1O3SA

Protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
b'DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRDTVGRILKMLEDQNLISAHGKTIVVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*AP*AP*AP*AP*TP*GP*CP*GP*AP*T)-3'
publication title Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: Alteration of DNA Binding Specificity Through Alteration of DNA Kinking
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 60
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o3sA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o3sA01
2ZNZA 2C6YA 5KHKA 4Q0PA 1OR7A 1W7PA 3GXOA 2ET1A 5HI0A 1Y0UA 3LA7A 4A0YA 4M9ZA 1R00A 3G73A 5FLHA 4WVZA 1ZHFA 4AQ6A 1FBQA 2M87A 3ZDSA 1ODDA 4KDPA 1EYBA 4ENMA 4PGHA 2VBZA 4MGZE 1KQ9A 1LJ9A 2QDRA 2QVSB 3H7YA 4CZZA 4JQFA 1HSJA 3DQVC 5BV6A 4ONUA 4KA4A 5LHHA 1ZG1A 3EETA 1U2WA 4P5OA 1VR3A 4LLGF 1HKSA 5BY5A 4HW0A 2FU4A 3RKXA 3JSOA 4D7SA 2NRAC 1IN8A 5BPXA 4EROA 2X4HA 2RDPA 2HOEA 1XGOA 1OYWA 2COMA 1ZRDA 3DPTA 2Q0AA 3F23A 1RC6A 1UW8A 3BPVA 4AIHA 4LTAA 1WKMA 2K0GA 4NQWA 2KRFA 4EV0A 3I7DA 3GYDA 2V09A 3M8EA 4L9TA 5KVRA 4IF4A 4UNOA 2FMLA 2QLZA 3RDIA 3EQLF 1R7JA 5I0SA 5I0TA 4L9NA 4MNUA 5BOXA 2FMYA 3RNSA 3U2RA 5FQ0B 5FO5A 2VE8A 4OU0A 1TQIA 1DGWA 3V7CA 3TNQA 2A68F 4JV4A 3ZMTA 2ZXJA 4XF4A 1OPCA 3DEUA 3T5XA 2ET7A 4MQ9F 3F8MA 4OMYA 1G4DA 3RJPA 2ZMEA 3TQNA 1CF7A 5I8SA 1WGPA 4LEJA 1FP1D 3M8FA 3R4KA 4QGNA 4BHCA 2IVMA 4GXOA 3WGHA 2D1VA 1ZLKA 4LFUA 4I0AA 4U7BA 2CYYA 3FHZA 1B9NA 3K1MA 1U5TB 4HVOA 1O4TA 1IRFA 1AWCA 2D40A 2ETEA 1DZTA 1WWXA 5F6FA 2HJIA 2EA4A 4XF1A 4P96A 3EUHA 3BU7A 3L00A 2TDXA 2GZWA 2LNBA 3H7JA 2K02A 2X0LA 4KIGA 1CAWA 4WZCA 1LKNA 3QP6A 1XCBA 2CQKA 3WU0A 4O9GA 4LK1F 2WWYA 3RPQA 2Z9OA 5LBQA 2V1UA 4LB5A 5E18F 2MA3A 1K78B 4IVNA 2L3DA 3OV8A 2D5FA 2BE5F 1MJAA 2QQAA 3V8LA 1WLTA 4IEXA 1CAXA 2RQPA 2Y48A 4UBGA 2EFWA 2PEXA 4O3MA 1QNTA 4HV5A 1XE7A 3E5UA 3F8FA 3KGLA 3V8KA 3FM5A 3E97A 2XHKA 2GWRA 4RGXA 3JSPA 4RGRA 4XFFA 3EJKA 2QJVA 3RPUA 1FYLA 3LA2A 5BPIA 1TQMA 2WV0A 2STTA 3M7GA 3ZMDA 4UVAA 4ZYGA 3ISPA 1T98A 3F8CA 2VQAA 3LFKA 1UIKA 3JW4A 1IXRC 4OOIA 3TO7A 1LB2A 4LUMA 4XF0A 3HRSA 3AAFA 3NVCA 4YSFA 2D1HA 2E7XA 2VT2A 5K8SA 2OU2A 2DPDA 4YYOA 1IZ1A 4META 2OZUA 2FNPA 1L0OC 3R0AA 3M1EA 3RZZA 1ZGJA 5TRDA 1OYIA 3R61A 4BNCA 1B1BA 3ECOA 2JT1A 1J5YA 2KIFA 3KP6A 2GC1A 1HQCA 1BI1A 4IHTA 4NHJA 2PYTA 1O7FA 1F5TA 1G3WA 1VJ2A 2K4JA 4GO1A 1P4AA 1EV7A 5LLQA 3VHRA 2HR3A 1ZN2A 3I4PA 4O5VA 2QCSB 2ELHA 5HLHA 1QO0D 1W5TA 3KGZA 1K6OA 2GA1A 5HDGA 3FHIB 4A0XA 3RYKA 1TTYA 5FD6A 1HW2A 3ZN1A 4KICA 3JTHA 3O6BB 2OPKA 2BNOA 4A6DA 3DF8A 1YG2A 4KNYA 2PMUA 4Y15A 2Z3YA 2O8XA 1UB9A 1O3QA 2LF8A 4G94A 1BC7C 1DUXC 4HAMA 1YFUA 4KN4X 3LSTA 1ZX5A 1P4XA 1ZARA 1R1VA 2OA4A 4XLNF 5ILVA 2RNJA 3SHRA 3UKVA 4NB5A 4P55A 4OIPF 1ONVA 4UVCA 3V7RA 2V6CA 1DPUA 2EV6A 1FSHA 1VTNC 1FZPB 1HSTA 4UV9A 4MGRA 5H6QA 2MH9A 4HBLA 1UCRA 2W84A 5HS8A 1KGSA 3E6DA 4KU8A 2FEZA 4IRGA 1SQ4A 2E1NA 3KLOA 3F22A 2K7LA 5CVRA 3VB2A 4XSXF 1LDKB 2YSRA 5FQ0A 2EAAA 4G6QA 2RKHA 5DCFA 3ELKA 4QMAA 3QU3A 3U11A 4DINB 1H0MA 1BI2A 3BPZA 1O3TA 3NSTA 1HW5A 2HYFA 4A5MA 4HYEA 4I98B 4EQQA 4M71A 2VONA 1T0FA 3QRFF 4ETSA 1LEBA 3L09A 1ZH5A 1U5TA 4IETA 3MEXA 5EZWA 2IRFG 2A07F 2XKPA 3ML6A 5D4SA 3I59A 4YIFA 2FQPA 1YFHA 3IDCB 2A6HF 3EQEA 1EH6A 2K4BA 3CJXA 4Q29A 2FF4A 3WTTC 5HDNA 3OD0A 4A6EA 2PMHA 3J81K 3GEZA 3WODF 3ZMSA 1O57A 4HLXA 4OMZA 5A2QK 5HVQC 1XCVA 2QVOA 4A0ZA 1WQ2A 4JK1X 2P6TA 2DFIA 1MJ9A 4XRFA 2VOPA 4H0EA 4ZZLA 4JVAA 1FP2A 2Q2EA 3VFZA 1ZAOA 3D0SA 3H1YA 4DQ2A 2NS0A 5D6EA 2GC2A 4GGGA 2Z2SB 4MEXF 3NL1A 5CLSA 1S29A 1QBJA 2J5OA 2AXLA 5JHUA 1TQPA 3HHGA 4CICA 5DCMB 2A69F 4EJUA 1J2XA 3V7SA 1SD7A 1J3RA 3B02A 2G7UA 5BMZA 2E7WA 2CV6A 1X7NA 1XGSA 3SZTA 4RGSA 1K79A 4AD9A 2ZMEB 4D7TA 2F4PA 1MKMA 2PBIA 1BN5A 5BUVA 3HUGA 4EM1A 1J1LA 4O6JA 1FX7A 2F5CA 2M8EA 3FWEA 1Z9CA 2KKOA 5JSOA 4WWCA 1LEAA 3COAC 2FNAA 4PIZA 2VOOA 1DDNA 4LUKA 4BXUA 3F72A 1UD1A 1EP0A 1ZZCA 3S7IA 4N9IA 1NYWA 2P7VB 4F7ZA 4G6DA 3MWMA 3MCZA 3E3VA 4OFGA 2JTVA 2N7GA 2Q4SA 2JRTA 4HBNA 4K8FA 5K5RA 3HRMA 1U5TC 4A5NA 1CAWB 3HT1A 4I09A 4CO8A 4L0YB 1G3SA 2DBBA 2D5HA 4Q0UA 2D93A 2HQNA 3G3ZA 1FPQA 2GC0A 1IN5A 3CUQB 1TW3A 1HBXG 5FPXA 1KA8A 4KFCA 1CAXB 4MGYE 2BYVE 4LLLA 4HQMA 1ZYRF 1I1SA 1SFEA 4FAGA 3PNAA 4MHGA 5HOOA 1J59A 2XAGA 1K7AA 3BJAA 1LRHA 4YIIA 5FGMA 4L5IA 5FLJA 2GXBA 2PHDA 4Q0VA 4Q48A 1ULYA 4EVIA 3IDBB 2Z33A 2FQ3A 1F4KA 1ZREA 3PQJA 1IUYA 4XFIA 4E2GA 4EJVA 2IP2A 5JAXA 3H50A 3E5XA 2PN6A 1PM7A 1H9TA 4HN0A 3ABTA 5ICFA 4YNIA 2JPBA 1KQ8A 2EFNA 1J9IA 3UKNA 2IXLA 3C1DA 1KQ0A 1DP7P 1UHMA 4ESBA 3QOPA 2CWEA 1LVAA 2CFXA 4S05A 3I5UA 4OLLA 2MBFA 2PJPA 3F8NA 3ECHA 2JSCA 3NW4A 1UPIA 5CVJA 4LMYA 4J1WA 4PIYA 5L3DA 3RYRA 1LR5A 4PIXA 3J80K 2HYGD 4XFHA 2CGPA 1FYMA 1SEFA 3IL2A 1SMTA 5I0UA 1HKQA 5E1XA 4Q4ZF 2R3SA 5L3EA 5BS6A 2DO7A 2H27A 1B9MA 5FLXK 3HTSB 1U78A 2DCTA 2O1QA 4IEWA 1O3RA 2PFWA 1REPC 2VXZA 2D2WA 2V1XA 4Z2YA 1WSUA 2QYOA 3CF6E 3GWZA 4GYIA 4EGZA 1T6SA 2ZO4A 2MD5A 5D5XB 2EVXA 2H09A 5ICGA 1ON2A 3R6SA 1IPJA 1FBUA 1S3JA 1FI2A 3HYIA 3LWFA 5K5OA 1E2XA 1KU2A 1D8KA 2Z99A 4DNCA 1BIAA 4BAYA 2GXGA 4UXAA 4MUVA 2W85A 1J75A 3CUOA 2XASA 5J6XA 4P9FA 3BB6A 2PLYA 3F3XA 4E2SA 5D8LB 4ESFA 4QXKA 1IN6A 2OYZA 3QP5A 5KHJA 4IJAA 4B09A 2CAUA 3K2ZA 2DW4A 4KL1A 2HDCA 3IRQA 2WC2A 4L5JA 1HXDA 1HKTA 5KK1A 1RIOH 4HDUA 2QWWA 1XGMA 4IRHA 1TNSA 2Y0MA 5DCMA 2BNMA 5D4RA 3FZVA 1XMKA 1FXZA 4WBBA 1RZ4A 2RGVA 3WTXC 2UY9A 5E20A 4HV6A 5EFUA 4Z82A 1Z7UA 2DQRA 5JFRA 5E1WA 1GQGA 4OIQF 4LLOA 3QPHA 2XLAA 4KWLA 3WE3A 1IAWA 2OA2A 2UXXA 2LDUA 4PJYA 3U0ZA 1Q5OA 4WK8F 3EYIA 1UIJA 2Z5UA 5CYVA 3QU6A 4I7HA 3PFIA 4HLTA 2ZJ2A 3I64A 3K9TA 5FB2A 2IXCA 3I59B 1P2FA 2L02A 1V70A 1LDDA 2L4AA 1NZCA 2BEOA 1S6LA 2W57A 2GA2A 5FPZA 3HSFA 2UXNA 4BQAA 1YLLA 4PCQA 3ROUA 3CEWA 1IW7F 4AQ2A 3M9AA 4ZYEA 5K1YA 4RD7A 3KP5A 1I5ZA 3KZZA 5D5UB 3HOTA 3M70A 2FBHA 1RGSA 1BIBA 2H6BA 4EJWA 2B0LA 4JTNA 3G7DA 1P4WA 3TDUC 1R5HA 4IEQA 1F1ZA 4CGZA 2RV8A 2OZJA 2ETHA 3CUQA 1DGRA 2Q8KA 2XAQA 4ASNA 2PAMA 1JHFA 1R1TA 2FOKA 4I0BA 3ACLA 3H3ZA 2A5YB 5JSRA 3ULQB 4M9XA 4QX5A 3FMRA 5F64A 4IEYA 3SCHA 5EEHA 3QAHA 4MEYF 3U10A 3NJZA 2XAJA 2EA2A 1XSDA 1OFNA 3DL3A 1GHCA 2CSOA 4KMUX 1XDUA 1QY4A 2AS5F 2ZKZA 1NE6A 3TO6A 2O0YA 3ETQA 2J5PA 3MZHA 5LRRA 4RAYA 4LG0A 1TW2A 1ZVFA 3B73A 3HHHA 4X6RB 1MD0A 4MV2A 4WF2A 4XF3A 3RTRA 5C6CA 4M73A 3MYXA 2O3FA 1QZYA 4L0ZB 4Y17A 3DPLC 4RB0A 5D6FA 4ZZDA 3SCFA 2LF7A 1J3QA 1ZLJA 3J81Z 2QBYA 4KIBA 1XD7A 1FNNA 5A2QZ 1KYZA 2O8QA 5D8KB 4Q47A 3RKYA 4LLNA 1FSEA 3K1PA 5E1RA 1Z6RA 3IBMA 2W24A 4ESJA 4UVBA 4EGYA 4HF2A 4ZH4F 4LK0F 2XVCA 2P4WA 1J7KA 1BI3A 1KU3A 1YFWA 2W25A 2HS5A 2GIVA 2VC0A 1SFXA 3REOA 3EHKA 3HSEA 4HX7A 3ES4A 5FDBA 2XAHA 4BYYA 4IEPA 1S7OA 1YS6A 3FX3A 3SQNA 2DK5A 4M9SA 2LKPA 2VBXA 4B29A 2KIMA 2ACJA 2M45A 4R52A 4HOBA 4I01A 4IHSA 1B59A 4M6XA 2KIUA 2WTEA 3NRVA 1SAXA 3ZPLA 1SFNA 2Q30A 2QNKA 3CUQC 3GUDA 4HX8A 4I3PA 1Z91A 5FFXA 2B8MA 2IPQX 2IA2A 1GXPA 3HIFA 2OAZA 2R7FA 2GQQA 4UHTA 3IKVA 4LA2A 1YW8A 4QWQA 4EM0B 2MHFA 1O7LA 3F21A 4JTOA 5BPDA 2ISZA 3QPTA 5J7MA 3D5LA 3SFZA 1FLIA 4PGGA 4IERA 2NAZA 3LWCA 3RYPA 4IEVA 1YO5C 4MH0E 2I45A 3EDPA 2IJLA 2EWNA 2OBPA 3GFIA 4LB6B 4M74A 2XGXA 3NKTA 1C0WA 1LNWA 1D3YA 4K2EA 3P9KA 3ES1A 4IEZA 4RB2C 2IA0A 1YHFA 4N9HA 2G7HA 5E17F 2WFPA 3S0MA 1I6XA 3PVBB 1X8MA 2PTMA 3GBFA 3JTGA 3GLXA 1XRUA 4IEUA 3BP8A 2QENA 2EFOA 2BGCA 2PI0A 2FA5A 2ADUA 1PUEE 4G7HF 4PZJA 1J0RA 4UV8A 4EJOA 3IC7A 4D0PA 1OD5A 3MPBA 2Q0OA 1FWZA 3WTSC 3FZ3A 4QLCU 3EYYA 1MJBA 2V79A 3K1NA 4XETA 1RUNA 5ICCA 1WI9A 3MAJA 5L3BA 3BDDA 4KYWA 2CW0F 4B8XA 1T39A 1RTVA 3C7JA 4AXOA 2QQ9A 3H1MA 5J3UA 2K27A 1HW1A 1U12A 1FOKA 3J80Z 2XLFA 1BC8C 3TNPB 2FXAA 2Z69A 3K69A 2KJBA 4YFKF 4YG2F 2IXKA 4M6YA 1KU7A 3FXUA 3FMSA 3P7NA 4U88A 3NEUA 3DN7A 2FSWA 2MC3A 3W6JB 3ZN0A 2DTRA 5CVVA 5KHHA 4G8XA 5FLXZ 4G9YA 5DDGA 3TO9A 3EO6A 4E70A 3D82A 1ZZ9A 4EJTA 1Z1DA 2IA1A 4KMFA 2IW5A 3CLPA 1YFXA 4EMSA 2K86A 2M30A 5ICEA 3BALA 3ST7A 5DD8A 1PDNC 2EFPA 3HRTA 4OINF 4U7DA 5IT9K 2EA7A 1I27A 3FXRA 4Y13A 3KMHA 4MQVA 3CO6C 2YR2A 4MGIE 4CXFA 5HLGA 1MGTA 4ENJA 1BOAA 2FRHA 1J58A 4XFCA 2BBYA 1IRGA 4Z07A 1EH8A 1T38A 3USSA 1O5LA 3SXYA 4FX4A 4UBHA 1USTA 2E9QA 5TJJA 4HSLA 3LOIA 5H6RA 2BV6A 2EK5A 2V9VA 3JAMK 1Q1HA 4WXCA 4IESA 2K9ZA 1MZBA 1V4RA 3Q5FA 5AVPA 1GXQA 4XF9A 2VODA 2IT0A 2ZKLA 4ZU4A 2M5WA 5L3CA 1G3TA 2QQBA 2HTSA 4R1HA 3GFMA 3N4MA 3WTVC 4UXNA 4R8HA 5HLIA 1IPKA 3WTYC 1YTYA 2P8TA 3L2CA 3FXQA 3I54A 4F8AA 2L01A 4BHBA 1V3FA 1XGNA 2XIGA 1CX4A 1JHHA 2ZCWA 1X8EA 4WXDA 2DPUA 5CU1A 5J8CA 4HQEA 1O5UA 3D0JA 3FMQA 2PA7A 4LG0B 2EJRA 4R79A 1DZRA 3FM3A 3F8BA 3UKTA 1QQIA 4ZYHA 2XRNA 4XEZA 1XE8A 1OYYA 3FFQA 5DEQA 1CGPA 3BY6A 2FBIA 3T0YA 2HKXA 3VODA 4L9JA 1QXRA 3H1WA 3TOBA 3V4GA 2QBYB 5LEJA 1STZA 1D8JA 3FF5A 5DV5A 1OI6A 1BJAA 2GAUA 3HRUA 4P9UA 2CG4A 4M72A 1AOYA 3BZ6A 5FD5A 5LGUA 6PAXA 1PP8F 1KYWA 5I8YA 4YFNF 5E16A 1YIOA 2ISYA 2L54A 3LA3A 5E8IA 4QM9A 4E2QA 2FBKA 2H6CA 2A61A 1R22A 3T1BA 3KP2A 5H20A 5DD4A 4H7LA 4XFGA 3TDZC 1W5SA 3H8UA 1QZZA 3WG9A 1BI0A 4WCGA 4AVBA 4AVAA 1E17A 2P7CB 4I02A 3SZPA 3DV8A 3BPXA 3H92A 4KN7X 3F6VA 4KT5C 1FYKA 5E8GA 5AONA 4A12A 1R36A 4L9VA 1H1IA 2VT3A 3R0JA 2VBWA 5LEKA 3IHUA 2CAVA 4BHPA 2O6GE 3C18A 3SCGA 3M3IA 4QM8A 2XV4S 4HX4A 1W7PD 3ZMVA 1H9GA 3KSCA 5I0RA 3IIAA 1ZNPA 3SMHA 2M1BA 3LAGA 3O2PE 1EH7A 3T8RA 1YWKA 1UFMA 3ELNA 4HMZA 2UZKA 2QUFA 1MDMA 2P6SA 4QGLA 4I2OA 3GF2A 4XBFA 1IXCA 2GU9A 3LAJA 1WRJA 4XFBA 3NQOA 2PAEA 1RUOA 3GFLA 1IN4A 2F5DA 1IF1A 1IXSB 5JSPA 4FT8A 5K5QA 3OOPA 2P5KA 1U6GA 2ESHA 1TNTA 4AVCA 3CTAA 4N0BA 4A2UA 1XSVA 2B5HA 1FT9A 3BROA 2KXLA 2A3SA 3KP4A 4AIJA 4XFAA 5LGTA 2VN2A 1Q43A 4Q5SF 3I58A 3WW3A 5CVIA 2C0ZA 3GYHX 2IXJA 3V8JA 1RL3A 3L9FA 1ZG3A 1ZZBA 4GYGA 5CADA 5LGNA 1DPRA 3I71A 4L11A 5I8TA 3O14A 2DT5A 2YX4A 2UYAA 5BQTA 2KJCA 4MTDA 3LAPA 4CYDA 1NXMA 5F1RA 2EV5A 4LGWA 4RAZA 3E6BA 3MQ0A 4GULA 2IXIA 1QGPA 4KWJA 2QZ8A 5JR7B 2DAOA 5FCCA 1FBSA 4HN1A 3OGJA 2RC4A 1ZRCA 3JZVA 3HOSA 3WW4A 2XL9A 3VOEA 1TBXA 2IXHA 1CAVB 5JVTA 1PMIA 3OTFA 2Q1ZB 4RB3C 4IRIA 4FAHA 1SFUA 4Q0SA 3WGIA 1ZZ7A 3KEOA 5HS9A 5E1ZB 2O03A 1YS7A 2XL7A 2XUBA 2XLGA 1WA4A 2XKOA 3S7EA 3RI4A 1SMYF 1Z05A 2JZYA 3I0TA 3GVAA 2NNNA 5LHGA 1UCXA 2VBYA 1Y9QA 3R60A 1JGSA 5FFZA 1XMAA 3KE2A 2XROA 2HWVA 5BXXA 5AIQA 2ATFA 3FE5A 3FJSA 1ON1A 5LHIA 4ORFA 2HTJA 1XB4A 2E1CA 1CAUB 2H0VA 2A6EF 4PDKA 1SD5A 5IT3A 2VECA 2YU3A 3S2WA 3L7WA 1YUDA 2CO5A 1Q3EA 4ENKA 3QACA 4HSJA 4U0YA 2ZNYA 5HS7A 3BJOA 1SD4A 4P9GA 2VPVA 3KFWX 3BOQA 2XAFA 2OD5A 5L3GA 2NNYA 3EBRA 2L4MA 2LSOA 3KP3A 3RKWA 1JXSA 2MLGA 1ZZ6A 4KWKA 2MPFA 3OCPA 4NVPA 1YLFA 3KZYA 1QXJA 2RN7A 1U8RA 3ZMUA 1TLHB 5ILUA 2QM3A 1YFYA 4KIFA 4GCVA 3KETA 3IWFA 2OQGA 3WTWC 1F9NA 3K0LA 3C3WA 2YPRA 5L3FA 2GH2A 3SXWA 1EPZA 4ZU5A 1OKRA 5CJ9A 3H9AA 3HQXA 4EWDA 3GO5A 5AIPA 2EV0A 4ENNA 2Y75A 5IT9Z 3GFJA 1YQAA 3E5QA 1NE4A 2HZTA 1R5GA 5D5VB 1G3YA 3MDPA 3I53A 1EY2A 4HVRA 5ERIA 1NHAA 1X3UA 1B4AA 4LD5A 3ZP5A 4OIOF 4IXAA 5ILSA 1D5VA 3P9CA 2VC1A 4WX9A 2RVCA 5I93A 2DK8A 3JAMZ 2ZFWA 3IKTA 4XSZF 5T3NA 3CDHA 2D45A 4MZUA 2G9WA 2O61A 1S8NA 5KBFA 4ON0A 3BCWA 2OZ6A 1FY7A 3H3UA 1P6RA 1LDJA 5CVUA 1W7PB 3HT2A 5FLIA 4IPAA 1UHWA 4YARA 3PQKA 3L2HA 1W4MA 2HKOA 1BBYA 2ZBKA 1ZG5A 4RS8A 5C8WA 5JI6A 4HF1A 3GZ5A 5KHGA 1JE8A 2PQQA 2F5FA 4EM2A 4IEOA 3DKWA 3ZMZA 4QGMA 1RI7A 4MTEA 3P9IA 4S04A 2PHLA 3T8TA 2DI3A 2JPCA 3U9GA 3CO2A 2DLLA 4Q0QA 4O9EA 1A04A 5J48A 2HQRA 2ESNA 1Z6TA 2HGCA 5EEGA 2PG4A 5KHIA 3TOAA 1K78A 3KEQA 3WGGA 4CHUA 4BH9A 2MNGA 3C3VA 1USSA 1X82A 3F6OA 1J3PA 3VEPA 4HVQA 1MDMB 1CAVA 5DUKA 3PLQA 3WW2A 1R1UA 3DFGA 4EWEA 4ZYDA 2EB7A 3MFKA 5I91A 3E6MA 3TGNA 3WTZA 3HSRA 1L3JA 3CO7C 3E6CC 3OF1A 2UYBA 3IRRA 1ZRFA 5ED4A 2OQRA 4YFXF 3ERED 1G6NA 3WE2A 3GZ6A 1XDSA 3WW1A 2P5LC 1SD6A 3IWZA 4LJZF 1S7AA 4FX0A 3KCCA 5DUIA 1GQHA 3MZYA 2VE9A 1T2KA 4HDVA 1CF7B 3N97A 1U3EM 3O3KA 1LQ1A 2MH2A 4KU7A 1QWRA 3WTUC 1CAUA 1ZZ8A 1O3SA 4YRDA 3CJNA 4LA3A 2MLKA 3J7AO 1BM9A 1P92A 1L3LA 4BIFA 3DXJF 1ZRRA 4FHTA 5DYMA 4RB1A 2IC1A 5JCTA 1KU9A 1Y3TA 5D5WB 4UUVA 2PQ8A 2NYXA 3WU1B 4ZU7A 4CDGA 2UWMA 1PP7U 4EWAA 1RNLA 1OMIA 4MX3A 4J1XA 2EFQA 2HEOA 2DU9A 4HZFA 3CLOA 3LZZA 4U0VA 1XN7A 2UY8A 3SHFA 1IN7A 3KLNA 4G7ZF 3Q9SA 5LRSA 1B6AA 4RGUA 4L18B 3DP7A 4AVPA 4OIRF 2H94A 2DQLA 2GC3A 3BWGA 1YYVA 4FBFA 3LQQA 4HF0A 2STWA 1YW7A 1QPMA 4WXHA 2YX7A 1I1GA 3HTUA 2V1DA 3LQRA 1GVJA 3CL1A 2FE3A 1XSXA 2P17A 2F2EA 5J8FA 4G7OF 2PFBA 1TQ5A 5JR3A 1JUHA 2B9UA 1R23A 2R7DA 3KP7A 4TV7A 4AWXB 5D1IA 4KUMA 4X6QB 1FC3A 3TKYA 3RIRA 1ZGAA 3Q9VA 4MGKE 4HA8A 2BNNA 3BJ6A 2Y0OA 4TLFA 4U0WA 2F5EA 3GW2A 4HLYA 4AIKA 3U1DA 2PAKA 1VP6A 1R58A 5HDKA 3W6KB 4JBAA 1H1MA 3GX4X 4L2NA 3ABUA 3ZQ7A 4LULA 4XLPF 1YW9A 2HFHA 2P5VA
chains in the Genus database with same CATH superfamily
3BZCA 2ZNZA 3U1KA 2JE7A 2E5NA 3VKFC 2C6YA 5KHKA 5LY2A 3GXOA 2RDNA 1U5XA 3DUIA 4M9ZA 1VBD2 1XQNA 5E6HA 1S0IA 1OOPB 1UMIA 4AQ6A 1PIV1 3HEFA 3GLLA 2LR8A 2MFZA 4KDPA 4ENMA 4XCAA 2FOWA 1VBB2 3VGIA 1LE8B 2QVSB 2D6LX 4JQFA 4ONUA 3MVPA 1U2WA 5FJHA 4E4ZA 3W2VA 4ZDLA 2X1EA 3EUKL 2IAIA 4HW0A 1ITYA 4D7SA 2X1CA 2RDPA 2HOEA 1XGOA 1X1DA 2ID4A 2COMA 2WKKA 1ZRDA 3F23A 1RC6A 2NMOA 3BPVA 1Y4WA 1I3QJ 2AH2A 2K0GA 4EV0A 1Q8PA 2H0BA 2V09A 1HJGA 3Q8BA 5IK8A 2FDFA 3M1HA 2FMLA 2BRTA 4Y20A 1R7JA 5I0SA 2R92J 2FMYA 4IV1A 4QSHA 5CKTA 4BMEA 5BNNB 4A3KJ 2WNEA 4NIDA 5FO5A 4OU0A 2ME6A 4AFMA 2A68F 2VR4A 3ZMTA 2ZXJA 3WV6A 4XF4A 1DHKB 1QJX3 3F8MA 4AEDB 1XNCA 3WG4A 3WF1A 5M5YJ 4LEJA 1FP1D 2WR9A 2WBKA 4GB31 4CXWA 3IB3A 3H1CA 1GICA 5FYMA 3FHZA 5KCMA 1ETYA 2JG8C 1D1BA 3ALQA 3HOVJ 1OCTC 1H6YA 1F35A 1WWXA 3TMOA 4LE4A 2EA4A 1BXHA 3O1SA 3C7EA 4FFGA 4M3CF 3LGRA 1ETVA 2TDXA 2YG0A 1VIWB 2GZWA 2LNBA 3H7JA 1YYNA 1SEUA 1K83J 4A4AA 1OT5A 4MG2A 3QP6A 4DRVA 2CQKA 2E1OA 4O9GA 3RPQA 2RR12 5EJ3A 2VBBA 2Z42A 2MA3A 1K78B 5ANQA 4IVNA 2Q2EB 2LTNA 5A32A 3AKRA 5FYUA 3RMXA 2JA2A 2GMMA 2J1SA 2EBIA 2Y48A 4UBGA 1QNTA 2VOVA 1W3VA 3F8FA 3KGLA 4AR2A 4P08A 3NWTA 4RGRA 2NOGA 4IV3C 2Q5TA 1DP0A 3EJKA 1NUKA 1GV2A 2QJVA 4URAA 5A3WA 1FYLA 3LA2A 1NAEA 5D8AA 4A3XA 1UZWA 1QJY3 3HGYA 2DBIA 2BBAA 2WYSA 4XZPA 3RZHA 3F8CA 2VQAA 1UIKA 1IXRC 2LTPA 2XJQA 1ACIA 4YSFA 3C7FA 4OUMA 3I3QA 4LKFA 3B93A 1UYYA 3WQ1A 1IZ1A 2OVUA 5IVBA 3G6EI 3DLAA 2ZMEC 4IOCF 1BR4A 2VU9A 5KAIC 1LTEA 5FFOC 2WAQN 5E79C 3LF7A 1G3WA 4GO1A 1P4AA 3VV1A 3GALA 2L7KA 3VHRA 2HR3A 2CHHA 2FCUA 4K6BA 2ELHA 5C9AB 4K1YA 5HXMA 5HLHA 1DU0A 1FOD1 3KGZA 1K6OA 4NOTA 3FHIB 5L36A 3EUHC 3AFKA 1FX5A 2DA4A 1HW2A 1XNDA 1N1SA 3ZN1A 3O5SA 4WM7C 4GXLA 2BFUS 2VZOA 3ESWB 3SH5A 4YRVA 2NOJB 3KF3A 2O8XA 1UB9A 5B1BH 2OJED 4G94A 3ATGA 5EHDA 1VQOI 1DUXC 4HAMA 5B3SH 4QQ2A 4LBKA 3LSTA 1VB4A 3CHXA 3I3DA 1UF2C 3SHRA 3UKVA 3LPGA 3L1PA 3V7RA 1HN1A 3JXSA 3HQRA 1R1A1 5E8AA 2X8KA 1LVKA 4D6RA 3ZQIA 4PJJA 5F08A 2RDQA 1OLME 4MGRA 1OCPA 4H4KC 2QA4I 3KF5A 4OHXA 1SFYA 4XJ9A 1FPN3 3E6DA 3SEZA 2E1NA 4RN5A 5CVRA 5C44J 4XSXF 5FQ0A 5DCFA 2ZMKA 4RQPC 2JA6J 2BY0A 1BK0A 1QOOA 2RE9A 1W36C 3Q8FA 1DF0A 1O3TA 3NSTA 4ZZ5A 1HW5A 2LALA 3FBNB 4HYEA 4HFSA 1SLLA 4FTHA 4RGGA 4HKWA 2DA7A 1AR91 3O1RA 3MEXA 2YS9A 3VKNA 5EJZB 5D4SA 2FQPA 3DEWA 4OZOA 4BQOA 3EQEA 3NAPB 4BQ3A 2E26A 3WTTC 5H2FC 4GKYA 1REEA 4UUSB 3WODF 4HLXA 4PJLA 4A0ZA 4AVTA 3S3OA 4CZCA 4JK1X 2P6TA 5J1UA 2AQEA 4W97A 2E35A 4BQQA 4H0EA 3VPRA 4ZZLA 4CDXA 4B3XA 4AQSA 3VFZA 3D0SA 3G4SI 3MO4A 4AAXA 5BNOC 3BG9A 2MSYA 2NS0A 4MEXF 3NL1A 1K12A 5JLVA 1BMV2 1A36A 1V6JA 4Z1VA 1B8IB 1TQPA 4OUSA 4PDWA 2DFFA 1DCSA 3DPRC 3WDTA 2W68A 4XRMA 4CDUC 3B02A 4TWTA 3HJRA 3I2JA 4BOWA 1S7EA 4KT6A 2ARXA 1AXKA 1K3IA 3HUGA 3ZFEA 3OYGA 4O6JA 4AEJA 1MS0A 3NV3A 5JSOA 5GLTA 2R073 4WWCA 1OVPA 4PIZA 1DDNA 3F72A 1PGL2 2ZHLA 4E7JA 1V6OA 4F7ZA 4G6DA 4YGCA 3VKLA 2D98A 4OQ8A 2CW7A 2WQ4A 1TMF3 1WJ5A 2P0WA 1MS5A 2Q4SA 3LD8A 2JRTA 4HBNA 2YFUA 3HRMA 3J7AY 1CZTA 3U4XA 2NXNB 3HT1A 3THTA 2CH0A 5FZ4A 4XYXA 1TT5B 4RHV1 1IN5A 3CUQB 2A3YA 2BDRA 2GDFA 2O8OA 1J84A 4KFCA 4O65A 2F5VA 1SZBA 4MGYE 2C9KA 4LLLA 2VNVA 4KG0A 1POQA 4MXVA 4HQMA 1FV2A 2VO5A 4W6YA 1C5IA 5F04A 2AQFA 5F3IA 4L5IA 5FLJA 4PI2A 1LOCA 4PI0A 2FDIA 4Q48A 4UF0A 2FQ3A 1ZREA 5C4JJ 4E2GA 4XUPA 1R083 5EJCA 3E5XA 2HYJA 4LO7A 3PM1A 4Q1RA 4XCBA 3ZX7A 1REFA 2RS53 1SCSA 2NLRA 3HBLA 4S05A 3FK7A 1MQTA 3I5UA 2MBFA 2PJPA 3F8NA 4V1PA 3ECHA 3MV01 3NW4A 3IIIA 3VZLA 2Z4FA 4CU6A 1HDKA 2CGPA 4F83A 3K4BA 1AVBA 5E1XA 2R32A 2DO7A 1SBDA 1RUJ1 2C24A 3CLQA 3KCXA 5FAXA 4XMAA 2LBFB 4GMP1 3HTSB 1U78A 4COWA 2O1QA 4IEWA 3UGGA 3PIJA 2D2WA 2V1XA 4Z2YA 1WSUA 3WDVA 1ULOA 4EGZA 2HQAA 1UG0A 5T5JA 4AEMA 1ETWA 4NWWA 2A6XA 3LE0A 3Q8AA 1P8JA 3ABMH 1IPJA 1Q1VA 1JS9A 4WVVA 1RUI3 1NA1A 5K7FA 3HYIA 3LWFA 3CDLA 5GTIC 1VLNA 2Z99A 1BIAA 4P9YA 4PQ9A 2A6WA 4BAYA 4UXAA 4MUVA 3B7MA 3S2DJ 4D1QA 2WLQA 3U4SA 2PLYA 4OI4A 3GTGJ 5IOYA 2AREA 4QXKA 1A78A 3T0AA 3HD8B 2OYZA 1BK1A 3QP5A 2W87A 1VZ0A 3K2ZA 2PLV2 2ZHMA 4BISA 4L5JA 5LW9A 4HDUA 2QWWA 1XGMA 2DA2A 3GHNA 4Y22B 2Y0MA 3NARA 5DCMA 1E5HA 1RZ4A 2B46X 4B1RA 1CQTA 1KITA 2UY9A 4HV6A 3OSDA 4RM2A 2KFDA 5EFUA 4DQAA 4BE3A 2DQRA 5JFRA 2VMCA 3C7OA 1JUMA 4PCRA 2B42B 4LLOA 3QPHA 1DU6A 2DMUA 2Y30A 3WE3A 1IAWA 3A0BC 2OA2A 2UXXA 2LDUA 3THDA 3U0ZA 4WK8F 3QCWA 1WWYA 2O8KA 2JDHA 1N75A 1VBE2 4F3QA 2AO9A 1O6UA 2Y33A 5C4WC 1C57A 2W57A 1K4TA 1K6YA 3MLKA 3GM8A 5FPZA 1UYPA 1UWWA 3CEWA 5K1YA 3KP5A 1I5ZA 4AZZA 4AI2A 1BHGA 5JOWA 3BGAA 3G6JB 3CZJA 4S2HA 1JZ7A 2PMZN 2GN3A 1MR5A 2K2SA 4WVWA 2Q8KA 4I0BA 2QTWB 5JSRA 1JT0A 3J8F3 4CP9A 1U8BA 2XF7A 3GTKJ 4IEYA 3SCHA 1QJX1 2RAEA 1MEC2 2CSOA 4CCOA 2AS5F 5FREA 2UUZA 5FUPA 1TG7A 2KZVA 4QPYA 3J7MA 3F2ZA 1TW2A 4GWIA 4MV2A 4XF3A 3EMRA 5CISA 1U5YA 1QDCA 3FXKA 4CE8A 1PJRA 4AYBA 5FZBA 3J7HA 5D6FA 4ZZDA 3J7NA 2LF7A 3TEXA 4W8JA 3JCIA 4KIBA 1XD7A 1FNNA 4LT5A 2WZR2 5FP4A 3OG2A 2O8QA 3JUUA 5D8KB 3RKYA 2EXJA 2A6VA 1Z6RA 3WF3A 2W24A 1IRXA 4XDOA 4QPOA 3HKZN 1YFWA 1MVEA 5FZCA 3T1MA 4PQQA 4U2AA 5F3EA 3REOA 1S0EA 2ZEYA 3HSEA 4HX7A 4BWOA 2IZWA 4XAEA 1EJ9A 2GBYA 3L2RA 1TEIA 3KT1A 2DF7A 4IEPA 2CSGA 1S7OA 3BG3A 1YS6A 3FX3A 3SQNA 3HN3A 4R4XA 2LKPA 2VBXA 5DPNA 4B29A 1BW6A 2ACJA 3PTYA 4R52A 3KVAA 4BY1J 5J09A 1FOXA 2JXAA 4IHSA 4E7HA 2KIUA 2WTEA 3ZPLA 1PNGA 4A7ZA 4XKBA 1SFNA 2QNKA 3BR3A 1NXD1 1QJY1 3ZO0B 4WVMB 4XHBA 1LOEA 2OKXA 1PUFA 2J1EA 3RSJA 3S93A 5A3TA 4N43C 1VPHA 1ONAA 3K48A 2ZB9A 5C71A 2TCTA 2OAZA 2ZACA 2R7FA 1VQMI 3OY8A 1OQEA 3ZVXA 3KCYA 5BPDA 4ATFA 5IP9J 3QPTA 3TAYA 4KGGA 1PZ9A 4KGQA 3AVSA 3AXEA 3POBA 4P5HA 4IEVA 1S9HA 3CQZJ 2I45A 2IJLA 2LY2A 2OBPA 1LESA 2JENA 4M74A 3MMYB 2WA0A 1ETXA 3VWBA 3NKTA 1C0WA 5FXXA 3P9KA 1RUF2 4IEZA 4RB2C 2EXIA 2IA0A 1Y1WJ 2G7HA 4INDA 3PMSA 3PFYA 4K1ZA 3S0MA 1YNAA 2R1DA 5H9PA 1X8MA 4RR3A 2E2HJ 3GLXA 2GOMA 4B1MA 2WB1N 2EICA 4OAYA 3OUJA 3PSFA 5EYYA 3GTJJ 2HEVF 2ADUA 1VMHA 4G7HF 4PZJA 4A3IJ 4D0PA 4GMP0 2OPWA 1FWZA 1YO8A 2XUMA 3WTSC 1G9BA 3I4NJ 3S1RJ 4LO5B 1YC61 4U87A 1SDWA 4G6TB 5ICCA 3ZOBA 2L9NA 4PJNA 3MAJA 1W6NA 4YVWA 4B8XA 1YIPA 5A7SA 2YB7A 4XQDA 1FPN1 4YVSA 4JKKA 1QOTA 5J3UA 1FOWA 3N7KA 4XR6A 5F0FA 1U12A 3SH4A 3J80Z 3E7LA 3D5OA 2VCMA 2JICA 1NLRA 3B94A 3ZMNA 4M3CE 2A3XA 4YFKF 2IXKA 2CV1A 3VYRB 1KU7A 3ZN0A 4CEYB 5CVVA 1Q56A 3K4JA 2W08A 2WWUA 5HLTA 5LY1A 4C3IJ 3F95A 3S3MA 1W6PA 3EO6A 2GOXB 1ZZ9A 5GAHJ 2HWF2 2D6PA 1Z3XA 4KMFA 2YU1A 1YFXA 1LHVA 5DD8A 3HRTA 2EH3A 3VZNA 3W9AA 4A3ZA 1V0AA 4P14A 2EA7A 3S14J 1HJFA 1I27A 3KMHA 4LITA 2VZQA 3JRFA 1XS9A 3CO6C 2W92A 4MGIE 2E2JJ 2FRHA 4L8QA 3AMPA 1T38A 3UK9A 3CCJI 4FX4A 4HSLA 3ILRA 1QVUA 5H6RA 4CPBD 1VQLI 1Q1HA 1SCRA 1UMQA 4LBJA 1HC8A 3G1OA 1MEC3 1W9WA 2VODA 2GSYA 5L3CA 1IRZA 4GA9A 1G3TA 1AZDA 3FHQA 3FHAA 5FRMA 4HETA 2ID6A 1IPKA 2P8TA 4ASKA 2Y31A 2VQLA 4TYSA 5BNPA 2I07B 1DZQA 3RMYA 1REDA 5C8CC 1V3FA 1WFXA 1BLZA 3IPVB 5KAFC 3LKJA 3WCSA 4M01A 5IVYA 1O5UA 2R071 1Y8RB 3EXUA 4V19K 4FE7A 1DZRA 1JBCA 5M3FJ 2DVDA 2XRNA 2RR11 4LBQB 4UT5A 1CGPA 3OYWA 1XG1A 2WNUA 1K5MC 5DN2A 1HIXA 1LFPA 5LEJA 1QEXA 4ES9A 5FP7A 4P9UA 1UO9A 2BTVC 3OYCA 4M72A 1AOYA 2QZ2A 3MPPG 4QPIB 4N7UA 4UFLA 1VQKI 1I9RA 2RS13 1PO12 1KEXA 2VZPA 4KJZA 1A3KA 2Y9ZA 4YFNF 5A3UA 2ISYA 4N4NB 1DQ6A 2CFOA 1JYNA 4H7LA 1WD3A 2ENRA 5T5LA 1QZZA 5FROA 1BI0A 3NV2A 3FIWA 1E17A 3BR0A 5B4XA 2NM1A 3DV8A 2X29A 4KT5C 1DQ1A 5C4XJ 1R081 4L9VA 1N77A 1H1IA 4Y52J 4NHKA 3UETA 3R0JA 2VBWA 3FUQA 3BPSA 2ZGSA 2DMNA 5EEAA 2RS51 1DLLA 2WIIB 3M3IA 3K3OA 2JA8J 4QM8A 1YIJI 2XV4S 1WJCA 1H9GA 1IG7A 2EIGA 3HXLA 4MHRA 3SMHA 3T8RA 1UFMA 1BKZA 2WO7A 4NPMA 3TYJA 2DA5A 2LROA 2OTLI 4HMZA 2QUFA 5FPBA 5FKMA 2P6SA 3I2OA 4CDWB 2R7WA 4AC0A 2GU9A 3O1PA 3RZKA 5FMCA 2ZEZA 2EIEA 1JZ5A 1AYM3 1JH5A 1IN4A 2CWSA 2F5DA 3RGBA 1IXSB 1Y9MA 4FCYA 3OOPA 5K5QA 4ZZ8A 3H8RA 2BXZA 4B7KA 1QA6A 3CTAA 3ZXEA 2A3SA 1EUUA 1PYVA 3HN1A 4XFAA 1KDKA 2IGNA 4BQYA 4CEWC 4W1UA 3ILFA 1GLHA 5F1JA 5LGTA 1Q43A 3TN93 2VZVA 4Q5SF 1RUI1 4X6AJ 2JRMA 4ITVA 1IQAA 2NQYA 3GTPJ 2IXJA 1ZG3A 2D43A 4DYQA 4WV8A 3NKGA 1B35A 2CQQA 4NN0A 2A1XA 3I71A 3N9PA 4L11A 5I8TA 3AKQA 2GNMA 4AEKA 3O14A 3SFIA 1OD3A 2RJKA 3KZ4C 2C4XA 3LQCA 1E57A 4N53C 1V54H 3VZMA 1T6BX 4CYDA 2L9SA 4D5CA 4RAZA 3U78A 2K3FA 1QGPA 2QZ8A 5JR7B 3J7YJ 5FCCA 1FBSA 2XBO3 4XTPA 3JZVA 2XL9A 3QH6A 3CCYA 2ZXWH 1GNYA 4II2A 2HWF3 2ZGLA 5JWPA 3FK6A 3M3EA 5JVTA 3AL5A 3NJVA 5AFEA 2Q1ZB 2YC2A 1SFUA 4Q0SA 2QQOA 1S2BA 5E1ZB 2O03A 3JB4C 3B6CA 3S7EA 4A42A 3U14A 2JE9A 1QU0A 4IOAF 2JZYA 3GVAA 2Y0IA 4PUSA 3VUOA 4A45A 1G2HA 1Y9QA 3AVRA 1JGSA 5FFZA 3KE2A 2XROA 1JT6A 5D21A 4XAAA 1R9TJ 4X1EA 1ON1A 5FMOS 4ORFA 3VBSC 1XB4A 4BEHA 1W6QA 1H8TB 2OS2A 1CAUB 2H0VA 1SLAA 4PDKA 4NHXA 1SD5A 5IT3A 1Q3EA 4ENKA 1K4SA 2WWSA 4HSJA 4U0YA 5JLWA 2ZNYA 4Q4W2 3AG1H 4P9GA 2VPVA 1MBEA 1VQ5I 5DUWA 2A70A 3J8F1 1TME2 3B9IA 4PLOA 1OLQA 3DECA 4V2WA 4KWKA 5ISLA 4NVPA 2UWAA 2TRTA 3UGHA 1TLHB 3H0GJ 4KIFA 1OOPA 1PGL1 4UFMA 1ALYA 3VL9A 3K0LA 3LMMA 1AX0A 4W4ZA 1NK2P 3N05A 1ZTRA 3SXWA 1EPZA 2VASA 3V0BB 3WU2C 5A7QA 4UUTA 3H9AA 3UJOA 3HQXA 3GO5A 5FY8A 1STMA 1AUYA 3NJXA 2ZGNA 4BCUA 2BFUL 1NE4A 2YYOA 1R5GA 1H4GA 1FYUA 2VZRA 3MDPA 3I53A 2G9FA 1NHAA 2K9SA 2HLEA 3DTKA 2I74A 2VBDA 5EDNA 4QQOA 2CU7A 5GLWA 5I93A 3PDQA 4OZXA 3GDBA 1GP4A 2MC4A 2CY6A 3W2AA 4XSZF 5IP6A 1NOVA 2ZA9A 3OSFA 3P1IA 3OBZA 1ND2B 3FKJA 2UURA 4XOPA 2H8WA 1S8NA 3ZN4A 5KBFA 1C3HA 4XLHA 4CDQA 5FYSA 3BCWA 4B4PA 2V5YA 3MZ8A 3HNMA 4FPYA 1CPMA 1S0JA 1YXWA 4AEDA 5CVUA 3HT2A 4Y1ZA 3RJ2X 5FIXA 5J1XA 4YARA 1N25A 1HLCA 1F4AA 5A3PA 2NS8A 2ZBKA 4FQ4A 1RMU3 5JZGA 5K0UB 4HF1A 3Q8EA 4A3DJ 1DGWX 4GWMA 1JE8A 1R092 2ARBA 2RG4A 2E33A 5HCAA 3AFGA 4NIIA 3M8LA 1RI7A 3AKZA 1RUG2 4IGQA 2QSHX 2PHLA 3NWKA 3CO2A 1QRYA 5F27A 4O9EA 5J48A 5FZ1A 4CUBA 2KZGA 4CU7A 2JSPA 2OQ6A 4L0PA 5KHIA 3T08A 1F5JA 3MEPA 3V0AA 1K78A 3WG1A 3WGGA 2AC1A 2YV8A 4AHWA 1MDMB 5DS9A 3WW2A 4A3FJ 2O7OA 5CA6A 4CXYA 2VAUA 2YGLA 2VCAA 1H30A 4RFRB 4ZYDA 4QX3A 4UWDA 2L9VA 1HF0A 5I91A 2BXYA 5BNGA 3HB9A 4RL7A 4RAGA 3CO7C 4CPBA 2KQRA 3PIPF 4C0HA 1ZRFA 4BDZA 4RFT0 3VD5A 4AWDA 3IWZA 2XJTA 1S7AA 4BJ0A 1XC5A 5JI9A 5EIYB 1MPXA 2DDBA 3MZYA 3VKMA 3N97A 2AACA 1U3EM 2DN0A 1W2AX 4MO3M 1LQ1A 2PLV1 1PVC2 3ZXAC 2XGEA 2YUEA 4YW4A 3AB0A 1LENA 1QXPA 4LA3A 1QVTA 2MLKA 2Y6JA 1G8WA 1L3LA 1ZRRA 4A6SA 4MOAA 4RB1A 1LHOA 2PQ8A 3CJIC 3O0WA 4R4ZA 1YIFA 5CFCA 1ND3A 1OBNA 4ZU7A 1CN1A 4CDGA 5J4YA 2UWMA 1HXS2 3A01B 4QHOA 3RZGA 3HWJA 3SHFA 2ZGQA 1IN7A 3KLNA 1AF9A 3MKZA 4A3JJ 4OIRF 1DLCA 4FP3A 2GC3A 4UY8I 1JTXA 1DP3A 4FBFA 1NG7A 1XYOA 2STWA 4FPEA 4QU2A 5FZMA 2QF7A 1OA4A 2V1DA 2FE3A 2WDBA 1XSXA 2F2EA 5D8AB 1NX9A 1TQ5A 2JA5J 2B9UA 2R7DA 3ZPOA 3VN4A 3KYDB 4AWXB 1GFF2 1VFCA 5A33B 4X6QB 1DQUA 3GTOJ 5FZGA 2BNNA 1T2XA 3LNQA 3GW2A 3U1DA 2PAKA 2HXOA 3W6KB 1JYIA 1C1LA 4M3DA 1PHMA 1PM4A 4H7MA 3GX4X 4QXBA 1F9KA 1MEC1 5IP7J 5HV4A 4M3CA 1YW9A 2EAKA 3PUBA 1XU1A 1OR7A 1POV3 4A0YA 1HRV3 4YFZA 1TWCJ 3SITA 1OCCH 4IGOA 4PJMA 3ZFGC 4KISA 1FBQA 2AXTC 3ZDSA 3L2VA 2J1TA 4JGZA 4PGHA 2WZR1 2BU9A 1KQ9A 5AC93 3GZEA 1LJ9A 2IEKA 2QDRA 3H7YA 2JDZA 2CW8A 5BV6A 4RS5C 3NAPA 3JRIA 3CCVI 5LHHA 1V55H 3EETA 4J01A 3FKIJ 1QIQA 1VR3A 2E1MB 4UUSA 4ATEA 3QPSA 1S0CA 3WQ0A 1OVSA 3ZM8A 5BY5A 3RKXA 5J3LA 5ACA2 3VKOA 2GALA 5BPXA 4EROA 2X4HA 2Q0AA 1E5RA 1YRZA 4DJAA 2RS11 3UGFA 1V9U3 1PO22 2L0KA 3ASNH 3H8XA 3IMNA 3MUZ1 2QLZA 1JUPA 5I0TA 4LMFA 3RG0A 2ZGOA 3RNSA 1XNAA 3U2RA 4AFBA 4FQGA 5FQ0B 1TQIA 1DGWA 2G0EA 2ZX1A 3R0RA 4XLAA 4JV4A 3PIGA 2HYKA 2LY9A 5FYTA 3GCWA 4JGYC 4A44A 2ET7A 5EF6A 3FMGA 4B4CA 3VBFA 5CKQA 1GSLA 2JG9A 3A03A 3M8FA 4S2DA 3R4KA 4OWRB 4GXOA 1W6OA 3WGHA 1WW5A 2D1VA 1ZLKA 1WZ2A 4LFUA 4U7BA 2OQ7A 1EAH2 1ZBE2 3K1MA 3TP3A 1O4TA 1IRFA 3R4UA 4DPNA 4BU2A 2D40A 2WWJA 3HBKA 1BCXA 1DZTA 5F6FA 4XF1A 2HWB2 4P96A 2WN2A 2VQHA 3L00A 1TNRA 3C2UA 2ZX4A 4JHTA 3VBRC 4C2MJ 2CYFA 2QSFX 4BLIA 1XCBA 3BCAA 1OJLA 4LK1F 2WWYA 3BIWE 3CCSI 2R1BA 2BWAA 1GP6A 5E18F 1X1BA 4CDXB 2W91A 1RUE2 3X2QH 2D5FA 3VDDC 4M3GA 1MJAA 1AYM1 3LEIA 3WCRA 4B3NA 1WLTA 3LCPA 2J1RA 2RJLA 3NNGA 3NV1A 3DGTA 3E5UA 2KP6A 3V8KA 3FM5A 2XHKA 1RHI3 4PDWB 4XFFA 4BA6A 1Y39A 2FZ2A 3TN91 2ADDA 1TQMA 2STTA 3M7GA 1UOBA 5JXIA 1T98A 2VXDA 3JW4A 1VMJA 3TO7A 3K6GA 3ZFEB 4C8DA 2DMTA 4LUMA 4HONA 5M3MJ 2DJIA 2GMEA 2D1HA 4BJ6C 1DG6A 2ZMLA 3VSKA 2DPDA 4YYOA 4HPKB 4ZDOA 1PIV2 2LLKA 3M1EA 3RZZA 3I97A 3ZSKA 1ZGJA 5TRDA 2LRPA 1OYIA 4BNCA 1B1BA 3ECOA 2JT1A 2ZGRA 5B2GB 5CFDC 3AMMA 4BDYA 1ZK8A 1BI1A 4QT6A 2PYTA 2DUQA 1F5TA 3S1MJ 2K4JA 1UELB 5JPNB 5K4LA 3OYNA 2XBO1 1CWPA 4XBLA 2HWF1 2QKLB 2J1UA 2GA1A 5C3EJ 3WINE 1TTYA 5FD6A 5ABJB 3QD6A 4NRMA 4LBQD 4Q4V3 2DYSH 3F0CA 2OPKA 2DA3A 3DF8A 3OPZA 2BUKA 4KNYA 1FIAA 2VZ3A 4YG0A 2Z3YA 2ZX0A 2R7RA 1HB3A 1BC7C 2XSJC 4AFAA 1E3OC 1OF4A 2V5DA 1IS3A 3KYCB 4CRQA 4WM8C 1UOGA 5FZLA 4XZUG 3T4VA 1R1VA 2OA4A 5FKOA 5HPOA 2ZTNA 4JCKA 2RNJA 1IUFA 2IGOA 4P55A 4JHZA 4UVCA 4HANA 2M7BA 3CCEI 4XOTA 4ASMB 1DPUA 3ZQGA 1SLTA 1SPPB 1OCOH 5H6QA 2MH9A 2X6OA 1UCRA 1UYZA 3WNPA 3CMAI 2W84A 5HS8A 1KGSA 4A3CJ 3NNMA 1MQTB 4Y22A 2NVUB 1RETA 1WGXA 1O8SA 1LDKB 2YSRA 2EAAA 3ELKA 5FZ3A 5A80A 1XMXA 3I3BA 4R9CA 2JG8B 4X0GA 1PZ7A 2HYFA 5FZ8A 3N7JA 3H36A 4EQQA 2COBA 1AL0G 4M71A 5IVCA 1WLWA 4ETSA 2RREA 5LFAA 1ZH5A 3G2BA 1U5TA 3KLSA 1R4NB 4IL6C 2Y0SA 4Z92B 2XKPA 1WH7A 2JK3A 3T09A 3H0DA 3MLLA 1U0JA 3IDCB 4AGGA 3RRDA 3CJXA 2FF4A 2K9LA 4IQPA 1IV6A 3PVEA 3AJZA 2PMHA 1OOPC 1PO23 3TL4X 5A2QK 3HZJA 1XCVA 1WQ2A 2GP5A 1YJWI 4EEFG 2DFIA 2R063 2CL2A 2XB6C 3VD9A 1MMNA 1FP2A 1ZAOA 2RMU2 3C2GA 5LA9A 3RKQA 2BWCA 4ZY9A 3HOZJ 3OYMA 4BQ5A 1S29A 2KIQA 2YUSA 3CESA 2AXLA 3CZ6A 4CICA 5DCMB 1Z3YA 2QQIA 4EJUA 4HOOA 1VQ7I 1J2XA 4CCLA 3A0HC 3NAUA 3V7SA 5C3RA 1RJ7A 4QHBA 2G7UA 1EAH3 1S0GA 3KD4A 3PUHA 5FZOA 1X7NA 1XGSA 2JWTA 3BZKA 3SZTA 4RGSA 1K79A 4AD9A 5B4NA 3JR9A 2ZMEB 1MKMA 1RMU1 1MS8A 2HWC3 1DFQA 1U9OA 4EM1A 3BODA 1J1LA 5BNNC 3THPA 1FX7A 2F5CA 4HRIA 3FWEA 1MBHA 4IKFA 1FOD2 5FZ0A 2UWCA 3COAC 1QU3A 4BXUA 2BV4A 1EP0A 1ZZCA 2X5IA 5HV0A 4DUVA 1GMMA 3HOYJ 2RVAA 3TWIA 3MWMA 3MCZA 1T6GC 3E3VA 2NP0A 4XRSG 1GV9A 3RJRA 4K8FA 3RFRA 4E7ZA 5DABA 1RUC3 4LOTA 2EZIA 2VQUA 5FZDA 2ZPXA 2CWMA 2D5HA 4DZJA 2D93A 3G3ZA 1FPQA 4LR4A 2OC6A 4QU1A 1TW3A 2XUEA 1TWAJ 4YM1A 4BZ4A 1KA8A 2LUWA 1CAXB 1R1A2 4D7YA 5KXBA 3HPNA 3ZXGA 5DQ0A 5LBFA 1ZYRF 1YX3A 2ES3A 4FTSA 1CONA 3J7LA 4FAGA 3PNAA 4MHGA 1K7AA 1QZEA 5F39A 4E8CA 2JDMA 2CTVA 2GXBA 4WVMA 4Q0VA 1JI8A 1ULYA 3HR9A 4EVIA 2Z33A 4FPJA 1F4KA 2WZPP 5KNLA 4IHYA 4MVTA 4EJVA 5JAXA 3H50A 3KV5A 1ETKA 1D4M2 1PM7A 1H9TA 1M06G 3DBRB 4XPVA 5ICFA 2HEYF 3H35A 3MW2A 2EFNA 3BG5A 3UKNA 2M2EA 3M4FA 3TB0A 2CWEA 1LVAA 2CFXA 1AR92 4LLFA 1POGA 3AG4H 4OLLA 4KITB 1CJDA 5HBAA 5CVJA 4HK9A 4PIYA 1LR5A 4PIXA 2HYGD 2VW0A 4GH4A 2ZJCA 1SEFA 2FD5A 2ZGPA 5DUVA 1AHSA 2R3SA 3A22A 1C28A 1WZXA 5H9RA 4CCKA 2H27A 4FETA 5A3NA 2ECCA 4IDZA 3MFCA 1B9MA 5FLXK 1T56A 1IV8A 2DCTA 1TWFJ 3HNYM 2PFWA 2EIJH 2QYOA 1VRBA 3HAGA 4QB6A 5C9AC 1C8M3 1SANA 4X8PA 4FXGB 1AXYA 4B1LA 5ICGA 4DEQA 4IE0A 4PK4A 4M3FA 1QGLA 4YIRX 5BNOB 5CQGA 3ZYIB 5DZFA 1VQ9I 4RAFA 2OUMA 4Q4W1 4HNUA 1A6CA 2VC9A 2E71A 2V72A 1IZ3A 4E2SA 5D8LB 3DPRB 2R7UA 1IN6A 1OA2A 1E5SA 4CDUB 2WNVA 5BYNA 5KHJA 2DOFA 5FYIA 4KL1A 2HDCA 3IRQA 2WC2A 1LOFC 4D6SA 2FDJA 3MICA 1IO2A 3IH3A 1RIOH 2WAOA 1FMD2 2V4JC 1V6IA 4IRHA 3WT3A 4LKSA 3A0NA 1DGLA 1FXZA 1POV1 2WAEA 1HRV1 2D6NA 4CEYA 3ITQA 5FYHA 3GF6A 4K21A 1HKDA 2XLAA 3T4HB 4UAPA 2FDKA 2W1SA 2WL1A 4RR3B 4GWJA 1D4VB 2WS93 5AC91 1TNFA 4RHV2 4XIKA 1W0NA 3IUOA 3ZRGA 3QU6A 1PMJX 1JZ4A 2OW4A 3I64A 2IXCA 1PVXA 1P2FA 2NS7A 1V70A 2L4AA 3AP7A 4BQ4A 2UXNA 3LDRA 4NNJA 2DUOA 1DGRM 3W6VA 2RMU3 4QPGC 5F7UA 4AQ2A 2A6ZA 3M70A 2OX0A 2DVAA 4GZ9A 2G19A 2H6BA 4EJWA 2A05A 1V9U1 4JTNA 3G7DA 5FWJA 3IDAA 2VXJA 2B45X 1W6NB 2LOOA 4BS9A 3ZQQA 4YVWB 2Q1MA 1IC8A 1QDOA 1Y6IA 4YVSB 4QX0A 4ASNA 4IZZA 2PAMA 1JHFA 1R1TA 2FOKA 4NRPA 1H6XA 3B00A 5FOBB 4XJZA 4M9XA 2IVIB 3FMRA 3VZOA 4FXKB 4RBOA 1HB4A 2CS3A 3DBLB 3NJZA 2OUJA 4COUA 3LSPA 3IPVA 5EZHA 4KMUX 1QY4A 2CUEA 2E53A 1CESA 3AC0A 1BR1A 4LO6B 4QB1A 2KRCA 2PHXA 3TO6A 1S0FA 3ETQA 2VW1A 1WW7A 1W6PB 1NCRB 1ZVFA 3PUSA 1MD0A 4WF2A 4D94A 1RUJ2 5C6CA 3I4IA 3D4KA 3MYXA 2O3FA 4OUEA 1OFSA 2OUHA 4LBQA 3DPLC 2F4OB 4RB0A 1ENHA 4Q8LA 3SCFA 3ZKYA 2RM23 3J81Z 2W48A 3ZQLA 4LOSA 4FPOB 2HNHA 2LY1A 1KFUL 4Q47A 1Z78A 4LLNA 4D0QA 1FSEA 3K1PA 5E1RA 4ESJA 5M0TA 4EGYA 2BW3B 2IVJA 4LK0F 2XVCA 1M4WA 5FMOL 5DZEA 3C7GA 5IK4A 5T54A 4UOJA 2VC0A 4C3HJ 4A93J 4OHZA 1W9SA 2ZJQF 4HEA2 1ZKGA 4M4RA 2E7QA 2XAHA 3KS7A 1JJ8C 4Q4X3 1RHI1 2K9MA 1DQ4A 4M9SA 1OA3A 1X1PA 5C3SA 3POWA 4M6XA 3NRVA 1SAXA 1Q8VA 4YW3A 5BNPB 3CUQC 2HI3A 4HX8A 3OBTA 4I3PA 1QHGA 4P9LA 2ECBA 3WF0A 2RDSA 2XAUA 1W39A 3QODA 5KC6A 2V4AA 4Y1XA 1G86A 3I2KA 1GXPA 2GQQA 4UHTA 3IKVA 1HV1A 1D2SA 4JTOA 1L7RA 3OOUA 3OYWB 1OQYA 1R5ID 1ZBA2 3D5LA 3SFZA 4D7MA 3ACFA 1R1ZA 1NLQA 3GJAA 2VIXA 2DURA 1VAMA 4AI8A 1UXXX 1KRIA 3RQ4A 1YHFA 2XDVA 3GBGA 4QKDA 1S5LC 5E17F 2WFPA 1UU5A 2ZXQA 4Q4V1 4IQ4A 3POJA 1O8PA 3M1CA 1N78A 4Y1UA 4XURA 4BE2A 1XRUA 2CV0A 4FP2A 2QENA 2EFOA 4UI9L 3I3MA 4OQ9A 1QF3A 1PUEE 4NPRA 2EPFA 2BPA2 1W99A 3MPBA 4AU7A 5FYCA 5LWBA 4QLCU 3ZFFA 1QJX2 3EYYA 1N3OA 3K1NA 1BR2A 1RUNA 5LK5A 3ZXJA 1XJAA 1WI9A 1FMD3 1CR7A 1OF3A 3CC4I 1GDTA 2WRAA 1VNDA 5L3BA 2VB6A 2P3JA 1URXA 2Y26A 2CW0F 1T39A 1RTVA 2PJRB 3MF6A 4E6KG 3LIHA 2DCYA 5KHDA 1WCSA 3TW7A 3HL2A 2VG9A 2R0FA 1FOKA 4YZ1A 1AR63 3TNPB 3K69A 2KJBA 1S0DA 2A71A 4NAOA 3TBDA 4F3JA 2JMWA 2R5ZA 1IKPA 4CYCA 3DN7A 3W6JB 1KGYA 4M3BA 5DDGA 1CZSA 4ARXA 5C5TA 3TO9A 3ZKUA 3AKTA 1POV0 2IA1A 2E5ZA 1LFUP 4JAAA 2IW5A 5ACA1 3AYAA 4Q4Y3 4EMSA 1SG3A 4ZJZA 4C30A 1GOFA 3D5SC 3ZYHA 2WQZC 5FK7A 4LK7A 1UL9A 4BQ1A 1PO21 1QJU3 3FXRA 5T5OA 1X3ZB 2DFBA 1H8TA 4ZDPA 5HLGA 1MGTA 3OL3A 4ENJA 1J58A 2ILMA 3WD5A 2BBYA 4Z07A 2R061 1B35B 1IGOA 3USSA 1O5LA 3SXYA 5TJJA 3OS1A 5GLVA 2Y6GA 4G9SB 4WXCA 4XIDA 4AGVA 1KJLA 4JDOA 2M0MA 3N3HA 5F5QA 1G8XA 3OYHA 4RYDA 1XSRA 4QXCA 2VTXA 2OTJI 3Q5FA 5LASA 1GXQA 3D8CA 3WF2A 2ZKLA 4ZU4A 4YGBA 1CZVA 4LHNA 4R1HA 3N4MA 1B72A 4R8HA 5HLIA 1S2KA 2VCBA 1YTYA 1T08B 1EAH1 1FNZA 3M3QA 5FZHA 5GAEJ 3L2CA 3SKJE 1GNZA 5LA2A 2XVLA 4A69C 4BHBA 2GLOA 5IVEA 1Y0NA 2WAQA 2DT7B 3CC7I 1CX4A 2HWC1 4XNFA 2ZCWA 3NNLA 4WXDA 3OD4A 1YX5A 3D0JA 3V0BA 2PA7A 5CQEA 1LFBA 4LG0B 4EATA 2EJRA 4BM8A 1AYN3 3FM3A 3SQOA 5JHFA 2IGMA 5F5AA 2JDUA 2YBSA 5IYDJ 3TOBA 3V4GA 3GZUC 1RUC1 3VHNA 2W1WA 5DAPA 4AK3A 2X1DA 4BEHB 3ONQA 1BJAA 4IHXA 1W6QB 2DVFA 3BU0A 4IW3A 3BZ6A 5FD5A 4RM3A 5LGUA 4J00A 3VBUC 3FFZA 3MKLA 3K4MA 3LSMA 5FY5A 1KYWA 1N1YA 5I8YA 1YIOA 1ND2A 3LA3A 4QM9A 2FDHA 1MNMC 3TOJA 2L9LA 1R22A 3T1BA 1BJZA 4TSVA 1CQ9A 2DCJA 2XONA 1W5SA 1FPN2 4GKXA 3H8UA 5FKCA 3HMYA 3WG9A 4KMQA 2LFBA 2JEMA 4AVAA 5IATA 2I2SA 3OBRA 2P7CB 4I02A 3SZPA 3JU9A 3BPXA 3H92A 3F6VA 5K0UA 4NWVA 1ULGA 1UNBA 3DEMA 5JDBA 3ZXKA 4DXTA 4NHMA 2VOTA 1ZBA3 1BEV2 5JXHA 4LBNA 4Y24A 3LOBA 2LW8A 2KPMA 3C18A 3SCGA 1X9PA 3RSNA 1V6MA 3RZJA 1W7PD 3RWNA 3PUFA 3VZKA 5I0RA 1YI2I 1KQRA 2VJ4A 2M9HA 3LAGA 1EH7A 4Y5SA 2X09A 1MDMA 2DVBA 2OV7A 2PHTA 2W47A 4XBFA 1IXCA 4D9JA 3LAJA 3FISA 2QEXI 1EPWA 3GFLA 3OYFA 1IF1A 4Q2FA 1Z7LA 3AMNA 1DYOA 1U6GA 4NE9A 4AVCA 2K9NA 4PFOA 4CDQB 2BVLA 1OISA 1C8M1 3HGGA 1OPMA 4AIJA 1US3A 5M5XJ 5JVVA 3H5AA 5E3LA 2MW8A 5CVIA 1HOMA 1K42A 3ZR8X 5LBCA 2VJ5A 3I3LA 5JZGB 3L9FA 3TEYA 2W82A 1ZZBA 4LO8A 4AVVA 3D5RC 2V6EA 5CADA 3ABKH 3B6AA 1DPRA 4CCEA 2DT5A 1GQPA 4Q27A 2YX4A 2DTWA 2DFCA 2VMEA 1K5JA 4MTDA 2R072 5C8CB 2YHJA 1IOAA 1NZIA 2EV5A 3GNEA 3E6BA 3A01A 2AENA 2IXIA 4NC7A 2DAOA 2JD4A 1TMF2 5IT6A 1ENRA 3V0AB 3OGJA 2RC4A 2W1QA 4JQTA 3HOSA 3WW4A 3VOEA 3VB9A 2IXHA 1W2UA 3B9CA 4ZS2A 3OTFA 4IRIA 5FPVA 1P9QC 5JUVA 2WS91 5HS9A 3NJYA 2XL7A 3O1TA 4BBSJ 2XUBA 5GALA 3ZGKA 1WA4A 2JVHA 4CZSA 3WEZA 3ZN6B 1S72I 3LL7A 2Z16A 4Y5TA 2D3SA 1CD3G 5IYYA 5EYRA 5A7PA 4XACA 2KMUA 4CEYC 1XMAA 2HEWF 1JI6A 1Z7S3 5BXXA 1WMXA 2RMU1 5A33A 2HTJA 4IE5A 2ZGTA 2E1CA 4LNVA 4BQNA 2A6EF 2NN8A 2VW2A 5FTTC 1RVF3 1W5CC 3L7WA 2E31A 5GTHC 1YUDA 4JC1A 1R082 2G9ZA 4RGKA 4PJ0C 5HS7A 2DU1A 3BJOA 3OY9A 1SD4A 3KFWX 1RKTA 5CFCB 1OH4A 1ND3B 3H3VK 5GADJ 4M00A 2NNYA 3EBRA 2L4MA 4A7KA 1ULPA 5LATA 2ID3A 4NC6A 2RS52 3KP3A 2MEV3 1YQ8A 1JXSA 2MLGA 2XGCA 1ZZ6A 1EF4A 5DAWA 2MPFA 1LGCA 1YLFA 3KZYA 1IHMA 4Y7NJ 3GZTB 5ILUA 3PUQA 2QM3A 4ZHNA 1W36D 4FFIA 3IWFA 2OQGA 1VQNI 5JXGA 3L9JT 2XR4A 5L3FA 5HNFA 2D97A 3CMGA 1SDDB 1AR83 2Y69H 3FXOA 4COYA 4EWDA 5EGOB 1IS4A 5IT9Z 3BTIA 4YGDA 3BTZA 1EY2A 2R7TA 2AHQA 4LD5A 3HG9A 3K3NA 2VC1A 1WW4A 4M0HA 2QDNA 3HOBA 1RUI2 1U9NA 4XHXA 2FCTA 2NVYJ 2VPRA 3OYLA 3JAMZ 1OLTA 4CEWB 2ZFWA 1QOSA 2VJIA 3TW6A 2NPIA 2G9WA 2O61A 4Q4X1 1SMVA 4MFDA 4M3CB 1CX1A 2LH9A 3U75A 5SV5A 5LD2C 2QSGX 2ZX2A 4EE2A 1VBA3 2OZ6A 3GZNB 4QPIC 3B01A 1FY7A 3IAS2 1D4M1 1LDJA 2A75A 3OPWA 2ZZQA 4IPAA 1UHWA 4BL0B 4XLCA 2PHFA 4GQ7A 4BXSV 3L2HA 1W4MA 1BEV3 4DYRA 3P3NA 3POEA 3AP9A 3I2FA 4QX7A 3CJTB 4JGZB 3POFA 2F5FA 1UKRA 2P6HA 4I6ZA 3ZYJB 4QGMA 3VD7A 3W21A 1Y1VJ 2QQWA 1D1AA 2GN7A 2NVTJ 4GALA 1GWKA 2VMDA 3Q0UA 1HQWA 1WLDA 2YDEA 2ZJRF 3WNXA 2ESNA 4K7JA 1PZ8A 3C7HA 2PG4A 5LK7B 1FJLA 3H9JA 2FX0A 2OPTA 1EV12 4FI9A 1X82A 4JX5A 4C2TA 1CAVA 3PLQA 4N4OB 2B7EA 5FJ8J 3M3CA 5GZCA 3MFKA 1H88C 2WFF3 5F3GA 1V5GA 3HSRA 1L3JA 3E6CC 2VUAA 2UYBA 3VBSB 2DJNA 3IRRA 4KH9A 2PMZA 5ED4A 3WE2A 3GZ6A 3A21A 3WW1A 4CDWC 3J8F2 4Z8BA 2PHUA 1W8NA 5DUIA 2VE9A 1T2KA 3VBOA 3VBFB 1Q8SA 2JG9B 4M4PA 3O3KA 1DGRN 2MH2A 4KU7A 1QWRA 3WLUA 1W6OB 4H3WA 4LHKA 1O3SA 1FMD1 4K3UA 1KD7A 3CJNA 4HPKA 2VY0A 2VKDA 1LEDA 4G4FA 4BIFA 1P92A 3WNOA 2Y64A 1T95A 1ENQA 5JCTA 2PHRA 1KU9A 1Y3TA 5JMCA 4UUVA 2A5WA 2NYXA 4F93B 3K75B 3PHMA 3WZ1A 3JQXA 1QJZA 1JW6A 2VM9A 1AR61 5F2SA 3CJQB 4NDLA 1OMIA 3FLTA 5T5PA 4HZFA 1LUJB 2VMGA 3LZZA 4XTMA 4A6OA 1YJKA 2Y6LA 4LG3A 5LRSA 2KISA 1D2QA 1B6AA 3CIHA 5ABJA 1VMFA 2KL4A 2L5QA 3LQQA 3HKZA 4Q4Y1 1YI9A 1YW7A 2JIJA 4WXHA 1UQXA 4ZONA 4XUQA 3LQRA 2HDDA 1GVJA 1FOYA 3PJRA 3JRBA 2P17A 3H0OA 4G7OF 2PFBA 1QJU1 1JUHA 3POSA 3JB8A 3GGLA 5HCFA 3AFHA 1ZGWA 4CCNA 1Y7BA 3TKYA 3X29B 3RIRA 3Q9VA 4E4DX 3IH2A 4MGKE 1SPPA 4HA8A 4U0WA 2F5EA 4HLYA 1F36A 2ZGKA 2BGOA 1H1MA 5FZIA 2V4VA 3UESA 4AHYA 1MACA 4TXWA 4JDMA 4ZKTB 2W9XA 4BB3A 3RZDJ 3S8PA 3T30A 3GJBA 4LULA 2YC4A 4XLPF 4MGSA 2P5VA 3OYBA 2JG8A 5FZ7A 3U21A 3ASOH 1JYCA 1BVP1 5E3NA 3AK0A 2WT2A 4E9KA 1UKGA 4EN8B 4CP0A 4A41A 1W7PA 1AL22 1Y0UA 2W1OA 4C2UA 5TISC 4XABA 2W52A 3H5NA 3PSIA 2M87A 1YRNB 2WQ8A 2CU5A 2WABA 1COV3 1ODDA 1PK6B 3IN9A 2GNBA 1NG0A 2VBZA 5B66C 1UAAA 4V2GA 1OQDA 1AYN1 4OMDA 4CZZA 4AE2A 1HSJA 3DQVC 1MZ6A 4AI0A 1GVDA 2K85A 1UOFA 5AVAA 4P5OA 5C3PA 1J09A 3ZXSA 1D0YA 5HODA 2WB1A 1XPXA 1ODNA 4ZYAA 4OVEA 2XXZA 2DA6A 1PX4A 1UW8A 1UY1A 1MMGA 5IYBJ 2WN3A 4QPQA 1WKMA 5FKKA 2ZX3A 3I7DA 3CP8A 2E6VA 3GYDA 1JUSA 3M8EA 4L9TA 5KVRA 4IF4A 2V7FA 3OR2C 4Q1PA 4XQFA 4RGAA 4MNUA 5BOXA 4HT1T 2FJ1A 3K4DA 2VE8A 2VD7A 1GNHA 4FOQA 1NTCA 3TNQA 2QKMB 1GWLA 1MS9A 4NHLA 3DEUA 3T5XA 5IAXA 4E7SA 1OSGA 4OI1A 3SH3A 2ZMEA 1CF7A 5I8SA 4IE4A 4BKXA 4UW5A 3OR1C 1SAUA 5APAA 4BMBA 1ND2C 4XJAA 2IVMA 4DY3A 3LSDA 3VDAA 4I0AA 2CYYA 2L9RA 1ZBA1 1U5TB 1ZR4A 5FRAA 4HVOA 3OGGA 3BQZA 2ETEA 3LEKA 4UYBA 2HJIA 2VMIA 1HCRA 1LPQA 2WA3A 3EUHA 1EV13 5FXZA 1A35A 1VB2A 4XJ8A 3AL0B 5K0UC 2X0LA 4WM7A 3OYIA 4WZCA 3WU0A 2BP6A 2ZEWA 3OYDA 2Z9OA 2V1UA 4LB5A 2L3DA 3T2OA 5M5WJ 2R49A 2BE5F 4NC8A 4FISA 2SBAA 4IEXA 1CAXA 2RQPA 4O3MA 1IDYA 1XE7A 3E97A 2GWRA 4RGXA 3JSPA 5E89A 5F6LB 3RQ0A 3UKGA 3JD73 3ILNA 3ZQFA 2XJSA 2ZFUA 5FZOB 1XPWA 3ZMDA 3MBWA 1OKOA 4FPHA 5IVFA 2BGPA 4A3MJ 3J4UH 4IV1C 2XPVA 4XONA 1LB2A 2A7AA 1DQ0A 1WMDA 1VQ8I 3NVCA 2DDAA 1GZWA 5FKBA 3PO2J 5K8SA 3HDDA 2WO3A 1MMDA 2X5IB 2BZDA 2O5RA 3KX2A 3SC7X 3ZSLA 2KIFA 3I2HA 3W58A 2A73B 2VZSA 1YQ6A 4L97A 4YW2A 1HQCA 3V42A 4YZ4A 4NHJA 1O7FA 3ZQCA 1VJ2A 4LBLA 3AKSA 3ASIA 5LLQA 1RPWA 2GM4A 1JUIA 5FPUA 3ACIA 1ZN2A 1MBGA 3I4PA 4O5VA 4RMNA 2QCSB 5FR3A 3DLLF 1W5TA 4QWNA 2XPWA 2W7NA 1RR7A 1Q8QA 5HDGA 4KBZA 1DGWY 4A0XA 1Q8OA 4XC9A 3VYTB 5FLMJ 1D0ZA 4YW7A 3N9QA 2RS12 3JTHA 5E88A 1Z77A 4A6DA 1R49A 4FPGA 1YG2A 2VMHA 3IMMA 1YJ9I 4Y15A 1KONA 2GNDA 5BNOA 4KN4X 1Z7S1 4EN9B 1ZX5A 1ZARA 2JB8A 3T0DA 4NB5A 3Q0WA 4BXXJ 1ONVA 2TEPA 3MUY1 1JZ8A 3DPRA 1WBFA 4CDUA 1FSHA 1RVF1 2Y6HA 4COVA 1OFCX 2WZEA 4LORA 1P7IA 4UV9A 5D8AC 4JGYB 2R0HA 4HBLA 3AYCA 3KT4A 4TLGA 3AX4A 2XJVA 4HG6B 4KU8A 2FEZA 4IRGA 1AL23 2K7LA 3BI3A 2MEV1 2VZ1A 2RKHA 3QU3A 5CB7A 3U11A 3DYMA 4GH4B 1SVMA 1H0MA 2Y34A 1MBFA 3UNGC 2D6KA 2EIBA 3CCUI 1MS1A 3MKYB 2VONA 1T0FA 5HNHA 3A1YA 2GIZA 1H8AC 3VBRB 1AR81 1WD4A 5EZWA 1AYM2 3O7OA 2A07F 3ML6A 4IXLA 1WMFA 1EH6A 4C9YA 4C0BA 4DFSA 2VNOA 5HDNA 4A6EA 4CUGA 1VBC3 2QUOA 1GWMA 3ZMSA 1O57A 5HVQC 4NAMA 1UZVA 1JODA 3O0VA 1VQ4I 3TN92 2E19A 3OOXA 3BLYA 1MW7A 4YWAA 2WNVB 5DZGA 2E1MC 3I56I 4DQ2A 4B8EA 4W6XA 2GC2A 4GGGA 2Z2SB 5FXWA 1W2TA 3IAQA 1QBJA 2J5OA 2M3AA 2CUJA 1H2KA 2R4GA 2I10A 5JHUA 1VBA1 2X6WA 3OIOA 1TC3C 4A3BJ 2Q1FA 1J3RA 5GLZA 1WCQA 2CV6A 4QDQA 4E27A 1BEV1 2VOXA 4FPFA 3PNYA 4D7TA 1YJNI 2F4PA 1NY72 2PBIA 2XBO2 2ZHKA 5BUVA 1NCRA 4BY7J 3DCFA 2M8EA 1Z9CA 1W0PA 2KKOA 1QJFA 2KDZA 3DEEA 1LEAA 2GNTA 1GUUA 2FNAA 2VOOA 3K4AA 4LUKA 1UD1A 3WNMA 3S7IA 1NYWA 4OFGA 2JKBA 1BZWA 2JIGA 2N7GA 2UWBA 4LIVA 1APNA 3CDZB 4FO9A 1OLMA 2JE8A 3V65A 5FP3A 2BW3A 3WUCA 1CAWB 3DXUA 3C8XA 3HM5A 4I09A 4CO8A 4D8MA 2DBBA 2B39A 5FY0A 2BVVA 3H3LA 4YZ2A 2Z1DA 4YGEA 2X10A 5FRNA 2HQNA 4KQ7A 4XIOA 4E4SA 2GC0A 5J37A 1HBXG 4UW3A 5FPXA 2R7OA 2B63J 2WFF1 3B5LB 1QQP2 2VOWA 5F5CA 1I1SA 1V5EA 5B5EC 5HOOA 1J59A 2XAGA 3BJAA 4J19A 4YIIA 1LRHA 4CDXC 3VL8A 1HA8A 2PHDA 1N1TA 3KQ4B 3IDBB 2QQUA 1BL0A 3KIOA 3WF4A 1IUYA 4XFIA 1UAIA 4L92A 1TWGJ 3P6BA 4PDWC 3WQBA 4F91B 4HN0A 2F48A 4YNIA 2JPBA 1KQ8A 2CNAA 3WHCA 3GBWA 1J9IA 3SKVA 3C1DA 1XE0A 1MMSA 1TMF1 1UHMA 2P5BA 5CAZA 4ESBA 2Z5WA 1OXCA 2BY1A 2XJPA 3ZFEC 2JSCA 2W00A 4XW3A 1UPIA 5KXDA 2Y6KA 3RYRA 3J80K 4XFHA 1SMTA 5I0UA 2ZSIB 2O9LA 3KT7A 5FZ6A 5C4WA 1J1TA 3U37A 4KBBA 2VI6A 4XKVA 4C90A 4H55A 5F0HA 1O3RA 1GBGA 2ZXIA 3QYFA 2O0OA 4NIGA 3CF6E 4XK4A 4GYIA 2QZ3A 2ZO4A 2VVEA 1H8VA 1RIRA 4NIHA 2BBVA 5D5XB 4PLMA 4XN3A 2JJ7A 3K70D 3R6SA 1FBUA 4NR1A 5ABJC 1S3JA 1KU2A 1D8KA 2FBEA 3KWVA 5FO9B 4RSUA 1J75A 3CUOA 2XASA 4I30A 2VGDA 1IG0A 2JB4A 4P9FA 2WLPA 1LOBA 1SFKA 1PX3A 3RCOA 5L7OB 1RMU2 2PJRA 2DW4A 4YW1A 2R5YA 3V56A 2VQTA 1HXDA 4YG3A 4AUXA 2XF6A 2LP0A 3ZLIA 3PU8A 2VZTA 5D4RA 2DUPA 4CCMA 1XMKA 2DODA 2BOIA 4HKLA 1I50J 3CJRB 2XQXA 1QPIA 3R4DB 3A7QA 4R9BA 5DG2A 4HNTA 4Z82A 5E1WA 5DAQA 1GQGA 4OIQF 5IVJA 1MQTC 3JBG2 1COV1 2G4IA 4KWLA 4QX8A 3GTLJ 3ZSJA 1OCRH 4D6QA 4YZ3A 4PJYA 1Q5OA 3EYIA 1UIJA 2X6YA 5CYVA 1VI0A 4HLTA 2ZJ2A 4XJWA 2IXSA 4L5EA 2HWD3 2HYXA 3I59B 2BEOA 1S6LA 4XXAA 2GA2A 4X8NA 3G71I 2BY2A 3OS0A 1FMVA 4BQ2A 2WAAA 3ZFFB 1IW7F 4RD7A 1MS3A 2VQGA 1RGSA 1I3AA 1G59A 1P4WA 3LSIA 1LOGA 1R5HA 2TBVA 4IEQA 1RJ8A 1F1ZA 4BK5A 2RV8A 2OZJA 3D3AA 3O1VA 2NZ9A 1L7LA 1NA1C 3DYPA 3CF5F 3ACLA 2A5YB 4FASD 3VHPA 5IFTA 4N43A 4JP0A 3ULQB 1EKEA 2DTYA 2XSDC 4QX5A 2D5VA 2GH8A 1W0OA 5C5UA 4MEYF 3U10A 4JX4A 2XAJA 2EA2A 1JXNA 1OFNA 3DL3A 4DIQA 1GHCA 1XDUA 2R5ZB 4CYCB 2AR6A 2ZKZA 1IQDC 4BLJA 2J5PA 4DS0A 2VNGA 4LG0A 3B73A 3ZXDA 4GJZA 1OUXA 2W1UA 4M73A 3MW3A 5CG8A 1QZYA 4L0ZB 3MLJA 1JYXA 4Y17A 1EV11 3VYSB 5A6ZA 1J3QA 5K9YA 2HH9A 5CIRA 3OIPA 1KYZA 2R7SA 4QAWA 3IBMA 4UVBA 1GZ9A 1QQP3 1HQLA 4ZH4F 2P4WA 2NMNA 4AVZA 2HS5A 2GIVA 3PL8A 2N8GA 5HCBA 2L7ZA 1GU3A 1SFXA 3EHKA 1RUD3 3NV4A 1A34A 4P00B 5FDBA 4L99A 4Y4RA 4BYYA 4R9DA 5IYCJ 3ZYRA 1IS5A 3DWLE 4TTGA 3HOUJ 3JD71 2RS33 5FYZA 2DFHA 1B72B 3ZSMA 3RZLA 4HOBA 2L7MP 1B59A 2OF7A 3PL0A 5DM6F 5EQUA 3RI8A 1Z91A 1S55A 5FFXA 2B8MA 1H1AA 5DG1A 2IPQX 3ZOIA 2IA2A 4CXXA 2IS6A 1HRV2 3VBHB 3LSKA 3O8HA 3HIFA 1H4HA 3HJEA 1NH3A 4LA2A 1YW8A 4EM0B 1O7LA 1YOVB 3VD4A 4XBQA 5FZEA 2ISZA 3Q8CA 2VKEA 5AC92 3LFUA 3DKXA 1ENSA 3BTYA 1FLIA 4PGGA 4IERA 2NAZA 3LWCA 3RYPA 3J26N 3BR6A 4XORA 1WJEA 1YO5C 3KV9A 3EDPA 1E3HA 1N47A 1VBD3 3NO8A 2E34A 3GFIA 1LNSA 1GZTA 1U5ZA 1D3YA 1ORKA 4K2EA 2XQRA 1VBB3 4N9HA 4YM2A 1UJ8A 3D1NI 1X1AA 2QQ8A 4IO9F 2J42A 2CQ7A 1GR3A 1I6XA 2XPUA 1V9U2 3PVBB 4QPWA 3GBFA 1ETQA 4QPGB 4QTRA 4IEUA 3BOPA 4P9XA 1JTZX 2BGCA 4HXCA 2PI0A 2FA5A 1MZEA 1UG2A 3MD2A 4H2AA 4UV8A 1DDLA 4EJOA 1OD5A 4OHYA 3FZ3A 2D3PA 3N7MA 2V79A 1KXGA 3AMHA 2JDAA 3PJYA 1LGBA 2ZZJA 1W28A 2W3JA 4ASLA 2AEYA 1LEMA 1UZZA 3FC0A 1FNYA