4IEXA

Unliganded room-temp cysteine dioxygenase at ph 6.2
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Cysteine Dioxygenase Structures from pH4 to 9: Consistent Cys-Persulfenate Formation at Intermediate pH and a Cys-Bound Enzyme at Higher pH.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 52
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4iexA00
2QCSB 4MGZE 1CAXA 2XL7A 1CAVB 4XFFA 1ZZ9A 5J3UA 4MGYE 3SMHA 4FT8A 3E6BA 5C6CA 2Q30A 3E97A 4I0AA 5J7MA 4KWLA 1ZVFA 2XLAA 4XFIA 1NXMA 1X8MA 4BYYA 4OLLA 5CADA 1CAWA 1WLTA 1VR3A 4F7ZA 1RL3A 2Q4SA 3IDCB 4BIFA 5BUVA 3LZZA 4LUKA 4ZU4A 4XF9A 2OYZA 4MUVA 3I59B 3QOPA 4CYDA 2MNGA 5T3NA 3L2HA 1O5UA 1Q43A 3FZ3A 4KU8A 4UBGA 4A2UA 2BEOA 3OD0A 3GBFA 2XKOA 4J1XA 1DZRA 2VQAA 3NVCA 4IEVA 3BPZA 3FJSA 1FXZA 2PQQA 5C8WA 3IBMA 1YUDA 3USSA 3IDBB 1DZTA 2VECA 4Q0QA 3U11A 3DKWA 3HT2A 1OI6A 4IERA 3H7JA 1OD5A 2UYAA 2PAMA 4QX5A 1U12A 3HQXA 2PHDA 4R8HA 3H9AA 5I0UA 3EQEA 5LRRA 2Q1ZB 2O1QA 3BALA 3LOIA 2OA2A 4HVOA 2UY9A 1H1IA 2F4PA 2V09A 1O3QA 2K0GA 2K9ZA 2ZCWA 5CU1A 5FCCA 2GC2A 3CJXA 5EFUA 5LEJA 1CAUB 1J58A 3DV8A 2D93A 2QJVA 1O7FA 3E6DA 5E1RA 1YWKA 3FE5A 4LUMA 3SXWA 1ZZ8A 2CAVA 2WC2A 3ES1A 2DCTA 5FLHA 4QMAA 2OZ6A 3NW4A 4HSJA 3RDIA 1H1MA 3LAGA 4I01A 1XE8A 1YFYA 1I5ZA 3S7IA 4FAGA 4FBFA 4LA3A 1XE7A 2B8MA 3FX3A 1O3SA 5I93A 1O3RA 4HZFA 4HLTA 4LEJA 4Z82A 1PM7A 2VPVA 4R52A 4AQ6A 4QXKA 5BY5A 1UIJA 1GQHA 3KMHA 2H6CA 3ES4A 4H7LA 3WW4A 2OPKA 3IWZA 2P17A 2BYVE 4JV4A 4XF0A 4MH0E 3E5UA 3FWEA 2IC1A 5K8SA 3CLPA 3TNPB 2GC1A 1QXJA 1YFUA 4XFHA 2FMYA 2GAUA 4LA2A 2BNMA 4YARA 3S7EA 3H8UA 4I02A 5JSOA 4FAHA 1Q3EA 4Q0PA 4YRDA 1CX4A 3CEWA 5JR7B 3B02A 2PTMA 5KHJA 2GC3A 5FLIA 4NVPA 2PAEA 3HIFA 5I91A 1UIKA 3CF6E 5LEKA 3MDPA 3MYXA 5D1IA 2XLGA 4XFAA 3NSTA 1J1LA 1YFXA 4I09A 4EWAA 5I0RA 1ZZBA 2C0ZA 4OFGA 2UYBA 2E9QA 4IEUA 1RGSA 3LA7A 4K8FA 4Q0UA 1RUOA 4XFBA 5BXXA 1LRHA 3I7DA 3H50A 3RZZA 3WW3A 2HJIA 4YSFA 1O4TA 2EVXA 3CL1A 1ZZ7A 4L2NA 5F1RA 1V70A 2XGXA 1O5LA 3EO6A 4ZU5A 2B5HA 3OTFA 3IIAA 2ET1A 2MHFA 4HVRA 1WGPA 5I0TA 4BHPA 3U0ZA 5JCTA 1LB2A 3UKTA 1ZREA 4Q0SA 4IEYA 4WVZA 1NYWA 1J3QA 4I3PA 4PIZA 1PMIA 3LWCA 4L11A 3H1WA 4EWEA 1QWRA 4J1WA 2GU9A 5KBFA 4P9GA 2ZKLA 3RPQA 4B29A 3PNAA 1NE6A 2N7GA 1ZRFA 2PHLA 4MGKE 1RTVA 4XF1A 3SCHA 3D0JA 4D7TA 3ROUA 3BCWA 1WA4A 3I54A 3KCCA 3NJZA 2QVSB 1QY4A 2XHKA 1CAXB 3DN7A 4XEZA 1NE4A 1ZZ6A 3ACLA 3H1YA 2IXIA 4E2GA 1DGRA 1LKNA 1CAWB 4XF3A 3E5XA 1DGWA 2H6BA 2EAAA 3WW2A 3HT1A 2XL9A 1EP0A 1ZRDA 4QGLA 5BV6A 3EJKA 1QXRA 3H1MA 4EWDA 3RYPA 2MPFA 5BPXA 3UKVA 5FPZA 4Q29A 5KHIA 4IEQA 1O3TA 1J3PA 4AVAA 2Y0OA 4KWJA 1Y9QA 4LLOA 4MX3A 1GQGA 3D0SA 2D5HA 2ETEA 3KGZA 3D82A 4KU7A 4Q0VA 2PYTA 1FT9A 1ZNPA 4QGMA 4DINB 1ZRCA 4MGIE 4E2QA 5I0SA 1X82A 1YFWA 1I6XA 2PA7A 3EHKA 4IESA 3M70A 3ZDSA 1SEFA 2OZJA 3MZHA 4F8AA 2XKPA 3SCFA 3VHRA 5FDBA 2D40A 1EYBA 3ETQA 1UPIA 2BNOA 4LULA 2FQPA 1CAUA 3H3UA 3NKTA 5FQ0A 2Z2SB 1J59A 3RYRA 1Q5OA 3UKNA 3MPBA 2CGPA 1HW5A 4AVBA 4IEZA 2QDRA 4N9HA 2UY8A 3LA2A 3EBRA 3OCPA 4HBNA 4IETA 3H3ZA 5HI0A 3PLQA 1ZZCA 2D5FA 3WW1A 4HMZA 2H0VA 4E2SA 3ST7A 4AXOA 3S0MA 1TQ5A 2XLFA 2B9UA 3FFQA 3E6CC 5EZWA 3JZVA 4Z07A 3KGLA 1OFNA 4ORFA 4JVAA 5AVPA 1RUNA 1VP6A 4PIXA 1CGPA 3DL3A 4IEWA 1SFNA 2Q0AA 4X6RB 5JSRA 2PAKA 4JTOA 2IXKA 4KWKA 5I8TA 4D7SA 1FI2A 1IPJA 5KHHA 1RC6A 3BU7A 4XFGA 5J48A 5JSPA 1UW8A 1EPZA 1JUHA 2GZWA 3KSCA 4KL1A 2ATFA 4O9EA 3SCGA 3G7DA 1Y3TA 4WZCA 3N4MA 4XF4A 4X6QB 3H7YA 3OF1A 4PIYA 4HSLA 3ELNA 3BB6A 1CAVA 1X7NA 4PJYA 1J3RA 2KXLA 4MV2A 3PVBB 2PFWA 3LA3A 4MZUA 1UD1A 4HN1A 4QM8A 2IXCA 5CVRA 1YLLA 1UCXA 1LR5A 4ONUA 4IEXA 4JTNA 1NZCA 2Z69A 2CAUA 4BH9A 3TNQA 5LRSA 2GH2A 2GC0A 3QACA 2IXLA 4ZU7A 1EY2A 3I59A 3NL1A 2IXJA 5FQ0B 5JAXA 3SHRA 2QNKA 3U10A 3M3IA 2ET7A 1L3JA 4GULA 4IEPA 5KHKA 4HVQA 4AVCA 5FLJA 1XRUA 3E5QA 4META 2BGCA 1ZRRA 4QM9A 5I8YA 1VJ2A 1G6NA 5E16A 2HKXA 4XFCA 4I0BA 4TLFA 4EV0A 5I8SA 3CO2A 3C3VA 1YHFA 2I45A 4N9IA 2EA7A 4QGNA 4I2OA 4XETA 2IXHA 4WBBA 2WFPA 3GYDA 2CV6A 1X8EA 5FPXA 2O8QA 4HN0A 3O14A 1SQ4A 3RNSA 4EROA 5KHGA 1OMIA 3RYKA 4O9GA 2BNNA 4LTAA 4IEOA 4YYOA 4YNIA 1IPKA 3OGJA 4RD7A 3R6SA 1ZX5A 4AQ2A 4UBHA 4UXAA 3FHIB
chains in the Genus database with same CATH superfamily
5EV7A 4JHTA 1VBE2 2DFCA 4BMEA 5C71A 2CHHA 1OSGA 4LITA 2R041 2QCSB 2AC1A 4MGZE 5J3UA 2A5ZA 4GMP0 3ZO0B 4QWNA 2RS31 3ORJA 3I3DA 2XPJA 3S30A 5EYXA 4AEJA 5C6CA 5JZGA 3NV4A 2PHXA 3LOBA 4KWLA 2XLAA 4NIDA 2ZEZA 4OLLA 1PK6A 1A6CA 4COWA 2MEV3 1DLLA 1TE1B 1D7PM 1WLTA 1DBNA 2W2IA 4LKDA 4CDUC 1VR3A 2ZXQA 2A3YA 3D6EA 4F7ZA 2Q4SA 3CJIA 5LY1A 4IGQA 1U5YA 1RUD2 1UPSA 3MI8A 4SLIA 1TEIA 3MW4A 1AXKA 1POV3 4CU8A 4IQPA 1ZYBA 3NJYA 4IXLA 4UF0A 3TOJA 1RHI1 3QOPA 3OYWB 1OF3A 1X33A 2DU1A 3FBMA 1Q43A 3VBOC 1RXGA 2NMNA 3O1RA 1X9TA 3QBQA 4XJWA 4KBBA 2BEOA 3QD6A 4A2UA 3UT0A 4FFHA 3NVCA 1FPN2 3BPZA 4BK5A 1LNSA 1AYN2 1EAH2 1UZWA 3ATGA 2D6OX 4YLZA 3IN9A 1BZWA 4XJAA 1YQ5A 5FXZA 2ZX0A 3V65A 2YFZA 4HANA 1TME3 3ZPYA 4CP1A 4QHOA 5JAXA 1YC61 3D5OA 4WVMA 3WF3A 1JS9A 5J36A 1W39A 1OLME 2ZABA 1MS1A 1OF4A 1QJY2 2PMWB 2EXKA 2ZHLA 4D6RA 2XMLA 1UAIA 1FYUA 4Q4W1 1LENA 4R8HA 5I0UA 1S55A 2DU0A 3RVHA 5ACA3 1Y7BA 2Q1ZB 5FOJB 4E4HA 2ZGQA 3LOIA 1GFF2 2IVJA 2HLEA 2FCVA 2WZR1 4HVOA 2UY9A 1H1IA 2F4PA 4KGGA 3WCSA 3K4AA 2IUWA 1O3QA 1W6PB 1OPOA 2K9ZA 3JQWA 3MLLA 3WV6A 5DAWA 1AZDA 1U0AA 2WNEA 3MW3A 1EV11 2D6MA 3N9QA 5EFUA 1CAUB 3B7MA 3GJBA 1J58A 1NLQA 4XUNA 1ENRA 4JGZB 3DV8A 5T50A 1Q8SA 2D93A 4LE4A 4CPBD 2AUYA 1UF2C 1AR81 1G86A 1LOEA 4WM7C 3PHMA 3VBHB 5E1RA 1GP4A 5IUQA 1OA2A 4RN5A 1MZ6A 3FE5A 4TTGA 4URTA 3SXWA 3MFCA 1S0IA 3C2UA 3O5SA 4N53A 2WS93 4Y3OA 5JZGB 2JXAA 1LGCA 3AX4A 3FFZA 5CNAA 4AVSA 2VG9A 4DIQA 1W8HA 4NPRA 1ND2B 1V6NA 2EXHA 1PK6B 3GBGA 3GF6A 3LAGA 2BVBA 3O0WA 4ASMB 1W3XA 1BEV3 2R1DA 3NAPC 3OGVA 3IT8A 2ORZA 1XXNA 2CSGA 3AYDA 1QDOA 3PTRB 4GJZA 1XE7A 5FR3A 2KA3A 3AZVA 2V72A 3FX3A 3K75B 3ME2A 2DVBA 2EALA 2EXJA 2IZWA 1AXZA 4LXLA 1W8ZA 2WO1A 3EMRA 4Z82A 1DGLA 1JUIA 3R4SA 1PM7A 3NRUA 5DUVA 4EZHA 4XBNA 5IW0A 2JG8C 2WBKA 1A3KA 1UY3A 4AQ6A 1SCSA 5BY5A 1UIJA 1VPHA 3ZIXA 2X8KA 1GQHA 4PBPA 4Y22A 5T5LA 3SEPA 3ES4A 4TSVA 2ZMLA 3NNMA 2P17A 1HQLA 5KR7A 3URFA 1QQP3 4MH0E 1LGNA 3E5UA 1BBT3 3FWEA 4EYUA 5K8SA 2YC4A 3P6BA 3WQ1A 1PNGA 5A33A 4BB3A 1QXJA 2A7AA 1CR7A 1D0GA 2WN3A 2WR9A 1LHUA 1VBD2 5CIRA 2ARCA 2PXJA 2JICA 4EN7B 2WAOA 3VBUA 3ILFA 3HMYA 3HWJA 3KV9A 5JUVA 1OKOA 5CFCA 5IT6A 2DCZA 3OG2A 1TNRA 4P9YA 1WD3A 3S7EA 4BLIA 2JDPA 5JR2A 2RDSA 3E1F1 4I02A 1NKGA 1AX2A 1NAEA 3OGGA 5F32A 4YW1A 4Q0PA 4TYSA 4CU7A 3GZEA 2QQKA 4CCEA 5JR7B 2VOTA 2JE8A 1FOD2 5CFDB 3RZMA 4M0HA 2HWB2 1AR72 2ZTNA 1V6OA 3WG2A 1QJY1 2WT0A 3WG1A 5K7PA 2PAEA 4EN8B 3LE0A 1CIYA 3HIFA 2DDUA 1GANA 4AFDA 1UIKA 4DZGA 4OI1A 1W6QA 4D8MA 3AB0A 3KHBA 2ILMA 4XYXA 1UOFA 5FK8A 3I97A 3I2GA 2XLGA 1YFXA 5K9YA 1F2NA 2WSUA 4EWAA 1PNFA 4OFGA 2C0ZA 4E4ZA 1FNYA 4IEUA 2E9QA 3P3PA 1RGSA 2ZGOA 2VCAA 4Q4X2 5EJ3A 1SLBA 2VAUA 4XFBA 5DAVA 2Y26A 3RZZA 4C91A 2D6PA 2DYCA 1ENQA 2VMFA 4NHYA 2VZ1A 3H8XA 1L7LA 2CGOA 2CGNA 3ACHA 1V9U2 2BJSA 4H14A 4J6GA 4D69A 2VVDA 4LBLA 3CL1A 4G9SB 1W2NA 2D3PA 1V70A 2DTWA 4L2NA 4U2AA 2XGXA 2RR11 1U5ZA 1ZBE1 4DXRA 4AFMA 4ZU5A 2B5HA 2MHFA 5K4LA 1LODA 3V0BA 4HETA 4HVRA 2P37A 1BMV1 1H1AA 1GP6A 5F5AA 5JCTA 1JZ5A 2CYFA 4XC9A 3UKTA 1ZREA 4NIHA 3WDUA 2JG9C 3GZTB 1VBA2 3ZXAC 2OT7A 4PIZA 4W4ZA 4XCBA 2A6ZA 4FXGB 1Y9MA 3GCXA 3WLUA 3GJAA 3UGHA 4CCOA 3KS7A 1XJAA 1QWRA 3J8F2 3M1HA 4J1WA 4Y22B 2IFRA 3PNAA 1J83A 4XBQA 2N7GA 1MQTB 4JQTA 1AX1A 3FL7A 2WNVA 4MGKE 3N7MA 3N9LA 5EHDA 3VB9A 1RTVA 1V6IA 1UMZA 1RVF2 3DYOA 5GLTA 3PUIA 4M0NA 4XW3A 3T0BA 4AK3A 4P08A 2VQUA 5A1FA 5A33B 4YW2A 4QPIC 4D7TA 2FMDA 2ZAHA 3BCWA 3NJZA 3TEXA 2QVSB 2RS51 5KWRA 2MEV1 3MIBA 2HWD2 1HV1A 3AL6A 5IK4A 2W39A 1CAXB 3S5AA 2D44A 4XEZA 3VBUB 2W0XA 2ZX3A 3V56A 5CFCB 2YGLA 2HEYF 4DXZA 2CNAA 5DUUA 1UMIA 4QX7A 3DPRA 1W8UA 2EIEA 3H1YA 3Q8FA 4LKEA 3VL8A 5AC92 1RUG1 2RM22 4ZY9A 4Q4V1 1DGRA 1CAWB 2Q1FA 4YG3A 2ZBJA 3WVJA 1HJGA 4BJ0A 1ZBA3 1DQ2A 4RFT0 1DFQA 1WLCA 2P6HA 3JXSA 2H6BA 1PGL2 1DLCA 4YGBA 5LA1A 3HT1A 3BOPA 2Q8OA 3CZJA 3I3QA 1YRZA 1F15A 4QQPA 4B4RA 5GZEA 4WVWA 2DCKA 2WDBA 1STMA 2VZPA 1G9AA 3UKVA 1NCQA 5FPZA 4OZXA 4IEQA 1PVXA 1YYNA 1HRV2 4KWJA 4MX3A 2ZGRA 4DNYA 2VNOA 1GQGA 4DFSA 2HWB1 2BERA 4CSWA 1MZFA 2QE3A 4NHLA 4CEWC 4CXYA 2DCYA 4R9CA 2J22A 2ETEA 3NV3A 3AMNA 4YW6A 4S2FA 1EUTA 5T5PA 4FTBA 3MUZ1 1TME1 2PYTA 1FT9A 3SH3A 4EJRA 4Q2FA 4AZZA 4BOWA 2WO2A 3NQHA 2BTVC 2C9KA 1QU0A 1ZNPA 3VBRC 4HXCA 4E2QA 2WNUC 1QKQA 1I6XA 2PA7A 1GICA 4IESA 4FFFA 1H2MA 2OZJA 3PJQA 5FP8A 3MUY1 1QJU2 5LWBA 5ACA1 3LGRA 3POWA 4BMBA 2QQJA 3ZLIA 5C8CA 1JTZX 2DCJA 1KITA 1UPIA 4Q8KA 5FO7B 2VMDA 4LULA 3WCRA 1QIQA 3T0DA 3HEIA 5A7OA 2AENA 1Q5OA 1LHWA 3UKNA 1C8M2 3HBZA 3M2MA 3ZSJA 2QDRA 4AE2A 1NY72 4N9HA 2UY8A 4DEVA 4HBNA 2ZX2A 2J1RA 4IETA 2VZVA 1CZVA 2CL2A 1PO23 4QDSA 5FZ1A 4CDQA 4J25A 1AR62 3WW1A 1Q8QA 3ST7A 2WNVB 5FYMA 3UJQA 4AEDA 3OY8A 4AXOA 3S0MA 5F37A 5DAQA 4NAMA 1BJQA 2R061 4JX0A 1K45A 3E6CC 1T6BX 2ZA9A 5EZWA 5IWFA 3ZFFC 3KGLA 1PIV3 1DCSA 1RUE1 1BEV1 4BQ2A 3LQCA 4MOAA 4ORFA 1IS6A 4QQHA 5GLZA 3ZYJB 5H9SA 1N3PA 2BOJA 3VZOA 1RUNA 5FMOL 1CGPA 5FJHA 1AF9A 4YVSA 4AL9A 1F4HA 2Q0AA 3DPRB 4P9JA 5SV8A 4X6RB 4ET7A 2HWD1 1F9KA 1QDCA 3VBOB 4A6OA 4JTOA 2IXKA 1GR3A 2Z4FA 4KWKA 2R0HA 5I8TA 4AI2A 1NLSA 3VLBB 3DUIA 4IE7A 2QZ2A 3APBA 3RSJA 1LULA 3BU7A 5FXWA 4C8DA 3IB3A 3J9SA 2GNBA 1WW5A 4GH4A 1LESA 4GJYA 5G05L 3TN93 1EPZA 5GKAC 4XQDA 5DAPA 4O9EA 1KJLA 5GM0A 2X5IA 3G7DA 4Y5TA 3KT4A 3N3HA 1KDMA 3U4SA 1LOFC 2VZRA 1I5PA 4PIYA 1OURA 3U4XA 2RS13 1VLNA 2VU9A 3O1TA 2G19A 3BB6A 1CAVA 4NPLA 4P5YA 4W6WA 4CP0A 1J3RA 5T5JA 3RJRA 4MV2A 4XJ9A 4MADA 2WT2A 3B3QE 4MZUA 1RITA 4NRMA 1HRV1 4LE3A 4Y5SA 4QU2A 1DYKA 4XMIA 1ZRIA 2CDOA 3WNOA 1S0JA 4JGZC 2R043 2YY1A 4ONUA 4AEKA 3WG3A 3UK9A 1RUH1 1OLRA 2R6QA 4RGAA 5HXMA 1NZCA 3JB4C 4X8NA 2W1QA 4LO5B 4BH9A 2ZGSA 5C8CB 5IFPA 4MO3M 3H42B 5L19A 3QACA 2BBVA 3SKJE 3AFKA 5AFBA 4IGPA 3NL1A 4NPMA 3GZUC 1HXS3 5CKQA 5JZGC 1JI6A 4BM8A 2W1UA 1GSLA 3SQOA 1W8TA 3DGTA 4XIOA 5F7UA 1RB8G 2BU9A 4C0HA 1JOJA 2W08A 2GMEA 1PK6C 2WN2A 3M3IA 3U10A 2X53S 1AJKA 1IKQA 3Q9OA 4WVVA 2XUMA 1LHNA 5FZ6A 4OYUA 4LMFA 4XXPA 3BODA 2ZHKA 4LBQD 3CJIC 3UGFA 1RHI3 2Y6KA 4CDQB 2YG0A 5IVJA 4NHKA 4META 2PELA 3GGLA 1PGSA 2D43A 1ZRRA 1HB3A 3ZSEA 2NQYA 1G6NA 5GLWA 4GMP1 4Y20A 4GXLA 3RWNA 2YXSA 5E16A 3VDCA 1W6MA 5FXXA 3VUOA 1YI7A 5A7SA 1K5MA 3U07A 2C6SA 3CO2A 3C3VA 5FY4A 2I45A 4N9IA 4PT6A 2JG8B 4Y5Z0 2XBO3 4QT6A 2I74A 2JE7A 3WDTA 2WFPA 3GYDA 2CV6A 4ATFA 2XWJB 3CBNA 5GJ6A 5FPXA 2UU8A 3KF3A 4AI0A 4C1XA 3O14A 1SQ4A 5KHGA 5LA9A 3AFGA 3WDWA 5FZHA 3ZYIB 3N7KA 3AP6A 4YYOA 3ZYRA 2ZMKA 3OGJA 4RD7A 5LBEA 3R6SA 4HFSA 2RJ2A 3V0AA 4UBHA 2ID4A 3U11A 3X29B 2X5IB 4UXAA 2VZOA 4Y4RA 2F17A 2XJPA 3VKMA 2WZR3 1US2A 2PHRA 1OVSA 2Y6GA 3VD4A 2A6WA 1KQRA 2JEMA 3NWKA 1CAVB 4ITCA 1ZZ9A 3RMYA 5ABJA 4FPLA 2VR4A 3WSOA 4MGYE 3SMHA 4EE2A 4FT8A 5J96B 1JYWA 3WUDA 1U5XA 2E32A 4IDZA 4NJ4A 5J7MA 1R64A 2YV8A 1NXMA 5FYHA 1X8MA 3H8OA 1XU1A 4N8MA 3ZSMA 3JU9A 5C5UA 1PHMA 3ILNA 2LALA 4G4FA 4OCTA 3HVDA 2ZZJA 2PLV1 4BCUA 4CDXA 1T6GC 1ZBA1 1QOSA 2JECA 1HIXA 2OKXA 3OUIA 1TNFA 4BIFA 5JWPA 1JYNA 4NIGA 4FI9A 1NQDA 1VBE3 1A78A 3H3LA 1AYM1 1GYKA 3LDKA 1E57A 3VZNA 2YGMA 1WA6X 1NA1A 2D3SA 3KV4A 2BRTA 4MUVA 4N53C 2OYZA 3WNMA 1V00A 4CYDA 3IMNA 5FZ3A 1OHFA 1RYYA 1IG3A 3IKWA 3RZLA 1UYZA 3T0AA 1QNWA 1D4M2 3N36A 1Z7S1 2B4KA 5J37A 3B9CA 3W21A 3PDQA 4RHV2 2VUAA 3ZR5A 4FQZA 3AKTA 2XKOA 5C5TA 4OQ9A 4NN0A 4A44A 1UMHA 4Y33A 1N1YA 2WA3A 4IEVA 5G04L 3VV1A 3HD8B 3WINE 2UWCA 5HBAA 1FXZA 4OZOA 5KC5A 2TNFA 4XJ8A 1YUDA 2QQPA 4DY3A 2B45X 2VW2A 1RMU2 2VECA 1C3HA 2QKDA 2Q8CA 2WLQA 2JJ6A 2XG3A 4CP9B 4KNCA 5LW9A 1DZQA 3HT2A 1OI6A 3K51A 3H7JA 1K5MB 1WCSA 4DXSA 1OD5A 5C3RA 2HEVF 4QX5A 2OXBA 2R49A 2RDNA 3HQXA 3J7MA 3PIJA 1TMF2 2E31A 1UKGA 2JD4A 3JUUA 3TWIA 5FZ0A 1WCKA 3UJOA 2PHDA 4TXWA 4M3CE 1XNKA 4BQWA 3T08A 5GZDA 5F5QA 4FTEA 5LRRA 1QNYA 1QXPA 4ZHNA 5A3UA 2NMOA 1WW6A 2Q5TA 1WMDA 2VE1A 1S0DA 3GNEA 5EXOA 4B7KA 4BQ4A 2OA2A 3HN1A 2V09A 4TN7A 3VBUC 2JIGA 2VCCA 5CU1A 2ZCWA 3FC0A 5CFCC 4HPKA 2E6VA 5FCCA 2GC2A 4LLFA 3I3BA 5LEJA 3ACIA 3NNGA 1W0OA 5GALA 1OA4A 2ZZQA 2DTYA 4LQRA 1VIWB 4XPVA 4HK8A 4OHVA 1QJY3 4YFWA 4GIQA 3WF1A 5F2SA 2V73A 1YWKA 1R1A2 1XNCA 4LUMA 5JMCA 4DUXA 2L9LA 5LBFA 5GLUA 1A34A 2BVVA 4LHLA 2R1BA 1R092 1UZ0A 2DCTA 3T4HB 1RUJ2 4E8DA 3J26N 2GDFA 1AHSA 1I5ZA 5F39A 5GZGA 1VALA 2V4VA 2GNTA 4A41A 3OBAA 4CDXB 3TBDA 5A3PA 5HXVA 3PUAA 5I93A 1CESA 4HLTA 2D98A 4QPGA 4LEJA 4CZSA 1K5JA 2YZ4A 4TWTA 2QTWB 2VPVA 4FP2A 2RR13 5FZOB 1ZBE3 3DXTA 4R52A 1WD4A 5L7OA 3BTYA 4QXKA 3ZYGA 2W1WA 3WHTA 5JXGA 5L36A 4FPFA 3I2KA 1I3HA 2XH6A 4PLNA 5FY7A 2BPA2 2OPKA 5CKMA 4AYUA 4CUBA 4JV4A 3LF7A 4CA9A 1CWPA 1GWLA 2A71A 2GMPA 3CLPA 3T2OA 2JDYA 3AK0A 3LDRA 5IK7A 2GC1A 1A8DA 1YFUA 3WOGA 1IPSA 5BNOA 4GWNA 1W8OA 4BZ4A 5FZIA 1H30A 3KCXA 4UFKA 1LCLA 3D4KA 2H0BA 4B4PA 5FPBA 3RWKX 5B4XA 1YNAA 2XVLA 4YARA 3VD3A 5FP3A 4Y4YA 1LEDA 5FZMA 4JAAA 2DUPA 2RS53 2WNVC 3NKGA 4MGQA 1LAJA 1HXS1 1IS5A 4HONA 4LIVA 3GCWA 3O1PA 2VNGA 4AFAA 5DN2A 1CJPA 1XPWA 2R072 5IVYA 2QQLA 1US3A 1HKDA 2YUEA 2EXIA 3WNNA 5A80A 4Z8BA 3LEGA 1RUG3 1UX6A 3NNLA 4Q4Y2 3ZPOA 1N1VA 2B42B 4Q4V3 1TZOA 1UY4A 5JPNB 1XYNA 1C5HA 3WDVA 5LEKA 3MYXA 5D1IA 5BNQA 1WUVA 3DPRC 4UAPA 3ZFFB 2G4IA 4XFAA 4I09A 2V5YA 3RGBA 4FPOB 4V1PA 1ZZBA 1W9SA 3OEAA 3AP9A 4CP2A 2Y6FA 2RJKA 1UN1A 3LA7A 4K7JA 1JZ7A 1PO12 2HWC2 3N9NA 4XE9A 5BXXA 4CCJA 5IK5A 4NHMA 3I7DA 2UWBA 3BIWE 4UI9L 5FZAA 5LZ6A 1F4AA 1HDKA 3IDEA 1XYPA 4XUQA 3WF2A 3I2OA 5FY8A 1O8SA 3J4UH 2HWB3 1AR73 4YSFA 4Y24A 5J09A 1V6LA 3MFAA 3KLSA 1NCQC 3POSA 2XBO1 5EQUA 1ZZ7A 2WFF1 1Q56A 2Z42A 3ZFGA 2GN3A 2SBAA 2QBXA 3THDA 3OEBA 4AF9A 3EO6A 1CQ9A 1OA3A 3MIHA 2VW0A 1VBB2 3OSDA 2WWUA 3OTFA 4PBOA 3V64A 2RJLA 1RUJ1 4GWMA 3ASIA 3U0ZA 4DMIA 4Q4X3 4QPGB 5JIUA 3RJ2X 3ZFEA 5DZEA 3JBG2 4I3PA 2A6XA 1SDWA 1REDA 3VBFA 1OQDA 1PMIA 1V9U3 4RS5A 2R30A 3MIEA 5CEHA 4IUGA 4BQXA 2VZSA 1PMHX 4QKBA 1NE6A 4XXAA 3AP5A 5C8CC 3VZMA 3HNYM 1LHVA 3PMSA 2GNDA 5C9AA 2BGOA 3SCHA 4ZS2A 1OOPA 4LBKA 4LHKA 2Q8EA 4EQVA 2FD8A 4UOJA 4X8PA 3ROUA 2ES3A 3I54A 4XBLA 2P34A 2PHTA 3M3QA 3P5BA 5J1XA 4PDWA 1ULOA 2WSVA 2XHKA 3VDDA 3DN7A 3I2DA 2J1VA 4QQOA 4A42A 2Y34A 4QDRA 4Z92B 4HKLA 1ZZ6A 1VBE1 1QJX2 2R063 4CDQC 4YVWA 3LIHA 4LR4A 3J8F3 2BQPA 2XJTA 3B01A 5FZEA 3W9AA 4DQAA 2XJRA 1UQXA 4QX3A 3SC7X 4AEDC 3J7HA 4CE8A 4QB6A 1RUE3 2D97A 4EN9B 1DGWX 4ZKTB 1RVF3 2WQ8A 3CJIB 1RJ7A 5JDBA 2EAAA 3SH4A 3VKOA 3J7LA 2W5FA 3WP3A 1BK0A 1UY1A 1APNA 2PHUA 5BV6A 1AR92 2DVGA 1WCQA 3KT7A 1GNHA 2HWD3 4ISQA 4UF0B 5TSWA 3WNLA 3WF4A 2BW8A 1XU2A 2FCTA 4BQYA 4CCLA 4CEYA 4NE9A 4Z2AA 4OVEA 1N3OA 4COYA 1UL9A 1O3TA 1ND3A 1J3PA 2O0OA 4YVSC 1NCRA 4AG4A 1RUD1 3W5NA 4OHYA 3AJYA 2RVAA 4D7YA 1I9RA 1N3QA 1SBEA 2X10A 4Q26A 1NZIA 3D0SA 3R4DB 4L0PA 4LIUA 2RM23 4UWDA 4ARYA 1Q8VA 1JBCA 1BCXA 4KU7A 1B35A 3C7HA 4NAOA 1OQ1A 4Q1PA 4UFIA 2O14A 4AAPA 1G8WA 4RQPA 4GH4C 5T55A 1QH6A 3WP4A 5FZGA 4DINB 3OUHA 4QKNA 3IAPA 5BNNA 1LU2A 1XC6A 1ZRCA 2V4AA 2X5IC 1XE0A 1UX7A 2FHRA 3M70A 1G7YA 3UETA 3MZHA 4F8AA 2P3YA 2VUCA 3ZFGB 1FPN1 1HRV3 4PF5A 3ON7A 2YU2A 4LBNA 1AYN1 1EAH1 4WVMB 5CKNA 3IAQA 4UYBA 4Y1VA 4JQRA 3FBYA 4W6XA 5DQ0A 4Y1XA 2V5DA 3NKTA 1RUH3 1RUF2 2Z2SB 1J59A 2OQ6A 1J84A 2JDZA 1JYTA 4OHXA 2A3XA 4GKYA 1HW5A 1HRI2 3T1LA 3ZFEB 4IE0A 4QD2A 4AI3A 1WW4A 1SLTA 2JIJA 3LA2A 3EBRA 2VMGA 3VBFB 2YBPA 4BK4A 5LB6A 3KHCA 5HI0A 5ANNA 2HH9A 4FQ4A 4RS5B 3AZZA 3VBSA 1YCIA 2J1SA 4S2DA 3RZJA 1JZ8A 2E51A 2D5FA 4QB1A 2TUNA 4HMZA 1QJU3 3PL0A 3PUHA 2H0VA 4K21A 1BXHA 3QH7A 4KMQA 3TEZA 1KJRA 5C9AB 1DHKB 4AFBA 5FMCA 1AL22 4V2WA 1PZ8A 3K77A 2B9UA 5FIXA 4RGKA 1GMMA 4PDWB 3KZ4C 1C8M3 4L9BA 1D4VB 1SPPA 3WNPA 3ZYFA 4AAXA 4N53B 1VP6A 4PIXA 1Z78A 1H8TA 4M3CA 1U5IA 3CU7A 4IEWA 4NHXA 1WMFA 4P9IA 4GMP3 2ARXA 3KB5A 4KBZA 3TAYA 5JSRA 3HR9A 2KM2A 2J1AA 5A1LA 3WG4A 4D7SA 2GP5A 1FI2A 3C7EA 3GDBA 1SACA 1IPJA 3KCYA 3O1MA 5HCFA 5IATA 3WNKA 2VNRA 5J48A 5JSPA 4NR1A 1OUSA 1UU5A 1VAKA 3N7LA 1K5MC 2GZWA 1OPMA 1BHGA 1KFUL 2ATFA 3KWVA 2ERFA 3ZX7A 1Y3TA 4CEYB 4CUAA 5DMYA 4A7KA 1WKYA 1H2NA 2VTXA 3A21A 1NCRB 4OUMA 2XXZA 4JKLA 5L73A 3OGSA 4HSLA 3BTZA 2XONA 4CTEA 4AWDA 4PJYA 2A75A 2JX9A 1SLCA 4KQ7A 3PVBB 3IZOA 1HN1A 2PFWA 3K3NA 4CRQA 1UD1A 4RSUA 2FDIA 4QM8A 3PJYA 1F5JA 4RQPB 1IQDC 5LASA 1YLLA 3FHQA 4MXVA 1FX5A 1OH4A 2ZS6B 3N9OA 4JC1A 1HQNA 3DXUA 3GHMA 5C3PA 1KRIA 3THPA 1W28A 2QFEA 1H9WA 3MIGA 2GN7A 5FMOS 5CA6A 1RUC2 4LPLA 2XJSA 3N9MA 2WS92 4QX1A 2VC9A 2XR4A 3B94A 1WBLA 5ABJC 2ZX4A 1ASJ2 3M3CA 2IXLA 4QU1A 5T52A 1VBD1 1EY2A 3I59A 3LDBA 5ANQA 2XUEA 2IXJA 3CMGA 3JCIA 5DZGA 2VMCA 2PLV3 5DG2A 1W9TA 5DDJ2 1IG0A 5APAA 1ZM1A 2VOKA 4OULA 4WV8A 1RINA 3SHRA 4YZ1A 1CPMA 2AZ5A 1AYM3 2ET7A 2Y6HA 3POIA 4ZPIA 4B7EA 3POYA 1JZ3A 3UNPA 4W8JA 4CDXC 4K9SA 4GULA 1RUF1 4IEPA 5KHKA 5FPLA 1WLDA 5FLJA 1XRUA 1XNDA 3E5QA 4Y1UA 1W6QB 2BGCA 4N43A 2NPIA 1HV0A 5FMBA 1FOD1 1AR71 1VJ2A 1NA1C 1R082 1Z7S3 3O0VA 4Y1ZA 3RZHA 5DPNA 3AMHA 4CDWA 1M4WA 4E9KA 3MV01 1KS5A 1BVP1 1QQP2 3WF0A 1BBT2 4I0BA 4UFJA 1JOPA 4TLFA 5F6LB 2WL1A 2VCBA 4TLGA 4XQWA 4ARXA 1D2SA 1SPPB 1YHFA 3IMMA 1H8TB 2W91A 4M3CB 3B5LB 1I1EA 5FUPA 3ZM8A 3HQUA 5FK7A 2OUHA 4Q4X1 5EYYA 3TEWA 2G9FA 3DYMA 3M7AA 5FUNA 1H4HA 2Y60A 4AEMA 2BZDA 1CPNA 4CCMA 4ZXEA 1G9CA 2O8QA 1OKQA 2OW4A 3RNSA 1V9U1 1PZ7A 4AI8A 4EROA 2FDKA 1OMIA 3OGRA 2XJQA 4N90A 3I49A 2BNNA 4LTAA 1G9BA 1UYYA 3V0BB 4YNIA 1IPKA 1DP0A 4ES9A 2YBKA 1O4YA 2NZ9A 2WO3A 1GOFA 3FHIB 3OD4A 2XVGA 3SNMA 2I07B 4B3NA 4IV1A 3I2HA 2ZEWA 1DU3D 3AMMA 3SEEA 1WMEA 3MLKA 4XFFA 4V2VA 2R7EB 2HWE2 4HG6B 2Y64A 3AKRA 5AVAA 1YO8A 1W2TA 2DFBA 1VBA1 2VGDA 3E97A 4A4AA 4XFIA 3MHZA 4P14A 2YBSA 3QH6A 4A6SA 5ISLA 1GQPA 5CADA 3J8F1 3HJRA 2HYXA 3WX5A 5DG1A 5A6XA 1K3IA 1WZXA 3AKQA 4Y26A 1UO9A 4P9XA 4AHYA 1E5IA 1GOGA 1M06G 4KI5M 3MF6A 5FZ8A 1RVF1 2LW8A 3Q8BA 3P3NA 3LZZA 4BQ3A 1PX3A 1JOBA 3SH5A 5FY9A 4ZU4A 3U78A 5FP4A 3I59B 2MNGA 5M0TA 4CU9A 3VHNA 2ENRA 3TEYA 2LROA 1O5UA 3FZ3A 1XOYA 4KU8A 3M3EA 4LBMA 4UBGA 3BPSA 1W0PA 2FZ1A 3ZN4A 4ATEA 4S2GA 4DXTA 4MVTA 5A3MA 5AC91 2RM21 4K40A 2IVIB 3ZXKA 1W2AX 3ACFA 2BGPA 2VQAA 1NCQB 4N43B 3FJSA 2JKBA 1HN0A 1D0HA 4BISA 5C70A 1PGL1 4QPGC 1CX1A 3BTAA 4HT1T 5H9RA 5ERLA 4B1LA 3ALQA 4Q0QA 1UU4A 4CDWB 5L7OC 4AHZA 3AZYA 4INDA 3DKWA 4XZUG 4FPJA 2WJSA 4UFMA 1CZSA 1V6KA 1R081 1U12A 4LKFA 1W6OA 3A0KA 4RHV3 1UYPA 4UW4A 1LOGA 1ENXA 1JZ4A 3CZUA 4N7UA 2KR2A 3H9AA 3PMEA 1JZ6A 5BNOC 2O1QA 3BALA 1W99A 4N7IA 2XWBB 3USUA 4AR2A 2P4EA 3OUJA 1RMU3 2K0GA 1UY2A 3GBWA 4KG0A 5F2WA 1JYIA 3CJXA 4YPJA 5LY2A 4QX0A 5FYUA 5L9RA 2YFUA 3DKQA 1HB1A 1QJU1 5E8AA 1FMD2 2FZ2A 2QJVA 3AKPA 2OPWA 1IS4A 1RJ8A 4FCAA 1SZBA 1TMF3 4BPZA 4D6QA 3B9IA 2WA4A 3E6DA 2C5DA 2GP3A 5C7GA 4FPYA 5DAXA 4LO4B 1C8M1 1PX4A 1GV9A 1NY71 2VD7A 4AEDB 3RG0A 1LTEA 3OY8B 2ZGLA 4IE6A 1MS4A 1DGRN 1VBC2 4QMAA 5FYZA 1H6YA 3THCA 1H1MA 3EB7A 4HKWA 1PVC2 4I01A 2BFUS 1QEXA 1VAMA 1YFYA 1AR61 1Z0HA 2VXJA 4RR3A 3S7IA 3ZXLA 1MS9A 1PGW2 2DBNA 2JDMA 4C0BA 4FBFA 1S0FA 4QHZA 4LA3A 3THTA 1JXNA 1MZEA 5JXJA 1JW6A 1R1ZA 3RS6A 5FZBA 4XTMA 4YVSB 2PHWA 5FXVA 1ZA7A 5JI7A 1G9DA 2WFF3 3PURA 3ZKUA 1CIWA 3T2QA 4FSJA 4DUWA 2CTVA 4RYDA 2E63A 1N47A 3LEMA 2DF7A 1R093 4PLMA 4MXWA 5JIAA 3GZAA 2YHJA 1RUJ3 4H7LA 4NUBA 5EJ1B 2FDJA 1CJDA 2W52A 3WW4A 1H4GA 4GH4B 3ZFGC 5F9TA 4YW4A 1W90A 2RDQA 5CB7A 5EPAA 2IC1A 3F2ZA 4NWVA 5EP9A 4M4PA 4QXHA 1UZVA 4XFHA 3PVNA 4AOCA 4AQTA 1F35A 1MS5A 1POV0 1VRH2 1Y4WA 1PO22 2FMYA 3ZFEC 5H9PA 3WQ0A 1YEWA 2B39A 1XNAA 5JXIA 3DF0A 1YIFA 2R0FA 3ZOIA 3JD72 3VBFC 5FPUA 3K3OA 4AQSA 3KVAA 5HCAA 4RS5C 4QXCA 5C33A 3H8UA 1LU1A 4FVVA 4LORA 3I3MA 5JSOA 1RIRA 4D6SA 1W6OB 3BOWA 2QQVA 4L97A 4GB32 4XJZA 3ZMNA 3ZXGA 2QQWA 1AUYA 1OQEA 5A32A 1MACA 5C9AC 3ZSKA 5FYSA 1WMXA 1OOPC 1JU4A 3B02A 3N9PA 4FPHA 2PTMA 4GAZA 4HL0A 4PHZA 1CVNA 5FLIA 3N7JA 3USUB 2RHPA 3GALA 3VL9A 4PDWC 4MHRA 1LJ7A 2ZPXA 2WO7A 5CZKA 5FAXA 3VDDC 2VULA 4NVPA 3LSDA 3CF6E 1FATA 4DPNA 1F31A 3MDPA 2UURA 2JD9A 2QQUA 3K4DA 3LSEA 1V6JA 2EICA 4YVWC 4CCDA 1J1LA 3QLQA 2W94A 3ZIWA 4DRRA 1T2XA 3BYWA 4CEYC 2RG4A 2BBAA 1W2UA 4LK6A 4XQ4A 3VHOA 3TN92 3S57A 2UYBA 1F8VA 4D3WA 4XUOA 4DUVA 3T1MA 1WW7A 3H50A 2D6LX 1POQA 4IGOA 4W65A 1KFXL 5I0DA 4MG2A 4ZS3A 1RUD3 2R073 3MIDA 3W20A 5DUWA 3W58A 4FOWA 5JXHA 2RS12 3WD5A 2R16A 2VMEA 1O4TA 2EVXA 4FOQA 4P02B 4Q4Y3 3AMPA 3HOBA 4QXBA 4Y20B 4AHWA 1KD7A 4B8EA 1ND3C 2WZ8A 1NCRC 2Q1MA 5FO9B 4RR3B 1W6MB 4NWWA 1UKRA 1UYXA 4YM3A 2XOMA 3M3OA 2VMIA 3VGIA 1QHDA 5C4WA 3OBTA 4P00B 4YW3A 2ET1A 1VBC1 2NP0A 2YPJA 4Y1YA 1B35C 4BHPA 4NOTA 2RS32 1PO13 4BE3A 4XAAA 1LB2A 1ZA4A 4RQPC 3WDXA 5A6YA 1GU3A 3KV5A 4XTPA 5K0UA 1JN2P 2P6CA 2TBVA 5BNNC 1FPN3 4XMAA 3LWCA 1AYN3 1EAH3 2YC2A 4L11A 4RFRB 4CXWA 3HNMA 4WM8A 3H1WA 5JPMB 4MXWB 3ZXEA 5FBJA 3POBA 2GU9A 2ZKLA 4B29A 1HLCA 2CU5A 5FY1A 4LBJA 3KT1A 2A73B 2P3KA 1SDDB 3HBKA 1LOCA 3OBZA 2P3JA 4LBOA 4MYEA 3V0AB 3D0JA 4I3GA 3ITQA 1VBB3 1JODA 4CU6A 2VBDA 2VUJA 1WA4A 3KCCA 1GZTA 1QMJA 1RHI2 3AM2A 3OBRA 3POGA 5ABJB 2RV9A 4A3ZA 2EAKA 4UFLA 3ZXFA 3RZKA 3VBSC 1GZCA 4OQ8A 1DQ6A 2B9VA 4YW7A 3F95A 4PI2A 1D2QA 2IXIA 3KM5A 1VRBA 3C7OA 1LKNA 2RDRA 3L2YA 5IVEA 3E5XA 1GP5A 1LOAA 3JD71 5A32B 5LA0A 2WIIB 1FNZA 2JE9A 3ECQA 5BNPA 1SMVA 3IDAA 2X05A 3WW2A 2EIBA 4DOUA 2XL9A 1EP0A 1ZRDA 4UW5A 1UOGA 1C1LA 1QXRA 1YQ6A 5T54A 4EWDA 1OXCA 4R4XA 5BPXA 1NG0A 1O59A 1NA1B 5FZFA 3NJVA 1H8TC 4Q27A 4Q29A 5KHIA 3RFRA 3U1XA 5KXBA 5HV4A 1Y9QA 4K1ZA 1H0BA 1URXA 3O0XA 2VY0A 3CQOA 3ZKYA 1W8FA 5F5IA 3PUQA 4Q4W2 4OI0A 1TVGA 3D82A 1S2BA 2WZEA 3KD4A 4Q0VA 5FZLA 5GZFA 4D0QA 2XJUA 2ZOEB 1A8MA 3ZR6A 1Y43B 1UWWA 1D4M1 4BA6A 3POFA 4QGMA 1ULPA 5L9VA 4MGIE 5I0SA 2ZJCA 2VQ0A 1X82A 2ZACA 4RHV1 5JMOA 4UT5A 3EHKA 4RL7A 1DQ5A 1EV12 3ZN6A 1DYOA 3VKFC 2A70A 3S5QA 2ZHMA 2ZKNA 1MPXA 5FP7A 3VHRA 3ZVXA 4HKOA 4K8RB 3UV9A 2D40A 3ETQA 1JHJA 4XURA 4LKSA 2G9ZA 4FTSA 4ASKA 3AP7A 1AR82 2BNOA 2D3RA 1RMU1 5FY0A 1QF3A 1CAUA 1S1AA 2AH2A 4JGYA 1SFPA 3AJZA 3MPBA 2JDAA 4BIOA 5K0UB 5FYYA 4I30A 3NV2A 2XQRA 1H2KA 3OCPA 2FDHA 1C1FA 3LPFA 3B69A 3H3ZA 3VBHA 1TMF1 5DABA 1VBD3 3PLQA 1ZZCA 4WM8B 4ZONA 4DS0A 5IVCA 4A45A 4HPKB 1S0GA 2AREA 2VOXA 4EN0A 5LK5A 1S0CA 2E7TA 2PN5A 3U75A 1TQ5A 4QX8A 4B4QA 3PVEA 1ND2A 2HWF2 4AVVA 1LEMA 4YZ2A 3FFQA 3JZVA 1IKPA 1DQ1A 3PU8A 1VMJA 3WUCA 2WAAA 1RUF3 1XNTA 3BGAA 4XDOA 5A6QA 2W92A 5IK8A 4M4RA 3OPWA 2QQOA 3DCQA 1NQJA 1HRI3 4NMIA 5AVPA 3VD7A 1DQ4A 5GLVA 4LNVA 1FOD3 4YZ4A 2ORXA 2QQMA 3DL3A 2VZ3A 4UW6A 4QDQA 3Q8EA 3LPGA 2AEZA 2J7MA 1W05A 1ENSA 4N43C 2ZEXA 1R1A1 2PAKA 3WR0A 1BK1A 2VVFA 2DVFA 1DIWA 1XQNA 4QKDA 3NV1A 2D7FA 2Z5WA 4C1WA 1MS8A 1K12A 1RC6A 2TEPA 3CNAA 4XFGA 4A7ZA 1R091 3G6JB 4CDWC 5BNPB 1AL23 3N35A 3MV11 1UW8A 5EWSA 3ZYBA 2RMU2 1KEXA 1JUHA 3MF9A 5CBLA 3T09A 1L7QA 4QQ2A 5HCBA 2GNMA 1N1SA 1MEC2 4FFIA 2KD7A 4WZCA 2Y33A 3ACGA 1SG3A 3N4MA 3KF5A 4XF4A 3H7YA 3OF1A 2QQNA 5A7NA 3FLPA 5A1AA 3T4VA 5L7OB 1SLLA 3ELNA 1O6UA 5IAXA 2GALA 1JU3A 5FYTA 3UYJA 1H8VA 2OIIA 2ZMNA 3HAGA 3I2IA 3LA3A 3SISA 2XHNA 4HN1A 2Y38A 3L9JT 3T2PA 1OBNA 4YGCA 2W87A 5FFOC 1C5IA 3A22A 5F3IA 5BNOB 1UCXA 1LR5A 3VKLA 4JTNA 1Q8OA 5KXDA 2NLRA 3ZN6B 2Z69A 5CFDA 2SLIA 4XZPA 1VBA3 1B09A 4IV1C 2VUDA 4ZXKA 1OH3A 4L99A 4XACA 5LBCA 4F83A 4YFZA 4H7MA 3LFIA 4PQ9A 3TNQA 2GH2A 3AZXA 2GC0A 5JLVA 5JOZA 2WZPP 4CCKA 1V0AA 5FWEA 3HN3A 1W2OA 5EJZB 4JGYB 4L92A 1W0NA 1AJOA 2RE9A 4I0WB 5KXEA 1J1TA 5FZCA 1AL0G 1RUI2 5FMDA 1QJFA 3AZWA 2C24A 2ARAA 3PU3A 4AVCA 4QQLA 1COV2 1SBDA 4PCRA 2RR12 3A7QA 1RUC3 4AGRA 1ZBE2 4ES8A 1GUIA 4GA9A 2A1XA 4FO9A 1AVBA 2R071 4GD4A 4LBQA 1LHOA 1WCUA 3U14A 2DBIA 1ASJ3 5AC93 2ADDA 1BMV2 4YZ3A 4Q4Y1 2PHFA 1CONA 2HKXA 4XFCA 5IVVA 3C8XA 2W46A 5DDJ3 2A6VA 4KWUA 1H9PA 3IIIA 4BQ5A 2VZQA 2E7AA 5CG9A 2A6YA 2JDHA 2GSYA 2EA7A 1GWMA 2HWF1 3A0NA 1YXWA 4I2OA 1REFA 1UU6A 4XETA 2IXHA 1NUKA 4WBBA 1S4CA 3B00A 1PO11 2HWC1 3TYJA 1YQCA 1NT0A 2VH9A 1X8EA 4JDNA 1NLRA 2WT1A 3VZLA 3I4IA 3GHNA 1R083 3I8TA 2X09A 3RYKA 1AXYA 3FLTA 2RS52 4YM0A 2MEV2 1MQTA 1VMHA 2JDUA 5HCHA 5DUXA 2OS2A 1ZX5A 2JWPA 3VDAA 1SCRA 1BKZA 4A3XA 5B4NA 4BQ1A 3POJA 2LUWA 2QQIA 1VBB1 4ZZ5A 1RUG2 1IGOA 4BWOA 2RMU1 3OPTA 1CAXA 1GOHA 2XL7A 1E5RA 4Q4V2 4SBVA 4JKKA 2O8OA 3BKZA 3M8LA 1MEC1 1C28A 3E6BA 3JBG1 2WQ4A 2Q30A 4PF1A 1HQWA 4I0AA 1ZVFA 3LEIA 5LK7B 1TG7A 4D94A 4BYYA 1OOPB 4BU2A 4FPGA 4OUEA 1CAWA 1OVPA 3M4FA 4AFCA 3R0RA 5FKCA 3KQ4B 2WABA 2BWAA 1IQAA 4QB2A 3WP6A 4AGVA 1RL3A 5AFEA 2YDEA 3IDCB 5FYCA 4U36A 5FUIA 3VDDB 2QDNA 5BUVA 1YIPA 2YU1A 3I3EA 2ZGUA 1OT5A 2G1MA 4OHZA 5F3EA 1FAYA 4Q5OA 2VO5A 4OI2A 1P8JA 3MPPG 4LUKA 3LEKA 4O61A 4XF9A 4YVWB 5F3GA 1ULGA 2HWE3 5FREA 1AR63 2VOVA 2AGSA 4P9WA 5T3NA 1TME2 3L2HA 3VD5A 1UXZA 2BP6A 1Q8PA 1W3VA 2XQXA 2ZGTA 2OVUA 3KVBA 1QJX1 4YW5A 5L9BA 4R9BA 2YB7A 3VZKA 2JB8A 4RR3C 3OD0A 1W6NA 2W9XA 3GBFA 4QAWA 1QH7A 3ZYPA 4Q1RA 3ZXDA 1UOBA 1MZ5A 1DZRA 4J1XA 4XABA 5ACA2 1C4RA 4FOYA 1W8NA 1ND3B 2PQQA 5A7PA 2K2SA 1RUI1 4LBQB 2JB4A 2DUOA 3IBMA 4S2HA 5D8AA 3USSA 4IV3A 3IDBB 3WXPA 1DZTA 1AR91 1UZZA 1WCDJ 2CWMA 4XUPA 1COV1 1JH5A 4M00A 2VNVA 4UFHA 1O4ZA 4LO8A 3OB8A 5E6HA 4IERA 1B35B 4K6BA 2UYAA 4E8CA 2PAMA 2WYSA 2B7YA 1SLIA 2DUQA 5BNNB 1HJFA 3QCWA 4QHBA 2AYHA 4KG8A 2G9GA 3LCPA 1CD3G 4GKXA 2BOIA 1YQ2A 2BWCA 3EQEA 1GKBA 5FV3A 2Y8KA 3AYEA 5FO8B 4W6YA 1MR5A 1DQ0A 3AXDA 2R062 2OUJA 4FPEA 1GZWA 2LTNA 3HQRA 5FJKA 1REEA 3AYCA 4GWIA 1RUE2 1BEV2 5LBBA 4Z2WA 3OOXA 4XIKA 4CDUA 4YG0A 3O12A 1IS3A 1O7FA 3VD9A 5FZ9A 1KXGA 3BU0A 5E89A 3NMBA 3VBSB 1SFYA 4CCCA 2QUOA 2R32A 4NIAA 2YYOA 2OX0A 1ZZ8A 1HRI1 2CAVA 5H9QA 1KS4A 5KC6A 2WC2A 2VZTA 1POV1 2HYKA 1L7RA 3ES1A 4YGDA 1HB4A 5FLHA 1UXXX 3ZYHA 2OZ6A 3NW4A 4HSJA 3RDIA 2VBPA 4E27A 3VBOA 1XE8A 4XDQA 3AXEA 4IW3A 4FAGA 3KQRA 1W8WA 2ZHNA 4XUTA 1FMD3 2VXRA 4AHXA 1JYCA 3GXUA 2W68A 1C57A 2B8MA 4BXFA 4CUGA 2UWAA 1O3SA 1AL21 2WYFA 1FV2A 1O3RA 3A23A 4HZFA 1G9FA 3AYAA 1CN1A 1UNBA 3O1VA 4H55A 4FOVA 4QPWA 2HBTA 3WZ1A 2ZGKA 4E4DX 1ULDA 1PMJX 2W1SA 1JMUB 2P5BA 3EYPA 1VBC3 1VMFA 2H6CA 3KMHA 2VQTA 3KV6A 2EIDA 5A3WA 1PVC3 2J1EA 3IWZA 1RUH2 3RI8A 4Z1VA 1W6NB 2BYVE 2ZGMA 4XF0A 5LATA 2A3WA 3RRDA 5C4WC 2VCMA 3ZN5A 5IVFA 3TNPB 5B2GB 1BVVA 4XDPA 1K42A 4XHXA 2QZ3A 2GAUA 5D8AB 4LA2A 2BNMA 4IV3B 5K0UC 1RXFA 1X50A 1XYOA 3K46A 2W95A 5A7QA 2YROA 4COUA 5A7WA 3O1UA 4P9LA 3O7OA 4G3YC 4WM8C 4HK9A 2WNOA 3AMQA 4TZDA 4B1MA 4FAHA 1Q3EA 4YRDA 1CX4A 1MVEA 2X29A 3VZJA 3CEWA 3NO8A 4WM7A 5SV5A 1SLAA 2XB6C 2WKKA 4PI0A 1H6XA 2BV4A 2GC3A 3D3AA 2XVKA 5CAZA 3BIEA 5FPAA 1VRH3 3U37A 1GZWB 3Q8CA 4JKMA 4JCKA 5I91A 1W9YA 3JD73 1NX9A 1RUC1 2WS91 1JZ2A 1UY0A 3NSTA 1PM4A 2WUHA 3NAPA 5F8PA 4CDUB 5A3NA 5JI9A 4BLJA 5I0RA 2JENA 1BLZA 1ASJ1 1YI9A 2VMHA 4LO7A 1GWKA 3FN9A 5FYVA 1YQ8A 2E33A 4Q0UA 4K8FA 1RUOA 4GB33 3BI3A 5JVVA 1OLMA 1BQPA 1E5HA 1LRHA 5FKBA 5BNPC 3WW3A 5DDJ1 3AC0A 5FWJA 5D2AA 3WQBA 2HJIA 2JG8A 4URAA 2LRPA 2E53A 5IYYA 5JOWA 3LD8A 1GNZA 5CYYA 4AGGA 3I2JA 5F1RA 2ZEYA 1OFSA 5LCWL 3T3YA 5GZCA 1O5LA 2DV9A 4YG6A 1GBGA 1S2EA 3H8RA 3IIAA 2FBEA 1D4M3 3WEZA 1UOJA 2PQSA 5I0TA 1WGPA 2AACA 4P5HA 5IVBA 1JYVA 1O91A 1QQP1 1UZYA 1XB9A 5HPOA 1BBT1 2NN8A 4IEYA 4JZRA 4Q0SA 4WVZA 2CWSA 5T5OA 1NYWA 1J3QA 4AI9A 4CVUA 2DURA 3FMGA 3AP4A 1CZTA 1F5FA 2I2SA 5FPVA 3MIFA 4H2AA 3PUSA 4EWEA 3T30A 3WT3A 3OPZA 4NRPA 1YJKA 4P9GA 3RPQA 5KBFA 4LT5A 3JQXA 4FFGA 3NJXA 3WNXA 4QPYA 2K46A 2PLV2 3RQ0A 2PHLA 1ZBA2 1ZRFA 1JYXA 4C90A 3RMXA 4XAEA 4XJUA 4XF1A 4YZ5A 5FZDA 2VBBA 4COVA 5CG8A 3POEA 1V6MA 2LM3A 2JKXA 1AYM2 4JGYC 4KGQA 2J42A 1QY4A 4IV1B 2F4LA 4YM2A 2RS33 2YMZA 1O8PA 1W9FA 4CPBA 1E5SA 3MLJA 2WQZC 3A4UA 2ZGPA 2GH8A 2HEWF 5FBZA 5A7WB 1GLHA 4MSVA 1NE4A 3VBHC 4AVTA 4E4SA 2WRAA 5F3CA 3FUOA 1ULCA 1Z7S2 4PLOA 3ACLA 2Y6JA 4UW3A 1KDKA 2BDRA 4E2GA 2Z79A 4M3CF 1VB2A 4K1YA 4XF3A 2HWE1 2AEYA 3CKHA 4W50A 3S6PA 1ST8A 3WQ7A 3RZGA 4WM7B 1DGWA 3NNFA 4ISRA 1YJLA 1DG6A 1ND2C 2XDVA 1XNBA 4KH9A 1WBFA 3MEPA 3DECA 3CHXA 4LJHA 4CCNA 4QGLA 3EJKA 3WP5A 3DEMA 3H1MA 1LOBA 4DO0A 4CXXA 1VE0A 3RYPA 2MPFA 3ZSLA 1R1A3 4LK7A 1GZ9A 1NOVA 4AVAA 2WINB 2Y0OA 4GWJA 4LLOA 2VM9A 3Q8AA 3NAPB 2J1TA 4JDOA 2HBUA 4R9AA 3LKJA 1ULEA 2D5HA 4CP9A 2EIGA 3KGZA 3B93A 5HV0A 4JHZA 3WY6A 3PVOA 4A7YA 2F6BA 2JDKA 4O7XA 2ZX1A 3K48A 4K3UA 3MW2A 4IL7A 2JG9A 3ILRA 3I2FA 4R4ZA 5IFTA 1BYHA 1YFWA 4DB5A 1Y9GA 5LA2A 4XOGA 3CDZB 3ZDSA 1SEFA 3PIGA 1QJZA 1S0BA 4NO4A 1VB4A 2XKPA 1ODNA 2AR6A 5FYBA 3SCFA 3AVSA 5A3LA 5FDBA 3LIGA 1EYBA 3W59A 1HB2A 2B46X 2C9AA 1XSRA 1ULFA 3HPNA 3VDBA 2ARBA 2FQPA 4QPIA 1WLWA 3H3UA 3MBWA 4Q4W3 2J1UA 4HOOA 3RYRA 5FQ0A 5F6KA 1PIV2 1OLQA 1H2LA 2CGPA 4AVBA 4IEZA 2VOWA 3GM8A 5FP9A 3IM0A 4GQ7A 1QOTA 5FYIA 3UGGA 2WWJA 3LB9A 2W3JA 1KGYA 4BXSV 2DVAA 3ABZA 4XILA 3D8CA 4FPCA 4L8QA 1EV13 5CFDC 4YGEA 1PZ9A 4MLOA 3IPVA 4FP3A 4IE4A 4PQQA 4EN6B 5J98B 4E2SA 4LHSA 4JRLA 3BTXA 3ETPA 4QKFA 1ODMA 5FZ7A 2CY6A 3VN4A 2C26A 1AR83 2LS6A 2XLFA 4MGSA 5A6ZA 4LO6B 1LECA 4FXKB 1DDLA 4Z07A 2Q8DA 1HX6A 1OFNA 2BUKA 2DVDA 2FDGA 4JVAA 2ZGNA 5E88A 3SLIA 1FMD1 3TB0A 4JDMA 5C3QA 1DF0A 2WWSA 1S0EA 3WHUA 3EXUA 1SFNA 3K2OA 3NNJA 4CEWA 2EF6A 5FZOA 3VHPA 4GZ9A 3RI9A 1S2KA 4K20A 5EIYB 1DYPA 3FLRA 4DEQA 4Q8LA 5KHHA 2NM1A 1X36A 2ADEA 2HWF3 2JDNA 1OUXA 3FUQA 4OMDA 5JOXA 2R042 1PVC1 3OJBA 3KSCA 3VBRA 3J7NA 2WNUA 4KL1A 2HWC3 3SCGA 3ZDVA 1PGW1 2VVEA 1MS3A 3O1OA 4DY5A 1VAVA 5C3OA 3INAA 4NRQA 4X6QB 2C4XA 3BVCA 1ALYA 2GMMA 4O65A 1MVQA 1EPWA 1QGLA 3CIHA 4OHWA 2E7QA 1LGBA 4H3WA 1X7NA 5D21A 5A70A 2D6NA 1W9WA 4DRVA 4F3JA 5FTTC 1HXS2 2KXLA 1NXD1 2BFUL 1ACCA 2NYYA 3HNBM 4FPKA 5FOBB 2FCUA 3O1SA 2IXCA 5CVRA 1GNYA 1MQTC 2VL4A 1W03A 2JG9B 3SITA 2XJVA 4IE5A 2RMU3 1OC1A 4ASLA 3SKVA 4IEXA 3AL5A 3VKNA 4AW7A 1MEC3 5KXCA 4R9DA 3JBG3 2VTFA 2YC0A 4M01A 4BDVB 2CAUA 1EUUA 5C3SA 2P1BA 3BUCA 3PTYA 5LRSA 3MO4A 3C7GA 1OD3A 1QOOA 2W47A 3TRSB 4YWAA 1VRH1 4LHNA 4AI1A 1PO21 5DZFA 4ZU7A 1SHWB 2P2KA 3K4ZA 4QPIB 2VW1A 3AKSA 5FQ0B 5FRAA 4RGGA 1JHNA 1IHMA 2DWRA 2P3IA 3DYPA 3OYWA 1C8NA 2VZUA 2Y0IA 3ZFFA 2IWGB 4QX2A 2QNKA 5IAVA 3T2TA 5JOYA 2CDPA 4RA0A 5FY5A 2FDFA 1L3JA 2XBO2 4ZZ8A 1ONAA 1QJEA 5DXDA 2WFF2 4GB31 4HVQA 1N1TA 5CISA 1PIV1 4EZ4A 3BN6A 3C7FA 2WLPA 3IPVB 2OQ7A 3JB8A 3W5MA 5FZ4A 4NROA 5KHJA 4QM9A 5I8YA 2YPDA 3R4UA 3ZXJA 1QJX3 5BYNA 5IHRA 5A3OA 3FHAA 3AVRA 1MS0A 1W06A 5A3TA 1AX0A 4EV0A 4COZA 2VJXA 5F5CA 3UL2A 5I8SA 3R05A 3UESA 4OI4A 1X9PA 2D6KA 1RUI3 2WZR2 4JRAA 3LFMA 3WDYA 4CUCA 1SBFA 3P1IA 1LOFA 4QGNA 3TN91 1AR93 2C1FA 3ENRA 2VTXJ 1XBFA 4OUSA 4CEWB 4MGTA 1COV3 3H0OA 4NIIA 4LOTA 2IFWA 5D8AC 4IV3C 4LOSA 4HN0A 4OMCA 4XVHA 3MICA 1IZ3A 2RS11 1W6PA 4XHBA 4GALA 5C4WB 4O9GA 4XCAA 1W04A 2E26A 4YM1A 1IOAA 4MHUA 4IEOA 5FZKA 1FV3A 4WZFA 3MGUA 1XSQA 5IJRA 3VBRB 4JGZA 1WWYA 2WNUB 3ZMOA 4AQ2A 2Y6LA 2ZAAA 5C8WA
chains in the Genus database with same CATH topology
5EV7A 1VBE2 2DFCA 4BMEA 1OSGA 2R041 2QCSB 4MGZE 5J3UA 2A5ZA 4GMP0 3ZO0B 2RS31 2XPJA 3S30A 5EYXA 4AEJA 5C6CA 5JZGA 3NV4A 2PHXA 3LOBA 4KWLA 2XLAA 4OLLA 1PK6A 1A6CA 4COWA 2MEV3 1DLLA 1TE1B 1WLTA 1DBNA 4CDUC 1VR3A 2A3YA 3D6EA 4F7ZA 2Q4SA 3CJIA 1U5YA 1RUD2 1UPSA 3MI8A 4SLIA 1TEIA 3MW4A 1AXKA 1POV3 4IQPA 1ZYBA 4IXLA 3TOJA 1RHI1 3QOPA 3OYWB 2DU1A 1X33A 3FBMA 1Q43A 3VBOC 2NMNA 3QBQA 4XJWA 4KBBA 2BEOA 3QD6A 4A2UA 3NVCA 1FPN2 3BPZA 1AYN2 1EAH2 3ATGA 2D6OX 4YLZA 3IN9A 1BZWA 4XJAA 2ZX0A 3V65A 4HANA 1TME3 3ZPYA 4CP1A 4WVMA 3D5OA 5J36A 1W39A 2ZABA 1MS1A 1QJY2 2ZHLA 2EXKA 1UAIA 1FYUA 4Q4W1 1LENA 4R8HA 5I0UA 1S55A 2DU0A 5ACA3 5FOJB 1Y7BA 2Q1ZB 2ZGQA 3LOIA 1GFF2 2WZR1 4HVOA 2UY9A 1H1IA 2F4PA 4KGGA 3WCSA 1O3QA 1W6PB 1OPOA 2K9ZA 3JQWA 3MLLA 3WV6A 1AZDA 1U0AA 2WNEA 3MW3A 1EV11 2D6MA 5EFUA 4BZ4A 1CAUB 3B7MA 1J58A 1ENRA 4JGZB 3DV8A 5T50A 1Q8SA 2D93A 4LE4A 2AUYA 1UF2C 1AR81 1G86A 1LOEA 4WM7C 3PHMA 3VBHB 5E1RA 5IUQA 1OA2A 1MZ6A 3FE5A 4URTA 3SXWA 3MFCA 1S0IA 3C2UA 3O5SA 4N53A 2WS93 5JZGB 2JXAA 1LGCA 3AX4A 3FFZA 5CNAA 4AVSA 2VG9A 4NPRA 1ND2B 1V6NA 2EXHA 1PK6B 3GBGA 3GF6A 3LAGA 2BVBA 3O0WA 4ASMB 1BEV3 2R1DA 3NAPC 3IT8A 3AYDA 1XXNA 1QDOA 1XE7A 2KA3A 3AZVA 3FX3A 3ME2A 2DVBA 2EALA 2EXJA 2IZWA 1AXZA 4Z82A 1DGLA 1JUIA 3R4SA 1PM7A 5DUVA 4XBNA 2JG8C 1A3KA 4AQ6A 1SCSA 5BY5A 1UIJA 3ZIXA 2X8KA 1GQHA 4PBPA 4Y22A 5T5LA 3ES4A 4TSVA 2ZMLA 2P17A 1HQLA 3URFA 1QQP3 4MH0E 1LGNA 3E5UA 1BBT3 3FWEA 5K8SA 3WQ1A 1PNGA 5A33A 1QXJA 2A7AA 1CR7A 1D0GA 1LHUA 1VBD2 5CIRA 2JICA 4EN7B 3VBUA 3ILFA 3HMYA 3HWJA 5CFCA 5IT6A 2DCZA 1TNRA 4P9YA 1WD3A 3S7EA 4BLIA 4I02A 3OGGA 1AX2A 4YW1A 4Q0PA 4TYSA 5JR7B 1FOD2 5CFDB 4M0HA 2HWB2 1AR72 2ZTNA 1V6OA 3WG2A 1QJY1 2WT0A 3WG1A 5K7PA 2PAEA 4EN8B 3HIFA 4DZGA 1GANA 4AFDA 1UIKA 4OI1A 1W6QA 3AB0A 2ILMA 4XYXA 2XLGA 1YFXA 5K9YA 1F2NA 2WSUA 4EWAA 1PNFA 4OFGA 2C0ZA 4E4ZA 1FNYA 4IEUA 2E9QA 3P3PA 1RGSA 2ZGOA 4Q4X2 5EJ3A 1SLBA 4XFBA 2Y26A 3RZZA 4C91A 2D6PA 2DYCA 1ENQA 2CGOA 2CGNA 1V9U2 4H14A 4J6GA 4D69A 2VVDA 4LBLA 3CL1A 4G9SB 4L2NA 2D3PA 1V70A 2DTWA 4U2AA 2XGXA 2RR11 1U5ZA 1ZBE1 4AFMA 4ZU5A 2B5HA 2MHFA 1LODA 3V0BA 4HETA 4HVRA 2P37A 1BMV1 1H1AA 5JCTA 2CYFA 3UKTA 1ZREA 3WDUA 2JG9C 3GZTB 1VBA2 3ZXAC 4PIZA 2A6ZA 4FXGB 3WLUA 3KS7A 4Y22B 1QWRA 3J8F2 3M1HA 4J1WA 2IFRA 3PNAA 4XBQA 2N7GA 1MQTB 1AX1A 2WNVA 4MGKE 3N7MA 1RTVA 1V6IA 1UMZA 1RVF2 4AK3A 5GLTA 4BPZA 4M0NA 4XW3A 5A33B 4YW2A 4QPIC 4D7TA 2FMDA 2ZAHA 3BCWA 3NJZA 2QVSB 2RS51 5KWRA 2MEV1 3MIBA 2HWD2 1HV1A 5IK4A 2W39A 1CAXB 2D44A 4XEZA 3VBUB 2W0XA 2ZX3A 3V56A 5CFCB 2YGLA 2HEYF 4DXZA 2CNAA 5DUUA 3DPRA 3H1YA 5AC92 3VL8A 1RUG1 2RM22 4Q4V1 1DGRA 1CAWB 4YG3A 2ZBJA 3WVJA 1ZBA3 1DQ2A 4RFT0 1DFQA 1WLCA 2H6BA 1PGL2 4YGBA 3HT1A 3BOPA 2Q8OA 4B4RA 1YRZA 4QQPA 5GZEA 4WVWA 2DCKA 1G9AA 3UKVA 1NCQA 5FPZA 4OZXA 4IEQA 1PVXA 1YYNA 1HRV2 4KWJA 4MX3A 2ZGRA 4DNYA 2VNOA 1GQGA 4DFSA 2HWB1 1MZFA 2QE3A 4NHLA 4CEWC 2DCYA 4R9CA 2ETEA 3NV3A 3AMNA 4S2FA 5T5PA 4FTBA 1TME1 2PYTA 1FT9A 3SH3A 4EJRA 4Q2FA 4BOWA 2BTVC 1QU0A 1ZNPA 3VBRC 4E2QA 2WNUC 1QKQA 1I6XA 2PA7A 1GICA 4IESA 1H2MA 2OZJA 3PJQA 1QJU2 5ACA1 3LGRA 3POWA 4BMBA 5C8CA 1JTZX 2DCJA 1KITA 1UPIA 4Q8KA 5FO7B 4LULA 3WCRA 2AENA 1Q5OA 1LHWA 3UKNA 1C8M2 3HBZA 3M2MA 3ZSJA 2QDRA 4AE2A 1NY72 4N9HA 2UY8A 4HBNA 2ZX2A 4IETA 2CL2A 1PO23 4CDQA 1AR62 3WW1A 1Q8QA 3ST7A 2WNVB 3UJQA 4AEDA 3OY8A 4AXOA 3S0MA 1BJQA 2R061 3E6CC 2ZA9A 5EZWA 3ZFFC 3KGLA 1PIV3 1RUE1 1BEV1 4QQHA 4ORFA 5GLZA 1IS6A 3ZYJB 5H9SA 1N3PA 3VZOA 1RUNA 5FMOL 1CGPA 1AF9A 4YVSA 2Q0AA 3DPRB 4P9JA 5SV8A 4X6RB 2HWD1 1F9KA 1QDCA 3VBOB 4JTOA 2IXKA 1GR3A 4KWKA 2R0HA 5I8TA 4AI2A 1NLSA 3VLBB 3DUIA 2QZ2A 3APBA 3RSJA 1LULA 3BU7A 3J9SA 2GNBA 1WW5A 4GH4A 1LESA 3TN93 1EPZA 5GKAC 4XQDA 4O9EA 1KJLA 5GM0A 2X5IA 3G7DA 3KT4A 3N3HA 1KDMA 1LOFC 4PIYA 3U4XA 2RS13 1VLNA 2VU9A 3BB6A 1CAVA 4W6WA 4CP0A 1J3RA 5T5JA 3RJRA 4MV2A 4XJ9A 2WT2A 3B3QE 4MZUA 1RITA 1HRV1 4LE3A 4QU2A 1DYKA 4XMIA 1S0JA 4JGZC 2R043 2YY1A 4ONUA 4AEKA 3WG3A 3UK9A 1RUH1 1OLRA 2R6QA 4RGAA 1NZCA 3JB4C 4X8NA 4LO5B 4BH9A 2ZGSA 5C8CB 5L19A 3QACA 2BBVA 3AFKA 5AFBA 3NL1A 3GZUC 1HXS3 5JZGC 4BM8A 1GSLA 3DGTA 4XIOA 1RB8G 4C0HA 1JOJA 2W08A 2GMEA 1PK6C 3U10A 3M3IA 2X53S 1AJKA 1IKQA 3Q9OA 4WVVA 2XUMA 1LHNA 4XXPA 3BODA 2ZHKA 4LBQD 3CJIC 1RHI3 4CDQB 4NHKA 4META 2PELA 1PGSA 2D43A 1ZRRA 3ZSEA 2NQYA 1G6NA 5GLWA 4GMP1 4Y20A 4GXLA 3RWNA 2YXSA 5E16A 1W6MA 3VUOA 1YI7A 1K5MA 3U07A 3CO2A 3C3VA 2I45A 4N9IA 2JG8B 4Y5Z0 2XBO3 4QT6A 2I74A 2JE7A 3WDTA 2WFPA 3GYDA 2CV6A 4ATFA 2XWJB 5GJ6A 5FPXA 2UU8A 4AI0A 3O14A 1SQ4A 5KHGA 3AFGA 3WDWA 3ZYIB 3N7KA 3AP6A 4YYOA 3ZYRA 2ZMKA 3OGJA 4RD7A 3R6SA 4HFSA 3V0AA 4UBHA 3U11A 3X29B 2X5IB 4UXAA 2XJPA 3VKMA 2WZR3 2PHRA 2A6WA 1KQRA 2JEMA 3NWKA 1CAVB 4ITCA 1ZZ9A 3RMYA 5ABJA 4FPLA 4MGYE 3SMHA 5J96B 4FT8A 3WUDA 1U5XA 5J7MA 2YV8A 1NXMA 1X8MA 1XU1A 3ZSMA 3JU9A 1PHMA 3ILNA 2LALA 4G4FA 2ZZJA 2PLV1 4BCUA 4CDXA 1T6GC 1ZBA1 1QOSA 2JECA 1HIXA 4BIFA 5JWPA 1TNFA 1NQDA 1VBE3 1A78A 1AYM1 1GYKA 1E57A 3VZNA 2YGMA 1NA1A 2D3SA 4MUVA 4N53C 2OYZA 1V00A 4CYDA 3IMNA 1OHFA 3IKWA 1QNWA 1D4M2 3N36A 1Z7S1 5J37A 3B9CA 4RHV2 2VUAA 4FQZA 3AKTA 2XKOA 4NN0A 1N1YA 2WA3A 4IEVA 3VV1A 3HD8B 3WINE 2UWCA 5HBAA 1FXZA 5KC5A 2TNFA 4XJ8A 1YUDA 2QQPA 4DY3A 2B45X 2VW2A 1RMU2 2VECA 1C3HA 2QKDA 2WLQA 2JJ6A 2XG3A 4KNCA 1DZQA 3HT2A 1OI6A 3K51A 3H7JA 1K5MB 1WCSA 1OD5A 2HEVF 4QX5A 2R49A 3HQXA 1TMF2 2JD4A 1UKGA 3JUUA 3TWIA 1WCKA 3UJOA 2PHDA 4M3CE 1XNKA 4FTEA 5GZDA 5F5QA 5LRRA 1QNYA 1QXPA 2NMOA 1WW6A 2Q5TA 1WMDA 3GNEA 1S0DA 5EXOA 4B7KA 2OA2A 3HN1A 2V09A 3VBUC 5CU1A 2ZCWA 3FC0A 5CFCC 4HPKA 2E6VA 5FCCA 2GC2A 4LLFA 5LEJA 1W0OA 5GALA 1OA4A 2ZZQA 2DTYA 1VIWB 4XPVA 4HK8A 4OHVA 1QJY3 4YFWA 4GIQA 2V73A 1YWKA 1R1A2 1XNCA 4LUMA 5JMCA 5GLUA 2BVVA 4LHLA 2R1BA 1R092 2DCTA 1RUJ2 3J26N 2GDFA 1AHSA 1I5ZA 5GZGA 1VALA 2GNTA 4CDXB 3TBDA 5HXVA 5I93A 1CESA 4HLTA 2D98A 4QPGA 4LEJA 4CZSA 2YZ4A 4TWTA 2VPVA 4FP2A 2RR13 1ZBE3 4R52A 1WD4A 5L7OA 4QXKA 3ZYGA 3WHTA 5L36A 4FPFA 4PLNA 1I3HA 2XH6A 2BPA2 2OPKA 4AYUA 4JV4A 2A71A 2GMPA 3CLPA 3AK0A 5IK7A 2GC1A 1A8DA 1YFUA 3WOGA 5BNOA 4GWNA 1H30A 3KCXA 1LCLA 3D4KA 2H0BA 4B4PA 1YNAA 2XVLA 4YARA 4Y4YA 1LEDA 4JAAA 2DUPA 2RS53 2WNVC 3NKGA 1HXS1 1IS5A 2VNGA 4AFAA 5KHJA 1CJPA 2R072 1HKDA 2YUEA 2EXIA 4Z8BA 1RUG3 1UX6A 4Q4Y2 1N1VA 2B42B 4Q4V3 5JPNB 1XYNA 1C5HA 3WDVA 5LEKA 3MYXA 5D1IA 5BNQA 1WUVA 3DPRC 3ZFFB 2G4IA 4XFAA 4I09A 2V5YA 4FPOB 4V1PA 1ZZBA 3AP9A 4CP2A 2RJKA 1UN1A 3LA7A 4K7JA 1PO12 2HWC2 4XE9A 5BXXA 5IK5A 4NHMA 3I7DA 2UWBA 3BIWE 1HDKA 3IDEA 1XYPA 3J4UH 2HWB3 1AR73 4YSFA 4Y24A 5J09A 1V6LA 3MFAA 3KLSA 1NCQC 3POSA 2XBO1 1ZZ7A 2WFF1 1Q56A 2Z42A 3ZFGA 2GN3A 2SBAA 4AF9A 3EO6A 1CQ9A 1OA3A 3MIHA 2VW0A 1VBB2 3OTFA 4PBOA 3V64A 2RJLA 1RUJ1 4GWMA 3ASIA 3U0ZA 4DMIA 4Q4X3 4QPGB 5JIUA 3RJ2X 3ZFEA 5DZEA 3JBG2 4I3PA 2A6XA 1SDWA 1REDA 3VBFA 1OQDA 1PMIA 1V9U3 4RS5A 2R30A 3MIEA 1NE6A 4XXAA 3AP5A 5C8CC 3VZMA 1LHVA 3PMSA 2GNDA 5C9AA 3SCHA 1OOPA 4LBKA 4LHKA 4X8PA 3ROUA 2ES3A 3I54A 4XBLA 2P34A 2PHTA 3M3QA 4PDWA 2WSVA 2XHKA 3VDDA 3DN7A 3I2DA 4QQOA 4Z92B 4HKLA 1ZZ6A 1VBE1 1QJX2 2R063 4CDQC 4YVWA 4LR4A 3J8F3 2BQPA 2XJTA 3B01A 3W9AA 4DQAA 2XJRA 4AEDC 1RUE3 2D97A 4EN9B 1DGWX 4ZKTB 1RVF3 3CJIB 1RJ7A 5JDBA 2EAAA 3SH4A 3VKOA 3WP3A 5BV6A 1APNA 2PHUA 1AR92 2DVGA 3KT7A 4ISQA 1GNHA 2HWD3 5TSWA 2BW8A 1XU2A 4CEYA 4OVEA 1N3OA 4COYA 1UL9A 1O3TA 1ND3A 1J3PA 2O0OA 4YVSC 1NCRA 4AG4A 1RUD1 4OHYA 3AJYA 4D7YA 1I9RA 1N3QA 1SBEA 4Q26A 4C1XA 3R4DB 3D0SA 2RM23 1Q8VA 1JBCA 1BCXA 4KU7A 1B35A 1OQ1A 4Q1PA 1G8WA 4RQPA 4GH4C 5T55A 1QH6A 3WP4A 1ZRCA 4DINB 5BNNA 1LU2A 2X5IC 2FHRA 3M70A 1G7YA 3MZHA 4F8AA 3ZFGB 1FPN1 1HRV3 4PF5A 4LBNA 1AYN1 1EAH1 4WVMB 4Y1VA 4JQRA 3FBYA 4W6XA 4Y1XA 3NKTA 1RUH3 1RUF2 2Z2SB 1J59A 2JDZA 4OHXA 2A3XA 4GKYA 1HW5A 1HRI2 3T1LA 3ZFEB 4AI3A 4QD2A 1WW4A 1SLTA 3LA2A 3EBRA 2VMGA 3VBFB 5HI0A 4FQ4A 4RS5B 3VBSA 3AZZA 1YCIA 4S2DA 2E51A 2D5FA 2TUNA 4HMZA 1QJU3 4K21A 2H0VA 1BXHA 3QH7A 1KJRA 5C9AB 1DHKB 4AFBA 1AL22 1PZ8A 2B9UA 4PDWB 3KZ4C 1C8M3 4L9BA 1D4VB 4N53B 1VP6A 4PIXA 1Z78A 1H8TA 4M3CA 1U5IA 3CU7A 4IEWA 4P9IA 1WMFA 4GMP3 2ARXA 3KB5A 3TAYA 5JSRA 3HR9A 2KM2A 3WG4A 4D7SA 1FI2A 1SACA 1IPJA 3KCYA 5HCFA 2VNRA 5J48A 5JSPA 4NR1A 1UU5A 1VAKA 3N7LA 1K5MC 2GZWA 1OPMA 1KFUL 2ATFA 3ZX7A 2ERFA 1Y3TA 4CEYB 4A7KA 1H2NA 1NCRB 4OUMA 5L73A 4HSLA 4CTEA 4AWDA 4PJYA 2A75A 2JX9A 1SLCA 4KQ7A 3PVBB 2PFWA 4CRQA 1UD1A 4RSUA 4QM8A 3PJYA 1F5JA 4RQPB 1YLLA 4MXVA 1FX5A 2ZS6B 4JC1A 1HQNA 3GHMA 1KRIA 3THPA 2QFEA 1H9WA 3MIGA 2GN7A 5FMOS 5CA6A 1RUC2 2XJSA 2WS92 3B94A 1WBLA 5ABJC 2ZX4A 1ASJ2 3M3CA 2IXLA 5T52A 1VBD1 1EY2A 3I59A 2IXJA 3JCIA 5DZGA 2PLV3 5DG2A 5DDJ2 4YZ1A 3SHRA 1ZM1A 2VOKA 4OULA 4WV8A 1RINA 1CPMA 2AZ5A 1AYM3 2ET7A 4B7EA 3POYA 4CDXC 4K9SA 4GULA 1RUF1 4IEPA 5KHKA 1WLDA 5FLJA 1XRUA 1XNDA 3E5QA 4Y1UA 1W6QB 2BGCA 4N43A 2NPIA 1HV0A 1FOD1 1AR71 1VJ2A 1NA1C 1R082 1Z7S3 3O0VA 4Y1ZA 3AMHA 4CDWA 1M4WA 4E9KA 1KS5A 1BVP1 1QQP2 1BBT2 4I0BA 4TLFA 5F6LB 2WL1A 4XQWA 1D2SA 1YHFA 1H8TB 4M3CB 3B5LB 1I1EA 2OUHA 4Q4X1 5EYYA 2G9FA 4AEMA 3M7AA 1H4HA 1CPNA 1G9CA 2O8QA 1OKQA 2OW4A 3RNSA 1V9U1 1PZ7A 4AI8A 4EROA 1OMIA 2XJQA 4N90A 2BNNA 4LTAA 1G9BA 3V0BB 4YNIA 1IPKA 4ES9A 1O4YA 2NZ9A 3FHIB 3OD4A 2XVGA 3SNMA 2I07B 4B3NA 4IV1A 1DU3D 3AMMA 1WMEA 3MLKA 4XFFA 2HWE2 3AKRA 5AVAA 1YO8A 2DFBA 2VGDA 1VBA1 3E97A 4XFIA 4P14A 3QH6A 5CADA 3J8F1 3WX5A 5DG1A 3AKQA 4Y26A 4P9XA 4AHYA 1M06G 3MF6A 1RVF1 3P3NA 3LZZA 3SH5A 4ZU4A 3I59B 2MNGA 3VHNA 2ENRA 1O5UA 3FZ3A 4KU8A 3M3EA 4LBMA 4UBGA 3ZN4A 1W0PA 2FZ1A 4ATEA 5AC91 4S2GA 5A3MA 4MVTA 2RM21 4K40A 3ZXKA 2VQAA 1NCQB 4N43B 3FJSA 2JKBA 1PGL1 1D0HA 4QPGC 3BTAA 4HT1T 5H9RA 3ALQA 4Q0QA 1UU4A 4CDWB 5L7OC 4AHZA 3AZYA 4INDA 3DKWA 4FPJA 2WJSA 1V6KA 1R081 1U12A 1W6OA 3A0KA 4RHV3 4UW4A 1LOGA 1ENXA 4N7UA 3H9AA 3PMEA 5BNOC 2O1QA 3BALA 4N7IA 2XWBB 3USUA 1RMU3 2K0GA 3GBWA 4KG0A 1JYIA 3CJXA 1QJU1 5E8AA 1FMD2 2FZ2A 2QJVA 3AKPA 1IS4A 1RJ8A 4FCAA 1TMF3 3B9IA 2WA4A 3E6DA 2C5DA 4FPYA 4LO4B 1C8M1 1GV9A 1NY71 4AEDB 3RG0A 1LTEA 3OY8B 2ZGLA 1MS4A 1DGRN 1VBC2 4QMAA 1H1MA 4HKWA 1PVC2 4I01A 2BFUS 1VAMA 1YFYA 1AR61 1Z0HA 4RR3A 3S7IA 3ZXLA 1MS9A 1PGW2 4C0BA 4FBFA 1S0FA 4LA3A 3THTA 1JXNA 1MZEA 1JW6A 1R1ZA 3RS6A