1O3SA

Protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRDTVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*AP*AP*AP*AP*TP*GP*CP*GP*AP*T)-3'
publication title Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: Alteration of DNA Binding Specificity Through Alteration of DNA Kinking
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 60
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o3sA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o3sA01
2QBYB 2BNMA 3FJSA 3EYIA 3L2CA 5BS6A 3HRTA 4AWXB 1K78A 3GF2A 5HDGA 4RD7A 3FX3A 4BHPA 4IRIA 3FXQA 2P17A 4YIFA 4G9YA 2GXGA 3UKVA 1GQGA 2QQ9A 4OIOF 4MGRA 1ZGAA 5JI6A 1QBJA 2PHLA 3PQJA 1YO5C 3U1DA 1DP7P 1LJ9A 1QZZA 3VEPA 4O3MA 2E1CA 1S3JA 2BV6A 3QU3A 2ET7A 1ONVA 1Z91A 4QM8A 4NQWA 3P7NA 1EH7A 4WK8F 3CEWA 4QM9A 2GA2A 2W24A 2Z33A 3NEUA 1RI7A 4ZU4A 3NW4A 2QZ8A 2CAVA 2ZKZA 5LHHA 4MTDA 4IEOA 2H94A 3I0TA 1CAXA 1CGPA 1WGPA 3MEXA 2ZXJA 1J59A 4HSLA 4EJUA 2A07F 2PI0A 5D4SA 5D4RA 3CJXA 4WCGA 3K69A 3F8CA 5L3BA 1IW7F 5CU1A 5DCFA 3JZVA 3KP5A 1XGOA 4EM0B 3ZMDA 2HQRA 1BN5A 3MAJA 4ENJA 1DDNA 1FSHA 1YFYA 3BZ6A 3OGJA 4MEYF 3IWFA 3RZZA 5K5QA 1TQ5A 4IPAA 3RPQA 1KU7A 2KJCA 2Z3YA 1CAUB 1Q43A 3F23A 3H1MA 1AWCA 3GFIA 1LR5A 5J8CA 2FBKA 4EWEA 5FD5A 3QPTA 2D40A 1U78A 1Y9QA 2P5VA 5L3GA 2ZO4A 2EAAA 3H3UA 3KP2A 3VFZA 2XL7A 1W7PD 2QVSB 2KIMA 5DCMA 1IN6A 2K86A 4YSFA 2GAUA 3E5QA 3V7CA 4EGYA 4UNOA 3T5XA 4YYOA 2R7FA 1Z6TA 1KYWA 1SAXA 1S7AA 2P7CB 3TKYA 1K79A 5F1RA 2D1VA 1IPJA 5D6FA 1J1LA 4LJZF 1PDNC 4EM2A 1GHCA 2Y48A 3FMSA 2OZUA 2HKXA 5DUIA 1R58A 1KQ0A 3S7EA 3K0LA 1IXCA 2GC0A 1O3RA 2GA1A 1OKRA 5ILSA 4X6QB 4A0ZA 1FBQA 3TO7A 3FF5A 2PHDA 4EM1A 4BXUA 3JSPA 4L18B 3PFIA 4N9IA 4XF9A 3HOSA 2B0LA 2L02A 4MHGA 5FQ0A 1T0FA 3M1EA 1GXPA 1XDSA 2IXIA 2FMLA 1Y3TA 3F8FA 2Z99A 4ESJA 2XKOA 3DPLC 4LULA 3EETA 4A0YA 3QP5A 4MTEA 1ON1A 1Z9CA 2PN6A 4HF1A 1F4KA 2VPVA 1YW8A 3IBMA 2STTA 2HFHA 3HQXA 3E6BA 2WC2A 3LA2A 1MD0A 2K27A 1YUDA 3GZ6A 2XAGA 1PP7U 5HDNA 1U8RA 2EB7A 2WV0A 3OCPA 1TNTA 1GQHA 4LTAA 4FAHA 1XGMA 1ZRFA 1EY2A 1X3UA 3FWEA 2MBFA 1ZZ6A 5CVJA 1J5YA 1TQIA 3W6JB 4XLNF 3BDDA 3IRQA 1YLLA 3EYYA 1XMAA 4B09A 4LUMA 3RJPA 4LK0F 4HLTA 2YR2A 3C7JA 2ZJ2A 3SCFA 1S8NA 4Q47A 2PFWA 1XGSA 2QYOA 3EBRA 1QQIA 1R00A 3C3VA 5E1RA 3TOAA 2K9ZA 3BWGA 3JTGA 2IJLA 2YU3A 3WGIA 4RB1A 3D0SA 3KEOA 3H7YA 1YFWA 3BPVA 1BI1A 1JUHA 1HXDA 2NS0A 2DFIA 2WTEA 2FMYA 2JSCA 2PAKA 4KL1A 2VC1A 1O5LA 4ORFA 1ZAOA 3ETQA 2COMA 4KIBA 1J0RA 3TGNA 4GYGA 1KQ9A 4IESA 2B9UA 4JTOA 4L11A 1U5TA 2PG4A 3P9CA 3COAC 3GX4X 5E20A 2F4PA 1YW7A 4I98B 1V3FA 1SFNA 3MCZA 4M72A 1UIJA 4XF0A 1Q1HA 2DI3A 5JSRA 4IXAA 2NNYA 4OINF 2DPDA 5FD6A 1E17A 2WFPA 4YFNF 4GYIA 1IPKA 5E8GA 1WI9A 3DXJF 1FWZA 1LKNA 3ML6A 4QGNA 1YFUA 5LEKA 3RYPA 5KHHA 2V09A 5AIPA 4MGZE 3C1DA 3TOBA 4KFCA 3VODA 2HS5A 3M8FA 3KSCA 4K2EA 3QPHA 5JSPA 4OMZA 3AAFA 3TNPB 3ES1A 3LZZA 3GFLA 3ZMVA 2FEZA 5DUKA 1RNLA 4XSXF 2QENA 1SD4A 1BJAA 2Q1ZB 3ZDSA 4YFXF 5TRDA 1LRHA 3ZP5A 3U11A 5KK1A 5BPDA 2IVMA 4LG0B 2CV6A 2OA4A 3U0ZA 3RKXA 2EA2A 1F9NA 4I7HA 2Q0OA 2XHKA 4JBAA 3QOPA 3IKTA 2ATFA 4PIZA 1W7PA 3K1PA 4YIIA 2UXNA 2EFNA 3K9TA 1UB9A 2VOPA 4QGLA 4YRDA 2UY9A 3DV8A 4PZJA 1YW9A 3KMHA 3N4MA 2QWWA 3F3XA 1BIAA 2ACJA 1ZNPA 2JPBA 2Z5UA 3V8KA 4KDPA 2NYXA 5JFRA 3J81Z 5E1WA 1IZ1A 4Q0SA 1VJ2A 3S7IA 2V9VA 2Z2SB 3O2PE 3RDIA 2UY8A 5HLIA 2H27A 4A0XA 4BHBA 4L9VA 1I5ZA 2Q4SA 2PEXA 1DUXC 3EO6A 3VOEA 3J80Z 2JRTA 3BJOA 1BBYA 4CZZA 3WTWC 2J5OA 5CJ9A 3OF1A 3EUHA 3HTSB 2A61A 2ZMEB 1IF1A 1WKMA 4H0EA 5L3DA 2VE9A 3I4PA 1T6SA 4Z82A 2ETHA 3ZPLA 4NVPA 3LSTA 4ASNA 2KIFA 5J6XA 1J9IA 3GW2A 3SCHA 4U0WA 3FE5A 4G7OF 2DQLA 4HVOA 3BPZA 4U0VA 4L5IA 2DO7A 1RGSA 3HSFA 4KT5C 3ABTA 3G3ZA 2KIUA 4Q0QA 1TW2A 4S04A 4G7HF 2V1DA 3LAJA 4GGGA 1ZHFA 4R1HA 3R60A 3V8JA 1PP8F 3WTZA 5D5XB 1QGPA 3RNSA 2M30A 1L3JA 3H1YA 5CLSA 3CUQC 2RVCA 3WG9A 1Z6RA 2DT5A 3FM5A 2F5FA 4Y15A 3CUQB 1NXMA 3FMQA 5FCCA 4J1WA 3DFGA 4EVIA 3TNQA 1R5HA 3D0JA 2Z9OA 3FHIB 2D2WA 1K78B 3T8RA 4UHTA 2P6TA 2UXXA 4A6DA 2E7WA 1ZVFA 2FA5A 2FNPA 2FNAA 5I93A 2IA1A 3USSA 4FBFA 5ICCA 1OYWA 4UV8A 1X8EA 3SXWA 3RKWA 1UFMA 1I1GA 3GXOA 3LA3A 4IRGA 3QRFF 1XN7A 4HBLA 4DNCA 3WU1B 2H6BA 3VB2A 1S29A 4HV5A 3OD0A 4M9SA 3M8EA 1TNSA 5LHGA 1LQ1A 1QWRA 4HN0A 1ON2A 2O61A 3Q9SA 2XGXA 2CWEA 3FZVA 4HQMA 3ISPA 1OR7A 2PA7A 1CAXB 3B73A 2EFQA 2VT2A 1ZRCA 3MDPA 5I0RA 1SEFA 2HWVA 2HZTA 4JK1X 3DP7A 1U6GA 3MPBA 1LDKB 3KZYA 5D6EA 2DU9A 4LMYA 5LRSA 4P96A 1Q3EA 2HJIA 2BNOA 5LGTA 1K7AA 3E6CC 4XF3A 5CVRA 4IEXA 4EGZA 1CF7A 3KP6A 3H1WA 1G3WA 4AIKA 3ZMUA 5IT3A 2XLAA 4D7SA 3J81K 1MKMA 3CLOA 3JTHA 5BQTA 2BE5F 4IEUA 3MQ0A 4U88A 1FYLA 3DL3A 1Z05A 2MLKA 3KLNA 3WTYC 2EV6A 3TQNA 2YSRA 3K1MA 3QACA 2JT1A 1MDMB 4IEQA 2F5DA 5JSOA 1SFEA 4S05A 4HQEA 3J80K 3IWZA 5ICFA 4IF4A 4HVQA 5DCMB 2PAEA 4LEJA 1EV7A 1W5TA 1NE6A 3MYXA 5JR3A 5DV5A 1RUOA 1OPCA 2IXHA 3ECHA 3PQKA 1YLFA 3HIFA 3V8LA 1YTYA 2HR3A 2G7HA 2HTJA 3WE2A 1SQ4A 2OU2A 4XFBA 4RGRA 3ELNA 6PAXA 4Q0UA 1H9GA 4PDKA 1QXRA 3CUOA 1RTVA 1O3QA 5JR7B 2ADUA 2UYBA 4CGZA 4Q0PA 1YIOA 2QBYA 3I54A 4ON0A 2MLGA 5D5VB 2STWA 4HAMA 1JHHA 4KWKA 2Q0AA 1KYZA 5BPXA 1HW1A 5DYMA 1L0OC 1B9NA 1ZRDA 3HUGA 4AXOA 1OMIA 1U2WA 5D5WB 2VN2A 5K8SA 3F72A 4OLLA 4QX5A 4WVZA 5FQ0B 2UWMA 1KQ8A 2ZNZA 2D93A 3E5XA 1VTNC 4IRHA 1G3YA 2OZ6A 5D8KB 1B4AA 1QY4A 3WE3A 1UPIA 2A3SA 5LHIA 3LOIA 1LEBA 3EQLF 2M5WA 3T0YA 2ISYA 4MH0E 4LLNA 2NNNA 4HW0A 1O4TA 4KA4A 4HLYA 3FXUA 2HYGD 3RI4A 5DEQA 4UBGA 1XCVA 4GCVA 4RB3C 2OZJA 3U10A 1FNNA 2M45A 3C18A 3H3ZA 4HMZA 4M71A 1P2FA 4E70A 1R1TA 1DZRA 1O7FA 1R1UA 3WTSC 3I7DA 4X6RB 2ESHA 4BHCA 4A5NA 1Z1DA 2IW5A 3CF6E 5HOOA 3M3IA 1FYKA 4LA2A 4ENNA 2FU4A 1CAVA 2ESNA 1OYYA 4GULA 3FM3A 1Y0UA 2L54A 2V6CA 5FDBA 2PFBA 3F8NA 5I8YA 1YFHA 4B29A 1WRJA 2IXKA 2XVCA 4IVNA 2W25A 2IP2A 4R52A 4KIFA 2CGPA 1J75A 3ZN0A 5FPZA 4IHSA 2PTMA 2EV0A 2FE3A 2O8XA 5HLHA 3WGHA 4D0PA 4BIFA 2A6EF 1R22A 1H1IA 1J3PA 5J3UA 3E5UA 2QLZA 1I1SA 2E9QA 4OMYA 4I2OA 1ZREA 1HKSA 1V4RA 4R8HA 5E1ZB 1U5TC 5J8FA 3EQEA 2RDPA 1RL3A 3WW4A 3E3VA 5AVPA 2GU9A 1U5TB 3ELKA 4AVBA 3TO6A 1HW5A 1XCBA 3GEZA 2O8QA 4LLOA 4U0YA 3D82A 1QNTA 2QM3A 5FO5A 3I71A 2P5LC 1ULYA 4GXOA 3U2RA 1MJ9A 3HYIA 5K5OA 4HZFA 1BM9A 2EFPA 4WXCA 3KCCA 2K7LA 1SMTA 3HOTA 1YHFA 5FB2A 4HX7A 1QPMA 4CDGA 3BB6A 4PIXA 2XROA 3JSOA 2HYFA 4E2GA 5C8WA 4CHUA 5BV6A 1CX4A 1ZRRA 3K2ZA 2EK5A 5D1IA 2XASA 3ST7A 2QUFA 3F6VA 2RV8A 4I0AA 4OOIA 1LDJA 5BY5A 4IJAA 1R5GA 2J5PA 3KGZA 4UXNA 2FRHA 2C6YA 3BALA 4EJWA 3WTTC 4HBNA 1G3SA 3RYRA 5HS7A 2O0YA 3GUDA 4LFUA 1HW2A 4E2QA 1L3LA 5IT9K 2EFOA 2X0LA 4M73A 4KUMA 4AD9A 2RNJA 2UYAA 2V79A 1FOKA 1IXSB 4N9HA 3I64A 4MZUA 2L4MA 4RGSA 3IHUA 4I02A 2V1XA 3L7WA 4XF1A 4OU0A 3HSRA 4LD5A 2BGCA 2GC2A 4G8XA 2IXJA 2XV4S 1FLIA 2HDCA 1T38A 1BI0A 4O5VA 3Q5FA 2MH2A 3SZPA 2CAUA 4O6JA 3DKWA 3ULQB 3FFQA 1FX7A 1XE7A 2RC4A 1ZZCA 5BXXA 4HN1A 4ZU7A 2EJRA 4PIYA 1A04A 4P9UA 4ESBA 1ZN2A 5I0UA 1SD7A 3UKTA 3R4KA 5L3FA 1KU2A 3HRMA 1CAWB 1IAWA 4QGMA 3LQQA 3CTAA 4IEZA 4MQ9F 4ENKA 2PJPA 2GH2A 4Q0VA 1C0WA 2QVOA 1H9TA 3WU0A 3I59A 2FF4A 3SHRA 4WXDA 1UHWA 2H6CA 1IRFA 2N7GA 4LB5A 4AVCA 1YS7A 4UBHA 1I6XA 3S0MA 4ZYEA 1IUYA 1MJBA 2P7VB 4AQ2A 3HRSA 1YG2A 4ZH4F 4XLPF 1VP6A 1DGRA 2P5KA 5ILUA 3O6BB 3LAPA 3F6OA 1D8KA 5E18F 3VHRA 3EDPA 3F8BA 4IEWA 2RQPA 3KP4A 5CYVA 3IDCB 2GC3A 5CADA 3T8TA 2FSWA 2W57A 3ECOA 2HOEA 4L9JA 1UW8A 2F5CA 5L3EA 2VT3A 1FBSA 5LGUA 5I91A 4XF4A 4IERA 2B5HA 1UCRA 4HLXA 1TTYA 4KNYA 4M74A 2ZCWA 1RC6A 3R0JA 2GZWA 4PGGA 1VR3A 3G7DA 3RTRA 1EH8A 1ZZ7A 1TQPA 2ZNYA 4BH9A 3JW4A 5K5RA 4L0ZB 5E8IA 2FBHA 1BC8C 2FXAA 1X7NA 3DQVC 4LGWA 2JTVA 2P4WA 5TJJA 2A69F 3WTXC 2H09A 4IEYA 1R1VA 3KP7A 4HF0A 2LSOA 2MH9A 4RGUA 2XLFA 1W4MA 3BJ6A 3WTVC 2EV5A 1FT9A 2VQAA 1P4AA 5H6RA 3BOQA 4EWAA 2XIGA 4ZZDA 2DAOA 3R6SA 4L2NA 4HF2A 2CO5A 4EMSA 3O14A 2BEOA 1B1BA 3BCWA 4AIHA 4FX4A 4YG2F 5KVRA 2JZYA 2X4HA 4KWJA 4CICA 3SZTA 1PUEE 4BQAA 3ACLA 5FLHA 3CO2A 2VBYA 3R0AA 2D5HA 5E17F 3F8MA 3P9KA 2RKHA 2LNBA 5J7MA 1FP2A 2F5EA 2VOOA 2VXZA 4N0BA 1OI6A 1J3RA 2XUBA 2ZMEA 2DLLA 2R3SA 2YX7A 1FC3A 3F21A 1HKTA 4EV0A 2AS5F 1IRGA 2QQAA 3H92A 1XE8A 2KRFA 2HEOA 4QWQA 4UUVA 4ONUA 3S2WA 5DD8A 4QMAA 4Z2YA 4HYEA 2DCTA 1NYWA 5BPIA 4IHTA 1WA4A 4IEVA 2VC0A 4ZZLA 1FZPB 1V70A 1EPZA 3GYDA 1KGSA 4F7ZA 1J3QA 2PBIA 3HT1A 4ETSA 1XDUA 2K4BA 3L00A 4U7DA 1XD7A 2L3DA 5FFZA 4L9NA 3R61A 3EJKA 4NB5A 2VECA 2P6SA 4U7BA 4DINB 3CL1A 5E16A 3CUQA 1FBUA 5FLXZ 3NJZA 4LLLA 4META 4MV2A 2JPCA 3K1NA 4MNUA 4M9XA 2D5FA 2HTSA 4RAZA 2C0ZA 2ZKLA 1U3EM 1EYBA 5ILVA 4EWDA 4TLFA 2L4AA 3CJNA 2Q30A 5I8SA 2ETEA 4MGYE 2DW4A 1HSTA 3EHKA 5A2QZ 1Q5OA 2HKOA 3DPTA 2VODA 5JCTA 4MX3A 3KZZA 3DEUA 4Q29A 1JXSA 4EJVA 1HQCA 1BI2A 4KWLA 1REPC 3E6MA 2PAMA 1K6OA 1JE8A 3HHHA 1S7OA 3NVCA 3IIAA 2BNNA 1KU9A 1DZTA 4XEZA 2XKPA 1NHAA 5BOXA 3BY6A 3GYHX 5DD4A 4KMUX 1O3SA 3FMRA 1YS6A 4L0YB 4HSJA 4MGKE 4XFCA 4R79A 1SFXA 3E6DA 4A2UA 1SD5A 3QP6A 1H1MA 5EFUA 1UD1A 1R36A 3NKTA 4RB0A 5KHJA 2A5YB 3IDBB 5IT9Z 1ZG3A 2QDRA 4ZU5A 1CAVB 3I58A 4RAYA 1YFXA 5J48A 3WW1A 5HS8A 3ABUA 4XFAA 1ZLKA 4ZYDA 4JQFA 1WWXA 1XSVA 2FQ3A 2IC1A 1B59A 3J7AO 5I0TA 4ESFA 2PLYA 4NHJA 4HA8A 2UZKA 4XSZF 3F22A 2O3FA 4M6XA 1E2XA 1MDMA 4DQ2A 1GVJA 3OV8A 4O9EA 2DTRA 1XSXA 1HBXG 3KFWX 4KICA 3NRVA 2EVXA 3N97A 1JHFA 2EA4A 3QAHA 4Z07A 4OFGA 1FPQA 3B02A 3CO6C 1OYIA 2OBPA 4HX4A 1G3TA 1ZG5A 2KJBA 1P4WA 1RZ4A 4HOBA 5CVVA 2KXLA 2PQQA 3WGGA 1PM7A 1ZX5A 4UVCA 2A6HF 2D1HA 2DK8A 1SMYF 4XFHA 2E7XA 3FZ3A 4EROA 3H50A 3MFKA 2YPRA 4MQVA 4XRFA 5EZWA 1JGSA 4FX0A 5KBFA 4WZCA 4QXKA 1ZYRF 5LGNA 2IRFG 1J2XA 1MJAA 4KU8A 2LDUA 2LF8A 3FHZA 3GFMA 5EEHA 1HSJA 2HGCA 4P9FA 1PMIA 4Q4ZF 4CO8A 5KHGA 2Y0OA 4J1XA 5ICGA 2FBIA 1CAUA 5LBQA 1G4DA 2GC1A 2DBBA 3D5LA 4UXAA 5H20A 3JAMZ 3HHGA 4OIPF 3IL2A 3I53A 2IXCA 2OPKA 1MGTA 2G7UA 2OAZA 3L2HA 3BPXA 3BP8A 4I01A 2IT0A 1DPRA 1F5TA 5AONA 5JVTA 2O6GE 4OIQF 1H0MA 3T1BA 3BJAA 1U12A 4F8AA 2WWYA 2Q8KA 1YQAA 5FLXK 2L01A 3Q9VA 2IPQX 2CFXA 4IEPA 4Q5SF 3U9GA 3NSTA 5CVUA 4PJYA 3WW2A 4HDUA 4HV6A 3V7RA 3I5UA 2OQRA 4IETA 2OA2A 4KU7A 3GZ5A 3ES4A 1ODDA 5A2QK 2ELHA 4FT8A 4KN4X 4LLGF 1WSUA 4JTNA 1ZG1A 5CVIA 2V1UA 3CLPA 3M9AA 2EA7A 4CXFA 1USTA 3DF8A 3M7GA 1KA8A 1B9MA 2MC3A 3QU6A 2P8TA 4G6QA 3KETA 4KMFA 1B6AA 4RB2C 5HI0A 3OOPA 2HQNA 3ZMZA 3GBFA 3ZN1A 1NE4A 3LWFA 1P6RA 5HLGA 1TQMA 2GWRA 2W85A 3MWMA 2D45A 5FPXA 4WXHA 2XLGA 3RKYA 3V4GA 4KN7X 3ZMTA 5D8LB 3SMHA 4M9ZA 2ET1A 4YNIA 3CDHA 2DK5A 4P9GA 1ZARA 3C3WA 3E97A 4OIRF 2PQ8A 5BUVA 4UVAA 3I59B 1FYMA 2QCSB 1W5SA 3IRRA 1I27A 1W7PB 4O9GA 4RS8A 4Y13A 2ISZA 4KIGA 2VBWA 1XMKA 5KHKA 2XAHA 1XB4A 3IKVA 4G94A 5ERIA 2IXLA 4BAYA 2YX4A 3WODF 5FLJA 4A6EA 4I3PA 2MNGA 1ZH5A 4P5OA 4XBFA 2GQQA 1O5UA 4MEXF 3TO9A 2M1BA 3RIRA 3SFZA 2OQGA 2XAFA 4PGHA 4WX9A 3HT2A 4JV4A 2EFWA 5I8TA 2PYTA 4G6DA 4WBBA 1T98A 3KGLA 4M6YA 4EQQA 3GLXA 1SFUA 5FLIA 5T3NA 4JVAA 5HVQC 4KYWA 1BC7C 2IA0A 4YARA 1UHMA 2NAZA 4EJTA 1FI2A 3LA7A 2M87A 2I45A 1EH6A 5C6CA 5HDKA 2M8EA 3GVAA 5ED4A 1LDDA 5AIQA 4XFIA 4XFFA 4RGXA 2CG4A 3O3KA 3M70A 5HS9A 4FHTA 3MZYA 5ICEA 4L5JA 1XSDA 1BIBA 4B8XA 5L3CA 3FXRA 3PNAA 2K0GA 5JAXA 2NRAC 3IC7A 2DQRA 4QLCU 2Y75A 4XETA 1LEAA 4Y17A 1TW3A 4G7ZF 2R7DA 3JAMK 1ZZ9A 1OD5A 4EJOA 1ZZ8A 1AOYA 4D7TA 4LA3A 2Z69A 1J58A 2GXBA 4HX8A 1FY7A 4LK1F 1NZCA 1GXQA 4LB6B 2K02A 2BYVE 2PMHA 2H0VA 3RPUA 4L9TA 4E2SA 1FXZA 2OD5A 1S6LA 3G73A 2O03A 1YWKA 3REOA 1LNWA 3ROUA 4UVBA 3PVBB 1DGWA 2O1QA 1STZA 1P4XA 2W84A 4WWCA 3ERED 1IN5A 2KKOA 1LVAA 2LKPA 1RUNA 4BYYA 5E1XA 5EEGA 3SQNA 1UIKA 3KEQA 1T2KA 1X8MA 3NL1A 2A68F 3BROA 4TV7A 5KHIA 1O3TA 1YYVA 2MD5A 2Y0MA 3L09A 1CAWA 1P92A 3DN7A 1F1ZA 4LG0A 5F6FA 1D5VA 2BBYA 4XFGA 3WTUC 4AVAA 2CSOA 1FSEA 3CO7C 2E1NA 2GIVA 1SD6A 3LFKA 2OYZA 2QQBA 4GO1A 3KLOA 4ZYGA 2VE8A 1IN7A 1EP0A 2ZBKA 1WLTA 2XRNA 3P9IA 1MZBA 4HDVA 4ENMA 4FAGA 2CYYA 1QO0D 4WF2A 1ZGJA 3SXYA 4I09A 3KP3A 2ZFWA 5DDGA 3KE2A 1KU3A 3ZQ7A 2B8MA 4A5MA 2PMUA 4MGIE 1XGNA 2RN7A 4HVRA 2G9WA 2TDXA 4A12A 3LWCA 1QXJA 1DPUA 2VONA 2MA3A 3HSEA 4P55A 3TDZC 3H9AA 4CYDA 3SHFA 1ZZBA 4AQ6A 5LRRA 3WW3A 1D3YA 1J7KA 5LEJA 3GWZA 4K8FA 4H7LA 1X82A 1G6NA 1R23A 2F2EA 2VBXA 1BOAA 1Z7UA 1O7LA 1LB2A 1CF7B 5H6QA 1OFNA 2FQPA 2LF7A 3NQOA 5K1YA 4YFKF 3MZHA 1ZLJA 3W6KB 3H7JA 3H8UA 1TBXA 1IXRC 1IN8A 3UKNA 1XRUA 1R7JA 5F64A 3BU7A 3TDUC 4I0BA 2MPFA 4BNCA 2AXLA 3HTUA 3L9FA 1QZYA 2RGVA 5FGMA 2DPUA 5LLQA 4AVPA 1D8JA 2MHFA 3OTFA 2CW0F 2QJVA 4LUKA 2XAQA 2IA2A 3RYKA 3GO5A 3LQRA 4Q48A 5I0SA 3HRUA 1HKQA 2Q2EA 1WQ2A 1UCXA 4PCQA 2EWNA 3GFJA 1RIOH 2XL9A 4UV9A 5D5UB 2K4JA 1IN4A 3LAGA 4ZYHA 1TLHB 1USSA 2QNKA 2VBZA 3PLQA 5JHUA 3V7SA 5BMZA 1BI3A 3SCGA 2CQKA 1FP1D 2XAJA 4MUVA 5FFXA 3ZMSA 2FOKA 1T39A 4AIJA 1O57A
chains in the Genus database with same CATH superfamily
2RVAA 2QBYB 1V6JA 1G9BA 1ACIA 1ULOA 5FZAA 3LOCA 1VQKI 2DVDA 4BEHA 1RKWA 4JGZA 3FX3A 1EV11 4IRIA 2DYRH 2JA7J 2P17A 4A3GJ 3MIGA 4Q4Y2 1U0JA 4YIFA 3KCXA 3KYLA 2D6PA 2JMWA 1H8TA 1DP7P 3VEPA 5FZFA 4O3MA 5FO9B 2E1CA 3I2OA 4DXZA 2ZPXA 2ZX3A 3SQOA 4IE7A 3WG2A 2WZR1 4WK8F 2Q5TA 3OSGA 2YBKA 1PNFA 4JKLA 1BL0A 4XORA 2W24A 4XRMA 2Z33A 4PLOA 3NW4A 4BUPA 4CU9A 2VOWA 1RUF3 2A6ZA 2ZKZA 5LHHA 4MTDA 3I2DA 1JTXA 2H94A 4QXBA 2CUZA 2R93J 1J59A 1N25A 4IQJA 1S2EA 3FXOA 1WMDA 5D4SA 5D4RA 2HWE1 4WCGA 3K69A 1H8AC 3F8CA 2GXAA 5L3BA 3LFMA 5CU1A 3PO3J 3KP5A 4G12A 1XGOA 3WP5A 5AC92 2HQRA 1U5IA 3MAJA 3RMXA 1X3WB 4MO7A 4Y52J 5C4WA 2PJRB 3U07A 3BT9A 1TME2 1YIJI 4C91A 2AENA 1Q43A 3S2DJ 3H1MA 4XJ9A 1DQ4A 3QPTA 3UKGA 3V56A 1U78A 4B1MA 3O0VA 5J36A 1CWPA 2P5VA 3Q8EA 1QF3A 5L3GA 1OPOA 2OX0A 3CU7A 5EIYB 3TBIA 2QVSB 2KIMA 5DCMA 3K70C 4KBZA 4AVTA 1QZEA 2GAUA 5C7GA 1LU2A 4UNOA 5FZIA 4PI0A 1TMF2 4JQRA 2AEZA 4DMIA 2WWJA 1BEV3 3OUHA 1PO22 1V54H 5F1RA 1JZ5A 3WDWA 4XZPA 4LJZF 4A3EJ 3M3OA 3OEBA 1XG1A 4E7KA 1JT0A 4PDWC 2HKXA 5DUIA 5FYZA 1R58A 2R1DA 3VN4A 4GH4C 1O3RA 5DUUA 3NNJA 1CIYA 4UUSA 2K9MA 3SEQA 3FF5A 2PHDA 1MBJA 1YQ5A 1GZWB 1X1CA 2WWUA 2L02A 2WNUB 1T0FA 1MW7A 1XDSA 1VBA3 2IXIA 4LULA 3EETA 3QP5A 4MTEA 4YZ1A 1QJY2 1ON1A 1Z9CA 2E35A 3IBMA 2WNVA 1AR93 1UZZA 3HPNA 3KPHA 4MXWA 4XC9A 4E4SA 1XTAA 3GZ6A 1APLC 1PP7U 4AEMA 1KDKA 2WQZC 3GCWA 3OCPA 2VQUA 4OZXA 4QPWA 4ASMB 2Y8KA 3FWEA 2K3FA 4N43B 3OR1C 3W21A 3PIPF 4BKXA 3C7JA 2ZJ2A 2HDDA 3SCFA 1S8NA 5JLXA 2VB6A 2WV1A 4E7JA 1S0FA 3EBRA 3OYKA 3PUBA 3M3EA 3ITQA 3AKQA 2R7SA 5C8CC 4U87A 2K9ZA 3BWGA 3H3LA 3JTGA 2PLV1 2YU3A 4PBOA 3WGIA 4RB1A 3KEOA 3ZRGA 1ENSA 5A1FA 1YFWA 1JTZX 3ONQA 2JB4A 2DFIA 3WHCA 3RWKX 1CPNA 2PHTA 1UU6A 4QDQA 4ORFA 5FLMJ 3IP4B 3TGNA 2FCVA 2ZSHB 4JTOA 1VRBA 1U5TA 5FZCA 3P9CA 2YROA 1R092 2DMTA 1A8DA 2IBDA 4M72A 4XF0A 5GZFA 5C70A 1GDTA 4BLIA 1ZBE3 1E17A 4HNUA 4YFNF 4GYIA 1IPKA 5E8GA 3MHZA 3L2UA 4XKCA 3S30A 3ZXFA 1NQJA 4P08A 4PF5A 4A42A 1YFUA 2R6QA 4XCBA 4URAA 1LULA 2ARXA 5AIPA 4MGZE 3VODA 2VQTA 4QPIB 3KSCA 4K2EA 2VM9A 3HWJA 2ZB9A 3QPHA 1JYIA 2IGNA 2YZ4A 3IMNA 4OMZA 1CQTA 3NNFA 3F2ZA 3OIPA 1W6MB 3I56I 2QENA 1SD4A 1HRI1 3AZVA 2E53A 2WAOA 2RR13 1W9TA 5KK1A 5BPDA 1VBA2 1ENQA 3WG4A 4OI1A 3RKXA 3U0ZA 3LPGA 3HOVJ 2ZXIA 1T56A 1F9NA 2Q0OA 1W6NA 3QOPA 3IKTA 5EZGA 2KDOA 2ATFA 4NJ4A 1AR92 1K4SA 2QQMA 2JG9C 5HV4A 4JGYA 2EFNA 4LMFA 2IGMA 5GP9A 4RHV1 5FUNA 3Q8BA 3O12A 4PZJA 2QWWA 1YQCA 3QPLA 1BIAA 1K6YA 4UFIA 1WLCA 2VOTA 1BA5A 1WCMJ 2VKHA 1SAUA 3J81Z 4OYUA 1F4HA 5JLVA 4B3XA 3N05A 3I3QA 2ELJA 4I6ZA 3ERMA 3GTJJ 1SLTA 3RCOA 4NPMA 2VOVA 3CC2I 1VNDA 2OTJI 4DNYA 2E63A 1VMFA 1UMZA 3SJMA 1ACCA 2NQYA 2B7EA 1BBYA 1HV0A 2ZMEC 4CZZA 1AL23 2HLEA 4H0EA 1IS4A 1T6SA 3ZPLA 1M4WA 3QYFA 3U1KA 1R1A1 2KIFA 1GNHA 3HR9A 5J6XA 4FE7A 2VG9A 2XQXA 3FE5A 4G7OF 2W68A 2LH9A 3HQUA 2CV0A 1CZTA 1R9TJ 4U0VA 3BPZA 1COV3 1JODA 1NG0A 3ZQFA 1XSQA 3WDXA 2DO7A 2NS8A 3WP6A 3S1RJ 2M0CA 3WDUA 3ABTA 1XU1A 4YW3A 4Q0QA 5FKCA 1CVNA 4E8DA 4G7HF 5JVVA 4DOZA 2V1DA 1ZBE2 4P9IA 1KRIA 3UGFA 2M30A 4NNJA 1L3JA 5FZBA 3RWNA 2BP6A 2B42B 2QQUA 3CUQB 3VBOA 4J1WA 1HQNA 5A3TA 1MZ5A 5FXZA 3AXDA 3I3MA 5A32A 3HBZA 3Q8FA 5K0UC 2JDUA 3WHTA 2R7QA 3FHIB 4PJMA 4BEHB 2XF6A 3CCLI 3V0AA 1ZVFA 4HG6B 3HEIA 1ETYA 1MS3A 1X2NA 1O4ZA 1KS5A 4IOAF 3KV4A 3VD7A 1X8EA 3RKWA 2VUJA 4DYRA 1UFMA 3N9QA 3K75B 4XHXA 4DNCA 1JYTA 4A3MJ 1S29A 4CP0A 5H9RA 3DUIA 5JMOA 1TNSA 1G59A 3AMMA 3DKXA 1QWRA 4NHYA 1WCQA 4HN0A 1ON2A 4XLAA 1LOFC 2XGXA 1Y6IA 3ISPA 2DOAA 2CNAA 5DUXA 3ZVXA 4ARYA 3B73A 2EFQA 4IOCF 1SEFA 4CE8A 1MS5A 2P2KA 3KZYA 1NCRC 2AZ5A 1K7AA 3BTCA 1PVXA 1R4MB 2CSGA 4YW1A 3FHQA 2BW8A 3OBRA 1W06A 5IT3A 4CEYC 4BQQA 2VL8A 5IOYA 4XM3A 1MKMA 2LG4A 1FYLA 1AL22 1A6CA 4IEQA 1D2SA 2FCUA 5A33A 2F5DA 3O1TA 2QQKA 3AM2A 1A35A 2WT2A 1SBEA 1JJ6C 4IF4A 4HVQA 5DCMB 1BK1A 4LEJA 4RR3C 5HNFA 3IZOA 1NE6A 1Y1WJ 3MYXA 4CRQA 1COV2 5DV5A 1U5ZA 4H2AA 2IXHA 1V0AA 1YLFA 4AQTA 1B09A 4CUAA 3OYBA 3FBMA 4P00B 2AR6A 1BMV2 3S1QJ 3RZDJ 3PIOF 4HKLA 1AYM3 2KM2A 2F4IA 1O3QA 5B1BH 5JR7B 2ADUA 3HBLA 2QKDA 2KFDA 2XPWA 2CQ7A 3C7FA 4AK3A 1T33A 3ZKYA 1HA8A 2W39A 2STWA 5LCWL 3HOYJ 3W3CA 2ZGRA 3KZ4C 1JHHA 4UUSB 2Q0AA 1Y43B 1JW6A 3CP2A 1PUFA 2DYCA 1HJFA 4AXOA 1H6XA 4JOMA 3ILNA 2P34A 4OLLA 1YJKA 2UWMA 4YVSA 1R082 1SLIA 3K4DA 4AEKA 1EAH3 4AYUA 5F8PA 3HDDA 4J25A 3DYPA 4DY3A 3R0RA 3ACHA 1G3YA 5D8KB 4Z1VA 2JKBA 3LPFA 5L7OA 3H8RA 2A3SA 4KQ7A 5ANQA 4E8CA 2R92J 5AC91 1UHSA 2P5BA 4FOQA 2NNNA 1O4TA 4D6QA 4KA4A 3ZO0B 1TME1 3CCRI 4HLYA 3FXUA 2HYGD 2QQIA 5DEQA 4P5HA 3CESA 4UBGA 2DVBA 2OZJA 1FNNA 5ABJC 4S0HB 4E70A 3NARA 3WTSC 4JDMA 1PGSA 5LY2A 2ESHA 5F3CA 1Z1DA 3M3IA 2BOJA 1FYKA 4A45A 3CJIA 5ANNA 3LSMA 3O5SA 2CRGA 1OJLA 4B3AA 5E79C 4RDUA 1UYPA 4JDNA 5J1RA 5FDBA 1LENA 1FOD3 2PFBA 4D8MA 2YU9J 4UW5A 1PO21 4XTPA 4IVNA 2CGPA 1DQUA 3GDBA 4IHSA 1GT0C 4AI3A 2EV0A 4A7YA 2FE3A 2A6EF 1H1IA 1J3PA 3H9GA 2BGOA 2E9QA 4DXRA 4OMYA 4I2OA 1ZREA 1C8M3 1RUJ2 1HKSA 2Z4FA 2LLKA 5J8FA 3EQEA 5FJKA 2LY9A 4C0BA 2GU9A 1U5TB 1PJRA 3TO6A 1Y8RB 2O8QA 3GCXA 4U36A 3NAPB 4CXWA 3KVAA 4YGDA 4G9SB 2Y0SN 1GUIA 1QJY1 3KCCA 1RJ8A 3HOTA 3DPRC 1AYM2 1UZ0A 1QPMA 3GBGA 1GV5A 2HYFA 4OI0A 3K2ZA 2SBAA 4KG8A 2QF7A 4GJZA 5FY9A 2XASA 3FN9A 3IKWA 3F6VA 2RV8A 4HKOA 4OOIA 4GAZA 1JTYA 1LDJA 4BL0B 4IJAA 3PNVA 1R5GA 2J5PA 4MVTA 3KGZA 2FRHA 3WTTC 1BVVA 5HS7A 1M1EB 4GIQA 3ABLH 2JE7A 2R7EB 1EAH2 1ZR4A 1HW2A 2DA3A 3H36A 3SEZA 1N77A 3ECQA 5IT9K 3OPWA 1A78A 4A3XA 4RLFA 4H7MA 4AHZA 2LD5A 4M73A 1HRV3 4KUMA 1ZM1A 1SFOJ 4AEJA 2W4SA 2YPJA 2XGEA 2RNJA 2DA5A 2V79A 1IXSB 1BW5A 4JGYB 3HJEA 3ZGKA 2L4MA 3MPPG 3K4KA 4OU0A 1LOCA 3ZFEA 2DCZA 1EUUA 1JU4A 3B00A 1MZFA 2IXJA 2XV4S 3Q8AA 2HDCA 3Q5FA 4AAXA 2CAUA 4O6JA 3QBQA 1YITI 2M3AA 3DKWA 4AI8A 4BQWA 5TISC 3A0BC 2Z5WA 4G3YC 3DGTA 4P9UA 1MS9A 1SDDB 3OYGA 4XQFA 4E9KA 3UKTA 2WADA 2AO9A 3EUAA 2QQPA 4PUSA 3HRMA 1CAWB 1ZGWA 1EUTA 1JU3A 2GH2A 4Q0VA 3VBHA 4QPGC 2YC4A 3ZR6A 3AVRA 1SVLA 3I59A 2XJTA 4Q4W3 1LE8A 5JIAA 2VJXA 2W08A 2DJIA 4CUBA 1QNYA 1X1AA 3OYFA 4UBHA 4BDZA 2V4JC 2J7MA 1SFKA 2E1MC 1C8M2 3AG3H 2P7VB 3HRSA 1S0EA 1YG2A 1D4M3 4XLPF 2R7TA 1VP6A 1DGRA 4D5FA 2ID6A 5KC5A 1A3KA 5FYHA 2LTPA 3F6OA 1C28A 1ULPA 3VHRA 5M5YJ 2X8KA 3N7KA 2ZHLA 3F8BA 4IEWA 2RQPA 5CYVA 2M2EA 5FV3A 2WT0A 3IDCB 1VBA1 4CU7A 2OS2A 2ZMNA 1VBD3 2GC3A 3T8TA 4Z2WA 2FZ2A 1LODA 4AW7A 1FBSA 1AR91 3Q0VA 4NPRA 5FZMA 3FXJA 5I91A 3U78A 3CMYA 2B5HA 4MHRA 2ZXWH 2DTZA 2XGDA 2ZAHA 4AHYA 5FRAA 5F1JA 3D4KA 5IVFA 1ZQ3P 4HLXA 1X1PA 2QQVA 3VBOB 1R49A 1RC6A 5A32B 5JZGA 3RTRA 1ZZ7A 2ZNYA 3JW4A 2WQ8A 3AKTA 3V0AB 2IS1A 4L0ZB 1R1ZA 2VAUA 1BC8C 1X7NA 2JTVA 1VZ0A 2A69F 2H09A 1T08B 5A7PA 3L1PA 5IAVA 1GVDA 2WB1N 3V0BB 3ZN6A 1GU3A 4RGUA 1W6QA 3GXUA 2W5FA 1HQLA 1HRV2 4OHZA 1W4MA 4XUPA 1MBHA 2VQAA 4OUEA 3CMGA 2DAOA 3R6SA 4FO9A 4LBNA 3O14A 1Q8PA 3GF6A 2Y69H 5E6HA 3NJYA 2ZA9A 2A05A 3MFCA 2BPA2 2GLOA 2C26A 4YG3A 3BCWA 4AIHA 4FX4A 3H0GJ 2R32A 5KVRA 5GTHC 5C44J 5LA0A 4KWJA 2ENRA 2GN3A 1QIQA 4TZDA 3KEYA 4XN3A 2LALA 1UAIA 4LK6A 3F8MA 2YGLA 3H0DA 2RKHA 1FP2A 5EP9A 2XJSA 1O8SA 2VMIA 5FY5A 2P3IA 5F3IA 1OI6A 3SDBA 1WBLA 2YU2A 3ZQIA 2HU9A 3ABKH 3T2OA 4A44A 4W65A 1ZBE1 2YX7A 1WUVA 1PVC3 2VQCA 1HKTA 4EV0A 1IRGA 2PELA 3ZIWA 3FL7A 3P3NA 4NBQA 2HEOA 3BIEA 2AGSA 3KS7A 4HOOA 4NQWB 2ZZQA 5FZLA 2RDRA 3IM0A 4ONUA 3S2WA 2E71A 3VV1A 5DD8A 5FKLA 4LO7A 2G9GA 3K46A 3DECA 1PIV3 1JT6A 1D4M2 4GB32 3DYOA 1NYWA 1JN2P 2ZX2A 4IHTA 4FP3A 2DCKA 3GYDA 1KGSA 5KXDA 4A3JJ 4F7ZA 4ETSA 1ZRIA 2HOSA 3VBUB 3APBA 2R7WA 3L00A 3WP4A 5EJCA 1PYVA 3R61A 1GLNA 3EJKA 2VXDA 1XNBA 4COVA 4NRMA 5D8AC 3CL1A 4AFBA 1MBGA 1FBUA 2MABA 2QQWA 2W46A 3CJTB 2A5ZA 4META 1W0NA 3K3OA 1REDA 4UW6A 2HTSA 1N1VA 4RAZA 1OCRH 4Y33A 1PUFB 1NT0A 5I8SA 2ETEA 1JOPA 3WF0A 1HSTA 3JCUC 1Q5OA 1X4OA 4YVSB 4AYBN 2HKOA 4X0GA 4MX3A 3AKZA 5IK7A 1VMJA 1V9U2 4XOPA 3LDBA 3PTYA 1V6NA 1LOAA 4Q29A 5IP6A 4BQ2A 3ZX7A 1JXSA 1HQCA 5L7OB 5A1AA 5F5CA 4IX7A 1G9DA 4RQPC 5J96B 3WDTA 2JK3A 2BNNA 1DZTA 4XEZA 1HLVA 2VMFA 1XNCA 2DA7A 1LCLA 3FMRA 1YS6A 3LFUA 4MGKE 4HSJA 3KLSA 3WXPA 1EF4A 2XVGA 3PSIA 1AL21 3E6DA 4A2UA 5EPAA 4K8RB 3OSFA 4B1RA 1HJGA 3NKTA 2A5YB 3ZXJA 4C90A 3RFRA 4QIWN 4ZU5A 1W1WE 1YFXA 1FATA 5J48A 1P8JA 1COV1 1PK6C 4XFAA 3BYWA 1VLNA 3GJBA 3THPA 1XSVA 1KJRA 5F6KA 1ENRA 3J7AO 2NXNB 2TUNA 1BMV1 2ZGPA 3POGA 3PJRA 3DKQA 3HNBM 1YXWA 1GYKA 3OV8A 4O9EA 5FPVA 1PVC2 3BGAA 1HBXG 3KFWX 3N97A 5EYRA 3QAHA 2KZGA 3CO6C 1G3TA 3LEMA 2P6HA 1P4WA 3NWKA 1GZCA 2ID3A 2KXLA 2PQQA 3WHUA 2JICA 4LK7A 4MHUA 4QKFA 2OIIA 4B4CA 4CVUA 1PIV2 3PIGA 2D1HA 1HX6A 2GN7A 4JQTA 5FMOS 4SBVA 3MFKA 2YPRA 3VKNA 1PMJX 5KBFA 4BA6A 3NJVA 5LGNA 2FCTA 4H3WA 2LY1A 9ANTA 3AJYA 1Z3YA 3UNPA 2LW8A 1HSJA 4P9FA 2Y0OA 2FBIA 3N7JA 2Y9YA 3I4NJ 2DBBA 5H20A 4RBOA 2WO2A 4E27A 3C7GA 3TEYA 3BPXA 3PHMA 1JYWA 4DIQA 4I01A 1DPRA 5JVTA 2O6GE 4OIQF 2AUYA 1Y9GA 2PHWA 3LSRA 2Q8EA 2NPIA 4HANA 1SMVA 1AF9A 1SDWA 4OULA 5IYYA 3NSTA 2JJ6A 1YX5A 3WW2A 3PUIA 2R073 5CQEA 3BC8A 3V7RA 4FOVA 1JKQC 3NWSA 3WZ1A 5T5OA 3G1MA 3N9PA 5LASA 3ZOIA 1W39A 3QODA 4M3GA 4KN4X 3CF2A 1ZG1A 3DU5A 3CLPA 3OS2A 2EA7A 3DF8A 1GUUA 1O59A 1W36C 4IL7A 1KA8A 3VWBA 2MC3A 2P8TA 2WNEA 5FZ3A 3ZSLA 4KMFA 5HI0A 2HQNA 3CCQI 3RSJA 1IG3A 3WF2A 3ZN1A 3LWFA 2JENA 3HKZN 3WDYA 2Q8OA 1OH4A 3AMQA 4DXTA 3GTQJ 1FEXA 2XXZA 3EB7A 1IG7A 3VBHB 4EJRA 2K9QA 1LGCA 3C3WA 1AYM1 2DTYA 3I59B 2A6VA 1LE8B 5M3FJ 1I27A 1W7PB 1OKQA 4CYCB 1BQPA 1OQEA 4YPJA 4Y13A 3H8XA 4KIGA 3IKVA 3B3QE 3ME2A 2IXLA 4CCJA 2YX4A 2EXHA 3WODF 5FLJA 4QHZA 2D6KA 5JOXA 3PO2J 3S3NA 3CJRB 2JEMA 3VB9A 4N8MA 3T30A 4UFMA 4YGBA 2XAFA 4BGDA 4PGHA 1RIRA 3UGGA 4WX9A 2C9AA 1GZTA 1EAH1 1T98A 3VYTB 1LHUA 1B72B 5T3NA 5HVQC 1VB4A 3CDZB 1PX3A 1FI2A 2I45A 3NRUA 3RGBA 5KAIC 5C6CA 5HDKA 3GVAA 2O8KA 5LWBA 4I30A 1EA3A 5ED4A 4FCYA 1UZYA 4RGXA 3FXMA 3PMEA 5HS9A 5JZGB 4GDFA 4HSRA 2X1EA 3I4IA 1MNEA 1YEWA 1DLCA 2K0GA 4XILA 3UESA 2FJ1A 1OH3A 5JPMB 4CXYA 1Q8OA 2DFCA 1BVP1 1POV0 1UZWA 1OISA 1W6QB 2R072 1ZZ8A 1FOD1 1FNYA 4CDXC 1IDZA 2OC6A 1DQ6A 4LK1F 1GXQA 1N3PA 3IPVA 1FXZA 2CWSA 2E5ZA 3UGHA 1S6LA 3W58A 3ROUA 3VYSB 4ZONA 1VQ8I 3PVBB 1STZA 4WWCA 4CDQC 2OPWA 4UOJA 5E1XA 1C8M1 3NL1A 1WWYA 2ZGKA 3MIBA 1IRZA 2M4KA 2O5RA 5A6QA 1O3TA 1YYVA 2MD5A 1QHGA 3POYA 1VQMI 3DN7A 2QSHX 1RR8C 4IV3A 1UMQA 3WTUC 1OLRA 5LBBA 3CO7C 2CU5A 3LFKA 5JIUA 1NX9A 1NAEA 4V2FA 3P9IA 4ENMA 4FAGA 4XZUG 1YRNB 1ETQA 2VGDA 2I5UA 3KP3A 2HWF2 1YRZA 1KU3A 4CCDA 2ZFUA 3BR2A 4WM7B 1MS0A 2BOIA 4MGIE 1OR7C 2TDXA 2W47A 4M3BA 1AR73 5HCBA 5F0CA 5A6YA 4P55A 4Q4V3 5EG0A 3WW3A 5K7FA 4BE1A 2L5QA 4M00A 5HCHA 4LQRA 4QB2A 4IE6A 1LB2A 1HRV1 4LKFA 3TEZA 2JDNA 3VL9A 4YIRX 1V6LA 1ZLJA 5ACA3 3H7JA 4OVEA 4HL0A 4Y4RA 1TBXA 2VKDA 2ZBJA 3UKNA 1BXHA 1XRUA 1V00A 1EJ9A 4I0BA 4BNCA 3PVEA 4W6YA 3E1SA 2AXLA 1W0UA 2RGVA 5FGMA 1Q8VA 1REEA 1D8JA 1ULCA 4AI0A 2X6XA 3OTFA 4LUKA 5CAZA 2EQRA 3RYKA 3GO5A 3LQRA 2D43A 3S3MA 1STMA 1HKQA 4LG3A 2VZ3A 3ZSJA 1OLMA 3OJBA 2X5IC 2M4GA 1SCSA 2EWNA 3MVPA 2W48A 5GADJ 4UV9A 2K4JA 4WVMA 1USSA 2QNKA 2V4AA 5DZFA 5JHUA 3NV4A 1KFXL 3ZYBA 5BMZA 2B7YA 4ET7A 1DYKA 4DGWB 4YVWC 4QX8A 2ZX0A 4YWAA 3ENRA 3FJSA 5CA6A 2LOOA 4JYKA 5BS6A 4YW7A 3QYEA 3DEWA 3KV5A 3OY8B 1D4M1 3ZR5A 3HPGA 1X58A 2VMDA 3OR2C 1ZBA3 4S2FA 3UKVA 1MEC3 3ZYIB 1UOJA 4OIOF 1BJZA 3P5BA 2PHLA 1VBD1 4IHWA 1LJ9A 5JUVA 1S3JA 3BG9A 5JDBA 1WJDA 4QX1A 1LPQA 2ET7A 2JVGA 4UT5A 3H5AA 1EH7A 1UX6A 1XBFA 3NEUA 4ZU4A 2WDBA 4KBBA 1CX1A 2JG8A 1CAXA 3K4NA 1KEXA 4XBNA 2VCBA 1XNKA 4BXSV 2ZXJA 2JIJA 5FPAA 2R5YB 2A07F 4Q4V2 2PI0A 4FPOB 4CEWA 1X50A 2WS93 2ZHKA 3CJXA 4A6SA 2WO1A 2EBIA 2E60A 4ABZA 4UY8I 3I9V2 5DCFA 4DZGA 2QGUA 2QQNA 5JI9A 3PM1A 3NV2A 4ENJA 1DDNA 1FSHA 3OGJA 4D6RA 1KDMA 3BR5A 3IWFA 4XK4A 1D1AA 1TQ5A 3U1XA 1KU7A 5ACA2 2KJCA 2Z3YA 4BY1J 1XE0A 1AWCA 4YZ4A 1BCXA 3UJOA 1HB2A 3T1LA 4AG4A 3MFAA 4MFEA 1YO8A 1D0ZA 3VFZA 4K20A 4P9XA 3SH3A 5FUIA 1IN6A 4YSFA 1FOYA 3E5QA 3ZKUA 2EZHA 3BG6A 4YYOA 2VNRA 3POBA 4NIAA 1ND3A 1S7AA 2P7CB 1K79A 3AYCA 5DABA 1QJFA 2D1VA 3THTA 1IPJA 2P3KA 2JX9A 2V9PA 1J1LA 1PDNC 5FMOL 2LKSA 1GHCA 2Y48A 3WNKA 3NV3A 2CQQA 5A6XA 5F9TA 1PVC1 3KHCA 5K7ZA 2C1FA 3VD3A 2CV2A 3K0LA 3DU6A 2TNFA 1T6BX 4XONA 1TE1B 4X6QB 4A0ZA 3BZCA 1POV1 1H9WA 1AXZA 3PFIA 4N9IA 2HVQA 1DLLA 3WG7H 1M06G 2KRCA 4MHGA 1PIV1 4BE2A 3T0AA 1F5JA 5JOWA 4XKVA 1OQDA 1Y3TA 3F8FA 1K4TA 2HBTA 3QCWA 4A0YA 2YV8A 1W0OA 3CZUA 2LRDA 1C57A 1MEC2 2K85A 1SLAA 5CFDC 1YNAA 1NXD1 2UWBA 4HXCA 1VQ4I 2STTA 3R4SA 1OC1A 3RZOJ 3HQXA 3E6BA 1LESA 1YUDA 2WO3A 1YYNA 1GNZA 5FWJA 1X3ZB 1WH5A 2WV0A 4JKKA 2DTWA 4LKSA 5FUPA 4E7SA 4XQWA 4LTAA 4FAHA 1XGMA 1MIJA 3OPZA 1EY2A 2VJIA 1ZZ6A 2MBFA 2LP0A 2NVYJ 1YLLA 5C4XJ 1XMAA 4P9YA 4Q4X3 1EKEA 1JZ2A 3RJPA 4LK0F 5DPNA 2NLRA 4HLTA 4N4NB 2A6TA 1WW6A 4DBQA 4Q47A 2WS92 1AKHB 4W4ZA 3G4SI 1CIWA 3WNOA 4AI9A 4FVVA 2A6YA 5T5JA 5KAFC 3QYBA 2W94A 2EAKA 3L2YA 2Y0IA 1PHMA 4YFWA 3H7YA 3BPVA 5BNPC 4WM8A 2V9KA 2NS0A 1YJWI 2JSCA 3ZXSA 2PAKA 4AVSA 3O1PA 5JXJA 2COMA 4KIBA 1J0RA 4IESA 2B9UA 1LOEA 3COAC 5E20A 4CP2A 1SFNA 4BK4A 3CQOA 1DCSA 2RMU3 2QFEA 3MCZA 2VD7A 1N3OA 1UNBA 2EIDA 5JSRA 4IXAA 3PVOA 2ARCA 3BG5A 1FWZA 4D1QA 2CS3A 4L9BA 1LKNA 1UMHA 1UY1A 1OA2A 3IPVB 4IW3A 3PUQA 2A7AA 1E57A 4UAPA 3ZXEA 4LXLA 5FKNA 5KC6A 5JSPA 4FETA 3AAFA 3ES1A 1TNFA 3LZZA 3GFLA 2R5ZA 5DUKA 2HXIA 3JRAA 2WABA 2EICA 1BJAA 2Q1ZB 5TRDA 1LRHA 3U11A 3PIJA 1G8XA 2IVMA 4IV3B 4N90A 2CV6A 2OA4A 5DMYA 2EA2A 2WSVA 1REFA 4JBAA 2RS13 3GM8A 4PIZA 5F0HA 4XYXA 1S7EA 3HOUJ 4AEDA 2UXNA 1JUMA 1FOWA 1WVRA 4YGCA 2VJ4A 1X2MA 5J47A 2WYSA 4QGLA 3S32A 2UY9A 2ZGQA 3DV8A 5LB6A 1YW9A 4XAAA 3F3XA 1ZNPA 5CG9A 2HNHA 1TVGA 2JPBA 4V19K 4KDPA 1F43A 3OYEA 1WW4A 5FTTC 1IZ1A 4NE9A 2V9VA 2Z2SB 4Q4X2 3RDIA 3W6VA 3D1NI 4PLNA 5HLIA 5B3SH 2ECCA 4A0XA 4BHBA 3CIHA 1I5ZA 1NA1A 1E3OC 3LDRA 3BG3A 3CBNA 3BJOA 4AGGA 3MI8A 2X53S 3WTWC 2J5OA 5CJ9A 2R071 4IE0A 4W50A 3HTSB 1MZEA 2ZMEB 1RB8G 3VGIA 5B66C 5L3DA 1MBKA 5F3EA 1RMU3 4Z82A 2WAEA 3HN3A 1L7RA 1WI3A 2DVGA 2EIJH 4NVPA 5CZKA 2ZHNA 1J9IA 5BNOA 3GW2A 4U0WA 2KZVA 4ATEA 1LUJB 4HPQA 5FY8A 3I2KA 4L5IA 5F0FA 1HLCA 1V55H 3HSFA 2K9SA 5IVVA 2KA3A 1XS9A 5DAPA 2ZHMA 2RMU2 4Y5SA 2FD8A 2DCYA 4S04A 3ZXGA 3MZ8A 4D5CA 1KS4A 3LAJA 1ZHFA 4Q8KA 3OBAA 4WVMB 1K5MA 3WNPA 1JYXA 2K9LA 4XUOA 1HXS2 3ZYJB 5H2FC 1HCRA 5FCCA 3JB4C 3BG7A 5FO7B 3DBLB 2HWF1 3D0JA 4BE0A 1MS8A 3IUOA 4UHTA 1ASJ3 5GAEJ 2DMPA 4A6DA 5K0UB 2FA5A 1KD7A 4HPKA 2JDYA 3AL0C 3BR1A 5LBFA 1W6OB 5HCAA 4I99C 3JCIA 3N36A 4M3EA 2RS12 4IRGA 3OGSA 3GZNB 4M3CE 5JI7A 1XN7A 2JD9A 4ZC3A 4HBLA 5C3OA 3CDLA 2H6BA 3VB2A 3N7MA 4XABA 4HV5A 4M9SA 3M8EA 1Z7S3 5LA9A 5LHGA 1NLSA 1LQ1A 2ILMA 4P14A 4JZRA 3S8PA 2O61A 5DS9A 3QH7A 1LU1A 1Y0NA 1OLTA 3FZVA 4HQMA 2PA7A 1R71A 1CAXB 3VBRC 2VT2A 1VFCA 1ZRCA 2QZ3A 2K9NA 5FO8B 3MDPA 3NWTA 1S0CA 3DP7A 1LDKB 4CEWB 4LMYA 4P96A 2BNOA 2VNOA 5LGTA 4N7IA 2VBDA 1YIFA 4AU7A 3URFA 4UF0B 4EGZA 1NCRB 3KP6A 3H1WA 1S0BA 1G3WA 5DZEA 3X29B 1ETKA 3ZMUA 2XLAA 4D7SA 5FOJB 2CH0A 2BE5F 3OG2A 3EXUA 4XUQA 3KLNA 3WTYC 2EV6A 5FPUA 1RUE3 3LSJA 3HNYM 1OCOH 2YSRA 1OOPA 3QACA 1DHKB 1MDMB 3UJQA 1RMU2 3PUAA 1RUC3 5JSOA 3KQRA 4QQ2A 4QX2A 1SFEA 2L7ZA 5IUQA 1U9NA 3J80K 3WG1A 2IVIB 3IWZA 5ICFA 1QKQA 4AOCA 3TL4X 2I07B 2XUMA 5AVAA 5JR3A 2D7FA 1RUOA 2D3RA 1OPCA 3K2AA 4TYSA 4RR3B 3N9OA 4BDVB 3HIFA 3V8LA 5B1AH 2DODA 4QPQA 4L8QA 1B8IB 2OU2A 4RGRA 1QXRA 2L7MP 2UYBA 3MW3A 1ENHA 1OFCX 1YIOA 2QBYA 3ZOBA 3I54A 1QNWA 2HWC3 3CMMA 2B9SA 2MLGA 1LECA 4QSHA 4HAMA 5HXVA 2IXSA 4AHXA 4KWKA 1KYZA 2A3XA 3R05A 5AFEA 1ZRDA 3HUGA 1OF4A 2HVSA 2VN2A 5K8SA 1ASJ2 1IGNA 2P1BA 3F72A 5IVYA 4QX5A 3VZMA 3MKYB 2MC4A 1OVPA 4DYCA 4Q4V1 3VKLA 3E5XA 1VTNC 1B4AA 1QY4A 3SYTA 1UPIA 1OD3A 4F83A 2VKVA 1LEBA 3F0CA 2PHUA 4YM1A 2R0QC 3NQHA 1H4GA 1JHNA 3UNGC 3LSEA 1JKPC 2EPFA 5ACA1 1XCVA 3A03A 4GCVA 1Z7S2 5BYNA 3AZZA 2M45A 4HMZA 4M71A 1R1TA 1HIXA 1O7FA 3VKOA 3LF7A 2ERFA 5ABJB 4X6RB 2IW5A 2XGCA 1EPWA 4ZHNA 1GOGA 3R4UA 4ENNA 1RC9A 1CD3G 4GULA 2WNUC 3FM3A 3OUJA 2LVSA 5FJ8J 1JZ7A 3P6BA 2Z42A 1VAMA 5FRMA 3CNAA 4CU6A 1WRJA 2IXKA 1BK0A 2VW0A 4QU1A 1XYPA 1R4NB 3C2GA 3IAPA 4WM8B 3WUDA 4QHBA 5EYYA 3ZFFC 2BVLA 1H6YA 2O8OA 5GLWA 5J3UA 4FFHA 2QLZA 1RUC2 4BBSJ 1I1SA 4JX6A 3L2VA 3PUHA 5DM6F 3CLQA 5E1ZB 3GZUC 1Y9MA 2WA4A 5IJRA 1VQ5I 5T54A 3WW4A 5B2GB 2LBFB 4A3LJ 4AVBA 4K6BA 1XCBA 3CHXA 5F6LB 4U0YA 1QNTA 2MW8A 2XRLA 1H4HA 5FO5A 3I71A 3U2RA 2RE9A 4AC0A 2J1AA 4DO0A 2NP0A 5FZ9A 1BM9A 3VSLA 4WXCA 2Q1FA 3CCSI 4NDLA 2K7LA 1MEC1 1SMTA 5FB2A 3BB6A 3UR3C 4CDGA 3JSOA 5C8WA 1SVMA 3LMMA 5D1IA 4A3IJ 4DFSA 2HWC2 1SPPA 5M3MJ 4FXGB 2QUFA 2JXAA 1K3IA 4NR1A 4LKEA 4UXNA 2C6YA 4S2HA 2JA6J 2EIMH 2WL1A 2BW3A 3K4JA 3CDIA 2W0XA 4LFUA 5CQGA 5EJ1B 4BB3A 5D21A 4E2QA 1VBE3 2XWBB 2WS91 3T2TA 2EFOA 5E3MA 4BY7J 3TYJA 2R16A 2OUJA 1KQRA 1VPHA 4AD9A 4QX7A 3K4ZA 3SLIA 2UYAA 5CB7A 1FOKA 4OCTA 4ZZ5A 2OW4A 3I64A 4DQAA 4MZUA 3IHUA 4QPOA 2JDAA 5BNNC 1OQYA 3QLQA 5HODA 1IJWC 2C9KA 3HSRA 4N43A 1WCSA 3TW6A 2WN3A 2XSDC 3V64A 1W9SA 1A36A 1C5HA 1HRI2 2D5VA 1FLIA 5FKKA 2MH2A 3SZPA 2RC4A 1HV1A 1TNRA 4FQGA 4ZU7A 1W9WA 2EIBA 4YW4A 4QDSA 2EJRA 4PIYA 4UW4A 4ESBA 1ZN2A 3K48A 4GMP3 4CDUA 3S93A 3ILFA 5C3SA 3R4KA 2L9LA 1NA1B 1W90A 4D94A 1KU2A 1NCQA 4FTHA 1IAWA 1AHDP 3CTAA 1O6UA 2PJPA 1C0WA 3LNQA 2QVOA 1UN1A 3VBSC 2BHZA 3SHRA 3FK7A 2PHXA 1UHWA 1RUI3 2LMDA 1R5ID 4QPGB 4K7JA 1I3HA 5FIXA 1LNSA 1ULDA 4W97A 1YS7A 3I2JA 5BNOB 4AE2A 4ZYEA 4AQ2A 1N78A 2XVLA 5C9AC 2P5KA 4DB5A 5FZDA 2VOXA 2E1MB 4IL6C 1AX1A 1ALYA 2VMGA 5IVJA 3O6BB 3OGRA 1D8KA 5E18F 2AXTC 4AFCA 1MVQA 3KP4A 1UZVA 2YC2A 3CQZJ 5EJ3A 4CCKA 3DTEA 2P37A 3DKYA 3CP8A 4XRSG 4RS5A 2XMLA 2HOEA 5A3OA 4ZTFA 1GV2A 4J6GA 1SEUA 5L3EA 3NNLA 2VT3A 4LE4A 4WZFA 2IVJA 3NV1A 4QPIA 4UB6C 4XQ4A 1X9PA 2DUQA 1XU2A 3BKZA 3ZPOA 5FKBA 3D3AA 1DQ2A 5ISLA 1C3HA 1WJAA 1JZ8A 4XR6A 1W6MA 3BCAA 3ZXLA 4PGGA 3G7DA 4C3JJ 4BMEA 4BQ1A 1K12A 4MOAA 1TQPA 4ZKTB 3ZYFA 5K5RA 4XLEA 3B5LB 2P4WA 5TJJA 4B4PA 5EYXA 4Q4X1 1XNTA 1HN0A 1DF0A 1VBE2 3WD5A 1R64A 1QVTA 1YQ8A 5APAA 1UF2C 3M07A 3FHNA 5FMBA 4BQNA 5A3WA 1FT9A 1P4AA 5I0DA 2CDPA 2HWB3 3VHNA 4L2NA 3VBFC 2CO5A 2BEOA 2B63J 1IRXA 5F7UA 3TEWA 3V65A 5T50A 3BZKA 1DFQA 1JHJA 3LSIA 4Q8LA 5HV0A 3RQ4A 3VYRB 4ASLA 5FLHA 2RJ2A 4JGZC 3DEMA 3CO2A 2VBYA 3OYNA 4BACA 4LHKA 2WWSA 2CGOA 1US3A 5J7MA 4CH7A 1HKDA 2VXZA 2XF5A 3LIGA 1NH3A 2ZXQA 4XKBA 4N0BA 2RMU1 2XUBA 3B9CA 3PUSA 1H8TC 2DLLA 1DGLA 1W3XA 4EN7B 1FC3A 3F21A 1TP4A 2L9VA 1JYCA 1OOPB 3HGGA 1RUI2 5EZHA 3ZLIA 1HXS1 3DWLE 3HEFA 5EWSA 3HOWJ 1QDCA 1NK2P 4QMAA 3G1LA 4Z2YA 1I5PA 1HB1A 2GMMA 2VC0A 4ZZLA 4CUGA 1WJ5A 5FXWA 1J3QA 2PBIA 4I0WB 1XDUA 2YUSA 1XD7A 4Z8BA 1Y1VJ 4L9NA 1LGBA 4NB5A 5GPAA 2YDEA 2RS11 5A7SA 3CUQA 3IMMA 3KHBA 5C4WC 1MVEA 2XPJA 4XE9A 1CESA 2CW7A 2CU7A 1YI9A 2VBPA 5J1UA 2ZKLA 4MIMA 5FR3A 5ILVA 2L4AA 2HYJA 3A2KA 1G9CA 3CJNA 4NC6A 4ANJA 2QBXA 3HUGB 2EXIA 3H9JA 5KWRA 1H88C 4Q5OA 3EHKA 1AL0G 2BBAA 4NC7A 3DPTA 5JCTA 4IV1A 4W6WA 4RSUA 3KZZA 1E5IA 5EDNA 3K7AJ 3MIFA 2LY2A 1AHSA 3OOUA 4XRSA 4EJVA 1REPC 2PAMA 1K6OA 2VW2A 1S7OA 3MF6A 1RESA 4EQVA 3A01B 1OBNA 1NHAA 3KT4A 4HFSA 2X5IA 2VMHA 2VPLA 2GNTA 4KMUX 1O3SA 1K61A 5GLZA 5A3NA 4XURA 4L0YB 4BBRJ 4QXHA 4R79A 4NIGA 1WKYA 2VPRA 1RMU1 2O7OA 1H1MA 2BY0A 4RB0A 5DUVA 1MPXA 1AVBA 4ATFA 1GSLA 2VCCA 3I58A 3DPUA 4WVWA 1T0FC 5HS8A 3ABUA 3WW1A 4JQFA 5CFCA 1WWXA 2JWTA 4L5EA 1SHWB 3TEXA 2NYYA 5DAQA 2G9ZA 4Q1RA 4HA8A 2H0BA 4F55A 1ZR2A 2WNVC 4XSZF 5CBLA 1E2XA 1I50J 4DQ2A 2EVXA 2EA4A 4Z07A 1FPQA 3B02A 2WZPP 1RZ4A 4HOBA 3BR6A 4NRPA 3WGGA 2I10A 1AA7A 2AACA 4AR2A 1O91A 3TN92 1ZX5A 1SMYF 2BQPA 5L9BA 1NLRA 1ASJ1 2VNGA 2XSJC 1V6MA 1VI0A 4J00A 5HLTA 3O1MA 4FX0A 3OS1A 3T0BA 1GWMA 1ZYRF 2IRFG 1RHI3 3M2MA 2LF8A 3FHZA 2XAUA 3MO4A 5K4LA 3GFMA 2IUWA 5EEHA 1PMIA 3WV6A 4Q4ZF 1DQ0A 3AP5A 1CAUA 5EQUA 1F31A 1G4DA 2LROA 2GC1A 2CUJA 3D5LA 1SPPB 1Z7S1 2G7UA 4GMP0 2XR4A 4RYDA 3S15J 3M3CA 3BJAA 3VPRA 1B35A 1U12A 2BZDA 1X33A 3PJQA 4F8AA 2WWYA 4N53A 2BW3B 2YC0A 1F9KA 2Q8KA 5FLXK 2RJLA 3OYDA 4HNTA 4CP9A 1JZ3A 2F4OB 4GKYA 3AKSA 3U9GA 5C3EJ 4CP1A 4HV6A 2X1CA 4FQZA 1I1EA 5LZ6A 1C1FA 3GZ5A 2ZXHA 4OI2A 3ES4A 4PF1A 2ELHA 3BOPA 4FT8A 1BYHA 1RUF2 2EIEA 3UL2A 4LR4A 3HMYA 1RUE1 1LFUP 3DXTA 3A1YA 1YJ9I 4DUVA 1RUC1 3M7GA 4PJNA 2ZJQF 4GQ7A 3A23A 4G6QA 3KETA 2Y6FA 3GZAA 2V72A 2VIXA 4FPYA 3SEEA 4RB2C 4PJ0C 3IIIA 4ISRA 4XDOA 3P5JA 1SLBA 4QU2A 2BFUS 3GBFA 2WA3A 3KF3A 3FDYA 1P6RA 1UG0A 4CDUB 2GWRA 1QH6A 4C9YA 1W0PA 1NCQB 5FPXA 4WXHA 2XLGA 1TT5B 4OAYA 5FMDA 4KN7X 2LC2A 4OQ9A 2Y64A 2C24A 4YNIA 1ZARA 4G4FA 5DTDA 4JGYC 3IRRA 1TWGJ 4M01A 2FDIA 4RS8A 1AX2A 5FK7A 2GNBA 3BVCA 2XAHA 4ISQA 2EZKA 5ERIA 3I2FA 2HWC1 4BAYA 2WZ8A 2BHYA 3ZQGA 1C5IA 1W9YA 1Y8QB 2DFHA 5J1YA 2CWMA 1DBNA 4P5OA 3NAPA 3TAYA 5FP3A 2GQQA 1O5UA 4NROA 1BEV2 2MGQA 3RIRA 2BY3A 2A3YA 4JV4A 4A3CJ 1OQ1A 4WBBA 4M6YA 1SFUA 3CMAI 4JVAA 4KYWA 5M5WJ 1BC7C 4RS5B 2IA0A 1UHMA 1RHI2 4AGRA 2JE9A 1UYZA 3GTPJ 2DJNA 3LA7A 1LFPA 2DMNA 2M87A 3ZSKA 4AQSA 3POFA 3T0DA 4COZA 3RZGA 3S17J 4QQOA 4UFHA 1PGW2 4XFIA 5M5XJ 3M70A 1Q8SA 4FHTA 3AMPA 2LUWA 2MD0A 4B8XA 2JQ7A 1X19A 3TWIA 3FXRA 3LEIA 1DP0A 4CZSA 5IK8A 2DF7A 2V5YA 5EJZB 2DQRA 2Y75A 1TW3A 2R7DA 3JAMK 1MZ6A 4EJOA 4X8NA 2JA8J 3C7HA 1PO13 4FFGA 4D7TA 4LA3A 3N35A 2Z69A 1J58A 2GXBA 2IGOA 2JDMA 1FY7A 3ZYRA 2XBO3 3S1NJ 2K02A 2PMHA 2H8RA 2H0VA 4L99A 4N7UA 2VU9A 3VBOC 4UVBA 5IY5H 1IN5A 4Q2FA 4COWA 1RUNA 5EEGA 3A0HC 1UIKA 1SG3A 4CCNA 4CDQB 2WFF3 5ERLA 4YLZA 1MBFA 3RG0A 4D0QA 2Y0MA 1CAWA 1P92A 1W8OA 1XNAA 2CSOA 1XXNA 1DU6A 4D3WA 2E1NA 3GTKJ 4GWMA 2QQBA 5JOZA 1EP0A 4BK5A 2XRNA 1WCUA 3PURA 4HDVA 3ACGA 4R9DA 3SXYA 2Y30A 4DRRA 3LCPA 3ZQ7A 1SLLA 2B8MA 4A5MA 2PMUA 5FY0A 3UT0A 4HVRA 2G9WA 3IN9A 3LWCA 1QXJA 5L73A 2VONA 3KIOA 4XL9A 3FISA 1LFBA 4RGAA 3TMOA 3H9AA 4AZZA 2BY2A 4CYDA 4RA2A 5LA2A 1ZZBA 4GWNA 2GMEA 5LRRA 4C2TA 4XIOA 2WT1A 1D3YA 2FOWA 3TP3A 5C5TA 4NIHA 3GWZA 1SBDA 4H7LA 1VBE1 4HSTA 1G6NA 1MMSA 3VD4A 4RFRB 1BOAA 1Z7UA 2R043 3C7OA 1LVKA 1CF7B 1OFNA 1ULGA 1MH4A 2LF7A 1CN1A 4V1PA 5K1YA 4YFKF 3MZHA 1H2KA 2VY0A 4XDQA 1QPIA 3FIWA 1IN8A 1W8HA 3TDUC 4FSJA 3MF9A 3RZJA 4JAAA 1LAJA 4HONA 3L9FA 5JPNB 2ZJPF 2DPUA 3B01A 4DBRA 4C1WA 2RR12 2QEXI 1FX5A 4UI9L 5IK4A 1TZLA 2WLQA 3O1VA 3V0BA 2E19A 2G9FA 4IV1B 2IA2A 4CCMA 2R063 4AM3A 1BHGA 5I0SA 4Q48A 2CJJA 5LD2C 2VCAA 5EV7A 4A3KJ 1WQ2A 1UCXA 4GMP1 4XVHA 4UFJA 3G6EI 3JQXA 2V5DA 1PO12 1VAKA 3LAGA 4ZYHA 2X5IB 4XLHA 3G71I 1YJNI 2VBZA 3PLQA 1JOJA 2XBO2 3ZM8A 1CJPA 1N47A 2XAJA 4MUVA 3GTMJ 1RUI1 2FOKA 1T39A 4RAFA 5JR2A 2XJVA 1VAVA 2BNMA 3EYIA 4GWJA 5IVBA 4YVWB 3UYJA 4AWXB 3C2UA 3O0XA 1UAAA 5HDGA 4RD7A 2WFF2 2DV9A 4BHPA 3JRCA 3KT1A 3FXQA 1U5XA 4YVSC 3VDDA 5CFCB 1SANA 3ACFA 3JBG3 1G9AA 2WRAA 5JXHA 2GXGA 2JSPA 4DW6A 3CMEI 1FJLA 2DVAA 3LSKA 4MGRA 3W2WA 5L7OC 2OKXA 3MLJA 3PQJA 3U1DA 1QZZA 2WAQN 4XNFA 4XHBA 2BV6A 3QU3A 5DXDA 1ONVA 2YBSA 4HG2A 1VRH3 2PLV3 1Z91A 4JP0A 4NQWA 3WLUA 3CEWA 1G2HA 2VO5A 3W5MA 4GFBA 4QAWA 5BNGA 2V7FA 2FBEA 1RI7A 2ADDA 1DU0A 1ND2A 3MIHA 1T8IA 3FBYA 3LSGA 3H42B 3KWVA 5FZ1A 3VKFC 3JXSA 3I0TA 4LOTA 4D7NA 5FYCA 1CGPA 1WJEA 5JHFA 4QPYA 1E3PA 3MEXA 3WOGA 3VBUA 4EJUA 1MQTC 1VBB3 3CJIC 4D6SA 4DEVA 5J1XA 3DBHB 4NN0A 1IW7F 5SV8A 2E51A 3PDQA 4EM0B 3ZMDA 3OL4A 5FAXA 1BN5A 3AYEA 2R042 1YFYA 4MEYF 3DTIA 4NIDA 2CTVA 4ZDPA 5K5QA 1FMVA 4IPAA 3RPQA 2VZ1A 3FXKA 1CAUB 5B4NA 3F23A 1RVF3 2HWB1 2FDGA 5J37A 1LR5A 5J8CA 3LB9A 2FBKA 1BOBA 1QXPA 2W7NA 4KG0A 3DCQA 5FD5A 3FUOA 1WMEA 2NN8A 2E26A 4MGQA 1WCKA 3Q8CA 3JD73 2W82A 2ZO4A 2EAAA 2WNOA 3KP2A 1K83J 2XL7A 1W7PD 1B35B 1IZ3A 4N53B 1D0HA 3WSOA 1RKTA 1BKZA 3NAUA 2CGNA 4CP9B 2R062 2R7FA 2LR8A 1Z6TA 1UJ8A 2DA1A 4D9JA 2JB8A 3TKYA 3B93A 3AKRA 3SH5A 3T09A 4EM2A 2H1KA 1QA6A 3FMSA 2JIGA 4P9WA 5FYVA 3I3LA 1R6RA 1DGWX 3S7EA 5GZCA 1KZHA 3S2HJ 3FLPA 1WHUA 2D3SA 2K3PA 5ILSA 5HCFA 1FBQA 4BJ0A 3TO7A 3DLAA 5LY1A 3JSPA 4XOTA 4L18B 4XIDA 2A5WA 3HOSA 2Y9ZA 3TN91 1OFSA 4M6VA 3C7EA 2W92A 3M1EA 1GXPA 2P3YA 1FOXA 2H8WA 5DDJ3 2WINB 5F5AA 3ATGA 4ESJA 2XKOA 3JBG2 1BBT3 2KMUA 2W00A 3GLLA 1F4KA 3D8CA 1WBFA 3VKMA 2GMPA 5CFDB 2WC2A 3PL0A 4IHXA 1X36A 2XAGA 1FNZA 1TWHJ 1U8RA 2DCEA 2EB7A 4NHMA 2E1OA 3PNTA 2OV7A 4ITCA 1TNTA 1D0XA 4A3DJ 3T4VA 1GQHA 3ZFEC 1HDPA 1X3UA 5J4YA 5GJ6A 1TQIA 3W6JB 3O1RA 3AXEA 2XVKA 3PNYA 2G4IA 3EYYA 2WBKA 1VBB2 2XB0X 2PMZA 3T2QA 4CCEA 1ZELA 1PGL1 2QYOA 1O4XA 4FTEA 1QQIA 1R00A 2OCCH 4QKNA 2BOLA 3C3VA 2BFUL 2Y0SA 3VBHC 3O8HA 1MR5A 5A80A 3MICA 1JUHA 1HXDA 3LEGA 1RUF1 1Z3XA 1YIPA 2WTEA 2FMYA 1RVF2 3LFIA 2VC1A 3MUZ1 5IW0A 4I76A 1W2UA 4JHZA 5DQ0A 1ZAOA 3JD72 4GYGA 1YJLA 2YU1A 1HN1A 1XPXA 4LHNA 2A6WA 2A6XA 4NMIA 2PG4A 2SLIA 1ST8A 3GX4X 4X6AJ 4FPEA 1V3FA 1D7PM 3AZWA 3GHMA 2LM3A 2TCTA 2CY6A 2DI3A 1OLME 2IFRA 4AI2A 1UOBA 2NNYA 3OGVA 2YYOA 4CSWA 2E32A 1LHOA 1WI9A 4IQPA 1J09A 4NOTA 3E0JB 3ML6A 1QH7A 3I2GA 2HDWA 4QGNA 3LGRA 4OHXA 5KHHA 2V09A 2BBVA 1JI6A 3C1DA 2IZWA 4KFCA 3RZKA 4FP2A 2HS5A 4EN0A 3OYJA 2PHRA 1N1TA 1W5CC 3RJRA 1E5RA 3TNPB 5CKNA 2YXSA 2FEZA 1RNLA 4XSXF 4GXLA 4YFXF 1FV3A 1J84A 1FOD2 1BEV1 5FPBA 1DQ5A 2K46A 2VXRA 3FLTA 4WV8A 2RJKA 4MG2A 4I7HA 1BBT2 5F32A 4PQQA 3FK6A 1W7PA 1RHI1 4CYCA 4XUTA 5FY7A 2VJJA 4YGEA 2JE8A 2JD4A 2VOPA 3NO8A 1W28A 4YRDA 3MGUA 4LKDA 4YW6A 4D69A 2L7FP 2Y31A 1QU3A 1VF9A 1S5LC 1P7JA 2Z5UA 4ZDLA 3S5QA 4QKBA 1PGW1 3V8KA 3A0NA 5JFRA 3QQAA 3ZSMA 4AIDA 2GOMA 4BLJA 3H5NA 4CCCA 3O2PE 1QGLA 4DY5A 2ZX4A 2UY8A 1B72A 2H27A 4L9VA 2PEXA 4Q4Y3 1DUXC 1FV2A 3J80Z 2C6SA 1L7LA 4DOUA 3EUHA 4P9LA 2A61A 4NHKA 4IUGA 5L9VA 1WZ2A 3OS0A 4Y24A 1SCRA 2ES3A 2VE9A 4OI4A 5A3MA 3J7ZI 1VQLI 2ETHA 2EIKH 1IO2A 4ASNA 4PQ9A 4LPLA 2XDVA 3K6GA 1PX4A 2PN5A 3OBTA 2DQLA 4HVOA 5DUWA 1JS9A 2WA0A 1TZOA 4KT5C 1JBCA 1AZDA 4AL9A 3G3ZA 4FPKA 1Y4WA 1GQPA 1DGRM 1TW2A 3AKPA 5CYYA 2PMWB 3L9JT 4R1HA 2WB1A 1RINA 2X6WA 1CQ9A 5FYMA 4BMBA 4LOSA 2RVCA 4CDWA 1I3QJ 1Z6RA 2DT5A 3FM5A 2F5FA 3AP7A 4EZHA 3FMQA 2EIGA 3GGLA 4QTRA 2AQEA 1R5HA 2E33A 2XG3A 2Z9OA 2Y6HA 2D2WA 5IP9J 3PU8A 2GALA 1GR3A 4CCLA 3TRSB 1JOBA 4LBQD 5FRNA 1S72I 3B6CA 1GOFA 5I93A 1XPWA 3VDDB 1YE9A 2IA1A 3USSA 3J7HA 2R1BA 3AL0B 5FY4A 1F8VA 1K42A 5ICCA 1OYWA 3SXWA 1TMF3 1AX0A 3GXOA 2CQNA 3LA3A 5FYSA 3QRFF 4Q4W2 3K70D 2DVFA 1YRNA 1MMNA 1MACA 3VD9A 3OD0A 4WM7A 2ZEWA 2KL4A 1ND2B 5A7OA 2WJSA 1OA4A 1LTEA 4FPHA 5GLUA 3Q9SA 4DRVA 2CWEA 2BJSA 4Y20A 3J7MA 2Y6KA 2FZ1A 3TBDA 2HWVA 4JK1X 5K7HA 2RR11 4YG0A 2KIQA 3VBRB 1N1SA 3N3HA 2DU9A 1VBD2 1NZIA 2ORXA 3NMBA 1Q3EA 2HJIA 5A7QA 3R4DB 4V2VA 4XDPA 5EHDA 2DOFA 3H5RA 4BXFA 4BQOA 3H35A 1QJY3 1PO11 3K4CA 2P0WA 4U88A 2DFBA 2MLKA 3TQNA 2XBO1 3HVDA 2B46X 4XXAA 5A7NA 1W8FA 2L7KA 4U2AA 1WLWA 2PAEA 4FPJA 2HZDA 1W5TA 4M4RA 2WFF1 5F5QA 4XUNA 3JUUA 5FFOC 2V6EA 1BR2A 4QB6A 2J1EA 4AI1A 1YTYA 4AYBA 4A3ZA 3WE2A 4JCKA 2P3JA 4XFBA 3ELNA 6PAXA 1H9GA 4PDKA 2AC1A 5F2WA 2D98A 3CUOA 2W9XA 3OSDA 3ACIA 1GLHA 1BR1A 5LW9A 1YOVB 1MH3A 2HXOA 3AB0A 4LLFA 2FQ4A 2VTXJ 2P4EA 2XJUA 2Q8DA 3KZIC 3ZFGC 4YM2A 1HW1A 2LYCA 3M3QA 3OY8A 1RUD3 1B9NA 3VYUB 2HOAA 1OMIA 1JZ6A 4RL7A 2VCMA 5G05L 4WVZA 3H3VK 4ZTJA 1NK3P 1IPSA 1K45A 2GSYA 3T1MA 1KQ8A 4RM3A 4M3DA 4IRHA 3AJZA 2CFOA 1R093 2ZGTA 3WE3A 1KONA 4LITA 1AXKA 3EQLF 2M5WA 3T0YA 2R041 4OUMA 2ISYA 1UOGA 1Z67A 4MH0E 2AYHA 4LLNA 1LJ7A 4BS9A 4RB3C 5GKAC 3C18A 3RKQA 2BVVA 3U37A 3ZMOA 4BQXA 2R5YA 3TEDA 3I7DA 1GP5A 4BHCA 4A5NA 3CF6E 5HOOA 4M0NA 2F6CA 1OF3A 4LA2A 3MIEA 3ZXAC 4HKWA 1Q1VA 2ESNA 1V6KA 1S1AA 3OYMA 2IGKA 4B43A 2L54A 3EUKL 2R061 4II3A 1U8BA 1URXA 1N3QA 2CL2A 1YFHA 5FKMA 2BXYA 2O9LA 4B29A 2R30A 3HM5A 1QQP3 2VW1A 4LBLA 2IP2A 3CZ6A 3HL2A 4LBQA 5FPZA 3K77A 2LTNA 2PTMA 1H8VA 4FPCA 2XPUA 3WX5A 4D0PA 2E7QA 4Q1PA 3BIWE 4M3CA 5HXMA 2F48A 4CA0A 1R22A 3RI9A 3ABZA 3ZFFB 2WAFA 1O4YA 1JJ8C 2RDPA 1V6OA 3WF4A 3ELKA 1HW5A 3GEZA 1ETOA 4LLOA 2YFZA 3D82A 3BTIA 3PJYA 2NVQJ 2QM3A 4E6KG 5J09A 4BOWA 1ULYA 1PZ8A 1MJ9A 3HYIA 1H2LA 4BM8A 2CHHA 5JWPA 3JBG1 4M3FA 2D97A 1ONAA 1YHFA 2OQ6A 4PIXA 2XROA 4PDWA 3WY6A 3HPHA 1W8ZA 4E2GA 4CHUA 2ME0A 4GH4A 1VRH1 4HRIA 2KISA 3L2WA 3GZEA 1F5FA 3ETPA 2CV1A 1W8NA 4Y4YA 4I0AA 4IQ4A 1RUD2 3ZDVA 5CPRB 1XNDA 2KDZA 4MYEA 3BALA 3TP0A 1G3SA 1D1CA 4PJLA 4BPZA 2X48A 1VBB1 2QZ2A 1FIPA 1S2BA 1ERDA 2WZEA 2R0HA 4XAEA 5DAWA 3VLBB 3HKZA 1OVSA 2VR4A 4TWTA 4S2GA 1RJ7A 4YFZA 3AP6A 1US2A 4Q27A 2ORZA 4RGSA 1IGOA 4OWRB 1V5GA 4I02A 2V1XA 2FHRA 5IYBJ 1RITA 5BNNB 2DT7B 4IEJA 1RVF1 2D6LX 2AH2A 1RRJA 2KP6A 2X9DA 4AVVA 2DDUA 2ZGLA 3JD71 5C4JJ 1A6QA 1W03A 3ULQB 3FFQA 1FX7A 1ZKGA 5KNLA