3FWEA

Crystal structure of the apo d138l cap mutant
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
202
structure length
202
Chain Sequence
QTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLLVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Structure of apo-CAP reveals that large conformational changes are necessary for DNA binding
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transcription regulator
total genus 56
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fweA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3fweA01
4HVRA 3EJKA 2IA2A 5ICEA 1YW9A 1W5SA 2PBIA 1ZZBA 3ULQB 4KMUX 4YIIA 4MTDA 4RGUA 3CF6E 3WTZA 5K1YA 3IDCB 3B73A 4HA8A 4QGLA 1ZRFA 1FX7A 3IHUA 2F5CA 4A5MA 5DUKA 1UHMA 4ETSA 4META 2DPUA 1K7AA 4EGZA 4LUMA 4BAYA 3FMQA 1XE8A 3ETQA 1UPIA 4CICA 4HVOA 2NRAC 2ISZA 4ZZLA 4G7OF 2YU3A 3GEZA 2HYGD 4EMSA 3B02A 4G7ZF 3J81K 5FO5A 4MQVA 2QVSB 4AVCA 5D6EA 1UIKA 2DQLA 1WSUA 1S6LA 1QWRA 2FEZA 3M8FA 3I5UA 1SEFA 1JXSA 4MX3A 1ODDA 1FBQA 3M70A 3S0MA 3UKTA 3ST7A 2PN6A 4LGWA 5CU1A 3H3UA 2BNNA 1FSHA 2FOKA 3FMRA 3W6JB 2NYXA 3R0AA 3GUDA 1YLFA 3K2ZA 2KIFA 2FMYA 2IXCA 4YRDA 3ZQ7A 4HQMA 3KEQA 1BI2A 1T38A 3M1EA 1VP6A 4AIJA 3S2WA 5C6CA 3J81Z 2M87A 3GFJA 2J5OA 3QAHA 3RYKA 3ZMUA 2C6YA 1G3YA 1WLTA 1F5TA 5I0SA 3KSCA 3ERED 2PFBA 4I98B 3LQQA 4LG0A 5CLSA 1SQ4A 2Z5UA 4WX9A 1IRGA 3GFLA 2JSCA 2QJVA 4ORFA 1NHAA 1Q3EA 3GWZA 1FC3A 4B8XA 4KMFA 2UXNA 4PJYA 4AQ2A 1J0RA 5LEJA 4ZU5A 2A6HF 5L3GA 1CAXA 1SD6A 3KP3A 3AAFA 1H9TA 2B9UA 1LKNA 1YFWA 1Z6RA 4AVPA 3PFIA 3GF2A 4LULA 4HF2A 4ZYDA 3DP7A 2CSOA 1LDKB 2HKXA 2HJIA 2TDXA 4HDVA 2OU2A 2VBXA 1VR3A 2CV6A 2LNBA 5HVQC 2PMUA 1XN7A 1RUOA 1HQCA 4HDUA 2IP2A 5D4RA 4P5OA 2O61A 5C8WA 2XVCA 4KIFA 1OFNA 1MDMA 2W25A 4KT5C 1ULYA 4OOIA 4EJOA 2UZKA 2ETHA 3HOTA 1D5VA 5E17F 3RKWA 2ZMEA 2DW4A 3ES4A 1TTYA 4HQEA 1OD5A 4KDPA 3WW3A 2VPVA 2HFHA 1YHFA 5JSRA 2R7DA 2MPFA 1LEAA 4KYWA 3FHIB 1TLHB 2A6EF 4I3PA 2P6SA 1R00A 3I58A 1A04A 3PNAA 2VC0A 2P5VA 5TJJA 3VB2A 1TNTA 3R4KA 2W85A 2LF8A 2YX7A 2W24A 2FRHA 3F8BA 4R79A 1R22A 2L3DA 3ACLA 3DN7A 2H6BA 1JUHA 4QX5A 2P8TA 2EFNA 2RQPA 1KU9A 3R60A 4G94A 2EA7A 1RTVA 4S05A 2QBYB 2VOOA 2GH2A 2D5FA 4WXHA 2ATFA 3H1YA 2H6CA 1P4WA 2Z99A 3V8LA 3KMHA 2COMA 1S29A 5D5WB 3IRQA 2YX4A 2HGCA 1K6OA 1BN5A 2CAUA 2DAOA 1OMIA 2PI0A 2GC3A 1DDNA 1U5TA 1AWCA 3ZN0A 1UCXA 3FF5A 2NS0A 4XF9A 2QYOA 5BV6A 1QNTA 2WV0A 4XF1A 3ECOA 3RPQA 4DINB 1ZN2A 3WTTC 5I93A 1PMIA 4ENJA 4ZZDA 3HOSA 2HS5A 3JW4A 5JFRA 4XFCA 1HBXG 4NVPA 1ZLKA 3JZVA 2BEOA 3V7CA 1IXCA 3NJZA 1F9NA 1O4TA 1WA4A 2NNNA 3I4PA 1EY2A 5D5XB 1DPUA 1Z05A 4ESBA 4KIGA 4OIOF 5CVRA 2OQRA 5KHHA 1SFXA 2PTMA 3WW2A 4DQ2A 1J2XA 4YARA 1Z91A 2Q8KA 2HYFA 5HOOA 1KYWA 4HX4A 4G9YA 2JT1A 3MAJA 2E7WA 2RVCA 4YFKF 4XEZA 4EGYA 5L3FA 3EDPA 3NEUA 4P55A 5BPIA 4XLNF 5LRSA 2ADUA 1LVAA 5AIQA 4E2SA 5FDBA 2FBHA 2FNAA 1OKRA 1O5UA 5HS7A 4OMYA 2P5LC 2GQQA 4EROA 2JZYA 1YFXA 5HLIA 4AVAA 1EV7A 3CUQC 2Z2SB 1K78A 1FXZA 1MGTA 2VBWA 1SFUA 2GAUA 5LRRA 1R23A 4CGZA 3EUHA 2OD5A 4I02A 5HDNA 2KRFA 2P6TA 5L3BA 4ZH4F 4J1XA 2GC0A 3D82A 3S7IA 5LHHA 4HV6A 3VODA 4CDGA 2EFQA 3BROA 2XGXA 4FHTA 4BYYA 2ZNZA 1YW8A 1Q1HA 1FSEA 4E2QA 2OA2A 2J5PA 1ZLJA 3BJ6A 4LLGF 3CL1A 5E1RA 1LNWA 3EYYA 3MZHA 3D0JA 5H6RA 3QP6A 4RD7A 4N9IA 3P9IA 5CVUA 2PFWA 2VT2A 2HTSA 4Q5SF 1I1GA 1U6GA 1FOKA 4BQAA 3FZVA 2YPRA 2PQ8A 4KNYA 3K1NA 4RAYA 5EZWA 4EWDA 4Z07A 3HRSA 4CZZA 3RI4A 2VC1A 2Q30A 3ABTA 3NVCA 1V3FA 1KQ0A 4OLLA 4K8FA 3KZZA 4ESJA 2HOEA 5JI6A 4A2UA 1B6AA 1J7KA 2JRTA 1KYZA 2VOPA 4P9GA 5KHGA 2MHFA 5K5OA 4Q0QA 1BBYA 3GXOA 1J59A 2K0GA 4Q0UA 1T6SA 4IEXA 1GXPA 5HDKA 5I8TA 3I0TA 2Q2EA 3E3VA 3JSPA 2XAFA 4Z82A 3P7NA 4Z2YA 4MGZE 1ZHFA 3NQOA 2Q4SA 4UV8A 5DUIA 2EV0A 3CDHA 3SCGA 1XGOA 5CVJA 4YFNF 3ELNA 3WTXC 1YTYA 2CWEA 5F6FA 4LLOA 4Q0PA 1T2KA 5H20A 3WE3A 2RC4A 3SXWA 1S8NA 2FE3A 1O7LA 1T0FA 4NQWA 3I53A 2PQQA 2MH2A 1IAWA 1NE6A 4PIYA 3IWFA 3O6BB 3U9GA 3ZMTA 1XCVA 3O2PE 2IXJA 1BOAA 4WK8F 1FYMA 5ICGA 4IETA 2ET7A 3LOIA 1GQGA 1B1BA 3FXRA 1V70A 4P9FA 3Q5FA 1YUDA 4H7LA 1J3PA 2XLFA 4OFGA 1XB4A 2DI3A 1YIOA 4UVCA 2GXBA 2XASA 4XFGA 3HTSB 1DZRA 3I59A 4RS8A 5I8YA 3WGHA 3ROUA 1PUEE 4MGKE 4U0YA 3DEUA 1UHWA 1RZ4A 4EJUA 2X0LA 3DPLC 3HSEA 3MZYA 1IXRC 2I45A 4IEZA 3F3XA 2ISYA 4HX7A 2L02A 1I5ZA 2P5KA 3C18A 3HSRA 4OINF 4HLXA 5ICCA 2FQ3A 4L5IA 4A0YA 3E5XA 4LMYA 3BWGA 2O03A 3F8NA 3H9AA 2QCSB 3PQJA 3MQ0A 5ICFA 4UVAA 1P6RA 2QZ8A 5BQTA 2UYAA 5BY5A 4WF2A 3EQEA 3KEOA 4ENMA 2STWA 1QBJA 4KL1A 1G4DA 4F8AA 5E1XA 2KJBA 3IKVA 4KWKA 1YFYA 2BNOA 1EH7A 3HYIA 1HW2A 1MJBA 1T98A 3FFQA 3VEPA 2XL7A 4IEWA 4M9XA 1XE7A 1CAVB 5FQ0B 2NAZA 4JK1X 4MV2A 3OD0A 1QZZA 1ZYRF 1HSJA 3OV8A 2VE9A 1QY4A 1B59A 3UKNA 4XF3A 1C0WA 2Q1ZB 2FA5A 4DNCA 4LUKA 1ZZ6A 4X6RB 1IF1A 3H92A 3C3WA 3E6CC 3T8RA 3TOBA 4YNIA 1SFNA 1H9GA 1O57A 4AXOA 4RGSA 2CYYA 4EVIA 3SHRA 2IT0A 4PGGA 5D5VB 1DGRA 4RB3C 5IT3A 5D5UB 2W57A 3IL2A 1BJAA 4HF1A 1IZ1A 1FPQA 1FBUA 2H94A 1IN7A 4BHCA 4L18B 5EFUA 4IHSA 4WWCA 5I8SA 4MUVA 2FSWA 5DCMB 4MGIE 5HI0A 3VFZA 2HZTA 2MBFA 1MZBA 2RN7A 2ZCWA 4OIQF 1P4AA 5LGNA 3HUGA 4O6JA 3GZ6A 2QLZA 3J7AO 2E1NA 3WGIA 4IEOA 4AWXB 4GULA 3CLOA 1ONVA 4FT8A 2DBBA 1IN5A 1BI1A 2PLYA 4RGRA 4TLFA 3LWFA 2JPCA 3MWMA 5J3UA 4TV7A 3VHRA 4HSJA 1TW2A 2O3FA 1SFEA 3MPBA 1H0MA 4HLYA 5FB2A 3LAPA 1RI7A 3R0JA 3E5QA 4A12A 4EWAA 1X3UA 3ECHA 2PYTA 2ZO4A 2DFIA 5LBQA 3LWCA 1KU3A 5E16A 1MJAA 4MQ9F 1OI6A 1USSA 4XFHA 5BMZA 5LHIA 5ILVA 2HQRA 4IRGA 1BI3A 1ZRDA 2XL9A 3MEXA 4OMZA 4EWEA 1IN8A 1SD5A 3DL3A 3CLPA 2X4HA 1Z9CA 4YFXF 5ILUA 4QLCU 5E18F 4IERA 3CUQA 2XKOA 3IKTA 5E8IA 3IIAA 4H0EA 2EWNA 2LSOA 3ZMZA 1TW3A 3E6BA 2L54A 3CEWA 1R1TA 1W7PA 1LRHA 2VODA 4MNUA 2A69F 1O3SA 1STZA 4EM1A 1JHHA 1SD7A 4RGXA 3I71A 4PGHA 4R1HA 1D3YA 2VN2A 3F8MA 1ZARA 4QWQA 1R1UA 2KJCA 3WTVC 1LEBA 5FLHA 1LB2A 3KGZA 2PMHA 1Q43A 2V1UA 2F2EA 1CAUB 3OF1A 3LA2A 3IDBB 5D6FA 4LA3A 5HDGA 4HAMA 2V9VA 4PIXA 4R8HA 2A68F 3HSFA 3RPUA 4NB5A 3KZYA 3MYXA 4LK1F 4D7SA 3GBFA 5BPDA 2UYBA 4QGNA 1XSVA 4IRHA 3T8TA 1IRFA 2ZKZA 3FHZA 4LG0B 5F1RA 2XRNA 4XLPF 2O0YA 2EFWA 3SMHA 4ESFA 2L4MA 2VBZA 5JSPA 3CTAA 4UNOA 3QP5A 3GYHX 2LDUA 3V7SA 1HW5A 1EYBA 3FMSA 3DQVC 1D8KA 3T1BA 1ZZ9A 4AVBA 1P2FA 2QVOA 2D40A 4JV4A 1CAXB 2OPKA 3TQNA 1FBSA 4EQQA 1PM7A 3REOA 4P9UA 4L0YB 2GC2A 1J75A 3CJXA 1YG2A 1PDNC 5F64A 1O5LA 3FWEA 4LK0F 3FXUA 2DT5A 3F6OA 5BPXA 2QNKA 2IA1A 1T39A 3L7WA 2H0VA 4UBHA 4HW0A 4JTOA 4G6QA 3JTGA 4Q29A 4QM8A 5KHIA 1OYYA 3PVBB 4O9EA 2MLKA 5H6QA 1MDMB 4KWJA 4M6XA 5LEKA 3F8FA 1KU7A 4BHPA 1PP8F 1KU2A 3KP5A 3RDIA 3USSA 1YO5C 1LJ9A 5T3NA 2ZMEB 4MGRA 4LB6B 4XSZF 5EEGA 2RGVA 5J7MA 5FLJA 1I27A 3WTYC 5HS8A 3BDDA 4GGGA 4EJVA 5D4SA 5FCCA 3RKXA 1OR7A 1YW7A 1CX4A 5FGMA 4RAZA 1RNLA 1F4KA 4ZYGA 4MGYE 1J5YA 1XCBA 1UCRA 5CADA 1YFUA 1HW1A 3CUOA 3K69A 2K02A 4O3MA 1UW8A 4Q0VA 3HRTA 4XF0A 1FT9A 1ZVFA 3SXYA 4MEXF 2XAQA 3HHHA 3JAMK 4FX4A 4ZYEA 4GYGA 4I2OA 2RV8A 4Q0SA 1FI2A 1U3EM 2IA0A 3NL1A 1P92A 3GFIA 2M5WA 2PAEA 1U5TB 2EVXA 1CF7A 1ZNPA 3WTWC 3NRVA 3DPTA 2OAZA 3BY6A 2DU9A 3EHKA 1RC6A 3FM3A 3H8UA 3GW2A 4WBBA 3E97A 4CYDA 5FLXK 5IT9Z 3KETA 4L0ZB 5I91A 4RB2C 2KXLA 2FBKA 1EPZA 2EB7A 2CAVA 3JAMZ 1R58A 4IHTA 2ACJA 3GFMA 4FX0A 2EA2A 1OYIA 3C3VA 3L09A 2HWVA 2PHLA 2ZXJA 1D8JA 3L2CA 1WRJA 3G3ZA 4EV0A 5LLQA 4UV9A 5E8GA 5JVTA 3LSTA 3W6KB 1O7FA 2GWRA 3FXQA 4U88A 1TQIA 3BALA 1FYLA 3P9CA 3F21A 3ABUA 3KLOA 4CXFA 2K9ZA 1UIJA 5FLXZ 1CAWA 2P4WA 1QZYA 2R3SA 3M3IA 4UUVA 2GXGA 4LFUA 2KIMA 2V79A 4A0ZA 2PA7A 3LAGA 2GZWA 1GQHA 2VBYA 1SMYF 4OU0A 3ML6A 2IVMA 1TQMA 3OCPA 3WTSC 3KLNA 1U78A 2VECA 1HKTA 2BNMA 4ZYHA 3F8CA 2Z9OA 3Q9VA 2CQKA 4GXOA 2PHDA 4YSFA 2XHKA 1BC8C 2QQBA 2STTA 2P7CB 4HN0A 4U0WA 4HBNA 2QDRA 4CO8A 5FD6A 4KWLA 1ZRRA 5LHGA 5JR3A 1W5TA 1EH6A 4P96A 4YIFA 3UKVA 1NZCA 2XAGA 1DZTA 3IC7A 4LEJA 5LGTA 2L4AA 1KGSA 1L0OC 3QPHA 2HEOA 2FMLA 2JPBA 3KP6A 4MTEA 5BOXA 3M8EA 3ZP5A 5E1WA 2O8XA 2IC1A 3GO5A 2IW5A 5E20A 2R7FA 2HDCA 3FX3A 3U10A 2PAMA 1ZZ7A 4PCQA 1GHCA 2UXXA 5JR7B 3SZTA 1YLLA 1RUNA 4MH0E 5L3DA 1X8MA 3F23A 3RZZA 3JSOA 2Z3YA 3Q9SA 4HV5A 3QU3A 1HSTA 5CYVA 4U7BA 5EEHA 1SAXA 3MDPA 2VT3A 2QQ9A 4ZU4A 1R1VA 2ZNYA 3I64A 2QWWA 2YR2A 5BS6A 5K5RA 2FBIA 3JTHA 5D8KB 3LA7A 2KKOA 1ZG1A 5KK1A 2G7UA 2K4JA 5DD4A 2BYVE 3H50A 1LR5A 3CO7C 1QQIA 1G3SA 3OTFA 4JTNA 4GO1A 3TO9A 3SQNA 1ZGAA 4D0PA 3I7DA 4EJWA 2W84A 3J80Z 5DDGA 4IPAA 1X8EA 4XFIA 2D2WA 3BPZA 3EETA 1PP7U 4E2GA 3WGGA 2WC2A 4XFBA 1ZRCA 1Y9QA 1U12A 1WI9A 2CW0F 3ZMDA 2IPQX 1DUXC 4CHUA 2B0LA 3D0SA 4KU8A 5J8FA 3BP8A 2XV4S 4S04A 1R5HA 1K79A 3MFKA 1XMAA 4HX8A 2UY8A 5JHUA 1NXMA 3KP7A 2BV6A 2V09A 1QO0D 5CVIA 1HKQA 1U8RA 4KFCA 2RDPA 3ZMSA 5HLGA 2XAHA 4KA4A 3DV8A 1KQ8A 3COAC 2GU9A 3O14A 1L3JA 2VQAA 2KIUA 1JE8A 3U2RA 1AOYA 2XAJA 3H1MA 5DD8A 1FLIA 2CFXA 2OBPA 2ETEA 4Y17A 5FLIA 2VXZA 3V7RA 2G7HA 3DFGA 3N97A 3HTUA 4L2NA 4ZU7A 2V1DA 3RIRA 3I59B 3M9AA 4XFAA 2MA3A 4A5NA 2E1CA 3GZ5A 1XDUA 4XRFA 4HVQA 4HZFA 1J1LA 1S3JA 1YS7A 3L9FA 1QGPA 1NYWA 5FPZA 3GYDA 4X6QB 3E6MA 4AD9A 2Z69A 4A6DA 2PJPA 4RB0A 5CVVA 3TO6A 1J3RA 3HHGA 3HT2A 3HIFA 5HS9A 4G8XA 4IEYA 2XLAA 4KN4X 4EJTA 2F5FA 1LQ1A 2FNPA 3SZPA 4OIPF 1RL3A 4Q4ZF 3V8KA 1XGMA 2WWYA 3HT1A 3R6SA 5K8SA 1TBXA 1U2WA 6PAXA 3HRMA 5DYMA 1TNSA 2OQGA 2YSRA 1O3TA 1EH8A 3QOPA 4BH9A 1O3QA 1XGNA 2XIGA 3LA3A 3BPVA 3VOEA 2O6GE 3F22A 2CGPA 5I0UA 4A0XA 1CAUA 3QU6A 2B8MA 3SFZA 3G7DA 2AXLA 4E70A 5J48A 4WZCA 2RNJA 3U11A 3QPTA 3ES1A 2HR3A 4LLLA 3K0LA 4R52A 2GIVA 3LAJA 2MH9A 5JSOA 1Q5OA 3TDZC 2WFPA 3PQKA 2UY9A 1ZH5A 1FWZA 5J6XA 1VJ2A 3WE2A 4HMZA 1RIOH 3KE2A 1R5GA 4YYOA 5LGUA 4WXDA 2H27A 4LD5A 5I0RA 1VTNC 1G6NA 3CJNA 4L9NA 2F4PA 4L9TA 3ZPLA 4L5JA 1O3RA 1Z1DA 3H7YA 2M45A 4LA2A 3HRUA 2ZKLA 4XSXF 1BIBA 1FP2A 1USTA 2K7LA 3EYIA 1XDSA 3R61A 1Z7UA 2ZFWA 5AIPA 1DGWA 4PIZA 4M9ZA 3U1DA 2QBYA 1KA8A 4KU7A 3RYRA 1E17A 3BU7A 2JTVA 4Y13A 5DEQA 2IXKA 3NKTA 3BZ6A 3IWZA 2ZBKA 4AQ6A 2FXAA 1TQPA 4I0AA 2D45A 3WG9A 2MD5A 2D1HA 2IXLA 4AIKA 4L9JA 3LZZA 3FM5A 2H09A 3BCWA 3WU1B 3ISPA 3PLQA 2P7VB 1BIAA 2MC3A 3D5LA 3KP2A 4Q48A 3DKWA 2XUBA 4M74A 2EJRA 1BC7C 2Y0OA 5KHKA 3P9KA 5L3EA 5DCFA 1S7AA 2BGCA 3V4GA 2QUFA 2IRFG 3BB6A 4AIHA 5KHJA 1BM9A 1W7PD 3WODF 3ZMVA 1XMKA 3CUQB 1FNNA 4N0BA 3WW4A 4BXUA 1S7OA 2IXHA 3E6DA 1W7PB 3TGNA 3DF8A 2C0ZA 5DV5A 2EV6A 3F72A 5BUVA 1DPRA 2OYZA 1SD4A 1IN4A 1BI0A 2K4BA 4I01A 1B4AA 1ZREA 1ZAOA 3C1DA 1ZZ8A 2M30A 3I54A 1UFMA 2HKOA 4XFFA 3FE5A 3BJOA 4QGMA 4G6DA 2A3SA 3TKYA 3FJSA 4ONUA 1ZG5A 4YG2F 2DTRA 1FZPB 4LLNA 4IRIA 3L00A 3F6VA 2OZ6A 4KUMA 4JBAA 3BPXA 1IN6A 2A07F 1ZX5A 3GX4X 2M8EA 4O9GA 5D1IA 3KCCA 4PZJA 1XSXA 2DK8A 5HLHA 3ELKA 1ON1A 5ED4A 5JAXA 1XSDA 2NNYA 2Y75A 2WTEA 3RKYA 3ZDSA 4LB5A 1OYWA 3LQRA 5L3CA 1YWKA 2EFOA 2DO7A 4LJZF 2L01A 2K27A 4IEVA 1QPMA 2FF4A 4IEQA 4L11A 5AVPA 1I6XA 3L2HA 2EAAA 1H1MA 3SCHA 5JCTA 5ILSA 5A2QK 4LTAA 2E9QA 1YS6A 2EA4A 2RKHA 2OA4A 1JGSA 5CJ9A 3TNQA 2V6CA 5J8CA 2AS5F 4J1WA 1J3QA 3C7JA 4B09A 4O5VA 2GC1A 2ELHA 1YFHA 4BIFA 4GYIA 2PG4A 4I7HA 2Q0AA 4WCGA 4RB1A 2BBYA 5IT9K 4F7ZA 5K5QA 1IUYA 4ENNA 3EQLF 1J58A 3V8JA 1ON2A 3FZ3A 4JQFA 1WGPA 4IF4A 4HN1A 3BJAA 2VONA 2UWMA 3NSTA 4ON0A 2XLGA 5A2QZ 1EP0A 1LDDA 3CO6C 2Y48A 3OGJA 1IW7F 1G3TA 3G73A 4MHGA 1P4XA 3M7GA 1SMTA 2O1QA 3O3KA 3EBRA 1OPCA 3SHFA 2P17A 5FFXA 3QACA 1NE4A 1YQAA 1IXSB 4BNCA 3TNPB 4HSLA 4M73A 4IEUA 1WQ2A 2VE8A 4I0BA 1LDJA 4M9SA 2EFPA 2PEXA 1J9IA 4U0VA 2M1BA 4M72A 4XF4A 1L3LA 1GXQA 1UD1A 2OZJA 2ESHA 1X7NA 4M6YA 3U0ZA 4FAHA 3TO7A 3RTRA 3KP4A 1G3WA 3MCZA 2LKPA 2FU4A 2O8QA 4ENKA 4HYEA 1REPC 5BXXA 5FFZA 3CO2A 2ZJ2A 4UXAA 3RNSA 3NW4A 2CG4A 1E2XA 3N4MA 2DK5A 1MD0A 1DP7P 2N7GA 2A61A 2B5HA 2MLGA 4EM2A 2IJLA 2GA2A 2DCTA 2DQRA 3QRFF 4XBFA 1HKSA 2D5HA 3H7JA 1HXDA 3K1MA 2DLLA 4I09A 4IEPA 1MKMA 1CF7B 2XKPA 4IXAA 2ESNA 2D93A 5KVRA 1K78B 1B9NA 1RGSA 3T5XA 4UVBA 1IPJA 4NHJA 1IPKA 4IESA 3T0YA 2Z33A 1QXRA 1FP1D 2ET1A 4FBFA 4QMAA 4M71A 4B29A 2OZUA 3RJPA 1V4RA 1XGSA 1R7JA 3TOAA 1X82A 3KGLA 4N9HA 1UB9A 2LF7A 5FPXA 3S7EA 2HTJA 1XRUA 5AONA 1I1SA 3LFKA 4MZUA 2QM3A 4EM0B 3EO6A 3DXJF 2F5DA 1CGPA 5KBFA 3J80K 1KQ9A 1WKMA 4A6EA 3GVAA 3HQXA 1JHFA 3BOQA 4BHBA 4UBGA 1B9MA 1Y3TA 4Y15A 3E5UA 4HLTA 1U5TC 1CAWB 4UXNA 2Q0OA 2XROA 5I0TA 4G7HF 1F1ZA 4KN7X 1CAVA 2HQNA 5FQ0A 5TRDA 2IXIA 5FD5A 4KICA 1Z6TA 4WXCA 2DPDA 2G9WA 4QXKA 2MNGA 3OOPA 2PAKA 1MJ9A 3SCFA 4FAGA 3K9TA 4GCVA 2CO5A 4IJAA 2E7XA 3ZN1A 4Q47A 1ZGJA 1H1IA 2EV5A 2Y0MA 1FY7A 4IVNA 2F5EA 4XETA 4WVZA 4D7TA 2QQAA 2QENA 4K2EA 3H1WA 4HOBA 1R36A 1QXJA 2FQPA 1W4MA 3RYPA 2D1VA 1Y0UA 3WW1A 2EK5A 1WWXA 3WTUC 4HBLA 4L9VA 1TQ5A 3TDUC 3IRRA 3IBMA 4QM9A 4ASNA 2V1XA 5DCMA 1ZZCA 4U7DA 4PDKA 3H3ZA 4OIRF 5D8LB 2BE5F 1FYKA 5E1ZB 1YYVA 1GVJA 2GA1A 3K1PA 4KIBA 4HF0A 2K86A 4JVAA 1ZG3A 3KFWX 2A5YB 5ERIA 1XD7A 4UHTA 3GLXA 4MEYF 3WU0A
chains in the Genus database with same CATH superfamily
4KJZA 3WNPA 3AXDA 4TTGA 1W5SA 3ZSJA 4AHWA 4R9DA 3CF6E 4A44A 5K1YA 4QHBA 4ZYAA 2F5CA 4A5MA 3JRIA 4DEVA 4ETSA 4META 3H36A 2DPUA 3T0DA 3LDKA 3O12A 3FMQA 3ETQA 1Z67A 2D6PA 2VQGA 2BFUS 4I6ZA 2ID6A 4HVOA 2WA0A 2DVGA 3WG3A 2OUMA 3J81K 2XVLA 2QVSB 5D6EA 5F3GA 4B4CA 2WSUA 2DQLA 3VDAA 2ZC2A 1Q8OA 1RINA 1S6LA 3ZXDA 3GZNB 3HNMA 1HLCA 3WF3A 2FEZA 3I5UA 1R9TJ 1QMJA 1JXSA 1E5IA 4MX3A 2JWPA 2KT0A 3S3NA 1H6XA 5IPAA 5FZCA 4CUAA 4DYRA 3AYCA 2K3PA 2DOAA 3I4IA 2CW7A 1YLFA 3RGBA 5T52A 2HEWF 2UWBA 3DEMA 2WZR2 5A3MA 4XM3A 5A1LA 3CCLI 2GBYA 2UUZA 3IM0A 3O7OA 4XIKA 2YPDA 4E7HA 1DQ1A 2VL4A 1I3QJ 3QAHA 2X10A 3BR2A 3RYKA 3GCMA 2ZX3A 5FROA 2VQLA 4Q4W2 3PUHA 2DVFA 1O4ZA 1F5TA 1KFXL 1MBJA 5I0SA 1MSFC 2WNUB 3MUZ1 4P9XA 4F92B 3N9LA 4BB3A 1VAKA 5CFCC 5CLSA 3GCXA 2QQLA 3AG2H 3CDIA 2MEV3 1S0EA 4B1MA 1NHAA 3TP3A 3I3DA 1FC3A 3WP5A 3D5RC 1PVC2 4Z92B 5SV8A 2TUNA 4PQ9A 3LSHA 4AQ2A 5LEJA 4ZU5A 4Z6YA 5KXEA 2DJIA 5FUPA 1WW6A 1T0FC 3NO8A 1SD6A 2EILH 1LHUA 1Z6RA 1I5PA 1LU1A 3NV1A 3GF2A 4A3LJ 4CCCA 4XDPA 3C7HA 2BW3A 1KJLA 1LDKB 4HDVA 5BNOA 2W0XA 3BQYA 2JA8J 4E4SA 1HRV2 5FY1A 3VZOA 2PLV1 2JDKA 2E19A 2VO5A 3JUUA 4XQFA 4D7NA 1YRNA 2XR4A 2WNVA 2JA7J 4MXWA 1NK3P 3QBQA 2K9LA 3FIWA 3OWTA 1FNZA 2YPJA 2ZMEA 4KNCA 2FCVA 1Z21A 4HQEA 2EAKA 1MQTC 5JUVA 2JKXA 3VZKA 1GU3A 2MPFA 4QX1A 3FHIB 1PZ7A 3OG2A 1Y7BA 4Q4X2 3NQHA 3HKZA 3PNAA 2P5VA 1FNYA 1AX0A 2FDJA 1QQP1 3KD4A 1GOHA 2YX7A 2GNBA 2L3DA 3K46A 1LOEA 1FMD1 1JUHA 4QX5A 2EFNA 1Y56A 4CEWB 3SEPA 3R60A 4G94A 2WO1A 2RJ2A 3POBA 2VOOA 3O5SA 3S1NJ 1H0BA 4E7SA 4YFZA 3B7MA 3QYFA 4IQPA 1WBFA 3KMHA 3K2AA 1PZ9A 5FREA 2HDWA 1F8VA 4S2GA 4M4PA 3W3CA 2HWB1 5D5WB 1BN5A 3KV4A 1DDNA 1V6OA 1AWCA 3DCFA 5LZ6A 1UCXA 2NS0A 5BV6A 1LVKA 2QEXI 4J01A 4BK4A 3U75A 1RHI3 1S55A 4DINB 2H0BA 3WTTC 1FIPA 4BY1J 4F3JA 4JGYB 4ENJA 4ZZDA 1MPXA 1TWCJ 3JU9A 2BEOA 3V7CA 2BY3A 4JP0A 2OQ7A 3CZ6A 3JQXA 4XN0A 5E3OA 1VQKI 1GBGA 3IUOA 3NJZA 1WA4A 1JKPC 2MG4A 3K48A 5FO9B 3VN4A 2ZGRA 1Z05A 4ESBA 4AF9A 3TEZA 2VKEA 1Y39A 4FO9A 2OQRA 1QJU2 1FYUA 5HCFA 3WCRA 1H30A 2WL1A 5BNPA 5CFDA 1BBT2 1US3A 3MAJA 3PJYA 4JRAA 2RJLA 1XC5A 4XEZA 4EGYA 2BOLA 4P55A 3RZDJ 2JSPA 4D6RA 5J37A 2JDHA 2FDHA 2QKDA 4E2SA 1A5JA 1UN1A 3USUB 1EF4A 3FKJA 2FNAA 2ARXA 5IVCA 3ZPOA 4CYCB 2CH0A 2JZYA 1LU2A 4PFOA 5B4NA 1D0GA 3WDWA 4AVAA 4FOWA 1AZDA 1EV7A 4BM8A 2Z2SB 3HDDA 4LO5B 2Y64A 2GAUA 1SVMA 4CGZA 2XPJA 2OD5A 4I02A 5HDNA 3O0XA 4XKBA 1K12A 4FCAA 2GC0A 4HV6A 2OCEA 1KGYA 4B4PA 2GXAA 3OUJA 4COVA 1ND3C 2XGXA 5A7SA 2JDAA 4MFDA 5FYCA 4UYBA 3I3EA 5KC5A 5L36A 1OH3A 2W4SA 3JBG2 2R92J 3QD6A 2OA2A 2J5PA 4ZONA 2LY2A 3NKGA 1UXXX 2BQPA 1RUH3 4XZUG 1X4OA 3MZHA 3D0JA 5H6RA 1Y4WA 2LW8A 2WN3A 2XGCA 4PJLA 2DF7A 4YVWB 4Q5SF 3X2QH 1U6GA 2C24A 2ZZJA 1R1ZA 1W2NA 3URFA 4PDWB 4N7UA 3OYHA 2PQ8A 2JA5J 4V2FA 4EWDA 3OYCA 5GAEJ 3T1LA 2Q30A 1HA8A 1KQ0A 5IYDJ 3VDBA 2RQQA 4MYEA 1YITI 1W3XA 4ESJA 2HOEA 1K4TA 1A6IA 2JRTA 1E57A 1S2BA 4YVSB 4YZ1A 3AP6A 5J4VA 2K0GA 1T6SA 4IEXA 4C3JJ 3MBWA 2FDGA 4Z2YA 3AXEA 2Q4SA 5CFCA 4UV8A 4LT5A 5CQGA 3SCGA 4QB6A 3BTIA 2BOIA 3UKGA 3ELNA 2JIGA 5IVVA 4DRVA 3WTXC 5IAVA 1UMIA 1DFQA 4XUOA 2ZB9A 3I2KA 1A3KA 1HDPA 3WE3A 2RC4A 4JGZB 3CJIC 3SXWA 2FE3A 1T0FA 4LKFA 3I4NJ 4QHOA 1ASJ3 3OSDA 2VBDA 4P9JA 1BOAA 1UOGA 4N4OB 4IETA 2ET7A 1B1BA 4IGQA 4AM3A 3AKZA 1YUDA 3WZ1A 1JODA 1GDTA 4QIWN 3AG3H 1JKOC 1BK1A 4DXZA 5IK4A 1B35B 1XB4A 5K0UC 2DI3A 1YIOA 3AKSA 4UVCA 1FTTA 1VBD1 2XASA 3HJEA 3I59A 1MNDA 3OYMA 4DY5A 4YW6A 5FTTC 4CUCA 3GTMJ 3MZYA 2AC1A 2W1SA 4IEZA 2F4OB 1I5ZA 2P5KA 3C18A 4L5IA 1DQ5A 4NWVA 4LMYA 1JUIA 3BWGA 1U0AA 1V5GA 1OQEA 5BNNB 3OEAA 3MQ0A 3OUHA 5D8AB 1UHSA 3K2OA 1MQTA 2UYAA 1OJLA 4A7ZA 2K85A 4H7MA 2L9VA 2O8KA 3KEOA 3EQEA 1QBJA 1OKOA 1SANA 4K3UA 1LAJA 4DOUA 1D1BA 4IL6C 3NJYA 1HW2A 3R0RA 1PM4A 4L99A 5HODA 2LOOA 1CAVB 5FQ0B 1VQ8I 3AFGA 2ERFA 1UZCA 3OYAA 3IAS2 2VZRA 2QA4I 1JT0A 1QY4A 1G9AA 3WU2C 2Q1ZB 2JE8A 2FA5A 4ATEA 5T50A 5E3LA 3TMOA 3T8RA 3PIJA 2DBNA 2LRPA 4AXOA 3BT9A 3VUOA 5C3QA 4RGSA 2OT7A 3ZN5A 4EVIA 3SHRA 3LF7A 3CJQB 1AYN2 3IL2A 2X6XA 1MMSA 4HG6B 2M4GA 1QJFA 4UOJA 2NLRA 5ANNA 4L18B 2R6QA 2FSWA 4FI9A 4MGIE 1O6UA 1XPWA 3LSIA 5AC92 3OOUA 2E1NA 2OXBA 3WGIA 3SH3A 1W5CC 5C3OA 5J40A 4FT8A 5I0DA 3VBSB 1YHQI 5FPAA 4IE6A 3VB9A 1PVEA 1RHI1 4TLFA 2JG9B 2JRMA 4CDQC 3FBMA 1S0BA 5J98B 3OYWA 4TV7A 4MFEA 1NLQA 3MPBA 1NCRB 3OS1A 4HLYA 5DUWA 1DGWY 5DS9A 1OVSA 1CPMA 3R0JA 2L9NA 2BBVA 4A12A 5L7OC 1HB1A 2ZO4A 1KU3A 1OI6A 1NKGA 3VL8A 2EIDA 3EUKL 2P3IA 1ZRDA 2XL9A 3W21A 4OMZA 2ZTNA 2VMEA 2X4HA 3P3PA 2ID4A 1BCXA 2DMQA 4AI1A 2GMEA 4JX5A 2BTVC 5EHDA 4JC1A 4R9BA 2W95A 2R041 3J8F3 2VE1A 1SLIA 3ECQA 1WH5A 2VODA 2Q8CA 4MNUA 2A69F 3D3AA 1O3SA 2VASA 2QQJA 3I71A 4IV1B 3SISA 4QWQA 1RUF3 1ND3A 1EJ9A 4DJAA 2CDOA 4RQPB 5FLHA 2VCCA 4QXHA 2PMHA 2K9MA 1A8MA 1WFXA 5A7PA 3WF4A 3IDBB 1XOYA 5HDGA 1NTCA 4HAMA 2JECA 1SMVA 1XS9A 2A68F 3RPUA 1WLWA 1XX5A 1RUG3 3KZYA 3MYXA 3ZQFA 4GMP3 3SEEA 4D7SA 1BXHA 4QGNA 1XSVA 5EJ3A 5L9RA 1COV3 3LSRA 1LTEA 4NR1A 4TZDA 1UX6A 1VQ5I 4LOTA 1LOGA 4XJAA 2R7SA 4HK9A 5FPLA 1OOPB 4YGDA 2YV8A 2CUJA 2LS6A 3I2JA 3VGIA 3DQVC 3LFUA 3T1BA 1JKRC 4LBQA 4N43B 3MV01 4AVBA 2DDAA 5L9VA 2QVOA 4JV4A 3LGRA 4WVMB 4A3MJ 1BZWA 1ZTRA 1WCQA 3WF0A 3ZXAC 4P9UA 4L0YB 2GC2A 1VBE3 1Z3XA 2YGLA 3VD7A 2GN3A 3FWEA 2LC2A 2JB4A 4AEJA 4QPWA 1FOD2 3S2HJ 1WCKA 2D43A 2FJ1A 2H0VA 3UJOA 1E5HA 3GM8A 1OCPA 4O9EA 4QXBA 1MDMB 2ARBA 1JZ6A 4BEHA 5LEKA 3CJIA 1W0PA 1JOPA 5T3NA 1FOYA 2GM4A 2R5ZB 4QD2A 1QF3A 2CQNA 2NS8A 5A3PA 4V2VA 3O1PA 4LB6B 4YZ3A 4G6TB 4XSZF 4ZS3A 2M34A 2RGVA 1BVP1 4P1WA 5EYXA 4JQRA 4OHYA 5K0UA 1OLQA 3K4CA 3BDDA 1GOFA 4Q8KA 3AL6A 1HQLA 2VU9A 1D1AA 4ZYGA 4MGYE 1GZWB 1S0IA 1G7YA 1UCRA 5J4YA 3GTOJ 3BKZA 1HW1A 1Y9MA 1I9RA 2MC4A 5J1XA 4NC6A 4PBOA 1FT9A 3HHHA 5K9YA 4FVVA 1B72A 1XTAA 1XMXA 4XDQA 2O8OA 4OQ9A 2J42A 1ST8A 3TN92 1U5TB 2EVXA 1CF7A 3ORJA 5B1AH 3NRVA 1OLTA 1OVPA 1QQP2 3BY6A 2WKKA 2QQIA 2GOXB 1RC6A 2W08A 3W2AA 1M4WA 4TLGA 1WJEA 3G71I 4CYDA 3OYIA 1OXCA 3ZFGC 1KDKA 3BPSA 4FQ4A 4S2FA 3OY9A 2V4VA 5FYVA 4L0ZB 2CWSA 1WJBA 2FBKA 2WQ4A 1IS4A 1T6BX 2EB7A 2P0WA 1HJGA 3MKYB 2QZ3A 2HOTA 2RHPA 4COWA 4Y4YA 1URXA 3THTA 3WXPA 4B47A 3AC0A 2YG0A 5LLQA 5JVTA 3Q8CA 3EXUA 1R5ID 2R0HA 3LSTA 2RVAA 5LK7B 1DDLA 4XTPA 1N77A 4Q4Y3 2GWRA 4NIDA 1P7IA 3BALA 3JCUC 4K9SA 3ABUA 1GWKA 4CXFA 4M3BA 3CP2A 1GV9A 5FKMA 3K4BA 3JD72 3SDBA 1S2EA 4UUVA 2A5WA 2V79A 1GSLA 3M8LA 5C8CC 2BERA 3OCPA 1R1A2 2QDNA 4DBRA 3VPRA 1OKQA 3KLNA 1U78A 1HKTA 3ITQA 4ZYHA 3MPPG 1IQAA 2Z9OA 1NA1C 4CDQA 1G8XA 3GLLA 1BEV2 3RWKX 2LY9A 4DW6A 2IGKA 2R93J 4HN0A 1CPNA 4FFGA 4PK4A 1O8PA 2QDRA 4BK5A 3IDEA 3LIGA 4XZPA 3RMYA 4F93B 1W5TA 1EH6A 4ISRA 1NZCA 5L7OA 4M3CB 1AX2A 4FPYA 1A6CA 3QPHA 2FMLA 3S1RJ 3KP6A 1GYKA 1QVTA 5BOXA 3ETPA 3DWLE 3LSGA 3M8EA 2O8XA 2IC1A 3PUAA 1MS1A 3FHQA 2IW5A 3F2ZA 2R7FA 1QJX2 3BR6A 3BQZA 3O1SA 1ZZ7A 2FCUA 1GHCA 1YLLA 2XOMA 4MH0E 3N9PA 1X8MA 4HPKA 2V4AA 3JSOA 3RZZA 4XRSA 2Z3YA 3X29B 3GMEA 3POYA 3QU3A 1HSTA 5EEHA 1BR4A 3MDPA 2XJVA 3RQ4A 5F39A 4ZDLA 3H8OA 3I64A 4GB32 3OMYA 5K5RA 3ESWB 3UK9A 3S15J 3LA7A 5FK8A 1OCTC 1D0ZA 5FYUA 1ZG1A 1R082 2Y0IA 3D5OA 1QH6A 4BQOA 4D3WA 2E35A 1FOWA 2LMDA 3CO7C 1QQIA 1NQDA 3DKYA 3QYEA 1DU0A 2AQEA 5FLMJ 3I7DA 2W84A 3J80Z 5DDGA 1X8EA 2CV1A 1TWGJ 3EETA 1UNBA 3ZM8A 3WGGA 4XFBA 4XJ8A 4Q26A 1U12A 5E89A 2IPQX 1DQ4A 1OUSA 4CHUA 4KU8A 2VW1A 5FRMA 2FX0A 2D7FA 1R5HA 1SBDA 3VD5A 1XMAA 4ABZA 4HX8A 5JHUA 1SLBA 3W5NA 3KP7A 2UURA 4GMP1 3ZMSA 2A71A 2XAHA 3CIHA 2HPMA 3LSPA 2GU9A 2WV1A 3HNYM 1COV1 2XHNA 3VKLA 3WDXA 1GT0C 1G59A 4UWDA 3TRSB 4C9YA 4ZDOA 3DTEA 3UJQA 2XGDA 1T2XA 4IV3C 3BU0A 2G7HA 3BG7A 3HJRA 4DZJA 3ZYHA 2WT0A 2LRDA 1SFOJ 5K7HA 1ZBE3 2V1DA 1VF9A 1SVOA 4UI9L 4JX6A 5IVEA 2E1CA 2WQZC 4HZFA 1J1LA 2J1UA 1QGPA 3GYDA 4X6QB 1NZIA 4A6DA 1YOVB 2PJPA 5TGTA 5CVVA 1DYPA 4CU7A 3LEKA 3LPGA 4A6SA 2QKMB 4M3EA 4IEYA 2XLAA 2FNPA 4OIPF 4EZHA 1RL3A 4Q4ZF 3V8KA 1KEXA 2G9ZA 2CL2A 2XJTA 3M3YJ 1QJY3 2CGOA 4OUEA 5IOZA 5DYMA 4FP2A 1TNSA 2OQGA 1O3TA 3DCQA 4BH9A 2XIGA 3QYBA 4NHLA 4GAZA 3VOEA 1W6MB 1PGL1 2W9XA 4A0XA 5IVBA 3G7DA 5F3IA 4E70A 3OR2C 1P7JA 2ZJPF 3WHUA 5JLWA 2HR3A 3SDGA 3K0LA 1UZVA 2GIVA 1HRI3 2MH9A 5C7GA 4BACA 1Q5OA 3MFAA 3VHNA 4ZXEA 3PQKA 1OPOA 3OYDA 3NNMA 1H6YA 1UY0A 2KISA 5IATA 1R5GA 4PI2A 5JZGC 1W0TA 2H27A 4CE8A 3WQ7A 2BY1A 4L9NA 4L9TA 3ZFGA 4K40A 1W0OA 3AG1H 3C7GA 1HXS3 1BIBA 3EYIA 2ZFWA 3HD8B 4M9ZA 2QBYA 3AKRA 3RYRA 1E17A 4Y13A 1P8JA 2W94A 4OHWA 2X5IB 3PJQA 3ZN6A 4AQ6A 2HWD3 4CDXC 2FXAA 4OYUA 4JQTA 3AB0A 2D45A 3WG9A 3VKOA 2IXLA 3BCWA 2H09A 3WU1B 3QCWA 3IH2A 3ISPA 1UOJA 1ZBA1 3BIEA 5C8CA 5HXMA 2RMU2 3DKWA 3WDVA 1C1FA 2EJRA 1BC7C 1OA2A 2HOAA 1UYYA 1S7AA 4BQ1A 2RAEA 5FZ0A 2QUFA 1NA1A 5KHJA 4BLIA 1AL0G 3CUQB 4XK4A 3IB3A 3SEQA 4N0BA 4CEYB 2ECBA 3HN1A 3MLKA 1LCLA 4B8EA 4A6OA 1VZ0A 4BXUA 5DUVA 1S7OA 3Q0VA 3CZUA 2C0ZA 5DV5A 2EV6A 4IE7A 1DPRA 5ANQA 1IN4A 2IS4A 1ZAOA 5BNOB 3A4UA 3H8XA 4GJZA 4G6DA 4YG2F 5J1YA 2XJSA 2DU0A 2DTRA 1FZPB 3RPUD 2OZ6A 3NJXA 2A07F 2VR4A 5D1IA 5T5LA 1YI2I 3AKTA 1SEUA 4RR3C 3ZDSA 4NJ4A 4XLEA 5J09A 2EFOA 2Y34A 5T5JA 1OLRA 2R042 4IEQA 1QPMA 1I6XA 3L2HA 1W8OA 1H1MA 2EAAA 3GZTB 1OD3A 4PF5A 3S14J 1XNBA 3QWLA 2EF6A 2W1UA 1YJWI 4MXVA 2E9QA 1R091 5JDBA 2RKHA 2OA4A 3W2VA 1AR92 2V6CA 2AS5F 3T2TA 4C2MJ 1Q56A 4AGGA 4QU2A 3ABLH 1YFHA 4WM7C 1EUTA 1IPSA 4GYIA 4RB1A 1TNRA 1Z0HA 1IUYA 1X19A 1PVXA 5CKMA 1IDYA 3FZ3A 5DMYA 1WGPA 4XKVA 4PI0A 2X29A 4ON0A 2XLGA 5A2QZ 4ZPIA 1JZ2A 4OUMA 5F6LB 2W00A 5KHDA 1W6OB 2IAIA 3CD6I 2LY1A 1SMTA 3BR3A 4IHWA 5FYBA 3KPHA 3QACA 2VQTA 4BNCA 4HSLA 4M73A 4IEUA 3BG6A 1WQ2A 4I0BA 1LDJA 1W6NB 5KR7A 1J9IA 2XWJB 4XBLA 3L2QA 4A42A 2CS3A 4IV3A 1JYWA 2M3AA 2VZUA 4YM3A 4JDOA 4DYQA 2G0EA 2ESHA 3BZCA 3O1OA 3U0ZA 1L7QA 4M3CE 3AX4A 3S17J 4BQWA 2W5FA 4RMNA 4NN0A 3HPNA 3MCZA 2BU9A 2G19A 5JPMB 1HIXA 2O8QA 1NT0A 4HYEA 1REPC 1X58A 2JVHA 4NUBA 5LBCA 3GTGJ 1DGLA 1LJ7A 3VKMA 2ZJ2A 3VZLA 1ZBE1 5M5XJ 1D2QA 2CG4A 2I8DA 1VBC3 1DP7P 2L0KA 2VUJA 3CMGA 4PBPA 2WAQN 3G6EI 3GTLJ 4URTA 2DQRA 3PUBA 3QRFF 3J4UH 3ZFEC 4BXFA 1H4HA 3H7JA 4FP3A 2XAUA 5FR3A 5IYCJ 2J7MA 2ZHKA 2RS53 2FDKA 5KVRA 1ALYA 4H4KC 2OTJI 2VQCA 3T5XA 3VDDB 5DAVA 3M3OA 1IPKA 5D2AA 5ABJA 3KCXA 4M71A 1QJY1 5LW9A 1R7JA 3TOAA 1PMJX 1IG7A 5CB7A 3KGLA 1PMHX 1UB9A 2LF7A 3S7EA 2HTJA 1ENHA 2R073 1I1SA 1RUD1 2QM3A 1AR72 1MS3A 3PNTA 3N9MA 1PX3A 3DXJF 1R49A 3I2HA 1KQ9A 5T54A 4AK3A 3OYBA 1UQXA 1MS8A 4FCYA 5JZGA 1ULCA 4UBGA 4XLHA 1ZK8A 1H2MA 4UXNA 5HBAA 3ZSLA 3MKZA 1F1ZA 4KN7X 1FTZA 4A3KJ 4I30A 5TRDA 2IXIA 3HAGA 4QQPA 4DUVA 4XPVA 2RE9A 3WP4A 4QPYA 3INAA 2JDZA 1Z6TA 3LQCA 3C7FA 4WXCA 2PAKA 2XQXA 5B4XA 3HGYA 5CAZA 4GCVA 4NHYA 2E7XA 1W6PB 4N90A 5IWFA 3WHBA 1K3IA 4Q47A 5EWSA 2Y0MA 3TYJA 2YROA 5FWJA 4XETA 4CDXA 4K2EA 1WCMJ 1HXS1 2J1SA 2YUEA 3ZPYA 2X8KA 2OTLI 3N3HA 3RYPA 4GH4C 1QPIA 4C3IJ 1QOTA 1POGA 1WWXA 3WTUC 1BHGA 1OCZH 2BVMA 1GLNA 3ZVXA 4PDKA 3H3ZA 1Z7S2 1GVJA 2HWD1 1LEMA 4HF0A 4HG2A 2KHMA 3VYRB 1PK6C 1F15A 3KFWX 1AR63 2DA4A 5A32A 3KVBA 5GTHC 1BR1A 2EIJH 4MEYF 5FBJA 4HVRA 1VBB3 1ZZBA 4KMUX 4YIIA 2ENRA 4MTDA 1T33A 5IAXA 3B6AA 1AR82 2AQFA 3B73A 3J9SA 3DF0A 1FX7A 4DZPA 5EDNA 5DUKA 3OYLA 3KHCA 2DU1A 5EZGA 3TOJA 4CICA 2ISZA 4ZZLA 1VB4A 2IEKA 2Y0SN 4RR3A 3VBHB 1YX5A 1MQTB 2ES3A 1WSUA 3M8FA 3UGHA 1SEFA 1UPSA 2HWC3 3PVOA 2I10A 4N4NB 3S0MA 4COZA 3CMMA 2PN6A 3RSNA 2F4MB 1QVUA 4LGWA 2E33A 2YU9J 4D94A 5CU1A 3H3UA 4GA9A 1FSHA 2FOKA 2NYXA 1VBA2 2NPIA 2KIFA 4EYUA 4WM7A 4C2TA 2QSHX 4BKXA 3KEQA 3FFZA 1T38A 3M1EA 4OWRB 4AIJA 1CR7A 5L73A 1FATA 2FUG2 3I2OA 5FK7A 2R7WA 1XXNA 2C6YA 4JDMA 3TW7A 2ZHMA 3HOUJ 2HWF1 3LFIA 3CCQI 1U5YA 1OA3A 5FYYA 4ZJZA 4MSVA 3LQQA 4LG0A 2Z5UA 3V42A 4WX9A 4D9JA 1IRGA 2JSCA 2QJVA 4DUXA 3WR0A 1LE8B 3GWZA 5FFOC 1DGRM 4KMFA 1O4YA 2KFDA 4PJYA 1J0RA 1BYHA 3AZVA 5LY2A 4UT5A 3KT7A 5L3GA 4XTMA 4INDA 1J09A 1H9TA 2WAQA 4CP1A 4RM2A 1TT5B 4ZY9A 3H5AA 2VG9A 4BMBA 2M9HA 3VL9A 1FV2A 4HF2A 1H88C 4AC0A 4PLNA 2JENA 3OYWB 4XUTA 2OU2A 1VR3A 4FFFA 2LNBA 4BJ5C 2OUJA 3WHTA 2D5VA 5HVQC 4Q4W3 1XN7A 3PIGA 1HQCA 1ULPA 5D4RA 2O61A 2YU2A 5FZOA 3OY8A 4KIFA 1OFNA 1ULYA 4OOIA 2ZSHB 2P34A 2UZKA 2ETHA 3HOTA 3WG4A 4CDWB 5E17F 2IBDA 3NAPB 2NZ9A 5GTIC 3ZFEA 1PVC3 2BY0A 1YHFA 3RKQA 3BZKA 1F4AA 2PXJA 3PVNA 4I3PA 3IPVB 1YIPA 4KISA 4HSRA 2VC0A 4BOWA 5IYYA 1VBC1 4II3A 2BOJA 2W85A 2E5ZA 1RMU2 1EV11 1LESA 2VOTA 3HL2A 3BODA 3WNXA 2VW0A 3ACLA 2K9QA 2H6BA 1A31A 4GFBA 2Q8EA 5FY4A 3VBFC 4LORA 1UZ0A 2RS51 4DO0A 2HQ5A 1HRV3 4K1ZA 4E7ZA 2EA7A 3THCA 4CCKA 1AJKA 3MF9A 4D69A 2LKXA 1P4WA 1ENQA 2ADDA 4TN7A 2DFHA 2COMA 4RDUA 2WJSA 2DAOA 2PI0A 1T56A 1IS6A 3ZN0A 3FF5A 4CXWA 4XF9A 2DCZA 4Q4X3 1X1BA 1XYNA 2JDPA 4XF1A 1LFUP 3P5BA 3WDTA 2EALA 5FY9A 4IHVA 1GKBA 1G9FA 3BN6A 4XNFA 1TMF2 3HOSA 5H9QA 4BE2A 2GIZA 3JW4A 4XFCA 1HBXG 3POFA 4NVPA 3CP8A 3J7LA 4U36A 4WVVA 2ZHNA 1F31A 2E1OA 1F9NA 1JH5A 4LO7A 2CQXA 3BTYA 2NNNA 3I4PA 5J1UA 2ME6A 1XNAA 5C4WC 3WNMA 1E5SA 3HEIA 4UF0B 5T5OA 3M7AA 4YWAA 1SFXA 1UY3A 1L7LA 2PTMA 4DQ2A 4AVVA 1SCRA 3PTYA 1J2XA 4GH4A 5IFPA 2Q8KA 5HOOA 1MVQA 1RUJ1 4G9YA 2PJRA 4XICA 3CMEI 2XC7A 5HCAA 5BPIA 1LHOA 3RZOJ 1ZBA2 5FZ3A 2VCBA 5F3EA 4XOPA 5LRSA 1OBNA 1PK6A 3W20A 2ADUA 5A6XA 5AIQA 1UU4A 1AKHB 1SFYA 4OMYA 2P5LC 4QKNA 1FIAA 2ZGUA 3PNYA 3WNOA 1FAYA 2Y0SA 5HLIA 2W1WA 2KA3A 3BVCA 4M00A 4CZSA 1QHHD 3WNNA 3JRGA 2Q8DA 4LHKA 5FJKA 3DEEA 4M3CF 1MGTA 3ZYRA 3D4KA 1IS3A 2VBWA 1FPN2 2KRFA 1RUI2 3DU6A 1ITYA 4EN0A 1AXYA 1BLZA 5FKCA 1IRXA 3S7IA 3GNEA 3VODA 2E26A 2OS2A 4XAEA 3BROA 2OVUA 1IQDC 2ZNZA 1YW8A 2ZXIA 2W3JA 4GKYA 3DBLB 4JCKA 4E2QA 5B66C 2CV2A 5FXXA 5E88A 1B72B 3CL1A 2JE9A 5GZFA 2DOFA 4GKXA 4RD7A 3P9IA 2HTSA 1IZ3A 1H8TB 1I1GA 1RUE2 4DB5A 3KHBA 1TL8A 3IAPA 1R092 1E5RA 4XYXA 3HZJA 2XVGA 1I3AA 3MGUA 2YPRA 1W05A 4FPLA 3O0WA 2XH6A 3K1NA 4K1YA 4RAYA 2EXHA 4Z07A 2XBO2 3NVCA 3KM5A 1MZ6A 2QTWB 1VIWB 3THPA 5JI6A 4A2UA 1J7KA 3RZMA 4XILA 4P9GA 5KHGA 4OMDA 3HEFA 3GHNA 2VPRA 1F9KA 1UOFA 1YYNA 3M3EA 3E3VA 3JSPA 1RIRA 4PT6A 2B46X 1GZCA 2GSYA 4QX2A 5FZFA 3P7NA 1MEC1 3JBG3 3MHZA 3NQOA 2Y26A 2WLPA 5HV0A 3CDHA 1HB3A 1XGOA 5DDJ1 5CVJA 3TEWA 4YZ2A 4YFNF 3UGGA 4EN6B 5F5QA 1QU0A 4EQVA 3I49A 1YTYA 2CWEA 5C3SA 2ZEWA 1WZXA 5H20A 3HB9A 5CNAA 1NUKA 5FKLA 1W2OA 2VMHA 2E60A 5FAXA 4NQWA 2PQQA 3I3QA 2MH2A 1IAWA 4JKKA 1NE6A 2IXJA 1FYMA 5ICGA 4BUPA 2VZSA 3LOIA 1PO13 1OLMA 1QEXA 3FXRA 3AL5A 4NNJA 1ULGA 4H7LA 2GXBA 4RHV2 4XFGA 3HTSB 2DURA 1DZRA 1P9QC 3WGHA 4MGKE 1WA6X 1UMZA 2IZWA 1IXRC 3A0KA 2WZR1 2L02A 3HSRA 2JICA 5ICCA 4WV8A 3UT0A 4A0YA 3GTQJ 1N1VA 3CKHA 4PCRA 2MW8A 2QCSB 1NG7A 3T2OA 4AAXA 2QZ8A 5BY5A 3HM5A 5FWEA 2Y30A 4KL1A 2AR6A 3A02A 2YS9A 5E1XA 1GWLA 3SKVA 1WW5A 3TBIA 3L2VA 2ZEZA 4PLMA 4FQGA 3P6BA 1LGNA 1E3OC 2VZ1A 3D6EA 4BJTA 5A6YA 1T98A 3VD3A 3FFQA 3VEPA 3ZXGA 1IHMA 2QF7A 1PIV2 1W8NA 1QZZA 2VVFA 3VBFA 2JMWA 4FTEA 4Y3OA 3UGFA 1HSJA 5KXDA 9ANTA 4XF3A 1C0WA 2R30A 3L1PA 2YHJA 1UYZA 4P00B 3C7OA 1IF1A 1Y8QB 1ACIA 1OF4A 3TOBA 1H9GA 3WDYA 5FYIA 3GALA 1ETXA 4I3GA 4BXSV 4PGGA 2DCEA 5JMCA 1OURA 4ANJA 2DUOA 1MNEA 2VNRA 4B44A 1HRV1 3A03A 2A6TA 2WZEA 4KBZA 1IZ1A 1FPQA 3HOXJ 1FBUA 3O1UA 5KXBA 2VUMJ 1YI7A 2NVYJ 4BHCA 5EFUA 4WWCA 3HQUA 3N9QA 5EP9A 5DCMB 1F5JA 2DMNA 2M2EA 4RS5B 1WH7A 3HUGA 4O6JA 3G6JB 2QLZA 3J7AO 1F36A 1OQYA 4IEOA 4UUSB 3VHOA 5FKOA 4AU7A 1BI1A 4Q4X1 2E7QA 1UO9A 1UZWA 3MO4A 3LWFA 3BG3A 5C4WA 4CUBA 3CU7A 1KQRA 2CWMA 3VHRA 4XLAA 5IYBJ 3H0OA 2AACA 2NOGA 1SFEA 3K4MA 2CUFA 1H0MA 4DNYA 2VI6A 5FB2A 2KR2A 2X6YA 1LNSA 3LAPA 1RI7A 1DG6A 1TG7A 1AYN3 2PYTA 5LBQA 3K4KA 3LWCA 4CDUC 1USSA 2DTWA 5ILVA 1CJDA 3DPUA 3MEXA 5IK7A 5AC93 5H9PA 1Z9CA 2CQ7A 5ILUA 1DCSA 4XMAA 4IERA 4N53B 1VMHA 5E8IA 3IIAA 4H0EA 2EWNA 3ZMZA 1TW3A 4QT6A 1W6QB 2L54A 2B42B 1YQ6A 3ATGA 4Q1RA 3B6CA 3D1NI 1WMEA 1STZA 1W2UA 3PMEA 4HNVA 4RGXA 4RA2A 1D3YA 3LB9A 3RWNA 2WR9A 1ND2B 1RITA 2VN2A 3F8MA 2TEPA 5BNGA 3WTVC 1GANA 4GRIA 1EAH1 1QOOA 4IUGA 3WQBA 1W2TA 2BY2A 3CQOA 1GUIA 3LA2A 2K5CA 2ZX0A 3OL3A 4PIXA 4R8HA 3PHMA 1QJU1 3ZKYA 4LK1F 5HV4A 1G9BA 3S32A 4AE2A 5BPDA 4HNTA 1BBT1 3POEA 4CCEA 1U8BA 1AL22 5FYHA 2OJED 1N1SA 1NCQC 5F1RA 2XRNA 3Q8AA 5A7WB 2EFWA 3ACFA 2P3JA 4ESFA 3J7HA 1DQUA 1B8IA 1V6NA 1JYVA 1X3WB 2LBFB 2KL4A 1WJFA 3PUIA 1TWFJ 1MR5A 4LR4A 4FE4A 1ZZ9A 2JKBA 4DY3A 3AMQA 2D40A 1CAXB 2WAFA 3TQNA 4IE4A 5FP8A 4EQQA 4R9AA 1X2NA 3LDBA 1PM7A 2VKHA 2J1TA 4LKEA 1J75A 3CJXA 1RUC1 1XNDA 5D21A 5DPNA 4XUQA 1RR8C 2IA1A 1T39A 2XDVA 1VQ4I 3L2WA 2P4EA 1LEDA 2CQQA 3JTGA 4Q29A 5B2GB 1OYYA 2WNUC 1VQLI 3JR9A 2MLKA 4GDFA 2WRAA 4OZXA 1SDWA 4KWJA 2ZXQA 2A6ZA 1KU2A 2VULA 3USSA 1YO5C 2B45X 1JHNA 3U07A 5C8CB 2ELKA 4TSVA 2J1RA 1NG6A 1JZ8A 5E79C 4GJYA 1BKZA 4QKDA 1X1AA 1YJ9I 3CCMI 1HLVA 5HS8A 4GGGA 4PSWA 4YM0A 5FCCA 3RKXA 1FX5A 1YW7A 3BG5A 4QSHA 4MO7A 5FGMA 4RAZA 3CCVI 3SEZA 3VZNA 2ZABA 1PJRA 3OUIA 5IP6A 5CADA 5B5EC 5JI9A 1YFUA 3LDRA 1MZ5A 4FPOB 2KRHA 3QOEA 4K7JA 1US2A 2K02A 2MGQA 1JMUB 4OI4A 4XF0A 4XDOA 3PDQA 2XAQA 5JOYA 1K5MB 1XPXA 4ZYEA 4GYGA 4I2OA 1RUH2 2EIGA 3HOZJ 4BBRJ 5HNFA 3ZOIA 3O1RA 2VMDA 2IA0A 3NL1A 3OL4A 1P92A 1WBLA 3H5NA 1ZNPA 3T30A 1W8TA 1JKQC 2KD7A 2P2KA 5JXGA 2DU9A 1MS0A 1R4NB 1BJQA 1HB2A 3GW2A 2GNDA 1W36C 3J7YJ 3CCEI 1YX3A 4DZGA 2WFF1 5JIAA 3MKLA 1VAVA 3V0AB 1U9OA 2VMGA 2CAVA 4CCNA 3JAMZ 1R58A 3GFMA 2EA2A 4CEWC 4CVUA 4RN5A 1SZBA 2PHLA 3T4HB 4Y1ZA 1D8JA 3L2CA 4WVWA 2VQHA 5FMCA 1SHWB 4EV0A 3POGA 4QWNA 1U0JA 2RM22 5E8GA 3IAM2 4X8PA 4ET7A 3V64A 1O7FA 2LFBA 1VB2A 4C3HJ 4V2GA 3JQWA 3IV5A 2W91A 1DU3D 2BWAA 1ZRIA 2Y31A 5HNHA 3TN93 1DYOA 2DXIA 2DA6A 5FLXZ 1CAWA 2DV9A 2VD7A 4QTRA 1K4SA 1QQP3 4A0ZA 1YIFA 1GMMA 1SMYF 3ML6A 2IVMA 4JGYC 5FZIA 2WLQA 3LPFA 1ENRA 4ZHNA 5DUXA 3PM1A 4HANA 4FISA 2AEYA 2PHDA 4KQ7A 2XHKA 1YQ2A 5A7OA 3P5JA 2P7CB 4U0WA 1REDA 4CO8A 1ZRRA 5JR3A 3G1OA 4AAPA 4P96A 1WVRA 1RUJ2 5DABA 2A5ZA 3VYUB 5M3MJ 4BQNA 5CKNA 2HWB3 5JMOA 2DTYA 4LPLA 2L4AA 3A23A 1HDKA 1XU2A 2HEOA 3ZQLA 4CDUA 2JPBA 4MTEA 2ZGPA 5LBBA 3ZP5A 3Q9OA 1IKQA 1SLTA 4DS0A 2K46A 3DGTA 5E20A 3L2YA 3JD73 1PHMA 2HDCA 2PAMA 1XJAA 3K4DA 5GLZA 2VW2A 3FN9A 4EZ4A 1RUNA 5EGOB 1AYN1 3MV11 2DYCA 4QX7A 4NHMA 4Z1VA 5AFEA 2FDFA 4RGAA 4AG4A 1GQPA 4DBQA 4QPQA 4A3BJ 2QWWA 1BEV3 2J1EA 2FBIA 1NY72 4F3QA 5AC91 2DMUA 3PU3A 4XHXA 5KK1A 2X6WA 2BYVE 1GWMA 1MMAA 5FZ1A 3H50A 5F6KA 1SC7A 5C4XJ 3OTFA 5ABJB 4GO1A 3SQNA 1WZ2A 1S2KA 3E0JB 4EJWA 3RI9A 5JXIA 1FMVA 1SACA 4XQWA 5K7PA 1PP7U 1A35A 1H9PA 4AR2A 4E2GA 3WQ0A 5GLVA 2WC2A 1ZRCA 3GXUA 1QJX3 1NCQA 2CW0F 4ZC3A 5CA6A 3ZMDA 1DUXC 2P3YA 2A73B 3D0SA 4ZXKA 5J8FA 3BP8A 2XV4S 3MEPA 4S04A 3OBTA 3EUAA 4YVWC 1K79A 5JVVA 2WYFA 3MFKA 1CZSA 2UY8A 4G12A 3KQRA 3HOVJ 4PDWC 5IT6A 5CVIA 5C9AB 1HKQA 1U8RA 4NE9A 4GB33 5HLGA 5A33B 2ARCA 1KQ8A 4O7XA 3COAC 1GNHA 4E8DA 5IK8A 3O14A 1WW4A 1L3JA 5HCHA 5GPCA 1R083 4AZZA 1RETA 1FLIA 5FLIA 3EYPA 1IV8A 4UFIA 4YVSC 1W28A 3DFGA 5C70A 3HTUA 2D6OX 3RIRA 1MEC2 4SBVA 5FZ9A 4XFAA 2DFCA 2MA3A 4E6KG 1TNFA 2P81A 2RDRA 1NX9A 2WNUA 5DDJ2 4DEQA 2FMDA 4HVQA 4XRFA 4UW6A 3H42B 1C1LA 2Z16A 2BZDA 5FPZA 2Z69A 4AD9A 1JZ4A 3H8RA 2DJNA 2CUZA 4RB0A 2Y6HA 3TO6A 2Q1MA 5HS9A 5E6HA 1QRYA 5F04A 3ACGA 4EJTA 1LQ1A 2WINB 2Y69H 1JS9A 2NN8A 1XGMA 3J8F2 4CCJA 5FY0A 1H8VA 4LE3A 4HXCA 4Q4V2 5K8SA 3CLQA 3HC7A 3W6VA 5G04L 5E3NA 2YFZA 3O1VA 4IOAF 2EXKA 3QOPA 5KCMA 2QQOA 1ULDA 4Y22B 2O6GE 2GMPA 3MUY1 5G05L 1CIYA 2AXLA 2RNJA 3QPTA 2YBSA 4NIAA 5BNNC 4UAPA 4NBQA 1O91A 1FOD1 5D8AC 5FMOS 2EQRA 1S0GA 3TDZC 4RR3B 4XMYA 1YC61 4EJRA 3QODA 1ZH5A 1N3OA 2SBAA 4AEDB 2WUHA 1RIOH 4B7EA 1MW7A 4WXDA 1SFPA 1G6NA 2PELA 2F4PA 4YEJA 1VBD3 1TT0A 4L5JA 2VZPA 4A69C 3J7MA 2QQWA 1WJ5A 1FP2A 1USTA 4WM7B 3R61A 2GH8A 3LFMA 1D0HA 3IMMA 4C91A 1VQNI 2JTVA 2VGDA 2IXKA 5DQ0A 3IWZA 4RAGA 2QQVA 3ZQHA 2DA5A 3VBUC 3ME2A 2EIKH 3OBRA 4J25A 1Q8SA 2WYSA 4FPCA 4YGBA 1LFPA 1UG2A 1Q8QA 2MD5A 1JJ8C 4E27A 3LZZA 2W2IA 4JHTA 3OSFA 4P14A 3V65A 3PLQA 1BIAA 2MC3A 3D5LA 3KP2A 1GLHA 4XC9A 3UV9A 2XUBA 4JGYA 5KHKA 3FUOA 3P9KA 4W4ZA 3ZR8X 2C9AA 2WB1A 2IRFG 3N05A 1A34A 4Q2FA 3TN91 3VBSC 2XPUA 5DTDA 2IXHA 3E6DA 1W7PB 2RR12 2J22A 3DF8A 2JN6A 1DQ0A 2OYZA 1SD4A 2H1KA 1HX6A 4NDLA 3KQ4B 2G1MA 3C1DA 2Q5TA 3A21A 1NCRC 4DFSA 4WM8B 1D2SA 4S0HB 2A3SA 4ONUA 1UOBA 5CPRB 5FP4A 2HWE2 4YW5A 5FZOB 4LLNA 5F5IA 3L00A 3OY8B 1G86A 4CP0A 4X8NA 4ITCA 1S0DA 4COUA 5L9BA 4F91B 2DK8A 3PNVA 4FQZA 4P08A 4OHVA 3USUA 1ON1A 4ASMB 2R7XA 4CYCA 1EKEA 3QH7A 2RMU3 2WTEA 3BOWA 3OIQA 4XLFA 4LB5A 4MO3M 1OYWA 5L3CA 3MW4A 2DO7A 2L01A 1BQPA 4IEVA 3SCHA 3DU5A 1AXZA 5ILSA 4QX0A 3JD71 3IT8A 5A2QK 4V19K 4LTAA 3MIBA 1MH4A 3WEZA 2EA4A 2CRGA 1T08B 1JGSA 5CJ9A 3RZJA 4P9LA 4V2WA 2DA2A 2WAAA 3I4MJ 1R1A1 4J1WA 3S5AA 3PO2J 2YMZA 4B09A 1EAH2 4O5VA 3IDAA 4BIFA 1QOSA 3V0BB 2PG4A 1BEV1 4YGCA 5IT9K 1HJFA 2YU1A 3EQLF 3V8JA 5LA9A 1SLCA 4JQFA 4L8QA 1LOCA 4IF4A 4HN1A 3DKQA 4FPKA 4AWDA 3TAYA 3UL2A 4BMEA 1LDDA 4W97A 2Y48A 4FSJA 1LHVA 4YVWA 2JEMA 1X9PA 4B1RA 1P4XA 5FLVA 4DXTA 2B39A 4PDWA 4YM1A 4CCMA 2R043 2O1QA 3DUIA 2R7ZJ 4LK6A 3LNQA 1OOPC 3I2DA 5EYYA 4Y20B 3GJBA 1IXSB 1QJX1 4RM3A 2VL8A 2OPTA 1REFA 4N43C 1UY2A 2W1OA 1AR93 4AQTA 2EFPA 4NIIA 3A4CA 4BE1A 5EXOA 3P1IA 5FZGA 3AP4A 4YVSA 4E4ZA 1RUC2 5A3OA 3ZFFB 3POJA 2WSVA 5F8PA 2OZJA 1PX4A 2ZEXA 4GB31 5IP7J 2PMZN 1WPKA 1ETVA 2DVBA 1C4RA 2XPVA 1JXNA 1R081 1GV2A 4GH4B 4NC8A 3ZR6A 3T4VA 2FU4A 1F5FA 1DLCA 2PHWA 5BXXA 1XYOA 2D3PA 3RNSA 1E0EA 2EZKA 3CJTB 4QDQA 3N4MA 1VAMA 2WA3A 3K4ZA 2E31A 2EIMH 1HQNA 2B5HA 1PK6B 2A6VA 4EM2A 3ZCOA 2GA2A 1ACCA 4XBFA 3H9JA 4I09A 2XKPA 2L7FP 2JWTA 3S3MA 4YW7A 2W87A 3OS2A 1OA4A 2HYKA 3IMNA 2O0OA 1B9NA 4KG0A 1PYVA 2AENA 1JJ6C 4UVBA 4XJUA 1OCRH 1IPJA 3C8XA 4RYDA 1Z3YA 1B09A 4IESA 5LASA 2Z33A 3AM2A 2ET1A 2JJ7A 1ZR2A 2ZJCA 4B29A 3RJPA 1XGSA 2W47A 2Z4FA 2PQSA 1M06G 1Z7LA 5BNNA 1W03A 2Q1FA 5JXJA 3GTPJ 2ARAA 2R1BA 5D8AA 2R32A 4OAZA 3LFKA 4AYUA 3NMBA 4EM0B 1SBFA 5DM7F 2D6KA 4A6EA 1JHFA 2I5UA 1Y3TA 3E5UA 1MS5A 1U5TC 3UNPA 2C26A 2Q0OA 4MIMA 4Z2AA 4G7HF 4GQ7A 2V73A 5IFTA 3ZQGA 2B9VA 1AU7A 1CAVA 5FQ0A 5LBFA 2WFF2 3ZYJB 1YE9A 3N7KA 1XNKA 2G9WA 2MNGA 1ETKA 3OOPA 4MHRA 4UFKA 4IJAA 3ZN1A 4HL0A 1H1IA 3VBUA 1FY7A 2F5EA 1AYM2 4D7TA 3BTCA 3DPRB 2QENA 2C6SA 3VBRC 1QXJA 4S2DA 3OYJA 4B3XA 2FQPA 1AR73 2EK5A 1HB4A 3WP3A 5A3TA 4HBLA 3RS6A 4CPBD 4L9VA 1TQ5A 3ONQA 3R05A 1MMGA 1OUXA 2BE5F 2R7TA 1C8M2 1S0FA 5FKKA 3A0BC 4KIBA 1PGW2 1ZG3A 2A5YB 5ERIA 3VBSA 2BUKA 3GLXA 1H2KA 3OOXA 1NG0A 4YW2A 1VRH1 5FKNA 2R4GA 3EJKA 5ICEA 1S0JA 2XUMA 2UU8A 3ULQB 2BHYA 1R4MB 3AYAA 4QB2A 2XUEA 1NCRA 3EUHC 3IDCB 4Y26A 4QGLA 3DLAA 1V00A 1YJNI 1UHMA 5K4LA 3VDCA 2OPWA 4MG2A 1RRJA 3CDLA 4UFJA 4LUMA 2NRAC 3WQ1A 1HRI2 2YU3A 2P1BA 4XE9A 1HCRA 4G7ZF 1Z7S3 5FO5A 4AVCA 1JTYA 3HWJA 4NC7A 1Z0XA 4FXGB 1MIJA 2E32A 3ZYFA 2YYOA 3M70A 2HBTA 1IC8A 3UKTA 3ST7A 4BU2A 4MGSA 2RMU1 4TWTA 2BNNA 1UKRA 5EG0B 3R0AA 2IXCA 1WLCA 4IXLA 1AR83 1GP4A 2NM1A 5C5UA 2LVSA 1UL9A 3BG9A 2DA3A 3OYFA 5FP9A 3S2WA 3LCPA 2M87A 5F37A 3JRBA 4R4XA 1NXD1 3ZMUA 1QNYA 4RL7A 3RRDA 4Y1VA 2RS31 4CA0A 2V5DA 2PMZA 1RJ8A 3KZIC 4I98B 1SQ4A 3PMSA 3LEMA 2ZPXA 5GLWA 1DP3A 2JA6J 4ORFA 2IUWA 1OOPA 2H1LA 4K21A 2UXNA 3HUGB 3C2GA 4N43A 1V54H 3ZYPA 2O14A 2ZJRF 4XJWA 2K3FA 1V6LA 2AUYA 3KP3A 3BOPA 3AAFA 4WVMA 3HBLA 2E51A 2ADEA 3AKQA 2B9UA 1LKNA 1VBA3 3ZXFA 4AVPA 1KITA 1GVDA 3BI3A 4LULA 4P02B 4ZYDA 3VYSB 5C4WB 2CSOA 4FPHA 2HJIA 2EZIA 1GZ9A 2TDXA 3FLPA 4QU1A 4QPGB 2RS12 2CV6A 1AR91 2PMUA 1RUOA 5FO8B 3I2FA 4HDUA 5C8WA 2XVCA 1MDMA 4RLQA 5IP9J 4EJOA 1S72I 3ABZA 1D5VA 1OFSA 1IG3A 2KRCA 2NS7A 3OGSA 3RKWA 3PIPF 5E3MA 1OFCX 3VBOB 2DW4A 3ES4A 1TTYA 2BXYA 1HF0A 3MICA 3JCIA 3WW3A 2VPVA 2HFHA 1XQNA 5JSRA 4OI1A 4XACA 2R7DA 2B7YA 3VDXA 1GFF2 1KD7A 2P6SA 5B3SH 2MFZA 3I58A 3M4OJ 2ICWG 5TJJA 1TNTA 1POQA 2D6NA 2LF8A 4E8CA 5HPOA 3F8BA 4R79A 1ETOA 3MF6A 1JZ3A 2WO2A 5TSWA 1GZWA 3H3LA 2G9FA 2P8TA 4EN8B 1SPPB 4Y1YA 1KU9A 5J96B 1RTVA 1CVNA 2P6CA 2GH2A 2Y6JA 2D5FA 2ATFA 4FETA 2VNGA 3G2BA 2ZZQA 3AMHA 5L19A 2IGMA 3POIA 4BQ5A 4IE0A 4DRRA 1UAIA 5CISA 4L97A 3NNJA 1D0YA 3NNLA 1CESA 2VMFA 2YX4A 4M3DA 1K6OA 2CAUA 2BZTA 1U5TA 1QNTA 3HBZA 1ODNA 2JIJA 3ECOA 1ZN2A 5I93A 3FXMA 1CWPA 1PMIA 3FL7A 3A01B 2HS5A 1RMU3 2E2HJ 1ZLKA 1ETYA 3CCYA 3HBKA 3AG4H 1O4TA 3BTZA 1JUMA 3JRDA 4HKOA 5GAHJ 1DPUA 1DGRN 2GMMA 4KIGA 2YC0A 1JT6A 4RFT0 4OIOF 3WG7H 3WG1A 2ZAHA 3M1HA 4FTBA 5KHHA 2X53S 3VBRA 2X5IC 4A3FJ 5C3PA 3HOWJ 2HYFA 1KYWA 3B01A 2F4IA 4HX4A 3LOCA 2JT1A 1SAUA 2RVCA 1NQJA 1RKTA 5LFAA 3NEUA 2WADA 4XLNF 4Y52J 1JYNA 2RG4A 3GTKJ 1W8ZA 2FD5A 3WX5A 1AR71 2E1MB 4CRQA 1TMF3 1YQ8A 2LG4A 2LYCA 3CUQC 2EZHA 2OC6A 4JRLA 4CEYC 2LH9A 1ORKA 1K78A 1FMWA 1FXZA 2NXNB 3H3VK 3AZWA 2BVLA 3EUHA 2QE3A 3ZLIA 2BWCA 5FPVA 3KX2A 2P6TA 4FPEA 4JX4A 2ZMKA 4M3CA 5DUUA 5L3BA 4PLOA 1ENXA 3D82A 4CU6A 2QQMA 5LHHA 4CDGA 3I8TA 2EFQA 2Z79A 2V9KA 2QGUA 1H8AC 5EYRA 2LALA 4DIQA 1Q1HA 2R072 4OI2A 1FSEA 5GZCA 3RZKA 1ZBA3 3CHXA 4JOMA 1ZLJA 5E1RA 3M07A 3EYYA 1DIWA 4A3ZA 5HCBA 1W8UA 2PFWA 2VT2A 1V5EA 4QX3A 2IS1A 1OCCH 1UY1A 3RMXA 2VZVA 5LCWL 2E34A 2R49A 4FTHA 3DEWA 3OSGA 4KNYA 4PQQA 1X2MA 1Z7S1 3RI4A 2VC1A 1FPN3 5FMOL 5DAPA 4YRVA 3KZZA 3DBHB 4KT6A 1RUI3 3Q0WA 2C4XA 2MHFA 5K5OA 4FFIA 4Q0QA 2F6BA 2W92A 5DZEA 2KPMA 2QZ2A 1XB9A 2XB0X 1UYXA 4Q0UA 3AK0A 1QGLA 1GXPA 5HDKA 5I8TA 3I0TA 2IVIB 4MGZE 1LPQA 1AR81 5DUIA 4AVSA 4XJZA 2QSFX 2PMWB 2GNTA 4LLOA 1MS4A 5FZKA 4Q0PA 4LBNA 1RUE3 2VJJA 4YLZA 1GR3A 2HYXA 1R093 1S8NA 4RLFA 1WCSA 3ON7A 3IWFA 1LECA 3ZMTA 1W9YA 1XCVA 3O2PE 1OLME 2XBO3 2X48A 2PHFA 1WMXA 1GQGA 3N36A 4B48A 1V70A 1NAEA 4H55A 5IOYA 4P9FA 1LULA 3Q5FA 2BGOA 2AYHA 2XLFA 2GDFA 4HKLA 3PL0A 3L2UA 3SFIA 5FYMA 4CCDA 4A3GJ 3Q0UA 3M3CA 3RFRA 3ZMOA 1OR7C 3ROUA 1PUEE 2VH9A 4U0YA 3BCAA 3DEUA 4EJUA 1VBA1 5IW0A 3OYNA 5C33A 1CONA 3WCSA 2I45A 5DZFA 3F3XA 2ISYA 4HX7A 5EEAA 1VRBA 4OINF 4HLXA 2DDUA 2FQ3A 3E5XA 4HETA 2O03A 3ZQIA 3F8NA 3FXJA 3LSMA 3H9AA 2OQ6A 3PQJA 1DGWX 3OGRA 5ICFA 4UVAA 5FZHA 2A05A 4WF2A 4ENMA 2STWA 2VMCA 1G4DA 1YJLA 2YDEA 2XJUA 4F8AA 1J84A 1YXWA 2NP0A 2QBXA 2WDBA 2BBAA 2HWC2 4M4RA 3AL0B 2XSDC 5GJ6A 2HEVF 3HYIA 1MJBA 4AI2A 1KXGA 2ZHLA 4IEWA 1XE7A 1FV3A 2NAZA 1BMV1 4PJ0C 3VDDC 4RHV3 4FFHA 5LY1A 1QNWA 2VQ0A 3UKNA 1W6MA 3MIDA 3Q3SA 3R4UA 5M5WJ 1MMNA 4LUKA 1ZZ6A 4X6RB 3H92A 3C3WA 3OBZA 4AVZA 2DT6A 2EPFA 3K4LA 1SFNA 3I2GA 2R062 5JHFA 4K6BA 5AVAA 2VIXA 2CYYA 2Z1DA 5HXVA 1NLRA 1DGRA 3ERMA 2W57A 1BJAA 1RESA 1NCQB 2VKVA 1RXFA 1AA7A 4IHSA 3WSOA 2HVRA 4MUVA 4HPQA 5HI0A 3VFZA 2HZTA 2MBFA 3S6PA 1MZBA 3ZDVA 2ZCWA 5F3CA 2BRTA 1TME2 3GZ6A 4QQOA 1R64A 2X09A 5H9RA 4QPIB 4AWXB 4GULA 3CLOA 3H9QA 1GP5A 1PIV3 3S57A 2A6YA 4LO4B 1IN5A 3CMAI 2XF6A 5CYYA 1S7EA 2PLYA 4YPJA 1W39A 2Y9YA 3VKNA 5FKBA 3MWMA 1GZTA 3ZXKA 4NIGA 3ZSMA 5J3UA 1RMU1 2X5IA 1TW2A 2VMIA 2O3FA 2ELJA 1WCDJ 1RUD3 2DMPA 3VZJA 4EWAA 1X3UA 4RGGA 5EIYB 4OHZA 4HEA2 3SYTA 1UAAA 4EE2A 2DFIA 5E16A 4MQ9F 2ZX1A 4XFHA 5BMZA 5LHIA 3PUQA 3U14A 1MVEA 2LREA 2Y33A 3H0DA 4E4HA 4EWEA 1U9NA 3DL3A 1IG0A 1OF3A 1RVF2 2ZGMA 4YFXF 4QLCU 5FV3A 5LA1A 2UWCA 3CUQA 1VRH2 2XKOA 3IKTA 4CEYA 2YY1A 1UU6A 3AYDA 3PFYA 2LSOA 4HFSA 4KG8A 4LBOA 5F2WA 5A3NA 1R1TA 4XORA 3CJRB 4LHLA 3VV1A 4EM1A 1SD7A 4F83A 4PGHA 1TMF1 2E7AA 4DYCA 5EV7A 5FZ6A 3E1SA 5EPAA 5JWPA 1R1UA 3M2MA 1LEBA 1LB2A 3FXLA 3TEDA 3AP5A 2V1UA 5FMBA 3CCJI 3OF1A 3NV4A 2M7AA 5BYNA 2CUEA 1SG3A 3DYMA 2LLKA 5D6FA 3K4JA 5JVGF 4HONA 2M0MA 3ZO0B 2CU7A 4NB5A 3WY6A 2ZGOA 3VBHC 3JXSA 2VTXA 3CESA 3WF2A 3T8TA 1IRFA 2ZKZA 1DQ6A 3PTRB 5FPUA 4AI0A 5FUIA 4CP9A 4XLPF 2O0YA 2L4MA 5A6ZA 1H89C 3BYWA 4UNOA 1UXZA 3GYHX 2Z5WA 4YG6A 1HW5A 2LK2A 1D8KA 3H0GJ 3Q8EA 1P2FA 1FBSA 3LEIA 1OQDA 4IO9F 5IK5A 5KNLA 1YG2A 1PDNC 5F7UA 2IGNA 4BCUA 2BW3B 4LK0F 3FXUA 5BPXA 4AQSA 3PJRA 1FPN1 2RS32 2HZDA 2F48A 1I3HA 1W8FA 2B4KA 5A3WA 4NAMA 2MABA 3ZYIB 1RUI1 4HW0A 4QM8A 1N3QA 2NVTJ 2K40A 1YRNB 3ZQQA 2JX9A 2CY6A 1UMQA 4PFPA 1W6OA 5H6QA 3AJYA 5ACA2 1AL23 2WNVB 3T08A 1I6HJ 4CA9A 1PGSA 4M6XA 4MXWB 4BHPA 4IQJA 1QDCA 3KP5A 3RDIA 4L5EA 3NNFA 2ZMEB 3H1CA 4BQQA 2VOVA 4AUXA 4EATA 1D4M2 3RCOA 3HPGA 5FYSA 1ZKGA 2YC4A 1W6NA 1HKDA 4PF1A 3BLYA 4UY8I 1Q8VA 5J7MA 4LBQD 1I27A 3WTYC 2AREA 1RUE1 1W0UA 3L2RA 3AYEA 3WP6A 2K9NA 1V9U2 5D4SA 1OR7A 4E4DX 1C8NA 1CX4A 1N25A 1YI9A 4A7YA 4C8DA 5KXCA 2XBO1 2HWF3 3BTLA 3N7LA 4AEKA 2VUAA 1MBEA 5LD2C 4EN9B 5IVJA 3CUOA 1UW8A 4O3MA 1GUUA 4AFCA 2ZJQF 1ZVFA 1AHSA 2V9PA 3SXYA 1KS4A 4CXXA 4F55A 4AYBN 4LIVA 3LSKA 3JAMK 2E2JJ 3T1MA 4CDWC 4LOSA 3HNBM 4Q0SA 1V6IA 3NAPC 5JI7A 1FI2A 1GOGA 2JE7A 4NROA 2A3YA