3FWEA

Crystal structure of the apo d138l cap mutant
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
202
structure length
202
Chain Sequence
QTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLLVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Catabolite gene activator
publication title Structure of apo-CAP reveals that large conformational changes are necessary for DNA binding
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 56
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fweA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3fweA01
1WKMA 5ERIA 4MHGA 1HSTA 3VOEA 5BV6A 3HRUA 4WVZA 2WC2A 1NE6A 3IRRA 4Q0VA 3D5LA 5D5VB 3G3ZA 1OYIA 1B59A 5HOOA 3GX4X 4IJAA 3K1PA 1J2XA 1W5TA 2MHFA 3LWFA 3CLOA 1HXDA 4KDPA 1RTVA 1Z7UA 2QQ9A 2P7CB 3GVAA 1NXMA 1IN4A 1BOAA 2Z5UA 1ZAOA 3BJOA 1QQIA 5HS8A 3D0SA 1MZBA 4RS8A 1J75A 5I8YA 4HAMA 3BWGA 1AOYA 4U0YA 2L02A 3ELKA 2QM3A 3WGHA 4PGHA 1ZHFA 2Y75A 4ZH4F 1UW8A 4A0YA 1ODDA 2JZYA 4EJWA 4HN1A 2FBHA 3EQEA 4EV0A 2PHDA 1YIOA 3FZ3A 4MTDA 4LA2A 1CAVB 2V6CA 5EEGA 3CUQA 4Y17A 5JSRA 4QMAA 3U9GA 1ZRRA 5BUVA 4MNUA 3AAFA 1QNTA 3T0YA 2GU9A 3FM3A 3RTRA 4EGYA 4KL1A 2XAJA 1JE8A 4J1XA 2OQRA 4KIBA 5F1RA 1QY4A 3H3UA 3KLNA 2FQ3A 5CVUA 2VBWA 1Z6TA 3NKTA 4G9YA 1XN7A 4UXAA 3WW1A 3ABUA 4E2GA 2R7DA 2QCSB 4EM1A 3RI4A 4FT8A 1Q1HA 2QYOA 1U3EM 5FQ0A 3NJZA 2RQPA 2DFIA 3KLOA 1WQ2A 1QXJA 3NQOA 2H0VA 3WODF 1SD4A 1R00A 2C6YA 2F4PA 2RGVA 5L3BA 1FT9A 1GVJA 2ADUA 1Z1DA 1YWKA 3C1DA 1QPMA 1T2KA 3BZ6A 2Q0AA 4FX4A 2FU4A 2Q8KA 4QWQA 4A0XA 1ZZ6A 3ETQA 4CYDA 4CICA 3GFLA 3KP2A 4GGGA 1ZLKA 4HDUA 4WXHA 3SMHA 3IKVA 3PQJA 3V7CA 3MEXA 1KU7A 2ZBKA 2IVMA 2W57A 3ZMSA 3T5XA 1YFHA 4KWLA 3BOQA 2M45A 2KRFA 2YR2A 2PQ8A 3H7YA 1BIAA 5AIQA 4FAHA 3MWMA 1J1LA 4IESA 5A2QK 4IEXA 5DV5A 2WFPA 1ZGAA 1U8RA 3H50A 4XFCA 1BI2A 4HQEA 2OZUA 3JSPA 5J48A 5JSPA 2GIVA 1J3QA 2PN6A 1IW7F 4PIXA 4OIPF 3F8CA 2QENA 3LQRA 3CLPA 5BQTA 1UIKA 2DCTA 4UUVA 3HSFA 2PJPA 3IC7A 5JCTA 4IRGA 1DZTA 2HTSA 3EYIA 1FI2A 4MGKE 3S7IA 4AVPA 2EK5A 2QNKA 1TBXA 1SMTA 3TO9A 5IT9K 5FDBA 1ZLJA 2NNYA 2X4HA 3TO7A 4XF0A 1OMIA 3E3VA 1WLTA 5JR3A 3TGNA 1P4WA 5L3CA 1IXRC 2Z33A 2GC0A 2FQPA 1KGSA 5BPXA 1SFXA 1ZG3A 2Q2EA 3CEWA 2EFNA 3ML6A 4HLTA 2Z69A 3RYRA 2VONA 2FRHA 2K4JA 3REOA 3FHIB 2X0LA 2ZJ2A 4LA3A 2ESNA 5LGTA 5BY5A 4A0ZA 3P7NA 1LJ9A 3H3ZA 5I0RA 1V3FA 4QGLA 4M9XA 4S05A 4HW0A 3BB6A 4R79A 1J7KA 1MKMA 1W7PD 2UYBA 5JI6A 4P9UA 4Q4ZF 5K1YA 1SQ4A 4OINF 1OYYA 3FXRA 2M5WA 4GYGA 3G7DA 4QGNA 1KYWA 4XF1A 2IRFG 4ORFA 1T6SA 4U0VA 1RGSA 3O2PE 4ZU5A 2FOKA 1XRUA 1YHFA 1R1UA 1ZZBA 3RPUA 4QM9A 1PP7U 4A6EA 5FLJA 5E8GA 2HDCA 1WA4A 4Z07A 1IXCA 1UD1A 2J5PA 4Q0PA 2L01A 4CO8A 2JRTA 1FPQA 2VOPA 3M7GA 1OYWA 4GCVA 3RYKA 3UKNA 2F5DA 1YS7A 5IT3A 1YFYA 1ZREA 2H6BA 3BPZA 4P9FA 5HDNA 3E6DA 2OQGA 2NNNA 3QP5A 2PFBA 4PCQA 2HR3A 1LDDA 2ZMEB 3J7AO 4E70A 1IUYA 1D5VA 1CAWA 3DV8A 4Z82A 4LTAA 3ES4A 5ICGA 3P9CA 3S0MA 4G8XA 4KN7X 4EM2A 2YX4A 3BJ6A 4P9GA 1QXRA 3B73A 2XROA 2KJBA 5BOXA 1PP8F 2QLZA 4ZU7A 2ZNYA 3WTSC 5K5OA 1MJAA 4YFKF 2LNBA 2DPDA 2NYXA 1X7NA 4G6DA 2HKOA 1RNLA 2DT5A 1E17A 1X8EA 1BC7C 1EH6A 3SZTA 4RGSA 2BYVE 1G3WA 1P4XA 1Z9CA 1HKSA 3L2HA 1I27A 2YU3A 5FB2A 1DPUA 1B9NA 2XL7A 2RDPA 1ZVFA 1L3JA 1G3SA 2V1DA 3ECOA 4XFAA 1VJ2A 5TJJA 1V70A 2G7HA 1BI0A 3DEUA 3FMQA 3L2CA 5FPZA 1LB2A 4XFIA 1XE8A 1LDJA 2A69F 1AWCA 4LG0A 4L9TA 3DXJF 2IXCA 2IA2A 4L9NA 2DO7A 3MCZA 2V79A 3IDBB 5FFZA 2LF7A 3O6BB 2LKPA 1MDMB 3V8JA 3ST7A 3WTUC 2GWRA 3IHUA 3I64A 3ACLA 4ZYHA 3RPQA 3HUGA 5LBQA 4S04A 3UKVA 2ATFA 4PDKA 1TNSA 1YW9A 4X6RB 2PI0A 3JAMK 5D6FA 4A5NA 4H7LA 2ETHA 2G9WA 5T3NA 4Z2YA 3NSTA 1LVAA 2VBYA 1ZARA 4YG2F 5JAXA 5KK1A 3M8FA 4LUKA 1U6GA 4I02A 2D1HA 1KU3A 3JSOA 3IRQA 3IBMA 2CQKA 2XLAA 5J6XA 4IEOA 1S29A 3MDPA 4GXOA 4JBAA 3GFIA 1GQHA 5I93A 4L5JA 5KHIA 3KETA 3WU0A 2IPQX 4OMZA 3R61A 2EA2A 3FHZA 2Q30A 4UVBA 4XFHA 5C8WA 3CUQB 3IDCB 1R7JA 6PAXA 5D1IA 2R7FA 2UZKA 2W24A 1DPRA 3QPHA 1XCVA 1IXSB 5EFUA 1UFMA 3UKTA 2FMLA 3EUHA 1KU2A 4M9SA 4KU8A 4RB1A 3SHRA 2CSOA 4ASNA 3LAPA 2STWA 1DUXC 1V4RA 4Y13A 5I0UA 2P8TA 3F8BA 2GA2A 4EJVA 5ILVA 3RYPA 5FLXK 2QWWA 1U78A 3C18A 1QWRA 2IXIA 4ZU4A 4L0YB 2K86A 2JTVA 5FQ0B 1DGRA 5EZWA 2EJRA 1KYZA 4MEYF 1X82A 3WW2A 4YFXF 1B4AA 1H1MA 2LSOA 4HV5A 1ZZ9A 1TQPA 1YW8A 4DQ2A 1YFXA 5K5QA 1ZN2A 2BBYA 1X8MA 3USSA 4KWKA 1USTA 1ZZ7A 4XEZA 2UWMA 1MD0A 1U12A 4CHUA 3LZZA 2Z99A 2GC2A 4MQ9F 4J1WA 4MGZE 5FLXZ 3PLQA 3U1DA 5LHGA 1QZZA 4ENJA 4XSXF 2DLLA 2TDXA 4NHJA 2H09A 4BQAA 4IHTA 4O9GA 3R0JA 2IT0A 3F6VA 1BN5A 4MEXF 4FX0A 3CO6C 1UCXA 4MH0E 4DINB 4HVOA 5CVIA 5D5XB 2P5KA 2QQBA 1DP7P 3ZP5A 3SXYA 3J80K 3EQLF 3FZVA 3ZN0A 4GULA 4HMZA 2YPRA 2XL9A 2FF4A 3L09A 3LFKA 3C3WA 2Z2SB 3ZMTA 3F21A 4HX8A 4KFCA 5FD5A 1J59A 3HT2A 3RKYA 4HQMA 1FOKA 3IWZA 4G7OF 3I0TA 5LGUA 5DD8A 5K8SA 3CO2A 3K1NA 1FY7A 1ZNPA 2ESHA 4X6QB 4YARA 2PMUA 2QDRA 1XSDA 1RUNA 2A5YB 3D82A 3ZPLA 1S3JA 4LB6B 4NB5A 4IEPA 3KZYA 1K7AA 4IEWA 3QACA 5DCFA 5D8KB 4EVIA 4WK8F 1ULYA 2FBKA 2WWYA 3U0ZA 1TNTA 4YSFA 1S6LA 1TQMA 4WCGA 2HEOA 1SAXA 2O3FA 2D45A 4CDGA 1SD5A 4OOIA 4KYWA 1ON2A 1RL3A 4NQWA 1U5TA 2PG4A 2ET1A 2ZXJA 3L7WA 2F5FA 3HHHA 4KUMA 1YFUA 1O3TA 1MJBA 3JW4A 2HS5A 4LULA 4B09A 4M6YA 2FE3A 2HJIA 3BY6A 3I5UA 2VBXA 2XAQA 2O1QA 4HVQA 2K7LA 3TDUC 3K2ZA 5CVVA 3GXOA 5HS9A 1HBXG 4WXCA 5H6RA 2STTA 2XHKA 5CADA 3GZ5A 4R8HA 2E1CA 2PAKA 1TW2A 4IVNA 5LLQA 2KJCA 4LLLA 5JHUA 3FE5A 2P6TA 3LWCA 4Q0SA 1QGPA 1IN7A 4LLOA 3GO5A 2GXGA 4FAGA 4FHTA 1VTNC 4ONUA 4YNIA 4HX4A 2WTEA 5L3EA 3R6SA 1OKRA 1TLHB 1DGWA 4XBFA 5D8LB 2DTRA 2HKXA 3LSTA 1KA8A 5E18F 4YIIA 2UY9A 4PIYA 4UVCA 1YFWA 4U7BA 5L3DA 2A6HF 3BJAA 3ZMUA 1BI1A 1NYWA 3E97A 4AQ2A 4XFBA 2EWNA 3KCCA 4JVAA 1L3LA 4TLFA 3VODA 1OR7A 5FLHA 4IETA 4KNYA 4IERA 2Z9OA 2G7UA 3QAHA 1FZPB 1IN8A 1HKTA 1EP0A 2RNJA 4AIHA 1YUDA 3U10A 4I0BA 3WTTC 4KMFA 1BI3A 4KIGA 3CJNA 4Q0QA 2DW4A 3H92A 4ENMA 4LGWA 1PDNC 1JGSA 2BE5F 2FMYA 2VE9A 1J3PA 3ES1A 4UNOA 4AVAA 2MH2A 5CYVA 4EROA 4AIKA 2HTJA 3I59B 1YYVA 1FSEA 2DBBA 3EETA 2KXLA 2GC1A 4MX3A 4OFGA 3P9KA 3HOSA 4META 4Q48A 4EWEA 4LFUA 3OV8A 3DF8A 3DPTA 4IEQA 1BIBA 3KGZA 1CGPA 4L9VA 2O8XA 1VR3A 4HN0A 1LDKB 1ZG1A 5CU1A 1TQIA 4OMYA 2D5FA 5A2QZ 3KE2A 1IZ1A 1HW2A 3N97A 3R0AA 1JHFA 3ZMDA 5JR7B 5FPXA 3WE2A 3Q5FA 3FWEA 1CAUB 4AD9A 3MQ0A 1IPJA 4ZZDA 2VC0A 1R1VA 4CGZA 5E1ZB 4FBFA 2VC1A 4LG0B 1L0OC 1CAVA 4YRDA 4HVRA 2OZJA 3EHKA 2EA4A 1SD7A 1ONVA 2GQQA 2KKOA 2IXLA 4KICA 3CL1A 2QBYA 1FLIA 4HDVA 3G73A 4ON0A 5DCMB 4BHBA 3W6KB 2F5EA 2BNMA 4JK1X 4IEVA 3SCHA 3F8FA 5IT9Z 4NVPA 1HQCA 1O7FA 2B0LA 3RNSA 5ILUA 2QZ8A 5LRSA 4Q29A 1R5GA 5AVPA 4WXDA 1EPZA 1P4AA 5H20A 3VB2A 4LMYA 4MUVA 2EV0A 1HKQA 2V1XA 3ISPA 2EA7A 1YG2A 5L3FA 1ZRDA 2W25A 3H1WA 4M74A 3GBFA 1IRFA 3FMSA 3JTHA 3SCFA 1XE7A 4AWXB 4RD7A 1K78A 3KP7A 2FBIA 2Y48A 4EQQA 4EM0B 1SMYF 4LEJA 3WE3A 3MAJA 4P96A 2M1BA 1TQ5A 3EO6A 4TV7A 3KP6A 3GWZA 1H1IA 3HOTA 4RAYA 2MBFA 4XFGA 3RKWA 4L9JA 4B8XA 2ELHA 5AIPA 5LEJA 3O3KA 3NW4A 4XF9A 2DAOA 1BM9A 1O3RA 1Q3EA 1FYLA 3NEUA 4A12A 3HSEA 4HF1A 3TOAA 3U11A 3LA3A 3BU7A 3I58A 1XB4A 1J9IA 2PAEA 4A6DA 5ICCA 4G94A 2COMA 2OA4A 4E2SA 2Y0MA 4BHCA 4LLNA 1I1SA 1XSXA 2OU2A 1GQGA 1H9GA 2ZO4A 3P9IA 3MZYA 4L5IA 3VFZA 3H8UA 4RAZA 5HLIA 1ZH5A 1FXZA 2XAHA 1T0FA 2ACJA 4JTNA 3ZQ7A 1E2XA 1YQAA 1R23A 2MH9A 2ZKZA 1XCBA 1RUOA 2AXLA 1DDNA 1S7AA 3FXUA 4KT5C 2PYTA 3ROUA 4YIFA 2D2WA 4XLPF 2B9UA 4EMSA 2JPBA 2GXBA 4O5VA 4Q5SF 1SFNA 4G7ZF 2OBPA 4U7DA 2OZ6A 1P2FA 2VBZA 4PJYA 3SCGA 2HYFA 1O3QA 1Z6RA 2A6EF 3BPXA 4R52A 1YS6A 3ECHA 1UCRA 2K02A 3IL2A 3ZN1A 2XGXA 3TDZC 2EVXA 4ESJA 5KHGA 4XF3A 5KHKA 1XMAA 3B02A 2P5LC 5LHHA 4M9ZA 2QVSB 1O57A 1LNWA 5LHIA 1KU9A 1XGSA 1H0MA 1VP6A 3NRVA 4XRFA 3LOIA 5CJ9A 2HQNA 3JZVA 1XDSA 2PFWA 5E20A 2CW0F 3MZHA 2VQAA 4HA8A 4M73A 1IN5A 2CO5A 2FNAA 3S7EA 1FWZA 4JTOA 2VT3A 2IC1A 2EV5A 3V7SA 4Q0UA 2CG4A 2ZCWA 3CUQC 3LAGA 4AVCA 2B5HA 5FCCA 2K27A 3J81K 1C0WA 2KIUA 1FNNA 2VODA 2UXXA 3HTUA 4I0AA 3IKTA 2P4WA 3KEQA 1PMIA 3CO7C 1RC6A 2OA2A 1Y3TA 1FBUA 4L11A 2AS5F 5I91A 3FXQA 3CF6E 3BP8A 2P5VA 1U5TB 3T1BA 4ZYEA 2Y0OA 3E5XA 3JAMZ 4RB3C 2UY8A 3F22A 2A3SA 2ZNZA 3LA2A 3OOPA 4QGMA 1YW7A 2K9ZA 1F4KA 1WI9A 4ZZLA 3C7JA 2D93A 1UHWA 5E1WA 5J8CA 1FP1D 1Q5OA 2JT1A 4RGXA 1ZGJA 3HQXA 2XAGA 5DD4A 2HOEA 4MGYE 4I3PA 4Q47A 5BXXA 1FYMA 1EH7A 2MLGA 4XSZF 3COAC 1OPCA 3M3IA 4HYEA 4EWAA 3WG9A 3PVBB 4BNCA 3RJPA 4MZUA 2XIGA 1FBSA 1MGTA 2EB7A 4BAYA 3WGIA 2JPCA 5ED4A 3E5QA 4WX9A 2HWVA 5J7MA 1NE4A 3D0JA 3E6BA 3F8NA 5F6FA 1JHHA 3ELNA 3FF5A 2VPVA 4QLCU 3LA7A 4EJUA 1OFNA 3OCPA 1TTYA 3KP4A 3KMHA 4KIFA 5JSOA 3QP6A 5JVTA 1LQ1A 3L00A 2CGPA 4HZFA 3KSCA 2ZFWA 5ICEA 4EJOA 1JUHA 1FYKA 3GF2A 4HX7A 3C3VA 5D4SA 1EY2A 4M6XA 1QBJA 3EDPA 2EAAA 3HRSA 3ABTA 1J3RA 2PLYA 3JTGA 1F5TA 2PQQA 1Y0UA 4LLGF 3I71A 2KIMA 2RC4A 3LQQA 4AQ6A 3BPVA 5FFXA 5FD6A 1XMKA 2FNPA 2CYYA 3W6JB 1FSHA 5LGNA 2E7XA 2EFQA 4HOBA 5J8FA 2MA3A 1O4TA 1MDMA 1T38A 2IXKA 5BPDA 2EFOA 1O3SA 2OPKA 4AIJA 4IPAA 1EV7A 3HTSB 2M8EA 2E1NA 3SZPA 4I09A 5KBFA 3GEZA 5AONA 3O14A 5LEKA 1ZZ8A 3J80Z 1D3YA 5F64A 5E1XA 5D4RA 1B9MA 1O5UA 2P17A 5DUKA 3WU1B 2VOOA 1EH8A 2LDUA 5E17F 2V09A 2I45A 3HIFA 2HQRA 4JV4A 4K8FA 1LEBA 1Z91A 4LB5A 1WRJA 3F23A 3OGJA 2O6GE 1TW3A 1YO5C 1R5HA 2P7VB 2PBIA 3LAJA 5I0TA 1CX4A 3DFGA 1HW5A 4N9IA 2HZTA 4EGZA 3TNQA 3PQKA 5CVRA 2CAVA 4IXAA 3I7DA 2FSWA 1PM7A 4M72A 3HSRA 3RDIA 1CAXA 4N0BA 2QBYB 5BS6A 3OTFA 3S2WA 1LKNA 2PHLA 5HLHA 2XKPA 3ZMZA 4OIRF 5HI0A 3R60A 1H9TA 1W7PA 3DPLC 5ILSA 1G4DA 4D7SA 2MLKA 3RZZA 3CDHA 3TQNA 3M8EA 5LRRA 4MTEA 3V8LA 1K6OA 4L18B 1ZZCA 4XF4A 2XRNA 5HDKA 1I1GA 1B6AA 4MQVA 2HGCA 3SFZA 4RGRA 3ZMVA 3HT1A 1Z05A 1K79A 3QU6A 4D7TA 4HF0A 4DNCA 5D5WB 2DPUA 2IA0A 4PGGA 4I2OA 1P92A 2HYGD 1FX7A 4IEUA 1UIJA 3WW3A 1FC3A 1K78B 3M9AA 4OU0A 1UPIA 2E9QA 4G6QA 4ZYDA 2WV0A 4HLYA 3GYDA 4O9EA 2DQRA 1I5ZA 4WWCA 2JSCA 2PAMA 2NAZA 1STZA 2GA1A 2K4BA 1CF7A 1HSJA 1CAWB 4ZYGA 2PMHA 3E6CC 2NS0A 4E2QA 1XGMA 1O7LA 2O8QA 1R22A 2MC3A 1G3TA 1ZRFA 3NVCA 3K0LA 2IXHA 1QO0D 4XETA 1Y9QA 1XDUA 3U2RA 2H94A 2BNNA 3QOPA 1O5LA 3I4PA 4IEZA 2L4AA 1BBYA 2MNGA 4IRHA 2DK8A 5KHJA 4O6JA 2A61A 3WTVC 1NHAA 1LR5A 3T8TA 2L3DA 3GYHX 1JXSA 2H27A 4BXUA 2OD5A 2Q0OA 2BGCA 2VXZA 5DEQA 4JQFA 4F8AA 3BDDA 3HHGA 2R3SA 2UXNA 4ESBA 5BMZA 5TRDA 2LF8A 4U0WA 3FX3A 1YTYA 1KQ8A 2QQAA 1G3YA 2VECA 1XGOA 3EYYA 1SFEA 2A07F 3EBRA 1GXQA 3ULQB 2V1UA 2W85A 4AXOA 2L54A 5HDGA 2RVCA 3K69A 4YYOA 3WTWC 2FA5A 4RGUA 1I6XA 2EFPA 2OAZA 2M30A 3ERED 4UV8A 4LD5A 4IRIA 2B8MA 5DUIA 1F9NA 5L3GA 1XGNA 5H6QA 4BIFA 2PTMA 4CZZA 3QPTA 4KN4X 3I53A 2UYAA 3WW4A 4CXFA 3WGGA 3Q9SA 5D6EA 2XKOA 2PA7A 3F3XA 2DK5A 4R1HA 3DN7A 2XAFA 3SHFA 5C6CA 3Q9VA 4A2UA 2Q4SA 2CAUA 1R1TA 2RV8A 3SQNA 4XLNF 3GZ6A 5J3UA 5FO5A 1W4MA 1REPC 1SD6A 1UHMA 1F1ZA 4HV6A 3V4GA 3KP5A 5E1RA 4QX5A 4IHSA 5JFRA 1EYBA 4OIQF 2CWEA 1SFUA 4I7HA 3CUOA 2QUFA 4RB0A 4OIOF 5I8SA 5K5RA 3I54A 4GYIA 1T98A 3PFIA 1IAWA 3FMRA 3QU3A 3GW2A 4B29A 4QM8A 2IA1A 4HBNA 5HS7A 1ZG5A 3RKXA 2FXAA 4HBLA 4LUMA 2D40A 3OD0A 2N7GA 1LEAA 1USSA 3R4KA 4WBBA 2K0GA 3HRMA 1GHCA 5EEHA 2O61A 3WTYC 3E6MA 1SEFA 4I01A 4BH9A 2DQLA 1GXPA 3FJSA 4P5OA 2E7WA 3I59A 1YLFA 1RI7A 5CLSA 1J58A 3F8MA 4N9HA 4KMUX 3TKYA 2XASA 3F6OA 1OD5A 3TOBA 4M71A 2BV6A 2EV6A 1S7OA 4YFNF 4P55A 2DI3A 3H1YA 2IW5A 3KEOA 3WTXC 2W84A 4I98B 3K9TA 4MGIE 3E5UA 3N4MA 2O0YA 5CVJA 3GFJA 3HRTA 5HVQC 4O3MA 5I8TA 2YSRA 1KQ9A 4L2NA 1D8JA 1U2WA 3DL3A 4LK1F 4RB2C 4H0EA 2IP2A 3TO6A 2V9VA 2OYZA 1A04A 1RZ4A 2L4MA 1CAUA 4HLXA 4ESFA 2DU9A 5DYMA 1NZCA 3BCWA 2FEZA 1T39A 3OF1A 4UBHA 1OI6A 2IXJA 4HSJA 4ENKA 3FM5A 2GC3A 4EWDA 2J5OA 2HFHA 1IRGA 1W5SA 4LJZF 3HYIA 4UVAA 2XVCA 4EJTA 4L0ZB 5DCMA 2D5HA 1BC8C 3VHRA 3H7JA 4BYYA 2NRAC 1DZRA 2A68F 1FBQA 2CV6A 3RIRA 1PUEE 3BROA 1U5TC 3CTAA 1IF1A 4LK0F 1MJ9A 2PEXA 3DKWA 3MYXA 3WTZA 2YX7A 2QVOA 4BHPA 1P6RA 1ZYRF 4AVBA 5I0SA 5D5UB 3VEPA 1QZYA 1J0RA 4F7ZA 2XLGA 1WSUA 4KU7A 1J5YA 3NL1A 2VT2A 3T8RA 5FLIA 3PNAA 4MGRA 1B1BA 5E16A 2F2EA 2XV4S 3GFMA 2H6CA 3DP7A 3KP3A 2ET7A 2BEOA 3KGLA 2O03A 3BALA 2F5CA 5E8IA 1G6NA 1YLLA 2XLFA 4UBGA 1IN6A 2ZKLA 2P6SA 3MPBA 3KZZA 1CAXB 2EFWA 2ISYA 1XSVA 2BNOA 4MV2A 3J81Z 2QJVA 4WF2A 2ZMEA 3M1EA 2RKHA 4KA4A 2GAUA 1W7PB 4Y15A 3H1MA 3SXWA 4IEYA 1WWXA 5HLGA 1HW1A 3FFQA 2VE8A 4XFFA 2Z3YA 2KIFA 4D0PA 1KQ0A 3GUDA 3F72A 2CFXA 4QXKA 5FGMA 3TNPB 2M87A 3M70A 1FP2A 4IF4A 4HF2A 4UV9A 2ETEA 3IWFA 3KFWX 3V8KA 4A5MA 4OLLA 4K2EA 1ZX5A 4U88A 1XD7A 3K1MA 3QRFF 1LRHA 1ON1A 1S8NA 3L9FA 4ENNA 4WZCA 5DDGA 1RIOH 2MD5A 2MPFA 1D8KA 4KWJA 3IIAA 2C0ZA 2D1VA 5KHHA 2Q1ZB 3V7RA 2ISZA 5BPIA 2XUBA 2GH2A 5ICFA 2IJLA 2RN7A 4ETSA 1X3UA 4UHTA 1CF7B 4HSLA 3H9AA 4G7HF 4PZJA 1Q43A 4PIZA 5KVRA 3EJKA 3GLXA 3CJXA 1R58A 4UXNA 1UB9A 3DQVC 1IPKA 1ZRCA 1BJAA 2VN2A 3ZDSA 2GZWA 1R36A 4GO1A 1WGPA 3MFKA
chains in the Genus database with same CATH superfamily
3AL0C 5FYTA 1CWPA 3VOEA 4RQPB 3ZQQA 2W3JA 5M3MJ 3M07A 2WC2A 3NJXA 5D5VB 3KV6A 3G3ZA 3GX4X 5C8CB 2V73A 1GT0C 1J2XA 1W5TA 1BL0A 2MHFA 4CDXA 4CU7A 5FREA 1HXDA 2JD4A 1UYYA 1RTVA 5LFAA 1TC3C 2PX9A 4N4NB 1IN4A 2Z5UA 5B1BH 3NV4A 1MS8A 3VZJA 3D0SA 2RVAA 5K0UB 5L9RA 1ODMA 1XNBA 2L02A 1JUMA 4XJZA 1H2KA 2LRPA 4Z2AA 3ASNH 5FUNA 2NVQJ 1ETXA 1FX5A 4ZH4F 5FPUA 1OLRA 1UW8A 4A0YA 1ODDA 2EICA 5GKAC 1LOBA 2R93J 5IK8A 4OVEA 2PHDA 4MTDA 2ZEWA 1PGW1 2V6CA 4XCAA 3OIQA 4A3XA 5F3CA 3AKQA 1HB4A 4QMAA 4XIDA 1EAH3 4YRVA 1W0TA 1S4CA 3AP7A 1MMDA 1RUE2 4MNUA 1QNTA 2RS53 1OVPA 3D5RC 4EGYA 4HG2A 1JE8A 4B3NA 4J1XA 3OGRA 2VCAA 5F6KA 2P0WA 2D6PA 3KLNA 3O7OA 4FQ4A 2VBWA 1Z6TA 1PO21 4X1EA 1QKQA 2AR6A 1MH4A 4UXAA 3WW1A 1DGRM 3FBIB 3TMOA 1YJNI 3RI4A 2FJ1A 4FT8A 1MMNA 4BB3A 2VW0A 2DYSH 3HQRA 3KIOA 1JTYA 1X2MA 1SPPB 3C7FA 2WV1A 2F4PA 3H0OA 2WNEA 2L7FP 2MW8A 3I3LA 1PHMA 1JZ6A 3PUHA 3C1DA 4DZPA 3RG0A 1L7RA 5L7OB 2DF7A 4QWQA 3ZXAC 1ZQ3P 4OI0A 3ETQA 3GFLA 2D43A 3HJRA 4WXHA 1F31A 3PIOF 3OR1C 2TEPA 2QTWB 1CZVA 3MEXA 4PT6A 3JRHA 1AYN3 4D94A 4IZZA 1VB4A 1V9U1 3ZMSA 4Y20B 1YFHA 5E3LA 2A6VA 3APBA 3UL2A 2YR2A 2VKDA 1BIAA 5KXDA 3GHMA 2RR11 2AO9A 3O12A 1VQ8I 2DTZA 1J1LA 5FO8B 4C3IJ 3PIJA 4IEXA 2NP0A 3TEYA 3J7AY 3EYPA 1ETWA 3K4BA 2K9NA 2OZUA 4YGDA 4Q1PA 2Q8DA 2GIVA 1J3QA 4H7MA 1DLCA 5F0HA 2ZB9A 1AYM3 4PIXA 1YJ9I 4BQWA 3F8CA 3AMNA 2DCTA 4UUVA 3VKMA 4GALA 3A22A 2Y34A 4OI1A 4INDA 1TWCJ 1FI2A 2ZEYA 4MGKE 3S7IA 4AVPA 4E7JA 4G12A 5IT9K 5FY5A 5H9SA 1SLIA 2NNYA 4YW5A 3TO7A 1D0XA 1S0CA 1CQ9A 2Z33A 4BXXJ 1PK6B 4LHNA 3K51A 1KGSA 1MQTB 1LGCA 2PXJA 1YIJI 2EFNA 3ML6A 2RMU3 2D6OX 2VONA 3CD6I 4QIWN 5T54A 2IUWA 3CP8A 2ESNA 2C1FA 5SV8A 1LJ9A 5I0RA 3BG5A 1GQPA 4QX8A 4QXBA 1LHWA 5HNHA 1J7KA 3RJ2X 2YFUA 4P9UA 3MKYB 1BEV1 4UI9L 4GYGA 3G7DA 4QGNA 5EYRA 4ORFA 3O2PE 3PIGA 5FXVA 4A7ZA 5KC6A 2VUJA 3OYHA 3JQXA 3O1VA 4A6EA 3UNGC 4MXWA 2FDJA 2ELKA 3DWLE 2L9VA 2HDCA 4Z07A 1IXCA 4AEMA 2VW2A 2W1QA 4DUWA 3U4XA 2VMHA 4Q0PA 3OEBA 2GSYA 4E8CA 5A3LA 4ZDPA 1GZWB 5DZFA 3NWTA 2CDPA 3RYKA 4LOTA 1AXKA 4RN5A 2OC6A 1YS7A 2HYJA 2R6QA 3Q9OA 4KGGA 4C9YA 4P9FA 2OW4A 3QP5A 3M1HA 4PCQA 1MEC1 1E5HA 2JG8C 2PHXA 2HR3A 4MXVA 3J7AO 4E70A 4M01A 5FBZA 1E3OC 1NTCA 4DBQA 1D5VA 1CAWA 4QDSA 3T1LA 1B35C 1RUE3 4LIVA 1OPOA 3ES4A 4LTAA 3P9CA 3ZYJB 1WKYA 1YHQI 2L7KA 2VJJA 3WCSA 1VQ6I 2XROA 4OHVA 2X1CA 4PJ0C 1NCRC 4ZU7A 1MBFA 4UOJA 2BPA2 1NA1B 5J1UA 3ZFFB 2LNBA 2DPDA 5C3QA 3SJMA 4D6SA 3M7AA 1TMF2 2DT5A 4LITA 2CQXA 1V54H 1RPWA 2ECBA 1EH6A 3SZTA 4RGSA 1DU0A 4A3JJ 2EF6A 1P4XA 4YW1A 2JA7J 3MN2A 3BIWE 1VLNA 4UW5A 3MFCA 1I27A 1W2NA 4XVHA 2YU3A 5IYBJ 2IS4A 2BDRA 2VB6A 3N9PA 4DOUA 3K70D 4IE6A 2XL7A 3GF6A 5FKNA 1G3SA 2KZVA 1W8ZA 2WJSA 3GZTB 4XFAA 4KITB 4GWMA 2A71A 2QFEA 2VZ1A 4XUQA 4L9BA 4XFIA 1XE8A 3K4DA 2AXTC 1AWCA 1QDCA 1XNAA 2EXKA 3PJQA 1QEXA 4EZ4A 2HQAA 4GB32 4XRMA 2B7YA 3K2OA 1DDLA 4L9NA 2DO7A 5F39A 3MCZA 2V79A 3O6BB 1FATA 4AHXA 1AXZA 4CDQA 4CUAA 4CEWC 3IHUA 1KONA 3DPUA 3I64A 4ZYHA 3RZJA 4XACA 4EN7B 3ME2A 4JRLA 3IP4B 4CYCA 3VDAA 4C1XA 2PI0A 3JAMK 2L7MP 1AVBA 4UT5A 1PO12 1LVAA 4DYQA 5KK1A 4YM1A 3M8FA 4LUKA 4I02A 2D1HA 2W95A 2R32A 3IRQA 3DF0A 3LEMA 5FZIA 5IYCJ 2WNUB 2WO2A 2CDOA 2IPQX 3HMYA 2EA2A 3VBUC 3FHZA 1JXNA 2Q30A 4XFHA 5GZGA 5J4YA 3G1MA 3KHCA 2W24A 3QPHA 4AI1A 3O1SA 3VBSC 4YVWC 5F0FA 1KU2A 2DVAA 1TP4A 1E57A 4QQLA 1B72A 1SG3A 1H6XA 1V4RA 4Y13A 1OC1A 5I0UA 3F8BA 3RYPA 3KYDB 5FLXK 2WZR1 1W36D 1ZA7A 2Z4FA 5FZGA 2FDKA 2KZGA 3LEGA 2WABA 5CZKA 1U9OA 3I97A 4MEYF 1KYZA 4YIRX 4D0QA 2HYKA 3V42A 4YFXF 1OVSA 5C4WA 1B4AA 1H1MA 1TQPA 3PTRB 4DQ2A 5K5QA 4BM8A 5LD2C 1X8MA 5TSWA 3MW3A 3WG4A 5APAA 1ZZ7A 2ZX4A 4KBZA 2UWMA 1MD0A 1LODA 3A21A 2VTXJ 2XONA 2X6OA 3NARA 4FFHA 3S17J 4XABA 3U1DA 1QZZA 4ENJA 2QQNA 2TDXA 1YI2I 1HQNA 1LENA 2H09A 1VAMA 4HK8A 3SLIA 2IT0A 4MEXF 3DKXA 3KV4A 1GP5A 4FFGA 5EGOA 3OMYA 2Q5TA 1UNBA 3TEXA 1UX7A 2E5ZA 3J80K 3W2VA 2H1LA 2FF4A 1W6PA 3RWKX 3LFKA 3S5QA 2Z2SB 1ODNA 4HX8A 3H42B 4GDFA 3HT2A 4RLFA 2IVJA 4CDUA 4ATFA 4BEHA 3DU6A 1FOKA 1LJ7A 4G7OF 5K8SA 3CO2A 1ZNPA 1F2NA 4X6QB 2E32A 2PMUA 4KGQA 2QDRA 1MVQA 1ZM1A 3D82A 3ZPLA 1UOJA 5F04A 1TMF3 3QACA 3VBRC 2JIJA 1N1VA 4WK8F 4QQHA 3CMGA 4FFFA 4CDGA 3HGYA 2WWSA 4KH9A 1V6OA 3P5JA 1MMSA 5IYYA 1Y4WA 2ZXJA 2X1EA 4BJTA 1GNZA 2F5FA 4B1LA 2BWAA 5F37A 4XQ4A 3JW4A 2HS5A 4LULA 4ANJA 4A3MJ 1FTTA 2M3AA 1WLWA 3I5UA 3F9KA 4XKBA 2E53A 3BR2A 4C8DA 5FP9A 1LKXA 1B8IA 3BCBA 2NS8A 2VBPA 3B01A 3ZLIA 1H30A 3UGHA 2VU9A 3K2ZA 1Z0HA 5HS9A 4KWUA 4WXCA 5H6RA 4LK6A 3VKFC 2XHKA 5CADA 3GZ5A 4R8HA 5CQEA 2VNVA 4JAAA 1S2BA 1UO9A 4LLLA 1J83A 2IGKA 1PMHX 1IN7A 2A3YA 3MW4A 5D8AC 4J19A 4FAGA 4JKMA 2J42A 1QVTA 1V6KA 4YNIA 4HX4A 3R6SA 5FOJB 1TLHB 4XBFA 1U0AA 3NWKA 4PIYA 2E2HJ 1PO13 4UVCA 2KR2A 3RQ0A 3RI9A 4P5YA 2YUSA 2M0MA 1BI1A 5BNNA 5FZOA 3E97A 2EIGA 4IE5A 1EPWA 4IETA 2ORXA 4CCMA 4QX2A 4UFIA 4NC7A 2MSYA 2RNJA 4KMFA 1HRI2 5FK8A 4JDMA 4KIGA 2EXIA 2Z1DA 4E7HA 4Q0QA 5IPAA 1EKEA 2HWF2 2XB5A 1PDNC 1JGSA 2VE9A 3ZO0B 4RQPA 2BQPA 5FZCA 4FCAA 4QPOA 3H9JA 1EUUA 1FSEA 2VUCA 2WLQA 2DFBA 5A6ZA 2KXLA 2ZGNA 5C8CA 2X29A 2MEV1 3GJBA 3LFUA 1QNYA 2EALA 3CBNA 3UETA 4Q48A 3CCLI 4LFUA 2ADEA 4JP0A 3DF8A 1AJOA 1BIBA 3HN1A 5JOYA 3S14J 1LDKB 5K0UA 1ZG1A 2D5FA 3ILNA 1L7LA 5B66C 3N9MA 3N97A 1BW6A 2NVUB 2VMGA 3GZUC 2QKDA 3FWEA 1PIV1 4AD9A 1E5RA 2ZXQA 3PUQA 4RM3A 1SHWB 2VC1A 1Z3YA 4CCDA 4LG0B 1CX1A 2BVLA 2C6SA 4HVRA 2OZJA 5EZGA 4Y1UA 2EA4A 4A93J 2IXLA 1XOYA 3OS2A 3KF5A 1FLIA 4HSRA 2R7TA 5A7WB 4ON0A 5DCMB 1Z7S1 2GNDA 2IAIA 2F5EA 2BNMA 4IEVA 1OCOH 2Y6KA 4N43C 5LRSA 2FDFA 2FD5A 3M1CA 4XUNA 1EPZA 4LMYA 4MUVA 2EV0A 2QQMA 4GH4B 3ISPA 2WZ8A 5CPRB 5BNOA 3FLRA 3H1WA 5CFCC 3ENRA 3PU3A 4FOQA 4IEJA 1XQNA 2WINB 4PLOA 1JKRC 3FC0A 4RD7A 4GWIA 4B1MA 3KP7A 1A35A 4LEJA 2ZMEC 5GTIC 3KM5A 1BBT2 1NG0A 2ID6A 1SVLA 4RAYA 2FMDA 3ZCOA 1DYPA 2ELHA 1QJFA 4F3QA 5AIPA 5LEJA 1QOTA 4IV3A 4M3CB 3S1NJ 4WVWA 4AAXA 2AC1A 1BM9A 2ZGPA 3EXUA 4AYBN 2C26A 1WLCA 1FYLA 1WMDA 4Y1YA 5CKNA 4NN0A 1DGRN 2VUAA 5GLWA 2E7AA 4IV1C 1AUYA 4CH7A 4Y20A 2PAEA 3CJRB 5L19A 1QQP3 3JCUC 4J25A 2COMA 3HN3A 2OA4A 1VBC2 2HWC1 2ELJA 2YY1A 2W94A 2Y0MA 4LLNA 4JQTA 1TT5B 3H5NA 3P9IA 2ZO4A 1R1A2 2VNGA 4XTMA 1SBEA 1U8BA 1WZ2A 3I3BA 3M4OJ 1R23A 1RUOA 3VZKA 1I6HJ 2AXLA 1DDNA 1Q8OA 4U87A 1S7AA 1WCMJ 2NYYA 4NC8A 4XLPF 1FOYA 2DVFA 2X09A 4Q5SF 4YGEA 4RGAA 2VBZA 5IVCA 4PJYA 2P3KA 2HI3A 1K6YA 2R7ZJ 4LHSA 4CDWC 2J1AA 2ZHNA 4R52A 1YS6A 3W5NA 1XU2A 4GXLA 2X10A 2K02A 4HSTA 4AGRA 3IL2A 2QQOA 2XVLA 2RS33 1XMAA 1N1YA 3T2OA 2DN0A 1VQ7I 1PK6A 4HKWA 1LNWA 4AI9A 1UL9A 4A3ZA 3ILFA 1MQTA 1HRI3 2JWTA 1VBB1 1Y1WJ 4D5FA 3MI8A 1M1EB 2HQNA 4XLFA 2RJ2A 1IUFA 2V9PA 3OSGA 2PFWA 3RRDA 1IS4A 5E20A 3DEEA 4HA8A 1PMJX 5F8PA 1PNGA 4P1WA 4COUA 4XCBA 3PSIA 1FWZA 1D2SA 2VT3A 4DRVA 4FASD 3BLYA 2EV5A 1JTZX 2DOEA 3CUQC 4XNFA 1S0BA 2B5HA 1W28A 2ZJRF 2W47A 2NVXJ 5JZGA 2K27A 3J81K 2KIUA 2VQLA 1LFBA 5FZ7A 3A02A 3GHNA 2W5FA 4CE8A 3POJA 3AYDA 3CO7C 3MUY1 2OA2A 1Y3TA 1BHGA 5FZAA 1Y0NA 4FE7A 2FBEA 4DY3A 1U5TB 2LH9A 2HU9A 2GN7A 3BZCA 3F22A 1GZWA 3VBOB 4RR3B 3RCOA 3OOPA 2NVYJ 3VDDC 4LMFA 1HDDC 4KJZA 2W2IA 3OYCA 2ZABA 1Q5OA 4RGXA 5FFOC 2DA3A 4W6YA 2HOEA 3Q0WA 4K21A 4UWDA 3ZYGA 4Q47A 2DMQA 3I3QA 1EA3A 4RS5A 3A0NA 2XPUA 4NROA 3PVBB 1WW7A 4BNCA 4LKFA 3L2YA 4NO4A 1XBFA 3KV9A 2WAFA 4J00A 1NA1A 4ZONA 4ZZ5A 1NE4A 2BVVA 2YPJA 4YG0A 1JHHA 3ELNA 3FF5A 4GZ9A 3PL8A 2HBTA 3A0KA 3VSKA 1OFNA 3O1PA 4NRMA 3OCPA 3CMYA 5LB6A 4RSUA 3POBA 5JVTA 1LQ1A 1BBT3 3L00A 4HZFA 4AGGA 3SC7X 3C3VA 5HCFA 5C3PA 1VQLI 5D4SA 3EDPA 3HRSA 3ABTA 1J3RA 3OYJA 2PQQA 1X36A 1QJX2 2ZXHA 1JYNA 3I71A 2ID3A 1ITYA 2WAEA 4AQ6A 4M4PA 4D5CA 5FZ4A 5FFXA 1POQA 4A3CJ 1NOVA 2K46A 2X6WA 5M5WJ 1FSHA 3JBG2 2BTVC 1WJBA 4HOBA 1OCRH 1O3SA 3U75A 1VBC3 1D4M1 5TISC 3GTMJ 3SZPA 4XOTA 2DTWA 3RS6A 5IK4A 1BVP1 5GM0A 5LEKA 5L36A 4BQXA 3BG9A 5F64A 1NLRA 2P17A 4N53A 1R081 3PJRA 2V09A 3WP3A 2I45A 2B42B 5FZ1A 3AKTA 3ZFEA 1LEBA 1Z91A 1E0EA 2XF5A 4LB5A 3OGJA 2O6GE 1TW3A 2X9DA 3OYDA 4FFIA 2WNUA 3LAJA 2WKKA 3WF2A 1BK0A 3HBKA 2IEKA 1CX4A 1HW5A 4JKLA 2DJIA 4LBKA 3O0VA 4W6WA 4XDPA 3I7DA 3HBZA 5EWSA 4M72A 1CAXA 2QBYB 2UU8A 1JKOC 2PMZA 3WF0A 2YU1A 3GTKJ 3JD73 4KISA 3LSEA 4XOGA 4XXAA 3S16J 3CDHA 3EUAA 2Y0SA 1K6OA 3AMQA 5FBJA 3WSOA 5HDKA 4MQVA 1MIJA 2JJ6A 3WY6A 3HT1A 1OT5A 1PGW2 2E19A 4HF0A 5FZEA 1WD4A 1FNZA 4XUOA 3QPLA 2ADDA 4HT1T 2ARCA 4PK4A 3OYFA 1VMJA 2JVGA 1FC3A 1K78B 3THDA 3PUIA 1HV1A 3M9AA 5C9AA 1ACIA 4AHWA 4L99A 1F5JA 1R4MB 2P3YA 3NNJA 1RKTA 5EEAA 3BG3A 2DQRA 3VZNA 1PO22 1JTXA 1DHKB 1W0PA 2NAZA 1STZA 2GA1A 1TNFA 1Y8RB 1NCQA 3HG9A 5TGTA 5JDBA 3E6CC 1D5YA 4JGZB 3SKVA 5M3FJ 3K0LA 4A3GJ 2P3JA 2XQXA 3POEA 2VL8A 3QOPA 3I4PA 3LSRA 4PHZA 2XH6A 4IQPA 4IEZA 4XBQA 4BPZA 2DTYA 4YEJA 2JENA 5EYYA 4WM8C 4UFKA 3M3EA 1WH7A 5IOZA 1PX4A 3U1KA 3T8TA 2L3DA 2BBVA 3TYJA 1ZA4A 3OGGA 1OISA 3HHGA 1LEMA 4ESBA 2M7AA 2VXDA 1CN1A 4R9AA 1V9U2 2LF8A 3MO4A 1U5YA 1ZR4A 1YTYA 1XGOA 3GTPJ 1VF9A 2RR12 2NVTJ 3EBRA 1QMJA 1O59A 3ZXKA 4E4DX 2V1UA 2W85A 4BQ3A 2JB8A 3GTLJ 1S0IA 2XF6A 3K69A 2OQ6A 4YYOA 3BTJA 1DQUA 2EFPA 4AM3A 4LKSA 1VMHA 4EYUA 2DOAA 2ID4A 1F9NA 1TEIA 3OEAA 1OOPC 2VQHA 2UYAA 1QJX3 2BERA 2VULA 2EPFA 4Q4W1 4BBRJ 5IAXA 1RXFA 5D6EA 2DA6A 2JSPA 5H9PA 2DK5A 4R1HA 2ZXIA 2CH0A 1OH3A 3Q9VA 4LBQB 2CAUA 2MG4A 3JBG3 2OX0A 4LNVA 3FHAA 1AL0G 1GWLA 5J47A 4XLNF 2F4IA 3BIEA 3HOUJ 1REPC 3WLUA 3SQOA 5FYZA 4LO4B 2V5DA 4OMCA 3KVBA 1KXGA 2A73B 3WF1A 4WM7C 1N3QA 4I7HA 2XVKA 1W2TA 5ERLA 4COYA 1S72I 3I54A 3BTZA 3ZOBA 1BEV2 3PFIA 3A01B 5DXDA 4QM8A 4HBNA 3PDQA 5HS7A 4LIUA 3MIGA 1X1DA 4Y5Z0 2VCCA 2D40A 3OD0A 2YGLA 1R71A 1LEAA 2DCEA 3ZXSA 4N90A 2CW7A 2K0GA 1X19A 5EEHA 4CUGA 2YXSA 3D1NI 5KC5A 1HKDA 3BQZA 3CDLA 4FI9A 1JZ7A 2ARBA 5GZDA 1LOFC 1GXPA 5C4JJ 3FDYA 4IHVA 4D7NA 2E7WA 4NNJA 2A3WA 1YLFA 1RHI1 1MEC2 4SBVA 4TLGA 3F6OA 1AR81 3OY8B 2EV6A 3OJBA 4DMIA 1GYKA 4QAWA 4I3GA 4P55A 3AP9A 2IW5A 3W9AA 4DO0A 1FYUA 1IRZA 1SLLA 4CDXC 3K9TA 3E5UA 2ZOEB 2QQ8A 2OS2A 3ZQGA 3N4MA 2L2OA 2O0YA 5HVQC 5I8TA 2VQTA 4L2NA 1D8JA 4YM0A 1O4XA 1UAAA 4RB2C 2V9VA 1MZEA 3OY9A 4ESFA 5JR2A 4A3KJ 3KVAA 2D5VA 3QPSA 4NJ4A 1R4NB 2XJRA 4MFEA 3FM5A 3VBHB 4D7MA 1W0OA 3HYIA 4UVAA 1R6RA 3WG2A 2BJSA 4K9SA 4CA0A 5DCMA 1COV1 3AVRA 3ZPOA 5T55A 3VHRA 5JIUA 3O0XA 2CWMA 2NRAC 2VASA 1DZRA 3IMMA 5CFDB 2CV6A 2BFUS 1WWYA 3MV11 1XJAA 1H9PA 3VBFA 3CC4I 4GH4A 1IQDC 5FAXA 2YX7A 4EEFG 3UYJA 1WSUA 4F91B 5A6QA 4OYUA 1J5YA 3NL1A 1JYIA 4A3DJ 4Y5TA 3HJEA 4MGRA 3GFMA 2H6CA 3DP7A 2A3XA 3KGLA 3HXLA 4XQWA 4BY7J 2JMWA 4DOZA 2PELA 1A34A 5EG0A 1JU3A 4UBGA 1NKGA 3IDAA 4LKDA 3I3MA 4QD2A 4M3CA 2M4KA 2R0HA 4JHZA 4QSHA 3WXPA 3QYFA 3AP5A 5HLGA 3UGGA 1RUF3 3PJYA 1SEUA 2ZMKA 1WMXA 4QXKA 5FGMA 1J84A 3M70A 3L2UA 4IF4A 3BTXA 1MZ5A 3VHPA 1OR7C 3RMXA 3UR3C 3V8KA 4A5MA 2VY0A 3V0BB 3A0HC 1ALYA 2VO5A 5F0CA 5FYMA 2Y38A 1DFQA 2G9GA 1S8NA 5DM7F 3GCWA 1ULEA 2DU1A 4W1UA 4W65A 3BR5A 2AZ5A 3NRUA 1YC61 1U5XA 1X50A 4YVSB 1WJCA 1BLZA 4BGDA 2ZPXA 2VPRA 4OWRB 5GZCA 3H9QA 1TT0A 2WZR2 3MGUA 5LASA 4UHTA 2RS11 1IS6A 5FKCA 4UXNA 3DQVC 4JGYB 4IL6C 1A5JA 3ZDSA 3ZQCA 1WKMA 5ERIA 4S0HB 2KDZA 5BV6A 2B9SA 2D3RA 2R0QC 4WVZA 4Q0VA 4DBRA 2I07B 1OYIA 2RAEA 3HPNA 3OYMA 2W08A 4KDPA 1TWFJ 2QQ9A 2CWSA 1G59A 3C7OA 1P9QC 3KB5A 5FMOS 3GVAA 1MS3A 2OPTA 2CNAA 4BMBA 4C0HA 1BOAA 3DEWA 2WA0A 1ZAOA 2BWCA 1WJDA 1QQIA 3V64A 1J75A 3MICA 2X85A 4D69A 3BWGA 3I4IA 2NLRA 3WGHA 4PGHA 1ZHFA 2Y75A 2L9SA 1MEC3 1G8WA 4EJWA 3CJTB 4HN1A 5FKMA 1CZTA 1HF0A 1DU3D 5EEGA 1FV3A 2P4EA 5JSRA 1VAKA 3Q8CA 1RVF1 4HL0A 3U9GA 4ZTFA 1ZRRA 5A7NA 5IOYA 3DYMA 2XJTA 3RTRA 4RR3A 2XAJA 4RHV1 3O0WA 2OT7A 4CZCA 2OQRA 4NOTA 1I9RA 2B39A 1ND3A 3I2FA 5JVGF 4AZZA 4UY8I 2VZRA 1W8WA 4CSWA 4BDVB 1STMA 4QPYA 3L2RA 3LOCA 1S0FA 4E2GA 4NMIA 4GJYA 4XRSA 2IS1A 1WQ2A 2DA2A 5JXJA 5EJ1B 3NQOA 1FJLA 1XYOA 4YW7A 5A3UA 2ZKNA 3WNLA 4Z1VA 3ZFGC 1EV11 5L3BA 3BQYA 4B7KA 3L1PA 3JRAA 1GZCA 4AIDA 2R7EB 3OPWA 3BZ6A 3UV9A 5JMCA 3J7ZI 4QHOA 2BP6A 3D5SC 4XC9A 4A0XA 2JDYA 3KP2A 5F5CA 1ZLKA 3K46A 4OULA 3CJIA 1MNEA 3OOXA 1YNAA 1HXS3 4OMDA 4MGTA 5JXGA 1S55A 1ACCA 5AFBA 3WP5A 4KWLA 2M45A 3OBTA 3HOWJ 3C8XA 2Y69H 2OXBA 3MWMA 1W6MB 2DUQA 4IESA 3IKWA 2VGDA 2X51A 4JDOA 1M4WA 5A2QK 4PF5A 5DV5A 2WFPA 3H50A 1BI2A 1XNCA 3FKIJ 5DG1A 4V2VA 3JSPA 4C91A 5J48A 1K4TA 5JSPA 2LLKA 3I8TA 3KZ4C 1LE8B 5IK5A 1IW7F 1W6NA 4Y4RA 2X5IB 3PU8A 2FCUA 4OIPF 3CLPA 2A5ZA 1RESA 3LFIA 4Y26A 1AX1A 3HSFA 2DT6A 1GZTA 2HTSA 4LJHA 3NJVA 3BR3A 4ABZA 1SMTA 4N4OB 4AHYA 1WLTA 3TGNA 1XE0A 1IXRC 2R1DA 2GC0A 2AEYA 1UOBA 5FP8A 2MEV2 3GM8A 1WFXA 4HKOA 1SFXA 1ZG3A 2Q2EA 1VAVA 3T2PA 2V6EA 2K4JA 3REOA 1H88C 1MBEA 2X0LA 5H9QA 4LA3A 5LZ6A 1W39A 1KJRA 3P7NA 2LTNA 2DCKA 1K83J 1V3FA 5DUVA 2F4LA 4HW0A 2BGOA 1XU1A 2X53S 4ZJZA 3T09A 1W7PD 2UYBA 4AHZA 1SQ4A 5T5JA 1QJU1 1QVUA 4YZ4A 1PIV2 1LULA 4MGSA 4XF1A 2NQYA 1T6SA 5F32A 4U0VA 4QX7A 2NS7A 3IT8A 2FOKA 1WW4A 4RA2A 1XRUA 2LW8A 5EPAA 3SNMA 3WDUA 1ZZBA 1PP7U 1AL21 5FLJA 5E8GA 1UD1A 4M00A 2O9LA 5FPBA 2GM4A 1SBDA 2GMEA 4Z2WA 3FXOA 2JRTA 1Z7S2 1OYWA 4GCVA 4FISA 2F5DA 3W20A 1E3HA 2WN2A 5F3EA 1V5EA 3H3VK 4OCTA 2OQGA 2NNNA 4QU1A 3K7AJ 4U36A 5DN2A 1VRH1 2V26A 1S9HA 4PI0A 4DYCA 2A6TA 2VXJA 2KQRA 3HAGA 1HC8A 3S0MA 3X29B 4KN7X 3OS0A 3BJ6A 1QXRA 3TP0A 1GKBA 2R073 1PP8F 3AL6A 2QLZA 2AH2A 1K5JA 2ZNYA 2A5WA 3WTSC 1U9NA 5K5OA 2R7RA 1MJAA 3DXTA 3CC7I 1KFUL 1X7NA 2CQQA 1RNLA 2LR8A 1X8EA 3JQWA 4RAGA 4OAZA 5IVYA 2VMDA 1HKSA 1ENHA 1F4AA 4XURA 3L2HA 4F93B 1BQPA 4C1WA 2D6LX 4BE0A 3UNPA 1DPUA 1V5GA 2R7QA 2EINH 5L73A 4LBOA 4V2WA 2WS93 3I55I 1ZVFA 3S5AA 3W58A 3TP3A 2V1DA 2HWD3 2YUEA 4C2UA 1JH5A 5TJJA 1AXYA 1JUPA 2HWC2 3DEUA 1BI0A 5DAXA 4IL7A 3POWA 2VOTA 2DCYA 1W3VA 5JI7A 1VB2A 2IXCA 4Q2FA 4AEDC 3DPRA 2LF7A 2IGOA 3I2DA 5EJCA 3ST7A 3WTUC 1AKHA 2GWRA 2E5NA 3RPQA 3HUGA 2E34A 3TB0A 5JI9A 4S04A 1LCLA 4M0NA 3UKVA 2ATFA 3MFAA 4QWNA 1IS5A 5E79C 1YW9A 3KT7A 4X6RB 1MBGA 3S8PA 4ISQA 5EXOA 4A5NA 2ETHA 5LWBA 4Q8KA 1GV2A 3MZ8A 3NSTA 1UYXA 5JAXA 3JRFA 2ZC2A 3K4CA 1KU3A 3CCSI 3JSOA 5GLUA 4XJAA 4QPGA 1NG7A 4IEOA 1S29A 3V0AB 5KHIA 1Y43B 4L5JA 3DLLF 3DBHB 3WU0A 1REDA 3LSHA 4QPIC 4NIIA 4NHYA 5FZ8A 4CVUA 2YBPA 1R7JA 4XR6A 6PAXA 5CYYA 2A05A 5JLWA 1JN2P 2KRHA 1IXSB 3RFRA 2QCOA 3C7GA 2LK2A 3UKTA 2FMLA 3EUHA 2RNGA 4M9SA 2VZOA 3OIPA 4Q4X1 3AB0A 1OF4A 2Y33A 1W9WA 5FP3A 2MEV3 2FOWA 2VIXA 3A01A 1HOMA 2ZBJA 1N77A 2E60A 1X9TA 1E5IA 5GLZA 3OL3A 2JKBA 2COBA 2VKVA 3VYUB 2OUHA 1U78A 4AYBA 5FY7A 2FHRA 1QWRA 4ZU4A 1ETOA 1VQ5I 1VE0A 2AREA 5GADJ 1SANA 1D0GA 2GN3A 1DGRA 4ZTJA 2FQ4A 2EJRA 3OG2A 4AVZA 1HLCA 2LSOA 3LF7A 4HV5A 1H8TB 1YW8A 4UFLA 2RDQA 5FZ0A 1H0BA 2WFF1 4TYSA 3USSA 1HA8A 2YROA 4E7SA 4YM2A 1W8HA 1GSLA 1CD3G 1W03A 2Z99A 2GC2A 1VQ9I 4MQ9F 1AR71 1W9SA 2IGNA 4MGZE 4Y33A 3J7YJ 3OBRA 4BQ2A 4RQPC 3PLQA 5LHGA 3OY8A 4XSXF 1OFCX 5M0TA 3ASOH 4B3XA 1Z7S3 3S3NA 3ZR6A 4J01A 4IHTA 5C8CC 3F6VA 4XJWA 1S7EA 5F7UA 4FX0A 3CCYA 1DZQA 4YFWA 2Y6JA 5CVIA 5D5XB 2P5KA 3OOUA 3WDWA 2QQBA 1DP7P 1RXGA 1ULDA 4GULA 2L5QA 2YPRA 2LKXA 2JEMA 3QQAA 4OHWA 3C3WA 1N1SA 3ZMTA 5K0UC 3DCQA 4R9DA 4X8NA 3MIBA 2P3IA 3RKYA 1UX6A 1JT0A 1MVEA 5GPAA 5LGUA 5DD8A 5B2GB 1PZ9A 4BQ5A 3POGA 3OBZA 1BK1A 1RIRA 3KT1A 1S3JA 4LB6B 4BLJA 1JYWA 1LOGA 3C2GA 3KZYA 4PJLA 3LPFA 4JZRA 5F3IA 1VFCA 3TBDA 5CFDA 1NLQA 4NHMA 4AUXA 3U0ZA 1JHJA 5FZLA 4LOCA 1S6LA 1VALA 1TQMA 2M2EA 3VHNA 2HEOA 2R16A 1SAXA 4LHLA 5C70A 3VD4A 2CQNA 4AI2A 1SD5A 4OOIA 4UFJA 2PHUA 3U14A 2Q1FA 1RL3A 2WAOA 1VBA3 4XZPA 1GV5A 4UUTA 3HHHA 4DZJA 4QB2A 3A1YA 1MJBA 2VAUA 1D4M2 5A7QA 3FFZA 1Z3XA 4AW7A 3ECQA 2NMOA 2XAQA 1R082 2K7LA 4H3WA 3WHUA 2QDNA 2VQCA 1SVOA 1BVVA 5J3LA 1OCZH 2KPMA 2PAKA 1AR61 4E7ZA 2KJCA 1Q8PA 5JHUA 2ZJPF 2FCVA 1QGPA 3OWTA 5L7OC 2WA4A 4LLOA 1LAJA 2KMUA 4FHTA 4F92B 3WV6A 4ONUA 5AFEA 1W9FA 1RKWA 5L3EA 3KLSA 4MXWB 4R9CA 1OKRA 2BOIA 4COVA 1SLCA 3F2ZA 2RG4A 4YIIA 2UY9A 4XBNA 2J1RA 5L3DA 3BJAA 3ZMUA 3J8F1 3TEDA 2VPLA 1VIWB 2YYOA 3MW2A 1YI7A 3IDEA 2EWNA 4XFBA 3KCCA 4JDNA 2G1MA 3U07A 5ABJA 3TWIA 4YVSA 2LM3A 1PZ7A 4ISRA 3QAHA 1FZPB 1POGA 3WDYA 3TW7A 1HKTA 2R30A 1EP0A 3U10A 3QBQA 4I0BA 3R4DB 5DAQA 4XLCA 2WB1N 1BI3A 1A3KA 2ZEXA 1C57A 3SEPA 2XJSA 4ENMA 2MABA 2BE5F 2FMYA 1YQ2A 3ES1A 3I2HA 2EXHA 4AIKA 1SBFA 5GZFA 4YWAA 2DUPA 3TEWA 1RJ8A 2DBBA 4HPKB 4OFGA 3BCAA 2I74A 5HBAA 3BGAA 1OKOA 4C3JJ 3OV8A 3DPTA 2V4AA 4BXFA 2A70A 4L9VA 2KT0A 3M4FA 2FX0A 4FXKB 5A1AA 1PK6C 4HN0A 3NNFA 3L9JT 5F27A 2WAAA 1MQTC 4GWNA 2LFBA 3BODA 4BIOA 4LKEA 2LG4A 1HQLA 5EYXA 5CIRA 1BR4A 4QXCA 3WE2A 4ES8A 1UG2A 1IPJA 4ZZDA 2VC0A 1OCTC 1R1VA 1GP6A 2AQFA 3AJZA 1RUD1 4FETA 5FJ8J 4QKNA 4FBFA 3P5BA 3AKSA 4YRDA 5FWJA 4A3LJ 1CJPA 4KQ7A 1TZOA 1W5CC 3M8LA 1ONVA 2E1MB 2DMUA 5LY1A 3CL1A 1F5FA 4CTEA 5E3OA 4HDVA 3G73A 2WN3A 4CDQB 2JICA 2N8GA 5FP4A 1QHDA 5IT9Z 1DF0A 1TWGJ 1HQCA 1BR1A 2B0LA 3RNSA 3N7MA 5ILUA 1SLTA 1CESA 2ECCA 2E2IJ 2XRLA 5H20A 5FY8A 2D7FA 3ZGKA 2V1XA 1UKGA 2EA7A 4Q26A 4PDWB 4IE4A 1WZXA 3K2AA 4QHZA 3BT9A 1ZRDA 3D8CA 2OKXA 1TWHJ 2V4JC 4LXLA 3JTHA 2YMZA 3ZOIA 4OQ8A 1FOWA 1RJ7A 4CPBA 2QQKA 3KZIC 1SMYF 4UAPA 3WE3A 4P96A 2M1BA 4PUSA 3GWZA 3I2OA 4CEYB 2MBFA 4Q4W2 1D7PM 3CNAA 3RKWA 4XFGA 1VMFA 4B8XA 2P37A 3O3KA 2B4KA 2JDZA 4CCLA 4XF9A 1O3RA 3FISA 2OTLI 1Q3EA 5M5XJ 1NA1C 1P8JA 3ZFFC 2E1OA 5A6XA 1DQ0A 4QXHA 1JOJA 3TOAA 1D4M3 3U11A 3ZDVA 1X33A 4PLMA 2ZX3A 2DVBA 2WBKA 3VYSB 2JG9B 3M3OA 4BXSV 2RS51 4QT6A 3UK9A 1ND2B 5JVVA 3ZSJA 1MS4A 1R083 3E1SA 1W6MA 4E2SA 4BHCA 5C4WB 2OU2A 2VKEA 3OUJA 4QQOA 1US3A 1SDWA 3T08A 1T0FA 4JTNA 1E2XA 3OGVA 2MH9A 1POV0 2HEVF 1XCBA 3HC7A 1JUSA 3FXUA 1DP0A 4U2AA 4YIFA 4A6SA 4HXCA 1DU6A 4CXWA 2GXBA 4DXTA 4CZSA 4D6QA 1P2FA 3SCGA 3BVCA 1SAUA 1OJLA 3LPGA 3OIOA 3BPXA 3G1OA 1FIAA 2E6VA 5EGOB 3ECHA 3ZN1A 3AYCA 4YFZA 3TDZC 2EVXA 4XF3A 2LALA 5KHKA 3B02A 1RHI2 4M9ZA 2IVIB 3LKJA 4NIGA 1N75A 1W6PB 3IPVA 5LHIA 3MKWB 1VP6A 5GALA 1AR82 4CDUB 5CJ9A 1XDSA 3T1MA 4G6TB 1AYN1 2PMWB 4M73A 3JREA 3S7EA 2WNUC 4JTOA 3VD3A 4NPMA 2XWJB 3ZSMA 1NX9A 4XAAA 2CG4A 1PVXA 2L9RA 1BR2A 4I0AA 3HGGA 4XONA 4M4RA 3J7HA 2Y60A 4B7EA 5FUPA 1WW6A 3RPUD 2BOLA 1AYM1 2PLV3 5DZGA 2ZGSA 1FBUA 2WY8Q 5J1YA 2DOFA 3GBWA 3DYOA 2R4GA 2Y0OA 3E5XA 3JAMZ 4GMP1 2I8DA 3H8XA 1COV2 5C3SA 3IIIA 2ZNZA 3W2AA 5I0DA 1YW7A 1WI9A 2D93A 2WT1A 5BNGA 3W59A 1B8IB 5J8CA 1FP1D 1T2XA 4GMP0 2JXAA 2XB6C 1ZGJA 4M3FA 2XAGA 4I3PA 5FZFA 4YLZA 2GALA 5BXXA 2RMU1 5A33A 1PJRA 3ZKUA 4XSZF 3PMSA 4I0WB 3COAC 3ZQLA 3M3IA 3VD7A 3WG9A 4MZUA 2XIGA 1SC7A 1O4ZA 1QOSA 1MGTA 3DYPA 2EB7A 4H4KC 4BAYA 3WGIA 4UW4A 2V9KA 2HWVA 2CMPA 5DDJ1 1WHUA 2NPIA 5F6FA 2AYHA 4QLCU 5BNNB 4EJUA 2WSVA 3BOWA 3KP4A 2L0KA 1W99A 4R4ZA 3ZX7A 4KIFA 1R49A 3QP6A 1T08B 3KSCA 2ZFWA 1FYKA 3GF2A 4HX7A 4AEJA 3WR0A 5EP9A 1OFSA 3NV3A 3FUQA 2OUMA 2PLYA 1LOCA 3JTGA 5EJ3A 1F5TA 1MPXA 3CKHA 2A6WA 3BTCA 1UELB 4UFHA 4FSJA 2RC4A 3H5AA 2E7TA 2HWE1 3ZIXA 2XWBB 2JWPA 2MA3A 2IS6A 1N3PA 1RB8G 1CPMA 1WMFA 4AI3A 2RS12 3HTSB 2M8EA 1P7JA 2E1NA 3I3EA 1FOD3 1MS9A 1ZZ8A 5FYIA 3J80Z 4X6AJ 4BMEA 4YZ5A 2DJNA 5E1XA 3S30A 4CEWA 5B5EC 3WU1B 2VOOA 2CUFA 1EH8A 3WHCA 1JZ2A 5EJZB 2Q8CA 2HQRA 3ORJA 3NWSA 5E3MA 1SLBA 2A7AA 2NOJB 1WRJA 3F23A 5T5LA 1F9KA 3V0AA 2PBIA 1JGGA 5I0TA 1N47A 5E3NA 2K2SA 3DFGA 2LC2A 5CVRA 4XM3A 4IXAA 1HRV3 3RZHA 5C5TA 1PM7A 3HSRA 2RJLA 2EIDA 5BS6A 4YW2A 2WAQN 1AX0A 1RUH1 3ZMZA 4YW3A 5HI0A 3VBUA 1ZYBA 1RHI3 2O14A 3R60A 2RJKA 5ILSA 1ZBE1 4JRAA 2MLKA 3MUZ1 3KPHA 3TQNA 5LRRA 3V8LA 4LBMA 5CKMA 4L18B 1ZZCA 4XF4A 5FYVA 1AR83 1DQ1A 2ZGLA 1B6AA 4NIDA 5LBFA 2Z16A 3VBSA 4IDZA 4RGRA 2LVSA 1HN1A 2ZGRA 1W2OA 1Z05A 1K79A 3LIGA 5BNOB 5D5WB 2DPUA 5HXMA 3CQZJ 3ZSLA 4BQ1A 1RVF2 1SMVA 4P9JA 1P92A 2I10A 1FX7A 4V2GA 1IQAA 1UIJA 4JC1A 2EILH 1K12A 3WW3A 3GJAA 1H8TA 4G6QA 1AR91 4RHV2 2WV0A 1GWKA 1QJEA 1YX3A 2HH9A 1ASJ3 1H8VA 1DGLA 2LTPA 2JSCA 2PAMA 1U5IA 3KHBA 4IV3B 3WNMA 3HM5A 5JOWA 3WG7H 3VLBB 3FLPA 1NG6A 3A4UA 2WDBA 4FTEA 4NRQA 4A41A 1O7LA 2O8QA 1COV3 1R22A 5FYSA 4IX7A 1G3TA 1ZRFA 2DODA 1LOEA 1IRXA 3AZZA 1O5LA 1QXPA 5FXZA 1OLTA 4BE2A 1EV12 5BNPA 3M2MA 5KWRA 2XJQA 5A3WA 4IRHA 4XJ9A 2DK8A 5HPOA 5KHJA 1WCQA 3WG1A 4LE3A 1FMWA 3LE0A 5HODA 4B43A 5FRMA 3QWLA 3GYHX 2D98A 1JXSA 3NKGA 4BXUA 2BGCA 5KXCA 4JQFA 3BDDA 5IATA 1DQ2A 2EZLA 4XAEA 4CP0A 3T4HB 2B63J 3CU7A 3PMEA 5GAEJ 4AWDA 5EQUA 4TN7A 1WGXA 3RSNA 1UPSA 1SFEA 2ENRA 4IE7A 2W00A 3WHBA 2QSFX 1W6OB 2VZUA 4AXOA 1X1PA 2KRCA 3VBRA 3WTWC 1A6QA 3L2VA 1I6XA 2ZJQF 4CCNA 1RUJ2 1P7IA 3ERED 4GH4C 3N05A 4B47A 4IRIA 2B8MA 4XN0A 5JXIA 4BIFA 3ABZA 4CZZA 3PIPF 1QHGA 3GTGJ 3EPZA 4BQOA 3FXKA 1UU4A 3WGGA 2JA8J 3AVSA 2PA7A 1YE9A 3VZOA 2LYCA 4RGKA 3HOXJ 1PZ8A 4RAFA 1Y39A 1R1TA 4CRQA 4FTBA 5JZGB 3Q8AA 5F5IA 1IZ3A 1W3XA 2IWGB 5IW0A 3AMMA 2RS13 1UY3A 1F1ZA 4YG6A 1WJAA 3R0RA 4HV6A 3KEYA 5FRNA 2JA6J 4JYKA 4D8MA 1EYBA 4OIQF 2Y2ZA 1QA6A 2QQIA 4XKCA 2Y30A 1TMF1 2XSJC 2R061 1J09A 3LQCA 4RB0A 4OIOF 1ETVA 4OI4A 1RR7A 1UYZA 5DZEA 5K5RA 4GRIA 1WCKA 4GYIA 4Q4V1 1QJU2 4LO8A 1T98A 1IAWA 3QU3A 2IA1A 4W6XA 1Q8QA 4MVTA 1YRNA 1ETKA 1BA5A 4HBLA 2XPVA 1AL22 3P1IA 3UT0A 1USSA 2YB7A 2EQRA 3KT4A 2Y64A 4RS5B 2CV1A 3H36A 3J26N 4OZOA 5A1FA 1SEFA 1K42A 5F5QA 2ZFUA 5FKLA 4UUSB 5A3MA 4B1RA 2G0EA 1URXA 2RDRA 2XVGA 4E4SA 2XUEA 1FEXA 1C5HA 2WT0A 4HPKA 1Y8QB 1UJ8A 4ZC3A 2XASA 4QB1A 3WINE 2X05A 2BV6A 4AFDA 1I5PA 4YFNF 2K9LA 3OBAA 4I98B 2JVHA 1AZDA 3ZN6B 5CVJA 4O3MA 2QF7A 3DXUA 2YSRA 3K4JA 1U2WA 2ZGTA 4BDYA 4LK1F 1ZGWA 4H0EA 2IP2A 3TO6A 3CZUA 2OYZA 1RZ4A 3U78A 2DU9A 5DYMA 2FEZA 1GOGA 2FUG2 2IXJA 1TZLA 2VOXA 2UWCA 3PURA 4ENKA 4XMAA 3J7MA 3T2QA 3H3LA 2YBKA 2MD0A 2QZ2A 1SZBA 2HVQA 3NO8A 1APLC 2HFHA 4LJZF 1NAEA 4RYDA 1YQCA 2PHFA 1W2UA 4X8PA 4EN9B 1G86A 1QDOA 3FLTA 4XILA 2KA3A 2DXIA 4PBOA 3WQBA 5CA6A 3AKZA 1XNTA 4CCEA 1H8AC 1U5TC 4B4CA 1KD7A 2VZVA 4KG0A 5FJKA 3MYXA 4PDWA 4N53B 4BHPA 1P6RA 1ZYRF 5JLVA 3VBOC 4RR3C 4SLIA 1MBKA 1QZYA 3PO3J 3MLJA 2GNBA 1UF2C 3T8RA 2W7NA 3FBYA 5FLIA 3ZFEB 3HDDA 5HCHA 4IQ4A 5E16A 3TAYA 5GPCA 2IFRA 1K45A 3KP3A 1H6YA 2ET7A 1R1ZA 2F5CA 1XTAA 2C24A 2DA4A 3O1TA 5ISLA 3SDGA 3IH3A 1G6NA 4CEYA 3AG2H 1YLLA 2XLFA 2XJUA 5E89A 1CIYA 3HWJA 2ZKLA 2VMCA 3MPBA 4P08A 2I2SA 3KZZA 1CAXB 1GNYA 1XSVA 1TL8A 3J81Z 2LS6A 2QJVA 1X4OA 4WF2A 2JDHA 2ZMEA 3M1EA 3IN9A 5C4XJ 5C3RA 2DCJA 4FQGA 3AKRA 3H1MA 1RUJ3 5F2WA 1HW1A 1TE1B 3FFQA 2AEZA 4AGVA 1GUIA 4K7JA 2Z3YA 1UOFA 4NE9A 3VL9A 5GJ6A 5JOZA 2JX9A 1KQ0A 1JYTA 9ANTA 2JG9A 2M87A 4DGWB 3RKQA 3QOEA 3NAPB 2LKSA 4TSVA 4QDRA 1ND2A 3IWFA 1O4YA 3CZJA 2EXJA 4K2EA 1O6UA 1WW5A 3J4UH 2CRGA 3J7LA 1XD7A 4EZHA 2G9ZA 4UFMA 4PFOA 4NDLA 4LORA 5C9AB 3L9FA 2AENA 4Q4X2 1IHMA 1QIQA 5DDGA 3G4SI 2MD5A 1D8KA 5FIXA 2TNFA 3C7HA 2C0ZA 4KI5M 5KHHA 2BGPA 1QRYA 5BPIA 1HQWA 2IJLA 1ZTRA 3S2HJ 1NCQB 4HSLA 3H9AA 4G7HF 4PZJA 4PIZA 4ZKTB 1BMV1 5LATA 3GLXA 2R1BA 2PQSA 2F5VA 1IPKA 2YBSA 2VN2A 3DEMA 3E6DA 2QQWA 2FD8A 1BW5A 4MHGA 2M9HA 2PHTA 1HSTA 1XYNA 2WFF2 3HRUA 1K4SA 2KD7A 4MHUA 3D5LA 5HOOA 1PX3A 1GVDA 2HOAA 4IJAA 1AL23 1BZWA 3THCA 1AR72 3S93A 4QDQA 3WDXA 4MIMA 3LWFA 4BQ4A 2MFZA 1Z7UA 3KX2A 2DDAA 2P7CB 2VUMJ 3ZKYA 3B6CA 4ZZ8A 3FBNB 1S0JA 4XW3A 1IOAA 1VQPI 1QQP1 1H89C 4RS8A 3MMYB 2KDOA 5A32A 5A3TA 5GAGJ 3S57A 3B93A 3ELKA 2QM3A 5DM6F 4FOWA 4LBQD 4A42A 1SCRA 3JB4C 5IJRA 3QYEA 1X9PA 4LG3A 5D2AA 3EQEA 2WIIB 1WI3A 3SEZA 4EV0A 5FLMJ 1YIOA 1NLSA 4LA2A 1CAVB 4RL7A 3ZSKA 3OD4A 4M6VA 3CUQA 4Y17A 4M3EA 3RZOJ 4JOMA 4CP9B 2GDFA 4K1ZA 1FOXA 1QNWA 2Y9YA 1IGOA 3T0YA 2GU9A 5JLXA 4KT6A 3RI8A 2D6MA 1XPWA 4KIBA 1QY4A 3H3UA 1W2AX 2XXZA 2RS31 4GB33 4G9YA 2XG3A 3BC8A 1XN7A 1FMVA 4JX6A 4R4XA 3ABUA 3R4SA 3T0BA 3GZAA 1QZEA 2QCSB 3PVOA 1MH3A 3W5MA 1AF9A 2PJRA 3ACIA 1Q1HA 1U3EM 1W05A 5FQ0A 3NJZA 2RQPA 2EZHA 3KLOA 1QXJA 2VTXA 1I50J 3SEEA 2ME6A 1R00A 3ZXGA 4L92A 2QEXI 4L97A 2Q8EA 2GOXB 3VKOA 3FBMA 4JGZC 2ADUA 1Z1DA 2WZEA 3MPPG 2OCCH 3PTYA 5HCBA 3VWBA 4DRRA 1A6IA 3U21A 2FZ2A 5C71A 3IMNA 3B9IA 4BISA 4QX1A 4FX4A 1ZZ6A 3PUFA 1PUFA 4HDUA 2DA5A 1AR62 5L9BA 3SMHA 3IKVA 4AQTA 3V7CA 3I2KA 2QQPA 4JKKA 2WO3A 1KU7A 1SFKA 2ZBKA 4RM2A 4UF0B 4XQDA 1PNFA 2XBO1 1IGNA 2W57A 4WZFA 3T5XA 4OHYA 5E88A 1F35A 2DUOA 2KRFA 3WCRA 2VOVA 3URFA 3H7YA 3K6GA 4FAHA 1UG0A 2HVSA 1LHVA 2VNOA 2W87A 3P6BA 1ZGAA 3WX5A 1U8RA 4HQEA 2E36A 2A1XA 2QQJA 3VHOA 1I3QJ 3N3HA 1UY1A 1LHUA 1YJWI 3LQRA 2QENA 1OF3A 1UIKA 2HPIA 4HG6B 2XMLA 3ZYIB 4IRGA 2R0FA 4E9KA 1CQTA 4URTA 1KZHA 3D4KA 1TBXA 3S3MA 4N7UA 5FDBA 3O1RA 1ZLJA 3EUKL 3KF3A 4W8JA 1VQMI 2X4HA 4XF0A 1OMIA 3E3VA 1P4WA 5L3CA 1REFA 5JOXA 4YELA 3CEWA 5LCWL 2Z69A 3RYRA 5IP7J 4YZ1A 3FHIB 4GKXA 5A3OA 3CCUI 5LGTA 1JU4A 3H3ZA 4QGLA 1LU2A 4S05A 3MVPA 3A4CA 1W9YA 2WFF3 3LSMA 2YZ4A 1Z77A 1ZBA1 3TBIA 1MKMA 5JI6A 4Q4ZF 1OQYA 3WF4A 2M5WA 3VBFB 2BW8A 1RUD2 4FPFA 1RGSA 3WUCA 5FYUA 4A3BJ 3FK7A 3EUHC 4NWWA 3GDBA 4JX0A 3H0GJ 3AL5A 1A8MA 1WA4A 2DDUA 2HXIA 1VBE1 4QKFA 4CO8A 1JZ4A 3N9QA 2VOPA 1KDKA 1RUG1 5K7HA 4MFDA 3AC0A 5A3NA 1DIWA 5EG0B 5IT3A 5HDNA 1V6IA 3B3QE 3LDRA 5IT6A 2PFBA 3POYA 1LDDA 2KM2A 1IUYA 1T8IA 4Z82A 2YDEA 2LY2A 4G8XA 4P9GA 2QUOA 3UESA 5C3OA 5BOXA 2DA7A 1ZK8A 5LBCA 5IYDJ 4YFKF 1RMU1 1CVNA 2WB1A 2NYXA 2W92A 4COZA 2YC4A 3JD71 1E17A 1ST8A 5ACA1 1BC7C 1WCDJ 2BYVE 1G3WA 4E27A 4TZDA 4ASLA 5JPMB 4IE0A 4CUCA 3OYAA 4FPHA 1RUC1 4CU8A 5EV7A 3ZMOA 3VYRB 2P34A 2W9XA 3G6JB 3VUOA 1MMAA 2RDPA 3K10A 1L3JA 2EBIA 4XLEA 5G05L 3VBHC 3T4VA 2DMNA 2RS52 4IKFA 3L2CA 3FMQA 5FPZA 2BY2A 1JODA 2A69F 4BCUA 4HNTA 1YITI 1ORKA 4AR2A 4CCCA 2ZHLA 1W6OA 1OCCH 3GNEA 1IV8A 2IA2A 5CFDC 1GUUA 1LPQA 1C1LA 1MNDA 5FZ9A 1QU3A 3IDBB 5FFZA 2R041 1C28A 3ACGA 5LBQA 1XSRA 4BKXA 2H0BA 4ARYA 4OZXA 1RRJA 2CU5A 1TNSA 2HWF3 4RFRB 3OYIA 2QQVA 2JDAA 2DFEA 4XUTA 3ZYFA 1XXNA 5D6FA 3ABKH 3FXJA 5FPAA 4H7LA 2XF7A 2G9WA 5KXEA 2WBMA 2MC4A 4ZPIA 4YG2F 3AG4H 1OOPA 3SH5A 2CGNA 1U6GA 4CCKA 2CQKA 3LGRA 1W6QB 5H2FC 3ONQA 4GXOA 4BK4A 4AF9A 3GFIA 5I93A 2CQ7A 1CIWA 1GOFA 3R61A 3CDZB 1AYN2 5FP7A 3IDCB 4FE4A 4XIOA 5D1IA 2OUJA 5JXHA 2ORZA 2W4SA 1DPRA 3THTA 5HNFA 3JB8A 4XK4A 1UFMA 2JA2A 1F15A 3X2QH 2V72A 3CP2A 2CUJA 2WNOA 2VOKA 3BR6A 2STWA 2FZ1A 1ND3B 2YU2A 4DW6A 2CUEA 5KXBA 2GA2A 4EJVA 5ANQA 1AYM2 4F52A 3GTJJ 4W50A 4YVSC 4NBQA 4L0YB 2O8KA 3UKGA 3UGFA 4A69C 2JTVA 5EZWA 1X82A 3IUOA 4OUSA 3CLQA 1FAYA 2MGQA 4UUSA 2AHQA 5IP9J 1ZZ9A 4CP2A 2BBAA 1YFXA 2BBYA 4K40A 2RM21 1C8M1 4KWKA 5FJHA 2PN5A 1SACA 1MW7A 2JDUA 2JQ7A 1U12A 3VDXA 4JGYC 3LZZA 3OYWB 3AK0A 2XOMA 1MBJA 3IAM2 2GXAA 3WNNA 4LBNA 2RMU2 2DLLA 3CJIB 2ZS6B 4NHJA 4XYXA 4XKWA 3HNMA 1ZKGA 4O9GA 3CCQI 3ZN6A 5FMCA 4DINB 1WLDA 2XAUA 3MIEA 3CCEI 1W04A 4HVOA 5KHDA 3VD9A 3ZP5A 3SXYA 5DDJ2 3EQLF 3FZVA 4HMZA 2HNHA 3BN6A 2XL9A 2O8OA 2E2JJ 3L09A 1J59A 1V5FA 2K85A 4OI2A 3RVHA 5JIAA 4GAZA 3IWZA 2ZGMA 1IG7A 1FY7A 3OB8A 3OYGA 2VUDA 1XSDA 1OLME 3HVDA 1IJWC 1K5MB 4N7IA 1LFPA 1W6NB 1OXCA 3JCIA 4NB5A 3SFIA 4HRIA 3K48A 4IEPA 1K7AA 5A70A 1NQDA 5DCFA 3ABMH 5D8KB 5EHDA 2FBKA 2WWYA 1OLQA 1R1A3 5FXWA 4Q8LA 2WY7Q 3ZIWA 4WCGA 1LFUP 3E7LA 2O3FA 2D45A 1D1BA 4KYWA 2HWE2 1UZCA 5FRAA 1JW6A 4V2FA 1QJZA 2E33A 3TW6A 1FPN1 2PG4A 4AU7A 2YC0A 4XIKA 3DCFA 3CCVI 2Q2EB 4KUMA 3AMHA 1O3TA 1V6LA 5GLTA 3FXMA 1POV3 4B09A 4YZ3A 2JK3A 4M6YA 2FE3A 1UQXA 2HJIA 3BY6A 1R091 2VBXA 2O1QA 4HVQA 2VD7A 3PVEA 3TDUC 2BW3B 2I5UA 3GXOA 2STTA 1UXXX 3GXUA 2E1CA 3RSJA 1TW2A 5LLQA 1Y9MA 1YYNA 2P6TA 3HOZJ 4Q0SA 3AZXA 2BV4A 1S0DA 4ZDOA 2ZZQA 2WTEA 3NAPA 2EIEA 1DGWA 2DTRA 3Q8BA 3OYNA 3LSTA 1KA8A 1ENXA 1JT6A 1YFWA 4BU2A 3ZXJA 4PQ9A 2A6HF 3ZVXA 1RUH2 1NYWA 4AQ2A 4B4RA 1ZBE2 4Z6YA 4UB8C 3AG1H 3VODA 1OR7A 3WUDA 1NY71 4CU9A 4KNYA 4IERA 2Z9OA 3U1XA 4NAMA 2G7UA 4BBSJ 3C7EA 4HOOA 3RQIA 4AIHA 1CONA 3CMEI 2CU7A 2EZIA 2YC2A 3A03A 3PNYA 1T0FC 3SH3A 4LOSA 3CJNA 2OJED 3ESWB 4Y7NJ 2X5IC 4LGWA 3WD5A 1AR92 4UNOA 4AVAA 3H8RA 4XJUA 4C30A 4NRPA 5C3EJ 3I59B 2J22A 1YYVA 4WVVA 3N9NA 5J98B 4HKLA 1M06G 4G9SB 3HEFA 3QYBA 1OD3A 3P9KA 1S0GA 2SBAA 4BE1A 1RUF1 5F6LB 3K4NA 3ON7A 5IY5H 4META 4EWEA 1OA2A 4GMP3 4V19K 1MZ6A 1CGPA 2O8XA 3W21A 1VR3A 1NT0A 5CU1A 4OMYA 4XJ8A 5A2QZ 1IZ1A 4S2HA 3R0AA 3ZMDA 5HXVA 5JR7B 1OA4A 1DG6A 2D6NA 4R9BA 2IFWA 4RDUA 5CG8A 5E1ZB 3WHTA 2OF7A 1L0OC 1CAVA 3WF3A 5LA9A 1HDPA 2ARXA 3WNOA 1TVGA 4HNVA 2GQQA 3DPRB 3BG7A 2LREA 1GV9A 4CP9A 2KL4A 1AKHB 3W6KB 1Z7LA 3SCHA 5CBLA 1GR3A 4FCYA 5DUXA 3F8FA 3HUGB 5DDJ3 4A3FJ 2QZ8A 5L9VA 4NPRA 4Q29A 1R5GA 1P4AA 2B9VA 3VB2A 3GBGA 2VQ0A 1YG2A 2CHHA 2WAQA 2ZGKA 2WLPA 2YFZA 5BYNA 1OKQA 4DQAA 5KAIC 3GLLA 3AXEA 2XPWA 3FMSA 3RZDJ 4BQQA 4OAYA 4QPGB 1F43A 3K75B 4AWXB 4EQQA 2FBIA