4AFDA

Structural and biochemical characterization of a novel carbohydrate binding module of endoglucanase cel5a from eubacterium cellulosolvens with a partially bound cellotetraose moeity.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
128
structure length
127
Chain Sequence
GADIVLFSGSKHVEFTDWGGTDWPSAYELQPPYQTMPFDLNKNFEIKVDYSGADIVLIFARWEHGSKPQIWAQSPYYVVDGTAVFTKEQIAKAYGSDDFSDLDYIGVKPLPSADGMTVTKIVASYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE CEL5A
publication title Understanding How Noncatalytic Carbohydrate Binding Modules Can Display Specificity for Xyloglucan.
pubmed doi rcsb
source organism Eubacterium cellulosolvens
molecule tags Hydrolase
total genus 24
structure length 127
sequence length 128
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18259 CBM65_1 Carbohydrate binding module 65 domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1070 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4afdA00
4AEKA 5AFEA 4AFDA 4AEMA 4BA6A 4AFMA 2YPJA
chains in the Genus database with same CATH superfamily
5GZFA 1ZBA2 3WDXA 1BEV3 4HLTA 5LASA 1OBNA 1MVQA 1UXZA 5LEJA 4XHBA 5JI7A 2VGDA 3N9OA 4BQ2A 4JAAA 1VMFA 3VDDC 1J3RA 2FDIA 1W2UA 2DFBA 2NN8A 4G9SB 2PLV1 1PK6C 1OVSA 2TUNA 2R073 4AI9A 1XXNA 5EYYA 1JOJA 1LOGA 3MFAA 4BE3A 3S57A 1DZRA 3RMYA 3TNQA 3IZOA 4ZPIA 3VLBB 1NX9A 2TEPA 5JAXA 1RC6A 4CE8A 1UF2C 1TVGA 2HYKA 3KF5A 4IEYA 5CZKA 2BVBA 4YPJA 3GALA 1F35A 3OF1A 4K7JA 5GLZA 2RS53 3AZZA 3WW4A 3ZN5A 4P02B 1ND2B 3D0SA 3ETPA 1GWMA 3HOBA 4XUNA 4UT5A 1HN0A 4IE4A 2YBSA 3U10A 2ERFA 2VH9A 4WBBA 5F5CA 2WWJA 1HDKA 1I9RA 4W4ZA 4DIQA 2VZ3A 3NJYA 2VZOA 4XJUA 3S5QA 3EQEA 2YU1A 5C5TA 4IW3A 4ASMB 4OUEA 4GKXA 2XUEA 4O9EA 3Q8FA 1VBB3 4XQ4A 3WQ7A 4XDPA 2BZDA 5IYYA 1XNKA 1PO23 3O1SA 4RA0A 5BNPB 4MGIE 1GOHA 3KM5A 2NMNA 5HI0A 3AJZA 1JHJA 5DUVA 3LPGA 4QGNA 1MQTB 1VBD2 2WZPP 4HETA 5GM0A 1YI9A 1SLIA 1I6XA 4JGYB 4EZHA 3BIWE 4PIXA 1LHOA 3THTA 1PMIA 2X5IA 3RYPA 2OQ7A 3H50A 2ARBA 2V5DA 3MPBA 4HSJA 3EO6A 3WHTA 1H6XA 3MO4A 3E5QA 4CZSA 4QWNA 2ZPXA 4KBZA 4N53A 3VD7A 4EN0A 4ZXEA 4Y1ZA 2FZ2A 3CJIB 4Y22A 4BQXA 2RMU1 2XOMA 4AI2A 5LBCA 1AR92 1GLHA 3OTFA 1W04A 4IV3A 4A42A 5JMOA 2PYTA 2WO7A 3DCQA 3JBG2 1PNFA 5EWSA 4CDWA 5ACA3 3MFCA 4MGQA 1R64A 4IE5A 1H1MA 4Y24A 4HFSA 1QQP2 1RUJ3 4G4FA 1EUTA 5J48A 3POIA 4NHKA 3ZMOA 2PQSA 2XHKA 2W39A 4OFGA 1A8DA 1TNRA 1QDCA 2OT7A 3WDTA 1R082 3ZR6A 1PNGA 4UI9L 2SBAA 4LHSA 2VXRA 4CDXB 2ATFA 4D6RA 3OG2A 1W3XA 1GQHA 3AMHA 3OEBA 1OVPA 2J7MA 4HOOA 5EPAA 3VBRC 4YM2A 5GZCA 1JOPA 3WF3A 5FR3A 1EAH3 3B9IA 3MBWA 2C4XA 1I5ZA 1RL3A 4BH9A 2VNRA 4BHPA 2XJVA 3DYOA 4CCJA 1IS4A 2QQUA 5JVVA 1F4AA 4JHZA 4QDSA 1YUDA 3WG3A 1LULA 2VVEA 1YC61 4ASKA 3UKNA 2PHFA 1RUG1 2E7TA 3FMGA 4YFZA 1TE1B 1OLQA 3I8TA 4S2HA 2G9GA 1H6YA 4K8RB 5IWFA 5T5LA 3AVRA 4A7YA 1HXS3 3AP6A 2WNOA 4LHNA 3E6BA 3THCA 4CRQA 3T4VA 2ZZJA 2B45X 2P3KA 3CL1A 2DU0A 1YHFA 2JX9A 4HPKB 1ONAA 3T08A 3VZMA 5C8WA 4AEKA 2VUCA 4AQTA 4BA6A 3KHCA 3UGHA 3ZXKA 5LWBA 4YG3A 3O1UA 5JOWA 2CSGA 2WZEA 3L9JT 4OQ9A 2OQ6A 2VCBA 1ND3B 3ZSJA 5KHIA 3GF6A 3OBRA 3VKFC 1RXGA 2RV9A 4ZU7A 1R091 1PO11 1JTZX 2FCTA 2CU5A 4OHVA 1JYXA 4HSLA 3ELNA 2BW8A 4ITCA 3AVSA 3PMSA 4XBQA 4LO8A 3ZYFA 4GB33 1GFF2 2EIGA 4ATFA 2DURA 2OX0A 1W6MA 4DFSA 5FO8B 4MG2A 2VUDA 1MS8A 4X8NA 4AGVA 1O3TA 2DYCA 1QJX2 2OXBA 3VBUA 1OF4A 1RHI1 4NR1A 1W06A 2PFWA 2BOIA 4W6YA 4Q4W2 3H7JA 2WLQA 1LOBA 3PUQA 1NQDA 2CDPA 3AP7A 5FO7B 4QKNA 3U37A 3HBKA 1WCQA 2QQKA 2P3YA 2ORZA 2DV9A 3VBFA 4ZONA 5DUXA 3BTXA 1H2NA 1ENQA 1QMJA 2X5IC 2YHJA 5A33A 3P1IA 2XLFA 4GWMA 4DUWA 4B1MA 1BEV1 2LM3A 5FPVA 4F3JA 4XF0A 4BQ4A 1DCSA 4EV0A 2WN3A 5DZEA 4Q5OA 1Y4WA 1MEC1 4FO9A 3DPRB 4N53C 3FX3A 1WLTA 2D98A 3KB5A 4NOTA 4BDVB 2JE7A 1V6NA 4NHMA 2GNBA 1AYM2 2Q4SA 4OI2A 5FKBA 3LKJA 4LPLA 4IV3C 2PHXA 2R071 3ILRA 3IAQA 4LLOA 4CDWC 1SLAA 2A7AA 2YUEA 1X8MA 3MPPG 3UV9A 3H0OA 4XZPA 1CQ9A 1PIV3 4M3CB 4XMAA 4Q8LA 5FZ0A 1UZZA 2RS51 4B4PA 2B46X 2PMWB 4TLGA 1IQAA 2CNAA 5JZGB 1JYCA 4XAAA 2VPVA 4PDWB 4RS5B 4UW3A 1Y9GA 4E2QA 1CAXB 3O12A 3CKHA 1KXGA 3OEAA 3DV8A 3RFRA 3AK0A 3O14A 3WW2A 4PQQA 5KXBA 4CCKA 2EXKA 4BOWA 2VW0A 2ZGRA 4PCRA 3KSCA 1J1LA 1SPPB 4Q26A 3V65A 1ZRFA 1SBDA 4AQSA 2F17A 3ATGA 1VBB1 5ISLA 2K9ZA 3LGRA 2ZX1A 2FDFA 1AVBA 3HVDA 2R062 1A6CA 1UXXX 3GXUA 1AX1A 1XBFA 1PO21 3I59B 5FWJA 2GZWA 3ZYJB 1KDKA 1UYYA 2X09A 5FUPA 2HWC3 3DN7A 1MZFA 1N1YA 1URXA 5I0RA 5KC6A 4QHBA 3POEA 1BZWA 1FXZA 4ARYA 4OHYA 5FXXA 4YVWA 1B35A 1WMEA 3WUDA 2VNOA 3N9LA 1RUF3 4R4ZA 1AXYA 1POV3 5JXIA 3N7JA 5FP8A 2V73A 3B93A 5FPAA 1C1LA 3ALQA 1AUYA 2DVDA 3I54A 2JDHA 1LEDA 3IDEA 4CDQA 3VBOB 1VBC1 4PI2A 1VAVA 4FFIA 5A7PA 4CP9B 1YRZA 1CJDA 1H30A 1Y7BA 4PF5A 3LFMA 3WNXA 2ZKLA 5C3OA 1C8NA 4E8DA 2WSUA 2IXJA 3S7EA 1XOYA 2VD7A 3JQXA 4QQHA 5FZKA 3RZHA 2YXSA 4XTMA 2AENA 4IEZA 2UURA 5ACA1 5A7OA 3MW4A 1H2MA 4MGSA 5C4WA 1RUJ1 3VBUC 5AFBA 3ZKYA 2OW4A 5LA1A 3VHOA 1AYN3 1QJU3 1G8WA 1S2EA 1SQ4A 2MPFA 1HV0A 4LKSA 5IAVA 4UW4A 1QY4A 2P6CA 2XR4A 2XKPA 4XQWA 3SITA 2H0VA 4ZS3A 3VBFC 4CCLA 3CJXA 4WM7B 2FDHA 2EVXA 2MEV2 2YC0A 4NJ4A 4UFLA 5APAA 4AEJA 1GQGA 2WO1A 1EAH1 5A7SA 3OYWB 5FZOA 4UW6A 4WM8A 4OLLA 2ZX4A 2XJTA 3H8OA 2DUQA 2IXIA 4COUA 1GZWB 1QNYA 1PM7A 4F7ZA 4RR3A 2ZACA 2VTFA 5JDBA 2W2IA 4NHXA 1NA1A 4R8HA 4QQPA 3WOGA 1WCSA 3NKTA 4LBJA 5FJKA 5FZFA 3ZXGA 1RYYA 1HXS1 1IQDC 1CZVA 4FPHA 2E33A 3AYEA 4YLZA 5DAQA 4YZ1A 3VUOA 5FYMA 2FDJA 1D4M2 2VO5A 1J83A 4I02A 4GJYA 5FYCA 4FPLA 3N9NA 4R4XA 4OMDA 5FXVA 1CPNA 5KXDA 3OSDA 3LA2A 5FQ0A 3E6CC 2YBKA 3SXWA 4XIOA 1W8HA 4XJAA 4Q0UA 3MUY1 2RVAA 2Y6HA 4NRMA 1X9PA 3UK9A 5F37A 1OSGA 3MF9A 4HMZA 3CZJA 2OYZA 2A6ZA 3ON7A 4YGDA 4JKKA 4BIOA 4FFHA 4GB31 1UKRA 1REFA 3GZAA 4FPGA 3GGLA 1ULOA 3SH5A 5FK8A 3MV11 1PZ9A 3RQ0A 3FC0A 3W59A 4H7MA 5F32A 3WDVA 2HWB2 2PAKA 3BKZA 4A4AA 2JG8A 3OD0A 4C1XA 4H7LA 2FMYA 1B35C 4N9HA 4YVWC 1F5JA 1JYTA 3VKOA 4E2SA 4CEYB 2WLPA 4K6BA 5CIRA 5FUIA 1I5PA 5B4XA 3WQ0A 2YPDA 3R4DB 2QQVA 5H9RA 2OKXA 2Y60A 1K3IA 4JTNA 1SCRA 2WFPA 4Q0SA 2J1RA 5BNNA 5IVVA 2EXHA 2XDVA 3MW2A 5FWEA 4BQYA 5LK7B 1Q5OA 1ULDA 3D82A 4PBOA 5D2AA 5HPOA 3OBTA 1SEFA 2BNOA 1O8PA 5TSWA 4NRQA 1UN1A 2VBBA 1COV3 5A80A 4V2VA 1DBNA 2Z2SB 3B94A 4XILA 3GZTB 1UZWA 4IEWA 1LHVA 1GOFA 2VC9A 1PIV1 3LZZA 2NQYA 3RZLA 4KGQA 3N9PA 4LO7A 4HVOA 1GNZA 5FZ7A 5HXVA 5CFDA 3ZN4A 1RUD2 3H8RA 2D6MA 2A73B 5HV0A 1V9U2 2J22A 4UBHA 1RUH2 1WW4A 3A4UA 3INAA 1E5RA 3DKWA 3IIAA 4HKWA 5FZ1A 4CEWA 4MUVA 3MLKA 4Y20B 4QAWA 3AJYA 1HRI2 3GZEA 5FJHA 3GZUC 3IT8A 3JUUA 1KS5A 1C1FA 4WM8C 3PL0A 3POBA 2BWCA 2WN2A 5FZAA 4AG4A 1LTEA 5DUWA 2HWE3 1ASJ2 3JD72 2A6VA 2BEOA 1QF3A 5ABJB 1LOEA 4RGAA 1VP6A 4XETA 1J3QA 1RUC3 5T52A 4RHV2 1NT0A 1NA1C 1ZZ8A 2CTVA 5T5PA 5K9YA 2E63A 1IS3A 2HWC1 3AL6A 3SH3A 3KCYA 3BB6A 4DOUA 3OBAA 3KVAA 2GDFA 3O1RA 3FFQA 3K4AA 2XMLA 1DLCA 3C8XA 3KWVA 4UWDA 1QDOA 1RUF1 3K46A 5LB6A 1DG6A 1POV1 2VXJA 2ZGSA 3WQBA 4A7ZA 1KJRA 4YSFA 4KU8A 1WMXA 1ZM1A 2D5HA 2VOXA 1C3HA 3T0BA 3WNNA 4YM1A 1S0CA 3MDPA 4YGBA 5A1FA 2BTVC 2ZMLA 4D7SA 4UYBA 2OZ6A 4FPJA 3I97A 4EN6B 3TOJA 1W28A 1NZIA 2BJSA 2UWAA 3SEPA 4W6XA 3VDCA 1JYVA 1JI6A 3WY6A 1DHKB 4LUMA 4MOAA 5FTTC 5IW0A 4CDUA 2WL1A 4LKEA 2VE1A 4KGGA 2IVJA 2JG8C 5KC5A 1LNSA 5EHDA 3W5NA 1AYN1 4LOSA 5FY9A 3K51A 4L92A 1X8EA 4XHXA 1CAVA 3AZYA 3GDBA 1Z7S3 2LALA 1V0AA 4QKFA 5HCHA 3LOIA 3QH7A 2E6VA 5CNAA 2A6WA 1AR73 4QQOA 5BNNC 1I3HA 1G9BA 4OQ8A 2G1MA 2ZMNA 4FPEA 1W6NB 1V6LA 3UGGA 2FCUA 2ZX3A 5FY7A 4NVPA 3RVHA 3RWKX 2D44A 5KWRA 3I3BA 2DVFA 3LEIA 1QXPA 2GALA 3VZNA 5I8TA 4JQRA 5T55A 2C9KA 1R1ZA 2TNFA 2DCJA 4XW3A 4N7UA 2PN5A 4QX2A 4WVVA 4XXPA 3VHNA 4BCUA 3ASIA 4O9GA 4OI0A 2CGNA 2C9AA 2ZEWA 1W8TA 3ENRA 2WS93 1UWWA 2Y0OA 3K3NA 4XURA 5CBLA 3J4UH 5CFDC 1GMMA 3ACIA 3ILFA 1SFPA 2IXKA 1UL9A 1Y3TA 2WFF3 1W0OA 2WO2A 2ZAHA 3C2UA 3CBNA 3WCSA 1H8TA 4CEWC 5C6CA 3V0BB 1FPN3 5IVFA 1XE8A 1YYNA 2VNGA 1TG7A 3BUCA 2GC1A 3WF1A 1IPSA 1GZTA 4KQ7A 1GR3A 4LBLA 1LODA 4NROA 1J84A 3PHMA 4CUCA 4FCAA 3AZWA 1TMF2 3ZYGA 3ZXLA 2VG9A 4Q4V3 3OD4A 2XJRA 1ULFA 1GKBA 4QT6A 1D2SA 4QB2A 1GSLA 3AKTA 1KS4A 3DYPA 1FMD2 4IUGA 2ZOEB 5JUVA 1F8VA 2DBIA 5IFTA 2PAEA 3SQOA 1ZREA 1ZA7A 4KI5M 1ALYA 1K45A 1OFSA 1W8WA 3N7MA 1PZ8A 4WV8A 5C9AB 4KBBA 1FT9A 1G6NA 5FP4A 4DRVA 1OURA 3MIDA 3IM0A 2Q1MA 2JECA 4LTAA 1CIWA 3POFA 3KT4A 4LOTA 4RSUA 5I0UA 4XFHA 3FN9A 2P5BA 5GKAC 5BNPA 1PVC3 3C3VA 4DUVA 1XYNA 1YIFA 1RUE3 1DYOA 4FFGA 4FBFA 1PMJX 1NCRB 1OOPA 4ZU5A 2XHNA 4BQWA 5GLWA 3LEGA 1PHMA 3CLPA 4AXOA 5JXGA 1W0PA 3H7YA 4MSVA 5IFPA 1COV1 3BU7A 3HNBM 1IOAA 2WKKA 4C90A 2F4LA 3UKTA 2YC4A 4YYOA 3ZR5A 3AP4A 1RJ8A 3VBSA 1OLME 4CDUC 3A7QA 4XC9A 3VKLA 2BYVE 4A3ZA 2Q1FA 1EYBA 3CJIA 5F8PA 1DIWA 4NO4A 4YW2A 3ZSLA 1X33A 4QKDA 3LAGA 1H2KA 4YZ5A 1N1VA 3OGSA 3T1LA 4P9YA 1NE6A 1HRV3 1RVF1 1GZ9A 3CEWA 3GHNA 3PUSA 2YROA 4RFT0 1IKPA 3ACGA 3FHQA 5A7WA 3I3MA 5JXHA 2Y64A 4IEVA 1NCQB 3JQWA 2JE8A 5FOBB 1BBT3 2BGPA 2HWE1 2R0HA 4DNYA 1HB1A 2ZGLA 1VRBA 2HWF2 3Q9OA 3AFKA 3M4FA 2R043 2K0GA 5DAPA 2X05A 1RUC1 1U5YA 3OOXA 4R9BA 1W3VA 3I2GA 3NNJA 4Q1PA 3K77A 3GBFA 5GALA 1IHMA 5FMOS 3RZMA 1ULGA 1NY71 3RRDA 1IGOA 2UYAA 2YMZA 5L7OA 4I2OA 3WHUA 5DZFA 1EUUA 4OYUA 5FY0A 2ZGQA 2RM23 3O7OA 2DDUA 4YFWA 4C1WA 3VDBA 2RS13 1I1EA 2GN7A 3JB4C 1ZBE3 3HQXA 4LUKA 5F39A 5LRRA 4GWJA 4OMCA 1H8TC 1Y9QA 4M3CE 2HBUA 3HBZA 5FOJB 2C1FA 1WUVA 3BYWA 3RGBA 4HPKA 4Z07A 3KZ4C 4JZRA 1AR83 3HR9A 2JDKA 2O14A 1J59A 3LSDA 1WD4A 1W2OA 1D7PM 4NAOA 2G9FA 5K0UB 4EJRA 5FO9B 5A6YA 1MZ6A 3OPTA 5FIXA 3R05A 3OGRA 1EV12 5GZGA 4AVCA 1W9TA 2VZTA 5L9BA 1RHI2 2ET1A 3S5AA 3PURA 3ZYHA 2VL4A 1UYXA 3AKPA 4GH4B 2JD9A 4ZKTB 1Z7S1 5C3SA 2DVBA 1YQ6A 2NPIA 1ULCA 2DVGA 2CHHA 1VBE3 4J1XA 5BNPC 3LIGA 4ES8A 2YZ4A 3ZYIB 1AR71 4XVHA 4LO4B 5T5JA 5F3EA 4FTBA 1Q43A 4K3UA 4AEMA 1YQ8A 2DCTA 2JDAA 2W3JA 3KV5A 4NHLA 1UIKA 3WNPA 3ZOIA 4HZFA 4NWVA 1OOPC 2IVIB 1U5ZA 4P08A 1GUIA 2IXHA 2XJPA 1MEC2 5EQUA 4MYEA 4CXXA 1SDWA 1H1IA 2P37A 4ZU4A 1E5HA 4Q4Y3 2A5ZA 5JR7B 3ZFGB 5L19A 3VBHB 2NMOA 3MF6A 3MLLA 3VBSC 3J8F3 4LBMA 1O5UA 4AVVA 4QDRA 4XXAA 3W21A 3O0VA 4MHUA 3CJIC 1JS9A 1W90A 3G6JB 5KHKA 4LHLA 1UAIA 2OIIA 3NAPA 2WFF1 5CFCA 1W8ZA 4QQLA 2RR13 3C7EA 5FZ4A 1Y43B 5LA9A 3V0AB 1FPN1 3Q8EA 1QWRA 1BK1A 1OLRA 4M3CA 3AYDA 2FDGA 2IUWA 1U12A 1IZ3A 3WDUA 4BWOA 4JGZA 3HPNA 3IDAA 4CPBD 1S0JA 1LKNA 2P17A 1TME3 1LHUA 4Q4V1 4V1PA 5JZGA 1TQ5A 1AZDA 4LBQD 2NZ9A 2DF7A 1CAXA 5A3NA 1W0NA 3URFA 1K5MA 1W6QB 4INDA 4K20A 1ZBA3 2QJVA 3DXTA 5KXCA 1SPPA 4HK8A 2QQMA 3MICA 4M00A 4P9LA 3RZKA 1PX3A 1QJY3 4GJZA 1HJFA 1YIPA 3I7DA 4LBKA 3S6PA 4AHXA 3I4IA 4K21A 4HVQA 3LA3A 3R6SA 3WP5A 3IAPA 3I59A 5IVJA 2W0XA 1KQRA 5FZ6A 1PVC1 1ZX5A 2Y8KA 5L73A 2VUJA 2W1WA 4N43B 4TN7A 3THPA 3VZKA 1J3PA 4IE6A 4B4RA 1RUE1 3OY8B 2UU8A 1FOD1 2DVAA 3A0NA 1BVVA 4P5HA 4RD7A 5JOZA 2WZR1 4EN9B 2P6HA 1VBC2 3U4SA 3LPFA 2NM1A 1YWKA 3MIEA 3FBMA 4SBVA 3ZO0B 5JIUA 4MZUA 3I2DA 5F5IA 1ZRIA 2A70A 4JC1A 1OI6A 1X82A 2Q30A 3CU7A 1OC1A 2ZGTA 2D6NA 1DQ4A 5GZEA 3W20A 3KV9A 4A6OA 2W92A 1MS0A 4S2FA 1APNA 2PHLA 1NE4A 2VECA 2JWPA 2BV4A 4AVBA 2JKXA 5F3GA 3SH4A 3PUAA 1LU2A 2BNNA 5F3CA 5C8CA 1YLLA 1IS6A 2CL2A 5FZIA 4QDQA 4ZXKA 4AEDC 1O5LA 2R32A 3PUIA 1HRV1 4LA2A 1QH7A 3FUOA 1GZCA 3ZDVA 2X10A 4EN7B 5FPXA 2W91A 1JODA 1R1A2 1WW5A 3AL5A 3J7LA 4RN5A 1VBD3 3ACFA 1BBT1 1XU1A 1YQ2A 2XH6A 3D3AA 2J1TA 1AF9A 1PGL2 2LW8A 2R041 3VDDB 1G7YA 2FD8A 4WM7A 2BBVA 1XNAA 2RS32 2RHPA 1DQ1A 4MGYE 5J7MA 4N8MA 4FAHA 5IK4A 4BK4A 4Y33A 4BIFA 4XCAA 4NHYA 5B4NA 1LOAA 4XFBA 2PELA 1Q3EA 5BXXA 3SCFA 4P14A 1HXS2 3P3PA 5A3UA 4XUQA 2RM21 5FLJA 3LCPA 5M0TA 1VBA2 4LE3A 5GLVA 4MXWA 2R16A 1UOFA 2Y6LA 4AI1A 3NAPC 1ZBE1 5BNOB 2MHFA 5A1LA 5CFCC 2WABA 3JBG3 1AXKA 4LK7A 5IJRA 2C24A 2X29A 4Y5TA 1QQP3 3VD5A 1CIYA 3D5OA 2XQXA 4KL1A 3ZFEB 4FPOB 3AKRA 2JDZA 4JGZC 1JW6A 5BNQA 1AR81 4NIIA 1R083 1H1AA 5JZGC 2SLIA 4E27A 3RJ2X 3MYXA 2JDUA 3MGUA 3FFZA 3APBA 4UF0B 4L8QA 1K5MC 5E89A 3BOWA 1C5IA 4PJYA 1QOSA 2DCZA 3GBGA 3M3OA 5FZBA 4NAMA 4AW7A 1QGLA 4I0AA 3VZJA 4D94A 1RGSA 2P3IA 2I74A 4HKOA 2BFUL 1FX5A 4LHKA 5FZ8A 4IEXA 5DDJ3 2GC2A 3UESA 3UKVA 3NJVA 1VBE1 4IGPA 4P9WA 1ODNA 2ZEXA 4BXSV 4YGEA 1DZTA 1OT5A 4LK6A 2ZTNA 2PHDA 4YGCA 3VZOA 3ZYBA 4AAPA 1WW6A 1DGRN 4QPIA 2RDNA 3PNAA 4Y1XA 4E9KA 1IG3A 5J09A 1JZ5A 4G3YC 4CEYA 1DGRA 2A3WA 2HYXA 4Q4Y1 3RI8A 1UMZA 3MIHA 1LHNA 2HWD3 3CHXA 3R0RA 3W58A 2UY8A 4R9CA 2A6XA 1W6PB 1UY0A 4Y1UA 4OCTA 4NIGA 3J8F1 1N3QA 1GU3A 4ONUA 5FLHA 2J1UA 2BOJA 1NXD1 5D21A 1NLQA 1RUI2 3T0AA 3DEMA 1RJ7A 3NKGA 4EWAA 1HB2A 5C8CC 2JKBA 2VU9A 4ARXA 2RJ2A 3LDKA 4K8FA 1XRUA 5C71A 4FAGA 1OF3A 4MVTA 1OPMA 4AE2A 1VAMA 3J7MA 4IEOA 2RR11 2WA3A 2ZHLA 4OUMA 2BP6A 3WUCA 1QJX3 2W95A 1ZA4A 1EPZA 2AEYA 2WJSA 4HKLA 2ARXA 3VBRB 4YZ2A 5LCWL 2ZHNA 3M2MA 4P9XA 2WA4A 4Q4W3 2ZMKA 5JPNB 4KG0A 3TN92 1IPJA 4AGRA 4GMP0 1TME1 4P9GA 3TEZA 1W8OA 1VE0A 5F5QA 3JU9A 2YC2A 3POJA 3ZVXA 3P6BA 4WVMA 4QX5A 5JR2A 2EAAA 1HKDA 1ZBA1 1VMJA 2JENA 3PIGA 1UOGA 1AR62 4JDOA 3OPZA 3BTZA 4PT6A 1QJY1 1FATA 3KD4A 2Q8CA 2XWJB 4D8MA 4MGKE 5ABJA 2KM2A 3X29B 1AYM3 5AC93 1CAUB 1RUF2 1F31A 4GZ9A 4Z2WA 5H9SA 1IPKA 3MZHA 2D7FA 4HONA 4DINB 1UZVA 4KMQA 1UOBA 1K42A 2OZJA 1AX0A 1CAWA 2ADEA 4XTPA 2VOVA 1UU4A 1TZOA 1NLSA 1S0GA 1X7NA 3H3UA 3T4HB 1HQWA 3AMPA 3M3CA 4HL0A 2ENRA 2WQZC 4RFRB 1BK0A 2JDNA 2GH8A 3K3OA 1HV1A 4CCCA 3DUIA 1XNBA 4QHZA 2OS2A 1A3KA 3POYA 4PI0A 3PLQA 2Y33A 1S0IA 2O0OA 5ERLA 2MNGA 5LA2A 1DYKA 1RMU2 2QNKA 1DQ6A 1UU5A 2WNVB 4RYDA 1V6OA 3BOPA 3BVCA 4D7TA 1YNAA 5JXJA 5F6KA 2YDEA 1RIRA 2E7AA 2VVDA 4J1WA 2R063 5KBFA 1GBGA 2OUJA 2YY1A 3KT1A 1FAYA 2BGCA 3N9MA 5FXWA 2E7QA 2CGOA 2X5IB 1DP0A 3KMHA 3JCIA 1JYIA 4QPIC 1VBD1 5AFEA 4FTSA 1Q56A 3H42B 1NAEA 1T6GC 2D43A 4UFMA 3KT7A 2CWSA 3U1XA 3S0MA 4CEYC 1WWYA 5BUVA 1DU3D 3PTYA 4AI8A 4N53B 5F2SA 3VD9A 3WNOA 4Y22B 1LR5A 5H9QA 1H4HA 3EB7A 4BM8A 2D6PA 4IV3B 5I8SA 3ZPOA 1CESA 4NIAA 4XF3A 1BMV2 2Y26A 4H3WA 2IZWA 4QB1A 1NOVA 1RB8G 4Q2FA 5T54A 5JWPA 2WQ8A 2W5FA 2JIJA 1SBFA 2GH2A 3MI8A 1H2LA 2ES3A 1XNDA 2W87A 1AL0G 1DF0A 3IN9A 4Q4X2 5DXDA 5C3PA 2FDKA 1QQP1 1RITA 2QDNA 1C8M2 3QH6A 4R52A 2Q8EA 4FPCA 3N4MA 3IKWA 5DAXA 1ULPA 4Q0PA 1EPWA 1W8UA 1R081 4CYDA 4I0WB 2Q0AA 2ZGPA 3POWA 1QXJA 4TLFA 5I0SA 3E5XA 5DN2A 4QPWA 3U14A 4CUBA 4XYXA 2MEV3 5L9VA 3V0BA 4ZHNA 5EIYB 1CD3G 1OKOA 3N7LA 4FXGB 4QPGA 1Z0HA 3N36A 3SMHA 2G4IA 3LDBA 4K40A 4IV1B 1OKQA 1A34A 2ID4A 5ABJC 3KGLA 1JZ6A 3U75A 5DDJ1 4N7IA 4E2GA 5DUUA 3AZXA 2Q8DA 4EROA 1LB2A 3H9AA 1UY4A 1QOOA 1XPWA 3V64A 1AHSA 4AR2A 3RZZA 1QKQA 3WZ1A 4AFAA 1DGWX 1JUIA 5C9AA 3QD6A 4XFAA 2ZZQA 3ILNA 3ZFFB 2VZRA 1FV3A 4R9DA 1D2QA 1QJFA 1VRH2 2XBO2 3I2HA 2WT0A 5DG2A 1MZ5A 4BYYA 5A3PA 2VCMA 3PJYA 5K8SA 4KWLA 2EIBA 2HWD1 2VCCA 2WNUB 5FYHA 2JDYA 2ZX2A 1KD7A 4CDQC 4DQAA 4I01A 1J1TA 1Q8OA 4XUOA 3D0JA 1NCRA 2VMCA 4D6QA 1YCIA 3USUA 5EJZB 3ZXFA 3ACHA 3VBUB 1SCSA 3SHRA 1M4WA 2AYHA 2UY9A 4JRLA 5FP7A 2WDBA 3RZJA 1HIXA 3SCGA 3ZM8A 3ACLA 1DFQA 2XPJA 3WCRA 4Y4YA 5C4WC 5JSOA 3N7KA 1QJX1 1MR5A 1H8VA 1RVF2 5DAVA 1PGSA 3VBFB 4E8CA 1FNZA 1W6OB 4GKYA 3SEEA 4AWDA 3IB3A 4Q4W1 1SFNA 1S0FA 3A22A 3HAGA 2VAUA 3IPVA 1UOJA 5CKNA 2Q5TA 1WGPA 1AL23 4AQ6A 1US3A 2VTXJ 2WNEA 5LW9A 2JD4A 3KQRA 3O0WA 1UPSA 2DCKA 4C91A 2AUYA 4AZZA 4E4HA 2WYSA 4QX3A 4M3CF 3NV2A 5EFUA 3RPQA 1LRHA 4DY3A 2G19A 2XXZA 2EIEA 3C7FA 2BERA 1UZYA 4IXLA 1STMA 4NWWA 4LO5B 2P1BA 1JZ2A 1S2BA 4RR3C 1AYM1 4S2DA 5AC91 1WA4A 4ATEA 5A6QA 1T2XA 2A6YA 2Y6GA 5KHGA 4JTOA 2AREA 2HBTA 2ILMA 4MV2A 4JKLA 3WD5A 1ZRDA 4XBLA 4NMIA 4IETA 4YW7A 4FSJA 1RUD3 3CZUA 4K1YA 4JRAA 4YZ3A 2CY6A 4BK5A 3M8LA 3E1F1 4NPRA 1V9U3 5I91A 2WQ4A 4ZS2A 4DEVA 1HQLA 2A3XA 5EV7A 3ZYRA 1WKYA 5FYYA 1HRI3 3EJKA 3NMBA 2O1QA 3QACA 1LGBA 4QPGC 1G9FA 1VR3A 4QXHA 5BPXA 1S0BA 1Q8QA 3K4ZA 3OUJA 3ZXJA 4PIZA 1ASJ3 1OHFA 5KR7A 2H6CA 4YVWB 1B35B 3AYCA 3WF4A 4Y5SA 2R061 3FLRA 1JHNA 3T0DA 2YB7A 3NV1A 4N90A 3HT1A 5GJ6A 1WBFA 1Q8VA 2RDSA 2HH9A 2V09A 1Q8PA 4JDMA 5C9AC 3WR0A 2YGMA 1AR72 4XFIA 4AL9A 1QJU1 3T2QA 5F9TA 1WD3A 3NJZA 3T3YA 1OH4A 4PLNA 3MIFA 1PGW2 4XAEA 4QXBA 4E4ZA 4FP3A 3VKNA 4BISA 3MW3A 2Y38A 4UFKA 2JG9A 1XQNA 5FYBA 3WINE 3DF0A 2N7GA 5DG1A 1D0HA 3HWJA 5B2GB 4Q1RA 4CTEA 4GWIA 1SBEA 1RUNA 1BLZA 1NCRC 4M4PA 4QM9A 3HJRA 5F5AA 3MV01 1GWLA 4P00B 4ORFA 4Y1VA 4D6SA 2HEWF 2ZHKA 1MS9A 3P3NA 2BU9A 2V4AA 3J7NA 3QCWA 3RYRA 2PLV2 3ZN6B 2ZGKA 1MPXA 3ZXDA 5F1RA 2QBXA 2FQPA 3HQRA 2WFF2 3AP9A 4TSVA 1LOFA 3NVCA 1GP4A 1XE7A 3AM2A 2VOKA 1DQ0A 1YJKA 3NNMA 3NRUA 4L9BA 5FZOB 1POQA 3AFGA 4Y1YA 4AGGA 2GP5A 4YZ4A 1XNTA 1SDDB 2IXCA 1OQ1A 3OB8A 3J9SA 2MEV1 4MLOA 1NKGA 5FDBA 5CA6A 3V0AA 2UWCA 3ZLIA 4ZZ5A 5FK7A 1NA1B 3AKQA 1ND2A 3GHMA 2BGOA 2W1SA 4X6QB 2JXAA 3FHAA 4LKDA 4LR4A 3OUHA 5F2WA 1OA3A 4Q27A 2WWSA 1VALA 1V6MA 2WAAA 4QX1A 2W94A 3L2HA 3ZMNA 1GV9A 1UMHA 2XKOA 2V5YA 4CSWA 3NL1A 4AVTA 3SCHA 1G9DA 4MGTA 1PVC2 3TEYA 5FQ0B 4LMFA 3UT0A 3FLPA 1U5IA 1FI2A 1LESA 3LF7A 1RUE2 3VD3A 1FOD2 3DXUA 4QX7A 3NNGA 2WZR2 4FXKB 4KNCA 2ZX0A 4XJWA 5LATA 2H0BA 1XE0A 5E16A 5FRAA 1TNFA 3OGJA 4XQDA 4N43A 1MQTA 1ZRRA 1QH6A 3H1WA 1S2KA 4BB3A 1WCDJ 2QZ2A 4XZUG 4JGYA 3IMNA 2AGSA 1TMF3 5T3NA 3W5MA 4LORA 2JG8B 3CQOA 1MACA 2RMU2 4QX0A 2AEZA 1FMD3 4HT1T 4WVWA 5LY1A 1ZZ6A 2XLAA 3HN1A 3NJXA 4XDOA 1HRV2 2YBPA 3M3EA 4XFGA 4IE0A 4IEQA 4RL7A 4Z1VA 5E88A 1RTVA 2AR6A 1J58A 4Z82A 1GICA 2E53A 2G9ZA 3EYPA 3B69A 3Q8AA 4Q8KA 1AL21 5A3MA 1JZ8A 4YVSB 1DLLA 2JG9C 1KEXA 2R042 4LBQB 3Q8BA 1UY1A 5FYZA 4XF1A 5HCAA 3SC7X 5H9PA 1UO9A 2HEVF 3MEPA 4QXKA 3T2TA 4CDXA 4V2WA 1UYPA 1Z78A 2D6LX 4LULA 5FBJA 5A6XA 2XONA 4YG6A 1XNCA 5L7OC 1WCUA 3ES4A 3MIBA 4EE2A 1RUG2 3PVEA 1G9CA 5FLIA 4EWDA 4A6SA 2BNMA 1F5FA 3AMQA 5C3QA 1YJLA 5FKCA 2HEYF 5JCTA 5FUNA 4CP1A 1QJEA 1LOFC 1VMHA 3VHRA 3A0KA 2XJSA 1PVXA 3VD4A 1DQ2A 4XJZA 1F4HA 2CGPA 5JSRA 2D5FA 3U78A 3KLSA 1RUD1 2D3RA 3WVJA 2WC2A 5FZCA 2D40A 1NG0A 1WCKA 4QMAA 4AI0A 1V9U1 2FCVA 5A70A 4AFDA 2HJIA 5BNOA 2J42A 1N1SA 1SLBA 3EXUA 5DZGA 5LK5A 4BZ4A 3BIEA 1HRI1 1YO8A 1LHWA 1V6KA 4L97A 5G05L 3ZFEA 1X36A 1ND2C 2VZ1A 1R092 1PO12 1ASJ1 1ZZ9A 1QJZA 1CZSA 1PX4A 2D3PA 2IFWA 4BMEA 4FTEA 2HWF3 2FMDA 2PHUA 3EBRA 3WSOA 3B3QE 4B7EA 4LA3A 4UF0A 4IL7A 1ENSA 1ND3A 5DPNA 1S1AA 4GD4A 5KXEA 3PTRB 2JEMA 1VBE2 4BPZA 3NQHA 3SNMA 5FY1A 3PUHA 3WNLA 5IUQA 2QQIA 2I07B 2WT2A 3PMEA 3RMXA 2K46A 2E26A 1U0AA 4B3NA 2PAMA 4BU2A 1FV2A 2BWAA 3B00A 3T09A 2Q1ZB 4QM8A 3G7DA 4HN0A 4N43C 3MIGA 1MQTC 2ZEYA 1QOTA 1BEV2 2QE3A 3TWIA 2J1AA 2CWMA 5EP9A 1CN1A 1HB4A 2GC3A 5FP3A 3J8F2 4JGYC 4K1ZA 1QXRA 5J98B 1D4VB 4RQPB 2VM9A 4CP2A 5D8AB 4E4DX 3D6EA 1XC6A 5CVRA 5FPLA 3VN4A 1WBLA 5A3WA 3JXSA 1O59A 2ZGUA 3KGZA 4FPFA 5FYTA 2KXLA 2R072 1U5XA 3F2ZA 5BV6A 2VMEA 4B4QA 1CR7A 1W6PA 2CDOA 3RG0A 5LBFA 4XOGA 3FHIB 2WS91 3DPRA 4XF4A 2VQ0A 1EV13 2B9UA 3OCPA 2RS52 1BHGA 1CPMA 1PM4A 2H6BA 2YFZA 1WMDA 3ZYPA 4HXCA 4FI9A 3WQ1A 5IHRA 2W47A 3NNFA 4I0BA 2XUMA 2ARCA 3GCWA 1KFXL 1WLWA 1GQPA 4RGGA 2GNDA 4AVAA 4YW1A 4PIYA 3FLTA 1JYWA 1HN1A 2HLEA 1LECA 2CAVA 4PDWA 4RS5A 5FMBA 4CDXC 1QJY2 1VBB2 1MEC3 1WZXA 2KR2A 5KHHA 3QBQA 4YARA 2F6BA 2A71A 1W2TA 4N9IA 4UOJA 4A44A 1LCLA 1CX1A 5A3OA 2EF6A 1PO22 4XFFA 3RS6A 2DTYA 4AYUA 2D97A 3ITQA 1H8TB 5FXZA 1W2AX 1UYZA 2W46A 4FT8A 4FQ4A 4O65A 3TB0A 2ADDA 1L7RA 4D3WA 4DS0A 1CAUA 1UIJA 5A32B 3IWZA 5BNOC 4LIUA 2C5DA 2VZPA 5A7NA 1YFWA 4U36A 4A3XA 4BLJA 4PLOA 4Q0QA 3U07A 2E51A 3HD8B 1XJAA 1AXZA 1US2A 1DQ5A 1CGPA 4QGMA 3F95A 2P34A 2YFUA 1YXWA 3ZFEC 3GJBA 2J1SA 4JKMA 1AJOA 2VQTA 2ZGNA 3BODA 1TMF1 2ZHMA 1C5HA 3LB9A 4YG0A 2D6OX 4KWUA 4XPVA 3GNEA 3VGIA 1S55A 2DFCA 4OVEA 4CXWA 1FMD1 3B02A 3RDIA 3AXEA 3RSJA 4OULA 2UWBA 5ACA2 1ND3C 2WYFA 2Q8OA 3VBOA 4CP9A 4FOYA 5CG9A 3V56A 1REDA 3VHPA 1G9AA 4JVAA 1O3RA 2P4EA 1RUJ2 2GNTA 2WNVA 4DZGA 5I8YA 4B7KA 1S0EA 4IGQA 2ARAA 3RJRA 1OOPB 3B5LB 3QLQA 3THDA 1UCXA 2VOWA 4RGKA 3WG2A 1UX6A 1F15A 1WA6X 2QVSB 3Q8CA 4FOWA 3BU0A 3KHBA 4LIVA 5HCFA 4Q0VA 5I0DA 2A75A 5A3TA 4AHZA 1EAH2 3R4SA 5C3RA 4X6RB 2A3YA 5EJ3A 2WSVA 3VBSB 2RDRA 4Y26A 1VBC3 3H1MA 5FZ3A 1N1TA 4COVA 2VVFA 1N3OA 2WT1A 4CUAA 3I49A 1K12A 3SISA 3NW4A 4NIDA 4XF9A 1O8SA 3TYJA 1PK6B 3OYWA 2Z79A 3BGAA 2QDRA 4H55A 4URTA 4WZFA 4Y4RA 1JYNA 1F9KA 5IK8A 2XB6C 3DPRC 1ST8A 1UQXA 2P3JA 3CO2A 3E97A 4MH0E 5A7WB 3BI3A 1GZWA 1AR93 1TEIA 2RS11 4NPLA 3GCXA 3UJOA 2B5HA 4COYA 3FE5A 1HB3A 1ZZ7A 1UMIA 2QQWA 5LA0A 2Y34A 1RUOA 4JHTA 2X53S 5FFOC 2R6QA 2DTWA 5CU1A 4NIHA 1JN2P 3I2KA 1QNWA 4XDQA 4Z2AA 3AC0A 2UYBA 3ABZA 2XJUA 5C7GA 3AKSA 3RYKA 1R1A3 2OVUA 3K2OA 1ENXA 3P5BA 2B39A 3NSTA 1OPOA 2W52A 3OBZA 3CDZB 4OI4A 4PQ9A 4CU7A 4PDWC 4RS5C 4BQ3A 2E31A 4SLIA 1VB2A 2HWF1 2VBPA 2AH2A 2ZCWA 2ZEZA 4AAXA 4AOCA 3LEMA 4GB32 4KWKA 1C28A 1UNBA 2RS33 5DDJ2 1JH5A 4YW5A 3VL9A 2R0FA 4MO3M 1SACA 1BXHA 1UZ0A 2R1BA 3H3LA 1UY3A 2WINB 3ZIXA 4AVSA 4LBNA 4BQ5A 4IV1A 4LITA 2BRTA 1ULEA 5FYIA 2EXIA 3NV4A 5IVBA 1GYKA 3LOBA 1POV0 5C5UA 1VBA3 2YYOA 2FBEA 5CG8A 1LU1A 2Z5WA 4L11A 4ZY9A 1A78A 2PHRA 2PXJA 5A7QA 3SKVA 4OHZA 2GN3A 4CVUA 1VIWB 2HWD2 4GA9A 1O4ZA 2B9VA 4IE7A 4ISQA 3ZFFA 3I3DA 4DB5A 2L9LA 1JU3A 4O7XA 1UD1A 2VZUA 2XG3A 4DEQA 3ZPYA 2IFRA 4YRDA 1UY2A 2WNUA 3RNSA 3FUQA 5IVEA 3KCCA 4XEZA 3VBOC 4AEDB 5GZDA 5HXMA 1W2NA 1PIV2 1IS5A 2WNVC 1EV11 4MGZE 2VMIA 4H14A 1CONA 3HT2A 1SZBA 1W8NA 4UAPA 3SLIA 3LEKA 4CP0A 5L9RA 1WLCA 1JBCA 2FZ1A 4LJHA 2GP3A 2QQLA 4XABA 4LEJA 5FY5A 3WG1A 1CJPA 1O3SA 1QIQA 2VZQA 1HLCA 2ZBJA 1W6OA 2VY0A 4UW5A 2F4PA 5FP9A 3UETA 5T50A 5A6ZA 3FJSA 1WMFA 4PHZA 4EZ4A 4ASLA 2R7EB 2PQQA 4KWJA 1KFUL 4D0QA 1UW8A 3GJAA 4QXCA 4WM7C 4YW4A 4Y20A 5AC92 3D4KA 2OPKA 3CNAA 3H8UA 4OUSA 3NAPB 1W99A 4I3PA 4DY5A 3J7HA 4QQ2A 5CFCB 2A1XA 2BFUS 3LE0A 2HWC2 1YQ5A 1RUI3 2QCSB 5EJ1B 1NQJA 2VMGA 4W50A 4UFIA 1LGCA 4DXZA 1DGLA 4JGZB 2AZ5A 4META 1ZRCA 3T1MA 4GWNA 5DABA 3ZXEA 5JMCA 1DYPA 3NNLA 4P9IA 2C0ZA 3DYMA 1X9TA 3N9QA 3POSA 4CU9A 3O1VA 1UPIA 2Z42A 3LWCA 4Y3OA 1K5MB 3T2OA 4DO0A 4QHOA 4PLMA 4YW3A 1PMHX 1YFYA 4TYSA 3I2IA 1L7LA 1LENA 2VMHA 1NLRA 3OGVA 3M3QA 4GXLA 4QB6A 3TN93 3BPSA 5FYUA 4IDZA 4CCNA 1ODMA 4MX3A 2BQPA 3WNKA 3AP5A 2D3SA 2WRAA 3CIHA 4L0PA 4MXVA 1SHWB 5FY4A 2RJKA 3S30A 4NE9A 3OGGA 2GU9A 3AMMA 3T30A 1AR63 4LE4A 2NLRA 1BYHA 2ZKNA 4TTGA 4JDNA 2EAKA 4IV1C 4DXSA 1KITA 1AYN2 1QJU2 4GALA 1MS3A 4XACA 4CA9A 4A2UA 3L2YA 4YM0A 1MS4A 3K75B 4HG6B 2D93A 4LO6B 4YWAA 3IDCB 1VPHA 2VBDA 3AB0A 3K48A 1V6JA 2VW2A 4X8PA 2O8QA 1KJLA 3HIFA 5EZWA 1OQDA 5CAZA 2ET7A 1H0BA 3ZFFC 3WP4A 4U2AA 3W9AA 1Q8SA 4AK3A 5LRSA 2DCYA 4UFHA 4FOVA 2VOTA 5E6HA 2Z69A 5FZEA 4HVRA 5BY5A 5C8CB 2WNUC 2VJXA 2ZS6B 5HBAA 1LAJA 5BYNA 5F3IA 4CDWB 4AF9A 1SFYA 4GIQA 1W6NA 1RMU3 3POGA 3LSEA 3VKMA 5FZ9A 3VL8A 4D69A 1AR91 1V6IA 5I0TA 5IVCA 1ZYBA 3IIIA 3M70A 3ZN6A 4OHWA 3JBG1 2YG0A 3M3IA 1W03A 4DXTA 4FPKA 2CAUA 4MHRA 4IEPA 2C26A 2Y0IA 3KVBA 4CCDA 1YFXA 2O8OA 1R1A1 2W68A 2XLGA 4L2NA 4YW6A 4IEUA 3FBYA 3TNPB 1LGNA 2XVLA 2PHTA 3A21A 1PGL1 4GMP3 4A45A 1ACCA 3OPWA 3LQCA 3PVOA 4GAZA 5FMCA 4CCEA 5C33A 3B7MA 1VJ2A 1W9FA 2RS31 3I2JA 3KQ4B 1NYWA 4MXWB 3WV6A 4CUGA 5FMDA 3TRSB 5JSPA 1N47A 1BVP1 1OH3A 1V70A 1RXFA 5SV5A 1XYPA 5F7UA 4QPYA 1JUHA 2LTNA 3U0ZA 4J25A 1VBA1 5D1IA 4P5YA 3GM8A 4BMBA 4QD2A 2EALA 3BTYA 2CYFA 1UKGA 3I2OA 4XUPA 5AVAA 1EY2A 1GOGA 2JDMA 2QQPA 4Q4X3 4FVVA 3WX5A 4CCMA 2QTWB 4L99A 2QUOA 2W9XA 3IDBB 1C8M3 3IBMA 1D4M3 2NYYA 3N3HA 4FPYA 1WW7A 4W65A 3GYDA 1H4GA 1SLLA 4A7KA 2D6KA 3JZVA 3O0XA 1COV2 1A8MA 3MLJA 2LUWA 3WG4A 5T5OA 1W6MB 1SG3A 2ZGMA 2TBVA 5JLVA 2QKDA 3LDRA 3S7IA 3O1OA 2B8MA 5IT6A 3DL3A 1VLNA 2B7YA 2VZVA 3PVNA 3FWEA 3QOPA 2GMMA 3MUZ1 2Y6FA 4QPIB 1AJKA 1PZ7A 2JE9A 5EXOA 3O1TA 2ORXA 4EWEA 5DMYA 5JIAA 4XMIA 3C7HA 1AL22 4OI1A 2LROA 2HWB3 4LT5A 5A33B 2OPWA 4B1LA 3AYAA 3ZXAC 1GP5A 1OUXA 2KD7A 3WNMA 2NP0A 2Y6JA 2WZ8A 1GWKA 2JB8A 2HWE2 2ZJCA 4UFJA 1VRH3 2XBO3 4MADA 3B9CA 2VZSA 4LNVA 4TZDA 4YVSA 1OA4A 4CPBA 5CADA 1HQNA 4E4SA 1E5IA 1BQPA 5FCCA 4LBQA 1RUC2 2PA7A 1LOCA 3KS7A 1NCQA 3KV6A 3H8XA 2GAUA 1JXNA 1O7FA 2GSYA 2RJLA 1NY72 4CU8A 1RUI1 3OJBA 5ANNA 1GNHA 2XL7A 4I09A 1ZVFA 3O5SA 3C7GA 1VB4A 4F83A 1XB9A 1YEWA 2EXJA 1NXMA 5FYSA 3CMGA 5GLTA 2BDRA 4XUTA 3PVBB 1RVF3 3CF6E 4FOQA 4JQTA 4F8AA 4WVMB 5E8AA 1Y9MA 1CZTA 1QU0A 1D0GA 3E5UA 3H3ZA 1YI7A 2XVKA 3TN91 1MS1A 5SV8A 1OA2A 1RUH3 4GQ7A 4M01A 1O4YA 4W6WA 5JI9A 2I2SA 1JZ7A 5CYYA 2JB4A 3I2FA 4DUXA 2IXLA 4I3GA 2EICA 2JICA 3EMRA 3I3QA 4XIKA 5G04L 4O61A 1FNYA 5K4LA 1O91A 4AHWA 1AR61 1GNYA 4XJ9A 4QGLA 3JD73 4KG8A 4XBNA 2J1VA 1GANA 2ZABA 5LZ6A 1CAWB 3M7AA 5DQ0A 5FZHA 1C57A 4WZCA 5J1XA 4RHV3 1Z7S2 2B42B 5K0UA 1ZZCA 2DU1A 2OUHA 2VQAA 2VNVA 3M1HA 5J3UA 4B29A 5DAWA 4CDQB 1JU4A 1T6BX 2DBNA 2WR9A 4GH4A 4QKBA 5FPZA 3USSA 1REEA 4IERA 3WXPA 4AHYA 1W9YA 1X50A 1ENRA 4TXWA 5ANQA 4B8EA 3UGFA 2AC1A 5HV4A 3VDAA 4M4RA 1V00A 5FBZA 2XGXA 3PJQA 4CU6A 3AZVA 4LLFA 4KH9A 5IVYA 3NV3A 4QU1A 2GMPA 2V4VA 4JCKA 3E6DA 1OMIA 1RMU1 5C4WB 3T2PA 4CCOA 3AX4A 2WS92 4QX8A 4RQPA 2HKXA 5D8AA 3TBDA 3ZSKA 3ZX7A 4OHXA 4OZOA 1ZNPA 4NRPA 3ZFGA 3VBHA 3WLUA 4P9JA 1O6UA 2WIIB 1HW5A 3C7OA 3U11A 3U4XA 3HN3A 3RI9A 5J37A 4C8DA 4CXYA 4Y5Z0 2R30A 5CB7A 1FPN2 2C6SA 2DUPA 5FZDA 1S4CA 4WM8B 3ZDSA 3D8CA 2QFEA 2XQRA 1W39A 2VUAA 4Q4V2 1MVEA 1BKZA 2E32A 4GMP1 4YVSC 2ETEA 3ZSMA 4W8JA 3WP6A 3AXDA 4RR3B 5FREA 4NPMA 4IGOA 1QHDA 3KV4A 1NCQC 1BMV1 3WW3A 4ZZ8A 1ZZBA 2W08A 3ES1A 4LKFA 1OQEA 3PU8A 1AX2A 1NUKA 1CVNA 3ETQA 1FYUA 3UNPA 1DDLA 2BUKA 4BXFA 1SLTA 1W6QA 4ISRA 3OUIA 2PLV3 4EQVA 5FZMA 4HBNA 3ZKUA 1JMUB 2WAOA 3BCWA 1LEMA 2Y6KA 1KGYA 4Q4X1 1XYOA 4XJ8A 2Z4FA 3WF2A 4DRRA 2QQJA 1E57A 3J26N 1C8M1 5L36A 1D4M1 5FZGA 5AVPA 5C70A 1OUSA 3WF0A 3R4UA 5FAXA 4QPGB 2BBAA 2VMFA 3JB8A 3UL2A 1VAKA 4FFFA 5A32A 4JX0A 3FZ3A 4LQRA 1UU6A 1XSQA 2YU2A 2CV6A 1O4TA 4LBOA 3FL7A 3O1PA 1JOBA 2JJ6A 3OY8A 4FP2A 2GNMA 3SKJE 3WP3A 1WLDA 3LA7A 4K9SA 4DMIA 1S0DA 1F2NA 5GLUA 5LBEA 2VCAA 3WEZA 1OD5A 2RDQA 5IK5A 2ZA9A 3HNYM 4DXRA 3WW1A 3LIHA 4NN0A 4AFCA 5J36A 4HK9A 2XVGA 2E9QA 1N3PA 5FMOL 4AFMA 1OD3A 4GULA 1W8FA 2RG4A 5LBBA 2VQUA 3NO8A 1W05A 2R1DA 4HN1A 5JOXA 5K0UC 1DZQA 3LD8A 4Z92B 3HMYA 2HWB1 4BJ0A 4M0NA 1P8JA 1O3QA 4A41A 4HANA 4LXLA 2QQOA 2VW1A 5BNNB 1MZEA 3EHKA 2WBKA 5IK7A 1M06G 3O1MA 4GH4C 1FOD3 1UX7A 2W1QA 1BBT2 2XJQA 2XWBB 1VRH1 2XBO1 2WZR3 3BTAA 3I3EA 2EIDA 3NWKA 3VV1A 3AMNA 3USUB 3ST7A 1JZ4A 3A23A 2QZ3A 4BQ1A 4IESA 1EP0A 2DWRA 4NUBA 2VMDA 3WDWA 4R9AA 3TEXA 3ZIWA 2I45A 2ZXQA 1JZ3A 3DKQA 4XFCA 4RQPC 4I30A 2JDPA 5D8AC 3VDDA 5CFDB 4S2GA 2RM22 2EA7A 1W9SA 2RMU3 3ROUA 4C0BA 4EN8B 1HX6A 2RS12 3ZFGC 1PK6A 3ORJA 3IPVB 1ZBE2 3VBHC 4PF1A 4AFBA 2X8KA 3PU3A 5JPMB 4CEWB 2PHWA 2B4KA 4M0HA 2IC1A 5FZLA 2J1EA 3PDQA 3BPZA 4UXAA 3VZLA 4AI3A 1B09A 1G86A 1CWPA 3B01A 3GBWA 1OFNA 1AR82 2OA2A 3KCXA 1RUH1 5CKQA 2YGLA 5IAXA 2P2KA 4FQZA 4IQPA 3LFIA 4DPNA 4AQ2A 3WDYA 2VTXA 5FPUA 5CISA 5F6LB 5J96B 4ES9A 2JIGA 3BN6A 5LY2A 3ZSEA 3PIJA 2R49A 4BLIA 4OZXA 3JD71 3KF3A 2QQNA 3UYJA 3K4DA 5A1AA 2YPJA 1SMVA 2ZGOA 2FHRA 2XL9A 1YQCA 3MHZA 1C4RA 4Q29A 4TWTA 1RINA 4RHV1 5I93A 1RUG3 4J6GA 4XE9A 4UBGA 3ECQA 1L3JA 4KU7A 5CKMA 4D7YA 1IKQA 2VULA 4PBPA 4WVZA 2IWGB 3DECA 3IMMA 1CX4A 1SLCA 1YFUA 4YM3A 3HNMA 2DUOA 4QU2A 3TEWA 2WO3A 5FY8A 5KHJA 1XU2A 1IG0A 1L7QA 5IATA 3RWNA 2LRPA 2V72A 4Z8BA 2BVVA 1E5SA 1H9WA 4Q4Y2 2WWUA 4COZA 5CEHA 3BALA 5E1RA 1HJGA 3N35A 4CDUB 5JOYA 2GMEA 1MS5A 3HEIA 1R093 1BCXA 1PO13 1BJQA 1OXCA 1OLMA 2KA3A 2GC0A 1XSRA 3ME2A 5FYVA 5HCBA 1DGWA 1NZCA 2BPA2 1CAVB 1K5JA 3TAYA 2AACA 4C0HA 2ZAAA 4AEDA 4URAA 5FV3A 2RR12 1QEXA 2JG9B 3DGTA 3RZGA 5LEKA 1KDMA 2VR4A 2YV8A 4YNIA 1KRIA 1W9WA 2WUHA 2PTMA 1LJ7A 1RHI3 2LS6A 3HQUA 5EYXA 5FPBA 3UJQA 3WT3A 4ET7A 4H2AA 3H1YA 2W1UA 4XCBA 1PGW1 3VB9A 5K7PA 1H9PA 4EYUA 1TME2 5A3LA 4JV4A 2RE9A 1GP6A 2K2SA 3VBRA 5L7OB 4COWA
chains in the Genus database with same CATH topology
5GZFA 1ZBA2 3WDXA 1BEV3 4HLTA 1MVQA 5LEJA 4XHBA 5JI7A 2VGDA 4JAAA 3VDDC 1J3RA 1W2UA 2DFBA 2NN8A 4G9SB 2PLV1 1PK6C 2TUNA 2R073 1XXNA 5EYYA 1JOJA 1LOGA 3MFAA 4BE3A 1DZRA 3RMYA 3TNQA 3VLBB 5JAXA 2TEPA 1RC6A 1UF2C 2HYKA 4IEYA 2BVBA 3GALA 4K7JA 3OF1A 5GLZA 3WW4A 2RS53 3AZZA 3ZN5A 1ND2B 3D0SA 3U10A 2ERFA 2VH9A 4WBBA 1HDKA 1I9RA 4XJUA 3EQEA 4ASMB 4GKXA 4O9EA 1VBB3 4XQ4A 3WQ7A 1XNKA 1PO23 4RA0A 5BNPB 4MGIE 3KM5A 2NMNA 5HI0A 3AJZA 5DUVA 4QGNA 1MQTB 1VBD2 2WZPP 4HETA 5GM0A 1YI9A 1SLIA 1I6XA 4JGYB 3BIWE 4PIXA 1LHOA 3THTA 1PMIA 2X5IA 3RYPA 3H50A 2ARBA 3MPBA 4HSJA 3EO6A 3WHTA 3E5QA 4CZSA 2ZPXA 4N53A 4EN0A 2FZ2A 4Y1ZA 3CJIB 4Y22A 2RMU1 4AI2A 1AR92 1GLHA 3OTFA 4IV3A 2PYTA 5ACA3 3JBG2 1PNFA 5EWSA 4CDWA 3MFCA 1H1MA 4Y24A 4HFSA 1QQP2 1RUJ3 4G4FA 5J48A 4NHKA 3ZMOA 2XHKA 2W39A 4OFGA 1A8DA 1TNRA 1QDCA 3WDTA 1R082 1PNGA 2SBAA 2VXRA 4CDXB 2ATFA 1GQHA 3AMHA 3VBRC 4YM2A 5GZCA 1EAH3 3B9IA 1I5ZA 1RL3A 4BH9A 2VNRA 4BHPA 2XJVA 1IS4A 5JVVA 3WG3A 1YUDA 1LULA 2VVEA 3UKNA 2PHFA 1RUG1 2E7TA 3FMGA 4YFZA 1TE1B 1OLQA 3I8TA 4S2HA 2G9GA 5T5LA 4A7YA 1HXS3 3AP6A 4LHNA 3E6BA 4CRQA 2ZZJA 2B45X 2P3KA 3CL1A 2DU0A 1YHFA 2JX9A 4HPKB 1ONAA 3VZMA 5C8WA 4AEKA 4AQTA 4BA6A 3ZXKA 4YG3A 5JOWA 3L9JT 1ND3B 3ZSJA 5KHIA 3GF6A 3OBRA 3VKFC 4ZU7A 1R091 1PO11 1JTZX 4OHVA 4HSLA 3ELNA 2BW8A 4ITCA 3PMSA 4XBQA 4LO8A 4GB33 1GFF2 2EIGA 4ATFA 2DURA 4DFSA 1W6MA 5FO8B 4X8NA 1MS8A 1O3TA 4AGVA 2DYCA 1QJX2 3VBUA 1RHI1 4NR1A 2PFWA 4W6YA 4Q4W2 3H7JA 2WLQA 1LOBA 1NQDA 3AP7A 5FO7B 2DV9A 3VBFA 5DUXA 1H2NA 1ENQA 1QMJA 2YHJA 2X5IC 5A33A 4GWMA 2XLFA 1BEV1 2LM3A 4F3JA 4XF0A 4EV0A 5DZEA 1MEC1 4FO9A 3DPRB 4N53C 3FX3A 1WLTA 2D98A 3KB5A 4NOTA 2JE7A 1V6NA 4NHMA 2GNBA 1AYM2 2Q4SA 4OI2A 3LKJA 4IV3C 2PHXA 2R071 3ILRA 4LLOA 4CDWC 1SLAA 2A7AA 2YUEA 1X8MA 3MPPG 3UV9A 3H0OA 4XZPA 1CQ9A 1PIV3 4M3CB 4XMAA 4Q8LA 1UZZA 2RS51 4B4PA 2B46X 1IQAA 2CNAA 5JZGB 1JYCA 2VPVA 4PDWB 4RS5B 4UW3A 4E2QA 1CAXB 3O12A 1KXGA 3DV8A 3AK0A 3O14A 3WW2A 5KXBA 2EXKA 4BOWA 2VW0A 2ZGRA 4PCRA 3KSCA 1J1LA 3V65A 4Q26A 1ZRFA 1SBDA 4AQSA 3ATGA 1VBB1 2K9ZA 3LGRA 2ZX1A 1AVBA 2R062 1A6CA 1AX1A 1PO21 3I59B 2GZWA 3ZYJB 1KDKA 2HWC3 3DN7A 1MZFA 1N1YA 1URXA 5I0RA 5KC6A 4QHBA 1BZWA 1FXZA 4OHYA 4YVWA 1B35A 1WMEA 3WUDA 2VNOA 1RUF3 4R4ZA 1AXYA 1POV3 3N7JA 2V73A 3B93A 1C1LA 3ALQA 1AUYA 2DVDA 3I54A 1LEDA 3IDEA 4CDQA 3VBOB 1VBC1 1VAVA 1YRZA 1CJDA 1H30A 1Y7BA 4PF5A 3WNXA 2ZKLA 1C8NA 2WSUA 2IXJA 3S7EA 3JQXA 4QQHA 2YXSA 4XTMA 2AENA 4IEZA 2UURA 5ACA1 3MW4A 1H2MA 5C4WA 1RUJ1 3VBUC 5AFBA 2OW4A 3VHOA 1AYN3 2MPFA 1G8WA 1QJU3 1SQ4A 1HV0A 4UW4A 1QY4A 2XKPA 4XQWA 3SITA 2H0VA 3VBFC 3CJXA 4WM7B 2EVXA 2MEV2 2YC0A 4AEJA 1GQGA 1EAH1 3OYWB 4UW6A 4WM8A 4OLLA 2ZX4A 2XJTA 2DUQA 2IXIA 4COUA 1GZWB 1QNYA 1PM7A 4F7ZA 4RR3A 2ZACA 5JDBA 1NA1A 4R8HA 4QQPA 3WOGA 1WCSA 3NKTA 4LBJA 3ZXGA 1HXS1 4FPHA 4YLZA 4YZ1A 3AYEA 3VUOA 1D4M2 4I02A 4FPLA 4R4XA 1CPNA 5KXDA 3LA2A 5FQ0A 3E6CC 3SXWA 4XIOA 4XJAA 4Q0UA 3UK9A 1OSGA 3MF9A 4HMZA 2OYZA 2A6ZA 4YGDA 4BIOA 4GB31 1UKRA 1REFA 3GZAA 4FPGA 3SH5A 1PZ9A 3RQ0A 3FC0A 3W59A 4H7MA 3WDVA 2HWB2 2PAKA 2JG8A 3OD0A 4C1XA 4H7LA 2FMYA 1B35C 4N9HA 4YVWC 1F5JA 3VKOA 4E2SA 4CEYB 2WLPA 4K6BA 5CIRA 3WQ0A 3R4DB 5H9RA 4JTNA 1SCRA 2WFPA 4Q0SA 5BNNA 2EXHA 3MW2A 5LK7B 1Q5OA 1ULDA 3D82A 4PBOA 3OBTA 1SEFA 2BNOA 5TSWA 1UN1A 1COV3 1DBNA 2Z2SB 3B94A 4XILA 3GZTB 4IEWA 1LHVA 1PIV1 3LZZA 2NQYA 4KGQA 4LO7A 4HVOA 1GNZA 5HXVA 5CFDA 3ZN4A 1RUD2 2D6MA 2A73B 1V9U2 4UBHA 1RUH2 1WW4A 3A4UA 3INAA 3IIAA 3DKWA 4HKWA 4CEWA 4MUVA 3MLKA 4Y20B 3AJYA 1HRI2 3GZUC 3IT8A 3JUUA 1KS5A 1C1FA 4WM8C 2BWCA 4AG4A 1LTEA 5DUWA 2HWE3 1ASJ2 3JD72 2A6VA 2BEOA 1QF3A 5ABJB 1LOEA 4RGAA 1VP6A 4XETA 1J3QA 1RUC3 5T52A 4RHV2 1NA1C 1ZZ8A 2CTVA 5T5PA 5K9YA 2E63A 1IS3A 2HWC1 3SH3A 3KCYA 3BB6A 4DOUA 2GDFA 3FFQA 1QDOA 1RUF1 1DG6A 1POV1 2ZGSA 4A7ZA 1KJRA 4YSFA 4KU8A 1ZM1A 2VOXA 2D5HA 1C3HA 4YM1A 1S0CA 3MDPA 4YGBA 2BTVC 2ZMLA 4D7SA 2OZ6A 4FPJA 4EN6B 3TOJA 2UWAA 4W6XA 3WY6A 1DHKB 4LUMA 5FTTC 4CDUA 2WL1A 4KGGA 2JG8C 5KC5A 1AYN1 3K51A 4L92A 1X8EA 4XHXA 1CAVA 3AZYA 1Z7S3 2LALA 3LOIA 3QH7A 2E6VA 5CNAA 2A6WA 1AR73 4QQOA 5BNNC 1I3HA 1G9BA 2ZMNA 4FPEA 1W6NB 1V6LA 2ZX3A 4NVPA 2D44A 5KWRA 2DVFA 3VZNA 1QXPA 2GALA 5I8TA 4JQRA 5T55A 1R1ZA 2TNFA 2DCJA 4XW3A 4N7UA 2PN5A 4WVVA 4XXPA 3VHNA 4BCUA 3ASIA 4O9GA 4OI0A 2CGNA 2C9AA 3ENRA 2WS93 2Y0OA 5CBLA 3J4UH 5CFDC 3ILFA 2IXKA 1UL9A 1Y3TA 2WFF3 1W0OA 3WCSA 2ZAHA 3C2UA 4CEWC 1H8TA 5C6CA 3V0BB 1FPN3 1XE8A 1YYNA 2VNGA 2GC1A 4KQ7A 1GR3A 4LBLA 1LODA 3PHMA 4FCAA 3AZWA 1TMF2 3ZYGA 3ZXLA 2VG9A 4Q4V3 3OD4A 2XJRA 1ULFA 1GKBA 4QT6A 1D2SA 1GSLA 3AKTA 1KS4A 1F8VA 1FMD2 2ZOEB 2PAEA 1ZREA 1ALYA 1OFSA 3N7MA 4WV8A 1PZ8A 5C9AB 4KBBA 1FT9A 1G6NA 4DRVA 3MIDA 3IM0A 2Q1MA 2JECA 4LTAA 1CIWA 3KT4A 4RSUA 5I0UA 4XFHA 5GKAC 5BNPA 1PVC3 3C3VA 1XYNA 1YIFA 1RUE3 4FBFA 4ZU5A 1NCRB 1OOPA 5GLWA 1PHMA 3CLPA 4AXOA 1W0PA 3H7YA 4MSVA 1COV1 3BU7A 1IOAA 2WKKA 4C90A 3UKTA 4YYOA 3AP4A 1RJ8A 3VBSA 4CDUC 3VKLA 2BYVE 1EYBA 3CJIA 1DIWA 4NO4A 4YW2A 3ZSLA 1X33A 3LAGA 1H2KA 4YZ5A 1N1VA 3T1LA 4P9YA 1NE6A 1HRV3 1RVF1 1GZ9A 3CEWA 3GHNA 2YROA 4RFT0 1IKPA 4IEVA 1NCQB 3JQWA 5FOBB 1BBT3 2HWE1 2R0HA 4DNYA 2ZGLA 2HWF2 3Q9OA 3AFKA 3M4FA 2R043 2K0GA 1RUC1 1U5YA 4R9BA 5GALA 4Q1PA 3GBFA 1IHMA 5FMOS 1ULGA 1NY71 3RRDA 1IGOA 2UYAA 2YMZA 4I2OA 3WHUA 5DZFA 2ZGQA 2RM23 3O7OA 4YFWA 4C1WA 2RS13 1I1EA 2GN7A 3JB4C 1ZBE3 3HQXA 4LUKA 5LRRA 1H8TC 1Y9QA 4M3CE 3HBZA 5FOJB 2C1FA 1WUVA 4HPKA 4Z07A 3KZ4C 1AR83 3HR9A 1J59A 3LSDA 1WD4A 2G9FA 5K0UB 4EJRA 5FO9B 1MZ6A 3R05A 1EV12 5GZGA 4AVCA 1RHI2 2ET1A 3AKPA 4GH4B 4ZKTB 1Z7S1 2DVBA 2NPIA 4J1XA 1ULCA 2DVGA 5BNPC 1VBE3 4ES8A 2YZ4A 3ZYIB 1AR71 5T5JA 4LO4B 4FTBA 1Q43A 4K3UA 4AEMA 2DCTA 4NHLA 1UIKA 4HZFA 4NWVA 1OOPC 1U5ZA 2XJPA 2IXHA 1MEC2 4MYEA 1SDWA 1H1IA 2P37A 4ZU4A 4Q4Y3 2A5ZA 5JR7B 3ZFGB 5L19A 3VBHB 2NMOA 3MF6A 3MLLA 3VBSC 3J8F3 4LBMA 1O5UA 4AVVA 4XXAA 3O0VA 3CJIC 3G6JB 5KHKA 4LHLA 1UAIA 2OIIA 3NAPA 2WFF1 5CFCA 4QQLA 2RR13 3V0AB 1Y43B 1FPN1 1QWRA 1BK1A 1OLRA 4M3CA 3AYDA 1U12A 1IZ3A 3WDUA 4BWOA 4JGZA 5JZGA 1S0JA 1LKNA 2P17A 1TME3 1LHUA 4Q4V1 4V1PA 1TQ5A 1AZDA 4LBQD 2NZ9A 2DF7A 1CAXA 3URFA 1K5MA 1W6QB 4INDA 4K20A 1ZBA3 2QJVA 5KXCA 4HK8A 3MICA 4M00A 4P9LA 1QJY3 3S6PA 1YIPA 3I7DA 4LBKA 4AHXA 3I4IA 4K21A 4HVQA 3LA3A 3R6SA 3WP5A 3I59A 2W0XA 1KQRA 1PVC1 1ZX5A 5L73A 3THPA 2VUJA 4N43B 3VZKA 4B4RA 4Z1VA 1J3PA 1RUE1 3OY8B 2UU8A 1FOD1 2DVAA 3A0NA 1BVVA 4P5HA 4RD7A 5JOZA 2WZR1 4EN9B 1VBC2 3MIEA 2NM1A 1YWKA 3ZO0B 3FBMA 4SBVA 5JIUA 4MZUA 3I2DA 2A70A 4JC1A 1OI6A 1X82A 2Q30A 3CU7A 2ZGTA 2D6NA 1DQ4A 5GZEA 1MS0A 4S2FA 1APNA 2PHLA 1NE4A 2VECA 4AVBA 3SH4A 1LU2A 2BNNA 5C8CA 1YLLA 1IS6A 2CL2A 4ZXKA 4AEDC 1O5LA 2R32A 1HRV1 4LA2A 1QH7A 3FUOA 1GZCA 4EN7B 5FPXA 1R1A2 1WW5A 1VBD3 1BBT1 1XU1A 2XH6A 1AF9A 1PGL2 2R041 3VDDB 1G7YA 4WM7A 2BBVA 2RS32 2RHPA 1DQ1A 4MGYE 5J7MA 5IK4A 4FAHA 4BIFA 1LOAA 4XFBA 2PELA 1Q3EA 5BXXA 3SCFA 4P14A 1HXS2 3P3PA 2RM21 5FLJA 3LCPA 1VBA2 4LE3A 5GLVA 4MXWA 2R16A 4AI1A 3NAPC 1ZBE1 5BNOB 2MHFA 5CFCC 3JBG3 1AXKA 2X29A 1QQP3 3D5OA 3ZFEB 4KL1A 4FPOB 3AKRA 2JDZA 4JGZC 1JW6A 5BNQA 1AR81 1R083 1H1AA 5JZGC 2SLIA 4E27A 3RJ2X 3MYXA 3MGUA 3FFZA 3APBA 4L8QA 1K5MC 5E89A 3BOWA 1C5IA 4PJYA 1QOSA 2DCZA 3GBGA 3M3OA 4AW7A 1QGLA 4I0AA 3VZJA 4D94A 1RGSA 2P3IA 2I74A 4HKOA 2BFUL 1FX5A 4LHKA 4IEXA 5DDJ3 2GC2A 3UKVA 1VBE1 4P9WA 4YGEA 1DZTA 2ZTNA 2PHDA 4YGCA 3VZOA 1WW6A 1DGRN 4QPIA 3PNAA 4E9KA 4Y1XA 5J09A 4G3YC 4CEYA 1DGRA 2A3WA 4Q4Y1 3RI8A 1UMZA 3MIHA 1LHNA 2HWD3 3R0RA 3W58A 2UY8A 4R9CA 2A6XA 1W6PB 4Y1UA 3J8F1 1N3QA 4ONUA 5FLHA 1NXD1 1RUI2 1RJ7A 3NKGA 4EWAA 5C8CC 2JKBA 2VU9A 4K8FA 1XRUA 4FAGA 4MVTA 1OPMA 4AE2A 1VAMA 4IEOA 2RR11 2WA3A 2ZHLA 4OUMA 3WUCA 1QJX3 4YZ2A 1ZA4A 1EPZA 2WJSA 4HKLA 3VBRB 2ARXA 2ZHNA 3M2MA 4P9XA 2WA4A 4Q4W3 2ZMKA 5JPNB 4KG0A 3TN92 1IPJA 4AGRA 4GMP0 1TME1 4P9GA 5F5QA 3JU9A 3ZVXA 5JWPA 4WVMA 4QX5A 1HKDA 1ZBA1 2EAAA 2JENA 1AR62 4JDOA 3OPZA 1QJY1 1FATA 3KD4A 2XWJB 4MGKE 5ABJA 2KM2A 3X29B 1AYM3 5AC93 1CAUB 1RUF2 1F31A 4Z2WA 3MZHA 5H9SA 1IPKA 2D7FA 4DINB 2OZJA 1AX0A 1CAWA 4XTPA 2VOVA 1UU4A 1NLSA 1S0GA 1X7NA 3H3UA 1HQWA 3AMPA 3M3CA 4HL0A 2ENRA 2WQZC 2GH8A 1HV1A 3DUIA 1XNBA 1A3KA 3POYA 3PLQA 1S0IA 2O0OA 2MNGA 1DYKA 1RMU2 2QNKA 1DQ6A 1UU5A 2WNVB 1V6OA 3BOPA 4D7TA 1YNAA 5F6KA 2YDEA 1RIRA 2E7AA 2VVDA 4J1WA 2R063 5KBFA 1GBGA 2OUJA 2YY1A 3KT1A 1FAYA 2BGCA 2E7QA 2CGOA 2X5IB 3KMHA 3JCIA 1JYIA 4QPIC 1VBD1 5AFEA 4FTSA 1Q56A 1T6GC 2D43A 3KT7A 2CWSA 3S0MA 4CEYC 5BUVA 1DU3D 3PTYA 4AI8A 4N53B 4Y22B 1LR5A 5H9QA 1H4HA 4BM8A 2D6PA 4IV3B 5I8SA 1CESA 4XF3A 1BMV2 2Y26A 4H3WA 2IZWA 1NOVA 1RB8G 4Q2FA 5T54A 1SBFA 2GH2A 3MI8A 1H2LA 2ES3A 1XNDA 4Q4X2 1AL0G 1DF0A 3IN9A 5DXDA 1QQP1 1RITA 2QDNA 1C8M2 3QH6A 4R52A 4FPCA 3N4MA 3IKWA 4Q0PA 1EPWA 1R081 4CYDA 4I0WB 2Q0AA 2ZGPA 3POWA 1QXJA 4TLFA 5I0SA 3E5XA 4XYXA 2MEV3 3V0BA 1CD3G 3N7LA 4FXGB 4QPGA 1Z0HA 3N36A 3SMHA 2G4IA 4K40A 4IV1B 1OKQA 5ABJC 3KGLA 5DDJ1 4N7IA 4E2GA 5DUUA 3AZXA 4EROA 1LB2A 3H9AA 1QOOA 3V64A 1AHSA 3RZZA 1QKQA 3WZ1A 4AFAA 1DGWX 1JUIA 5C9AA 3QD6A 4XFAA 2ZZQA 3ILNA 3ZFFB 1FV3A 4R9DA 1D2QA 1VRH2 2XBO2 4BYYA 2WT0A 5DG2A 1MZ5A 3PJYA 5K8SA 4KWLA 2HWD1 2WNUB 2ZX2A 1KD7A 4CDQC 4DQAA 4I01A 1J1TA 1Q8OA 3D0JA 1NCRA 1YCIA 3USUA 3ZXFA 3VBUB 1SCSA 3SHRA 1M4WA 2AYHA 2UY9A 4JRLA 1HIXA 3SCGA 3ACLA 1DFQA 2XPJA 3WCRA 4Y4YA 5C4WC 5JSOA 3N7KA 1QJX1 1MR5A 1H8VA 1RVF2 3VBFB 1PGSA 1FNZA 1W6OB 4GKYA 4AWDA 4Q4W1 1SFNA 1S0FA 3HAGA 3IPVA 2Q5TA 1WGPA 1AL23 4AQ6A 2WNEA 2JD4A 3KQRA 3O0WA 1UPSA 2DCKA 4C91A 2AUYA 4M3CF 3NV2A 5EFUA 3RPQA 1LRHA 4DY3A 1UZYA 4IXLA 4NWWA 4LO5B 1S2BA 4RR3C 1AYM1 4S2DA 5AC91 1WA4A 4ATEA 2A6YA 5KHGA 4JTOA 2AREA 2ILMA 4MV2A 3WD5A 1ZRDA 4XBLA 4IETA 4FSJA 1RUD3 4K1YA 4JRAA 4YZ3A 2CY6A 3M8LA 4NPRA 1V9U3 5I91A 2WQ4A 1HQLA 2A3XA 5EV7A 3ZYRA 1HRI3 3EJKA 2O1QA 3QACA 1LGBA 4QPGC 1G9FA 1VR3A 5BPXA 3ZXJA 1S0BA 1Q8QA 4PIZA 1ASJ3 1OHFA 2H6CA 4YVWB 1B35B 3AYCA 2R061 3FLRA 1JHNA 3NV1A 4N90A 3HT1A 5GJ6A 1WBFA 1Q8VA 2V09A 1Q8PA 4JDMA 5C9AC 3WR0A 2YGMA 1AR72 4XFIA 1QJU1 5F9TA 1WD3A 3NJZA 4PLNA 3MIFA 1PGW2 4E4ZA 4FP3A 3VKNA 3MW3A 2Y38A 2JG9A 1XQNA 3WINE 3DF0A 2N7GA 5DG1A 1D0HA 3HWJA 5B2GB 4Q1RA 4CTEA 1SBEA 1RUNA 1NCRC 4QM9A 4ORFA 4Y1VA 2HEWF 2ZHKA 1MS9A 3P3NA 3QCWA 5L7OA 3RYRA 2PLV2 3ZN6B 2ZGKA 3ZXDA 5F1RA 2FQPA 2WFF2 3AP9A 4TSVA 1LOFA 3NVCA 1XE7A 3AM2A 2VOKA 1DQ0A 1YJKA 4L9BA 4Y1YA 3AFGA 4AGGA 4YZ4A 2IXCA 1OQ1A 3J9SA 2MEV1 4MLOA 5FDBA 3V0AA 5CA6A 2UWCA 1NA1B 3AKQA 1ND2A 3GHMA 4X6QB 2JXAA 4LR4A 1OA3A 4Q27A 2WWSA 1VALA 1V6MA 3L2HA 3ZMNA 1GV9A 2XKOA 2V5YA 3NL1A 4AVTA 3SCHA 1G9DA 1PVC2 5FQ0B 3FLPA 1U5IA 1FI2A 1LESA 1RUE2 1FOD2 2WZR2 4FXKB 4KNCA 2ZX0A 4XJWA 2H0BA 5E16A 5FRAA 1TNFA 3OGJA 4XQDA 4N43A 1MQTA 1ZRRA 1QH6A 3H1WA 1S2KA 1WCDJ 2QZ2A 4JGYA 3IMNA 2AGSA 1TMF3 5T3NA 2JG8B 1MACA 2RMU2 1FMD3 4HT1T 4WVWA 1ZZ6A 2XLAA 3HN1A 1HRV2 3M3EA 4XFGA 4IEQA 4RL7A 5E88A 1RTVA 2AR6A 1J58A 4Z82A 1GICA 2E53A 4Q8KA 3B69A 1AL21 5A3MA 4YVSB 1DLLA 2JG9C 2R042 4LBQB 4XF1A 5HCAA 5H9PA 2HEVF 3MEPA 4QXKA 3T2TA 4CDXA 4LULA 1Z78A 2D6LX 4YG6A 1XNCA 5L7OC 1G9CA 3ES4A 3MIBA 1RUG2 3PVEA 5FLIA 4EWDA 2BNMA 1F5FA 3AMQA 1YJLA 2HEYF 5JCTA 4CP1A 1LOFC 3VHRA 3A0KA 2XJSA 1PVXA 1DQ2A 4XJZA 2CGPA 5JSRA 2D5FA 3KLSA 1RUD1 2D3RA 3WVJA 2WC2A 2D40A 1NG0A 1WCKA 4QMAA 4AI0A 1V9U1 5BNOA 4AFDA 2HJIA 1N1SA 1SLBA 3EXUA 5DZGA 5LK5A 4BZ4A 1HRI1 1YO8A 1LHWA 1V6KA 4L97A 3ZFEA 1X36A 1ND2C 1R092 1PO12 1ASJ1 1ZZ9A 1QJZA 2D3PA 2IFWA 4BMEA 4FTEA 2HWF3 2FMDA 2PHUA 3EBRA 3B3QE 4B7EA 4LA3A 4IL7A 1ENSA 1ND3A 1S1AA 5KXEA 2JEMA 1VBE2 4BPZA 3SNMA 5IUQA 2WT2A 2I07B 3PMEA 3RMXA 1U0AA 4B3NA 2PAMA 1FV2A 2BWAA 3B00A 2Q1ZB 4QM8A 3G7DA 4HN0A 4N43C 3MIGA 1MQTC 1QOTA 1BEV2 2QE3A 3TWIA 2CWMA 1CN1A 2GC3A 3J8F2 4JGYC 4K1ZA 1QXRA 5J98B 1D4VB 4RQPB 4CP2A 4E4DX 5D8AB 3D6EA 5CVRA 3VN4A 1WBLA 4FPFA 2ZGUA 3KGZA 2KXLA 2R072 1U5XA 5BV6A 4B4QA 1CR7A 1W6PA 3RG0A 4XOGA 3FHIB 2WS91 3DPRA 4XF4A 2VQ0A 1EV13 2B9UA 3OCPA 2RS52 1CPMA 2H6BA 1WMDA 3ZYPA 3WQ1A 4I0BA 2XUMA 1KFXL 1WLWA 4RGGA 2GNDA 4AVAA 4YW1A 4PIYA 3FLTA 1LECA 2CAVA 4PDWA 4RS5A 4CDXC 1QJY2 1VBB2 1MEC3 5KHHA 3QBQA 4YARA 2F6BA 2A71A 4N9IA 1LCLA 2EF6A 1PO22 4XFFA 3RS6A 2DTYA 4AYUA 2D97A 1H8TB 4FT8A 4FQ4A 3TB0A 4D3WA 4DS0A 1CAUA 1UIJA 5A32B 3IWZA 5BNOC 2C5DA 1YFWA 4U36A 4A3XA 4BLJA 4PLOA 4Q0QA 3U07A 2E51A 3HD8B 1AXZA 1CGPA 1DQ5A 4QGMA 2P34A 1YXWA 3ZFEC 1AJOA 2ZGNA 3BODA 1TMF1 2ZHMA 1C5HA 3LB9A 4YG0A 2D6OX 4XPVA 3VGIA 3GNEA 1S55A 2DFCA 4OVEA 1FMD1 3B02A 3RDIA 3AXEA 3RSJA 4OULA 2UWBA 5ACA2 1ND3C 2Q8OA 3VBOA 4FOYA 5CG9A 3V56A 1REDA 3VHPA 1G9AA 4JVAA 1O3RA 2WNVA 1RUJ2 2GNTA 4DZGA 5I8YA 4B7KA 1S0EA 3RJRA 1OOPB 3B5LB 3QLQA 1UCXA 2VOWA 3WG2A 1UX6A 2QVSB 4FOWA 5HCFA 4Q0VA 2A75A 4AHZA 1EAH2 3R4SA 4X6RB 2A3YA 5EJ3A 2WSVA 3VBSB 4Y26A 1VBC3 3H1MA 1N1TA 4COVA 2VVFA 1N3OA 2WT1A 3SISA 3NW4A 4XF9A 3TYJA 1PK6B 3OYWA 2Z79A 4H55A 2QDRA 4URTA 4WZFA 5IK8A 1F9KA 2XB6C 3DPRC 2P3JA 3E97A 3CO2A 4MH0E 1GZWA 1AR93 1TEIA 2RS11 4COYA 3UJOA 2B5HA 3FE5A 1ZZ7A 1RUOA 2X53S 5FFOC 2R6QA 2DTWA 5CU1A 1JN2P 1QNWA 4XDQA 2UYBA 2XJUA 3AKSA 3RYKA 1R1A3 2OVUA 1ENXA 2B39A 3NSTA 1OPOA 2W52A 4PQ9A 4OI4A 4PDWC 4RS5C 4SLIA 1VB2A 2HWF1 2ZCWA 2AH2A 4GB32 4KWKA 1C28A 2RS33 5DDJ2 1JH5A 4YW5A 3VL9A 2R0FA 1SACA 1BXHA 2R1BA 2WINB 3ZIXA 4AVSA 4LBNA 4IV1A 1ULEA 2EXIA 3NV4A 3LOBA 1GYKA 1POV0 1VBA3 2YYOA 2FBEA 5CG8A 1LU1A 2Z5WA 4L11A 1A78A 2PHRA 4OHZA 2GN3A 1VIWB 2HWD2 4GA9A 1O4ZA 4ISQA 3ZFFA 4DB5A 1UD1A 2XG3A 3ZPYA 2IFRA 4YRDA 2WNUA 3RNSA 3FUQA 3KCCA 4XEZA 3VBOC 4AEDB 5GZDA 1PIV2 1IS5A 2WNVC 1EV11 4MGZE 2VMIA 4H14A 1CONA 3HT2A 3SLIA 4CP0A 1WLCA 1JBCA 2FZ1A 1O3SA 4LEJA 3WG1A 1CJPA 1HLCA 2ZBJA 1W6OA 2VY0A 4UW5A 2F4PA 5T50A 3FJSA 1WMFA 4ASLA 2PQQA 4KWJA 1KFUL 1UW8A 4WM7C 4YW4A 4Y20A 5AC92 3D4KA 2OPKA 3CNAA 3H8UA 4OUSA 3NAPB 4I3PA 4DY5A 4QQ2A 5CFCB 2BFUS 2HWC2 1RUI3 2QCSB 1NQJA 2VMGA 1LGCA 4DXZA 1DGLA 4JGZB 2AZ5A 4META 1ZRCA 3T1MA 4GWNA 3ZXEA 5JMCA 1DYPA 4P9IA 2C0ZA 3POSA