3FWEA

Crystal structure of the apo d138l cap mutant
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
202
structure length
202
Chain Sequence
QTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLLVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of apo-CAP reveals that large conformational changes are necessary for DNA binding
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transcription regulator
molecule keywords Catabolite gene activator
total genus 56
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fweA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3fweA01
5JSRA 4XF9A 2K4JA 2F5FA 3WODF 1YTYA 3RPQA 4AQ6A 3UKTA 1SFXA 2QZ8A 2FA5A 4M9ZA 2IXLA 1F1ZA 2VC1A 4HVOA 4IEUA 2Y0OA 2F2EA 3QP6A 1CF7B 1V4RA 4TLFA 3RTRA 4X6RB 1FWZA 2PQ8A 5H6QA 2K86A 1OI6A 2O8XA 3LZZA 4KN4X 2CW0F 1OYIA 2X4HA 3DXJF 1ZRRA 1P4WA 3CO7C 1IXSB 4ZYEA 4E2QA 4QGLA 3MYXA 4D7TA 1UB9A 2PN6A 3VFZA 3KGZA 3I59A 2JSCA 4XFCA 4RGUA 4JBAA 3HIFA 1DPUA 1H9GA 5E1XA 2C0ZA 2IVMA 2RV8A 3BZ6A 2UWMA 4B29A 2EJRA 2VONA 4ZU5A 1EY2A 4OMYA 4J1XA 3K2ZA 4YFXF 4KU8A 2RGVA 2HEOA 1DZRA 2CSOA 5D5UB 1MJ9A 2A6HF 2QVOA 3MQ0A 1JHHA 4Z07A 3WTZA 1XGOA 4O5VA 2K4BA 4O9EA 4M6YA 5EZWA 5EEGA 1FNNA 3E6BA 1TNTA 5L3GA 1YUDA 2Z9OA 5TRDA 2GC1A 4QWQA 3ROUA 4XEZA 3H7YA 5FQ0A 4N0BA 1MGTA 3D0SA 4PCQA 4MTEA 1Z6RA 2W84A 2AXLA 2JPBA 3DKWA 4LULA 3ABTA 1QZZA 1F5TA 4CICA 5DCMB 4A5NA 4IHTA 3UKVA 1FOKA 1IN5A 3S0MA 1U5TA 2GA1A 2Q4SA 5CADA 4A2UA 5LEJA 2DTRA 2EK5A 4WCGA 2EA7A 1MJBA 4L2NA 1IN7A 5D6FA 4OLLA 4YFNF 2XAGA 5IT9Z 1IXCA 4BQAA 2VQAA 2XASA 3DP7A 1BIBA 4D7SA 5C8WA 5KVRA 1ZLJA 1T98A 4IXAA 2A6EF 5D1IA 2Q0AA 4ASNA 3K0LA 2WFPA 1SD6A 1XGNA 2IRFG 1X7NA 4GYGA 3LOIA 4U0WA 3ES4A 3P9IA 2DO7A 4RGRA 2D40A 4AVPA 2XL9A 1SFUA 4O3MA 3S7EA 2Z3YA 4HQEA 1D8JA 3M7GA 3IDCB 5LRSA 4HMZA 1VP6A 1KU2A 1BM9A 1MKMA 3KZZA 2E7WA 4IEOA 3KP5A 4KICA 2CQKA 3TDUC 1J2XA 4A0YA 3SHFA 1XB4A 4Q47A 5FLIA 2QYOA 5BV6A 1YFYA 4A5MA 1OMIA 1CAXB 3K69A 3F8MA 4JTNA 1AWCA 5ICCA 1EP0A 3RYPA 4XFBA 1LEBA 4XRFA 5KHHA 4PGHA 1UHMA 1YW8A 1IPKA 2Z99A 3HSRA 2IT0A 2PFBA 5L3DA 3V4GA 1Z1DA 3KE2A 1FYKA 1IF1A 2A07F 4HDUA 4HSLA 5DD4A 3BALA 2RKHA 1O3RA 4KMFA 4FX0A 3C3WA 5F64A 2BNNA 2HKOA 3E6DA 5DUIA 4GULA 1TW2A 3CUQA 4DNCA 5F1RA 1H0MA 5E16A 2IP2A 2E9QA 1OYYA 2A3SA 5J6XA 3TNQA 2ZKZA 5ICFA 3IRQA 4I3PA 5JI6A 4ZU4A 5I0SA 1OPCA 4ZZDA 5LHIA 2DFIA 5D4RA 2ZNZA 5E1RA 2UY8A 2RN7A 4A6DA 4KL1A 4RD7A 1R5HA 1WLTA 1Y0UA 3EBRA 4HX7A 4NQWA 2Z2SB 4Q0PA 4HN1A 1W5TA 1TTYA 2MC3A 4OIOF 5J8FA 2DPDA 2DCTA 2CYYA 1W7PA 1ZG1A 1FBQA 3COAC 3GO5A 2XKPA 4KU7A 2K02A 2OU2A 2VECA 5TJJA 4FHTA 2ZMEA 3TNPB 4EV0A 1FP2A 1ZN2A 4HF0A 4KMUX 5J48A 1UPIA 2QNKA 2VODA 2MHFA 4FT8A 1SEFA 3BJ6A 3FE5A 1USSA 1YO5C 3MEXA 5BPXA 4RB2C 4LLLA 1XSDA 3BDDA 2XKOA 2ET7A 4ENJA 4L18B 1W7PD 3QACA 3FX3A 1R1UA 3HHGA 1IRGA 1ZNPA 2J5PA 4MGZE 1QZYA 4QGNA 3JZVA 5HS7A 5E1ZB 4D0PA 1TQMA 3QPTA 3NVCA 2XAHA 2YX4A 4WX9A 3MWMA 3U10A 3D5LA 3H9AA 3I4PA 4UHTA 4UBGA 2ET1A 3GXOA 1J3QA 2PBIA 2Z69A 4LMYA 3KSCA 1BC7C 2QBYB 2P8TA 3QU6A 3ZN1A 1WI9A 2HDCA 2MH2A 1YFWA 1R5GA 1U5TC 1WGPA 2PI0A 2CV6A 4EWDA 3JAMZ 3NSTA 1K7AA 4IF4A 2ZO4A 3F8NA 5CU1A 2RC4A 2PEXA 1O57A 4O6JA 1BOAA 3IBMA 3E5UA 3DEUA 2Q1ZB 4JV4A 2G9WA 1KQ8A 4I01A 3KLOA 4LG0A 2V09A 3L09A 1TQ5A 1GXPA 3EO6A 4G7OF 5EFUA 3R4KA 4LK1F 3O3KA 5H6RA 3M8EA 2BGCA 2MA3A 2EB7A 3S7IA 2P5KA 2VE8A 1ZRFA 2M30A 1DZTA 3OV8A 2GAUA 2KKOA 5I0UA 2TDXA 5JHUA 2OQRA 2RQPA 1XSVA 4IEYA 5I93A 2Y75A 4MQVA 1EH8A 3MZYA 3E97A 5HDGA 3HHHA 1H1MA 1YS6A 4EM0B 4F7ZA 1RNLA 3RJPA 3H3UA 4ESJA 1G6NA 2FF4A 3EYYA 3U0ZA 1YW9A 4AVAA 4OIQF 4EJVA 5BMZA 3TO7A 5ED4A 1ULYA 1IPJA 2D1HA 5JCTA 4UVAA 2NNNA 1YQAA 2QJVA 4M72A 1Z9CA 2O3FA 1JXSA 5HS9A 4QGMA 5E17F 3RDIA 3FF5A 3LA3A 4ENKA 1T38A 1V70A 2KRFA 4I2OA 1GXQA 2IC1A 4RGSA 3FM5A 3WU0A 1IN6A 1YWKA 2EFPA 1LR5A 1BI0A 4XSZF 3J80Z 3H50A 5BQTA 2P5VA 4YIIA 3EQEA 4WBBA 4OFGA 2ELHA 3GLXA 1ZH5A 1DPRA 4HLYA 4JK1X 1R1TA 4FAGA 2PFWA 3QU3A 2HS5A 4J1WA 4XLNF 4I0BA 3F22A 1D5VA 4EGYA 2GXBA 4GGGA 2H0VA 3VHRA 4PIYA 1F9NA 2A68F 4META 4G6DA 4QM8A 3CTAA 1G3YA 1FXZA 2XL7A 4HV6A 3Q5FA 1UIJA 2XHKA 2KIUA 4ESBA 4JVAA 4KWJA 2LKPA 4LJZF 1SFEA 3KFWX 1R23A 1MJAA 1BN5A 3KP3A 1YFUA 2V9VA 4XFFA 3DPLC 3VEPA 3CLOA 4BHBA 2QQBA 3R61A 1KGSA 4IEZA 4LFUA 1VTNC 2F5DA 1HKSA 5LHHA 4MQ9F 1XN7A 2QLZA 2HYFA 1CAXA 4MGYE 1HSJA 1FSHA 3GBFA 2F4PA 3U2RA 4E2SA 1QY4A 2IA2A 2R7DA 3ZMSA 3ZQ7A 5FDBA 2V1UA 2YPRA 4M71A 4CHUA 1ZGAA 3RPUA 5K8SA 5DYMA 3NJZA 2X0LA 3GWZA 2C6YA 1SMTA 2HWVA 4LUMA 1IW7F 1LDJA 4QLCU 2OZJA 3F8FA 2UYBA 3C3VA 5FFXA 2DPUA 4Q4ZF 1UIKA 2M5WA 1WA4A 3FM3A 4NB5A 2VBYA 5ICEA 4X6QB 4HF2A 2FRHA 2YU3A 3BPVA 2FNPA 4HF1A 3WG9A 3CJXA 2ESHA 1SQ4A 1UFMA 3BPXA 3QRFF 1J3RA 2HKXA 3DF8A 5CYVA 1F4KA 3LWCA 4HBLA 3Q9VA 5FLXZ 2B0LA 3GYHX 5JSOA 3FHIB 1ZRDA 1B4AA 2DBBA 1JUHA 1O3QA 3GVAA 1ZZ8A 5CVUA 3ES1A 1ZREA 2YR2A 3R60A 2GWRA 3ETQA 4KYWA 1O4TA 2Q0OA 3HTSB 1WKMA 2QDRA 4IHSA 5I0TA 5FQ0B 5I8YA 4AIHA 4Q48A 3KZYA 3I58A 1RGSA 3CDHA 5LGTA 2D5HA 4IVNA 1T2KA 1U5TB 1IZ1A 3KP7A 3S2WA 3I71A 4OMZA 3GYDA 2PHLA 1HBXG 1KQ0A 1YG2A 3REOA 3JTHA 2XIGA 3FMQA 2P6TA 2STTA 4FBFA 3BWGA 1GVJA 5D8KB 5FCCA 1XE7A 3ZMZA 2IA0A 5HI0A 3B02A 3TOBA 3IKTA 2ZMEB 3RI4A 3F23A 2BNMA 4WF2A 1L3JA 3ERED 5CVVA 1ZG5A 2UY9A 3LA2A 2YX7A 1LVAA 2P17A 3KEOA 3D82A 5E20A 3RKXA 4UXNA 3RYKA 4G94A 2P6SA 4AD9A 3C18A 1FP1D 4LA3A 4H7LA 1QPMA 3BPZA 2KIMA 2PA7A 2IXJA 2Y0MA 2FE3A 5FD6A 3WW1A 3F8CA 2L4AA 1OYWA 2JTVA 1BC8C 4ORFA 1XGSA 4I09A 4LUKA 3KP2A 3F6OA 4LLGF 5J3UA 4R79A 1NE4A 3QPHA 1R22A 1S29A 2B8MA 2JRTA 4LLOA 1FSEA 1J5YA 3HQXA 1YHFA 2FQPA 2BYVE 2ACJA 3K1PA 3L7WA 4LA2A 4QXKA 4ESFA 3O6BB 4CXFA 1Z91A 4BHCA 2XGXA 1CAUB 2P4WA 3K1MA 1J75A 1J59A 1Y3TA 3RNSA 1J1LA 3LQRA 5BOXA 2KJCA 1FYLA 3VOEA 1BI3A 1YLLA 2R7FA 4GXOA 4I98B 1PM7A 1MD0A 4P9GA 2JZYA 4LG0B 4LK0F 1D8KA 4BXUA 4A12A 3WTVC 2J5OA 4XFGA 3LAGA 5KHIA 3B73A 2R3SA 4RB3C 4I0AA 1YFXA 3TGNA 1LQ1A 4WWCA 3ISPA 4RB1A 1EPZA 3U11A 4LLNA 2HOEA 1V3FA 5FO5A 1XCBA 2E1NA 2QQAA 2EWNA 3M3IA 1Q5OA 4XBFA 5HS8A 3ST7A 1PP8F 1P4AA 2XRNA 3T8TA 1SMYF 1O3TA 1QNTA 2UZKA 2OA4A 2UXNA 3FJSA 2VT2A 4E2GA 3I59B 3FFQA 2V1XA 4P55A 4M74A 5LLQA 4L5IA 2PTMA 2QQ9A 2DK5A 3HRUA 2CGPA 4HZFA 1GQHA 4QMAA 1X8EA 1EH6A 3BCWA 4IEPA 1ON1A 3WGGA 2D5FA 3OCPA 3WW3A 1FY7A 1C0WA 4MGIE 2LF8A 4XSXF 2BEOA 3SXWA 2HQNA 5JFRA 1K78A 3EUHA 1X8MA 2V6CA 3DN7A 2D45A 5AIQA 4IRGA 3VB2A 4YNIA 3IIAA 3FMSA 5DCMA 1XGMA 1I27A 1J58A 1P2FA 2K9ZA 1R00A 2ZKLA 4U7BA 4RS8A 5E8GA 3O2PE 4L9NA 3T5XA 3VODA 3CUOA 1TNSA 3WTXC 3W6JB 3IWFA 5T3NA 2OAZA 3ML6A 4HBNA 2ETHA 4XLPF 3JAMK 1FBSA 1XMKA 2WTEA 3PQJA 4HYEA 2XLAA 5DUKA 5C6CA 3D0JA 4L9JA 4YSFA 4KT5C 2MLKA 1STZA 4AIKA 3ZPLA 3OD0A 1NE6A 3HRTA 5KHGA 4GO1A 1OD5A 3LQQA 3H7JA 5HDKA 3HOTA 4K2EA 4ENMA 4Q0QA 3RZZA 1P6RA 3T1BA 2EV6A 4E70A 4M73A 3ACLA 4HSJA 4DQ2A 5IT3A 2VOPA 2IXCA 1Z7UA 3MDPA 3DL3A 2P5LC 4MNUA 1QO0D 3TO6A 2W85A 3WTSC 1LNWA 4MGKE 1NXMA 2DU9A 2DLLA 2PMHA 4MHGA 1LB2A 4MEXF 1WQ2A 4RB0A 2A69F 4PZJA 1J0RA 4L5JA 1ZZ6A 2DQRA 3LFKA 1QQIA 4KA4A 5CVJA 3TDZC 5I8SA 2PJPA 1IXRC 1BI2A 2IW5A 2OD5A 1B9NA 2PYTA 1EV7A 4HX4A 3FZ3A 2NNYA 3WE3A 5HLGA 1CAUA 3N4MA 2CAUA 2OA2A 3JSOA 2V1DA 1KQ9A 4O9GA 4L0YB 1BI1A 4Z82A 1SD5A 1WRJA 1YS7A 5FLHA 4XETA 4YARA 3WTUC 3WTTC 2GA2A 1MZBA 3L2HA 3WTWC 2BBYA 1XDSA 3KP6A 4ON0A 2B9UA 4BIFA 3SCFA 3ZDSA 1R7JA 4AWXB 5L3CA 2O0YA 2Z33A 4IESA 2LSOA 4LB6B 4A0ZA 1W7PB 1PP7U 1RIOH 5E8IA 2ZXJA 1JHFA 2OPKA 1Q1HA 3E5QA 2L54A 1W4MA 2VC0A 1OKRA 1S6LA 2YSRA 3QAHA 1HKQA 5FPZA 4HA8A 3RKWA 5AONA 3E6CC 3TQNA 3H3ZA 5FLXK 1T0FA 2GC0A 2ZJ2A 4MTDA 4WVZA 2PG4A 2QVSB 2LDUA 2VE9A 3DV8A 5IT9K 1X3UA 2FXAA 3KMHA 4A0XA 3IHUA 4UXAA 4LD5A 4MGRA 4LEJA 2OZUA 1B59A 3WTYC 4S04A 2EA2A 5FLJA 2Q30A 1JGSA 3R0JA 1KA8A 2O03A 1UCXA 1PDNC 1NZCA 3BB6A 1FYMA 3SQNA 3J7AO 2WV0A 1K78B 1E2XA 4IEVA 2RVCA 5KBFA 2H6CA 3FHZA 4HQMA 1RI7A 1SAXA 4WXHA 4MV2A 4PIZA 5KHKA 2PAEA 2EV5A 1SD4A 1ZLKA 4L9TA 5DCFA 5I91A 3RKYA 1O3SA 5HDNA 2L4MA 1CAWA 4HLTA 4QX5A 1L0OC 4GCVA 3ECOA 1RUNA 4TV7A 5AIPA 4Z2YA 1XE8A 5D4SA 4ZYHA 3CO2A 5J7MA 3HSEA 5D5WB 1R36A 4BH9A 4PGGA 5I0RA 2CG4A 5D8LB 2XLGA 2ZNYA 4HW0A 4XFHA 4EMSA 3K9TA 1H1IA 4OIPF 5F6FA 2JT1A 4ONUA 1Y9QA 3NEUA 4L0ZB 1T39A 3GF2A 1BBYA 4UBHA 2HZTA 4XFIA 2UXXA 3ZN0A 3G73A 3F8BA 4Y17A 5L3EA 4GYIA 4S05A 3CUQC 4UVBA 2QM3A 1ZGJA 3OOPA 3IDBB 4UNOA 1FPQA 2KIFA 3P7NA 3FWEA 5LRRA 4ZU7A 3LWFA 1LKNA 4PJYA 4EROA 4NVPA 2ADUA 3I64A 2P7CB 2FSWA 4KIFA 4ZYGA 3M9AA 4U0YA 2XAJA 3W6KB 2PAKA 4KIBA 2K0GA 2VBZA 4Q5SF 1IN4A 3PFIA 3WGHA 4QM9A 2NRAC 3KETA 3BJAA 3NW4A 2EFQA 3T0YA 4WK8F 1VJ2A 3GX4X 2M87A 4G7ZF 3J80K 4I7HA 1YFHA 1ODDA 3CJNA 1PUEE 3CO6C 2F5EA 2GC3A 2UYAA 4HN0A 1EH7A 3TKYA 2KXLA 1MDMB 2H09A 2FBIA 3HRMA 1WWXA 4EJWA 3FXRA 1Q3EA 3I7DA 3O14A 1IUYA 4RAYA 4UV8A 2ZBKA 4A6EA 3AAFA 2DW4A 4HAMA 1SFNA 3FMRA 4G8XA 5DD8A 1K6OA 1CGPA 4HVQA 3EHKA 1XSXA 2OBPA 4ZZLA 2VOOA 2HR3A 1E17A 4IPAA 2CWEA 3HUGA 4Y15A 4H0EA 4YRDA 2Q8KA 1XD7A 1Z05A 1XRUA 5LBQA 1CAVA 1UD1A 1P4XA 3ULQB 2VXZA 4OU0A 2MPFA 3BROA 1ZRCA 1TLHB 4U7DA 2EFNA 2CO5A 5A2QK 3CUQB 1FBUA 4KN7X 5ILSA 3LAPA 1BJAA 1TQIA 3IC7A 1XCVA 3MZHA 3ZMDA 2FMLA 3G7DA 2VBWA 2QUFA 3HT1A 1YW7A 2O8QA 5FGMA 4KUMA 2DI3A 4HX8A 4XF4A 3HTUA 1ZZ9A 3F3XA 3HSFA 2FQ3A 1J7KA 4CYDA 3WU1B 1QGPA 1OR7A 5HVQC 5A2QZ 3P9CA 5CVRA 1O7LA 2HGCA 3RIRA 1QWRA 5ILUA 1LDDA 2O61A 4EM1A 3MPBA 1ZZCA 5BPIA 2GH2A 3DFGA 3FXUA 2VN2A 3IKVA 2W57A 4WXDA 4CZZA 1LRHA 4Y13A 1I5ZA 2ZCWA 3GZ6A 1CAWB 4YFKF 3H92A 2BV6A 5KHJA 1S7AA 4OOIA 1KYWA 3ZP5A 5CJ9A 4RGXA 1ZVFA 3SXYA 5D5XB 5KK1A 2V79A 1TQPA 1U2WA 2DAOA 1L3LA 3KCCA 5FPXA 1B6AA 2K7LA 1HW5A 4EQQA 2RNJA 3GZ5A 2QWWA 2FOKA 1BIAA 2O6GE 3LA7A 1DGWA 2EA4A 2H6BA 4Q0SA 5JAXA 1GHCA 1FI2A 1USTA 1ZG3A 2PHDA 5FFZA 3BY6A 3V7CA 4LTAA 3DQVC 2XVCA 2HYGD 3JSPA 2H27A 4IRIA 5D5VB 2OQGA 4HV5A 2L3DA 4EVIA 4JQFA 2EFOA 5I8TA 2VBXA 1G3SA 3EYIA 3ECHA 1UHWA 1YIOA 4KDPA 3WE2A 3F21A 2EV0A 2E1CA 1P92A 3OF1A 2GZWA 2OZ6A 4MZUA 4PIXA 4AVCA 4RAZA 4G9YA 4ZYDA 4XF1A 2DK8A 2MH9A 2XLFA 3NQOA 3SMHA 1U3EM 1Z6TA 2W24A 3KP4A 4IJAA 1HW2A 5FD5A 3FZVA 4IEWA 2EVXA 2NS0A 4Q29A 1G4DA 2IJLA 3QOPA 4M6XA 3ZMVA 2XV4S 4L11A 3V7SA 1XMAA 3V8LA 4IEXA 5DEQA 3OTFA 2DQLA 4KFCA 1CX4A 3U1DA 2FBKA 1KU7A 2NAZA 2M1BA 1UW8A 2GIVA 3IRRA 5ICGA 3MCZA 1IN8A 3T8RA 2COMA 4P96A 2D93A 3L9FA 1ZX5A 2K27A 4KIGA 3H8UA 4EJOA 3I53A 4M9XA 2N7GA 5BS6A 4AQ2A 3I0TA 3F72A 1FT9A 2L01A 1RL3A 2HFHA 4LGWA 3GW2A 3M70A 4OINF 3F6VA 2FEZA 1HQCA 2G7HA 4B8XA 3CLPA 2ISYA 4KNYA 4P9UA 3CL1A 4BNCA 4R8HA 2D2WA 1LJ9A 2Y48A 5JR7B 1ONVA 3BJOA 4IRHA 2CAVA 4BHPA 1SD7A 2M8EA 3WW2A 2L02A 2XROA 3H1MA 4IERA 1UCRA 5J8CA 1REPC 4ENNA 1OFNA 1KU9A 1HXDA 1QXRA 4EGZA 2VT3A 1O7FA 4YG2F 2B5HA 3ELNA 3H1YA 3K1NA 4AVBA 1R58A 1J3PA 4MH0E 5LGUA 3EQLF 5ERIA 2FNAA 3PNAA 1GQGA 2MLGA 1G3WA 1B9MA 2G7UA 4YYOA 1A04A 5FB2A 4LB5A 5K5OA 2GXGA 5K5RA 1JE8A 3DPTA 3KLNA 1ZARA 3I5UA 4XF3A 5L3FA 5H20A 4HDVA 1CF7A 2IPQX 3HRSA 1QXJA 3TOAA 5K1YA 3R0AA 3JW4A 4Q0UA 1HSTA 1LEAA 2BE5F 4DINB 4U0VA 1U12A 1LDKB 2IXKA 4F8AA 3CF6E 4P5OA 4CDGA 4KWKA 3ZMTA 3GUDA 4EWAA 4U88A 1NHAA 2MBFA 1J9IA 1NYWA 2W25A 3USSA 3GFJA 2QCSB 4XFAA 5K5QA 3E3VA 4FAHA 3PQKA 3EDPA 1FC3A 2MD5A 3GEZA 3KGLA 1U6GA 1H9TA 1O5UA 2LF7A 3G3ZA 5D6EA 3E6MA 3GFLA 1PMIA 1QBJA 2VPVA 1W5SA 3KEQA 4CO8A 3P9KA 1I1SA 3NL1A 3M1EA 4EM2A 5DV5A 3ELKA 1Q43A 4M9SA 4K8FA 3GFMA 1DDNA 5HOOA 2NYXA 1RTVA 2HTSA 5LEKA 4IEQA 6PAXA 3MFKA 4L9VA 3TO9A 4R52A 5BPDA 3UKNA 4AXOA 5LHGA 1FX7A 1FZPB 5BXXA 2GC2A 3IL2A 1VR3A 2HJIA 1ZYRF 1B1BA 5LGNA 1U8RA 4MUVA 2FU4A 3V8KA 1ZZ7A 4AIJA 5L3BA 2ISZA 4MX3A 4WZCA 2MNGA 3PVBB 4UUVA 4MEYF 4G6QA 4JTOA 2M45A 4G7HF 2ZFWA 1CAVB 2I45A 5JSPA 4UVCA 2STWA 4KWLA 2OYZA 3SCHA 1RUOA 3FXQA 2LNBA 3LSTA 2EAAA 2WC2A 3M8FA 2GQQA 2E7XA 1MDMA 4B09A 4HVRA 3PLQA 2AS5F 4ETSA 4I02A 5BUVA 1I1GA 2HQRA 2BNOA 1G3TA 2P7VB 5E18F 3OGJA 1S3JA 2Z5UA 3GFIA 2HTJA 5DDGA 3IWZA 3SZTA 1R1VA 5JR3A 3HYIA 5HLIA 3V7RA 4IETA 5JVTA 1AOYA 3NKTA 2PLYA 3LAJA 2ETEA 2IXIA 1WSUA 4XF0A 4EJTA 3R6SA 1DUXC 2QBYA 4P9FA 5EEHA 2KJBA 3C1DA 4BYYA 2XAQA 3ABUA 3J81K 1I6XA 2PAMA 4UV9A 3E5XA 1ZHFA 2CFXA 2XUBA 3N97A 5E1WA 5AVPA 4FX4A 4N9IA 4BAYA 3U9GA 1X82A 3EJKA 2IXHA 3QP5A 3V8JA 2H94A 2A61A 3HOSA 1S7OA 1IRFA 1S8NA 1TBXA 1YLFA 1TW3A 1FLIA 3BP8A 5CVIA 1D3YA 2FMYA 4ZH4F 4R1HA 4WXCA 4PDKA 4Q0VA 4HLXA 3JTGA 2WWYA 2O1QA 4HOBA 3WW4A 1ZAOA 3NRVA 2FBHA 2PQQA 2JPCA 1KU3A 1YYVA 2EFWA 1K79A 1RZ4A 2XAFA 5ILVA 1DP7P 2F5CA 3I54A 3SZPA 3J81Z 4OIRF 3SFZA 5BY5A 1ZZBA 2RDPA 3L2CA 2ATFA 1HKTA 4EWEA 3L00A 4YIFA 3HT2A 1O5LA 3EETA 1IAWA 2IA1A 1RC6A 3BOQA 3RYRA 3CEWA 2PMUA 2D1VA 3Q9SA 1KYZA 1U78A 2A5YB 3SHRA 5CLSA 3MAJA 3WGIA 1DGRA 1EYBA 2QENA 2Q2EA 4N9HA 5HLHA 3SCGA 1HW1A 4EJUA 1ON2A 2DT5A 3C7JA 3BU7A 4CGZA 1T6SA 1XDUA 2GU9A 3H1WA 4NHJA 2ESNA 3ZMUA
chains in the Genus database with same CATH superfamily
2MFZA 2XWBB 5FP8A 1OURA 2QQIA 3RPQA 3K2OA 2HOTA 3NQHA 4AQ6A 1WW6A 1TWAJ 3THTA 3DPRC 2HWD1 1F1ZA 1SLCA 3OYJA 2WZR1 3Q8BA 2E1OA 4Q4Y3 2BUKA 5TSWA 1RUH2 3FXKA 5HV0A 3HUGB 1SEUA 4GH4C 4F55A 1ZRRA 1OYIA 3UT0A 4DZGA 1P4WA 1AL23 5A7WA 2F6BA 4ZYEA 4E2QA 4KG8A 4LO4B 4P00B 1YQ2A 1E5SA 4XUQA 1W8ZA 1VRH3 2FDFA 2YPJA 2UWMA 4B29A 1O8SA 4OMYA 4J1XA 5G04L 2DTWA 4CEWA 1GWMA 1FOD3 4KU8A 3WVJA 4FO9A 2RE9A 4HNUA 5D5UB 3IMNA 3CD6I 1UXZA 2A6HF 1C8M1 5FZMA 1K61A 3RRDA 5KCMA 3M2MA 1JW6A 5JIAA 2CQNA 4O9EA 5EEGA 1BEV3 2FX0A 1TNTA 1NUKA 1YUDA 4XEZA 4WV8A 4MTEA 1Z6RA 2D43A 4EE2A 4AFCA 3LIGA 1F5TA 4RQPA 4CICA 3VDCA 1UYYA 4DFSA 1RKWA 2EIEA 1KFXL 4C1WA 4NIDA 2HWB2 4D69A 1YQ5A 1IN7A 1IQDC 1OCRH 4XBQA 4M4RA 1D4M1 2VQAA 4E7LA 4C2TA 5KVRA 5DABA 5D1IA 4ASNA 3QODA 1R4NB 1SD6A 1X7NA 1B8IB 3FISA 2L7FP 3VZNA 5IAVA 2OV7A 1UYZA 4MGQA 2MEV2 1W0TA 4AVPA 3B7MA 4UW6A 5CEHA 4EN9B 4NJ4A 1W0UA 3ZXAC 4KGGA 4B3XA 3S7EA 2Z3YA 4XRSA 1A78A 3N35A 1JZ7A 3K10A 5LRSA 5F7UA 4KITB 1JJ6C 1UG0A 1VP6A 3KD4A 1KU2A 2DYSH 2WNEA 2HQ5A 3FUQA 1T33A 4GDFA 4NIAA 4GB33 2E2IJ 3TDUC 2B4KA 3AP6A 1J2XA 3ZVXA 4GIQA 2V72A 3SHFA 2QYOA 1NLRA 1OF3A 1CAXB 3K69A 2ECBA 4JTNA 4DUXA 5ICCA 3CCRI 4KBZA 4XFBA 4OI1A 4UB8C 4PGHA 4QPGA 1UHMA 4AHWA 5GZGA 2UV1A 3MKLA 1REDA 4IZZA 3E1F1 2E34A 2QBXA 5L3DA 5C5UA 3VDXA 3SJMA 1VBA1 1RUF2 1Z1DA 3GZAA 2K40A 4HDUA 4HSLA 2RKHA 1X50A 4FX0A 2VJ4A 2EZKA 5BNPB 3E1SA 2HKOA 3LEKA 2X5IA 3VLBB 3B01A 3NKGA 1TW2A 4N90A 3R4SA 3AK0A 4DNCA 3OR2C 2ZHLA 5CNAA 2WS91 5CYYA 2IP2A 2E9QA 2EIBA 5BNGA 5J6XA 2EZLA 1PMHX 1WD3A 3W2AA 2LD5A 2D98A 1PM4A 4FPYA 4MVTA 1TMF2 5LHIA 5D4RA 4IE4A 3SYTA 2UY8A 1ZRIA 3H9QA 1TME3 1Y0UA 4Q0PA 3LD8A 1TTYA 1DBNA 1CZTA 4HK9A 3KIOA 2VPRA 4NHKA 1QHHD 4RA2A 1W7PA 2IGMA 1FOD2 3ZR8X 1ZG1A 2VXRA 2OKXA 2VXJA 3COAC 3GO5A 1ULOA 4C3IJ 2A6XA 1NA1A 5TJJA 5GZCA 3SISA 4FHTA 4BY1J 5LY1A 4LKFA 3J7YJ 2M2EA 4HF0A 2QFEA 4KMUX 1UPIA 1ZBA1 1JZ8A 3R05A 2VODA 3WDVA 4COYA 3FE5A 2RS33 2IS2A 2FQ4A 3C7FA 3MEXA 3BCAA 3AYEA 3C7HA 3DEWA 4RMNA 3DKQA 4MFDA 2JSPA 3GHNA 3HHGA 2EAKA 4I99C 1ZNPA 4MGZE 1QZYA 2WIIB 3D5SC 3B9CA 3KV5A 4FQ4A 2VQUA 4L5EA 1K45A 4WX9A 4NNJA 3MWMA 1S2EA 5BNNA 4LITA 3Q8AA 2Y0SA 2ID4A 4FTBA 2MSYA 3J9SA 4N43A 2ET1A 1O6UA 4LMYA 4FE4A 2VW0A 2QBYB 3VBFB 2W00A 1JUMA 4OUMA 3ZN1A 1AF9A 1YFWA 1W6OB 1NKGA 1R5GA 3BR2A 1ODNA 2CV6A 4EWDA 3HEFA 5FUPA 1V0AA 1SZBA 5TISC 3F8NA 4XTMA 3ZFEC 5LA2A 1C8NA 2AEYA 5ABJC 2LVSA 1EKEA 1NY71 4A3CJ 1Z7S3 5M5XJ 3BTIA 2V09A 4G7OF 5JI9A 3WDXA 4TN7A 2CW8A 1EF4A 5J37A 3ESWB 2MA3A 2EB7A 3UGFA 3POGA 5LFAA 2BY2A 4KISA 3VKOA 1HXS1 3O12A 1PYVA 2BWCA 3PVNA 3A01A 4E7HA 4IEYA 5I93A 4MQVA 4FPGA 5CKNA 2NS7A 1VNDA 2GM4A 2WWJA 3HNMA 1UMHA 4YW2A 3H3UA 4ESJA 4W1UA 4K1YA 5IK5A 1W8TA 4BLJA 1X33A 5ED4A 1ULYA 1KGYA 5JCTA 4O65A 4EJRA 3WDUA 5E17F 4XLFA 1RHI1 3FM5A 1PHMA 1YWKA 4A7YA 1ULPA 3B94A 1AR91 4BU2A 1HDPA 3J80Z 4QX7A 3VBRB 4BQ3A 2P5VA 4YIIA 5T54A 4FFFA 2XB0X 4OCTA 2JJ7A 2LP0A 3GLXA 4LO5B 4JK1X 1WW5A 3BOPA 2HU9A 1LGCA 2W1WA 1YCIA 4GGGA 2JG9B 1F9NA 2RQQA 3FHQA 3B6AA 3HQUA 3JRHA 2RAEA 1WVRA 4HV6A 2K2SA 4ESBA 4JVAA 1WW4A 3O1VA 3MMYB 1OCZH 1DQ4A 5FZLA 3JD72 1MJAA 2V6EA 2PHTA 3E0JB 1DU0A 1SANA 3DPLC 2XMLA 4F91B 3CLOA 3AKTA 2QQBA 4A7ZA 4IEZA 4RSUA 4NUBA 2F5DA 1MACA 4QDSA 1QZEA 1CAXA 4MGYE 1APNA 1UQXA 5CQGA 4ET7A 3IIIA 1RMU3 4BLIA 3JB8A 1GYKA 5JOYA 4FTHA 3TN93 4M0NA 1KRIA 1AL0G 4CDQC 2R7DA 3GM8A 3CJIB 2DJNA 1BXHA 3KT4A 4QX1A 2VOXA 2YPRA 5EZGA 4S2GA 5K8SA 5DYMA 2IGNA 4XJ9A 3NJZA 3ZO0B 2X0LA 2C6YA 1U5IA 3DF0A 3BU0A 2QSGX 2RVAA 2W2IA 1LDJA 3WX5A 3N7KA 1ZBE2 1W0OA 4Y1YA 4BDZA 5FJKA 3LSPA 2BXYA 1S0JA 2M5WA 1WA4A 4U36A 1LHVA 2VBYA 3NV1A 2FRHA 1D1BA 2YU3A 3M8LA 4ZS3A 3ZXKA 4XQ4A 3S30A 3S3OA 5FRMA 3DF8A 1ZYBA 3LWCA 3RPUD 5JSOA 3FHIB 2M4GA 1UAAA 1B4AA 3WD5A 3OY8A 3K46A 3GVAA 1Q8SA 2W94A 3CMGA 4KYWA 3HTSB 3O0WA 5C4XJ 2E2JJ 2Y34A 5EXOA 3KEYA 1WBLA 3I58A 1Z3XA 5DG1A 5LGTA 1W3XA 2D5HA 3KP7A 4PSWA 4A3LJ 3S2WA 1VBB1 1X36A 3MIBA 1WMDA 1TWFJ 3UV9A 1XPXA 2G19A 4RGGA 3JTHA 3QYEA 4PLOA 1OISA 2A73B 3CF5F 4EQVA 1W9YA 1UMIA 1XE7A 4G9SB 2IA0A 5HI0A 1MBEA 4XOTA 2E19A 3F23A 3RI4A 2B63J 5GZDA 2BNMA 3D5OA 5IVJA 3ERED 1ZG5A 1XBFA 1MS5A 3LA2A 1LVAA 5L9VA 3U14A 3S5AA 1S9HA 5E20A 3PIOF 2VKHA 3RKXA 4UXNA 1H8TB 2Y6LA 4AD9A 1FP1D 1RUE2 4H7LA 2VBDA 1URXA 1WLDA 1JZ6A 2IXJA 2CV2A 2VQLA 1HF0A 4HSRA 1W8OA 4UFKA 4PJJA 1OA4A 3F8CA 5GLWA 3WW1A 1OOPA 2L4AA 2JTVA 1BC8C 4ORFA 1GWKA 3F6OA 5F0HA 3T4VA 5J3UA 3RSNA 2JDZA 1R22A 4AHXA 2O8KA 1N25A 2B8MA 4A3JJ 1W6OA 2JG8A 1J5YA 1MS8A 2DJIA 3HQXA 3M07A 4IV1B 2A70A 3JR9A 1VBC2 2M34A 5IVBA 5HNHA 2W95A 4ESFA 5E3LA 3HJRA 3MLJA 3O6BB 1Z91A 1OSGA 3MD2A 2ZA9A 2X6OA 4PK4A 1OQDA 2XGXA 1R093 2UUZA 3OMYA 3USUB 1ODMA 2JK3A 1WJEA 4L97A 1J1LA 3LQRA 1GWLA 3KVBA 5A70A 3VOEA 2LW8A 1A3KA 2CL2A 2JZYA 3W5MA 4LK0F 4A12A 1OPOA 4OHZA 2VL8A 5EJ1B 4I0AA 5BNNB 2GNMA 4WWCA 3ISPA 3FMGA 4FFIA 2DTYA 1EPZA 4WM7C 2WSUA 2VZQA 4ARXA 1XCBA 2ZB9A 2EWNA 4FISA 2WWSA 4YFZA 4AEDA 1PP8F 4XIDA 2BY1A 2XRNA 5CKMA 3ZFFA 5C3OA 1LHUA 3FJSA 2IAIA 4ES8A 3LPGA 3FFQA 4DYCA 2V1XA 4P55A 2RMU1 3IM0A 3LSHA 1MIJA 2NP0A 1W2NA 1LNSA 2HBTA 4M6VA 2PTMA 5IAXA 3TBDA 2OJED 3HRUA 4CPBA 1UZVA 1XNTA 2HZDA 1S0CA 2BGOA 1UJ8A 5M0TA 5ISLA 1NLQA 2D5FA 4CU9A 1AYN1 1FY7A 4MGIE 2LF8A 5C4WA 3HM5A 4BK4A 1AKHA 4A42A 1PX3A 4XUPA 3VZLA 2WT0A 1LOBA 3CJIC 1K78A 4FPJA 5C9AC 3EUHA 1X8MA 5J1RA 2V6CA 2VLAA 5AIQA 2NXNB 1FYUA 1TMF1 2BQPA 1I27A 1J58A 4HKWA 5F27A 2FZ1A 1R00A 4BZ4A 4U7BA 5C70A 3O2PE 3AFKA 2DODA 1JJ8C 4L9NA 2ERFA 1T2XA 2Q1FA 3T5XA 3VODA 3NMBA 1K12A 3QOEA 1TNSA 2HYJA 1QJU1 4LOTA 3ML6A 5DM7F 3VD9A 3CQZJ 2ETHA 4MADA 1PO22 3CNAA 3CCSI 3M7AA 5IK4A 5DUKA 1O4YA 3BGAA 5FYYA 1O4ZA 4KT5C 4OMCA 1GQPA 4FSJA 4AIKA 2IUWA 3VBOC 4FPEA 4GO1A 2VVDA 3V0BA 3P5JA 3HOTA 4Q0QA 4K2EA 5CQEA 4M3GA 4E70A 4HSJA 4DQ2A 2IXCA 4Z92B 3HBZA 4ITCA 1H9WA 3WTSC 2GOXB 4MGKE 5LASA 3FLRA 2K9QA 4HT1T 2DLLA 3G4SI 2RS12 3HC7A 1GNYA 4AEDC 4ZC3A 3APBA 1HB2A 1WQ2A 3D3AA 4I76A 2A69F 4PZJA 2C9AA 1J0RA 4L5JA 1ZZ6A 1QQIA 4KA4A 1ZELA 5I8SA 1OH3A 2VCAA 2PJPA 3MO4A 5HODA 4GAZA 1LHNA 4HX4A 1GZWB 4M3CA 2LFBA 5HLGA 1PZ9A 1SBFA 2JDUA 1W5CC 3JSOA 4BE1A 1ULDA 4LXLA 1CX1A 3O0VA 5IVVA 1BI1A 1SD5A 4HANA 1YS7A 4GJYA 4QKBA 4H4KC 4Y5SA 1A35A 1JGGA 4YARA 3W9AA 2XJQA 3CIHA 4WZFA 3HPHA 4D5FA 4HNVA 3H35A 4M3EA 5IP9J 1AR62 2F5VA 1R7JA 1KJLA 4XDOA 3V64A 3SDGA 2O0YA 5L3CA 1PZ7A 4XN0A 3I2OA 4XACA 2LALA 1UX7A 5T5LA 4AGGA 4A0ZA 1FOYA 1R083 1JI6A 5D8AB 4LO6B 5M3FJ 4NHYA 2ZXJA 4XJZA 1Q1HA 2L54A 2XJRA 3ASOH 1C1FA 3PL0A 2UU8A 1S2BA 2IWGB 1U9OA 1X58A 4HG6B 4AI2A 3AJYA 1GSLA 2V26A 4WVZA 4AWDA 2CMPA 2ZHNA 2VE9A 3DV8A 5IT9K 1RUD1 2L5QA 1YJ9I 2D97A 4LK6A 1LEDA 4UXAA 2OZUA 4S04A 4KJZA 5C4WB 1QOTA 3DU6A 3R0JA 1FYMA 1O59A 1HB1A 4RN5A 3J7AO 1K78B 1E2XA 4HQMA 1RI7A 1D0XA 3RZJA 3MUZ1 4YVWC 4MV2A 2ZMLA 4PIZA 2BVLA 2EV5A 1RUF3 4DBQA 3I8TA 3WG2A 3K4CA 1Y56A 3VKLA 1Y9GA 4CEWB 4COUA 3N9LA 4DB5A 5C8CA 4LBKA 4S2HA 4GCVA 4AR2A 4N53C 4ZYHA 3CO2A 1CJDA 3WZ1A 4PGGA 4K21A 2MEV1 3GZNB 3X29B 2CG4A 4E4DX 5D8LB 2XLGA 4XQWA 4HW0A 4XFHA 4EMSA 1H1IA 2JWPA 1RIRA 5FRNA 1S0BA 2CW7A 4LOCA 1W28A 3OYWB 4UYBA 1NA1C 1BBYA 5B3SH 4UBHA 1IUFA 3UK9A 4QXBA 4XCAA 1MH4A 4XFIA 3G6EI 4J6GA 2K5CA 3T3YA 2G9FA 2VJJA 2JDHA 5L3EA 2C9KA 4S05A 1HRV3 1F31A 1ZGJA 2VVFA 2KIFA 3P7NA 2LG4A 3NARA 5B2GB 5LRRA 1Q8QA 3NJXA 3LWFA 4PJYA 2V1NA 4INDA 2EIDA 2P7CB 3UR3C 5FZGA 4KIFA 2ZFUA 4A4AA 2K0GA 2JJ6A 1MSFC 5D8AC 3MUY1 1AZDA 2HWC1 3KETA 3BJAA 2HWB3 2EFQA 3T0YA 1VJ2A 4UB6C 1UKRA 1KZHA 4GD4A 4I7HA 1R5ID 1ODDA 4RM3A 5L36A 1YIJI 5L9BA 3CCJI 2IS6A 1VBC1 1SHWB 1WWXA 4F93B 3TP3A 1DQ1A 1FNYA 1XU2A 1RUG2 3O14A 5EYXA 4Y4RA 3MFCA 4Y3OA 4FPOB 4A6EA 4GH4B 4QPGB 2LLKA 1K6OA 1CGPA 2RMU2 4UWDA 5FYSA 1EJ9A 3T2PA 2JG8C 1IS4A 3OWTA 2HR3A 3T0AA 2DUQA 4AEDB 4I30A 2PHRA 3J7LA 4G3YC 4ZS2A 4R9BA 4YZ5A 1XRUA 5SV5A 1RETA 2AENA 3ULQB 5FR3A 2VXZA 2ILMA 5T55A 1SFPA 4RS5B 1TLHB 2OVUA 2YFUA 1V6JA 1UOFA 3KQRA 3CUQB 4JKMA 1RUH3 1MS1A 3POBA 5I0DA 5ILSA 1WGXA 3OYHA 2F4IA 3IC7A 1W0NA 5DAWA 4R9DA 3MZHA 1CIYA 1VBD2 5J3LA 1COV1 3G7DA 2O8QA 2AO9A 3CMAI 3MKYB 2LKSA 4HX8A 4XF4A 3HTUA 1A8DA 2FQ3A 1QGPA 4Y33A 5A2QZ 1GLHA 5CVRA 2HGCA 1QWRA 2FDJA 3SEPA 2R041 1PO13 1A5JA 2O61A 4A3DJ 2IBDA 1HRI3 3AM2A 3MPBA 5BPIA 3GDBA 3BIWE 5JPMB 2YC4A 4I6ZA 3S17J 3PO3J 3IKVA 1FMVA 3JCUC 3AP7A 4WXDA 4XOPA 2XRLA 4IQPA 4Y13A 4FOVA 1PGW1 3ZYPA 2RDRA 2WABA 1KYWA 4CDWC 4D3WA 3ZP5A 4JGZC 4RGXA 3K4MA 1BA5A 1TQPA 4AAXA 3TYJA 2DAOA 3KZIC 1UZCA 1L3LA 2VMGA 1PO12 1B6AA 2K7LA 2O5RA 4QXHA 2FOKA 3LA7A 1DGWA 2H6BA 2I07B 1PVC2 1ASJ3 4JX4A 1DGRM 5DQ0A 5FFZA 3BY6A 5FKKA 2G0EA 2M0MA 5DG2A 2KIQA 4QSHA 3JSPA 3OPZA 4UT5A 2E31A 1R9TJ 4QX2A 5DDJ2 4YVWB 1SFOJ 3TRSB 2FDGA 1E57A 1QMJA 5I8TA 2LR8A 4NC7A 3F21A 2EV0A 4V19K 2OQ6A 4IGPA 4JDMA 3ZN5A 1US2A 3H9GA 5IOYA 2R0FA 4E6KG 2Y9YA 3I3BA 5HCHA 5FKBA 2ID3A 5BNPC 3BTZA 1GP6A 1W6NB 2LY1A 1HW2A 3ERMA 1WFXA 1JYCA 4IEWA 1S5LC 5A32A 1ERDA 1CR7A 4XPVA 4P9JA 2PX9A 1TME1 5FZ6A 3V7SA 2Y30A 1YQ8A 3S8PA 3OTFA 1JTZX 2VBPA 4KFCA 2WQ8A 4XOGA 2XG3A 1X2NA 1X9PA 2XF6A 4M4PA 4E9KA 5LD2C 1KU7A 1ULEA 4UUTA 1JODA 1ALYA 2GDFA 4RR3B 3AMNA 5EYRA 1LGBA 2AHQA 2YBKA 2VQCA 3T8RA 4P96A 1NG0A 2D93A 3VYUB 2KRHA 1QOOA 5L7OB 2IS4A 3I53A 4M9XA 3ZR5A 5LATA 3M3CA 5BS6A 1AHDP 4AQ2A 2R7QA 1GV9A 4M3CF 1NTCA 1YX5A 2HFHA 3GW2A 1N1SA 4YELA 2FEZA 3K2AA 5GAHJ 4KWUA 1S2KA 4R8HA 2TRTA 4QPOA 5H9RA 5JR7B 4IRHA 4RFRB 5J96B 3THDA 4IV3A 4IERA 3HR9A 3N9QA 2EZHA 1GU3A 3KVAA 1HXDA 3LEIA 2R0HA 4XBLA 3VBUC 4C2UA 4PSXA 3V0BB 4EGZA 1G9FA 1PO23 3PJYA 1OVSA 2AQFA 1O7FA 5F6LB 4YG2F 4Z8BA 2Q8CA 3ELNA 4OI4A 1J3PA 4MH0E 2VJIA 1ND2B 4FASD 1POV3 1V6OA 2YS9A 5ERIA 2FNAA 3AZVA 3PNAA 2MLGA 1RUC3 5T50A 5GLZA 1B9MA 1YI9A 4LB5A 3AMQA 1LFBA 4FFGA 1JE8A 5LZ6A 4HDVA 3QBQA 1CF7A 2HOSA 5K1YA 2QQ8A 4Q0UA 5CISA 1XXNA 2BE5F 3HB9A 4U0VA 3U1XA 5K7FA 2IXKA 4CDGA 4YM0A 4RA0A 3ZMTA 3ZXFA 1J9IA 1REFA 5ABJB 3GFJA 5KC6A 2VOTA 4XFAA 5FKOA 4A3EJ 2AQEA 3E3VA 3EDPA 1FC3A 1BJZA 2D44A 2WYSA 3ABLH 1QJU2 2W4SA 4WVMB 2V4AA 1U6GA 2R7XA 5IK8A 4BPZA 3WNOA 2LC2A 3E6MA 3PVOA 2QGUA 4RHV2 1MEC3 2GSYA 1VBE1 1RITA 1I1SA 4DRRA 4E7IA 1WCDJ 3MLKA 3KX2A 5H9QA 4BMEA 4EM2A 2K9SA 1Q43A 2ENRA 1N47A 5FY7A 2Q8EA 5KXDA 1RTVA 4XK4A 2NYYA 3H5RA 1POQA 5LHGA 2LMDA 3JQXA 1VR3A 5FMCA 2DMNA 2FU4A 3RZMA 4AIJA 5L3BA 4MO3M 2E2HJ 1CJPA 3C2HA 2JIGA 4XUNA 3OUIA 1RUG1 5A6QA 2I2SA 5AFBA 2JDKA 4MEYF 4AI9A 3G6JB 2M45A 1O4XA 1UX6A 3TN91 3KYDB 1CAVB 4PBOA 2FD8A 3SCHA 1S0DA 4URTA 2LNBA 2L2OA 2R5YA 2JKXA 1N3QA 2E7XA 2WADA 1Q1VA 3PLQA 2KFDA 1PUFA 1I1GA 1ZKGA 4CDWB 2UWCA 2BNOA 1LOFC 2P7VB 4HONA 1YITI 1C57A 4AFMA 4GH4A 3IWZA 4PQQA 1R1VA 5JR3A 3V7RA 3JBG1 2RNGA 5JVTA 1AOYA 3U07A 2CNAA 3T2OA 4Q4Y1 5DS9A 5A3OA 4XLHA 4DPNA 1RXGA 1MPXA 5C8CB 3I4IA 4XICA 4P9FA 3LCPA 1BEV1 1UXXX 2LBFB 1WW7A 2RS13 3NNJA 3QWLA 1MQTC 3Q0WA 5E1WA 5AVPA 4CDXB 4BKXA 3RI9A 1DYKA 1X82A 2VUMJ 3EJKA 3QD6A 3J7NA 2DOFA 3IN9A 2IXHA 3QP5A 5CFCC 2H94A 5IATA 4CXYA 2A61A 4ASMB 1KJRA 1S7OA 1D4M3 2FD5A 1VQPI 3BR6A 2ME6A 3I4NJ 1GDTA 1TBXA 1YLFA 5GTHC 5CVIA 4MOAA 4QDQA 1H8AC 1FEXA 4ZH4F 4R1HA 1NG7A 1ZAOA 1ZQ3P 1NAEA 1I39A 4KH9A 2JKBA 1XTAA 1WHUA 2A3YA 2GP5A 3ETPA 2R072 1TWGJ 1RUH1 1BR1A 3RFRA 3J81Z 1PGSA 4IQ4A 3SFZA 2MC4A 5DAQA 3CKHA 3HT2A 4XC9A 3RYRA 4B8EA 4Z1VA 2WDBA 1U78A 5LW9A 4N8MA 5L7OC 1UL9A 3WNLA 4MG2A 4NPLA 3IT8A 3H36A 1TWCJ 3WGIA 3JRDA 5GLTA 4UOJA 1RYYA 2K85A 2VW1A 1A6IA 1HW1A 4EJUA 2DT5A 3C7JA 3BU7A 4FTSA 1T6SA 2RDSA 4URAA 5J48A 1SPPA 1SACA 3A01B 5CBLA 5IYDJ 2K4JA 2F5FA 2Q5TA 3WODF 3I2GA 2LROA 3HN3A 3UKTA 3JRGA 3UETA 1XNBA 3VBHC 2Y0OA 4P14A 2F2EA 3QP6A 2JEMA 4CPBD 2BOJA 3K4NA 3WNMA 2NPIA 1BHGA 4TLFA 3T2QA 3RTRA 4X6RB 2VNVA 4IHXA 2PQ8A 3CZ6A 3VZJA 5H6QA 2K86A 2O8XA 4FFHA 3ZSEA 1V6MA 3IB3A 1EUUA 4D94A 2X4HA 3DXJF 1LENA 1IXSB 2UURA 4AIDA 1PJRA 4QGLA 5L19A 3MYXA 4D7TA 2PN6A 3WQ7A 1A8MA 5A7SA 2JSCA 2DDAA 3INAA 3HIFA 3L2RA 1DPUA 4XJUA 2K9MA 5E1XA 4LR4A 2IVMA 3BZ6A 2ZOEB 3BPSA 5F9TA 1JYTA 2VONA 4R4ZA 4ZU5A 3HMYA 3C8XA 4CA0A 4XQFA 3ZPYA 2R073 4BEHB 3OD4A 2DCJA 4BBRJ 4AFDA 4IV3C 4UI9L 3HOBA 4OQ8A 3WHTA 2AREA 3GCWA 5DM6F 5EZWA 2DU0A 3PIGA 1WJDA 4DBRA 1XC5A 2Z9OA 5TRDA 2GC1A 1AX0A 3I2KA 5FPLA 4YG6A 3ROUA 3H7YA 2VOKA 4N0BA 3D0SA 1OLRA 2JG9A 3DKWA 4BQ4A 3ABTA 3NAPB 1FOKA 4Q8KA 2GA1A 1HX6A 4A2UA 2ZGOA 4DNYA 2EA7A 1MJBA 3BIEA 1MNEA 4OLLA 5LA0A 3VDDA 1VFCA 5IT9Z 4SBVA 2XASA 1Y1WJ 3DP7A 1BIBA 5ABJA 4GZ9A 4D7SA 1VIWB 1MMNA 1BOBA 1JTXA 2CFOA 4GJZA 1T98A 4DRVA 3AKQA 1IGNA 3NRUA 2X48A 5A6XA 4U0WA 3NWSA 1VB4A 3CJRB 2BU9A 3P9IA 3ES4A 1HV1A 2VKEA 4K3UA 2CUZA 2JVHA 2DMUA 1SLAA 2CRGA 1D8JA 4Q4W1 3M7GA 4LBLA 4AQTA 2DCYA 3MW3A 3BG5A 4HMZA 1FTTA 1BM9A 2E7WA 3N9OA 1YI7A 2VKDA 2CWMA 1RPWA 4Y1ZA 1T8IA 4Q47A 4BJ6C 5BV6A 3TWIA 1YFYA 3AKZA 4A5MA 1OMIA 1PGL1 1AWCA 1DU3D 1AR83 1TT0A 3RYPA 3T0BA 1Z0HA 5M5YJ 1LEBA 5KHHA 5FLMJ 4QTRA 2OTLI 1W9SA 4Y1XA 1YJNI 2W1SA 1IPKA 2Z99A 3HSRA 2PQSA 2D6NA 5FOJB 2IT0A 1Z21A 1N3PA 3LSDA 1WCSA 4YG0A 2NLRA 2VD7A 3KE2A 4LKDA 3VBUA 3WG1A 1FIAA 1VBE2 5DD4A 2PMZA 5HCAA 3BALA 3C3WA 2RR13 1ASJ2 2E5NA 1JBCA 1PIV2 3RJRA 2VMHA 3URFA 2KT0A 2PHWA 1I1EA 2DA7A 1H0MA 2UWAA 2WAAA 2JA7J 1Z7S2 5ICFA 3IRQA 2RHPA 2CUJA 3NAUA 2ZX2A 3VD4A 3AG4H 2DFIA 3GGLA 3C2GA 2X5IC 2EIGA 2RN7A 3FL7A 2EBIA 3WV6A 3ZFFC 1R5HA 3EBRA 3BR3A 5DMYA 1W9FA 1UZ0A 3A4CA 5C5TA 1LOFA 2CYYA 2CUEA 3POEA 4IOCF 4FP2A 1LFPA 1VI0A 2LBFA 1XNDA 4KU7A 3CCVI 4JZRA 4ZKTB 1Y7BA 3TNPB 5J1YA 1ZN2A 1REEA 3ZQIA 3VSLA 5FTTC 1L7RA 2QNKA 4X1EA 2J1AA 4FT8A 1SEFA 3BJ6A 1OF4A 1YO5C 1BW6A 4WM8B 1U5XA 2X9DA 4RB2C 2P1BA 2WFF1 2QTWB 1XSDA 5IPAA 5F0CA 1ND3C 2LS6A 3PFYA 2C26A 1IRGA 5F5QA 2ZJQF 1YEWA 1BBT1 1GOFA 4QGNA 4LIUA 5E1ZB 2RS32 2ZHKA 1VALA 4PFPA 4D0PA 4LE4A 1TQMA 1TL8A 2ZEWA 3NVCA 3R4DB 1TP4A 4NIHA 3G1LA 1WZXA 1XNAA 2ZJPF 1QU3A 3H9AA 4PDWC 3I4PA 3M1CA 4ZXEA 4UHTA 3GXOA 3VBSB 1S0IA 5HCBA 3KSCA 4NMIA 4MLOA 3QU6A 3UESA 5DAPA 2MH2A 4HG2A 1U9NA 2J42A 1U5TC 5IVEA 1HV0A 1WGPA 3JAMZ 2BVVA 2VZRA 2Y0SN 1CQ9A 4IF4A 4IXLA 4OZXA 2ZO4A 5CU1A 2ZEZA 1O57A 4O6JA 5A3NA 1BOAA 3IBMA 4N53B 2G9WA 4IO9F 4I01A 3KLOA 4LG0A 3RQ4A 1TQ5A 3EO6A 1QJU3 5EFUA 4LK1F 2AGSA 5EIYB 1BEV2 4RQPB 2HWD3 2RJKA 3S7IA 5DZFA 3IZOA 2M30A 1DZTA 1QJFA 3OV8A 2CJJA 5JHUA 1OFSA 3LSJA 3ZFFB 5GPAA 5HDGA 1G9DA 3HHHA 3MBWA 3CCMI 2EXKA 1XSRA 1CQTA 2AYHA 4LK7A 1DYPA 1VQ5I 2WBKA 5GAGJ 2X10A 4HPQA 4Z2AA 1LULA 3EYYA 1JUIA 2Z16A 1EV11 2DURA 4EJVA 4OIQF 5BMZA 4JCKA 1IPJA 1VBB2 4XONA 3AL5A 1NX9A 2NNNA 1YQAA 3OYDA 2XOMA 1XSQA 2O3FA 4BE0A 5HS9A 4QGMA 4EN7B 3RMYA 3RDIA 4J19A 3DPRA 2KRFA 2IC1A 3SKJE 5GZEA 4XSZF 2J1UA 1LJ7A 2QQKA 3H50A 3MVPA 5BQTA 1N78A 1S7EA 1DFQA 4XN3A 4XKWA 3Q0VA 1EPWA 1ZH5A 1DPRA 1K6YA 3VUOA 4FAGA 4FE7A 3QU3A 4DS0A 4J1WA 1RKTA 2BFUL 5A7NA 5F1JA 1MMSA 2DFCA 3T4HB 3WF4A 1ENHA 3GJBA 3HBKA 4ZXKA 4NPRA 5EQUA 2H0VA 1E3PA 3NNFA 3ZN6B 3EUAA 2WV1A 4G6DA 2HWF2 1G3YA 1BBT3 3AFGA 3BLYA 1FOWA 2EXIA 3C7OA 3SH5A 4B44A 1I9RA 4HETA 5CKTA 2WQ4A 2IXSA 1ZBE1 3FXLA 4DGWB 2XJVA 5EJCA 1SFEA 3VDAA 3S2HJ 1OH4A 4L9BA 1BN5A 1OJLA 3KP3A 2V9VA 4NPMA 1PIV3 3BZKA 2PMWB 3ZFGB 4PLMA 2SBAA 1VTNC 1YX3A 1D0HA 1HKSA 2CV0A 4MQ9F 1XN7A 1G8WA 4LBMA 2LYCA 4DXZA 5EDNA 2F4PA 2CDOA 4E2SA 1S0GA 3K4LA 2IA2A 3ZMSA 3H0DA 5HBAA 2GIZA 1JKOC 3FBYA 1W2UA 4HK8A 3RGBA 3OPWA 1ZGAA 2Z42A 3N9NA 5EHDA 4AHZA 1AA7A 4Q4Y2 1SMTA 4RFT0 4LUMA 3K4KA 1Y0NA 4QLCU 1XPWA 2W0XA 1IRZA 1UOBA 2UYBA 2P4EA 2WO3A 1DLLA 4Z6YA 3K4ZA 3SEZA 2B39A 1YHQI 4LIVA 4NWWA 1OVPA 2Y2ZA 4NB5A 5T5PA 5ICEA 4X6QB 3P5BA 1RVF3 2FNPA 3LOCA 1WJFA 1Q8PA 1COV3 4HF1A 3WG9A 4DZJA 2GNTA 2VULA 4ZZ5A 1J3RA 1E5RA 4KT6A 2GMMA 5CYVA 4CXWA 2ES3A 5FLXZ 5B4NA 2B0LA 3OYEA 3CCQI 1MZ5A 5M5WJ 3JU9A 1SLLA 2YR2A 2GWRA 3ETQA 2Z4FA 1V54H 1QHGA 2HWF3 5JXIA 3PUHA 4AIHA 5CIRA 4AI0A 3KZYA 1W36D 3VHPA 1WI3A 2Y26A 4V1PA 5FY5A 4B48A 1R49A 4IVNA 1IZ1A 1OA2A 4WVVA 3I71A 4DEQA 1HBXG 2BERA 1JUPA 1Q8VA 1W6NA 1MSEC 3LPFA 3AG1H 5A32B 3BWGA 2WRAA 3HWJA 4TTGA 3W59A 2ZAHA 1FMWA 4UF0A 2QDNA 2HQAA 4LKEA 1Q56A 3TEYA 2UY9A 3OOUA 1YQ6A 2YX7A 3RZGA 2P17A 3KEOA 3JRAA 4QT6A 2ZGQA 3H3LA 4AFBA 4D5CA 1QPMA 3O8HA 3C2BA 1FAYA 5JDBA 5FJ8J 1ASJ1 5FD6A 3S1QJ 1LTEA 1LOGA 4IE7A 3KP2A 1BL0A 2D7FA 2VB6A 4R79A 3KV6A 4PUSA 2JQ7A 3WG3A 5JUVA 2IEKA 2JRTA 1RUI2 4FOYA 4IGOA 1KQRA 4PJ0C 5CZKA 5E89A 1AR61 1P8JA 3QQAA 1YQCA 2FQPA 2XQRA 5LBBA 3JD71 3J4UH 2OIIA 1B72A 2JECA 2BZDA 1EAH2 1XG1A 1K4TA 4QXKA 5KHDA 3QH7A 3I2FA 1OCOH 2VM9A 4CXFA 2ARBA 2ZZQA 1CN1A 2W82A 4XORA 4AVVA 2IGKA 1CAUB 5GTIC 5LA9A 1JYVA 3K1MA 1J59A 4AI8A 5F32A 3CU7A 1H88C 2ZAAA 2KJCA 1MH3A 1SLTA 2WN2A 4I98B 5KAFC 1W39A 4Y7NJ 5F5CA 4YW5A 5FYCA 5KHIA 3B73A 2R3SA 1YFXA 3TGNA 3SKVA 4LLNA 2HOEA 2QQNA 3RI8A 5EGOA 4XR6A 4C90A 4XBFA 1HQNA 3ST7A 2L7MP 1RJ8A 4W97A 1P4AA 3KPHA 1SMYF 4JOMA 4AI1A 1IJWC 2R7VA 2UZKA 2OA4A 2NVTJ 1H1AA 2W08A 5KC5A 2J1SA 1WCQA 3ZQFA 1UY0A 1OT5A 2Y31A 3AG3H 4OI0A 4CYCB 4D7NA 2R7ZJ 1RINA 4NC6A 2ZXIA 3IH2A 4IEPA 4NOTA 3DECA 2RS51 3WW3A 1O91A 4YVWA 2TUNA 4JDNA 3WLUA 2CV1A 3OY9A 4M00A 4PFOA 2HQNA 2DN0A 5JFRA 5F37A 1RUJ2 2D6LX 1MMGA 1XOYA 2XGCA 3VB2A 4XMIA 2PELA 5HLTA 3PHMA 5GALA 1P2FA 2QF7A 2K9ZA 1VQ9I 5F3IA 5C4JJ 2DUOA 2RS11 1XC6A 4B4CA 4JYKA 5FK8A 5GLUA 5GADJ 5F04A 2X51A 1DQ2A 2HWC3 4N43B 5EJ3A 3PM1A 2K9NA 3LSKA 3HL2A 3KWVA 4TZDA 4NDLA 1RUE3 1UU4A 3PJRA 2OAZA 5CAZA 4HBNA 5FKLA 1JU3A 4COZA 1LODA 3W2WA 4FQGA 3JAMK 1FBSA 4EZ4A 2X29A 4CDUA 3PQJA 2E51A 2G1MA 2OUMA 2DV9A 1RUE1 3HOUJ 2JICA 4BXFA 3UKGA 4PJNA 3HXLA 3ZYRA 1B35B 4LHKA 1TNRA 3VZOA 4U87A 1H4HA 1OD5A 2K9LA 3LQQA 3H7JA 5HDKA 3RZZA 3T1BA 4M73A 1BCXA 3WF1A 1Z7UA 1MBHA 3GMEA 1VQMI 3MDPA 4MNUA 1QO0D 3TO6A 2NVQJ 5LA1A 4JQTA 1R082 2R32A 1T6GC 2KMUA 3LL7A 2A6ZA 1Y8QB 1HB4A 1AR82 2PMHA 1LE8A 1QH6A 4OHVA 3UL2A 4OMDA 1ETKA 4MHGA 4MEXF 4XRSG 4LE3A 3LFKA 4BL0B 3TDZC 2FJ1A 1N1YA 3MKZA 2FDHA 3K70D 4K6BA 2HH9A 3PNYA 4C91A 1EV7A 3FZ3A 5JLXA 2NNYA 1SLIA 3ZFEB 2W7NA 3WE3A 4M0HA 2Z1DA 5FYUA 2OA2A 2V1DA 4O9GA 3D5RC 4CEWC 4GWIA 4BIOA 1WRJA 3VYSB 5FLHA 3BG3A 1NCQC 5K0UC 1A34A 3O1RA 3L2HA 2P37A 5LWBA 2BBYA 3KP6A 1SCSA 4NRMA 1G86A 3BQZA 4NQWB 1JOJA 1GVDA 2X09A 1UZZA 2BY3A 4JX5A 4IESA 2LSOA 3VBOA 3H0OA 3MIEA 2E7QA 5E8IA 2N8GA 1GT0C 2JDMA 3IH4A 3OGRA 5K7PA 1GP5A 1D7PM 4LPLA 3O8GA 4DXRA 3VBRC 1ENRA 2YSRA 4N43C 2L9NA 2YBPA 5FZ4A 5AONA 1NT0A 2K3FA 3GTLJ 5FZCA 3TBIA 1UY1A 4H55A 3H3ZA 5FLXK 4D7MA 1EV13 4MTDA 2PG4A 1UWWA 2QVSB 2LDUA 4Q4V3 1NZIA 3GZUC 3OJBA 2FXAA 3KMHA 1R1ZA 2LRDA 4LD5A 4LEJA 1B59A 3WTYC 2RM22 1U5ZA 4OHXA 2W1QA 3IPVB 1VF9A 1KA8A 1UCXA 1PDNC 3HD8B 3M3OA 1X1CA 3LMMA 1W8NA 3GTPJ 2RVCA 4XNFA 2H6CA 4IEVA 4UFLA 4HEA2 2A5WA 3O1OA 3VPRA 2EF6A 5FYTA 5KHKA 1W99A 5DCFA 3J7MA 3ALQA 4BQNA 4IV3B 3RKYA 1FV3A 1MQTB 4AFAA 2L9RA 1OOPB 4CDXC 4FVVA 2Q1MA 3FXOA 1L0OC 4IUGA 5ACA1 4TV7A 3I3QA 5D4SA 1EAH3 4FCYA 5D5WB 1RB8G 2P3KA 4XIKA 2ZNYA 4MIMA 4E8CA 1AKHB 2JT1A 1IPSA 4Q8LA 2BV4A 4BXXJ 5ERLA 5F5AA 4AK3A 3K70C 3LSGA 2M0CA 4O7XA 2NM1A 3G73A 3F8BA 4EEFG 2XBO1 1TG7A 3ZIXA 4DY5A 3LSIA 5FZHA 2NOGA 2QUOA 4GYIA 4UVBA 1ENSA 2XBO3 3DYPA 2QQPA 5B1BH 3A02A 1MS0A 1CONA 3FWEA 1YJWI 1ETYA 1LKNA 3I64A 1BMV1 2FSWA 5FYZA 2KQRA 4NO4A 2PAKA 4Q5SF 3OEBA 1R1A1 1W6PA 2HEWF 5DXDA 4YW3A 1ETVA 1GLNA 3DTIA 4B1LA 4LO7A 2GP3A 2M87A 4G7ZF 3HKZA 5BNOA 3BTJA 3WQ1A 5HPOA 2YUEA 1WMEA 1HLVA 1B35C 3CJNA 3B93A 5A7OA 2GC3A 4HN0A 2KXLA 4QQPA 2M7BA 2H09A 2KL4A 1P7JA 4EJWA 5F0FA 3FXRA 1V55H 4BBSJ 3I7DA 4RAYA 1VBC3 2R1BA 5E6HA 5FZ0A 3CDLA 4HAMA 2G4IA 1SFNA 5CKQA 4K8RB 1K3IA 3N7JA 4HVQA 4DXSA 1XSXA 2E6VA 2VOOA 4CU7A 5JLWA 2AH2A 2XJTA 4Y15A 4H0EA 4OWRB 2Q8KA 3CP2A 1XD7A 1Z05A 1Y4WA 3VBHB 3P3NA 5LBQA 4LO8A 1DHKB 3WP4A 1Y1VJ 2JDNA 4U7DA 5GZFA 2CO5A 2ARXA 3T2TA 1RUD2 1PO11 1Y8RB 3ZPOA 4X6AJ 5E3MA 3NO8A 2JG9C 5CFDB 1B35A 4OI2A 2H1KA 4KGQA 1L7QA 3ZMDA 3Q9OA 1Z0XA 3OIQA 2VBWA 2QUFA 1YW7A 3DYOA 1DGWX 2R16A 4A6SA 2DI3A 3KYCB 2RS31 3PMEA 3UGHA 3HSFA 3F3XA 4CYDA 1IC8A 1H8TC 3K4JA 3OUJA 5D8AA 3A0KA 2VR4A 3CDZB 2GH2A 1I5PA 3DFGA 2I74A 4ZPIA 1NLSA 3L2WA 2WL1A 5FY8A 1YO8A 2ZCWA 5F3EA 1RUG3 3GZ6A 4CCJA 4ISQA 4P9YA 1T08B 1S7AA 1JKRC 3LOBA 4OOIA 1TMF3 4RHV3 3C2UA 1WCMJ 5JHFA 2WS92 4CDQB 2ZGUA 3K4DA 1YJLA 4BQYA 3SXYA 1U2WA 4CDUB 3CMMA 1DP3A 3OSDA 5GJ6A 3KCCA 3WUDA 5AFEA 3RZDJ 3GZ5A 2RNJA 4EQQA 2A6YA 2V5YA 4QD2A 2W1OA 1QA6A 1C4RA 5JAXA 1GHCA 1USTA 4IX7A 4QPIC 4LTAA 3EYPA 5ANNA 3K48A 3AZXA 2HYGD 2H27A 3TP0A 5D5VB 2Y6FA 3G1MA 5C3QA 2XSDC 5FZOA 5J09A 1A6CA 3B6CA 4OUEA 4JQFA 1OA3A 3DEMA 2VBXA 3EPZA 5FYHA 1G3SA 4FETA 5BNNC 3D1NI 1UHWA 4JGYB 1YE9A 1I50J 1P92A 2A71A 2W1UA 2GZWA 2ZGTA 1SC7A 3ECQA 3RKQA 4AVCA 4PI0A 4G9YA 4ZYDA 1OD3A 4XF1A 3VKMA 4D8MA 2MH9A 1OLTA 2DA5A 4AC0A 4A69C 1D1AA 3ZXJA 1W2TA 2F4LA 5FD5A 1OQYA 2E71A 3H42B 5J4YA 2EVXA 4Q29A 1W05A 1NXD1 3BG6A 4M6XA 2ID6A 1W9WA 3AL6A 4IEXA 1QF3A 5DEQA 5CFDC 3M1HA 4QX0A 4X0GA 5A7QA 3OS0A 1UW8A 3QYBA 3L9FA 3VZKA 4EJOA 2VW2A 3H1CA 2N7GA 2DFBA 3O0XA 2DA3A 5F2WA 4B3AA 2DFEA 3F72A 4LG3A 5E3OA 4MXVA 3BT9A 3J7ZI 2BPA2 5FY4A 3F6VA 1FPN1 1TE1B 1J84A 1W8FA 2D2WA 1LJ9A 4IV1A 2Y48A 5JI7A 1ONVA 2XC7A 2CAVA 3WF3A 2P3YA 1SD7A 1UN1A 1NCRA 4XCBA 1VQ8I 5J8CA 3O1PA 1OFNA 1QIQA 4YRVA 4PF1A 2XAUA 2A05A 4IV1C 1A36A 2JA5J 3AMPA 2VT3A 1IG3A 4HXCA 4ZDPA 2B5HA 4JQRA 1GNZA 3K1NA 3Q8EA 2WR9A 4J00A 3EQLF 2WZEA 3OBRA 1VBA2 3M8JA 1G3WA 1YI2I 5FB2A 4QQLA 4CVUA 4IHWA 2GXGA 4CEYA 3OGGA 2WY8Q 2BOIA 2W3JA 3KLNA 2J1VA 3I5UA 5GPCA 2VTXA 3I2JA 1NK2P 2XJUA 1QXJA 1HN0A 4AVSA 5JLVA 4L99A 5C3PA 5JOWA 1U12A 5JZGB 1C5HA 1XNCA 1RUD3 4P5OA 4NHLA 1R081 4KWKA 3GUDA 2VMFA 1NYWA 2W25A 2QCSB 5K5QA 2DYCA 3PQKA 1ETXA 1XNKA 2OXBA 3KGLA 4FXGB 1QDCA 4YVSA 1O5UA 3AYDA 1P7IA 2WA0A 1HA8A 3GFLA 1ZR4A 1QBJA 4UUSB 1W5SA 3LFMA 4CO8A 2R7RA 4P9XA 2KD7A 3OIPA 4B7EA 5JXGA 3NL1A 4UW5A 3ORJA 2DCZA 1GOGA 3BODA 4UAPA 1ZBA3 1AJKA 2DVDA 4EYUA 2A6WA 2E1MB 3ITQA 5HOOA 2HTSA 5IYCJ 2DA4A 2ME0A 2MW8A 5LEKA 1WLCA 1S1AA 3MFKA 3TO9A 3DCQA 5BXXA 3GJAA 3IL2A 1K5MC 1ZYRF 3IAQA 3U78A 5LGNA 3NAPA 4XILA 3IP4B 5FMOL 2JDAA 4XZPA 5LCWL 4WZCA 2B7EA 2C5DA 3PVBB 5C4WC 3VDDB 1G9BA 1MS3A 1LKXA 5A3WA 3WDWA 1YJKA 2E35A 2EIMH 1DG6A 2A1XA 1AX2A 1X1DA 2STWA 1RUOA 1ULFA 3ZRGA 2WYFA 4ISRA 2G9GA 1ZA4A 1LAJA 5BUVA 1UU6A 1W6MB 3OYWA 3WXPA 5E18F 2R071 1S3JA 2HTJA 1C8M3 1VBA3 3HYIA 4IETA 3I2HA 3J8F1 1OC1A 5DTDA 4AEJA 2ZMEC 5LBCA 2PLYA 5FLVA 1X1PA 2LREA 4EZHA 3DBHB 2YUSA 1WSUA 2IXIA 1M06G 4EJTA 1RVF1 1JZ4A 2QBYA 2KJBA 2XAQA 3L2QA 2YZ4A 2QKDA 1ZHFA 2CFXA 1UYXA 2XUBA 1TME2 2BHYA 1JOPA 1IKQA 1ETWA 3AYCA 1KS4A 4LJHA 4E7ZA 2NVYJ 2VXDA 3HOSA 4RAGA 3PUSA 3JREA 1S55A 1S8NA 2HVSA 4GWMA 3SFIA 2ORXA 1TW3A 3BP8A 1D3YA 1IDZA 2WNVC 4WXCA 3D4KA 3JTGA 2O1QA 4K40A 3BTLA 4G6TB 2TCTA 1UNBA 3ZQCA 2XPWA 2JPCA 5FJHA 3BR5A 1K79A 1RZ4A 3A03A 2PN5A 3SQOA 1DP7P 1GFF2 3OEAA 3I54A 4GALA 2RM23 1X9TA 4CZCA 1JH5A 3NJVA 3ZFGC 1SBEA 3S1RJ 1OUSA 2ATFA 4B7KA 1HKTA 4Q4V2 1UPSA 3SNMA 4EWEA 5FZ3A 5EJZB 1O5LA 4RLFA 5ACA3 3AYAA 3BOQA 3M3YJ 3ILRA 3M3QA 2ZJRF 3CEWA 4CU6A 2XWJB 2PMUA 3FIWA 3S6PA 3GBWA 3WNNA 2KA3A 3DXTA 2A5YB 3LGRA 3SHRA 5CLSA 2PLV2 3MAJA 4ES9A 2QENA 2E36A 3SCGA 2VZVA 4BE3A 3ZXDA 4RYDA 5FIXA 3H1WA 2KZGA 3ZMUA 9ANTA 5JSRA 2Z5WA 4XF9A 1YTYA 1OLMA 3SEQA 5CPRB 2VC9A 2RS53 1SFXA 3VBFC 4ATFA 3VBRA 3T30A 4IEUA 4HVOA 3DU5A 2W9XA 4QHZA 1CF7B 1STMA 1DF0A 1JYXA 1FWZA 1QU0A 2BW3A 4MHUA 4KN4X 5DUWA 4U2AA 4PI2A 4XJAA 3OR1C 2IVJA 4XKBA 2C24A 3S32A 2VZ1A 3VFZA 3KGZA 3I59A 4XFCA 1H9GA 4LMFA 2RV8A 2HPIA 4AYBA 2P0WA 2RGVA 4RS5C 3J8F3 1PMJX 3ZSKA 2QVOA 2JUCA 3PL8A 2XDVA 1JHHA 2BOLA 4O5VA 2GBYA 5JZGC 1C5IA 4M6YA 5FRAA 5HCFA 5L3GA 5DAXA 4R4XA 3JBG2 1DP0A 5JVGF 4QWQA 1MGTA 2EZIA 5FY1A 4FOQA 2AXLA 2M8GX 4LULA 4YW1A 3KV9A 5DCMB 2FBEA 4IHTA 3UKVA 3S0MA 3R0RA 3UNPA 2ZXQA 1N75A 1U5TA 2VOVA 2Q4SA 5CADA 1AL22 1S0EA 1KS5A 5LEJA 2DTRA 4WCGA 1OQ1A 3JUUA 4L2NA 4YFNF 2XAGA 4C1XA 1IXCA 3A22A 4BQAA 3ACHA 3MGUA 2VPLA 2NVUB 4DUVA 1ZLJA 2Y9ZA 3I2IA 2Q0AA 4CP2A 4QX3A 3K0LA 2WFPA 3LEMA 2IRFG 2QSHX 4XUTA 3OYAA 1BW5A 2HDDA 4RGRA 2D40A 2WNUC 2XL9A 4O3MA 2H8RA 3O7OA 4HQEA 2XF5A 1MKMA 3KZZA 1AU7A 4H14A 2YU2A 2RDNA 5A3PA 4IEOA 1RUJ3 3KP5A 4A0YA 3OSFA 5FLIA 2B7YA 3P6BA 4PT6A 5L73A 3CF2A 2NQYA 3F8MA 1EP0A 4C0BA 1WH7A 4XZUG 2EPFA 2R93J 3RZKA 2R49A 4XRFA 4CP1A 1ND3B 2PHUA 1H6XA 3MF9A 3AP5A 1POV1 3CJIA 2R30A 4IE6A 4QAWA 2O9LA 1OHFA 2PFBA 3V4GA 2QQWA 1PO21 2ZTNA 4DQAA 2Q8DA 1IF1A 2A07F 4KMFA 4OHWA 3WNKA 5F64A 2BNNA 4JP0A 3FDYA 3E6DA 4CUCA 5DUIA 1A31A 3CUQA 3ZYGA 3N9MA 4E8DA 1VRBA 5E16A 1AX1A 1OYYA 2A3SA 3MV01 2GH8A 4JGZA 3TNQA 1W6MA 5JI6A 4ZZDA 3ZQLA 2ZNZA 4RD7A 5F3GA 1VAVA 1WLTA 5FREA 4AHYA 2MYSA 4W6WA 4NQWA 1W5TA 2BXZA 1H2LA 3EMRA 1PGL2 5J8FA 4F83A 2DCTA 4A3KJ 5GM0A 3BYWA 3KT1A 1XX5A 1FBQA 4AVTA 4S2FA 2K02A 2DFHA 2OU2A 2ZMEA 5IFPA 3PMSA 4Z2WA 1FP2A 1IQAA 3I3DA 5FP4A 2RJ2A 3TB0A 3GCMA 1VQ7I 4G4FA 3FHNA 1USSA 3POIA 5BPXA 3V65A 5EP9A 1TWHJ 4LLLA 2SLIA 4NROA 1UOJA 3BDDA 3NNGA 5L9RA 2XKOA 1FATA 1RUI3 2ZGRA 3MN2A 2QZ2A 4ENJA 4L18B 3F95A 1W7PD 3QACA 3MF6A 4CCNA 1R1UA 2L9SA 2XGDA 4OUSA 2F4OB 2J5PA 1XJAA 2OF7A 3QPTA 3IH3A 2KRCA 2XAHA 1JT0A 2HXOA 3RJ2X 2JA6J 2YG0A 1QDOA 3CHXA 2JX9A 2JA8J 1F35A 3ZMNA 1FX5A 3LNQA 1D0GA 2BW8A 2E63A 1QJZA 2PBIA 3HPNA 4AZZA 1BMV2 4QIWN 3W58A 2Z69A 2C6SA 1SVMA 1BC7C 4QB2A 2R043 3CC7I 1WI9A 2HDCA 1PX4A 2XONA 1AR93 3HDDA 1EV12 2PI0A 3PO2J 4UFMA 2NVXJ 4C3JJ 1K7AA 4B4PA 1IO2A 2LY9A 2PEXA 2P3JA 1WPKA 2IS1A 3E5UA 3DEUA 2Q1ZB 4JV4A 1F5JA 1MBJA 4A3IJ 4JC1A 3WF0A 3R4KA 4P5HA 3O3KA 5H6RA 3VYRB 4M3CB 2R062 4B47A 2LKXA 4Q4V1 4W65A 3K3OA 2HVRA 2P5KA 3RQIA 1DDLA 1ZRFA 2DTZA 3AKRA 1OKOA 1RMU1 2GAUA 5DDJ1 5FPAA 2TDXA 4BOWA 2RQPA 1XSVA 1OCTC 1WJCA 4SLIA 1B09A 3HGYA 1EH8A 3MZYA 1NH3A 1LE8B 3LDKA 3VHNA 1XYNA 4FPKA 3HGGA 2OX0A 3WP6A 4ZDOA 3DTEA 4HOOA 4CTEA 2FF4A 2VE1A 4UFIA 1YW9A 4AVAA 4CCKA 2XVGA 3TO7A 2RJLA 3K3NA 5BNOB 2D1HA 3GBGA 4V2FA 4M72A 1Z9CA 2WWUA 4HFSA 3OYMA 1WJAA 3FF5A 5B1AH 4ENKA 4I2OA 2LTNA 1GXQA 4RGSA 2CY6A 5FMBA 3I97A 1IN6A 1EAH1 2X85A 1WKYA 1BI0A 5C8CC 5JWPA 1T6BX 3EQEA 4PBPA 4IKFA 4OFGA 2ELHA 2EIJH 2Y38A 2HS5A 4XLNF 4I0BA 3ZXGA 4Y22A 2FDKA 4EGYA 3VBUB 2DMQA 2GXBA 1OOPC 2D3RA 4PF5A 5FZ7A 2A68F 3POWA 4META 1PIV1 3CTAA 4ATEA 3ZR6A 1XYOA 2XL7A 3J8F2 1UIJA 2VQGA 3PUBA 2WSVA 3POYA 4KWJA 4CP9A 1QJEA 2W39A 4LJZF 3PU3A 3T1MA 5IFTA 1K4SA 2I10A 1R23A 1O8PA 3K6GA 5C9AB 1BBT2 2CHHA 2B9SA 1YFUA 1K42A 2ZS6B 2GN3A 3LDRA 2Y8KA 2LOOA 3VEPA 2XPJA 1LESA 3HOVJ 3OGSA 2L7KA 4AU7A 1VQ6I 5IT6A 5C71A 4LFUA 4XRMA 4P9LA 4A41A 1HSJA 3DKYA 5LY2A 3GBFA 4B1MA 2L9LA 3U2RA 2ELKA 3W6VA 2RS52 2E7TA 4H7MA 1ZK8A 5FDBA 2V1UA 4M71A 4W4ZA 1WD4A 4LLFA 5FO7B 1AHSA 1BK1A 3OYFA 5A1LA 2UWBA 1VQNI 4MO7A 1IW7F 1VAMA 2PLV3 3OG2A 3WEZA 5FBZA 2WO1A 3B9IA 3QPLA 1H6YA 5FFXA 2DPUA 4Q4ZF 1UIKA 4YW6A 3MLLA 1ONAA 1HN1A 3FM3A 1V5FA 2BRTA 4JGYC 2HBUA 2ESHA 3I3MA 1UFMA 3BPXA 4II3A 3QRFF 3HOWJ 3SITA 3Q9VA 3GYHX 2RMU3 1ZRDA 2DBBA 1JUHA 4EATA 3VBOB 3ONQA 3K4BA 3I3EA 1UELB 3ES1A 4CDWA 1WKMA 2QDRA 4CP0A 2D6KA 5I0TA 1A6QA 3B5LB 5FQ0B 5I8YA 4Q48A 2HWD2 1JZ2A 1W6QB 1ZR2A 3MV11 2ZGPA 2CSGA 1T2KA 2A3XA 2AXTC 5FPVA 3GYDA 4W50A 2PHLA 2JDYA 1C28A 2P6TA 4AEMA 3I55I 4GFBA 2STTA 1L7LA 1GVJA 1GUUA 4HPKB 5D8KB 4AG4A 3RG0A 1YRNA 2ZX4A 3RZOJ 3NAPC 1L3JA 4P02B 3UGGA 1RUC1 5JVVA 1SDWA 3CMYA 3WT3A 4F52A 3RYKA 4G94A 4LA3A 5LB6A 5FZ1A 3Q8FA 3BPZA 3VYTB 5FYVA 2Y0MA 2ZX0A 3V42A 3VZMA 2X6WA 3RVHA 2FE3A 2M7AA 1RC9A 1XGSA 5FZ8A 2I8DA 4LUKA 4LLGF 2X6YA 3SH3A 3N7MA 3QPHA 3WNPA 1S29A 2DDUA 1FSEA 4LBQD 5TGTA 2E33A 3V0AA 2ZACA 3HAGA 1OPMA 3KCXA 1E0EA 2BYVE 3K1PA 5GP9A 4B43A 3L7WA 1HDDC 1QHDA 2QQUA 4CP9B 4BACA 2DA6A 4A3MJ 3IDEA 1FOD1 3K77A 2ICWG 4XXPA 3S57A 1JOBA 1I6HJ 3WP5A 3OL3A 2VVEA 3GHMA 4Q1RA 3RMXA 2LTPA 4BM8A 4C3HJ 4S0HB 2P4WA 3I9V2 3JCIA 3C7EA 3RNSA 3OUHA 5FY9A 2DXIA 5BOXA 3CMEI 1FYLA 1AR71 1BI3A 5AC92 1ZBA2 2R7FA 3AKPA 2W68A 5BNOC 1PM7A 1MD0A 4K20A 4LG0B 1WJ5A 4BXUA 1H8VA 4JX6A 1QJY3 4RB3C 4JKKA 3A0BC 4J01A 1Y43B 5FO9B 4RB1A 3U11A 1RUJ1 4RGKA 2KPMA 2VMCA 3PUFA 2GMPA 2E1NA 2QQAA 3M3IA 1BKZA 1BR4A 2ZABA 2YV8A 5HS8A 2MG4A 3T8TA 1O3TA 2LUWA 2VTFA 1QVUA 3ZKYA 4FI9A 1D2SA 1JKQC 3J26N 2P2KA 4E2GA 3BI3A 1VMFA 2X5IB 4X8PA 1ZGWA 3N05A 5FYBA 3KQ4B 4L5IA 3TEZA 2XB5A 1QQP1 5FXVA 1VQOI 2QQ9A 1GQHA 4QMAA 1X8EA 2YFZA 5FXWA 3W5NA 3VWBA 1CZVA 4DIQA 3WGGA 5EF6A 2YROA 3OCPA 1MBKA 2VUJA 1C0WA 3PSFA 4BQXA 3OY8B 5HXMA 3PU8A 4YG3A 4XIOA 5H9PA 4H2AA 4Q27A 2R0QC 2FCTA 4WM8C 3VV1A 3DN7A 4IRGA 1IDYA 1Z77A