4AFDA

Structural and biochemical characterization of a novel carbohydrate binding module of endoglucanase cel5a from eubacterium cellulosolvens with a partially bound cellotetraose moeity.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
128
structure length
127
Chain Sequence
GADIVLFSGSKHVEFTDWGGTDWPSAYELQPPYQTMPFDLNKNFEIKVDYSGADIVLIFARWEHGSKPQIWAQSPYYVVDGTAVFTKEQIAKAYGSDDFSDLDYIGVKPLPSADGMTVTKIVASYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE CEL5A
publication title Understanding How Noncatalytic Carbohydrate Binding Modules Can Display Specificity for Xyloglucan.
pubmed doi rcsb
source organism Eubacterium cellulosolvens
total genus 24
structure length 127
sequence length 128
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18259 CBM65_1 Carbohydrate binding module 65 domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1070 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4afdA00
4BA6A 4AEKA 2YPJA 4AEMA 4AFDA 4AFMA 5AFEA
chains in the Genus database with same CATH superfamily
5GM0A 5B4NA 1V6MA 5IUQA 5KHJA 4TXWA 5LRSA 2J1SA 1DLLA 3PJQA 2HEVF 4JHZA 1KFUL 3QLQA 4Y5SA 2KXLA 1LAJA 1NUKA 3PIGA 3ZYPA 4YW6A 4ZXKA 4AG4A 5C3OA 3RZJA 1AR73 4LR4A 2X53S 3M3IA 1NE6A 4QGNA 2IFWA 3HWJA 2HWC1 1REEA 3ENRA 1YFYA 4HANA 3VHRA 4XQ4A 5BPXA 4PF1A 5FPAA 1QDCA 2D6OX 2JEMA 2ZAAA 1AR81 2NQYA 3CBNA 4K1ZA 4NUBA 4OI2A 1RUH1 3FE5A 2Q1MA 4FPLA 4AEMA 2XBO2 3VBUB 1P8JA 5DQ0A 4IEQA 3FMGA 3IZOA 3SLIA 4F83A 2BOJA 3AP4A 3P5BA 4FXKB 1AYM1 3GCWA 4XJWA 5C8CC 1SBEA 3K3OA 3PU3A 4FPYA 1OA3A 2R0HA 3WCSA 3WVJA 3WNLA 4ZKTB 2C5DA 3E6CC 4COZA 2EF6A 4GMP3 2RDQA 1SACA 4GULA 3T2PA 4L8QA 1KITA 1JZ7A 2JXAA 1IZ3A 1CD3G 2VTXA 1DBNA 4XFAA 3ECQA 1DGRN 1W6PA 3LEGA 1ODNA 4GJYA 1RUF3 5I0TA 1WD4A 1MEC2 1SPPB 4NVPA 4FTEA 2JG8C 4Y24A 5KWRA 1KDKA 3MV01 1PGL2 1V6IA 2W47A 4OMCA 1WCSA 1BLZA 1BK1A 5IK8A 3WW3A 1S2BA 4A6SA 2NLRA 5FZ7A 1YIFA 3A23A 4OZXA 1RXGA 1OURA 3UL2A 2QQPA 3OSDA 1LENA 5LY2A 2ZJCA 4LO4B 4CEWB 4W6WA 4CUBA 1MS1A 4PJYA 1J58A 4QX0A 1REDA 5BY5A 1N1TA 4ISQA 2X8KA 3VN4A 2JDYA 3OGJA 1O5LA 4JCKA 2YZ4A 4QXBA 1OKQA 3K75B 4WM8A 5H9QA 1X9TA 5BV6A 2LW8A 3USUB 2OYZA 5A3WA 1H4HA 2BV4A 1GZ9A 4LKEA 2RVAA 4QPIA 3RVHA 3VKLA 3ZXDA 5FFOC 2YU2A 2VMCA 3HMYA 5A80A 5JR7B 3JXSA 5BNOC 2AENA 1NE4A 3V56A 4COUA 4JDMA 4YG6A 4HPKB 4OVEA 4YVSC 5CFDC 1YFUA 2W3JA 3KM5A 4P14A 4BXFA 1JZ4A 3ZFEC 1ZREA 2DDUA 2G1MA 4I3GA 1O3TA 1UY1A 3URFA 1NY71 1IPKA 1VRH2 3GYDA 4Q4W3 2D43A 3ST7A 2VOVA 2GALA 4XBQA 1PO22 2J1RA 3WNMA 3ZKYA 4AHXA 4IQPA 1CPMA 1GWMA 2BEOA 2P5BA 2P3YA 3WSOA 3RWKX 1KFXL 3VZKA 3N7KA 1DYKA 3S30A 1RUI1 4XDOA 2JIGA 3TWIA 4JGZB 4QD2A 4GWMA 1UO9A 3FHIB 3HBKA 2E33A 2EICA 4SLIA 4JX0A 2XVGA 1Q3EA 4UFMA 5HXMA 3HAGA 5FRAA 4QQOA 4JGYC 4Z92B 1SMVA 1T2XA 1WBLA 4COVA 1RMU2 2GNTA 2ZGSA 3RYPA 3FC0A 4NPMA 2CGNA 4AZZA 4HKWA 4BLJA 1E5RA 1W3VA 5A33A 3DXTA 4PQ9A 3AZZA 3LFMA 4CYDA 3TEWA 4XOGA 3I2KA 5FR3A 3SXWA 2D6MA 2P37A 4LE4A 2AGSA 2W87A 4AW7A 1MACA 2VECA 1ENSA 3KGLA 1ZBA3 1YJKA 1ZRRA 5LEJA 3KVBA 4QGLA 3WDWA 1RUG1 3ROUA 3GM8A 1AL21 4LXLA 2WLPA 5F1RA 2UURA 1J3RA 3RDIA 4BHPA 5L9VA 1L7RA 2F4LA 1E5IA 4XMIA 2YY1A 2X05A 3RMYA 3B69A 2GC0A 3KB5A 3AP7A 2Y0IA 5CIRA 2FCTA 2XJUA 3AXDA 4WVMA 5L7OB 1W9SA 2GU9A 5D21A 4OQ9A 2UWCA 3U11A 5ERLA 2JX9A 2VW2A 4PBPA 4CA9A 1WLDA 1RUC3 4UXAA 4JTNA 3PUQA 1RUE3 1JYXA 3ZYBA 5IK4A 2ZX2A 4OI0A 3I49A 1XRUA 1MS4A 3ELNA 1EV11 4EWAA 4Q0QA 1F31A 3ATGA 4O61A 3VBOA 5IYYA 1ASJ2 1H2NA 2FDIA 1DGWX 4NO4A 5F5IA 4QXHA 1H4GA 4AVCA 2VZPA 1XE8A 4Q4V1 3RJ2X 4Q0VA 4N43B 2BERA 1NLRA 1Z7S1 2DV9A 2IVIB 4M3CB 1W6PB 4XDPA 5CKMA 3I59A 3NWKA 4LBKA 2XJRA 3ZYFA 3RGBA 4A7YA 3NNLA 2DFBA 2XG3A 4FOQA 5F32A 1IG0A 3MBWA 3DECA 4Y1VA 4YM0A 1YQ8A 5HBAA 2FMYA 2NPIA 4Q0PA 3ZXAC 1NLSA 5T50A 4GWJA 3GBFA 1XNTA 2VOWA 4WBBA 1J3QA 5I8TA 3FZ3A 5FYUA 2EAAA 1FYUA 1K5JA 1R081 2PTMA 4YW5A 2WQ8A 3WNOA 1OQ1A 1JOJA 2DYCA 2Q0AA 4CTEA 3PTRB 3VDDA 5FPXA 2ZX0A 3IB3A 5F5AA 2PLV2 3CQOA 2B46X 1DF0A 3LPGA 4H14A 3SITA 1XC6A 4CCMA 1EAH1 3NO8A 3WQ7A 1IS6A 1M4WA 4CVUA 2C6SA 2JG9A 2RDRA 4IL7A 5LRRA 5LA1A 3RS6A 3EMRA 4DRRA 5IVCA 4CCEA 2XVLA 2QQUA 2P3IA 3MUY1 1WW6A 2X29A 1C8NA 4WM8C 5IHRA 3W5NA 1JZ3A 5DAXA 1LHNA 2UU8A 2UWBA 2GMPA 5BYNA 2PHUA 2ZEWA 1LKNA 3C7HA 2I45A 2Y6LA 3H1MA 4JKLA 4MGKE 4QPIC 5DDJ2 5C4WA 5T5JA 3MFAA 4DUVA 2ZHLA 4HSJA 2VNRA 2O0OA 5FZAA 3RI8A 1VBD1 1HB4A 4CDWB 1DQ5A 4XF0A 5JMOA 1NOVA 3FBMA 1NCRA 1D2SA 1OC1A 3JBG1 4BJ0A 5T52A 3VLBB 4AAXA 3RWNA 3NAPB 1NA1A 5DG1A 4QMAA 5AFBA 5D8AA 2AR6A 3N35A 4XXAA 2RR12 4IE5A 3AKPA 4W8JA 4YGBA 5B2GB 4PLNA 1NXMA 1DYPA 4OQ8A 2VMIA 1H6XA 4IETA 5A7OA 1DGWA 5HI0A 4BISA 3AMNA 4DEQA 3WF1A 2JECA 2XBO3 5J98B 4K1YA 1FOD3 3O1PA 1Z78A 3KLSA 4XUOA 4YZ1A 1DGRA 4K6BA 5J48A 2ZOEB 4NWWA 5T5LA 2J22A 3CJIA 1GZWB 2ZS6B 1A6CA 2ET1A 3AYDA 1POV1 3ILNA 3G6JB 5GZEA 3CNAA 1HQLA 1VALA 1ZRCA 3I3DA 4HOOA 2YGLA 1OFNA 3EBRA 4YG3A 2XWJB 2Z79A 5F39A 1H8TA 4Y26A 2WZR1 1N47A 1MEC3 1HX6A 2R071 4YW2A 3RZHA 2QDNA 2RMU3 2VUJA 1WMFA 2WQZC 3WF3A 4BK4A 4NN0A 5LA9A 1UOBA 4XAAA 1BCXA 3DV8A 3A0KA 3ES1A 5FZ3A 3C7FA 1ZYBA 4Y20B 3V0BB 2XXZA 1UWWA 1HDKA 2CNAA 1ALYA 4RL7A 3HD8B 5I0SA 3VDCA 5IW0A 3T2TA 3AKTA 4KG8A 4C91A 1SG3A 1UYZA 4D6QA 1KD7A 1AR62 2VR4A 1XQNA 2BJSA 3B93A 4LBQD 1OOPC 1RGSA 3AK0A 5FWEA 1VBB1 1W8FA 1GP5A 1HLCA 3IIIA 3QCWA 1STMA 4LBQA 2PMWB 3RFRA 1MQTB 4CDQB 5FZ0A 3RPQA 2ADDA 1ZA4A 2C26A 3U07A 1QGLA 4ZU5A 1UN1A 3L9JT 3B9IA 3POJA 2Y26A 4NROA 1XOYA 1V70A 2IXHA 4H7MA 4KWUA 4ATFA 4XUTA 4DUWA 5LASA 2VZUA 2YC4A 4L99A 1UU6A 3VBOC 4KMQA 1IS4A 3ZFGB 2X5IA 4LA2A 4Q4X1 2GC1A 4K8RB 3ZVXA 4HN0A 5FZBA 1Q56A 3KT7A 4Q1RA 3QH7A 2V4AA 3WQBA 5C3QA 2JDHA 1PO23 1UYXA 4LPLA 5FUNA 2Q8OA 4B3NA 4FFFA 3IPVA 1JOPA 1BVP1 2JICA 3ACHA 2YC2A 3H0OA 4FPGA 1JYVA 1A3KA 3DKQA 4ASMB 4FAHA 5FY1A 3MF6A 1COV1 3BB6A 1VBE1 3JU9A 4S2FA 3UKVA 3WZ1A 1ZZ7A 4XHXA 2ZX4A 2NMOA 5F5CA 1S0IA 3O14A 5A3TA 1EY2A 1HW5A 2AREA 3VZMA 1YQ6A 2CWSA 5T5PA 4CSWA 3PDQA 1RMU3 4ARXA 3AL6A 4BQ2A 2ZGNA 3PJYA 3VDDC 1QJY2 2CDPA 1LOEA 1B09A 2Y6KA 2PAMA 1AX2A 2PXJA 4LHLA 5H9PA 1VBA1 2WQ4A 1X82A 4J25A 4EYUA 1ZBE1 5EPAA 1CZTA 2D93A 4CDXA 5JSOA 5FQ0B 5JZGA 4HMZA 2JG9C 4RFRB 5FXZA 3AKSA 4R52A 5FZLA 4WZCA 2OPKA 5D1IA 4BE3A 4FPKA 1IOAA 3OB8A 3WNNA 3MEPA 2EXKA 2FCVA 3MIDA 2PHXA 4YFZA 1NA1B 3VUOA 2JD9A 4FAGA 5C4WC 5D8AB 3BGAA 2Y38A 1PHMA 2RE9A 4MYEA 3P6BA 3I2HA 1X50A 3BUCA 1BYHA 1UL9A 3G7DA 4I0BA 4IEUA 4XACA 2ZAHA 2CGOA 4M3CF 3NW4A 1NCRC 4X6RB 1HXS1 3A22A 3PL0A 5FPZA 1WMXA 3HJRA 3CMGA 3T1LA 4BQXA 3C7OA 1W2OA 3A0NA 2Y0OA 4MGZE 4AQ2A 3KD4A 4HVOA 1RXFA 1ASJ3 3AFGA 3LB9A 5LA2A 4AI0A 1GZCA 3KMHA 2B7YA 2ZKNA 3L2HA 5DPNA 1XU1A 4H7LA 1F4HA 2WAOA 3M70A 1QDOA 3B02A 4MHUA 1H8TB 4FFGA 5T54A 3J7HA 2QQWA 1U5YA 2GNBA 4Q27A 4Q4Y2 1AR72 5DG2A 1AXZA 1TE1B 1W05A 4QDQA 5DUUA 5FY4A 2KM2A 1Y3TA 2WFPA 4QX2A 4Y1YA 3BVCA 4Z2WA 3CJIC 2FMDA 2R062 1R64A 1W8HA 3CU7A 3KV6A 4YW3A 5JSRA 3VBSB 2P6CA 1D4M1 1QIQA 3IDEA 1N1SA 1CAUB 5FZMA 4W6XA 1LB2A 2BBVA 1W8WA 1KDMA 4XFCA 5BXXA 5KXDA 1H8TC 3HIFA 3VZNA 3IDCB 4FXGB 2JDMA 1JU3A 4LMFA 4XTPA 3ZN5A 1Y43B 3DPRA 5CFCA 2VOTA 2ZA9A 3VBRA 4P9YA 1OLRA 3DUIA 2PHLA 2VO5A 1CJPA 2WO1A 3HR9A 2O14A 2QBXA 4GWIA 4GWNA 2PLV3 3BCWA 3ME2A 5LBEA 1CX4A 1HRV1 2H0VA 3J8F2 5FYVA 5KR7A 1RVF1 4GIQA 5JIUA 4ONUA 4R9CA 5E16A 3UGGA 1FV3A 4X8PA 4RS5A 1DHKB 1MVEA 2RJLA 4XFIA 5JXGA 1W03A 4YLZA 2ZGUA 2GNDA 3I8TA 5FYCA 3PMSA 2J7MA 4M0HA 1DZQA 4LHSA 1UU4A 1H1MA 2A71A 3E5XA 2QQVA 5C7GA 2JB4A 4BQYA 5DDJ3 4RR3B 4AEDC 1I9RA 2LRPA 1ZZCA 2WS91 3VZOA 4TLFA 4CPBD 4INDA 3WD5A 1CGPA 2DWRA 4RD7A 4BZ4A 2XONA 1SCRA 4NR1A 3SMHA 4CPBA 1LGNA 3LOBA 1SDWA 3ZPYA 5IVJA 2X5IC 3MPPG 4GH4C 5A1AA 1PO11 1OD5A 2WYSA 4GMP0 3N3HA 1PVC2 4N9HA 4V2VA 4AAPA 3O12A 4ASKA 2NM1A 3THTA 5K7PA 3ZPOA 2RR13 5JUVA 1H6YA 1HKDA 3KSCA 1PZ9A 4DPNA 1QJU3 1V0AA 1W8TA 2JDPA 3J7MA 3LA2A 4B8EA 1NYWA 4RN5A 3HQXA 3OUJA 3ZYHA 2Q5TA 4A3XA 2HJIA 3S7IA 1JYCA 1YC61 1E5SA 4Q4W2 4CDXB 1VBC1 2DCZA 2DCYA 2GAUA 3OBRA 5LK5A 1SCSA 2ZGTA 3ETPA 4TYSA 3NVCA 2R49A 1VJ2A 1FMD1 3U1XA 3LEIA 3AVSA 1JZ2A 2G9FA 3POEA 3RZGA 1B35B 1X33A 1PIV3 3WHUA 4GB33 5EQUA 4D69A 4ITCA 2ZEZA 3LE0A 1JXNA 5JZGC 2LALA 3WXPA 2HWD2 3ASIA 4MGYE 4ZONA 4KU8A 2Y6GA 5ANNA 1LOBA 1UAIA 3POSA 2GC3A 2PA7A 4AVBA 4FTSA 4LIVA 2E6VA 4OCTA 5JOWA 5CEHA 2YBKA 1BMV2 1AR63 3VL9A 2FHRA 3EO6A 4YW4A 4AOCA 1U5XA 2B45X 4NHYA 5FP8A 1ULGA 3UK9A 2JG8A 1NXD1 3N7JA 5FZOA 2HKXA 3GALA 2VGDA 5KC6A 1NAEA 3BALA 5F37A 2W2IA 4FQZA 4C0HA 2CSGA 3I2IA 1V6LA 2JDNA 1JUHA 2FDHA 3H1WA 4O9EA 2R042 4ZZ8A 4LBJA 2FQPA 2OA2A 1G8WA 3NV1A 4XBLA 3B00A 4RGAA 5FWJA 4MGTA 4DXRA 2VMHA 4HLTA 3WF4A 3ZIXA 3Q9OA 4PI2A 2VZ1A 2VTFA 3LSDA 4HVQA 1O3SA 1IHMA 1RC6A 2O8QA 1R092 1TME1 2XUEA 2OKXA 2ARAA 4LLFA 4L9BA 3POBA 4CEYA 4COWA 2WNEA 2ZMLA 4LK6A 1F8VA 1H9PA 2GMEA 2VBBA 3K4AA 1RUE2 3H8OA 2FDGA 1K5MB 1OUXA 2VQAA 4Q0SA 4ORFA 3DPRB 5CFCB 4IEVA 2YPJA 5BNOA 4DQAA 1OQDA 4YVSA 1TQ5A 1DDLA 3AXEA 1AX0A 1WA4A 1Z0HA 2A5ZA 1V9U2 2DURA 2HLEA 4ISRA 1IGOA 2V72A 2ZHMA 4Q2FA 1K3IA 1EPZA 1W9FA 3GJAA 3LKJA 3WW4A 3FN9A 4CCDA 2XR4A 4M0NA 5FZ4A 3VBRC 3E97A 1JN2P 1Q8QA 1OMIA 4QKBA 4A45A 1FPN1 5BNPA 5IT6A 3GHNA 5DN2A 1XNCA 2ID4A 2JKBA 3ZSEA 2Z2SB 3UV9A 4IXLA 2PFWA 1QJX2 5K4LA 1GQGA 1U5IA 3E6DA 5FZEA 2VNOA 1ND3B 2YB7A 4RS5C 2WO7A 1N1YA 1AR92 2Y34A 4M4PA 3B5LB 3GGLA 2P3KA 2SBAA 4A7ZA 1QU0A 3H8XA 4JGYA 3SQOA 5FK7A 3PHMA 1BBT2 4XCBA 1MZFA 3SHRA 4F7ZA 3VDBA 4GD4A 2HWF2 4GZ9A 5FO8B 2VZSA 3C8XA 3OEBA 1SLTA 4PBOA 3AMQA 4AVSA 1W90A 2X09A 3LIGA 2N7GA 3U37A 2WT0A 4Z8BA 5A1FA 3O1TA 5LCWL 1R1A1 1IQAA 2VCCA 1RL3A 3M4FA 4QX5A 5DAPA 1JBCA 3AMHA 3LQCA 2ADEA 3NNGA 5IFTA 3GZEA 3MW2A 1WCDJ 2VJXA 1UW8A 1DIWA 5CVRA 4WM7A 5A7PA 5F5QA 1JUIA 2E7TA 2Y60A 4XAEA 3TN91 2ZGPA 3KGZA 1FATA 5ACA1 2JKXA 3AZXA 2O1QA 4M4RA 5HV4A 5AC91 3OY8A 3WF0A 1TVGA 1HIXA 1C57A 1RUD1 3RI9A 2DBNA 1UOFA 3NSTA 4BMBA 2IXLA 4BM8A 4CP2A 4HT1T 4AE2A 3POIA 4MADA 1S2EA 4CDUA 3LEKA 4ZU4A 5G05L 1SLLA 2WBKA 1AYN1 4Q4Y3 2YBSA 5DZEA 2JE7A 5APAA 5C8CB 5IVEA 5I0UA 1J59A 2W08A 3QACA 4UW6A 4DZGA 4CU9A 2R063 4WVZA 3W9AA 1CAWB 1BKZA 3ZN4A 1YXWA 5A3NA 2FDFA 1Y7BA 2C24A 2B4KA 1UZZA 3UKNA 2WA4A 1J83A 1QY4A 1UKRA 2O8OA 4AR2A 4RHV1 1CIYA 1TEIA 4E8DA 1L3JA 2J42A 2W94A 1C8M1 1FOD2 1Y9GA 3VZJA 3U4XA 2VBPA 2JG8B 3AMMA 1RUJ2 5CB7A 4U2AA 5FZOB 1O3QA 1O91A 1VPHA 4BIOA 1BEV1 3RZMA 4BB3A 3PIJA 4LUMA 1IKQA 1SLIA 3J8F3 3OJBA 4L11A 5E88A 3KCCA 1G7YA 3PURA 1TMF2 1ZVFA 3Q8FA 4XDQA 5KHKA 1KQRA 2HWB2 4HVRA 5FZKA 2XKPA 3PMEA 1Q43A 1WWYA 2RMU2 5A3LA 5FKBA 5C5UA 1UPIA 1W9TA 4MG2A 2A6XA 3P3NA 3I3EA 4AFBA 1W6MA 3HN3A 5HCBA 1GWKA 1CIWA 5A1LA 1YO8A 2XHKA 2XMLA 2WC2A 1GNHA 3OF1A 4JC1A 5FLIA 5BNOB 4PIYA 2BVBA 5IJRA 4EQVA 4DINB 3NRUA 2VC9A 4RSUA 2NYYA 5CFDB 4YVSB 4QXKA 5FXXA 1OF3A 4XXPA 4KGGA 1PVXA 3ACFA 4MXWA 3ZFEB 4MX3A 1W06A 2VM9A 4EN6B 1FAYA 2XB6C 4CEYC 2RM22 1X9PA 2W1SA 1DFQA 1PVC3 1FX5A 2FCUA 4IEWA 4URTA 4UWDA 5DUXA 4NMIA 4DMIA 1W99A 4WVVA 1NKGA 2ZCWA 5J36A 1EUTA 3TBDA 2TUNA 1FV2A 4UI9L 5FZIA 2VVEA 4QX8A 2HYKA 2XH6A 3SCGA 2BOIA 2YFUA 1AR71 2E31A 5FP4A 5FZDA 1QOTA 3RZLA 2Y8KA 5JOYA 1G9CA 3AVRA 2RS52 3AP6A 3D6EA 3MIEA 4JGYB 3WG3A 3N36A 2E7QA 2R7EB 2E53A 5FZ9A 5BNPC 3OBTA 4DY5A 1V6KA 4E27A 3LFIA 1DQ2A 2W1WA 2XJPA 3O5SA 5FP7A 4NRQA 4QPGA 2PHTA 1RTVA 2W39A 4CP9B 4DXTA 1BK0A 2OX0A 3UGFA 4AQ6A 4R4XA 1JU4A 1VR3A 2HWD3 1NZCA 4LKSA 4IW3A 4XMAA 3BIEA 1KJLA 5FBZA 3I2DA 4QX7A 4BQ4A 3JUUA 1RUF1 3FHAA 2B9VA 1YQCA 1Z7S3 1UKGA 1OA2A 2HWE2 5T3NA 3HT2A 3T0BA 2LTNA 3O1SA 5FYMA 3OY8B 4LULA 4Q26A 4CU7A 2BNMA 2RDNA 4XUQA 2VAUA 4V1PA 5C9AA 1UOJA 2FBEA 2YBPA 2VE1A 4NHKA 1ENXA 4CUGA 4XYXA 2IXJA 4FOYA 1ZZBA 4WM7C 3LAGA 2C1FA 4X6QB 4EWEA 1HN1A 1YQ5A 2R043 1WUVA 4FPJA 4UW4A 4PHZA 2EAKA 4FO9A 4A44A 3RMXA 3A21A 3DKWA 3MICA 4XJZA 1UZ0A 2SLIA 1CX1A 2J1TA 3MZHA 2BW8A 2BFUS 4CXYA 1YFWA 1OOPA 4FFIA 5FZHA 1LTEA 1MS9A 3AYEA 5FIXA 2ZEYA 3D3AA 5DAWA 1R093 5FMBA 3TYJA 4GQ7A 2KD7A 4PLMA 2B8MA 2DVFA 4CDUC 3MI8A 2UY8A 1H2LA 3AJZA 4NHLA 5CISA 2XJTA 3CZUA 1ND2A 2WWUA 3T0AA 1H1IA 4W4ZA 4JKMA 3WV6A 3K3NA 5DZGA 4M00A 3ZMNA 5EJZB 1AZDA 4LO8A 4AHWA 1V9U3 5C9AC 4R9DA 5K9YA 3FX3A 1E5HA 2MEV2 4AF9A 1CZSA 2VOKA 2YMZA 2WNVC 1LECA 2VG9A 3O1RA 4BA6A 2E9QA 3CDZB 5BNNA 4AGGA 1ZRDA 4YGCA 3CO2A 5FYIA 3O1VA 4BLIA 5BNQA 3H8RA 3LF7A 1WA6X 1G9BA 1GOGA 4XHBA 3AMPA 3S0MA 1W6MB 4O65A 1QJX3 4J6GA 5FBJA 3AX4A 5FO9B 1UMZA 2A70A 3S6PA 1WMEA 1VAVA 3ZM8A 3ACLA 4MSVA 3R4DB 1AR93 3QOPA 4CCCA 2JE9A 3ZSMA 4G9SB 1VLNA 1JZ5A 4CRQA 5JPMB 4TSVA 4C8DA 1BBT3 5AVPA 3S5QA 2BU9A 4QB2A 2HEWF 3LCPA 2HWF3 4FOWA 4Q5OA 2VMGA 4AGVA 3N4MA 3WW2A 4CCLA 2ZACA 4MXWB 3MHZA 3O0VA 4WM8B 4C1WA 5A32A 3B9CA 4LIUA 5HXVA 2WA3A 3N9OA 2DF7A 3A4UA 5A6ZA 1OSGA 5IATA 4QPIB 1EP0A 1ZBA1 4S2HA 4UF0A 1OHFA 3OPTA 4XURA 1QOSA 2BWCA 4K21A 5GLWA 3BTZA 2WFF2 1LHOA 3GF6A 5ABJA 1IPJA 1QMJA 3ZX7A 1QQP2 2EIEA 1K42A 4YZ3A 2WABA 1C5IA 4RA0A 1T6GC 4XFGA 3KHCA 2QDRA 2R073 1GYKA 3KF5A 2VH9A 2RS32 4KH9A 3FBYA 1WGPA 5JI9A 3UNPA 3IBMA 4JQRA 4MUVA 1W2TA 2WAAA 4I0AA 4ZS2A 1RUC1 1AF9A 3ZXFA 5EFUA 4F3JA 3VBHA 5JOZA 2D7FA 4JAAA 5JXJA 3JCIA 3BPZA 1VAMA 4DIQA 4R9AA 5CG8A 4QU2A 4DRVA 4AYUA 1GFF2 3VKFC 3H8UA 4CZSA 4XC9A 3U10A 2Z42A 2R30A 4OHXA 3ZN6A 4GALA 1AXKA 2RV9A 4ES9A 5FPBA 5LEKA 1QJU2 2XWBB 3SEEA 3ON7A 4FI9A 1AJOA 2G9ZA 1AX1A 5A33B 2OIIA 4QPGC 4BWOA 4CP0A 5GLZA 1C3HA 1HRI2 2PHDA 4Y33A 1RUNA 4CCJA 4V2WA 1RUOA 4QHZA 1RUJ3 2ERFA 4A41A 4DOUA 1REFA 5IWFA 3JD71 3OGRA 4KQ7A 3RG0A 3PUIA 4IGPA 4UW5A 1TMF3 1CQ9A 1QH7A 1VE0A 1PIV2 3BTAA 4GB32 1OI6A 1NZIA 2HWB3 1SZBA 3BI3A 4GKYA 4IEPA 2ZHNA 1A8MA 2YPDA 2VQ0A 1OOPB 1PGW1 4WVMB 3VHPA 1C4RA 1S2KA 2DTYA 1PNFA 2XVKA 4PQQA 4XF3A 3VHOA 3WP6A 2ZMKA 3ZOIA 5LBFA 2DBIA 2VVDA 4HXCA 4DEVA 1Y9QA 1UY4A 5LBBA 2VXJA 2NP0A 1MPXA 5GLVA 4AQSA 2RS11 3W21A 1LR5A 2OXBA 5SV5A 1RHI2 2H0BA 1MZEA 1XBFA 5B4XA 2XQXA 4NIIA 3O1MA 5FJKA 3OG2A 4B7KA 5FKCA 3VBOB 3TB0A 1PM4A 2J1AA 2GSYA 4PLOA 5FPLA 3ZXKA 1G9DA 1OFSA 1DQ6A 3ES4A 2ZTNA 4FPOB 2PYTA 3LA3A 2RM23 4YFWA 2D5HA 2WO3A 2XJQA 4EZ4A 5GJ6A 3HN1A 3I59B 4AEDA 3M3OA 5H9RA 4NIGA 3BN6A 4E9KA 4AHYA 1QJZA 4QPWA 5GZGA 2DFCA 2A3WA 1ND2C 1PZ8A 3MDPA 2BTVC 1O8SA 4P9LA 2JIJA 4GH4A 5F9TA 5E89A 4LHKA 1YI9A 1QXPA 4B4RA 3IAQA 1UIKA 2VL4A 1GICA 4YGDA 5FXWA 5C70A 2VZOA 1RITA 2RS53 4I01A 1O7FA 1PM7A 2BDRA 1W6NA 1OD3A 1D7PM 1XE0A 2D6PA 1L7LA 2QQIA 2QQKA 2VZVA 2ZX1A 3D5OA 5BNNC 1WLTA 3VDDB 2P3JA 4FSJA 2WNUA 2XBO1 1SBFA 4UFJA 2AC1A 1KGYA 1ST8A 5FLHA 1KS4A 1HXS3 3MV11 1DYOA 3FLTA 3GHMA 2DTWA 1Y4WA 4YM3A 2XL9A 2AACA 3BYWA 4D7TA 3OBAA 3GNEA 2JG9B 1I5ZA 1DZRA 3APBA 1MS3A 4RQPA 4ASLA 5HCFA 5F8PA 4IDZA 4LBNA 5FYHA 1WLCA 5CAZA 3DGTA 4JTOA 2LUWA 1APNA 1UU5A 4N53A 4E8CA 2RJKA 1MEC1 3AB0A 4SBVA 4YYOA 2F6BA 2HWE3 3OD4A 3SH4A 4BIFA 4Y4YA 1PGL1 2YDEA 4LHNA 3VD3A 3NNFA 4P9JA 3M2MA 5C4WB 3D8CA 4Y5TA 4EV0A 5I91A 2HWC2 3K46A 4PIXA 2B9UA 1KJRA 2CWMA 2ARCA 2V09A 4OFGA 2XHNA 1CVNA 3OCPA 1QWRA 3AC0A 1US3A 1CAVA 4NRPA 4BYYA 5ABJC 1PNGA 3V65A 2B39A 1NCRB 1Q5OA 1AR82 2P2KA 1YYNA 3LOIA 4L97A 4DY3A 1RUH2 2Z5WA 1GBGA 4P00B 3C7EA 2BGCA 5FY8A 4S2GA 2ZGLA 5LW9A 3ZXJA 2NZ9A 4Q0UA 4JDNA 1AYM2 2K0GA 3WDUA 3ZN6B 4RFT0 3VV1A 5CKNA 5FUPA 1IS3A 2QQMA 3RJRA 3VBHC 4CUCA 2OQ6A 5KHHA 5IAVA 3QH6A 3THCA 3LEMA 1JI6A 1UXZA 4Y22A 3WDXA 3VKMA 4M01A 2GP5A 1UIJA 2J1UA 1FNZA 3BU7A 4YGEA 3H7JA 2D44A 1SFYA 2VQUA 3ZFFC 1GOFA 1ULOA 4QT6A 3CJIB 1ZZ9A 1V6JA 2EALA 5I8SA 3UYJA 4MH0E 3TRSB 1JHJA 3F95A 1VRH1 3P3PA 1D4VB 2L9LA 1ENQA 1PO21 1M06G 3DCQA 5CNAA 5E8AA 3SISA 4HFSA 2D3SA 2D40A 2MEV3 5T55A 3RSJA 1J1LA 4YVWA 4OULA 3JQWA 2AH2A 4L92A 4MOAA 3UESA 4GA9A 4QM8A 3PNAA 2R32A 5HV0A 4B29A 2ATFA 2D3PA 5ANQA 4BOWA 4DB5A 2DUPA 5EV7A 3FLPA 3HT1A 2V4VA 4XFHA 2EA7A 2Y6HA 4PIZA 2Y6FA 1UMIA 1W2NA 1I1EA 4XFBA 5CADA 2VZRA 3ITQA 2AUYA 1RMU1 3WY6A 1V6NA 5J1XA 1JMUB 4LBLA 4U36A 2AZ5A 2VCBA 4AEJA 4Y1XA 1XU2A 2LROA 1JOBA 5EXOA 2ZKLA 4LBQB 2QJVA 1NLQA 1UX6A 3AZWA 3B01A 2QKDA 4CE8A 4ZXEA 3T4HB 3WG1A 1R1ZA 4H2AA 1NY72 4AEDB 1VIWB 3AKRA 5EWSA 5C71A 2E51A 2LS6A 3FLRA 3J4UH 4FOVA 2E63A 3NL1A 4Q29A 1Y9MA 2YU1A 3M3QA 2WFF3 4AI8A 1QJFA 1RUI2 2ZEXA 4D7SA 1K12A 2VNGA 2WDBA 2WWSA 2X5IB 3GXUA 4GH4B 1QQP3 4I09A 1NX9A 2G19A 3KT4A 4KGQA 4A6OA 4AVTA 5K0UA 4BXSV 3ACIA 5F3EA 5JSPA 2PHRA 3ZDVA 3IKWA 1MS8A 3BODA 1OT5A 1W2AX 1RINA 2RS33 4XF9A 3B7MA 1CAXA 3IPVB 2BNNA 3K48A 2D98A 2B5HA 2WT1A 4K9SA 5GKAC 3OPZA 2DCJA 3T2OA 1OBNA 3H50A 3WX5A 3MIGA 2VCMA 4E4ZA 3IIAA 4DUXA 4L2NA 2GH2A 1ASJ1 3FUQA 4LTAA 5EIYB 1DGLA 2EXJA 2QZ2A 3HNMA 3ZLIA 4WZFA 2UYAA 5L9BA 3GBWA 4A3ZA 1ACCA 5A7NA 2ZGMA 3K2OA 3N9QA 1WW5A 4LE3A 1G6NA 4XIKA 3H9AA 3ZYJB 3AYCA 5EP9A 5JIAA 2YGMA 2WNUC 4XJ8A 4UW3A 1RUG2 1AL0G 2QQOA 1AL22 3O7OA 1WKYA 1FI2A 2VUDA 1OLQA 1HRI3 3TAYA 3T30A 1JODA 4Y3OA 1QNWA 1ULCA 4J1WA 5JZGB 4P02B 1A8DA 4LO7A 3VBFA 4UFLA 4D6RA 4RQPC 4HSLA 3CEWA 2WNOA 1XB9A 2DU0A 1VB4A 5LWBA 2UWAA 1DLCA 1NT0A 4QGMA 3VDAA 2VUCA 4N53C 4EROA 1NCQC 1PK6A 2CV6A 4OYUA 5IVFA 3TEYA 3WDYA 1EV12 1N3PA 1VMHA 2OW4A 2PLV1 3MLLA 4QHOA 1UD1A 4AI3A 4XUNA 4E2GA 5JOXA 4FVVA 1I3HA 3X29B 2AEYA 2XL7A 1S1AA 1YNAA 3WNKA 4Q4V2 3O0XA 2D6NA 2C9KA 4UAPA 1ULPA 1Z7S2 3I2FA 1RHI3 4OHVA 1MS0A 4IEOA 5JLVA 4E4DX 1U0AA 5FMOS 5FOBB 1YIPA 2BRTA 1VMJA 4FBFA 2KA3A 1YI7A 3KT1A 2MHFA 1LESA 2YV8A 3MLKA 3OPWA 5DDJ1 2UY9A 1H9WA 2Z4FA 3NJVA 4YARA 2BQPA 1DCSA 4IEXA 2I2SA 4LBMA 2W5FA 4EN9B 1LU2A 1F5JA 3E6BA 1GP4A 3GBGA 5A7SA 4I30A 1R082 1LODA 2ZGQA 1LGCA 1YWKA 2VY0A 4OMDA 1H0BA 5HCHA 3WP3A 4XQDA 1SFPA 5GALA 4LKDA 1HQWA 3OGSA 4IERA 1EAH2 4CCNA 2RR11 3DYOA 3O0WA 2DVBA 1UZYA 3RRDA 4YVWC 2ENRA 3PVEA 3WDTA 1R1A3 3ALQA 3LGRA 5FAXA 3AM2A 3VBRB 3SCFA 4JKKA 2BPA2 4QKFA 1O5UA 3EQEA 4OHWA 1XNBA 4E2SA 1LU1A 2VMFA 4BU2A 2CHHA 3ZR5A 3TN93 3M7AA 2JDZA 3FUOA 3NV3A 2BFUL 4RS5B 5FYYA 5FOJB 1K45A 3VKNA 4N7IA 2QQNA 2GP3A 1F5FA 4URAA 4FP3A 3VL8A 1UZWA 1VBD2 3IAPA 4XFFA 2ZBJA 2HBUA 2VZ3A 1BJQA 2WUHA 2YG0A 4NOTA 3J7LA 4BQ1A 2E26A 3AL5A 3NKTA 4XF1A 3JBG2 4CEWA 4MXVA 1VB2A 5DAQA 3WP4A 3CKHA 4A4AA 4P5YA 5F2SA 2C9AA 3R0RA 1UOGA 2YFZA 5FZGA 3FFZA 3S57A 1SDDB 2HWC3 2VZQA 2H6CA 2ZGKA 3N9LA 2FDJA 4G3YC 3LSEA 3POGA 4WVWA 5IVYA 3USUA 2IXIA 4BQ5A 4UFKA 2DUOA 3H3ZA 1DQ1A 1AR61 4XZUG 1AR83 4ZZ5A 1UY2A 1RUH3 5K0UC 1VRBA 3JB4C 3LDBA 2ZZQA 3I7DA 5DUVA 4D3WA 4XABA 3WDVA 1ZRIA 5FYSA 1AYM3 4HPKA 2K9ZA 2QNKA 1UCXA 4GXLA 5IK7A 1UYYA 3PUAA 1U12A 1GP6A 1CZVA 2VMDA 4MHRA 1JH5A 2W92A 2VCAA 5JXIA 3OD0A 4JDOA 5F3GA 3SKVA 3GZUC 1LJ7A 5IFPA 1ENRA 2WZR2 4PDWC 5JAXA 4I2OA 3K51A 2R072 2PN5A 4JGZA 1WCQA 4LITA 2OUJA 3OUIA 5A6XA 1YRZA 3U0ZA 1BQPA 5J09A 4LK7A 1HV0A 1OH4A 2A73B 2VTXJ 4OUSA 3EHKA 2A3YA 4UOJA 4FPEA 1C28A 4OI4A 2A6YA 3I2GA 4R8HA 2W9XA 3WINE 4XTMA 2PHFA 1W0NA 1HN0A 4QDRA 5L73A 2RG4A 4B7EA 5KBFA 3KV4A 4AFAA 3J7NA 3D4KA 5EYYA 3VBFC 1LOAA 5L19A 5EJ3A 1NQDA 1VBB2 3WT3A 1J1TA 2VBDA 3SKJE 4IUGA 2IC1A 1XNDA 3WW1A 3WR0A 2BP6A 1PK6C 2WO2A 5DMYA 1POV0 5LZ6A 3TEXA 2P17A 2WNVA 2R1DA 1O6UA 1QJY1 4N90A 4CXWA 4NIHA 4IGQA 1W6QA 5A6QA 2B42B 4EN0A 3N9NA 2WLQA 3NNMA 1OXCA 4QAWA 3OBZA 4ZS3A 5C6CA 1T6BX 4K40A 4LEJA 4Q4X2 5CA6A 5JMCA 3EXUA 1O4ZA 1W6OA 3ZXEA 2VULA 4CXXA 2UYBA 3HVDA 4MO3M 1IQDC 5L7OA 3IDBB 1O4YA 3MYXA 1SQ4A 5FMCA 5JI7A 3GZTB 3VD9A 2WT2A 2D6KA 4MVTA 4TLGA 5FY7A 4CP1A 1IPSA 1RUI3 5FYZA 4OUEA 2ETEA 4D0QA 2GMMA 2ZGRA 3VKOA 4A42A 1E57A 2I07B 4PCRA 1COV2 1VBE2 4CEYB 4JRLA 1A78A 4BMEA 3HQUA 4EE2A 5A7QA 3W58A 3MIBA 1W2UA 4RGGA 3Q8EA 4FPFA 3T2QA 4N9IA 2A75A 4LO6B 1W0OA 4NPRA 5DABA 5GZFA 1D0HA 4N43A 4M3CA 4Q8KA 1ZZ8A 1JZ8A 3IMMA 3WF2A 3EYPA 1YLLA 3VBUC 2Q30A 5H9SA 2DCKA 3U4SA 4CCOA 5I0DA 4AFCA 1VBA2 1GSLA 4A7KA 1ZBE2 2Y64A 3LZZA 1O8PA 2WINB 2Z69A 4NPLA 3MFCA 2MNGA 4FT8A 4LLOA 5KXEA 5GZDA 4EWDA 2VW0A 1HB1A 3K4DA 4LJHA 5BNPB 3ZDSA 2G4IA 3IMNA 1HB2A 1RUG3 1AL23 1LOCA 3KVAA 3MLJA 4Q4Y1 4Z07A 5F2WA 5FMDA 4ZU7A 4BCUA 3KV5A 3KCYA 1POQA 2GDFA 3HNBM 1ONAA 3N9MA 4LQRA 1S0JA 2R061 4LO5B 2BZDA 3MIHA 4DS0A 2OZJA 4P5HA 2G9GA 2R1BA 3L2YA 5FZ6A 4KWKA 1U5ZA 4W65A 2WSVA 5JPNB 1UQXA 2PAKA 2BGPA 1SEFA 5LK7B 4LT5A 1WMDA 2EXHA 1SHWB 1SLCA 2W46A 1LCLA 2CY6A 4ATEA 3I54A 2CL2A 1CJDA 1HXS2 1SLBA 1WD3A 3HOBA 2W52A 4CEWC 1URXA 4B1LA 4JZRA 4W6YA 1H30A 1ULEA 1EV13 4LOSA 1PMHX 3WUCA 4GMP1 3WEZA 3J8F1 2RHPA 1QXRA 3QBQA 5FZCA 1ZNPA 4NWVA 3C2UA 2FZ1A 4K20A 2W91A 4C90A 4EN7B 4Q4V3 4WM7B 4QKDA 2ZHKA 3PLQA 2ZABA 1QF3A 1KS5A 1N3QA 4MGQA 2P34A 4CDWA 3BTYA 3FL7A 1MZ6A 4JRAA 1JHNA 4OUMA 5SV8A 4ARYA 3F2ZA 4HK8A 5FZ1A 3SC7X 1LULA 3E5QA 3AYAA 4ES8A 3NAPA 1S0FA 1D4M2 1LEDA 4CDUB 3I3MA 4ZPIA 5C3RA 4FP2A 4MGSA 2ZMNA 4TWTA 1H2KA 1ZZ6A 1R083 4JGZC 1JS9A 3SNMA 2ARBA 1YCIA 3C3VA 4FPHA 5CYYA 2CGPA 3I4IA 5FYBA 3CZJA 5FP9A 1PVC1 1XE7A 2YHJA 1HRV2 4D7YA 2CU5A 1EAH3 1RVF2 2EIGA 4QQHA 1UY0A 3PVBB 4EJRA 1I6XA 1W8OA 4FCAA 3JZVA 2WNVB 1O3RA 1GZWA 1EUUA 4R9BA 5L36A 1CN1A 3MF9A 1W6QB 2XGXA 4LKFA 3LD8A 5FPUA 2V5DA 1GQPA 2XJVA 4Q4W1 1LOFA 1OVSA 3KWVA 4NHMA 3M3EA 4YNIA 1W6OB 3V64A 3ZIWA 2JDAA 4XEZA 2TBVA 1OVPA 2WS92 3MW3A 3FFQA 1VBD3 1D2QA 4Y20A 3V0BA 1PX4A 1UZVA 4O7XA 1O4TA 3KQ4B 3FWEA 4MLOA 2IVJA 1FNYA 4KBZA 2GC2A 3JBG3 1WCUA 4E2QA 3RZZA 2F17A 1PO12 3JQXA 2HWD1 3VB9A 1W28A 3EB7A 2R0FA 5EZWA 5KXCA 4FPCA 2ARXA 3PVOA 2IUWA 1W8UA 1NQJA 5L7OC 2I74A 1MQTA 4CDQA 2YXSA 3MO4A 3AFKA 3OTFA 2ILMA 2WIIB 1W9WA 2XKOA 3CL1A 1BMV1 3VD5A 2JD4A 3BPSA 4YWAA 3ZSKA 4Q8LA 4I0WB 4IGOA 5CU1A 4IE4A 4YZ4A 2FDKA 5F3CA 2PQQA 2WZPP 4CU8A 5I8YA 1VBC2 1O59A 3ZFGA 3VGIA 3Q8AA 1GV9A 2GH8A 4XJAA 5M0TA 4IEYA 3UKTA 1ZRFA 3JD73 4N43C 2R041 1FMD2 1POV3 1OQEA 2WR9A 4ZY9A 5L9RA 5A3PA 1GWLA 5FZFA 2D3RA 3B94A 3H42B 2WZR3 3UJOA 3RQ0A 2TEPA 3KZ4C 1ZM1A 3I2JA 4XETA 4MZUA 5FPVA 2ET7A 1R091 4FTBA 1HJGA 4OHYA 3W5MA 1LHWA 1MZ5A 2DVAA 2GN7A 2W1QA 4IE0A 4MV2A 3RNSA 4JQTA 2D5FA 1TNFA 1RUE1 4UBGA 4LA3A 3BIWE 4ET7A 3M8LA 2ZGOA 3OOXA 2JDUA 4QPGB 5CZKA 2RS13 5CKQA 4KNCA 1GNZA 4PI0A 3O1OA 1DQ4A 4S2DA 4YW7A 3I3BA 5F3IA 4JVAA 3ZFFA 2BGOA 1VBB3 5A3UA 1V9U1 1BVVA 2FZ2A 3HBZA 5JR2A 4META 3AP9A 5FQ0A 3QD6A 3E5UA 1XSQA 2OPWA 2WL1A 3MW4A 5FCCA 3RYRA 3VZLA 3WCRA 1Q8VA 3T08A 4D94A 4HETA 1H1AA 1A34A 1IKPA 5C9AB 1LOGA 2WRAA 2Y6JA 4HONA 5IK5A 1OPMA 1QJX1 3SH3A 4M3CE 3SH5A 3MGUA 5HPOA 4Q4X3 3IDAA 1TME2 2BNOA 3TOJA 2OQ7A 5FK8A 1AR91 4AGRA 4LOTA 4CDWC 1QHDA 1BBT1 1RB8G 2E7AA 3INAA 2HWF1 2BUKA 1MR5A 2CAVA 1QOOA 3USSA 4AWDA 1UXXX 4UFHA 5FY9A 5LA0A 1W39A 4E4HA 3KF3A 4YG0A 2XQRA 2WN2A 4IE7A 3S5AA 5DAVA 3K4ZA 3NAPC 1COV3 1DQ0A 1VBE3 4N7UA 3CIHA 2Q8DA 4DNYA 5J96B 1OH3A 4L0PA 1YUDA 3WUDA 3LDKA 1I5PA 2WWJA 1OLMA 5DUWA 3ZYGA 3GZAA 4AI9A 1ND2B 4XQWA 1FPN2 5FY5A 4P9WA 2Q8EA 2ZX3A 4FQ4A 4AFDA 2BVVA 4LNVA 4TN7A 4TTGA 5K8SA 3TEZA 2JB8A 3IWZA 5F6KA 1JZ6A 4FFHA 1S0GA 1GZTA 1VBA3 2VQTA 3AZVA 4XPVA 3T3YA 1Q8PA 1RJ7A 1ZBE3 5GZCA 1WCKA 1F35A 1IS5A 1FT9A 4LUKA 4X8NA 3ZXLA 4G4FA 3VBSA 5BNNB 1PGSA 1CPNA 4MGIE 5A70A 1D0GA 1CAUA 2IFRA 3KCXA 2HEYF 4DFSA 2RDSA 3ETQA 4I02A 2DCTA 1GLHA 2CTVA 2VOXA 1LOFC 4XUPA 4COYA 2HBTA 5FMOL 3OYWA 2IZWA 3RYKA 4AK3A 4B4QA 4HKOA 4YZ2A 1R1A2 2R6QA 1LEMA 4UYBA 4Y1ZA 2A6VA 5E6HA 4NE9A 1BHGA 3DF0A 1S55A 4YW1A 4IV1A 3KHBA 3BOWA 3KV9A 1QNYA 5CBLA 2WSUA 1LHUA 3NJXA 5A32B 1FOD1 1US2A 1RUJ1 3TN92 5GLUA 5ACA2 5AC92 4BK5A 4UF0B 4K3UA 1ULFA 2ZZJA 2XUMA 1MQTC 2IWGB 3ILRA 4CDQC 4H55A 1RUD2 1VRH3 4LORA 5FJHA 3TNPB 1TMF1 4XJUA 4AHZA 2VUAA 5FUIA 2EIBA 2F4PA 3M3CA 4RR3A 4B1MA 5ABJB 2HWB1 1YFXA 2GZWA 3BU0A 1LRHA 1PX3A 3D82A 1NCQA 4QHBA 2EIDA 1YJLA 2RMU1 4LBOA 2YROA 3W59A 4F8AA 2XPJA 1AYN2 2QCSB 2JDKA 4K7JA 5T5OA 2RJ2A 4RGKA 3LA7A 1S0EA 3UETA 3ZFGC 1ULDA 2X10A 1MS5A 4J1XA 3WQ0A 2AYHA 5FDBA 3TNQA 1XYPA 3HNYM 5C5TA 4BPZA 4O9GA 4QQ2A 5C8WA 3VBHB 4XJ9A 1D4M3 3LPFA 1GR3A 3OGVA 3J9SA 4QKNA 5AVAA 1DG6A 4KI5M 1KRIA 1H8VA 3J26N 4RHV2 2DVGA 2WN3A 2K2SA 4QXCA 2LM3A 3HEIA 4QU1A 5D2AA 5G04L 4CU6A 2TNFA 4NIAA 4IE6A 1C8M2 2XLGA 4RYDA 3ZFFB 4Z1VA 3P1IA 4P9XA 3BOPA 2QQLA 2E32A 1BEV2 2RM21 4IV3A 1LHVA 4XF4A 1SLAA 1XJAA 4D6SA 1HRV3 3ABZA 5AFEA 5E1RA 1RVF3 1F4AA 1G9FA 1OPOA 3PUHA 1QJEA 1VP6A 5LBCA 3I97A 1CONA 3LDRA 3H1YA 1WW4A 3NNJA 4AEKA 2NN8A 3CF6E 4YPJA 4I3PA 1B35A 3ZKUA 4EN8B 4OLLA 4QX3A 2OUHA 3IM0A 3ILFA 3ZYRA 3SEPA 5IVVA 5EYXA 2RS51 1GOHA 4GKXA 5FREA 5JVVA 4AI2A 4TZDA 4HKLA 1GNYA 1VAKA 5FLJA 1AVBA 3H3LA 1JYWA 1S0DA 2BWAA 2WS93 1W0PA 4C0BA 1YEWA 1J84A 5EHDA 4YZ5A 5ISLA 1OUSA 4OZOA 3WNXA 1XSRA 5I0RA 4PF5A 1HB3A 2NMNA 3THPA 4UT5A 1UNBA 2JJ6A 3FHQA 3JB8A 2P4EA 1NA1C 1W8NA 1QEXA 2QQJA 4NRMA 1PO13 5D8AC 1UF2C 4NAMA 4AVVA 4JV4A 3MIFA 4AVAA 1H2MA 3T0DA 3DYPA 3GJBA 3K77A 2EVXA 3FJSA 3V0AA 2EXIA 4E4SA 1GKBA 4Z2AA 5JDBA 1J3PA 2HWE1 3NV4A 3IN9A 4XIOA 4DXZA 3OEAA 5CG9A 1LGBA 1XNKA 2OZ6A 2QVSB 2ZPXA 2VXRA 4NAOA 1QXJA 2P1BA 1VBC3 2DUQA 2Q1FA 2W68A 2BBAA 3R4UA 5FTTC 1TG7A 3WP5A 1S4CA 3WNPA 3H3UA 1RIRA 3T1MA 2XDVA 1TNRA 2QZ3A 1FMD3 5A7WA 1X7NA 3ZSLA 2HYXA 1K5MA 1GMMA 2VZTA 3M1HA 4KL1A 4OI1A 4CCKA 1YQ2A 4ZHNA 1JYIA 3OYWB 2AEZA 4XCAA 1KXGA 1S0BA 1HV1A 3I3QA 1AHSA 2GNMA 5FZ8A 1WBFA 2VNVA 5HCAA 3VBSC 1W6NB 4YSFA 1WLWA 3H7YA 4IV1B 2YC0A 5GLTA 2WNUB 1YHFA 2WYFA 1DU3D 2YYOA 3R4SA 2VD7A 4BH9A 4BQ3A 4Z82A 1RUF2 2ES3A 1G9AA 1G86A 2PQSA 3ZMOA 2XLFA 4PDWA 2C4XA 3GDBA 4AL9A 3MUZ1 3A7QA 4XILA 4B4PA 1JTZX 3ZXGA 3D0SA 4Y5Z0 4RQPB 3KQRA 3CLPA 1C1LA 4EZHA 5IVBA 4AI1A 4IV1C 2WKKA 2QUOA 2MEV1 2WZEA 4HBNA 1W9YA 1CR7A 1ND3A 2MPFA 1XYOA 2P6HA 3N9PA 3R05A 2D97A 4IESA 4N53B 1NCQB 3UT0A 1AUYA 1QH6A 1ZA7A 4AQTA 5BUVA 3VD4A 2J1VA 5KXBA 3ACGA 1OLME 2A7AA 2YUEA 3N7LA 5FXVA 4XW3A 3U75A 1V00A 3Q8CA 4NJ4A 1UY3A 1RJ8A 4P9IA 5KC5A 4UFIA 4HG6B 3WQ1A 2QTWB 2KR2A 3ZYIB 2V73A 3DN7A 4KU7A 5KHIA 1CAVB 1BZWA 1TME3 1XNAA 1Q8SA 2CYFA 3AKQA 3NKGA 4QDSA 4RR3C 2R16A 3ZR6A 5J37A 3LIHA 2QFEA 5C3SA 1F2NA 1DP0A 1GANA 3NV2A 1WW7A 1JW6A 4JHTA 4QQLA 3Q8BA 5DXDA 1UMHA 1JYNA 4D8MA 2JENA 4YM1A 3D0JA 4IV3B 4W50A 4BQWA 3RZKA 2CDOA 3ZO0B 5FY0A 4CUAA 1UPSA 4P9GA 4QWNA 2WFF1 4K8FA 4Y22B 5I93A 3W20A 4A2UA 4WV8A 5C3PA 1QQP1 3I2OA 5C33A 2VVFA 1FPN3 2XOMA 1PMIA 4UBHA 4IV3C 1W3XA 3EJKA 3OUHA 4CDXC 5FV3A 2RS31 3POWA 1N3OA 5C8CA 2W95A 2IXCA 4QB1A 2OT7A 3GCXA 2QE3A 5FP3A 4YVWB 4OHZA 3THDA 1CAWA 3B3QE 5A3MA 5F6LB 4QM9A 2PELA 1GU3A 1X8MA 3PU8A 2XJSA 3CHXA 3PTYA 2W0XA 3R6SA 3ORJA 2Q4SA 5FO7B 1B35C 4R4ZA 3NMBA 3VBUA 1JYTA 1EYBA 4QPYA 1QKQA 1OA4A 2VPVA 4IEZA 1F9KA 4NIDA 2XLAA 3UJQA 4C1XA 1ZX5A 4XVHA 3T09A 2Q1ZB 1ZBA2 5IAXA 5LB6A 4GJZA 1TZOA 1QJU1 4YRDA 1EPWA 1OF4A 1S0CA 4H3WA 2GN3A 3UGHA 1XXNA 1BXHA 4YM2A 3V0AB 1C5HA 1CESA 3VD7A 2JWPA 1ODMA 3SCHA 1HRI1 2BYVE 2ORZA 2A6WA 1SPPA 1HJFA 1PZ7A 4Y1UA 5ACA3 1FXZA 4KG0A 4DXSA 2DU1A 5AC93 4QX1A 1NG0A 2HH9A 4Y4RA 2JE8A 2DVDA 2PHWA 2Y33A 3DYMA 3WLUA 1RUD3 1W8ZA 3HPNA 1RUC2 1HQNA 1N1VA 3IT8A 5A7WB 2A1XA 1PIV1 5LY1A 4GB31 4XBNA 4GAZA 5JXHA 3U78A 2Q8CA 5K0UB 3T4VA 2C0ZA 2D6LX 5KHGA 3S7EA 1X36A 1AYN3 1WZXA 3NQHA 4Q1PA 5EJ1B 5CFDA 4HK9A 5J3UA 1CAXB 2A3XA 3WOGA 3WG2A 1X8EA 4HN1A 3ZFEA 3U14A 3DL3A 4HL0A 2H6BA 1RHI1 1C1FA 1K5MC 2WJSA 2VMEA 1SBDA 3DPRC 4RHV3 5CFCC 2VU9A 4PDWB 1AXYA 1V6OA 4QQPA 1QJY3 3NJYA 1C8M3 4PT6A 2W1UA 3E1F1 3OGGA 4AFMA 1L7QA 2K46A 3C7GA 1BEV3 3JD72 1W04A 1XYNA 5LATA 1F15A 1OKOA 3PVNA 1GUIA 3WG4A 5J7MA 4P08A 3BTXA 4KWJA 3LWCA 4DO0A 1XPWA 4XE9A 5FYTA 4KBBA 3CJXA 2WZ8A 3BKZA 1CWPA 4XZPA 5JCTA 3O1UA 3WHTA 2VW1A 2A6ZA 1UYPA 1PGW2 3MPBA 1LNSA 3VBFB 3VHNA 4CP9A 5A3OA 1GQHA 1AJKA 1MVQA 1UX7A 2IXKA 1PMJX 2ZXQA 2FD8A 1ND3C 5F7UA 4HZFA 3POFA 2ORXA 5TSWA 1PK6B 3AJYA 1KEXA 1RYYA 2OVUA 2RS12 1Q8OA 3DXUA 3ZSJA 4KWLA 3HQRA 5DZFA 2CAUA 4AXOA 1DZTA 4NHXA 5A6YA 3NJZA 2J1EA 4BDVB 2V5YA 3DEMA 1IG3A 2PAEA 1VMFA 1SFNA 3AZYA 2OS2A 5JWPA 3KS7A 3AP5A 4QB6A 3POYA 3N7MA 4N8MA 3PUSA
chains in the Genus database with same CATH topology
5GM0A 1V6MA 5IUQA 5KHJA 5LRSA 1DLLA 3PJQA 2HEVF 1KFUL 3QLQA 2KXLA 3ZYPA 4ZXKA 4AG4A 1AR73 4LR4A 2X53S 3M3IA 1NE6A 4QGNA 2IFWA 3HWJA 2HWC1 1REEA 3ENRA 1YFYA 4HANA 3VHRA 4XQ4A 5BPXA 1QDCA 2D6OX 2JEMA 2ZAAA 1AR81 2NQYA 4K1ZA 4OI2A 1RUH1 3FE5A 2Q1MA 4FPLA 4AEMA 2XBO2 3VBUB 4IEQA 3FMGA 3SLIA 4F83A 3AP4A 4FXKB 1AYM1 4XJWA 5C8CC 1SBEA 4FPYA 3WCSA 3WVJA 1OA3A 2R0HA 4ZKTB 3E6CC 2C5DA 4COZA 2EF6A 4GMP3 4GULA 1SACA 4L8QA 1KITA 2JXAA 1IZ3A 1CD3G 1DBNA 4XFAA 3ECQA 1DGRN 1W6PA 1RUF3 5I0TA 1WD4A 1MEC2 4NVPA 4FTEA 2JG8C 4Y24A 5KWRA 1KDKA 1PGL2 1V6IA 1WCSA 1BK1A 5IK8A 3WW3A 1S2BA 2NLRA 1YIFA 4OZXA 2QQPA 3UL2A 1LENA 2ZJCA 4LO4B 4CEWB 4W6WA 1MS1A 4PJYA 1J58A 5BY5A 1REDA 1N1TA 4ISQA 2X8KA 3VN4A 3OGJA 1O5LA 4JCKA 2YZ4A 4WM8A 1OKQA 5H9QA 5BV6A 3USUB 2OYZA 1H4HA 1GZ9A 4QPIA 3VKLA 3ZXDA 5FFOC 3HMYA 5JR7B 5BNOC 2AENA 1NE4A 3V56A 4COUA 4JDMA 4YG6A 4HPKB 4OVEA 4YVSC 5CFDC 1YFUA 3KM5A 4P14A 3ZFEC 1ZREA 4I3GA 1O3TA 3URFA 1NY71 1IPKA 1VRH2 3GYDA 4Q4W3 2D43A 3ST7A 2VOVA 2GALA 4XBQA 1PO22 4AHXA 4IQPA 1CPMA 2BEOA 3VZKA 1KFXL 3N7KA 1DYKA 3S30A 1RUI1 3TWIA 4JGZB 4QD2A 4GWMA 3FHIB 4SLIA 2XVGA 1Q3EA 3HAGA 5FRAA 4QQOA 4JGYC 4Z92B 1SMVA 1WBLA 4COVA 1RMU2 2GNTA 2ZGSA 3RYPA 3FC0A 2CGNA 4HKWA 4BLJA 5A33A 4PQ9A 3AZZA 4CYDA 4XOGA 3SXWA 2D6MA 2P37A 4LE4A 2AGSA 4AW7A 2VECA 1MACA 1ENSA 3KGLA 1ZBA3 1YJKA 1ZRRA 5LEJA 4QGLA 3WDWA 1RUG1 3ROUA 1AL21 2WLPA 5F1RA 2UURA 1J3RA 3RDIA 4BHPA 4XMIA 2YY1A 3RMYA 3B69A 2GC0A 3KB5A 3AP7A 2Y0IA 5CIRA 2XJUA 4WVMA 3AXDA 5L7OB 2GU9A 2UWCA 3U11A 2JX9A 2VW2A 4PBPA 1WLDA 1RUC3 4UXAA 4JTNA 4OI0A 1RUE3 5IK4A 2ZX2A 1XRUA 1MS4A 3ELNA 1EV11 4EWAA 4Q0QA 1F31A 3ATGA 3VBOA 1ASJ2 1H2NA 1DGWX 4NO4A 1H4GA 4AVCA 1XE8A 4Q4V1 3RJ2X 4Q0VA 4N43B 4M3CB 1NLRA 1Z7S1 2DV9A 1W6PB 3I59A 3NWKA 4LBKA 2XJRA 4A7YA 2DFBA 2XG3A 4FOQA 4Y1VA 5HBAA 4YM0A 2FMYA 2NPIA 4Q0PA 3ZXAC 1NLSA 5T50A 3GBFA 2VOWA 4WBBA 1J3QA 5I8TA 3FZ3A 2EAAA 1FYUA 1R081 2PTMA 4YW5A 1OQ1A 1JOJA 2DYCA 2Q0AA 4CTEA 3VDDA 5FPXA 2ZX0A 2PLV2 2B46X 1DF0A 4H14A 3SITA 1EAH1 3NO8A 3WQ7A 1IS6A 1M4WA 2JG9A 4IL7A 5LRRA 3RS6A 4DRRA 2XVLA 2P3IA 1WW6A 2X29A 1C8NA 4WM8C 1LHNA 2UU8A 2UWBA 2GMPA 5BYNA 2PHUA 1LKNA 3H1MA 2I45A 4QPIC 5DDJ2 4MGKE 5T5JA 5C4WA 3MFAA 2ZHLA 4HSJA 2VNRA 2O0OA 3RI8A 1VBD1 4CDWB 1DQ5A 4XF0A 1NOVA 3FBMA 1NCRA 1D2SA 3JBG1 5T52A 3VLBB 3RWNA 3NAPB 1NA1A 5DG1A 4QMAA 5AFBA 5D8AA 2AR6A 3N35A 4XXAA 2RR12 5B2GB 3AKPA 4YGBA 4PLNA 1NXMA 1DYPA 2VMIA 4IETA 1DGWA 5HI0A 3AMNA 2JECA 2XBO3 5J98B 4K1YA 1FOD3 1Z78A 3KLSA 4YZ1A 1DGRA 4K6BA 5J48A 2ZOEB 4NWWA 3CJIA 1GZWB 2ZS6B 1A6CA 2ET1A 3AYDA 1POV1 3ILNA 3G6JB 5GZEA 3CNAA 1HQLA 1VALA 1ZRCA 2YGLA 1OFNA 3EBRA 4YG3A 2XWJB 2Z79A 1H8TA 4Y26A 2WZR1 1N47A 1MEC3 1HX6A 2R071 4YW2A 2QDNA 2RMU3 2VUJA 1WMFA 2WQZC 4NN0A 1BCXA 3DV8A 3A0KA 3ES1A 4Y20B 1ZYBA 3V0BB 1HDKA 2CNAA 1ALYA 4RL7A 3HD8B 5I0SA 3T2TA 4C91A 3AKTA 4KG8A 1AR62 1KD7A 1XQNA 3B93A 4LBQD 1OOPC 1RGSA 3AK0A 1VBB1 3QCWA 1HLCA 4LBQA 1MQTB 4CDQB 3RPQA 1ZA4A 3U07A 1QGLA 4ZU5A 1UN1A 3L9JT 3B9IA 2Y26A 4H7MA 1V70A 2IXHA 4ATFA 4L99A 1UU6A 3VBOC 1IS4A 3ZFGB 2X5IA 4LA2A 4Q4X1 2GC1A 3ZVXA 4HN0A 1Q56A 3KT7A 4Q1RA 3QH7A 1PO23 4B3NA 2Q8OA 3IPVA 1BVP1 2JICA 3H0OA 4FPGA 1A3KA 4ASMB 4FAHA 3MF6A 1COV1 3BB6A 1VBE1 3JU9A 4S2FA 3UKVA 3WZ1A 1ZZ7A 4XHXA 2ZX4A 2NMOA 1S0IA 3O14A 1EY2A 1HW5A 2AREA 3VZMA 5T5PA 2CWSA 1RMU3 2ZGNA 3PJYA 3VDDC 1QJY2 1LOEA 1B09A 2PAMA 1AX2A 4LHLA 5H9PA 2WQ4A 1VBA1 1X82A 1ZBE1 2D93A 4CDXA 5JSOA 5FQ0B 5JZGA 4HMZA 2JG9C 3AKSA 4R52A 4WZCA 2OPKA 5D1IA 4BE3A 4FPKA 1IOAA 3MEPA 2EXKA 3MIDA 2PHXA 4YFZA 1NA1B 3VUOA 4FAGA 5C4WC 5D8AB 2Y38A 1PHMA 2RE9A 4MYEA 1X50A 1BYHA 1UL9A 3G7DA 4I0BA 4IEUA 2ZAHA 2CGOA 4M3CF 3NW4A 1NCRC 4X6RB 1HXS1 5FPZA 3T1LA 3A0NA 2Y0OA 4MGZE 4AQ2A 3KD4A 4HVOA 3AFGA 1ASJ3 3LB9A 4AI0A 1GZCA 3KMHA 2B7YA 2ZKNA 3L2HA 1XU1A 4H7LA 3M70A 1QDOA 3B02A 1H8TB 5T54A 4Q27A 1U5YA 2GNBA 4Q4Y2 1AR72 5DG2A 1AXZA 1TE1B 5DUUA 2KM2A 1Y3TA 2WFPA 4Y1YA 4Z2WA 3CJIC 2FMDA 2R062 3CU7A 4YW3A 5JSRA 3VBSB 1D4M1 3IDEA 1N1SA 1CAUB 1LB2A 4W6XA 2BBVA 1KDMA 4XFCA 5BXXA 5KXDA 1H8TC 3HIFA 3VZNA 3IDCB 4FXGB 4XTPA 3ZN5A 1Y43B 3DPRA 5CFCA 2ZA9A 3VBRA 4P9YA 1OLRA 3DUIA 2PHLA 1CJPA 3HR9A 4GWNA 2PLV3 3BCWA 3ME2A 1CX4A 1HRV1 2H0VA 3J8F2 1RVF1 4GIQA 5JIUA 4ONUA 4R9CA 5E16A 1FV3A 4X8PA 4RS5A 1DHKB 1MVEA 2RJLA 4XFIA 4YLZA 2ZGUA 2GNDA 3I8TA 3PMSA 4M0HA 1DZQA 1UU4A 1H1MA 2A71A 3E5XA 5DDJ3 4RR3B 4AEDC 1I9RA 1ZZCA 2WS91 3VZOA 4TLFA 4INDA 3WD5A 1CGPA 2DWRA 4RD7A 4BZ4A 1SCRA 4NR1A 3SMHA 1LGNA 3LOBA 1SDWA 3ZPYA 2X5IC 3MPPG 4GH4C 1PO11 1OD5A 4GMP0 3N3HA 1PVC2 4N9HA 3O12A 2NM1A 3THTA 5K7PA 2RR13 1HKDA 3KSCA 1PZ9A 4DPNA 1QJU3 3LA2A 4B8EA 1NYWA 3HQXA 2Q5TA 4A3XA 2HJIA 3S7IA 1JYCA 4Q4W2 4CDXB 1VBC1 2DCZA 2DCYA 2GAUA 3OBRA 5LK5A 1SCSA 2ZGTA 4TYSA 3NVCA 2R49A 1VJ2A 1FMD1 2G9FA 1B35B 1X33A 1PIV3 3WHUA 4GB33 4D69A 4ITCA 1JXNA 5JZGC 2LALA 3WXPA 2HWD2 3ASIA 4MGYE 4KU8A 1LOBA 1UAIA 3POSA 2GC3A 2PA7A 4AVBA 4FTSA 2E6VA 5JOWA 1BMV2 1AR63 3VL9A 2FHRA 3EO6A 4YW4A 1U5XA 2B45X 1ULGA 3UK9A 2JG8A 1NXD1 3N7JA 2HKXA 3GALA 2VGDA 5KC6A 3BALA 4FQZA 4C0HA 1V6LA 1JUHA 3H1WA 4O9EA 2R042 4LBJA 2FQPA 2OA2A 1G8WA 3NV1A 4XBLA 3B00A 4RGAA 2VMHA 4HLTA 3ZIXA 3Q9OA 4HVQA 3LSDA 1O3SA 1IHMA 1RC6A 2O8QA 1R092 1TME1 4LLFA 4L9BA 4CEYA 4COWA 2WNEA 2ZMLA 1F8VA 1H9PA 2GMEA 1RUE2 1K5MB 2VQAA 4Q0SA 4ORFA 3DPRB 5CFCB 4IEVA 2YPJA 5BNOA 4DQAA 1OQDA 4YVSA 1TQ5A 1DDLA 3AXEA 1AX0A 1WA4A 1Z0HA 2A5ZA 1V9U2 2DURA 1IGOA 2ZHMA 4Q2FA 1EPZA 3LKJA 3WW4A 4M0NA 3VBRC 3E97A 1JN2P 1Q8QA 1OMIA 5BNPA 5IT6A 1FPN1 3GHNA 1XNCA 2JKBA 3ZSEA 2Z2SB 3UV9A 4IXLA 2PFWA 1QJX2 1GQGA 1U5IA 3E6DA 2VNOA 1ND3B 4RS5C 1N1YA 1AR92 3B5LB 2P3KA 2SBAA 4A7ZA 1QU0A 4JGYA 3PHMA 1BBT2 3SHRA 1MZFA 4F7ZA 2HWF2 5FO8B 4PBOA 1SLTA 3AMQA 4AVSA 4Z8BA 2N7GA 2WT0A 1R1A1 1IQAA 3M4FA 1RL3A 4QX5A 1JBCA 3AMHA 3MW2A 1WCDJ 1UW8A 1DIWA 5CVRA 4WM7A 5F5QA 1JUIA 2E7TA 3TN91 2ZGPA 3KGZA 1FATA 5ACA1 3AZXA 2O1QA 5AC91 3OY8A 1HIXA 1C57A 1RUD1 3RI9A 3NSTA 4BMBA 2IXLA 4BM8A 4CP2A 4HT1T 4AE2A 4CDUA 4ZU4A 1SLLA 1AYN1 4Q4Y3 5C8CB 5DZEA 2JE7A 1J59A 5I0UA 2W08A 3QACA 4UW6A 4DZGA 2R063 4WVZA 3W9AA 1CAWB 1BKZA 3ZN4A 1YXWA 1Y7BA 3UKNA 1UZZA 2WA4A 1QY4A 1UKRA 2O8OA 4RHV1 1TEIA 1L3JA 1C8M1 1FOD2 3VZJA 3U4XA 3AMMA 2JG8B 5CB7A 1RUJ2 4U2AA 1O3QA 1O91A 4BIOA 1BEV1 4LUMA 1IKQA 1SLIA 3J8F3 3OJBA 4L11A 5E88A 3KCCA 1G7YA 1TMF2 1ZVFA 4XDQA 5KHKA 1KQRA 2HWB2 4HVRA 2XKPA 3PMEA 1Q43A 2RMU2 5A3LA 1UPIA 2A6XA 3P3NA 4AFBA 1W6MA 5HCBA 1CIWA 1YO8A 2XHKA 2WC2A 1GNHA 3OF1A 4JC1A 5FLIA 5BNOB 4PIYA 2BVBA 4DINB 4RSUA 2NYYA 5CFDB 4YVSB 4QXKA 4XXPA 4KGGA 1PVXA 4MXWA 3ZFEB 4MX3A 4EN6B 1FAYA 2XB6C 4CEYC 2RM22 1DFQA 1PVC3 1FX5A 4IEWA 4URTA 5DUXA 4DMIA 4WVVA 2ZCWA 5J36A 3TBDA 2TUNA 1FV2A 2VVEA 3SCGA 2HYKA 2XH6A 1AR71 1QOTA 5JOYA 1G9CA 2RS52 3AP6A 3D6EA 3MIEA 4JGYB 3WG3A 3N36A 2E7QA 5BNPC 2E53A 3OBTA 4DY5A 1V6KA 4E27A 1DQ2A 3O5SA 2XJPA 4QPGA 2PHTA 1RTVA 2W39A 4AQ6A 4R4XA 1VR3A 2HWD3 1NZCA 4XMAA 1KJLA 5FBZA 3I2DA 3JUUA 1RUF1 1Z7S3 1UKGA 1OA2A 2HWE2 5T3NA 3HT2A 2LTNA 3OY8B 4LULA 4Q26A 2BNMA 5C9AA 4V1PA 2FBEA 4NHKA 1ENXA 4XYXA 2IXJA 4FOYA 1ZZBA 4WM7C 3LAGA 2C1FA 4X6QB 4EWEA 4FPJA 2R043 1WUVA 4UW4A 2EAKA 4FO9A 3RMXA 3DKWA 3MICA 4XJZA 2SLIA 3MZHA 2BW8A 2BFUS 1YFWA 1OOPA 1LTEA 1MS9A 3AYEA 1R093 3TYJA 4GQ7A 4PLMA 2B8MA 2DVFA 4CDUC 3MI8A 2UY8A 1H2LA 3AJZA 4NHLA 2XJTA 1ND2A 1H1IA 3WV6A 5DZGA 4M00A 3ZMNA 1AZDA 4LO8A 4AHWA 1V9U3 5K9YA 4R9DA 3FX3A 2MEV2 4AF9A 2VOKA 2YMZA 2WNVC 1LECA 2VG9A 4BA6A 2E9QA 1ZRDA 5BNNA 4AGGA 4YGCA 3CO2A 4BLIA 5BNQA 1G9BA 4XHBA 3AMPA 3S0MA 1W6MB 1QJX3 4J6GA 3AX4A 5FO9B 1UMZA 2A70A 3S6PA 1WMEA 1VAVA 3ACLA 4MSVA 3R4DB 1AR93 3QOPA 2JE9A 3ZSMA 4G9SB 1VLNA 4CRQA 5JPMB 4TSVA 1BBT3 5AVPA 2HEWF 3LCPA 2HWF3 4FOWA 4AGVA 2VMGA 3N4MA 3WW2A 2ZACA 4MXWB 3O0VA 4WM8B 4C1WA 5A32A 3B9CA 5HXVA 2WA3A 2DF7A 3A4UA 1OSGA 4QPIB 1EP0A 1ZBA1 4S2HA 1OHFA 1QOSA 2BWCA 4K21A 5GLWA 2WFF2 1LHOA 3GF6A 5ABJA 1IPJA 1QMJA 3ZX7A 1QQP2 4YZ3A 1C5IA 4RA0A 1T6GC 4XFGA 2QDRA 2R073 1GYKA 2VH9A 2RS32 4KH9A 3FBYA 1WGPA 5JI9A 3IBMA 4JQRA 4MUVA 4I0AA 1RUC1 1AF9A 3ZXFA 5EFUA 4F3JA 3VBHA 5JOZA 2D7FA 4JAAA 3JCIA 3BPZA 1VAMA 4R9AA 5CG8A 4QU2A 4DRVA 4AYUA 1GFF2 3VKFC 3H8UA 4CZSA 3U10A 2Z42A 2R30A 4OHXA 3ZN6A 4GALA 1AXKA 4ES9A 5LEKA 1QJU2 2XWBB 1AJOA 1AX1A 5A33B 2OIIA 4QPGC 4BWOA 4CP0A 5GLZA 1C3HA 1HRI2 2PHDA 1RUNA 1RUOA 1RUJ3 2ERFA 4DOUA 1REFA 3JD71 4KQ7A 3RG0A 4UW5A 1TMF3 1CQ9A 1QH7A 1PIV2 3BTAA 4GB32 1OI6A 2HWB3 4GKYA 4IEPA 2ZHNA 1A8MA 5C9AC 2VQ0A 1OOPB 1PGW1 4WVMB 3VHPA 1C4RA 1S2KA 2DTYA 1PNFA 2XVKA 4XF3A 3WP6A 3VHOA 2ZMKA 2VVDA 1Y9QA 2NP0A 5GLVA 4AQSA 2RS11 1LR5A 1RHI2 2H0BA 1MZEA 4B7KA 3VBOB 3TB0A 1G9DA 2GSYA 4PLOA 3ZXKA 1OFSA 1DQ6A 3ES4A 2ZTNA 4FPOB 2PYTA 3LA3A 2RM23 4YFWA 2D5HA 2XJQA 5GJ6A 3HN1A 3I59B 4AEDA 3M3OA 5H9RA 4E9KA 4AHYA 1QJZA 5GZGA 2DFCA 2A3WA 1ND2C 1PZ8A 3MDPA 2BTVC 4P9LA 4GH4A 5F9TA 5E89A 4LHKA 1YI9A 1QXPA 4B4RA 1UIKA 1GICA 4YGDA 1RITA 2RS53 4I01A 1O7FA 1PM7A 1W6NA 2ZX1A 4ISRA 3D5OA 2D6PA 5BNNC 1ZRFA 4FSJA 1WLTA 3VDDB 2P3JA 2WNUA 2XBO1 1SBFA 5FLHA 1KS4A 1HXS3 3FLTA 3GHMA 2DTWA 4YM3A 2XL9A 4D7TA 3GNEA 2JG9B 1I5ZA 1DZRA 3APBA 1MS3A 4RQPA 4ASLA 5HCFA 4LBNA 5CAZA 5FOBB 1WLCA 3DGTA 4JTOA 2LUWA 1APNA 1UU5A 4N53A 2RJKA 1MEC1 3AB0A 4SBVA 4YYOA 2F6BA 2HWE3 3OD4A 3SH4A 4BIFA 4Y4YA 1PGL1 2YDEA 4LHNA 5C4WB 4P9JA 3M2MA 3D8CA 4EV0A 5I91A 2HWC2 4PIXA 2B9UA 1KJRA 2CWMA 2V09A 4OFGA 3OCPA 1CVNA 3WDVA 1QWRA 1CAVA 4BYYA 5ABJC 1PNGA 3V65A 2B39A 1NCRB 1Q5OA 1AR82 2P2KA 1YYNA 3LOIA 4L97A 4DY3A 1RUH2 2Z5WA 1GBGA 2BGCA 4S2GA 2ZGLA 3ZXJA 2NZ9A 4Q0UA 4JDNA 1AYM2 2K0GA 3WDUA 3ZN6B 4RFT0 1IS3A 3RJRA 3VBHC 5KHHA 3QH6A 4Y22A 3WDXA 3VKMA 4M01A 1UIJA 1FNZA 3BU7A 4YGEA 3H7JA 2D44A 1SFYA 3ZFFC 4QT6A 5I8SA 3CJIB 1ZZ9A 1V6JA 2EALA 4MH0E 3TRSB 1VRH1 3P3PA 1D4VB 1ENQA 1PO21 1M06G 5CNAA 5E8AA 3SISA 4HFSA 2D3SA 2D40A 2MEV3 5T55A 3RSJA 1J1LA 4YVWA 4OULA 3JQWA 2AH2A 4L92A 4GA9A 4QM8A 3PNAA 2R32A 4B29A 2ATFA 2D3PA 4BOWA 4DB5A 2DUPA 5EV7A 3FLPA 3HT1A 4XFHA 2EA7A 4PIZA 1I1EA 4XFBA 5CADA 2AUYA 1RMU1 3WY6A 1V6NA 4LBLA 4U36A 2AZ5A 4AEJA 4Y1XA 1XU2A 5EXOA 2ZKLA 4LBQB 2QJVA 1UX6A 3AZWA 3B01A 2QKDA 3WG1A 1R1ZA 1NY72 4AEDB 1VIWB 3AKRA 5EWSA 2E51A 3FLRA 4FOVA 3J4UH 4Q29A 2E63A 3NL1A 3M3QA 2WFF3 4AI8A 1RUI2 4D7SA 2WWSA 2VNGA 2X5IB 4GH4B 4KGQA 4I09A 1QQP3 3KT4A 4AVTA 5K0UA 5JSPA 2PHRA 3IKWA 1MS8A 3BODA 1RINA 2RS33 4XF9A 3B7MA 1CAXA 3IPVB 2BNNA 3K48A 2D98A 2B5HA 2WT1A 4K9SA 5GKAC 3OPZA 2DCJA 3H50A 3WX5A 3MIGA 4E4ZA 3IIAA 4L2NA 2GH2A 1ASJ1 3FUQA 4LTAA 1DGLA 2EXJA 2QZ2A 4WZFA 2UYAA 3GBWA 2ZGMA 1WW5A 4LE3A 1G6NA 4XIKA 3H9AA 3ZYJB 3AYCA 5JIAA 2YGMA 2WNUC 4XJ8A 4UW3A 1RUG2 1AL0G 3O7OA 1AL22 1FI2A 1OLQA 1HRI3 3TAYA 1QNWA 1ULCA 4J1WA 5JZGB 1A8DA 4LO7A 3VBFA 4RQPC 4HSLA 3CEWA 2DU0A 1VB4A 2UWAA 4QGMA 4N53C 4EROA 1NCQC 1PK6A 2CV6A 3WDYA 1EV12 1N3PA 2PLV1 2OW4A 4AI3A 3MLLA 1UD1A 4E2GA 5JOXA 4FVVA 1I3HA 3X29B 2XL7A 1S1AA 1YNAA 4Q4V2 3O0XA 2D6NA 1Z7S2 1RHI3 4OHVA 1MS0A 4IEOA 5JLVA 4E4DX 1U0AA 5FMOS 1YIPA 4FBFA 2KA3A 1YI7A 3KT1A 2MHFA 1LESA 2YV8A 3MLKA 5DDJ1 2UY9A 1H9WA 4YARA 2BQPA 4IEXA 2I2SA 4LBMA 4EN9B 1LU2A 1F5JA 3E6BA 3GBGA 4I30A 1R082 1LODA 2ZGQA 1LGCA 1YWKA 2VY0A 1H0BA 3WP3A 4XQDA 5GALA 1HQWA 4IERA 1EAH2 2RR11 3O0WA 2DVBA 1UZYA 3RRDA 4YVWC 2ENRA 3PVEA 3WDTA 1R1A3 3ALQA 3LGRA 5FAXA 3AM2A 3VBRB 3SCFA 2BPA2 1O5UA 3EQEA 4OHWA 1XNBA 4E2SA 1LU1A 3TN93 3M7AA 2JDZA 3FUOA 3NV3A 2BFUL 4RS5B 5FOJB 3VKNA 4N7IA 1F5FA 4FP3A 3VL8A 1VBD2 4XFFA 2ZBJA 4NOTA 1BJQA 4BQ1A 3NKTA 4XF1A 3JBG2 4CEWA 4MXVA 1VB2A 3WP4A 2C9AA 3R0RA 3FFZA 2HWC3 2H6CA 2ZGKA 4G3YC 3LSEA 4WVWA 3USUA 2IXIA 2DUOA 3H3ZA 1DQ1A 1AR61 1AR83 1RUH3 5K0UC 3JB4C 5DUVA 2ZZQA 3I7DA 4D3WA 1AYM3 4HPKA 2K9ZA 2QNKA 1UCXA 4GXLA 5IK7A 1U12A 1JH5A 3OD0A 4JDOA 3GZUC 1LJ7A 1ENRA 2WZR2 4PDWC 5JAXA 4I2OA 3K51A 2R072 2PN5A 4JGZA 2OUJA 1YRZA 3U0ZA 1BQPA 5J09A 1HV0A 2A73B 4OUSA 3EHKA 2A3YA 4FPEA 1C28A 4OI4A 2A6YA 4R8HA 3WINE 4XTMA 2PHFA 5L73A 4B7EA 5KBFA 4AFAA 3D4KA 5EYYA 3VBFC 1LOAA 5L19A 5EJ3A 1NQDA 1VBB2 3WT3A 1J1TA 2IC1A 1XNDA 3WW1A 3WR0A 1PK6C 1POV0 2P17A 2WNVA 2R1DA 1QJY1 4N90A 1W6QA 2B42B 4EN0A 2WLQA 5C6CA 4K40A 4Q4X2 4LEJA 5CA6A 5JMCA 3EXUA 1O4ZA 1W6OA 3ZXEA 2VULA 2UYBA 5L7OA 3IDBB 1O4YA 3MYXA 1SQ4A 5JI7A 3GZTB 2WT2A 2D6KA 4MVTA 4CP1A 1RUI3 2ETEA 2GMMA 2ZGRA 3VKOA 1E57A 2I07B 4PCRA 1COV2 1VBE2 4CEYB 4JRLA 1A78A 4BMEA 3W58A 3MIBA 1W2UA 4RGGA 4FPFA 4N9IA 2A75A 4LO6B 1W0OA 4NPRA 5GZFA 1D0HA 4N43A 4M3CA 4Q8KA 1ZZ8A 3VBUC 1YLLA 2Q30A 5H9SA 2DCKA 4AFCA 1VBA2 1GSLA 4A7KA 1ZBE2 3LZZA 2WINB 2Z69A 3MFCA 2MNGA 4FT8A 4LLOA 5KXEA 5GZDA 4EWDA 2VW0A 5BNPB 3ZDSA 2G4IA 3IMNA 1RUG3 1AL23 1LOCA 3MLJA 4Q4Y1 4ZU7A 4Z07A 4BCUA 3KCYA 2GDFA 1ONAA 1S0JA 2R061 4LO5B 3MIHA 4DS0A 2OZJA 4P5HA 2G9GA 2R1BA 3L2YA 4KWKA 1U5ZA 4W65A 2WSVA 5JPNB 2PAKA 5LK7B 4LT5A 1SEFA 1WMDA 2EXHA 1SLCA 4ATEA 1LCLA 2CY6A 3I54A 2CL2A 1CJDA 1HXS2 1SLBA 1WD3A 4CEWC 2W52A 1URXA 4W6YA 1H30A 1ULEA 1EV13 3WUCA 4GMP1 3J8F1 2RHPA 1QXRA 3QBQA 1ZNPA 4NWVA 3C2UA 2FZ1A 4K20A 4C90A 4EN7B 4Q4V3 4WM7B 2ZHKA 3PLQA 2ZABA 1QF3A 1KS5A 1N3QA 2P34A 4CDWA 1MZ6A 4JRAA 1JHNA 4OUMA 5SV8A 4HK8A 1LULA 3E5QA 3AYAA 4ES8A 3NAPA 1S0FA 1D4M2 1LEDA 4CDUB 4FP2A 2ZMNA 4TWTA 1H2KA 1ZZ6A 1R083 4JGZC 3SNMA 2ARBA 1YCIA 3C3VA 4FPHA 2CGPA 3I4IA 1PVC1 1XE7A 2YHJA 1HRV2 4D7YA 1EAH3 1RVF2 2EIGA 4QQHA 3PVBB 4EJRA 1I6XA 4FCAA 3JZVA 2WNVB 1O3RA 1GZWA 4R9BA 5L36A 1CN1A 3MF9A 1W6QB 2XGXA 2XJVA 4Q4W1 1LOFA 4NHMA 4YNIA 3M3EA 1W6OB 3V64A 3ZIWA 4XEZA 2TBVA 2WS92 3MW3A 3FFQA 1VBD3 1D2QA 4Y20A 3V0BA 1O4TA 3FWEA 4MLOA 1FNYA 2GC2A 3JBG3 4E2QA 3RZZA 3JQXA 1PO12 2HWD1 2R0FA 5EZWA 5KXCA 4FPCA 2ARXA 3PVOA 5L7OC 1NQJA 2I74A 1MQTA 4CDQA 2YXSA 3AFKA 3OTFA 2ILMA 2WIIB 2XKOA 3CL1A 1BMV1 2JD4A 3ZSKA 4Q8LA 4I0WB 5CU1A 4YZ4A 2PQQA 2WZPP 5I8YA 1VBC2 3ZFGA 3VGIA 1GV9A 2GH8A 4XJAA 4IEYA 3UKTA 3JD73 4N43C 2R041 1FMD2 1POV3 1OQEA 2D3RA 3B94A 3UJOA 2WZR3 3RQ0A 2TEPA 3KZ4C 1ZM1A 4XETA 4MZUA 2ET7A 1R091 4FTBA 4OHY