2GMEA

Metal-free (apo) p. angolensis seed lectin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
239
structure length
226
Chain Sequence
EDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPNQVIAVEFDTFYTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lectin
publication title Interplay Between Metal Binding and cis/trans Isomerization in Legume Lectins: Structural and Thermodynamic Study of P. angolensis Lectin.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 50
structure length 226
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2gmeA00
4FPKA 1UZYA 1GICA 3DUIA 1I1EA 2WSUA 2FMDA 2PHXA 3L2YA 3N3HA 3VKFC 4Y22B 4AGGA 3WDXA 4P14A 1YXWA 4YZ3A 3BOPA 4YG0A 1LULA 3INAA 1YYNA 5GLWA 3IKWA 2DU0A 2VUAA 1W6MA 2DVBA 2Z42A 1IS3A 1C57A 1SLCA 3N7LA 1SFYA 1CONA 1S0CA 1PZ8A 4XJ9A 1W6QB 4YW4A 3O5SA 2JD4A 1JN2P 2CY6A 3MW4A 1RINA 1KDMA 5EYXA 1G9BA 2SBAA 1MS0A 2DVAA 1N3QA 4ASMB 4Z8BA 2CWSA 4XJ8A 4GKXA 1FX5A 1LGBA 1DQ6A 1OQ1A 2AUYA 1DLLA 3AP6A 2GN3A 3AZWA 1GZWA 3AP7A 5EWSA 1S0JA 4XMAA 4CRQA 4YW3A 3OBRA 1CQ9A 4WVVA 2B7YA 4YM1A 3IMNA 5CBLA 4BOWA 1ULCA 1YI7A 1W6PB 1Y7BA 1FV3A 4ATFA 4F83A 3NV4A 2DUQA 3APBA 4FQ4A 1SCRA 3GALA 1DGLA 1ZA4A 4R9CA 4LBQD 1ULGA 2V5YA 1LENA 1V6OA 1W0PA 3FLTA 4YGDA 5H9QA 4XHBA 3W58A 5H9SA 2DVGA 2V73A 1BYHA 1IS4A 1QOTA 4KBBA 1LTEA 3DGTA 4FPJA 1WLDA 5LK5A 3SLIA 3WCRA 4YZ1A 2ZGMA 4LBMA 1LESA 3TAYA 3UJQA 3PJQA 4AYUA 5GZCA 1WBLA 5T55A 4GXLA 4Y26A 2FHRA 1G9DA 3WHUA 1LHVA 4Y24A 3MW2A 4K20A 4XBNA 2NP0A 4P9YA 1Q8QA 1AF9A 2VW2A 2DTYA 4XE9A 2JECA 4C1WA 2E53A 3RG0A 1UAIA 1DQ4A 1GLHA 2NMOA 4JRAA 4FP3A 4XYXA 3WG1A 3WDYA 2AH2A 5DUUA 1IKPA 5GM0A 4YG3A 4YW5A 1N1YA 1KJLA 4YFZA 2ARXA 3O12A 2EIGA 2UU8A 4UW4A 3B00A 2ZABA 1W6NB 5DZGA 5DZEA 2ES3A 4PCRA 5IK8A 1VLNA 1JHNA 3RRDA 4ZKTB 3ILNA 1O4YA 3IPVB 1F9KA 2UWBA 4NO4A 5HCAA 5JOYA 1AVBA 3O0WA 3Q9OA 3TB0A 3WDWA 2ZACA 3ZVXA 4DS0A 3ENRA 1VALA 4H55A 4XBLA 5DZFA 3AP9A 4U36A 3JUUA 3U4XA 3AX4A 1CIWA 2GNBA 4RA0A 5GZDA 1S0IA 1DYPA 1UMZA 3ILRA 2ENRA 3AYEA 1QKQA 2BQPA 4ISRA 3AZXA 4XMIA 3PVOA 1BQPA 2VW0A 2DWRA 5GJ6A 1LCLA 4UW3A 2A3YA 5JMCA 2RHPA 1QOSA 1AJKA 4HANA 3N35A 2A6ZA 3UL2A 1V6LA 3SH5A 4K1ZA 4CZSA 3OY8B 2ZA9A 4WZFA 1MZ5A 2PHFA 2W68A 1LEMA 2VU9A 3NV1A 2D6LX 2PHUA 3UJOA 5IT6A 3AK0A 1LOBA 4GA9A 2LALA 3O0XA 4Y1ZA 1GZ9A 1FYUA 3FLRA 4HL0A 5HCBA 2NM1A 4PQ9A 4GWMA 5DG1A 1Q8SA 1WBFA 2GN7A 5F5QA 4XIOA 1KDKA 2A3WA 1D2SA 2EXJA 2GNTA 4P9WA 1LHUA 4FP2A 4FOQA 3B01A 5JOZA 1I3HA 4P9XA 4YG6A 1JBCA 4XXAA 5DUVA 2D43A 3B9CA 2NYYA 2ZMKA 1V00A 1UZZA 2ARBA 1MZ6A 4Y22A 5DUWA 4BMEA 2XG3A 2ZHKA 1BKZA 1XQNA 1LOFA 1CR7A 1MS1A 3N7JA 1IS6A 1GKBA 1LGNA 1D0HA 1QDOA 1WW4A 2A70A 2JE9A 2I2SA 4M3CE 1SLAA 1F31A 3BODA 1FNYA 4XIKA 1LOGA 3LSEA 1WW6A 3M3OA 1SBFA 1W6QA 3ATGA 4FPGA 2ZHMA 4XJAA 3VKMA 2DV9A 2AR6A 2UWAA 3OGGA 4UW6A 4D69A 4XBQA 1IKQA 5T5JA 3R05A 3ZSJA 3OYWB 4L8QA 1RITA 1SCSA 1W0OA 1H9WA 2KM2A 2WT2A 1SLLA 3OYWA 2D6KA 3PVEA 4XJZA 3POYA 3WLUA 1CPNA 4Y1UA 4YW2A 2WT1A 4LBOA 5E8AA 1KRIA 1SBDA 2DTWA 2D7FA 3OPZA 4U2AA 1LJ7A 1QMJA 2E6VA 3H0OA 4R9BA 5GALA 1W6PA 1X50A 3D4KA 4YM3A 5KXCA 2PHRA 2NZ9A 4FVVA 1IS5A 4YM0A 1KITA 2R1BA 4FPCA 1GZCA 2LTNA 1O4ZA 4XDQA 2JE7A 4AVSA 3MW3A 4XZPA 1YIFA 3V64A 3RMYA 3HMYA 3O0VA 3WUCA 2D6PA 4BM8A 1GNHA 1QNWA 4XJUA 5EYYA 3ZXJA 2WT0A 1DQ0A 2D3SA 1AX2A 4YLZA 5GZGA 2E7QA 1V6JA 4TZDA 4SLIA 4NOTA 4JC1A 2D3PA 5HCFA 1DBNA 2ZGUA 2XB6C 4YZ5A 5T5OA 2CNAA 5H9RA 3KM5A 3WZ1A 4ITCA 1KJRA 3RS6A 2EF6A 2A6XA 4R9DA 3N7KA 2A71A 2GMMA 4YZ2A 1DYKA 1Q56A 3FLPA 5GLUA 2P3JA 2ZGKA 3BTAA 2ZHNA 5DXDA 3POWA 1JYCA 1JXNA 2A75A 4Y20B 1N1TA 3FBYA 1S0EA 1NLSA 3PMEA 3ZPYA 4C1XA 2P37A 4FOVA 1SLBA 5JDBA 3RQ0A 1AJOA 3RMXA 1W6NA 2TEPA 1ENQA 5F9TA 5JOWA 2SLIA 1A3KA 1QGLA 2AGSA 2YROA 4Q8KA 2WKKA 2NN8A 3IPVA 5CNAA 1HLCA 4M3CB 5FREA 3NWKA 4DRVA 5KXEA 5H9PA 3AYDA 3M2MA 1IOAA 1CPMA 2D6OX 2W39A 1ZM1A 1MS4A 2ZKNA 3AFKA 4LBQB 1VIWB 2EALA 1WLCA 1G8WA 2R49A 3V0BB 5L73A 1MVQA 3NV3A 4FPEA 4YW1A 1V6NA 1WCSA 5CA6A 4Y1VA 3AJYA 2D44A 1NXD1 1S0GA 4LBLA 1HKDA 2G4IA 1C1FA 1DQ5A 2ZGPA 3ZXKA 2ZHLA 1LECA 3ZSMA 5CAZA 4TYSA 5T5LA 2A5ZA 1WD3A 2P3IA 1CJPA 1BXHA 4PBPA 1Q8OA 4LBNA 2GDFA 1ONAA 2A6WA 2VH9A 4FQZA 4Q27A 2ZAAA 3OY8A 4WVWA 5AVAA 2DVFA 3D5OA 5GZEA 2P34A 1Q8VA 1GNZA 2OVUA 2AYHA 2NMNA 1S0FA 1DIWA 2GMPA 2GMEA 1FV2A 4RL7A 4Y1YA 5KXBA 1OKQA 3NV2A 1SACA 3CNAA 1V6KA 3FFZA 3VV1A 1UKGA 2GNMA 5IK5A 1LU1A 1AX0A 1AXZA 2A6YA 2OW4A 1RIRA 4XTPA 1URXA 4I30A 4YGCA 4Q26A 4YFWA 2YZ4A 3ILFA 3T2TA 1W6OB 2HYKA 1CESA 2OUHA 5GLZA 5T5PA 3ZSLA 1W6OA 4DQAA 4FPYA 1CN1A 2OUJA 1LHNA 4AGRA 3HN1A 5T50A 2DYCA 1AXYA 2DURA 2ZGNA 4Q1PA 3USUB 2EXHA 4XOGA 1C4RA 2ZGOA 3HR9A 4AVTA 3USUA 1R1ZA 3AP4A 3AXDA 1A8DA 1DQ2A 1QNYA 3SISA 2ZBJA 5BYNA 3M1HA 1AZDA 1LOFC 3A0NA 1N3PA 3ZXFA 4DFSA 5KXDA 4MYEA 4XTMA 3WHTA 4YZ4A 1MS5A 1SLIA 1GSLA 2DUPA 2CL2A 2CTVA 1WLWA 1ULFA 2P2KA 4GKYA 1DQ1A 3ZYRA 1JUIA 2JKBA 4Q2FA 1CVNA 4Q8LA 1KQRA 1LODA 5DUXA 2YMZA 1QU0A 3WNXA 3VKLA 1LHWA 1W6MB 2W52A 3OBTA 4M3CF 1UL9A 4K1YA 3SH3A 2D6MA 1SLTA 3V65A 1LOCA 3A4UA 4FOWA 4BPZA 1OFSA 2ZGLA 1TEIA 1SBEA 5SV8A 1N47A 1J1TA 4PBOA 3AJZA 3T1MA 4AGVA 1LOAA 4FOYA 3ZXEA 2PHTA 3UK9A 2VW1A 3T1LA 2UWCA 1WD4A 3RSJA 4FPLA 1MACA 4DRRA 3R4SA 1B09A 1GZWB 1VAMA 4YGEA 4FPFA 1N3OA 1MS3A 4IQPA 5IUQA 3ASIA 1LOEA 1MR5A 3JU9A 3D6EA 1GBGA 3IM0A 3M3QA 1S0BA 4ISQA 3WUDA 3MPPG 1H30A 3I4IA 2YY1A 1QOOA 3LCPA 3M3CA 4PF5A 1U0AA 4K21A 3AYAA 4XJWA 3ZXLA 2EXKA 1LGCA 2PHWA 4Y1XA 1S0DA 3AP5A 3POSA 2D6NA 2ZGRA 4OZXA 5DG2A 3BIWE 2UURA 4LBKA 1JW6A 1FAYA 3WV6A 4R9AA 3VKOA 3SITA 5IK4A 1Z78A 5GLVA 4YM2A 3V0AB 1H9PA 1LU2A 2C5DA 4Y20A 4XILA 1WW5A 3V0AA 2AENA 5T54A 5EXOA 2ZGTA 4BLJA 3WDTA 1ULDA 3FUOA 4Q1RA 4ZXKA 3WVJA 1S1AA 3ZYPA 1UN1A 1FATA 1UPSA 1PZ9A 3VKNA 4M3CA 5E88A 3VUOA 1FNZA 4FPOB 4BLIA 3SNMA 4LBQA 2GALA 1HQLA 4UW5A 4DPNA 2E51A 3R4UA 2E7TA 1V6IA 3V0BA 1DFQA 3M3EA 3W59A 2W08A 1DHKB 3B3QE 2A7AA 2DVDA 5CB7A 1BZWA 2VXRA 1A78A 1C1LA 1QDCA 1WW7A 2D3RA 3I8TA 4LBJA 3SH4A 4ATEA 2ZGSA 1G86A 2A3XA 3WDUA 2PELA 3GNEA 1ENRA 1LHOA 3QLQA 3KQRA 1G7YA 1WUVA 2ZGQA 5GLTA 4AVVA 1DZQA 3WG2A 2R16A 2WNEA 2R0FA 4W65A 2GNDA 4GWNA 2WSVA 3B69A 4BMBA 2JJ6A 2WJSA 5JVVA 1QF3A 1GANA 2CYFA 3N36A 4FPHA 3QCWA 3IN9A 5GZFA 4AWDA 3WOGA 4WV8A 4XXPA 3AZZA 4BQ1A 1F5FA 2DUOA 3AZVA 5JOXA 3LSDA 1V6MA 5JLVA 4M00A 4GALA 1PZ7A 3WCSA 3MEPA 2CWMA 4XHXA 4JCKA 1YRZA 4YGBA 5T52A 1APNA 3ZSKA 2ZMNA 5FRAA 2H0BA 4CTEA 4M01A 2AREA 2WQZC 1N1VA 1UX6A 2R1DA 1MVEA 2YXSA 2ZZJA 1LEDA 2ERFA 2P3KA 2VY0A 1JOJA 2EAKA 2DU1A 3A0KA 1ULEA 2R0HA 3WDVA 2C9AA 1N1SA 3AZYA 3AYCA 5E89A 5IK7A 1VAVA 3C2UA 1G9CA 1EPWA 1BJQA 1ENSA 2Q5TA 1HDKA 3OJBA 3PVNA 3WG4A 2JDZA 2A6VA 3N7MA 1G9AA 1MS8A 2YV8A 2EXIA 1G9FA 2ZMLA 1YO8A 1GYKA 1JYIA 1AX1A 3AXEA 3FUQA 1Q8PA 1MS9A 1HQWA 1Z0HA 1GV9A 3WG3A 2WLQA 1AXKA
chains in the Genus database with same CATH superfamily
2W95A 2WO1A 4FPKA 5IATA 3M8LA 2YU1A 3N3HA 4AGGA 4DUVA 3BN6A 3NJXA 4GB32 4Z1VA 1LULA 2JICA 4YVSC 2QDNA 1RJ8A 2OA2A 2DU0A 2VUAA 2BUKA 2YFZA 3GM8A 1WLTA 4B7KA 3TEZA 3ZKUA 2QDRA 3DXUA 3N7LA 4CDQC 5A3UA 4XJ9A 4YW4A 2P6HA 2ZTNA 2VVDA 3RYRA 3JBG2 4X8PA 2HWC3 1REFA 3PJYA 4XJ8A 1C8NA 5LK7B 2FCVA 4MZUA 2JG8A 1QHDA 3AP6A 2RJ2A 4Z82A 3HBZA 4XMAA 1RUC2 4CDUC 5EJZB 2GH8A 3LDKA 3IMNA 4BOWA 1ULCA 4WM8C 1Y7BA 1FV3A 2ZX3A 5FLHA 3NV4A 4FQ4A 3MV01 3GALA 4LE4A 4LK7A 1ZA4A 3VD3A 3THPA 4YGDA 5H9QA 3SEEA 1JOBA 1DGWX 2QQPA 4XHBA 3NAPB 1GP4A 2DVGA 3DV8A 3ME2A 1QOTA 1IS4A 5H9SA 4UT5A 4FPJA 2WQ4A 4M4PA 5FPAA 2W3JA 4PDWC 1LESA 3UJQA 3CQOA 3ITQA 1ULPA 3D3AA 4CYDA 3ZR6A 4QPIA 5FZ8A 5GZCA 4K7JA 4MHUA 2FHRA 2Y8KA 4E4SA 3D8CA 4FFGA 1AR63 1H4HA 1O6UA 3JB8A 1GWKA 2PAKA 1Q8QA 1AF9A 4L0PA 1H2KA 2VW2A 1RUI1 2XKPA 2OZJA 2Y6HA 5ISLA 2K46A 1K5MA 1DQ4A 1UAIA 2J1SA 4Q0PA 3RG0A 4EROA 5J48A 3WDYA 3OGVA 2AH2A 5DUUA 5JIAA 1WWYA 5L9RA 1N1YA 1H0BA 2VMCA 1KJLA 3OG2A 1OT5A 2EIGA 1VPHA 2PAEA 1QQP1 5KHJA 1UYPA 2C4XA 3WW3A 5DZEA 4IE6A 2ES3A 1JZ7A 4PCRA 2RV9A 4BQ5A 1XYNA 2VZOA 1JHJA 4LLFA 4AHXA 1SPPA 5FCCA 1JHNA 1BBT2 2W1SA 4ZKTB 3IPVB 1O4YA 4JV4A 4OQ9A 1YQCA 2UWBA 3VBUA 1DCSA 2WLPA 4CEYB 4CUBA 5HCAA 3MYXA 1JU3A 3SHRA 3TB0A 3WDWA 2CV6A 2H0VA 2K0GA 2OPWA 3MIFA 4LORA 1SHWB 2BOIA 5I0SA 2A73B 3WF3A 2GNBA 1CIWA 3JQXA 5FZ6A 1HV0A 5GZDA 1RUD1 2J42A 4CE8A 1OQDA 4RQPB 5FXVA 1QKQA 4L97A 2WNUA 2JDNA 2VZ3A 4ISRA 3WNKA 1I5PA 1XJAA 1J58A 3PVOA 4KWUA 4QB1A 1C28A 4TTGA 3H1WA 4QT6A 4UW3A 4Q4V2 1ZVFA 1GNYA 3ETQA 1V9U2 4HKOA 5K7PA 2H6BA 3N35A 1QJU2 5FY9A 5DAPA 1JMUB 3JD71 3UL2A 3SH5A 3VZJA 4K1ZA 1MQTC 3OY8B 5C8CB 2Y33A 1REDA 4HN1A 3NV1A 1LEMA 1TME1 4OYUA 4DNYA 5HCHA 1W06A 2D6LX 2PHUA 3OD0A 1S55A 4N43C 4OI2A 4JKKA 4BHPA 3AK0A 3T30A 4XURA 3ZN4A 4CU6A 4K9SA 1CAXA 5FIXA 3I59A 3WEZA 4XC9A 3GHNA 4QB6A 1D2QA 4Q0UA 2BEOA 2E26A 2LALA 1E5SA 3O0XA 4KG8A 5CFCB 1VRH2 4BU2A 1E5RA 1FOD2 1GZ9A 5LZ6A 3H3ZA 4HL0A 1AYN1 1YJLA 3BVCA 3AKTA 3T0BA 3VDDB 2B9VA 2Y26A 2LRPA 4FSJA 3CBNA 1HRI2 1J3PA 5F5QA 2A3WA 5A7WB 4P9WA 1LHUA 4B7EA 4PIXA 2RS52 4OHXA 1V00A 3AMMA 5EJ1B 3F2ZA 4BMEA 1PVC3 1VBA1 2C1FA 1UO9A 3IAQA 3QACA 1QJY2 1XQNA 2IXHA 1CR7A 2BOJA 4MO3M 3NQHA 5HXVA 4R4XA 1LGNA 4B29A 4I09A 5JPNB 3AMHA 4M3CE 4P9LA 3URFA 1F31A 3BODA 4JGYA 2B8MA 1FNYA 1NY72 2XVLA 5DAVA 4META 5FZAA 5A7QA 1RUE2 3CDZB 3LSEA 1WW6A 3ZYGA 3N9LA 5CISA 4FPGA 2ZHMA 5FMOS 3OGGA 4P5YA 4IE5A 4XBQA 4LHNA 1PO13 1IKQA 2QQLA 5FK7A 4X8NA 5FV3A 3OYWB 4L8QA 1SCSA 1H9WA 1SLLA 2D6KA 3I2KA 2R073 5KBFA 4EN0A 2EIBA 5FYZA 1RTVA 4LO8A 4CCNA 3ZMOA 3RZMA 4LBOA 1KRIA 4MGIE 5FPLA 3HOBA 4U2AA 1XU2A 3RJ2X 2I74A 1LJ7A 1QMJA 2HWF2 1W8WA 4LLOA 4R9BA 5GALA 4BDVB 1R093 1CAWB 3C7EA 4UFKA 3WW4A 4Q4W3 4OLLA 4ZY9A 1F4AA 4ZXEA 3ZO0B 4AVSA 3U0ZA 1PIV1 3ZFGA 2XGXA 3RFRA 4MGZE 3VHNA 3HMYA 3VL9A 2D6PA 1SEFA 5KWRA 3BPSA 3TEXA 3WW1A 3K3OA 4QDRA 3E6CC 4AEKA 1TMF3 3NAPC 1AX2A 1NOVA 1ASJ2 3CJIB 4G9SB 2WZPP 4CDXA 4E2GA 3WF4A 1H6YA 4EZHA 4TZDA 4AI0A 1PO21 4JC1A 4AEDB 4LK6A 2D3PA 1DBNA 1VE0A 1REEA 1ZNPA 2BNOA 2XB6C 1AL22 4AAPA 4YZ5A 1EV11 4BH9A 2IWGB 1PK6B 5F7UA 2VTXJ 2VZVA 2WUHA 3N7KA 2GMMA 4AQ2A 1NCQB 1T2XA 5A1FA 3BB6A 5FQ0A 5B4NA 2PMWB 3M70A 3POWA 3PTRB 1RXFA 2QQWA 4QX7A 4AE2A 1YQ2A 1N1TA 2Q0AA 3PMEA 4M4RA 4X6RB 2P37A 3PIJA 2XMLA 4QGLA 4ZU7A 5J09A 4S2GA 5I93A 2WZEA 4HVRA 4P5HA 2AGSA 2BP6A 4CU9A 1UY3A 2MEV1 2UY9A 3O7OA 1XNAA 5C6CA 2BBVA 1JYTA 2WKKA 1UXZA 3KT1A 4NIGA 3ZYBA 1XB9A 3EBRA 4J1WA 2RR13 4KBZA 4RYDA 3AYDA 4DINB 2J1RA 1ZA7A 1MS4A 5DDJ1 3AFKA 4QGNA 2RM22 1H8TB 2BZDA 4Y5Z0 4B3NA 4CEYC 5JXJA 3V0BB 5L73A 1IGOA 3AFGA 3NV3A 2YC4A 4WM7A 5JI7A 3AVSA 5ABJA 4L92A 1G6NA 4L11A 1ODMA 4I0BA 1BMV2 2D44A 3AMPA 3LPGA 4YVWA 5JZGB 4LUMA 1GQHA 1NXD1 2ARAA 5K0UB 3E6DA 2GC3A 4Q4X3 2G4IA 2R042 4JAAA 4RQPC 5T5LA 1GQGA 1WD3A 4QX3A 1BVP1 5A6QA 4W6XA 4GH4A 4PBPA 5FY4A 5ABJC 3VHOA 4TN7A 4Q27A 4WVWA 1ONAA 2A6WA 3SC7X 3W20A 5J1XA 5M0TA 2DVFA 2Y0IA 3D0JA 3VZMA 2VMGA 3MIEA 3VGIA 3WY6A 2GMPA 2XL9A 3THCA 4JX0A 1FV2A 5C8CC 2R063 4C90A 4WZCA 2DCKA 3FFZA 1K42A 1UKGA 3TNQA 3LA7A 1Y9GA 5FLJA 1SMVA 1RIRA 1URXA 5FZHA 3KB5A 4Q26A 2WYFA 3NKGA 5BV6A 3H8UA 2WS91 2YZ4A 3V56A 5C3RA 5CFCC 3IAPA 1L7LA 5FYTA 1C8M2 2OUHA 1ZRDA 1CESA 2VMEA 1LNSA 1ND3A 2AZ5A 3DKWA 2BPA2 1UQXA 1W6OA 3PMSA 1CN1A 1W2AX 2OUJA 3LWCA 3VDDC 3VBSB 5JUVA 1LHNA 4XF0A 4AGRA 4Q4Y1 5T50A 4MV2A 2Y6LA 1AXYA 2DURA 2RDSA 4Q1PA 1UIKA 4GWJA 4Y4RA 4N7UA 3USUA 1R1ZA 3WP3A 3AXDA 1A8DA 4RN5A 2XQRA 5CYYA 2BWCA 1H6XA 1AZDA 1NA1B 3VBHB 3ZXFA 3CO2A 2ZEYA 2QQKA 2GAUA 2B42B 1SLIA 4QQHA 2VZ1A 2DUPA 2Y60A 1F4HA 5F6LB 4UFMA 2HWD1 2KA3A 1I5ZA 3UKTA 1H2MA 3WNXA 3VKLA 2ZOEB 4BQ4A 2ZEXA 5J37A 1OF4A 5FZKA 1PGL1 2W52A 3VD5A 3PUIA 3O1TA 4GMP1 5FPXA 1SLTA 3CHXA 4URTA 3SQOA 5A3MA 5FXWA 1OFSA 4GJZA 2VMHA 2ZGLA 1TEIA 2FDFA 4NHXA 3AJZA 1HRV3 5J96B 3FN9A 3MLKA 4AGVA 1LOAA 4I01A 1OD5A 2ZX2A 5FYSA 5ACA1 4D7TA 1MZFA 2UWCA 1OA3A 2O8QA 2DDUA 3RSJA 1MACA 2JG8B 4QM9A 4DRRA 3WP4A 4HT1T 4FAHA 4FPFA 5FJHA 4W4ZA 3ZFFA 5LA0A 2RDNA 2ZZQA 4ISQA 4A6SA 1U5YA 5JR2A 4NRPA 4PF5A 4GB31 3CJIC 1XNTA 1X9PA 4HVQA 3ZXLA 1DZTA 1VBC2 1ODNA 4DMIA 2FDHA 4Y1XA 1ZBA2 5CKQA 3I97A 3BIWE 4AEDC 1OOPA 3GHMA 4M0HA 1FAYA 1CX4A 4R9AA 2C24A 3RZJA 3SITA 5FPUA 2ORZA 4LJHA 4LKSA 1PK6C 4QPIB 4YM2A 1NG0A 3ACHA 4OZOA 2JDUA 3LD8A 3NMBA 3B02A 3JBG1 3OUIA 1NCQC 2RS12 2AENA 1QH7A 1I9RA 2JX9A 3D82A 1ULDA 3VD9A 1RUG2 3WVJA 1M06G 1S1AA 4NWWA 3ZYPA 1J59A 1RUC1 1VMHA 2IXLA 2OKXA 3VKNA 4DIQA 2QNKA 4IV3A 4M3CA 3BTYA 1CGPA 3LPFA 2WZR3 3TNPB 3VUOA 3UETA 2VPVA 3C3VA 2FCTA 3SNMA 4H14A 1HQLA 2P5BA 2XHKA 3WNOA 4DPNA 2E51A 4JDMA 4P9IA 2MPFA 4NIAA 4QQPA 1RHI3 1RUH3 1DHKB 1DGRN 2A7AA 2DFBA 2LS6A 2Q1MA 3WP5A 4RGKA 4XUPA 2E63A 4E8DA 1BZWA 5BUVA 1H8TC 3AKQA 4NUBA 2HWB1 1SPPB 4CA9A 2JG9A 4XCBA 4BQWA 3VBUB 5AC91 3POIA 3MDPA 3WDUA 5F2WA 1ENRA 1LHOA 3QLQA 2NLRA 1WUVA 4AVVA 5A3LA 2WO3A 2Y34A 1DZQA 3BKZA 4A4AA 2OT7A 2JB8A 5JZGC 1FMD2 4W65A 4BMBA 1FPN1 1YFYA 5A3PA 5K0UC 4NR1A 5DAQA 1VBA2 2Z5WA 2WJSA 5LCWL 2WRAA 3KSCA 1MEC3 4FXKB 4O7XA 1QF3A 2CYFA 3N36A 3DPRA 4W6WA 4A44A 1S2BA 2FQPA 5TSWA 2WNUB 4LO7A 5A3OA 3WOGA 4XXPA 5JR7B 4HSJA 3S30A 2VC9A 2LROA 1F5FA 1OI6A 2DUOA 1CZTA 3HVDA 4XZUG 1T6BX 1ZRFA 5LASA 5JAXA 3ZX7A 5IYYA 3D0SA 4HBNA 2CWMA 2ZJCA 4XHXA 5KR7A 2FDKA 1Y43B 2RJLA 3WQBA 2ZMNA 5A3NA 4LKFA 1POV1 2AREA 3HQUA 2P3KA 2ERFA 3LGRA 4B4RA 2FMYA 2EAKA 1EUTA 5CIRA 3A0KA 1ULEA 1N1SA 1ZZBA 5E89A 1CAXB 5LBBA 3I59B 5D1IA 5IK7A 2VQTA 1F8VA 1RC6A 1EPWA 3WG4A 3BTXA 4K8RB 2YV8A 3CF6E 3MZHA 5G05L 2Z69A 3VBSC 5FZFA 2CHHA 4MX3A 1JYIA 4RD7A 1NE6A 1QH6A 2VO5A 3CJXA 3FUQA 5FYUA 1SDDB 3QH6A 3OUHA 1UY1A 3FL7A 5IVFA 4QKNA 1CIYA 1A8MA 1AXKA 1OC1A 4RR3A 4Q4V1 4PHZA 1E5HA 5SV5A 1UZYA 1AUYA 3DUIA 1ND2A 3OGJA 2WSUA 2W1UA 1QJU1 3WP6A 3VBHC 3L2YA 1NA1C 1W8TA 4YYOA 1PO22 4DXTA 4KG0A 4PI2A 3UGHA 3BOPA 4YG0A 2YDEA 3ZXAC 4CDQB 4RSUA 2WYSA 4P02B 1ZBE3 2PQQA 1W6MA 3KS7A 2Z42A 1XU1A 4JGYB 4QPGA 1YC61 3H8RA 1IS3A 1C57A 1SLCA 4OI0A 1SFYA 1S0CA 1PZ8A 4D7SA 4E2QA 1XE7A 2VBDA 5CVRA 5HI0A 1JN2P 2QQNA 3MW4A 3BPZA 3CU7A 2SBAA 4AQTA 2DVAA 4MSVA 4Y3OA 4AI9A 4ASMB 4CP1A 1FOD1 3DKQA 2QQVA 4UFHA 4HLTA 4Z8BA 5JIUA 1LGBA 3TEYA 3C7FA 2X5IA 1RUI3 1W03A 1HRI1 2GN3A 1XYPA 3AZWA 2IZWA 4IGOA 1CQ9A 4WVVA 1NT0A 2B7YA 2VZPA 4H7MA 1VMFA 5CBLA 4P9GA 2G9ZA 2JG8C 4F83A 2RS51 3PUQA 4CCDA 3APBA 1YUDA 3RI9A 1C5IA 1SCRA 2Y6FA 5F2SA 4LITA 4LBQD 1QQP3 5F3CA 1LENA 1UY0A 1TG7A 1QJY1 1UX7A 1A34A 2E33A 3ZFGB 2V73A 3JZVA 4E4ZA 1LTEA 2YHJA 1XOYA 5LK5A 5IVVA 4D0QA 4LBMA 2WNVA 1K12A 4CDXB 2QCSB 3GJAA 5FZ9A 2D40A 3IB3A 4GXLA 4J25A 5LA1A 1COV2 4Y24A 2JDMA 4WVZA 4DY5A 1RUD3 2VGDA 2W91A 3JCIA 4QPIC 2V72A 4EZ4A 4EN8B 1OVPA 1H4GA 2QQUA 2YGLA 4XE9A 2JECA 4C1WA 1UCXA 1UU5A 2NMOA 1EAH3 4FP3A 2I45A 4OI1A 3B93A 5D8AA 5FQ0B 2WINB 2XHNA 4CEWB 3MI8A 4EQVA 3JD73 2UU8A 2Q1FA 1GR3A 4QB2A 1ZREA 5DZGA 1TME3 2Z79A 4ZONA 1U5ZA 1HW5A 2F17A 5FJKA 1KEXA 2ET7A 5IAVA 3RRDA 2YBKA 2XLGA 3ILNA 2XL7A 1NUKA 1D4M2 4EV0A 3ACLA 1ASJ1 3ZVXA 1JH5A 4DS0A 5C3OA 3HQXA 4XBLA 3KLSA 4Q4Y2 4CU7A 5DZFA 2YFUA 1OLQA 3VBUC 2QUOA 5IJRA 2VAUA 4CXWA 1W8OA 1EUUA 2TBVA 4RA0A 3KGZA 2GU9A 4WM7B 1AYN3 1AL21 1UMZA 4HXCA 2A1XA 2OS2A 2YBPA 3AYEA 1XNKA 4QXCA 4YVWB 3R0RA 2XOMA 2BQPA 1STMA 4V2WA 4XMIA 3DF0A 1VP6A 5AFEA 2VW0A 3C7HA 2XUEA 2RMU3 5GJ6A 5F37A 2MNGA 2JDAA 4AF9A 4HZFA 1OFNA 2RHPA 1QOSA 2WNUC 5JMCA 2B46X 4H2AA 5A7PA 4GH4B 3MO4A 2HWD2 2CGNA 1CAUA 1W2NA 5FMDA 5FZ0A 3GJBA 4PIYA 4XQ4A 3VN4A 4WZFA 4CZSA 1MZ5A 1ZZ8A 2PHFA 2W68A 5F1RA 2VU9A 2VVFA 3C7GA 5LW9A 3KT4A 2IXKA 4MHRA 3Q8BA 2VZSA 3TRSB 4UBHA 4BJ0A 3POFA 5FDBA 3VLBB 4GA9A 2RM21 1B35A 5FP7A 3LQCA 4Y1ZA 1H2LA 1VBD2 5A6YA 4F7ZA 2Q8OA 1BMV1 4Q5OA 1Q8SA 2GN7A 3LIGA 1KDKA 1D2SA 4MGQA 5AC93 3J7NA 1ND3B 2R041 4QHBA 4QHZA 3BGAA 5JOZA 1R082 1I3HA 4PI0A 2XONA 1VBB1 2D43A 3B9CA 2NYYA 3ZXGA 4PLOA 4FCAA 5DUWA 2IFRA 2OXBA 2XG3A 2ZHKA 4IGQA 2HBTA 5BPXA 1PIV3 3BU0A 2RS32 2K9ZA 3BTZA 2A70A 5FAXA 2XBO2 4OFGA 3RZHA 1ST8A 3UESA 2DCYA 3FJSA 5DQ0A 1SFPA 4XIKA 5CFDB 3BCWA 4MLOA 2CU5A 3M3OA 1DG6A 1W6QA 3ATGA 1IPSA 5IVBA 1JYNA 4JGYC 2PFWA 2ZXQA 4FXGB 1Y9MA 1NLQA 3VDBA 1GP6A 2BVVA 1W0OA 2KM2A 2WT2A 1EV13 5FZBA 3KF3A 2VNVA 5KHIA 4IV1A 4Y1UA 2Y6GA 3MV11 5LRRA 2FZ2A 1C8M1 2WA3A 3H3UA 1RVF2 2YUEA 2D7FA 3OPZA 1OURA 4AFDA 3QOPA 3H0OA 3N9MA 2QZ2A 2V5DA 3VD4A 2XJRA 3G6JB 4UWDA 2NZ9A 5IFTA 4CCKA 4FVVA 3HNYM 4URAA 1KFXL 2VOTA 5KHKA 4DXRA 1SDWA 3OBZA 4XCAA 4XFHA 1GZCA 3H1YA 3J8F3 5FOJB 2JE7A 3NNLA 1Y4WA 3MW3A 2J1VA 1YIFA 2HWB2 1X33A 2MEV3 1E57A 3RMYA 3V64A 3VD7A 3IBMA 4IGPA 1US3A 3WUCA 2WBKA 1QNWA 4XJUA 5EYYA 5F5AA 3ZFFB 3ZXJA 4AFCA 2C26A 3MFCA 4V2VA 2D3SA 4XFGA 4YLZA 3ZFGC 5DDJ3 2E7QA 1PM4A 1FPN2 4YWAA 2YU2A 1V6JA 4LUKA 5A33A 4AOCA 5A7NA 1IQAA 1AYM2 4CDXC 4LE3A 3KM5A 4IEWA 3UT0A 4ITCA 2J1TA 4KWKA 1J3RA 1KJRA 4Z07A 3RS6A 3ACIA 4JRLA 4QQLA 4R9DA 1OOPB 3VZNA 1OVSA 4YZ2A 4LQRA 4COYA 3HJRA 2W87A 1Q56A 5LB6A 3CKHA 3P3NA 3S5AA 2ZHNA 3Q8FA 1JOPA 1JYCA 3VDAA 1JXNA 2Y6JA 2OPKA 1HQNA 4WVMA 1NLSA 4RHV2 4COUA 1JZ2A 2VQ0A 5FUPA 5FY1A 4CEWC 1ENQA 3UNPA 2V09A 2SLIA 2EA7A 4L99A 5A1LA 3NJYA 3FBMA 1UYZA 1KD7A 2WFF2 1UZWA 2NN8A 2OQ6A 1W2TA 5CNAA 3U1XA 4IV3B 4M3CB 4ZZ8A 2VECA 3RZZA 4MGTA 4N53A 1IOAA 2WL1A 3OBAA 1VIWB 2EALA 4LULA 2R49A 3GYDA 1MVQA 2WZ8A 2VMIA 4FPEA 2WNOA 4YW1A 1QXRA 1AR83 5CA6A 1VBC1 4Y1VA 2BTVC 2WS93 3ZXDA 1JZ8A 1ZBA1 2JG9B 1CZSA 4WM7C 4LBLA 2GZWA 4RFT0 4IERA 1LECA 2O14A 3EJKA 4OCTA 4ZHNA 4YVWC 3ZIXA 3T4VA 3T0DA 1UOJA 2RS11 1Q8OA 3ACFA 4UF0A 4FTSA 2GC0A 5FMCA 4LBNA 5CKMA 1AR92 2XUMA 5EPAA 2ZAAA 5ANQA 3D5OA 3PTYA 5GKAC 1RUG1 4GH4C 5LATA 2OVUA 2W92A 2NMNA 3PUHA 4PIZA 5FMOL 1W28A 4JGZB 3FMGA 3NV2A 1SACA 4O61A 3VV1A 1XRUA 3A7QA 2JEMA 1AXZA 2XJTA 4E4DX 3PDQA 4YGCA 2G19A 3P6BA 1YI9A 2J1EA 4CCEA 3P1IA 4GMP3 4ZS3A 5JXGA 2FCUA 4LOSA 1PX4A 4I3PA 1J1LA 4HK8A 3S6PA 3T2TA 3ZSLA 5KHHA 2FBEA 5EHDA 1WMDA 2VZQA 5EZWA 4GULA 1FMD1 1UMHA 1ND3C 5EJ3A 5ACA3 1UF2C 3GF6A 1QJX2 4CCCA 2ZGNA 1FXZA 4YARA 4CP0A 2EXHA 4XOGA 3HR9A 5JI9A 1OSGA 4XUQA 5I0RA 4LT5A 3NL1A 2VBBA 3SISA 4XUOA 3FX3A 4NIHA 1LOFC 4DFSA 1F15A 2QJVA 4C91A 5C3QA 4TWTA 4RR3B 3SEPA 3KT7A 3IIIA 2DBIA 1ND2B 2X53S 1WLWA 2ZS6B 1UOBA 3MGUA 3OF1A 4YVSA 1JUIA 2VNRA 4GB33 5CFDC 4Q8LA 4JQRA 3TN91 1KQRA 3KQ4B 2YMZA 1QU0A 1W99A 4IEXA 4OUMA 3I3MA 2X05A 2ZX0A 1W6MB 4M3CF 1DGRA 1UL9A 4QPGB 1PMHX 2D6MA 1YCIA 4OULA 5JCTA 2W9XA 4HMZA 1VBE1 3EXUA 5FZDA 3CIHA 4CCOA 5SV8A 1GOHA 4HSLA 4SBVA 5A32A 3JBG3 2VMDA 3MBWA 4AEMA 5J36A 3T1LA 1OF3A 1WD4A 4A3ZA 3ST7A 3H7YA 1VR3A 2X5IB 3R4SA 5BNPA 3T09A 1RUC3 5T3NA 1J3QA 1HXS1 1GP5A 1K45A 1MS3A 1N3OA 2B39A 4N9HA 2X10A 3ASIA 5FZOA 1LOEA 5FP3A 4QXHA 5FXZA 3B7MA 2Y0OA 3CL1A 3M3QA 3RYKA 3ZFFC 1H30A 5FZGA 3N9PA 4CCLA 3ZN6A 4G4FA 4KL1A 2HWE2 1MZEA 4XJWA 1EP0A 3I54A 2EXKA 1HV1A 2PHWA 2CDOA 2VOVA 4DXSA 5A6XA 3VB9A 2D6NA 5KC6A 3HQRA 2WNVB 4AXOA 2VULA 1UNBA 5GLVA 3UGGA 4IEPA 3WR0A 1ZZ9A 4QMAA 4ARXA 3V0AB 1NZIA 2RDQA 1IPJA 1OOPC 3PUSA 4XILA 1H1MA 1WW5A 5FP8A 4BZ4A 2WO2A 1UD1A 3UKNA 4MXWA 1XNCA 1GMMA 1F5JA 1FATA 3I3EA 1JZ4A 2Q8EA 2X8KA 4IDZA 3NNJA 5FY5A 4NPRA 5D8AB 2C6SA 4NHKA 1O8SA 4LBQA 4NPMA 1AR72 1V6IA 3S57A 4UFJA 4IV3C 1POV3 4COWA 1YNAA 2W08A 2W46A 3B3QE 4BQ2A 4D6SA 4AQSA 2DVDA 3KV9A 5F8PA 2BDRA 1BBT3 1A78A 1BEV2 1WW7A 4LBJA 2BRTA 3VZKA 3LOBA 2IXIA 2ZGSA 3KCXA 1E5IA 4KWJA 5C4WA 2PELA 3ETPA 2FDIA 2BFUS 3WG2A 1HB1A 1VBB2 5LRSA 2R0FA 2JG9C 3MIGA 1COV1 2VTXA 2WSVA 3PU3A 4UOJA 2HBUA 2X09A 1L7RA 3UV9A 1GANA 1NE4A 5IFPA 2D5HA 1WCUA 4I0AA 4XAEA 3EO6A 1VJ2A 1OD3A 1XE0A 4K3UA 4JKMA 5BY5A 2J1UA 4LIVA 4RGGA 5JOXA 3WNLA 4Q4V3 3QBQA 1V9U3 4RFRB 5A80A 4JTNA 1V6MA 1QJU3 2DBNA 4J1XA 4M00A 3B9IA 1PZ7A 4BK4A 3OSDA 4EE2A 5JLVA 1O3SA 1YRZA 4LPLA 4JKLA 2HEYF 1CAUB 4JGZC 1LRHA 1N1VA 2UY8A 2R1DA 5EP9A 1J83A 1X8MA 2YGMA 3IDEA 4CP9A 4E9KA 1XXNA 2ZZJA 1LEDA 4S2HA 5CKNA 1Y9QA 4IEVA 1D4M1 3POGA 1KXGA 3NKTA 3AZYA 3AYCA 3ES1A 3HEIA 1QEXA 2Q5TA 1TNFA 3HPNA 1HB3A 4NMIA 3MPBA 4XETA 1B35B 3N7MA 1G9AA 3K2OA 2QFEA 1VRH3 2EXIA 1FOD3 1GYKA 3ROUA 3OPTA 4IESA 5BNQA 1AX1A 3ZDVA 4Q0SA 1OLRA 1YFXA 3O1SA 1MS9A 4V1PA 3ZFEB 3ZYFA 2VD7A 1VB4A 3WG3A 1GSLA 3BALA 2RS53 1WA4A 1I1EA 1GICA 4XQWA 2DFCA 3VKFC 5K8SA 1KS4A 4QDSA 4K8FA 5E6HA 2OZ6A 3WDXA 1YXWA 4YZ3A 3BIEA 4RR3C 2B9UA 1QJY3 5HPOA 1WMFA 1ND2C 1YYNA 2ARCA 1OH4A 3IKWA 4QU2A 1GWMA 4NROA 5ANNA 2DVBA 4LA3A 3DCQA 1UY2A 4NN0A 3SKVA 1RUE3 4IW3A 4XFCA 4BYYA 5K4LA 1W6QB 1RUF2 2JD4A 3OGRA 4UAPA 2CY6A 5BXXA 4QGMA 4LKDA 1UW8A 1R1A2 4QPGC 5EYXA 3VBRA 4AEJA 4D94A 1G9BA 5FY7A 2AEZA 1MS0A 1N3QA 4XEZA 1DF0A 1VBD1 3A21A 4GKXA 1DQ6A 1UYXA 1OQ1A 4DO0A 1DLLA 3K75B 3AP7A 5FZCA 1S0JA 1D4VB 2PHLA 2RJKA 2V4AA 3M4FA 4XUNA 2VVEA 2WO7A 2CGPA 2HWF3 1XYOA 1RUOA 3CMGA 3AVRA 1R081 4FT8A 2X5IC 3LOIA 2CAVA 5IVCA 3MIBA 3LEMA 4R9CA 2V5YA 1V6OA 2EIDA 5FYIA 3ALQA 5L7OA 4AFMA 1X8EA 1W8ZA 2EIEA 3T0AA 1NKGA 2RS31 4KBBA 3LFIA 3U75A 2XBO1 3DGTA 1WLDA 5FZMA 4CXXA 5C3SA 4YZ1A 1F2NA 1FI2A 4AI8A 1ASJ3 5EIYB 3TAYA 2OIIA 5E1RA 4AYUA 5BNNA 5T55A 1VMJA 3H42B 4QQ2A 2ET1A 3BOWA 3KV5A 4BK5A 4ES8A 1G9DA 5HV4A 3GZEA 4W6YA 3WHUA 2JXAA 5A33B 3MW2A 2WNVC 4P00B 2PLV2 5KC5A 1AL23 2L9LA 4P9YA 5JPMB 4ZU5A 2JWPA 2JIJA 2EICA 1K5MB 3F95A 5I8SA 3WQ7A 4GIQA 1RVF1 4XYXA 5J3UA 2WC2A 3LE0A 4XFIA 5G04L 5IHRA 1IKPA 4YG3A 4DB5A 2ARXA 3O12A 4E4HA 5D8AC 3B00A 1JZ6A 4XUTA 2ZABA 3JQWA 1OH3A 3K3NA 5I8TA 4QWNA 5FPZA 1YFWA 1RMU2 1ALYA 4EWEA 1JUHA 1F9KA 1QJZA 4BE3A 4NO4A 5JOYA 1AVBA 2VOKA 5CG9A 1HJGA 2ZACA 5IAXA 1JI6A 2RM23 3SCFA 5C70A 2XJPA 3AP9A 3MUZ1 4LOTA 4U36A 2WAOA 5LY2A 4AR2A 4AVBA 1Z7S2 3U4XA 3PL0A 3AX4A 1W9YA 1AYM1 1DGWA 2ZKLA 3CLPA 3T2OA 1O7FA 2ENRA 2B45X 2PN5A 4Y4YA 4N8MA 3UKVA 2PA7A 3AZXA 3THDA 2R043 5AVPA 1Y3TA 1RUJ2 1BQPA 5F5IA 5F5CA 5FZ1A 4KMQA 2XPJA 2A3YA 5FYYA 2VR4A 1H1AA 1AJKA 3WXPA 1PNFA 1W9FA 3R4DB 4FFIA 2A6ZA 2P4EA 4RHV1 4UF0B 3TN92 1V6LA 3I3BA 1RYYA 2ZA9A 4MG2A 2Y38A 2E31A 2WFF1 3NJVA 3UJOA 5IVEA 1VBE2 5IT6A 5APAA 2VE1A 4PJYA 2GH2A 3JXSA 1U5IA 1XPWA 2XJVA 1IPKA 2VQAA 3C7OA 3FLRA 3IIAA 3MUY1 5HCBA 2NM1A 4CUAA 1B35C 4GWMA 4PQ9A 5DG1A 1WBFA 1C8M3 1HXS2 4OHWA 5FO7B 4COVA 5LA2A 4FP2A 4FOQA 3B01A 4P9XA 4YG6A 5C5TA 1JBCA 5J7MA 4GZ9A 1EYBA 2ZMKA 3LDRA 1UZZA 2ARBA 4HVOA 4LKEA 3ZFEC 4Y22A 1OQEA 1W8UA 1AR91 4XACA 2ADEA 1MS1A 2IXCA 3N7JA 1IS6A 4IETA 1GKBA 4DOUA 4EN7B 2WFPA 5LA9A 1AHSA 1QDOA 1WW4A 1UMIA 3LA3A 4D6RA 3MLLA 3K4ZA 1X9TA 1QJEA 5L19A 1RGSA 2J1AA 1PM7A 1SBFA 4CP2A 2QBXA 4XJAA 3U37A 1DP0A 3VKMA 4Q0VA 4GMP0 3ZN5A 2R7EB 4KWLA 5T5JA 3R05A 3ZSJA 1O5LA 3AMQA 1S2EA 2HWC2 3OYWA 1QJFA 3WW2A 3POYA 3WLUA 4YW2A 2ORXA 5FLIA 2WT1A 3HNBM 5E8AA 3W21A 3DN7A 1SBDA 1ZZCA 1POQA 2WN3A 4TLFA 2E6VA 5ERLA 1W6PA 1X50A 5CG8A 2PHRA 1IS5A 3I2DA 4FI9A 2CDPA 4JZRA 5FYMA 2JE8A 3EQEA 1QJX1 3RGBA 5EQUA 5IVJA 4FPCA 4XDQA 1GZTA 3FZ3A 4XZPA 5BNPB 2Q4SA 1GNHA 5LY1A 2G9GA 4O65A 3U07A 1YIPA 2WT0A 1DQ0A 3LDBA 5FZOB 2B4KA 2D98A 2G1MA 4IEUA 3H1MA 2HKXA 5DABA 5E16A 1LR5A 3RWKX 3MF9A 1DYOA 5C7GA 4SLIA 2HEWF 1AR62 4CSWA 1VBC3 2CNAA 2W47A 3AL6A 2P6CA 1ZBA3 2P1BA 3FHAA 3AC0A 4TLGA 5FYVA 4EN6B 4L9BA 1IG3A 2GC2A 3AL5A 4HKLA 1PK6A 1ENXA 2FZ1A 2YC0A 1O3TA 5GLUA 3FLPA 2P3JA 4QPWA 3BTAA 5DXDA 1K5MC 3ZSEA 2VMFA 2RS13 3FBYA 1S0EA 4AK3A 3J7LA 3I2IA 5FY0A 1SLBA 4ARYA 3RQ0A 1M4WA 4XPVA 4AHZA 4J6GA 3RMXA 1Q5OA 1DLCA 1W6NA 3OPWA 3J4UH 1RUG3 4MXWB 5F9TA 5JOWA 3H7JA 5C9AA 4B4QA 1J84A 1Q3EA 2YROA 4INDA 3M7AA 1IZ3A 4DRVA 3HD8B 3NWKA 4XF1A 5KXEA 4HOOA 3PHMA 2D6OX 2W39A 1ZM1A 4LBQB 2JD9A 3I3QA 2XJSA 3OB8A 1QY4A 3H8OA 3CZJA 2QQJA 3TYJA 5HBAA 1GU3A 1W39A 5L36A 3DXTA 4N53C 5ABJB 2HWE1 2YG0A 3SKJE 4AG4A 2Y6KA 1NLRA 3AJYA 4BCUA 5L9VA 1OUXA 1SZBA 3ZLIA 1C1FA 1DQ5A 2ZGPA 4A7YA 3I49A 2ZHLA 3ZSMA 5CAZA 2ID4A 4MADA 1FMD3 2NPIA 4XVHA 2P3IA 1CJPA 1NQJA 1VBA3 4H7LA 5FZ3A 1S4CA 3FHQA 4C0BA 5AVAA 2VH9A 2YPJA 2WAAA 2GC1A 1W8NA 3WQ0A 2P34A 1BK1A 3DYMA 1GNZA 4MGYE 2YYOA 4EYUA 2BW8A 5CZKA 1S0FA 4NE9A 3T08A 3VBFA 3U11A 1SQ4A 2V4VA 5FUIA 4P9JA 4BXFA 1AR71 3CNAA 3WNNA 1V6KA 2WZR1 4YPJA 2LUWA 2IFWA 5FO8B 1AX0A 1NCRA 2A6YA 3GCXA 2OW4A 4AAXA 3POBA 4XTPA 4I30A 4QX8A 4CP9B 3I3DA 1US2A 4DXZA 5FZ7A 1BEV1 4OHZA 2WQ8A 2VBPA 1W6OB 5GLZA 5D2AA 5IW0A 2VG9A 1WCQA 1WKYA 3E1F1 3FFQA 4AHYA 4CPBD 4DQAA 4FPYA 1UOGA 1H8VA 1TE1B 2J7MA 3K4AA 3OGSA 4HONA 4YW6A 3ORJA 4LO4B 4HK9A 3USUB 1PVC2 5JWPA 3VHPA 5C3PA 2G9FA 3RZGA 3AP4A 4AQ6A 1OMIA 2XH6A 3LFMA 1YLLA 2WWUA 1QNYA 5B4XA 3VBOA 2ZBJA 3A0NA 1N3PA 3H8XA 4Z2WA 3A23A 2XLFA 3ELNA 4MYEA 4XTMA 3WHTA 1ZZ6A 3NNGA 3HNMA 3G7DA 2CTVA 2PHDA 1PO23 1ULFA 2P2KA 4GKYA 4OUSA 2DCTA 2W1WA 5FPBA 3ZYRA 2FDJA 2JKBA 2X29A 4IEOA 4K40A 1PO12 1CVNA 4Q2FA 5BNOA 3N4MA 1A6CA 5DUXA 4A41A 4QKDA 3H9AA 1LHWA 2R072 3SH3A 4FO9A 4K1YA 5A6ZA 5I8YA 5DMYA 4O9EA 2IXJA 2ZEWA 5F32A 1LOCA 3BU7A 3KVAA 3V65A 3VHRA 2BU9A 3KMHA 4FOWA 4BPZA 1C5HA 2VM9A 2VUJA 3VBRB 2LW8A 2R6QA 3U14A 1WGPA 1YWKA 1R092 4BQXA 3E5XA 4FAGA 3ZXEA 1YEWA 2PHTA 3O1UA 1UOFA 2VW1A 4XABA 4XFAA 4B4PA 4Q4W2 4FPLA 4LHKA 1CZVA 5FO9B 4M0NA 1B09A 5LBEA 1VAMA 4YGEA 3LEGA 3FHIB 4GQ7A 5IUQA 2VCMA 3MFAA 1F35A 2YBSA 2GSYA 4CUCA 1OBNA 5BNPC 1MR5A 3JU9A 1TMF2 4YW7A 3O1VA 4JTOA 4FFHA 5FKCA 3S5QA 1GBGA 2LM3A 3H50A 1S0BA 3IM0A 3IWZA 3MPPG 3I4IA 3ECQA 3PNAA 3M3CA 4KH9A 4XQDA 4CVUA 5L7OB 3AYAA 2I07B 5FZIA 3AKSA 1LGCA 4HETA 1XNBA 4IUGA 3I2OA 4RS5A 5FWEA 1VB2A 1S0DA 3AP5A 1WMEA 2UURA 1ZBE1 4LBKA 1JW6A 3W5MA 3WV6A 4AVAA 4MUVA 1RUF1 2VZTA 2WWJA 3DEMA 2ZEZA 3HIFA 1Z78A 5BNNB 1QWRA 1COV3 1R1A1 4AHWA 1DDLA 1H9PA 1LU2A 1O4TA 5JMOA 4Y20A 4JQTA 3AMNA 4QKFA 3WX5A 2JENA 5T54A 5FBZA 1RL3A 3WDTA 4IEYA 2HYXA 3O1MA 4NHYA 1W0NA 3TEWA 1UN1A 1RXGA 3RVHA 2N7GA 1UPSA 4ZS2A 1IHMA 1ZZ7A 4AFAA 3RZKA 4NHMA 4QHOA 2RR12 1BCXA 4FPOB 1ZRIA 4BLIA 4JHZA 3GXUA 4A7ZA 2GALA 1NX9A 4UW5A 2F6BA 3R4UA 2E7TA 2PQSA 3M3EA 2Z2SB 3W59A 3I2JA 1XE8A 2JB4A 2VOWA 4L2NA 1O5UA 5F6KA 4A42A 5CB7A 1EY2A 2VXRA 1C1LA 4ATEA 1D4M3 5FTTC 2CGOA 2F4PA 3OCPA 1HX6A 1W05A 4LO6B 1WCKA 2VNGA 3LEKA 3GNEA 3MF6A 1RB8G 2XQXA 4Q4X2 1G7YA 5GLTA 4Q4Y3 4Y5TA 2WNEA 2JKXA 2GNDA 3S7EA 4IE0A 3B69A 3E6BA 5C4WC 2JJ6A 2PLV1 3DPRB 5FY8A 4HPKA 4FPHA 4XF3A 1ULOA 3IN9A 5GZFA 4AWDA 1HB4A 3IT8A 1YJKA 3W9AA 4BQ1A 2BGOA 1K5JA 4QX1A 3C8XA 1UU4A 2XVKA 3LSDA 2YB7A 1EAH1 2R062 4COZA 3B94A 4ZPIA 1KGYA 2QVSB 3WCSA 4CDWA 2HH9A 2HWD3 3MEPA 1O3QA 4JCKA 5T52A 2PXJA 1L3JA 2H0BA 3O14A 1KFUL 3ON7A 4M01A 1MVEA 3KV4A 1O91A 1RMU1 3LA2A 2QQOA 3PIGA 4QXKA 4QDQA 2DU1A 4A7KA 4QX2A 2R0HA 2C9AA 2XDVA 5FOBB 3UGFA 3C2UA 4MXVA 1G9CA 3PVNA 1BJQA 1HDKA 2JDZA 1MS8A 1Z7S1 2KXLA 5FFOC 5FR3A 1VBD3 5HXMA 1G9FA 2FD8A 2NQYA 1YO8A 2AC1A 2XR4A 5J98B 5LBFA 5A7SA 1Q8PA 2P3YA 3IDBB 1HQWA 1GV9A 4CCJA 1RUJ1 1R083 1OPOA 2WLQA 1GWLA 3GGLA 4NAMA 4GJYA 4XDOA 4IEQA 4NJ4A 3T4HB 3VZOA 3J7HA 4LHSA 1ZRRA 2RMU1 4GAZA 1OXCA 1DZRA 2FMDA 2PHXA 2PTMA 3N9OA 4N7IA 2BNNA 1AL0G 4Y22B 1CJDA 2J22A 1NYWA 3NW4A 4P14A 4I0WB 5DAWA 3TWIA 4E27A 1JZ3A 3KHCA 1U5XA 2QKDA 3INAA 2RS33 5GLWA 1D7PM 4CDQA 2XBO3 4KNCA 2JDKA 2VL4A 1JYXA 4Q0QA 3W5NA 3LIHA 3OEAA 4JDNA 2JDPA 1CONA 3LKJA 3O5SA 4AL9A 4K6BA 5F39A 4E8CA 1RINA 1KDMA 4LA2A 1PGW2 3VZLA 3POJA 3P3PA 1HRV2 5DPNA 1ZRCA 4Q29A 4CDUA 4XF4A 2CWSA 3VBRC 1FX5A 4WM8A 4BXSV 1X82A 2AUYA 1LAJA 1XBFA 3ABZA 1GZWA 1TZOA 1NXMA 4OUEA 5EWSA 1RVF3 4YW3A 3OBRA 4LR4A 4CRQA 4AVCA 3DL3A 4ONUA 3KD4A 4WBBA 4YM1A 5I0DA 1W9TA 4G3YC 1YI7A 1W6PB 3KGLA 4ATFA 2DUQA 4IEZA 5F3EA 3NSTA 1DGLA 1PGSA 3ZR5A 1ULGA 2ATFA 3FLTA 1W0PA 1XSQA 2PAMA 2EVXA 4MGKE 1BVVA 2HWB3 3W58A 4KGQA 3FE5A 4PDWA 3R6SA 2BFUL 1JYVA 1BYHA 3BI3A 4R8HA 1UPIA 4TSVA 3GCWA 3SLIA 2FDGA 4O9GA 4GD4A 3WCRA 3ZKYA 1OLME 5L7OC 2DCZA 4H3WA 2AEYA 1LKNA 3BUCA 1V0AA 1UXXX 2ZGMA 1HB2A 5F3IA 4A2UA 1OHFA 3PJQA 1FPN3 5JSOA 3H3LA 1WBLA 4QQOA 4Y26A 4LO5B 5F3GA 1LHVA 1XC6A 1TQ5A 4K20A 1AYM3 4XBNA 1P8JA 4OVEA 2NP0A 2HWC1 4ASLA 3OTFA 1ACCA 3LZZA 5BNNC 3O1PA 2XKOA 4R4ZA 2DTYA 5AFBA 4LHLA 2E53A 1W2UA 1GLHA 4S2DA 3WG1A 4JRAA 2XVGA 3RPQA 2WZR2 5GM0A 1D0GA 2O0OA 3Q8CA 3HN3A 5JXIA 5LWBA 4YW5A 4CEWA 4QX5A 2VXJA 4RHV3 2UYAA 4NWVA 2OYZA 4F8AA 4YFZA 2VUCA 1W9WA 2WDBA 4UW4A 3NNFA 1RHI2 1RUH2 1W6NB 3PU8A 1W90A 1W9SA 5IK8A 3J8F1 5C9AB 1PHMA 2WFF3 4FBFA 1VLNA 5I91A 4QX0A 4HN0A 5FPVA 3O0WA 2CAUA 3GZTB 3HBKA 3Q9OA 3N9NA 3ENRA 1VALA 4H55A 2BYVE 4CUGA 5C5UA 2E7AA 1GQPA 4KU7A 3JUUA 4DZGA 1AR61 1H1IA 4EJRA 4EWAA 1MEC2 1S0IA 5FYHA 1DYPA 3ILRA 3JB4C 2W1QA 3NRUA 1NAEA 1TNRA 1WMXA 2D5FA 2VZUA 3RI8A 2HLEA 3GBGA 3AKRA 1QXPA 3DPRC 3K77A 3U78A 2XXZA 4HFSA 4N90A 2DWRA 1LCLA 4LTAA 4BB3A 4S2FA 1MQTA 3IDCB 4Y5SA 3LAGA 4MOAA 1T6GC 4HANA 1JTZX 2Q30A 1W8FA 3S0MA 4OI4A 4A6OA 2AACA 3GDBA 1AR93 4N43A 3GZAA 1CAVA 3KVBA 3WT3A 3MLJA 3RDIA 3SCHA 3J26N 1YQ6A 5A70A 3P5BA 2VOXA 4JHTA 5A3WA 3VBFB 1LOBA 4AI1A 4CU8A 5FP9A 5FP4A 4PLMA 1NCRB 1FYUA 4QD2A 1HRI3 2WA4A 3EYPA 3I7DA 5I0UA 1AR81 4AI2A 5JXHA 4XIOA 2GNTA 1JU4A 2EXJA 1LB2A 4UBGA 4W50A 3OD4A 4XXAA 5DUVA 3T3YA 1L7QA 1MZ6A 2XWBB 4B1MA 1QJX3 1ZX5A 1VRBA 2O1QA 3HT1A 4BIFA 3T2QA 1KS5A 1BKZA 2ILMA 1LOFA 3M3IA 1D0HA 2JE9A 3VBOB 4OMCA 2I2SA 1SLAA 1ZBE2 2WIIB 2WABA 4QPYA 2HJIA 3E97A 1LOGA 2IUWA 3POEA 2QQMA 4UI9L 5I0TA 5CFDA 2WN2A 5LEKA 2DV9A 1HN0A 2AR6A 2UWAA 4UW6A 3WF2A 4D69A 3NO8A 5BNOB 4P08A 2ZPXA 5JSRA 1RITA 1YHFA 4XJZA 4ZU4A 4IV1B 3PVEA 5L9BA 2RVAA 1CPNA 3KWVA 4IE7A 3MIDA 3A22A 4CPBA 1RUI2 2Q1ZB 3ZPOA 4D7YA 4KQ7A 5FYCA 2DTWA 3K46A 3PVBB 4XW3A 1JYWA 4B1LA 2UYBA 1OPMA 3D4KA 1UU6A 3WF0A 5FK8A 4YM3A 5KXCA 4QM8A 2Y64A 3LEIA 4YM0A 4BIOA 1BK0A 1KITA 2R1BA 1QQP2 1PVC1 4EWDA 1MPXA 1O4ZA 2LTNA 3ZYIB 3NAPA 5B2GB 1YQ5A 1UWWA 3O0VA 2VCAA 4BM8A 4TXWA 1JZ5A 3S7IA 3ZIWA 3ZYJB 2W94A 4JDOA 5LBCA 3RYPA 5GZGA 2TUNA 3IDAA 3HT2A 3KZ4C 3OEBA 4CXYA 3USSA 1NQDA 2HWE3 4NOTA 1PO11 4F3JA 3U10A 5HCFA 2ZX1A 2ZGUA 3FWEA 3FC0A 1TVGA 5T5OA 1OUSA 1O8PA 1RUD2 5H9RA 3U4SA 4RS5B 3WZ1A 2R071 4NAOA 2EF6A 3GBWA 1OKOA 1VAKA 2A6XA 4QAWA 3VL8A 2VCBA 4UXAA 2A71A 2W2IA 2C0ZA 3RZLA 5FMBA 1EAH2 1DYKA 2Q8DA 5FZEA 2ZGKA 3N9QA 2XLAA 2XWJB 4WVMB 4YNIA 1R091 4XDPA 2A75A 4C0HA 4Y20B 4C1XA 4D6QA 3ZPYA 3WF1A 1PMJX 4FOVA 2H6CA 5JDBA 2O8OA 3JD72 4UYBA 5DAXA 1AJOA 4FTEA 2TEPA 4Q4W1 3MHZA 1BLZA 2DCJA 1A3KA 1EPZA 1PMIA 1QGLA 1TME2 3DYPA 1S2KA 4PLNA 4Q8KA 3DYOA 1JODA 3IPVA 2WR9A 3J9SA 4HKWA 4N53B 1ZYBA 4UFLA 1HLCA 5FREA 4CEYA 1W04A 5H9PA 3M2MA 3RWNA 1CPMA 1TMF1 1IG0A 1AR73 1UYYA 1GUIA 4IXLA 4PF1A 2ZKNA 5C9AC 4MH0E 1NZCA 1WLCA 4X6QB 1GOGA 1G8WA 4DUWA 4XFBA 2VCCA 2QE3A 1V6NA 3AM2A 5D21A 1WCSA 3WQ1A 4OQ8A 1AYN2 1BEV3 1IQDC 4RQPA 4FFFA 2KR2A 4I02A 1I6XA 1S0GA 3KHBA 1HKDA 1VBB3 3ZXKA 5HV0A 4Y33A 4TYSA 2RMU2 2A5ZA 3UYJA 1V70A 1BXHA 3THTA 3SCGA 5CEHA 2VTFA 4Z2AA 3KV6A 1JS9A 1W8HA 4ZZ5A 2GDFA 4HPKB 4FQZA 2IC1A 3OY8A 5GZEA 5C8CA 3GBFA 1Q8VA 2AYHA 2JIGA 3EHKA 1DIWA 1YQ8A 2GMEA 3J7MA 4RL7A 4Y1YA 2RR11 5KXBA 1OLMA 1OKQA 2BGCA 4JGZA 1CWPA 4NHLA 4CDWB 3ZYHA 2KD7A 2GNMA 5IK5A 1LU1A 3VBFC 1UZVA 3WD5A 1OA2A 1YFUA 5CFCA 1C3HA 1X7NA 1PVXA 4AW7A 1K3IA 4YFWA 2E32A 3VDDA 4A3XA 5FZ4A 5IWFA 2C9KA 1NCRC 1HN1A 2RG4A 4C8DA 1BBT1 3ILFA 3OOXA 5A7WA 2HYKA 5T5PA 2BJSA 4Q4X1 5AC92 1R64A 2JDYA 3IZOA 4RGAA 4KGGA 5FBJA 4DUXA 3EB7A 3TOJA 5CADA 5JSPA 3HN1A 2DYCA 5LEJA 3AKPA 2R32A 2W5FA 4MGSA 1FT9A 5IVYA 5FZLA 1C4RA 2ZGOA 4UFIA 4A45A 2GP5A 3ZMNA 4AVTA 1PIV2 3CEWA 1DQ2A 3O1RA 1XNDA 5BYNA 2BBAA 3M1HA 3MICA 5KXDA 3NVCA 2GP3A 4YZ4A 1MS5A 3I2GA 2QQIA 2R061 2VNOA 5DN2A 4YVSB 2CL2A 4HG6B 3VBOC 4ES9A 1V9U1 3KCCA 1DQ1A 4XAAA 4BWOA 1PX3A 5A7OA 1WA6X 1LODA 2IVJA 2Z4FA 3L9JT 3RNSA 1UIJA 1UKRA 1EV12 3E5QA 4IL7A 4OHVA 1BHGA 5FYBA 1W3XA 3OBTA 1SFNA 4B8EA 4NVPA 5BNOC 1QIQA 2JDHA 5C33A 3A4UA 1O3RA 1RUF3 4IV1C 4CCMA 2XJQA 3NJZA 1R1A3 1SBEA 5A32B 4D3WA 4NRMA 1N47A 3IMMA 1J1TA 1CAWA 3I2FA 4PBOA 1OA4A 3ACGA 3T1MA 4JVAA 4KU8A 4FOYA 4CDUB 3UK9A 3CZUA 3K4DA 1VRH1 4LIUA 5EV7A 4NRQA 3TBDA 4WM8B 3J8F2 2VJXA 2RE9A 1GZWB 2MEV2 4NPLA 3PURA 1Q43A 4IQPA 4AI3A 2WWSA 4BISA 2P17A 3E5UA 3WSOA 5A1AA 2W0XA 3CJIA 3D6EA 3PLQA 2E9QA 5DDJ2 4DEQA 4EN9B 3WUDA 3ZN6B 2ZAHA 3K51A 2YY1A 1QOOA 3LCPA 5FWJA 1U0AA 3GZUC 4K21A 2YPDA 1O59A 3K48A 4AEDA 1W3VA 5FUNA 4PDWB 2BWAA 5A3TA 1XSRA 5EFUA 3SXWA 3POSA 2YC2A 2ZGRA 4OZXA 5DG2A 3ES4A 3Q8AA 1NY71 1NCQA 1RUNA 4R52A 3VKOA 3WINE 5IK4A 1RUE1 4PT6A 4QXBA 4RS5C 2PYTA 3T2PA 4W8JA 1PGW1 2C5DA 2OX0A 4MVTA 4LMFA 1WCDJ 1W2OA 1HRV1 2PLV3 4XF9A 3V0AA 3B5LB 3ZOIA 2D93A 5EXOA 3I2HA 4LNVA 3OUJA 4QKBA 2ZGTA 4BLJA 4Z92B 2VZRA 3FUOA 4Q1RA 4ZXKA 1SG3A 4BQYA 4OMDA 4I2OA 3MIHA 4QU1A 2RDRA 3LB9A 1PZ9A 4AZZA 5E88A 4OHYA 2BNMA 4GWIA 1FNZA 2HWF1 1GOFA 1UZ0A 3SMHA 1WZXA 1H8TA 1H2NA 3V0BA 1DFQA 1UY4A 5KHGA 3X29B 3HAGA 3WNPA 1AR82 1RMU3 3LF7A 4LEJA 2D3RA 1QDCA 2WS92 3SH4A 3I8TA 4D8MA 5C4WB 5JZGA 1G86A 2A3XA 5K0UA 4N9IA 3KQRA 3L2HA 2ZGQA 1PNGA 2QZ3A 2EAAA 2R16A 5FXXA 4ASKA 3O1OA 2ETEA 2OQ7A 4GWNA 1Z7S3 3KF5A 2ADDA 4DEVA 2IVIB 2VQUA 4YRDA 5JVVA 4I3GA 2ZX4A 2BGPA 4YSFA 2VUDA 3QH7A 3QCWA 2B5HA 2MHFA 4ORFA 4PQQA 4WV8A 1POV0 1RUJ3 3AZZA 3Q8EA 3AZVA 2HEVF 1CD3G 5CU1A 1MQTB 4XFFA 4GALA 3WNMA 3DECA 3PUAA 1HIXA 4FTBA 3TN93 3ZSKA 4YGBA 3VDCA 1APNA 3NNMA 2F4LA 4N43B 5FRAA 1RHI1 1RUH1 4CTEA 2WQZC 1CAVB 1UX6A 4E2SA 1RJ7A 4CDWC 2YXSA 1PGL2 5FKBA 2VY0A 3BYWA 3QD6A 1JOJA 1HJFA 1VBE3 1QXJA 5K9YA 1CX1A 3WDVA 5C8WA 2ZCWA 5C71A 2CSGA 3ZDSA 2TNFA 3VBSA 1U12A 1VAVA 2Q8CA 3RJRA 1X36A 4AFBA 2BERA 1ENSA 3OJBA 4BA6A 4IE4A 2K2SA 2A6VA 1GFF2 2D97A 2BVBA 2ZMLA 2R30A 1MEC1 5ACA2 2XJUA 4NIDA 3AXEA 4LXLA 4NIIA 1HXS3 4KI5M 4DY3A 2BV4A 3AB0A 1Z0HA 4BQ3A 3ZM8A 3VBHA 4ET7A 1NA1A 2QTWB 2DF7A 3ZFEA 1DU3D 3EMRA 3HWJA 3KCYA
chains in the Genus database with same CATH topology
4FPKA 3M8LA 3N3HA 4AGGA 4GB32 4Z1VA 1LULA 2JICA 4YVSC 2QDNA 1RJ8A 2OA2A 2DU0A 2VUAA 2BUKA 1WLTA 4B7KA 2QDRA 3N7LA 4CDQC 4XJ9A 4YW4A 2ZTNA 2VVDA 3RYRA 3JBG2 4X8PA 2HWC3 1REFA 3PJYA 4XJ8A 1C8NA 5LK7B 4MZUA 2JG8A 1QHDA 3AP6A 4Z82A 3HBZA 4XMAA 1RUC2 4CDUC 2GH8A 3IMNA 4BOWA 1ULCA 4WM8C 1Y7BA 1FV3A 2ZX3A 5FLHA 3NV4A 4FQ4A 3GALA 4LE4A 1ZA4A 3THPA 4YGDA 5H9QA 1DGWX 2QQPA 4XHBA 3NAPB 3ME2A 2DVGA 3DV8A 5H9SA 1QOTA 1IS4A 4FPJA 2WQ4A 4PDWC 1LESA 3UJQA 5LEKA 5GZCA 4CYDA 4QPIA 4K7JA 2FHRA 4E4SA 3D8CA 1AR63 1H4HA 3JB8A 2PAKA 1Q8QA 1AF9A 1H2KA 2VW2A 1RUI1 2XKPA 2OZJA 3RG0A 1K5MA 1DQ4A 1UAIA 4Q0PA 4EROA 5J48A 3WDYA 2AH2A 5DUUA 5JIAA 1N1YA 1H0BA 1KJLA 2EIGA 2PAEA 1QQP1 5KHJA 3WW3A 5DZEA 2ES3A 4PCRA 1XYNA 4LLFA 4AHXA 5FCCA 1JHNA 1BBT2 4ZKTB 3IPVB 1O4YA 4JV4A 3VBUA 2UWBA 4CEYB 2WLPA 5HCAA 3MYXA 3SHRA 3TB0A 3WDWA 2CV6A 2H0VA 2K0GA 3MIFA 5I0SA 2A73B 1CIWA 2GNBA 3JQXA 1HV0A 5GZDA 1RUD1 1OQDA 4RQPB 1QKQA 4L97A 2WNUA 4ISRA 3PVOA 1J58A 1C28A 3H1WA 4QT6A 4UW3A 4Q4V2 1ZVFA 3ETQA 1V9U2 4HKOA 5K7PA 2H6BA 3N35A 1QJU2 3JD71 3UL2A 3SH5A 3VZJA 4K1ZA 1MQTC 3OY8B 5C8CB 4HN1A 1REDA 3NV1A 1LEMA 1TME1 4DNYA 2D6LX 2PHUA 3OD0A 1S55A 4N43C 4OI2A 4BHPA 3AK0A 3ZN4A 4K9SA 1CAXA 3I59A 3GHNA 1D2QA 4Q0UA 2BEOA 2LALA 3O0XA 4KG8A 5CFCB 1VRH2 1FOD2 1GZ9A 3H3ZA 4HL0A 1AYN1 1YJLA 3AKTA 4FSJA 3VDDB 2Y26A 1HRI2 1J3PA 5F5QA 2A3WA 4P9WA 1LHUA 4B7EA 4PIXA 2RS52 4OHXA 1V00A 3AMMA 4BMEA 1PVC3 1VBA1 2C1FA 3QACA 1QJY2 1XQNA 2IXHA 1CR7A 5HXVA 4R4XA 1LGNA 4B29A 4I09A 5JPNB 3AMHA 4M3CE 4P9LA 3URFA 1F31A 3BODA 4JGYA 2B8MA 1FNYA 1NY72 2XVLA 4META 1RUE2 3LSEA 1WW6A 3ZYGA 4FPGA 2ZHMA 5FMOS 3OGGA 4XBQA 4LHNA 1PO13 1IKQA 4X8NA 3OYWB 4L8QA 1SCSA 1H9WA 1SLLA 2D6KA 2R073 5KBFA 4EN0A 1RTVA 4LO8A 3ZMOA 4LBOA 1KRIA 4MGIE 5AC91 4U2AA 1XU2A 3RJ2X 2I74A 1LJ7A 1QMJA 2HWF2 4LLOA 4R9BA 5GALA 1R093 1CAWB 3WW4A 4Q4W3 4OLLA 4AVSA 3ZO0B 3U0ZA 1PIV1 3ZFGA 2XGXA 4MGZE 3VHNA 3HMYA 3VL9A 2D6PA 1SEFA 5KWRA 3WW1A 3E6CC 4AEKA 1TMF3 3NAPC 1AX2A 1NOVA 1ASJ2 3CJIB 4G9SB 2WZPP 4CDXA 4E2GA 4TZDA 4AI0A 1PO21 4JC1A 4AEDB 2D3PA 1DBNA 1ZNPA 1REEA 2BNOA 2XB6C 4YZ5A 1AL22 1EV11 4BH9A 2IWGB 1PK6B 3N7KA 2GMMA 4AQ2A 1NCQB 3BB6A 5FQ0A 3M70A 3POWA 4AE2A 1N1TA 2Q0AA 3PMEA 4X6RB 2P37A 4QGLA 4ZU7A 5J09A 4S2GA 5I93A 4HVRA 4P5HA 2AGSA 2UY9A 2MEV1 3O7OA 5C6CA 2BBVA 2WKKA 3KT1A 3EBRA 4J1WA 2RR13 3AYDA 4DINB 1MS4A 5DDJ1 3AFKA 4QGNA 2RM22 1H8TB 4Y5Z0 4B3NA 4CEYC 3V0BB 5L73A 1IGOA 3AFGA 3NV3A 4WM7A 5JI7A 5ABJA 4L92A 1G6NA 4L11A 4I0BA 1BMV2 2D44A 3AMPA 4YVWA 5JZGB 4LUMA 1GQHA 1NXD1 5K0UB 3E6DA 2GC3A 4Q4X3 2G4IA 2R042 4JAAA 4RQPC 5T5LA 1GQGA 1WD3A 1BVP1 4W6XA 4GH4A 4PBPA 3VHOA 4Q27A 4WVWA 1ONAA 2A6WA 2DVFA 2Y0IA 3D0JA 3VZMA 2VMGA 3MIEA 3VGIA 3WY6A 2GMPA 2XL9A 1FV2A 5C8CC 2R063 4C90A 4WZCA 2DCKA 3FFZA 1UKGA 3TNQA 3LA7A 5FLJA 1SMVA 1RIRA 1URXA 3KB5A 4Q26A 3NKGA 5BV6A 3H8UA 2WS91 2YZ4A 5CFCC 1ZRDA 1C8M2 2OUHA 1CESA 3DKWA 1ND3A 2AZ5A 2BPA2 1W6OA 3VBSB 3PMSA 1CN1A 2OUJA 3LWCA 3VDDC 1LHNA 4XF0A 4AGRA 4Q4Y1 5T50A 4MV2A 1AXYA 2DURA 4Q1PA 1UIKA 4N7UA 3USUA 1R1ZA 3WP3A 3AXDA 1A8DA 2BWCA 3VBHB 1AZDA 1NA1B 3ZXFA 3CO2A 2GAUA 2B42B 1SLIA 4QQHA 2DUPA 5F6LB 2HWD1 2KA3A 1I5ZA 3UKTA 1H2MA 3WNXA 3VKLA 2ZOEB 5J37A 1PGL1 2W52A 4GMP1 5FPXA 1SLTA 4URTA 5A3MA 1OFSA 2VMHA 2ZGLA 1TEIA 3AJZA 1HRV3 5J96B 3MLKA 4AGVA 1LOAA 4I01A 1OD5A 2ZX2A 5ACA1 4D7TA 1MZFA 2UWCA 1OA3A 2O8QA 3RSJA 1MACA 2JG8B 4QM9A 4DRRA 3WP4A 4HT1T 4FAHA 4FPFA 3ZFFA 2ZZQA 4ISQA 1U5YA 4PF5A 4GB31 3CJIC 4HVQA 3ZXLA 1DZTA 1VBC2 4DMIA 4Y1XA 1ZBA2 3BIWE 4AEDC 1OOPA 3GHMA 4M0HA 1FAYA 1CX4A 4R9AA 3SITA 1PK6C 4QPIB 4YM2A 1NG0A 3B02A 3JBG1 1NCQC 2RS12 2AENA 1QH7A 1I9RA 2JX9A 3D82A 1ULDA 1RUG2 3WVJA 1M06G 1S1AA 4NWWA 3ZYPA 1J59A 1RUC1 2IXLA 3VKNA 2QNKA 4IV3A 4M3CA 1CGPA 3TNPB 2WZR3 3VUOA 2VPVA 3C3VA 3SNMA 4DPNA 4H14A 1HQLA 2XHKA 2E51A 4JDMA 4P9IA 2MPFA 4QQPA 1RHI3 1RUH3 1DHKB 1DGRN 2A7AA 2DFBA 2Q1MA 3WP5A 2E63A 1BZWA 5BUVA 1H8TC 3AKQA 2HWB1 2JG9A 3VBUB 3MDPA 3WDUA 1ENRA 1LHOA 3QLQA 2NLRA 1WUVA 4AVVA 5A3LA 1DZQA 5JZGC 1FMD2 4W65A 4BMBA 1FPN1 1YFYA 5K0UC 4NR1A 1VBA2 2Z5WA 2WJSA 3KSCA 4FXKB 1MEC3 1QF3A 2CYFA 3N36A 3DPRA 4W6WA 1S2BA 2FQPA 5TSWA 2WNUB 4LO7A 3WOGA 4XXPA 5JR7B 4HSJA 3S30A 1F5FA 1OI6A 2DUOA 1ZRFA 5JAXA 3ZX7A 3D0SA 4HBNA 2CWMA 2ZJCA 4XHXA 1Y43B 2RJLA 2ZMNA 1POV1 2AREA 2P3KA 2ERFA 3LGRA 4B4RA 2FMYA 2EAKA 5CIRA 3A0KA 1ULEA 1N1SA 1ZZBA 5E89A 1CAXB 5IK7A 3I59B 5D1IA 1F8VA 1RC6A 1EPWA 3WG4A 2YV8A 3CF6E 3MZHA 2Z69A 3VBSC 4MX3A 1JYIA 4RD7A 1NE6A 1QH6A 3CJXA 3FUQA 3QH6A 1A8MA 1AXKA 4RR3A 4Q4V1 5SV5A 1UZYA 1AUYA 3DUIA 1ND2A 3OGJA 2WSUA 1QJU1 3WP6A 3VBHC 3L2YA 1NA1C 4YYOA 1PO22 4KG0A 3BOPA 4YG0A 2YDEA 3ZXAC 4CDQB 4RSUA 1ZBE3 2PQQA 1W6MA 3KS7A 2Z42A 1XU1A 4JGYB 4QPGA 1IS3A 1C57A 1SLCA 4OI0A 1SFYA 1S0CA 1PZ8A 4D7SA 4E2QA 1XE7A 5CVRA 5HI0A 1JN2P 3MW4A 3BPZA 3CU7A 2SBAA 4AQTA 2DVAA 4MSVA 4ASMB 4CP1A 1FOD1 4Z8BA 4HLTA 5JIUA 1LGBA 2X5IA 1RUI3 2GN3A 1HRI1 3AZWA 1XYPA 2IZWA 1CQ9A 4WVVA 2B7YA 4H7MA 5CBLA 4P9GA 2JG8C 4F83A 2RS51 3APBA 1YUDA 3RI9A 1C5IA 1SCRA 4LBQD 1QQP3 1LENA 1QJY1 3ZFGB 2V73A 3JZVA 4E4ZA 1LTEA 2YHJA 5LK5A 4LBMA 2WNVA 4CDXB 2QCSB 2D40A 4GXLA 1COV2 4Y24A 4WVZA 4DY5A 1RUD3 2VGDA 3JCIA 4QPIC 4EN8B 1H4GA 2YGLA 4XE9A 2JECA 4C1WA 1UCXA 1UU5A 2NMOA 1EAH3 4FP3A 2I45A 4OI1A 3B93A 5D8AA 5FQ0B 2WINB 4CEWB 3MI8A 3JD73 2UU8A 1GR3A 1ZREA 5DZGA 1TME3 2Z79A 1U5ZA 1HW5A 2ET7A 3RRDA 2XLGA 3ILNA 2XL7A 1D4M2 4EV0A 3ACLA 1ASJ1 3ZVXA 1JH5A 4DS0A 3HQXA 4XBLA 3KLSA 4Q4Y2 5DZFA 1OLQA 3VBUC 2QUOA 2TBVA 4RA0A 4WM7B 3KGZA 2GU9A 1AYN3 1AL21 1UMZA 3AYEA 4YVWB 1XNKA 3R0RA 2BQPA 4XMIA 3DF0A 1VP6A 5AFEA 2VW0A 5GJ6A 2RMU3 2MNGA 4AF9A 4HZFA 1OFNA 2RHPA 1QOSA 2WNUC 5JMCA 2B46X 4GH4B 2HWD2 2CGNA 1CAUA 3VN4A 4XQ4A 4PIYA 4CZSA 4WZFA 1MZ5A 1ZZ8A 2PHFA 2W68A 5F1RA 2VU9A 2VVFA 3KT4A 2IXKA 3TRSB 4UBHA 5FDBA 3VLBB 4GA9A 2RM21 1B35A 4Y1ZA 1H2LA 1VBD2 4F7ZA 2Q8OA 1BMV1 1Q8SA 2GN7A 1KDKA 1D2SA 5AC93 1ND3B 2R041 4QHBA 5JOZA 1R082 1I3HA 1VBB1 2D43A 3B9CA 2NYYA 3ZXGA 4PLOA 4FCAA 5DUWA 2IFRA 2XG3A 2ZHKA 5BPXA 1PIV3 2RS32 2K9ZA 2A70A 5FAXA 2XBO2 4OFGA 2DCYA 3FJSA 4XIKA 5CFDB 3BCWA 4MLOA 3M3OA 1DG6A 1W6QA 3ATGA 4JGYC 2PFWA 4FXGB 2BVVA 1W0OA 2KM2A 2WT2A 1EV13 5KHIA 4IV1A 4Y1UA 5LRRA 2FZ2A 1C8M1 2WA3A 3H3UA 1RVF2 2YUEA 2D7FA 3OPZA 4AFDA 3QOPA 3H0OA 2QZ2A 2XJRA 3G6JB 2NZ9A 4FVVA 1KFXL 5KHKA 1SDWA 4XFHA 1GZCA 3H1YA 3J8F3 5FOJB 2JE7A 3MW3A 1YIFA 2HWB2 1X33A 2MEV3 1E57A 3RMYA 3V64A 3IBMA 3WUCA 1QNWA 4XJUA 5EYYA 3ZXJA 3ZFFB 4AFCA 3MFCA 4XFGA 2D3SA 4YLZA 3ZFGC 5DDJ3 2E7QA 1FPN2 1V6JA 4LUKA 5A33A 1IQAA 1AYM2 4CDXC 4LE3A 3KM5A 4IEWA 4ITCA 4Z07A 4KWKA 1KJRA 1J3RA 3RS6A 4JRLA 4QQLA 4R9DA 3VZNA 1OOPB 4YZ2A 4COYA 1Q56A 3P3NA 2ZHNA 1JYCA 1JXNA 2OPKA 1HQNA 4WVMA 1NLSA 4RHV2 4COUA 2VQ0A 4CEWC 1ENQA 2V09A 2SLIA 2EA7A 4L99A 3FBMA 1KD7A 2WFF2 2NN8A 5CNAA 4IV3B 4M3CB 2VECA 3RZZA 4N53A 1IOAA 2WL1A 1VIWB 2EALA 4LULA 2R49A 3GYDA 1MVQA 2VMIA 4FPEA 4YW1A 1QXRA 1AR83 5CA6A 1VBC1 4Y1VA 2BTVC 2WS93 3ZXDA 1ZBA1 2JG9B 4WM7C 4LBLA 2GZWA 4RFT0 4IERA 1LECA 3EJKA 4YVWC 3ZIXA 4FTSA 2RS11 1Q8OA 2GC0A 4LBNA 1AR92 2XUMA 2ZAAA 3D5OA 3PTYA 5GKAC 1RUG1 4GH4C 2OVUA 2NMNA 4PIZA 5FMOL 4JGZB 3FMGA 3NV2A 1SACA 3VV1A 1XRUA 2XJTA 2JEMA 1AXZA 4E4DX 4YGCA 1YI9A 4GMP3 4I3PA 3S6PA 1J1LA 4HK8A 3T2TA 3ZSLA 5KHHA 2FBEA 1WMDA 5EZWA 4GULA 1FMD1 1ND3C 5EJ3A 5ACA3 1UF2C 3GF6A 1QJX2 4YARA 2ZGNA 1FXZA 4CP0A 2EXHA 4XOGA 3HR9A 5JI9A 1OSGA 5I0RA 4LT5A 3NL1A 3SISA 3FX3A 1LOFC 4DFSA 2QJVA 4C91A 4TWTA 4RR3B 3KT7A 1ND2B 2X53S 1WLWA 2ZS6B 3MGUA 3OF1A 4YVSA 1JUIA 2VNRA 4GB33 5CFDC 4Q8LA 4JQRA 3TN91 1KQRA 2YMZA 1QU0A 4IEXA 4OUMA 2ZX0A 1W6MB 4M3CF 1DGRA 1UL9A 4QPGB 2D6MA 1YCIA 4OULA 5JCTA 4HMZA 1VBE1 3EXUA 5SV8A 4HSLA 4SBVA 5A32A 3JBG3 4AEMA 5J36A 3T1LA 1WD4A 3ST7A 3H7YA 1VR3A 2X5IB 3R