4IEXA

Unliganded room-temp cysteine dioxygenase at ph 6.2
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cysteine Dioxygenase Structures from pH4 to 9: Consistent Cys-Persulfenate Formation at Intermediate pH and a Cys-Bound Enzyme at Higher pH.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
total genus 52
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4iexA00
1L3JA 4PIXA 2BGCA 2B5HA 1UW8A 1X7NA 1ZNPA 5CADA 2Q0AA 3M3IA 2PFWA 3WW4A 1GQHA 4F8AA 3CEWA 4JV4A 3ELNA 2QCSB 4XEZA 4BIFA 2ET7A 1SFNA 4ORFA 1OI6A 2XKPA 2Q4SA 3BU7A 3OF1A 5T3NA 5C8WA 1Q3EA 4EWEA 5I91A 1YFUA 2KXLA 4BHPA 3I54A 5I8YA 4BH9A 4XFFA 3OCPA 3TNQA 3D82A 3D0SA 4NVPA 2F4PA 2ETEA 2K9ZA 4J1WA 1J3PA 4A2UA 2D40A 4JVAA 4PIZA 1RTVA 5JSPA 5LEKA 2D5HA 5C6CA 3RZZA 1ZZ7A 4QGNA 4HN0A 1ZZ6A 1O3RA 5J48A 3IDCB 2GC1A 2MNGA 3G7DA 5JAXA 1NE6A 3SXWA 3I59B 2CGPA 1YFWA 4IERA 1ZRFA 3EHKA 3VHRA 4F7ZA 4IEOA 2UY9A 4N9IA 1VP6A 3CF6E 2QNKA 4YYOA 4X6QB 4LUMA 4I2OA 4E2QA 3SCFA 4FAHA 4IEPA 4IEWA 4Q0QA 2ZKLA 4FT8A 4AVCA 1O5LA 2GH2A 2XGXA 4QM9A 4JTOA 3USSA 3HT2A 3LOIA 3H8UA 2PAMA 3CLPA 1ZRCA 4YARA 4N9HA 3FHIB 4IEYA 5KHGA 5I0UA 4META 4I01A 1CAWA 3CL1A 5FLIA 1J59A 3NW4A 1LRHA 2EVXA 1IPJA 5FDBA 1OFNA 3BB6A 3RYKA 4I0BA 3KMHA 2UY8A 4AQ6A 2XL9A 2BYVE 4BYYA 2XLFA 4LA2A 4QM8A 5E1RA 3O14A 4XFGA 2PAEA 2CAUA 4H7LA 1YLLA 1HW5A 2IXHA 4LEJA 3H1MA 3LA7A 4PJYA 4XFHA 4LA3A 3SCHA 4EWAA 1Q43A 4ZU4A 1CAWB 4AVBA 1CX4A 2GZWA 3LZZA 3FJSA 2WC2A 4XF4A 2OZ6A 2OYZA 5LRRA 3IWZA 3FE5A 3DKWA 2D5FA 4CYDA 3ST7A 5JR7B 3GBFA 4IEUA 4QMAA 2DCTA 4D7SA 5CU1A 3KGZA 1IPKA 4Q0UA 4IEXA 5J3UA 2PTMA 3TNPB 4QGLA 5I8SA 3EJKA 4Z82A 3IBMA 2BEOA 1CAVB 5EFUA 4E2SA 1RUNA 4R52A 4XETA 5JCTA 3E5XA 3UKNA 4YRDA 3UKTA 5EZWA 1CAXB 2PHLA 3ES1A 5FPZA 2VQAA 1NXMA 1ZVFA 4MZUA 1YWKA 3E6DA 3DN7A 4EROA 2XKOA 4OFGA 3BCWA 4XF0A 2PYTA 1VR3A 4Q0PA 4AXOA 3EQEA 3ZDSA 1QY4A 5BPXA 1YFYA 1NE4A 3WW1A 1DZRA 2EAAA 1ZRRA 4HSJA 1WGPA 4Q29A 3RNSA 1ZZ9A 1G6NA 4KL1A 5I0RA 3S7EA 4XFCA 3KSCA 3I7DA 4IESA 4MGKE 2N7GA 2PAKA 4MUVA 3S0MA 4HVRA 1CAUB 2XHKA 1NYWA 1LR5A 3FFQA 1EP0A 1UIKA 4HLTA 2ET1A 5E16A 1OD5A 2CAVA 1CAUA 2OZJA 3LA2A 1X82A 1J58A 3RDIA 1U12A 3S7IA 3H7YA 1PM7A 4HMZA 2Y0OA 4ONUA 3HIFA 2Z69A 2PHDA 2Z2SB 2Q30A 1EY2A 2I45A 5FCCA 2IXIA 5BXXA 3L2HA 4UBGA 2ATFA 4KU7A 1CGPA 3NKTA 4MGIE 3D0JA 3MDPA 4IEVA 4I02A 3CJXA 1X8MA 2B8MA 3B02A 3SMHA 4XFIA 4DINB 2GC2A 1CAVA 4KWJA 2VPVA 5BY5A 3H50A 1UCXA 3LA3A 3SCGA 5LRSA 3H1WA 1XE7A 1OMIA 3DL3A 3HT1A 1TQ5A 4HZFA 3BPZA 3MYXA 1WLTA 3R6SA 4LTAA 2PA7A 1ZZBA 3MZHA 3LAGA 5K8SA 1UD1A 3OTFA 4Q0SA 2V09A 4L2NA 1O7FA 3RYPA 2K0GA 5KBFA 1QXJA 4ZU5A 1O3SA 4B29A 3EO6A 5J7MA 4YNIA 5KHKA 1ZRDA 3RPQA 5FQ0B 4KU8A 2C0ZA 4XF9A 4K8FA 1ZX5A 2IXJA 3E5UA 4I3PA 4L11A 1QXRA 4QGMA 4HVQA 2IXKA 4KWKA 3PLQA 4MH0E 5FLJA 1ZZCA 3LWCA 4IETA 3E6CC 3KGLA 4RD7A 4HBNA 1YFXA 4E2GA 2FQPA 5I93A 1PMIA 4I09A 1YHFA 4IEZA 1O3QA 1ZZ8A 1I6XA 5BUVA 3OD0A 5F1RA 3NJZA 1YUDA 2XLGA 5BV6A 1EPZA 5JSRA 3JZVA 5KHIA 2D93A 2MPFA 2UYAA 2H6CA 1QWRA 1LKNA 2PQQA 4OLLA 3ETQA 4O9GA 4HVOA 1RUOA 4JTNA 4XFBA 3CO2A 3FX3A 4LULA 4YSFA 1ZREA 2ZCWA 5HI0A 4LLOA 3FWEA 4EV0A 5FQ0A 4KWLA 4ZU7A 4MGZE 4X6RB 1H1MA 3KCCA 2MHFA 1GQGA 3E97A 1SQ4A 2BNNA 3I59A 2GAUA 2BNMA 2OA2A 3WW3A 2IXCA 4XF3A 5D1IA 3U10A 5I8TA 1RGSA 5JSOA 3QACA 2H6BA 2XL7A 1DGRA 2OPKA 4AQ2A 2WFPA 4GULA 1J3RA 4FAGA 5FLHA 3MPBA 1FT9A 2UYBA 1FXZA 4XFAA 3PNAA 1O5UA 2QVSB 3ACLA 3EBRA 1EYBA 4O9EA 2IC1A 2QJVA 1V70A 1JUHA 4R8HA 3WW2A 1H1IA 1NZCA 2H0VA 3NVCA 1J1LA 1SEFA 3ES4A 1O3TA 1DZTA 2O1QA 1XRUA 4UBHA 2BNOA 2QDRA 1WA4A 5CVRA 3IIAA 3M70A 4LUKA 3C3VA 1Y3TA 4XF1A 1UIJA 3NSTA 4HSLA 4EWDA 1O4TA 3E6BA 4WVZA 1I5ZA 1XE8A 4D7TA 2GU9A 4Q0VA 2XLAA 4AVAA 2EA7A 3H7JA 3GYDA 3HQXA 3ROUA 4MX3A 5I0TA 4QXKA 5AVPA 3N4MA 1J3QA 1Q5OA 1FI2A 3UKVA 1X8EA 2O8QA 2FMYA 3H3UA 3H9AA 1UPIA 2E9QA 1VJ2A 2IXLA 3PVBB 4J1XA 4P9GA 2HKXA 2GC3A 2VECA 4MV2A 2HJIA 3OGJA 4I0AA 3SHRA 1RL3A 2Q1ZB 4MGYE 2CV6A 4HN1A 3DV8A 3E5QA 3RYRA 2GC0A 2B9UA 4QX5A 4IEQA 5KHJA 3U0ZA 5FPXA 3BALA 3IDBB 3H3ZA 5LEJA 4Z07A 3U11A 5I0SA 4WBBA 1LB2A 5KHHA 4WZCA 4TLFA 1Y9QA 4PIYA 1DGWA 2P17A 3NL1A 1RC6A 4UXAA 1CAXA 3FZ3A 3H1YA 4FBFA 3QOPA
chains in the Genus database with same CATH superfamily
5FY0A 4XBNA 2ZHKA 4XHXA 5JUVA 1LECA 1QQP3 2WQ8A 1VB4A 3M3IA 4XBLA 1S0BA 3J26N 3WW4A 3U07A 1GOGA 1I3HA 3N7JA 1COV2 2C6SA 2FDFA 2ES3A 1HV0A 1MEC1 1PK6A 5JVVA 2QCSB 4BIFA 2WO2A 3BTZA 4V1PA 4OZOA 4LPLA 1SFNA 5FZOB 5EIYB 1PO22 1QOOA 4OULA 2XUMA 3TAYA 4OHZA 1URXA 2Q4SA 2VZRA 2JENA 1Q3EA 3N7LA 1W0OA 1NA1B 4P9JA 1QH7A 2B7YA 2W1UA 3I54A 4XFFA 5C3SA 2R073 3WDVA 1HB2A 2LTNA 4MSVA 5FY9A 1DLCA 1IQAA 5L19A 4LBQB 2RV9A 3DEMA 1O91A 1LOAA 1RUE3 2EXKA 2CL2A 2VOTA 1A78A 4PF5A 1L7QA 5JZGA 1C8M2 2VZOA 5FXXA 2QQNA 2P6HA 4MHRA 4A2UA 4PIZA 1K5MB 5F5IA 2BBAA 1BXHA 1EAH1 2XJVA 2Y6JA 3T2OA 5C6CA 1UMHA 1XC6A 3ZYBA 1R1A2 4FPEA 4K6BA 1RUF1 1GZWA 2MNGA 3J8F3 4XZUG 2W47A 3SXWA 3I59B 1PZ8A 2CGPA 2ZEXA 1BLZA 1FOD3 2BOJA 2G9FA 5FYTA 4E8DA 4PLOA 4YWAA 3SH4A 5CFDA 1V9U1 4KWUA 1OVSA 2XJQA 5A3WA 1F2NA 3VZNA 1PNFA 1SLLA 5C4WB 5IVVA 2ZJCA 1OQ1A 2TNFA 3HJRA 4QX3A 2R7EB 5E89A 3Q8FA 4JGYC 4E2QA 5A6QA 5HCAA 3LOBA 1JZ2A 1AF9A 4RGGA 3ZFEA 1VBC2 4Z2AA 4G3YC 1AJKA 5H9PA 4GB33 2GH2A 2J1EA 1RUI3 4NN0A 2HWE1 4IV3A 1I1EA 4CUBA 2GMPA 3PU8A 3DXTA 4Q4Y2 3DXUA 2XH6A 3EB7A 4AVVA 2YXSA 4GMP1 3MUZ1 4GH4C 1OA2A 4J6GA 1K3IA 3A23A 1SMVA 4LBQA 4HETA 1MS3A 1W05A 5LBBA 2VR4A 1PIV1 1RINA 2RMU2 2PN5A 2BOIA 3CLPA 3KM5A 4Y5SA 1W8FA 3PURA 4YGBA 1UOFA 5IFPA 4N9HA 2HWF2 4YG0A 1LEMA 2W1SA 3JU9A 5I0UA 3LGRA 3ZR5A 5LK7B 3AP5A 1HQLA 2WL1A 3CL1A 5FZBA 1V6OA 3AP7A 3C7EA 4CPBA 1QKQA 3OY8B 4A7KA 3BB6A 1D7PM 1MZEA 1H6XA 5C9AB 3B7MA 4I0BA 1C8M3 1RXGA 2GNDA 4GXLA 4QDSA 3AKQA 5C8CC 4AQ6A 1U5XA 3MLLA 5GM0A 3NAPC 1BMV1 2AC1A 1B35B 1ZA4A 2BGOA 4LA2A 5CG8A 3VL9A 3LEKA 3O14A 4XJ8A 2ORXA 3VBOC 3H1MA 5FRAA 3W59A 3JB4C 3P3PA 1Q43A 3JCIA 1W0NA 4ZU4A 3TB0A 3ZYJB 3LZZA 4AVBA 3CZUA 3AYAA 4MXWB 3VD3A 3ZFFC 2OZ6A 2WZEA 3M7AA 3J7NA 2Q8OA 4RQPC 1H8VA 5LRRA 2WDBA 2WNEA 3IWZA 3WINE 1CQ9A 3K4ZA 2DURA 2FZ1A 4JDNA 4WVMB 5JOYA 2D5FA 3P5BA 4U2AA 2DCJA 3ST7A 1POQA 3BVCA 3C7OA 3BTAA 1GZTA 5FZ0A 1UY2A 4P02B 4D7SA 5JLVA 2A3XA 5EWSA 4CU8A 1PNGA 1QJX3 1W8UA 5IWFA 1OPOA 1C57A 1LOFA 2WFF1 3K3NA 2VUCA 3B69A 4YFWA 5FYCA 5J3UA 1QJX1 1PGW2 4WVWA 3B94A 4CTEA 1LODA 1TNRA 1YI7A 2QQIA 3JQWA 1ULCA 4UFKA 2XBO2 5T5PA 4M3CE 5FOJB 3SC7X 4MHUA 4RHV3 3KCYA 3KWVA 1OOPB 5JCTA 2QZ3A 5JR2A 5IW0A 4CEWB 1W06A 2C26A 2R042 4YRDA 3CBNA 5G04L 1D2QA 3BKZA 3O0VA 1JU3A 3SKVA 1PO13 2D6PA 5IHRA 1ZVFA 1EUTA 4XCAA 1EV13 4XABA 1PO11 3D3AA 3E6DA 4EROA 3MICA 3O1RA 5ANNA 4XF0A 3WY6A 1VR3A 2OXBA 4M4PA 1FYUA 4IV3C 1NE4A 2E53A 2ZEZA 1PGW1 4ZPIA 2PLV1 4UYBA 4RGKA 1IKQA 2UWBA 2AUYA 2BQPA 2P2KA 4Q29A 2J1VA 4O65A 4Q4W2 5GLTA 3TRSB 4CCKA 2ZAAA 4D6RA 3RNSA 5JOZA 1U0AA 1XNDA 5EPAA 5FWEA 1OKOA 3OEBA 2YBPA 3TEXA 3VD5A 4J25A 3VBOB 5B4NA 3KSCA 2WT2A 2DTWA 4IESA 1SLAA 2N7GA 4MUVA 1FOD2 3S0MA 2XHKA 3OGSA 1NYWA 4LKFA 5ABJC 2FCTA 3SKJE 1FMD2 2HH9A 1UIKA 1B35C 4JZRA 1QU0A 1DZQA 3M3CA 2Z42A 4O7XA 5J1XA 2D7FA 3OGRA 3ZXDA 1AR81 1J58A 3OSDA 4XILA 3FC0A 1YQ8A 3MV01 2GSYA 1MQTC 2ARBA 2VJXA 2WR9A 1F9KA 3POBA 4OQ8A 2Y0OA 1Z7S1 3USUB 3JUUA 1AYN2 4YW3A 1KITA 1DHKB 3HIFA 4LBNA 2WJSA 4LR4A 3AB0A 2WN2A 2Q30A 3KV6A 2KA3A 5K7PA 1AYN1 3POWA 4AEMA 1C5IA 3PUSA 5CIRA 1UX7A 2EIDA 2V72A 2VUJA 5JOXA 1IG3A 1ZBE3 2RE9A 4EN9B 2ATFA 1QJZA 1HQNA 2ZHLA 1BBT1 1LJ7A 1W6NB 3RGBA 4DXSA 5CFCA 1UU6A 5LBFA 2VNOA 1S0EA 4MGIE 1W6MB 1S0GA 4KG8A 2YC2A 1X8MA 2A6ZA 2B8MA 3SMHA 4GZ9A 3AL5A 4BQWA 5ANQA 1W9WA 2Y6GA 2P3IA 4COWA 4XURA 5A7WB 4KWJA 1ZA7A 4QXCA 5F6LB 5H9SA 5KR7A 1AR71 2OQ6A 1BYHA 4EZ4A 2WINB 4Y20A 1HJGA 1SBFA 4NJ4A 1G86A 4YZ4A 3FLRA 1ENQA 2CGNA 1UCXA 4CDQA 4GB31 3SCGA 1BHGA 1H0BA 5LRSA 3AJYA 2LROA 5B4XA 1T6GC 3EMRA 3KD4A 2NQYA 3OEAA 3IPVB 1S2KA 1UY1A 2WT0A 1GNZA 4B8EA 5FYUA 4AOCA 3SH3A 4N7UA 1NZIA 4C91A 3E1F1 3THTA 4PDWB 3ZMOA 4LTAA 2FD8A 2VZ3A 5FYSA 3C8XA 1RVF3 5F8PA 3T4HB 2HWC3 5K8SA 2BUKA 4A4AA 2CY6A 3MHZA 2V09A 5L36A 2FCVA 2K0GA 3PTRB 4LIVA 1ND3C 2X10A 5FZKA 4NIAA 2RDQA 3UK9A 1NLSA 4ZU5A 5J7MA 1W8WA 2DBNA 1MR5A 2DWRA 4RS5B 3VBUB 4LJHA 1OFSA 1HB4A 4KU8A 1SLTA 3RI9A 4QT6A 1PMJX 2RDRA 3HPNA 3U4XA 2BU9A 1TME1 1O59A 4FPOB 3H42B 4I3PA 1B09A 1EAH3 4ZS2A 5FZCA 1QXRA 4CDXB 2WWSA 1VBC3 3O1SA 3KZ4C 4QGMA 4BMBA 3ZXEA 4DRVA 5C4WC 2BGPA 2VVEA 2WA4A 1OVPA 5AC92 5CKMA 1LHOA 2RS11 4E2GA 1PMIA 2X53S 4IEZA 1VAVA 5F39A 1GSLA 5HCFA 4CCLA 1LAJA 4AEDA 4CEYA 1N3PA 4B3NA 1ZZ8A 2MEV3 3AYEA 3K51A 1DGWX 4B1LA 3AVSA 3NJZA 4Z2WA 1EV12 3JB8A 2XLGA 4XJAA 2VZ1A 5JDBA 1DDLA 1VMHA 3JZVA 5KHIA 1YI9A 5IK8A 2MPFA 1RUH3 5IYYA 1APNA 1QWRA 3I2KA 2AGSA 4FOYA 4HPKB 3N7KA 2VW1A 4DXRA 2QZ2A 2YFUA 4V2WA 2QQVA 4IE0A 1QJU3 2TBVA 1YQ5A 1AYM3 2WKKA 2DFCA 1FMD1 2NN8A 4ASKA 4QU2A 4XUPA 4O61A 2QUOA 2VAUA 2VNVA 3ACFA 3KCCA 1UY4A 2MHFA 1ZYBA 1H30A 3WZ1A 4EN8B 4GWIA 2RDSA 2ZABA 3RJRA 2PHWA 4P5YA 2V4AA 3B9CA 3NJYA 4P14A 5L9BA 2RG4A 2XMLA 3AC0A 1WW5A 2IXCA 3DKQA 2R0HA 3AKTA 2IFWA 3AK0A 1OT5A 1KQRA 1RGSA 1RJ7A 2AACA 1N3QA 3G6JB 2XL7A 4V2VA 2FHRA 2VMFA 2WFPA 3JQXA 3MFAA 3KCXA 1W9FA 4FAGA 3AP9A 2UYBA 3WDTA 4HXCA 3LEIA 2E26A 2VNGA 5DXDA 1GWMA 4IUGA 3VBHB 2IC1A 4QX1A 4OI1A 3WP5A 2XVKA 4N8MA 1D4M1 5FZHA 1H1IA 4AK3A 5A3PA 2NP0A 1NZCA 2GMMA 2H0VA 3POFA 2HWB1 1W6OA 3IIIA 5GLVA 4XYXA 1J1LA 1QXPA 4WM8B 3THDA 3ES4A 4B4PA 1DZTA 3THPA 1XRUA 1NCRA 1U5IA 3WDXA 3KV4A 5FO7B 5FYHA 2YMZA 1YCIA 1WA4A 4XTPA 3QCWA 2JB4A 1OUSA 3IIAA 3VL8A 4CDXA 1JUIA 4QD2A 2NMOA 1C8NA 4AFDA 2BV4A 3B3QE 4UFLA 4AI1A 3IDEA 4GIQA 3I49A 1EPWA 3VV1A 4AGGA 3D5OA 3WNKA 2VD7A 2EAKA 2HWF3 4KGGA 2WQ4A 1I5ZA 1OF4A 1PMHX 1XE8A 4QKFA 5FZDA 3WQ7A 1CD3G 4C8DA 3RVHA 5CAZA 5HV0A 5DAQA 3LIHA 1WA6X 1YQ6A 3ILRA 1R1ZA 3H7JA 1DQ0A 3WF1A 4NRQA 4BQ1A 3ROUA 1JN2P 1DYOA 5C70A 1TE1B 1CZTA 3FUOA 2D3SA 1OF3A 4M0NA 3N4MA 3N9OA 4CPBD 3J7LA 4Q26A 4PQQA 3A21A 2YU1A 1H2LA 2W3JA 3H9AA 4K1YA 1X36A 2IUWA 3I4IA 5FPLA 1NLRA 2IXLA 2JIJA 1QJY3 2P37A 1VJ2A 3ACHA 1GR3A 1RUC3 2DCYA 4ARXA 4F83A 4ISRA 2CDPA 1VRH1 2VZVA 4MV2A 2W87A 1S0JA 3MF9A 4I0AA 1RL3A 2VZQA 2Q1ZB 4AFMA 2CV6A 4HN1A 1JOBA 5F3EA 3MIEA 1LGBA 4LO5B 2CHHA 2WS91 4QX5A 4AVTA 4IE4A 5DUWA 3S6PA 1LHNA 2JDMA 3ETPA 3PDQA 5FZEA 1TMF3 3WDUA 3LSDA 4FP2A 4QQOA 2PHXA 2SBAA 2QQPA 2RS32 1CIWA 4NIGA 1A8DA 1W39A 4WZCA 2C9KA 3ATGA 3TBDA 3MIBA 3AMNA 4NHKA 3CU7A 1GU3A 1LOGA 2O0OA 3EXUA 1NA1C 3PL0A 4XBQA 2VBPA 1L3JA 2WNVA 4AE2A 4XC9A 2YDEA 4AFAA 1COV1 1ZNPA 4KNCA 1UU5A 1PHMA 4GJYA 5CKNA 2ZGPA 1GQHA 1YJKA 4PBOA 3LDBA 3CEWA 1Q8VA 3BTXA 3ZN6A 2OIIA 2V4VA 4Y22B 1RUI2 1IOAA 2C4XA 2ET7A 4A44A 4UW6A 1POV3 1LU2A 2PHRA 2Y34A 2YZ4A 4QX0A 4LK6A 1NCRB 2JE8A 4PT6A 2XKPA 4OVEA 5A70A 5F37A 3OF1A 3RS6A 4XDOA 2P4EA 3GDBA 1DF0A 3GHNA 2KXLA 2WZ8A 5EXOA 3WOGA 2X09A 5I8YA 4BH9A 2CTVA 1ULDA 4D6QA 3BGAA 4QQ2A 1WMXA 4LBLA 5DG2A 2A7AA 3TNQA 3VBRA 1DLLA 4TN7A 3D82A 4BISA 1AR83 4NVPA 2VQUA 4CDQB 4P00B 4BQ5A 3VKOA 1QOTA 3A4UA 5L9VA 2WLQA 4OHYA 2ETEA 4ET7A 2VXRA 3R4SA 2K9ZA 5GZDA 1DFQA 2R32A 3SQOA 3J4UH 1NXD1 4JVAA 1AXKA 4JQTA 5BNOA 2ERFA 5FXWA 4DNYA 5J36A 2D5HA 1K45A 3GJBA 3RZZA 1SDDB 4QGNA 3O1MA 1ALYA 2HYXA 1ZZ6A 1XYOA 4BE3A 1HN1A 1MZ6A 3VDAA 4RA0A 2CDOA 4URAA 1ULGA 1C3HA 1UYYA 2W08A 2GC1A 4TWTA 4NHXA 2HWC1 4XQDA 5BNNC 1NE6A 4R9DA 3S30A 3M3EA 2WA3A 4XTMA 5GJ6A 3T2TA 3C7GA 4XXPA 2ID4A 1NLQA 5T55A 3VB9A 3N3HA 2GALA 3HNYM 5EP9A 1V9U3 2UY9A 3Q9OA 3VDDA 4FFGA 1VP6A 3CF6E 2GP3A 2QNKA 1VBE2 3PUQA 5EJ3A 4X6QB 4AI9A 3UJOA 3VBFB 5C3OA 3I97A 1H8TA 2W52A 3HAGA 1DYKA 1Q8QA 2C24A 1J84A 2GDFA 4M4RA 1VMJA 5FY1A 1S0DA 4IEWA 4FAHA 5BNOB 4Q0QA 2ZKLA 4AVCA 1O5LA 4OMCA 4XE9A 4BQ3A 4QM9A 3VD4A 4MG2A 4RQPB 2QDNA 3LFIA 3VUOA 2XR4A 3ZFFB 1XQNA 2VCAA 4D94A 3H8UA 5JIUA 1R093 3N9QA 1IHMA 2YU2A 1ND2A 2XDVA 3ABZA 3NV2A 2Y0IA 1UXZA 2ZXQA 2W94A 4ZXEA 4IEYA 2JDNA 2W91A 2ZEYA 4I01A 1CAWA 2E32A 1GP6A 3J7HA 5A7NA 1YJLA 1M4WA 2R6QA 1ULFA 5JWPA 2VMHA 2WNVC 4HANA 4FO9A 4JRLA 4Q1PA 5HBAA 3MV11 2G1MA 2XQRA 3T2QA 3KMHA 4R9BA 2H0BA 2WBKA 1XE0A 2XL9A 1HLCA 2P34A 4MGTA 1ZBA3 3HNBM 3TN93 3FBMA 4HONA 3OD4A 3RWKX 3ZKUA 3I3QA 4AEJA 2JIGA 2ARXA 2WO1A 2PHFA 4H55A 4NPLA 4FCAA 5C5TA 5E1RA 4PLMA 4XFGA 5IVJA 1VLNA 2CAUA 4NRPA 2G9ZA 1OH4A 1Z7S2 2VZTA 4H7LA 4LEJA 3S5QA 4BWOA 4Y4YA 1SLBA 4XFHA 3WG3A 3USUA 3NV3A 3VBSC 1DQ6A 1AYM1 1QIQA 2E31A 1STMA 1PZ7A 2GZWA 3PUIA 3CZJA 5FYYA 4PDWA 4XF4A 4RL7A 4L92A 5ACA1 4M01A 2Y6FA 3FMGA 4CP9A 2NPIA 2RR13 2P3JA 3FE5A 3HN1A 1GANA 1HRV2 1WLWA 4CYDA 1FV2A 1XNTA 1NY72 4HKOA 5JR7B 1HJFA 1QJY1 3GBFA 4LOSA 1YYNA 1GZCA 4RR3A 4DUWA 2EXHA 2MEV1 3HQRA 5SV8A 2X5IB 4W6YA 1NCQC 5FMBA 5IJRA 2AENA 5EJ1B 4IEXA 3CIHA 2PTMA 4QGLA 5I8SA 1PK6B 4EE2A 5K0UB 5JXJA 3CMGA 2JDUA 2Y8KA 2Y33A 1WCDJ 1OA3A 4NO4A 1RUF2 1J83A 4HG6B 1KXGA 1LOEA 1LESA 4R52A 4XETA 4GKXA 2ZA9A 4QPYA 3RG0A 3MW4A 1ST8A 3E5XA 4C0BA 1F8VA 1ULEA 1UPSA 4LE3A 5LBEA 1WLCA 1QHDA 2RS51 2PHLA 1W6NA 1H9PA 1F15A 5K0UC 3O1VA 2ORZA 2W46A 4OQ9A 1VBE3 1HB1A 1W6MA 1R083 2JG9C 3BYWA 3I2GA 1WZXA 1YWKA 2W95A 2WZPP 2R062 4OFGA 3BCWA 2A6WA 3HD8B 4WM7C 1FPN3 2X5IC 1CPNA 3M3OA 1U5YA 4EN6B 1W2UA 1QY4A 5BPXA 5EV7A 2ADEA 3VGIA 1S0FA 2DUQA 4OI2A 3WCSA 1NQDA 3WW1A 1AXYA 1OLME 1DZRA 4X8NA 4FI9A 1ZRRA 3HMYA 3LEMA 1K5JA 2WO7A 2D44A 2WS92 2LS6A 2ZX1A 5GLUA 4CDUA 1JZ3A 3OUJA 1IQDC 3T08A 3DECA 4NROA 1RUH2 2X8KA 5F2WA 3QH6A 1X33A 5I0RA 3S7EA 3WNXA 3D6EA 3QBQA 3A7QA 3WUDA 3IAPA 4MGKE 3ZXLA 3MI8A 3ZPYA 4HVRA 1YC61 1CAUB 1TEIA 1W9TA 4BU2A 2WYFA 1F5FA 2QQMA 3FFQA 4Z92B 4W8JA 4QPIA 1RMU1 2JICA 4QHOA 2ET1A 3TEWA 5JMCA 3I2JA 2JD4A 5T50A 2XWBB 2OZJA 3LA2A 2QQWA 1DGLA 3APBA 1CJDA 3LSEA 5DZFA 2XG3A 3GBGA 3UGGA 4EYUA 1BMV2 2YC0A 1UWWA 3S7IA 1O8PA 3PUHA 5FP7A 1PM7A 1LCLA 1SPPA 4HMZA 4K21A 4K1ZA 1WW6A 3BUCA 4ONUA 2Z69A 2PHDA 4RHV1 4BM8A 1HXS3 2I45A 4LBOA 1AYN3 2RHPA 4W6XA 4CXXA 1AX1A 3NNJA 4XDQA 3W21A 4GMP0 1REDA 2ZMKA 4QB2A 5FMOS 5BXXA 3WD5A 1F31A 3FBYA 4HOOA 4FFFA 2JDYA 4UBGA 3WNMA 3D4KA 1ULPA 3M4FA 3POGA 4YM3A 2QQJA 3GZUC 3O0XA 5IVCA 2QBXA 2WZR1 3FLPA 1KJRA 1TVGA 4IV1C 3VKMA 4QDRA 1VBA2 4QPGA 3MDPA 3ZFGB 4I02A 3CJXA 1HN0A 3ZX7A 4TXWA 3LIGA 3B02A 3GXUA 1FPN1 1JOJA 4NAOA 5I0DA 3UESA 5A1AA 2GC2A 2D3PA 2HWB2 1AL21 1WUVA 2WNUB 1ASJ3 2JG8C 3NNLA 1V0AA 3B5LB 4COZA 2VPVA 3VZJA 5JPNB 2QTWB 1SCRA 4BQXA 5BY5A 3H50A 2OW4A 5H9RA 1CZSA 4F3JA 4FPGA 1BJQA 2VNRA 2P5BA 5A3OA 3U4SA 2A71A 3WF3A 5AC93 4A41A 4AI0A 5HXVA 4FPFA 2Q8CA 4Q4V2 4QX8A 1IZ3A 1HKDA 3K2OA 5ACA2 4LOTA 3DL3A 4CCJA 3HT1A 5IFTA 2IFRA 3LDRA 3AXEA 3IMMA 5IVFA 4Q4V1 4LE4A 2TEPA 3VHOA 3HR9A 4BXSV 2K2SA 3MYXA 4QPGB 3H8XA 5E8AA 2ZZQA 1VBD3 1W9SA 1YNAA 1QJY2 2PA7A 4FTSA 1DU3D 4DQAA 1E5SA 1RMU3 3KVBA 3NAPB 4Q0SA 2YG0A 5JXIA 2CWSA 1O7FA 4LHKA 1GZWB 4FFHA 2XPJA 1VPHA 3PJYA 4B29A 3ZN6B 3ZXGA 5LY1A 3WP3A 3O1PA 2J1RA 2R16A 1ZRDA 1CPMA 3RPQA 4A3XA 2C0ZA 4KH9A 4LO8A 3GJAA 3PHMA 4E4HA 2IXJA 3E5UA 4IGPA 4NRMA 2Y26A 1HRI1 3AZXA 4L11A 3WX5A 5GZGA 2PMWB 3BPSA 2IXKA 5FZMA 4HVQA 2ILMA 1RHI3 4P9XA 4MH0E 1OURA 2YPDA 4GH4B 1NG0A 3AYCA 2QQOA 2JD9A 5FBJA 1BEV1 1O6UA 2A70A 1ZZCA 4U36A 1HX6A 4IETA 4GWNA 4AYUA 4QXHA 5C9AA 3WVJA 3ECQA 3E6CC 3WNPA 1YFXA 4FQZA 4D69A 2QFEA 2A5ZA 1OLMA 2FQPA 5I93A 3UT0A 1DBNA 3TEZA 1ENRA 5A80A 2YBKA 3H0OA 3I2OA 1GP4A 1WCKA 4CDWA 5C8CB 1VBB2 3LFMA 4QQHA 5A33A 5DMYA 3OD0A 2ZZJA 5F6KA 2XJRA 1YUDA 5A7QA 5EQUA 1LGCA 1KRIA 1EPZA 3ZPOA 2G19A 5LA1A 4JQRA 4QKNA 1W99A 1MEC2 1PVXA 2W9XA 4YZ3A 4YW1A 2PQQA 2DU1A 5FY4A 3VBHA 1AR73 4OLLA 1WBLA 3Q8BA 4QKBA 2F6BA 4O9GA 5D21A 4FTEA 5M0TA 4IDZA 3FX3A 2VQ0A 4LULA 3ZFFA 1RUOA 1G9AA 1S1AA 4YSFA 2AEZA 1ZREA 2ZCWA 4LIUA 2NLRA 1POV0 5F32A 2VXJA 4EV0A 3WP6A 4LMFA 5FQ0A 3CHXA 3VBFA 4ZU7A 4MGZE 3AM2A 4RYDA 4CP0A 3KHCA 2E7QA 4FVVA 1AR92 4FXKB 4GQ7A 3WF0A 1H2KA 3GCWA 1DP0A 1UYZA 1FAYA 5L7OC 3MPPG 1RJ8A 2BNNA 4E4ZA 3AYDA 2GAUA 5LB6A 5FPUA 5HCHA 5A7PA 1K5MA 5LY2A 3WUCA 4UI9L 1AR63 3UJQA 5EJZB 1DCSA 2AREA 3UETA 4L9BA 4XF3A 2VOWA 5I8TA 2WWJA 4DUVA 4MYEA 3WEZA 2VZSA 3DPRB 2GP5A 2ZGUA 4OZXA 4BK4A 4AQ2A 1DG6A 3PMEA 4GULA 1US2A 1RYYA 5FZGA 1FXZA 3AXDA 3PNAA 1ULOA 2G4IA 1O5UA 2CSGA 3ACLA 5D8AB 3EBRA 3U1XA 1MS8A 1VB2A 4O9EA 4SLIA 1ZBE1 2R30A 1A34A 2ZX4A 1JUHA 3I2HA 1UOGA 3HVDA 2MEV2 2VO5A 1JS9A 3NVCA 4L99A 5IUQA 5FO9B 1O3TA 4Y22A 1R1A1 1UL9A 3OPWA 2SLIA 2O14A 3IT8A 4UBHA 3VLBB 5A3NA 5F5AA 1NX9A 5FZIA 1BVP1 2D97A 5CVRA 4DXZA 1SFPA 3GHMA 3M70A 4LUKA 4DOUA 1UIJA 3ZSJA 4HSLA 4FPHA 4LORA 2RM23 4OHXA 3ZIXA 3CKHA 3N9LA 1V00A 5E6HA 1RIRA 3VHPA 1RUE2 4JKMA 4XDPA 5A32A 5ABJB 5FYZA 4Q0VA 2DBIA 4AVAA 4AF9A 2B4KA 4FQ4A 4OI0A 4B1MA 3HQXA 5BNPB 2EIEA 5AVPA 1PIV3 5T52A 3UKVA 2YYOA 3Q8EA 1S2BA 3ENRA 5LASA 1PO23 1JMUB 1PZ9A 5FYBA 2E9QA 3AL6A 1VBD2 1RUD2 4FOVA 4G4FA 3WSOA 4CP1A 5DAWA 2XJSA 3V0BA 3O1OA 2PLV3 3GBWA 5CYYA 4YVSB 2HWD3 3WF2A 2HKXA 5AVAA 2F4LA 2ZX0A 4IV3B 2VECA 4CCCA 1QH6A 4NWVA 4YW7A 3OGJA 3SITA 2PHUA 3SHRA 3AKSA 4ITCA 4Q27A 5BNNB 1AR82 2JEMA 5FXVA 2UWAA 4D8MA 3ZYIB 1W28A 4IW3A 1WMDA 4IGQA 1ZRCA 2W1WA 1NT0A 2PQSA 4IE5A 5GKAC 1CWPA 5KHJA 4HT1T 1LOCA 3U0ZA 4W4ZA 3IB3A 3HWJA 3BALA 3IDBB 3TOJA 4YW4A 2J7MA 3HNMA 3PIJA 2OS2A 1UNBA 5K4LA 4COUA 5I0SA 3AZZA 2YB7A 2X05A 4WBBA 3SNMA 1VBB3 3LQCA 1F4HA 5J09A 4ASMB 4CDQC 4EQVA 5FYVA 3KT7A 5GALA 2BBVA 4TLFA 2EICA 4C90A 2P6CA 4PIYA 4XJZA 5FKCA 4QAWA 4XMAA 4A3ZA 3NL1A 4LK7A 3OJBA 4YG6A 1IS3A 1G8WA 2YGMA 3CJIA 3FZ3A 2I74A 3RSJA 3H1YA 4A42A 2Q1MA 1ZBA1 3TN91 1N1YA 4PIXA 4QU1A 2Y6LA 2JDKA 1HXS1 2BGCA 1UW8A 3FLTA 4OI4A 3VZOA 4NIDA 3KQRA 2ZGTA 1MS4A 2Q0AA 4PI2A 1JTZX 2WIIB 4QPWA 3UL2A 3WP4A 4K9SA 3F2ZA 1AR91 5T54A 2VQTA 5F2SA 4F8AA 1A8MA 4MADA 1BQPA 4BLJA 3H8RA 4JV4A 1AR93 1I9RA 5FY5A 2XVLA 1W6QB 2Q5TA 5FTTC 1N1TA 1ODMA 1OI6A 1FV3A 5D2AA 1JZ5A 5CZKA 3RZJA 4CU6A 2GN7A 2NM1A 5FJHA 3WXPA 3OGVA 4LKDA 3NJVA 1UO9A 2ZGNA 3ON7A 4MXVA 2D6MA 2WRAA 2YHJA 1WW7A 3OCPA 4RS5C 3VBUC 3R4UA 3POIA 1GICA 1YIFA 3D0SA 5LBCA 3K3OA 2D6NA 2JX9A 1GYKA 1UKGA 2WO3A 2E51A 1NY71 1AL23 4C0HA 1Q8PA 5APAA 3ZFEB 4RN5A 1NKGA 1SBDA 3FHAA 1QNYA 4J1WA 5CFDC 4PDWC 4XUNA 1M06G 2D40A 3M8LA 1D0HA 2FBEA 1RTVA 2WS93 3LB9A 4CDUB 5JSPA 4AGVA 5LEKA 1VAMA 1PGL2 2W1QA 1MZ5A 4N53B 4Q4W3 2WSVA 5DN2A 3VKNA 4YGCA 1GZ9A 1H8TC 1TG7A 3POJA 3I8TA 4RGAA 2Q8DA 2LUWA 5CFCB 4PHZA 1O3RA 3K77A 3AVRA 3AJZA 4CXYA 3WHTA 5FYMA 5FZ6A 3DPRC 1HRV1 2HWD2 1YFWA 4IERA 1LOFC 2OKXA 3OY8A 4IEOA 4UFHA 3B01A 1OUXA 1XYPA 3T4VA 4LT5A 4YYOA 4LXLA 1GNYA 1YQ2A 4CZSA 1P8JA 5J96B 1XU1A 1PO12 4AFBA 2AH2A 2VMGA 1Z7S3 4I2OA 4A6OA 1OH3A 1W6PB 4IEPA 3JBG1 3ZYGA 5DABA 1SG3A 1JYXA 5A3LA 1HRI3 2EIGA 2FZ2A 5FPVA 2YFZA 2JG9B 2XGXA 3JBG3 4DIQA 4NPRA 1DQ4A 1E5IA 2R1BA 2VZPA 4HFSA 3USSA 1OSGA 3LKJA 3LOIA 1Y7BA 5BNQA 2WNUA 1W9YA 3DYPA 4FPJA 4QB6A 4K3UA 3UGFA 4BDVB 4YARA 1XSQA 3FHIB 1YEWA 1HQWA 2VBBA 4NHYA 5LK5A 4Q4V3 5KHGA 3SLIA 3H3LA 2DCZA 2TUNA 4AAPA 3NW4A 5JI9A 2EVXA 5CFDB 4M3CF 1PK6C 4D7YA 1IPJA 2A3WA 1UYPA 1VRH2 5JMOA 1QJFA 1OFNA 4Y26A 3RYKA 2ZX2A 1NCQB 2YUEA 4JCKA 4TYSA 1KFUL 2J1TA 3PIGA 4GH4A 4AZZA 2UY8A 3VZMA 5LATA 3NNGA 4BYYA 2J42A 2WN3A 1IGOA 2JWPA 2UWCA 1RUD3 1W8TA 1XBFA 1W2TA 2OVUA 2RJ2A 4XOGA 4Y24A 1RHI2 1JZ4A 1MVQA 4FOWA 1V6NA 1MACA 1YO8A 4H3WA 4JGZB 1YLLA 1HW5A 2IXHA 2Z4FA 4PJYA 2XWJB 3BODA 4K20A 3RWNA 1WW4A 4LA3A 3VBSB 3SCHA 4GWMA 1KDMA 4EWAA 4AQTA 1QJEA 1CX4A 4RS5A 2RS53 3VBUA 3FJSA 3CNAA 4CCEA 2WC2A 4RSUA 3RI8A 1PX3A 2VUAA 2OYZA 2F17A 1R081 4A7ZA 3DUIA 3ZYRA 2JG8B 2Q8EA 2RJLA 4N43A 1H4HA 4NWWA 5FP8A 2DCTA 1C8M1 3N7MA 5CU1A 4Y1XA 3MO4A 1AJOA 1ND2B 1BVVA 4AR2A 4D3WA 4HPKA 1IPKA 2XJPA 4Q0UA 3AP4A 1JU4A 3KV5A 1H2NA 1TZOA 1COV3 3PVNA 4TLGA 1PVC1 4Z82A 3IBMA 2BEOA 1D4VB 4E2SA 5A33B 1RUNA 4GB32 4AG4A 3WF4A 3VZLA 4FPLA 1GP5A 1BBT2 2VCCA 4LO4B 4CEWC 2VCBA 3UKNA 3UKTA 5A1LA 3V0BB 2VZUA 5EZWA 1CVNA 1CAXB 3ES1A 3OPTA 3L2YA 1LULA 4XZPA 1NXMA 1VBE1 3P6BA 4MOAA 3OGGA 3V0AA 4YG3A 3I2DA 2BP6A 4JDOA 1G7YA 2XKOA 5FV3A 1KD7A 4Q0PA 1MZFA 4AXOA 1C28A 2CYFA 5FPAA 5KXDA 1N3OA 1YFYA 3WG2A 4DFSA 3I3EA 2QKDA 1LHVA 2XJTA 1DIWA 1RUE1 4XUOA 2BRTA 4ISQA 3BI3A 2EAAA 4CXWA 4AI8A 4HSJA 1WGPA 2VG9A 1C5HA 4NIIA 1KEXA 1DGRN 2FMDA 4PQ9A 5FP3A 4LQRA 4X8PA 2VY0A 2ENRA 1PIV2 4DUXA 3ILFA 1UYXA 4CRQA 1UAIA 3IM0A 1UMIA 4ATFA 5BYNA 4AHWA 4BQ2A 4KL1A 2HEYF 4LO7A 1JBCA 1DYPA 1RHI1 1UF2C 1TNFA 1ACCA 1F5JA 2VVDA 1W3XA 3I7DA 1FMD3 2CWMA 4JGZC 4AGRA 1OQEA 2R061 2PAKA 4HKWA 4IQPA 4WM8A 5FZOA 1KDKA 1LR5A 1CR7A 5FZFA 1RUF3 3NO8A 2YROA 4HLTA 5L7OA 4M0HA 1RUJ3 1QMJA 3BIEA 4YW5A 1CAUA 1W03A 5FK8A 1OQDA 1X82A 4M3CA 2RR11 1BKZA 2Y38A 4QPIB 5D8AA 3RDIA 1U12A 1LU1A 3SISA 5JXHA 5J37A 3RZGA 4WM7B 4RQPA 2JECA 4MGQA 4IV1A 3VBSA 2DU0A 2Z2SB 1KFXL 3OPZA 1EY2A 1US3A 4XXAA 5CG9A 1B35A 2LRPA 3KVAA 5HPOA 3S57A 4QX2A 1MS5A 2BTVC 2IXIA 4AW7A 3H8OA 3LPFA 4GA9A 3TEYA 3L2HA 3OYWA 4K8RB 2HLEA 4NHLA 1WCQA 2C9AA 2QE3A 5FY8A 2ZX3A 4IGOA 1G9BA 1K42A 3IKWA 3RZKA 1REEA 3A22A 1ZBE2 2E63A 5CB7A 3U37A 1JW6A 2JDPA 2JJ6A 1WLDA 3MW3A 4DINB 1VBA1 2VMEA 1CAVA 2WUHA 2XBO3 4KMQA 1ONAA 2PELA 1WD3A 4YFZA 2YGLA 2FDGA 3PUAA 1SACA 3LA3A 1BK1A 1JXNA 2V5DA 2ZTNA 5DUXA 4C1XA 5IVEA 4UT5A 4Q1RA 2HEVF 3A0NA 4QKDA 1OMIA 1HXS2 1NA1A 2CNAA 3NWKA 4Q4Y3 4CDWB 2ZBJA 2JXAA 4HZFA 4Y1UA 2NZ9A 1AXZA 1WLTA 1XNAA 3OBZA 1O4YA 3R6SA 3AFGA 5CA6A 4H2AA 2I07B 3MZHA 5T5OA 5ACA3 3ZFEC 5FP4A 3GNEA 3OTFA 1DQ2A 4DXTA 1FX5A 1A3KA 5KBFA 2C1FA 3HBZA 3O7OA 4M00A 1G9CA 3EO6A 5FREA 4YNIA 3OYWB 1YXWA 3WQBA 3ZMNA 5KHKA 4Q8KA 2WNVB 3PU3A 5FZLA 4KBBA 5FQ0B 4EZHA 2OQ7A 4YW2A 1V9U2 4CCOA 1RUD1 3LDKA 4K8FA 4I3GA 5C3PA 1SPPB 4P9YA 4WM8C 1UX6A 4CSWA 1REFA 5TSWA 1AX0A 3PVEA 1QNWA 4KWKA 1ND3A 3PLQA 2XHNA 2BDRA 2YBSA 4B4RA 3IMNA 3ITQA 1RUG2 3LWCA 4R9CA 3KGLA 5JZGC 4S2DA 4M3CB 4YM0A 5FKBA 4HBNA 3ZVXA 4E8CA 4FPKA 5CNAA 5CEHA 4IE6A 2RMU3 4I09A 5GLWA 3ZSEA 5BNOC 1L7LA 2E7AA 2ZHMA 4URTA 1GKBA 2LW8A 5IAXA 4UF0A 3VBFC 2RS52 1I6XA 5BUVA 3C7HA 2ZGOA 2A6XA 5BV6A 4YVWB 5JSRA 1QJU2 3IPVA 3ACIA 3ILNA 2D93A 2WWUA 5LCWL 4P9WA 1LKNA 5FZ1A 4AWDA 3RZLA 4XJ9A 1ASJ1 3ETQA 4LKEA 1SHWB 4P9LA 3VDDC 4JTNA 2EALA 3CO2A 4XFBA 5DPNA 3ZN5A 3T1LA 5JIAA 4MVTA 3ZIWA 5L73A 1GV9A 3N9NA 2GMEA 4AL9A 5HI0A 5AC91 2DTYA 4LLOA 1OOPC 4QPGC 2WAOA 3FWEA 4BLIA 1JZ8A 4CEYC 1BZWA 1JI6A 1W8ZA 2G9GA 5GZEA 4XUTA 5A7WA 1KJLA 1XB9A 2KM2A 4DMIA 4CCMA 5A6XA 4YLZA 5FBZA 3GF6A 3V65A 1GQGA 1Q56A 5H9QA 4CA9A 3KB5A 1VBD1 3VDDB 3POSA 1L7RA 3QH7A 2BNMA 2ZOEB 3ASIA 2VOVA 2W92A 4KQ7A 4AQSA 1MS0A 3TWIA 5LW9A 1RITA 2OA2A 1WCSA 3AX4A 2YC4A 4XCBA 4YVSC 4FTBA 1WWYA 4IE7A 3WW3A 4XIOA 4LHSA 2OUHA 3NMBA 5D1IA 5HXMA 3MFCA 2D6KA 3ZM8A 1OKQA 4CU9A 4JDMA 3W9AA 2H6BA 2DVFA 5FMDA 1DGRA 5IT6A 2OPKA 2R041 3T3YA 1UQXA 2RM21 1UMZA 1J3RA 1NCRC 3GZTB 1FT9A 1LGNA 3Q8AA 4OUEA 1UZYA 4UF0B 5C8CA 3TYJA 4ZHNA 5BNPC 4IXLA 5JZGB 2QVSB 1QGLA 2BVVA 2BW8A 2QJVA 4CEYB 1V70A 3RFRA 4R8HA 4PI0A 3R4DB 4RHV2 4BIOA 3AFKA 5GZCA 2RS31 5CBLA 2VBDA 2ZHNA 1OD3A 4QXBA 3CJIC 4D0QA 2FCUA 1K12A 5KXBA 5F5CA 1NOVA 5DDJ2 1AVBA 1UXXX 3ZSKA 1D2SA 4XMIA 2BNOA 1VALA 2OX0A 2QDRA 1XNCA 4YVWC 2E33A 2CU5A 2R1DA 1QQP2 4QHBA 2A3YA 3WNOA 1O8SA 1Y3TA 1VRH3 4XF1A 4HKLA 5FZ9A 3NSTA 4L8QA 2VVFA 1ND3B 4AEDC 5C5UA 5HV4A 4A45A 1PGSA 1O4TA 4FSJA 3KS7A 3E6BA 4COYA 1MEC3 1ASJ2 5K9YA 1AL22 4RR3C 1R091 1GWKA 3MGUA 5C33A 2PXJA 3JBG2 1JYTA 2XLAA 2EA7A 4UW4A 4CDWC 1H2MA 2XUEA 2E6VA 3GYDA 4JHTA 2GNTA 4MX3A 3VBRC 5A3TA 4BJ0A 4QXKA 4CDXC 1RB8G 4BZ4A 1AHSA 1J3QA 1Q5OA 3R0RA 2IVIB 3KF3A 5FUIA 4AI3A 4GWJA 4N53A 2HBUA 1UPIA 1FATA 1GOHA 1HB3A 1LHWA 3B00A 1RXFA 1JHNA 3KF5A 2VH9A 3MUY1 2AEYA 1DQ1A 3P3NA 4P9GA 2VMIA 3POEA 4A6SA 4YZ1A 5A3MA 2VC9A 1TME3 2Y60A 5IVBA 1S55A 4XJWA 4Y20B 5DQ0A 3LD8A 1AYM2 1Y4WA 4ARYA 3BIWE 2J1AA 4CP2A 2VCMA 3DPRA 4MGYE 3VBRB 5CFCC 2ZMNA 1S4CA 2B42B 2OT7A 3THCA 3E5QA 3DF0A 3RYRA 5IK7A 2GC0A 4GKYA 4DZGA 4BQ4A 3VD9A 2B9UA 2LM3A 4XJUA 4RR3B 5FPXA 1OPMA 1GOFA 5LEJA 1QEXA 3H3ZA 4Z07A 1UZVA 1SLCA 2JB8A 4MGSA 4XPVA 4R9AA 1JOPA 3W5MA 2KR2A 1N1SA 2ARAA 3W20A 3BOWA 4YZ5A 4ZONA 5KC5A 5ERLA 5KHHA 2RS13 1FNYA 3NKGA 2DCKA 2ZGLA 1JYVA 4TZDA 3RJ2X 2UU8A 4MXWA 1FOD1 1DGWA 2EF6A 2P17A 5CKQA 4YM1A 1RC6A 5IAVA 4UXAA 5FWJA 1GWLA 5C3QA 1CAXA 3I3MA 1S0CA 3WCRA 5BNPA 5FY7A 2VE1A 4QPIC 4LITA 3RMYA 4OUMA 2B5HA 1V6MA 1X7NA 5CADA 1LHUA 1QDCA 3CJIB 3MIHA 3OUIA 5FUPA 4CCDA 4FPCA 2PFWA 3N9PA 2VW2A 3I2IA 4XHBA 2VMCA 3V56A 3O12A 3F95A 3RZMA 4AHYA 1LNSA 2VTFA 1RUJ2 1W2OA 3B9IA 3ELNA 3NAPA 4QX7A 4XEZA 3U78A 5JOWA 4P5HA 4KBZA 1U5ZA 1AL0G 4ORFA 4H7MA 3ZXFA 1NUKA 2A6YA 4OHWA 1N47A 3AMQA 5FMOL 3BU7A 2WABA 3JD72 1RUG3 4FPYA 5T3NA 5C8WA 1ODNA 4EWEA 5F9TA 5I91A 1YFUA 2W0XA 4A7YA 4DY3A 1KS4A 1W3VA 4N7IA 4BHPA 3C7FA 4QWNA 5A7SA 3AMPA 3ZKYA 2DDUA 2OUJA 5FO8B 2HWD1 4XAAA 1HIXA 4AI2A 1AR61 2L9LA 1GQPA 1H1AA 4I0WB 5FPBA 2R072 1WD4A 2JDHA 3I3DA 1S0IA 3GGLA 3NNFA 4LBJA 2DFBA 4HL0A 5C4WA 3ZO0B 2F4PA 1YQCA 3WT3A 2NMNA 2Y6HA 3MIFA 2Z79A 4RFT0 4W65A 3HN3A 4KI5M 4JX0A 1J3PA 1SDWA 1AR72 1NAEA 3P1IA 4QB1A 1VBC1 5T5LA 1QJX2 5CISA 2VU9A 2XOMA 4PCRA 1UZZA 1LOBA 2HEWF 4Q4W1 1ZZ7A 5DUVA 3SEPA 4ASLA 5IATA 4HN0A 3MF6A 4E4DX 3T09A 5J48A 3IDCB 2RR12 4I30A 3ZFGA 4L97A 4QQPA 3G7DA 1HV1A 5JAXA 3IAQA 4Q8LA 4BPZA 2XJUA 1C1LA 3EHKA 1ZRFA 2LALA 5FK7A 3VHRA 1OLRA 2JKBA 4F7ZA 1R1A3 3FHQA 3POYA 4N9IA 1CZVA 5FXZA 2WNUC 5A6YA 1ENSA 2DUPA 2HYKA 4Y1VA 3ME2A 3A0KA 4LUMA 1ND2C 4ZS3A 2ZGMA 3SEEA 4D6SA 3SCFA 1SLIA 1X9TA 3MIGA 2ZGSA 1BEV2 1VE0A 4FT8A 4IV1B 4NHMA 4Z8BA 2ZGQA 1A6CA 1JYIA 5GLZA 3QD6A 4TTGA 4JTOA 2RDNA 2WNOA 3HT2A 5DAPA 1WMFA 2HWF1 4JRAA 1WKYA 3WG1A 4OHVA 3RMXA 4UFMA 1C1FA 4B4QA 1UOBA 2EXJA 2PAMA 1IKPA 1CIYA 4AVSA 2R063 3RQ0A 3T2PA 4JC1A 4S2HA 4META 5FLIA 1J59A 1LRHA 4ZY9A 1JYCA 1GBGA 5A1FA 5LZ6A 2VOKA 4HK9A 2BVBA 5FDBA 2XVGA 4YW6A 2AYHA 1IS4A 3VDCA 4CP9B 2YPJA 5JXGA 5KWRA 5HCBA 3T0BA 3VHNA 5L9RA 4CE8A 2ZGKA 4CUCA 2O8OA 2BYVE 5GZFA 2JDZA 3K4DA 4FXGB 4NIHA 1SFYA 4AEKA 2XLFA 1GMMA 2X29A 3VDBA 4AAXA 1PM4A 4QM8A 3W58A 2PAEA 2WT1A 4BXFA 3C2UA 3WDWA 1VAKA 5IK5A 1XYNA 1MQTA 1Y9MA 3LA7A 2VUDA 3RZHA 3B93A 4Y5Z0 1HRV3 1CAWB 1JHJA 5C3RA 3O1TA 1XNKA 4DPNA 1RVF1 2BFUL 3HQUA 5FZ3A 3WR0A 4UFJA 1AR62 3GCXA 3KV9A 1Z78A 2VULA 2D6OX 2WAAA 3DKWA 3FL7A 1OLQA 4Y33A 3PJQA 4IEUA 4JGYB 3DYMA 1HRI2 4NPMA 4QMAA 1XSRA 3VBOA 4LKSA 4AHXA 4HK8A 2JDAA 2DV9A 4ZXKA 4TSVA 3KGZA 2D6LX 1GUIA 5DG1A 4XW3A 2V73A 2E7TA 5IVYA 3TNPB 4Y1YA 3M1HA 4C1WA 2W68A 1UZ0A 3EJKA 1PVC3 4GD4A 4LLFA 2J22A 1W6PA 5DZGA 2WFF2 4ZZ5A 5FFOC 3OBRA 1CAVB 3M2MA 3CQOA 5EFUA 3GM8A 4Y3OA 5F5QA 4DO0A 1POV1 1XXNA 1BEV3 1Z0HA 4Y1ZA 4XQWA 1LEDA 3NV4A 1YRZA 5KC6A 2ZAHA 2P1BA 2VQAA 5FPZA 4CDUC 4FP3A 3ZYPA 2BWAA 2GNBA 3K48A 3NRUA 3NJXA 3KT1A 4MZUA 4Y5TA 4PLNA 1RUJ1 3OUHA 1BBT3 3DN7A 3ZYHA 1UY0A 1MQTB 2PYTA 3EYPA 4Z1VA 1MS1A 2Q1FA 3EQEA 5FMCA 3ZDSA 1C4RA 1JYNA 5ISLA 2DVBA 4DRRA 1JZ7A 2RJKA 3U75A 4XACA 2R49A 2W2IA 3MW2A 4UW5A 5A7OA 5DDJ1 1LENA 5FYIA 5LA2A 4Q4X1 2XQXA 4BQYA 3FN9A 4CUGA 1RUC2 4SBVA 4DS0A 2ZEWA 5K0UA 5C7GA 1KGYA 5F3CA 1UKRA 3OBTA 4YZ2A 1QJU1 1ZZ9A 3KLSA 4UWDA 4DY5A 1G6NA 1G9FA 5F7UA 3R05A 4GJZA 4JHZA 1TME2 4XFCA 1UY3A 3M3QA 1W8OA 4INDA 3MEPA 4BA6A 4NOTA 1UN1A 3HEIA 4Y4RA 2JE9A 1TMF1 3SH5A 3N35A 3AZWA 2VTXJ 3V64A 2IVJA 1EP0A 4OUSA 2AZ5A 4MO3M 5E16A 1MS9A 1JZ6A 1OD5A 3ZN4A 2CAVA 4WVMA 1GFF2 2XONA 3OOXA 5FAXA 2JKXA 2RM22 4BCUA 5L7OB 3LEGA 3VN4A 2HWC2 4Q5OA 2ARCA 3H7YA 4DEQA 1MVEA 2FDHA 4B7KA 1F4AA 4XQ4A 4UW3A 1XNBA 1R64A 3NQHA 3VKFC 3CDZB 4LHNA 1E5RA 1V6IA 4R4ZA 1H6YA 5ABJA 5JI7A 5LWBA 1CX1A 1O4ZA 2XXZA 4P08A 2YY1A 5FCCA 1AZDA 1V6LA 2QQUA 2ZKNA 3ORJA 1EUUA 1OBNA 3RRDA 1ZM1A 1OC1A 2P3KA 5FZ7A 2J1UA 2Y6KA 4LBQD 4MLOA 1CN1A 4N43C 2HWE2 4KU7A 4QDQA 3VD7A 3ZR6A 1CGPA 1T6BX 4NAMA 4QQLA 3WNLA 3J9SA 2HWB3 5A3UA 1VBB1 3NKTA 3D0JA 2R071 2VGDA 4IEVA 1W0PA 1V6JA 2WSUA 3V0AB 3AMHA 3LF7A 2A73B 1VBA3 4XFIA 1XOYA 3J8F2 3FUQA 4KGQA 2ZPXA 3BOPA 1PVC2 2BFUS 3PTYA 1OOPA 1JYWA 2GNMA 4ATEA 1RUI1 4UAPA 4CEWA 3AZVA 2DF7A 2BJSA 3BU0A 1SBEA 2X5IA 2KD7A 2WLPA 2BPA2 2ADDA 3H1WA 3URFA 2VM9A 2ZACA 3HBKA 4GMP3 1DQ5A 1D0GA 1OA4A 3JD73 5FUNA 1ZBA2 3TN92 3X29B 3LE0A 4XAEA 1RVF2 1XE7A 3INAA 1W8NA 2B45X 1TQ5A 1I5PA 5B2GB 5DUUA 2C5DA 4PBPA 2JE7A 3ZXAC 5F3IA 4YVSA 3BPZA 3QLQA 3T30A 3MBWA 3IN9A 2RS33 2JG8A 1N1VA 1FPN2 1QOSA 1ZZBA 3HOBA 3LAGA 2DVGA 3J8F1 1UD1A 4CCNA 5FJKA 1S2EA 4YGDA 1D4M2 2J1SA 4L2NA 3RYPA 1PX4A 3O5SA 4ES9A 1QXJA 1IPSA 1BK0A 3FFZA 4YM2A 3O0WA 4UOJA 5FZAA 3WHUA 3K4AA 2YV8A 2ZGRA 5G05L 4E27A 5FR3A 2OPWA 1RUC1 1W04A 1O3SA 5C9AC 3ZDVA 5KXEA 3WQ0A 1PGL1 4ZKTB 4KG0A 4LBKA 3IDAA 3JXSA 4XF9A 5A32B 1QQP1 1J1TA 1ZX5A 2IWGB 3T1MA 3DGTA 1FNZA 4NUBA 2ZS6B 3LCPA 2CGOA 1W2AX 4L0PA 2VOXA 2HWE3 4S2GA 1G9DA 2D43A 4AHZA 4NE9A 2DVAA 1LTEA 4K40A 1WCUA 1WMEA 3J7MA 4N90A 4NMIA 5FLJA 5D8AC 2HBTA 2B39A 4YVWA 4RD7A 1MPXA 4W6WA 1E5HA 2QQLA 1H4GA 2DVDA 3MLKA 5AFBA 1YHFA 4JAAA 1F35A 1W2NA 2D3RA 4PF1A 3WQ1A 1O3QA 1BCXA 1IS6A 5J98B 2B46X 4LNVA 2WZR2 4WZFA 4XVHA 5F1RA 4W50A 3WV6A 5BNNA 5FOBB 3OB8A 3PVOA 3U14A 4EJRA 2A6VA 1UOJA 2PHTA 2H6CA 2UYAA 2W39A 3K75B 1RUH1 4UFIA 5FZ4A 3UNPA 2FDKA 2K46A 4EN7B 4HVOA 2R043 2Z5WA 4YPJA 1UU4A 4FOQA 4WVVA 1Y9GA 3JD71 1CESA 1H8TB 1VRBA 4N53C 1SZBA 1YIPA 2XB6C 4KWLA 2NYYA 3KQ4B 5FZ8A 3ZXKA 2IZWA 1H1MA 1OHFA 4X6RB 1CJPA 4Q4Y1 5C71A 1SCSA 2WQZC 3E97A 4FFIA 2W5FA 4P9IA 1SQ4A 3AMMA 4ES8A 3I59A 1Q8OA 4B7EA 5T5JA 3IZOA 4JKKA 3ZSMA 4CUAA 3T0DA 1JH5A 3NV1A 1GNHA 3BN6A 5EYXA 3NNMA 1OXCA 1EAH2 2VTXA 4IL7A 3AP6A 3K46A 3U10A 3ZLIA 5JSOA 2B9VA 3QACA 2GN3A 4COVA 4CU7A 3OG2A 1HDKA 1XPWA 4QHZA 1ZRIA 2ZMLA 2A1XA 1Y43B 5FLHA 3PMSA 3MPBA 1WBFA 1AUYA 4BMEA 4DB5A 4XFAA 1GLHA 3KT4A 3I2FA 4XUQA 2GH8A 4WM7A 1XU2A 3GZAA 1EYBA 1K5MC 1T2XA 1W6OB 2VW0A 5DAVA 3WW2A 1D4M3 4E4SA 3LPGA 1RUG1 1VIWB 2A75A 4E9KA 1SEFA 4AEDB 2FDJA 4JKLA 3T0AA 1PO21 2O1QA 3GALA 4GAZA 3UGHA 3S5AA 1X50A 5FP9A 4XIKA 5EHDA 3MIDA 2XBO1 2Y64A 1AX2A 1UZWA 5KXCA 4LHLA 2EIBA 3C3VA 4Q2FA 2AR6A 3WDYA 1W8HA 2RVAA 4LBMA 5EYYA 4BB3A 4JGZA 3O1UA 2FDIA 2I2SA 1R092 4EWDA 5DZEA 4LO6B 3Q8CA 5AFEA 3N36A 1V6KA 4WVZA 3N9MA 3ZXJA 4D7TA 4BOWA 2P3YA 1KS5A 2GU9A 1RMU2 4S2FA 5IK4A 1NCQA 2RS12 3AZYA 2DUOA 5DAXA 3VBHC 3ACGA 3ALQA 5I0TA 1FI2A 4OCTA 1X8EA 4GALA 2O8QA 2FMYA 3H3UA 1H9WA 3AKRA 4DEVA 5FIXA 4YGEA 3PVBB 1CONA 3VZKA 3VKLA 2BWCA 4J1XA 1ENXA 5DDJ3 3W5NA 3GZEA 5LA0A 2EXIA 4EN0A 3ZSLA 3KHBA 2JG9A 2GC3A 2WFF3 3BTYA 4OMDA 2HJIA 1X9PA 2BZDA 3ZFGC 2BERA 4R4XA 4Q4X3 2PLV2 5A6ZA 2QQKA 1IG0A 1JODA 3AKPA 3ZOIA 3MLJA 3L9JT 3ZYFA 3DYOA 3DV8A 4JGYA 4WV8A 1R082 4Q4X2 2V5YA 4N43B 1VMFA 3WLUA 4ZZ8A 3WG4A 4IEQA 2D98A 5SV5A 3D8CA 3UYJA 2R0FA 2UURA 4OYUA 3U11A 1W6QA 2VMDA 1EV11 1W90A 2WZR3 1LB2A 2RMU1 3OBAA 5F3GA 5LA9A 1QDOA 5JPMB 4AFCA 1QF3A 4RFRB 5E88A 3WNNA 4CVUA 1Y9QA 1TMF2 1XJAA 2WYSA 3I3BA 3DCQA 4G9SB 4BK5A 1IS5A 1E57A 2VL4A 1Q8SA 3UV9A 4NR1A 4H14A 2DYCA 1NQJA 4K7JA 4FBFA 3QOPA
chains in the Genus database with same CATH topology
4XBNA 2ZHKA 4XHXA 1LECA 1QQP3 1VB4A 3M3IA 4XBLA 1S0BA 3J26N 3WW4A 3U07A 1I3HA 3N7JA 1COV2 2ES3A 1HV0A 1MEC1 1PK6A 5JVVA 2QCSB 4BIFA 4V1PA 1SFNA 1PO22 1QOOA 4OULA 2XUMA 3TAYA 4OHZA 1URXA 2Q4SA 2JENA 1Q3EA 3N7LA 1W0OA 1NA1B 4P9JA 1QH7A 2B7YA 3I54A 4XFFA 2R073 3WDVA 2LTNA 4MSVA 5L19A 1IQAA 4LBQB 1O91A 1LOAA 1RUE3 2EXKA 2CL2A 4PF5A 1A78A 5JZGA 1C8M2 4A2UA 4PIZA 1K5MB 1BXHA 1EAH1 2XJVA 5C6CA 1R1A2 4FPEA 4K6BA 1RUF1 1GZWA 2MNGA 3J8F3 3SXWA 3I59B 1PZ8A 2CGPA 1FOD3 2G9FA 4PLOA 3SH4A 5CFDA 1V9U1 2XJQA 1F2NA 3VZNA 1PNFA 1SLLA 2ZJCA 1OQ1A 2TNFA 5E89A 4JGYC 4E2QA 5HCAA 3LOBA 1AF9A 4RGGA 3ZFEA 1VBC2 4G3YC 1AJKA 5H9PA 4GB33 2GH2A 1RUI3 4NN0A 2HWE1 4IV3A 1I1EA 2GMPA 4Q4Y2 2XH6A 4AVVA 2YXSA 4GMP1 4GH4C 1OA2A 4J6GA 1SMVA 4LBQA 4HETA 1MS3A 2BPA2 1PIV1 1RINA 2RMU2 2PN5A 5HXVA 3CLPA 3KM5A 4YGBA 1ZRCA 4N9HA 2HWF2 4YG0A 1LEMA 3JU9A 5I0UA 3LGRA 5LK7B 3AP5A 3CL1A 1HQLA 2WL1A 1V6OA 3AP7A 1QKQA 3OY8B 4A7KA 3BB6A 1MZEA 5C9AB 3B7MA 4I0BA 1C8M3 2GNDA 4GXLA 5C8CC 3AKQA 4AQ6A 1U5XA 3MLLA 5GM0A 3NAPC 1BMV1 1B35B 1ZA4A 4LA2A 5CG8A 3VL9A 3O14A 4XJ8A 3VBOC 3H1MA 5FRAA 3W59A 3JB4C 3P3PA 1Q43A 3JCIA 4ZU4A 3TB0A 3ZYJB 4AVBA 3LZZA 4MXWB 3AYAA 3ZFFC 2OZ6A 3M7AA 2Q8OA 4RQPC 1H8VA 5LRRA 2WNEA 3WINE 3IWZA 4A7ZA 1CQ9A 5JOYA 2DURA 2FZ1A 4JDNA 4WVMB 2D5FA 4U2AA 2DCJA 3ST7A 3BTAA 4D7SA 5JLVA 2A3XA 5EWSA 1PNGA 1QJX3 1OPOA 1C57A 1LOFA 2WFF1 4YFWA 3B69A 5J3UA 1QJX1 1PGW2 4WVWA 3B94A 4CTEA 1LODA 1TNRA 1YI7A 3JQWA 1ULCA 2XBO2 5T5PA 4M3CE 5FOJB 4RHV3 3KCYA 1OOPB 5JCTA 2QZ3A 4CEWB 2R042 4YRDA 1D2QA 3O0VA 1PO13 2D6PA 1ZVFA 1EV13 1PO11 3E6DA 4EROA 3MICA 4XF0A 3WY6A 1VR3A 1FYUA 4IV3C 1NE4A 2E53A 1PGW1 2PLV1 1IKQA 2UWBA 2AUYA 2BQPA 2P2KA 4Q29A 4Q4W2 5GLTA 3TRSB 2ZAAA 3RNSA 5JOZA 1U0AA 1XNDA 3VBOB 3KSCA 2WT2A 2DTWA 4IESA 1SLAA 2N7GA 4MUVA 1FOD2 3S0MA 2XHKA 5ABJC 1NYWA 1FMD2 1UIKA 1B35C 1QU0A 1DZQA 3M3CA 2Z42A 2D7FA 3ZXDA 1AR81 1J58A 4XILA 3FC0A 2GSYA 1MQTC 2ARBA 1F9KA 2Y0OA 1Z7S1 3USUB 3JUUA 1AYN2 4YW3A 1KITA 1DHKB 3HIFA 4LBNA 2WJSA 4LR4A 3AB0A 2Q30A 2KA3A 5K7PA 1AYN1 3POWA 4AEMA 1C5IA 5CIRA 2VUJA 5JOXA 1ZBE3 2RE9A 4EN9B 2ATFA 1QJZA 1HQNA 2ZHLA 1BBT1 1LJ7A 1W6NB 5CFCA 1UU6A 2VNOA 1S0EA 4MGIE 1W6MB 1S0GA 4KG8A 1X8MA 2A6ZA 2B8MA 3SMHA 2P3IA 4COWA 4KWJA 5F6LB 5H9SA 1AR71 1BYHA 2WINB 4Y20A 1SBFA 1G86A 4YZ4A 3FLRA 1ENQA 2CGNA 1UCXA 4CDQA 4GB31 3SCGA 1H0BA 5LRSA 3AJYA 1T6GC 3KD4A 2NQYA 3IPVB 1S2KA 2WT0A 1GNZA 4B8EA 3SH3A 4N7UA 4C91A 3THTA 4PDWB 3ZMOA 4LTAA 1RVF3 2HWC3 5K8SA 2BUKA 2CY6A 2V09A 5L36A 2K0GA 1ND3C 3UK9A 1NLSA 4ZU5A 5J7MA 1MR5A 2DWRA 4RS5B 3VBUB 1OFSA 4KU8A 1SLTA 3RI9A 4QT6A 3U4XA 1TME1 4FPOB 4I3PA 1B09A 1EAH3 1QXRA 4CDXB 2WWSA 1VBC3 3KZ4C 4QGMA 4BMBA 3ZXEA 4DRVA 5C4WC 2VVEA 2WA4A 5AC92 1LHOA 2RS11 4E2GA 1PMIA 2X53S 4IEZA 1VAVA 1GSLA 5HCFA 4AEDA 4CEYA 1N3PA 4B3NA 1ZZ8A 2MEV3 3AYEA 3K51A 1DGWX 3NJZA 4Z2WA 1EV12 3JB8A 2XLGA 4XJAA 5JDBA 1DDLA 3JZVA 5KHIA 1YI9A 5IK8A 2MPFA 1RUH3 1APNA 1QWRA 2AGSA 4FOYA 4HPKB 3N7KA 2VW1A 2QZ2A 1QJU3 2TBVA 1AYM3 2WKKA 2DFCA 1FMD1 2NN8A 4QU2A 2QUOA 3KCCA 2MHFA 1ZYBA 1H30A 3WZ1A 4EN8B 2ZABA 3RJRA 2PHWA 3B9CA 4P14A 1WW5A 2IXCA 2R0HA 3AKTA 2IFWA 3AK0A 1KQRA 1RGSA 1RJ7A 1N3QA 3G6JB 2XL7A 2FHRA 2WFPA 3JQXA 3MFAA 3KCXA 4FAGA 3AP9A 2UYBA 3WDTA 2VNGA 5DXDA 3VBHB 2IC1A 4OI1A 3WP5A 2XVKA 1D4M1 1H1IA 4AK3A 2NP0A 1NZCA 2GMMA 2H0VA 2HWB1 1W6OA 5GLVA 4XYXA 1J1LA 1QXPA 4WM8B 4B4PA 3ES4A 1DZTA 3THPA 1XRUA 1NCRA 1U5IA 3WDXA 5FO7B 2YMZA 1YCIA 1WA4A 4XTPA 3QCWA 3IIAA 3VL8A 4CDXA 1JUIA 4QD2A 2NMOA 1C8NA 4AFDA 3B3QE 4AI1A 3IDEA 4GIQA 1EPWA 3VV1A 4AGGA 3D5OA 2EAKA 2HWF3 4KGGA 2WQ4A 1I5ZA 1XE8A 3WQ7A 1CD3G 5CAZA 3ILRA 1R1ZA 3H7JA 1DQ0A 4BQ1A 3ROUA 1JN2P 1TE1B 3FUOA 2D3SA 4M0NA 3N4MA 4Q26A 1H2LA 3H9AA 4K1YA 1X36A 3I4IA 1NLRA 1VJ2A 2IXLA 1QJY3 2P37A 1GR3A 1RUC3 2DCYA 4F83A 4ISRA 1VRH1 4MV2A 1S0JA 3MF9A 4I0AA 1RL3A 2Q1ZB 4AFMA 2CV6A 4HN1A 3MIEA 1LGBA 4LO5B 2WS91 4QX5A 4AVTA 5DUWA 3S6PA 1LHNA 3WDUA 1TMF3 3LSDA 4FP2A 4QQOA 2PHXA 2SBAA 2QQPA 2RS32 1CIWA 1A8DA 1W39A 4WZCA 3ATGA 3TBDA 3MIBA 3AMNA 4NHKA 3CU7A 1LOGA 2O0OA 3EXUA 1NA1C 4XBQA 1L3JA 2WNVA 4AE2A 2YDEA 4AFAA 1COV1 1ZNPA 4KNCA 1UU5A 1PHMA 2ZGPA 1GQHA 1YJKA 4PBOA 3CEWA 1Q8VA 3ZN6A 2OIIA 4Y22B 1RUI2 1IOAA 2ET7A 4UW6A 1POV3 1LU2A 2PHRA 2YZ4A 1NCRB 2XKPA 4OVEA 3OF1A 3RS6A 1DF0A 3GHNA 2KXLA 5EXOA 3WOGA 5I8YA 4BH9A 2CTVA 1ULDA 4QQ2A 5DG2A 4LBLA 3VBRA 2A7AA 3TNQA 1DLLA 3D82A 1AR83 4NVPA 4CDQB 3VKOA 1QOTA 3A4UA 2WLQA 4OHYA 2ETEA 2VXRA 3R4SA 2K9ZA 5GZDA 1DFQA 2R32A 3J4UH 1NXD1 4JVAA 1AXKA 5BNOA 5J36A 2ERFA 4DNYA 2D5HA 3RZZA 4QGNA 1ALYA 1ZZ6A 1XYOA 4BE3A 1MZ6A 4RA0A 1ULGA 1C3HA 2W08A 2GC1A 4TWTA 4XQDA 2HWC1 5BNNC 1NE6A 4R9DA 3S30A 3M3EA 2WA3A 4XTMA 5GJ6A 3T2TA 4XXPA 5T55A 3N3HA 2GALA 1V9U3 2UY9A 3Q9OA 3VDDA 1VP6A 3CF6E 2QNKA 5EJ3A 1VBE2 4X6QB 3UJOA 3VBFB 1H8TA 2W52A 3HAGA 1DYKA 1Q8QA 2GDFA 4FAHA 5FO8B 1S0DA 4IEWA 5BNOB 4Q0QA 2ZKLA 4AVCA 1O5LA 4XE9A 4QM9A 4RQPB 2QDNA 3VUOA 3ZFFB 1XQNA 4D94A 3H8UA 5JIUA 1R093 1IHMA 1ND2A 3NV2A 2Y0IA 4IEYA 4I01A 1CAWA 1YJLA 1M4WA 2R6QA 1ULFA 5JWPA 2VMHA 2WNVC 4HANA 4FO9A 4JRLA 4Q1PA 5HBAA 3KMHA 4R9BA 2H0BA 2XL9A 1HLCA 2P34A 1ZBA3 3TN93 3FBMA 3OD4A 4AEJA 2ARXA 2PHFA 4H55A 4FCAA 5E1RA 4PLMA 4XFGA 1VLNA 2CAUA 4H7LA 1Z7S2 4BWOA 4LEJA 4Y4YA 1SLBA 4XFHA 3WG3A 3USUA 3NV3A 3VBSC 1DQ6A 1AYM1 1PZ7A 2GZWA 4PDWA 4XF4A 4RL7A 4L92A 5ACA1 4M01A 3FMGA 2NPIA 2RR13 2P3JA 3FE5A 3HN1A 1GANA 1HRV2 1WLWA 4CYDA 1FV2A 4HKOA 1NY72 5JR7B 1QJY1 3GBFA 1YYNA 1GZCA 4RR3A 2EXHA 2MEV1 5SV8A 2X5IB 4W6YA 1NCQC 2AENA 4IEXA 2PTMA 4QGLA 5I8SA 1PK6B 5K0UB 1WCDJ 1OA3A 4NO4A 1RUF2 1KXGA 1LOEA 1LESA 4R52A 4XETA 4GKXA 2ZA9A 4QPYA 3RG0A 3MW4A 3E5XA 4C0BA 1F8VA 1ULEA 1UPSA 4LE3A 1WLCA 1QHDA 2RS51 2PHLA 1W6NA 1H9PA 5K0UC 1VBE3 1W6MA 2JG9C 1R083 1YWKA 2WZPP 2R062 4OFGA 3BCWA 2A6WA 3HD8B 4WM7C 1FPN3 2X5IC 1CPNA 3M3OA 1U5YA 4EN6B 1W2UA 1QY4A 5BPXA 5EV7A 3VGIA 1S0FA 2DUQA 4OI2A 3WCSA 1NQDA 3WW1A 1AXYA 1DZRA 4X8NA 1ZRRA 3HMYA 2D44A 2WS92 5GLUA 2ZX1A 4CDUA 1RUH2 2X8KA 3QH6A 1X33A 5I0RA 3S7EA 3WNXA 3D6EA 3QBQA 3WUDA 4MGKE 3ZXLA 3MI8A 3ZPYA 4HVRA 1CAUB 1TEIA 4Z92B 3FFQA 1F5FA 4QPIA 1RMU1 2JICA 2ET1A 5JMCA 2JD4A 5T50A 2XWBB 2OZJA 3LA2A 3APBA 1DGLA 3LSEA 1CJDA 5DZFA 1BMV2 2XG3A 3GBGA 2YC0A 3S7IA 1PM7A 1LCLA 4HMZA 4K21A 4K1ZA 1WW6A 4ONUA 2Z69A 2PHDA 4RHV1 4BM8A 1HXS3 2I45A 4LBOA 1AYN3 2RHPA 4W6XA 1AX1A 4XDQA 4GMP0 1REDA 2ZMKA 5FMOS 5BXXA 3WD5A 1F31A 3FBYA 4UBGA 3D4KA 3M4FA 4YM3A 3GZUC 3O0XA 2WZR1 3FLPA 1KJRA 4IV1C 3VKMA 4QPGA 1VBA2 3ZFGB 3MDPA 4I02A 3CJXA 3ZX7A 3B02A 1FPN1 1JOJA 2GC2A 2D3PA 2HWB2 1AL21 1WUVA 2WNUB 1ASJ3 2JG8C 3B5LB 4COZA 2VPVA 3VZJA 5JPNB 1SCRA 5BY5A 3H50A 2OW4A 5H9RA 4F3JA 4FPGA 1BJQA 2VNRA 2A71A 5AC93 4AI0A 4FPFA 4Q4V2 1IZ3A 1HKDA 5ACA2 3DL3A 3HT1A 2IFRA 3AXEA 4Q4V1 4LE4A 2TEPA 3VHOA 3HR9A 2K2SA 3MYXA 4QPGB 5E8AA 2ZZQA 1VBD3 1YNAA 4FTSA 1QJY2 2PA7A 1DU3D 4DQAA 1RMU3 3NAPB 4Q0SA 2CWSA 1O7FA 4LHKA 1GZWB 2XPJA 3PJYA 4B29A 3ZN6B 3ZXGA 3WP3A 2R16A 1ZRDA 1CPMA 3RPQA 4A3XA 2C0ZA 4KH9A 4LO8A 3PHMA 2IXJA 3E5UA 2Y26A 1HRI1 3AZXA 4L11A 3WX5A 5GZGA 4HVQA 2IXKA 2ILMA 1RHI3 4P9XA 4MH0E 5C4WB 4GH4B 1NG0A 3AYCA 1BEV1 2A70A 1ZZCA 4U36A 1HX6A 4IETA 4GWNA 4AYUA 5C9AA 3E6CC 3WVJA 3ECQA 1YFXA 4FQZA 4D69A 2QFEA 2A5ZA 2FQPA 5I93A 1DBNA 1ENRA 3H0OA 1WCKA 4CDWA 5C8CB 1VBB2 4QQHA 5A33A 3OD0A 2ZZJA 5F6KA 2XJRA 1YUDA 1LGCA 1KRIA 1EPZA 4JQRA 1MEC2 1PVXA 4YZ3A 4YW1A 2PQQA 2DU1A 3VBHA 1AR73 4OLLA 1WBLA 4FTEA 2F6BA 4O9GA 1RUOA 3FX3A 2VQ0A 4LULA 3ZFFA 1G9AA 1S1AA 4YSFA 1ZREA 2ZCWA 2NLRA 1POV0 4EV0A 3WP6A 5FQ0A 4ZU7A 3VBFA 4MGZE 3AM2A 4CP0A 2E7QA 4FVVA 1AR92 4FXKB 4GQ7A 1H2KA 1FAYA 5L7OC 3MPPG 1RJ8A 2BNNA 4E4ZA 3AYDA 2GAUA 1K5MA 3WUCA 3UJQA 1AR63 2AREA 4L9BA 4XF3A 2VOWA 5I8TA 4MYEA 3DPRB 4OZXA 2ZGUA 4AQ2A 1DG6A 3PMEA 4GULA 1FXZA 3AXDA 3PNAA 2G4IA 1O5UA 3ACLA 5D8AB 3EBRA 1MS8A 1VB2A 4O9EA 4SLIA 1ZBE1 2R30A 2ZX4A 1JUHA 2MEV2 4L99A 3NVCA 5IUQA 5FO9B 1O3TA 4Y22A 1R1A1 1UL9A 2SLIA 3IT8A 4UBHA 3VLBB 1BVP1 2D97A 5CVRA 4DXZA 3GHMA 3M70A 4LUKA 4DOUA 1UIJA 3ZSJA 4HSLA 4FPHA 2RM23 4OHXA 3ZIXA 1V00A 1RIRA 3VHPA 1RUE2 5A32A 5ABJB 4Q0VA 4AVAA 4AF9A 4FQ4A 4OI0A 3HQXA 5BNPB 5AVPA 1PIV3 5T52A 3UKVA 2YYOA 1S2BA 3ENRA 1PO23 1PZ9A 2E9QA 1VBD2 1RUD2 4FOVA 4G4FA 4CP1A 3V0BA 2XJSA 2PLV3 3GBWA 4YVSB 2HWD3 2HKXA 5AVAA 2ZX0A 4IV3B 2VECA 1QH6A 4NWVA 3OGJA 3SITA 2PHUA 3SHRA 3AKSA 4ITCA 4Q27A 5BNNB 1AR82 2JEMA 2UWAA 3ZYIB 1WMDA 5GKAC 5KHJA 4HT1T 1LOCA 3U0ZA 3HWJA 3BALA 3IDBB 3TOJA 4YW4A 4COUA 5I0SA 3AZZA 4WBBA 3SNMA 1VBB3 5J09A 4ASMB 4CDQC 3KT7A 5GALA 2BBVA 4TLFA 4C90A 4PIYA 4XJZA 4XMAA 3NL1A 4YG6A 3OJBA 1IS3A 1G8WA 2YGMA 3CJIA 3FZ3A 2I74A 3RSJA 3H1YA 2Q1MA 1ZBA1 3TN91 1N1YA 4PIXA 1HXS1 2BGCA 1UW8A 3FLTA 4OI4A 3VZOA 3KQRA 2ZGTA 1MS4A 2Q0AA 1JTZX 2WIIB 3UL2A 3WP4A 4K9SA 1AR91 5T54A 4F8AA 1A8MA 4BLJA 1BQPA 4JV4A 1AR93 1I9RA 2XVLA 1W6QB 2Q5TA 5FTTC 1N1TA 1OI6A 1FV3A 2GN7A 2NM1A 3WXPA 2ZGNA 4MXVA 2D6MA 2YHJA 3OCPA 1WW7A 4RS5C 3VBUC 3R4UA 1GICA 1YIFA 3D0SA 2D6NA 2JX9A 1GYKA 1UKGA 2E51A 1NY71 1AL23 4C0HA 1Q8PA 3ZFEB 1SBDA 5CFDC 1QNYA 4J1WA 1M06G 4PDWC 2D40A 3M8LA 1D0HA 2FBEA 1RTVA 2WS93 3LB9A 4CDUB 5JSPA 4AGVA 5LEKA 1VAMA 1PGL2 1MZ5A 4N53B 4Q4W3 2WSVA 3VKNA 4YGCA 1GZ9A 1H8TC 1O3RA 4RGAA 3I8TA 5CFCB 2LUWA 3AJZA 3WHTA 3DPRC 1HRV1 2HWD2 1YFWA 4IERA 1LOFC 3OY8A 4IEOA 3B01A 1XYPA 4LT5A 4YYOA 4CZSA 5J96B 1XU1A 1PO12 4AFBA 2AH2A 2VMGA 1Z7S3 4I2OA 1W6PB 4IEPA 3JBG1 3ZYGA 5A3LA 1HRI3 2EIGA 2FZ2A 2JG9B 2XGXA 3JBG3 4NPRA 1DQ4A 2R1BA 4HFSA 3USSA 1OSGA 3LKJA 3LOIA 1Y7BA 5BNQA 2WNUA 4FPJA 4K3UA 4YARA 3FHIB 5LK5A 1HQWA 5KHGA 4Q4V3 3SLIA 2DCZA 2TUNA 5JI9A 3NW4A 2EVXA 5CFDB 4M3CF 1PK6C 4D7YA 1IPJA 2A3WA 1VRH2 1OFNA 4Y26A 3RYKA 2ZX2A 1NCQB 2YUEA 4JCKA 4TYSA 1KFUL 4GH4A 2UY8A 3VZMA 4BYYA 1IGOA 2UWCA 1RUD3 2OVUA 4XOGA 4Y24A 1RHI2 1MVQA 4FOWA 1V6NA 1MACA 1YO8A 4H3WA 4JGZB 1YLLA 1HW5A 2IXHA 4PJYA 2XWJB 3BODA 4K20A 3RWNA 1WW4A 4LA3A 3VBSB 3SCHA 4GWMA 1KDMA 4EWAA 4AQTA 1CX4A 4RS5A 2RS53 3VBUA 3FJSA 3CNAA 2WC2A 4RSUA 3RI8A 2VUAA 2OYZA 1R081 3DUIA 3ZYRA 2JG8B 2RJLA 4N43A 1H4HA 4NWWA 2DCTA 1C8M1 3N7MA 5CU1A 4Y1XA 1AJOA 1ND2B 1BVVA 4D3WA 4HPKA 1IPKA 2XJPA 4Q0UA 3AP4A 1H2NA 1COV3 3PVNA 1PVC1 4Z82A 3IBMA 2BEOA 1D4VB