3FWEA

Crystal structure of the apo d138l cap mutant
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
202
structure length
202
Chain Sequence
QTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLLVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Structure of apo-CAP reveals that large conformational changes are necessary for DNA binding
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transcription regulator
total genus 56
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fweA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3fweA01
4GO1A 3GFLA 2LSOA 1ZLKA 1ZRFA 3L00A 5TRDA 3K0LA 2PAEA 4UV9A 3RYKA 2K0GA 1F9NA 1G3YA 3CO2A 5LRRA 3WW3A 4LLOA 3R0JA 3C3WA 4LD5A 4A0YA 4XF9A 3SCHA 4QWQA 2V79A 2C6YA 5FCCA 1SFXA 1YFYA 3LAJA 5AVPA 2JTVA 2L4AA 4A6EA 3EQLF 4Q0PA 2PMHA 3E5UA 2IW5A 2UY8A 1YG2A 4YIIA 2RC4A 2XV4S 2E7WA 4LLGF 3J81Z 3KLOA 3LA3A 5CADA 1T2KA 1XSDA 2O0YA 4ZYDA 2UY9A 5FGMA 4NVPA 5BY5A 2WWYA 3F23A 1TNTA 4BXUA 4P9FA 2MPFA 2E1CA 3LA2A 1WA4A 1BOAA 3ES1A 2P17A 4CO8A 1JUHA 3MZYA 4XLNF 4U7DA 2O8XA 1O3TA 5JSPA 4XFBA 1O57A 3C18A 4ESJA 4WXCA 5LHIA 3C1DA 1B9MA 2BNNA 4J1WA 2WC2A 3JSPA 2VODA 4L2NA 3CJNA 1PM7A 2X4HA 3I7DA 2P5KA 2A07F 3EQEA 4BH9A 4KIGA 1Q43A 1MD0A 3DL3A 2C0ZA 4MGYE 5JAXA 5BPDA 2M45A 4META 4FAHA 3EHKA 2VBXA 4BYYA 2ETEA 2WFPA 3FZVA 4P5OA 2OA4A 2IA0A 3HHGA 4HLXA 1OKRA 4YRDA 1K6OA 4LMYA 2P6SA 2NRAC 4GULA 4I2OA 1XE7A 4Z2YA 4IEVA 4LUMA 2EV6A 2D1HA 4ENMA 3TNQA 2H27A 4CZZA 4EM0B 4EGZA 4RB0A 5ILSA 4NHJA 1YW8A 5FLXK 2NNNA 1SFUA 3GEZA 3W6JB 1OR7A 2OAZA 1J3QA 2ZFWA 3SXYA 4GXOA 1LQ1A 1L0OC 1R5GA 2A5YB 2GA2A 3JSOA 4QMAA 1YLFA 4ZYGA 1V4RA 4I7HA 4KN4X 1DP7P 3ROUA 4B09A 1Y9QA 5I0TA 2QJVA 3JW4A 2PTMA 4RB3C 4L0ZB 3WODF 2E7XA 4M73A 4MX3A 2PFBA 3HRMA 4ETSA 5JVTA 2QENA 1MZBA 4LG0B 4AQ6A 2B0LA 2P8TA 5CYVA 1IRGA 2GC2A 4IXAA 5JR7B 5I8TA 1R1UA 3IKVA 2HJIA 1LEBA 4AIHA 3NKTA 1BM9A 1R1TA 2BE5F 3QP5A 1CF7A 4WVZA 4ESFA 3TGNA 2XAFA 2BV6A 2QQAA 4WXDA 1H0MA 3VEPA 1T38A 4KYWA 1EH6A 4CXFA 1TLHB 2WTEA 2PAMA 3FMRA 1IN8A 1UIKA 4IESA 4JTNA 4JV4A 3UKTA 1Z6RA 3WTVC 4MQVA 1I5ZA 2FBIA 2VE8A 1J75A 3ULQB 1AWCA 2STWA 5BPIA 5I0RA 2OZUA 5H6QA 4WK8F 4ZYEA 1XSXA 5LLQA 3IKTA 3D82A 1EYBA 2KIMA 1PMIA 1I27A 3FXQA 3R61A 1U12A 3SCGA 1DPUA 3RKYA 4R1HA 5T3NA 5FLXZ 2XUBA 2JZYA 2RV8A 4PJYA 5HS7A 4EM1A 3GXOA 5ICEA 3B02A 1UFMA 2MC3A 2VBWA 2XVCA 2JRTA 4EJTA 3KLNA 3TKYA 3O2PE 1K79A 1EV7A 4M6YA 1P2FA 2DCTA 3WE2A 1B59A 3D0SA 1HBXG 4OOIA 3GYDA 4IEWA 1UCRA 1W7PD 5HOOA 1FLIA 3IRQA 1W4MA 2PQ8A 1IPJA 3FFQA 1U5TC 2F5FA 3RYPA 5HLGA 5CU1A 3J80K 4LG0A 1YUDA 1TQMA 2GIVA 3EYIA 3MQ0A 3J7AO 3SQNA 4HOBA 1O3QA 4FHTA 3V4GA 4IEZA 4OINF 1P4XA 4IEYA 2ISZA 3WTUC 3QPHA 1KU3A 1KYZA 3F22A 1Y3TA 3M1EA 2EVXA 3DP7A 3HT1A 4CDGA 1XCVA 2ZBKA 4E2SA 2VQAA 4H0EA 1YLLA 4XFIA 3MZHA 1IN6A 1BBYA 3F21A 1FYMA 1KU7A 2M5WA 4J1XA 3ABUA 3HYIA 1IN4A 3R60A 1USSA 3F8BA 3F8NA 1Z1DA 1DGWA 3CEWA 4LK0F 2XL9A 3GFIA 2F2EA 2K4BA 1KA8A 2ISYA 1R7JA 1OFNA 3ES4A 2BNOA 3JTHA 4IERA 3H50A 1H9GA 4WXHA 2OA2A 2O3FA 2P7CB 4LUKA 1XCBA 1O3RA 2P5VA 5H6RA 5FQ0B 3CLOA 4HDUA 1FYKA 2TDXA 2CW0F 2CGPA 1TQIA 2ZNZA 4M9SA 2H6CA 1SEFA 4P55A 5ERIA 3U11A 1SD5A 2LNBA 2IA1A 1YYVA 4HX4A 2FA5A 3ACLA 3J80Z 4XFFA 4MGRA 4RD7A 3I5UA 3FF5A 3TOBA 3BWGA 3TO7A 2XASA 4HV6A 1E17A 1SAXA 4QGNA 1RUOA 3VODA 2OPKA 3KP7A 2ZMEB 2ETHA 3IBMA 2KIUA 4CICA 1S7AA 1R22A 2EA4A 1J59A 5TJJA 4G6DA 4K2EA 2IRFG 4X6QB 4I3PA 4HN0A 1YQAA 1CAVA 1ZYRF 2UXNA 1HKTA 2CQKA 3L2CA 2PHDA 3CF6E 2RQPA 4RGUA 3BJOA 1NE4A 1MDMB 1A04A 1D5VA 2MD5A 5E16A 4CYDA 3FWEA 2JSCA 2P4WA 1TW2A 3WG9A 3OCPA 2K86A 4UV8A 1HW1A 3QRFF 4O3MA 4CHUA 4LLNA 5DD4A 5HVQC 5E1ZB 1ZN2A 3QOPA 4BQAA 3WTXC 3HT2A 1BC7C 4AWXB 3F8CA 3ECHA 3OGJA 2BGCA 3OF1A 4JQFA 1TW3A 5FQ0A 4IETA 4LLLA 2MH2A 4EWAA 1O7FA 3KGLA 1IN5A 3E97A 3KFWX 1FT9A 3KMHA 5DEQA 3WGHA 2HYGD 1USTA 3QU6A 4A5MA 2XAHA 3V8LA 3NW4A 2OYZA 1FSEA 4UXAA 3T5XA 4XFHA 1LRHA 2H0VA 1IN7A 1FZPB 1FYLA 3CJXA 1WLTA 3JZVA 1D8JA 4R52A 3GYHX 5L3EA 5BMZA 1RC6A 1O5UA 4GGGA 5C8WA 4KT5C 4BHBA 2ZMEA 3KETA 5HDNA 4F7ZA 1ZRRA 4Y17A 1U2WA 3R4KA 5DCMB 1DGRA 2OU2A 4P9UA 1AOYA 1W7PB 3I0TA 1ZH5A 2PQQA 2FRHA 4UUVA 3C7JA 1ZHFA 1SD4A 4L9VA 4XSZF 1I1GA 2FF4A 5BV6A 2FNAA 2CV6A 2YX7A 4M71A 1IF1A 4KWKA 4OFGA 2R7DA 3W6KB 1MDMA 2COMA 2MBFA 1S6LA 5HI0A 1XGNA 3GX4X 4FX0A 2ACJA 4KIBA 4KL1A 3BP8A 3U10A 5EZWA 1SMYF 1XDUA 4EWEA 1G4DA 1O5LA 2Q4SA 2RVCA 5FLHA 3RPQA 2OQGA 5KHIA 2IJLA 2LKPA 3ZQ7A 1SD6A 2EAAA 3AAFA 1ZZBA 2JPCA 1STZA 3ECOA 5DDGA 2MLKA 1WI9A 4Y15A 1HXDA 2XLFA 1WWXA 3R6SA 2IXJA 2FXAA 3BPXA 4M9ZA 1J1LA 3C3VA 1YW7A 1T0FA 3T0YA 4ENKA 1I1SA 4O6JA 3WW2A 1ZGJA 3I54A 3TQNA 1FI2A 1YO5C 5E17F 2OD5A 1T39A 4HF0A 1U5TB 3HOTA 5JI6A 1L3LA 3S7EA 4XETA 4UBHA 2DT5A 4ONUA 2D93A 2FQ3A 5KHKA 1D8KA 4YIFA 1HKQA 5D1IA 4EJOA 3BY6A 4RGRA 4XSXF 3P7NA 4ZU4A 1YFUA 2N7GA 1OD5A 1LDDA 3NVCA 4WWCA 2PYTA 2M87A 3RPUA 4BAYA 5L3GA 4EQQA 1BIBA 3K69A 2GU9A 5DCMA 1W7PA 4HVQA 2PMUA 3N4MA 1VP6A 5DCFA 3LWFA 5F64A 3E6MA 4HZFA 4EV0A 2IXHA 3LSTA 4Q5SF 3PFIA 3LA7A 5F1RA 4KN7X 1QXJA 5BXXA 2GXBA 4HVRA 3OD0A 5CLSA 5C6CA 4KA4A 2J5PA 2WV0A 5BOXA 1J5YA 1OYWA 3ISPA 4I0BA 4UNOA 3U1DA 5K5OA 4EVIA 3RTRA 5FPXA 5DD8A 4KICA 2FOKA 5CVJA 1YS7A 1FP2A 4MV2A 3KP4A 4ZYHA 2DFIA 2DPDA 4FX4A 3M8FA 4IRIA 2HWVA 5K1YA 2DLLA 2IPQX 4MGKE 2EFOA 1CAUB 1WKMA 3IWZA 4BIFA 3Q9VA 1BI3A 1QY4A 2W85A 2DU9A 1U5TA 1LR5A 5JR3A 3QPTA 2CAVA 1YHFA 4XF3A 4R79A 3DQVC 4L0YB 1UCXA 1FC3A 2UWMA 4KMUX 4QM8A 1MJAA 1FBSA 5D8LB 1Z7UA 3EYYA 5LEKA 3CDHA 3IWFA 1JHHA 3ABTA 2FBKA 1LKNA 3H3UA 2O61A 4NB5A 4U0YA 1FBUA 4XFCA 3WGIA 1XE8A 4U0VA 4PIZA 2CAUA 1CAWB 1X82A 2V09A 1UHMA 2FMLA 2VBYA 4IEXA 4OIOF 4ZH4F 4HBNA 2M1BA 4IEOA 5J8FA 3WU1B 3NSTA 2Q0OA 1RL3A 1G3WA 3S7IA 1DPRA 3ZP5A 2HFHA 4I09A 2W57A 3RYRA 3MWMA 5LRSA 4G7ZF 2AXLA 2VE9A 4AD9A 2G7UA 1P4AA 3I4PA 5J8CA 2RN7A 3H7YA 1LDKB 3P9IA 1G6NA 1K7AA 4YG2F 4XRFA 3MYXA 1WSUA 1JHFA 4BNCA 1QZZA 3ELKA 3RNSA 1IZ1A 2ZXJA 2HYFA 4OIRF 3GWZA 2Q1ZB 3HSRA 1ZG5A 4PIYA 1RI7A 4HN1A 2A3SA 4IJAA 2PI0A 3IDBB 4TV7A 1CAUA 1EP0A 1S7OA 2PA7A 4F8AA 3ML6A 4L9TA 1RTVA 4EJUA 1YFHA 5AIPA 5LHGA 3GZ5A 2ZO4A 5I8YA 4S05A 4RAYA 2EFQA 1LJ9A 3SZPA 3I59B 2IVMA 3DF8A 1SFEA 3PNAA 3FX3A 5HLHA 5L3CA 4PZJA 5BPXA 4HYEA 1XGSA 2Q2EA 4A0ZA 1YWKA 2STTA 1VR3A 2OBPA 3FMSA 2GWRA 2HTSA 2HQNA 1O7LA 3BOQA 4M74A 2DTRA 3G3ZA 3KZYA 3NQOA 2W25A 4HA8A 1J9IA 1IRFA 4GYIA 4ENJA 1FP1D 3EUHA 3TO6A 5DUIA 2VC0A 4CGZA 3LAPA 4WF2A 3VB2A 3LZZA 5HDKA 2V9VA 1JE8A 2HKXA 5D8KB 1LNWA 1J2XA 3ZMTA 4XFAA 5DYMA 1BC8C 1TBXA 5ED4A 4QGLA 2QYOA 4MTDA 4KU7A 1QGPA 4YFKF 2F5CA 4HDVA 4MEXF 3EJKA 5KVRA 1V3FA 4Q48A 2YPRA 3SZTA 2PFWA 4HMZA 3NL1A 1B6AA 1NYWA 1ZX5A 3I71A 4L5IA 1MJ9A 2DI3A 4HLTA 1T6SA 2PEXA 4AXOA 1U3EM 3GLXA 4Z82A 2O6GE 1ODDA 5CVUA 3HOSA 1EH8A 4Q0VA 1BI2A 2VN2A 3T1BA 3HIFA 3MCZA 5CJ9A 4MNUA 3COAC 2LF8A 4G6QA 4GCVA 4EWDA 4AQ2A 4O9GA 2PN6A 1DZRA 1PUEE 1GXQA 4MTEA 3HTSB 4K8FA 2W24A 4R8HA 2F4PA 3F72A 2UXXA 2EV0A 4ENNA 4DINB 1BN5A 3JTGA 4N0BA 3PVBB 3KZZA 1YS6A 3HRUA 2XAJA 4RAZA 4HAMA 4LB5A 1ZZ9A 1OYYA 2DK5A 2QDRA 3H8UA 3USSA 3WW1A 2XL7A 1FWZA 1VTNC 1U78A 3L9FA 2B8MA 4EJWA 4U7BA 2D45A 4IHSA 2FU4A 2GXGA 4Q4ZF 4XF1A 2B9UA 2ZCWA 1ZREA 4ZU5A 2PAKA 4FT8A 3LQQA 3SHFA 1HW5A 4HX7A 2P5LC 3TDZC 1VJ2A 2IP2A 1IPKA 3EBRA 4QLCU 5L3BA 3PQKA 5I8SA 1PDNC 2CG4A 2EJRA 5D5XB 4OMZA 5DV5A 1YTYA 4OU0A 3HTUA 2FNPA 3H92A 1ZG1A 4HW0A 1YFWA 1Q3EA 3CTAA 3FJSA 4MZUA 2VOPA 1WGPA 2H6BA 2JPBA 4WZCA 1R58A 5HS8A 2DBBA 3WTSC 3BDDA 3DPTA 5AIQA 2OZJA 2MHFA 2Z2SB 4LEJA 2P6TA 3VOEA 5D5UB 4HX8A 1RIOH 1U8RA 1HQCA 4HV5A 1SMTA 2ET7A 5KK1A 4JTOA 3HRTA 3H1WA 3BCWA 2D1VA 4PDKA 1X3UA 5BS6A 1YFXA 1E2XA 5D5VB 1XMAA 4I0AA 3V7CA 3IC7A 2HEOA 2QVOA 4IEPA 1ZZCA 2I45A 1S3JA 4XFGA 3L09A 4WCGA 5BUVA 2W84A 3ST7A 3GFJA 1DUXC 3M3IA 2A6HF 2QWWA 1ZARA 2MH9A 4YNIA 4D7SA 5F6FA 1LDJA 2E9QA 1G3SA 3K1PA 2V1UA 3G7DA 1Z05A 1X7NA 2IT0A 5FO5A 3IIAA 3JAMK 1KGSA 1D3YA 4DQ2A 2QUFA 4M6XA 4A0XA 4Z07A 3E5XA 3TNPB 4ON0A 2IC1A 1SQ4A 2GQQA 3O6BB 2QQ9A 5J3UA 3MDPA 5DUKA 2K9ZA 1QPMA 2L3DA 3B73A 5EEGA 3FHIB 1KYWA 3IL2A 5FB2A 2EK5A 3NJZA 4E70A 1MJBA 1R00A 3O3KA 2H09A 3MFKA 5ILVA 4MEYF 2QZ8A 2V6CA 3UKNA 4Y13A 2V1XA 1BJAA 1IAWA 1ZRCA 4Q47A 1TQ5A 4ZZDA 1K78B 3P9CA 1J0RA 2NAZA 1F5TA 1S29A 3RI4A 3O14A 2VT2A 3ZMDA 2A6EF 4P9GA 3BPVA 1G3TA 4MUVA 3H7JA 2O03A 3WTWC 4LTAA 5FLIA 1P6RA 4IVNA 1GXPA 2XKOA 4M9XA 5D4SA 2IA2A 4EJVA 1KQ0A 3GW2A 1Q1HA 2KKOA 1XMKA 4M72A 2V1DA 2QBYB 3DEUA 2YU3A 3OV8A 1ON2A 4WX9A 4RGSA 3F8MA 4B29A 4G94A 2RDPA 3CO6C 2Y48A 1C0WA 5E8GA 3F6OA 1UB9A 4L9NA 5KHGA 3M9AA 1LB2A 4YSFA 3FZ3A 4IPAA 3DV8A 1JGSA 3WGGA 3U9GA 1RUNA 1WQ2A 1MKMA 3WTZA 4EM2A 3FM5A 4QGMA 4LB6B 2HKOA 1DZTA 1KU9A 3NEUA 3RIRA 4AIKA 4MGZE 4KDPA 4MHGA 4MGIE 1S8NA 5BQTA 3KEOA 2Z99A 1P92A 3I58A 4ESBA 2MLGA 2K02A 3HHHA 1KQ9A 1W5TA 2DO7A 2ESHA 2K4JA 2QCSB 3BJAA 2Q30A 2K27A 1NE6A 2VOOA 3JAMZ 4I01A 4L11A 1NHAA 4HQMA 2GAUA 4ZU7A 3FE5A 3IDCB 5E1XA 1W5SA 4LJZF 4FBFA 3DXJF 1XGOA 2CFXA 3F3XA 3CLPA 3LQRA 1CX4A 3MPBA 2O8QA 3CO7C 4DNCA 5FDBA 1FY7A 4HBLA 4YFXF 3IRRA 3LOIA 3E5QA 2ZKZA 1YIOA 5D6FA 5K5RA 1K78A 2ZKLA 3CUQC 1EPZA 3ZMUA 2ATFA 4UVBA 1NZCA 5I0SA 3BB6A 2X0LA 2D5HA 1ZRDA 5FFZA 2Y0MA 4HF1A 4MH0E 4RGXA 3DN7A 4H7LA 1EY2A 1I6XA 1REPC 3LWCA 1CF7B 2UZKA 2RKHA 4PGHA 3I53A 2QBYA 1V70A 3OOPA 3EETA 2DQLA 4G9YA 3M70A 5J7MA 3E3VA 1ONVA 3E6BA 3FXUA 4A12A 5HLIA 4A6DA 3KP3A 2ESNA 1ZVFA 5EFUA 3MAJA 1FSHA 2IXLA 1H1MA 5LHHA 2HGCA 1OMIA 3F6VA 2XGXA 2Z33A 1O3SA 1UD1A 4UVAA 3M7GA 1HSTA 4IF4A 3HQXA 4ORFA 2GZWA 4Q0QA 4HSJA 3SHRA 3I64A 1CGPA 2KIFA 4Q0UA 2MA3A 2GC0A 4OMYA 4XBFA 3V7SA 5E18F 3FMQA 1IW7F 5E20A 1IUYA 1KQ8A 3QP6A 3FM3A 3IHUA 2DAOA 2UYBA 3LFKA 4GYGA 1QQIA 4O9EA 2VT3A 2CYYA 2FQPA 2Y0OA 2ET1A 2E1NA 1TNSA 1GQHA 1IXCA 4XEZA 2FSWA 2J5OA 3FHZA 4KNYA 1XDSA 3ZPLA 1WRJA 2A68F 1ULYA 1JXSA 4AVPA 1X8MA 4HLYA 2BYVE 3GFMA 3D5LA 1X8EA 5CVRA 1DDNA 5D6EA 2FMYA 3GVAA 1QXRA 4E2GA 2IXIA 4OIPF 5J48A 2F5DA 2L02A 1XGMA 3QAHA 4A5NA 5I91A 3R0AA 3KP5A 4IEUA 3UKVA 2A69F 1XB4A 4LULA 5LGNA 1SFNA 4P96A 3ELNA 1OYIA 2Z69A 2IXCA 2G9WA 3RZZA 3RKXA 5FPZA 3PLQA 4E2QA 5L3FA 1RGSA 2VBZA 3GO5A 3G73A 3EO6A 4S04A 4Q0SA 4LA2A 2K7LA 2EB7A 3VFZA 5LGTA 1ZG3A 4QM9A 1XN7A 3H3ZA 4IRGA 4FAGA 3TO9A 3KGZA 4LA3A 1TTYA 3REOA 2D40A 2DPUA 5HS9A 3KP2A 2KXLA 4U88A 5D4RA 4G7HF 3SFZA 4OLLA 4O5VA 5JFRA 2PHLA 4UXNA 5LBQA 3ETQA 2ZJ2A 3RDIA 3DPLC 4IHTA 2VECA 4AVCA 2AS5F 1KU2A 3GUDA 4AIJA 2KJCA 4TLFA 4IRHA 2XKPA 1RZ4A 4EROA 2BEOA 4YFNF 1LEAA 2NS0A 2ELHA 1IXSB 3K1MA 5ICGA 4PGGA 4EMSA 4B8XA 2CO5A 5K8SA 4KIFA 5E1RA 4PIXA 1B9NA 5IT9K 2VPVA 2HQRA 2HZTA 1UPIA 5JSRA 4JK1X 1CAWA 1HW2A 2H94A 5JCTA 2L01A 2DQRA 3E6DA 3WW4A 1ZGAA 1T98A 3U2RA 2GC3A 2XLAA 4L18B 3MEXA 3BZ6A 2P7VB 1U6GA 3V8JA 4KFCA 5E1WA 3ZDSA 1P4WA 3LAGA 3VHRA 2NNYA 1ZLJA 3V7RA 3KE2A 1CAXB 2O1QA 1J3PA 1F4KA 3V8KA 3WTYC 3Q5FA 4UHTA 4QXKA 5JHUA 4HQEA 1OI6A 4G7OF 3KCCA 1XD7A 4HF2A 4HSLA 2L4MA 2HDCA 2PJPA 1B4AA 1RNLA 2QLZA 4MQ9F 2D2WA 2YR2A 1CAVB 2L54A 3CUOA 5CVIA 1R36A 2R3SA 1H1IA 1XRUA 5I93A 1Z6TA 2EA7A 3ZMSA 2HTJA 4D7TA 5A2QK 2Z3YA 2XRNA 3SCFA 3QACA 4JBAA 3WE3A 5K5QA 4RB2C 4XLPF 5ICCA 1UW8A 3PQJA 2XLGA 4KWLA 3H1MA 2ZNYA 3KP6A 1QO0D 1PP7U 5ILUA 2PLYA 5H20A 1FOKA 2PBIA 1YW9A 3TDUC 2PG4A 2MNGA 1HSJA 5CVVA 1B1BA 3I59A 1ON1A 4KU8A 2Y75A 3ZN1A 4KUMA 4LGWA 2VXZA 4EGYA 3GZ6A 4N9IA 3N97A 4WBBA 2RNJA 2XAQA 2R7FA 2CWEA 1QZYA 4D0PA 2M30A 4KWJA 3OTFA 2QVSB 3E6CC 3U0ZA 2EV5A 5IT9Z 3SMHA 4N9HA 2CSOA 5J6XA 2IXKA 5L3DA 6PAXA 4BHCA 3BU7A 2FE3A 3CUQB 1HKSA 3BJ6A 4U0WA 2D5FA 5FD6A 1H9TA 3H9AA 2BNMA 2DK8A 4OIQF 2VONA 2G7HA 2EA2A 1PP8F 2B5HA 2M8EA 1SD7A 5FD5A 2VC1A 1CAXA 1GHCA 3SXWA 2Z9OA 3T8RA 4UVCA 1J58A 1ZAOA 2LF7A 3ZN0A 1R23A 4I98B 5KHHA 4ZZLA 1O4TA 3L7WA 4BHPA 4AVBA 4RS8A 2QQBA 1R5HA 3DKWA 3M8EA 3K1NA 5JSOA 1R1VA 4IEQA 3T8TA 3ZMVA 1Z9CA 2EWNA 3WU0A 5A2QZ 2NYXA 3GF2A 5ICFA 3P9KA 2QNKA 1BIAA 1IXRC 3S0MA 4Q29A 3L2HA 1TQPA 2GC1A 1ZZ8A 3BPZA 4NQWA 2XIGA 4KMFA 1J7KA 2YX4A 2DW4A 2XROA 5AONA 2KJBA 5FLJA 1QBJA 1FX7A 2EFNA 2Q8KA 5E8IA 5LEJA 1EH7A 1GQGA 2XAGA 3BALA 1GVJA 3DFGA 1L3JA 1Q5OA 3Q9SA 2Q0AA 1UIJA 1Z91A 3K9TA 3HSFA 2QM3A 1OPCA 2LDUA 1FBQA 4AVAA 2OQRA 4XF0A 3EDPA 1FXZA 1BI1A 3WTTC 1XSVA 3HRSA 2EFWA 1QNTA 4ASNA 2FBHA 2EFPA 5D5WB 4JVAA 5EEHA 3D0JA 2KRFA 3HSEA 4L5JA 4RB1A 2YSRA 1MGTA 3BROA 3CUQA 1FPQA 3HUGA 3S2WA 3QU3A 3J81K 4A2UA 2F5EA 5I0UA 2BBYA 4UBGA 5FFXA 3KSCA 3F8FA 4L9JA 3RJPA 1NXMA 4YYOA 3ERED 2GH2A 2A61A 3KEQA 5KBFA 4LK1F 4PCQA 3RKWA 2OZ6A 5IT3A 2ADUA 4YARA 5LGUA 3K2ZA 1F1ZA 2RGVA 2HOEA 1QWRA 2FEZA 1Y0UA 3GBFA 2Z5UA 5KHJA 1UHWA 1ZNPA 1FNNA 2HS5A 4QX5A 2HR3A 2GA1A 4LFUA 1J3RA 4HVOA 2XHKA 4I02A 2JT1A 3TOAA 4X6RB 3CL1A 3NRVA 1BI0A 3H1YA 1ZZ7A 3ZMZA 4XF4A 3FXRA 1LVAA 1ZZ6A 4G8XA 2UYAA 5HDGA
chains in the Genus database with same CATH superfamily
3PVEA 2E71A 1VZ0A 3WP3A 4ATFA 3K4LA 3GFLA 1OD3A 4GB31 3ILFA 4CTEA 2FDFA 3RS6A 5DAXA 2K0GA 1HLCA 5FYYA 2CNAA 1G3YA 1O8SA 3CO2A 5M5WJ 1E57A 3C3WA 5IP7J 1WPKA 1YFYA 4QX0A 2L4AA 4A6EA 3EQLF 3POBA 1UHSA 2ZB9A 1UKGA 5JZGB 5J47A 2E7WA 4BOWA 5ACA2 3OPTA 5CADA 5F04A 3LEMA 2O0YA 1OPMA 1WJFA 2UY9A 3JUUA 4LPLA 1W06A 1QNYA 4NVPA 3LSPA 1Z78A 3Q8BA 2WINB 3OIPA 2JJ7A 1P8JA 3F23A 4P9FA 3VBSB 2E1CA 2ERFA 5IHRA 2WNVB 4Z6YA 4U7DA 3VWBA 3M4FA 3K4BA 1VIWB 2DA2A 3TWIA 2V7FA 4DGWB 4CPBD 3UR3C 2E2HJ 4CDWC 4B3NA 2ZXQA 1PIV2 5L9RA 4FO9A 3JSPA 2VODA 1U5XA 3ZFEC 4JKKA 3EQEA 3OUHA 4BH9A 1Q43A 1MD0A 5BPDA 2EZKA 1ULDA 4Q2FA 4K20A 2RJLA 4CP9A 2VBXA 1FPN2 2LP0A 4XQDA 3FUQA 2WFPA 3FZVA 1ZBE1 4B48A 2OTJI 2MEV3 2HYJA 4HLXA 4IXLA 4YRDA 1K6OA 4LMYA 4GULA 4V19K 3IH4A 2W1QA 4LO6B 3BVCA 2M34A 4IEVA 1GOGA 4P9XA 5LWBA 2R92J 3KEYA 1RKWA 5M3MJ 1UZ0A 3WNNA 5ILSA 1YW8A 1SFUA 3GEZA 3W6JB 5F0HA 2ZFWA 2RS52 3D4KA 3UV9A 1ZK8A 2LKSA 1OUSA 4PT6A 2GA2A 2Y9YA 1V4RA 1WCDJ 4I7HA 1T0FC 2E35A 4X8NA 1XNTA 1UX6A 1MS4A 2PTMA 1W8NA 4QPGB 3WODF 2E7XA 2E2IJ 4MX3A 1HDDC 2QENA 3CCMI 4I30A 1SBFA 2B63J 1G9CA 3UNPA 3OSDA 2P8TA 3R4DB 3VUOA 3AL0C 1SG3A 5FZBA 5I8TA 1R093 2WA3A 3OS1A 4BXXJ 3J8F1 3N7LA 4RS5A 2Y9ZA 1CF7A 3ENRA 2XAFA 2ECBA 4WXDA 2BWAA 2E60A 1WWYA 3VEPA 1SVMA 2ZXWH 1R71A 1U5YA 1A31A 5FIXA 4CDQB 2WTEA 2PAMA 3FLTA 5AC91 1UIKA 4IESA 1Q8PA 1DBNA 3CNAA 3I4IA 4OMCA 3OGRA 3ZMNA 1Y43B 4NOTA 1W8FA 1OFSA 1Z6RA 3WTVC 2WS91 4E7IA 2ZPXA 4FQ4A 2STWA 3H9GA 4L0PA 4U87A 4NHYA 1H89C 2OTLI 1IS3A 3VZNA 4EN9B 1PMIA 1I27A 2BOLA 1IDYA 5FTTC 3FXLA 2FZ2A 4ZS2A 3ZQHA 3RKYA 5T3NA 3HPGA 5FLXZ 4W50A 2JZYA 1JUPA 4PJYA 4CH7A 4EM1A 5ICEA 3ZXJA 2MC3A 2D3SA 2WAQA 4G3YC 3KLNA 3TKYA 2WAAA 4QDRA 3ZN5A 3O2PE 3GGLA 3C2GA 4GDFA 3RPUD 3NKGA 1AR93 4YGDA 1MBJA 2XAUA 3WE2A 4MXWA 4HEA2 4BMBA 2YC4A 4IEWA 2VUJA 1UCRA 1GNHA 1W7PD 2Z4FA 3IDAA 2XPJA 5BNNA 1R081 1W4MA 2EIJH 5CU1A 2E36A 3J80K 2GIVA 1BL0A 2E63A 2GNTA 3TN91 3CCEI 3SQNA 1GVDA 2DBNA 4OUSA 3Q0WA 1BZWA 5JMOA 4FHTA 3RCOA 5CBLA 2HWB1 2DOFA 3TW6A 4QHZA 3JR9A 4IEYA 4YFWA 5J98B 2DU0A 2I5UA 3WTUC 3VBHC 3QPHA 3HEIA 1KU3A 3MZ8A 1KYZA 3F22A 2Q1MA 2L7ZA 3QH6A 4E2SA 1QH6A 4Q4V3 1EAH2 2KFDA 3I8TA 3BTZA 5L36A 3DTKA 1AR63 2J22A 4XFIA 2R49A 3H9JA 1JZ3A 5FREA 3WP4A 3I2KA 1VMFA 3F21A 1FYMA 3L1PA 1KU7A 2L9NA 3ABUA 3HYIA 1OPOA 1QJX2 3TP0A 1Y8RB 3V65A 1E3HA 4LK0F 1KA8A 1R7JA 2HBTA 4FPYA 4IERA 3PL0A 1H9GA 2OA2A 3EYPA 2HWD3 1W36C 1ND2C 1XXNA 2RMU1 1REEA 3VDDC 4F3QA 1EA3A 4E9KA 5H6RA 2Y26A 5FQ0B 4HDUA 5C7GA 5D8AB 3QH7A 1FYKA 1OUXA 3ZPYA 1RUG2 3ACHA 4Q4Y3 3OYKA 3U11A 5FR3A 1F2NA 2E7QA 2IA1A 3WF2A 3LNQA 2KP6A 3SZGA 3BWGA 1RUD3 1H8TA 2FD5A 3EUKL 2O8KA 1SAXA 5K4LA 3VODA 2OPKA 2ZMKA 1QVTA 1DQ5A 4PFPA 1Y0NA 3HNMA 1MBEA 3OYFA 5DXDA 5B4XA 4LR4A 4CICA 1COV3 1QJY1 5ABJA 2DURA 1QJZA 3QPLA 5DDJ1 2IRFG 4C2TA 3EUHC 4X6QB 4I3PA 4YPJA 5FYTA 3POIA 1W36D 1QQP3 1IS6A 1RETA 3L2CA 4AR2A 1G9DA 3FC0A 5C8CB 2YROA 5CFCB 4CDXB 2YC2A 4A3XA 2VLAA 2K86A 1MMGA 4CHUA 4LLNA 5FBZA 1RESA 3DKXA 4LK7A 1SDWA 1DP0A 4Y20A 1ZN2A 1BHGA 2RR11 2NXNB 4C90A 1BBT3 5IT6A 4P9IA 4OI0A 5M5YJ 3GTLJ 1SHWB 4IETA 3PSFA 2MH2A 3E97A 1FT9A 3RGBA 1PGSA 1CPMA 2VTFA 3B94A 5EF6A 1LFUP 1SPPB 2W5FA 1H2NA 2GN7A 2FCTA 3M3QA 4XFHA 1LRHA 2A6XA 3D1NI 1WLTA 5H9SA 3MIBA 1JZ4A 5FYBA 4R52A 5L3EA 5BMZA 4PI2A 1RC6A 3W6VA 2RDSA 4GGGA 1VBE1 3K46A 4AIDA 1AYM1 4KT5C 4BHBA 5F3GA 5HDNA 3PM1A 4F7ZA 1ZRRA 2XJSA 4Y17A 2FCVA 1YITI 1N47A 4P9UA 4QKBA 2V26A 3I0TA 1AX2A 4JQRA 2FRHA 1WBFA 3OY9A 1OKQA 3IDEA 4UUVA 3WVJA 4EZ4A 3WDUA 3C7JA 1ZHFA 1SD4A 4L9VA 4BE2A 3CC4I 3J7NA 4M71A 3QD6A 4OFGA 5IVEA 1MMNA 3R0RA 4MGTA 4I3GA 2CFOA 5FZAA 3RMYA 2CS3A 2R061 4KIBA 4KL1A 4ZYAA 3BP8A 5EZWA 5J4VA 1PUFA 4Q4X3 4EWEA 1G4DA 3AYEA 1O5LA 2QFEA 1WHUA 2DA6A 3FXMA 3OYAA 2OQGA 2IJLA 2EAAA 1UY4A 2V4JC 4WVMA 2F6CA 1RMU1 2JPCA 3ECOA 5DDGA 1VQ5I 2JDUA 4Y15A 1UY3A 2ZHLA 4ARXA 1XPXA 1WWXA 4QPQA 3R6SA 2FXAA 4HSRA 2IXJA 4M9ZA 2ARAA 1PIV3 1UF2C 1F31A 3JRBA 3T0YA 5EG0A 1ND3A 4MVTA 2BZDA 1NY71 2I74A 3TQNA 5LW9A 4UYBA 2JDHA 1R1A2 4V2VA 5E17F 2XWBB 1T39A 2J1SA 2BW8A 5JI6A 3GZUC 3S7EA 3RZGA 2DT5A 5FJ8J 1HQNA 5KHKA 2VGDA 3PIJA 4X8PA 2EAKA 1D8KA 4QTRA 2AYHA 4NRQA 3WNMA 4HPKB 4PDWA 1FPN3 2LALA 3N7JA 4LBQD 4ZU4A 3UKGA 1OD5A 1YXWA 3MPPG 1ENRA 3LPFA 1BIBA 1PK6C 3ZLIA 2GU9A 3G1LA 3JBG2 3I2DA 1F4AA 2PMUA 5FUNA 2JEMA 5FOBB 3BKZA 1Y9MA 2ZMEC 2JDMA 2VBBA 4JX5A 3E6MA 4EV0A 4CU7A 3LA7A 3JRCA 4I0WB 4CA9A 1OOPB 2Y8KA 5BXXA 4QX8A 1IGOA 3MD2A 1QJU1 2CRGA 3GM8A 3PL8A 3IB3A 4F52A 5C6CA 4UW4A 2DVBA 1IRXA 3DU6A 3ZYPA 3A0KA 2J5PA 5BOXA 1J5YA 1OYWA 2BVMA 1ENQA 4GXLA 1PVC2 5EJ3A 2R7ZJ 4UNOA 3B69A 3VD9A 4CP1A 5K5OA 3RTRA 3PTRB 3AP4A 2ZBJA 5A3WA 2E19A 1FP2A 2HYXA 3SISA 1V9U2 3VYRB 1LTEA 2JG8A 2DPDA 2XVLA 1W6PA 1POV3 2GMPA 4AF9A 3HOWJ 1ENSA 2ZZJA 3M3YJ 4URAA 4MGKE 3RZOJ 3PNVA 5HBAA 3WXPA 5ISLA 2J42A 1A6QA 1BI3A 2Y6LA 1QY4A 3IKWA 2M7BA 2DVFA 1AJKA 4XF3A 2BBVA 3RRDA 1BJQA 4OQ9A 2BOJA 2UWMA 2KISA 4R4XA 3HBLA 3VBFA 4BQXA 4IHVA 5EYRA 1IQAA 2QTWB 5GPAA 1FBSA 5D8LB 2PQSA 2X9DA 4NO4A 3I3LA 1U5IA 3ABTA 1O8PA 3L2YA 4QQLA 4AFDA 3IP4B 2EXHA 2WZPP 1YJLA 4XHXA 2WZR2 3VZMA 1BEV2 3WGIA 4PF1A 4U0VA 3WF0A 5JXHA 2BERA 5A33B 3LSJA 2ZTNA 1U0JA 2M1BA 4AUXA 4IEOA 3NJXA 4XDQA 1DPRA 4EYUA 5FWJA 5FZOA 1WJBA 5CG9A 2L7MP 3MWMA 5T50A 2RS11 2LROA 4QHOA 4PFOA 2WQ4A 5FP4A 3JB4C 4YVWC 3I4PA 2R041 5EZGA 2FDIA 4XLAA 1H8AC 3OYDA 2XPUA 1MBFA 3W59A 4YG2F 2W1UA 1WSUA 1JHFA 3ELKA 2WFF2 1KDMA 3RNSA 2K2SA 1E5RA 3NAPB 3OPZA 2HYFA 5A6ZA 4OIRF 3CQOA 1ETXA 1HF0A 3G4SI 1WUVA 3OYIA 1TZOA 1OCOH 2A3SA 3CLQA 1EAH3 3IDBB 2LBFA 4TV7A 2E32A 1EP0A 3ML6A 2D97A 1W39A 5A7QA 3GZ5A 1LECA 1V6LA 1X33A 1W0PA 4KG8A 3K4KA 3AM2A 3DF8A 4DZJA 1QJX3 2ZGTA 4D94A 1S9HA 2OIIA 5HLHA 5L3CA 5L7OB 5F37A 3W2VA 1IS4A 3H5NA 2HQNA 1RITA 3S8PA 4DXRA 1MS1A 4UW5A 2W25A 4HA8A 1WH5A 4LE3A 1HRI2 1VI0A 1HC8A 5B66C 2LVSA 4CGZA 1NX9A 4WF2A 4IO9F 4QB2A 5CKMA 4CUCA 5FRMA 2V9VA 5D8KB 2V4AA 1LNWA 3ZMTA 3WG7H 4IV1C 1RUG3 3UK9A 1TG7A 2GOXB 4RR3A 1IQDC 2V9KA 1H88C 2PHUA 2VG9A 1QU0A 5F9TA 4N43A 5KXEA 1N3QA 5A6XA 4RFRB 1VMHA 2VMIA 1SANA 1MJ9A 5JIAA 1T6SA 4AXOA 3V42A 3BIEA 1ETOA 2VTXJ 4DXSA 4X6AJ 3ZFFB 3D5RC 1ODDA 4M0HA 4Q0VA 3U78A 3T1BA 2VNRA 4TWTA 2NVTJ 1BQPA 1Y7BA 4MNUA 5E3MA 3COAC 4K8RB 4G6QA 3IAS2 1WZXA 4K7JA 5DG1A 4NPRA 2F4PA 3NARA 2UXXA 2EV0A 3DKQA 2A6TA 4N0BA 2EIDA 2RNGA 3PVBB 3KZZA 5JVVA 4MHRA 1YS6A 3HRUA 1OF3A 2DK5A 3H8UA 4QX7A 3USSA 5IW0A 9ANTA 1XNDA 4XC9A 2WAQN 1HCRA 1OCZH 4DJAA 1Z0HA 2B8MA 2D45A 3AYAA 3MGUA 5LFAA 5IK8A 2GXGA 4UT5A 2A5ZA 2X6YA 4BQ1A 2JKXA 1WMEA 2B9UA 2X85A 5HODA 2PAKA 2WNOA 4XDPA 3LQQA 1PO21 4XONA 1HW5A 1W8ZA 3EBRA 4GWJA 3PQKA 3LFIA 2EJRA 4COZA 5D5XB 3JCIA 4OMZA 2R0QC 1YTYA 2PMWB 2FNPA 1Q3EA 4GWIA 3POEA 1AVBA 5JPMB 2AC1A 3FJSA 4MZUA 3ZR6A 3NNJA 3OYEA 3ZSLA 3OY8A 1PZ7A 2RHPA 2UUZA 4FOWA 3DPTA 1LHWA 2P6TA 3W9AA 1S0DA 3AMHA 1JUSA 2W00A 2NOJB 1JJ8C 3Q0VA 3DTEA 4PQ9A 1V6NA 3BCWA 5T55A 1VLNA 3MBWA 4YWAA 4C0BA 2D1VA 4XILA 2MD0A 1AR82 4XKVA 5HXMA 2WAFA 1RIRA 4BE3A 4IEPA 1ZZCA 3OGGA 5BUVA 3KT1A 2W84A 2HBUA 1DUXC 4BU2A 3OOUA 1L7RA 3FN9A 1TEIA 4FPCA 5LA2A 3R4UA 4HT1T 3HKZA 1X3WB 1G3SA 3K1PA 2HOSA 3S15J 3JB8A 2J1UA 5GTHC 4CYCA 1REDA 3T4VA 4XUPA 2EBIA 1K4SA 3G7DA 1XNCA 3ZGKA 2IT0A 1KS5A 4E4DX 1LOGA 3DEEA 2H8WA 4DQ2A 2NVXJ 4JGYB 3EUAA 5C4WA 3CJTB 3O6BB 2DCJA 2CV1A 1W05A 3MDPA 1QPMA 3B73A 5FP7A 3VD4A 3MMYB 5JI7A 4E70A 1JOBA 1QOTA 5GLZA 5ILVA 2V6CA 2WRAA 1BJAA 4CDUB 1QKQA 3F95A 1SLIA 2LM3A 3P9CA 3WG3A 4COUA 3AZZA 3O14A 1S29A 3RI4A 5E89A 4YM3A 2A6EF 4FXGB 4P9GA 1VAVA 2EALA 1SCRA 2ZGNA 3BLYA 4M9XA 5CFCA 1VRBA 3QCWA 2DCYA 1Q1HA 2KKOA 3RQ4A 3N9LA 2V1DA 5C3SA 2QBYB 3DEUA 4BBRJ 3OV8A 3RSNA 1ON2A 4RGSA 2P4EA 5IY5H 2CDPA 3CO6C 4Y22B 3GHNA 1C0WA 3WG4A 3F6OA 2GMMA 3HL2A 1XX5A 2F4LA 4L9NA 3JBG3 3ZXLA 1LB2A 1I9RA 5KHGA 1H8VA 4QPOA 1MKMA 2HKOA 3MEPA 1KU9A 3RIRA 2XMLA 4AIKA 1W0TA 4KDPA 1SPPA 1S8NA 3EB7A 1DZQA 3VYSB 5EQUA 1VBD2 3T0AA 4GMP3 1I3HA 2MLGA 3VZLA 1KQ9A 1W5TA 2DO7A 1QGLA 4XLFA 2K4JA 4B1RA 2Q30A 1RUC3 4DYQA 5LATA 1L7QA 1PVC3 3N7KA 4ZU7A 3FE5A 4FBFA 5ACA1 2CFXA 3CLPA 2WO1A 3LQRA 3MPBA 3X29B 2O8QA 3CO7C 1V9U3 3CCRI 4HBLA 3N9MA 1JYVA 1IKQA 3IRRA 1OLTA 3E5QA 5T5JA 1YIOA 3I2HA 1A34A 1TT5B 2ZKLA 4N8MA 3ZMUA 4IE6A 3ETPA 5GZFA 5JI9A 2HWE1 2ZGOA 2R0HA 2WADA 1SFOJ 4MH0E 2LTNA 2W1WA 2SBAA 2LTPA 1REPC 3AVRA 3LWCA 3GCWA 1R49A 2DJIA 1C1LA 2UZKA 4Y4RA 3PMSA 4Y1YA 3J7HA 3E3VA 3FXUA 5GAGJ 1MEC3 1C5HA 4A6DA 4B44A 3LSRA 1NCRA 2YXSA 3MAJA 2VW2A 1XG1A 1FPN1 2BDRA 2XGXA 2Y30A 1CR7A 4RAFA 4HKWA 4ZHNA 1TE1B 1VQOI 1O3SA 4QX1A 1UD1A 2L7KA 2AUYA 4UVAA 4Y3OA 2GZWA 4HSJA 5EDNA 2MA3A 2GC0A 2AZ5A 5E18F 5E20A 2ZJPF 3WDVA 1IUYA 2RS51 3F9KA 4W65A 5DUXA 5JHFA 4CEWC 4CXXA 4NWVA 3LFKA 4O9EA 3DPUA 3CZJA 5IFPA 3GBWA 2R5ZB 1B35A 2E1NA 2VUMJ 2XRLA 4WV8A 1GICA 4XNFA 3L2UA 2WFF3 1LOFC 1T8IA 3FHZA 2GOMA 4Z2WA 5FLMJ 3H3LA 4B1MA 3PUQA 3CMYA 1JXSA 4AVPA 3FUOA 4II3A 4HLYA 3VV1A 3PVNA 4B7EA 3GFMA 1Y4WA 3POYA 1X8EA 3CQZJ 4C3HJ 5A3OA 1LENA 5CVRA 5E79C 3HMYA 3VKOA 3HD8B 5GZGA 4JDOA 5AFBA 4AEDC 4KNCA 2F5DA 5C70A 4A7ZA 1UQXA 2RJKA 5I91A 5FPUA 4BDZA 3WNLA 1OF4A 1CPNA 1X9TA 4M3CB 1BW5A 4P96A 1SFNA 3DXUA 1OYIA 2Z69A 2ZGSA 2W82A 4QPIB 1HRI3 1CZVA 2JMWA 5FPZA 3OYCA 4L97A 4QWNA 4DUWA 4CEYC 3USUB 2IEKA 5LZ6A 4S04A 2K7LA 3GNEA 1ZG3A 2DMQA 1T2XA 4D7YA 1XN7A 1XNAA 2P34A 3H3VK 1MH3A 5HS9A 3KP2A 2A3WA 3ASNH 1RR7A 5SV8A 3P6BA 4U88A 4G7HF 3SNMA 5JFRA 4YLZA 5LBQA 4PJLA 3ETQA 3TEZA 3DPLC 3PUSA 3RG0A 3GUDA 4AIJA 3S17J 3SH4A 3VKFC 4YFNF 2WNUA 2NS0A 1N1YA 4EMSA 4YGBA 3WDTA 2CO5A 3CIHA 4YVSB 1HKDA 3AMPA 2HQRA 3PUHA 1UN1A 4HK9A 5JSRA 5LBFA 1NG0A 1HW2A 4Y1XA 3BN6A 1T98A 2GC3A 1OCRH 4L18B 1XTAA 3BTJA 3BZ6A 3JQWA 3KV9A 5IJRA 3VHRA 4L99A 3KE2A 4GALA 1J3PA 2RS32 3PFYA 4Q4W2 5A3PA 1W90A 3AP7A 4NAMA 1OLRA 2XWJB 2CQ7A 1NG6A 3IIIA 2ID4A 1OQEA 3C8XA 3MN2A 1C57A 1B4AA 2D2WA 2YR2A 3AKTA 2L54A 3CUOA 5IVBA 3WV6A 4S2HA 5M5XJ 4CCEA 5A3NA 4C91A 5A2QK 4ZTFA 5DAQA 4XQ4A 2XRNA 3SCFA 3O1SA 1LOCA 1KJRA 2CGOA 3BG3A 1RB8G 3KP6A 2ZSIB 2P2KA 4MO7A 2QF7A 5ILUA 2PLYA 4AVVA 4NQWB 4QXHA 3M3CA 2PBIA 3POSA 4FOYA 4RAGA 4IL7A 1B1BA 5FZ6A 1ON1A 4KU8A 3PUFA 2Y75A 3OS0A 4KUMA 5FZ8A 5EGOB 2XH6A 2CGNA 1VALA 2RNJA 2XAQA 3D3AA 4D0PA 4UUSB 1V0AA 4KWJA 5JPNB 4H55A 2VW1A 4CU8A 1AR83 1WCUA 3O1MA 6PAXA 3M3EA 1W8OA 3KYLA 3B6AA 3HUGB 4U0WA 2Y34A 2D5FA 1H9TA 1T56A 3RZDJ 2VE1A 4Z2AA 2EA2A 2AO9A 3AZVA 4QPGC 2M8EA 5B2GB 5FD5A 3R4SA 1GHCA 1ALYA 1B09A 1FOD1 5GADJ 5FPVA 3T8RA 4O61A 5ANQA 1ZAOA 2LF7A 4XORA 5KHHA 3ZFEB 1JYIA 4FFGA 4AI0A 3L7WA 4BHPA 2FUG2 3PU3A 3SEZA 3ZN6A 5F5IA 1R1VA 4J25A 2WSUA 2A6WA 2WB1N 3WNPA 3HJRA 3ZMVA 1UOFA 5FUPA 5KWRA 2NYXA 2QEXI 4CDQC 3Q8CA 3GF2A 1UG0A 1BIAA 2E5ZA 1BLZA 3S0MA 5J1YA 3S2HJ 1AR72 2ZKNA 2YX4A 5CFDB 3IH3A 1FX7A 3WT3A 3ABLH 2FD8A 1CQ9A 5LEJA 1EH7A 2EIBA 2IAIA 2L7FP 2E5NA 1RXGA 2QM3A 1OPCA 1MVEA 3WTTC 3HRSA 3CCLI 3I2OA 3MIHA 4YZ2A 4A3GJ 2CYFA 2XR4A 5D2AA 4NE9A 4ZXKA 2VMEA 2YSRA 3ZPOA 2KZVA 3S2WA 1FPQA 3VLBB 2CHHA 2BBYA 2X53S 2DT6A 5FFXA 5A7SA 5IOZA 1NXMA 4W6WA 3KEQA 1VBD3 4LK1F 4PCQA 4J01A 1UZWA 5IT3A 1DGRM 3ORJA 5LGUA 1F1ZA 2VKEA 4BLJA 2RGVA 4B4PA 2W91A 1HV1A 2AENA 2AEYA 5FZ9A 3AFGA 2GH8A 1UHWA 1ZNPA 4PLOA 1QF3A 1O4YA 1FMD2 1US2A 1J3RA 2VVEA 1RRJA 4TLGA 5FKKA 2C9AA 3TOAA 1BVVA 4JAAA 4DXZA 1MMDA 4IUGA 3H1YA 2R7UA 1LVAA 5LA0A 3QYEA 1VBB2 4G8XA 1UG2A 5HDGA 3KWVA 3SLIA 4GO1A 1O91A 3C7EA 2VAUA 4JGZB 1ZRFA 2OXBA 4A45A 1VRH1 4IGOA 2PAEA 4MLOA 3RYKA 3DYMA 3CU7A 4COYA 3WW3A 4XAEA 1UY1A 4XF9A 3SCHA 1R1A1 5FZFA 1YX5A 5FCCA 3CDIA 3KIOA 4ES9A 4DPNA 2M8GX 3CMGA 4KBZA 4Q0PA 2IW5A 1YG2A 4ABZA 4YIIA 2XV4S 2DTYA 5D8AC 2CU7A 1MMSA 1D7PM 1ODMA 3J81Z 2RV9A 5FMDA 3LA3A 1UOGA 3VBUA 1ZA4A 1HB2A 4AGVA 1LU1A 2WWJA 3MKWB 4QX3A 2CV2A 3PUAA 5FGMA 1CVNA 2WWYA 1DGRN 1R1ZA 1TNTA 3KCYA 3LIGA 3VBHB 5JOZA 4QXCA 3LA2A 2Y6HA 4LO4B 1BOAA 4ZZ8A 1AHSA 3M4OJ 1P9QC 2YPDA 1O3TA 1FOYA 2O8XA 2EICA 4XFBA 1O57A 3K51A 5LHIA 3C1DA 3CZ6A 3ZQIA 4J1WA 2WC2A 4L2NA 3LFMA 3I7DA 4Y22A 2P5KA 3DPRC 1KRIA 1IJWC 2ILMA 3ZSJA 3CC2I 3A0BC 2M45A 2HDWA 4AL9A 1GMMA 2JSPA 3JRAA 2LUWA 4UF0B 2ETEA 3S3OA 2ZOEB 3IH2A 2OA4A 2BJSA 2IA0A 3VDDB 1VQ8I 1JN2P 2KDZA 4FPGA 4XOTA 3V0BB 3NNMA 4LUMA 2JG9B 5F32A 2D1HA 4ENMA 2XQXA 2RREA 3FIWA 2H27A 4CZZA 5FO8B 4P14A 3RJ2X 4RB0A 5FLXK 5CKNA 1OR7A 2OW4A 4GFBA 4GXOA 4RMNA 2X5IA 4IQPA 5GM0A 3CCVI 3A23A 3JSOA 2Q1FA 4EATA 3BC8A 3ZYGA 1DP7P 2D6NA 3ROUA 1HN1A 2RDRA 1DLCA 3B9IA 3NWTA 2QJVA 1CONA 3ASIA 4L0ZB 4M73A 2QUOA 1G9BA 2JN6A 2PFBA 4ETSA 2UWBA 5JVTA 1MZBA 4LG0B 2WZR1 1UAIA 2VD7A 1BEV1 4AQ6A 2B0LA 1ONAA 1Y56A 4ZKTB 2DUPA 2OCCH 1IRGA 4XCBA 2A73B 2GLOA 5CA6A 1R1UA 3IKVA 2HJIA 2VQTA 4AIHA 3NKTA 4M3GA 2BE5F 4WVZA 1VBA3 4ESFA 2R7RA 4NJ4A 3J8F2 3A7QA 2L5QA 2VH9A 4XAAA 1T38A 4M00A 2DUQA 3RKQA 1TLHB 2XXZA 4JTNA 1VFCA 4JV4A 2XB6C 5AC92 3WG1A 3LGRA 2Z42A 4FPLA 2HEVF 4BPZA 1I5PA 1STMA 2R1BA 5HCBA 2FBIA 2VE8A 1XC5A 1J75A 1WCKA 4H14A 3UGFA 1S0JA 2OZUA 2WFF1 1QDOA 1H2MA 5LLQA 3D82A 1GANA 4A42A 5F08A 5FO7B 4ZZ5A 5FYZA 3NWSA 1JI6A 2BGPA 1KDKA 3SCGA 2RS33 4IKFA 1DPUA 3WEZA 3AG2H 4UFMA 2X6XA 4R1HA 2G4IA 1RVF1 4FTSA 4JQTA 2RV8A 3HPNA 4XBQA 5HS7A 5L9BA 4BQ5A 4G12A 4NNJA 2JRTA 1X4PA 1A6CA 4B3AA 1JZ8A 2R7EB 4CCMA 2DCTA 4RHV1 5FMOL 1UPSA 5FZ1A 1B59A 3D0SA 1HBXG 1NLQA 4IDZA 2K40A 3OIQA 4F91B 4OOIA 3MKZA 3GTMJ 3GYDA 2FDKA 4AYBA 2VVDA 3K75B 5C33A 4P5HA 2LC2A 2PQ8A 3FFQA 3PSIA 1XC6A 4E4SA 1R082 1HRI1 1OHFA 1LAJA 1ZBA2 1UO9A 4ZS3A 2B39A 4XE9A 3TN92 1O3QA 3K4ZA 3V4GA 3VZKA 1P4XA 3AZWA 5BNOA 3H36A 2E7AA 3ZFGB 2EVXA 3HT1A 2ZBKA 1NXD1 3WHCA 1E5IA 1YLLA 5FZ4A 2UURA 2ZEWA 2HWC2 1OLME 4ES8A 5EJCA 1OOPC 5GLWA 2IS1A 1XSRA 2FJ1A 3AZYA 5KXDA 2VZTA 5C9AC 1DGWA 1ODNA 2OUHA 5LBBA 3K6GA 3ES4A 3RJRA 5FPBA 1LGBA 4WXHA 2ZGMA 1SVOA 1AL22 3HPHA 2O3FA 1EUTA 2P7CB 5GZDA 2GMEA 3SEPA 4LUKA 2AQEA 1O3RA 1V5GA 1AKHA 1F5JA 1OVSA 5DZGA 3UL2A 2RMU2 2TDXA 3SEQA 2CGPA 1TQIA 2P3IA 4AE2A 4FOQA 3TYJA 1SD5A 2GNBA 2LNBA 3OG2A 3VZJA 1PGW1 2DTZA 3IN9A 4PUSA 1C8M1 2F4MB 2FA5A 4B3XA 3TL4X 4ITVA 2VR4A 4XOGA 4MGRA 1PK6B 3TW7A 1HRV2 1AR73 2FBEA 2ZGPA 1E17A 4AHWA 2P81A 5FKMA 4P9LA 5DUUA 4IV3A 5FY1A 3OYWB 2ZMEB 1UL9A 2D6LX 5L9VA 3IBMA 2X09A 3LSIA 2K9NA 1UWWA 1BJZA 1X36A 2KIUA 4LIVA 5TJJA 1SFPA 4MIMA 1TWFJ 4G6DA 3B6CA 4QKNA 2HWF2 2HZDA 2PJRB 1QJY2 3NNGA 3KD4A 4S2FA 5DDJ2 3LSMA 5DN2A 1ZYRF 2ZJRF 4RGUA 1MDMB 1D5VA 1O6UA 4PSXA 1AF9A 4CYDA 3CBNA 3ZYBA 2JSCA 2P4WA 1LVKA 4CPBA 1HW1A 3UT0A 3QRFF 4O3MA 4RGGA 4MFDA 4S0HB 1TWGJ 4OUMA 4ET7A 4BQAA 3MFCA 4UAPA 4AWXB 4JZRA 2YG0A 5A7OA 3ECHA 2I8DA 4E7LA 3VD7A 5T54A 1EF4A 3NAPC 4FFFA 3IMNA 4AGRA 5B1AH 2VUCA 2VJ5A 4IX7A 5M3FJ 5DEQA 1DGWX 3GBGA 2JB8A 2XAHA 3V8LA 3NW4A 3OWTA 1V54H 3N9OA 1P7IA 2HYKA 3S3NA 3CJXA 3WOGA 4CCDA 1VBB3 3JU9A 2E6VA 4XIDA 3PHMA 3RZKA 4YM1A 1BMV2 2VZSA 5C8WA 4B4RA 4HETA 3IMMA 3ACFA 5L7OC 2DYCA 5C5TA 1WCQA 4WM8B 2ME6A 1U2WA 1AYM2 4QU1A 4CDWA 1AU7A 3JRFA 1QJEA 2Z16A 2OU2A 3T1MA 1UX7A 5KNLA 4M3CE 4F92B 2DOAA 4BDYA 1NK2P 3T0BA 5BV6A 2GSYA 2NVUB 1JI8A 1ZRIA 3VHNA 1IF1A 5C3QA 3KQ4B 4YVWB 5IK7A 4HKOA 2NZ9A 2W0XA 4FSJA 4LHLA 2MBFA 5F5CA 5C3OA 2XPVA 2ACJA 1W28A 3WNXA 2RDQA 2HXIA 1NH3A 1XDUA 2VZVA 4ASMB 2W4SA 3ZR8X 1OH4A 2BY1A 2R062 3I3BA 4LHNA 2Q4SA 5FLHA 1LGCA 3RPQA 3ZQ7A 1SD6A 3AAFA 4QX2A 4FPOB 4BMEA 5BNPB 2MLKA 1WI9A 1HXDA 4Q1RA 1RMU2 1DQUA 1S1AA 3LIHA 1VBD1 1UU6A 1T0FA 1I1SA 3ZX7A 1ZGJA 3GJBA 1YJWI 2OD5A 4XIKA 1NY72 4HF0A 1U5TB 1W6NB 3WHUA 3NV1A 4WM7A 2VULA 4XETA 3T1LA 4E7SA 1S72I 2BVVA 2WA4A 1K5MB 3BY6A 2Y6FA 2MYSA 3OEAA 4QAWA 1X50A 2N7GA 3FBNB 2QQPA 3BG9A 4XMAA 3VYUB 3RPUA 3KYDB 2R7TA 2XUMA 2WKKA 3A0NA 1ZBE3 2A71A 1JZ2A 4EQQA 5IVYA 3K69A 5DCMA 4UFIA 1YJNI 4IV1B 3G1MA 1W7PA 4HVQA 2AR6A 2WBKA 2K3FA 2RQQA 5GPCA 4RQPA 5A32A 5DCFA 1WLCA 4Q5SF 3TRSB 4YW6A 3ECQA 1XS9A 4KN7X 3WY6A 1GUUA 3FK7A 4HVRA 3GTOJ 5DUWA 4HNUA 3JQXA 1DHKB 4N7IA 1MZEA 4I0BA 1KQRA 2WABA 4LO5B 4ZDLA 3VGIA 3ZMOA 2FOKA 5CVJA 4M3BA 4ZYHA 4YRVA 1ULOA 3J8F3 3QOEA 3KF3A 2UWAA 3HEFA 5FY5A 4AFCA 3BT9A 1M06G 2IPQX 2D98A 1D0ZA 4AI3A 2DA7A 1R9TJ 5AC93 4AGGA 3HOVJ 2DU9A 5C44J 1LR5A 3QPTA 2BTVC 5FZEA 3V56A 1N77A 1W8HA 4R79A 3LDRA 5A3UA 3S93A 4DEQA 4QM8A 1MJAA 1Z7UA 2ZSHB 2WS93 3CDHA 4XTPA 2IFWA 3WLUA 1PGL1 1LKNA 3H3UA 1ST8A 3BR6A 2O61A 3MV11 2XJQA 4PDWC 3O0VA 4U0YA 1FBUA 2W52A 4FFHA 4XLHA 3HGGA 4IEXA 4O7XA 3DBHB 2M0MA 5J8FA 5DAWA 2GM4A 3WU1B 1CJPA 4N7UA 3S7IA 1VQPI 2R7XA 4CDUC 3ONQA 1W6MA 2HFHA 3M8LA 1JTYA 2W57A 3MKLA 4G7ZF 4DS0A 2VE9A 4NPLA 3K2AA 1IG7A 2RS12 2FQ4A 4AVZA 1EV12 3WUCA 2W08A 1R083 3H7YA 4UF0A 1N25A 2VBDA 3I4MJ 1YRNA 4CCOA 1ZBA3 2R042 2HI3A 1ND2A 1R64A 2XHNA 1QZZA 3TN93 4P9YA 5FZDA 2WT1A 1KZHA 1V55H 5KC5A 5IP9J 1E0EA 3GTJJ 2HWB3 5HCFA 1FTZA 4PIYA 1RI7A 3VBOB 5FXZA 4BXSV 2A7AA 2QSGX 1CAUA 1PO12 5EZHA 4BY1J 1RTVA 4EJUA 3OSGA 5LHGA 3CDLA 3AVSA 1LJ9A 4PZJA 4MOAA 1D0YA 4XJZA 1DLLA 2ME0A 4HYEA 2Q2EA 3LDKA 3FMSA 5EEAA 1O7LA 2YBSA 2DTRA 3G3ZA 1GYKA 5ANNA 4A3MJ 3WF1A 2EILH 4GMP0 1AL23 4GWMA 5DM6F 1REFA 3UJQA 3EUHA 3TO6A 2VC0A 3PVOA 3B7MA 3VB2A 1YNAA 1LPQA 5DABA 5HDKA 1JE8A 2RMU3 2HKXA 1J2XA 5DYMA 1BC8C 5ED4A 3LD8A 2RS31 4Q4W1 2Y6GA 4X1EA 4YFKF 3I4NJ 2K5CA 4HDVA 3EJKA 5KVRA 4E8DA 5L19A 2CTVA 5FXWA 1V3FA 4OAYA 4Q48A 2W9XA 1LHNA 3IM0A 3SZTA 3I3EA 4HMZA 4Q8LA 1LOEA 2NMNA 1NCQA 3C2UA 3FL7A 3L2QA 3I71A 4L5IA 4D7NA 2DI3A 1RUJ1 3P3NA 2PEXA 2DVAA 3RQ0A 4BLIA 5F2WA 2O6GE 5CVUA 4IE5A 3HOSA 1EH8A 3A4UA 1GV5A 4PJMA 5A1AA 3MCZA 5CJ9A 1QOSA 3BTIA 4GCVA 4O9GA 2JIJA 1DZRA 1GXQA 3HTSB 3HWJA 2ID6A 1D1AA 3F72A 2OPWA 2HWF3 4ENNA 4NRMA 1QJY3 4DEVA 3OJBA 5DDJ3 1H4HA 1CESA 1FTTA 3ZO0B 3MW3A 1H6XA 2XAJA 4RAZA 4HAMA 3GMEA 2ARCA 3QBQA 1OYYA 4DFSA 2ECCA 3VBRA 4X0GA 2JD9A 2XL7A 1W0UA 2ZHNA 3FKJA 2BZTA 4EJWA 4U7BA 3T2QA 4BY7J 5CQGA 5FV3A 1ZREA 5IYDJ 3B93A 4ZU5A 3HJEA 1LESA 4HX7A 1WMXA 2IP2A 1QOOA 4QLCU 5L3BA 1SEUA 4FETA 2CG4A 3IAQA 4LBQA 3C7FA 2CW8A 4GD4A 3H42B 1QIQA 3O8GA 4OU0A 3HTUA 1W99A 1YFWA 2A70A 1MQTA 3T09A 2G19A 5E6HA 2VOPA 1WGPA 3MF9A 2H6BA 4WZCA 1VMJA 5J4YA 1GR3A 4KGGA 3BDDA 4OYUA 5AIQA 4GKXA 2Z2SB 4OI1A 4RR3C 2WLQA 2R5YB 1HQCA 1VQ6I 1SMTA 4JTOA 2RG4A 4N43C 3HRTA 1US3A 2X1EA 1VBE3 2OX0A 1AYM3 4HNVA 4PDKA 2ZHKA 4PSWA 1E2XA 4LMFA 1XMAA 4I0AA 3HQUA 3IC7A 1W04A 3Q8EA 3HC7A 4A69C 3H1CA 5FOJB 3GFJA 2NYYA 3SJMA 1ZARA 2MH9A 4CEWB 4D7SA 1W8WA 3N3HA 2E9QA 3IAPA 1W6OA 3LE0A 1MNDA 1QHGA 4B8EA 2WYSA 2R063 4OI2A 2DA1A 2E53A 5J1XA 1D3YA 2CQXA 4XK4A 2QUFA 4M6XA 4Z07A 3PJYA 1SQ4A 4LKDA 2GQQA 2TEPA 1OKOA 2K9ZA 1ULFA 1BW6A 2DDBA 2RE9A 5EEGA 3FHIB 4QKFA 1KYWA 5FB2A 2J1VA 5IYCJ 2P3YA 1WW5A 1RMU3 1R00A 4YVSC 3NQHA 5EYXA 2QZ8A 2V1XA 2YPJA 4AEDB 4Q47A 4ZZDA 3J7AY 1J0RA 1N1TA 3ZMDA 3OD4A 3MLKA 3BPVA 4MUVA 3ZYRA 5K0UA 3WTWC 4LTAA 3NWKA 1GXPA 1FMD1 1ETKA 4LBOA 1I50J 4HG6B 1XMKA 5K7PA 4DO0A 5DS9A 4FFIA 1ZKGA 3ATGA 2RDPA 2PHXA 2Y48A 3POJA 4OWRB 5GLTA 5E8GA 3FLPA 4XR6A 3A4CA 4YSFA 4RSUA 3KHCA 3DV8A 1JGSA 3WGGA 1SLLA 1H2KA 4QGMA 1DZTA 3LEGA 3NEUA 3SITA 2JE9A 4MGIE 2VOTA 2LYCA 2ARBA 1C4RA 4RL7A 3I58A 3ZXFA 3HHHA 1XB9A 4IOAF 2BV4A 2XDVA 2ZS6B 1QJU3 4DY5A 1Q8QA 3JAMZ 2DWRA 1NHAA 3VDBA 2WN2A 5GLUA 4BCUA 2GAUA 3IDCB 1LE8A 2VJ4A 1W5SA 3FK6A 2A1XA 4LKSA 3U1XA 1X4OA 2HLEA 2V4VA 1KS4A 5FDBA 1FY7A 4YFXF 3HBZA 1DU6A 4AI8A 1DYOA 4GJZA 4UFHA 3B3QE 3LOIA 2G0EA 1HXS2 2ZKZA 3KPHA 3JREA 3V0AB 3PIOF 5C4WC 5D6FA 2OKXA 1AL0G 2CSGA 2KA3A 1K78A 3VYTB 1NZCA 4F55A 1ITYA 2L9LA 1ZRDA 4HF1A 4II2A 4CA0A 4RGXA 2HWE2 4A3EJ 2KLOA 2RKHA 4PGHA 1MACA 3WG2A 3EETA 3IPVB 4G9YA 1Z67A 4XRMA 5J7MA 4AW7A 1ONVA 3E6BA 3JXSA 4BEHB 2W2IA 2IFRA 1XYOA 1X1AA 1FSHA 1OMIA 3F6VA 4D5FA 1DYPA 2E26A 4OAZA 3QYBA 1FYUA 4E7HA 5EJ1B 4NC7A 3M7GA 4N53B 1HSTA 3ABZA 3T4HB 3HQXA 3A01A 4BISA 4Q0QA 1YO8A 5B4NA 4FVVA 3OYLA 1U8BA 3JD72 3VKMA 2V5YA 4TXWA 1TC3C 2JUGA 3Q0UA 2VZOA 2ZGKA 5CFDC 2VC9A 2RS13 3RFRA 3GZEA 2DAOA 2VJJA 2OQ6A 4MSVA 2XGEA 2MW8A 4WVVA 2E51A 5A3LA 1XSQA 2R043 3BPSA 1QQIA 4CXYA 2VT3A 4GH4A 4YM2A 2CYYA 1IDZA 2FQPA 2NVYJ 1GLNA 1YX3A 3UNGC 4XZUG 4AHZA 2B46X 3VB9A 2KPMA 4Y24A 2W95A 2FSWA 3LEIA 1IV8A 2A68F 1ULYA 1X8MA 2CH0A 1PNGA 1PO13 4NIIA 2K46A 1LOAA 1DDNA 4S2DA 3P3PA 1K5JA 1WBLA 3DCFA 3PUBA 2HPMA 2IXIA 1NA1B 2C26A 2L02A 4G4FA 1XGMA 4YZ5A 3QAHA 4LQRA 4A5NA 3KP5A 3UKVA 4R9CA 3ELNA 3VPRA 3CP8A 2IXCA 1TVGA 2B7YA 1W9SA 3PLQA 4E2QA 1RGSA 4EN0A 2XF6A 4WVWA 2ELKA 3S57A 5EIYB 4WZFA 4Q0SA 4AI9A 3BTAA 4QM9A 2WBMA 3H3ZA 2E1OA 1K42A 3TO9A 4LA3A 5EYYA 3OYGA 3REOA 5IVVA 2D40A 2DPUA 2VJXA 4Y4YA 2IGKA 4XN3A 3HOXJ 2VXJA 4L92A 3C2BA 2VKHA 1DIWA 5GALA 5D4RA 3SFZA 4HXCA 4OLLA 2ZEXA 2PHLA 4INDA 3FHQA 3JRHA 3I2FA 4XHBA 3I2GA 4JGZC 1B8IB 4AVCA 2KJCA 4TLFA 4IRHA 4FP2A 4LITA 1IC8A 2BEOA 1LEAA 4KGQA 2ELHA 1IXSB 5TGTA 5AFEA 5ICGA 4PGGA 3U14A 2RVAA 1RHI1 1DYKA 5K8SA 5E1RA 2E2JJ 4NIDA 2BY2A 2KL4A 1H9PA 2VO5A 2J1EA 1JU3A 1D0GA 2H94A 2L01A 1B35C 4OHZA 5FZMA 1ZBA1 2XPWA 1ULPA 2WLPA 4XXAA 2XLAA 2P7VB 2VMFA 2BUKA 4DRVA 4KFCA 4YW7A 2NNYA 1ZLJA 3V7RA 1CAXB 2WV1A 3M3OA 2E33A 2C24A 2ZX3A 3S1NJ 1MSFC 4QXKA 3EXUA 5J40A 1I3QJ 2MC4A 1WLDA 3G1OA 3KCCA 2HDCA 3MF6A 2GP5A 1B72A 2HWC1 4FTEA 2BWCA 2QLZA 2F4IA 4MQ9F 3ZQGA 1CAVB 2HQAA 5CVIA 1YE9A 1H1IA 5F0CA 3ZDVA 1WCMJ 5I93A 4YZ1A 3BTXA 1Z6TA 2EA7A 2HTJA 2WJSA 3BI3A 2Z3YA 1PO23 1UY2A 4M4RA 2VU9A 5ICCA 3PQJA 2XLGA 2GNDA 1W3VA 2ZEZA 1N1VA 4Q26A 2KDOA 1PP7U 1AL21 3CJQB 3J9SA 3C2HA 2CWSA 2W46A 1K3IA 1FOKA 2OVUA 3CJIA 3LKJA 2R4GA 5IPAA 2PG4A 2AGSA 2MNGA 4CCNA 1SBDA 1F43A 2F5VA 1SACA 1A78A 1ZGWA 4LGWA 1EJ9A 1XOYA 1PYVA 3N97A 1H4GA 4S2GA 4WBBA 2JG9C 5FXVA 3RZMA 1JKPC 1MZFA 2R7FA 3RZHA 1JODA 1S5LC 1QRYA 2A5WA 1SLAA 1Y39A 5CKTA 4CZCA 3T0DA 2EV5A 2KMUA 5IT9Z 4N9HA 4K21A 3NNLA 1KFUL 2IXKA 4OZOA 5L3DA 4BL0B 2D6PA 3BU7A 1HRV1 3CUQB 4Q1PA 4K9SA 1W2AX 2ZX1A 2V6EA 4OIQF 2G7HA 2P3KA 5JIUA 3KVAA 4BQOA 1DP3A 2Z9OA 2IBDA 1WW6A 4JHTA 4QQ2A 4UVCA 1X2NA 4CVUA 2BOIA 2HWF1 4JX0A 1FOD2 3D8CA 4Z92B 3S5AA 1O4TA 4OUEA 3DPRB 2ARXA 2I07B 1GZWA 4OHVA 2VKVA 3OOXA 4NUBA 3OBAA 3N35A 3T8TA 3NJVA 4RFT0 1BVP1 3GJAA 4ASLA 4C1XA 5FZKA 2EXIA 5JVGF 4Q29A 1TWCJ 1TQPA 1Y6IA 1ZZ8A 5SV5A 2XIGA 2W92A 2DW4A 2HVQA 2KJBA 2VM9A 2OT7A 1NQDA 2EFNA 2FOWA 5E8IA 3CCQI 1GVJA 3DFGA 3Q9SA 1F36A 1MPXA 4LBLA 4JKMA 3U75A 1OJLA 2LDUA 1FBQA 5LASA 4XF0A 1FXZA 4ASNA 2L2OA 5A7NA 4FCAA 5G05L 4JVAA 5EEHA 3D0JA 1JYWA 3HSEA 2EZLA 1ASJ2 3Q3SA 3BROA 3AJZA 3AL6A 1C1FA 5DM7F 1BMV1 3J81K 2F5EA 2DCKA 5IVCA 2F48A 3KSCA 4L9JA 1ULEA 1X1CA 5KBFA 3GXUA 5GKAC 2CV0A 3K2ZA 5EP9A 4XMIA 4UOJA 3T2OA 1RUI2 1QPIA 2D6OX 2GALA 2VIXA 3ZQQA 4NMIA 2WWSA 1W9FA 4XABA 5KHJA 5FKNA 3A21A 4QX5A 3TEWA 4MO3M 2WDBA 4A7YA 2BW3A 3BU0A 5E88A 2LLKA 2XHKA 3ZFGC 4KJZA 5ACA3 1WCSA 4X6RB 3NRVA 1ZZ7A 3ZMZA 5HCAA 3NMBA 2VXRA 3FXRA 1XQNA 1GT0C 3MVPA 1J84A 4M01A 2UYAA 3D5OA 1J1TA 4CP9B 4BQNA 2OF7A 2Y0SN 2B45X 3AB0A 3D6EA 4YGEA 2LSOA 2A6ZA 1DQ6A 3L00A 4A3IJ 5TRDA 4D69A 3A22A 1F9NA 3QLQA 2HWE3 1FOWA 1E5HA 3EPZA 1VPHA 1VRH2 1MNMC 3R0JA 1BA5A 2H1KA 3I56I 4A0YA 2JE8A 5FJHA 4QWQA 1YI7A 2C6YA 1SFXA 3LOCA 3LAJA 2DYRH 1PX4A 5AVPA 2VI6A 2VBPA 4QHBA 2WT0A 4UWDA 2PMHA 3E5UA 1GWKA 2UY8A 3POFA 2DFCA 2PHTA 2RC4A 1Z7S1 3KM5A 1ZR2A 1D4M2 2LREA 2ZGUA 1XSDA 3M2MA 4DXTA 4ZYDA 1VQKI 3RSJA 4UB8C 5BY5A 4RDUA 4BXUA 2MPFA 1YOVB 2EXJA 3OYNA 3WQ7A 1WA4A 3CMEI 4B43A 1HDPA 3I55I 3ES1A 2P17A 4CO8A 4YZ4A 3MZYA 4XLNF 4JDNA 2UV1A 3D5SC 2RS53 1O4XA 3J7LA 2BNNA 2KIQA 4ZY9A 2X4HA 4CEYA 3HB9A 3FMGA 1UZZA 1JYTA 4KIGA 5C9AB 1W9WA 1S0GA 4MGYE 3K70C 3UETA 4NAOA 1DG6A 2QCOA 3NV2A 2XJPA 4FAHA 3LSDA 4E7ZA 2O9LA 2COBA 4NHMA 4P5OA 1KITA 4R4ZA 1WMDA 1OKRA 2P6SA 1LOBA 1PHMA 5FYVA 3K4NA 5IAVA 3ZKYA 2ELJA 2LRPA 2OPTA 3TNQA 4EM0B 2W48A 4NHJA 2NNNA 3WF4A 4W6YA 5CB7A 4LBJA 4D7MA 1NOVA 1VAKA 2ZX0A 2CWMA 1R5GA 3MV01 2A5YB 5JZGA 2O7OA 1AA7A 4KN4X 4QB1A 4MXWB 4D0QA 3K77A 4PQQA 5CG8A 3JW4A 4RB3C 5BNNB 5FK8A 2QDNA 2YUEA 1VBC1 5KCMA 3K70D 3VBUC 4XM3A 5CYVA 2VNOA 2ZFUA 4B4CA 3BQYA 2JWTA 3TEDA 1VQMI 2GC2A 3VBSA 4QD2A 4IXAA 5JR7B 2WNVA 2LD5A 1R1TA 5HXVA 1S7EA 4J00A 2VJIA 3QP5A 4Y5Z0 2HXOA 3TGNA 4WM8C 2QQAA 4I6ZA 4I76A 2YHJA 4KYWA 5GP9A 3WINE 3FMRA 3NJYA 1C5IA 2DXIA 4XBLA 5HV4A 2O5RA 3UKTA 2QQKA 3AMQA 1EV11 1OURA 3U07A 2ZACA 1MR5A 4XUQA 4MQVA 4BQYA 1I5ZA 2ORZA 3ULQB 1AWCA 2DMNA 5I0RA 5H6QA 4ZDOA 3NAUA 3PNTA 4WK8F 3MKYB 1EYBA 1BCXA 4C1WA 3LSEA 3FXQA 3R61A 1U12A 3MIDA 4AVTA 2W1SA 4DRRA 3OR2C 1R092 1X58A 5B1BH 2R071 4JOMA 5FZLA 2VW0A 1PO11 2UWCA 3V64A 4KG0A 4UFLA 1CJDA 3WQBA 2XVCA 1RVF2 5BNPC 2G9GA 4EJTA 4CUBA 4M3CF 4ZDPA 4JX6A 2M0CA 1P2FA 2D43A 4RA2A 2JKBA 1OR7C 1XPWA 5IOYA 3LDBA 4RHV2 2X5IC 4QPGA 1MS0A 3A1YA 3IRQA 1IPJA 3CESA 1U5TC 2F5FA 1DDLA 5HLGA 1TL8A 1K5MC 3J7AO 1T33A 3Q9OA 2CDOA 1S4CA 3N9QA 4OINF 2YFZA 3WQ0A 2FCUA 3THCA 3ZSMA 3B01A 2ISZA 3AMNA 1HOMA 3DP7A 2WO2A 1XCVA 4CDQA 1OISA 4H0EA 5JMCA 4CCKA 5FKOA 4LBMA 2NM1A 2SLIA 1WKYA 1IN6A 2P1BA 1AR92 4BBSJ 2M5WA 4J1XA 2WB1A 1IN4A 1QXPA 4QDSA 1SCSA 4E8CA 1USSA 3GALA 3F8NA 1JHNA 2KR2A 1RYYA 3HNYM 3CEWA 1BR1A 2XL9A 2QZ3A 2BNOA 2BFUL 2C5DA 2Y33A 1G8XA 2IGMA 5E3LA 2GNMA 2Q5TA 2FDGA 2TCTA 1FOD3 4RLQA 2P6HA 4SBVA 2NOGA 2P5VA 1LEMA 4XIOA 4V2FA 4P55A 1AR62 2R0FA 1PJRA 2LRDA 1N78A 4FQZA 4Y7NJ 3KV4A 4HX4A 4EN6B 3LPGA 3AG4H 2OJED 1PGW2 3ACLA 1C8M2 4RD7A 3TO7A 2XASA 4HV6A 3FBIB 1Z3XA 3HZJA 4QGNA 3KP7A 1GWLA 3VHPA 1YCIA 1QH7A 3AP5A 2M7AA 3OIOA 1S7AA 1JGGA 3H8OA 2DMPA 1R22A 3SDBA 1J59A 4K2EA 2BP6A 2DTWA 2JE7A 5T5PA 2ADEA 1IHMA 3AP9A 1CAVA 3PURA 5BNOC 1HKTA 4FE4A 2AH2A 2PHDA 5IYBJ 1D0XA 3DEWA 4YELA 4BWOA 2LOOA 1QJFA 1NE4A 1A04A 1APLC 5E16A 2YU9J 2D44A 2QQVA 4UW3A 5IP6A 1TW2A 4UV8A 1GFF2 4IL6C 1PUFB 5CEHA 5DD4A 3WCSA 1U9OA 5HVQC 1RUD2 4UFJA 1FV3A 3DEMA 4JRLA 4ASKA 3OBTA 4WVMB 1BC7C 2JICA 1TMF1 2BGCA 3I9V2 3GCXA 1MSEC 3NO8A 5F0FA 5FQ0A 2RM21 1COV2 4EWAA 3O8HA 5D8AA 1IN5A 5EG0B 1WW4A 3WU2C 2XB0X 5G04L 3VBOC 3S16J 4A5MA 2CUJA 4NN0A 3F2ZA 3LOBA 4C9YA 2H0VA 2JA7J 1HQWA 4LO7A 1DCSA 1TME2 3T30A 4XJWA 3GYHX 4PDWB 2E1MC 2KZGA 3S3MA 2JQ7A 4RM3A 3FHAA 1O5UA 2M3AA 1GLHA 3J4UH 2O14A 5FY4A 1F9KA 1X3ZB 2JECA 2DVGA 5KAFC 2WY8Q 2JENA 1Z21A 1BBT2 3TP3A 1DGRA 1VRH3 1F8VA 4U36A 1S0CA 2K9QA 1ZH5A 2VQHA 2PQQA 4Y26A 3TAYA 5F1JA 1OBNA 2LK2A 5JLWA 4FTBA 4XSZF 2CJJA 1I1GA 1RUF1 5EV7A 2FNAA 1R1A3 1RJ8A 2KD7A 4W8JA 2LH9A 2WN3A 1CQTA 1QDCA 1DQ1A 4KWKA 4AZZA 1JU4A 5C8CA 5GAHJ 3WQ1A 2IWGB 4XQWA 5FYHA 4CDXA 1YQCA 3BTYA 1XGNA 1KFXL 3U10A 1VB4A 4GKYA 1JZ7A 2HEYF 3ZYJB 1Z3YA 1D0HA 1G59A 2BVLA 2B4KA 4B4QA 4XW3A 4CCLA 2V9PA 5KHDA 5FO9B 2LKPA 4RBOA 1NTCA 2V72A 1ZZBA 1MBKA 2XSDC 1STZA 3LSGA 3IT8A 4MGSA 1Q8SA 3SEEA 1VQ4I 2JG8B 3OUIA 1W6PB 1YW7A 2FDJA 3ON7A 1OCCH 3I54A 1FI2A 3H9QA 1MIJA 1ETWA 4YZ3A 1JW6A 3MLJA 2D93A 5D1IA 4EJOA 4RGRA 4A3LJ 3VBFB 2DCZA 3HOBA 4I99C 4Q4X2 1LDDA 2PYTA 1GP6A 1S55A 3CC7I 2M9HA 3TB0A 4XICA 5L3GA 1Y9GA 3HM5A 1HXS1 1SLTA 3N4MA 4PLMA 2GIZA 2ZC2A 1VP6A 2OUMA 3BG6A 3LWFA 5F64A 3N05A 4DUXA 3RVHA 2DFFA 1R4NB 3PFIA 4YIRX 1BK1A 4N4NB 5F1RA 4QT6A 1QXJA 3PIGA 1UY0A 5K7FA 1A36A 5FZOB 3OD0A 1AX0A 3HN1A 1IG0A 4IGPA 1Y1VJ 1JZ6A 3HQRA 1W2UA 5C4JJ 4A3KJ 3NV3A 1OXCA 4AFBA 1ZM1A 2G9FA 4XXPA 3U1DA 4PHZA 2ZZQA 2WZR3 5DD8A 1BEV3 3DLAA 1YS7A 3T2TA 4LHSA 4MV2A 3ABKH 3KP4A 2L9SA 2DFIA 1R4MB 1TWHJ 1S0BA 1FOXA 4PLNA 5IUQA 2HWVA 2XJUA 3WSOA 4R9DA 2LBFB 1E5SA 3JD71 4HNTA 1WVRA 3Q9VA 4A3FJ 4L8QA 2JX9A 2JJ6A 2VZPA 2XB5A 1X1BA 2CAVA 3WD5A 2Z5WA 4BIOA 3DQVC 2W68A 4L0YB 4HPKA 1FC3A 4KMUX 1RR8C 3S32A 1OCPA 1RUH2 2ADDA 2DCEA 3FBYA 4WM7C 1HV0A 2N8GA 3IWFA 3O7OA 4A7KA 1H1AA 3KB5A 4QKDA 1SFYA 1NLSA 3LMMA 4NB5A 1PGL2 4XFCA 3OEBA 1XE8A 4QQOA 1CAWB 2V1NA 3SYTA 1RUE1 1X82A 1LJ7A 1UHMA 2V09A 4IE0A 2FMLA 3AKZA 2NQYA 5KXCA 3I3DA 1RVF3 4OIOF 4ZH4F 4HBNA 1MS8A 2Q8DA 1OOPA 1T08B 2Q0OA 1RL3A 1G3WA 2D3PA 4RQPC 2VPRA 4AFAA 4RR3B 3ZQFA 2GBYA 4I09A 3RYRA 5C9AA 5LRSA 4RHV3 1OCTC 2AXLA 2W39A 2H1LA 5IVFA 3O1TA 2IGOA 1ETVA 4N43B 1P4AA 2RN7A 1EUUA 1LDKB 3DGTA 2NS7A 2BHZA 4XRFA 3POWA 3MYXA 4Z1VA 4BK4A 1QU3A 1AYN1 3GTQJ 1W5CC 4YW2A 1IZ1A 2IZWA 2W87A 1YIFA 2KHMA 3HSRA 4BQQA 1XNBA 4HN1A 3KZIC 4IJAA 5IVJA 1YFHA 2P6CA 3MUZ1 4S05A 4RAYA 4M3DA 2EFQA 1ORKA 3SZPA 3W5NA 3O1PA 2VQGA 3RQIA 3FXJA 3P1IA 2YYOA 3LCPA 2DBIA 5BPXA 2BXYA 3VHOA 3PUIA 2OUJA 1XGSA 4A0ZA 1YWKA 2A05A 1VR3A 2OBPA 2HTSA 3BOQA 4M74A 4XRSA 3KZYA 3NQOA 4XACA 1J9IA 1IRFA 4GYIA 1FP1D 3KT4A 4QQPA 1H6YA 1IG3A 5DUIA 3GZTB 4NIAA 4LKEA 3MO4A 5A33A 3ILRA 3ME2A 1ZA7A 2XBO1 1TBXA 4JX4A 5FY0A 4QGLA 2IS4A