1O3SA

Protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRDTVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: Alteration of DNA Binding Specificity Through Alteration of DNA Kinking
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*AP*AP*AP*AP*AP*TP*GP*CP*GP*AP*T)-3'
total genus 60
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o3sA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o3sA01
2EFNA 3PNAA 1UFMA 2RQPA 1EPZA 3FF5A 1FP2A 2ZMEB 4KWKA 4LLLA 5ICEA 5D5XB 3MQ0A 1MJAA 2MNGA 3E3VA 2HGCA 3BROA 4BIFA 4CXFA 4PZJA 4OINF 2PN6A 1O3SA 3EJKA 3I53A 4LLNA 2HS5A 4HBNA 2MA3A 4HQMA 5FGMA 1FP1D 4CDGA 1UIJA 4HVRA 2Z3YA 2LSOA 1IW7F 4AQ2A 4PIXA 2PAEA 5FPZA 3NVCA 2AS5F 3F6OA 5KHHA 1LQ1A 4AVPA 4DQ2A 3HYIA 3LQRA 4EM1A 4HSJA 4MGIE 2ZJ2A 1ON2A 1USSA 1J3PA 2EFWA 4QXKA 3B73A 3IHUA 1QXJA 3ERED 1ZGAA 3GFJA 3CUOA 2VOOA 4OU0A 2EFPA 1YO5C 1DZTA 1S7AA 4KU7A 5D4RA 3L2HA 1QPMA 3BY6A 4BH9A 1ZLJA 4HN1A 5ILSA 2PYTA 4Q0UA 4OMZA 3H7JA 5I0TA 5K5RA 4Z2YA 1FSHA 5E18F 2XAGA 2OZ6A 4O6JA 4HQEA 2RGVA 2XLAA 1O57A 4IJAA 2XV4S 3ZP5A 5JSOA 1QNTA 1G4DA 5L3GA 5LEKA 1K78B 3TDZC 2RN7A 2IT0A 4META 1Z1DA 3CTAA 4ZYEA 1LR5A 3L7WA 3H7YA 2H6BA 4UVBA 1WSUA 2H0VA 1O7LA 2GXBA 5J3UA 1U2WA 4MGKE 5C8WA 5JHUA 1RGSA 2GH2A 3LSTA 2FXAA 1ODDA 4QX5A 1ZRDA 5I8YA 4KNYA 3BJ6A 3CO7C 3I5UA 4UXNA 4RGRA 3WW2A 2ZCWA 2G7UA 4AXOA 4UXAA 2KIUA 3ML6A 2D45A 2XRNA 3WU1B 2MLKA 2IP2A 3CJXA 3KP4A 2CYYA 2OQRA 2L01A 4XLNF 3BPXA 1YUDA 3CJNA 3W6JB 1OKRA 4J1WA 2GA1A 1IPKA 1ZNPA 2EV6A 1HKTA 2NNNA 1J0RA 2MPFA 4M74A 1SEFA 3QAHA 3U10A 3CO6C 1UW8A 1ZG3A 1TBXA 5K5OA 4L5IA 3PQKA 4ZYDA 5EZWA 2FBHA 4OFGA 4NHJA 3R0AA 2P5KA 5JSRA 4LA2A 4EJOA 4M9ZA 1RL3A 3DQVC 3VOEA 5HS8A 2EWNA 4U7BA 2D5HA 1FC3A 3F22A 4MTDA 4ONUA 3SZTA 1YWKA 2QENA 4Z07A 1RUNA 3C18A 1DZRA 3D0JA 2QQBA 1B6AA 3ZMZA 2NYXA 1IRGA 2DCTA 3IC7A 1YS6A 1XCBA 3FWEA 2CQKA 1U5TA 1S6LA 2OZJA 1O3TA 5FLJA 4I0AA 2IXIA 1YFWA 1LDKB 2XGXA 4KA4A 1CAVA 5T3NA 1Z91A 4ZH4F 2O61A 1J9IA 2GC0A 3T8RA 2H27A 4WWCA 1IUYA 2EFQA 3U9GA 5F1RA 5DDGA 2IC1A 3F8FA 2K9ZA 1U5TB 2FU4A 1FWZA 3IRRA 4R8HA 4RD7A 4MEXF 2FRHA 2BGCA 1X7NA 3M8EA 3DP7A 1SAXA 5FQ0A 1LKNA 4KMUX 1O5UA 4HA8A 4JVAA 3GZ6A 4E2SA 2LNBA 4KWJA 2WWYA 1QZYA 4AIJA 4IF4A 3O3KA 2L54A 3OD0A 4UV8A 3I71A 5CVUA 2V6CA 3U11A 1XRUA 2W57A 1ZLKA 2DU9A 4WZCA 5BS6A 3H92A 2ZKZA 1XN7A 3WW4A 3W6KB 4CYDA 4X6QB 2OAZA 1YQAA 4IPAA 4GCVA 3EDPA 1J2XA 3C3VA 3RJPA 5JCTA 5KHGA 3MZYA 2V1UA 1IXRC 4KUMA 3DXJF 3BZ6A 3KZZA 2PLYA 1IZ1A 2QM3A 4M9XA 1Y0UA 1MGTA 5I91A 1YW7A 4Q47A 1J75A 2D1HA 4OMYA 1NE4A 3TDUC 1XB4A 3NQOA 5E1WA 4XSZF 2QLZA 4G6DA 4HOBA 4J1XA 2M1BA 4TLFA 5CVRA 1R1TA 3SCFA 1F1ZA 2JT1A 4XF3A 3FMRA 1YFHA 3LAGA 3RPQA 5AIPA 4Q0VA 4RB2C 2BNOA 5JR7B 1QGPA 2PBIA 5DYMA 4ESFA 3ZMTA 5D1IA 1KYWA 5FLIA 3HIFA 2PA7A 4EJUA 3D5LA 2A6EF 4BXUA 4L9VA 2V1XA 2QJVA 1BIAA 1I1SA 2OA4A 2ZMEA 3DF8A 4XLPF 4LEJA 3D82A 2UZKA 4MQVA 2V79A 1R1UA 4WXDA 4XF0A 3HSEA 1KGSA 3K1PA 2UYBA 2XL9A 3DPTA 1ZYRF 2Y0OA 4KMFA 1ZZCA 5DEQA 5J8FA 3C7JA 3J80K 5LGNA 2MLGA 1GVJA 4HF2A 4YIIA 5FLXK 3QPHA 4LB6B 4O5VA 1OD5A 3RYPA 4UUVA 2O8QA 3VHRA 2GZWA 1R1VA 2OBPA 4KICA 3HRUA 3FMQA 3BP8A 1T38A 1IN4A 2XIGA 1STZA 3KCCA 3V8KA 3BCWA 2FBIA 3F8CA 1OI6A 2DK8A 1JHHA 3ELKA 3WG9A 5BUVA 3K9TA 4G8XA 2XLGA 3IKTA 1QXRA 3S0MA 2PQ8A 4QM8A 2KIFA 4YIFA 5DD4A 2QBYB 4KL1A 4NB5A 1U5TC 2BEOA 2W25A 4IRIA 5IT9K 5HVQC 2CW0F 4LULA 1EH7A 3EO6A 2H6CA 2A69F 1BC7C 3IIAA 1O7FA 3E5UA 3JW4A 3USSA 1IN7A 2V9VA 2QVOA 2EV0A 1Y3TA 3K1MA 4M9SA 4L11A 2HYFA 1CAUB 4QM9A 4EMSA 1W7PB 4EM2A 4YNIA 3QU3A 4EJVA 4XFGA 4N0BA 2DLLA 2AXLA 3F8NA 2HQRA 1Q1HA 3TO6A 4HX4A 2IW5A 3MFKA 3FM3A 3WTVC 3P9IA 1VJ2A 1B59A 2EJRA 2VXZA 1A04A 4D7SA 1XMKA 3P9KA 4HX7A 1BI3A 4Q48A 5LRRA 4IETA 2P8TA 2VBWA 1WI9A 4IXAA 5F6FA 1Q5OA 4WF2A 2HKXA 5DUKA 1TW3A 3VFZA 1F9NA 3GUDA 3KP6A 5CYVA 2N7GA 2PQQA 2EA2A 1WA4A 4XFHA 5C6CA 3KP5A 1SFXA 3HQXA 2XAFA 2YPRA 3DKWA 2K02A 2CWEA 3HT1A 4DINB 1RI7A 2ESHA 4QGLA 2HZTA 3TNQA 4M71A 3ZMUA 2EAAA 3JTGA 3HOTA 1I5ZA 3L9FA 3ES1A 2BV6A 2DQRA 2NS0A 1YYVA 4UHTA 5AONA 5FFXA 5E16A 2DPDA 3E6DA 5DV5A 1LDJA 1EY2A 2E1NA 4IRHA 1YLFA 4UBGA 1QZZA 1FI2A 3MPBA 4G9YA 3BU7A 5E1ZB 3M7GA 2EB7A 4JQFA 3RPUA 1XGNA 2HYGD 3E6CC 1REPC 1SD4A 1UCRA 1S29A 5DCFA 3KSCA 2L02A 4HX8A 1KU7A 1NXMA 3SCHA 2EA7A 5CLSA 3KGLA 1USTA 5ILVA 2D1VA 2ZNZA 4KIFA 5BPDA 1PM7A 2FA5A 1ZZBA 2ZFWA 1L0OC 2P6SA 3EQLF 3T1BA 1RZ4A 1J59A 3KZYA 4LD5A 3F8BA 1ONVA 3CUQB 3N4MA 4HLXA 1FBSA 4LGWA 1ON1A 5L3FA 4RS8A 3KEQA 4HBLA 4I01A 4S04A 3FE5A 1X8EA 3WODF 2ACJA 3GBFA 3K0LA 4LTAA 2WC2A 2A07F 5BOXA 3PQJA 2MBFA 3L00A 2JSCA 4PIZA 2ZNYA 3F72A 2GC1A 2YU3A 2E7WA 1NZCA 4I0BA 1U78A 3SFZA 1H1IA 1V3FA 3GF2A 3SXYA 1ZRRA 2VC1A 4HLYA 2VBZA 2C6YA 2W24A 3H8UA 4F7ZA 4L0ZB 1UPIA 2QVSB 3MEXA 3J81K 4HDVA 5LLQA 1FPQA 2IVMA 1VP6A 2E1CA 1PDNC 5D4SA 1G3YA 3GO5A 2HQNA 4Q0SA 2QYOA 3KP2A 3RNSA 4GGGA 1W4MA 5H20A 3QPTA 5FPXA 3V8LA 4IERA 4EGZA 2VT2A 1FYMA 2IJLA 4PCQA 1BIBA 4ZU5A 3C3WA 3E6MA 3GX4X 2HJIA 1W5SA 2XKOA 1DPRA 4GYIA 4IHSA 4YSFA 1CF7B 3WW3A 4QGMA 3FZ3A 3I58A 4FBFA 3TO7A 1F5TA 2ETHA 1WRJA 1ZREA 1T0FA 5HLHA 3WTWC 3JZVA 4PDKA 1JE8A 3IWFA 3VODA 5DUIA 4ENMA 2ETEA 2M5WA 4ON0A 4MQ9F 3O6BB 4EWAA 1BBYA 3I59A 4CHUA 5E17F 4A6DA 5HDNA 1BOAA 3NRVA 4A0ZA 1EH6A 2CFXA 4IEUA 2VECA 4HF1A 2KJCA 4JTOA 4KFCA 4KYWA 3T0YA 2OZUA 3JSPA 4UVAA 3WTZA 2FMLA 3I59B 1AOYA 1UIKA 1V4RA 1BI1A 3HRMA 3S7IA 3WE3A 5JFRA 2QWWA 3HRSA 4MEYF 1G3WA 2GA2A 2XKPA 2K4BA 1ZN2A 3UKVA 1LDDA 2BYVE 2NNYA 3MYXA 1HW1A 4A6EA 5LHIA 3BJOA 3R0JA 3FMSA 3FXQA 3LOIA 1DPUA 1LEAA 4XBFA 5E20A 3JAMZ 3TNPB 1H0MA 3MAJA 2P5LC 1XSXA 5L3BA 2STWA 3ZMVA 3H3UA 1RNLA 3C1DA 2QDRA 5FLXZ 1WGPA 3F3XA 2Y0MA 2J5OA 1YG2A 2GIVA 2OD5A 3KFWX 1X3UA 4XEZA 3J7AO 1K7AA 1LRHA 3FXUA 3EQEA 5A2QZ 2PMHA 1YS7A 2P7CB 2B8MA 4HV5A 3V7RA 4A5MA 1VR3A 2RC4A 5D6FA 4YARA 4UVCA 4S05A 2QQ9A 3LA3A 2K86A 5BV6A 4HV6A 1J58A 4GYGA 4R79A 2B0LA 1Z05A 2F5FA 4Q0PA 1XMAA 1FZPB 3G73A 3GW2A 2DT5A 5ED4A 2PMUA 4PGGA 5HS9A 4XSXF 5EFUA 2VPVA 3UKTA 2IXKA 4E2QA 1P4WA 4A0YA 5TRDA 3H3ZA 3J80Z 4I09A 2EK5A 4O9EA 3RIRA 3HT2A 3IL2A 1S3JA 2KXLA 2VC0A 1ZGJA 2Q1ZB 1IN8A 1XGOA 1QQIA 4EGYA 4PJYA 1S7OA 3HOSA 4HDUA 1D8JA 3FM5A 2QBYA 1Z6TA 3N97A 2ISYA 1KYZA 4EJWA 2HR3A 2PAMA 1U6GA 4ZYHA 3GFIA 4FT8A 3NKTA 4RAZA 4KIGA 1OFNA 1IRFA 2JPBA 3BPZA 4XETA 2JRTA 3M3IA 2CV6A 4HMZA 4EWEA 1XCVA 3WGIA 4GO1A 3ZQ7A 1KU3A 2TDXA 4AWXB 5JI6A 5LHGA 2Z33A 1EH8A 1OYIA 3V7CA 2Z9OA 3K69A 3IBMA 3ST7A 1HXDA 5TJJA 2EVXA 4X6RB 2CAVA 1LB2A 5FQ0B 1P4XA 1NYWA 3TO9A 4BAYA 1XGSA 3TQNA 4EVIA 2BNNA 4CO8A 3I0TA 4E70A 1HW2A 4JBAA 4M6YA 4RGUA 3OGJA 3MCZA 1TLHB 4AIHA 4YFNF 5I8SA 2VQAA 4IVNA 3OCPA 1FBUA 5LHHA 2A3SA 4Q0QA 2VE9A 2O1QA 5J7MA 2VBXA 2QNKA 1J3RA 4UBHA 1D5VA 4AVCA 1LVAA 3CDHA 4KT5C 2Q4SA 3ZPLA 2R3SA 3F6VA 4ZZDA 1FLIA 1ZG5A 3FZVA 1JUHA 4ETSA 1HSJA 5I0SA 5E8IA 5KBFA 4H0EA 3CLPA 1HKQA 1P4AA 5FD6A 4WXCA 1VTNC 4WK8F 2BNMA 1P2FA 2BE5F 3M70A 2ESNA 4M72A 1TNTA 1SQ4A 2K4JA 1E2XA 1G6NA 2UWMA 1OPCA 2VODA 2RDPA 3KETA 3MZHA 2ZBKA 3U0ZA 3LA7A 4JV4A 1MDMA 2CSOA 2PHDA 5D8KB 3KMHA 3I7DA 5ERIA 4L18B 1J1LA 2O0YA 2IA0A 2HWVA 3IWZA 3HRTA 5KHKA 4RB1A 2OA2A 4P9FA 1WLTA 1HSTA 3SCGA 4K2EA 3PLQA 1R36A 3QU6A 1J5YA 1YHFA 2FNPA 5CJ9A 1BM9A 1FNNA 3ISPA 4FAHA 2P17A 1I1GA 4U0WA 4O3MA 3ROUA 1EP0A 1CAUA 2PHLA 4ENJA 1DGRA 3HSFA 3T8TA 4LMYA 2BBYA 3B02A 3HTUA 5HLGA 3I4PA 1CX4A 4A12A 3H50A 2X4HA 2OU2A 4XFBA 5KVRA 4G7OF 5I93A 1BI0A 2ZO4A 3BPVA 1KQ9A 1R5HA 2DQLA 2UXXA 3QRFF 4G94A 1PP7U 1EYBA 4HZFA 3QACA 1C0WA 4KU8A 4D0PA 2FMYA 1J7KA 4OIRF 3GYHX 4JTNA 2HTJA 3V8JA 1MJBA 3H1MA 1MD0A 1XGMA 3LWCA 1YIOA 1L3LA 2A68F 3WGGA 2W84A 3RDIA 2QCSB 1XDSA 4Z82A 5I0UA 3NEUA 2P7VB 2Q0OA 5D5VB 3GFMA 3DEUA 3WTSC 3MDPA 3SMHA 2F5EA 2KRFA 1CGPA 2GC2A 5EEHA 2UXNA 5D8LB 4XF9A 2DO7A 4B09A 1IN5A 1G3SA 1H9GA 3PFIA 4AIKA 2P5VA 3NJZA 1Q3EA 4LJZF 3SHRA 1FX7A 2Q30A 3JSOA 1RIOH 1U3EM 3HSRA 4YFXF 5H6QA 2DTRA 2ET1A 4BHBA 2B5HA 1B1BA 2EFOA 2J5PA 3KP3A 4UNOA 1L3JA 3E5XA 1CF7A 1KU9A 3E97A 1WQ2A 1SMYF 1DDNA 3EHKA 3R60A 2CO5A 1ZZ8A 2A6HF 2HTSA 4MH0E 3EYYA 1IN6A 2E9QA 2K0GA 5L3DA 2VOPA 3WU0A 1UD1A 1SD7A 4KN4X 3RI4A 3Q5FA 4AVAA 3RKXA 4LUKA 1ZRCA 2RKHA 3QOPA 2ET7A 5BPXA 2ELHA 1R23A 3SXWA 2Y48A 5FLHA 3H9AA 2V1DA 2DI3A 1YW9A 5J48A 4QLCU 4IHTA 3LAPA 2WTEA 4XF4A 1T98A 4UV9A 2A61A 4L2NA 4LUMA 1IAWA 1UHMA 3LFKA 3QP6A 5CVIA 3T5XA 3S7EA 1RTVA 4HVQA 3FX3A 3V4GA 2JZYA 2MH9A 2GU9A 3HTSB 1K79A 1T6SA 2XUBA 5L3CA 3AAFA 4EQQA 4MNUA 4ZYGA 1KQ0A 1GQHA 4ZU7A 1YFYA 3P9CA 3CF6E 2CGPA 3F8MA 3CUQC 1I27A 4MV2A 3ELNA 4R52A 3ZMSA 2IA1A 2FSWA 5E8GA 2DPUA 4IEQA 4IEYA 2Q0AA 1B4AA 3MWMA 4XRFA 1UB9A 1YLLA 1X8MA 2LF8A 2K27A 3RKYA 1DUXC 2HEOA 4XFCA 2GAUA 3Q9VA 2D93A 5HI0A 1ZZ9A 4B8XA 1I6XA 2PAKA 4YYOA 5K8SA 2PI0A 1O3QA 3KLOA 2FNAA 3ABUA 2YSRA 2M30A 4YG2F 4MZUA 3DV8A 3CUQA 3DL3A 3EETA 1YTYA 5F64A 3KP7A 2IXHA 1R58A 1KA8A 3ULQB 4ENNA 1FXZA 5L3EA 2CG4A 3RZZA 3ZMDA 2W85A 1SFUA 3FHIB 4NQWA 2FQ3A 1BJAA 4M6XA 5JR3A 3GZ5A 4IEXA 5FCCA 3OTFA 3RTRA 2K7LA 4BYYA 2HDCA 3BALA 4CGZA 2FE3A 2PG4A 4P96A 4RB3C 4PGHA 3J81Z 4HYEA 4NVPA 5JVTA 4ZU4A 4ZZLA 1H1MA 3FHZA 5CVVA 2O6GE 1R5GA 5HLIA 4MX3A 2C0ZA 3WTUC 2PFBA 2GC3A 4WVZA 4MHGA 1HKSA 1FBQA 2GXGA 2MH2A 1GHCA 1YFUA 2O3FA 2KIMA 2DK5A 2KJBA 2I45A 2H09A 3GXOA 1TQ5A 3IKVA 5D5WB 5ICCA 4M73A 5FFZA 3JTHA 5DD8A 3REOA 3GYDA 1LEBA 2VONA 3ES4A 3RYKA 2F5CA 1O5LA 3H1WA 4LLOA 1NE6A 2D2WA 2M8EA 3WTXC 2Q2EA 2IA2A 2IXJA 2L3DA 4HN0A 2JPCA 2QQAA 3ECOA 4XFFA 1Z6RA 4OIQF 1AWCA 3K2ZA 4QGNA 3EYIA 5HS7A 2M45A 5HOOA 3G7DA 1D3YA 2LF7A 1FOKA 2MC3A 1W7PD 2G9WA 2PTMA 3PVBB 4MGYE 4HAMA 2NAZA 1YW8A 4LLGF 4OIOF 1SD6A 1GQGA 1UCXA 1RUOA 1ZH5A 3KE2A 3BDDA 1MJ9A 4F8AA 1U8RA 1TQIA 3KEOA 4DNCA 2WFPA 4XF1A 4G6QA 4FX0A 3L09A 1ZG1A 4KN7X 4EM0B 1HW5A 4AD9A 4L9JA 3ZDSA 1FT9A 2UY8A 4L9NA 1ZAOA 1XDUA 5E1XA 2Q8KA 3R61A 4B29A 5LGUA 2P6TA 1JGSA 5IT9Z 3ACLA 4XFIA 5CVJA 4ORFA 4IESA 5H6RA 5BPIA 5IT3A 4BNCA 1B9NA 4GXOA 4EWDA 4A2UA 4IRGA 5LEJA 1H9TA 4LK1F 4OIPF 2Z2SB 1W7PA 3ETQA 4IEPA 1WKMA 3RYRA 1J3QA 4ESJA 1QO0D 4RGSA 4L5JA 3LAJA 4PIYA 2XAHA 4Y13A 2LKPA 2DFIA 2O03A 1XE8A 2XVCA 4KIBA 3GVAA 3V7SA 4HLTA 1Z7UA 1ZZ7A 1GXPA 2EA4A 3HUGA 4AQ6A 4QWQA 3EUHA 4D7TA 2E7XA 4U0VA 3LZZA 3TOAA 3SZPA 1IXCA 1BN5A 1KU2A 4E2GA 2L4MA 2OQGA 2ADUA 2PJPA 5HDKA 1IXSB 4Y17A 1IPJA 2XLFA 2DAOA 5J6XA 3OOPA 4I02A 1K78A 4Q5SF 2XAQA 4OLLA 4U88A 1OMIA 2KKOA 4G7ZF 1PP8F 4XFAA 4IEWA 2WV0A 1FY7A 2YR2A 1ZX5A 4Y15A 2YX7A 1LJ9A 5LGTA 3RKWA 1S8NA 2A5YB 1Q43A 1TQPA 1R00A 3ECHA 3O14A 2R7DA 1P6RA 2PEXA 1DP7P 2FQPA 1OYWA 1XSDA 2GQQA 4HVOA 4IEVA 2RVCA 1XE7A 3JAMK 3KLNA 1U12A 5KHJA 3FJSA 4Q29A 4CICA 5K1YA 1EV7A 3Q9SA 1UHWA 4FHTA 1TNSA 3LA2A 3TOBA 4FAGA 2DW4A 2XASA 1XSVA 4KDPA 2MHFA 1OYYA 3SHFA 4P5OA 1CAVB 3LQQA 2Z99A 2D40A 4U7DA 4CZZA 1LNWA 3P7NA 3WTTC 2IRFG 4TV7A 2YX4A 5AIQA 1CAXB 1BC8C 3R4KA 4ESBA 3CO2A 5BMZA 1SD5A 4EROA 3UKNA 2VT3A 1G3TA 4BQAA 2VN2A 3GWZA 3WW1A 4I2OA 1ZARA 4MUVA 3SQNA 5HDGA 4MTEA 1FYKA 1JHFA 1ZVFA 4HW0A 5BQTA 2CAUA 4P9UA 3M8FA 2PFWA 3I64A 2F5DA 2EV5A 4IEZA 2HOEA 5J8CA 3F23A 4I3PA 1ZZ6A 3BWGA 5LBQA 3BB6A 3NSTA 4GULA 4LA3A 1W5TA 3S2WA 2IXCA 5CU1A 4QMAA 4RGXA 3U1DA 4P9GA 3FFQA 3R6SA 3M1EA 1QBJA 1NHAA 1SFEA 4HSLA 3ABTA 2UY9A 5D5UB 2G7HA 3NL1A 5EEGA 1MKMA 2STTA 4AVBA 2FBKA 2B9UA 4JK1X 3EBRA 3IDCB 4H7LA 4LFUA 3VB2A 4BHPA 4EJTA 2OYZA 1FYLA 1TQMA 3E6BA 4YFKF 4WXHA 1KQ8A 2P4WA 5KHIA 3L2CA 2H94A 3WTYC 1ZRFA 1TTYA 3COAC 2M87A 5BXXA 4MGRA 2FEZA 4BHCA 4LG0A 5FO5A 3ZN1A 1BI2A 1T39A 3H1YA 1CAWB 3CEWA 2HKOA 5E1RA 2F4PA 3DPLC 1XD7A 3GFLA 1HBXG 4LB5A 4WCGA 2DBBA 4L0YB 3U2RA 5LRSA 1HQCA 4I98B 2QZ8A 1O3RA 3FXRA 4N9HA 4U0YA 2JTVA 5FB2A 5BY5A 3WE2A 2D5FA 1SMTA 2FF4A 4OOIA 2QUFA 1R22A 2XHKA 4KWLA 3GLXA 5ILUA 4G7HF 2ISZA 2IXLA 3I54A 5KK1A 4A5NA 1YFXA 3DN7A 1QY4A 4ASNA 2FOKA 3K1NA 4WX9A 2ZKLA 2GWRA 5I0RA 3OF1A 4Q4ZF 4EV0A 3CL1A 4LK0F 5JSPA 1OR7A 3HHGA 3HHHA 1QWRA 4IEOA 1IF1A 1FSEA 1ULYA 1X82A 1RC6A 4R1HA 5DCMB 4I7HA 2VE8A 4RB0A 5AVPA 1SFNA 1Z9CA 3E5QA 4ENKA 5FD5A 1E17A 1DGWA 5DCMA 1R7JA 1CAXA 3O2PE 3VEPA 4A0XA 2F2EA 4LG0B 1JXSA 4HF0A 2RNJA 4WBBA 2IPQX 2LDUA 6PAXA 3BOQA 1O4TA 1CAWA 5ICGA 2UYAA 3D0SA 2L4AA 2X0LA 4N9IA 1WWXA 3DFGA 2OPKA 5ICFA 2Y75A 2O8XA 2Z5UA 1MZBA 2XL7A 1GXQA 3KGZA 1V70A 3TKYA 4YRDA 4RAYA 2ZXJA 2VBYA 2NRAC 5JAXA 1D8KA 4MGZE 5K5QA 3OV8A 4K8FA 3BJAA 1ZHFA 2HFHA 4FX4A 3ZN0A 4L9TA 3IRQA 5CADA 3CLOA 3QP5A 1PUEE 4O9GA 3M9AA 1T2KA 1MDMB 2V09A 3TGNA 2XROA 1Y9QA 4P55A 1PMIA 3WGHA 2ATFA 5FDBA 1TW2A 1P92A 2MD5A 5A2QK 5I8TA 3G3ZA 3GEZA 3F21A 2Z69A 1K6OA 3IDBB 3NW4A 2RV8A 2R7FA 1B9MA 2COMA 3LWFA 2XAJA 1F4KA 5D6EA
chains in the Genus database with same CATH superfamily
2ZSIB 3PNAA 2M7AA 3FF5A 1EPZA 2EXKA 2ZMEB 2UWAA 2A3XA 3NWKA 3B93A 4LLLA 5EXOA 1PJRA 3A0HC 4FPFA 2L7MP 4CEWC 4B44A 3E3VA 1BJQA 4BIFA 5IP9J 4OUMA 2R043 4MHRA 1MBJA 1WW5A 2YBKA 1F35A 3JREA 1JOBA 2MA3A 1AU7A 4HQMA 1GOFA 4CDGA 1CQ9A 4HVRA 2Z3YA 2YDEA 1LOCA 2LSOA 2WR9A 1OA2A 4AFDA 5E88A 2QQOA 3NVCA 1ZBA3 1X1DA 3A0NA 1LQ1A 4AVPA 3LQCA 1SBFA 3GTQJ 4JDOA 1TMF2 3OSGA 1OR7C 4UAPA 4HSJA 5FUPA 3N35A 1SVMA 3RMYA 1VQNI 5FY1A 5F37A 1D5YA 4FXGB 2Y30A 4Y22A 3N7KA 2VOOA 4OU0A 2E1MC 2BVVA 5E3OA 4QDRA 1YO5C 2R7VA 1RUF2 1JYXA 1DZTA 1W0PA 2Z79A 3L2HA 2Q5TA 4XNFA 2BY1A 5ILSA 2PYTA 5DM7F 4PDWA 3CHXA 4BXXJ 4Q0UA 3H3VK 5I0TA 2GNDA 4Z2YA 5LB6A 2ZX3A 1FSHA 2ZJPF 1B72A 4RQPB 2JWTA 2Z16A 2XLAA 2PLV2 1O57A 1ENRA 4IJAA 4QIWN 2GLOA 1CZVA 1W9FA 2V9PA 5JSOA 2DCZA 2BXYA 1AR82 1G4DA 3D5SC 4B1LA 2RN7A 2FCUA 2DWRA 4META 4B47A 3Q8CA 4N53A 5EEAA 4HOOA 1ND2A 4UVBA 1WSUA 2DVDA 1BW6A 5DMYA 2GXBA 4QHBA 1E3PA 3L2VA 4AAXA 5FY5A 3E1SA 1MBGA 4IEJA 1YI2I 3N05A 4FXKB 5H9RA 3ZIWA 4LBLA 3W2VA 3WQBA 2ZCWA 2ZXWH 1JZ6A 4AXOA 3OYEA 2EZKA 2XRNA 3WU1B 3BPXA 1CWPA 4LT5A 1R71A 4GH4B 4RHV2 2ZMNA 3CJNA 3OSFA 3BTZA 4YG0A 2Y0SN 1ZNPA 4XDQA 2EV6A 2VJXA 3VL8A 4JRAA 3HR9A 1QQP1 1REFA 3U10A 1QU3A 5IHRA 5CBLA 4OFGA 4NHJA 2DFCA 5A6ZA 1V6KA 2ELKA 1E5RA 4LA2A 4A3XA 4J19A 4M9ZA 5FP8A 2VZTA 1V5EA 3L2YA 3VOEA 3CZJA 4HPQA 1LESA 1TZOA 2JA7J 4U7BA 2J42A 1CN1A 1K4SA 3WHUA 4ONUA 1W28A 4ZTFA 2QENA 4GH4A 5DDJ3 1D4M1 2LY2A 2GN3A 5CISA 1RUNA 3TAYA 3ZMZA 5FK7A 4DXRA 1ETYA 1IRGA 4XOPA 3O1VA 1GP5A 4PJLA 1NQDA 1Q8PA 4FFIA 4QHOA 3TBDA 3CCJI 2RE9A 1O3TA 4I0AA 2IXIA 4NPLA 1CAVA 4XABA 5T3NA 2O61A 1J9IA 1STMA 1W04A 3T8RA 2IBDA 4WWCA 2WYFA 4BUPA 1MSFC 5AVAA 5F1RA 5IFTA 2IC1A 5DZEA 4RBOA 5GPCA 1FWZA 1YQ5A 2YPJA 1AX0A 1X7NA 4A3JJ 5FKMA 3DP7A 1MNDA 1SAXA 3LIHA 2XRLA 5HCFA 4JX4A 5ERLA 4HA8A 3T0DA 3HNYM 4JVAA 1BK1A 2O7OA 4M0NA 3LSIA 2A5ZA 1NCQB 2ZX1A 4KWJA 2QQPA 1OVSA 4AW7A 5A1AA 1QZYA 1V6OA 5GLVA 4QB1A 3WV6A 2QSHX 2L54A 3OD0A 1EPWA 2V6CA 3VBFC 3ILNA 3DXUA 3OYFA 2W57A 3ZQLA 1ZLKA 4WZCA 2L9NA 3W6KB 4CYDA 3RWNA 2OAZA 1YQAA 3ZN6A 1NQJA 2JG9C 3NNFA 4GCVA 4IGQA 3RJPA 4GQ7A 1I3AA 3MZYA 2R063 1QJY1 5CYYA 3TN92 2BOJA 2YB7A 2D1HA 1FOD3 1NE4A 1XB4A 1JJ8C 5C4WC 3OYBA 5JXGA 2VJIA 2QLZA 3LIGA 4PK4A 2WO3A 2M1BA 1IRXA 5K7HA 4EATA 1F1ZA 2XUEA 1JYTA 1IZ3A 3FMRA 1UAIA 1YFHA 4PDWC 5JR7B 5IT6A 2A1XA 1OKOA 4ESFA 3V0BB 3ZMTA 1WWYA 3HIFA 4EJUA 5K0UC 3D3AA 3FFZA 4BXUA 2P4EA 2DMTA 2QJVA 2OA4A 2FHRA 4GWIA 4PBOA 4B48A 3IKWA 1ETQA 3DF8A 1R1UA 2DCKA 1PGL2 1AHSA 1PUFB 3HSEA 2X6OA 3IIIA 3OGRA 5F2WA 4URAA 2XL9A 3KS7A 3Q3SA 2DYCA 2Y0OA 3KD4A 2KL4A 4KMFA 2OW4A 5LGNA 2LKXA 1GVJA 2QCOA 2YXSA 2TRTA 2LH9A 2EICA 3C2BA 2GSYA 2XAUA 2QBXA 1ODNA 4UUVA 2Q8EA 3A4UA 2VQLA 2OBPA 5JVGF 4KICA 3HRUA 2L7KA 4NQWB 1XPWA 1T38A 4RMNA 3SKVA 4D6RA 2XIGA 3O8HA 2Z1DA 5FY0A 3BCWA 1OI6A 2BZTA 3QH7A 2HWF1 2DK8A 1Y8QB 4I3GA 1U5IA 2NVXJ 4QPGC 1RUD1 2WO7A 3S0MA 1H30A 4YIFA 5DD4A 1N75A 4NB5A 2B63J 3J7MA 4IRIA 1H2KA 3ORJA 2VCCA 3Q0UA 1OD3A 2HYJA 2JG8A 4ZXKA 4NO4A 4R4XA 1EH7A 1SLAA 4MG2A 4XZPA 4IV1A 5ABJC 3M1CA 2H8RA 4RR3C 3KVBA 4XMAA 2A3YA 4G12A 2QVOA 4BDZA 4BA6A 4N43B 4Y7NJ 5LATA 4EM2A 4EJVA 3B00A 4N0BA 2DLLA 2AXLA 2HQRA 3ZQCA 4BY1J 3DU6A 2W0XA 3AL5A 4UT5A 4HX4A 2VC9A 2D6NA 3FM3A 2M0CA 3P9IA 4D7SA 4KQ7A 3H8OA 4DUXA 2OV7A 3C2HA 4PI0A 5IK4A 4IXAA 3A1YA 2CSGA 5LK7B 5DUKA 1OLME 1Y4WA 2VULA 1ETWA 4BJ0A 2R5YB 3ZYFA 1VQ5I 4XUOA 4ZZ8A 4AUXA 2W1OA 2UU8A 2N7GA 1VQ8I 4X0GA 2Z42A 3DYPA 4PI2A 4L97A 5D21A 1WCQA 2CWEA 2ID3A 4CCLA 4QX7A 3HT1A 3P3NA 2JE7A 2HZTA 4LBQB 3DTIA 1I5ZA 3L9FA 5GP9A 1K4TA 5BNOC 4P9IA 4UHTA 4UFHA 1TNRA 5CKNA 4YGBA 5DV5A 1RYYA 1YLFA 2RJLA 4UBGA 3VBHC 3KF5A 1FI2A 2W94A 1GUUA 2V7FA 1RHI2 4LR4A 5LWBA 5A3MA 1OCPA 4W65A 3LSMA 4BQNA 3E6CC 1C1LA 5BNOB 3W21A 3KSCA 1NXMA 3DXTA 2JJ6A 1RPWA 3MBWA 5E3MA 2R041 3MW3A 2DF7A 2HOSA 3KGLA 1USTA 4QTRA 4F93B 5BPDA 3ZO0B 1PM7A 1VQ4I 2FA5A 3MN2A 2ARXA 2C6SA 1RZ4A 1RUI2 3H1CA 4DQAA 1GZ9A 1MEC1 3ASOH 2L7FP 3F8BA 1QNYA 3MF9A 2MG4A 3N4MA 5GZCA 4UB6C 1R091 4PSWA 4HBLA 1UY2A 1D1AA 3FE5A 3K0LA 1ERDA 1NCRA 1CX1A 4E4DX 5A3UA 2MBFA 3HOWJ 4XLCA 2QEXI 2ZNYA 2GC1A 1WFXA 4P08A 2CDPA 4MXWA 3BTXA 2HXOA 4FQGA 5C9AA 4I0BA 2EIGA 4C90A 3SFZA 2ZMLA 1V3FA 3M2MA 2W7NA 2VBZA 3H8UA 3JBG2 2C9AA 1UPIA 2G4IA 3J81K 3IAQA 1FPQA 3POSA 5D4SA 3FXJA 2QYOA 2O5RA 2JIGA 3B6CA 4FFHA 4V19K 1GDTA 2O8OA 5C70A 4IERA 4AI9A 4CDUC 3PNVA 2VT2A 2E19A 1FYMA 3TN91 5EGOA 3I3QA 1FTZA 3J9SA 2LRPA 1I39A 2DA4A 1IS3A 3D8CA 3I3DA 3OS1A 4Y1VA 3BZCA 3TO7A 3ENRA 1DQ2A 2ETHA 5FROA 5LY1A 1JE8A 2KR2A 2WWUA 3ZYGA 5LY2A 3IWFA 5FXZA 2M5WA 5E89A 3M3CA 4MQ9F 2V6EA 2VMIA 3ZFFC 4RYDA 3I59A 2UV1A 2VBDA 5J4VA 2VECA 4E4ZA 4HF1A 3JRGA 4JTOA 3ZXKA 3T0YA 3KYCB 4C2TA 3DTKA 4JOMA 4UVAA 1XQNA 3INAA 3S1NJ 2WQ4A 2B4KA 1UIKA 2M4KA 2Z5WA 1V4RA 1GLNA 3HRMA 3S7IA 5JFRA 1AYN2 5F0HA 3QWLA 3S3NA 4MEYF 1EV13 4AI2A 1YJKA 3ZFEC 1XC6A 1LDDA 1HW1A 1TME3 4A6EA 4UW5A 3BJOA 3T08A 3FXQA 1DPUA 4XBFA 5E20A 1DQ1A 1KS5A 1XSXA 2MC4A 1OURA 3WT3A 4XN3A 1D2SA 3T30A 3C1DA 1FOYA 5IK7A 3F3XA 5FZFA 5C4WA 2Y0MA 2J5OA 1YG2A 5HXVA 3ZSMA 4CCKA 3VDAA 3I3BA 2OD5A 4LBOA 3KEYA 3PIOF 4XEZA 3HEFA 3FXUA 4XQWA 2LFBA 5JLXA 4UFMA 4NJ4A 1W6NB 3OBRA 2DUOA 4COZA 4DUVA 3V0AA 5BNNA 4FTBA 2LROA 2ZGQA 4HANA 1VR3A 2RC4A 4UVCA 4HL0A 5AFBA 2K85A 2LM3A 4KISA 4GWJA 4HV6A 1CPNA 1J58A 4GYGA 1JHNA 5FZ3A 2DA5A 4COVA 2GNTA 4Q4V2 1HN1A 2XBO3 3A21A 3HG9A 1FZPB 3GW2A 3WG3A 3SZGA 3ZQFA 1R64A 1EUUA 5AC93 1BMV2 2QQNA 5DXDA 3UKTA 2IXKA 5FYCA 1P4WA 4A0YA 4D94A 3NNJA 2DMUA 3VBUB 1WJBA 3TB0A 1FMVA 1VQ9I 4O9EA 3VZOA 1OBNA 4LE3A 1ZGJA 2HLEA 2WA4A 2YYOA 1XGOA 1QQIA 1WMFA 4EGYA 4PJYA 1ND2B 2QBYA 1COV3 2ELJA 3MKWB 4XQFA 4HT1T 3HOXJ 2FUG2 1WLCA 4FT8A 3NKTA 5FWEA 3ALQA 3MIBA 3BTCA 1OFNA 4BDVB 1IRFA 2JPBA 4HMZA 5FZ4A 3L2RA 4AEDB 1XCVA 1H88C 1AYM1 4GO1A 2W4SA 1W2NA 3ZQ7A 1LVKA 4AWXB 2P37A 2DYSH 1OYIA 2Z9OA 4AR2A 3ST7A 5FJKA 4R4ZA 4X6RB 2OUMA 4XBLA 3TO9A 1U9NA 1XGSA 2MD0A 2BNNA 4E70A 3ATGA 2VXRA 4JBAA 2TBVA 2DU0A 3MCZA 4AIHA 4FTSA 2NXNB 4YFNF 1KEXA 2VQAA 1DYKA 1FBUA 5LHHA 3OCPA 2A3SA 3PVEA 4Q0QA 5J7MA 1X1CA 2VBXA 2VUDA 3VPRA 4A41A 4XTPA 3ZPLA 2R3SA 3WD5A 1HSJA 1U8BA 4H0EA 3CLPA 1EKEA 2JN6A 1HKQA 3RZKA 1VTNC 4WK8F 1P2FA 4AEMA 1TNTA 3RQ0A 1G6NA 1WCSA 3BG9A 2HWD3 2VH9A 4CUGA 3TP0A 2D43A 4LKEA 3SJMA 1VFCA 4E8DA 3S30A 1MDMA 5FJHA 4V2WA 5D8KB 4FP2A 1PMHX 1WI3A 3VZKA 1CIWA 3WDYA 4L18B 2IA0A 4D3WA 4RB1A 2OA2A 5CEHA 3NQHA 5LW9A 4P9FA 1WLTA 1MVQA 1HSTA 1WJAA 1VAKA 1R36A 2ARBA 5A7SA 1CQTA 3KV5A 1IS4A 4QX8A 3HPNA 4YWAA 4IE4A 3WDXA 1K6YA 4O3MA 1GANA 1BJZA 1Z77A 1CAUA 2AEYA 2WABA 1DQUA 1FTTA 4HSTA 3S93A 4A69C 5KR7A 4LMYA 1NK3P 3B02A 1IUFA 2HWB2 1ZTRA 2W52A 2LY1A 4RSUA 4BBSJ 2XB5A 1A8DA 1XX5A 3OYMA 2W3JA 5IVVA 3BUCA 2BQPA 4S2FA 3QPLA 1GZCA 5K0UB 3K4ZA 4FPCA 5FYHA 4IE6A 1WJ5A 3AVSA 1R5HA 2DQLA 5KHDA 3QRFF 4YW2A 2IEKA 1AHDP 5D2AA 4IV1B 2FMYA 1WPKA 1FMWA 2LLKA 3LFUA 3RZOJ 5LBCA 3GDBA 2HTJA 2QQ8A 1PYVA 2AACA 3CCMI 2ZHNA 1MJBA 1QDOA 9ANTA 2LALA 1L3LA 3PTRB 4DZPA 1RUH2 2WA0A 1XDSA 5FKLA 3NEUA 2W39A 2P7VB 4BM8A 3R4DB 4NAMA 3DEUA 3WTSC 4G9SB 1VBD1 2JEMA 4IV1C 1MSEC 3E7LA 4XF9A 4LHLA 4B09A 1G3SA 4FE4A 1E5SA 3PFIA 4AIKA 3NJZA 1EUTA 3KWVA 3OL4A 3CZ6A 1U3EM 5H6QA 1IKQA 2GN7A 2DTRA 1PVC2 3N7LA 4ARXA 2EFOA 2J5PA 4A3GJ 2Y69H 4EQVA 1CF7A 3E97A 4HK8A 1UZCA 1AYN1 1SMYF 4C3HJ 3R60A 2CO5A 4Q4X2 1IN6A 2PXJA 4P9JA 3IAPA 4PFPA 1HA8A 5L3DA 2VOPA 2Q2EB 4NC8A 4UUSB 1SD7A 3WCSA 4LUKA 1A31A 4UF0A 5FZ1A 3FXKA 1ZRCA 2RKHA 3QOPA 3AYAA 1QNWA 3ZXFA 3L2UA 2R7UA 3IH2A 4E4SA 3ZKYA 3H9AA 3VD9A 3K10A 2R7EB 4LK6A 2A61A 1AR62 1IAWA 1PVC3 2A75A 2X48A 1I3QJ 3ILFA 3I49A 5F27A 1H2MA 1LU1A 4B3NA 1RTVA 1IS5A 5FMOL 3T2PA 4W6XA 3CDIA 4A7YA 4SBVA 4CZSA 3V4GA 2MEV2 2NMOA 2GU9A 3PUQA 2KT0A 3HTSB 1K79A 1OHFA 2XUBA 5L3CA 4QX0A 4EQQA 3MGUA 2CGPA 3F8MA 1XNTA 4UWDA 1I27A 3K2AA 2DURA 4Q4Y3 2FSWA 2ORXA 1C4RA 4BMBA 2FCTA 2Q0AA 3MWMA 3EUAA 4P9LA 3RKYA 3ERMA 2HEOA 4QPIA 3TN93 3Q9VA 5M5WJ 2F6BA 1ZZ9A 4YVSC 2QUOA 1OA4A 2IGMA 4A6OA 3MI8A 2M30A 3K6GA 2RV9A 4YG2F 2ZMKA 3Q8BA 2W68A 1C28A 4MZUA 3DV8A 1VQKI 3B7MA 3CUQA 5GM0A 4FPKA 3KP7A 2IXHA 1KA8A 3ULQB 2O8KA 4C1XA 3AVRA 4RLQA 3QPSA 5L3EA 4TXWA 1SFUA 2JIJA 4J25A 5FCCA 4XK4A 3RTRA 4LBQD 3T1LA 4CGZA 2ZX0A 3M3OA 4P96A 3K51A 4FSJA 5FPAA 3MIHA 1VRH2 3J81Z 4QAWA 3J8F2 3N9LA 4ZU4A 4IZZA 3FHZA 5CVVA 1UELB 4J00A 1R5GA 2O6GE 3GTLJ 1PZ8A 3WDUA 5IOYA 2OTLI 3PSFA 3IH3A 1HKSA 1FBQA 3EXUA 2JDNA 4RQPC 4YGDA 4PLNA 2W46A 4NHMA 1GHCA 3VZNA 3WEZA 3W20A 1TME1 2O3FA 1Y56A 3WF3A 2I45A 3GXOA 1TQ5A 3IKVA 5D8AB 5FTTC 4IHYA 2HWC3 2RS33 3ZXSA 3JTHA 5FPVA 2DTWA 3REOA 1LEBA 1PO12 4BWOA 4MHUA 1JKRC 3OOUA 2A6YA 2OKXA 1SVLA 2SBAA 4BGDA 1FEXA 4HN0A 1CR7A 2VMHA 2QQAA 4XFFA 1AWCA 1IGNA 2R93J 2DTYA 5HS7A 2PMZN 1XJAA 3ZSJA 2WA3A 4Y26A 1FOKA 1BLZA 4MGYE 4N4NB 1QVTA 3PJQA 3ME2A 1S9HA 3JR9A 4URTA 1REDA 1D0YA 5HODA 1A78A 5FY9A 3WG7H 2DDBA 4XAAA 1MJ9A 4MXVA 4A3KJ 4HETA 3KEOA 4DNCA 2V4JC 1R9TJ 4XF1A 3CU7A 2R1DA 2VLAA 4FX0A 4K7JA 1Q8OA 4EM0B 1B72B 3OYKA 4WM7A 3ZDSA 1COV2 4DUWA 3H0OA 1RUD2 4L9NA 1ZAOA 3AZVA 1GV9A 2D6KA 2X8KA 1XDUA 1R093 1OPMA 1JGSA 1JZ8A 2P81A 1HB3A 2A6VA 4C1WA 2DCJA 5M0TA 2DJIA 1B9NA 2VQTA 4IRGA 1H9TA 3WXPA 3RZJA 1W7PA 4NOTA 1M06G 1WKMA 4GD4A 3KCXA 4ZS2A 4BQ1A 3C7EA 3AB0A 2XBO2 3S8PA 4EJRA 1LGCA 1OC1A 1R083 4Z92B 2XVCA 3V7SA 1Z7UA 2ICWG 5JIAA 2Y6LA 3ZYBA 3LFIA 5IUQA 4A93J 1IXCA 1BN5A 1VQ7I 4NRMA 5GTHC 3MFCA 3CCEI 4XBQA 4NIAA 5LASA 4KITB 3GALA 4Y17A 2YV8A 2NS7A 1W6OB 2F5VA 4Q5SF 3MF6A 4OLLA 1PP8F 4AQTA 2ZJQF 4LKSA 1ZX5A 3VBFB 1W8UA 2OCCH 4WM7C 2JA2A 3AG1H 2JDPA 3ECHA 4TN7A 4R9AA 3QD6A 3F95A 2RM22 4CCDA 1DP7P 5JOXA 5FUIA 4XRMA 1XYOA 1BMV1 3VZMA 1CJPA 5ISLA 5GJ6A 2RVCA 2WFF1 5HXMA 1WGXA 1U12A 3FJSA 2E2HJ 4XHXA 1TNSA 1LGBA 4OYUA 3BOWA 3QYEA 1F5FA 1OYYA 3SHFA 3B9IA 1CAVB 3LQQA 2Z99A 5KAIC 4CZZA 2RMU2 1OQEA 2E6VA 2YX4A 1QQP3 4LNVA 3A23A 1KONA 1R5ID 4YW4A 3S5AA 4I99C 4DRVA 1C5IA 1DGRN 3SQNA 3USUB 1I5PA 1FYKA 1TT0A 3OPZA 5IY5H 3ZYHA 4N53B 1U9OA 3AL6A 3M8FA 2WDBA 2PFWA 2IAIA 4K20A 3N3HA 2F5DA 4IEZA 5F2SA 3ONQA 5J8CA 3F23A 2LTNA 3AMNA 5IVCA 2EIKH 5DUVA 3NSTA 4GULA 2J1VA 3QH6A 1G9AA 1W5TA 5AFEA 4RGXA 3VBHB 3AMQA 2HU9A 2PMWB 2L5QA 3M1EA 1RMU1 4HSLA 4MIMA 3TBIA 2X85A 2G7HA 5IK5A 1O6UA 5A3PA 1JH5A 2STTA 4INDA 2R4GA 5L19A 4A44A 5A70A 4DYRA 5JVVA 4LFUA 2ILMA 1RUE1 2P3IA 4EJTA 3VD5A 4OI0A 5KAFC 4WXHA 2XVKA 4XN0A 1ASJ1 5KHIA 3L2CA 1ZRFA 5T54A 2CL2A 1I9RA 1ND2C 1SFOJ 2BHYA 2QQIA 3CZUA 5DN2A 3JBG3 3I56I 3GJBA 2ZGPA 1GUIA 1CAWB 3CEWA 4RFT0 2JJ7A 4KWUA 2IXSA 2CQQA 1VQOI 4AQSA 4WCGA 2DBBA 1MMNA 4L0YB 3U2RA 1W39A 3J7NA 4HPKB 4Y4YA 1Z7S1 5ACA1 2CQ7A 2JTVA 3S2DJ 3WE2A 3HKZN 2E5NA 4OHYA 1R22A 2PHFA 4LBJA 1APNA 5ILUA 4G7HF 2DMQA 2ISZA 2BFUS 4F91B 1GZWA 1MEC2 5KK1A 2WNOA 1R49A 3W2WA 1UYPA 3POIA 2WBMA 2BXZA 2YC4A 2R1BA 4DIQA 1KGYA 5JSPA 1OR7A 2AENA 1FMD1 1XSQA 5C5UA 1VLNA 4OI1A 1P8JA 3U1KA 1YC61 1X4OA 2BERA 4ZC3A 3ZXGA 4A7ZA 4COYA 1UHSA 1V6LA 2ADDA 1FMD3 2QQKA 4RB0A 3GZTB 3H5NA 1XXNA 5IFPA 3G1MA 3QLQA 5FD5A 2JECA 3BLYA 5LA9A 1CAXA 1AJOA 3O2PE 3VEPA 4A0XA 2FOWA 4QQHA 2IPQX 2LDUA 3TYJA 3PUIA 4BMEA 1CAWA 4XMIA 4F3QA 2XVGA 3D0SA 3FLPA 2L4AA 2LOOA 1OJLA 3DFGA 3N9OA 4S2GA 1TWCJ 2XGCA 5ICFA 2O8XA 2VTFA 1ULOA 3KGZA 3TKYA 5LK5A 2HBTA 1JGGA 4OMDA 2NVQJ 2NQYA 2VBYA 4AWDA 3LD8A 2NRAC 3VDBA 3S15J 2OS2A 4FX4A 5CADA 3CLOA 3QP5A 3JCUC 1YQ8A 1Y9QA 2KRCA 2DVFA 3WGHA 3TL4X 1P92A 1VMFA 2DVAA 1V6MA 1RUF1 1PGW1 3G3ZA 2R7FA 1B9MA 2E2JJ 3LWFA 2VGDA 2XGEA 2EFNA 4ARYA 2OF7A 3I55I 1UFMA 1W2TA 3T1MA 3SDBA 5D5XB 3H9GA 4RS5A 2HGCA 3HL2A 2JA5J 3BROA 2WWSA 4CXFA 4CU9A 4OINF 3OR1C 2PN6A 3EJKA 4CE8A 4CEYA 2HS5A 2I2SA 2XJQA 5TISC 4ES8A 1IGOA 1UIJA 1NCRC 5A6QA 1OFSA 3HJEA 4PIXA 1N3OA 2P34A 5G04L 2MGQA 2X05A 3LEIA 4LPLA 1UYXA 4DQ2A 3LQRA 4JQTA 3U37A 1XE0A 3PIGA 4MGIE 4JP0A 4RDUA 4QXHA 5FO7B 5DAPA 1AUYA 3OL3A 5LFAA 4E9KA 5IP6A 2V5DA 3B73A 4CEYC 1QXJA 3ERED 1ZGAA 2CV1A 2VZPA 5JOWA 2EFPA 2ZAAA 5B4NA 3V64A 1S7AA 1Z7LA 1QPMA 2R49A 4BH9A 2F48A 3WHBA 1ZLJA 4HN1A 3KLSA 4OMZA 1G7YA 3AXDA 5FWJA 4NPMA 1ZYBA 4TWTA 2FDGA 1S0GA 4AI3A 1QNTA 1W90A 1YXWA 5L3GA 1AXZA 5LEKA 2IT0A 3WR0A 4DZJA 3AXEA 3WP4A 1GNYA 1MIJA 3H7YA 2YUEA 4JZRA 1NZIA 3THDA 1O7LA 1ZGWA 5C8WA 4YZ3A 3WVJA 4QWNA 3LSTA 4BE2A 1WLDA 3WQ1A 1KRIA 4JDNA 2X51A 1QXPA 4KNYA 4ASKA 4ANJA 2JUGA 4UXNA 5GLUA 3WW2A 4LK7A 2G7UA 2FJ1A 4UXAA 4NHLA 4N43C 3ML6A 3ON7A 1FPN3 3A02A 2IP2A 2OQRA 2L01A 4AGVA 4XLNF 1NG6A 1YUDA 1S2BA 5EJ3A 3UV9A 1OKRA 4J1WA 2CUZA 1UX6A 1RKWA 2W82A 3CF2A 1U5YA 3M4FA 5CKQA 4DXZA 2BWAA 1W0UA 1AL22 2WNEA 5FRNA 2SLIA 5DDJ2 3H8XA 2EPFA 2JDUA 3CO6C 1UW8A 2OVUA 1ZG3A 1ACIA 5K5OA 4JDMA 3UR3C 2ADEA 3HBZA 4XUTA 1MH4A 2P6HA 2FBHA 1XU1A 2RS13 4AVTA 2MYSA 4C2MJ 3B3QE 5JSRA 4EJOA 4DBRA 1ETVA 1RL3A 2E71A 2E1MB 3UKGA 3B01A 1VB4A 3S1QJ 1UOJA 4MTDA 3SZTA 1YWKA 1SLTA 1O4YA 2EQRA 1HDKA 5ABJA 1H4HA 3C18A 1DZRA 4PJNA 1AR63 2ZJCA 2NYXA 3U4SA 1R1A2 3IC7A 1YS6A 1XCBA 4UFLA 4AHWA 3FWEA 1D0GA 4DNYA 2BGOA 4Y20A 3MW2A 1TG7A 4B8EA 3MLLA 4ZH4F 1FMD2 5FZDA 4UY8I 2KFDA 2GC0A 1X9PA 1MH3A 1MACA 2CH0A 2BPA2 2VNOA 1IUYA 2EFQA 3U9GA 1ASJ2 1ZA7A 1QF3A 3F8FA 2D3PA 5EZHA 1WBFA 4ET7A 5L7OA 4JHTA 3AP7A 5F04A 1DFQA 5GALA 4YG6A 3WF1A 2BY3A 5GZFA 3GTKJ 3M3EA 3BU0A 1VBB2 2VZOA 4E7JA 3I2HA 3TWIA 1YRZA 3NAPA 4GALA 2WUHA 4BQQA 1ONAA 2D98A 2LNBA 5J36A 1TWFJ 4IHWA 1RJ7A 2JE9A 4AIJA 1U0AA 2CQNA 5FFOC 5CFCB 3O3KA 4WV8A 3ZMOA 4JYKA 2HVRA 4UV8A 5E6HA 3I71A 3GNEA 1XRUA 3GZAA 1Y9GA 3WQ7A 2M9HA 5APAA 1XN7A 4OHVA 4WVMB 1NTCA 3G4SI 2PX9A 3ZXDA 2LMDA 4R9BA 3LEMA 5JCTA 1H89C 2V1UA 1UOFA 3BZ6A 3OUJA 3KZZA 1IZ1A 4PSXA 1Y0UA 4FOWA 5GLZA 5I91A 3KT7A 4XOGA 5CZKA 4Y24A 3ZQHA 4CP1A 2JK3A 5E1WA 4BQ5A 1B35C 1IQDC 4G6DA 4HOBA 1XBFA 4E6KG 2IFWA 1DP3A 4IV3A 5JXIA 2JT1A 5AIPA 3CCQI 1OOPC 4RB2C 2ZS6B 1UG2A 1K3IA 4WVMA 3NO8A 1S4CA 3FN9A 4FO9A 2V1XA 1HV1A 4W8JA 4KT6A 1BIAA 1I1SA 2E36A 1LGNA 2ZMEA 3VGIA 1R1A1 2F6CA 4BQYA 2BVMA 4W97A 2JDHA 4AVVA 4MO3M 1G9CA 3D82A 2V79A 2AZ5A 1DQ4A 1SHWB 1F15A 4TLGA 1X50A 1OCOH 3K1PA 1T8IA 4BE0A 3BODA 1ZYRF 4OAZA 3NV4A 5DEQA 1JUMA 5J8FA 3KV6A 5FXXA 5C3RA 3J80K 1PNFA 2MLGA 1VPHA 4KI5M 4HF2A 4YIIA 3PIPF 1ETKA 5FLXK 3DTEA 4LB6B 4IOCF 1OD5A 3RZMA 1MMGA 2GZWA 3JRHA 4LLFA 4M3EA 2EXJA 1S2KA 3SYTA 2BBVA 3GM8A 2PHTA 2F4IA 1UKGA 3HAGA 2LUWA 1QQP2 3F8CA 2VMFA 1SC7A 4BEHA 1IG0A 3WG9A 4GRIA 1E57A 2VIXA 4DEVA 3K9TA 4PJJA 1QXRA 4GB32 3ESWB 5D8AC 5F9TA 2PQ8A 1YQ2A 2ES3A 2KIFA 1WJDA 3VD7A 4RHV1 2Y33A 3L2QA 4EN6B 2R7SA 2BEOA 3I4IA 1BR2A 4M3DA 1US2A 3BR5A 2CU5A 2VE1A 2CW0F 1RUJ2 3PMSA 1JTZX 4XZUG 3EO6A 2IVJA 2A69F 2TCTA 2VUAA 3Q8EA 4Z2WA 4SLIA 3JW4A 3G2BA 4CPBA 1IN7A 4HEA2 1H8AC 3K1MA 3KM5A 4L11A 5FYIA 1GYKA 1ZBE2 1UMZA 2VZRA 2IFRA 1CAUB 3JRDA 5HPOA 4YNIA 1IPSA 1YX5A 3QU3A 3CNAA 2VNGA 2JVGA 3IDEA 3B69A 2RVAA 3TO6A 4DBQA 2FDFA 4CXWA 3MFKA 1BVVA 1HQNA 4N43A 4TZDA 1OUXA 2VXZA 1AR91 3RPUD 1A04A 1JYNA 3HXLA 2R5YA 4BIOA 3AC0A 3VBUA 4Q48A 1MEC3 2P8TA 2VBWA 2XJPA 1S72I 1WI9A 3CJTB 1F31A 3ZIXA 4AU7A 1Q5OA 4WF2A 3BG6A 2HWB3 4MSVA 1TP4A 3NARA 3VFZA 3QQAA 2LYCA 1QGLA 3WF0A 5CYVA 2A70A 2PQQA 3AMPA 3QCWA 2GMMA 1WA4A 2PJRA 4TSVA 2HWF3 2J1SA 3JRFA 2FMDA 1SFXA 3S1RJ 3FHQA 2K02A 4XC9A 1WHUA 2DTZA 1RI7A 1FV3A 4AL9A 4H7MA 2EAAA 4CDWB 3JTGA 2RS11 2DQRA 1YYVA 2BVBA 1W8ZA 1AR72 5AONA 2W1WA 5E16A 1HRI1 3MV11 3MPPG 3ZCOA 1GNHA 1VRH1 4IRHA 1TT5B 3RKQA 1QZZA 3MPBA 2DU1A 4I0WB 3HPGA 5E1ZB 3M7GA 2OC6A 1REPC 3KHBA 3S1MJ 4CDXC 4YVSB 2EA7A 5CLSA 2WNVA 4AK3A 2VZSA 2X1CA 4J6GA 2ZNZA 2XC7A 2ZFWA 1L0OC 2AQFA 3EQLF 5LBBA 3T1BA 4XORA 5FZOA 3VKMA 4CEWB 4YW7A 4NROA 1RMU3 1IDYA 5L36A 5L3FA 4HLXA 1FBSA 2VJJA 1ON1A 4RS8A 1H1AA 3KEQA 4I01A 3VB9A 3AP9A 2ACJA 2RS32 2Y8KA 3GBFA 1J1TA 1LJ7A 5EV7A 4II3A 5EG0A 1PGL1 5KWRA 3L00A 1UXZA 1TWGJ 3I8TA 1NZCA 2KRHA 2NMNA 3GF2A 3LEKA 3VKNA 4CXYA 1EV12 2GP3A 3SXYA 2V4AA 2VC1A 2YPDA 3J8F3 1RINA 2JA6J 2C6YA 2Y0SA 4Q1RA 1UY0A 4L0ZB 2QVSB 1W0OA 4D5FA 3MEXA 2WNUC 4HDVA 2IVMA 3GO5A 1F4HA 4Q0SA 3KYDB 3N7MA 1QHHD 1S0BA 2K3FA 4B1RA 3O1UA 1W4MA 5H20A 2J1RA 3FBNB 2EXIA 2G9GA 1LOGA 2IJLA 1RESA 2NLRA 3OYNA 2BW3B 1BIBA 2XWBB 2R7TA 1MS9A 3LSEA 5DAWA 3AKQA 1JODA 2ZXQA 4A3MJ 1UY4A 4IHSA 1BBT2 2X10A 2XJRA 4YSFA 3WW3A 1UPSA 2C4XA 2WY7Q 5FZIA 1NG7A 1WRJA 4M3CB 5CA6A 1D1BA 2ARAA 1VF9A 4CCOA 5L9RA 3OYDA 1FX5A 5FYYA 4XJAA 4C8DA 3VODA 5DUIA 4ENMA 4Q26A 2VKVA 3VDCA 2Y9YA 4ON0A 4UB8C 1LODA 3O6BB 5B1BH 5LA0A 4CHUA 3NRVA 1EH6A 3DLAA 2GMEA 1S55A 1Z7S2 1A6CA 4QU1A 3JSPA 3WOGA 4XBNA 5BNNC 2LC2A 3KV4A 3WG2A 1AOYA 3UGHA 2UURA 2P6CA 2C1FA 4X1EA 2CWSA 2QWWA 2ME6A 1A3KA 3HRSA 5LBEA 2XKPA 2K5CA 3SEEA 2A6ZA 3H5AA 1YE9A 2K4BA 4O61A 3UKVA 1GBGA 1B8IA 2WL1A 1KS4A 3K70D 2HWE3 4CPBD 5FIXA 3NV1A 2XWJB 5C71A 2PN5A 3KHCA 2STWA 3HVDA 1DDLA 2RM21 1OLQA 4OZXA 4B7EA 3I9V2 5A1FA 1WGPA 4AGGA 1CZSA 3KB5A 3VDDB 2GBYA 2GIVA 3C7FA 2ZSHB 1QJX1 2CUJA 4IQJA 1GQPA 4FPEA 2VOXA 3KFWX 2WZR1 1X3UA 1RUF3 5EP9A 4AGRA 1A36A 4A3LJ 3ACFA 2WRAA 5B66C 4AFBA 2B8MA 2P7CB 2JXAA 2P3KA 4HV5A 3V7RA 2VD7A 4Q4X1 3JCIA 1NG0A 2QQWA 2CNAA 2CS3A 1LOFA 3LSGA 5TGTA 2VJ5A 1O8PA 1JZ7A 1UF2C 2LW8A 4P02B 4CRQA 1Z05A 2F5FA 1XMAA 5FZAA 3UK9A 2R16A 5C9AB 2CYFA 4XSXF 1JW6A 1K5MC 5EFUA 3VDDA 2VY0A 5JPNB 4LHSA 1VQMI 2VNRA 2R042 3H3ZA 4MGSA 3RIRA 2HZDA 5IW0A 2VC0A 4XAEA 2Q1ZB 2Y2ZA 1UMIA 4HDUA 3FM5A 1BEV3 4L5EA 4GMP3 3N97A 5LA2A 3KZIC 1KYZA 1RUI3 4EJWA 1M1EB 2PAMA 1U6GA 4ZYHA 2FZ2A 4YM2A 1N3QA 3GFIA 2E7AA 3JB8A 4RAZA 2CU7A 1PUFA 3BPZA 3LSPA 2FD8A 3EPZA 2VTXA 2HQ5A 1HQWA 4EWEA 2DFFA 3WGIA 4IGOA 1UY3A 4CUAA 4GKXA 2LBFA 3VBOC 4QKDA 2TDXA 5I0DA 2VMCA 2A05A 2AO9A 3IDAA 1AJKA 3K69A 2CAVA 5FQ0B 1P4XA 1NYWA 2WIIB 4GA9A 2NZ9A 1Q8SA 1REEA 3TQNA 1VAMA 4EVIA 2HEVF 4Y22B 4A3BJ 1E5HA 1HW2A 5IPAA 2OIIA 2BOLA 3KQ4B 1OFCX 3H36A 4QT6A 3URFA 5I8SA 2X1DA 3ZDVA 4XONA 1LCLA 3U4XA 2QNKA 2RQQA 1OQ1A 1D5VA 4CP2A 1ZBA2 2XR4A 1Y0NA 1ZG5A 2LP0A 4YM1A 5DAVA 1H4GA 5I0SA 3HDDA 1P4AA 3GZEA 3ZLIA 1SQ4A 2K4JA 5FXVA 1E2XA 3B6AA 3DPRA 3KETA 3W58A 1SLCA 3MZHA 3OYAA 1RHI3 3POEA 2ZBKA 4QPYA 1Y7BA 1NOVA 5DAXA 3CIHA 3ZYJB 2PHDA 4DXTA 5IYCJ 1BK0A 4AFCA 2B9SA 3NWTA 3WNKA 5C4JJ 4YW5A 2ZX4A 3PLQA 3VBOA 3QU6A 1J5YA 3WDWA 5CJ9A 1XNBA 3AG4H 5EIYB 2P17A 1R082 4C3JJ 2ZPXA 2PHLA 5IOZA 3H35A 1DGRA 5FZKA 3HSFA 3T8TA 1YQ6A 1QJU3 3L1PA 2BBYA 4Q27A 2R7XA 4K9SA 3I4PA 4NIHA 3K4DA 5CB7A 2ZEWA 1CJDA 3ZFFB 1ITYA 3H50A 2IVIB 3E0JB 2OU2A 4HG6B 1OLTA 1DQ5A 3VLBB 4Y1UA 1UOGA 4NN0A 2ZO4A 3BPVA 1CONA 3PVOA 5A3WA 3W59A 1EYBA 3AL0C 3T09A 2VL4A 3QACA 3ZFEB 2AEZA 2Y60A 1VBC2 2V5YA 2W08A 2K9QA 5T52A 4B4QA 2QZ2A 5C3SA 1UN1A 1YIOA 1CZTA 3OG2A 2A68F 2W84A 3LOCA 4P1WA 2R062 5FP3A 4XQDA 1ULDA 3T4VA 3TP3A 4XILA 4FPLA 4PUSA 2KRFA 3BC8A 1UQXA 3HOUJ 3HOYJ 4TYSA 3AL0B 1WA6X 3KYLA 3O0WA 1WH7A 3IAM2 2E31A 4A3IJ 4H3WA 4RGKA 3PM1A 3I2KA 3SHRA 1FX7A 2OPWA 3QOEA 2R072 5FAXA 5K7ZA 1BOBA 3F0CA 4YM3A 2ET1A 3PUHA 2DOEA 2B5HA 3TRSB 2WAQN 2HWE2 2FD5A 3MO4A 3E5XA 4C0HA 1WQ2A 3K4MA 4HG2A 3S2HJ 3SH4A 4XLAA 5F8PA 1FOD2 3JU9A 1N3PA 3POGA 3RI4A 2WNUB 5BPXA 3HJRA 1NA1A 2DCYA 2VL8A 1SPPB 2Y48A 4LOTA 1D7PM 3FL7A 1KDKA 3IP4B 2DI3A 5JLVA 1W36C 2L9SA 2EH3A 4Q2FA 2Y31A 4QLCU 4IHTA 3LAPA 4H14A 4XF4A 4KG0A 1T98A 4UV9A 1VBA1 4L2NA 4LUMA 1VBA2 1LHWA 1UHMA 3LFKA 5CVIA 3K4AA 3QYBA 3DEMA 1ZQ3P 5FLMJ 3M4OJ 2YC2A 4CTEA 5L7OB 2JZYA 1JTYA 3CCYA 2JKBA 5F0CA 2WNVC 4YW3A 3CCLI 1T6SA 4YG3A 2DOFA 1RMU2 2MEV1 4QHZA 4ZU7A 1YFYA 4M4PA 5EYXA 2ZC2A 5IWFA 3HBLA 3ELNA 3OOXA 4P5YA 2DPUA 4IEQA 4Q4V3 1RXFA 3P5JA 1PMJX 1HF0A 1B4AA 1X8MA 3O1SA 2LF8A 3R0RA 1FJLA 2UWBA 4U36A 2R30A 3G1LA 1N1YA 2CGNA 4XFCA 4LBMA 4EN0A 4YYOA 5K8SA 1YJLA 4RHV3 1BBT3 2FNAA 1WCUA 3ABUA 2YSRA 1G59A 2WNUA 4LE4A 5B4XA 2B45X 3EETA 1YTYA 2AQEA 1RB8G 1R1A3 3BTJA 1VQ6I 1G8XA 1LHNA 4FOYA 4LORA 4YZ4A 1OCCH 4CU8A 1R092 2CG4A 2W85A 3F2ZA 2XF5A 1O91A 5JR3A 3GZ5A 4IEXA 5F5IA 4BYYA 2WO1A 1H2LA 5BNQA 4BQ2A 1PVC1 3K70C 1Z21A 3RI9A 1UJ8A 3ZN4A 2WFF2 5JVTA 4YGEA 3HB9A 1HRI2 4ZZLA 4RR3B 5HLIA 3PL8A 1PO22 2BTVC 2QQUA 4XJZA 3WTUC 1ENHA 2PFBA 3POFA 2ZJRF 2GC3A 2VCBA 3BTIA 4WVZA 3C2UA 4PT6A 2D3SA 4ZYAA 4KGGA 4FPOB 4J01A 2DK5A 1ETOA 3PURA 1W8HA 4GAZA 2R061 1SLBA 2QE3A 2K9MA 5FZEA 4NHXA 3GXUA 2YBSA 2YU2A 3T2QA 2VAUA 3ZXLA 3ZM8A 3V56A 1WZXA 1XU2A 3BQYA 5JR2A 4OVEA 3OB8A 1O5LA 5GZEA 3TW6A 2D2WA 4XJ9A 2IXJA 1JXNA 3PNYA 4E7SA 3NKGA 2BY2A 1BQPA 1VQLI 2VW0A 3DKYA 2WT1A 5JI7A 1R081 3G7DA 1PO13 1SANA 2LF7A 2WBKA 5BYNA 2MC3A 1UZVA 3UT0A 2NAZA 1POV0 4E27A 3HNBM 3BIWE 4ABZA 4OIOF 1WW6A 2XOMA 1ZH5A 2YFZA 4OZOA 1BXHA 2I74A 4AHZA 3IZOA 1A6IA 1U8RA 4Y5Z0 2ZGUA 1RUJ1 4JKMA 4BOWA 4BK5A 1ZBE3 4KN7X 5A3NA 3W5MA 5JOYA 4XVHA 4AD9A 1W6MB 3C7HA 1ENXA 5DAQA 3U1XA 2WAAA 2CJJA 1ZBE1 5FBJA 5DS9A 2Q8KA 1W8NA 2W5FA 4B29A 1JKPC 4IW3A 5IT9Z 3ACLA 4FPHA 2VO5A 5BPIA 5IT3A 4ASLA 2H0BA 2WN3A 2VZVA 4EWDA 4PF5A 4Q8KA 5FJ8J 5FZHA 4OIPF 3A03A 1TVGA 1K61A 5HNHA 2KZVA 1QO0D 4M00A 2LKPA 1R6RA 2O03A 5F1JA 1APLC 3KIOA 2RREA 4F55A 4KIBA 4JKKA 1D0XA 2XPUA 4AQ6A 4XPVA 4QWQA 3EUHA 1UY1A 4U0VA 3NV3A 1GSLA 4V1PA 3ZSEA 1LHVA 2EIJH 4MLOA 2HDDA 2L0KA 4Q4Y2 2ZB9A 3WNLA 2CTVA 1WJFA 2Y6JA 2RS51 1YJ9I 2JB4A 4CCNA 2ADUA 2K9NA 2L9RA 1IPJA 2ERFA 2W91A 2M7BA 3BG3A 4FETA 4U88A 3AP4A 4XFAA 2BBAA 1GKBA 3RKWA 1S8NA 4CCMA 2KZGA 3IPVA 4K40A 2R7DA 1P6RA 1JTXA 2PEXA 4MYEA 5HCBA 1X1BA 4X6AJ 2FQPA 1OYWA 4L92A 2VOVA 1TL8A 3GZNB 5J4YA 3OJBA 2E63A 1H9PA 2DT7B 2R7RA 2WJSA 3L9JT 3O1TA 5K1YA 1MS8A 4FHTA 3BKZA 3LA2A 4FAGA 2I5UA 3OS0A 2DW4A 2YMZA 1T2XA 1XSVA 4KDPA 4G6TB 4FISA 2GNBA 5HLTA 4U7DA 2GP5A 3P7NA 3K75B 3WTTC 4TV7A 2IRFG 1CAXB 3R4KA 2ZGNA 1T0FC 3ZR6A 4BL0B 1OQDA 5K0UA 3UKNA 1ND3A 3VBRB 5FKOA 4BQAA 2VN2A 4FTEA 2HVQA 1OA3A 4EE2A 4Z1VA 4MUVA 3APBA 1C8NA 1FIPA 3LDBA 5FZ0A 5HDGA 4MTEA 3MVPA 1YQCA 4DOZA 1ZVFA 3NNLA 4HW0A 3OSDA 5BQTA 2W00A 2JDZA 4XCAA 4XJ8A 1W03A 2EV5A 1JOPA 2HOEA 3UGFA 2K3PA 1W6QB 3BWGA 2VUJA 1SAUA 5DQ0A 5LBQA 3BB6A 3VHPA 3VKFC 1WCDJ 3S2WA 4QMAA 3U1DA 1QBJA 2NVYJ 3FBIB 3DPRC 1RUH3 2HEYF 1IQAA 2JKXA 3NNGA 4ZKTB 2EF6A 3NL1A 2VVEA 3DU5A 3B9CA 4B4CA 4AVBA 2BFUL 5BNPC 1AVBA 2FBKA 2B9UA 1Z0HA 3IDCB 3D4KA 4P00B 1MBKA 4DGWB 4GWNA 5J40A 4H2AA 2OYZA 3HMYA 1SDDB 1TQMA 1Y9MA 4YFKF 1DYPA 4ZY9A 4NUBA 1GOHA 2H94A 3WTYC 1TTYA 1XNAA 4A42A 3COAC 4MGRA 2EIDA 4IV3C 5K9YA 4LG0A 3C8XA 3ZN1A 2EZHA 3NRUA 3OY9A 3GGLA 4P14A 1YHQI 5CAZA 1GNZA 3AZWA 4QQOA 4FPYA 4IUGA 5F32A 5B2GB 4LKFA 5JHFA 4UFIA 2OX0A 1FOD1 2CFOA 5D8AA 3SLIA 2DV9A 5FB2A 5BY5A 2DA6A 3BTLA 3H0DA 4N4OB 1AXYA 4RAFA 3A4CA 2LKSA 3HKZA 3VWBA 1X4PA 2L2OA 1OF4A 3I54A 4A5NA 5GZDA 3KQRA 4JGYB 5T55A 4BQ4A 5JMCA 5H9QA 5A32A 3H3LA 5C8CC 4CXXA 2IS1A 2ORZA 4Q4ZF 5FZMA 3SDGA 4LK0F 2IGKA 3MIDA 3HHHA 1IF1A 3PVNA 2EXHA 1URXA 5GADJ 1X82A 1Y1VJ 3K46A 3QYFA 5DCMB 3VV1A 5FZBA 3AP6A 3WNNA 1W3VA 2BRTA 3I2OA 5AVPA 2YU9J 1Z9CA 2XGDA 4E7LA 3B5LB 4ENKA 1R7JA 5H2FC 4FFGA 1JXSA 2F2EA 4LBNA 2QGUA 4HF0A 1HJGA 6PAXA 2QF7A 4C2UA 4R9CA 5ICGA 2UYAA 4LITA 4V2VA 3FDYA 4BQWA 1EV11 2X0LA 1RC9A 2W2IA 5J1UA 1DGWX 3NAUA 2OPKA 4QB6A 2Z5UA 1MZBA 3MLKA 2MFZA 1RUI1 4YRDA 5LZ6A 5KXCA 1VQPI 2WSUA 1MBHA 2R7WA 4K8RB 4M3GA 5C3OA 1QJEA 5K5QA 2DODA 1ZHFA 1QMJA 4IQ4A 3CC2I 3EUHC 1KZHA 1KJRA 1TMF1 1PUEE 4O9GA 3M9AA 2ZBJA 1MDMB 2XROA 2WQ8A 1PMIA 2ATFA 3FHAA 3M7AA 1H6YA 2O9LA 1AR92 1KFXL 4GFBA 1K6OA 3IDBB 2XAJA 1DCSA 2CDOA 2IS6A 5D6EA 4RL7A 4XICA 1DHKB 2CUEA 1F5JA 3JRBA 2RQPA 4DXSA 1Y43B 5ICEA 1PNGA 3MQ0A 1MJAA 4W6YA 4IOAF 4V2FA 2RS53 3OBAA 2DA2A 4IX7A 3CCSI 1O3SA 1UU4A 2PHWA 2VR4A 4LLNA 2JVHA 5FGMA 5A1LA 5SV8A 5FYBA 4OULA 4A45A 1G9FA 1LU2A 3LE0A 1NLSA 2V9KA 2PAEA 5FPZA 2AS5F 3AKZA 4Q4W1 5KHHA 4BZ4A 1AR93 2AH2A 4EM1A 5A3TA 1HB1A 4WM8B 3MV01 2BV4A 2ZJ2A 1ZBA1 4PCRA 1J3PA 4QXKA 1ORKA 2WLPA 3IHUA 3GFJA 3N9QA 2M8GX 4OQ9A 3CF5F 2B9VA 1KQRA 5FRMA 4RS5C 5D4RA 3BY6A 2VTXJ 4PLOA 4XXAA 4E7ZA 1N77A 2RR11 3H7JA 2WZEA 4JGYC 1PO11 2XAGA 1POGA 5FOJB 4HQEA 1ZR2A 4N90A 4AOCA 5M5XJ 2XV4S 3ZP5A 2X6YA 3FKJA 2AUYA 4BCUA 4XLHA 3TDZC 3M07A 2W1SA 1Z1DA 5EG0B 4ZYEA 1U0JA 1LR5A 3BGAA 3DGTA 3DYMA 2H6BA 1U2WA 4MGKE 1LUJB 4C9YA 1J84A 4HKWA 1RGSA 3VBOB 2GH2A 2Q1MA 4NHKA 2FXAA 1ODDA 3OEAA 1XOYA 3BJ6A 3M8JA 1ULGA 2ENRA 4LXLA 2GDFA 3CO7C 1A34A 4DJAA 4BDYA 4GB33 4BBRJ 4OI2A 3KP4A 2CYYA 2LD5A 1LOFC 5DUXA 1UMHA 2VKHA 3Q8FA 1IPKA 4GB31 4PJMA 3K48A 4C3IJ 2VVFA 1JYCA 3ZFGC 2NNNA 2NOJB 5F7UA 1J0RA 1LOAA 2MPFA 4XOTA 4B3AA 4BK4A 1VMHA 3QAHA 3ZOIA 1MW7A 1TBXA 2DUQA 4ZYDA 5FKKA 1C8M2 1OF3A 1OQYA 2GXAA 3DBRB 3R0AA 2VPLA 1LFBA 2P5KA 3D5OA 3OPWA 5KC6A 4QPWA 2VASA 5A33B 3S57A 1I6HJ 1YYNA 4XLEA 2Y0IA 4A3DJ 2EWNA 1JT0A 2D5HA 3F22A 3GBGA 2EALA 4QPGB 2QKDA 2JG8C 2QQBA 4N7IA 3RMXA 2DCTA 1KDMA 1SDWA 1HOMA 4OHWA 4C91A 2CQKA 1Z3XA 2ZKNA 1U5TA 1S6LA 2OZJA 4NDLA 1RJ8A 5FLJA 1YFWA 2KD7A 2XGXA 4KA4A 1Z91A 2BU9A 1M4WA 4PFOA 2JDMA 1BVP1 2H27A 1FYUA 5DDGA 2K9ZA 4YM0A 3IRRA 4R8HA 4MEXF 2FRHA 4XJWA 1HN0A 2VXDA 3M8EA 2CUFA 2AREA 4I30A 4CCJA 1DIWA 4KMUX 3VBUC 1O5UA 3VBRC 1O8SA 5FO8B 2XJTA 2ECBA 4FQZA 3GZ6A 3AYEA 3WINE 1V5FA 4YGCA 2WWYA 1UOBA 5FYVA 4K21A 3VZLA 2B42B 3AYCA 3DBLB 3UESA 1RVF3 1Y8RB 1B35B 5EJZB 1HB2A 2WZ8A 5CVUA 3AKTA 5SV5A 3ZR5A 3SEPA 4NBQA 1QDCA 5BS6A 3H92A 3OS2A 3WW4A 3V0BA 4X6QB 4HSRA 1J2XA 2NVUB 5KC5A 1IXRC 4KUMA 2JDKA 1GMMA 2PLYA 5K7FA 4M9XA 3SH3A 4EYUA 4QX2A 4NE9A 4JX6A 4Q47A 4D7NA 4OMYA 1QJY3 4C0BA 3TDUC 3NQOA 2XQXA 1JBCA 4J1XA 1IDZA 2UUZA 2RMU1 2RM23 4TLFA 4UW6A 5CVRA 5E79C 1RVF2 3SCFA 1W06A 1IG7A 3HPHA 4YZ1A 2DCEA 1ND3B 1W6PB 4CDUB 3RPQA 3BT9A 5C33A 2BNOA 1C8M3 1QGPA 4CDQA 3WQ0A 5FLIA 2OCEA 3D5LA 4DY5A 5JZGA 2A6EF 1JOJA 1N1SA 1HLCA 1ZR4A 3WNPA 3A0BC 4XLPF 1MS5A 4OUEA 3PUFA 2R7ZJ 2UZKA 1XB9A 4XF0A 4IHXA 5FZLA 1KGSA 2UYBA 2FDHA 2JDAA 2Y6FA 1S7EA 1Q1VA 3DPTA 1ENQA 2LBFB 2BHZA 1ZZCA 1PM4A 1GOGA 1AL23 1LHOA 3O12A 2EAKA 4NPRA 4O5VA 3Q9OA 2O8QA 3WF4A 1YX3A 2WAFA 4Q4Y1 3BP8A 5FV3A 1STZA 1W05A 3V8KA 1BL0A 1UYYA 3VYUB 3K4BA 1JHHA 2P0WA 3ELKA 4CP9A 5BUVA 1RIRA 1YI9A 4NIGA 1AYM3 4G8XA 5EDNA 4Y1ZA 3IKTA 3NV2A 3WZ1A 5ANNA 4QM8A 5B5EC 2QBYB 4KL1A 1TWHJ 1V9U2 2J1EA 3E1F1 3WG4A 1HRV3 4U2AA 2CW7A 1X19A 2VW2A 1ALYA 4X8NA 2XUMA 1BC7C 3IIAA 1O7FA 1V6NA 1JI8A 3E5UA 3LSRA 1AR71 2YHJA 3USSA 2F17A 3OUHA 4LOSA 2V9VA 1JYWA 2EV0A 4M9SA 3MIFA 1DGLA 1PIV1 3OIPA 4S0HB 1XPXA 4QM9A 4EMSA 1W7PB 4XFGA 4BY7J 3CC4I 4JRLA 3F8NA 1Q1HA 5CFCA 1F4AA 2IW5A 4GJZA 4DYQA 3WTVC 2ZXHA 1SFKA 4XUPA 2A6WA 3NJVA 3WNXA 4B7KA 3IN9A 3P9KA 4HX7A 4XW3A 1BI3A 5J1YA 5LRRA 4AEDA 4D6QA 3I3LA 4IETA 3THTA 5F6FA 2B46X 2HKXA 3G6JB 1PO23 1SEUA 3GUDA 3KP6A 1NA1C 4CDWA 4YPJA 3FXLA 1WD3A 4XFHA 1LEDA 3HOVJ 3KP5A 3SITA 1TME2 4BQOA 2YPRA 3DKWA 3DLLF 4CVUA 5L7OC 1HKDA 3TEZA 2ESHA 3TNQA 2XDVA 1PIV2 3HOTA 3ES1A 5J37A 5C8CA 3OYWA 3OYIA 3ACGA 4OAYA 1W8FA 3E6DA 3RZLA 3J8F1 1JHJA 1C3HA 4CA0A 2E1NA 1QJZA 4GKYA 2VKEA 3BU7A 3AFHA 3WY6A 2EB7A 4JQFA 3MKYB 3RPUA 2CRGA 2V73A 3N9PA 1SD4A 1VRBA 1HXS2 1UCRA 1S29A 5DCFA 1VBE1 5FK8A 2L02A 2H8WA 1KU7A 4FFFA 3ZPOA 3O1RA 1Q8VA 3VHNA 1JMUB 4LIVA 5CIRA 5IVJA 4XRSA 4GDFA 2JRMA 3OWTA 5C3QA 2P6SA 3CJRB 4UW4A 1MS0A 2RG4A 3ZFGA 5KXEA 3KZYA 4LD5A 1QZEA 1ONVA 3MW4A 1K83J 3OYCA 3CUQB 5A33A 2ZMEC 2VCMA 1WH5A 3VYRB 4LGWA 1SACA 4LO7A 4JC1A 1X8EA 3ABLH 1UO9A 4M01A 5M5YJ 4LKDA 3M8LA 4AI1A 4X8PA 3GCMA 4F52A 4E7HA 4LTAA 3PQJA 2VQHA 2KP6A 3AZXA 2CQXA 2JSCA 4PIZA 2OTJI 3F72A 5J47A 2YU3A 2E7WA 3JQWA 2G19A 3T3YA 1U78A 3HNMA 3DCFA 5A32B 1H1IA 5AC92 1NY71 4CDXA 2VI6A 3VUOA 1OISA 1OUSA 2W24A 3HM5A 2IUWA 1OLRA 3AKPA 3VBHA 4NNJA 5LLQA 1VP6A 2E1CA 1IHMA 3RNSA 4XHBA 4GGGA 1DYOA 3PTYA 5FKNA 3QPTA 5H9PA 3V8LA 2L7ZA 4AFMA 2YC0A 4EGZA 1SBDA 5JDBA 4PCQA 4XQ4A 2ZGKA 3GJAA 4ZU5A 5A6YA 2I07B 3OY8A 2JB8A 3GX4X 2XKOA 1EA3A 1DPRA 1CF7B 4PDWB 3FZ3A 2BY0A 3I58A 4FBFA 1F5TA 1ZREA 3QBQA 5HLHA 3BG5A 4PDKA 1WUVA 2D97A 3HUGB 3RQ4A 3ZKUA 3A22A 3ZQQA 4W6WA 3RZDJ 4QXBA 2NPIA 2Q8DA 3DBHB 2VUMJ 3VYSB 1JYIA 5E17F 5HDNA 1BOAA 1UU5A 2CFXA 4XE9A 2O14A 4IEUA 2D44A 5FYTA 5FP7A 4CZCA 4IE0A 2FQ4A 3FC0A 4UYBA 2OZUA 4UUSA 2FMLA 1WMDA 3JQXA 1V54H 3C7GA 3A2KA 1BI1A 1YJNI 5FY7A 4PHZA 5F3IA 2Q1FA 3KT4A 1DU0A 5F5AA 1W2UA 3GBWA 1MR5A 1G3WA 1YITI 2WADA 1ZN2A 4IE5A 3TEYA 2BYVE 2NNYA 2DVGA 5T5JA 5LHIA 5DG1A 1YOVB 3FMSA 3LOIA 2MEV3 1LEAA 2ZOEB 3JAMZ 3WCRA 3MAJA 1H0MA 5L3BA 1VBC1 3ZMVA 2R073 3GZUC 5EGOB 1NH3A 1OT5A 3H3UA 4GMP0 4AI8A 4ZJZA 1VBC3 2RJ2A 4II2A 1GZTA 3POYA 1K7AA 3M1HA 1LRHA 3LDKA 3RGBA 2ZHLA 3EQEA 1W0TA 4XKVA 3RG0A 3ZQGA 5T50A 1YS7A 2CHHA 2KQRA 5T5OA 1E5IA 4A5MA<