1O3SA

Protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRDTVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: Alteration of DNA Binding Specificity Through Alteration of DNA Kinking
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*AP*AP*AP*AP*AP*TP*GP*CP*GP*AP*T)-3'
total genus 60
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o3sA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o3sA01
1VR3A 1K79A 4HYEA 2ZBKA 3FXUA 5E8GA 4YIFA 2YPRA 1UFMA 3RKXA 1DZRA 2E7XA 1DPUA 1IPKA 5EZWA 5C8WA 5I0UA 5IT3A 5HOOA 4M74A 3ULQB 1HW2A 1R1VA 3R60A 2WTEA 3QOPA 2FU4A 3QU6A 1WSUA 2G9WA 3VOEA 4BHPA 1ONVA 1UHWA 2BGCA 2XLFA 4P9UA 5LLQA 3WW3A 2GXGA 1KQ0A 4RB3C 1FLIA 2FA5A 2BNOA 4BYYA 5H20A 2P5VA 1BIBA 4I3PA 1J7KA 3DV8A 3LA2A 5ED4A 3SFZA 4F8AA 1YTYA 3R0AA 3DKWA 3RI4A 2OAZA 5FLXK 4U0YA 3E6CC 5K5QA 3IBMA 3RPQA 2L01A 1O57A 3V7RA 1OR7A 5H6QA 2GQQA 2FBIA 2ZJ2A 2P6SA 1J0RA 2YU3A 5L3BA 4OFGA 4HBNA 4D0PA 2A69F 2VQAA 4QM8A 4GCVA 1MDMB 5HI0A 5FDBA 2VT2A 4FHTA 4MX3A 2P4WA 1OFNA 2UZKA 2JZYA 1LEBA 4Q29A 3LAPA 3U1DA 3C3VA 2Q30A 3I59B 3KE2A 5J8FA 1Q5OA 2HR3A 5JAXA 3K69A 2ZO4A 5KHGA 3ZP5A 1Q1HA 1S29A 2CGPA 1ZRFA 5I8YA 5FD6A 2WC2A 5DCMA 1XGSA 3ERED 1S3JA 1FSHA 2Y75A 5JVTA 2MC3A 4L9TA 5LRRA 1FYMA 1KU3A 3EQLF 1G3YA 4ZYEA 4Q4ZF 2EFWA 4DNCA 2KXLA 4U0VA 1BN5A 2IXCA 1HQCA 4XFIA 4YG2F 4XLPF 2H27A 5DCFA 1MDMA 3MWMA 1VJ2A 3LWCA 4AQ2A 2C6YA 3J81K 2XAJA 4A0XA 2F4PA 3M70A 4RB1A 3DXJF 4BQAA 4ZU7A 3VFZA 5I8TA 1CAVA 2DQLA 2XHKA 3IWFA 1XE7A 1QO0D 4O3MA 5I93A 2XAGA 4S05A 2GC3A 1JHFA 3ELKA 4CDGA 4QLCU 4EQQA 2HOEA 5JR3A 1YHFA 4HV5A 1IN6A 5D6EA 1B9MA 5CVIA 2QZ8A 1MJAA 4Q0SA 4UUVA 3SZTA 1SD6A 2XLAA 2XIGA 2V09A 4XF4A 3DEUA 3FM3A 5F1RA 1HW1A 2EVXA 1U2WA 4MEXF 4UHTA 4AXOA 2QJVA 3HT1A 1KU9A 2HGCA 4MHGA 5DDGA 4JTNA 3ZDSA 1IN8A 1Z6TA 4XETA 1BI2A 4XFCA 2J5PA 3HSEA 2DBBA 5LGUA 3O14A 4EWDA 3EO6A 4U0WA 1TLHB 3WG9A 5FLIA 4META 3U0ZA 5K5OA 2D1HA 1W5TA 4LFUA 5BOXA 2IPQX 2P17A 5HS8A 1PDNC 3HRUA 3SCHA 4RB0A 4MGKE 2PMHA 3N97A 1G3TA 3V8KA 3KZZA 3ACLA 2UWMA 3EYIA 2LF7A 4Q47A 1BIAA 3U9GA 1CAWB 4YARA 2P7VB 1LKNA 1QBJA 1R58A 1H9TA 3SCFA 2P7CB 5JCTA 2R7DA 1ZLKA 1USTA 3GFLA 1PM7A 4MNUA 1FT9A 2OD5A 2ZKZA 1RZ4A 3JTGA 2NNNA 2D5HA 3ECOA 4M6XA 1OI6A 2RDPA 3GYHX 5E1RA 1IW7F 3CO7C 4L9JA 1HKTA 3TKYA 3RZZA 2NNYA 2VONA 2L54A 4QXKA 1LEAA 2VOPA 3RKYA 1P6RA 4MGZE 3FF5A 4M9SA 1RNLA 3FX3A 2YSRA 5EEHA 2CV6A 1XE8A 2I45A 4I98B 3KP4A 2DQRA 4B8XA 1GHCA 4JVAA 1L3JA 4DQ2A 5KK1A 5AIQA 1IXRC 3W6KB 3WTWC 4AVAA 1G6NA 2IXIA 3R4KA 2D1VA 1WLTA 3GYDA 2ZCWA 1NYWA 1O3RA 2OA2A 4R1HA 2F5FA 3IRQA 3IKVA 1ZRRA 1O5LA 5BPIA 3HRTA 3Q9SA 1O7FA 1U3EM 1RL3A 5DCMB 1PMIA 4TLFA 1ZREA 2FXAA 2XAHA 1UCRA 2EFOA 4HQMA 2PJPA 3RYPA 1XMKA 1NE4A 2AXLA 2UXNA 5D5VB 1J5YA 2GC0A 4KICA 3ECHA 4UNOA 2MD5A 2C0ZA 3C3WA 2O6GE 2P6TA 3ISPA 1TBXA 4EGYA 3IIAA 2CFXA 3L9FA 1XDSA 1JXSA 1ZGJA 3F8CA 5J7MA 3TNQA 1H1IA 4YYOA 1U5TC 2QBYA 2VECA 3HOSA 1YS6A 1OYYA 2ZKLA 5IT9K 1OKRA 2O3FA 1JUHA 1Q3EA 1BC8C 4QM9A 1YG2A 4E2QA 2GXBA 1AOYA 4G7HF 2QQ9A 1R36A 2A61A 1QGPA 3MZYA 2ZMEA 2IRFG 1YFXA 3IHUA 2Q1ZB 2VT3A 1ZRCA 1FC3A 4EJWA 3COAC 1P4AA 4OMYA 4M71A 3FMRA 2JSCA 3KMHA 2L4AA 4HSLA 3FFQA 1GVJA 1UB9A 3BP8A 1E17A 3FZVA 4AIHA 4RGSA 1XCVA 5L3CA 1J1LA 3F6OA 5JSOA 5FLJA 2PTMA 2LF8A 4EMSA 1ZNPA 4KT5C 3E5QA 3E3VA 1TQIA 3V8LA 2STWA 4LULA 4ESJA 2HFHA 4RGXA 3O3KA 3TO6A 3V7CA 4XFAA 1OPCA 4IEOA 3GVAA 1RUOA 4OIQF 1D3YA 1R22A 3GF2A 3FHZA 2PAEA 3F6VA 3LAJA 1IXCA 1PP8F 2W85A 3RPUA 1YFHA 3DL3A 1YLFA 2VBXA 1IF1A 2FRHA 5FPZA 3ROUA 1WI9A 5FB2A 3S0MA 3E97A 5KHIA 4P9FA 3R61A 1HKQA 1X7NA 1QXRA 2W24A 5KBFA 4L11A 2ZNZA 5E1XA 4O9GA 4LA2A 3KZYA 3P7NA 3NRVA 3BWGA 3ES4A 4KU8A 1DDNA 2ET7A 1FBQA 2FEZA 4GYGA 2OPKA 3BROA 2ZFWA 1I1SA 1S8NA 2PFBA 2BE5F 2GA1A 4JQFA 2Z69A 2IJLA 1I6XA 4E70A 4HDVA 3H9AA 1KGSA 3KP2A 2HS5A 1Z9CA 5EFUA 2NS0A 1RI7A 4XEZA 3M9AA 4TV7A 5CU1A 2E1NA 2M30A 2QVOA 3V8JA 1H9GA 1Y3TA 3LOIA 1IN7A 3FZ3A 1F4KA 4FBFA 1WA4A 3QPTA 4S04A 6PAXA 1CAXA 2M8EA 1KU7A 4Y17A 2KIUA 4WZCA 2DI3A 5FQ0A 1ON1A 3NJZA 3GBFA 2W84A 4ENMA 4HX8A 4HV6A 3WW2A 3RTRA 4M73A 5E8IA 3IC7A 3LWFA 4Y15A 1IUYA 2Z33A 3RYKA 2OZJA 2GC2A 3BALA 3WTUC 4Q0VA 3DFGA 1SFEA 1D8KA 1WWXA 1SFNA 4UBGA 3PFIA 1QY4A 4L5IA 3RKWA 2UYAA 3PVBB 1Z1DA 2WFPA 4MH0E 2RQPA 1J2XA 1FNNA 3K1MA 4IRIA 5KHJA 2Y48A 4MTDA 2GH2A 4LB5A 3BPVA 4ENKA 5HLIA 3U2RA 2PMUA 5FQ0B 4WXDA 1J58A 3H8UA 3UKNA 5ILVA 1X8MA 4A0YA 4QGMA 3S7EA 2CG4A 2ESNA 1J3PA 1EP0A 4L0ZB 2EA7A 4AIKA 2K86A 1QXJA 2O1QA 3GLXA 3WGHA 3IWZA 3ZQ7A 4HA8A 4KN7X 1OYIA 4FX4A 1Y0UA 2HEOA 5KHKA 2PAKA 3JSPA 4R8HA 3TO9A 5JR7B 2PBIA 2HQNA 4M72A 2W57A 1YW8A 3HYIA 2FNPA 1KYWA 1FI2A 2NYXA 1YQAA 3P9IA 2W25A 2KIMA 3LQQA 1P4WA 5E1WA 2PI0A 2E7WA 4KIGA 4E2SA 4OLLA 4XF3A 5HDNA 1TW2A 2GZWA 3GZ5A 1CAVB 1AWCA 3E6BA 2V1UA 4RB2C 4HQEA 4WVZA 3F8FA 4ZU4A 2EV0A 1MJ9A 5HS7A 4KUMA 1STZA 4WXCA 1B6AA 3ZMDA 3KFWX 4BAYA 3Q9VA 2CAUA 4AQ6A 3KCCA 2IA2A 1CAXB 1TNSA 4MGIE 1IXSB 5F6FA 4OMZA 2OQGA 5E1ZB 4Z82A 2HTSA 1QQIA 3MYXA 5D5UB 2E9QA 1EYBA 2K9ZA 3GX4X 3T5XA 3VODA 1ZZBA 1L3LA 1SD7A 2IT0A 2DFIA 2ELHA 4GXOA 5CVJA 4IEQA 3SQNA 2FE3A 2PLYA 1ZG1A 5BY5A 4E2GA 2OBPA 3I59A 4G7ZF 3LA7A 1XSXA 1U78A 4G6DA 5DEQA 5ICEA 1U5TA 4HF1A 1YWKA 2XAFA 2R7FA 2MA3A 3QRFF 3G73A 1FXZA 3WTSC 3ZN0A 2A5YB 3OD0A 4YFNF 2IA1A 5H6RA 2UY8A 1ZHFA 2PQQA 3BPZA 3CUQA 1NE6A 1YIOA 3OF1A 3OCPA 4A6EA 1QPMA 5HDGA 3WODF 2O03A 4CICA 4Z07A 1R5HA 2VC1A 2Q0OA 1LB2A 4J1XA 2DO7A 5J48A 5BPDA 2G7UA 1S6LA 3ST7A 2EFPA 4KIFA 3WTZA 2FQ3A 3SXYA 1IPJA 4K8FA 2D40A 4XFBA 3J80Z 4AVBA 3TOBA 4ZU5A 4LUMA 1CF7B 4A0ZA 1IN4A 3WW1A 4IEUA 3QP5A 2Q2EA 1ZZ8A 3C1DA 4O6JA 4QGLA 1ZH5A 5AVPA 2OA4A 4UBHA 5ICFA 2ZNYA 5K5RA 4X6RB 5I0TA 5FO5A 2EFQA 3TDUC 4QGNA 2EB7A 1FP1D 3ES1A 4PIXA 2OYZA 3KP7A 5I0SA 3MDPA 3KP5A 4KA4A 1U5TB 3M7GA 2XL9A 4RAZA 3V4GA 2EK5A 5BMZA 3PLQA 4LLOA 1IZ1A 4EVIA 2IP2A 1XGOA 2DTRA 2RKHA 4L2NA 2VOOA 3E6MA 3GFMA 3FJSA 5FD5A 5BV6A 2Y0MA 2BYVE 3DPTA 4A6DA 5JSRA 4ENJA 4L5JA 2CW0F 3WTTC 1HSTA 3VEPA 2DW4A 4HOBA 1T38A 4D7SA 3T8TA 1BI1A 2UY9A 3UKVA 2VN2A 3FXQA 3GWZA 1XSDA 3MCZA 4HF2A 1FBSA 2ET1A 3J7AO 1KQ8A 3RNSA 1BI3A 2LDUA 4PGGA 3JAMK 3BJ6A 3EDPA 4IEPA 1J59A 1USSA 1YS7A 5TJJA 4PIZA 2CAVA 3B73A 1FP2A 2H09A 3LA3A 1P92A 5L3EA 1G3WA 3LZZA 3C7JA 3MFKA 1P4XA 3ABTA 4ESBA 2L02A 3NEUA 1FX7A 1I1GA 4G6QA 4Q48A 2VODA 2VBYA 1EH8A 4IEXA 4IRGA 3HIFA 5F64A 2QDRA 1SFXA 1XMAA 4HF0A 2MH9A 2VE8A 2XAQA 4CGZA 1CX4A 2DLLA 4H7LA 4I7HA 4UVCA 5LHGA 4R52A 4XSZF 2L4MA 3DN7A 1R00A 2ISZA 1SEFA 1U6GA 4PCQA 4L0YB 5CYVA 3R6SA 3S2WA 2LKPA 2HTJA 1YYVA 4IEYA 1CAWA 4AVPA 1ZX5A 4LUKA 2RV8A 3WTYC 3HRMA 1ZG5A 1ZZ7A 2XUBA 3SZPA 2P5LC 1EY2A 3EJKA 4QWQA 2QQAA 2HZTA 1JGSA 1W5SA 3I58A 3ETQA 2GAUA 1KA8A 4EJOA 2VPVA 3HOTA 1UD1A 4K2EA 2H6BA 2XRNA 4PJYA 5BXXA 1OYWA 1S7OA 2VBZA 2OZ6A 1J9IA 1PUEE 4P5OA 1ZZ9A 4AD9A 4UVBA 4IETA 3CEWA 1TQMA 1O3QA 3NL1A 1RUNA 4PZJA 3N4MA 3BJOA 1ODDA 3WGGA 2RGVA 3HRSA 2A07F 2QVSB 5KVRA 3HUGA 1IRGA 5D6FA 2O8XA 4OU0A 1ZZ6A 1VTNC 4O9EA 3BB6A 3BPXA 1EPZA 2QYOA 3GUDA 3L7WA 3OGJA 2BNMA 4Q0UA 2N7GA 4NQWA 2K4JA 3BU7A 1LVAA 1O3TA 2NRAC 1IAWA 5T3NA 4RD7A 4HLYA 2FQPA 4ORFA 1FSEA 2FF4A 3CUQC 4D7TA 1O4TA 2O0YA 4JK1X 4OINF 3FHIB 5LEJA 1W4MA 5J6XA 4U7DA 2H0VA 3L2HA 3TOAA 2GWRA 1CAUA 1R1UA 5AONA 3CF6E 4LK1F 4YFKF 1H1MA 5K8SA 4GYIA 3G3ZA 1SD5A 1YO5C 4YNIA 1WGPA 4FT8A 4HVOA 2XASA 2H6CA 3F8BA 1TQPA 4XFGA 1HSJA 3H3ZA 2D93A 4Y13A 1QWRA 3E5XA 2ETEA 3I4PA 2R3SA 3HHHA 5E17F 1R7JA 4KIBA 2DPDA 2K27A 2IXKA 4KWJA 3USSA 3KGLA 1V70A 1ZRDA 4FAHA 2EV6A 1GQHA 2HYFA 1T2KA 4ZH4F 2MLKA 3U10A 4U7BA 1W7PD 2IXLA 3BZ6A 5I91A 1XSVA 4MTEA 2HQRA 4IEVA 5BUVA 1LQ1A 1KQ9A 3LFKA 1J3QA 4LJZF 3HTUA 1FY7A 3RJPA 4HX7A 5DD4A 4PIYA 1BJAA 4BXUA 2A6EF 3FE5A 5CVRA 4AIJA 1FYLA 1DZTA 4OIPF 1BOAA 5DUIA 2P5KA 2X0LA 5D1IA 4GULA 2J5OA 2B9UA 2IA0A 2ACJA 4EM1A 2QQBA 4WWCA 4CZZA 4MUVA 3F8MA 3FM5A 3NSTA 2HKXA 3FXRA 3G7DA 2MLGA 3SMHA 1Z91A 3ZMSA 4IPAA 2YX4A 2M1BA 2PA7A 2QNKA 5FCCA 2DK8A 3ZN1A 1HBXG 4HX4A 1I27A 1MJBA 4PGHA 2CQKA 2D45A 4KFCA 1ZYRF 4N0BA 3CUQB 2K4BA 4BH9A 4R79A 1R23A 3IDBB 4YSFA 2G7HA 4LG0B 3K1NA 3L09A 1NXMA 1UIJA 1JE8A 2RC4A 1LDKB 1WKMA 3I64A 3I53A 4ZYHA 5D4RA 1WRJA 1K6OA 3I0TA 3VHRA 3TO7A 1Z6RA 4KMFA 3F21A 1BM9A 3HHGA 2FSWA 3S7IA 1J3RA 4LD5A 5LHHA 1CF7A 4I0BA 4RGRA 2LSOA 4EJTA 1UW8A 3U11A 2VXZA 4ONUA 2BNNA 5LBQA 1OMIA 3L00A 4GGGA 1Z7UA 2OZUA 4G7OF 5K1YA 3JZVA 2DU9A 5CVVA 3FMQA 2RVCA 4IHSA 4KNYA 3MZHA 2JPBA 2JRTA 4RS8A 2B0LA 3I5UA 4HBLA 1CGPA 3JW4A 2WWYA 3CL1A 4L9NA 4N9IA 5E16A 3O2PE 4LMYA 2Q0AA 1ON2A 3KSCA 2X4HA 2PFWA 1MZBA 1T0FA 5I8SA 3F72A 1LNWA 4HMZA 5C6CA 3B02A 2F2EA 4XSXF 4KN4X 3CTAA 2O8QA 2DK5A 4NB5A 2F5CA 2O61A 1K78B 4MEYF 1FOKA 3T8RA 3TNPB 2MBFA 4G94A 1ULYA 4HLXA 4EJUA 3MEXA 1DP7P 4MGRA 1NHAA 3H1YA 2F5DA 2BV6A 4UXNA 5HVQC 4EV0A 4MGYE 2B5HA 4XBFA 3H92A 4F7ZA 3H1MA 2EA2A 2ETHA 2FMLA 3UKTA 4HDUA 2ZXJA 4BHBA 3LQRA 2A3SA 1KU2A 1HXDA 2GC1A 3ZPLA 3QP6A 2FBHA 3WTXC 3OV8A 3D82A 3TGNA 3ABUA 4XRFA 3J81Z 1K7AA 1REPC 4A5MA 3J80K 1YFUA 2EWNA 1R1TA 1B4AA 1SMTA 3HSFA 4I02A 1G3SA 5FFXA 1OD5A 3NQOA 3SHFA 1V4RA 5BS6A 4CYDA 4OIOF 2CYYA 1GXQA 4EM0B 2HKOA 3WU0A 3VB2A 1GQGA 2Z2SB 4M9XA 4YFXF 1EV7A 4M6YA 5D5WB 1F9NA 1U12A 4IHTA 4BHCA 2MH2A 2COMA 4UVAA 2UXXA 3REOA 5A2QK 3QU3A 1KYZA 4WX9A 1UPIA 4AVCA 4WXHA 1SD4A 1GXPA 2EFNA 3I7DA 1ZZCA 4EROA 2XVCA 3I71A 4ZZLA 1S7AA 2CO5A 5ILUA 4YRDA 4LG0A 3WE2A 2MPFA 2QLZA 3M3IA 5DV5A 2EJRA 4H0EA 3I54A 4I09A 4ESFA 2CWEA 3KP3A 1O3SA 4LEJA 1RIOH 5HLGA 4XLNF 4KDPA 5L3FA 4KYWA 3M8EA 4A12A 3KEOA 1YW7A 3GW2A 1D8JA 3EYYA 1ZLJA 2Q4SA 3ZMZA 1F1ZA 3EETA 5HLHA 4EM2A 4WCGA 4BNCA 3K2ZA 1XGNA 3RYRA 2PHDA 1K78A 4XF1A 3FWEA 2ATFA 2HJIA 3MPBA 1TQ5A 1X8EA 5A2QZ 4EJVA 3H1WA 4Q0QA 2IW5A 3IRRA 2QM3A 2HYGD 5L3GA 2TDXA 5BQTA 2HWVA 2KRFA 2YX7A 5KHHA 4KWKA 2XLGA 1HW5A 3QACA 2MNGA 3SHRA 5D5XB 2KJBA 2JT1A 2NAZA 2D2WA 2F5EA 4NHJA 1P2FA 1J75A 2EAAA 3OOPA 4N9HA 4YIIA 2PG4A 1SMYF 3KLNA 1XD7A 5JSPA 2KJCA 2RNJA 2XKPA 3IL2A 2V1DA 2V9VA 4X6QB 1MKMA 4QX5A 3WE3A 3L2CA 4JV4A 2ESHA 1WQ2A 2ZMEB 3CJXA 4L9VA 4IEZA 5D4SA 4IRHA 1B1BA 1R5GA 2QCSB 4MZUA 2JPCA 1BI0A 1ZN2A 3P9KA 1BBYA 4EWEA 5CVUA 2H94A 1YFYA 3JAMZ 4JBAA 4IERA 2FBKA 1V3FA 3PNAA 3F22A 1RTVA 4Q5SF 3ZMUA 3GZ6A 3HTSB 4EGZA 3DQVC 4P96A 3DP7A 1ZARA 3EHKA 4CHUA 1Y9QA 1T6SA 1YLLA 3ZMTA 5JFRA 5JHUA 2V1XA 5DD8A 5FPXA 5E20A 3LSTA 2GU9A 3C18A 2Z3YA 1XB4A 1H0MA 3DPLC 5FLHA 1TW3A 5EEGA 4JTOA 3R0JA 2MHFA 3BOQA 5DUKA 3NVCA 1CAUB 2QENA 3BY6A 4B09A 5LHIA 5CJ9A 3F23A 1G4DA 3H50A 1O7LA 3M8FA 4UV9A 1XDUA 4G8XA 4HN1A 4UV8A 4LGWA 3CLPA 2GIVA 5FGMA 4P9GA 3EUHA 3CO6C 5ICCA 2DPUA 2VBWA 5D8KB 1DUXC 4GO1A 5ERIA 1ZG3A 1XGMA 4KU7A 5I0RA 2L3DA 2PHLA 5E18F 2PN6A 4IXAA 1YFWA 4EWAA 4ON0A 4OOIA 4IJAA 4MQ9F 3E6DA 3JSOA 2AS5F 3D5LA 4LLNA 2IVMA 5LGNA 2ISYA 4J1WA 3RDIA 3F3XA 1ZAOA 2QUFA 3BJAA 2BBYA 1Z05A 2DT5A 2IC1A 2B8MA 4HVRA 1A04A 5BPXA 4G9YA 2HDCA 2K0GA 2XV4S 4LLLA 5FFZA 1C0WA 2YR2A 1L0OC 3EBRA 3NW4A 2WV0A 3CLOA 2DAOA 4ZZDA 4ENNA 4RGUA 3D0SA 2STTA 4A5NA 5LRSA 3AAFA 4I0AA 2P8TA 1UHMA 1E2XA 2KKOA 4XF0A 3JTHA 1MD0A 3NKTA 1DPRA 1SFUA 5D8LB 3MAJA 3OTFA 2VC0A 3IKTA 3GEZA 1EH6A 4HVQA 3GO5A 5IT9Z 2V79A 2GA2A 3HT2A 3QPHA 4HN0A 3GFIA 2EA4A 3E5UA 4HAMA 3H3UA 2FOKA 4B29A 4LA3A 3M1EA 3H7JA 2CSOA 1XRUA 5LEKA 3HQXA 4IEWA 3ZMVA 4QMAA 3TDZC 1UIKA 2EV5A 2BEOA 2OQRA 5HDKA 2Q8KA 1EH7A 4KMUX 4RAYA 1FYKA 2RN7A 2Z5UA 3H7YA 5DYMA 4WF2A 5FLXZ 1FPQA 5L3DA 1XN7A 4HSJA 2K7LA 3BDDA 1LJ9A 5J3UA 4PDKA 3K0LA 4I01A 1UCXA 2PQ8A 1DGWA 1DGRA 3WTVC 2ADUA 4ZYGA 3D0JA 1I5ZA 4LB6B 5CLSA 3KLOA 3SXWA 4CXFA 1LR5A 3ELNA 1T39A 2PEXA 2A6HF 2Z99A 4DINB 4NVPA 2M5WA 4ETSA 2KIFA 2E1CA 2Y0OA 5JI6A 3CJNA 3T1BA 4LTAA 5CADA 3K9TA 1QNTA 3PQJA 1B9NA 3F8NA 1VP6A 4KWLA 1F5TA 4CO8A 4HLTA 4LK0F 1YUDA 5J8CA 4KL1A 5ICGA 3LAGA 3P9CA 2IXHA 4WBBA 3TQNA 4ZYDA 4LLGF 3CDHA 3EQEA 2V6CA 4P55A 3V7SA 4XFHA 2XL7A 1LDJA 5TRDA 1W7PA 3BCWA 4HZFA 1BC7C 3QAHA 4IVNA 1RGSA 3MQ0A 5HS9A 3PQKA 4HW0A 3KGZA 1HKSA 4Z2YA 2PYTA 2D5FA 1TNTA 4BIFA 1LRHA 3O6BB 2M45A 4IESA 1QZZA 2QWWA 1FWZA 3K1PA 1MGTA 4M9ZA 2A68F 2FNAA 1ZVFA 3T0YA 4U88A 2JTVA 1TTYA 5LGTA 2M87A 1ZGAA 5AIPA 3KP6A 3Q5FA 4XF9A 2IXJA 3WGIA 3ML6A 3KEQA 3HSRA 3RIRA 1XCBA 4FX0A 4OIRF 1IN5A 1W7PB 1X3UA 3DF8A 3GFJA 1NZCA 1U8RA 4L18B 4IF4A 4AWXB 1JHHA 3SCGA 3WU1B 1QZYA 3KETA 1B59A 4XFFA 2DCTA 4MQVA 4A2UA 1RC6A 1PP7U 4WK8F 1T98A 1YW9A 2UYBA 4O5VA 1O5UA 3CO2A 4MV2A 2Z9OA 4UXAA 3W6JB 1FZPB 1D5VA 3GXOA 2K02A 1SAXA 2XROA 2LNBA 2OU2A 3FMSA 1X82A 2XGXA 4I2OA 2FMYA 2PAMA 5ILSA 2XKOA 1FBUA 3WW4A 4Q0PA 1SQ4A 2VE9A 3IDCB 1LDDA 1Q43A 1IRFA 2QBYB 4FAGA 3CUOA 4ASNA
chains in the Genus database with same CATH superfamily
1VR3A 2QQJA 2ZPXA 4HYEA 3MV11 1DGRM 3KHBA 3RKXA 5FOJB 1DPUA 2DA6A 5EZWA 2Y31A 5JOZA 5HOOA 4A93J 3MFCA 4AVTA 1IPSA 2Y2ZA 2WTEA 3S16J 3O1OA 3BG7A 2D97A 5G04L 5A3TA 1BBT2 1TWAJ 2LM3A 2YC4A 3VOEA 3FL7A 1ONVA 3K4ZA 2ZJQF 4P9UA 3SEPA 5F2SA 1W0NA 2O14A 2AR6A 4TXWA 1AR93 3BR0A 1EKEA 2R7RA 1IKPA 2W9XA 2P5VA 4QQ2A 1RUD1 2XGEA 1LHWA 1CJDA 2ZTNA 1JW6A 1T95A 3KZIC 2BY1A 3LGRA 3M1HA 1YTYA 2QEXI 2Y30A 3H0DA 2DMTA 1I3QJ 1NA1A 3OGRA 3ME2A 4BQOA 2C4XA 5FLXK 3IBMA 3RPQA 3ORJA 1O57A 4F55A 5H6QA 2P6SA 1MPXA 5L3BA 2BV4A 3K4CA 1HRV2 5FZ3A 1XPWA 4UUSA 4C3HJ 1IDZA 3ZFEB 4ITCA 1DCSA 5KC6A 3AXEA 3U1DA 1R1A3 4LBNA 3AKSA 3I59B 1ND3A 2WSVA 1Y43B 1IJWC 2QDNA 2HR3A 2LOOA 4AFBA 5KHGA 3ZP5A 2W52A 2KL4A 4K3UA 1LECA 5DCMA 3WP6A 3PIJA 1S3JA 2Y75A 2CQXA 2RM23 4L9TA 4MADA 1W03A 4C3IJ 4XORA 1FYMA 2X6YA 1G3YA 3CNAA 3AFHA 2VZQA 3EB7A 2LVSA 4DNCA 2A05A 2WAFA 4U0VA 5FO9B 1BN5A 2WY7Q 2HXIA 2X85A 1DQ0A 2H27A 1UZVA 1XMXA 3MWMA 4D8MA 4AQ2A 3K6GA 2C6YA 3JBG1 1JZ7A 4NNJA 3M70A 4ZU7A 2DFBA 1CAVA 3IWFA 4UY8I 1W6MB 2X9DA 3DGTA 4O3MA 5I93A 4GWMA 2RHPA 4AL9A 2GC3A 3ELKA 4CDGA 4EQQA 3JRGA 1AJOA 1TMF3 2VL4A 1RIRA 4UFLA 4NAMA 3BOPA 1M1EB 5CVIA 2QZ8A 4Q0SA 4UUVA 3WQ7A 3MUY1 1WCMJ 4IL6C 5BYNA 4BIOA 3GLLA 4CPBA 5KAIC 1DQ6A 4FVVA 1HW1A 5F5IA 5T5JA 5IP6A 2EF6A 4DRRA 1UKRA 1P9QC 4AXOA 1OA3A 4QU1A 1H30A 3RZLA 1FMWA 1P7JA 1NX9A 4K40A 4Q4X2 4XFCA 4I99C 2LBFA 2B39A 4W4ZA 3O14A 4EWDA 4GWIA 3NAUA 5FLIA 3U0ZA 1YJKA 3TWIA 3HRUA 4FASD 1O8SA 1PO22 1VB2A 3BZCA 2BQPA 3K4AA 3VBFB 3KZZA 2W1UA 2UWMA 2PHWA 1EAH1 3PURA 5FP7A 4JHTA 5F37A 2WQ4A 1W1WE 4Q47A 2FHRA 3J7AY 1UY1A 3FXLA 2GSYA 2E60A 3I55I 1QBJA 1JTXA 4QPIA 4XBQA 2R7DA 1SDDB 3BCAA 2OD5A 1RZ4A 1DYKA 1WLDA 2NNNA 1DG6A 1IW7F 2PQSA 2QQVA 2FQ4A 4L9JA 2ZABA 5LD2C 1DGLA 1QMJA 4WM8C 2CHHA 4FQZA 3OR2C 2R072 4M9SA 1RNLA 3FX3A 2I45A 4I98B 3KP4A 4PUSA 4B8XA 1L3JA 4GJYA 2DA1A 5AIQA 3I3MA 2IS2A 1SCSA 4AVAA 1C4RA 4E4HA 2AACA 3GYDA 2ZCWA 2HH9A 2XQRA 1O3RA 2OA2A 2EIMH 1AYN1 3IRQA 1RXFA 5FROA 1O5LA 5BPIA 3HRTA 1NCRA 1EV13 4PFOA 5DMYA 1ZREA 1UCRA 5FRAA 4HQMA 3PJRA 2AXLA 5FXVA 1RHI3 3ECHA 3WXPA 2MD5A 3JRHA 4IE5A 1NZIA 4XRSA 1H1IA 2QBYA 3HOSA 1OYYA 1XNDA 3JREA 1FPN2 1JZ8A 4ZZ5A 3W20A 1BC8C 4JKKA 4G7HF 5HXMA 1ULGA 1R36A 1Z3XA 1BXHA 1RINA 4Y1YA 5FZHA 4V1PA 1IC8A 2M7BA 3ZQLA 1DYPA 3KMHA 1QJZA 4N43B 4XUQA 3LMMA 2X6OA 4Y5TA 3BP8A 5CA6A 1V6IA 5HCFA 1PZ8A 5JXJA 3RGBA 4RGSA 1XCVA 3FBYA 2LFBA 3F6OA 1Q8SA 1TQIA 3V8LA 1G9FA 1LOFC 4ESJA 4DGWB 4MO7A 1JYXA 1PJRA 3CLQA 5HV0A 1OPCA 3GVAA 1RUOA 1AZDA 1VNDA 4W1UA 3VBHB 2ZJPF 1D3YA 3FHZA 4GD4A 4V2FA 1IXCA 1PP8F 5FYIA 4B48A 3AJYA 3DL3A 1BA5A 2AXTC 4D3WA 3DKQA 2FRHA 3DLAA 4BBRJ 5FPZA 3BTZA 3I2HA 5FB2A 3KPHA 5KHIA 1X7NA 5KBFA 3LL7A 4L11A 3WDTA 4Q27A 1GU3A 2QBXA 1XC6A 5LBEA 3KZYA 2A6TA 3MIHA 3QOEA 2P3IA 3NRVA 2TNFA 4CA0A 1C8M3 4I30A 1JMUB 4QHOA 4MHRA 2FEZA 4CEWB 1I1SA 4YPJA 2BE5F 3QPLA 4IV3A 2GA1A 4JQFA 5FMBA 3RCOA 2CGOA 4E70A 2ME6A 2IS4A 4NC7A 3H9AA 2RQQA 3CJIA 2L7FP 5EFUA 3WG1A 3VZOA 2AC1A 4XEZA 4C2TA 3M9AA 1W6NB 3FUOA 4HPQA 2M30A 1AX1A 1IZ3A 1IN7A 1NY71 4DO0A 1WA4A 6PAXA 3OYIA 4CDUA 2M8EA 2KIUA 4AAPA 4WZCA 4XN3A 3J7ZI 1OHFA 4HX8A 5FFOC 4XE9A 2P34A 3WW2A 5E8IA 2VPRA 5ABJB 4Q4Y3 4YZ1A 3CHXA 1UU4A 1JTZX 4LXLA 2PHFA 4OHXA 2WS92 3PSIA 1D4VB 1ULOA 1HLVA 3BALA 5JPMB 5ACA3 1D8KA 2W08A 2JXAA 2DVDA 4URTA 3E0JB 4L5IA 1MZ5A 1GNZA 2UYAA 2VCBA 4XOTA 3UGFA 3T1LA 2CNAA 1JU4A 4KGQA 2HEYF 2H1KA 4G9SB 4AFCA 3K1MA 2XPJA 1H6YA 2Y48A 4DEVA 3BPVA 3LFUA 1W36D 3MW4A 5FQ0B 3E1SA 3UKNA 1MS5A 5I0DA 1WGXA 1M06G 4A0YA 2HWD3 1BW5A 1POV0 1DHKB 1JZ5A 4NOTA 3M1CA 2PHXA 3HKZA 4FPGA 2XVGA 5FJKA 3G1LA 5GPCA 1R082 5FMCA 4EQVA 3ZQ7A 4XXAA 4BQWA 4XNFA 1TEIA 2HEOA 3HQUA 1LHVA 3JSPA 1A8MA 3FN9A 3SISA 4QX2A 5F6KA 5JR7B 2FDJA 1YW8A 1HJFA 2WWUA 3GDBA 2D44A 5CG9A 2ILMA 4FFGA 2JG9C 3ZKUA 2KIMA 1GICA 1ND3B 5E1WA 1CIYA 2VJJA 4XDOA 5EJ3A 5HDNA 3NQHA 1IQDC 2ZEYA 3E6BA 3SDBA 3FFZA 1JUMA 1W9WA 3TN93 3GZTB 1MJ9A 1OJLA 2NS8A 3CKHA 3X2QH 4DY3A 2LC2A 2G19A 1JS9A 3KFWX 5GTIC 3Q9VA 1A8DA 1WCSA 1EPWA 3GJBA 5DABA 2IA2A 4RGAA 2BVVA 3VD7A 3PHMA 2QZ3A 3J7LA 4C2UA 3S32A 1NCQC 4MGIE 4COUA 2WQ8A 4QKNA 5F6FA 2OQGA 3FXMA 4AUXA 2GIZA 3PFYA 5E1ZB 2HTSA 3MYXA 2K9ZA 2E9QA 1L3LA 2DVGA 2VZ3A 2IT0A 3PNVA 5TSWA 2PX9A 3MW2A 2QQUA 1QJX2 3JD71 1ZG1A 2DXIA 3ZVXA 5BY5A 4XURA 2OBPA 2JWTA 3JQWA 5JZGC 1R1A2 1W8FA 2CV2A 4E8CA 1U5TA 4HF1A 1QU0A 3ZN0A 4BK4A 3GJAA 2A5YB 2QSGX 3I2DA 3CP2A 5H6RA 2KPMA 3M3YJ 3BPZA 1KITA 1YIOA 3QPSA 1D2SA 3OF1A 1VBB2 4JRLA 3B93A 3G6EI 4Z07A 3QCWA 1O4XA 1LB2A 1HA8A 4J1XA 2F5VA 5J48A 5BPDA 4N7UA 2G7UA 1UYZA 2EFPA 3WTZA 2DA3A 4K8FA 2YMZA 2D40A 3J80Z 3QD6A 3ZN6A 1WLWA 3OBRA 3FHQA 3KVBA 2DYRH 3WW1A 4IEUA 3QP5A 4KISA 2DURA 1RUI1 2ZACA 4QGLA 4BCUA 3MKLA 3PTRB 1RRJA 3BTAA 2R16A 2OA4A 2GOXB 5A7PA 1G86A 5FO5A 1YRNB 2XGDA 2JB8A 4PIXA 3DPRB 3PU3A 5AFBA 3KP5A 4CEYA 5FPUA 2XL9A 1W9YA 3V4GA 3LIHA 5BMZA 5KXEA 4LE4A 1IZ1A 5HCAA 3WG2A 2M8GX 4FPCA 2RKHA 1RMU1 1QJX1 5F3CA 3GFMA 2MEV3 4CZCA 5JSRA 3K4BA 3NARA 4NRMA 2WDBA 1UY2A 1HSTA 1QJFA 3PVNA 4HOBA 1T38A 3A23A 5C9AB 3T8TA 4IOCF 1BI1A 2AGSA 1OKQA 2VN2A 4F93B 3RKQA 3GWZA 1XSDA 1JUSA 3AFKA 2LYCA 4X0GA 4Y4YA 5FKMA 2FD8A 5BNQA 3NNMA 1KQ8A 2LDUA 2W1SA 3BJ6A 3VYUB 2GM4A 1YS7A 2ZJRF 1DLLA 4XKBA 3ZR8X 2NVXJ 1C1FA 4CDQB 5F5AA 1V5FA 3EUAA 1QDOA 2EXIA 3M3OA 4KGGA 3ABTA 4ESBA 1U8BA 1U9NA 3HN3A 3CCVI 1ULCA 1IG3A 2X1DA 3IH3A 1WW5A 3IM0A 1W2UA 2D6MA 3OSGA 1C8NA 4MXWB 2DDAA 5F64A 2JKBA 3VBUC 1SFXA 5CIRA 2R5YA 3ACHA 2ZXIA 3LSGA 3J8F1 4CGZA 4OMDA 1D1AA 3FBNB 4I7HA 4UVCA 4XSZF 2L4MA 2K2SA 4IHVA 3B5LB 4YGDA 2ISZA 3AVRA 4E4ZA 3G2BA 4UT5A 3S2WA 2LKPA 2HWB3 4AVPA 3TRSB 4Y24A 5JMCA 1J09A 2WZ8A 4Q4W1 2VJ5A 2QQAA 1W5SA 3I58A 1W2TA 5IAVA 2FZ2A 2HEVF 3BC8A 2BY3A 3K2AA 4Y52J 1UYXA 1QF3A 4LJHA 1V6NA 4CEYB 3GTGJ 3WNKA 1J9IA 2DA7A 1PHMA 4DQAA 5E79C 4LOCA 1XS9A 2F4OB 3I3LA 4GB31 3NL1A 4PZJA 3N7MA 5ABJC 4ANJA 2QQNA 1V6LA 5B4NA 1ODDA 4LE3A 3TEZA 3HOUJ 4AU7A 3OGSA 4OU0A 4RDUA 1IUFA 4LOSA 3GUDA 3OGJA 1AR91 3HZJA 4OMCA 3PL8A 1QHHD 4RL7A 3N3HA 4HRIA 1O3TA 4COWA 5C5UA 2GNMA 1WUVA 4ORFA 1RUE2 2FF4A 1XBFA 3CUQC 3JUUA 4D7TA 1IGOA 4QX3A 2O0YA 4JK1X 4DNYA 1GV9A 1AR63 3WF3A 4R9CA 2R0FA 3TOAA 1RMU3 1DQ1A 2DCZA 3VL9A 5FZBA 4GYIA 5FY1A 1H2MA 4QXCA 3LSMA 5D8AC 4XMYA 5IATA 5A32B 1W2NA 4P14A 1UJ8A 2HQAA 1YO5C 1LUJB 4V2VA 1WGPA 4FT8A 4V2WA 3F8BA 1TQPA 1ACIA 1HSJA 3H3ZA 1JUIA 2D93A 2EZLA 3ZO0B 1TNRA 3AMNA 1PK6B 2R0HA 4FFIA 4XUTA 4JDNA 5FZCA 4KWJA 3POGA 4XOGA 1ZRDA 4HSTA 1LE8B 2HYFA 1QEXA 5FP8A 3U10A 2IXLA 2E32A 3BG6A 5JPNB 5I91A 1WI3A 4LHNA 1KQ9A 1IRXA 1Z78A 3HTUA 4C91A 3HGGA 4PIYA 3VBOC 4BXUA 2DA5A 4UOJA 3OY9A 2ZAHA 2KIQA 2VMDA 2CW8A 2XC7A 3ACGA 5DXDA 4JYKA 1DZTA 5C4WC 4JDOA 4G12A 3KF3A 5JOXA 4MFEA 2DWRA 4LIVA 3VBHA 2B9UA 4CU6A 4EN8B 4EM1A 5J37A 5C33A 1COV1 3FM5A 2L9VA 1VQ7I 3ZMSA 2YX4A 1S2KA 2PA7A 2P4EA 4HX4A 1HBXG 2X53S 3LDRA 1BYHA 2D45A 4N0BA 5FPVA 2K4BA 4R79A 4YSFA 3IMMA 4EZHA 2CDOA 5E6HA 3VBSA 3PVOA 3W59A 4OZXA 1JE8A 1HQWA 1Q8QA 1X3ZB 1K6OA 3B9CA 3CIHA 1Z6RA 5IAXA 1NQDA 3T4VA 1YRZA 5FBZA 1BM9A 2FSWA 2K9LA 3FXKA 2HWB1 2WBMA 2Z5WA 2FDGA 2YS9A 4RGRA 3UGHA 1D1BA 1HJGA 3U11A 3DWLE 2VXZA 3C2BA 2BNNA 5JI9A 1Z7UA 4G7OF 1VMJA 3JZVA 3RZGA 2DU9A 2WZR2 3WV6A 2EIJH 1SC7A 1F4HA 2B0LA 1YC61 5M5XJ 4C1WA 3QYBA 2DFEA 2V9KA 1UY3A 2AEZA 3AC0A 4N9IA 1Z7LA 2W39A 3O2PE 1MNEA 2JRMA 3KSCA 2X4HA 3UJQA 2WBKA 4XMAA 1OH4A 4P9YA 4JGZA 4HMZA 2F2EA 1RKTA 2CL2A 3KV5A 2LY2A 5EYYA 3RZOJ 3GTMJ 5EJ1B 2ZSHB 2HDWA 2O61A 3S5QA 3WCRA 3T8RA 1MQTB 1DP3A 2EZIA 3AZXA 4BQ2A 4MGRA 1NHAA 2F5DA 4RLFA 3UNPA 3S3NA 3ZQGA 3T08A 5L7OC 2ETHA 4ISQA 2FOWA 3UKTA 4E7JA 2H0BA 2R6QA 2D43A 3WDWA 2V72A 2A3SA 2ZGUA 2GC1A 3ZPLA 4EN7B 2FBHA 3M3EA 1VRH2 3NJYA 1K7AA 3TL4X 2P81A 2Y9ZA 4D7YA 2EWNA 3JQXA 5FBJA 1R1TA 1A6QA 1VBC2 4DYQA 5GALA 5EHDA 3UNGC 5FFXA 2IS6A 2WNUC 3J7HA 2XJTA 5BS6A 3FK6A 2YB7A 2CYYA 1GXQA 3VD5A 4LKSA 1I3HA 2HKOA 4QPQA 4AYBA 3VB2A 1GQGA 2XBO2 5C4JJ 4M01A 4Q2FA 3S2DJ 3HNMA 5GP9A 2KISA 3D8CA 5D5WB 1CD3G 4XPVA 2Y6GA 4RR3B 1U12A 1W04A 2ELJA 1F31A 5BNPA 4PF5A 2MH2A 2COMA 3CF5F 4CCJA 1PO12 5LB6A 4UVAA 2VZPA 4XLCA 1PX4A 4AVCA 3EUHC 1GXPA 4IHXA 4XIDA 2ARCA 5FJHA 1X33A 2X10A 1CONA 1QJU3 1Y39A 1VMFA 4YRDA 2MPFA 3M3IA 1VQLI 4I09A 1PNFA 2HZDA 3OBZA 1AL22 1BR2A 3C2HA 3QQAA 3A0BC 5L7OA 4XLNF 4KDPA 5HCBA 4A12A 2BOIA 4FPKA 1YW7A 1AF9A 4JGZB 4C3JJ 1NH3A 1OUSA 2NLRA 2JE7A 4BEHA 2WV1A 1UKGA 2PHDA 3G71I 2YC0A 4Q8LA 4XTMA 5FXXA 3FWEA 4P00B 3MPBA 4C9YA 5A2QZ 2RS13 1R49A 2WLPA 5A32A 4DB5A 5L3GA 1X1BA 1RUE1 2KRFA 1RJ7A 2XLGA 5DUUA 2MNGA 3SHRA 4M0HA 1X1CA 2D2WA 2F5EA 1D0GA 4A3MJ 4N9HA 3Q8EA 5D8AB 2PG4A 4BQ3A 1XD7A 4NPLA 2L9RA 3M8JA 5BNPC 4QX5A 4KITB 2BVBA 4JV4A 2ESHA 1LENA 4IRHA 5FKLA 4CDXB 2ZHKA 1C5IA 4II2A 4A3GJ 2VASA 3MKWB 1W99A 4IERA 3PNAA 1RUE3 5EG0B 3DU6A 3NV2A 5FZ9A 1RTVA 4Q5SF 3ZMUA 2ZX2A 4P96A 1AR71 3BVCA 1ZARA 3UV9A 4XLEA 3JRIA 5JFRA 1YLLA 2YHJA 2ZMEC 3OL3A 5FPXA 4C90A 4ITVA 3C18A 4XIKA 5DAQA 2R7OA 4XHBA 1RUD3 3DKXA 1NOVA 4JTOA 3W5NA 1H88C 4B1MA 2CRGA 4YELA 5DUKA 3AL0B 4NAOA 1UY0A 2QENA 4NWVA 3F23A 1G4DA 4P08A 3UT0A 5ACA1 3HBLA 2XRLA 5FKCA 4LGWA 2GIVA 1E3OC 2BY0A 1MH4A 3TBDA 3CCMI 3DEMA 4IV1B 4A3EJ 1DUXC 3AZWA 1MZEA 5FZ7A 5JXIA 4GO1A 3V0BA 3CJRB 4AFDA 2KFDA 2MW8A 4EN9B 2VZTA 3A2KA 4IXAA 4NRQA 1YFWA 4QPIC 3E6DA 3ZFFC 3VHOA 1H9WA 1MBEA 1LGNA 3VBFC 5K7ZA 1EV11 2EZKA 3RDIA 3PMEA 3MLJA 1VMHA 4YEJA 1CR7A 2BBYA 1Z05A 4HVRA 3R0RA 1A04A 4WVMA 2HDCA 2CWSA 3DCQA 1GZCA 3BU0A 4LLLA 5JXGA 2L9SA 1LOCA 5FFZA 3LNQA 1L0OC 1SVOA 3RI8A 4M6VA 3OYKA 5DDJ2 4ENNA 3D5RC 3D0SA 2ZGOA 5A3UA 1E0EA 5E3OA 1SMVA 4A5NA 3H9QA 4JZRA 1ND3C 2VTXA 2KKOA 3JTHA 1HOMA 2JA7J 3RZHA 5D8LB 3S1RJ 5CFDC 1QJU1 2VC0A 1DQ4A 3RZJA 1XYOA 2FX0A 1WJEA 3RMXA 1BEV3 4HVQA 4JX5A 2CDPA 2V79A 2GA2A 3RVHA 2HEWF 5A6QA 1PIV3 1ALYA 1MH3A 3E1F1 2PHUA 2ZAAA 4HAMA 3M1EA 4A44A 3H7JA 3WF2A 1A34A 5LEKA 4B4CA 4IEWA 4QMAA 4IW3A 1WJCA 2EV5A 1ZBE1 1H8VA 2PELA 1EH7A 3HOXJ 4AEDA 2G9FA 3BI3A 4UB8C 3OSDA 1A6CA 2YC2A 3H7YA 5JLWA 5FLXZ 2R7WA 1FPQA 2UUZA 5L3DA 3S1MJ 4HSJA 4OAYA 2K7LA 4KMQA 3H1CA 4CH7A 2PQ8A 1DGWA 3QLQA 2ADUA 1E3HA 5CLSA 3KLOA 3H0OA 1OLMA 4QWNA 3VBSB 2JDMA 3IAS2 2KIFA 2XJPA 4LTAA 5CADA 1D4M1 5E8AA 3F8NA 4LLFA 4OUSA 5EJZB 2A6WA 1F5TA 4CO8A 3ZR5A 3J7MA 2YY1A 1FIPA 1QIQA 1HN1A 5ICGA 1SPPA 4XZPA 3PUSA 3DPUA 3TQNA 2V6CA 4RS5A 3FIWA 3AG2H 4JHZA 3BCWA 5CKQA 3QAHA 1RGSA 3VKLA 3MQ0A 3VBOA 3LSKA 1W28A 4K9SA 3KGZA 2WKKA 2PYTA 1FMVA 4PDWC 3O6BB 3J7YJ 5C8CA 4IESA 3B6CA 4XAEA 4NE9A 2QWWA 2E2JJ 1MGTA 4M9ZA 1XU2A 3WF4A 3ZMOA 1VPHA 1TTYA 3ZSLA 1AUYA 2BPA2 1UZCA 1UZ0A 5GZDA 5D2AA 1VQ8I 1UOFA 4ATEA 1SACA 2WZEA 3VHPA 2YU1A 3KEQA 2YGLA 5LA0A 3MICA 4A3KJ 4PI0A 4RFT0 1W7PB 3VYSB 5GAEJ 1X3UA 2C5DA 2WT0A 2GH8A 1GUUA 2A5WA 1FOWA 2A70A 3ALQA 4B43A 5A7NA 3IH2A 3KETA 1RUD2 1VBA3 2LG4A 1E5HA 3HOVJ 3AP6A 1MSEC 1SFOJ 3MEPA 4HNTA 4CTEA 4A2UA 1RC6A 1T98A 1F15A 4X8PA 2D98A 4QU2A 4BACA 4JOMA 1FZPB 2QE3A 4CUCA 2K02A 1ND2B 1UU5A 1YQCA 4YM1A 3FMSA 4IE4A 3RI9A 3HNBM 2XGXA 3MLKA 5ILSA 5IHRA 1W90A 4BY7J 1FBUA 3OEBA 4Q0PA 3K3NA 1SQ4A 4YWAA 3CUOA 4ASNA 4CYCA 3N9NA 3AKQA 3AB0A 4AI8A 2L5QA 4RFRB 3O1RA 4YIFA 2IUWA 1UFMA 3CCJI 1VLNA 1W3XA 2B7YA 1JOPA 3D3AA 5FRMA 1G8WA 3WUDA 1RJ8A 5I0UA 1SLLA 2O7OA 3R60A 3A21A 5GZCA 3QOPA 1W8NA 2FU4A 3LEIA 3QU6A 3VBRB 4M4RA 5B2GB 4JGZC 3BTLA 5DZFA 5LLQA 1CESA 5FLMJ 2OUMA 5DZGA 3KCYA 2R063 2EZHA 1K12A 1MZFA 4I3PA 1RUH3 1LHNA 1VBD2 3DV8A 5F0FA 4C8DA 2YU9J 3SFZA 2OVUA 4F8AA 2ZMNA 3WP5A 4AIDA 2MEV2 2JIJA 5IYCJ 2QZ2A 3KB5A 2XR4A 3RI4A 3I9V2 2OAZA 4XUOA 4N53B 5C8CB 4U0YA 3E6CC 1ZR2A 2DTYA 1ETYA 2JG9A 4MHUA 2L01A 2OPTA 2IFWA 1JYTA 2GP5A 2GQQA 2FBIA 2ZJ2A 1J0RA 4PHZA 2AHQA 5M3MJ 5A7SA 4ABZA 2VQAA 4QM8A 4YLZA 2VT2A 4AGGA 4BA6A 4MX3A 1SFKA 2UZKA 1ZYBA 5T5LA 3MZ8A 1WJBA 1PZ9A 2UWCA 3GZEA 4BK5A 4E6KG 4D6QA 4YW6A 5J8FA 2VUDA 3VZNA 2C24A 4ASMB 3LSIA 1Q5OA 5FAXA 2JQ7A 1UOJA 2OQ6A 5JAXA 4OZOA 1N1TA 2ZO4A 3Q9OA 3S30A 2CGPA 1UO9A 4MXWA 5I8YA 5GJ6A 2VOWA 2WC2A 2IGOA 4V2GA 1XGSA 3ERED 2HVSA 1POV1 1EA3A 5T5PA 2MC3A 1KU3A 3EQLF 5IVVA 5DG1A 4YIRX 2KXLA 4CVUA 1ASJ1 2AREA 3WU2C 1HQCA 4XFIA 2WNVA 2RS12 4P9LA 1SFYA 2QQOA 4FQGA 2PMZA 2RJKA 1MDMA 1UL9A 3LWCA 2FUG2 4MSVA 2G9GA 4HK9A 2XAJA 4A0XA 2F4PA 4ZTJA 3HB9A 1C8M2 5K0UC 3VFZA 4KT6A 3LSRA 4DUXA 2HWE3 1XE7A 2BJSA 4FOWA 1K83J 2XAGA 1W6OB 1ENXA 3RMYA 1VQNI 4QLCU 5FZLA 5JR3A 1YHFA 1UOBA 1IN6A 4XQFA 4A3DJ 5D6EA 5CNAA 1SD6A 2XLAA 2XIGA 1VBE3 1W9FA 3FM3A 3MIDA 5B1BH 1XTAA 2EVXA 1QKQA 2X09A 3VSLA 1B09A 2QJVA 3HT1A 2LR8A 1WMFA 4JGYB 5FR3A 4NUBA 4Y33A 3JD72 1IN8A 5CG8A 2EXKA 4BOWA 4GIQA 3B9IA 5J1UA 1RITA 1OA4A 2D1HA 3RWKX 2RS32 1NA1C 2IPQX 1WCKA 3T09A 1SLAA 1FTZA 5F3GA 4NBQA 3SCHA 2PLV2 5CPRB 3N97A 3M4OJ 3V8KA 3ZKYA 2LF7A 2VI6A 3JRCA 1BIAA 1CAWB 1BCXA 1BOBA 2CFOA 2E63A 2J1RA 4LBKA 1OISA 1ZTRA 3KZ4C 1LKNA 1N75A 3IKWA 4I6ZA 1R58A 3B94A 1NLSA 1H9TA 3SCFA 2V4JC 4NN0A 3ECQA 3K51A 1XJAA 5GADJ 1ZLKA 2QQ8A 2MSYA 1R083 4I3GA 3GFLA 1PM7A 4MNUA 4FQ4A 5BNOB 1VQMI 1FT9A 2WL1A 4QPGC 4M6XA 2DFFA 5E1RA 3G1OA 3CO7C 3PUQA 1OLQA 4CP9A 4HNVA 2IBDA 1HKTA 1W8HA 3TKYA 1CQTA 2L54A 5JUVA 1HDDC 2VOPA 2RNGA 1P6RA 4MGZE 1E3PA 3WR0A 2W1OA 2CV6A 3LSJA 4CDWB 1KRIA 1HB3A 3IDAA 1GHCA 4JVAA 4DQ2A 1GP6A 2L9NA 4IKFA 2XJSA 3QODA 3AYEA 4RQPA 2IXIA 3R4KA 2D1VA 4NPMA 2WZR1 5GLTA 3TB0A 1V6OA 2F5FA 4MGTA 1H9PA 3IKVA 1ZRRA 1UAAA 1O7FA 1DYOA 5DCMB 4TLFA 2FXAA 2XAHA 1VQ5I 1JU3A 3A02A 1NE4A 5D5VB 3L2QA 3N9LA 4KICA 2O6GE 2P6TA 2B9VA 3L9FA 1Z67A 1SVMA 4A6SA 1ZGJA 3F8CA 1GFF2 3ASIA 4YYOA 2VMGA 1U5TC 3RZDJ 1S9HA 4FOYA 2VECA 2VW2A 4XDPA 5C9AA 2ZKLA 5T5OA 5B3SH 5IT9K 1OKRA 4DMIA 1Q3EA 2GMPA 4CXWA 2BWAA 4AAXA 2VMHA 1N25A 1ORKA 1QGPA 2ZMEA 1GANA 1QQP2 1YFXA 2VT3A 5CAZA 1ZRCA 2VJIA 1H0BA 5GZGA 4OMYA 1RB8G 5F1JA 3FMRA 1I1EA 4HL0A 5AC91 2ECBA 2E31A 4HSLA 3HBKA 3KS7A 2RM22 3S15J 4LKFA 1ENQA 2D6PA 4RA0A 5L3CA 4QB1A 2LF8A 2CS3A 3PU8A 4CDXC 3E5QA 3E3VA 1JGGA 4JKLA 2R93J 1UG0A 1KZHA 2NXNB 1PGW2 3TO6A 3V64A 3V7CA 2J1SA 3O7OA 4IEOA 2CW7A 3U4XA 3GF2A 3HNYM 3F6VA 3WP4A 3T2QA 1ZGWA 3LEGA 2PHTA 4LO4B 2E5NA 3AZVA 3ESWB 4XRSG 1IF1A 3PUFA 4LOTA 1XNBA 3VBFA 2ZFUA 3WT3A 1WI9A 3TW7A 3E97A 4P9FA 2WAOA 3R61A 1HKQA 4Y1XA 1D5YA 5DAPA 2JG9B 1B72A 3JB4C 3MIFA 3DUIA 1H6XA 2V6EA 2EINH 3ES4A 5BNNB 3N7KA 1DDNA 1TNFA 2ZX3A 3BROA 2ZFWA 1N3QA 1OF4A 5CKMA 4YVSB 1FOD3 2A6VA 4CUGA 4LORA 1QOSA 1W0UA 1LFBA 2BY2A 3KP2A 2HS5A 1OD3A 2NS0A 3MIEA 1W05A 4Y5Z0 5CU1A 3H5AA 1H9GA 3LOIA 3FZ3A 4RS5C 4Z92B 1SLBA 1PUFA 3QPTA 1CAXA 2XBO1 1KU7A 2CU5A 2DI3A 3A4UA 5FZEA 3ZQIA 2W84A 4ENMA 4UW4A 3IC7A 4Y15A 1IUYA 2ZX1A 4YFZA 4ISRA 1VBC1 2LUWA 2ARAA 3OUIA 4GAZA 5A33A 4E4DX 3GCMA 1G9CA 3DFGA 2QSHX 1HRV3 3NRUA 3BTIA 3OOUA 3RKWA 1OCOH 1Z1DA 1STMA 2WO3A 2WFPA 4MH0E 3HM5A 2VIXA 2HVQA 2PXJA 2BHZA 4M4PA 4IV3B 3ZPYA 4Q5OA 5F3IA 5KNLA 4ENKA 4BQ5A 4WXDA 3ACIA 1MS0A 3DPRA 4QGMA 2CG4A 2ESNA 4PSWA 1TC3C 2Y34A 4L0ZB 3BODA 2A3YA 1QXJA 3I3DA 4H7MA 3GLXA 3OY8B 5DN2A 3IWZA 2ID3A 4KN7X 4FX4A 2BRTA 2WZR3 3BR1A 2VLAA 4O7XA 5FZ0A 5AC93 2GNBA 1JT0A 2PBIA 1XPXA 1OCRH 4HKLA 3B69A 4S2GA 1W8TA 4BLIA 4Q4V1 5F0CA 3DF0A 4RGGA 3BTYA 1K61A 1FI2A 1COV2 3RG0A 1YQAA 3WNLA 4XJ8A 4AVSA 3M2MA 1X9PA 3LQQA 5DS9A 1Z7S1 4KIGA 4BXSV 2GZWA 3GZ5A 1AWCA 5AFEA 5C3RA 2V1UA 2Y9YA 5HBAA 4RB2C 4WVZA 3UK9A 2EV0A 5HS7A 1STZA 4NHLA 4KNCA 4NIHA 3JCUC 1B6AA 3ZMDA 1VQ6I 3ERMA 4BAYA 2JG8C 1K4SA 5EZGA 1NA1B 3AMQA 1IXSB 4Z8BA 1NLRA 4HG2A 1QQIA 3VYTB 1V5EA 3T5XA 3VODA 4JGYC 1WMDA 3ZCOA 4CP9B 2ELHA 4X1EA 3ZDVA 2W47A 2VNGA 1RUC1 3SFIA 3SQNA 2PLYA 1MBJA 5A3MA 1W6OA 3OL4A 4Z2WA 3VSKA 1H89C 1ENSA 4G6DA 1B8IA 4K7JA 2J1TA 1UN1A 5ICEA 1YWKA 2NP0A 4IGPA 3QRFF 2R7FA 3WTSC 3CMEI 1NAEA 1GWLA 4ZS3A 4CP1A 1QJY3 1RVF1 1ZHFA 5IVEA 2PQQA 1I9RA 5LWBA 3Q8BA 5DZEA 1XNKA 4GQ7A 4CP0A 4A6EA 5HDGA 4QB6A 2WA3A 3BIWE 2VC1A 3L1PA 1YQ2A 4QPIB 2DO7A 5DAVA 4Y22A 4B44A 2NYYA 3UJOA 4AVBA 4ZU5A 1RUJ2 4LUMA 1CF7B 2F4IA 2VC9A 1IN4A 1QQP3 2EIEA 4LKDA 4CCLA 2AZ5A 1UZYA 4WZFA 4BJTA 4CDWC 1CPMA 5ICFA 5KXDA 1OLTA 3OWTA 1L7QA 4M3BA 5K5RA 1W5CC 4X6RB 3OYHA 2EFQA 1MNMC 4ZYAA 3URFA 3AMPA 2EB7A 1FP1D 2OYZA 4GKYA 1MS9A 5EYXA 4PCRA 3KP7A 5FXZA 4E9KA 3PLQA 3GCXA 2OV7A 3OYCA 1XGOA 4FPEA 4CDQA 3E6MA 2BZTA 1OOPC 3KIOA 2R5ZA 4B47A 1SAUA 4BZ4A 5BV6A 2Y0MA 2BYVE 3DPTA 4A6DA 4G6TB 3LFMA 3WD5A 4L5JA 1RUF3 5CQGA 2JICA 4XKCA 3IUOA 2XF6A 2XJQA 1NCQB 2K40A 3AP7A 5FREA 4D7SA 5LA1A 2KQRA 2VMIA 3IB3A 1X9TA 3FXQA 5FLVA 1UY4A 2IGMA 4QX1A 5FZ8A 4HF2A 3KHCA 1FBSA 5FKBA 4PGGA 1PO13 3EDPA 1DF0A 2YUEA 2I5UA 3NO8A 1J59A 1PGL1 4E7LA 5TJJA 1GV5A 4HXCA 4M3GA 2CAVA 4UFMA 3WY6A 3I2OA 1ZR4A 1N1YA 2H09A 3ABZA 4FP2A 5JOWA 1QNYA 4QB2A 4DYRA 5IYDJ 3LZZA 4UAPA 5DQ0A 4AEMA 4K21A 1I1GA 4Q48A 2E7QA 4AI0A 1R1A1 1Y7BA 5GZEA 3H9GA 4IEXA 4IRGA 4F3QA 1P7IA 4HSRA 5C71A 4ZZ8A 4HF0A 2XQXA 1OFSA 1V5GA 1HRI1 2XAQA 2W1WA 3JRDA 4H7LA 1E5SA 5F39A 2P5BA 1HRI2 1SEFA 1U6GA 3J7NA 1OOPA 4XN0A 3R6SA 2I8DA 2ZHNA 4IEYA 1CAWA 4LUKA 1HN0A 3HRMA 2JN6A 1ZZ7A 1NCRB 2P5LC 3ZN4A 3FKIJ 4AWDA 1JGSA 5A33B 1YEWA 1F43A 2A75A 3ETQA 2GAUA 5A7QA 1MEC2 2K5CA 3K4LA 4HG6B 4EJOA 3OBTA 4RHV3 3ACFA 1ULEA 4PJYA 3U75A 3AYCA 1OYWA 2OZ6A 4F52A 5A7WB 1VQOI 1XX5A 4N4NB 2Y6JA 4ET7A 3PO3J 1Q8VA 4AD9A 2BU9A 3FLRA 3OB8A 4NPRA 1S72I 3N4MA 4Q4W3 3OIQA 5A6YA 4ES9A 3WGGA 3HRSA 2A07F 1MACA 4IE7A 1IRGA 5D6FA 3TMOA 2O8XA 2XG3A 3BB6A 2Q1FA 3BPXA 4B4PA 2QYOA 3L7WA 4R4ZA 2BNMA 1OC1A 4DZJA 2M0MA 4NQWA 1VBB1 3BU7A 4YVWC 3UGGA 5T3NA 2WO2A 4RD7A 4UI9L 1FSEA 3VGIA 4D69A 1O4TA 4L97A 1QNWA 4OINF 1RVF2 1ZRIA 1SANA 2LKXA 3K2OA 3NJVA 3L2HA 5CFDA 2GWRA 5AONA 3CF6E 2QQKA 4LK1F 1LHOA 3C2GA 4O61A 1H1MA 2LS6A 4OQ9A 1LFUP 3NNJA 4LR4A 2R7UA 1AYM1 1LOGA 4YNIA 4HVOA 2EICA 2XASA 2H6CA 5L73A 4Y13A 5C44J 4NMIA 3IMNA 5HV4A 3HOYJ 2BOLA 1JYIA 1R7JA 2K27A 5CFCA 4W97A 1WMXA 1KS5A 1RUJ1 2XF5A 3PUHA 4JRAA 3USSA 2DUQA 1PVC3 1V70A 2G9ZA 3ABKH 4NO4A 2EV6A 1GQHA 2Q8CA 3BLYA 3FHAA 2VVDA 1K5MC 1W7PD 4C1XA 3BZ6A 4LBOA 1XSVA 2J1AA 4MTEA 2RMU2 4LJZF 1DQ2A 5JR2A 4HX7A 4XR6A 1NY72 2ZGNA 1POV3 3PIGA 1JHNA 1QJX3 4AIJA 2VUCA 1PK6C 4DY5A 3K4KA 5EXOA 1PO11 1RETA 1DIWA 4QSHA 2FDIA 3U14A 2F4MB 4QPYA 5DUIA 4YZ5A 2JB4A 2ZSIB 1UXXX 1SLTA 2CJJA 4WWCA 4ZC3A 3ILRA 5FPLA 1Z0XA 2JA8J 2MLGA 4D0QA 1Z91A 2M2EA 4IPAA 4L92A 5A7WA 3VBOB 2DCEA 1LJ7A 2ZKNA 1YO8A 1I27A 1MJBA 3AKPA 2ORZA 2W5FA 1X36A 4CDUB 2RS53 2Q8OA 4XLAA 1S0BA 2CYFA 1G9AA 4AI1A 2C26A 3K1NA 4AHWA 4A6OA 1UIJA 1HRI3 1HQLA 1BMV2 5ABJA 1WKMA 2WAQN 3I64A 1RR8C 1BEV1 4FPJA 2ZXQA 4ZYHA 3I0TA 1DLCA 2A7AA 4H4KC 2HWC2 1XYPA 5LHHA 1CF7A 1ODNA 5C8CC 5FKKA 4I0BA 4MIMA 1OQDA 2LSOA 1TG7A 3T30A 4EJTA 4DZPA 1WVRA 1CIWA 2K9SA 4E7ZA 4GGGA 3LPGA 4UFJA 3GTJJ 5M0TA 5CVVA 1GOFA 3FMQA 2BZDA 4IHWA 3T2PA 1NT0A 4KNYA 3MZHA 1Z3YA 2RREA 3I5UA 2WWYA 2DV9A 3LE0A 3CL1A 2DT6A 5K7HA 2G1MA 4L9NA 2Z42A 4CYCB 1W0OA 4LBLA 1GV2A 5D8AA 1T0FA 1NLQA 1QQP1 1WJ5A 4PQQA 1LNWA 3WP3A 2VQGA 5DUXA 4XUPA 4Z6YA 4TYSA 4LT5A 3VBRA 1REEA 4OUMA 2O8QA 4NB5A 3VPRA 2GOMA 4BJ5C 2VAUA 1I5PA 3WQ1A 2H1LA 5E3NA 3RFRA 3FLPA 2YG0A 1NUKA 2BV6A 2XSDC 4UW3A 4HEA2 2J42A 4EV0A 4WV8A 2B5HA 4KI5M 4M3EA 2EA2A 3DU5A 1AX2A 2ZXJA 3OSFA 2XVLA 4CCMA 5DAWA 1KU2A 1GQPA 3OYGA 2D5VA 3QP6A 4Y7NJ 2CMPA 1AL23 3WEZA 2OXBA 5JDBA 1W2OA 3TGNA 1W39A 1REPC 4A5MA 1OVPA 1B4AA 3MKYB 3DLLF 4R4XA 3OR1C 4C30A 3N9PA 1G3SA 1PVC2 1FOYA 3SHFA 3JRFA 4QXHA 1VALA 3DECA 1QHGA 2R7QA 3JRAA 1LTEA 3GM8A 4KH9A 1VRBA 2NPIA 1GNHA 2R4GA 4M9XA 3JU9A 3ASNH 4DW6A 1EV7A 4H2AA 1G9DA 1HF0A 4WM8B 1K5MB 4ZPIA 4IHTA 2YV8A 3LOBA 2B45X 3BGAA 4BHCA 3BTCA 2P3KA 5A6XA 2UXXA 4GA9A 1MMSA 5A2QK 3QU3A 3G4SI 5F3EA 3CCQI 4WX9A 3ZXJA 4WXHA 3I7DA 2RR12 2PMWB 2V5DA 2EXJA 5KC5A 4LK7A 1PM4A 5A1LA 2JSPA 4TWTA 3LB9A 2NOJB 4NHXA 3LSDA 2QLZA 4XILA 4J00A 2VUJA 2EJRA 2ZGQA 1VRH3 2CWEA 1N77A 2XB6C 1O3SA 2QQLA 2RS31 2ID4A 3OYFA 3F95A 1ZA7A 4ZJZA 5DG2A 3M8EA 4B1RA 1OH3A 2E7TA 2YU2A 4KQ7A 3IN9A 2X48A 1ZLJA 2E2HJ 5FZOB 3ZMZA 2AYHA 3EETA 5EG0A 3V0AA 1JKPC 2L7KA 2BHYA 3RYRA 1Z7S3 3M8LA 1RYYA 1TQ5A 5IK5A 3S1QJ 4J25A 4IX7A 2CV1A 3CQZJ 1IV6A 3LSHA 5BQTA 2HWVA 3Q8AA 3QACA 3KYCB 2KJBA 2JT1A 5LATA 1J75A 2EAAA 2BERA 1SMYF 3KLNA 1GSLA 2OF7A 3IP4B 5IJRA 2RNJA 2HDDA 3IL2A 1XB9A 4X6QB 3WE3A 4FFFA 2ZMEB 3CJXA 4IEZA 4LIUA 1R5GA 4ZKTB 3CCRI 1LNSA 1K6YA 1A6IA 3P9KA 3NNGA 1JZ4A 4EWEA 2H94A 3JAMZ 2E53A 4EEFG 4A7YA 1V3FA 3ZSMA 2GDFA 5EWSA 1WA6X 2E1MB 1N47A 3HTSB 4EGZA 2B42B 3MN2A 1KQRA 3C7FA 2KLOA 4E7KA 1T6SA 3WDXA 2GALA 2JG8B 3P6BA 2OIIA 2XAUA 5DD8A 3LSTA 1U5IA 1U5ZA 2ZMLA 2X1CA 1XB4A 5TISC 1H0MA 5FLHA 1TW3A 3ZN5A 4R9AA 2JDAA 5E3LA 2R5ZB 1AXZA 2HYKA 5DAXA 3BOQA 3RQ4A 3BY6A 5CJ9A 3M8FA 3ON7A 4PK4A 5BNOA 3BG3A 1XDUA 1HRV1 4RHV2 3I3QA 4UV8A 2LY1A 1AR92 4P9GA 3EUHA 2EH3A 2VBWA 3SLIA 3S1NJ 5FTTC 3BR6A 5ERIA 1W0TA 1ZG3A 3UKGA 1PMHX 5E18F 4RR3A 3RZKA 5K7PA 1GLHA 4IJAA 3JSOA 5EPAA 1HQNA 2JD9A 3ZSJA 2MEV1 4MFDA 3D5LA 4LLNA 3D5SC 1R71A 5LGNA 4J1WA 2VQHA 3F3XA 4GDFA 1ZAOA 3SH5A 4L99A 3LDBA 1UU6A 2IC1A 2W82A 1X4OA 2K0GA 5FMDA 2XV4S 3O1SA 2R0QC 3LFIA 5FOBB 1C0WA 3EBRA 3CLOA 1JTYA 4ZZDA 1R64A 1JJ6C 4QAWA 3CMMA 5LRSA 2BW3A 5GZFA 1VBE1 2P8TA 1UHMA 1JKOC 5L9VA 1QVTA 3NKTA 4RQPC 3IPVA 3Q3SA 3HJRA 2M4GA 1EH6A 1P8JA 1HCRA 3GO5A 4PSXA 4JCKA 1WPKA 4AK3A 4LG3A 1FTTA 1ZQ3P 4QKFA 4TN7A 3H3UA 1RUG2 4B29A 3HUGB 2HI3A 3OYLA 2YYOA 3TDZC 4YGCA 4RA2A 1DGWX 4BE2A 5HDKA 3BG9A 3C2UA 4KMUX 1GP4A 2RN7A 2ZOEB 1Q8OA 1QJY2 3CCSI 4XCBA 5DYMA 4HOOA 5K0UA 4WF2A 1AR82 2P6CA 1JJ8C 3S2HJ 1ULFA 5J3UA 4PDKA 1E5RA 1YIFA 4XLHA 1UCXA 1DGRA 3WTVC 2GNTA 3CDLA 1YJWI 3D0JA 3T0AA 3RRDA 3W21A 1BVP1 3K48A 4DINB 2R7SA 4JQRA 5IVCA 4XRMA 2E1CA 3AP5A 3OD4A 5JI6A 2NMOA 3T1BA 2DVBA 2RS11 2VTFA 1PIV1 1KFUL 1B9NA 2VO5A 1VP6A 4YVSA 2JA2A 1SDWA 4LK0F 2KZVA 2VXJA 2DFHA 4MOAA 5J8CA 3IAM2 1DU3D 4YW1A 3HGYA 1ZBE3 4IQJA 1S0GA 2WNEA 2W3JA 4C0HA 4LLGF 2D6NA 4F83A 3SNMA 3KQ4B 3TP3A 3A4CA 3AKRA 4E7IA 1YIJI 2FCTA 3ZYIB 1ST8A 3OYEA 4QDRA 5TRDA 1W7PA 2RVAA 4HZFA 4IVNA 2CQNA 2GXAA 2WINB 4HW0A 1HKSA 3PJQA 3LEKA 1APLC 2RMU3 3VV1A 1GBGA 1SBFA 3O1VA 3ZYGA 2ICWG 2WT1A 3K1PA 2D3PA 1BK1A 2A68F 1YX5A 1YQ8A 4A3BJ 2JTVA 1D4M3 2FCVA 2M87A 5FK7A 1ZGAA 5AIPA 1KJLA 3KP6A 2VUMJ 4XF9A 2RAEA 3ML6A 1H1AA 2R042 3POFA 4OI2A 4Y3OA 1XCBA 4FX0A 1LOAA 3RQIA 3CESA 3ZSEA 4D7NA 3POEA 1H2LA 3MBWA 2BVLA 1U8RA 4Y26A 4IF4A 2HOSA 3VBUB 4Y4RA 4FE4A 3SCGA 3WU1B 1QZYA 2J22A 1SPPB 3S17J 2P37A 4YVSC 2KRCA 4XJ9A 2DTZA 2VMEA 4WK8F 1W6PA 5C4XJ 3KV9A 2EILH 4O5VA 2VJ4A 1G2HA 2OT7A 3SKVA 3EMRA 2BBVA 4ZS2A 2Z9OA 3W6JB 3GXOA 2XROA 4FISA 1LE8A 3NKGA 4YVWB 2ENRA 2K46A 2CUFA 3ZXLA 2Z16A 2VE9A 1LDDA 1Q43A 1IRFA 4FAGA 5IT6A 5H9PA 1K79A 2ZBKA 3FXUA 5E8GA 1A5JA 5LBFA 2YPRA 3SDGA 4FPYA 1CPNA 1PK6A 2E7XA 1IPKA 2RDQA 3ILFA 2O9LA 5C8WA 2Y26A 4M74A 3ULQB 2E35A 2WFF2 1MQTA 1MBKA 1NG7A 5A80A 4PQ9A 3OS0A 5J1YA 4QPWA 2K9QA 2WQZC 2VB6A 3V42A 3UESA 2G9WA 4BHPA 1OOPB 3H8RA 3Q0VA 3WW3A 1LULA 4FFHA 1FLIA 1FV2A 4BYYA 5JLXA 1BIBA 2VOXA 4TLGA 3TN92 3R0AA 2Z4FA 1NCRC 3DKWA 2WS91 5FZMA 1ETXA 5CISA 3TEYA 4AF9A 1POQA 1T8IA 5J40A 2X51A 1W8OA 2VBPA 3M3QA 2OX0A 2M9HA 2RJ2A 2OPWA 4Y1UA 4D0PA 2A69F 4GCVA 1MDMB 1S0IA 3NWKA 4RHV1 5FDBA 4EE2A 4FHTA 1ITYA 2P4WA 2FCUA 5JVGF 1VQ9I 1Z21A 2XB5A 1X4PA 2JZYA 2VXDA 1LEBA 2CGNA 2KD7A 1WMEA 3C3VA 3CCUI 1VQ4I 1QJY1 2W91A 1MBHA 1AXKA 1RUH1 1BZWA 5FY0A 4XCAA 3K69A 3T4HB 3H0GJ 2TCTA 3CC7I 1S29A 5M5WJ 2YXSA 1ZRFA 3S93A 5FD6A 3L2YA 4JGYA 2JENA 1FSHA 1DU6A 3VZMA 2JECA 5LRRA 4Q4X3 1I3AA 4DUWA 2JDPA 4ZYEA 5GAHJ 4N90A 2EFWA 4DPNA 4HONA 2CWMA 1TWCJ 4J19A 4YG2F 1D4M2 2KHMA 4XLPF 4M3CE 5DCFA 1FOD2 4UFIA 3LSPA 1ZBA1 1VJ2A 3QYFA 2NVYJ 3DXJF 2NZ9A 5I8TA 2DQLA 2XHKA 1RESA 3Q8CA 1QO0D 3ASOH 2A6YA 4S05A 4WM7A 1JHFA 2NVUB 1JH5A 1K42A 1UYPA 3I8TA 1TWGJ 3NNFA 1B9MA 1OF3A 3MLLA 2LH9A 1MJAA 3DEWA 2RV9A 5FV3A 2O0OA 3SZTA 4S2HA 2V09A 4XF4A 3DEUA 4AG4A 1U2WA 2DOAA 1GDTA 1UMHA 2X8KA 2YDEA 4D6SA 2KA3A 1WH5A 4MHGA 1RUF1 5GAGJ 3ZDSA 1BR4A 4CDWA 1Z6TA 1CZSA 1BI2A 2J5PA 5IOYA 4MO3M 2DBBA 5LGUA 2RDNA 5J96B 3EO6A 4U0WA 2MABA 1QOTA 2BFUL 1TLHB 3WG9A 4META 1MS3A 4LBQD 4SLIA 1Q1VA 3HKZN 2YUSA 1MBFA 4AHYA 3OUJA 4G4FA 4D5FA 1PDNC 1QU3A 3AMHA 3OMYA 2B7EA 3RPUD 3ACLA 3EXUA 4YGBA 3VYRB 3EYIA 1HV1A 3KF5A 2BFUS 4N53C 1GMMA 5FMOL 4XTPA 2XWJB 1ETOA 4JX6A 4PJ0C 1PMJX 3H5RA 1IHMA 3JXSA 4IUGA 2VQTA 2CSGA 3J26N 9ANTA 5FZIA 4Q4Y2 1USTA 4Y22B 2D5HA 3ECOA 1OI6A 3W3CA 3ZYJB 1UAIA 4M3CA 5C4WA 2ERFA 2VONA 4QXKA 3V0BB 5F7UA 1LEAA 3I2KA 4B3NA 1JHJA 4D9JA 5CKNA 1LGBA 1UMQA 3FDYA 2XBO3 1KJRA 1OT5A 2YSRA 2M7AA 4NHMA 1VB4A 1NG6A 1WW4A 1XE8A 5ERLA 2DQRA 2RS52 1AVBA 1JODA 5F27A 1S0DA 5KK1A 3RQ0A 1FPN1 3VDCA 5E88A 1IXRC 3W6KB 2VZVA 1IDYA 1WLTA 3ZYRA 1Y1VJ 1HIXA 1NYWA 4R1HA 5L36A 2LY9A 4INDA 3SJMA 1JBCA 2A5ZA 1GVDA 1U3EM 1BBT3 3AG4H 3NNLA 3ZXEA 3H3LA 2EFOA 1MMNA 2PJPA 3RYPA 2PJRA 1XMKA 3W6VA 5JXHA 1J5YA 4UNOA 4LHLA 4JX4A 3C3WA 4HT1T 1N78A 1TBXA 4EGYA 3IIAA 2CFXA 1IQAA 1XDSA 1JXSA 1UG2A 3TNQA 1D0HA 1JYWA 2WYSA 4L5EA 1GZTA 3MPPG 4KG0A 3BTXA 1YS6A 4BJ0A 5BNNC 1AKHA 2O3FA 4B8EA 4QM9A 1YG2A 4E2QA 5HLTA 2W2IA 4YW4A 4XKWA 2A61A 4I0WB 2YPDA 2IRFG 3MI8A 2IFRA 3IHUA 2Q1ZB 4DJAA 3AJZA 4EJWA 3COAC 1P4AA 4M71A 3L2UA 2VTXJ 2CUEA 5T54A 3RSNA 2L4AA 3FFQA 1GVJA 2E7AA 4M3FA 2A3XA 2OUJA 4GZ9A 1JN2P 3FZVA 2XUMA 4AIHA 1FMD1 1J1LA 5T52A 4XKVA 2C9KA 5JSOA 2WA4A 2PTMA 5FLJA 1ZNPA 1MMGA 4D7MA 5CZKA 1AHDP 4LULA 4IHYA 4YM2A 1F5JA 5CB7A 2ADDA 2DUOA 1MMAA 2F17A 1YCIA 4N4OB 4IZZA 4R9DA 2PAEA 2RR13 3LAJA 4BY1J 2HBUA 1LEMA 4MGQA 2BOJA 3RPUA 2Q8EA 5IK4A 1YFHA 3IV5A 1YLFA 2VBXA 2DMUA 3I2JA 2BP6A 4NROA 1FX5A 3ONQA 1TME1 5JZGB 1HC8A 1PX3A 4BEHB 1QXRA 3LD8A 5A70A 5LK7B 2ZNZA 1PYVA 5E1XA 4O9GA 4LA2A 5JHFA 3SC7X 2FDKA 3P7NA 1OCPA 3K70D 1NQJA 3BWGA 3GTKJ 4KU8A 3P5BA 4RS5B 3KCXA 2DA4A 2WB1A 2WWSA 3NWSA 2E71A 1PZ7A 3MO4A 3OIOA 1AXYA 2GMMA 2RR11 3POYA 3POSA 1PGW1 1RUH2 2WNUA 4HDVA 1W0PA 2DU1A 3CF2A 5GLVA 2Y6KA 1RI7A 3WNOA 3KEYA 4HFSA 1CN1A 1FMD2 1S0EA 2QVOA 4A4AA 4K6BA 1Y3TA 1W8WA 4UW6A 4S04A 2RM21 2BXZA 4HNUA 4YZ4A 4FTEA 3D1NI 2O8OA 2VMCA 5E89A 1ON1A 3NJZA 3N35A 3GBFA 3QYEA 1JYNA 2VR4A 1BHGA 4HV6A 3RTRA 3FC0A 4M73A 3KX2A 1DP0A 2NS7A 4ZONA 3LWFA 2Y33A 1ONAA 4RM3A 3OPZA 1YJNI 2W0XA 3RYKA 3N05A 3EYPA 1Y6IA 1AA7A 4W6WA 2GC2A 3WTUC 4V19K 1OURA 4Q0VA 1UOGA 2PN5A 2NM1A 1QY4A 5CFDB 3D4KA 3PVBB 4G3YC 4D94A 5FWJA 3SYTA 4XJZA 2RQPA 1J2XA 2C1FA 3WDVA 4MG2A 3HPGA 4XBLA 4IRIA 3T2TA 5KHJA 2OKXA 2MGQA 1J1TA 4MTDA 2HNHA 2A6ZA 4CUBA 5HLIA 2DJIA 1EAH2 2J1VA 5ILVA 2V4VA 3S7EA 2VQCA 1J3PA 1EP0A 2LTPA 4IGOA 2K86A 2O1QA 4GB33 1VAVA 1WBFA 4HPKA 2E6VA 2NVTJ 1OQ1A 3WGHA 2MC4A 4HA8A 1OYIA 5A3OA 4B4RA 3AL6A 2BW8A 3W2WA 4R8HA 4DXRA 1I39A 2JUCA 5FZGA 4PJLA 2HQNA 3ZXAC 3IZOA 2ADEA 2VZSA 2FNPA 4O65A 2ZC2A 4D5CA 1KYWA 2L7ZA 2NYXA 3WHCA 2W25A 1P4WA 2PI0A 2IEKA 1OR7C 5F6LB 4XICA 4E2SA 4OLLA 4XF3A 4Q4Y1 3O8GA 5IY5H 5A1AA 4K20A 4CZSA 4HQEA 1MS1A 4H14A 2WRAA 4YVWA 1X2MA 2ZEWA 4PDWB 4DBQA 4KUMA 4RYDA 4I76A 3WX5A 4ZY9A 2HYXA 4AC0A 4AQ6A 2AO9A 3KCCA 2NQYA 4NC8A 1TNSA 2QF7A 1RUJ3 5LA2A 4XL9A 4P9WA 4WVWA 4Z82A 5D5UB 1VI0A 1T56A 1EYBA 3AMMA 4XAAA 3VZKA 3GX4X 3OGGA 1MVQA 1SD7A 5E3MA 2QKDA 5J1RA 3A7QA 2HWD2 3OBAA 4Q4V3 5F5CA 4GXOA 1IS5A 1RMU2 1S0JA 1LU2A 2HWE2 2Y38A 3VDBA 4NC6A 3LA7A 2WO1A 1XSXA 3ZLIA 5LW9A 3I4NJ 3I2GA 1O8PA 2WY8Q 1R6RA 5C3QA 5IPAA 5FYTA 4EJRA 1LHUA 4BU2A 1HV0A 5K4LA 1FAYA 3OD0A 2ZHMA 2IA1A 3NJXA 3DYPA 3CUQA 1NE6A 4PLMA 5FYBA 3OCPA 1DQ5A 4A3LJ 1QPMA 3ZFFB 3K75B 3PNYA 2MFZA 2O03A 3WODF 4CICA 4B7KA 1R5HA 3ZYHA 2Q0OA 4PBOA 2QQWA 3USUA 4TTGA 3WDYA 2CUZA 1PIV2 3ST7A 4KIFA 4OYUA 5EV7A 4NIIA 2FQ3A 4JKMA 2R041 4XQDA 3FHNA 3WQ0A 4XFBA 1FOD1 5T50A 3TOBA 4IV3C 1W36C 5FZOA 3M7AA 4A0ZA 2DMQA 5F5QA 5GPAA 3O0WA 3C1DA 2LW8A 4QQHA 4O6JA 3AG3H 2BVMA 1LESA 4A3ZA 4ZTFA 2XH6A 5HCHA 4UBHA 5LASA 3MD2A 4OHYA 2V7FA 1VZ0A 5DDJ3 2ZNYA 4KG8A 5I0TA 3TDUC 5FZDA 4CCEA 3ES1A 2R061 3PNTA 1AU7A 1X50A 5I0SA 2WFF3 4KA4A 1TT5B 4NIGA 3TEXA 2EK5A 4LLOA 4B1LA 1ULPA 4EVIA 4NDLA 2IP2A 2DYSH 1X1DA 3ZXDA 2N8GA 2VOOA 3WINE 1H4GA 1GT0C 5FD5A 2ECCA 4ZXEA 2FDFA 4Z1VA 3VBHC 1KS4A 4QT6A 3WTTC 3PL0A 2QQIA 3VEPA 2DW4A 2R1DA 4A42A 5IVJA 2UY9A 4TSVA 3MFAA 2DCKA 2VNOA 5CYYA 3IPVB 4FXKB 4BDYA 1L7RA 3MCZA 1EJ9A 1SHWB 2ET1A 3LOCA 4PLOA 4GFBA 3RNSA 1JYVA 3JAMK 2WNUB 3DTEA 3APBA 1J84A 3WHTA 1USSA 1GOHA 1M4WA 4LBMA 3AG1H 4AVVA 3B73A 1AR73 1MEC1 5FKOA 2IGNA 1EUUA 4BLJA 3C7JA 3MFKA 3O12A 1P4XA 1S4CA 2L02A 1B35A 2VBYA 4C0BA 3DCFA 5GM0A 2R1BA<