1O3SA

Protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRDTVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation/dna
molecule keywords 5'-D(*AP*AP*AP*AP*AP*TP*GP*CP*GP*AP*T)-3'
publication title Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: Alteration of DNA Binding Specificity Through Alteration of DNA Kinking
pubmed doi rcsb
source organism Escherichia coli
total genus 60
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o3sA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o3sA01
2ET1A 1LEAA 2XAFA 3TDUC 1IAWA 3KZYA 2DQRA 1VP6A 1ON2A 2BE5F 5DV5A 1QY4A 3QU6A 4D0PA 2STTA 1TNTA 1W7PA 2GC2A 4HVQA 4XBFA 2CV6A 1DDNA 3CJXA 4ZU5A 3CLPA 2P5LC 1LVAA 1HW1A 6PAXA 1FNNA 1HKSA 4HBLA 2HOEA 3IIAA 5I91A 1PUEE 2IT0A 4HLTA 5BPIA 5ICFA 2P5KA 3HTSB 4AIKA 1MZBA 1X8EA 3TNQA 1BOAA 2MPFA 4OU0A 2RC4A 1DZTA 3L9FA 4EJVA 4YG2F 1IXCA 2H6BA 1W7PB 3V7RA 5A2QK 2B5HA 4ASNA 3QP6A 3V8JA 2YSRA 2ZNYA 3RNSA 4K2EA 3D5LA 4LFUA 2PJPA 1O3SA 2ET7A 5ILVA 4IEXA 4ENNA 2VXZA 2FF4A 4J1WA 1R1TA 2A3SA 3CO7C 1SMTA 2FSWA 2FXAA 1ZG1A 1H9GA 3GYDA 5IT3A 2DQLA 1DP7P 2DAOA 4E2SA 3ELNA 4LD5A 1S6LA 4R79A 2UYBA 4HDVA 2HYGD 3QRFF 1RUOA 1YIOA 3DF8A 2CQKA 5J7MA 2MLKA 2X4HA 2ATFA 1XN7A 2EV0A 2MH2A 1RNLA 2ESHA 3DL3A 3ML6A 1I1GA 4RS8A 1T2KA 3LA7A 1OI6A 5H6RA 3IL2A 4IEYA 1SMYF 4EJUA 2VOPA 3KGLA 1XCVA 1EY2A 1NHAA 5BPDA 4JK1X 4AVAA 4HQEA 1NE6A 5H6QA 3M8EA 5E1XA 1U5TB 4LJZF 4H0EA 3BJAA 1UW8A 4IEVA 4G6DA 4UBHA 2RV8A 3BPXA 1L0OC 3E3VA 3BZ6A 3CUQA 2ZMEB 4OIOF 4UV8A 2K02A 3WTUC 1CAUA 5I8TA 4G6QA 1CF7B 2QBYB 2IP2A 1FYKA 2KIMA 3SFZA 3K2ZA 4I09A 2GXGA 2D93A 2E7XA 2H09A 5JVTA 4R52A 1SFUA 1JE8A 3K1NA 5CLSA 4RB1A 1XRUA 1EP0A 1OYWA 1YW9A 3MZHA 4YNIA 1YTYA 2UWMA 2B8MA 3BU7A 2GC3A 3WGGA 2XV4S 4GCVA 1RL3A 4L5JA 3ECOA 1EV7A 1OYYA 1LDDA 3SZPA 4LG0B 5CVVA 3S7EA 2F5EA 5LRRA 2XKOA 2EFQA 3GFLA 1XGMA 2NRAC 1ODDA 4RAYA 1L3JA 4ORFA 1SD4A 3DPTA 3LA3A 2ZXJA 3LAPA 1FP2A 3RZZA 3VFZA 3SCHA 1B59A 3MYXA 4H7LA 3HHGA 3EETA 5K5QA 2BYVE 1P4WA 2XLFA 3F6VA 1MDMB 4AVBA 1ZAOA 3ZPLA 3KFWX 2BV6A 1G3SA 4HX4A 4OLLA 3O6BB 2MA3A 4HOBA 5HDGA 3HOTA 2E1CA 1QO0D 4MUVA 3F8CA 2BNOA 1QXRA 3OCPA 3FMRA 5D6EA 3E6DA 4OMYA 4U0VA 3JAMZ 3FXQA 3I5UA 2XVCA 2HQRA 4O5VA 4MHGA 1E17A 2QQ9A 1FP1D 2EA2A 2AXLA 1CAWB 4A5NA 3ELKA 1O5UA 4MGYE 4EJOA 4QM8A 2D2WA 1R7JA 3ULQB 4MEXF 5FPXA 1X82A 3DPLC 1V3FA 2NNNA 4LGWA 4FT8A 5KHGA 5HI0A 2RVCA 1TNSA 1L3LA 4UNOA 1UPIA 1FBQA 3I54A 3BPZA 4X6QB 3EHKA 3M8FA 3I53A 1DPUA 4HX7A 4XFHA 3ABUA 3KP7A 3IC7A 4EQQA 1U6GA 5DYMA 5I8SA 1I6XA 1R36A 4AQ6A 4EWEA 2QQBA 5I8YA 3NJZA 2L4AA 4JTNA 4GYIA 4P9GA 3LAGA 2COMA 1OR7A 2UY8A 3JZVA 3ZN1A 2KJBA 3GFIA 3WW4A 2ACJA 1LJ9A 3DKWA 3TO9A 3ES4A 5T3NA 3ES1A 1F9NA 3F8MA 2Q8KA 3GZ5A 2A61A 4LA2A 1UFMA 5CYVA 5FLXK 2YX4A 1DGWA 2O61A 4G8XA 1LDKB 3FFQA 3RDIA 1RTVA 4EGYA 2GAUA 5LEJA 3COAC 5LGNA 3PQJA 1GHCA 4OINF 5BS6A 4N9IA 3GBFA 4EJTA 1IW7F 1VR3A 2YPRA 3C18A 3TO6A 1O5LA 3ZMTA 5CVIA 2YX7A 2B0LA 4S05A 4IXAA 3K0LA 3WODF 5LEKA 1O3QA 4KT5C 3H8UA 3WTWC 4META 1TLHB 5KK1A 2LSOA 3KP5A 5KVRA 1ZZ8A 3RPQA 3QACA 5E8GA 1P92A 4I3PA 5LBQA 2A68F 4NHJA 4M71A 1R22A 2C6YA 3RIRA 1LB2A 1IN6A 5J8CA 2XAQA 1KGSA 2OD5A 3GEZA 5FQ0B 4O9GA 1ZZ9A 1K78A 3U2RA 3IBMA 5BV6A 3M70A 4PCQA 4FX0A 5ERIA 1VTNC 5K8SA 3L00A 4L5IA 5HS7A 3FZVA 1Q43A 1IRFA 1P4AA 4U7DA 3HTUA 2IXLA 1B9MA 1C0WA 1U5TC 3KP2A 4HVRA 2IA0A 3ZP5A 2EVXA 4NVPA 4WZCA 4OIQF 1W4MA 3BJ6A 4OOIA 4XEZA 2GC0A 5FGMA 3REOA 1OPCA 3KMHA 1IF1A 3NQOA 3T0YA 3M3IA 1S7AA 1H1MA 2HKOA 2K4BA 2BNMA 1IUYA 3PVBB 5F1RA 4EROA 2XAHA 1K78B 1XB4A 1J3QA 1JHHA 3SQNA 4O6JA 3KLOA 2RN7A 5DCMB 4PIXA 5L3GA 4QLCU 1RZ4A 4BHBA 2Z9OA 1Y3TA 4LTAA 3AAFA 2QQAA 2EAAA 1ZN2A 4A0ZA 5BMZA 3J80Z 4MGKE 2CFXA 4KL1A 4YFKF 2FQ3A 2QWWA 1EH7A 3U0ZA 4HW0A 3HUGA 4UV9A 5E17F 5L3EA 4KIFA 2I45A 3D0JA 4HAMA 1STZA 2GXBA 2OQRA 4UVBA 2XHKA 2VODA 3E6BA 4A12A 1Q1HA 5F6FA 4EMSA 1UHMA 2CW0F 1ZLJA 4XLNF 1FBUA 5HDNA 5AVPA 4WXHA 2XAJA 1BC7C 2XGXA 2HZTA 4DNCA 2K9ZA 3DEUA 2HGCA 2XLAA 3USSA 3ZN0A 1ZREA 5CVRA 4HN1A 2HTJA 5CADA 1IN7A 2ZKZA 1FWZA 2JZYA 3OV8A 5FFXA 1K6OA 3QP5A 3L2HA 2WV0A 1B1BA 5E1ZB 4JV4A 2IC1A 3FXUA 2F5DA 3SMHA 1H0MA 2KIUA 4Q0UA 2DW4A 5DDGA 4QGMA 2V6CA 4AQ2A 4P5OA 2FEZA 2V9VA 1TQPA 1XD7A 3WTVC 4EGZA 4I0AA 2R7FA 3LFKA 1OFNA 5E1WA 1EYBA 1TW3A 4I02A 1QZYA 2EFNA 2PTMA 1ZNPA 3G7DA 2QNKA 2P7VB 2EWNA 4XSXF 4KFCA 4OFGA 2P17A 5LGTA 5LHIA 1SD7A 1T0FA 4BAYA 4IHSA 2A5YB 3EYYA 4UXNA 3SXWA 3M7GA 1XCBA 4YIFA 4I7HA 5JSRA 2OA4A 2JRTA 1B6AA 5DUKA 2Q4SA 2H27A 4Q0SA 3P7NA 1T38A 5FLJA 2O1QA 2OZ6A 4KYWA 3BALA 5LHGA 2DLLA 3QAHA 3WG9A 1CAXA 1U8RA 2KXLA 4RGXA 1W7PD 4E2GA 2JT1A 2XL9A 1KQ9A 4N0BA 3WE2A 3M1EA 4XF9A 2D45A 5ILSA 5K5OA 2OU2A 3MZYA 4IF4A 2Q1ZB 2ZBKA 4HV6A 3Q5FA 1HQCA 3TOAA 3WU1B 3N97A 4N9HA 3F22A 2HS5A 1XDSA 3GUDA 5J3UA 3ZMSA 2P8TA 5AIQA 4KA4A 5EEHA 4LK0F 2EFPA 4OMZA 4MNUA 5ICCA 3DQVC 2CWEA 4ZYGA 1LEBA 3J7AO 3GO5A 1F5TA 1ULYA 3IWZA 1T39A 4D7SA 2CAUA 4HYEA 4IEQA 5HLGA 5D8KB 4ZU7A 4KN4X 5FB2A 1HW2A 1GQHA 5DCFA 4IPAA 3FJSA 1TQMA 2HTSA 4FBFA 1XDUA 3Q9VA 2XAGA 2VC0A 4G94A 4ONUA 2Z3YA 3Q9SA 3R6SA 2WWYA 2UZKA 3KCCA 3F8FA 2GWRA 2F5CA 5I93A 3F21A 1FC3A 4KUMA 4WXCA 3H9AA 4LUMA 5ICGA 4AVCA 4XF0A 3VODA 3NRVA 2ZFWA 4CDGA 3NEUA 4BIFA 4RB3C 3HRTA 4XFFA 5I0SA 2K27A 1DPRA 4M73A 3D82A 1WKMA 3WGIA 5HLHA 2XUBA 4L9NA 4PGHA 1ZZCA 1HKTA 4KDPA 2V1UA 1I5ZA 1WGPA 1ZARA 1ON1A 4QMAA 2G7UA 1YLLA 3DP7A 2OAZA 4GGGA 2H94A 4PJYA 2HKXA 2M5WA 1UD1A 4A2UA 3EQLF 1Q3EA 3KP3A 2MH9A 2ZO4A 1CX4A 5J8FA 1KA8A 3C3WA 1WSUA 4Y13A 4M6YA 3FMSA 3IHUA 3TO7A 4ESFA 5EEGA 5E18F 3FMQA 3WGHA 4EM1A 3ETQA 5KBFA 2ETEA 3KETA 4ZYDA 3W6JB 2QJVA 1ZRRA 5CVUA 5H20A 4KMUX 3MWMA 1CAVA 3WW3A 4UHTA 2IW5A 3EQEA 2O03A 1S8NA 3LQQA 1KU2A 4A6DA 4P9FA 2CGPA 2PHDA 2XRNA 4G9YA 3MCZA 4BQAA 4IETA 1V70A 2Y0OA 2A69F 3S2WA 1YO5C 4Z82A 2E1NA 2DK5A 2A07F 1O7LA 1XGOA 3HSFA 2W84A 4ETSA 4HZFA 4UXAA 3CUQB 4ENMA 4A0XA 1RC6A 1KU9A 2Z2SB 4TLFA 3I64A 2Q0OA 1CAUB 4HV5A 4IEOA 2G7HA 3T8RA 4JBAA 4KU8A 1CAVB 4EM2A 3NVCA 2PN6A 1OYIA 3BP8A 3H50A 1ZHFA 5BY5A 2BEOA 3H3ZA 1FY7A 1J1LA 2P6TA 3MEXA 3H1MA 2OQGA 3ZMZA 5AONA 5HDKA 2JSCA 1NE4A 2VT2A 4WBBA 4U7BA 1ZLKA 3BOQA 3ERED 2F2EA 2FMLA 2L3DA 3I58A 1IPJA 3LA2A 2EB7A 4QX5A 1Y9QA 1UB9A 4HA8A 5D5UB 2OA2A 3R60A 1ZX5A 2Z69A 3HSRA 4F7ZA 4Y15A 2H6CA 2BNNA 4XFGA 1Z9CA 2O8QA 5L3DA 2UY9A 4IEPA 1PDNC 1SD5A 1Y0UA 4QM9A 4FAHA 2PLYA 1YUDA 3EBRA 3GX4X 1EH6A 5AIPA 3UKNA 2P4WA 4G7HF 1TQIA 2FQPA 3DXJF 2QM3A 3I59A 2STWA 3KP4A 4L9VA 4M72A 5KHHA 1FI2A 3CF6E 5LLQA 3EYIA 1QGPA 2P6SA 3C1DA 2PA7A 5ICEA 1MJ9A 4KN7X 5BOXA 3I4PA 3OOPA 5J48A 5IT9K 3QOPA 4MTDA 4ESBA 1Z6TA 2CO5A 2O8XA 1S7OA 5JR3A 2PMUA 2L02A 1FYLA 4M9SA 5LRSA 3J81K 4KWJA 4R1HA 2ZJ2A 4Z07A 5FLHA 1G3YA 2F5FA 3WE3A 4KWKA 5I0TA 5L3BA 3T1BA 2IA2A 4CXFA 1RI7A 4K8FA 5BPXA 1YLFA 2VBWA 4BYYA 4Q48A 4NQWA 2C0ZA 5BUVA 3BY6A 5HLIA 1YHFA 4AIHA 3HIFA 3MDPA 1ZRCA 5D5XB 4WX9A 3RYPA 5CU1A 3IDBB 4MQVA 4NB5A 2QDRA 4XETA 3P9KA 2PQQA 1R00A 5A2QZ 4AWXB 2XKPA 2BGCA 3RJPA 3LWCA 1FSEA 5LHHA 4MZUA 1USTA 3LOIA 3FM5A 1YW7A 3DFGA 5DD8A 4MX3A 4CICA 3GLXA 4YIIA 5FO5A 1P2FA 1FYMA 3VEPA 3ST7A 3LWFA 1D8KA 2IXIA 3PFIA 4LLNA 3FWEA 3B73A 1U12A 1QQIA 1HSTA 3HHHA 5DUIA 1BIAA 4XF4A 1I1SA 1KYZA 2IXJA 4L11A 4Q47A 4HN0A 3GW2A 2XLGA 3NL1A 2V79A 5D6FA 1I27A 4JQFA 1K79A 4YYOA 2UXXA 1Z91A 2FBIA 4HX8A 4M9ZA 2OZUA 3HYIA 4LULA 3KLNA 1BN5A 1FPQA 1D8JA 2W24A 2P7CB 2JTVA 1IXRC 2M8EA 3DV8A 3EO6A 2G9WA 1DUXC 3PNAA 1UIKA 3L2CA 1REPC 5JHUA 3GWZA 4P9UA 1G3TA 1MJBA 2NS0A 3T8TA 4O9EA 1A04A 1WQ2A 2PAMA 4FX4A 2NYXA 3U1DA 3CL1A 3K1MA 2IXCA 4UBGA 2A6HF 1MD0A 3BWGA 5BQTA 3OD0A 2WTEA 5LGUA 4Q4ZF 2EFOA 3CUQC 1J2XA 2WC2A 2MD5A 2Y75A 4GXOA 3VHRA 5I0RA 4JTOA 2FE3A 2NAZA 3SCGA 2YU3A 2FA5A 5KHKA 1HXDA 4Q29A 1HBXG 5KHJA 3V8LA 4RGSA 2VPVA 1QWRA 3F23A 3ABTA 3OTFA 4P96A 2HDCA 5JSPA 4EWAA 2VONA 2Q0AA 2ISZA 4L9JA 1ZYRF 4YRDA 2CYYA 5K5RA 4EVIA 3M9AA 2KIFA 1NZCA 3CEWA 2VE9A 3OF1A 1O57A 3F8NA 4ZU4A 2XROA 5E1RA 3FHZA 1FBSA 3ECHA 3HT2A 3V7CA 4RD7A 1Q5OA 1BBYA 3BB6A 4I2OA 4YSFA 1XE8A 2VOOA 1AWCA 3RKWA 2QUFA 3K1PA 4XFCA 1X8MA 4TV7A 2LNBA 1IZ1A 1R1UA 1XE7A 1RUNA 1XSVA 2EV6A 1BI3A 1YFWA 5E8IA 5K1YA 1JHFA 3ZQ7A 2L54A 1X3UA 1LNWA 3IKTA 3G3ZA 3FZ3A 1DZRA 2JPBA 3H92A 1KQ8A 3HRUA 3CO6C 1R23A 3HSEA 2D1VA 4LEJA 4PDKA 1UIJA 1WI9A 2VT3A 1LDJA 1O3TA 1F4KA 3CTAA 2QENA 3JAMK 1D5VA 4ZYHA 5ILUA 5L3CA 3I7DA 1ZGJA 4HDUA 3IRRA 2W25A 4IERA 3H7YA 4Q0QA 4P55A 3E5QA 4XLPF 4XRFA 4YFNF 3JSPA 5JCTA 4HLYA 4YFXF 3WTTC 3EDPA 3KZZA 3HRSA 1ZRFA 4HQMA 4L9TA 2W85A 4IEUA 5CVJA 2PHLA 2D5FA 1ZRDA 3KP6A 4M9XA 5FLIA 3OGJA 3RTRA 2W57A 2GH2A 1J5YA 1YW8A 2EJRA 3FHIB 3CO2A 4CYDA 1WLTA 2V1XA 4OIPF 2CSOA 1YFYA 2HR3A 1CAXB 2O6GE 4D7TA 4I98B 5C6CA 4PZJA 4LLGF 4Q0PA 3KEQA 3E5XA 1F1ZA 3U11A 4RB2C 2PMHA 2NNYA 4HVOA 3IRQA 4UVCA 3NKTA 4CHUA 2K0GA 4MTEA 2MBFA 4FHTA 5FLXZ 3SXYA 4CGZA 2IPQX 4HMZA 3GXOA 3EUHA 2JPCA 3I71A 4QWQA 2PAKA 5JSOA 2J5OA 1HKQA 1LKNA 1BI0A 2VQAA 3F6OA 3IWFA 4LK1F 1WA4A 1YG2A 1FLIA 3KE2A 2HWVA 2ZCWA 4KIGA 2GA1A 3H3UA 1PM7A 3GZ6A 2EK5A 4G7ZF 1PP7U 4KICA 4IEWA 5CJ9A 3U9GA 1XMKA 1HW5A 2DT5A 4IRIA 2CG4A 3DN7A 1J59A 4GULA 1MGTA 3MQ0A 1V4RA 4GO1A 3GFMA 4MH0E 4XSZF 2BBYA 3H1YA 5F64A 1T98A 1P4XA 3VOEA 3SZTA 4IESA 2Y0MA 1ZH5A 2M30A 4EWDA 3TDZC 1TBXA 3KSCA 1FT9A 2EA7A 3GF2A 3R4KA 3QU3A 2K7LA 5TRDA 2MLGA 5JFRA 1ZZBA 4ZZLA 3O14A 4B09A 3IKVA 3TOBA 4B8XA 4EJWA 3JSOA 1SFXA 1S29A 3D0SA 1U5TA 2QZ8A 1SD6A 3B02A 3FF5A 4IVNA 1XSDA 3MPBA 3P9CA 2UXNA 1XGSA 4L0YB 2RQPA 2ZMEA 2AS5F 3ZMDA 1FSHA 4HF1A 1CF7A 2QBYA 4QGNA 4XF1A 2IRFG 3QPTA 4LB5A 2ADUA 1TTYA 1H9TA 1ZGAA 3RPUA 1BIBA 1KQ0A 1YFXA 4BHPA 1GVJA 4S04A 4DQ2A 3G73A 1RIOH 2DO7A 4LMYA 1BC8C 4AIJA 2ZNZA 3HT1A 2IVMA 2V09A 2J5PA 1FX7A 5EZWA 4KU7A 5FD6A 1VJ2A 2HYFA 1FOKA 3J80K 3V7SA 2FBKA 1J9IA 1IPKA 4MGIE 4WF2A 4LG0A 5TJJA 3IDCB 4PGGA 2X0LA 4HF0A 3U10A 2KRFA 1WWXA 3NW4A 1BI1A 2YR2A 3C3VA 4UVAA 2UYAA 4HSLA 3PQKA 4EV0A 4IHTA 4ZZDA 1QBJA 3GVAA 1UCRA 2GQQA 2MC3A 3I0TA 1J7KA 4RAZA 5BXXA 1TQ5A 1MDMA 4CO8A 5C8WA 1OKRA 2F4PA 3JW4A 4AVPA 3C7JA 2RDPA 4U88A 1YWKA 1IRGA 4ON0A 4L18B 1SFEA 5J6XA 4XFIA 4A6EA 4O3MA 2QVSB 4X6RB 2DTRA 2Z5UA 1O7FA 2FOKA 3VB2A 3ZDSA 3MFKA 2DPUA 5I0UA 1O3RA 2R3SA 2EA4A 2DCTA 3HOSA 3ZMVA 3F72A 4Q5SF 4HSJA 4XFBA 1CAWA 1BI2A 4GYGA 4LA3A 1EPZA 2HJIA 2P5VA 3GYHX 2D5HA 2DFIA 5L3FA 1OD5A 3NSTA 4JVAA 4Y17A 4I01A 2Z99A 4E70A 3E5UA 3R61A 4YARA 4WK8F 5D4SA 3BDDA 3JTGA 1GQGA 3JTHA 2PG4A 1B4AA 2ETHA 1R5GA 3LZZA 2LKPA 1XSXA 2M87A 2IXHA 2IXKA 2FNPA 2B9UA 1G3WA 4MQ9F 3RKXA 2IA1A 1USSA 2FMYA 1D3YA 1YFHA 4BH9A 2K4JA 1KU3A 4KWLA 4F8AA 2ELHA 1IXSB 4RGUA 2PBIA 3WW2A 4AD9A 1QXJA 4B29A 2PI0A 4DINB 2GIVA 3FX3A 5D4RA 1PP8F 3H1WA 4AXOA 1R58A 3KGZA 2H0VA 3O3KA 1HSJA 3UKTA 3I59B 5E20A 2VBZA 3LQRA 2KKOA 2Y48A 2OZJA 2O3FA 1T6SA 4OIRF 3R0JA 1XMAA 3ROUA 1NXMA 2PAEA 3S7IA 1J58A 2N7GA 4QGLA 1EH8A 4EM0B 1J75A 3RYRA 1FXZA 1KU7A 1LQ1A 4XFAA 2QLZA 1R1VA 4WVZA 5D5WB 4CZZA 4FAGA 2FBHA 3PLQA 2D1HA 4U0WA 3V8KA 2RNJA 4IJAA 3BJOA 2HQNA 3F8BA 3ISPA 3L09A 3BPVA 3V4GA 1U78A 2DK8A 2L01A 3W6KB 4MGRA 2DI3A 2M1BA 3RKYA 4ENJA 5FQ0A 1O4TA 4LUKA 4M6XA 2GA2A 3TNPB 1W5TA 4BHCA 1DGRA 3BCWA 3EJKA 3RYKA 1YS7A 3O2PE 2MNGA 4J1XA 1K7AA 4QXKA 4WWCA 2ESNA 2A6EF 2VBYA 4I0BA 4MV2A 2GC1A 3WU0A 5HOOA 1SQ4A 1MKMA 2QCSB 2PFBA 2L4MA 3FM3A 3FXRA 2RGVA 4WXDA 3WTZA 1H1IA 1E2XA 4WCGA 3QPHA 4R8HA 2RKHA 4BXUA 1YYVA 1LRHA 4L0ZB 1BM9A 1BJAA 1TW2A 3LSTA 5DCMA 4HBNA 2Q30A 2LDUA 3E97A 3K9TA 3SCFA 2GZWA 3GFJA 1J3RA 1XGNA 1NYWA 5ED4A 3L7WA 2QYOA 5DD4A 1JUHA 1Z7UA 5FFZA 1AOYA 4M74A 3TQNA 4ZH4F 4A5MA 2HEOA 2QVOA 1S3JA 2D40A 1X7NA 5FPZA 5HS9A 5D1IA 2CAVA 3R0AA 1WRJA 4HF2A 3WTYC 2VBXA 5HS8A 3T5XA 1P6RA 1KYWA 5E16A 3E6MA 2E7WA 4UUVA 3S0MA 2PEXA 1ZG3A 1CGPA 4MEYF 5DEQA 5EFUA 4G7OF 2XIGA 2GU9A 2EV5A 3KEOA 1FZPB 1QPMA 2OPKA 1PMIA 1YFUA 1JXSA 2DPDA 5FDBA 4LLOA 2IJLA 2FNAA 1OMIA 5D5VB 3SHFA 1ZG5A 2R7DA 2XASA 3MAJA 3ZMUA 4ENKA 3N4MA 1YS6A 3CJNA 2O0YA 1ONVA 3CUOA 2LF7A 1Z1DA 2LF8A 3H7JA 2FRHA 5D8LB 4A0YA 3K69A 1MJAA 2DBBA 4IRHA 2ZKLA 3HQXA 2Z33A 1Z05A 4RGRA 4IEZA 1SFNA 1SAXA 4L2NA 5KHIA 2VECA 4BNCA 3WTSC 3BROA 1ZZ7A 1GXQA 1R5HA 4KNYA 1G6NA 2MHFA 2E9QA 4RB0A 5FD5A 4XF3A 3TGNA 4IRGA 3CLOA 3HRMA 2V1DA 3P9IA 4KMFA 3F3XA 3LAJA 1ZVFA 1JGSA 2M45A 4PIZA 5JR7B 1LR5A 3UKVA 4Z2YA 2XL7A 4LB6B 2PFWA 1QZZA 2Q2EA 1IN8A 2K86A 3CDHA 3RI4A 4Q0VA 2PQ8A 2KJCA 3WW1A 1IN5A 2WFPA 3TKYA 5FCCA 2VN2A 2DU9A 1B9NA 4KIBA 1UHWA 2TDXA 5HVQC 1W5SA 4ZYEA 1UCXA 3ACLA 2OBPA 2OYZA 1Z6RA 4HLXA 3E6CC 1RGSA 2EFWA 1IN4A 1GXPA 3SHRA 1ZZ6A 5IT9Z 5JAXA 3FE5A 1U3EM 2ISYA 4E2QA 1SEFA 4PIYA 4U0YA 4ESJA 2FU4A 2HFHA 2VC1A 4LLLA 4MGZE 1J3PA 5JI6A 1QNTA 3WTXC 2PYTA 3J81Z 1YQAA 1U2WA 1J0RA 2VE8A 1G4DA
chains in the Genus database with same CATH superfamily
3ZOBA 2YB7A 3X29B 3TDUC 4C0HA 1K45A 5IOYA 5DV5A 2STTA 3WG3A 1W7PA 2DVBA 1ZBE1 5FREA 2GC2A 3MIBA 2BUKA 3AYCA 3CJXA 4OAYA 1SHWB 3CLPA 5FZHA 2DFHA 4YELA 1VQPI 3AXDA 1EUTA 4FVVA 1FNNA 1WI3A 2VM9A 3MPPG 3MZ8A 5BNNC 2FX0A 1G8WA 3LSHA 4NC6A 3S1RJ 1KONA 3AJYA 4P5HA 5DUUA 3TOJA 2MPFA 4M0NA 4OU0A 1DZTA 1TMF3 2DA4A 2R93J 1V6JA 3O7OA 3PUBA 4K6BA 3PFYA 5BNQA 3IKWA 1NCRB 4FISA 3I4IA 1SLAA 3V7RA 1HXS3 5GPCA 5GZFA 1S4CA 4NNJA 2DCKA 2B5HA 3S2DJ 4YW6A 5FZ1A 1XC5A 3RNSA 2WLPA 2G9FA 2W0XA 4A7YA 2ET7A 5T5LA 2ZGPA 1UU6A 2VG9A 3PUQA 1T6BX 3S2HJ 2JDMA 3BTYA 1V9U2 2R7EB 3K46A 2WNUC 4DXTA 4I30A 4BQ4A 3WDVA 5FO9B 5IT3A 3B9IA 2DQLA 3PIGA 5EF6A 4CPBA 4HDVA 3QRFF 4I0WB 3DF8A 2CQKA 2CS3A 3A1YA 5H2FC 4V2GA 2W1OA 3OYEA 2ATFA 2R0HA 1XN7A 4A69C 2WB1A 2V26A 1ULOA 4QAWA 4CDUC 3K4CA 1FOD2 5H6RA 1SMYF 1GZWA 1QNYA 3KGLA 1XCVA 5C4WA 3AFHA 5A6ZA 4FQ4A 5IP9J 1A36A 2F4LA 4LJZF 2WN2A 3CJIA 3H0DA 3FFZA 4G6DA 3BPXA 1YJKA 1FOYA 4OIOF 2K02A 1PZ9A 3ZXLA 1CAUA 5I8TA 4UW5A 5CFDB 1CF7B 2QBYB 1FYKA 3K2ZA 2D98A 2IFWA 3LEIA 2H09A 5FZDA 2ZXQA 1JE8A 2PMZN 5CLSA 1VAKA 1X36A 1XRUA 3LPGA 3GM8A 1AR81 1OYWA 3I2GA 1UXZA 1ENQA 3BU7A 2GC3A 3DXTA 3GNEA 4LHLA 2VUDA 4PK4A 3RZDJ 1RL3A 3ECOA 2VOWA 3WSOA 2IS4A 3CQOA 3ZMNA 3A0HC 3M7AA 2F5EA 5F08A 2EFQA 1XGMA 2WR9A 1ODDA 2HWB1 5LBEA 1F35A 2W39A 4XMYA 3EUKL 4QTRA 4YW5A 2DU0A 3VFZA 4LG3A 3MYXA 3TBDA 1I3QJ 4X1EA 3F6VA 4AVBA 1ZAOA 3QH6A 3Q3SA 3CQZJ 2BV6A 3U4SA 2DTWA 3Q8EA 4HOBA 1HQLA 2E5NA 4D7NA 4XNFA 3FMRA 2LY1A 4OMYA 4U0VA 3FXQA 4Y24A 5JOXA 2RR13 1UYYA 1CD3G 3H9GA 1S5LC 2AXLA 4ES8A 4A5NA 3ELKA 2W92A 3MEPA 4MEXF 3K7AJ 2FDJA 5FBJA 5EPAA 1VQNI 4HKOA 5FY4A 5HI0A 4C30A 4B4CA 4M3GA 1ODNA 3B3QE 4V2VA 1LKXA 3AG4H 1OFSA 3VYSB 5HNHA 2BVVA 5EZGA 3I53A 1DPUA 3HDDA 4XFHA 2QSHX 4BY1J 2E2JJ 2RDRA 1I6XA 2PLV3 4EWEA 3IP4B 3GJBA 4GYIA 4Q4W2 4OCTA 4K40A 4GB33 1OR7A 2UY8A 3CCEI 1VMHA 3LSDA 4E7KA 4GMP1 5K0UC 5T3NA 3ES4A 3ES1A 5EYRA 3VWBA 1ZBA2 4DMIA 1I3AA 1W39A 2I07B 3GZ5A 4Q4V2 3EUHC 4HG2A 2R16A 2VUJA 2O61A 3IAM2 1UU4A 3H0OA 2GAUA 2BXZA 4ET7A 2BHYA 5EYYA 5AFBA 4JC1A 4IOAF 4E4ZA 4EJTA 4BMEA 1IW7F 3POIA 2YPRA 1SC7A 2Y34A 3C7GA 3C18A 1O5LA 2YX7A 4RGAA 1Z78A 5A70A 2B0LA 4S05A 2HYKA 5FMBA 4IGPA 4KT5C 3PIJA 1VBE1 4YPJA 2DA1A 1TME2 2JA2A 5KVRA 1JU4A 1ZZ8A 2L0KA 4NAOA 2MYSA 5E8GA 4RFT0 2AHQA 1WMXA 2A68F 3S93A 4M71A 2C6YA 3RIRA 1OH4A 1IN6A 3UJQA 5CFCA 1KGSA 2VCBA 4NPRA 4P5YA 3RSJA 4PCQA 5K8SA 3VD7A 3L00A 3TL4X 1Q43A 1TWHJ 4PSWA 1N25A 2JA6J 1PZ7A 1B9MA 1K6YA 3O0VA 2LBFA 4K1YA 4GQ7A 3S14J 2JD4A 3ZN4A 1V6LA 3VUOA 5FYMA 3DECA 3A2KA 2E51A 5A7WB 3KMHA 1IF1A 4INDA 2HKOA 3HKZN 3RRDA 5F0HA 3KV9A 3C7OA 2ELJA 2ARAA 3SQNA 3ACHA 2EXHA 5DCMB 4PIXA 5L3GA 2KD7A 4NROA 3QBQA 4LR4A 4CDUB 2CFXA 4HNVA 1Z21A 1OUSA 4KL1A 3FXJA 3TEDA 2FQ3A 2QWWA 4HW0A 3VZMA 5E17F 1SCRA 2I45A 3D0JA 1UOBA 1D4M1 5BNOC 5DG2A 1X2MA 4XRMA 4CCDA 3E6BA 3IZOA 4A12A 1X1BA 5F6FA 3VPRA 2JKXA 1VQOI 2OC6A 1AXYA 2C9KA 1NCQC 3PNVA 2E2IJ 5HDNA 5CKNA 1AR71 1GLHA 2M0MA 1AR92 2XGXA 4LKSA 4AFBA 2V6EA 2XPUA 2RJKA 5A3MA 1HDKA 3WDXA 3OV8A 5FFXA 2JG8A 2WWJA 1K6OA 2JN6A 2YBSA 2EZHA 4PF5A 4BQQA 3FXUA 1H0MA 2KIUA 2DW4A 4ITCA 2BTVC 3P5BA 4QGMA 2V6CA 3ASOH 4KG0A 3W2WA 4AQ2A 2LKXA 2V9VA 1TQPA 2EIGA 3WTVC 2LTPA 4EGZA 4BLJA 2JUCA 3ZQFA 3LFKA 5E1WA 1PK6C 4QPIB 4CP9A 2QNKA 2P7VB 4KFCA 1Z67A 2BP6A 4J6GA 4QPGB 3VHNA 1CX1A 1GOHA 5B66C 5LHIA 1SD7A 1T0FA 4BAYA 2R7OA 3VYUB 3VBSB 2A5YB 4AIDA 3HEIA 3VKOA 3BOWA 2R30A 1XCBA 2O8KA 1YIPA 3FC0A 3PIPF 4DQAA 2DA2A 4I7HA 3POSA 5JSRA 2OA4A 4UT5A 5DUKA 4IQJA 3BTLA 3ZO0B 1T38A 5F1JA 4NBQA 2NM1A 4BGDA 2NN8A 2YXSA 3PNYA 3QAHA 1LESA 4DNYA 1VBB3 3MW2A 1XNBA 4BA6A 1JKRC 5B1AH 3AZXA 3S15J 1JI6A 3N36A 2D3RA 5FZCA 2JDYA 1A34A 3M1EA 5M5WJ 1V5FA 3VBOB 2W9XA 1C1FA 4GWNA 4EEFG 2ZAHA 2ZBKA 4E4HA 3Q5FA 5DDJ2 3N97A 1UZWA 2P2KA 3F22A 2HS5A 5JLWA 2WN3A 1XDSA 3WUDA 4R9BA 3GTPJ 4PDWC 1KEXA 5EEHA 2EFPA 1H8VA 1H2MA 3M8LA 3KCXA 2XJUA 4OMZA 4D5FA 2EALA 2WT0A 3DQVC 3HOYJ 4QPQA 4KISA 1RESA 1LEBA 3J7AO 4P00B 5DZGA 1F5TA 3IWZA 5C5TA 2VJXA 4TYSA 1VBA2 4D7SA 2CAUA 4HYEA 1KJRA 3OIPA 4CA0A 2WABA 4RSUA 3IN9A 3K4ZA 2HTSA 4IHYA 3MFAA 2P3JA 3JD71 3CF5F 4Q4V1 3Q9VA 4LBQA 2VC0A 2QF7A 4UUSA 2R7WA 3LDBA 4MVTA 4KUMA 4LIUA 2WIIB 2YHJA 3FLRA 2Q8OA 3HAGA 4XF0A 3AZWA 5FOBB 4OI0A 3G4SI 2O0OA 4C3IJ 1N77A 5FZ7A 5I0SA 2K27A 2WZPP 5JZGA 1NG0A 1ACIA 2XJQA 1DPRA 4PJMA 1Q8SA 4QHZA 3Q0WA 1JYCA 4AI0A 1ZELA 4LHSA 3FDYA 2XGCA 4HONA 4UWDA 2K9QA 4W6YA 2G7UA 1YLLA 3H9QA 1WGXA 3GZUC 4LKEA 2LY2A 4PJYA 1G86A 2VC9A 2PXJA 1PVEA 3HN1A 3KP3A 4FFFA 2LRPA 1XX5A 3C3WA 1WSUA 4FPFA 1DU6A 1DU0A 3GCXA 4GWIA 1JN2P 2R072 1DYOA 4XOTA 4CP0A 5F5AA 4AQSA 4CU8A 2EZLA 3OYAA 3B00A 4NUBA 4JQTA 1ZRRA 5H9SA 1Z3XA 5H20A 3WW3A 2L7MP 4N4NB 2YG0A 1Z7LA 2E26A 2LLKA 3HPHA 4LQRA 1MS3A 2V9PA 1YQ2A 3DCFA 3H5RA 4OZOA 4Y26A 4IETA 4UUTA 2VPRA 1HRI3 5KC5A 2A69F 1UMHA 3RS6A 1RXFA 4UFIA 4LKFA 1PIV1 4UXAA 3ACGA 2KPMA 2QUOA 5FK7A 2VXDA 1KU9A 2Z2SB 4IGQA 2YUSA 3POBA 4OHYA 2W91A 4NIDA 1GU3A 5GLTA 5ABJC 3WD5A 1JZ4A 4KU8A 3JRHA 1UOJA 3LQCA 4ATFA 1LUJB 1S0CA 1MQTB 1V55H 3H50A 1AR91 1ZHFA 4CCJA 3H3ZA 2VZOA 4Y1UA 2ZA9A 2VASA 5AONA 3AFGA 3UJOA 2V4VA 3ATGA 1NE4A 2VT2A 3BC8A 4I99C 4U7BA 1ZLKA 3ERED 2F2EA 2FMLA 3I58A 4QX5A 4BQ3A 2K9MA 3N7LA 1N78A 3OGGA 2YC4A 1VRH3 1PO23 4M4RA 2ZHKA 3VBUB 2ZXIA 2H6CA 2ZHMA 3BG3A 5ANQA 5C3QA 4QM9A 2CW8A 3RJRA 1D5YA 4FAHA 1R083 4JAAA 5AIPA 1NTCA 1TQIA 2FQPA 2QQNA 2JMWA 2MW8A 2WJSA 1AX2A 3CF6E 4AWDA 2I74A 3ZXKA 2D6PA 2XQXA 5IT9K 3QOPA 4WM8B 4W4ZA 2CO5A 1B35A 3WDTA 3OS2A 1R64A 1EV13 4PI0A 3DKQA 5F37A 2YC0A 4M3CF 2QGUA 4R1HA 2JG9B 4IV3B 3WLUA 4Z07A 4NAMA 1GP6A 2F5FA 3VDDB 4XLAA 2GP5A 5L3BA 1VQ8I 4Y5SA 4ARYA 1AYN2 1RI7A 4QX7A 2EINH 4AIHA 1MIJA 5BNNA 4C91A 3PURA 1RHI3 4WX9A 5FZ4A 1S2KA 1JYIA 1MBKA 5DS9A 2HBUA 4MQVA 2HXIA 3P9KA 1LGBA 1SPPA 1RKTA 2PQQA 5DZFA 2RS11 1FOWA 1ULCA 1FSEA 5FPAA 1FMD3 1USTA 3FM5A 4CDWA 1VBA1 1YW7A 1DQ5A 3VEPA 3NWKA 1TNFA 3RQIA 4FOVA 1TMF2 3PFIA 3VZNA 2ENRA 4EN9B 3B73A 2NMOA 3ZXAC 2JVHA 5FUPA 3ZPYA 1HXS2 5DUIA 4XF4A 1KYZA 2IXJA 2WNUA 1IC8A 3VKFC 1H0BA 4HN0A 3AG2H 2RS32 3LB9A 3NL1A 2W08A 3SEZA 3J7NA 4YYOA 2A6XA 2FBIA 2YROA 4SBVA 3HYIA 1O4ZA 4CTEA 1FPQA 3LMMA 5C71A 2B7EA 4QIWN 3OYHA 2WQ4A 4NN0A 4XUQA 2WINB 3K48A 1WJEA 3C2BA 3AG1H 4UF0A 2QTWB 3PNAA 4QT6A 3R0RA 4JGYC 5AC93 1W1WE 2D6NA 5FXWA 2ZJRF 4FX4A 2BY3A 3K4JA 4C3HJ 3K1MA 2IXCA 2WAQA 3M3QA 2QA4I 2VJ5A 4MXWA 2A6HF 5BQTA 1WFXA 3OD0A 2R7TA 5LGUA 3S32A 4EJRA 4CEWB 3CUQC 2BV4A 2WC2A 5IUQA 5I0RA 4QB1A 3SCGA 5EZHA 2R071 2FA5A 5KHKA 1HXDA 1DGLA 1RUJ2 2Z4FA 1QWRA 3VD9A 1PJRA 2E31A 2ZEWA 3ABTA 4YVSB 3OTFA 4DOZA 2VONA 3NMBA 4BLIA 2E7AA 3C7HA 2R92J 1ZYRF 3T1MA 2CYYA 3CEWA 5EGOA 3W2AA 2VE9A 4IX7A 2BWAA 1UZZA 4AI1A 4C1WA 3FHZA 1FBSA 5A33A 4RD7A 2GP3A 1BBYA 1RINA 4WVMB 2PHXA 2BW8A 1XE8A 4XOGA 4MGSA 1G9DA 4KT6A 3RKWA 2VQLA 2OPTA 2X51A 3PNTA 4EQVA 4IDZA 4XZUG 2KA3A 3CJTB 2Y6HA 2WAOA 2LTNA 4AUXA 4D5CA 1BI3A 5IP7J 1JHFA 5SV5A 5H9QA 3ZQ7A 2L54A 1X3UA 4DYCA 3AL6A 3OSDA 3RQ0A 1H2LA 2ZGQA 3AM2A 3U78A 1V6MA 3QPLA 3ENRA 2Q8CA 3A23A 4PDKA 1WI9A 3OY8A 2VT3A 1LDJA 1O3TA 1JUSA 4CXWA 3VKMA 5ILUA 2ZGMA 3OL3A 4UW4A 4IERA 1PO11 4E8DA 3H7YA 2BVBA 1I5PA 4XLPF 4XRFA 1C28A 3JSPA 1TVGA 1P7JA 3PU3A 3O12A 4YFXF 3WTTC 3OYJA 2BXYA 2RR12 3SISA 3KZZA 3W2VA 2X09A 3S3MA 2DVDA 4QQPA 4BQOA 2XJVA 3OJBA 3PUAA 4XJWA 1D1BA 4Y3OA 2CJJA 4M9XA 3OGJA 2RS52 3I2OA 2W57A 3FL7A 2OQ7A 3USUA 5M0TA 5HPOA 3IPVA 2HBTA 4XAAA 2V1XA 3ZPOA 4OIPF 1R1A2 4EYUA 3FXMA 2O6GE 2UUZA 3KEQA 1JYTA 3E5XA 1F1ZA 1M06G 2QQIA 4JHTA 2CGNA 3GGLA 3IRQA 1EAH3 3NKTA 2PLV2 1ZR2A 5K0UA 4CHUA 2XSJC 2MBFA 5FLXZ 1ZA4A 5E3LA 1OF4A 3LF7A 2EF6A 2E60A 3EUHA 1DQ1A 3JUUA 4GB32 2LKSA 4N53A 1O4YA 2JIGA 2JE8A 4O61A 3KE2A 5GZGA 1AYN1 1HDPA 2AQFA 3HG9A 3I2JA 2EK5A 1N3PA 2DJIA 4P02B 2CU5A 3I3LA 4IEWA 1QZEA 3OS1A 5CJ9A 4LBJA 1XMKA 1HW5A 2DT5A 1U0JA 4IRIA 2CG4A 4AFAA 3DN7A 2YU1A 4CDQC 1J59A 4GULA 5FAXA 4BQWA 3ZQHA 4XSZF 1WW4A 2FBEA 2W4SA 5DAPA 2E63A 3VOEA 1BR4A 2ZGKA 1US3A 4EZHA 1OXCA 3HL2A 3A0NA 5FRAA 1WHUA 3TDZC 4LBLA 4CUAA 2PMZA 3KSCA 1FT9A 3QYEA 3QU3A 2K7LA 2MLGA 1VRBA 4C0BA 4ZZLA 3CMAI 3HNYM 3IKVA 4B8XA 3OBZA 1QJX1 4EJWA 1SFXA 3P5JA 2CV2A 1HXS1 2TBVA 2Y6KA 5B4NA 5K7ZA 2X6OA 1XSDA 2X5IB 4ASMB 1SVMA 3S30A 5M5XJ 3ZMDA 4SLIA 3ASNH 4ASKA 1JUMA 2WSVA 4K8RB 4N7IA 4XF1A 5E6HA 3QPTA 2MGQA 3ZQGA 3HOWJ 5BNPC 4CZSA 2GNBA 3GTKJ 3UL2A 4AIJA 1RUF2 4XJ8A 2J5PA 2A6TA 5EZWA 2DT7B 1F9KA 4B1MA 3HN3A 2R5YB 1FV3A 1MZFA 4MGIE 1IQAA 3VKLA 1VI0A 4PGGA 1U5XA 2XVKA 5BNOA 2WNVA 1BI1A 2YR2A 4AHWA 5FO7B 4L8QA 3ZR6A 1MEC2 3D6EA 3LCPA 1X2NA 1J09A 1DDLA 1NCQA 1HJGA 2MC3A 5C9AB 4P9WA 1OQDA 1S0DA 3L2YA 5C8WA 3JW4A 3PVOA 2Y30A 2VD7A 5GLZA 1UKRA 1SFEA 1BMV1 2VY0A 2UURA 4O3MA 2QVSB 2Z5UA 3VB2A 2D44A 3BOPA 2X8KA 5I0UA 1MACA 1OKQA 2DCTA 1KGYA 5HODA 3PMSA 1LOGA 4HSJA 3CBNA 2E1MC 5GZEA 2YC2A 2P5VA 1PK6A 3GYHX 2WZR3 5L3FA 3AZVA 1OD5A 1OSGA 4J19A 3MUZ1 4I01A 1BJZA 1W36C 4WK8F 3Q0VA 3JTHA 2PG4A 2ETHA 2DUOA 2VVDA 3T0BA 2LKPA 3I2HA 5E8AA 2B39A 3K2AA 3BTZA 4XQWA 2IGMA 1IHMA 4AEKA 2JDHA 2DWRA 3POEA 5SV8A 1D3YA 3WXPA 1GZ9A 3HEFA 1JT6A 2VZ3A 3NNJA 3LSJA 2WRAA 2PBIA 3ZSLA 4AVZA 4YGBA 1ZKGA 3RG0A 3AX4A 4F3QA 5FJKA 1PP8F 3GJAA 4NDLA 2JWPA 3ABZA 3AVSA 4AXOA 1FOXA 2ZMLA 4K20A 3UKTA 2KKOA 1VBB2 3T30A 4AAPA 2RR11 1RJ7A 2ZXWH 4CU6A 5LZ6A 3MKWB 3R0JA 2Y69H 2Y9ZA 1X1PA 1HCRA 1ETKA 3OYLA 4PDWA 4EM0B 3JCIA 4RR3A 1JTZX 3RYRA 1KU7A 3ZM8A 1LQ1A 3W3CA 4XUOA 1XJAA 2GBYA 1R1VA 4A3EJ 5D5WB 4JYKA 3PLQA 2D1HA 3ZR5A 4U0WA 3V8KA 2HEYF 3BJOA 2HQNA 2OIIA 1BEV3 2ILMA 3F8BA 4FP3A 2WQZC 2E35A 3I4NJ 2W1WA 4K3UA 2BHZA 2DK8A 2L01A 3HKZA 3H9JA 1GR3A 2B63J 2M1BA 4LBMA 2IAIA 2RM23 5L19A 3BCWA 4DFSA 1TC3C 3RYKA 2MNGA 3T2OA 3I3DA 2VBYA 2WFF3 1YJLA 4DUVA 1SQ4A 1CVNA 4FSJA 1W0UA 2PFBA 2L4MA 1SAUA 3AP6A 2QSFX 3UV9A 4RQPC 3OWTA 2VXJA 3ZN6A 3GLLA 1X19A 5A3UA 4N8MA 4URAA 1BJAA 4OHVA 5FMOL 5LA1A 3LSTA 4HBNA 4JDNA 1JZ6A 5HNFA 5LBCA 3SCFA 3NNFA 1J3RA 1CIYA 2W48A 4LBKA 2GH8A 1FV2A 3L7WA 1W6OB 5K7FA 5FFZA 1W0PA 4GDFA 2J1TA 4D6SA 3N9PA 4ZH4F 1VZ0A 5GPAA 1CWPA 1F43A 3MF9A 2QVOA 3TN93 5FPZA 4BEHB 3UNPA 1W0TA 1UX6A 4TSVA 1IDZA 2F17A 5F2WA 1KYWA 5E16A 1B8IA 4UUVA 3QODA 4NHMA 1FIAA 5IK4A 5IVCA 3K51A 3VHOA 4AK3A 3W5NA 1UN1A 4MEYF 5EFUA 5T52A 2QCOA 5F27A 3UKGA 2VUCA 2XPWA 1UNBA 3LPFA 4S2HA 4AEMA 4CVUA 1R4NB 3LOCA 2CQXA 4U87A 2PHWA 4LLOA 2XH6A 4R4ZA 2OCEA 1OMIA 3OSFA 3SHFA 5IFTA 1KDMA 2JXAA 1ULGA 2VOTA 1DF0A 1MBEA 4HPKB 5FPUA 1MZ6A 2IFRA 3CUOA 3ZXFA 5ABJA 4NWWA 2ARXA 5L73A 1HRI2 1MJAA 2ZKLA 4MXVA 2A5WA 3BU0A 5KHIA 1ND2C 1PGW2 3WTSC 1GOFA 1ZZ7A 1GXQA 4D7MA 1W9FA 3S17J 4BXFA 4A3JJ 2MHFA 3L2VA 3LEKA 1Y9MA 3TGNA 4BE1A 2RJ2A 5LBFA 3LAJA 1VMJA 5A6YA 3ZFGB 3B5LB 3JREA 4CEYC 4Z2YA 3MIDA 3NQHA 1BOBA 1SZBA 1QZZA 1IN8A 3CDHA 2YMZA 3JXSA 1IN5A 1SLTA 2C26A 2WFPA 3TKYA 3J7MA 2DU9A 4DBRA 2DTYA 2E1MB 5FZIA 1W5SA 4ZYEA 1DGWY 1PO22 3G2BA 2CWMA 4NO4A 2QFEA 1HB2A 4AHZA 3ZXDA 2ZJPF 5FWJA 1IN4A 1GXPA 1R082 2UV1A 1H8TC 1BA5A 4UFKA 4HETA 5JAXA 1L7LA 1N1YA 2R041 5IT6A 2EIMH 4W6XA 1TWGJ 2VC1A 3ZFFA 4MGZE 1J3PA 5JI6A 2YS9A 1OA2A 3J81Z 2GDFA 1U2WA 1OQEA 2DOEA 1J0RA 4A3KJ 3IT8A 3KT4A 3O1MA 2ET1A 3VL9A 3KZYA 2DQRA 1VP6A 2NLRA 1WLCA 1RPWA 5FZKA 1E0EA 5K7HA 4RAGA 4XBFA 2JICA 1CONA 1DDNA 5FZFA 2F4OB 2JA8J 1EUUA 4FPHA 1VBB1 4C2MJ 3BR6A 2HOEA 1RRJA 1PHMA 3IIAA 2NZ9A 5I91A 2IT0A 4HLTA 5BPIA 1BBT2 5CKMA 2HDWA 2RMU1 1MZBA 1X8EA 1BOAA 2CUEA 2RC4A 3K4BA 4AM3A 4QU1A 4JQRA 1WW7A 3VBHC 3GTMJ 2J1VA 2YSRA 2ZNYA 1DYPA 1HKDA 1W04A 4K2EA 2VTXA 1O3SA 5IYYA 1NOVA 3WDWA 1AXKA 4YLZA 5B5EC 1WCKA 5HLTA 1R1TA 1PGL2 3CO7C 3DBLB 1J84A 3SJMA 4XCBA 3BPSA 3M4OJ 2OT7A 3AC0A 4E2SA 3ZYPA 3RZGA 4COYA 3ELNA 3NNLA 4XBLA 3OYDA 4BL0B 1RUOA 2JB4A 1KS5A 4BDZA 1YIOA 1LFPA 4G12A 3KYCB 4BXXJ 2MLKA 2ZB9A 3RPUD 1AYM1 1I9RA 1WLWA 1L7QA 1M4WA 2JVGA 2QE3A 4RS8A 1T2KA 5FP8A 1OI6A 3IL2A 2XQRA 3LFUA 4BB3A 2R7VA 4JGYA 3DEMA 5F5IA 3UETA 5KC6A 4W50A 1NHAA 3OR1C 4IHXA 4HQEA 4WM7B 4CZCA 3C2UA 1U5TB 5JXHA 1QJFA 3BJAA 4D6QA 3MF6A 5AC92 2XONA 4IEVA 4UBHA 3FK7A 2RV8A 2K2SA 4KITB 5CB7A 4RM3A 3CUQA 1XBFA 2ZMEB 5GM0A 3WTUC 4G6QA 4AQTA 3PJQA 5GTHC 5A32A 3ZRGA 1RUC3 2P6HA 5DABA 3C7EA 2IP2A 1OD3A 2GXGA 2E5ZA 2I5UA 2D93A 5IJRA 2E7XA 4GXLA 5JVTA 4R52A 1SFUA 3S1NJ 4RB1A 3GTOJ 1YQ5A 3M2MA 2E7TA 3MZHA 1YTYA 2UWMA 1H1AA 4ISQA 3WGGA 3CESA 2XV4S 1FMWA 4L5JA 2ID6A 1LDDA 4LG0B 2ZGLA 1PM4A 3WNOA 1HB4A 5FY5A 3OBAA 1DP3A 1L3JA 1SD4A 1TEIA 1FP2A 1MR5A 4L9BA 3GZTB 1B59A 3EETA 3PUFA 2F5VA 5FFOC 1LE8A 5FZLA 1PVC3 2WT2A 3WOGA 1BW6A 3P3NA 2BW3A 1HRI1 1MS8A 3AK0A 3ZPLA 3KFWX 5EWSA 4PBOA 2VO5A 1VQ6I 3J26N 4OLLA 4YIRX 1N3QA 1IV6A 2OCCH 1T08B 2YZ4A 4MUVA 1GWMA 4H3WA 1VQKI 2NVQJ 4ATEA 3BVCA 2XVCA 4CCLA 2HQRA 1FP1D 4EN8B 4S2FA 3BQZA 1WA6X 1CAWB 1OVSA 5JR2A 4A3LJ 3KQ4B 4MGYE 1O5UA 2XBO3 5J36A 2D2WA 1R7JA 4G9SB 1FTZA 2RG4A 4CEYB 1DCSA 5FPXA 4OHWA 1X82A 2G19A 3WUCA 5KHGA 2DTZA 4XURA 4A42A 5EYXA 1TNSA 1XNDA 4E7ZA 5DM6F 1ZM1A 4UW3A 4FQGA 1FBQA 3BPZA 5FKOA 4FCYA 1RUH3 4X6QB 1GNYA 3WR0A 4BJ6C 1VRH1 3ABUA 2Z42A 1TZOA 4LK6A 2PJRA 4OI1A 1R36A 1IQDC 4AQ6A 3K4AA 3R4UA 2QQBA 4NPMA 4P9LA 5I8YA 1R081 3U75A 4D8MA 1W03A 1JYVA 2COMA 1JT0A 1OCTC 3H8OA 2KJBA 5F5QA 1NY71 3A01A 4LNVA 3F8MA 3WHUA 4PJLA 3FKJA 2JE9A 1OLME 1IV8A 5FLXK 4ZPIA 1WCDJ 1Y9GA 3F95A 3BR5A 3NAPB 2W2IA 3MUY1 5LGNA 3COAC 5FYYA 1JYNA 4N9IA 1EV11 4ZS3A 3DF0A 3TO6A 3ZMTA 2QEXI 2WAFA 2HYJA 1ASJ2 3WODF 3KZ4C 1O3QA 4KNCA 1XG1A 3TB0A 3WTWC 5GAHJ 2QDNA 4CDQA 4META 1TLHB 5KK1A 1QH6A 3BCAA 3KP5A 1W05A 2EPFA 3QACA 4YZ5A 1LJ7A 2D3PA 4LHNA 2A3WA 4M3DA 3Q8FA 1Y8QB 5IYDJ 1LB2A 1NUKA 1K4TA 2DBNA 3GEZA 5FQ0B 1RHI1 1MBJA 3CLQA 3CKHA 1OBNA 3M70A 3VD3A 4FX0A 5ERIA 1AA7A 5HS7A 9ANTA 3C8XA 2X6WA 3FZVA 1IRFA 1P4AA 3HTUA 4YGDA 2WADA 1C0WA 1FMD1 1FOD3 1PGL1 3KP2A 2DCZA 3FLPA 2DYCA 5JWPA 1XQNA 3RJ2X 2IA0A 4HEA2 2ZFUA 1W4MA 4QU2A 3BJ6A 1FMVA 1VQ4I 2GC0A 3REOA 4R4XA 3POYA 1W6PB 4X0GA 1RVF3 3RZKA 4KG8A 1N1VA 5LA9A 3WP5A 1S7AA 2BNMA 2CUZA 5F1RA 2KHMA 1ENXA 1VLNA 2DVFA 3VYTB 2VQ0A 5BNPA 2RVAA 2Y0IA 1CR7A 1C8M3 4UAPA 4BHBA 2Z9OA 1DGRN 2HEVF 5FK8A 3V0AA 2KP6A 3JR9A 4MGKE 4GH4B 5LWBA 1EH7A 3U0ZA 5L3EA 1UWWA 3CCVI 4XTPA 4BE0A 2WA0A 3H1CA 4B3NA 4UVBA 2WKKA 3ZLIA 4Y22A 2JD9A 1W9TA 3NWTA 1Q1HA 3E0JB 1IRZA 3OUIA 4QDSA 1UHMA 1OC1A 3KM5A 3AP4A 5AVPA 2WUHA 2XAJA 1KFUL 4N90A 2HZTA 2R7SA 4DNCA 3DEUA 3ZYFA 3AZYA 3ZN0A 1ZREA 4BPZA 3PU8A 3L2HA 4ZXKA 1QHGA 3FKIJ 1ENSA 4XHXA 2VTFA 2NQYA 4UI9L 2EBIA 1ZQ3P 4Q0UA 4C8DA 3N05A 1YRNB 4GMP0 2JIJA 4FQZA 5H9PA 1W99A 3ECQA 2DMNA 4XXPA 4OWRB 1EYBA 3ACIA 1TW3A 3CHXA 2MSYA 5DN2A 3G7DA 1DQUA 3ZKUA 4RGKA 4XSXF 3ILRA 1AR62 3S3NA 4OFGA 4Y20A 4HSRA 2QQLA 2V72A 3BODA 4HT1T 4W1UA 4UXNA 2LYCA 3I3QA 3M7GA 3D1NI 2WZR2 4B4PA 3IMMA 3ORJA 2H1LA 1NZIA 1B6AA 2W52A 2L5QA 2H27A 2O1QA 3C2HA 2OZ6A 1BK1A 5FYIA 3MO4A 1E3HA 1CZTA 2DLLA 1VQLI 4GJZA 4EATA 2Q2EB 5J47A 4G3YC 1W3VA 3UYJA 1U8RA 4RGXA 2XL9A 2VJIA 4JCKA 1J83A 1GQPA 2WA4A 2WBMA 4Q4W3 2D45A 1LHWA 1JMUB 4GAZA 2FMDA 2ZBJA 5LY2A 4RS5B 3APBA 3A0KA 5A7QA 3LL7A 1LULA 4YVWC 3GUDA 5J3UA 3ZMSA 5AIQA 1RMU1 4LK0F 1D2SA 2W46A 4MNUA 5ICCA 1F31A 3GXUA 3BTXA 2CWEA 4ZKTB 1U5IA 3ZFEB 4YW4A 2JRMA 1GICA 3OB8A 1ULYA 1T39A 3WQ1A 3AP9A 4K21A 2AYHA 2HWC2 5FB2A 1GQHA 4CUCA 4IPAA 5EDNA 1TQMA 4UFMA 2D6MA 4FBFA 4JDOA 5EJCA 4BWOA 3TW6A 3JB8A 4ONUA 3R6SA 2WWYA 1VE0A 1UYPA 1R1ZA 3JBG3 1GUIA 5JXIA 1JKQC 1EAH1 3POFA 3WG7H 2V1NA 3POWA 4WXCA 4LUMA 2ZEYA 3FBNB 2RM22 4AGVA 4MO3M 4DOUA 1S55A 3VODA 2BDRA 1JOJA 5CFCC 3HRTA 3PUHA 4CP1A 1K12A 1OFCX 4RQPA 3CC2I 3D82A 3WGIA 4L9NA 1HKTA 1QHHD 2V1UA 1I5ZA 1WGPA 2EIDA 2HWF2 5GADJ 1GANA 3Q8BA 3RQ4A 1OQ1A 5FXXA 3EXUA 4QMAA 1Y1VJ 1OQYA 2LH9A 2HKXA 2M5WA 1UD1A 3WP4A 2ZO4A 1CX4A 2BWCA 1KA8A 1MVQA 1QOOA 3IHUA 3VBFC 1I1EA 3B01A 4XORA 3FMQA 3WGHA 1DLCA 3KT1A 5LD2C 1I50J 4EM1A 3A4UA 1W6MA 5KBFA 1GV5A 2NOGA 2K5CA 1LVKA 1JOPA 4P1WA 3IDAA 5D21A 3MWMA 1GZWB 2IW5A 3EQEA 4J01A 1R4MB 2O03A 1MQTA 3SKVA 3A03A 3K10A 3LQQA 5C4WB 4F3JA 5LW9A 1X4PA 3D5OA 2VCAA 4A6DA 3G6EI 1T56A 1YEWA 2PHDA 2XRNA 3IIIA 4G9YA 3ZYIB 3WF0A 4BQAA 1V70A 3CJIB 3S2WA 1YO5C 1GBGA 1LOCA 3B93A 1FAYA 2A07F 3HOXJ 1LHUA 1DQ4A 4B48A 4AOCA 5E3MA 4A0XA 1RC6A 1AF9A 5KR7A 3I64A 1A6QA 1CAUB 1XS9A 2LS6A 4Q8KA 4IEOA 2D6OX 2EICA 3VB9A 1OKOA 2JG8C 1AL0G 2ORZA 1COV2 1ND2A 5C7GA 1OUXA 3H5NA 2OQGA 1AX0A 3VDXA 1OA4A 4I6ZA 5L7OC 2D6KA 3T2QA 4WBBA 1W8HA 4UFJA 1IPJA 3LA2A 5DTDA 1JTXA 5FXZA 4HA8A 5D5UB 4X8NA 1GSLA 2NVYJ 3N7KA 1SANA 1NA1A 1MVEA 4XQFA 2Z69A 1N75A 3HSRA 4F7ZA 2BNNA 3D3AA 4XFGA 2O8QA 2ZXHA 2V4AA 3PVNA 1YJ9I 2UY9A 3ZYHA 4Q4Y3 1RYYA 4XJ9A 3JRDA 2FDHA 1UZ0A 4HFSA 5F8PA 3I56I 2WZ8A 1OHFA 5IATA 4Z2WA 4L9VA 4M72A 5KHHA 2JECA 1FI2A 5LLQA 3CCSI 2EXJA 1QGPA 3L2QA 3C1DA 2PA7A 5ICEA 3MIHA 3I4PA 1H8TA 5J48A 2B42B 2XUMA 4E9KA 1A31A 5JR3A 3ZMOA 3VL8A 2PMUA 3AG3H 3AKZA 4NC8A 2HPMA 1QMJA 2ZPXA 2DA7A 3K77A 4FETA 4M9SA 3J81K 3PUSA 1A5JA 4JGZC 5LASA 4B3AA 4AL9A 1G3YA 3WEZA 3WE3A 1PUFA 2E1OA 1TG7A 4G4FA 3OOUA 1YLFA 1CQTA 4BYYA 2C0ZA 1E5SA 4NQWA 2WS93 5HLIA 4KI5M 5CBLA 1UG0A 2UWBA 4O7XA 3DPRC 1ZRCA 4FFHA 5D5XB 2EILH 5GALA 1K5MC 4XETA 2WO7A 1R00A 5A2QZ 4AWXB 4A6OA 2BGCA 2OPWA 3G1MA 5CG9A 3LOIA 4DZPA 4MX3A 3T09A 4CICA 3VBHA 4YIIA 5FO5A 1FYMA 2E6VA 4AYBA 1QH7A 3ESWB 4Q4X3 1D8KA 2IXIA 4NR1A 3EYPA 4JKKA 1ETOA 3FWEA 1QQIA 2B45X 1HSTA 2WAEA 4ZZ5A 2M9HA 2P5BA 3J4UH 5T5JA 3ZR8X 1Y0NA 2AACA 4BQNA 1BEV1 1JU3A 2VMCA 3HZJA 1I27A 4JQFA 5C4XJ 5JZGC 4HX8A 4M9ZA 2OZUA 4CCKA 4A41A 4CEWA 4XXAA 1BN5A 1D8JA 2P7CB 2AZ5A 3PTYA 4JKMA 2BERA 4QWNA 2WFF1 3DV8A 1P8JA 3M1HA 1UIKA 5CFCB 3L2CA 1REPC 1TWAJ 3GWZA 3N9QA 1G3TA 2NS0A 2WLQA 1WQ2A 4MGTA 2BFUS 1MW7A 4BBSJ 1X58A 3U1DA 3THTA 3OEBA 3HOZJ 2XR4A 4UBGA 1MD0A 5FZGA 3W6VA 2LBFB 1R091 2VBPA 4Q4ZF 1K42A 1J2XA 3OYNA 1DP0A 4B3XA 3CP8A 2J1UA 1U0AA 4XR6A 4E8CA 3DKYA 4JTOA 2NAZA 3VN4A 4Q29A 1IJWC 2VMDA 2YBKA 3V8LA 2YU2A 3CZJA 2OF7A 1QQP3 4P96A 4D69A 5IVVA 1UQXA 2R6QA 1TNRA 3PJYA 2ISZA 2IGOA 5HXVA 3ZDVA 1U9NA 2CQ7A 1RUC2 4EVIA 3M9AA 2KIFA 3TN91 2FDIA 1VQ7I 3ZXJA 1O57A 3LSEA 2VULA 2XGEA 2ZEXA 3OG2A 4BE2A 3LFIA 4I2OA 4COUA 4YSFA 5EQUA 2VOOA 1AWCA 3S57A 4XFCA 1X3ZB 4TV7A 3V65A 4FCAA 1RUNA 2ZX4A 4XCAA 3T0DA 1GWKA 1WBFA 3ALQA 3S1MJ 5JVVA 2ZHNA 3PJRA 5F0FA 2ZABA 3G3ZA 3K4MA 3FZ3A 1HB3A 4Y1ZA 1AZDA 4E7HA 4LO4B 1KQ8A 1R23A 1UY0A 3POGA 4ARXA 2D1VA 5J09A 4LEJA 3OYCA 3O8GA 1CPMA 1W2AX 2UU8A 1F4KA 3IRRA 1X3WB 3JRAA 2W25A 2OKXA 4Y4RA 4P55A 2Y38A 4CP9B 3E5QA 3MBWA 3BTCA 4M3BA 2ZSIB 2BZDA 5JCTA 4HLYA 1IGOA 4NIGA 4H55A 1ETXA 3EDPA 1YQ8A 2W47A 4K7JA 2W85A 1GOGA 4IEUA 1JYWA 5CVJA 1AX1A 1PGSA 5L9RA 2D5FA 5DAWA 1X33A 5C3SA 3KP6A 3N35A 1LU1A 1J5YA 2M4KA 2COBA 2Y6LA 3CO2A 4Y5Z0 5F3GA 1H8AC 3SH5A 2TCTA 2M7AA 2K9LA 4DBQA 1YFYA 2HR3A 1VQMI 2M2EA 1RUH2 4LLGF 4Q0PA 2XUEA 4M6VA 4RB2C 2PMHA 2NNYA 4HVOA 5BYNA 1WD4A 3TEXA 5C44J 4TTGA 5DM7F 1T6GC 2K0GA 2X1DA 4CGZA 2VZSA 3R05A 5FY7A 3QLQA 3GXOA 4IV1C 4PCRA 2VKEA 4HRIA 1HKQA 1LKNA 1BI0A 2W95A 1A8MA 2CWSA 3O1UA 2SLIA 2ZCWA 4KIGA 2IXSA 2ZC2A 2GA1A 1PM7A 1MNEA 3GZ6A 4HNUA 4RBOA 2FD8A 4AAXA 4Z6YA 3OGVA 4YM1A 5FY8A 3U9GA 3KIOA 1JOBA 3DU5A 4CDWC 3MQ0A 4GO1A 4N43C 5L36A 1APNA 1PZ8A 2RS33 1AJOA 5A7OA 5EIYB 5F64A 4BXSV 1T98A 4M00A 1RXGA 2HOSA 1Q8PA 4IESA 2Y0MA 2F6BA 5LY1A 4CCOA 5IK8A 1D4VB 4AEDC 2XVGA 3RCOA 2CQNA 1TBXA 3GF2A 4LBQB 5C8CC 4BQ2A 3WF4A 4UFHA 1ZZBA 2VVFA 1HV0A 4B09A 1APLC 3DLLF 2FDKA 3C2GA 1RUI1 5KCMA 1O91A 3JSOA 2F6CA 3ZX7A 4KJZA 3D0SA 1HLCA 2QZ8A 1SD6A 3B02A 3KEYA 1S0IA 3MPBA 3P9CA 2UXNA 2G0EA 1XGSA 2AS5F 1AR83 1FSHA 1TT0A 4HF1A 3J9SA 5JZGB 4QGNA 4Y1YA 1H9TA 1ZGAA 3RPUA 2E53A 3O8HA 1BIBA 1KQ0A 2QKLB 1YFXA 2Y33A 1VAMA 1RIOH 2DO7A 1K61A 1BC8C 5C5UA 1U9OA 2G9ZA 2VQGA 3HT1A 4QHOA 1FX7A 1RUJ3 2W94A 1RVF2 3IAS2 5FD6A 2DA5A 2HYFA 1R71A 3RMXA 2FBKA 2XJSA 1J9IA 1IPKA 3WU2C 2X0LA 4QX8A 4QX2A 4ZDLA 1C8M2 3NW4A 1ND3C 1AL21 4UVAA 3E1SA 4AVSA 4XRSG 4IHTA 4COVA 1MMAA 2R5ZA 1E5IA 2XB0X 3GVAA 1UCRA 4COZA 4RAZA 2LG4A 1T2XA 4MIMA 2GNDA 5BXXA 1TQ5A 1MDMA 3BR0A 4AVPA 1YWKA 2R7ZJ 3VSLA 4ON0A 3HBZA 1NQJA 5A1AA 3KVAA 3UK9A 2JA5J 4FXKB 2VQHA 5FTTC 2DTRA 5J1UA 2RJLA 3MFCA 1O3RA 2R3SA 1WCSA 2W1SA 2C6SA 3HOSA 1Y6IA 4XJAA 2XHNA 4XFBA 2Y2ZA 2KISA 2XPJA 1BI2A 1WJAA 2HJIA 3WNXA 3ETPA 2D5HA 4BBRJ 2LOOA 4DIQA 2X85A 5HCHA 3E5UA 5D4SA 1LECA 3W5MA 1PNFA 4FTSA 2IXHA 4K9SA 1POQA 2AXTC 1ULEA 1A3KA 1GP5A 3S6PA 3T4VA 4XIOA 4PFOA 1YQ6A 1G3WA 2DUQA 3DBRB 3RKXA 3RKQA 4RL7A 3TRSB 4OZXA 1FYUA 2R062 3MD2A 4F8AA 1IG3A 1PVC1 1QJY1 2RS53 2BBVA 4B29A 2PI0A 3PL8A 4ZZ8A 1QHDA 1AKHA 4I3GA 2WBKA 1R1A3 4PFPA 3PO3J 2A5ZA 2QQVA 2HYXA 4IL6C 3PSFA 5E20A 1CZSA 2J1AA 1AVBA 3TP3A 2O3FA 4M0HA 1VBD3 1VBE3 1XMAA 4YVWA 1A8DA 2XBO1 1NXMA 3AMQA 3OR2C 3VBRC 5H9RA 4CCNA 1RUE1 3VLBB 1WH5A 1OH3A 5DQ0A 1POV0 2X48A 1J75A 4YG3A 3E7LA 3H5AA 2VNRA 3FIWA 4CDXA 1B35B 4WVZA 4AI8A 2FBHA 2LALA 4XICA 1V0AA 2RNJA 1RUH1 2R4GA 4D0QA 3QPSA 1OOPA 4N53C 4NOTA 3L09A 4AHYA 2FZ1A 1JZ5A 5B1BH 3NV3A 4QKBA 2DI3A 4BU2A 1DHKB 5JIUA 5EG0A 4DJAA 4ENJA 3OIQA 2VMFA 3OBRA 1O4TA 5J96B 2IEKA 4BHCA 1DGRA 5FLVA 3ZN5A 3O2PE 1JZ7A 4PJ0C 5FRMA 4WVWA 4MV2A 5BNNB 3ZYJB 4JKLA 2ZGRA 1SPPB 3FM3A 4ABZA 3QD6A 4QD2A 3ZSMA 4WCGA 3QPHA 3GDBA 3JBG2 4CDWB 2RKHA 4L5EA 2VAUA 2XF5A 4BXUA 1YYVA 1LRHA 3FUOA 3RWKX 4RM2A 1D4M3 1C3HA 1TW2A 1Q8OA 1LTEA 4BS9A 1MNMC 3P1IA 4QQOA 5FO8B 1V9U1 1ETWA 2WNUB 4QXHA 4K1ZA 2E32A 2VUMJ 4YFZA 2XB6C 3LIHA 3L1PA 4J00A 1RUF3 2NVTJ 1AOYA 2L9VA 4ZDPA 1R6RA 1QDOA 4BK5A 4A5MA 1PMHX 4PBPA 1B72A 1UU5A 5DXDA 3VBFA 1ORKA 3O1OA 3S1QJ 1H2KA 3I49A 1NAEA 2GMMA 4UF0B 2ZGSA 2OW4A 4FTEA 1FOD1 3S0MA 1ZG3A 3S8PA 1CGPA 3AKRA 2HWE2 1MEC3 2XIGA 2GU9A 4DUWA 2Y6GA 1FZPB 3OPWA 4XMAA 1JZ2A 3DGTA 2WNVC 1S2BA 1ULDA 4DZJA 4AVTA 4MXWB 1JXSA 1YI7A 5FDBA 2A75A 3WZ1A 1WKYA 1NX9A 2FNAA 2GN3A 1VB2A 4V2WA 3X2QH 5D5VB 1G59A 3AJZA 3ZYBA 4XKCA 1QJU2 2R7DA 3O1VA 4P14A 2CUFA 2K85A 3MAJA 3ZMUA 2VZQA 3WP6A 4A44A 3H8XA 1F4AA 2O0YA 4BMBA 1Z1DA 2XJPA 5DUWA 3F9KA 2FRHA 1K3IA 4XE9A 3J7HA 1JHJA 1UY3A 1W06A 1W9WA 3HQXA 4L2NA 1W8TA 3DTEA 4D3WA 1G6NA 1LOAA 3J7AY 2Y31A 3FXOA 3SDBA 5FD5A 5L7OA 3HRMA 4H4KC 2V1DA 1NQDA 3CJRB 3P9IA 5A33B 4KMFA 4M3FA 1ZVFA 3PL0A 1D2QA 2M45A 3VZLA 4KWUA 1RITA 3NAUA 3AFKA 2XL7A 3MVPA 3LGRA 5CAZA 2DXIA 2PFWA 4QQ2A 4Q0VA 3RI4A 2VNOA 2PQ8A 2VMHA 1MPXA 3A22A 4QKDA 4UB6C 5DAVA 1X1CA 2TDXA 5HVQC 1OVPA 4YW3A 2OBPA 5TISC 4IE5A 1Z6RA 1PMJX 1RUD3 5GTIC 2MG4A 4Q4Y2 1OLTA 5CIRA 4XHBA 5IVBA 2QBXA 1ZZ6A 2HQ5A 1W3XA 5FLMJ 1HDDC 3L2RA 2JJ6A 3HR9A 3OY8B 1KRIA 4FXGB 1U3EM 2ISYA 3CCLI 4E2QA 1SEFA 1ZTRA 5G04L 4ESJA 2LC2A 4LLLA 1ETQA 5GZDA 3AYDA 1QNTA 2WNEA 3TAYA 1IGNA 1YQAA 1G4DA 1WLDA 1EF4A 4Q26A 5D8AA 3KVBA 2XAFA 4YM0A 3U4XA 4FPJA 2H8RA 1QY4A 4JGZA 4D0PA 1TNTA 3DXUA 3LD8A 4HVQA 1SFYA 2CV6A 2WV1A 4LBQD 1G8XA 1TL8A 1Q1VA 2DDAA 4MYEA 4RR3C 4BUPA 1JHNA 2GOXB 3USUB 3INAA 4HBLA 2DYRH 2VW0A 3IPVB 1LAJA 1KFXL 4L99A 4A7ZA 5ICFA 1C5HA 3BZCA 2P5KA 3HTSB 4AIKA 4Q4W1 3FISA 3DPRA 3TNQA 1E3OC 1SG3A 1WVRA 3NJVA 3L9FA 1K5MA 1IXCA 2H6BA 2WS92 5A2QK 5K0UB 4ASNA 5E88A 2AGSA 1ZBA1 3V8JA 1A6CA 1H89C 4C2TA 4FFGA 2JDNA 4LFUA 1ALYA 5ILVA 4IEXA 5APAA 5J40A 4ENNA 4IZZA 3QYBA 2HOTA 1MSFC 4OYUA 1SEUA 2FSWA 2FXAA 1ZG1A 1H9GA 4NIAA 3VD5A 1DP7P 1F5JA 5A7NA 2DAOA 1UKGA 3BLYA 2EIBA 1W8ZA 4Q4X2 1S6LA 2CMPA 5ANNA 2HYGD 1BK0A 2ID3A 3ZYRA 4WM7A 3MN2A 4IE6A 4XW3A 3I2FA 2JKBA 1TME1 4N4OB 4YG6A 3J7ZI 2GXAA 2Y6FA 1VNDA 1STMA 3ML6A 4XC9A 1I1GA 3NARA 3ZQIA 1H9PA 3JBG1 3LA7A 3GCMA 3ZIWA 4IEYA 2QKDA 3KD4A 1PIV3 4GJYA 4EJUA 2VOPA 2DDUA 3ZSKA 3AP7A 2J1EA 5BPDA 2VIXA 1AXZA 1VB4A 1NE6A 5H6QA 4LOCA 1UZCA 1LU2A 2HEWF 1FEXA 4DUXA 1W9YA 3ZKYA 1ZRIA 1U8BA 2L9NA 4TZDA 2WDBA 2CU7A 1L0OC 3E3VA 3BZ6A 3VZJA 3AP5A 4KGQA 1G9BA 2H1KA 2KIMA 3SFZA 4I09A 1ZR4A 3FUQA 5FP3A 5J3LA 2HI3A 5FYBA 3I55I 3K1NA 1YXWA 2JENA 4RHV3 4J25A 4IOCF 4P08A 5F3IA 3VZKA 3VD4A 2IGKA 1UG2A 4PT6A 2W1UA 5DG1A 2B8MA 3S16J 2WO2A 5HCFA 1OYYA 2A1XA 3WDYA 5CVVA 5BNOB 1QQP2 5LRRA 2XKOA 3MIEA 2ORXA 2NRAC 2WNVB 1QVUA 2LK2A 4RAYA 4ORFA 3DPTA 2BPA2 3LA3A 2ZXJA 3LAPA 1YIJI 2WSUA 2P3KA 4QHBA 3RZZA 1ZGWA 2BGPA 1NCQB 1IO2A 3HMYA 2Q5TA 5K5QA 2BYVE 1GVDA 1P4WA 5FZOA 2XLFA 1SLLA 1F36A 1JGGA 1HRV2 3JRCA 3WHCA 1G3SA 1YJNI 4HX4A 3O6BB 3N9LA 5HDGA 3HOTA 2E1CA 3F8CA 2BNOA 2ZZJA 1QXRA 3FBMA 3OCPA 3J8F3 4XLHA 4BJ0A 5D6EA 5B3SH 2VKDA 3I5UA 4GRIA 1P7IA 1W28A 1E17A 2EA2A 2VQCA 4BOWA 4EJOA 4QM8A 2LM3A 4CUBA 1PK6B 5M3FJ 3DPLC 1V3FA 2ZGUA 4FT8A 4Q8LA 1GDTA 3M3CA 1ZBE2 2RVCA 5JLXA 2DA3A 2UWAA 2I2SA 3DWLE 1L3LA 1UPIA 3NV2A 1T95A 2OV7A 2RS13 3I3BA 1SLCA 3Q9OA 4EQQA 3IV5A 1VQ9I 5DYMA 3ZFFC 1NG7A 1IOAA 3THCA 4GIQA 5J1YA 4Q4Y1 1TWFJ 3NJZA 4JTNA 2BGOA 4M4PA 3C7FA 2DFCA 3RZLA 4MO7A 1SMVA 3JZVA 3ZN1A 4A93J 1NCRC 3WW4A 4L0PA 4DZGA 2ACJA 1GUUA 3WNNA 5DMYA 4BDYA 4CXXA 3TO9A 1BBT3 4AR2A 2P0WA 4DRRA 2FJ1A 2Q8KA 2A61A 5CYVA 2YX4A 1ETVA 4HSTA 1DGWA 5CYYA 3OPTA 2Y64A 4G8XA 5DDJ1 4RLFA 2VBDA 4IV1A 1LDKB 3FFQA 3DU6A 3WCRA 2XDVA 4IXLA 4G6TB 1RTVA 5A3TA 4EGYA 5LEJA 1OLRA 2O8OA 2JA7J 1DQ6A 3PQJA 4A3MJ 2HH9A 4OINF 2W7NA 4PDWB 1VR3A 4YRVA 4RR3B 4C1XA 2VNVA 3VDAA 3H42B 1RUG3 4IXAA 1W2OA 1RIRA 5LEKA 2K3PA 2HWD3 1VIWB 4N43A 2Y6JA 3RPQA 2DN0A 4UFLA 1P92A 2WS91 5C3PA 4NHJA 1R22A 3NNMA 5J8CA 4AEDA 4XONA 2ADEA 2OD5A 1XNKA 4ZS2A 4DEVA 2L7FP 5LFAA 4O9GA 3U2RA 3IBMA 1MMDA 1VTNC 5C8CA 2XOMA 4U7DA 1Y39A 1I3HA 3SLIA 5FPBA 4HVRA 4ZY9A 2QKMB 5IVJA 1S72I 2P3YA 3AKTA 3ZP5A 4DY5A 5F6KA 4WZCA 4Q4X1 4OI4A 4RN5A 3FK6A 4OOIA 2WWSA 4XEZA 5CFDC 5FGMA 1BJQA 3T0AA 3KX2A 1OPCA 3T0YA 4H14A 3M3IA 3ZN6B 5IWFA 1H1MA 2K4BA 3KV6A 2PHFA 3PVBB 2DVGA 4EROA 1YNAA 2FDFA 2QZ2A 1K78B 1UHSA 5C70A 3KLOA 2RN7A 1RZ4A 3TYJA 1Y3TA 4LTAA 4HOOA 1AR82 1QXPA 4D6RA 1DIWA 3HUGA 4UV9A 2ZSHB 3ZQQA 2XF6A 2B9SA 3BI3A 2GXBA 2OQRA 4S2GA 2JE7A 2HWB2 4IE4A 1MSEC 4EMSA 1BKZA 2XJTA 1ND3A 2KIQA 1ZLJA 5A3OA 3PTRB 4WXHA 1BC7C 2K9ZA 4RYDA 4XJUA 2HTJA 5CADA 2ZKZA 3IH4A 1FWZA 4URTA 3QP5A 2WV0A 2ARBA 1WMFA 5CEHA 1PO13 5KXDA 3LSGA 5E1ZB 1KZHA 2IC1A 3SMHA 1V6KA 2DCYA 1DZQA 3MW3A 2A6WA 2F4MB 4QPWA 1Y56A 1MS4A 2R1BA 4I0AA 1UX7A 4I02A 1QZYA 3BQYA 2EFNA 5ABJB 2RREA 5GAGJ 3ZXGA 2PTMA 1ZNPA 4Y1XA 2AEYA 3MLJA 1FATA 1V6IA 1SFPA 4P9JA 5K9YA 3AL0C 2P17A 5LGTA 5E3NA 4A4AA 4L92A 3TBIA 4IHSA 3DTKA 3EYYA 3AYEA 4YIFA 2WQ8A 2JRTA 1Z0XA 3NJYA 4LK7A 3CDIA 1LOEA 3LSKA 5FLJA 4II3A 1XTAA 1YE9A 3OD4A 1CAXA 1AHSA 2BOLA 2KXLA 3DTIA 2NP0A 1FNYA 3JRFA 3L9JT 5ILSA 5K5OA 1WW5A 1IS4A 2OU2A 3MZYA 4HV6A 1Z0HA 4OI2A 1HQCA 1D0ZA 3TOAA 1W8UA 4CP2A 2P1BA 4N9HA 3ZSJA 4CCEA 1BR1A 2P8TA 3N7MA 1DQ2A 4EN6B 5A3NA 3VBRA 2LFBA 2OUJA 4HK8A 4ZYGA 3FHAA 3ZFFB 4PLOA 2IUWA 1VBD2 2RNGA 1VBE2 4IEQA 5HLGA 5DUXA 3SEPA 3AMPA 4ZU7A 1QGLA 2E36A 2VZRA 5CPRB 1HW2A 2CYFA 1ASJ3 1QJX3 5GAEJ 1XDUA 2VH9A 2AC1A 4XTMA 1POV3 4NPLA 3MIGA 2ZKNA 3D5RC 2JQ7A 1YJWI 2UZKA 3KCCA 3VZOA 3OYKA 5FJ8J 2GWRA 2F5CA 1JTYA 5I93A 3F21A 4A3XA 3U07A 5ICGA 4AVCA 4ASLA 1TZLA 2I8DA 2Z5WA 2ZFWA 2Y0SN 3B6CA 1LGNA 3AMHA 3DYPA 5CNAA 2QQWA 1WKMA 4HG6B 5HLHA 2GALA 4PGHA 1ZZCA 4NMIA 1TMF1 4KDPA 4W8JA 2OTLI 3MW4A 1O8SA 1UYZA 3RSNA 2FQ4A 3DP7A 1SFKA 3QH7A 2OAZA 3ON7A 4GGGA 2H94A 2VW2A 2RS31 3N9OA 1LPQA 3EQLF 1Q3EA 1OCZH 2HDDA 4A6SA 1D4M2 4OHXA 3H8RA 1C5IA 5J8FA 1BZWA 4Y13A 4A45A 4M6YA 3FMSA 3TO7A 4RA0A 1LFUP 5EEGA 3G1LA 3OYWA 4W97A 1FNZA 2L7KA 2D6LX 3CP2A 2DOFA 1AR72 3CCYA 3KETA 3OL4A 2QJVA 1UF2C 4UHTA 1JUPA 4HNTA 4DB5A 4JGYB 1PVXA 2MEV3 3BKZA 1S8NA 2OS2A 4BQ5A 3R4DB 4BQXA 1KU2A 2GLOA 2O7OA 5FR3A 4XQDA 4JX6A 2BOJA 1BR2A 3MCZA 1ZYBA 3PSIA 2E1NA 1O7LA 1XGOA 4IO9F 2W84A 2JK3A 3CUQB 4ENMA 4XZPA 2CSGA 2DJNA 3JCUC 4TLFA 3I2KA 2OX0A 4GD4A 3DLAA 2VW1A 4QPIC 4HV5A 2G7HA 3T8RA 5A32B 3GTQJ 2KT0A 1TP4A 1CAVB 1RUJ1 5FP4A 3ERMA 1EJ9A 4QPGC 3NVCA 2PN6A 3BP8A 4QSHA 3VBSC 1G9CA 4W6WA 5EHDA 1FY7A 3JQWA 4F92B 2W1QA 3MHZA 4BM8A 1SVOA 5EV7A 1VBC3 3KQRA 3PIOF 1AR63 4BDVB 1W8OA 1T33A 2L3DA 1S0EA 2WYSA 2EB7A 2IGNA 1UB9A 1Y9QA 3KPHA 1LOFC 2PELA 3FBIB 3R60A 3POJA 4B4QA 1ZX5A 2EH3A 2DDBA 4EN0A 1MMGA 4HK9A 4Y15A 2VE1A 1UY1A 1RR8C 3VBOC 2MFZA 1YUDA 3EBRA 3GX4X 1LE8B 1EH6A 3UKNA 2P4WA 4G7HF 4XKWA 5FKCA 3KHBA 2BW3B 3OPZA 3KB5A 3I59A 4C3JJ 2R7RA 4YZ3A 3AL0B 3CJQB 2VLAA 4BQYA 3LEGA 3WX5A 1KITA 2VZUA 3NV1A 3KV4A 2VJ4A 2DU1A 5IVYA 2XAUA 4QX3A 3IUOA 2W87A 2JDPA 5LATA 1F8VA 2VZVA 4KGGA 3ZOIA 3ZCOA 1RUD2 1W8NA 3DUIA 2LR8A 2L02A 2KL4A 2KQRA 5LRSA 2V9KA 4KWJA 3IH2A 1X9PA 2ZJ2A 2KFDA 5FLHA 2BRTA 1M1EB 2VKHA 3JD72