA 3ABUA 4AD9A 2Z33A 3LOIA 1O4TA 2HOEA 4A0ZA 1WGPA 5K5RA 3ZMVA 5K5OA 5BV6A 1R22A 3ST7A 4AVAA 1X8EA 3P7NA 1PM7A 4RGRA 3EJKA 1Z9CA 1FSHA 4M74A 5DD4A 1MJ9A 1YG2A 4LEJA 3KEQA 2R7FA 1FZPB 4UBHA 4KN7X 2ZO4A 1KYWA 2ISYA 2P5LC 4UXNA 4YRDA 1YUDA 2XRNA 1ZG3A 1L3JA 4U7DA 3CDHA 3FM3A 4QMAA 1HSJA 3G3ZA 4HV5A 4A6EA 1D5VA 1FXZA 4QGMA 3BP8A 1Y0UA 3OCPA 1TW3A 4J1XA 3HRMA 1TNSA 1OD5A 5FCCA 3K2ZA 3N97A 3OD0A 1LDDA 1XSXA 5CU1A 5FPXA 3CL1A 2QQAA 4E70A 2XL9A 2KIFA 4FX0A 1Q3EA 3CTAA 3V7SA 2Y48A 5JSOA 4HOBA 3BU7A 4WX9A 2DPDA 2HZTA 3P9IA 3BZ6A 3BDDA 2PG4A 1SFUA 5LGNA 5ICGA 2QQBA 4IHSA 4YG2F 3I64A 1GHCA 2STWA 5ILSA 2VBZA 4EJTA 3TOAA 3MYXA 4IXAA 2HQRA 3FM5A 3NKTA 4I2OA 5JVTA 4L5IA 3KP4A 2TDXA 4JQFA 5L3GA 2HQNA 1V3FA 1Q43A 1IUYA 4AVBA 1S7OA 4LUKA 1I1SA 1LRHA 2GXGA 4TLFA 4BQAA 4B09A 1QNTA 5J8CA 3TO6A 4WWCA 1YW9A 1RZ4A 5L3CA 1JXSA 3K1NA 1NE6A 3EBRA 3M7GA 2AS5F 4YNIA 2A69F 2XGXA 2P5KA 4UV8A 3U2RA 4HV6A 1ZZCA 2IA1A 1YFUA 3NJZA 1JHHA 2D45A 4F8AA 5J8FA 2ADUA 1U5TC 3T8TA 4CXFA 3R61A 3J81Z 3GFJA 5I0SA 3GFIA 1QZZA 4MTDA 3LFKA 3Q9VA 2C6YA 3I7DA 5LRRA 3IKTA 4I0BA 2KJCA 4HF0A 3GWZA 3LAJA 2ZKZA 1MJAA 3D82A 4Q48A 1FYMA 1NZCA 1IRGA 4N9IA 3WTUC 3QP6A 2OZ6A 5C6CA 3JSOA 3OOPA 3ZQ7A 2LSOA 5D6EA 3C1DA 4CDGA 2QNKA 3DPTA 3U10A 1G6NA 5BUVA 2L02A 2DTRA 2ZXJA 5JSRA 2E1NA 3ZMDA 3Q5FA 1DPUA 2EK5A 3UKTA 4IRGA 5JCTA 2QDRA 2LF8A 2IA0A 1NXMA 1UW8A 4AIKA 4Q0UA 3B73A 4EM1A 3U11A 1KQ9A 3IBMA 3F21A 4LG0B 4GYIA 4QGLA 1WA4A 4AVCA 4HX7A 1L0OC 3FMRA 1LDKB 1B9NA 1F1ZA 1F4KA 2XAFA 1IW7F 4M9SA 5ILUA 1YW7A 3ECHA 4JV4A 4XETA 2GC0A 1J3RA 5CVJA 1QPMA 2NNYA 5I8YA 2L54A 3HOSA 5I0UA 3GLXA 3VFZA 4RAZA 5BS6A 1UB9A 3DFGA 5LEKA 2PA7A 3TDUC 2KJBA 1EH8A 4I02A 5KHJA 5IT9K 2HFHA 1O5UA 2YX4A 2V6CA 2HGCA 3NQOA 1NYWA 5JSPA 4OIRF 2F5DA 5CVRA 1LB2A 3OTFA 5D1IA 2VBYA 3QACA 2Z3YA 3WGHA 4G7OF 3KFWX 3WODF 1GQGA 1YS7A 1OI6A 3RPUA 4CHUA 1J75A 5TRDA 2JSCA 2F5CA 2GH2A 3KLNA 5LGUA 1QQIA 2NAZA 4M9ZA 1B6AA 5HVQC 2CV6A 1Q5OA 5T3NA 3PQKA 3KE2A 4P5OA 5E8GA 3F6OA 2QCSB 1QY4A 2GC2A 1S3JA 4KIFA 2V09A 5HLHA 3FE5A 1ZZ6A 2YR2A 2M45A 5D5UB 2ZBKA 3RJPA 3RYKA 2EFNA 4UVAA 1BOAA 5E17F 1Q1HA 2P7CB 3WTSC 5K5QA 1R58A 2W25A 3O6BB 3H3ZA 4PIZA 3ES4A 3CEWA 3DP7A 4JK1X 4GCVA 2Q0OA 3ACLA 4YSFA 3FF5A 2VE8A 3BWGA 4XF3A 4MGRA 4HAMA 3ULQB 1IPKA 2G9WA 3KETA 3GW2A 2DO7A 2LF7A 1XGNA 3PLQA 1ULYA 2Q2EA 4LULA 2EFOA 3V8JA 2LDUA 2QENA 1D3YA 4BNCA 1DP7P 5BY5A 4EROA 1ZVFA 4OIPF 5FDBA 4JBAA 4HVRA 4HF2A 4L18B 3PVBB 3WTTC 4IEQA 3TQNA 4YARA 4I3PA 4DINB 4EGZA 1P2FA 2RGVA 5DCFA 5KHHA 2CAVA 1XMAA 2XAGA 2HYFA 3WU0A 5FQ0A 2BBYA 4PDKA 2G7UA 4M6XA 2DPUA 4BAYA 4KMUX 4RGSA 3K9TA 5AVPA 2EA4A 4OINF 2K4JA 2HR3A 3WTZA 1QXJA 3C7JA 4I7HA 3C18A 4XSZF 2B8MA 4ZYHA 3BALA 3ECOA 4P96A 5JI6A 3O14A 4HSJA 3S7IA 2MC3A 3V7CA 4LLNA 2F5EA 3HTUA 1SAXA 4HVOA 3FMSA 2NYXA 4AWXB 3E5XA 2EA7A 1ZRDA 1W5TA 2CW0F 3CJNA 3U1DA 1NHAA 2OA4A 4A12A 2ETHA 1CAXA 4XFBA 3U9GA 2XKPA 5FLXK 2BGCA 1YHFA 5ERIA 2H09A 4KWJA 2QVSB 4JTNA 1SMYF 4Z2YA 1U5TB 1R5GA 1IZ1A 3R4KA 1CAWA 4IEPA 1QBJA 5D5VB 1KU3A 2L3DA 3VOEA 4QXKA 2EA2A 2P7VB 4IPAA 4L2NA 4WZCA 2FMYA 1UPIA 3F22A 3WTXC 4A2UA 3F8NA 3REOA 3O2PE 1HSTA 2XKOA 2O61A 2JZYA 2M87A 2M5WA 3MQ0A 2FOKA 3LA3A 3OGJA 4JTOA 1YLLA 2MA3A 5AIQA 5DDGA 5EEGA 1KA8A 2DK8A 2W85A 1U6GA 3L09A 2FF4A 1ZZ9A 5D4SA 3JAMZ 4MGIE 1YWKA 2K27A 3KGLA 1R7JA 2JT1A 2M8EA 5CVUA 1I6XA 1WSUA 4MUVA 4QWQA 2BNNA 3TGNA 3RTRA 1XE8A 2VONA 4XBFA 4ENKA 1QWRA 1ZG1A 2ACJA 2FNPA 1ZGJA 3O3KA 2ESHA 3K69A 4G9YA 2OZUA 1J3PA 4BHPA 1U8RA 1S29A 1R36A 3F8MA 1HKSA 2QZ8A 5FFZA 1GXQA 2GQQA 2WC2A 4HZFA 3TO9A 4Q0PA 2Z5UA 3ZN0A 4GO1A 4AXOA 4M73A 5D4RA 3ZP5A 2D40A 1TLHB 1RIOH 1Y9QA 4LB6B 1QXRA 3C3WA 3SXYA 1J58A 2FSWA 2UWMA 1FI2A 2HKOA 2PI0A 1IXCA 5LHIA 1IN6A 3WG9A 3LSTA 1OMIA 4LMYA 5KVRA 5TJJA 4RGXA 2BNOA 2P6TA 4Z82A 3DKWA 3QU6A 4IRIA 1YQAA 4WXCA 1Y3TA 2XL7A 1T2KA 1K7AA 2IXLA 3QOPA 5KHIA 4OIQF 3EYYA 4P9GA 5FGMA 3T5XA 3TDZC 3CUQB 1P4XA 2Q4SA 1RI7A 4BHCA 4HQEA 2MPFA 1UCRA 3WW2A 3KMHA 4KIGA 3BOQA 6PAXA 1LKNA 3QU3A 2EV0A 2Z2SB 2J5OA 3JTGA 1S6LA 3BCWA 2O0YA 2VOPA 4UVBA 3J7AO 3FWEA 1OFNA 2BYVE 4PIXA 4P9UA 2F4PA 3HIFA 5K8SA 1U12A 2RV8A 1ZRCA 4S05A 2WTEA 1CF7B 4YIFA 4M72A 3I54A 1MKMA 3KSCA 1HBXG 3BPZA 4MGZE 3G7DA 2QWWA 4IJAA 4IEXA 1YFHA 1CAUB 1U2WA 2C0ZA 3GFMA 5J7MA 1BI0A 4H0EA 3RDIA 2HTJA 3R0JA 3KP5A 4RAYA 4KA4A 2DT5A 2DW4A 1X82A 3E5QA 5J3UA 4Q4ZF 2Z9OA 4A0XA 1SFEA 3W6JB 2YX7A 3ZN1A 3ABTA 1X3UA 1B59A 1DPRA 3P9KA 1LNWA 4EJVA 3DEUA 3FXQA 1R1VA 2EV6A 3R60A 4NHJA 2HS5A 2DAOA 2OA2A 5HDNA 2OAZA 3KCCA 3HSRA 4OMZA 3P9CA 3IDBB 1XMKA 3IL2A 3V8KA 4U0VA 3FZ3A 1EH6A 1K78B 3Q9SA 1PDNC 3VB2A 3I53A 3M1EA 1IN7A 4I98B 1T0FA 4M9XA 4O6JA 3GFLA 2PJPA 3HRTA 5A2QK 3E6CC 2A3SA 3IWZA 5EZWA 4HN1A 1G3YA 1MZBA 3SXWA 5LGTA 1JE8A 1Z91A 2UZKA 1P92A 4QLCU 3JW4A 4ORFA 4J1WA 4L9TA 5H6RA 1L3LA 1Z6TA 1O7FA 4GXOA 1MD0A 1BBYA 3LA2A 2D1VA 4KICA 4RD7A 2VC0A 1KQ0A 2PFWA 2COMA 5FFXA 2QBYB 3NVCA 1ONVA 5DUIA 4Q5SF 2Z99A 2D5HA 2EFWA 2HJIA 4RB0A 1ZRRA 4WVZA 4U7BA 2FU4A 4YIIA 1ZZBA 4E2QA 5K1YA 1O5LA 4BHBA 3I59B 3R6SA 1UIJA 4IEZA 1XCBA 3HT1A 5L3BA 3S2WA 2VT2A 5JR7B 3V8LA 4HMZA 3R0AA 5AONA 5ICCA 1WKMA 2MBFA 4QX5A 3LA7A 4HLTA 2UYBA 3LWFA 3HTSB 1XE7A 4G6QA 5CYVA 4IEWA 2VBWA 4MHGA 3WGGA 1H9GA 1FPQA 2YPRA 2XLGA 3H9AA 1SD4A 4B8XA 2BEOA 1S8NA 5L3DA 4I0AA 1EH7A 2XASA 1SEFA 4LD5A 2N7GA 3WTVC 5E1XA 4CZZA 4XFGA 1DZTA 1SFXA 1PP7U 3TNPB 4EJUA 4IEOA 2ZNYA 2CO5A 4KL1A 4Q0VA 3FMQA 1HKQA 2GA2A 2ET7A 4R1HA 5LHGA 1ODDA 5DCMB 1QGPA 4CGZA 3RNSA 4XFHA 5E1WA 1J7KA 4ZYGA 5I93A 3RKXA 4XF4A 1IN4A 5ED4A 1WRJA 2XIGA 4YFNF 1ZNPA 4UUVA 4FX4A 4LK1F 3LZZA 1ZLJA 3T8RA 3CLPA 4RB3C 2VQAA 4L11A 2P5VA 4MGYE 3RYRA 1LQ1A 3LQRA 2CFXA 1T39A 4LFUA 2GZWA 5KK1A 2CG4A 4IHTA 3V7RA 2DU9A 2K4BA 3M9AA 2H0VA 4AQ6A 2UXXA 1XCVA 1TQPA 1C0WA 3QPTA 5IT3A 5HDGA 4NVPA 5FB2A 3BJAA 2MLKA 4MX3A 1FX7A 3UKNA 3FZVA 2OD5A 1J9IA 4Z07A 1FYLA 4LB5A 1UD1A 1RUOA 2BE5F 2O1QA 4XFFA 4BXUA 4RS8A 5JHUA 3J81K 1CX4A 2EFPA 2FE3A 3E6MA 2W24A 1G3SA 4Q0QA 5D5WB 4WK8F 4HDVA 3KLOA 4G8XA 5FD5A 5BOXA 1YTYA 2FA5A 3ISPA 4HSLA 5BXXA 3PFIA 3PNAA 3N4MA 2H6BA 2ATFA 3I4PA 2IRFG 3BB6A 4Q29A 2O8XA 4FAGA 2GIVA 2XAJA 4CYDA 4UXAA 5HS7A 4KN4X 3T1BA 4AVPA 4GYGA 2EB7A 2W57A 4AIHA 1STZA 3IKVA 3DQVC 4H7LA 2HTSA 3ZMUA 2H6CA 3DN7A 5FLHA 2VOOA 3CLOA 1K6OA 3F8FA 1A04A 2O6GE 4ZU4A 5JFRA 3ML6A 1I5ZA 2Y75A 4CO8A 2E1CA 2UY9A 5LLQA 4LJZF 2V1XA 3MCZA 2G7HA 2IXHA 3EUHA 5D8LB 4JVAA 4EWEA 2UXNA 2ZCWA 5BMZA 1O3QA 3VODA 1TNTA 3H1YA 2PAMA 3I58A 4ONUA 4LK0F 5H20A 4D0PA 4META 3J80Z 1KYZA 1WQ2A 2IXKA 1FBUA 4ZZDA 1RC6A 4EV0A 5FLJA 3F3XA 2M1BA 2VODA 2JPCA 1DZRA 3LAGA 2RVCA 4KMFA 3WU1B 4ESBA 2ELHA 1RTVA 1P6RA 2UY8A 1ZX5A 3H92A 1W7PB 4FHTA 2IJLA 4R8HA 4QM9A 1IF1A 1B9MA 1J2XA 2QQ9A 1UIKA 1FNNA 2VPVA 3I5UA 1VJ2A 4FAHA 3GVAA 2RDPA 2HDCA 1CAVB 2D5FA 4PZJA 2QJVA 3FX3A 3HRUA 3MFKA 5C8WA 5FQ0B 1IN8A 5BPXA 4OLLA 1YFYA 5D8KB 1O3TA 3GUDA 1O3RA 1WI9A 1TW2A 4LA2A 1Z7UA 4XFAA 2IXIA 1XRUA 3IWFA 1MJBA 4ZU5A 4TV7A 1LJ9A 1MDMB 3WW4A 3WW1A 4BH9A 3RZZA 1YO5C 2FQPA 1YLFA 1J3QA 2DLLA 3GZ6A 4DQ2A 1VTNC 2V9VA 1XSVA 2PTMA 1RL3A 4EWDA 1ZRFA 1ZH5A 4Y13A 4EM2A 4X6QB 4FBFA 1XGOA 1R00A 4PJYA 4O5VA 3EYIA 5HLIA 3WE3A 5J48A 2OZJA 2H27A 3E3VA 4PCQA 3SHRA 3K1MA 4UHTA 3QAHA 2GAUA 3D5LA 3RKWA 4EJWA 4IEUA 1V4RA 3QP5A 4KNYA 1CGPA 3KZYA 3ZPLA 1FSEA 3L9FA 5FD6A 3LAPA 2DCTA 3IRQA 2E7XA 1D8JA 2MHFA 2KIUA 4ZYDA 5I91A 2PYTA 1J59A 1PMIA 4ENNA 4UNOA 3K0LA 1TTYA 3GBFA 5F64A 1WWXA 2EWNA 5CVIA 4GGGA 4KU7A 3CUOA 1XGSA 4O9GA 5DD8A 3RPQA 2E9QA 4K2EA 2OQRA 3H8UA 2B5HA 4X6RB 1Z1DA 3S0MA 5BPDA 4KIBA 2HEOA 4GULA 3H3UA 4RB1A 4HF1A 3W6KB 5I0TA 2X4HA 4KUMA 1I1GA 3MEXA 3E97A 3ELKA 4HBNA 1ZN2A 2A68F 3GX4X 2CYYA 3CUQA 4EVIA 4RB2C 2I45A 4XF0A 4HBLA 2EFQA 1QZYA 1LR5A 3JTHA 5HS9A 4BYYA 2PHDA 1R23A 4M6YA 1GVJA 4LLGF 3EDPA 5CVVA 3D0SA 2GXBA 3ZDSA 2IW5A 4MNUA 4A6DA 5ICFA 4R79A 4LLLA 2L4AA 3K1PA 2O8QA 1T98A 2MLGA 1PP8F 2WV0A 2HWVA 3RI4A 1PUEE 2YU3A 4P9FA 2NRAC 1W5SA 4MEYF 2XAQA 1CF7A 2K9ZA 1FC3A 3I0TA 4XLNF 4B29A 2ZMEB 2XHKA 3COAC 3JAMK 3MZYA 1E2XA 3SQNA 2PQQA 3CO2A 4IEVA 5E18F 1CAUA 2GU9A 1KQ8A 3OV8A 3HSFA 2V1UA 2GA1A 2W84A 3DV8A 5JR3A 2OYZA 3JSPA 4FT8A 3MWMA 3HQXA 5HDKA 3E6BA 2M30A 1IXRC 3U0ZA 1WLTA 3KEOA 4QGNA 2PBIA 3L2HA 2A61A 2BNMA 5ICEA 3WTWC 3I71A 4AQ2A 4E2SA 2RN7A 3H7YA 2CQKA 1BN5A 3ELNA 2VBXA 4MV2A 5EFUA 2XROA 2IP2A 5LEJA 1E17A 5D6FA 3KZZA 1DGWA 2P6SA 3KGZA 3SCGA 4OFGA 3SZTA 1T6SA 3EETA 4XLPF 1O7LA 2F5FA 3SCHA 3USSA 4YFKF 1U3EM 2QLZA 4N0BA 1FBSA 1K79A 3DPLC 1K78A 4U0WA 2CAUA 3VHRA 1ZG5A 4L9JA 4KDPA 1EP0A 2MNGA 3L2CA 1NE4A 1O57A 4L9NA 4ENMA 1FP1D 1G3WA 4ENJA 1DDNA 4LGWA 3KP7A 2ET1A 2ZFWA 4A0YA 2A07F 3V4GA 2PAEA 2RKHA 3EHKA 1FY7A 2EV5A 2ZNZA 2EAAA 1R1TA 2K0GA 3GZ5A 4ESFA 2IXJA 3PQJA 1R1UA 2QVOA 1O3SA 4MTEA 4EMSA 4KYWA 4G6DA 4HDUA 1RNLA 2QM3A 2QBYA 1REPC 3MAJA 3CJXA 3HSEA 4Y17A 4HX8A 1HW5A 2OQGA 1EYBA 2EVXA 4O9EA 2PEXA 3I59A 4Y15A 1LVAA 2KXLA 4I09A 4HQMA 2V1DA 5IT9Z 1BI3A 2O3FA 2AXLA 1ON2A 3WW3A 1XDUA 5FLIA 2D1HA 1HW1A 2B0LA 3F23A 3E6DA 3GYDA 2FRHA 2CGPA 3HUGA 2J5PA 2H94A 5I0RA 3L7WA 2ZKLA 2Y0OA 4MQVA 1YFWA
chains in the Genus database with same CATH superfamily
2GN7A 1VQ9I 3AJZA 1XDSA 3VYSB 4D7TA 4XRFA 3C3VA 2QQMA 2HDWA 1TQ5A 5C4WB 3TO7A 3LMMA 4HLYA 1XYNA 2FQ3A 4O3MA 4LBLA 1BXHA 4UV9A 4HVQA 3ZMZA 4AGGA 2X48A 4DS0A 1R1A1 1AOYA 2GC3A 1BC8C 3VBUB 2FCTA 5C9AB 2DFHA 1F5TA 4TTGA 5FK7A 4LG0A 3ZQCA 5HPOA 1USSA 4IERA 1LOBA 1JZ7A 3PVOA 5A3WA 2CV1A 3AKRA 2R7OA 4A5MA 2XJUA 1UMZA 4PJMA 3R0RA 2E19A 2VZUA 4FPOB 4P55A 4M3CF 2OU2A 4EWAA 4G4FA 1MQTA 2O03A 1ST8A 4LG3A 4NAOA 1B4AA 2E35A 4LXLA 4F7ZA 1J5YA 4W50A 1LDJA 3AKPA 3HHHA 1GU3A 3IDCB 3VBRB 4XRSG 3ZN6B 4IHWA 3DCFA 3OYBA 2P37A 4OOIA 3GALA 3SMHA 3GHMA 4M3EA 2FDFA 2G9FA 4Y1UA 1RVF2 4NB5A 4L0PA 5FYUA 3BQYA 5CZKA 4LA3A 4OHXA 1OPCA 4E7JA 1YI7A 1SD6A 4KU8A 4D6RA 4HLXA 3RYPA 3MLJA 5JLWA 3X2QH 2Q1ZB 2X6YA 4ITCA 4CYCB 3H0OA 3AL0B 3FKJA 4XF9A 1UCXA 4BE2A 1Y1WJ 2AYHA 4NIIA 3ZXDA 1QJY2 1IG7A 2STTA 2BOIA 5C3QA 5CFCC 3GO5A 3I2JA 1M1EB 5F5IA 3PURA 2KRFA 1VBB2 1SHWB 2VGDA 1X7NA 2WRAA 4KT6A 4E2GA 1ULCA 1EV7A 3BOPA 4JKKA 2PLYA 3D6EA 2ERFA 5JPNB 3GTQJ 2Z1DA 2EJRA 3CP2A 5FZEA 1WD4A 4EM0B 2E5ZA 5EGOA 1OPMA 2BHZA 4XF1A 2KKOA 1H0MA 5IFTA 1OYYA 2NNNA 4RLQA 1GWMA 4KNCA 5L7OA 4IRHA 3H5RA 3TKYA 4AYBN 1AWCA 2SLIA 3PJRA 5FREA 5HS8A 3C7EA 2R7DA 2E63A 3A23A 1APNA 3KB5A 4BACA 3F8CA 1BHGA 2DA5A 1JXNA 5JMCA 2OT7A 1EA3A 4MZUA 2VMHA 5C4XJ 3WNKA 2WAEA 1SQ4A 2ZGOA 2IS1A 5LHHA 3BJOA 1LTEA 1RGSA 4GH4B 2L9NA 4HK8A 3VBHC 1W7PA 2OQ7A 1GWLA 2XB0X 2A6HF 1SBEA 1WCKA 5F2SA 4MEXF 2KZVA 1DCSA 1URXA 3CNAA 1BIBA 3KV6A 3UKGA 1NK2P 1YX3A 3ACIA 4MFEA 4BY1J 2A5ZA 3HNBM 3S2DJ 3RZOJ 2DK5A 3J7YJ 2B9UA 1FYKA 1DF0A 2E2IJ 3I97A 3HGGA 1B8IA 3IIAA 4CDWA 1FWZA 2BVMA 2DCYA 1U5TA 1W90A 4M0HA 2H0BA 2Z69A 5H9RA 3OGVA 4BE3A 4WXDA 3OYDA 1G3TA 2A6WA 3ILRA 4HX4A 2D3RA 1K61A 1SBDA 1GUUA 2VXJA 2QE3A 1VP6A 4RAGA 5BNGA 1ZBE3 2LG4A 2XJSA 3IPVA 4AYUA 1A3KA 1PVC2 4FXKB 1KONA 1I50J 5LK5A 2ZGLA 4W6YA 4CCLA 2TRTA 5E20A 1BK0A 3IKWA 4COYA 3MZHA 3O1VA 2R063 3HRSA 4ZYEA 1UZZA 1I3AA 3TB0A 4RAFA 1WD3A 3NJXA 3F72A 1ZHFA 1B1BA 1XTAA 3H1WA 5J1YA 5CLSA 1AU7A 1ZBE1 3ABLH 3NSTA 5SV5A 3NL1A 1AL23 4AIJA 4O65A 1MZ5A 5KHKA 4MGKE 4CU8A 1VQKI 1FMD3 3BTJA 4TLGA 3SKVA 1IV8A 4GAZA 4XHBA 1PO23 2JDMA 3V56A 2RREA 4Y22B 2JWPA 5LZ6A 3GF2A 2W46A 1GLNA 2JUCA 2D5VA 2DTZA 4NHKA 4B48A 2R061 3UETA 4IETA 2ZJ2A 1H30A 3VDCA 3VV1A 1EPZA 5IOZA 2R30A 5D2AA 2E7AA 1HJFA 1DDLA 1FP2A 3H1MA 1S7AA 5D5XB 1IXSB 3B00A 4RYDA 2IVIB 1HKTA 1W6OB 2PXJA 4YM0A 4A3ZA 1HW2A 4LMFA 3FXOA 2JDAA 3WF4A 2V7FA 3HQRA 2DVAA 1AR72 1AL21 3I4IA 1BJAA 2JIJA 1FMD1 2QUFA 2DVBA 2RVAA 4C2TA 1PO21 2QQ8A 4K8FA 3OB8A 1KGSA 1GZWB 1ZR2A 3C7FA 1OYIA 1DQ6A 3ZFEC 2LBFA 2CSOA 1FT9A 4U88A 1X2NA 1PVC3 3ABZA 3TRSB 1RUI2 4LUMA 1R5HA 3B6CA 3EQEA 2ME6A 4A3FJ 5A33B 4D6SA 2Y0MA 2V26A 4OUSA 2FBIA 1YC61 1EV13 3QOEA 3GYHX 3PIJA 4AC0A 2ZMEA 2FQ4A 3DEEA 2ZMLA 2XUBA 3ZPOA 2FBKA 5M5XJ 2E33A 1A34A 1R093 3HN1A 4N7IA 2Z33A 3LOIA 1O4TA 3MO4A 1PVC1 4KGQA 2HOEA 2GP5A 4RM3A 2JA5J 3CF2A 3HL2A 4LBOA 4MOAA 2NS8A 5BV6A 1R22A 3ST7A 4AVAA 2HEYF 5B1AH 2ME0A 1X33A 1WMFA 1PM7A 1K5MA 4Q2FA 1MJ9A 5KCMA 2CQ7A 3CD6I 1FZPB 1BBT2 4KN7X 2WINB 3FL7A 2ISYA 1QRYA 2P5LC 2CUFA 4UXNA 1BA5A 1EV11 3GJAA 2JG9C 1DP0A 1YUDA 1ZG3A 3N9QA 1L3JA 4U7DA 4A6EA 3WNXA 4BU2A 4QGMA 1NY71 3VBHB 1R091 3IIIA 5GLTA 1Y0UA 4A7YA 1RUD2 3OCPA 1X1BA 1TW3A 3HRMA 5FYSA 1OXCA 3ASNH 4LKDA 2X6WA 2OV7A 1KRIA 1ETXA 3OD0A 2EZKA 4M3DA 3L2UA 3S1NJ 4KGGA 1ZRIA 3IZOA 1YIJI 1Z0XA 1C28A 5DM7F 2R92J 4AFMA 2X51A 3V7SA 2Y48A 1E0EA 1LFPA 1LOAA 4ARYA 4U87A 4KH9A 3IB3A 4K1YA 3LFIA 3APBA 1R49A 1WMXA 2WIIB 2D3SA 3G6JB 5ILSA 4RBOA 2VBZA 5FRAA 1NX9A 1W9YA 3MYXA 2Q1MA 5A3UA 3UT0A 1X19A 1OFCX 2JKBA 3NKTA 3KT1A 3KP4A 2TDXA 2QQNA 1JI6A 3MLKA 3JR9A 4BE1A 1Q43A 4AVBA 4CP9B 1FNZA 2XB6C 1S7OA 1ODMA 2G1MA 4B09A 1RITA 1QNTA 5J8CA 3ALQA 3TO6A 1YW9A 1JXSA 3K1NA 3O0WA 4BBSJ 2A69F 3U2RA 4HV6A 3POBA 5A3OA 3HPNA 1POV0 3VBSA 1BBT3 3NJZA 2GMMA 5C4WA 3WDYA 1OHFA 1JHHA 2AGSA 5FLMJ 3S1MJ 3MZ8A 2W39A 3VZOA 4D9JA 2J7MA 4AWDA 3GFJA 3PTRB 2WKKA 3USUB 3N9OA 5C9AA 4FSJA 4MTDA 1OC1A 3LFKA 1AYM2 4CP0A 3J7ZI 1HN0A 1RUD3 5LRRA 5M3MJ 3I2GA 3IM0A 2KJCA 1ASJ2 4HF0A 1H8VA 2ZKZA 3D82A 1YOVB 4AI2A 3PNTA 3S2HJ 3RZDJ 3QP6A 2VTXJ 3N35A 2PMZA 2WSVA 2J1RA 2VUMJ 3ZQ7A 5D6EA 1BBT1 3U21A 4LHSA 4CDXB 4QX7A 4LHLA 2DTRA 1PO13 1DPUA 3UKTA 5LWBA 4IRGA 3VBRA 3ZFEB 4AZZA 2EXHA 4C9YA 1RUD1 2JB8A 3U11A 2O8OA 1BEV3 1GZ9A 2E34A 3VWBA 4D5FA 4RGGA 2B9SA 3UJQA 2BOLA 1WA4A 3MKLA 2KT0A 4MO7A 1XNBA 5FKCA 3FMRA 3ZQQA 1F1ZA 2XAFA 1YW7A 4BDYA 4XETA 3VKLA 1PGSA 1JZ6A 4CYCA 2VW1A 3RWKX 2L54A 4PJNA 2ADEA 1QDOA 1TG7A 1FV3A 1UB9A 3GLLA 2ZGRA 3TDUC 4I02A 1EH8A 2R7RA 4Y1VA 1PO11 4FFHA 5IT9K 2YX4A 4QB2A 3OSDA 5EYXA 4CU9A 4OIRF 1AJOA 1LB2A 3MF6A 3OTFA 2VI6A 2D6OX 1YS7A 1BEV1 4Z8BA 3WDTA 1C5HA 4CHUA 5HV4A 2KRCA 5HODA 2XUMA 2ZBJA 2L9VA 4PF5A 4CCKA 5GTIC 3T1MA 3S15J 5LGUA 3VDBA 4A41A 1B6AA 5HVQC 3EB7A 3UESA 2XC7A 1AYM3 1ZYBA 2UWAA 1J1TA 3LSJA 4YVWC 3DLLF 5DM6F 4AU7A 5DG1A 5HLHA 2YR2A 2JG9B 4NWWA 1I39A 2J1UA 4PQ9A 2ZBKA 2EFNA 1BOAA 3WQBA 2P7CB 3WTSC 5K5QA 3H3ZA 5T5LA 1R6RA 3ES4A 3CEWA 1BW6A 4GCVA 2Q0OA 4YSFA 5BNQA 1BR1A 4MGRA 5T54A 4OYUA 1IPKA 4B7KA 2CWMA 5FYVA 3GW2A 4R9AA 3HOUJ 3DXUA 1C8M2 4GH4A 2Y9YA 1AYM1 4J6GA 3WG4A 1XGNA 4B44A 1ULYA 5B4XA 4PFOA 4RA0A 4BISA 1WH5A 1HRV2 4GB33 1D3YA 1ULGA 4BNCA 2RAEA 5BY5A 3ZSKA 4CP1A 3DKYA 4JBAA 4M3CE 4L18B 3PVBB 2RS12 3WTTC 3TEYA 4A42A 5DCFA 5KHHA 3T2QA 3SEZA 4H7MA 2XAGA 4ZDLA 2G7UA 1QU3A 4M6XA 3JCUC 2FCUA 1WJ5A 1R1ZA 3NMBA 1DGWX 3D5OA 2EA4A 5FRNA 1RUG2 2HR3A 1ZR4A 4AQTA 1QXJA 1JT6A 3C7JA 4XSZF 4ZYHA 3ECOA 4P96A 1G59A 4HSJA 4GQ7A 1BR2A 3V7CA 2F5EA 4HVOA 2VULA 3FMSA 3MUZ1 4AWXB 2H1LA 2RJ2A 1ZRDA 2CW0F 4GB31 5BNPB 2YUSA 3Q8CA 1LFBA 2OCCH 4UF0B 4XRSA 2LALA 1TZLA 3KQ4B 5ERIA 2XRLA 1D0HA 1RRJA 2E7QA 4PUSA 1SMYF 4HKLA 2CW7A 3HD8B 3HVDA 3THTA 3FBYA 3P5JA 1R5GA 1IZ1A 3R4KA 2L3DA 3GM8A 3WDXA 2EA2A 2P7VB 1JGGA 3MIFA 2VCMA 5EJZB 4WZCA 1U0JA 1MMDA 3F22A 2XVLA 3ZFFC 3VLBB 3REOA 3QQAA 1JOJA 4Y22A 1S0DA 3E7LA 3TMOA 1PX3A 3RMYA 5DDGA 1PVXA 5EEGA 3CMAI 1KA8A 1UYZA 5F9TA 3O1TA 2D3PA 2VQUA 4XJUA 4LKEA 1UZCA 2VASA 1U6GA 2CNAA 2OJED 3JAMZ 4MGIE 4XACA 2A7AA 2CMPA 3KGLA 1R7JA 2M8EA 2WV1A 5CVUA 3ZQHA 4MUVA 2I74A 4QWQA 1OCCH 4FFFA 1W6OA 1YQ8A 3TGNA 3RTRA 5FROA 2MD0A 1Z7S3 2RS13 2XMLA 1W2UA 1QWRA 3HB9A 4NAMA 4YGCA 1G9DA 1IOAA 2WAQN 3X29B 2UUZA 3K69A 4UFHA 3FHNA 2BV4A 4ZZ8A 3K4CA 1U8RA 3MBWA 3F8MA 3NV4A 4D3WA 2WQ4A 2QZ8A 2DCEA 3ZMOA 5DG2A 1GXQA 2GQQA 2WC2A 4Q0PA 2Z5UA 2R7ZJ 2JDYA 4M73A 5D4RA 4BE0A 1OQDA 4JGYC 3PDQA 3ABMH 3SXYA 2UWMA 4A3XA 1Z7S1 2RS11 4CDUC 1IN6A 4IL6C 1MSFC 3CCMI 1H2LA 4NPRA 5TJJA 2VVFA 4HT1T 4IRIA 1H6XA 3S16J 1YQAA 4U2AA 1TT0A 1Y3TA 4C2MJ 3S1RJ 1N3QA 1RYYA 3DCQA 4YVWB 4ITVA 5FGMA 4NRQA 1ULDA 4A7ZA 1W28A 3VSLA 1LOCA 1SFOJ 2WYSA 2MPFA 1U5XA 3BOQA 1XQNA 1S0FA 2J5OA 3JTGA 4Q1RA 2KZGA 4UW3A 3BCWA 2O0YA 1WLDA 2LTPA 2RNGA 3FWEA 4RM2A 3M8LA 3ESWB 3CF5F 3VBHA 4E8DA 3HIFA 1FV2A 4XTPA 2WTEA 2ZACA 2CQQA 4ZYAA 5E3NA 4Y20B 2ARAA 3AL6A 2OX0A 4DOUA 1YFHA 4QX2A 3GFMA 5HXMA 4H0EA 3RDIA 1X1AA 2M4KA 2DT5A 2EIBA 1X82A 5J96B 3E5QA 4LIVA 3WF0A 1W6MB 3UR3C 2DA6A 1NOVA 4YW7A 1LE8B 1JYXA 3A02A 2KDOA 3P9KA 3IUOA 3BCAA 3FXQA 3VSKA 5IY5H 2RG4A 4NHJA 5FMOS 2WO1A 2VBPA 1C57A 3WF2A 5HDNA 5IHRA 3HSRA 2JDNA 3NNJA 1VRH3 3TW7A 3P9CA 1XMKA 2WADA 4U0VA 5IPAA 3FBIB 3PVEA 3HOBA 4DUXA 4CP9A 4DPNA 4PDWB 3I2FA 3I53A 1LHUA 3GJBA 5KWRA 3E6CC 1ND2A 5EZWA 4HN1A 1G3YA 3BR5A 5FZHA 3WDVA 4E8CA 3CMYA 5HNFA 4ORFA 2LR8A 1O7FA 3ZFFB 1KFUL 2RQQA 3VN4A 3KYCB 1HRI2 2Z4FA 2UWCA 4KICA 5F27A 2RDNA 1YRNB 2PFWA 1VRH1 1CIYA 5DUIA 4Q5SF 2VOXA 2X53S 2VU9A 2JD4A 1F8VA 2XGEA 5DABA 2WZR2 5FMOL 4U7BA 1QNYA 1QOSA 3LOBA 1O5LA 2AHQA 1US3A 4RQPC 1ND3A 5CKQA 1XCBA 3WU2C 1TE1B 5JR7B 3T3YA 5EJ3A 4HMZA 5C5TA 1S0CA 4QPGA 2QSHX 1JHNA 2VUCA 3HUGB 3FLPA 5CYVA 4MXVA 3BZCA 2VBBA 4CDXA 5JXHA 1CJDA 5IOYA 4MHGA 4PBOA 3WGGA 3RZKA 2VZVA 4BWOA 1SD4A 4YZ3A 2XPVA 3ZFEA 2XASA 4LD5A 1DQ0A 3WTVC 2BU9A 1OURA 1V6KA 4QPIA 4CZZA 4XFGA 1DZTA 1F43A 1SLIA 5T55A 4FETA 1N3PA 2BGOA 3CHXA 4Y4RA 4JGYB 3DBRB 3POGA 4XYXA 4R1HA 2WNUC 1C1LA 5DCMB 4JRAA 5F3IA 4CGZA 3RNSA 5EV7A 4XFHA 1OKOA 1H4HA 2XG3A 4CDUB 3G6EI 3CJQB 5ANQA 3VYTB 1IN4A 5A3MA 1VI0A 2DCJA 1ZNPA 3EPZA 4QT6A 3B6AA 4LK1F 2VOTA 3LZZA 1E3HA 2JKXA 3CLPA 1N3OA 2GH8A 3JD72 2LC2A 4E27A 1RMU3 1LQ1A 1PMHX 1LFUP 2WZEA 2WA4A 5IVBA 4NOTA 4UW6A 2K4BA 4EN6B 2ZJPF 3EUAA 4M00A 1WJBA 4AQ6A 3VKMA 5TISC 4CCJA 5F37A 1SC7A 4E7LA 3MIGA 5HDGA 3IAPA 5FB2A 4CA9A 1H4GA 2P5BA 1G9BA 2ZXQA 2AUYA 2ORZA 2ZGMA 2JG9A 3FXJA 2O1QA 2G0EA 4BXUA 1RUJ3 3OS1A 5E89A 2FD8A 1RMU1 1DGRN 1RR8C 2WAAA 1JMUB 3KLOA 1XU1A 2QZ2A 1POGA 1YTYA 3PUBA 1MBEA 3ISPA 3IN9A 4HSLA 4UB8C 2A5WA 1IHMA 3NAUA 2ZGUA 3BB6A 2IFRA 2O8XA 4AHXA 3GZNB 2E32A 2KIQA 4LE3A 3FXMA 3U1KA 1S0BA 2EB7A 2G9GA 2W57A 1FPN2 4AIHA 2R4GA 3IKVA 5IAXA 4H7LA 2HTSA 2H6CA 2VOOA 3CLOA 2DVFA 3F8FA 5I0DA 1A04A 5JFRA 2I10A 3ZSJA 2JDHA 1I5ZA 1RUJ1 3FLRA 4GJZA 4D69A 4CO8A 1N75A 5LLQA 2D6PA 3OY8B 4INDA 4LJZF 5FZ8A 2VUAA 2XB5A 1OCOH 2V1XA 1FOD2 3VL8A 5IP9J 2GXAA 2TNFA 3CP8A 4XLHA 2G7HA 4AEDB 3T0BA 1PGL1 2K9SA 2UXNA 1TNTA 2PAMA 4Y26A 3O1RA 3I58A 1JT0A 4ONUA 4AG4A 5H20A 4META 2IXKA 3SH4A 5CFDC 4Y7NJ 1FBUA 3I3LA 4XBNA 1R4NB 4OI2A 4DB5A 2CU7A 1C3HA 2VODA 2JPCA 4A3GJ 4KMFA 3DECA 3W58A 4P9XA 2GNDA 3ZR5A 5BNPA 3ACFA 4BIOA 4UF0A 3J7AY 4FHTA 4R8HA 1IF1A 1LU1A 1J2XA 1FNNA 3OYGA 1OCPA 4FAHA 3GVAA 1CAVB 1EAH3 2OPTA 1W0OA 3FX3A 1XB9A 1DHKB 1JZ5A 1Z7UA 3WCRA 1XRUA 3IWFA 4RQPB 2W94A 2EPFA 1LENA 3AP4A 1U9OA 4BH9A 3D4KA 4OQ9A 2K5CA 3CCUI 5LA0A 1UAAA 2ZXWH 5FKNA 3THPA 4IZZA 1K5JA 1W36D 3EYIA 1JKRC 4YZ2A 1EAH1 5JI9A 3U1XA 1QH6A 1R64A 4FPJA 3OSGA 1B35C 4XDOA 2GAUA 3RKWA 1XNDA 4IEUA 4ZKTB 1XU2A 5FTTC 1J09A 5A3PA 1CGPA 1OQ1A 5A1LA 3KZYA 2GLOA 3Q0VA 2W1UA 5FZOB 3WEZA 1XYOA 2WNOA 2KQRA 3RI8A 4ZYDA 3I2OA 2WQ8A 5GLWA 2PYTA 4ENNA 3K0LA 5LB6A 3GBFA 1IS3A 5F64A 2F6CA 3AG3H 4KWUA 2VCBA 1W2AX 2HWE2 1QF3A 4K2EA 3KF3A 2R7SA 4FO9A 4FFGA 3RSJA 4GULA 2I5UA 2V4VA 4RB1A 1KJRA 4AHWA 5I0TA 3NWTA 2LK2A 4KUMA 1V6NA 4YVWA 1XS9A 3AMNA 1D7PM 2CYYA 3MUY1 1CD3G 3PL0A 3PIGA 5B1BH 4LBQA 2JXAA 4RB2C 2ZJQF 5F1JA 4HBLA 5IT6A 1J83A 1AR93 5HS9A 2KHMA 4BYYA 2PHDA 2VQTA 3EDPA 1A6CA 4Q4X2 4XL9A 3ZDSA 2VQCA 4A6DA 4QU2A 2L4AA 1T98A 2MLGA 1T08B 1PP8F 1UY0A 3K4AA 1MEC2 4MVTA 1PUEE 1JYCA 1UU4A 1NUKA 4K6BA 3OYWB 4XLNF 3S17J 1COV2 4Y20A 3RMXA 4ZS3A 1VBD3 1Q56A 5CG8A 1YQ2A 5E18F 4E7SA 2L7MP 2BP6A 3TYJA 3MIEA 1BW5A 4XIDA 1AR91 1APLC 1UZYA 4AYBA 3UJOA 3OYFA 2WN2A 4AI9A 3U0ZA 3KEOA 4QGNA 2PBIA 1LE8A 1UNBA 3L2HA 3PM1A 2A61A 2BNMA 1K4SA 2XR4A 4CEYC 4MGQA 3WZ1A 2RN7A 4MV2A 4S2GA 1H1AA 1DGRM 5LEJA 4UUSB 3CZ6A 5CFDB 1MMGA 5KR7A 3HWJA 4QAWA 3FDYA 1CN1A 3EETA 1NLRA 1O7LA 1VBD1 3N36A 1EPWA 4CCCA 4XUOA 2DVDA 1K79A 4YG0A 2CAUA 3HKZN 3VHRA 3F95A 4PDWA 4MXWB 4NE9A 1Y1VJ 4KDPA 3WINE 1GP6A 3H42B 3S5AA 1PHMA 4UFMA 3C2BA 4ENMA 4OMCA 4I3GA 4ENJA 2PHUA 4FPEA 2NLRA 2DODA 4UW4A 1YEWA 2VD7A 3ZFFA 1V6IA 2OUMA 2E36A 5CNAA 3LSGA 1V6OA 5LA2A 4DBQA 2HBUA 2C6SA 1IO2A 1O3SA 4EMSA 4KYWA 2QM3A 1RNLA 4UFJA 4DGWB 4WM8C 1GLHA 2Y30A 5A6QA 4RS5C 1WW5A 3CJXA 5CQEA 4II3A 2PJRA 1U5ZA 1ZELA 1EYBA 4QPQA 3GHNA 5JLVA 3FXLA 3W2VA 3ZXKA 2VW2A 4Y15A 1LVAA 3ZQIA 2V1DA 4KISA 1MS3A 3AFGA 1DGWY 4OZXA 4CE8A 4NC7A 5IATA 5FZIA 2XONA 3I4NJ 4BJ6C 1CJPA 5C3EJ 1B35B 1ZK8A 2FRHA 1OA2A 3KS7A 3HUGA 4ATEA 2H94A 4G3YC 1SLBA 1HXDA 4ETSA 2HWF2 4IE7A 5HLTA 2XPWA 3WGIA 1E57A 2OUHA 1HLVA 2RQPA 3AMHA 2BOJA 3BROA 4WZFA 2B7EA 3T09A 2VE9A 5F04A 2RNJA 4HSRA 1ZLKA 3HYIA 4JGYA 1LHVA 3KEYA 1IAWA 3CO6C 1KU9A 5DUXA 1VALA 5DUKA 4JDNA 5DCMA 4MGSA 5EYYA 2MH2A 5EEAA 4CDUA 2QYOA 4KWLA 2IT0A 1R5ID 3GTLJ 3POIA 1A8MA 1YQ6A 3R4UA 5FIXA 2IA2A 2V73A 5JHFA 3S3NA 5LBQA 1W8NA 2DA2A 2C26A 4N4NB 4AIDA 2IVJA 2BBVA 3J8F2 1VRBA 1HJGA 1T38A 1X8MA 3S5QA 2R16A 2JICA 5FZCA 2K9MA 2IEKA 2LP0A 5C4JJ 4LTAA 3O1SA 2HYGD 2E5NA 1BM9A 2ELKA 3WCSA 2R7TA 2FZ2A 1XGMA 3HZJA 2GMPA 1WHUA 1A31A 4LO5B 2Q8KA 4U0YA 2K85A 1CIWA 2KPMA 2HYXA 2GC1A 4YFXF 4JGZC 4BXXJ 1VAMA 2CDPA 1WBLA 1H9PA 4YM2A 5E8IA 4BQ1A 2WAOA 1T2XA 1BL0A 1ENSA 5FZFA 3OYLA 2R5ZB 3SNMA 2OW4A 2OF7A 3B02A 2VMEA 5F3CA 3ZIXA 3IHUA 1W5CC 4DY3A 1W8OA 5FR3A 2BBAA 3LFMA 4EGYA 1RC9A 1FLIA 1UWWA 1TBXA 3CUQC 2UYAA 1K83J 1IQDC 4CEYB 3OY8A 3LPGA 4MHRA 5LY1A 2QA4I 2QFEA 3H7JA 3H3LA 1RUE3 3OF1A 4OHVA 3EQLF 3AZXA 1Z6RA 2A6EF 3HHGA 4P08A 4AEDA 4CP2A 4QTRA 1M06G 4JCKA 4QQ2A 3OUHA 2BWCA 4WVMB 3M8EA 4YYOA 1Z78A 1T95A 3KX2A 2P4EA 1P4AA 1SACA 1KDKA 1ETOA 3IC7A 2TEPA 3CDZB 4OI0A 2P6HA 4QQOA 2MH9A 3JRIA 4IGQA 2WABA 5F6KA 1EUUA 4L5JA 1WFXA 4BXSV 2HPMA 2JECA 2HEWF 1S2KA 5DDJ3 1CPNA 4B4RA 1YFXA 1D8KA 3B93A 5A70A 3NNGA 1RUE1 3VD5A 4BOWA 1WWYA 1GXPA 1CAVA 5FPLA 1JH5A 1SFNA 2E7WA 4LLFA 4RS5B 1UHWA 5CADA 3M7AA 2RV9A 1CX1A 2L01A 2IZWA 4AF9A 4RHV2 1SDDB 1MZEA 4EJOA 4GIQA 3QBQA 4I01A 2FEZA 1P7JA 2PMUA 2NM1A 3MVPA 3RRDA 3VHOA 2W91A 1YS6A 5DDJ1 2IAIA 3DKXA 1IGOA 5E6HA 2H8RA 3F8BA 3KT7A 1Z05A 2DYCA 4FCAA 1HXS2 1O6UA 2F48A 5IFPA 4XKWA 2XVCA 5FJHA 1CAXB 1VLNA 3VHNA 3H5NA 3CBNA 1HKDA 2RHPA 4R52A 3PSIA 3M3OA 5FP4A 4AW7A 3QYFA 4LO8A 4F91B 1DQ1A 2Y9ZA 2Z42A 1E3PA 1KJLA 5J47A 1HB4A 2ETEA 2RJLA 5FZOA 5T5OA 3DF0A 4GWJA 1IRXA 4ABZA 4PGHA 3LEIA 3FUQA 9ANTA 2JRTA 3OEAA 2XAHA 5D8AC 1HQLA 3CCQI 1RUNA 4Y24A 5FXXA 4ASNA 2K9LA 1W06A 4DZJA 1KU7A 5IP6A 2WFPA 4A3EJ 4HPQA 1IRFA 2DCZA 1SD7A 3G71I 4OAZA 3MGUA 5CJ9A 1G4DA 2RJKA 3POEA 3K3OA 1BI2A 2BVVA 4GMP3 2K9QA 4R4ZA 5IK7A 2F5VA 3BR3A 5FYMA 1F36A 1S1AA 4QM8A 5IK8A 2D98A 2P8TA 5IAVA 4HKOA 1AKHB 2EIKH 2FMLA 4JX0A 2WNVC 1S2BA 4JHZA 4RHV3 5F1RA 2HYJA 2VNRA 2LKPA 2A5YB 2VKHA 2ARBA 1V00A 3CCJI 4PIYA 3FBMA 2FBHA 5BYNA 2VN2A 4YIRX 1ZQ3P 4MQ9F 1USTA 1GP4A 5BPIA 2MEV2 2NN8A 2IXCA 2B63J 1RPWA 3V0AB 1XE0A 1VB2A 1TQMA 3H0DA 3NAPB 4HA8A 1VPHA 3OY9A 4GMP1 1GQHA 3A2KA 3AVSA 2E31A 4RGUA 1E5SA 3AAFA 3K75B 1TMF2 5TSWA 4RHV1 4M71A 2V4AA 2CTVA 2H1KA 5A2QZ 2AZ5A 1IZ3A 4ZH4F 3OYWA 2CWSA 4CZCA 2OPWA 5EEHA 5C8CC 1ITYA 3ABUA 3HGYA 3K4BA 1WCSA 1EF4A 4IOAF 1OUSA 1D4M2 1GOFA 4I0WB 1H2KA 2FOWA 5K5RA 3ZOBA 2B4KA 3EJKA 5J36A 1VBC2 3RVHA 5JXGA 2ES3A 3HOXJ 2R7FA 1BVP1 3ZXGA 1A6IA 1PMJX 3ZFGA 2HXOA 2XQRA 2XRNA 3CDHA 1PGW1 4QMAA 3G3ZA 5J1XA 3GXUA 4GXLA 2IGMA 3BP8A 5C33A 5FYIA 4MXWA 1RXGA 1R083 1TNSA 1OD5A 5FCCA 2PLV3 5GAGJ 5DAVA 5FKMA 3BR2A 3NKGA 2JA6J 3N97A 1EUTA 5C70A 5CU1A 4K9SA 5AVAA 1C4RA 3M2MA 2CW8A 1SVMA 2KIFA 1W36C 2VO5A 4UAPA 2VJXA 2VNVA 1NG7A 2BQPA 2ZABA 4XC9A 4CUGA 3TL4X 4WX9A 3P9IA 4HNVA 4EYUA 2A3YA 3VBFA 3W6VA 3C7OA 4B1LA 4BZ4A 3BDDA 1FTZA 1SFUA 1AXZA 5ICGA 2QQBA 4IHSA 4LO4B 3A03A 1PZ7A 4A69C 5GLVA 5L7OC 2Y31A 1B09A 1R081 2PLV1 3HBKA 1OVPA 3FM5A 3ZX7A 3THCA 3VB9A 1TWFJ 3Q3SA 4I2OA 5C7GA 2VOKA 1CQ9A 2ZSIB 1WCMJ 2YDEA 4BK5A 2Y26A 3ZM8A 1N1SA 4LUKA 4GWNA 2VLAA 3ZYFA 4GD4A 4N53B 4Q26A 1SLAA 3D5RC 1VAKA 1S4CA 3T08A 2ZGQA 5L3CA 2C24A 2DA7A 3M3EA 2WNEA 2ZJRF 2IA1A 2YZ4A 1OKQA 5CKNA 2OTJI 1L7LA 1FIPA 3U75A 4HONA 4CDWC 1U5TC 3AZZA 2XJTA 2X6XA 5FY7A 1M4WA 1QZZA 1A35A 2ZOEB 3ECQA 1S0IA 4E4HA 1UPSA 4BPZA 1RETA 1QHGA 1JZ2A 4C0BA 2GALA 1CZTA 2KR2A 1RKTA 1NZCA 2WAQA 4Y52J 1SVLA 4N9IA 3WTUC 4P5HA 2WNVB 3KPHA 4X1EA 3HAGA 5J4YA 1SZBA 1DLLA 4CDGA 2WS92 3C8XA 5JI7A 3DPTA 1MNDA 2BVBA 1RUF3 1G6NA 2QQJA 5BUVA 2ZXJA 3WR0A 2BGPA 2E1NA 4YEJA 4M6VA 3LEGA 5E79C 1PK6A 2QDRA 2X10A 1NXMA 1UW8A 3B73A 2KISA 2CUZA 5KAFC 5JIAA 4LG0B 1D2QA 2O8KA 4HKWA 4TN7A 4HX7A 2DXIA 1LDKB 1B9NA 5ILUA 1RJ7A 4JV4A 1UZVA 2ZXHA 1J3RA 2LYCA 4Q8LA 2NNYA 5I8YA 3DBHB 5A7SA 4E4DX 3MIBA 5KAIC 1JW6A 4Z92B 3GLXA 2AQEA 2BJSA 5A3LA 1SVOA 2VCCA 4PJ0C 4DYRA 1RUF1 3AZWA 3HJEA 2KJBA 4BLJA 2HQ5A 2YV8A 3E1F1 5C8CB 2R5ZA 1KD7A 1V6JA 2V5DA 5H9PA 4DRVA 3CJIA 1WCDJ 5CVRA 2CDOA 2ELJA 2VBYA 2Z3YA 4KMQA 1OI6A 4F3JA 2HI3A 2X9DA 2J1EA 3KLNA 2ZHLA 3WQ0A 2JQ7A 1E5HA 1MS8A 1DU6A 2YU2A 4CEYA 2BY2A 5K7HA 3KE2A 1A5JA 5E8GA 4EN9B 2VNOA 2VW0A 1UXXX 1AHSA 2GC2A 4QX8A 1S3JA 2DMUA 1ZZ6A 5D5UB 2M3AA 4UVAA 3LIGA 4DXZA 5J1UA 3LIHA 1MMSA 1R58A 3O6BB 4FPYA 1A36A 4NROA 3ZYGA 3ACLA 1FMWA 1ONAA 4HAMA 3ULQB 2MABA 4HFSA 4XXAA 2EZLA 1LGNA 1UELB 1UY4A 1GUIA 1IS4A 3PLQA 2JJ7A 1QXPA 2NVUB 1IG0A 2EFOA 4B3NA 2QENA 1DP7P 3KHBA 2ARCA 2YC4A 4CVUA 4OIPF 5FDBA 1D0XA 4RS5A 5EGOB 4DMIA 4DZGA 5L7OB 5IYCJ 4BJ5C 1K5MC 4L8QA 4I3PA 3BTLA 1P2FA 1W3XA 5FQ0A 2BBYA 4PDKA 5IK5A 3T30A 2DPUA 4IHYA 2L7FP 2QDNA 1VBE2 4OINF 2C1FA 3WTZA 4I7HA 3C18A 2DMQA 3BALA 1V5EA 5JI6A 4A3DJ 3S7IA 3ZO0B 4IW3A 1MSEC 3OYHA 2EA7A 1W5TA 3GCWA 3U1DA 3O1OA 2OA4A 2ETHA 1CAXA 2W2IA 3DPRA 5FP8A 2BGCA 4YG6A 2MFZA 2PHFA 2H09A 1G2HA 3BUCA 3OYJA 5CKMA 4CDWB 4Z2YA 1GNYA 1W0PA 1U5TB 3WLUA 2H8WA 4P5YA 1HOMA 4YPJA 4S2HA 4N4OB 4IPAA 1YITI 3HMYA 1MBJA 5F0HA 3BR0A 3F8NA 4QSHA 4Z6YA 2DBNA 1NLSA 4Q4Y3 3BQZA 3BCBA 2M87A 2Y60A 4XRMA 1XNKA 3WT3A 5FV3A 4XJAA 3VD9A 1XSRA 3VD4A 2EIDA 2VKEA 1YLLA 4BQQA 4XBLA 1TC3C 4FISA 2JE8A 2W85A 3L09A 1F4AA 4XW3A 3ITQA 3PHMA 5A1FA 4BCUA 1WSUA 3B5LB 4UI9L 2VZSA 4CCNA 1AKHA 4BGDA 4DFSA 1X9TA 1AJKA 2VKDA 1ZG1A 4BQNA 5HBAA 3VBSC 2GM4A 4AFBA 1O4ZA 2W1SA 1ZGJA 4Q4Y1 2GDFA 2XF6A 4BHPA 2OKXA 1HKSA 1VBE3 4JQRA 4B8EA 1OCZH 3V0AA 1I9RA 4GO1A 4AXOA 3NAPA 3ZP5A 2ILMA 1TLHB 3KVAA 4HANA 2XVKA 2FSWA 4FCYA 1DQUA 1FI2A 3WQ7A 5LHIA 1ACCA 4QHOA 3WG9A 4NHXA 3K77A 1PM4A 3MLLA 5IP7J 4CXYA 2IS4A 3QU6A 2V9PA 1S0GA 1VBE1 3K7AJ 1K7AA 2DN0A 1KDMA 1PIV2 4ZXKA 2K40A 4XN3A 3T5XA 1HV0A 3NV1A 3T0DA 4XUQA 2M4GA 5JLXA 3UGFA 3DGTA 2D7FA 2FZ1A 1UCRA 3D8CA 3KMHA 2X5IA 4KIGA 3QU3A 3OS2A 2Z2SB 3OYIA 2K46A 1Z0HA 4ZHNA 4Q4W2 2NVXJ 4CXXA 3DU5A 2VOPA 4C30A 3SITA 2WA0A 4PIXA 2F4PA 1U12A 2DVGA 2ZS6B 4YIFA 4G9SB 3PUSA 2GMEA 4M72A 1MKMA 1HBXG 1LNSA 4TWTA 5M3FJ 1U2WA 1UOFA 4AAPA 2WFF2 1QDCA 3HQUA 3KP5A 1K5MB 2DMNA 2AH2A 5FY8A 2WQZC 3RQ0A 1SFEA 1N25A 2YX7A 3V64A 4Z2WA 4EZHA 1B59A 1LNWA 5FOBB 3DEUA 1Y8QB 2EV6A 2V4JC 5DAQA 3CQOA 2DAOA 2OA2A 2ZAHA 3KCCA 1WMEA 2EAKA 4QWNA 4OMZA 4DUWA 4PFPA 1HIXA 2HWC2 1D5YA 3OUJA 1K78B 3Q9SA 2QQWA 5E3MA 5A7WA 4N53A 4BQ5A 1DG6A 2A3SA 2NVQJ 3ZXLA 2XSDC 1WGXA 2HVRA 5LGTA 4LBQD 2UZKA 2HBTA 1O4YA 3S1QJ 1W9FA 5H6RA 1L3LA 4HPKB 4GXOA 1NCQC 3JUUA 1LU2A 1HX6A 1SDWA 4RD7A 5FZLA 4NDLA 3POSA 2COMA 3LEKA 3I3EA 1ONVA 2QQVA 4QQPA 2HJIA 5FOJB 1DYPA 3A0KA 4WVZA 1QVUA 3JRBA 1MVQA 5K1YA 4BHBA 3I59B 3R6SA 5L3BA 3V8LA 3N9MA 3K70D 3R0AA 5AONA 5ICCA 2WNVA 1WKMA 2MBFA 4QX5A 5CAZA 3LA7A 1VQNI 2UYBA 1LODA 2VPRA 2ZA9A 3VBSB 3HPGA 4UUTA 1GV5A 2YPRA 2W3JA 5GM0A 1A78A 1WUVA 4BA6A 2HOTA 3INAA 5L3DA 4I0AA 1IKPA 3CESA 4DQAA 2KL4A 1OQEA 4V2VA 5APAA 5J98B 4V2WA 3K3NA 4IEOA 2VJJA 4AK3A 2R49A 5T5JA 5GLUA 3EUKL 2GA2A 3W5NA 3PMEA 4HG6B 5LHGA 3BG7A 1OVSA 1DLCA 1QGPA 1QVTA 5E1WA 1Y4WA 1W04A 4B7EA 5LA9A 4XF4A 2R7QA 1ALYA 2HH9A 2RM23 1WRJA 3WX5A 2XIGA 1G9FA 3OL3A 4UUVA 5DTDA 1U5YA 5C8CA 4L11A 2P5VA 3CZJA 3B94A 4UFIA 1YJKA 4DW6A 2DJNA 2D6NA 2RS32 2CFXA 3N9NA 1QJX3 2CG4A 3NNLA 3BTXA 3D1NI 4IE5A 3ZXSA 2DU1A 3AC0A 1VMJA 1TQPA 1C0WA 3J7LA 3QPTA 4AVVA 1IJWC 3GTMJ 1MS4A 3NV3A 4D8MA 1HLCA 3BJAA 3CCRI 2MLKA 4KITB 5FYZA 1FX7A 1QJU3 5C3PA 2ZX0A 2OD5A 1J9IA 2RM21 4OUMA 2EILH 2JA2A 5FBJA 4QIWN 3KM5A 4Y1XA 1UD1A 1RUOA 2BE5F 4B3XA 1XOYA 4RS8A 5JHUA 1MW7A 2EFPA 2Y38A 1RB8G 2ZHKA 1K42A 3WG3A 1MS9A 4Q0QA 4Y4YA 4WK8F 4HDVA 4G8XA 3OR1C 1QJX1 2Y6JA 4XXPA 3HR9A 5BXXA 3PFIA 2UWBA 4Z2AA 4BL0B 2H6BA 5EHDA 3NJVA 3I4PA 3PNYA 2HNHA 4Q29A 2XAJA 2X29A 5HS7A 3TP0A 1QJEA 1HQWA 4AVPA 5LK7B 4XBQA 2EALA 4A3CJ 2VOWA 2DFCA 1XC5A 1QJU1 4DXSA 4PJJA 5FYYA 2DT6A 1K6OA 1AHDP 2LREA 1D1CA 2O6GE 3ZYBA 2P3KA 4A3KJ 4AAXA 5GZFA 4XMYA 2UY9A 4DYCA 4F93B 1NCRB 1GZCA 1W8FA 1XXNA 1VQ5I 2DFBA 2PQSA 1JYWA 4XNFA 2IXHA 3FIWA 3Q8BA 2L0KA 2ZCWA 1QPIA 2L7KA 2YFZA 1YX5A 2W68A 3ZOIA 3VL9A 3J80Z 1W0UA 1AR82 5JIUA 2Y6KA 3WQ1A 2D43A 2VQGA 4ATFA 5FLJA 3V42A 3LAGA 1DZRA 3HEIA 2RVCA 3WU1B 1RVF3 3TN92 2RDQA 2G19A 3Q0UA 1KEXA 1RTVA 2UY8A 4P9WA 4XMAA 2IJLA 3OBTA 4NN0A 1J84A 3SQOA 1UIKA 1NCQB 2VPVA 3I5UA 3LFUA 4MG2A 1SEUA 4M01A 1OJLA 4PZJA 4D1QA 1QJY3 4AR2A 1WPKA 3HRUA 5C8WA 3AYDA 5BPXA 1YFYA 3UV9A 5D8KB 1O3TA 3GUDA 3WUCA 5JUVA 1WI9A 3BIWE 1TW2A 3LEMA 1WJCA 3GTJJ 4XONA 1VBB3 2WT1A 4ZU5A 4TV7A 3VPRA 1RVF1 1MVEA 2DA4A 3WW1A 5JDBA 1OCTC 5FWEA 1J3QA 2ZC2A 2F4MB 5CQGA 4FE4A 1VTNC 1BVVA 4DEVA 4NHYA 1RL3A 3OGRA 1JZ8A 1ZRFA 4X6QB 4NWVA 3VKFC 3MIHA 3MN2A 1RUH2 2VY0A 4BQOA 3H8XA 1ND2C 1V5FA 1TME2 1QJY1 2YG0A 3E3VA 2OVUA 4PCQA 1ENRA 1DYOA 3SHRA 3K1MA 1XJAA 3PJQA 4R9DA 1UAIA 3QAHA 2NOGA 2Q1FA 3U37A 1V4RA 1V54H 4EATA 4AVTA 4KNYA 2LS6A 2WBKA 3H3VK 1VBB1 1B72B 2PHRA 2WUHA 4QPYA 1FSEA 2ZHMA 4RDUA 4IQJA 3ZYRA 1D8JA 1AR83 1IDZA 1OD3A 1CWPA 4YWAA 3UL2A 2IFWA 2QSFX 4HL0A 4XTMA 1J59A 2LOOA 2FHRA 1JBCA 3IH4A 4UNOA 1SPPA 1UF2C 1ND3C 4NQWB 3WDUA 4MFDA 5DD8A 3RPQA 2E9QA 4RR3B 3MF9A 2OQRA 3AG4H 5EZHA 2XWJB 2B5HA 4QPGC 3POJA 4X6RB 1D1BA 3JXSA 4CDXC 2O9LA 1SAUA 3WNMA 1QEXA 1REEA 2LY1A 2X4HA 4LNVA 4IV1C 5FZ1A 3MEXA 1AR81 4ZS2A 2JVHA 4XOTA 4D7MA 3LPFA 4QPIC 1ZN2A 2XOMA 1GOHA 3KWVA 5F08A 3RZGA 4U36A 1QKQA 1Z67A 4L5EA 1BQPA 1OISA 3JTHA 4ET7A 2L9SA 1AYN2 2QQUA 1R23A 4M6YA 5CVVA 3D0SA 1JUMA 4QHBA 3DBLB 1RUH3 5E3OA 2O8QA 2CYFA 2WV0A 4HEA2 1K3IA 4ZJZA 1MH3A 4H14A 4MEYF 1H8AC 1FC3A 2LLKA 4B29A 2XHKA 3JAMK 3MZYA 5L9BA 5EIYB 2BXYA 4IEVA 2JK3A 3EXUA 2W0XA 3K4KA 2V1UA 2GA1A 2W84A 4LHKA 5JR3A 4C8DA 1QJFA 1JHJA 1QJZA 3MWMA 3HQXA 5HDKA 5IVVA 4B4CA 1RUH1 4HSTA 3B3QE 3S30A 4AQ2A 3I71A 4E2SA 3H7YA 2CQKA 1BN5A 2VBXA 2XROA 2IP2A 5AFBA 3CCYA 5D6FA 2P6SA 1UYYA 2BXZA 1AR73 5IVYA 2R042 4XLPF 4LJHA 2F5FA 3A1YA 3USSA 4QPWA 4IHVA 5JWPA 1K78A 2NVTJ 2J42A 1ZG5A 2JVGA 4KG0A 3PIOF 4FOWA 2MNGA 5GJ6A 2VZPA 1O57A 3O5SA 2ZKNA 1REFA 1RUI3 1FP1D 1G3WA 1Z21A 4LGWA 1GNZA 4F83A 4YGEA 1JTZX 2D6LX 3BTIA 3SC7X 4G6TB 3EHKA 1UOBA 1FY7A 2EV5A 4HPKA 1YE9A 2M7BA 1W6QB 1R1TA 2JWTA 1P8JA 1JOBA 4P02B 3KLSA 3PQJA 2AO9A 1AR71 2YC0A 4XKVA 5BNOB 3PJYA 1I1EA 4B4PA 3HSEA 1VB4A 4LBMA 4HX8A 5IVEA 2LM3A 1OSGA 3I59A 3K10A 3L1PA 5DS9A 1RUI1 3N9LA 2DU0A 1BI3A 2O3FA 4NMIA 2DFEA 3MKYB 2W9XA 1ND2B 1XDUA 3LQCA 3BR6A 5GZCA 3CCVI 3BU0A 5FLIA 5BNPC 2D1HA 2ID6A 3PUQA 3LSMA 5I0RA 3L7WA 2JEMA 1O59A 1JODA 4MQVA 3VZMA 2EZHA 4JX5A 1V6LA 1XNCA 4XUTA 3VYUB 1FNYA 3B9CA 4S04A 3ETQA 5L3EA 2W95A 3KHCA 3QWLA 3VUOA 2FBEA 2BY1A 5E8AA 2ZGPA 2W92A 3JU9A 3F2ZA 1ND3B 2Q8CA 1PX4A 2PQ8A 3J7MA 3BPVA 3HT2A 5GZGA 4OUEA 2LNBA 1T56A 1Q8VA 4E7ZA 2EINH 2XLFA 3FHIB 4L9VA 4B4QA 4QPGB 3M3IA 4P9LA 3F6VA 2HOSA 1YJLA 3D0JA 3AYAA 2BHYA 2P17A 3HNYM 4IV1B 3E5UA 2ZMNA 4QPIB 3S14J 1VAVA 4JAAA 1YJNI 4QHZA 2HWD2 4GZ9A 4GFBA 2L5QA 1SCSA 1VMHA 3AKTA 4JDOA 2PAKA 1DUXC 3KP6A 2LKXA 5KXCA 3A0BC 1UG2A 4XURA 4DNCA 1IN5A 2PHXA 1L7QA 3W21A 3PO3J 5F0CA 1BZWA 4XIKA 2VH9A 4QX0A 1H9TA 1MACA 3S3OA 2C9AA 3ZKYA 5KBFA 4D7YA 2HOAA 2BZTA 3GEZA 1F35A 3ES1A 5FLXZ 4WVWA 4CCDA 3FXRA 3F9KA 2VT3A 4E6KG 1RIRA 3RFRA 1DQ2A 3JRCA 3JZVA 2QZ3A 3QPHA 1KS5A 4XFCA 1W39A 2DJIA 1ASJ3 1TT5B 5FZDA 5K0UC 4OVEA 2A6XA 1ZYRF 4QQHA 5JAXA 1NCRA 3DYPA 3WHBA 3RZMA 5DV5A 2XF5A 3THDA 4WBBA 1LECA 3MPBA 4JX4A 4XVHA 3UK9A 5CIRA 4AI0A 1TQIA 1IPJA 3SFZA 1ETVA 1FBQA 4EQVA 1XSDA 2F4OB 5DUUA 1I27A 1OH3A 3U4SA 3H8RA 2F2EA 3RCOA 5KXEA 4IE6A 2DYRH 2OC6A 1ASJ1 1D4VB 2GP3A 3ZQLA 2ENRA 2CS3A 3RKYA 1H1IA 4PSWA 3K70C 4KI5M 2Y69H 1RXFA 4FOQA 2QQKA 1NCQA 5H9SA 4NHLA 4COUA 3UKVA 3MFCA 3I56I 3ZXFA 2ECCA 4ZZLA 3DWLE 1T6BX 3Q8EA 3MDPA 4XE9A 4XEZA 2K02A 4ZXEA 4MH0E 1W2NA 1XX5A 5ERLA 5LA1A 1ZREA 5G04L 4OMYA 1JHFA 2RC4A 1NLQA 3T0YA 1UFMA 1F9KA 1YYVA 1W9TA 1G86A 3AZYA 3H35A 5FZ7A 2OPKA 4G94A 3CO7C 1YI9A 2XJRA 2HWB2 2VXRA 3HOTA 1OKRA 1K12A 2PHLA 3KV5A 4NPLA 4PDWC 1XB4A 3CQZJ 4P9YA 1UMIA 1FOXA 2D93A 2A70A 1MGTA 2DQRA 2WWYA 3O1PA 2E1MC 1V9U2 4AFAA 1X4PA 3OPTA 3ZYPA 1UHMA 3DEWA 3PUFA 4Q47A 2CY6A 3NW4A 1H1MA 5B2GB 1B72A 1W4MA 2ID3A 1UHSA 4RMNA 3PU3A 1WZXA 5KHGA 1AX1A 2FDGA 5DN2A 3I2HA 3UNGC 2E2JJ 1RJ8A 5JOYA 1C8M3 1VR3A 1ULPA 2Q0AA 2Y6FA 3KF5A 4FOVA 3ZMSA 2VXZA 5HLGA 1U0AA 3NEUA 3FFZA 1J1LA 4HYEA 3FJSA 2YHJA 3ZXEA 3SDBA 1HRV3 1VQ8I 4NQWA 4DIQA 2RMU2 3OYKA 4LPLA 2IPQX 3PU8A 4K8RB 4V1PA 1VIWB 4F52A 2IBDA 3L2QA 4RR3A 3S7EA 5HCBA 5A7QA 3G73A 4UFLA 1I3HA 2BDRA 3IRRA 3WXPA 1OA4A 3LCPA 4ESJA 2PN5A 1K4TA 1POQA 3IT8A 1VBA2 3FFQA 3WY6A 3KP2A 3WOGA 4NHMA 2PFBA 3ZCOA 5HCHA 2HU9A 1HQNA 1D2SA 2RS52 1W0TA 3SZGA 3EO6A 1RUG3 5HOOA 4KFCA 5H6QA 1C8M1 4A7KA 3RZHA 1YQCA 5DEQA 2W1OA 2R072 1X1DA 1Y6IA 3C7HA 5F6FA 3DL3A 5IK4A 4LBJA 2IC1A 4D0QA 2K86A 4XAEA 5GZDA 4IEYA 2HWB3 1HRV1 3LQQA 3OYMA 2WSUA 4NIAA 3ENRA 2CWEA 2Z79A 4XUNA 4FFIA 2MD5A 2XV4S 2XQXA 2WBMA 4OHWA 2WB1N 1EKEA 1GMMA 3LWCA 4IF4A 4WXHA 3SHFA 1BMV2 4LKSA 1RUG1 4BMBA 4UVCA 4YVSA 1YW8A 2ZFUA 5K0UB 3R4SA 3K2AA 4Y33A 1NG6A 1SMTA 1W1WE 2HWB1 4AD9A 1Q8PA 4LBQB 1H89C 3BZKA 3IDEA 3OS0A 4DRRA 2QSGX 1R1A2 1XG1A 1LOEA 1US2A 4A0ZA 1MBFA 3ZMVA 1JN2P 5FMDA 2JRMA 1JZ4A 1X8EA 3ZSMA 4M74A 4DNYA 2RMU3 4BEHB 4LEJA 1NZIA 2AR6A 1KYWA 2CQNA 5B66C 5F2WA 3WUDA 4HV5A 1D5VA 1FXZA 3A22A 2EIJH 2J1TA 2LMDA 3WNOA 1W2OA 1R9TJ 5H9QA 4J1XA 1IUFA 2R073 2FX0A 1PZ9A 1JYTA 2WY7Q 2YU1A 3C2UA 3CL1A 1JKOC 3G1LA 4E70A 5FXWA 2ICWG 2AXTC 2MW8A 4FX0A 1Q3EA 3ZR6A 3CTAA 4C2UA 1W6QA 4B1RA 5TGTA 1JU4A 3CDLA 1GBGA 2ZZQA 4HOBA 4V2FA 3KQRA 1Q1VA 3SH3A 4XOGA 2DDBA 5BNOA 1DBNA 2PG4A 2G4IA 3NWSA 4AEDC 5F32A 5EF6A 2WYFA 3AYCA 4D5CA 3I64A 2AACA 4PSXA 1GHCA 3Q9OA 2STWA 4N43A 4LO7A 4IXAA 3AJYA 2R071 4I30A 2FUG2 1YIPA 2YMZA 5JVTA 4L5IA 2XJQA 3TAYA 3GBGA 2HQNA 1V3FA 4WM7C 3WNLA 1LGBA 1IUYA 3AVRA 5F3GA 2E1MB 1LRHA 2GXGA 4J00A 3PL8A 2CSGA 5HNHA 4WWCA 3POWA 4BQ2A 1JJ6C 1OA3A 1RZ4A 2R6QA 2X8KA 3DYMA 1NE6A 3EBRA 4Y1ZA 3M7GA 4YNIA 2XGXA 4UV8A 1MS5A 3TW6A 2D45A 4F8AA 5J8FA 2PJRB 3T8TA 3G2BA 1UYPA 4AGRA 5BNNB 1X36A 3J81Z 4EE2A 3GFIA 3VKOA 2AEZA 2W47A 2NZ9A 3I7DA 2VVEA 1DP3A 4L9BA 4YFWA 3GDBA 2LD5A 4JKLA 4FPFA 1S2EA 4QXCA 4OULA 4Q48A 1FYMA 3TEZA 2UURA 1CPMA 1NT0A 4QDSA 3VZJA 1VF9A 3CJTB 4DJAA 2CHHA 3KVBA 4IV1A 3JSOA 2LSOA 1OBNA 3AP9A 2W48A 1KXGA 4IX7A 2QNKA 1G7YA 3U10A 3I55I 3QD6A 3H9GA 3DYOA 1AX2A 2V9KA 2R7EB 3ZMDA 1QNWA 1CZVA 1D0GA 5K7PA 3FKIJ 1WW4A 2EIEA 2W87A 2X1CA 2IA0A 4AIKA 3QODA 5FKKA 4EM1A 2LRDA 1KQ9A 3F21A 4GYIA 4A3IJ 3K48A 4AVCA 4JC1A 3O8GA 2B9VA 4M9SA 3ECHA 4NIDA 2GC0A 4LORA 1KITA 3GCMA 2MSYA 5T5PA 3HOSA 3OPWA 2DUPA 1KGYA 4IOCF 5FZBA 3G1MA 4S0HB 5BS6A 1OT5A 2PA7A 3QH6A 3I3QA 5AFEA 1HRI3 4QDQA 2HFHA 2V6CA 2HGCA 5GAHJ 2DTWA 3BPSA 3QACA 4YFZA 2EZIA 2PHTA 3RPUA 1OUXA 2WZR3 1ZBE2 5E3LA 4M9ZA 2YROA 5T3NA 2NMOA 3VYRB 1W6NB 4JZRA 3I3BA 4P5OA 1Z7LA 2FDIA 3F6OA 3AZVA 3RWNA 1QY4A 4KIFA 3K4MA 5ABJA 1TWCJ 2M45A 5LW9A 2R062 1HRI1 3BGAA 2R7VA 3A0NA 2A1XA 3RSNA 3ZR8X 5FKBA 4K3UA 4V19K 3PNVA 1N47A 3J4UH 1IS5A 3JQXA 4RFRB 3DP7A 2D6MA 2VZQA 5F3EA 2V72A 5FZ0A 4JK1X 2WZR1 2RE9A 3FF5A 3Q0WA 3BWGA 2W1QA 1W05A 3KETA 2WO3A 3C2GA 1AL22 1U8BA 2VB6A 1OH4A 2D97A 2KMUA 1FMD2 1GNHA 1PO22 5J37A 2GOMA 1I3QJ 3SISA 3V8JA 3K4NA 5FFOC 2LDUA 4FTHA 3R05A 2HQAA 3A01B 1WLWA 1ZVFA 2CUJA 3SJMA 4HVRA 4HF2A 1WW7A 2WT0A 3JD73 5FXZA 5CEHA 4YARA 4DINB 2E7TA 2KA3A 2CAVA 2HYFA 5B3SH 3ABKH 4C90A 3ZFGC 3JRAA 4BAYA 4RGSA 2WAFA 3PFYA 4L97A 5AVPA 2OQ6A 4WM7B 2K4JA 2CU5A 1NA1C 3DKQA 5GPCA 4MIMA 1XMXA 3O14A 2P81A 4LLNA 1SAXA 2A6ZA 2NYXA 3CJNA 2M2EA 1NHAA 2QKLB 5FY4A 2J1SA 4XFBA 2Y0SA 2XKPA 5GLZA 4GJYA 3O7OA 5H2FC 3BT9A 3JD71 4OHYA 5DUWA 2QVSB 4JTNA 3VD7A 4IEPA 1VFCA 1QBJA 3VBFC 5D5VB 1KU3A 4XM3A 3VOEA 4CZSA 1YNAA 1DGLA 4BKXA 5L9VA 2FMYA 1UPIA 2YBPA 1EV12 4YGDA 3WTXC 3JCIA 1DU3D 4KBZA 3O2PE 3MHZA 3CDIA 5T52A 2XKOA 1ULFA 2O61A 4DZPA 4R4XA 2JZYA 1FPN3 1NY72 3LA3A 1R092 2EXJA 2MA3A 5AIQA 1VQMI 4URTA 1H2NA 2DK8A 1PUFB 1TNFA 4GA9A 3MMYB 5D4SA 2WL1A 5LASA 1FOD3 2K27A 3V0BA 4AI8A 2JT1A 3LE0A 1YXWA 2E1OA 4YM3A 4A3JJ 1XE8A 3M4FA 3KT4A 4XBFA 4LHNA 1GZTA 3LKJA 3AB0A 1W3VA 2ACJA 2IXSA 2FNPA 4YW2A 3O3KA 4A6OA 2ESHA 3GZTB 4JP0A 2I07B 3RJRA 4G9YA 2OZUA 5FPUA 2LUWA 1ZKGA 4M0NA 1FPN1 1R36A 4CTEA 5FFZA 5AC92 1R4MB 4LQRA 2YGLA 2VXDA 3TO9A 4B1MA 4O61A 1VQ6I 3FN9A 1VZ0A 4GKYA 3LSHA 3LSIA 1FOD1 4F55A 4LB6B 1Y9QA 5EYRA 4D94A 1QXRA 2O0OA 3AP6A 3DLAA 3C3WA 2COBA 2PI0A 3WHTA 4I99C 4HNTA 4BQ3A 4P1WA 3GCXA 5ACA2 1YRZA 4BB3A 3LSTA 1OMIA 2BERA 4LMYA 1X1PA 3OMYA 4RGXA 2BNOA 5CFCB 3ME2A 2GOXB 4Z82A 1O8PA 5K0UA 2ZJCA 3O1UA 2JD9A 4CCEA 3CU7A 1WBFA 2CGNA 2IXLA 1PK6C 3QOPA 1ETKA 2Y6GA 5KHIA 4OIQF 1BOBA 3EYYA 4P9GA 1GFF2 3OEBA 5C3RA 3TDZC 3ZQFA 3QLQA 3OYNA 1P4XA 3JRGA 2VNGA 5FZAA 4HOOA 4BEHA 5FMBA 4OQ8A 2JE7A 4XDPA 1UO9A 2KRHA