1O3SA

Protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRDTVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*AP*AP*AP*AP*TP*GP*CP*GP*AP*T)-3'
publication title Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: Alteration of DNA Binding Specificity Through Alteration of DNA Kinking
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 60
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o3sA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o3sA01
3EHKA 1BN5A 4A12A 3HTSB 2CG4A 5I0RA 1YO5C 4QLCU 1MDMA 2Z5UA 2K7LA 3DF8A 1ZZ8A 1HKQA 3RKWA 3P7NA 3T8TA 5K8SA 5J7MA 4IEQA 3K2ZA 1QNTA 4LULA 3IDCB 4HQEA 2XGXA 1WSUA 2GXGA 3REOA 4TLFA 3HHHA 4XBFA 5ED4A 2P6SA 4KWLA 1KA8A 1K7AA 1KU9A 5J48A 3EO6A 2UYAA 4XFHA 1QWRA 1RNLA 4E2SA 2F5EA 2PLYA 5E1WA 1R5HA 4OMZA 2CFXA 2Q2EA 1BIBA 1WWXA 4P96A 4XFIA 1GVJA 3CO7C 2DU9A 1RL3A 3H50A 4J1XA 3I5UA 4A5MA 3LSTA 1Y0UA 4QGNA 3I71A 1OR7A 2FSWA 1L0OC 4IF4A 2ADUA 4KN4X 4HYEA 3W6KB 3C7JA 3SQNA 5BPDA 4CGZA 3VODA 3MAJA 1MKMA 1P4WA 3RPQA 1X8MA 1IRGA 3NW4A 1TQPA 3SZTA 3RTRA 4F7ZA 2VONA 3H92A 3BB6A 4MNUA 1XSDA 1IAWA 4L9TA 3JSOA 2MBFA 4AQ2A 3QU3A 2QUFA 3TGNA 3FHIB 1KU7A 3C1DA 4LLGF 3ISPA 1SD5A 3HRMA 1Q43A 3ES4A 5FQ0A 2ET1A 4KA4A 1Z1DA 3L2HA 1P6RA 2W84A 3VHRA 1K6OA 2Q30A 3DFGA 4E70A 3O6BB 3ZDSA 2OQGA 4OFGA 3ZMDA 3DP7A 2GC0A 3KCCA 1G3SA 4WCGA 4WXHA 4ZYHA 1YS6A 2ZKLA 1ZRFA 3IC7A 3F21A 3WTYC 4KIBA 2XAFA 5LHIA 1XCVA 2GC3A 3ABTA 3ZPLA 3ES1A 4QX5A 4EQQA 2ETEA 1HKSA 2ZMEA 2MNGA 1CF7A 3LAGA 1V4RA 2DK5A 4RAYA 4LTAA 3EUHA 1ZX5A 3QPHA 1UB9A 1CAXB 3WTZA 4LLOA 1FLIA 4IEUA 1Y3TA 2Y0MA 2A61A 1U5TB 4YARA 2KJBA 4HMZA 1FSEA 1A04A 1OYIA 2K27A 4QM8A 2HZTA 1G6NA 2Z69A 2V09A 1E2XA 1IF1A 4G9YA 4I09A 2D1HA 4O9GA 2EA4A 4HX7A 3V7RA 1ZH5A 5ICGA 2MLKA 1FX7A 3TDZC 3LAJA 3E5XA 4XF3A 1IXSB 3K69A 2EFNA 4IESA 3KP4A 4A6DA 2HWVA 3LFKA 1KGSA 4Y15A 5E20A 5HDNA 2XKOA 2L4AA 3COAC 1W4MA 2GA1A 1B9NA 4XF4A 4HF1A 3WW1A 4R52A 5LLQA 4EWEA 1DPRA 4IRGA 3WE3A 4GYGA 2BYVE 3Q5FA 2FBKA 1XE8A 2PBIA 1WQ2A 1G3YA 4M6XA 4HF2A 2P5VA 3B02A 1TQIA 4PJYA 4M9ZA 3U0ZA 4F8AA 2BNOA 2XAJA 3F8FA 3WU0A 2HS5A 2Q0OA 2XIGA 3GFLA 3L09A 1FBQA 3KMHA 4K2EA 2KIMA 2ZNZA 3T0YA 3FFQA 3SHRA 3U11A 4L11A 1W5SA 2E7XA 3FM3A 5BUVA 2PMHA 3WW4A 4UBGA 4I98B 2PA7A 3LZZA 5FLHA 4PIYA 5LEJA 1RUOA 3GO5A 3BPZA 5JI6A 2RC4A 2G9WA 3F3XA 4LMYA 4XRFA 3RYKA 4X6RB 4QGMA 3FF5A 3BJOA 3NL1A 1USSA 5CADA 4HX8A 2DI3A 1FYLA 3R6SA 3I53A 3KGZA 1DUXC 2A3SA 2PAEA 5HI0A 3ZN1A 1TW3A 4I0AA 3TO9A 3E6CC 3KFWX 5K1YA 2IXLA 1QZYA 4G8XA 1B1BA 3EDPA 4RAZA 1XSXA 3HUGA 3VEPA 1U3EM 4O3MA 4U0YA 4RB3C 1ZLKA 1SQ4A 5D5VB 2OD5A 3N97A 4EWDA 2XVCA 1YIOA 3BROA 1H1MA 1UD1A 5AIPA 3N4MA 2O8QA 1ZARA 3M3IA 3KP5A 5DCFA 2JZYA 3G3ZA 3IHUA 5DEQA 4ASNA 3WE2A 3KSCA 4EGZA 3BP8A 1UW8A 3GW2A 2O8XA 4M74A 2B8MA 2HQNA 3DL3A 5FB2A 1UIKA 5E8GA 5JCTA 3WTWC 4LFUA 1G4DA 5FPZA 1ZYRF 1J59A 4FBFA 1YFXA 2VBWA 3K1MA 4BHCA 2M45A 4IRHA 1U12A 2QNKA 3RYPA 3CLPA 4O9EA 3D0JA 1YYVA 1U2WA 5L3EA 2PG4A 3DPTA 1ZZ7A 1SD7A 4A0ZA 4DQ2A 1Z05A 3TO6A 1K79A 3KP2A 1IUYA 5DDGA 5BOXA 1F1ZA 2XHKA 2ACJA 2QBYA 2ESHA 2PJPA 1TQ5A 1IXCA 2YSRA 2CAUA 2ET7A 2EB7A 4MV2A 5LGTA 1O7LA 1BI2A 3P9CA 1BOAA 1JGSA 1ZRCA 2UZKA 1Z6RA 2P7VB 4YIFA 1DP7P 2F5CA 3LQQA 2H0VA 1ZNPA 2L01A 3BPXA 3WTUC 1IN5A 2P8TA 4EMSA 3IBMA 2FNPA 1X8EA 3JSPA 3MDPA 3S2WA 1B59A 4MUVA 1YFHA 4ON0A 1UPIA 5ICCA 3SCHA 4JV4A 2QQ9A 1LEAA 4HSLA 2J5PA 5E1RA 2MA3A 5LEKA 2VOPA 1ON2A 3Q9VA 3BOQA 4ZYGA 1BC8C 1R23A 3K1NA 2I45A 1AOYA 2UXXA 1SMTA 3D0SA 4N0BA 1DGRA 4UBHA 3ROUA 5FPXA 2DW4A 1RIOH 3TOAA 1I1SA 1LDJA 5ILVA 3DN7A 3BJ6A 2LF8A 5HLHA 1MJ9A 4XLPF 1J58A 1OYYA 2IXKA 4O5VA 3GXOA 1ZN2A 4KDPA 3DPLC 1XE7A 3S7IA 2X0LA 2E1CA 1ON1A 2FE3A 1G3WA 3GLXA 1F5TA 3KLNA 1XMKA 1O3RA 3OGJA 4YIIA 2PQQA 2PYTA 4N9IA 1E17A 3HRUA 4HVRA 3EETA 3CF6E 3H1YA 3H7YA 4MGKE 1UHMA 5EEHA 1DDNA 2EA2A 2IT0A 2DLLA 2KJCA 2BV6A 5F1RA 5JR3A 1ONVA 4L2NA 2B9UA 2HTSA 2VODA 4KWJA 4FAGA 3VB2A 2QVSB 4QXKA 4ZU5A 5LGUA 3T8RA 1CAVB 2ATFA 3EJKA 2GC2A 1XDUA 3Q9SA 4L18B 4CZZA 1WI9A 1U6GA 1J2XA 1YFWA 3FWEA 4I2OA 1QXRA 3MYXA 1D3YA 3I59B 5DD4A 1J75A 1NYWA 2WFPA 4LB6B 5J8CA 1REPC 1R36A 3WGIA 1QGPA 5TJJA 1MD0A 2E1NA 3J81K 3E6DA 2FU4A 2QQBA 2Z3YA 1FBUA 2B5HA 1UIJA 1SAXA 2PAKA 4LUKA 4Q0SA 5E1ZB 2GXBA 4I02A 3LWCA 4Z82A 3FJSA 1IN4A 5BMZA 5KHJA 1ZVFA 1YW7A 2Z2SB 1D5VA 2P7CB 2EJRA 1XGNA 2QENA 1J5YA 3TKYA 2XAHA 2XRNA 2HEOA 2A68F 3GZ6A 3C3VA 5BQTA 4KMFA 2HYGD 4A6EA 4LEJA 1GQHA 5LRRA 2C6YA 1U78A 3V8LA 4MEYF 5BY5A 5ILUA 4EVIA 1OD5A 4P5OA 4HOBA 4OU0A 3UKTA 2VXZA 1XGMA 4EM2A 5E17F 1DPUA 3G73A 2OZJA 4LB5A 2DQLA 3CUQB 3M70A 2CSOA 2K02A 5IT3A 3I0TA 5CU1A 1CAXA 2DCTA 4I01A 2FNAA 1KU3A 2K4BA 4ENNA 3ZP5A 4HX4A 4ONUA 2PHLA 2FOKA 1QO0D 1FY7A 6PAXA 2L02A 1BC7C 1WA4A 2PFWA 4R1HA 4YFKF 1NXMA 3L7WA 3F23A 3J81Z 2ISZA 4IHTA 2FEZA 4DINB 1L3JA 2VN2A 5FFXA 4KFCA 2EFQA 4PIZA 1UHWA 1FP2A 1R1UA 1T2KA 3O3KA 2RGVA 5JVTA 2Z33A 1IXRC 1U8RA 2PQ8A 3I4PA 3QRFF 2YR2A 2O3FA 1OI6A 1HKTA 1YUDA 4ESBA 5IT9K 5C6CA 2XASA 2VT2A 3R60A 1FPQA 5I93A 5DV5A 4WZCA 5D5XB 2HQRA 3HQXA 2X4HA 2W57A 1ZREA 2LSOA 3MEXA 1K78B 4MEXF 5KK1A 2D5FA 1LVAA 2M8EA 1J3QA 4HV6A 1SFXA 4HDVA 1ZRRA 3WW2A 5KBFA 4IETA 2GIVA 5HLGA 4BQAA 1MGTA 4HN0A 4BYYA 4YG2F 1NE6A 4ETSA 3UKNA 5FDBA 5I0UA 4YSFA 4OIRF 5FO5A 2M87A 1FOKA 3GWZA 4LUMA 2FRHA 5FLXK 3L9FA 4WXCA 3ELKA 1ULYA 2O03A 2VBXA 5JSRA 2MH2A 1B4AA 2CYYA 4WK8F 2N7GA 1SFUA 2OA4A 3JAMK 1QPMA 3HOTA 3F8NA 4LG0B 3HHGA 3MZHA 4CO8A 4MX3A 5I0SA 2UY9A 3H1WA 3SXWA 1GQGA 4J1WA 2V79A 4UUVA 1FT9A 4I3PA 5HVQC 5HS9A 4HN1A 5LHHA 2KRFA 2VT3A 4MHGA 3AAFA 1KYZA 4IRIA 2V1UA 4HBNA 3I58A 3NQOA 4YFNF 4AIJA 1FNNA 1O3TA 1FI2A 2PI0A 4PDKA 1H0MA 4EGYA 4HZFA 1VJ2A 1HW1A 4JTNA 1JHFA 2EA7A 3DQVC 5I0TA 1P4AA 4JVAA 4EM1A 2DBBA 4LK1F 5F6FA 1QY4A 3CTAA 3TOBA 2DPDA 4M6YA 1WKMA 3M1EA 2HFHA 3RI4A 1VR3A 4IEVA 4I0BA 4QM9A 4UNOA 1KQ0A 4N9HA 4U0WA 2QQAA 5CLSA 5FLXZ 3GYHX 4ZH4F 2YU3A 1UCRA 4WX9A 1B9MA 2BNNA 4XFFA 4RS8A 2V1XA 4UHTA 4XF1A 5LBQA 2D45A 1ZZCA 2EK5A 2VQAA 4PGGA 4WVZA 1R1TA 1W5TA 3ABUA 5HLIA 1V3FA 5T3NA 4RGSA 1YW8A 4MQVA 3HSFA 1R7JA 4Q5SF 3F8MA 3TO7A 5HDGA 1XGSA 2GH2A 4U0VA 2JRTA 5FGMA 1HXDA 3H3ZA 3BALA 3JW4A 2G7UA 2KIFA 3JTGA 4A2UA 3R61A 4HSJA 5AVPA 4IHSA 2DK8A 3PLQA 2BBYA 2VOOA 2Q4SA 4D7TA 5LHGA 1O4TA 3ULQB 1PP8F 2LKPA 5L3BA 2DO7A 3LA7A 1O3SA 3FXRA 4ENMA 4L5IA 3M9AA 4HW0A 5HS7A 4KU8A 5H6QA 4HLXA 1LJ9A 5FD6A 3LOIA 2FMYA 2P5LC 4KWKA 2QYOA 5J3UA 4MGZE 2PFBA 1GXPA 5L3GA 3GZ5A 1YQAA 3GFMA 4LLLA 2XL9A 3KLOA 1ZRDA 1YLLA 2HKOA 2GU9A 3WTXC 1EH7A 4OIOF 1YS7A 2W24A 3SCFA 4CDGA 4ENKA 4H0EA 2NS0A 4META 4IEWA 3M8EA 1O3QA 3HTUA 2IXIA 4GULA 4ZU4A 4KUMA 2H6BA 3GF2A 2HTJA 1P4XA 3FZVA 4GXOA 5CVVA 2L4MA 5CVIA 2H09A 2VECA 1XSVA 1TNTA 3GEZA 2ZNYA 1CAVA 4NHJA 2R3SA 3FZ3A 2O0YA 3O14A 2D93A 3OV8A 1FC3A 5CVJA 1WRJA 3I7DA 1O57A 1RGSA 2VBYA 3KE2A 3I59A 2PEXA 4HLTA 1IN7A 3DKWA 3FHZA 1EY2A 5BPIA 3QACA 2K9ZA 3P9IA 1W7PD 2CWEA 2OU2A 2IA2A 3WTVC 1O5LA 2STTA 1TNSA 3KP3A 3G7DA 4EJOA 3KP7A 3IL2A 5LRSA 3NRVA 2R7FA 4M9XA 3EQEA 4EM0B 5HDKA 1Q3EA 5DD8A 3GBFA 2Y0OA 3IIAA 4UV8A 2JPBA 1MZBA 4TV7A 2ZCWA 2F5FA 3E97A 1DZRA 1FXZA 3KP6A 4RB1A 2UXNA 2YX7A 1YG2A 2XAQA 4GO1A 3K9TA 1I6XA 1QXJA 2CV6A 3OD0A 1KYWA 4G6QA 3HSEA 4L0ZB 2Q1ZB 3F22A 4LJZF 1PP7U 4R8HA 5JSOA 4RD7A 2OBPA 1J9IA 1S7OA 3E3VA 5LGNA 5I8SA 4HDUA 1TTYA 4U7BA 2A6HF 5CJ9A 4E2QA 1BI1A 3H3UA 3UKVA 2W85A 3BCWA 3CUQA 1LRHA 1IW7F 4A0XA 4Q0UA 2MHFA 2A69F 4Q48A 1SEFA 4AVBA 1H9GA 3J80K 4AVPA 4KYWA 3RKXA 4QWQA 2IRFG 3V7SA 4OINF 2F5DA 3FMSA 3TDUC 5F64A 4P9UA 4ESJA 3IKVA 3RYRA 1Z9CA 2QLZA 3ACLA 3EQLF 2HKXA 3HYIA 2XV4S 2V9VA 2WV0A 4RB0A 3LA2A 2VBZA 4GGGA 3S0MA 1P92A 1T6SA 2FF4A 3FXUA 4EROA 2NNYA 4KNYA 1XRUA 3SCGA 2JT1A 3KETA 3RPUA 2LNBA 5BXXA 4L5JA 4O6JA 1CAWB 3GFJA 4MGYE 5I8TA 2OPKA 5D6EA 3SXYA 2WC2A 1K78A 2O6GE 5E1XA 4XF9A 2QWWA 4IPAA 3PNAA 2PHDA 4MGRA 4YNIA 3BDDA 3DV8A 1FYMA 4HBLA 4AXOA 2IPQX 2Z9OA 3RNSA 3CLOA 3CUQC 2FXAA 2FQPA 2EWNA 1GHCA 2EFPA 4M71A 2AXLA 3KEQA 1JE8A 1TQMA 1CAUB 3IRQA 2E9QA 2XUBA 2FBHA 4AQ6A 1EV7A 1ZGAA 3K1PA 1LDDA 2O61A 4KN7X 1ZG3A 1S8NA 3V4GA 2BE5F 2OZUA 3E6BA 4ZYDA 4PCQA 2G7HA 2IJLA 3LWFA 4ZZDA 1PUEE 1LQ1A 3QP5A 2L54A 4KIGA 4OIPF 3H1MA 1Q1HA 4S05A 3RKYA 1YWKA 1IZ1A 3IRRA 2HGCA 3FX3A 4LG0A 3ZQ7A 2JSCA 2DPUA 1SMYF 3GVAA 5D5UB 5FLIA 3NEUA 2RN7A 1NHAA 4IEYA 3GYDA 5EFUA 2PMUA 2EFWA 4M73A 4Q47A 3WU1B 3L2CA 1FBSA 3M7GA 2NAZA 1XGOA 1NZCA 4NVPA 4G7OF 1Q5OA 4CYDA 3GX4X 3KZYA 3R0AA 5L3CA 3HT1A 4EJWA 2VE8A 5AONA 3GFIA 1USTA 2P6TA 3HIFA 2CO5A 1BM9A 4UVAA 1GXQA 4X6QB 3D82A 1RZ4A 3NKTA 2ZO4A 4FX0A 1HW2A 3M8FA 3WW3A 2F4PA 1U5TA 2RNJA 2QVOA 3NSTA 3LQRA 2FMLA 1TBXA 3LA3A 4IVNA 3QU6A 3EBRA 4HA8A 3I54A 1J3RA 2VPVA 1OKRA 1Z6TA 3ML6A 1XMAA 4KL1A 3ZMZA 1L3LA 5BV6A 1XD7A 1IPKA 4I7HA 4BHBA 3JTHA 3NJZA 2Z99A 2JPCA 4JK1X 1T0FA 1NE4A 3E5UA 1R00A 1XCBA 3F8CA 2AS5F 2P4WA 3WG9A 4PIXA 2UWMA 1J7KA 4P9FA 4XSZF 5D4SA 2ZXJA 3MZYA 4EJTA 3WTTC 4D0PA 5D6FA 2LDUA 5D5WB 2JTVA 2D5HA 4EJUA 5ICFA 1YW9A 2DAOA 2KKOA 2DQRA 2J5OA 4JQFA 4QGLA 4WXDA 4NQWA 2VC0A 4Q0PA 3C3WA 5D8LB 2QZ8A 5D1IA 3HRTA 4BH9A 5A2QK 4YYOA 1ZGJA 2CAVA 1LKNA 4B8XA 1R58A 3KZZA 5CVRA 5CYVA 5H6RA 4MTEA 2PTMA 2HR3A 1J3PA 1U5TC 3V8KA 3BJAA 3KEOA 1IRFA 1OPCA 3SFZA 3HSRA 2WTEA 2GA2A 3F72A 4LGWA 3U2RA 1JHHA 2GZWA 3QPTA 1KQ8A 3IWZA 3QAHA 2XL7A 4BHPA 4OMYA 3F8BA 4GYIA 4RGXA 3FE5A 4MTDA 4RGRA 4S04A 5E18F 3JZVA 3T5XA 3ELNA 2EFOA 1Z91A 2IXHA 4PGHA 3U1DA 4G94A 2ETHA 4IEPA 3PQKA 2CQKA 4XEZA 3DEUA 2EAAA 3WGHA 5IT9Z 2ZJ2A 2O1QA 1S29A 4Y13A 1RUNA 2V6CA 4BXUA 4AIKA 4HVOA 3WGGA 2IC1A 1W7PB 1FP1D 2M30A 4G6DA 1G3TA 3K0LA 3CUOA 5DCMB 3OTFA 1O5UA 5BPXA 4UXAA 3CJNA 4BIFA 1VP6A 2ZBKA 2P5KA 4QMAA 5A2QZ 2A07F 1MDMB 3H8UA 4YRDA 4H7LA 2TDXA 2BGCA 2KXLA 2VC1A 4YFXF 3V7CA 3V8JA 2YX4A 1LEBA 4ZZLA 3E5QA 5E16A 1CGPA 4M72A 2CGPA 1X82A 1JXSA 1RTVA 4HVQA 3QOPA 3CL1A 1XB4A 3IKTA 4ORFA 1EP0A 3CEWA 4ESFA 4L0YB 1LNWA 3B73A 5KHIA 1HSJA 4WF2A 1R22A 3JAMZ 4D7SA 4UVBA 3T1BA 2IVMA 1STZA 2MH9A 3TQNA 4ZYEA 1T39A 5K5QA 2BNMA 1WGPA 2ZFWA 1QBJA 1B6AA 1TLHB 4XETA 2H27A 1J1LA 4ZU7A 1BIAA 1PMIA 3RDIA 2K4JA 4U88A 4KT5C 2HDCA 4LK0F 5L3DA 4WWCA 1HBXG 2D2WA 4LA3A 1H1IA 4IERA 2XLAA 2QM3A 4Q0QA 2W25A 5E8IA 4EWAA 3MQ0A 2K86A 4B29A 5K5RA 4B09A 3MFKA 2XAGA 2ESNA 1R1VA 2D40A 2A6EF 1ZLJA 4L9VA 1H9TA 1FZPB 3USSA 1IN6A 1IN8A 2P17A 1HQCA 1OMIA 1SFNA 5KHGA 4P55A 3ZMUA 5FD5A 3U9GA 3MCZA 2QDRA 2KIUA 5JR7B 3O2PE 4XFCA 1SFEA 5FQ0B 1QQIA 5ICEA 1SD4A 3OOPA 3E6MA 5AIQA 4IEXA 4HAMA 2EV6A 2RDPA 2QCSB 3IDBB 4PZJA 5D4RA 2DTRA 1JUHA 3J7AO 4MGIE 3WODF 1XDSA 1XN7A 2IA1A 1I27A 4FT8A 3FXQA 4KMUX 4UVCA 4OLLA 4L9JA 2HYFA 2YPRA 5KHHA 3OCPA 1S3JA 5CVUA 1V70A 3H9AA 4CXFA 2ZMEB 1CF7B 1PDNC 3CDHA 1AWCA 2R7DA 2L3DA 3RZZA 1YTYA 3NVCA 4WBBA 3PQJA 5TRDA 2A5YB 3ECOA 5KVRA 2OYZA 3S7EA 1HW5A 1F4KA 1HSTA 5DYMA 1UCXA 1CAWA 4AVAA 4EV0A 4FHTA 4Q0VA 2XLFA 1DGWA 3FMRA 3CO6C 1R5GA 2GC1A 4MQ9F 1YFUA 5I91A 1MJAA 2QJVA 4GCVA 1LDKB 1BJAA 3H7JA 3OF1A 2MLGA 4R79A 3CO2A 4LLNA 4A5NA 4Z07A 2D1VA 2Q0AA 5HOOA 4OIQF 1CX4A 3ZN0A 2LF7A 1CAUA 2ELHA 1ZG1A 2IA0A 5H20A 5D8KB 5DUKA 1FYKA 2IXJA 2EVXA 5L3FA 2Y75A 1TW2A 5DUIA 1RI7A 3SMHA 4IEOA 3IWFA 2IXCA 4OOIA 3ZMTA 4HQMA 2M5WA 3U10A 5JAXA 2DFIA 1J0RA 3RIRA 4RB2C 5ILSA 1T98A 3BWGA 2COMA 3EYIA 3LAPA 3W6JB 1EH6A 2ZKZA 4UXNA 4AD9A 4BAYA 4LA2A 2GQQA 1QZZA 5FCCA 4E2GA 3SHFA 4MH0E 4XLNF 5JHUA 2XROA 2OZ6A 1BBYA 1ZAOA 2H6CA 1ODDA 1ZZBA 1LR5A 1BI0A 4AIHA 4HF0A 4CHUA 1Y9QA 1YHFA 4Y17A 4XFBA 1P2FA 2UYBA 5K5OA 3TNPB 4FAHA 1SD6A 4Q4ZF 4XF0A 4KICA 1IPJA 1X3UA 3PFIA 4IXAA 2HJIA 3F6OA 3VFZA 4K8FA 1OFNA 2RV8A 3VOEA 4CICA 5KHKA 3BPVA 4LD5A 4FX4A 4IEZA 3ERED 1PM7A 5C8WA 2GAUA 3ECHA 1EH8A 3F6VA 2V1DA 4U7DA 1OYWA 3C18A 3RJPA 4UV9A 2EV5A 2K0GA 1O7FA 4G7HF 4HLYA 5J6XA 1EPZA 5ERIA 3ZMVA 1ZG5A 1FWZA 2OA2A 1ZZ6A 4XFAA 2XKPA 3FMQA 4M9SA 2FQ3A 3P9KA 3HRSA 1T38A 1DZTA 4AWXB 5EZWA 2UY8A 3CJXA 1Z7UA 2PN6A 1D8KA 4XSXF 3BZ6A 3WTSC 2FBIA 4JBAA 2C0ZA 4P9GA 2MC3A 4BNCA 2CW0F 4JTOA 1RC6A 3BY6A 4XFGA 1I1GA 5FLJA 1EYBA 4G7ZF 2NNNA 5HS8A 3GUDA 4ENJA 5JSPA 1D8JA 5I8YA 2MD5A 1S7AA 2PAMA 3R4KA 3I64A 3SZPA 2Q8KA 2MPFA 2B0LA 2HOEA 2WWYA 4HV5A 1LB2A 2F2EA 4KIFA 3J80Z 1BI3A 3MPBA 2QBYB 3FM5A 1YLFA 1I5ZA 3QP6A 2OQRA 2BEOA 1S6LA 1FSHA 3KGLA 1KQ9A 3DXJF 5FFZA 3EYYA 2EV0A 3D5LA 4RGUA 1MJBA 1C0WA 1YFYA 4Q29A 2XLGA 5JFRA 2RVCA 3HOSA 2ISYA 5EEGA 4L9NA 2VE9A 2IW5A 4DNCA 2FA5A 3R0JA 3ZMSA 2STWA 1UFMA 3MWMA 3BU7A 2GWRA 1ZZ9A 3HT2A 1ZHFA 1X7NA 3PVBB 4EJVA 2DT5A 1KU2A 2OAZA 3ETQA 4Z2YA 2E7WA 5J8FA 2NYXA 4NB5A 4KU7A 1W7PA 2IP2A 4A0YA 3ST7A 2NRAC 1WLTA 2RKHA 1VTNC 5DCMA 4AVCA 2H94A 2RQPA 2M1BA 3TNQA 2Y48A 4IJAA 3L00A 4MZUA 5BS6A 1F9NA
chains in the Genus database with same CATH superfamily
4CU9A 3EHKA 5E3OA 1MDMA 3F2ZA 1R1A2 5FZBA 1HKQA 5T55A 3BKZA 4E9KA 3T8TA 5K8SA 4LPLA 1N3QA 3LD8A 3WG2A 3REOA 2ERFA 3HHHA 3AKQA 4OUMA 4XBFA 4BCUA 1Z67A 1CR7A 2VZ1A 1K7AA 4BISA 4KITB 1ULGA 3O8GA 3CMMA 1PVEA 2XDVA 3IDEA 5AC92 4BK4A 1RNLA 1ZQ3P 1REDA 2F5EA 2PLYA 2ILMA 1OISA 2WS91 3HQUA 2CFXA 2WNVB 1WWXA 4XFIA 1FIPA 4QPIA 4UW4A 2QGUA 3DBHB 1RUF3 2ZGUA 5F04A 5FO7B 4XOPA 2QQOA 4A5MA 1MBKA 1RESA 3CCQI 1M1EB 2FSWA 1L0OC 3FBNB 3S93A 4IF4A 1U8BA 1BW5A 2ZGPA 4QSHA 4CGZA 5LBFA 2FDGA 1MKMA 2VQLA 5DQ0A 1WMXA 2CUEA 1X33A 4F7ZA 1F43A 3ZXEA 5C4WA 3X2QH 5GTIC 4Q2FA 3HVDA 3JSOA 5HV0A 5EJ1B 3USUA 1PIV2 1GSLA 3I56I 4RM3A 3UNPA 4LMFA 3VDDB 2WKKA 3AC0A 3CCYA 3H9JA 3UR3C 1V0AA 5B4XA 2M0MA 2JDPA 1DU0A 3OOUA 1K6OA 3HWJA 2ZSHB 5IK7A 2C6SA 2E33A 1TL8A 4MHUA 2OQGA 3L2RA 4LHSA 3K4CA 3AXEA 1K5MC 1LOFA 3DP7A 3N9LA 3PIJA 3WINE 4JQRA 4P00B 2ZXIA 4WCGA 4WXHA 5E3MA 2ZTNA 1ZRFA 1HQNA 4QB1A 5J96B 3F21A 4IE0A 2XAFA 1V9U2 4XLAA 2Y34A 4YVWC 5GKAC 3CD6I 1HKSA 1RUG2 2EIEA 1CF7A 3LAGA 1V4RA 4LTAA 1ZX5A 5CG8A 3S1QJ 1MBFA 4QKFA 4M00A 2J22A 1H30A 1MEC2 2MEV2 2KJBA 3JRCA 4HOOA 1FSEA 1W39A 2WAEA 1HQLA 3KVAA 2VMIA 2CNAA 3O1SA 2ZHMA 1XPXA 5FBZA 1E2XA 4Y52J 4I09A 3N7LA 3V7RA 2CQNA 2JG9A 3E5XA 3E0JB 5JLXA 1JW6A 2VZPA 3KP4A 1G9FA 3AKSA 3WQ1A 4XQFA 2WADA 3LFKA 5E20A 4Q4Y1 1J84A 3COAC 1B9NA 3WG3A 1A35A 3WW1A 2V9PA 3FISA 5D21A 4EWEA 1DPRA 2UU8A 3Q5FA 1VPHA 3OPZA 2I5UA 2PBIA 1WQ2A 1G3YA 2W95A 4M6XA 3B02A 2DA1A 1TQIA 2VPRA 3ZQFA 2XAJA 3WU0A 4XILA 1WZ2A 1FBQA 2DOAA 1OA2A 1UZ0A 1BEV2 3SHRA 3U11A 4DRVA 4BACA 4E7KA 5ABJC 1UPSA 4UBGA 3KV5A 4PIYA 4KG8A 5DG2A 2ZMEC 3BPZA 5JI6A 4QDQA 2DV9A 3F3XA 2E2HJ 4B48A 1VQOI 4ET7A 2RJLA 2XJVA 4E7SA 1OKQA 4HX8A 1FYLA 4A3FJ 4J00A 4BY1J 1ETXA 3ZN1A 3O1TA 3C2BA 3GLLA 3E6CC 2WNUC 3KCXA 1H8AC 1MNMC 1HJFA 1QZYA 3EDPA 2YDEA 3VEPA 1HDPA 1HXS2 1DP3A 3GF6A 2HWB1 3VZJA 5IP7J 4W8JA 4B7EA 1ZLKA 5K7FA 1Z0HA 4HK8A 2OD5A 3A22A 1V5GA 1ENXA 3N97A 2XVCA 4H4KC 3BROA 5FP7A 2L9LA 1H1MA 3H3LA 1UD1A 3S14J 1ZARA 3NWSA 1E3OC 3O1MA 1RETA 5DEQA 4IL6C 4QAWA 2JENA 1CVNA 3AZVA 2HYXA 4L99A 1LGNA 5E8GA 3TN93 4NPLA 4FBFA 1XJAA 2W1QA 3OGRA 5B1AH 3K1MA 1IOAA 4IRHA 3K4JA 2QNKA 3RYPA 4DB5A 2KDZA 4OQ8A 3D0JA 1U2WA 2YFZA 5J1UA 2PG4A 4M6VA 3ACGA 2WO3A 2RS53 1JUMA 1Z05A 3NO8A 3CDIA 5EZHA 2P5BA 1DQUA 5DDGA 5BOXA 4CVUA 2ESHA 4CH7A 1A6IA 4K7JA 2YSRA 2XH6A 1FX5A 1CESA 2EB7A 3U37A 1PK6A 3QH6A 4BQWA 1JGSA 2K3FA 2R7RA 2P7VB 3BIEA 4BXXJ 4P02B 4Y4YA 1TME1 1SVMA 2DCJA 2WQZC 4BQQA 5JMOA 4GB32 4EN0A 4LHLA 1X8EA 1W8WA 3MDPA 1NCRB 1B59A 4MUVA 4B8EA 1YFHA 3TEYA 3S3MA 4BBSJ 5LY2A 5KWRA 2RAEA 4NDLA 5FYBA 2J5PA 1A6CA 1ETQA 5EIYB 4JKKA 5LEKA 2R7SA 2HBTA 2VOPA 2WZ8A 5LY1A 3BOQA 4PI2A 2WB1A 3RMXA 5JR2A 1F5FA 4GAZA 4AU7A 4C9YA 3K1NA 1CIYA 2KT0A 4G12A 2ZMNA 3L2QA 1WCKA 2DW4A 4PCRA 5ANQA 1RIOH 1I1SA 1AR93 1LDJA 5ILVA 2VXDA 2M2EA 5HLHA 4FQ4A 4ZZ5A 5CYYA 4KDPA 2E34A 4YEJA 1ON1A 4Z2WA 2FE3A 1OOPB 2ID3A 2LYCA 3KLNA 4W6WA 4TTGA 4YIIA 5DAPA 2PQQA 2PYTA 1MH3A 3CF6E 5GJ6A 4FPKA 1W3XA 5EEHA 1Z3YA 2V73A 4YW6A 3O5SA 3Q0VA 3UKGA 3NV2A 4YFWA 1HKDA 4GKXA 2B9UA 3DBRB 3BR3A 3R4DB 4ASKA 1ZBE1 3T8RA 4JX4A 1XDUA 1MS8A 3FWEA 4I2OA 4RAFA 1QXRA 1S0FA 3MYXA 1D3YA 3CC7I 4I6ZA 4F83A 1NYWA 1REPC 1DDLA 4RLFA 3AP5A 5TJJA 3ZN4A 1GV5A 1HLCA 2VW1A 1PHMA 2QQBA 1IS3A 3O8HA 4ATFA 2B5HA 2PAKA 3P3PA 4DEVA 3GGLA 3MO4A 1BJZA 4M3FA 1MH4A 3LWCA 4XACA 3FJSA 2VCMA 4HT1T 3VDDA 2B42B 3DPRA 5C9AC 5KHJA 2IFRA 1YW7A 3MKYB 5FFOC 1D5VA 1GV2A 2EJRA 4XJWA 1XGNA 2R32A 3B5LB 4CZCA 1OT5A 2DT7B 2EICA 1QU3A 4PLOA 3JRFA 1T95A 4YZ5A 1VMHA 2HWD2 3VKNA 4D6QA 4TXWA 4KMFA 1KXGA 3WG1A 4LE4A 1S2EA 3RQ0A 5GLVA 2TUNA 4EVIA 3GBGA 1BVP1 1M4WA 4P5OA 4HOBA 3WHUA 4EM2A 3AYEA 2VVEA 1DPUA 5TISC 3G73A 3ZLIA 4II2A 4NIHA 1Y7BA 2OZJA 4LB5A 2DQLA 3I55I 4KNCA 3CUQB 3MLJA 2VBPA 4ITVA 1OBNA 3AL0C 2CSOA 1F15A 2K02A 5IT3A 4OHXA 1LUJB 4UF0B 4LBJA 5CU1A 2RV9A 4I01A 1KU3A 4K1ZA 4ENNA 4YGBA 3HXLA 2WABA 3TAYA 3RZLA 4XXPA 3AZYA 1BC7C 2RS52 2L7ZA 4R1HA 2PFWA 2DUQA 2ZJRF 3MIGA 4XR6A 1LOBA 4DINB 1L3JA 2B9VA 1JTYA 2LKXA 3FMGA 5FYTA 5G04L 2Y9ZA 2ZX2A 1MBHA 2HWC1 3LCPA 4GMP0 1UHWA 4UFMA 1U8RA 3VBSC 1Y8RB 2KZGA 2CWMA 3S3NA 1HKTA 4IX7A 2PLV1 2VVFA 4TWTA 3MI8A 1BCXA 2RS33 4QXHA 5C6CA 3MFAA 1FPQA 4AAXA 5IOZA 4ZYAA 3RZGA 2XB5A 1VQKI 3HQXA 4C3HJ 2X4HA 2W57A 2LSOA 5FUIA 4MEXF 2D5FA 3ZO0B 1LVAA 1OHFA 1XC6A 1DZQA 3MBWA 1J3QA 1SFXA 4A6SA 1TNFA 5L9VA 3WW2A 3UGFA 5KBFA 2E1OA 4QXBA 3ZM8A 4E4DX 4N7IA 4ZDOA 3HDDA 4D69A 2VOWA 1UG0A 3UKNA 5FDBA 4GH4B 1Z77A 5I0UA 5JXIA 4JX0A 2IVIB 4IKFA 3HOVJ 3IP4B 2RR11 3LQCA 4XKCA 2J1EA 2E1MB 2FRHA 4CDQA 1XNAA 2Q8DA 1TG7A 4XLHA 4XZPA 2H1LA 1XTAA 1ULYA 2VJ5A 4IHYA 3TP3A 3DEEA 2OA4A 4FPHA 3LDKA 3F8NA 3Q8CA 3HHGA 4CO8A 4ES9A 3H1WA 3BG6A 1GDTA 5DUXA 1GQGA 4EJRA 1FT9A 2E31A 2DMNA 2VKVA 5HVQC 2LTPA 5HS9A 2R041 3AFHA 2K9LA 4JAAA 3I2KA 4XLFA 4MHGA 2Y6GA 2KISA 2DUPA 5IAVA 1OVPA 3N7JA 3NQOA 4ISRA 4AIJA 2MSYA 2W82A 4YELA 4GWNA 4BY7J 3DLLF 1LVKA 1K4TA 1TT0A 3WDVA 3K4DA 2FDHA 2EA7A 3DQVC 3TRSB 2BERA 2DURA 3HBLA 1VBC2 3NMBA 4HEA2 4LK1F 4Q8LA 1OXCA 3WNKA 3TOBA 1OA4A 4ABZA 4DBRA 1QZEA 4XKBA 4M6YA 1G9DA 1QHGA 3OWTA 1VR3A 4OI2A 1KQ0A 4U0WA 2VPLA 5CLSA 1MNEA 2O9LA 2RJKA 2CHHA 2DMPA 1O8PA 2BGPA 1JZ4A 4XFFA 4JDOA 5BNPC 5KXCA 1A78A 4K8RB 1PVXA 4EYUA 3O12A 2D45A 1ZZCA 1K61A 3CESA 4LT5A 4PGGA 1DQ0A 1V3FA 4RGSA 1JYVA 1JI6A 1YW8A 3H8OA 2JKBA 5CA6A 3W2VA 3NAUA 3OL3A 5IHRA 3CQZJ 3HSFA 1CQ9A 1R7JA 3LSPA 1NCRA 4YM2A 3B94A 3T4VA 1MMDA 4U0VA 3W2AA 5AVPA 2G7UA 3OYHA 4HSJA 5TSWA 2VOOA 2CH0A 4INDA 1MBJA 1BBT1 3LA7A 3FXRA 4CA0A 2VNRA 3JRAA 2RVAA 5H6QA 3BR5A 3FL7A 4HLXA 4Y1UA 1LJ9A 4AC0A 1SFPA 2P37A 1WVRA 2P5LC 1HQWA 3BQZA 3S15J 3H35A 2JVGA 3ZKYA 2ZJQF 1GXPA 4URTA 3GFMA 4GALA 1W03A 1HRV1 3DKQA 3WNOA 2FDIA 1ZRDA 2RM23 4J01A 5KC5A 1OOPA 4DYCA 1ZM1A 1C4RA 1OCZH 3VD5A 2OQ7A 4UUSB 2W24A 4CDGA 4XPVA 4ES8A 4FE4A 5EXOA 1O3QA 2WRAA 4UFJA 2RS32 2AHQA 2XWJB 4GULA 3VV1A 2PMZA 4AVZA 1L7RA 3U07A 4L0PA 3FZVA 4P5HA 4OHYA 1LOGA 2YGMA 1AYM3 1FYUA 2VUMJ 4EN7B 1X9TA 1S2KA 1UYPA 2VJIA 4KG0A 4IE4A 1PVC1 3RG0A 5B66C 2QCOA 4NHJA 2O0YA 4QX8A 1DYKA 2OX0A 2GH8A 3ZN6B 1VRH2 2PHWA 4BA6A 4HRIA 4MGSA 4RSUA 2PEXA 4HLTA 1XNTA 3DKWA 1EY2A 5A3WA 3MIDA 1DG6A 2Y2ZA 1V6MA 3PL0A 4L97A 5F08A 1AL0G 4P08A 1W28A 5FP4A 1Q3EA 4JRLA 3I2OA 3C7FA 2Y0OA 2B9SA 2P4EA 1LJ7A 3BR2A 4TV7A 1K42A 1DZRA 4LOCA 3KP6A 1ACIA 2UXNA 2YX7A 1HDKA 5JVVA 1SFYA 3B69A 4AQSA 3K9TA 1I6XA 4G6QA 3HSEA 1VMJA 4LJZF 1RB8G 4R8HA 1C57A 2L0KA 4RD7A 2OBPA 4PBPA 2RS13 1JUSA 4BE1A 4U7BA 3HOYJ 1CIWA 2VOTA 5ERLA 4E2QA 2DCZA 2VD7A 5FXVA 3H3UA 4A3DJ 1H9PA 4NPMA 2XPUA 4B7KA 3VBHB 3CUQA 4TLGA 4WZFA 1PO11 2JJ7A 1ENSA 5H9QA 1IW7F 2MHFA 4UF0A 4CCCA 1FPN1 4XONA 2VB6A 5CIRA 1WI3A 2X1CA 3RFRA 1AR63 2AEYA 4KYWA 3KZIC 1UXXX 3RKXA 5J4YA 2DA3A 4Q4X3 3U1KA 3F95A 2R7WA 4IHWA 1RUE3 2R7VA 3TDUC 3K46A 2Q5TA 1GUUA 1TEIA 4OHZA 5F0FA 3RYRA 1Z9CA 3BYWA 2XV4S 2BHYA 3OYMA 1BK1A 4M3EA 4GGGA 1DCSA 4B3NA 4FPGA 3FXUA 5FRAA 1T08B 3S16J 3CNAA 3SCGA 4TN7A 3BZCA 2I74A 4ZONA 1BLZA 3DEWA 4L5JA 3AG3H 3UJOA 3GFJA 5I8TA 2DA5A 3BCAA 2WC2A 3SXYA 4D7MA 1C8M2 4IPAA 3ZOBA 3BDDA 3DV8A 2E7QA 2DYCA 2QQIA 2FQPA 2XF5A 2EFPA 3BGAA 3KEQA 2YROA 1TQMA 2NXNB 2NVYJ 1AVBA 1R092 1LFUP 1D0XA 3TBIA 2O61A 2DDBA 1E3PA 2R061 2C26A 1JYTA 1W8ZA 2BE5F 2VZUA 3K51A 1VBE3 2JDKA 4XRSA 2K9NA 5JZGA 1QJU1 1OQ1A 2L54A 4KIGA 4OIPF 3THCA 2BTVC 3RKYA 4XICA 5ACA1 1IZ1A 4EN6B 2JSCA 2DPUA 1LENA 3A1YA 4AQTA 3ZN5A 1AHSA 2DVAA 1NHAA 5IYBJ 3GYDA 1N3OA 5E88A 1JBCA 2ARBA 3L2CA 3M7GA 3MLLA 3POGA 4CEYC 4P9YA 4HL0A 3ZYHA 1MS3A 4EJWA 1K6YA 4MO7A 1R083 4NRQA 1W8HA 2JE8A 1GXQA 1VF9A 1ND2C 3NKTA 1DIWA 4A3ZA 5FO8B 2RNJA 1PO22 2XAUA 1K12A 1WKYA 2FMLA 3LA3A 4IVNA 1TMF1 1UZVA 2G9FA 2VAUA 1XMAA 4KL1A 4ZDLA 4URAA 4BHBA 1RUC2 3JTHA 2A70A 5DMYA 2JPCA 1POV1 3WT3A 1EV11 3VHNA 4AI3A 1XCBA 3SEZA 4LLFA 2VO5A 5E8AA 2UWMA 2HVRA 4TSVA 1HOMA 4P9FA 1H2NA 5BNOC 3MZYA 4EJTA 2H1KA 5D6FA 2JTVA 1ENRA 1EAH2 2WB1N 3K4LA 3EMRA 2DAOA 2E5NA 5L7OC 2J5OA 4JQFA 4BMBA 4YM0A 2RS12 4WXDA 1LCLA 1WJFA 4Q0PA 3C3WA 1F31A 2QZ8A 3IDAA 5D1IA 3OSFA 3GZUC 4YYOA 3H8XA 4KI5M 3GZAA 1UMQA 2DFEA 1R58A 4B44A 2UWCA 4MTEA 2HR3A 1J3PA 3V8KA 3S2DJ 1OPCA 3SFZA 2C9AA 5EF6A 2GZWA 1RHI1 4PSXA 1ZKGA 2XL7A 1QH6A 3I2FA 3FE5A 2LY2A 4RS5C 2D6KA 4MTDA 1IG0A 3QYFA 3T5XA 2RJ2A 2EFOA 4MXVA 4P5YA 2DA6A 3JD73 1XYNA 2ZHNA 2CQKA 3PUBA 1XQNA 2Q8OA 3DEUA 2ZJ2A 2NVQJ 1LOCA 4NBQA 4NRPA 4IV1C 4JRAA 3POJA 3DBLB 1IS5A 5KC6A 1GLNA 5APAA 1RKWA 5KAFC 3K0LA 2ORZA 2Y26A 2E2IJ 5BPXA 3J8F3 1RJ8A 2GNBA 3CJNA 2HPIA 2ZAHA 2VQ0A 4BIFA 2F6BA 3UK9A 3RJRA 4E7JA 1MS4A 2WZR2 2VXRA 4H7LA 2TDXA 3V0AB 2DODA 4YFXF 4PSWA 4M3DA 3ZN6A 5E16A 2MD0A 2GDFA 4M72A 4NC6A 3TW6A 2CGPA 1JXSA 4A7ZA 1RTVA 1I50J 4E7ZA 4XUPA 5DXDA 4ORFA 1DQ6A 4UW6A 2W4SA 4IOAF 4NHMA 3H5NA 2YBSA 2P6HA 5FAXA 3ZQIA 3AKTA 3RQIA 1KZHA 1STZA 1UG2A 1DQ5A 4XBLA 1VBB2 4AGRA 1WMEA 2R4GA 2WFF1 4YVWB 5EYXA 2X6WA 3OS1A 3GCWA 2ZFWA 3MW3A 1W8TA 3NWTA 1K45A 4U88A 4KT5C 4NJ4A 2D2WA 2X6YA 5FP8A 4IERA 4Q0QA 4XUNA 3LEIA 3MQ0A 2JA5J 2ESNA 2DTYA 2A6EF 1ZLJA 1UL9A 1IN6A 2QQ8A 4NNJA 4LJHA 3VDBA 1G8XA 3VBHA 3LDBA 5KHGA 1F4HA 1D4M3 1BR1A 2X1EA 2LW8A 3FHAA 2R5YA 4RHV3 3O2PE 1VQ4I 3HJRA 5FQ0B 4EN8B 5JUVA 4IEXA 3KLSA 2EV6A 5A3PA 3BPSA 3G6JB 5FYUA 2QCSB 5D4RA 2DTRA 2WN2A 3J7AO 2ZEZA 2ZAAA 3WODF 1XDSA 1XN7A 1E5IA 1XXNA 1RMU3 4DYRA 3FXQA 2CY6A 4KMUX 3HAGA 4L9JA 1W6QA 5DS9A 2HYFA 2XB0X 4DNYA 2DA2A 1S3JA 1V70A 3OYWB 3H9AA 2E7TA 2ZMEB 4MVTA 2FD8A 4M3GA 1V55H 5FZOA 2R7DA 5FKNA 3KWVA 2VL4A 1YTYA 1VE0A 3NVCA 5F3CA 4FOWA 4MIMA 4DPNA 1UCXA 1O91A 3OIQA 3KX2A 4RYDA 2LKSA 5T5JA 2R7XA 4QX7A 5EJZB 2BWAA 4F92B 1MJAA 4GA9A 1O59A 1W8OA 2VASA 4GCVA 4P14A 4BQ3A 2F5VA 3K4KA 2OPTA 1FNYA 3PO2J 3A21A 2Q0AA 5HOOA 4OIQF 1CX4A 1H0BA 1CPNA 2ELHA 2ZACA 2ELKA 5D8KB 2AREA 2EVXA 2E6VA 5L3FA 1GKBA 4COWA 2WO7A 5J4VA 5A3NA 4CEWC 2JRMA 4IEOA 3ZMTA 3JD72 4HQMA 5LBEA 5LWBA 1DU3D 2AUYA 2D7FA 3J26N 4P9LA 5ILSA 2UUZA 3TEWA 5IP9J 2WA0A 3LAPA 2ZKZA 4AD9A 3LFIA 2GQQA 4LKDA 1COV1 1HRI1 3FXOA 4E2GA 3RZDJ 4MH0E 2IGKA 4XIOA 1W9YA 1ZAOA 3BR6A 1QMJA 1RVF3 1ENQA 5FY0A 5C8CA 1DF0A 2KL4A 2J1UA 5FYSA 3W3CA 3QYBA 4Q4W1 1P2FA 2HXOA 3S1RJ 4FAHA 4RDUA 3OL4A 2ZBJA 1X3UA 1ERDA 4LORA 3VBUC 2HWF1 4ARYA 3GTOJ 4A3JJ 4PF5A 2QF7A 1RIRA 4IEZA 1OC1A 1PM7A 5LASA 3ECHA 1EH8A 3VZNA 4U7DA 1OYWA 3RJPA 4N43C 1JGGA 1OUSA 2K0GA 1VLNA 4LE3A 1GOHA 3KHCA 4HLYA 4Y7NJ 4B3XA 2XGCA 1SCRA 3ZMVA 4XJ8A 1FWZA 2OA2A 3FXMA 1LEDA 4XFAA 2VZOA 1OCTC 2E2JJ 2JDYA 3P9KA 4QPQA 3ZOIA 5K0UC 3MKWB 1GP5A 3HRSA 5KR7A 2WS93 1T38A 2EXKA 4MSVA 2JMWA 4GD4A 4N90A 1KGYA 3WTSC 2MC3A 4JTOA 1RC6A 2ZX3A 4AEDC 5JSPA 3QPSA 2ZGSA 2CMPA 5GPCA 5F0HA 1WBLA 3I64A 3JCUC 1V54H 3SZPA 2Q8KA 1ZBA1 3K70D 4HV5A 2QKLB 3EPZA 4KIFA 4A3BJ 1D1AA 5FO9B 1W05A 1JKOC 1AR81 3FHQA 1I5ZA 4Y20A 2OQRA 2BEOA 3LSKA 1FSHA 3G1LA 3O0WA 3KGLA 2X53S 1IO2A 2EV0A 3O1RA 4NWWA 2YZ4A 3WHCA 3HOSA 2ISYA 5EEGA 2BOLA 4L9NA 2IGOA 4FETA 3I4MJ 2R49A 2TRTA 2W48A 2W5FA 3ACFA 3ZQLA 4DNCA 4CDWC 2ZJPF 3ZMSA 4NMIA 2PMZN 5JOWA 3W59A 1W8NA 1UFMA 1NQJA 2DTWA 2VJ4A 2GWRA 1X7NA 4IOCF 1QNWA 2OAZA 1NLSA 5FZ9A 2E7WA 2LOOA 5F3GA 2JDMA 5J8FA 3AG2H 4NB5A 2XC7A 4JGYB 1OQYA 2QQPA 1TZLA 1HIXA 3AP7A 3C8XA 1WLTA 1YOVB 2VJJA 4LO4B 3RWKX 5T50A 4J6GA 4IJAA 1YJNI 5BS6A 1V6LA 2W92A 5DAXA 3J7LA 3M7AA 3HTSB 1WZXA 4LO6B 1QU0A 3JCIA 2X05A 4QLCU 2DJIA 2K7LA 2OUJA 5F8PA 1ZZ8A 2XBO1 3V0AA 3I49A 2P3KA 5J7MA 3K2ZA 1H1AA 4TLFA 3FC0A 5ED4A 2JIGA 5FZMA 4ZZ8A 2L9SA 3FBIB 2XRLA 1K5MA 2PQSA 4XHBA 5C7GA 4XFHA 1QWRA 3BG9A 1IKPA 1UU6A 2LD5A 1R5HA 2OV7A 4Q4Y3 5IAXA 1VFCA 4P96A 4YVWA 1FOWA 1QOSA 4GRIA 1TNRA 1Y9MA 3I2GA 3H42B 3AL0B 2B45X 2QSFX 2BFUS 2DU9A 1RL3A 2D98A 4OQ9A 3I5UA 4JX6A 3QQAA 5ACA2 4XAAA 3WVJA 1XSRA 1HJGA 3GALA 5A33B 4HYEA 4LBQD 3SQNA 3BTYA 3VODA 1P4WA 3NW4A 3N35A 2XPJA 3D5SC 3SZTA 3H92A 2WWJA 4MNUA 2ZX0A 2DU1A 1UMZA 4AQ2A 3BIWE 2G19A 9ANTA 3QU3A 2QUFA 3TGNA 3VBSB 4LLGF 2QQUA 4XQWA 5FQ0A 3I4IA 2ET1A 4KA4A 1Z1DA 4G6TB 1Z7S3 3VHRA 1UY0A 3DFGA 4E70A 3ON7A 2E53A 1UOBA 2JA7J 2HWB3 2IGMA 4OFGA 3VUOA 2WA3A 3DUIA 2VGDA 3KCCA 1RKTA 2Q1FA 4ZYHA 5E6HA 2ZKLA 1BQPA 1W6NB 4IL7A 3WDUA 1WJ5A 1UMHA 3NV1A 1UWWA 5FZ6A 3DF0A 4KIBA 5LHIA 3RWNA 2YPDA 3IM0A 3ES1A 3ZPLA 2HQAA 3OYWA 4EQQA 1JT0A 2ETEA 3ZXSA 2ZMEA 2VUJA 2MNGA 4D7YA 2UV1A 1Y1VJ 1HB1A 4FTBA 5A70A 4HNTA 3RRDA 1CAXB 4R4ZA 4IEUA 1LE8B 1URXA 2W1UA 3ACHA 1U5TB 3HN3A 1OR7C 4HMZA 4UFIA 3FDYA 1OLTA 2EZHA 4DXTA 5HNFA 5DZGA 3UT0A 1W9SA 2IS6A 3IH3A 2WJSA 4QM8A 3OYDA 2JA2A 2ZGNA 2WY8Q 1YJKA 1IF1A 4G9YA 2D1HA 4XC9A 4HX7A 1ZH5A 2MLKA 3AP6A 2VI6A 4XF3A 1IXSB 2FCTA 4QU2A 4IESA 1GICA 1X1DA 4A6DA 3IAM2 5GZGA 4WVVA 2X6XA 3IAS2 3DTKA 3S1MJ 1AUYA 2XKOA 1S9HA 1RUJ1 4FSJA 4NHYA 2GA1A 2R6QA 1YIJI 2C24A 1MBEA 3WE3A 3H0DA 4GYGA 2BYVE 4YM3A 4A93J 3KV6A 1JJ6C 1A5JA 2WV1A 2P5VA 4CA9A 4M9ZA 3CC2I 2BNOA 2HS5A 2PXJA 2Q0OA 2XIGA 1VI0A 3GFLA 3L09A 5IYCJ 2KQRA 1V6OA 4F3QA 2NM1A 5BUVA 4UFLA 2PMHA 2VMDA 4I98B 4LKEA 2CRGA 2PMWB 5CFDC 4B1MA 1KFUL 2ME6A 4YW3A 4IZZA 3I3DA 5FPUA 3FXKA 2G9WA 2E35A 4XRFA 2YGLA 4QGMA 5JLVA 3NL1A 2PHTA 4W97A 1USSA 5CADA 1S2BA 3R6SA 1DYPA 3I53A 2CUFA 1DUXC 2CL2A 1JT6A 5BNPB 1TW3A 3PMSA 4JKMA 4AI2A 2IXLA 3U14A 2VMCA 3ZFFC 1BKZA 1OFSA 1B1BA 4CCJA 1U3EM 3ZYFA 2CV0A 4O3MA 2VBDA 4IE6A 4U0YA 3B93A 3ZXKA 1PGL1 5C70A 4RB3C 1LHWA 3VHPA 4RL7A 1AR73 3JRHA 1YIOA 2EZKA 3ZYIB 1IG7A 3CMGA 4FFGA 1W6OA 2GP3A 5FJ8J 1X3ZB 2R7TA 4ASNA 3INAA 3SDBA 3WQ7A 3U4SA 3GW2A 2O8XA 2B8MA 2TBVA 4LO5B 4FPEA 1LULA 1H8VA 5F5IA 5FXZA 3NWKA 1ZTRA 1DFQA 2QUOA 1MS9A 3E1F1 1J59A 4QTRA 3POBA 1NY71 2EAKA 2R7ZJ 3FN9A 3AYCA 3AYAA 2V4JC 2Y69H 4DZPA 5L3EA 1ZZ7A 4A0ZA 3ZR6A 2VUDA 1GP6A 3SEPA 3KP2A 2FDKA 1FATA 2KD7A 1TQ5A 2CAUA 2LG4A 1I6HJ 3MW4A 1H8TC 1GQPA 1ZRCA 1BL0A 3HMYA 1DP7P 2F5CA 3K4BA 4FCAA 3B00A 4PUSA 1PNGA 2WSVA 1JJ8C 2YC4A 3W5MA 3WTUC 4O61A 3VBOB 5K7HA 3OIPA 4EMSA 2LFBA 3IBMA 3S2WA 3VD7A 1J09A 1YQ8A 2RMU3 3DTIA 2Y6HA 3SCHA 2P81A 1QH7A 3LB9A 3JUUA 4BJ5C 1SCSA 3H5RA 1ON2A 5FZKA 4QWNA 4ZYGA 1WCQA 1BC8C 1Y9GA 3KT1A 5J09A 1X1CA 1SMTA 4FPFA 5CPRB 1DGRA 2BRTA 4UBHA 3ROUA 2H8WA 1QQP1 1VRBA 2WIIB 1MJ9A 5C9AA 3U4XA 2IXKA 2XUMA 1ZN2A 3DU6A 4AR2A 2E1CA 1G3WA 3GLXA 2VY0A 3RZOJ 4B4PA 3MPPG 1F5TA 4AEJA 2HWE1 1XMKA 1WGXA 2HWC3 3I2JA 3CP2A 3MMYB 1YIPA 4DY5A 1E17A 3H1YA 4W4ZA 1BW6A 1QJY2 1VBD3 1RUD3 1UHMA 2EA2A 1HN0A 2X9DA 5EV7A 2PLV3 2KJCA 2BV6A 4L2NA 2COBA 2ECBA 5FPBA 3IH4A 1QJX2 5JMCA 1JKQC 3GTQJ 4ZU5A 1CAVB 1R1A1 3EJKA 1AX1A 1JXNA 2QQLA 3CDZB 3R4UA 4CZZA 1U6GA 1SDDB 3LEMA 1ETOA 5FZ1A 3SFIA 5A33A 3QBQA 5FY9A 1ULDA 3I59B 5DD4A 1J75A 2KDOA 4LB6B 1R36A 2Y6FA 2PJRB 1I5PA 3AKRA 4UYBA 2R7OA 1R64A 1MD0A 1H88C 3J81K 2K40A 4I76A 2K5CA 5AC91 1SAXA 4Q0SA 2ES3A 1L7QA 5E1ZB 1SC7A 2RR13 1S5LC 4I02A 2OS2A 2ICWG 1K3IA 3VBSA 5BMZA 3I3BA 1W9WA 5B1BH 2P7CB 3HGGA 4D7NA 3T2PA 3U78A 1PNFA 2XAHA 2HEOA 3PURA 4MFDA 1FEXA 2EH3A 3PDQA 3OYBA 4ZXKA 4A6EA 1GQHA 5C3SA 5LRRA 1JOPA 1VAVA 2HLEA 4A45A 2MYSA 3V8LA 4MEYF 1VQ5I 3H8RA 2E51A 2FUG2 1CZTA 3AKZA 5FZAA 5IPAA 1FOD3 2R043 1W6NA 1D7PM 2VXZA 1XGMA 5E17F 5LA2A 3CJIC 4KH9A 4BJ6C 5A3TA 4WM8C 4ZS2A 3I0TA 3A01B 1PIV1 3VL8A 1CAXA 2DCTA 2GXAA 2FNAA 4CDXC 1LE8A 4ANJA 4UWDA 1X4PA 3CP8A 2VBBA 4ONUA 2DOEA 3T09A 2AACA 4AFMA 1YX5A 1WA4A 4A7YA 1SBDA 3J81Z 2FEZA 1W0OA 4AFDA 4FTHA 3MZ8A 4X6AJ 2EFQA 2ZFUA 1T2KA 5FY5A 4MOAA 5JVTA 1IXRC 3X29B 1YQ5A 2PQ8A 1ULOA 3ZXAC 5L36A 3HZJA 1IKQA 1V9U1 1OI6A 1RUG1 2OJED 1YUDA 2BZTA 2ZS6B 1KQRA 3GNEA 3VHOA 5IT9K 2XASA 5EP9A 3A23A 5I93A 2RMU2 5DV5A 4WZCA 1OCRH 2Y60A 2MEV1 2JG8B 1DQ1A 2VKDA 4LOSA 3C7HA 4HDVA 4IETA 5JPMB 1M06G 4E27A 1MGTA 5SV8A 2DVDA 1BBT3 4BYYA 4YG2F 1VIWB 1YHQI 3W20A 1O4ZA 4FPYA 3KVBA 1SVOA 2EZIA 4XMIA 1SPPB 2A05A 2M87A 2M34A 4LUMA 5FLXK 5BNPA 3L9FA 3WHTA 5BNNB 2J1TA 4WXCA 1ASJ2 3ECQA 2QKDA 5JSRA 2MH2A 2CYYA 4WK8F 1HRV3 2W47A 3JAMK 1V6JA 1A36A 3SXWA 5J98B 3LSMA 4I3PA 5L9RA 1RUH1 1RUD2 4HN1A 2I2SA 4QPIC 4Z8BA 4BQ2A 3RMYA 3I58A 3O0XA 5A32B 3MVPA 3UJQA 4BEHB 2ZHKA 3K48A 1LECA 2L2OA 1H0MA 2FDJA 2M4KA 4AI0A 4EGYA 2LREA 2W9XA 4OUEA 1VJ2A 1SG3A 3AMMA 2X5IB 4JVAA 1PVC3 2JA8J 3C7OA 1H2MA 4RS5B 5IYDJ 4N53C 2OTJI 4CU6A 3PO3J 4O7XA 1NQDA 3M1EA 1W2TA 3RI4A 1MMSA 3AL5A 4QM9A 4UNOA 1JYCA 4U36A 5FLXZ 4XUTA 3GYHX 2YU3A 4QKDA 3P6BA 1OFCX 1B9MA 3ZXJA 1XSQA 2RDSA 4IV1B 2WUHA 5JLWA 1B35C 5LBBA 5J40A 2EK5A 1RUF1 2CGNA 2KR2A 5M3MJ 1LOFC 1W5TA 2EIKH 5A6ZA 5HLIA 3AXDA 2RDQA 4MQVA 4BQ1A 3AFGA 3D8CA 4W6YA 1NZIA 1IDYA 2LP0A 3EYPA 1FOD2 1IC8A 1H4HA 1JTXA 4M3BA 3H3ZA 4NE9A 4IHSA 2R5ZB 2JX9A 2Z1DA 1D2SA 1N1VA 2PHXA 3ZXLA 1ONAA 3ULQB 4G3YC 1PP8F 3ZPYA 4E4ZA 1O3SA 4ENMA 3NKGA 5IY5H 3M9AA 4HW0A 2Y64A 2ENRA 1PO13 4XZUG 2GIZA 1JU4A 3BG7A 4BIOA 5C4WB 4D0QA 5FD6A 1FPN3 3AM2A 3CLQA 4KWKA 5AVAA 1KDKA 1BOBA 1ENHA 4MFEA 3BTCA 1W0UA 5L3GA 3GZ5A 1YQAA 3EUKL 4IGQA 5CFCC 2YBKA 4GB31 2CDPA 2BPA2 5A1AA 1YC61 3IZOA 4DZGA 3HKZA 2KM2A 4ZDPA 2GU9A 3K10A 5IUQA 3SCFA 1VQ8I 3WDYA 2DFBA 2VCCA 4IEWA 3M8EA 1AXYA 3VBFB 4W65A 4G4FA 2H6BA 3A0KA 5JOYA 2HTJA 1P4XA 3VKFC 3CQOA 3A4CA 1JODA 1KJRA 2XVKA 1GOGA 2XQRA 3T0BA 4X1EA 2NVTJ 1F36A 2WT2A 3GEZA 4Q1RA 2ZNYA 1CAVA 5CQEA 3DKXA 3OV8A 1FC3A 5DUUA 5FZIA 5CVJA 2Y6LA 4IEJA 4PJNA 3I7DA 1YJ9I 2NVUB 3I59A 4CP9A 4CXXA 3IMNA 5E79C 2K9ZA 1W7PD 2OU2A 3WTVC 3OYNA 1O5LA 4JGZB 5B4NA 2V4VA 3KP3A 3IL2A 3ZSKA 5LRSA 3NRVA 1VAMA 4M9XA 4EM0B 2DT6A 3PUAA 1SVLA 2R063 3LSJA 2VG9A 1W36D 4RB1A 3AK0A 4TZDA 1QJU3 2JSPA 4LBNA 1AF9A 1G2HA 2CJJA 1WD3A 1CD3G 4CCOA 3F22A 1DU6A 3CC4I 3WHBA 2JEMA 4Y5SA 1WJDA 4HKOA 3GDBA 5KHDA 3E3VA 1PX4A 2YUSA 5I8SA 4HDUA 3ASIA 2RDNA 4ARXA 2VR4A 2E60A 2JB8A 3LPFA 2KMUA 3S3OA 3UKVA 4NR1A 3PTYA 1PYVA 1V00A 2BZDA 2DUOA 4XDQA 2LALA 5FIXA 4XL9A 3V64A 3A01A 3R0RA 1UY2A 2A69F 4R9DA 3URFA 1A34A 1RUI2 1YJLA 4AVPA 3NARA 3A0BC 5C3QA 2FZ2A 1LKXA 1TMF3 3CU7A 4QDRA 4NN0A 3AG1H 3GTLJ 5FZGA 3ERMA 1DGLA 4CEWB 1PUFA 1IQAA 1NY72 1FMD2 3PSFA 2HWD1 2F5DA 2QLZA 2Y31A 3MD2A 1POV3 3EQLF 1EV13 3HYIA 3LA2A 3PUQA 3NAPC 3S0MA 3G1OA 3D5OA 1T6SA 3IMMA 4EROA 3OBTA 2NNYA 1H6XA 4KNYA 2L7FP 3ABMH 5H9RA 1JHNA 1LAJA 2LNBA 5BXXA 1ND2A 3WNMA 1KS4A 2CFOA 1YQCA 4CUAA 1F35A 2GMMA 2RS51 3VBUB 2QWWA 2PHDA 4ZTJA 2EIJH 4II3A 4AXOA 2IPQX 2Z9OA 1X9PA 2JK3A 1JE8A 5F5CA 4CP1A 2XUBA 4AQ6A 1SPPA 1OPOA 4NIGA 5IVCA 1CPMA 1RHI3 1AKHB 1S8NA 1PK6B 2YY1A 4C8DA 2OZUA 4DFSA 5A1LA 1ND3C 5BNNA 2IJLA 1LQ1A 2ME0A 2R16A 4S05A 4KBZA 4CXWA 3D6EA 3FX3A 1SMYF 3GVAA 4WV8A 5A6QA 5DPNA 5FLIA 1ZGWA 4IEYA 5EFUA 4M73A 4Q47A 4JX5A 4Q4V2 2LRDA 5L9BA 1FBSA 5GALA 3SC7X 2OXBA 3ZDVA 2WNVC 4XCAA 2HWE2 4NVPA 1E5SA 3PU8A 1Q5OA 3CMYA 3GX4X 3KZYA 1MIJA 3R0AA 2K46A 5AONA 1P7JA 3GFIA 1SZBA 1ULPA 3NNLA 3GCMA 1BM9A 1W2OA 5AFBA 3BCBA 5A32A 1FTTA 3GMEA 4BEHA 1HW2A 3M8FA 2WZEA 5DAWA 5JDBA 1QVTA 3LQRA 5CKNA 1VQ6I 1TBXA 2GNMA 3OBRA 3QU6A 2X5IA 4DBQA 1OKRA 4JHZA 1LOAA 4RS5A 4PJLA 1HB4A 3M3EA 4CDWB 3NJZA 2Z99A 3WOGA 5IT6A 2Q8EA 1LTEA 2GNTA 1NE4A 3CCVI 1R00A 3LF7A 3Q8AA 4O65A 4UW3A 1OLRA 2ZXJA 2JD4A 4IV1A 4LQRA 3WTTC 2D5HA 1PGW1 2WFF3 1KONA 2ADEA 2TCTA 1XMXA 5FRMA 1YW9A 2HU9A 1QA6A 3SNMA 2DQRA 2VKEA 3K2OA 1DGRN 1OQEA 2KIQA 4A3MJ 4K9SA 1VBC1 4PQ9A 4NQWA 2VULA 5D8LB 1Y4WA 2VTXA 2VUAA 4DYQA 2R5ZA 3S30A 5CYVA 5M5XJ 5EGOB 4EEFG 2TNFA 5J47A 3BJAA 1IRFA 1SMVA 1Z21A 3HBZA 2Y0IA 2WTEA 4AEKA 2GA2A 3U2RA 3QPTA 3BG5A 3IWZA 3QAHA 2P34A 3N9OA 1H4GA 5GAHJ 3ZQGA 3DPRB 4S04A 5E18F 3OUJA 4Q27A 2ARCA 3IT8A 4YW7A 1T0FC 2L9NA 4G94A 4BJTA 2Y0SA 2ZABA 3VDXA 4YRVA 2EIDA 4XEZA 2HNHA 4MLOA 3ZYPA 3WGHA 1BK0A 3T4HB 1RUNA 2V6CA 1RXFA 1I9RA 4HVOA 2IC1A 2P3YA 2KRHA 1W7PB 1STMA 5FZ7A 3VBFA 4BQOA 2M30A 4G6DA 1G3TA 3SEEA 2DYRH 1JS9A 1O5UA 3ASNH 1YNAA 2DCKA 4UXAA 1MVEA 2JE9A 3W6VA 5GZDA 1U5YA 1VP6A 4Y4RA 1XB9A 2ZBKA 3FFZA 3VKMA 3ZQQA 3NJXA 1E0EA 4YRDA 2G9GA 3V8JA 3OYKA 1EA3A 4EATA 1JKPC 2MFZA 4LO7A 3ME2A 4JDNA 3AKPA 4HVQA 3CL1A 2FD5A 4JGZA 1C8NA 4ESFA 1H9WA 5KHIA 3B6CA 4WF2A 1X58A 4OMDA 1UJ8A 4HPKB 4KISA 2PHRA 3RS6A 3T1BA 2RS31 4XM3A 2MH9A 2BJSA 3M8JA 1IGOA 3OUHA 2CV2A 3VDAA 2AR6A 5K5QA 2BNMA 2VZRA 3I3EA 4IW3A 5FPAA 1WGPA 2PHUA 1B6AA 4XETA 3NNFA 2H27A 4FTSA 4BU2A 2H0BA 3PIOF 2HDCA 2XXZA 3CF2A 4S2FA 2A6XA 3S8PA 2QM3A 5A6XA 2ZA9A 2W25A 1VRH1 5DDJ3 1HRI3 2VVDA 4D8MA 4EWAA 4PJ0C 1VQ7I 2K86A 2YU2A 5EG0B 1AL22 1RUH2 5F5QA 1XNCA 1AYN2 1IN8A 2CS3A 1OMIA 1SFNA 4QIWN 3JB4C 1GR3A 3ZMUA 3JRDA 4A7KA 5FD5A 4Q4W3 3J7HA 3PJQA 5FLVA 2QDRA 1POQA 4RM2A 3T1MA 3MUZ1 4FPJA 5ICEA 1SD4A 3OOPA 2HWF3 5AIQA 4CDQB 3AB0A 4HKWA 4CEWA 4BXFA 1IS6A 4HAMA 3VZMA 1E5RA 2MG4A 5GTHC 3IDBB 2DOFA 4QPWA 1MSFC 3I2HA 4FT8A 3POSA 1W1WE 1OD3A 3N7MA 3ZR8X 4Y26A 1ZRIA 2ZPXA 2D44A 1O6UA 5CFDB 2OTLI 3V0BA 2VL8A 1C5IA 4QX1A 1O4XA 3E7LA 3GTJJ 3DYOA 5B2GB 4WBBA 2F4IA 1W2AX 1RUF2 5TRDA 3S7EA 4GQ7A 2P3IA 2ZKNA 4COUA 4FHTA 3N9PA 4S2HA 1WHUA 2JWTA 2VLAA 2E5ZA 3VBUA 4MQ9F 5I91A 1ZBA3 2KHMA 2JVHA 3H9GA 3CO2A 3POFA 4A5NA 1BA5A 2YC0A 4N43A 2D1VA 1AR83 4IHXA 2P3JA 1SHWB 4KGQA 5DUKA 1FYKA 4IQPA 1X4OA 1UX7A 1MMAA 1AKHA 1TW2A 2LTNA 4FP2A 3IWFA 4JC1A 4OOIA 2N8GA 2Q1MA 4XN0A 4AVSA 5K0UA 3UYJA 1J0RA 2PELA 3CCSI 1T98A 3MLKA 1T56A 4CDUC 2COMA 3EYIA 3W6JB 3H36A 2ZEXA 4KJZA 4UXNA 4BAYA 4LA2A 2PN5A 1QZZA 1C8M1 4X8NA 2YBPA 4AEDA 4BQ4A 5JHUA 5BNQA 3K7AJ 2OZ6A 2D6PA 1BBYA 3OG2A 1ZZBA 1LR5A 5DG1A 4H3WA 2P1BA 4YWAA 4IGPA 1YHFA 1R091 3ABZA 4XFBA 2UYBA 5IK5A 1Q8QA 4KICA 3DWLE 3OR1C 2BVLA 1H8TB 4IXAA 3F6OA 4K8FA 3VOEA 4CICA 3CKHA 5KHKA 3BPVA 4FX4A 1EF4A 2JIJA 2PX9A 3HUGB 2VTXJ 5FXXA 1GZCA 5C8WA 1XOYA 3F6VA 2V1DA 4CDWA 2WQ4A 2SLIA 4G7HF 1CZVA 5FUPA 1EPZA 5J3LA 4FQGA 2XKPA 2K85A 2EINH 1UAAA 4A3XA 1EUTA 2UY8A 2P6CA 3POYA 1PO21 4GWMA 4P9GA 3AJYA 5CISA 3BY6A 4XFGA 1I1GA 4XK4A 4FQZA 3HN1A 1EYBA 1N1TA 4G7ZF 4ENJA 1D8JA 5I8YA 1S7AA 2PAMA 1VBA3 4K6BA 3WSOA 3C2UA 1RUC1 2WWYA 2F17A 2Z42A 1LB2A 4AI9A 1NAEA 1CQTA 3J80Z 5FP3A 3MPBA 2QBYB 3FM5A 5EGOA 3QP6A 4CCNA 3HKZN 1WMFA 4NAOA 2DFCA 3D5LA 4RGUA 1MQTB 1YFYA 5BYNA 4XDPA 2RVCA 2IW5A 1EAH1 3AMPA 2ZX4A 5T5OA 2FA5A 3OS0A 3O1UA 5F2WA 1I39A 1KD7A 3MWMA 5F2SA 1HCRA 2RS11 2ADDA 3HT2A 2VC9A 2W1WA 2A7AA 3PUSA 3CZ6A 3ETQA 5FKMA 2WAFA 4FTEA 3HPHA 1UZCA 4KU7A 3LSHA 4HETA 1HA8A 1W7PA 3J7NA 4YW5A 4AL9A 4Y3OA 4KMQA 2VNOA 4CRQA 3TN92 5JOZA 4LKFA 5I0RA 1UNBA 1YO5C 4RLQA 2WZPP 1QHDA 5KXDA 4XIDA 3RKWA 1LNSA 4AHYA 4IEQA 1ETVA 2WYFA 1QNTA 4LULA 3IDCB 4BM8A 4GH4C 4HQEA 2XGXA 1WSUA 2D3PA 3LSGA 4YG3A 2VNGA 4CE8A 2HDWA 1MZ5A 5J48A 5LW9A 3A2KA 5HCAA 1LU1A 3EO6A 1YYNA 4XNFA 3HPGA 2UYAA 1C3HA 4E2SA 1GWKA 4HPKA 5A3MA 2VZ3A 4Y22B 4OMZA 3PUFA 3CJIB 2X48A 1BIBA 1RUJ3 1GVJA 4LXLA 4DUVA 5IW0A 4MO3M 4WM8B 4GJYA 3H50A 1A3KA 5CKTA 2WZR1 2BY0A 4CDXB 1DBNA 4NO4A 3T0AA 1ZR2A 5JIAA 1MSEC 3NV4A 1Y0UA 2WA4A 1OR7A 5GZEA 2YFUA 3W6KB 5A80A 2K9SA 1GWMA 3RPQA 1IRGA 4MYEA 5A3LA 5EG0A 1EUUA 4UI9L 5DN2A 5FR3A 5LZ6A 1XSDA 3VYUB 2EXIA 4L9TA 1VBE1 3QYEA 3AFKA 4DUXA 1AHDP 1A8DA 2VOXA 1B72B 2ZHLA 1C5HA 1F8VA 1VBB1 1KU7A 3C1DA 1AR92 3FHIB 3ISPA 1SD5A 5LA9A 1S7EA 1FAYA 3O1VA 1JUIA 2QQJA 3L2HA 2W84A 5JZGB 2Q30A 1YQ6A 2J7MA 2D43A 2D97A 3BTIA 3ZMDA 3CCLI 3OB8A 3H3VK 1JH5A 4TYSA 1G3SA 2GP5A 1ST8A 3IPVB 3IC7A 4OUSA 1P8JA 2G0EA 1GFF2 1OJLA 1XCVA 2GC3A 5CFDA 1EJ9A 2OVUA 2DF7A 3ESWB 4RAYA 1LU2A 3WCSA 1LODA 3QPHA 3OYCA 2RREA 5JHFA 4H55A 3WTZA 4LLOA 5D8AC 3VL9A 1PGW2 2E32A 2J1RA 3JBG3 4YARA 5FY7A 1VBA2 3ZFEB 4QHOA 5F37A 1A04A 1WW6A 3OSGA 1R5ID 5FUNA 4YGEA 2HZTA 2Z69A 3ZFFA 4IQ4A 2V09A 5EHDA 4O9GA 4XUQA 1X3WB 2V5YA 3ZQHA 4ZPIA 4OI1A 1FX7A 1ULFA 3TDZC 5A7PA 3LAJA 4A6OA 5FZFA 3K69A 1VQNI 2EFNA 3AX4A 4PDWC 1DGWX 4GWJA 1LHVA 3KQ4B 3D3AA 2L4AA 2DCEA 4A3EJ 4XF4A 4HF1A 4R52A 5LLQA 3S17J 2HOTA 2FBKA 1Y43B 1XE8A 3BR1A 3EUAA 4HF2A 3U0ZA 4F8AA 3F8FA 1JMUB 3KMHA 4K2EA 2ZNZA 3T0YA 3SLIA 2E7XA 3FM3A 4LHKA 5HXVA 3WW4A 2PA7A 1IHMA 5LEJA 1RUOA 4IQJA 3GO5A 2RC4A 4LMYA 3EUHC 3L1PA 3WDWA 2CU7A 3MIFA 4X6RB 1IJWC 3FF5A 4AM3A 3POIA 4MHRA 5FY8A 4COVA 5CQGA 1MS1A 3KGZA 5FK8A 1IG3A 2PAEA 3SZGA 1QQP3 4C0HA 5LD2C 4I0AA 1H8TA 3FUOA 3KFWX 3I2IA 3JD71 5FKOA 1B35B 5JIUA 3KYCB 4G8XA 4PBOA 5KCMA 1XSXA 3HUGA 1G86A 4LITA 1BR2A 3GJBA 2W1SA 2WN3A 2GLOA 4Y33A 4H7MA 1K4SA 3KF5A 1SQ4A 5D5VB 3B9CA 4EWDA 2MC4A 2YB7A 4D94A 1LHNA 5AIPA 3WNNA 2D6MA 3M3IA 5ANNA 1REFA 1YEWA 4EGZA 3DL3A 2VE1A 5FB2A 5FKBA 2G4IA 3PIPF 3WTWC 3CCRI 1G4DA 5FPZA 1ZYRF 1OF4A 5DZFA 4BQNA 5IVFA 1YFXA 3M3OA 2VBWA 4IV3C 2M45A 2D6OX 1R1A3 3J7AY 1U12A 2DN0A 2OPWA 2V26A 3ZKUA 4D1QA 2VCBA 1POV0 3JRIA 3VBHC 5CFCB 1X1BA 4DQ2A 4B3AA 3TO6A 1K79A 4NIAA 1T2XA 1F1ZA 2QBYA 1V5FA 2PJPA 3BTZA 2Y0SN 3U1XA 5C3OA 3IN9A 4XRMA 4MV2A 4Y1XA 1O7LA 5AC93 5CBLA 4H14A 2ZGOA 2VQTA 2DA4A 2UZKA 1MQTA 4OI0A 3DYPA 4LBMA 4WM7B 2JDNA 3Q8EA 1JOJA 2H0VA 5LB6A 2WBMA 3SH4A 1ZNPA 5FYYA 2L01A 1IN5A 4A3CJ 3PTRB 1RYYA 1GBGA 4Q5OA 2LROA 3RI9A 3D5RC 2LVSA 1MZEA 5ICCA 1P7IA 1IZ3A 1LEAA 4HSLA 5IK8A 2IAIA 2MA3A 5FOBB 4BK5A 1S0GA 4ZY9A 4YW4A 5FZDA 5KXBA 1VQLI 5FZLA 4XLEA 1R23A 1CJDA 2YU9J 3WDXA 5C3EJ 3FBMA 2I45A 1AOYA 3D0SA 3JBG2 1NXD1 2OKXA 1PIV3 5FPXA 4GFBA 1OPMA 5J1XA 4XBNA 5H9SA 3K3NA 3DN7A 4P9XA 1PJRA 3QD6A 5F6KA 2R5YB 5FZ4A 4FFHA 4XLPF 1J58A 2YYOA 3GXOA 3DPLC 1XE7A 5FYCA 3S7IA 2X0LA 3WF2A 1RMU1 3P5JA 1XNKA 2X1DA 3D4KA 1N1YA 4JYKA 3A0HC 1O3RA 3CF5F 4C1XA 3OGJA 1UX6A 5FZCA 3OYJA 2A5ZA 4N9IA 3K4MA 4LK6A 3HRUA 4HVRA 4MGKE 1W6QB 4DRRA 2VKHA 1V9U3 4EQVA 3FK7A 4Y22A 2IT0A 1RUG3 3CJIA 2DLLA 2HEYF 2HVQA 3DCQA 5F1RA 5JR3A 4OAYA 4AZZA 1F2NA 3AZZA 3OGGA 2NPIA 5FZOB 3I3MA 4FAGA 4WM8A 1NG7A 3VB2A 1MEC3 4YGCA 5FLMJ 4BE2A 2MEV3 2EIBA 2ATFA 5HPOA 4CDXA 2R073 3HC7A 4XHXA 2CDOA 1WI9A 3QLQA 3BN6A 4CCKA 3LPGA 5FZHA 5J1YA 5J8CA 3WGIA 1QGPA 2DVGA 4DZJA 3AJZA 2AH2A 2FU4A 2Z3YA 1FBUA 5E3LA 5JXJA 3WQ0A 3NAPB 1B72A 4Q8KA 1IUFA 3GJAA 4FFFA 1V6IA 3FUQA 2Z2SB 2E26A 5C4XJ 2L9VA 1J5YA 2JWPA 4OVEA 3L2VA 1R1ZA 2XRNA 2VM9A 3GZ6A 4BDVB 1TT5B 3C3VA 2RM22 3MFCA 4LEJA 2W91A 2WBKA 2C6YA 2ZMKA 1U78A 3M3QA 5BY5A 1QJEA 1X2NA 1BEV3 4FI9A 2JICA 1Z7LA 3IPVA 2VMFA 3I4NJ 1UO9A 3OEBA 2C9KA 1S0EA 1KFXL 2VZSA 1UU5A 4DY3A 3M70A 5C8CB 1AYM2 1JYNA 2O8OA 2WWSA 3IIIA 4E8DA 2FHRA 1EKEA 3M07A 2W46A 4PJJA 4HX4A 3ZFEA 2PHLA 2FOKA 3VBRC 6PAXA 3M8LA 2WQ8A 2BFUL 4QHZA 5EYYA 4B1LA 1ND3B 2GSYA 2YMZA 2XJTA 2HPMA 3L9JT 3BQYA 3L7WA 1Z0XA 1HXS3 4IHTA 2ZXWH 1HF0A 3IAPA 3WF0A 4A4AA 4EZ4A 1X2MA 3KPHA 1R6RA 1R1UA 1GLHA 3ZRGA 1MACA 3RCOA 2RGVA 5LA1A 3HM5A 3QRFF 2YR2A 1XBFA 1SAUA 2O3FA 5M5WJ 1KDMA 4HK9A 2KA3A 5D2AA 1OH3A 3KIOA 5D5XB 3DYMA 3N3HA 2BP6A 3O1OA 1ZREA 4HXCA 5FREA 2A3XA 4BQ5A 1AXKA 2HZDA 5KK1A 1T6GC 3C7GA 1HLVA 2M8EA 1UMIA 2QSHX 4Z92B 3FXJA 2GIVA 4N53A 5IK4A 4J19A 3ZQCA 1KEXA 2WO2A 1JTZX 3T2QA 4PHZA 4ETSA 5IVVA 4PQQA 5LA0A 5C5TA 2BVMA 4Y20B 2HDDA 1PMJX 1FOKA 1WPKA 3I3QA 4CUGA 3JREA 3VYRB 1QJZA 1AR62 2BY1A 4K1YA 4E4HA 4AAPA 3MGUA 3JRGA 4Q4X2 1B35A 2O03A 4UFKA 1RUE2 4GB33 4XJUA 2N7GA 1SFUA 4CPBD 3HQRA 3HOTA 3RZHA 4AI8A 1Q56A 2ARAA 1NA1C 1OURA 5FJKA 4UUVA 3POEA 5FYMA 1ULCA 1K5JA 3WNXA 4F91B 1WMDA 3PU3A 4C91A 2VT3A 2AQFA 1LESA 4CTEA 3MKLA 1W6MB 1KYZA 4HBNA 5J36A 3WQBA 4YFNF 1O3TA 1FI2A 2V9KA 4PDKA 1GNZA 4W1UA 3VD4A 4GXLA 4AE2A 1DP0A 2R072 1HW1A 4JTNA 4QT6A 5LFAA 3GCXA 1O4YA 3LIGA 2LLKA 3MEPA 1POGA 5I0TA 5DUWA 1P4AA 2DVBA 4EM1A 3CBNA 3VZLA 1PZ7A 2ORXA 2BOIA 5F6FA 3CTAA 3ZIXA 2DPDA 2FZ1A 5CFCA 2K3PA 1YIFA 1WKMA 2WT0A 1U0JA 4IDZA 4I0BA 5JXGA 3PHMA 3BC8A 4FVVA 4WX9A 3H5AA 2BNNA 4QQPA 1K5MB 4RS8A 2V1XA 1TWFJ 3ILNA 3T2OA 3EB7A 3LKJA 5LBQA 1VBE2 5FYZA 3G6EI 4WM7A 2VQAA 4YG0A 3B3QE 4Y5Z0 3ABUA 5T3NA 4XJZA 4UFHA 1ZR4A 1YI2I 4Q5SF 4A3GJ 3F8MA 3TO7A 1T6BX 1US2A 3ZSLA 2X6OA 4SLIA 1XGSA 1GU3A 4AFBA 5FGMA 2R0FA 3JW4A 3LOBA 3JTGA 3R61A 3CMAI 2BBYA 4D7TA 2LR8A 1R082 2B7EA 1R71A 5L3BA 2D3SA 1HV0A 4L5IA 5HS7A 4EE2A 4FCYA 3TBDA 4FOQA 1OA3A 1GANA 2FMYA 4ITCA 1VZ0A 1F5JA 2QYOA 4L8QA 4L5EA 1Z7S1 5J3UA 1UYYA 4XXAA 2PFBA 3BLYA 3OY8A 4LLLA 4RA0A 5A3UA 1PM4A 1JYXA 3DGTA 1D0YA 2VOVA 2XL9A 1WA6X 2HWD3 2C4XA 1W9FA 2AO9A 4NOTA 3CHXA 3W9AA 2XSDC 3UV9A 3WTXC 4OIOF 1YS7A 1Q8VA 2ZZJA 1WUVA 4YZ4A 4ENKA 4H0EA 3WCRA 2QQWA 2NS0A 2XHNA 4META 4AHXA 4QPGC 1Q8SA 1JKRC 1DLCA 2ZGQA 4BBRJ 4R9AA 2O5RA 4ZU4A 3RQ4A 4OYUA 3FXLA 5ABJB 1JUPA 3PFYA 4UAPA 4M4PA 2KFDA 5CVVA 2ZGLA 1FOXA 1XU2A 3VZOA 3HL2A 1ETWA 2P0WA 1WJBA 1TWCJ 4CCDA 1UAIA 2R3SA 1QDOA 4BUPA 4D5CA 2NP0A 5KNLA 1WRJA 4WVMB 2JUGA 1RGSA 2QEXI 2A6YA 3J7YJ 4JQTA 1IN7A 3FHZA 2WNUB 5BPIA 2CW8A 2GOMA 3N05A 5T54A 2G9ZA 4XVHA 2IA2A 4CU7A 4IHVA 2M3AA 1TNSA 3G7DA