2GMEA

Metal-free (apo) p. angolensis seed lectin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
239
structure length
226
Chain Sequence
b'EDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPNQVIAVEFDTFYTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lectin
publication title Interplay Between Metal Binding and cis/trans Isomerization in Legume Lectins: Structural and Thermodynamic Study of P. angolensis Lectin.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 50
structure length 226
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2gmeA00
1W6OB 4AVSA 1IS5A 1LGBA 3PJQA 2NMOA 1RITA 1QGLA 1YRZA 4Y1ZA 1WD3A 4XJ9A 2VW0A 1AJKA 3FUOA 3AP4A 3O5SA 2KM2A 5E88A 1FV3A 3MW4A 3B00A 3WHTA 3SLIA 1W0OA 4BOWA 2GNDA 4P9YA 1W6MB 4K1ZA 1GNZA 5LK5A 3ILNA 1YIFA 2DVGA 4XOGA 5DG1A 1MZ6A 1CPNA 2Q5TA 5EWSA 1CQ9A 1N1YA 4TZDA 4FPCA 1FV2A 2WKKA 2D43A 3RG0A 2DURA 4UW4A 5H9QA 3OY8B 1YO8A 2JE7A 1G9DA 1N3OA 3AFKA 1CIWA 2VXRA 1C4RA 4BLJA 1LODA 2A5ZA 4TYSA 1JN2P 4U2AA 1WW6A 3LSEA 5IK7A 3V0AB 3VKLA 2WSUA 2A6VA 3NV2A 1KJLA 3SITA 4AVTA 1HKDA 1GBGA 4I30A 4XJAA 5GLUA 1QDOA 2ERFA 2EAKA 3WVJA 4DRVA 1CN1A 3D4KA 5JOXA 4XJWA 2R1BA 3M3OA 2A6YA 1LGCA 2W39A 2YXSA 3NV3A 4DS0A 4XTPA 2ZGKA 1LTEA 1JBCA 1WLWA 1IOAA 2ZGMA 3B69A 4KBBA 2GNMA 2SLIA 3ZYRA 1Q8VA 4YM0A 1HQLA 5DG2A 3AJZA 3WG2A 1FX5A 4FPGA 3IPVB 2JE9A 4XBQA 2G4IA 1ONAA 1IS3A 2WSVA 4M01A 3M3CA 1BYHA 2OUJA 1ULDA 1DIWA 3ASIA 2R49A 3ZXKA 2CWMA 4K1YA 1A8DA 1GV9A 3ZXJA 5CB7A 5T5LA 4GKXA 3WHUA 3C2UA 1DYPA 4YGDA 3MW3A 3AZWA 4FOYA 2NN8A 1MS5A 2ZMLA 1QMJA 1LHUA 1DQ0A 1VAMA 1GYKA 3V0BB 3WUDA 3ZSMA 3FLPA 2R1DA 2DUPA 1TEIA 3SNMA 3AP7A 3TB0A 2EXKA 1Q56A 1RIRA 5HCFA 3OYWA 3IM0A 2ZGRA 5EXOA 3AYEA 5DUXA 1KRIA 1KQRA 3SH4A 3TAYA 1BXHA 3WDXA 5T5JA 3IN9A 1AXKA 2CYFA 1Q8OA 1QF3A 3AP9A 3CNAA 1H9WA 4GALA 4YGEA 1WLCA 2BQPA 3KQRA 3OBRA 2VU9A 3RS6A 1SCSA 2PHXA 4K20A 4D69A 1QU0A 1W6QA 2PHRA 1UKGA 4YFZA 1LEDA 4FOWA 5JMCA 3V0BA 5DZEA 2AH2A 2DWRA 2UURA 2AREA 2P3JA 2R0HA 3BIWE 1G7YA 1V6LA 1R1ZA 4FP2A 4ASMB 2OUHA 2VH9A 4C1WA 4LBQD 2ZGOA 2ZGQA 1SLAA 2D6NA 3LCPA 4XHXA 1ULFA 3MEPA 1MS8A 5CA6A 5GZGA 3POWA 1DBNA 1S0CA 2VY0A 2OW4A 4FPJA 4BPZA 2YMZA 3PMEA 1C57A 1UZYA 2H0BA 3BTAA 1UZZA 2R16A 4LBJA 1QOTA 5IK4A 5F9TA 5H9SA 4R9AA 1MS1A 1MR5A 1U0AA 2YV8A 2A3XA 3M3EA 3FFZA 3W59A 4IQPA 1GLHA 1V6MA 1WW4A 1D0HA 1SACA 1ULCA 2D3RA 3HN1A 2EXHA 3INAA 1DGLA 1ENRA 3KM5A 1MVQA 1FNZA 1N1VA 4XXAA 4PF5A 2E53A 1H30A 1SLTA 3NV4A 1LOCA 3POYA 4Y26A 5GLWA 2A71A 1SLLA 1G9FA 2YROA 4JCKA 2DVAA 5FRAA 2ZHKA 3UJOA 1KDMA 1BQPA 4DPNA 1DYKA 1N47A 2EF6A 1BJQA 1MS4A 1WD4A 2W52A 1X50A 1S0EA 3I4IA 4WV8A 4Y20A 5AVAA 5SV8A 1AF9A 4CRQA 2DVFA 4PCRA 1DQ4A 1SFYA 1CR7A 4RL7A 3O0VA 4YW3A 2ZACA 1V6KA 4LBQA 4R9BA 2DU1A 1SLCA 3FLRA 4U36A 2PHTA 5T5OA 4Q26A 3AP6A 4XMAA 4FPKA 4BM8A 4Z8BA 2GMMA 4UW3A 1CONA 5IUQA 3ZVXA 5CBLA 3RSJA 1EPWA 3AK0A 3MW2A 1H9PA 1YYNA 2A6WA 2AYHA 2CTVA 2CWSA 4L8QA 1WBFA 4OZXA 3AP5A 3FLTA 1PZ7A 4R9DA 2ZGTA 3VUOA 1CJPA 4GXLA 5T54A 2RHPA 4DFSA 1W6NA 2ZAAA 4YW4A 1QDCA 4XJUA 4CZSA 3N7KA 4M3CA 2A6ZA 3DGTA 5E89A 1LECA 1SLIA 1MS3A 2V73A 4M3CE 5HCBA 4XDQA 4Y1VA 1JUIA 3MPPG 1ENSA 2JDZA 2I2SA 4XE9A 2C9AA 2CY6A 2WT1A 4YLZA 3M1HA 1UAIA 5IT6A 4P9WA 4AGVA 2XB6C 2ZGUA 4Q8LA 1LOEA 1CPMA 2AGSA 1I3HA 3AZZA 3GALA 3N35A 1AX1A 1AXZA 3ZSLA 3UK9A 3AJYA 4YM2A 2ZA9A 3A4UA 4FOVA 3ZXLA 1HQWA 3RQ0A 1S0DA 1GSLA 3WDTA 1LOFA 4FPFA 1LJ7A 4YZ3A 3M3QA 4AGGA 2HYKA 2ZGSA 3L2YA 1JHNA 1FAYA 1B09A 1LEMA 5GLTA 3OYWB 3UJQA 1VAVA 1CESA 1AJOA 2JD4A 2GDFA 4YW2A 1CVNA 2ZMKA 4LBLA 1HDKA 1YXWA 2UWAA 3N7LA 2D44A 4DQAA 5IK8A 1ZA4A 3BOPA 3ENRA 3AX4A 2AENA 2E7TA 2A70A 1F9KA 1LHVA 1GKBA 1UX6A 2DYCA 4FPEA 4ATFA 2GNTA 2WLQA 3AZVA 1QNWA 1N3PA 1W6QB 2EXIA 3A0KA 1LENA 3AXDA 1FYUA 2DU0A 3IMNA 4BMEA 4Y24A 4XZPA 3ZPYA 1NLSA 2DVBA 3I8TA 1GNHA 2ENRA 2E6VA 3T1LA 4BMBA 4H55A 4M3CF 2EIGA 3OPZA 4YG0A 5JOYA 1O4YA 4FVVA 3IKWA 2PHUA 3USUB 2LALA 1RINA 1DHKB 2GN3A 4HANA 1N1SA 4ZXKA 5GM0A 2A3WA 1LCLA 2FHRA 4WVWA 2DUQA 2NZ9A 3ATGA 3AZYA 5DUVA 2B7YA 5FREA 5E8AA 2E7QA 1V6JA 1KITA 1LGNA 2WJSA 2D6MA 3R4UA 3VKNA 1MS0A 4XXPA 5KXEA 4YZ4A 1PZ9A 2ZHNA 2ZABA 1LU1A 3WDWA 4JRAA 1V6NA 2D3SA 2Z42A 4Q27A 1KJRA 4AGRA 1GZ9A 3USUA 3WG3A 1SCRA 2A75A 4Y22A 1IS4A 4R9CA 1IKPA 4YZ1A 4YM1A 4Q8KA 3PVOA 3ZSJA 1F5FA 2YZ4A 4PQ9A 1N1TA 1OQ1A 3ILFA 4LBMA 1BZWA 2NMNA 1W0PA 2DUOA 3WLUA 2A3YA 1VIWB 3VKOA 1S1AA 1AX2A 4FPOB 4Y20B 1ULGA 3T2TA 3DUIA 1GZWA 3HMYA 5KXCA 3W58A 2ZHMA 3APBA 1DQ5A 1YI7A 4LBQB 5GJ6A 5GLVA 2UWBA 1QKQA 3AXEA 1Z78A 5KXBA 1G9CA 1LOFC 2LTNA 3B01A 2D6PA 1SBEA 2P3KA 2V5YA 1DQ1A 2SBAA 3AZXA 3R4SA 1N3QA 2P2KA 3T1MA 3WG4A 4AWDA 1IS6A 4XHBA 3FBYA 5GLZA 4FP3A 4F83A 1G9BA 1QOOA 4UW5A 1WBLA 1FNYA 4XTMA 1W6NB 4GA9A 3WV6A 2WT0A 1C1LA 4UW6A 5GZFA 5KXDA 4P14A 4M3CB 2ZKNA 4XIOA 2PHFA 2DVDA 5JVVA 3SH3A 4K21A 2NM1A 3M2MA 4YM3A 1JYCA 2ZMNA 1OKQA 2A7AA 1F31A 1S0FA 3UL2A 1G9AA 1SBFA 2AUYA 2P34A 4FPHA 4Q1RA 1AXYA 2GN7A 3D6EA 5DXDA 2W08A 3WCSA 1SLBA 2WT2A 1MVEA 5GALA 4P9XA 5F5QA 1GANA 1Z0HA 3V65A 1MACA 1V6IA 3WNXA 2DTWA 1GZCA 1V00A 5IK5A 2FMDA 3D5OA 1C1FA 1W6OA 4HL0A 1VLNA 4Q2FA 5H9PA 1KDKA 3WDVA 3VKMA 4XIKA 1WLDA 3VV1A 3QLQA 3VKFC 1HLCA 1LESA 1DQ2A 3WUCA 1APNA 3JU9A 2D7FA 5JOWA 2ARXA 1ENQA 2ARBA 2P3IA 4GWMA 1NXD1 3RMXA 4Y1UA 3SISA 2CNAA 2VW2A 3SH5A 3ZSKA 1W6MA 4LBNA 2VW1A 4NO4A 1SBDA 4PBPA 1JW6A 3FUQA 2ZGNA 1AZDA 1O4ZA 1DQ6A 3O12A 2ZGLA 1ULEA 2GMPA 4WVVA 4YZ5A 1WCSA 2ZHLA 1WW5A 3N7JA 3RMYA 1QNYA 1LHWA 4XBNA 3N36A 3WCRA 2R0FA 3HR9A 1MZ5A 3ZXEA 1LOBA 4M00A 3NV1A 4CTEA 1LHNA 1AVBA 3OY8A 2P37A 4YW1A 3Q9OA 4AYUA 5JOZA 2ZZJA 5CAZA 2A6XA 4FPLA 2UU8A 1PZ8A 3U4XA 3OJBA 3V0AA 5JDBA 1AX0A 3AYDA 3PVEA 1LHOA 3OBTA 4YZ2A 4ITCA 4PBOA 1VALA 4C1XA 1OFSA 1Q8SA 1UL9A 4YGCA 5EYYA 3RRDA 4BQ1A 2GNBA 3O0XA 1WW7A 5T55A 2PHWA 4XYXA 4YW5A 1DFQA 1V6OA 5CNAA 1URXA 1UMZA 5H9RA 2JJ6A 4Q1PA 3A0NA 2E51A 3AYCA 3JUUA 2XG3A 4FQ4A 4ISRA 5DUWA 4Y22B 3OGGA 4MYEA 4WZFA 2WNEA 5T52A 4XILA 1QOSA 2GMEA 2TEPA 3ILRA 3IPVA 3NWKA 4NOTA 5EYXA 2ES3A 5DUUA 1G8WA 1GICA 2ZBJA 5GZEA 1IKQA 3GNEA 4Y1XA 1XQNA 1JYIA 1W6PB 3R05A 4ATEA 2NYYA 1J1TA 1DZQA 3POSA 4YGBA 1S0GA 2WQZC 3ZXFA 5BYNA 1GZWB 4AVVA 4XJZA 5L73A 3V64A 4XMIA 1DLLA 2GALA 3N3HA 1UN1A 4BLIA 3B3QE 4YG3A 1MS9A 5JLVA 5T50A 3B9CA 1I1EA 1LOGA 2JKBA 2EALA 4DRRA 2UWCA 2AR6A 4YFWA 2NP0A 2EXJA 1LULA 2D6OX 3ZYPA 3PVNA 3BODA 1JOJA 1G86A 1S0JA 3WDYA 4JC1A 1A78A 4ZKTB 1Q8QA 1W6PA 4W65A 3N7MA 2JECA 1LOAA 5DZGA 1WUVA 3AYAA 5HCAA 1Y7BA 1S0IA 4YG6A 4LBOA 3WG1A 3O0WA 4XJ8A 1UPSA 2VUAA 2D6KA 4FPYA 4GKYA 4Y1YA 3WDUA 2DTYA 1LU2A 2W68A 5GZCA 3WOGA 2ZGPA 1Q8PA 1FATA 4LBKA 5DZFA 4XBLA 2PELA 1S0BA 4FQZA 4ISQA 2D6LX 4FOQA 2C5DA 5T5PA 3QCWA 1BKZA 4GWNA 2D3PA 4RA0A 1ZM1A 4SLIA 3WZ1A 1A3KA 1D2SA 2CL2A 3H0OA 1JXNA 3LSDA 2YY1A 2DV9A 5GZDA 2OVUA
chains in the Genus database with same CATH superfamily
1UWWA 4Y4RA 2JDHA 1U5YA 5EJ3A 4GD4A 5C9AB 4LA2A 1QGLA 1YRZA 5FYVA 1XNAA 3E1F1 3I7DA 2W95A 3J8F1 2KM2A 5E88A 3UGGA 4QX1A 3WW2A 3ZFGA 1CAUB 2LM3A 5C4WC 1JZ5A 1W0OA 5CIRA 1O3RA 1C8M1 2XJUA 4K7JA 1H2LA 1KEXA 2QQUA 3T30A 4Z2AA 3BTZA 2GNDA 2G9FA 2J22A 4W4ZA 1FPN1 2JG8B 1W6MB 4K1ZA 1JYTA 5F6KA 4NHKA 4ZU7A 3VBUA 1UY0A 5CZKA 1YIFA 4IUGA 3H50A 3PL0A 3CZUA 4J25A 5DG1A 5JPMB 2BRTA 1MZ6A 4XUOA 1CQ9A 2J1VA 1UMHA 4TSVA 2H0VA 2WKKA 4CVUA 1OBNA 2W47A 3I3DA 5FMOS 4UW4A 4BB3A 1JUHA 2JE7A 1G9DA 1VBC1 3H1WA 1C4RA 5FV3A 4B7EA 4OI4A 1JN2P 5CEHA 5JXIA 4FFHA 4U2AA 2XVKA 2WSUA 3GJBA 2A6VA 2PHLA 3NV2A 1JU4A 1DGWX 4BQ5A 4IEPA 1HKDA 4I30A 3TEXA 5FY9A 1UD1A 4LO5B 5JOXA 1ACCA 4EN7B 3H42B 2R1BA 2A6YA 1LGCA 3N9OA 3NV3A 4MXWB 5CYYA 5GKAC 1WLWA 1JBCA 2KA3A 5A1AA 5A32B 4L99A 2SLIA 1ZBA1 2VMIA 5IVCA 2VZVA 1HQLA 5L9RA 2RS13 3BI3A 4M4RA 3WG2A 3IPVB 2VQUA 4C0HA 1C3HA 3O1TA 1AYN1 1ONAA 2G1MA 3ZN6B 1RUD1 1ULDA 3ASIA 4QX0A 4JDOA 2GSYA 3LDBA 4F7ZA 2YPDA 2VCBA 4LO8A 4CEYA 1OLMA 1UY1A 4NHLA 1VBD1 2J7MA 1YC61 1UMIA 3LPFA 1OLME 5FZFA 5CKNA 3OD0A 2JDNA 4LQRA 3GHNA 2OPKA 2Z69A 4EWEA 1STMA 3EYPA 3I3MA 1VAMA 2WA4A 3LWCA 1Y9MA 2VMDA 5LA1A 1R091 4OQ8A 3AP7A 4AI9A 3TB0A 1IPJA 1Q56A 4QQLA 3OYWA 2ZGRA 4QWNA 2P6CA 3CJIB 5FY1A 1KQRA 3ZXDA 3IN9A 4IEOA 1AXKA 4KMQA 2O1QA 4GALA 2PA7A 2BW8A 4IETA 2JIGA 2BU9A 1EY2A 3KQRA 2JG9A 3OBRA 5IW0A 4YW6A 2XWBB 3HQUA 2PHXA 3H3UA 4D69A 1QU0A 5C5TA 2PHRA 3AL6A 3OSDA 2J1EA 4YFZA 3V0BA 2IVJA 1OC1A 1KXGA 2AH2A 5DZEA 5J36A 1P8JA 2IWGB 2W94A 3JXSA 4P9IA 5LRRA 1RHI1 3GXUA 3WX5A 4QB2A 3AB0A 2WN2A 2LRPA 5L9VA 1G7YA 3JZVA 4N43C 5FPLA 3RYKA 1JYWA 2VH9A 1PMIA 1SLAA 1W2UA 4QPYA 2ZX4A 4IV1B 1VBE1 1ULFA 1ASJ1 2W0XA 1UX7A 3POWA 3VZOA 1DBNA 1S0CA 4BPZA 2QDNA 1UPIA 2YMZA 3PMEA 2R16A 1QOTA 3LGRA 2QZ2A 3SQOA 3BVCA 5HV0A 3W5MA 1MS1A 4KG8A 2GAUA 3W59A 3IDEA 2D3RA 5FWJA 1D0HA 1UZWA 1AL23 1VP6A 5DDJ3 1OF3A 3INAA 1DGLA 2AZ5A 5LA0A 1FNZA 1N1VA 2YFZA 4JVAA 5GLWA 1H30A 3POYA 4JGYA 2A71A 3ZXAC 1POQA 1G9FA 4JCKA 4N7UA 3HNBM 2HEVF 1TMF2 3MUZ1 4QDQA 2MPFA 2WABA 4XVHA 4AI2A 2EF6A 4JX0A 5CVRA 5JR2A 2R32A 4FFFA 1ZBE2 3BKZA 1X50A 3I4IA 1B35C 1EAH3 5L7OA 1OURA 1AF9A 2BDRA 2DVFA 5DN2A 1DQ4A 1SFYA 3THDA 4A7KA 3O0VA 1BBT3 1PVC3 3VBHC 2HWE1 4JTNA 1XNBA 4CDXB 4NMIA 4OZOA 4PIXA 2Y0IA 4FPKA 4BM8A 1ZA7A 4Z8BA 1RUJ3 2FDGA 5IUQA 3ZMOA 1GQHA 3AK0A 3O1MA 1R64A 4AEDA 2AYHA 2CTVA 3JB4C 4L8QA 1PZ7A 4LEJA 2WS92 3PUSA 2HBTA 1CJPA 2ORZA 4OLLA 4OMDA 2W9XA 4O9GA 5FLHA 4BQWA 4DFSA 1RL3A 2XUEA 1QDCA 5A33A 2H6CA 2YU1A 2BGOA 4P9JA 2HJIA 4M3CA 3DGTA 4N8MA 3H1MA 1XU1A 4IEUA 5JUVA 1ENXA 1BK1A 1DZTA 2PQSA 2V73A 4M3CE 4ES9A 4Y1VA 3A23A 1VRBA 3KQ4B 5FK7A 1GOHA 1JTZX 2GP5A 1SMVA 4QKFA 4YLZA 5E1RA 4JGZA 1UAIA 3T2OA 5IT6A 4QDRA 4AGVA 4EROA 2AEZA 1AR93 4O7XA 3N35A 3NW4A 4AVCA 4CDWB 3T2QA 1XSRA 4BA6A 2RS12 1AX1A 3E6CC 5FLIA 1XYOA 3AJYA 4NHMA 2OZJA 3MBWA 1JODA 4D7YA 2I45A 1HQWA 3RQ0A 3KT7A 3VD3A 1HB3A 1GSLA 4CPBA 1LJ7A 1ND3A 4YZ3A 2VUJA 4BISA 1H8TC 4D8MA 2HYKA 5FZEA 4ZU5A 1JHNA 2RG4A 3A22A 3O1PA 1UY2A 5ACA3 3UJQA 1NX9A 4KWJA 1OA3A 1VAVA 4HPKA 2QQPA 2FDFA 4LBLA 2UWAA 3N7LA 2WBKA 5IK8A 4L92A 5IVYA 2W2IA 4MH0E 4IGPA 2XL9A 1YI9A 1IG0A 3KGLA 2ZKLA 4GJZA 1UXZA 3HVDA 1W6QB 4COVA 2YGLA 1PM4A 2X8KA 1UY3A 4MGSA 3ZPYA 2DVBA 4P9GA 5E16A 2WZEA 2E6VA 1LAJA 3VBUC 1OPMA 2WWSA 4M3CF 1POV3 1GWMA 3KHBA 2YC4A 3PU3A 3ACIA 1NOVA 5IAXA 2JDYA 3AMHA 1TNRA 1OH4A 1RINA 1SFPA 4HANA 2VQ0A 1UXXX 2FCUA 2V72A 2A3WA 3Q8CA 4BU2A 1Z7S2 1GP6A 4R4ZA 1NCRA 3ATGA 4DY3A 2VZPA 3GF6A 1QJU3 4IEQA 5ANQA 1TQ5A 3R4UA 2ZEWA 2WO7A 4RD7A 5KXEA 4GMP1 3EBRA 1EPZA 2RDSA 1PZ9A 2H6BA 1KS5A 5LW9A 2WFPA 2ZABA 1W2OA 5FZ1A 1V6NA 1HQNA 4QHBA 4Y22A 1IS4A 4R9CA 3SXWA 4Q0QA 5CU1A 5FBZA 4ZXEA 2C1FA 1GU3A 4CXXA 2QCSB 1NA1B 5FR3A 2CV6A 4OHYA 1XB9A 3HT1A 1YNAA 2WNVB 1BK0A 3KLSA 1QXJA 4BK4A 2B9UA 1YFUA 2VGDA 1Y4WA 3VKOA 4AF9A 4TWTA 1AX2A 4BH9A 4HLTA 4LITA 4Y20B 2HKXA 1ULGA 2JKXA 1X36A 5EHDA 4COYA 5LCWL 3FJSA 5LZ6A 2PN5A 1AL22 3APBA 4QPWA 1YI7A 4RS5B 3J9SA 4QU1A 5GJ6A 4CCNA 5LY2A 1Z78A 1W2AX 1LOFC 1PMJX 5IVVA 4UT5A 4GZ9A 1O8PA 1RUC2 2SBAA 4CEYC 3T1MA 3OUJA 3ZPOA 5FP4A 2VOKA 3WNKA 3I2GA 3PVBB 2X5IB 5GLZA 4GH4A 4QM8A 5DAQA 5AC93 1QHDA 1G9BA 2C0ZA 2JDMA 3JCIA 1WBLA 2E32A 4TLFA 3WV6A 1YQ6A 2OPWA 4UFMA 1EAH2 4RR3B 4AOCA 1QJX3 4AAXA 4CEWA 4QPGA 1VMHA 4Q0PA 1PVC2 2PHFA 3CJXA 3VD7A 4Y5Z0 1NYWA 3VDDA 4Q4X3 4K21A 2NM1A 2OQ7A 2CHHA 2ZPXA 1E5SA 1WA6X 1QXPA 3U11A 4YM3A 1RUJ2 3S5QA 3OF1A 1G9AA 4AVBA 1IPKA 1F31A 1W3VA 4CU8A 2P34A 4Q1RA 4FPHA 5FZ7A 3WINE 3WCSA 1I5ZA 1AHSA 4D7TA 5GALA 1WGPA 3SKJE 4XFAA 4EN0A 1GANA 3V65A 3K3NA 1V6IA 3WNXA 2JG9C 1V00A 5FZKA 4O9EA 5DAXA 2IVIB 1DF0A 2BBVA 5BY5A 3ORJA 3M70A 1RTVA 1PNGA 3LA3A 4I02A 4LIVA 5C9AA 5FWEA 4BWOA 4FFIA 1HJFA 4UFLA 3J7NA 3VKFC 1LESA 3DKQA 4YARA 4AL9A 5FXWA 3MIFA 1DQ2A 4Q29A 3WUCA 1APNA 1CAUA 2D7FA 3E6DA 1ENQA 3B93A 1H4GA 2ARBA 2RJ2A 3GBGA 3RMXA 2GH8A 5FXZA 2WC2A 5LBCA 1TMF1 2E33A 3I3EA 1S4CA 2CNAA 1ODMA 2JG8A 3ZSKA 4YSFA 1W6MA 2IFWA 3N4MA 3MIHA 5J1XA 4ZS2A 4B1MA 1SBDA 2PFWA 1EV11 1JW6A 1ZBE1 1AZDA 4YVSB 3WQBA 1BHGA 1SHWB 3MIDA 5FXVA 3KHCA 2ZHLA 1WW5A 3RMYA 3DYPA 4HT1T 2HWC3 4XBNA 5JXGA 2PQQA 2R0FA 4S2FA 4JHZA 4Q4Y3 4DMIA 5ACA2 3POGA 1JZ6A 1LOBA 2VZ3A 5F3IA 3NV1A 3B7MA 1AVBA 2FD8A 1GQGA 1QIQA 2P37A 3Q9OA 4JGYC 4RGKA 5FZ0A 4OCTA 4AYUA 3MV11 3LOIA 5CAZA 5JOZA 1MZFA 1YQCA 2ADDA 4FPLA 2RJKA 1PZ8A 3KV4A 3QD6A 4N90A 1RHI3 3IWZA 1PMHX 1UZ0A 2WS91 2Y0OA 3NJYA 4IV3B 4K40A 4XCBA 4XQWA 4ITCA 3KV6A 1VALA 4NPRA 4MGQA 1OFSA 3R0RA 4PBOA 1UIJA 5EJZB 5EYYA 5C8CC 3H8UA 3O0XA 4FTBA 5K0UC 2PHWA 5L7OC 1UNBA 5FYZA 5CADA 3USSA 1I9RA 2QDRA 5H9RA 3T4HB 4H7LA 4MXWA 3A0NA 3HJRA 3JUUA 2Q1ZB 3NAPB 2ILMA 4ISRA 1J84A 4QX8A 4QGLA 1YEWA 4MYEA 5A32A 3RFRA 3W21A 3K46A 3U78A 2WNEA 2QFEA 1UZVA 5T52A 4AQSA 3U4SA 4XILA 4XFBA 4AEDC 3IPVA 1JS9A 5EYXA 4AI0A 1D4M3 5A7NA 1O3SA 2J1UA 2OXBA 3GNEA 3ZN6A 1JOBA 1W6PB 3R05A 1VB2A 3KWVA 2B5HA 3OGSA 2RS11 3UT0A 1NLRA 4YGBA 1FMD3 1S0GA 2WQZC 4XJZA 1JYXA 3DYOA 5L73A 3V64A 2V4AA 1J3PA 4XMIA 3N3HA 4BLIA 4YG3A 4FBFA 4UFHA 5T50A 3BUCA 1XRUA 5FY4A 4DRRA 1O59A 4EZ4A 1ZVFA 5I0DA 4GWIA 3ZYPA 3BODA 1OSGA 1G86A 4ZKTB 3IMMA 1A78A 4LK6A 3FL7A 5FMDA 3N7MA 1RGSA 2ATFA 3PJYA 3VDBA 4COZA 1OT5A 2FCVA 2DCZA 3O0WA 1UPSA 4Y1YA 3J26N 5A3UA 3WDUA 4W6WA 5CG8A 3CJIA 3KCYA 3CU7A 5FQ0B 3IAQA 4LE4A 1L7RA 5GZCA 3D3AA 2V5DA 1ND3C 3K4DA 1Q8PA 4DXSA 4OHZA 4XBLA 3R6SA 2YG0A 4FQZA 2D6LX 4CCCA 5T5PA 5FPZA 1QJZA 4V1PA 4AXOA 1UOJA 3ZIXA 5AC92 3AFGA 4W50A 1Z7S1 1D2SA 2CL2A 2VUCA 3H0OA 1CIYA 3ZMNA 1JZ3A 1QJX2 2YY1A 4NIGA 4OUSA 2ET7A 3POEA 4ZPIA 4Q4X2 1LGBA 5BNOB 5AFEA 4LR4A 4CA9A 3ALQA 4IV1A 3WNLA 2NMOA 3I3QA 1WD3A 2ET1A 3JD72 4ZZ8A 1OLRA 1PX3A 5IJRA 4HKOA 1S2BA 4E4HA 1E57A 4WVMB 4LHNA 2JWPA 5C3RA 1ZZCA 3Q8BA 4K3UA 2WZR3 3ILNA 4NIIA 4XCAA 1M4WA 3C7GA 2DVGA 1UOFA 3TNQA 5C33A 4BJ0A 3UV9A 2Q5TA 3RI9A 2VG9A 1ZRRA 1AL21 4CCJA 4LK7A 4N7IA 5FUIA 3WR0A 2OKXA 1RUC1 4Q0VA 1N3OA 2TBVA 3C3VA 4QQPA 4BQ2A 5A3TA 1CIWA 1AR72 2VXRA 3O7OA 2Q0AA 3ON7A 4CDXA 4CU9A 3WW3A 3FMGA 2OZ6A 5EV7A 1X33A 3P6BA 4UAPA 1EAH1 1WMEA 4XJAA 5FZ6A 5GLUA 4AVTA 1IGOA 1PVC1 1NXMA 5FYMA 5DAPA 3D4KA 4DRVA 4EN9B 2HWC2 4LNVA 3M3OA 4Q4Y2 4LJHA 4LUMA 4UYBA 4XTPA 4BXFA 2ZGKA 5FZOB 1RUJ1 2ZGMA 4YVWB 4CYDA 5JXJA 5FPBA 2XXZA 1PK6B 3WW4A 3LB9A 1O3QA 1FX5A 3P5BA 2HWF2 4FPGA 4AFCA 2FDKA 4RQPB 4MZUA 4GH4C 4FAHA 3WQ1A 1IS3A 1DCSA 2WSVA 4O61A 4M01A 5F6LB 2BNMA 3P3NA 2Y6FA 4XAAA 4CEWC 1A8DA 2G19A 4QPGC 1D0GA 3LQCA 4YYOA 3IDBB 5D2AA 3NKTA 4Y33A 2ZX3A 3VDDC 3GCWA 1R1A2 3ZYJB 5K7PA 1J58A 4AEKA 1OUSA 5J09A 2YBKA 3C7FA 3UESA 4LKSA 1XE8A 4CDWA 4LORA 2PAEA 3ACFA 4I0BA 2NN8A 1D4M2 1ND2B 1CAWB 3ZYIB 1VMJA 1GYKA 1RUG3 3ZSMA 1RUF3 2OQ6A 2XKOA 2DUPA 5FZLA 4JQRA 3SNMA 2WZPP 4QQ2A 2JDAA 2VO5A 1FMD2 3ECQA 3IM0A 3H3LA 1BXHA 5FJKA 5FUPA 2K9ZA 4C0BA 5C9AC 4ZHNA 1Q8OA 3AP9A 1H6XA 2JD9A 1H9WA 4YGEA 4RHV1 5EJ1B 2WO2A 2EICA 1D2QA 2EAAA 1A8MA 5ACA1 1PO23 5DQ0A 2VU9A 4KU7A 4XUNA 3RS6A 3PURA 4OHVA 3N9MA 5HCHA 1DG6A 2R073 4UWDA 4B4QA 1W6QA 4NVPA 4URAA 4CUGA 2UURA 2AREA 2JG8C 2VOWA 2VULA 1QQP3 2R0HA 1X7NA 1O7FA 2VC9A 1V6LA 4FP2A 2VZ1A 4C1WA 4DIQA 2VMHA 3MIGA 2ZGOA 3I2IA 3AKTA 1MS8A 2PMWB 2VY0A 2OW4A 4FPJA 1FOD3 2YGMA 4LBJA 5IK4A 3C7EA 4AK3A 3T2PA 2Z5WA 1U0AA 1RUE3 1H8TA 3FFZA 4IQPA 1V6MA 1WW4A 3C7OA 1ULCA 2F4PA 3VN4A 1MVQA 4XXAA 3VHPA 2E53A 1SLTA 1W06A 3E97A 3GYDA 4Y26A 3VHOA 2XR4A 2YROA 4UBHA 1TMF3 1MEC2 1NA1A 4HSLA 4DPNA 3MFAA 1DYKA 2WNVA 1N47A 1W9SA 1EV13 1OI6A 1ZBE3 3PUAA 4FXGB 1F4HA 4Y20A 4E27A 5CG9A 5A6YA 5HPOA 2L9LA 5FMCA 3AMQA 1L7QA 1V6KA 2OIIA 4RS5A 3WQ7A 2WZR2 2DU1A 4OULA 1NLQA 4HSJA 2VVFA 3TBDA 4P00B 3POBA 2YC0A 4XF9A 2Y6JA 3RZKA 4IXLA 2ID4A 1H9PA 4XF0A 4OZXA 2WS93 3AP5A 1UOGA 2X5IA 3FLTA 3R4DB 4CUCA 2JX9A 1COV3 4XFIA 5T54A 3M7AA 1NY71 1VR3A 1ALYA 4YW4A 4CU6A 4WM7B 2RDQA 4RR3A 5AFBA 1KFXL 1E5RA 2LW8A 2GC1A 3POJA 2VD7A 2HBUA 4META 5FYSA 2W1UA 1SLIA 4E2SA 5AC91 1V0AA 5FO7B 4YRDA 1MS3A 2P6HA 2QQVA 3W5NA 1W8ZA 4LMFA 5FMBA 2Z2SB 5FLJA 4X6RB 2Y6LA 3QBQA 1QJX1 2AACA 4HG6B 1JMUB 1ENSA 4TLGA 4SBVA 4XFHA 4E9KA 2I2SA 2XVLA 3THPA 3CJIC 4UFIA 4Q4X1 3GJAA 2XL7A 2CY6A 2WT1A 3DKWA 4J1XA 1W99A 3M1HA 3QH7A 2FDHA 2Y26A 4PT6A 1NCQB 2R7EB 2XB6C 1F4AA 1TG7A 3AL5A 1I3HA 2QKDA 3AZZA 2C9KA 3JD71 5LB6A 4NAOA 2P1BA 3ZSLA 4K6BA 2XBO2 5IAVA 2ZA9A 4JKMA 3DF0A 2VR4A 1MQTB 4MG2A 1QH6A 4PLOA 4B4PA 1LOFA 4CP9B 5A6ZA 2R063 3AKSA 3PIGA 4IL7A 5LBEA 3L2YA 3VD4A 1LEMA 1B09A 1VPHA 1O3TA 1T6GC 2JD4A 4XW3A 1JHJA 4ZS3A 1YXWA 3AMMA 5C71A 2D44A 4IV1C 5JCTA 3U0ZA 1OQEA 2HLEA 3RZLA 3BOPA 4P9LA 1HRV3 3MHZA 4QB6A 2AENA 2A70A 4HFSA 3HPNA 4N53B 4ATFA 4FPEA 1FXZA 3WP5A 2GNTA 2WLQA 1N3PA 2EXIA 3IMNA 2D40A 1AR71 1FYUA 4BMEA 1RUG2 4XDPA 1RUF2 4XZPA 4MGKE 3LD8A 3I8TA 4M4PA 4AEJA 4RYDA 4H55A 1OD3A 2XJSA 3MO4A 4JAAA 1K5JA 5BNPB 5FYBA 3ZN4A 2VXJA 3OPZA 4FVVA 3KZ4C 4DUXA 3USUB 4KGGA 4CDQB 2V4VA 2RJLA 1W3XA 2HWC1 1Z7S3 4Q4Y1 4WVWA 2DUQA 4IV3A 1PO22 1U5IA 3LIHA 3MI8A 5DUVA 2VZTA 2R072 4QPIA 4NN0A 4JRLA 2E7QA 3ACGA 3CMGA 2D6MA 2VVDA 3S6PA 2XOMA 2HWF1 4PHZA 4UOJA 5KHGA 4QX3A 1QQP2 2ZHNA 4JQTA 1YFXA 4JRAA 4CDXC 2D3SA 2GZWA 2Z42A 1TME2 4Q27A 2WRAA 4AGRA 1SCRA 4A3ZA 5F1RA 4Q8KA 5LRSA 4P5YA 3D0SA 1US3A 3VZMA 1XJAA 1N1TA 1R1A1 4CCLA 4Z1VA 1FOD2 1W05A 2TNFA 3N9LA 3WLUA 2A3YA 1VIWB 3ZR5A 3FHIB 4IESA 3DEMA 4FPOB 5I0RA 1K5MA 1NUKA 4OI0A 1RUE2 3WQ0A 1D4M1 3HMYA 5JMOA 1HRI2 2R30A 1H1AA 2QQIA 1DDLA 2UWBA 5KXBA 4BQYA 2IXIA 3KD4A 2LTNA 1OH3A 1ULPA 1RUC3 4H7MA 1FMD1 1HW5A 1W03A 5EPAA 1WMFA 3AZXA 4EJRA 4YPJA 2A1XA 1CAVA 3O1RA 4QX7A 5C8CA 1EV12 1REDA 3SCFA 1ZZ8A 2WAAA 5K0UA 4CDWC 4GA9A 5B2GB 1H4HA 1C1LA 1UOBA 2WT0A 3JQWA 4UW6A 4CCOA 4QU2A 2IFRA 3ME2A 2ZKNA 5FQ0A 2DVDA 1PGSA 1GNYA 1W2TA 3LPGA 3SH3A 3NJZA 4NWVA 4B3NA 3GBWA 2QVSB 3IT8A 1XSQA 2A7AA 1S0FA 4LKDA 3JB8A 1AXYA 2GN7A 5DXDA 4FXKB 2BTVC 2W08A 4HXCA 1SLBA 2WT2A 1MVEA 1H1MA 3CDZB 3ZSEA 4DOUA 1COV2 4GQ7A 1Z0HA 4E4SA 4LE3A 2VBPA 1JYNA 2VBDA 1HB2A 5LEJA 1GZCA 1V9U2 1C1FA 3CLPA 4F8AA 4IERA 5LA9A 3PU8A 2RS53 4Q2FA 5APAA 5H9PA 2GP3A 4BE3A 5BNOA 1KDKA 3VKMA 5JSRA 2QQWA 2ZXQA 5KHIA 2DCJA 2XONA 4FFGA 1IQDC 1I6XA 4NROA 1HJGA 5CFCB 4B4RA 3JU9A 3NMBA 4YW7A 1K3IA 5JOWA 2G9GA 3MIBA 2P3IA 4HVQA 2XMLA 4GWMA 1NXD1 2UY8A 4WVMA 1MEC1 1NQDA 4MOAA 3SH5A 3BU7A 4LBNA 2VW1A 1AL0G 4GB33 4PLNA 3D8CA 2FDIA 4PBPA 5DAVA 3JBG2 2YHJA 1OOPB 1PO11 4KG0A 5D21A 2GMPA 3DXUA 3ZX7A 4EV0A 1WCSA 5DAWA 3P1IA 1HN0A 2R062 5A7QA 3O1OA 4MXVA 4RHV3 2WZR1 2DCKA 2ZX2A 1H6YA 3WCRA 4AQTA 1MZ5A 2W1QA 4LKEA 1PGW2 1LHNA 1XBFA 3POIA 5JXHA 3BPSA 3MLKA 3O14A 2UU8A 4XDOA 3WNOA 1HRV2 2VL4A 1NA1C 1PNFA 2YBPA 3OJBA 4LIUA 3PVEA 4MSVA 4B8EA 2WNVC 2Y34A 5KWRA 4JDMA 3LFIA 4QXBA 3RRDA 1Q8SA 4MGZE 3VZLA 2C24A 4A42A 1KFUL 4HK8A 2Q4SA 4XYXA 1H2MA 4QB1A 5CFDB 4V2VA 4JV4A 4DEVA 1UMZA 4RS5C 5FZMA 4AFMA 2B39A 2E7AA 4AHWA 3AYCA 2Y6GA 3LZZA 5FZOA 3LEMA 2W87A 2JEMA 3OGGA 5JI9A 5JZGB 1PK6A 4WZFA 3ZR6A 4KGQA 1S2EA 3PUHA 2G9ZA 3Q8FA 2GMEA 4NOTA 2VM9A 4RQPA 2X5IC 2ZBJA 4KH9A 3VLBB 4RR3C 1J1TA 4PDWB 2FDJA 2XBO1 5BYNA 3QH6A 1GZWB 3WNPA 3ZDVA 3NNMA 2YBSA 2GALA 2KR2A 3ETPA 2ETEA 2XDVA 3NNJA 1LOGA 1I1EA 3U4XA 2EALA 3K48A 4J1WA 1LULA 5A1FA 2BPA2 2UY9A 3ZYGA 2I74A 2PAMA 3OCPA 3PVNA 3H9AA 5BNNB 1JOJA 1S0JA 1CAWA 4HBNA 3WDYA 1JOPA 1YWKA 1VMFA 1WUVA 1TZOA 2W5FA 1Y7BA 3FHAA 3TN93 3ELNA 2FBEA 4QKBA 3PUIA 1UIKA 4ARXA 1NKGA 1XE7A 4CP0A 3IBMA 3BIEA 3O1UA 2IC1A 1RUG1 5C7GA 1RUF1 2RV9A 2ZGPA 1RJ8A 1XNDA 4LBKA 5DZFA 1Q43A 2O14A 2PELA 4O65A 2BFUL 3PUQA 4I01A 3SHRA 3M8LA 1HN1A 4AVAA 3ZFGB 4IEWA 3EJKA 4D7SA 2D3PA 5FY5A 3WZ1A 1HV1A 1PM7A 3AKQA 3ITQA 1PO21 1XU2A 2CDPA 2N7GA 1PGL2 2R071 2DV9A 1SDWA 3E6BA 4S2GA 4AHYA 5FOBB 3IIIA 2XJQA 4YVSC 5LATA 3POFA 5B4NA 4AVSA 1IS5A 2CGNA 1DGRA 4XAEA 1UF2C 4AR2A 4XUQA 2VZSA 4E8DA 1QQP1 3PJQA 3U07A 1RITA 2ZZQA 4A44A 4Y1ZA 5A7WB 4XJ9A 2VW0A 3FZ3A 1TME1 1WCUA 2Q30A 2BNNA 3JD73 3N9NA 4IDZA 4NHXA 1FV3A 3MW4A 2ZEZA 5F8PA 3L2HA 5IWFA 3WHTA 2P4EA 3E5QA 4P08A 2RVAA 3D82A 2WN3A 1OVPA 4XFCA 1REEA 4FO9A 4DNYA 1ZRIA 5KHKA 2VCCA 4V2WA 2BZDA 3FE5A 4IV3C 2O0OA 1PX4A 1FOD1 3ZXGA 1GNZA 1W9FA 4QPIC 3VD9A 5CISA 3OD4A 2RS52 2EIDA 5EWSA 4LT5A 1RUE1 1GUIA 1OA4A 2Y6KA 1HRI1 1N1YA 2GC3A 2IXJA 1UY4A 4FPCA 1FV2A 4QD2A 2WQ4A 2D43A 3NAPC 3JQXA 2DURA 1OMIA 4RGGA 5CKQA 5FUNA 5FZ8A 2X53S 2ZEYA 2ZOEB 3OB8A 3M4FA 3AFKA 4Q4V3 2VVEA 1AR73 4BLJA 4GULA 1LODA 2A5ZA 2OX0A 2WFF3 2HWD3 4L9BA 5IFPA 2DCYA 3HBZA 1HB4A 1WW6A 4OVEA 3SC7X 4DZGA 4GB32 2EIBA 3HD8B 3V0AB 3WF4A 4B29A 3SITA 5A7SA 4G4FA 2JB4A 5FKCA 3AKRA 4HZFA 3HN3A 1K5MC 2VQAA 1QDOA 3IDAA 2ERFA 5FYIA 2EAKA 4MGYE 3W9AA 1ZRFA 4IW3A 1U5XA 3S30A 1CN1A 4AFAA 4RHV2 1AR83 5J37A 4XJWA 4GAZA 2W39A 3GZEA 2ZX0A 1GP5A 2Q1FA 1KD7A 4D6QA 1LTEA 1IOAA 2GC2A 3ZYRA 2GNMA 4WM7A 4AQ6A 4YM0A 3CKHA 4P02B 5DG2A 1IPSA 2HWF3 3UKVA 5J96B 1W9WA 4FCAA 3ABZA 1COV1 4IE0A 1QJEA 5A7OA 4LA3A 3M3CA 5L36A 2OUJA 3H7JA 4XABA 1DIWA 3BYWA 3QOPA 3KS7A 1V9U1 3VBOB 3H8RA 5FZCA 2VTXA 2JDUA 1DP0A 1M06G 1GV9A 3HBKA 4W65A 3ZXJA 2X29A 1XYNA 4GKXA 5F3EA 5T5LA 1R1A3 4XUPA 4EYUA 3B5LB 4Y5TA 1DYPA 1NCQA 4YGDA 5F3CA 3MW3A 2WWUA 4H14A 5D8AB 2RR12 4Q5OA 5FYCA 4FOYA 1XPWA 3VZKA 1GOFA 2P17A 1MS5A 2QZ3A 2ZMLA 1WMDA 1MQTA 1SPPB 4PF1A 1LHUA 1QWRA 3J7MA 1CZTA 4RFRB 2QQJA 4XC9A 4FI9A 3V0BB 4CP9A 3FLPA 5I0TA 4C8DA 3LFMA 2EXKA 2RS33 2VECA 2ZTNA 3ZYHA 5DPNA 3MDPA 3JBG1 5HCFA 3A21A 1DZRA 3AYEA 2J1RA 5BNOC 2K46A 4TXWA 3HQXA 5T5JA 2R061 1QF3A 2ARAA 3MPBA 1WLCA 2BQPA 3BPZA 4Z82A 1HV0A 2VOVA 5F3GA 4HKLA 1PGW1 1SCSA 4N53A 4HETA 4IE6A 4K20A 4OQ9A 1IZ3A 3UKTA 4NRQA 4FOWA 2DWRA 2YB7A 1HRV1 1ZREA 3TN92 2BJSA 3OPWA 1AR62 4AW7A 1R1ZA 4ASMB 4AFBA 3OG2A 5FZGA 3DPRB 4LBQD 5FTTC 2XWJB 4CDQA 3G6JB 4XHXA 4QM9A 2WINB 2HWB3 1NY72 4B7KA 5GZGA 5CA6A 5J3UA 4QKNA 3BALA 5G04L 5FPXA 2VTFA 2VUDA 5FYHA 4JDNA 5JWPA 1UZYA 2H0BA 2KD7A 4LTAA 1WKYA 1AUYA 4BDVB 4CCEA 1RYYA 5F9TA 5A70A 4BQ4A 4R9AA 4UXAA 5IVEA 1SDDB 2EVXA 1WCDJ 3H7YA 2A3XA 4XPVA 3M3EA 4LOTA 3RI8A 5IVBA 2Y64A 3MGUA 1QJY2 2J1AA 3NNLA 5HV4A 5FZDA 1YFWA 3I2HA 5I93A 3OPTA 1LRHA 4PF5A 3ES1A 1LOCA 4IE5A 3I2OA 3RZHA 3TEZA 2BERA 1MEC3 1NG0A 3ACLA 3UJOA 2Q8EA 3ZOIA 4CCMA 1KDMA 4KBZA 5L19A 4MO3M 3UGFA 2QTWB 3TYJA 1BCXA 3KV9A 1WD4A 1PK6C 2LUWA 2WUHA 2W52A 4K8RB 1PO13 4WV8A 3U10A 3VHNA 1UYPA 5SV8A 4PCRA 5A33B 3DECA 4G3YC 4R52A 4RQPC 1CR7A 4RL7A 4YW3A 1ZNPA 1CX4A 5FZHA 4G9SB 1RMU2 1SLCA 2PHTA 4HMZA 5BNQA 4A2UA 3WNNA 2WO1A 1EUUA 2JENA 4XMAA 3S7EA 3TNPB 2GMMA 4UW3A 1CONA 2X10A 4EN8B 3RSJA 1JI6A 3N9QA 4HN1A 2A6WA 5SV5A 3OUHA 2FQPA 1WBFA 2XKPA 4JZRA 3M3IA 4KI5M 2ZGTA 3I2DA 2Q8CA 3VUOA 4GXLA 4OHWA 4JGZB 4Q4V2 4FTSA 4CZSA 3LA2A 2A6ZA 2WFF2 4L11A 2HWD2 2JICA 1ND2C 1LECA 2JE8A 4QMAA 4A7YA 5FJHA 3VBFB 1QXRA 3HAGA 2VZUA 5HCBA 4URTA 4B1LA 1PGL1 3MPPG 2IZWA 4CXWA 1O8SA 2JDZA 4S2DA 1AR82 2VNOA 4XE9A 3ZFEB 4LLFA 3EMRA 4P9WA 4Q8LA 1LOEA 1CPMA 1YJLA 2AGSA 3I3BA 4W6XA 3ROUA 1ZZ9A 2BEOA 1JYVA 3S5AA 1W8NA 2XBO3 1QH7A 3OBZA 4FOVA 3ZXLA 3GM8A 1GFF2 3TEWA 1S0DA 2VNRA 3WDTA 4MX3A 3M3QA 4AGGA 2VNGA 3GDBA 1EYBA 5CFCA 1FAYA 1U12A 1S2KA 2RS51 2GH2A 2XPJA 1CVNA 3FBMA 3FX3A 1HDKA 3LEKA 4OFGA 3WNMA 5KR7A 4DQAA 4BQXA 3VZNA 3DV8A 3EHKA 3AX4A 5EQUA 2K0GA 3T3YA 3I59B 1NCRB 1TE1B 1F9KA 1LHVA 1UX6A 2VTXJ 3VBSB 4PLMA 4JKKA 3AZVA 2NLRA 1QNWA 3AXDA 3A0KA 1LENA 2W1SA 4NE9A 4CDUA 2CGOA 3L9JT 1Y9QA 1REFA 4GB31 1L7LA 2F4LA 1RC6A 2RS32 3P3PA 2W3JA 3MIEA 3T1LA 1XE0A 5LEKA 4E2GA 4UFJA 3SEEA 3F2ZA 4OI2A 3WP3A 5JOYA 1O4YA 1W39A 3WP4A 2WO3A 1R083 3HNMA 4Z92B 2RM22 5I0SA 5K9YA 1DHKB 4ZXKA 3ZFFB 2QE3A 5BPXA 1LCLA 1CJDA 1CZSA 2FHRA 2IUWA 4CP1A 3S0MA 1UYYA 1RUI3 3E5UA 1GQPA 2B7YA 3KB5A 4I0WB 5E8AA 5FREA 3PLQA 4COUA 3WP6A 1L3JA 1KITA 1LGNA 2WJSA 4NPMA 3VKNA 4XEZA 2JDKA 4YZ4A 3WDWA 2HH9A 4PI0A 3IZOA 1G6NA 4NIHA 1TME3 2XJPA 1KJRA 1RVF2 4YZ1A 3KF3A 3TOJA 5JZGA 2XQXA 4YM1A 5CKMA 1LKNA 2RDNA 3PVOA 2HWB2 2P5BA 5FFOC 1XNTA 2HYXA 1IHMA 5FZ9A 4XUTA 1J3RA 4XF1A 2WA3A 3EB7A 3UYJA 1BZWA 1NZIA 1VBA2 1GR3A 5AVPA 1W0PA 2DUOA 5ABJB 2RR11 4WM7C 2CAVA 3H3ZA 4PDWA 5A80A 1W8WA 3T2TA 1HRI3 1GZWA 3DUIA 4AHXA 5KXCA 1KGYA 1VRH3 3RWNA 2B8MA 2RDRA 3C7HA 3HQRA 4LBQB 2BGCA 5GLVA 1VBB3 2QQMA 1QEXA 5I8SA 3KF5A 2D6PA 3OGVA 4KU8A 1SBEA 2P3KA 1DQ1A 1LNSA 2YUEA 2J42A 1SEFA 4ORFA 4QX2A 3UGHA 4CDUB 3ZYBA 2P2KA 2VJXA 3WG4A 4AEMA 3LDRA 1IS6A 4AWDA 5BNNA 2Q8OA 3T0AA 4XHBA 2Y8KA 3FBYA 4XQDA 3NJVA 1NCQC 5ERLA 1QOOA 1SZBA 4UW5A 1K42A 4XTMA 1W6NB 4QHZA 1PO12 3W20A 5GZFA 1CAXB 2XVGA 3J4UH 3RZGA 4P14A 2BWCA 2DF7A 3DN7A 4MADA 4CUBA 1MQTC 4W8JA 1O5LA 1ZRDA 1D4VB 2CAUA 3TN91 4HOOA 1AR61 1NQJA 1W8TA 3M2MA 2PAKA 3RYRA 1PIV3 2WYSA 3D0JA 1H2KA 1JYCA 1RXFA 2ZMNA 4MV2A 1HXS3 2DBIA 1SBFA 1RJ7A 3ETQA 4LUKA 5J7MA 1W04A 4DXRA 5F5IA 4JTOA 5F5QA 3AC0A 4MVTA 2GC0A 3GZAA 1V9U3 2DTWA 5FZAA 4N53C 4Y4YA 4QGMA 4HL0A 4CSWA 1C5IA 1VLNA 4FSJA 5F2SA 3FFQA 3RDIA 3WDVA 2D5HA 1E5IA 4WM8B 3T0DA 4XIKA 1WLDA 3VV1A 1CX1A 3IAPA 4OHXA 4GMP0 5A7WA 1QJY1 1HLCA 2DDUA 3OEBA 5FXXA 3VBOA 2JXAA 1U5ZA 1W90A 5BNPC 2WR9A 3VBRB 2R041 2ARXA 4CDQC 1UW8A 2WNUB 5K8SA 4Q0SA 1ZX5A 4NR1A 3SISA 3EQEA 2VW2A 3PTRB 2R6QA 1BEV3 4NO4A 3I49A 4NHYA 2B42B 3JBG3 1O91A 3FUQA 3THTA 3EXUA 4IEYA 3O12A 4P5HA 2ZGLA 1ULEA 3KT4A 4X6QB 2OYZA 1X9PA 2E26A 4YZ5A 2W1WA 3N7JA 1NE4A 5A3LA 2VNVA 2JB8A 4XF3A 1QNYA 4ZONA 1LHWA 3LIGA 5FO8B 1RMU1 3HR9A 4QKDA 3VDCA 2JIJA 4M00A 4CTEA 2RMU3 4YW1A 5C4WB 3ZYFA 2ZZJA 3K4ZA 4ONUA 4CE8A 3HEIA 4Z2WA 3KCXA 2WIIB 3ZN5A 3V0AA 3MUY1 2ZJCA 4M0NA 4YVSA 1UL9A 4WBBA 4YGCA 4BQ1A 4Q4V1 5FO9B 1H8VA 2GNBA 3LEIA 1WW7A 5T55A 2LROA 2WFF1 1DFQA 4QXKA 2HWD1 5C70A 1V6OA 3E5XA 1URXA 1UU5A 3VD5A 4BZ4A 2JJ6A 5FZBA 3K2OA 2E51A 1QJFA 1WLTA 2XG3A 3LKJA 3WF1A 5DUWA 5I8TA 2B9VA 1R082 4LOSA 4CXYA 1F8VA 1AR81 3DXTA 2MNGA 5IATA 4WZCA 3URFA 3NWKA 4QXCA 2E63A 5DUUA 1G8WA 1RUI2 1GICA 4Q4W3 5GZEA 5T3NA 2ARCA 2D97A 1XQNA 4IEVA 1ST8A 4ATEA 3O1VA 3X29B 4YWAA 3PDQA 1DZQA 3PNAA 3CIHA 3POSA 3RJRA 3NRUA 3G7DA 4JKLA 1UO9A 1WZXA 4PQQA 1JZ2A 2BUKA 4DY5A 4DEQA 3NAPA 3K77A 4KL1A 5BV6A 1DLLA 4GWJA 4DB5A 4PIYA 3B3QE 1HX6A 1MS9A 5JLVA 5LK7B 3B9CA 5D8AA 3WD5A 3VDAA 5FKBA 4BXSV 4CP2A 5J48A 5C8WA 1JZ4A 2UWCA 2AR6A 2PXJA 1E5HA 2EXJA 4NAMA 4YFWA 4H3WA 3I2KA 1SPPA 4CCDA 1T2XA 2B4KA 2BFUS 1W6PA 2VOXA 2AEYA 2MEV2 4NUBA 1LOAA 4NPLA 4UF0B 3MLJA 4KWKA 3DL3A 4LBOA 3WG1A 5A1LA 5C3SA 4XJ8A 3RGBA 4GKYA 1AYM3 4X8PA 1VRH2 2DTYA 3EO6A 2BVVA 2QBXA 2W68A 4CU7A 3WF3A 5I8YA 1VBB2 2ZX1A 3WOGA 4DINB 1W28A 4AFDA 2RS31 2XLFA 2Q8DA 5EIYB 5DMYA 2FZ1A 1S0BA 5CFCC 4ISQA 1GOGA 3I2JA 4HK9A 4QAWA 2RM21 4HVRA 4SLIA 1A3KA 5F7UA 4AI8A 2B46X 2XUMA 1JXNA 3H8XA 1J83A 3U75A 3A7QA 1J3QA 5FY7A 2OVUA 3ZDSA 3ACHA 1W6OB 5JAXA 5JI7A 1OOPC 3DPRA 4ASKA 3H8OA 4TZDA 3TWIA 2WYFA 1JZ8A 1Y3TA 3RZMA 4BK5A 5FY8A 2CU5A 1PIV2 1OFNA 1W0NA 1S55A 1AJKA 5FK8A 4NIAA 1RVF1 1HXS2 2MHFA 2XHNA 3AP4A 3BB6A 1V70A 3FUOA 3B00A 3O5SA 4Q0UA 3THCA 3SLIA 2WNOA 5C3PA 4L97A 2E9QA 4QX5A 2HWB1 4EZHA 4BOWA 3HWJA 4P9YA 4XACA 2FCTA 5DABA 1VBA1 5LK5A 3MICA 1W8UA 4N43B 4R8HA 3AKPA 4XOGA 4R4XA 3BU0A 1CPNA 4DUWA 5CFDC 3FN9A 5BXXA 3HNYM 1PHMA 3NNFA 2W46A 2PLV3 2J1SA 3KVBA 3RG0A 3CQOA 1LR5A 5KHHA 3S7IA 2J1TA 5JZGC 1JZ7A 4JHTA 2BBAA 1YO8A 3OY8B 4N9HA 5H9QA 3RNSA 3AVSA 3AM2A 2XHKA 4I3GA 4TYSA 4IE7A 4HN0A 2WAOA 3LSEA 5IK7A 1BEV2 3VKLA 4XF4A 3KCCA 1DGWA 1KJLA 2LS6A 3LA7A 2C6SA 1GBGA 1T6BX 2YPJA 4PDWC 4MLOA 3GBFA 3WVJA 5FZ3A 3VZJA 1IQAA 5FMOL 3WEZA 1GP4A 3LOBA 4IGOA 2YXSA 4DS0A 1ULOA 3FWEA 2DFBA 2RMU2 4KBBA 1CWPA 3B69A 2O8OA 1Q8VA 1B35B 3AJZA 1JH5A 5FYTA 4C91A 5BNNC 2JE9A 4XBQA 3N9PA 3VBFA 2G4IA 5EZWA 3VBHB 1BYHA 2IXHA 3ZXKA 2R49A 1NT0A 1XOYA 2CWMA 3MYXA 5FBJA 5EP9A 4K1YA 4A6OA 2Y38A 3GZUC 2Y33A 5CB7A 3U37A 3ZFEA 3WHUA 4YVWA 1DLCA 3C2UA 5HCAA 1RUH3 2RR13 3AZWA 4LHSA 4AI3A 3F95A 2D93A 3ZFGC 1FT9A 1WMXA 5E6HA 4Q4W2 1OXCA 1QMJA 4ET7A 5BUVA 2BVBA 2PYTA 4XFGA 1DQ0A 1W8FA 1H2NA 3WUDA 1O5UA 2R1DA 2V09A 3OGRA 1TEIA 1H1IA 3B9IA 1O4TA 4EWAA 5I91A 5JPNB 1RIRA 4ZU4A 5EXOA 4EWDA 3RPQA 4LO4B 5DUXA 1KRIA 3SH4A 3TAYA 1ODNA 2VE1A 3WDXA 5KC5A 2C4XA 4XETA 2CYFA 3CNAA 5JSPA 4AHZA 2D5FA 5EFUA 3VBOC 4CUAA 4INDA 2AC1A 2XQRA 3I59A 5HXVA 5A3WA 3ZLIA 1ND2A 3VBSA 2FZ2A 1UKGA 5KC6A 1LEDA 5JMCA 1W9YA 4D6RA 1GZTA 1BVP1 1AR63 4RSUA 2P3JA 5IVFA 2UYAA 1H8TB 1ZZBA 3BIWE 3H1YA 1AYM2 3BN6A 1YIPA 4C90A 2OUHA 3J8F3 2VZQA 3NKGA 2HEWF 3RZZA 4LLOA 2ZGQA 3CL1A 2D6NA 3LCPA 5A3OA 3ZFFA 2TUNA 1C8M3 4EQVA 2VQTA 1BLZA 1OUXA 2IXKA 3MEPA 3MV01 1WCKA 2F6BA 3RJ2X 1ZZ7A 1X8EA 1FPN3 1XYPA 2YU2A 1HIXA 1C57A 5FPVA 1R081 3BTAA 1UZZA 5FZ4A 3RWKX 4AQ2A 5H9SA 1UQXA 1C28A 4MUVA 1UKRA 1MR5A 1RXGA 2YV8A 3NSTA 2VPVA 4L0PA 4W6YA 1YJKA 3SCHA 5JR7B 3WW1A 5FY0A 1RUI1 5FDBA 1GLHA 1QJY3 2VMGA 1MZEA 1SACA 5F39A 2QQLA 3HN1A 2X05A 4QHOA 2EXHA 3KM5A 1ENRA 5DDJ2 3VBUB 3WY6A 5IYYA 4OUMA 1JU3A 2R043 1CD3G 2ZAHA 3NV4A 2GU9A 5L9BA 3HT2A 1SLLA 3C8XA 5FRAA 1VBC3 2DVAA 2ZHKA 3S57A 1BQPA 5KHJA 5IHRA 1UYZA 2PHDA 3I2FA 1BJQA 1MS4A 5FP9A 5LBFA 5ABJA 3KGZA 3KV5A 4HONA 2BGPA 1EP0A 1S0EA 2B45X 5AVAA 3B94A 4CRQA 4NJ4A 2Z79A 4ZZ5A 5A3NA 3BOWA 1RMU3 2JDPA 2ZACA 4LBQA 1BBT2 2MEV1 3LF7A 4R9BA 4AG4A 5F37A 1HB1A 3FLRA 4U36A 5T5OA 4MGTA 2VCAA 4Q26A 3UKNA 3AP6A 2XLAA 4K8FA 5CBLA 3ZVXA 4CPBD 2XJVA 1EPWA 1ZBA3 1VRH1 2PLV2 3K51A 2CWSA 1YYNA 1OD5A 3AMPA 3MW2A 2I07B 2WDBA 2WLPA 1VBB1 5FAXA 2FMYA 5ANNA 4R9DA 3VB9A 1BVVA 4DUVA 1AYN3 2RHPA 1W6NA 2ZAAA 4IEZA 5D8AC 1RUD3 1CAXA 3AMNA 1ZYBA 3B02A 4XJUA 3VL9A 2VBBA 3N7KA 4MHRA 5E89A 2QQNA 1YQ8A 3I97A 2QNKA 4EE2A 4LO7A 3I54A 5LA2A 5B4XA 4H2AA 4M0HA 3WF0A 2WQ8A 5F32A 4L2NA 3Q8AA 1VBD3 4XDQA 5FIXA 5LWBA 1FI2A 1LB2A 1JUIA 3CBNA 1DU3D 4X8NA 4QQHA 4QT6A 3BCWA 1WWYA 2C9AA 2ZS6B 4CEYB 3HIFA 2DCTA 3NO8A 2XGXA 1XNCA 3TEYA 4ASLA 2XJTA 2BV4A 4D3WA 1PIV1 2ZGUA 1H0BA 1HXS1 1AR92 3GALA 2VMFA 1R093 1YQ5A 1AXZA 3UK9A 1POV0 2BYVE 1BMV2 4YM2A 1W8HA 1C8NA 3A4UA 3LAGA 1TVGA 5FYYA 5A3PA 3NVCA 5FP3A 4HKWA 4WM8A 3CO2A 4FPFA 4OI1A 3NNGA 3BTYA 4BCUA 2VOTA 4GIQA 2ZGSA 3V56A 3WF2A 1MPXA 3MF9A 1A6CA 4XQ4A 4UFKA 5GLTA 3VBRA 4Z07A 3OYWB 2OA2A 3DPRC 1CESA 1AJOA 1DYOA 2GDFA 2WNUA 3GGLA 2ZMKA 4Y3OA 4YW2A 3QACA 5FPAA 1ZA4A 1RUH2 1YLLA 1F2NA 3ENRA 2XH6A 2Y6HA 4F3JA 4FAGA 1X82A 2E7TA 2JG9B 2NPIA 3HOBA 2DYCA 1GKBA 1UYXA 5JIAA 4QPIB 4ES8A 2QQOA 1WA4A 2DU0A 3RVHA 2VCMA 4N9IA 4Y24A 3UETA 3ES4A 5C3OA 1NLSA 3K4AA 1BEV1 1GNHA 2ENRA 1VBE3 3SMHA 1ASJ3 4BMBA 4LKFA 2E31A 2EIGA 2EA7A 4YG0A 3ZKUA 5C4WA 3IKWA 2PHUA 2RM23 1DGRN 1OKOA 2XLGA 1F5JA 3MFCA 2LALA 2GN3A 2CSGA 1N1SA 5GM0A 3OTFA 2NZ9A 1US2A 2A73B 4DO0A 3AZYA 2RMU1 3J7LA 1QJU2 4J6GA 5G05L 1V6JA 5TSWA 2UYBA 1MS0A 4XXPA 3WSOA 1KS4A 2VMEA 4UI9L 2HEYF 1K5MB 5FPUA 1LU1A 4E2QA 4NIDA 5BNPA 1RVF3 4IE4A 5A7PA 1GZ9A 3J8F2 4XZUG 3USUA 2A75A 4I0AA 3WG3A 4I09A 1IKPA 4A45A 5K4LA 1UU4A 1C8M2 4JGYB 3ZSJA 3CZJA 1F5FA 2YZ4A 2BOIA 1WCQA 1SG3A 4PQ9A 1CAVB 1EUTA 1FPN2 1OQ1A 1VBA3 3ILFA 4LBMA 4OUEA 5I0UA 2HWE3 3OEAA 3SEPA 2NMNA 4JGZC 5C8CB 2VMCA 3T09A 4NRPA 1QY4A 1S1AA 3MLLA 3DYMA 5HI0A 5K0UB 5L7OB 3PMSA 2YYOA 2YDEA 4HVOA 3VL8A 2ORXA 4Q4W1 3W58A 4EN6B 2ZHMA 1Q5OA 1DQ5A 3ST7A 3VBFC 2Y60A 1YCIA 3CF6E 3AXEA 1QKQA 3IIAA 1G9CA 2R042 3B01A 5JIUA 4BIOA 1OA2A 2V5YA 4E8CA 4BQ3A 4LULA 3R4SA 1VBC2 3NJXA 1K12A 1N3QA 1OQDA 3LE0A 4YNIA 4AEDB 2IXLA 3ZFEC 1OVSA 4F83A 2BOJA 4FP3A 4YVWC 5J98B 2VZOA 1OPOA 1FNYA 2BWAA 4UF0A 3BTXA 5A6QA 2EIEA 5KXDA 4D6SA 4M3CB 4XIOA 5C5UA 3MF6A 5JVVA 4QQOA 4UBGA 5F5CA 4S2HA 4XURA 5FP8A 1Y9GA 1AYM1 1OLQA 1OKQA 1W2NA 1ZBA2 3IDCB 5D1IA 3UL2A 2AUYA 3D6EA 1IG3A 2WZ8A 4P9XA 4KNCA 4E4ZA 1AYN2 3TRSB 1RUD2 3AVRA 1MACA 1Y43B 3KMHA 4LHLA 1NCRC 3VGIA 5IK5A 2FMDA 3D5OA 3VBSC 2F17A 5F5AA 1W6OA 4TN7A 4A7ZA 3RYPA 2QUOA 1D7PM 4PIZA 4Y5SA 1ZRCA 1GMMA 1VBD2 3QLQA 1I5PA 1ND3B 4PI2A 5DDJ1 1GWKA 1XC6A 1OF4A 2OT7A 4HPKB 3ZFFC 1GWLA 3CHXA 3GZTB 3J7HA 3K3OA 2WWJA 4Y1UA 1X8MA 3T08A 2XJRA 3K75B 4LPLA 5HBAA 5LBBA 1XNKA 4I2OA 1R092 1F15A 2W92A 1A34A 2K2SA 2WL1A 4N43A 2ZGNA 4RN5A 3T4VA 1ZZ6A 1O4ZA 2D98A 1DQ6A 2P3YA 3CEWA 3NQHA 3U14A 1X9TA 5A6XA 4WVVA 1W9TA 1J1LA 2QQKA 1W8OA 1O6UA 1BBT1 2YFUA 3N36A 4NWWA 4FTEA 3ZXEA 5FCCA 3SKVA 3O1SA 3OY8A 1VE0A 1NAEA 2PLV1 4MGIE 4AI1A 1RUNA 2A6XA 3ZO0B 3KT1A 1YUDA 3PIJA 4CCKA 1RUOA 4GMP3 5JDBA 1AX0A 3AYDA 3OUIA 1RHI2 3LEGA 1LHOA 3OBTA 1UCXA 2VAUA 3ZIWA 3ZKYA 4C1XA 4GJYA 3FHQA 4YZ2A 5ABJC 1OOPA 5C6CA 2IXCA 4KWLA 2W91A 3KVAA 4YW5A 1F35A 4K9SA 5FOJB 1VAKA 4ZY9A 3LDKA 5CNAA 2VZRA 4KQ7A 2O8QA 1VBE2 2Q1MA 3MZHA 1ASJ2 4TTGA 1YHFA 3OOXA 4Q1PA 4FQ4A 4BHPA 5IFTA 4LO6B 4Y22B 4OMCA 5F2WA 4DXZA 5JSOA 1SQ4A 2YC2A 3U1XA 4CDUC 1B35A 1QOSA 2TEPA 3ILRA 4LXLA 3WT3A 5M0TA 4A6SA 2ES3A 3VBHA 4ARYA 2Z4FA 4XFFA 5ISLA 1IKQA 4IEXA 3ZM8A 4Y1XA 3Q8EA 2CDOA 1JYIA 1AR91 4I3PA 2NYYA 5CFDA 4AZZA 2C26A 2KXLA 3FC0A 1C5HA 3PHMA 1Q3EA 1BMV1 3ZXFA 4A41A 4RFT0 3OBAA 1TNFA 4OYUA 4AVVA 5KBFA 4E4DX 3VHRA 3PTYA 4QXHA 1UN1A 2RE9A 4BIFA 2ZCWA 1RB8G 3BGAA 3RZJA 4A4AA 3GCXA 2DBNA 3SCGA 4A3XA 2JKBA 5FZIA 2NP0A 2D6OX 4MHUA 5IVJA 4QDSA 2MEV3 4JC1A 2HWE2 1Q8QA 1RUH1 4FT8A 4GH4B 2X09A 1XXNA 2JECA 4PJYA 3AYAA 1UU6A 4NRMA 1VJ2A 4WVZA 5DZGA 1S0IA 3T0BA 4DXTA 4YG6A 1YQ2A 4AE2A 4COWA 1CGPA 4KWUA 4AAPA 2VUAA 2D6KA 2OS2A 4FPYA 4CEWB 2CGPA 4QPGB 1J59A 5C3QA 1CZVA 1LU2A 5LASA 3KSCA 1NZCA 5A3MA 3VDDB 4WM8C 2ZEXA 4BYYA 4LHKA 2BP6A 1FATA 3IB3A 3DCQA 1YFYA 3GHMA 4D0QA 2PTMA 5FP7A 3VBRC 2ADEA 4FOQA 3WXPA 2C5DA 1K45A 1POV1 3QCWA 3OGJA 1BKZA 2WNUC 4GWNA 4IGQA 3UNPA 1PVXA 4RA0A 1SFNA 1ZM1A 2NQYA 4RGAA 4QGNA 1VB4A 4D94A 5HXMA 5LY1A 1NE6A 1OHFA 2DFCA 3LSDA 3NL1A 5FYUA 1QJU1 2QJVA 2BNOA 5GZDA
chains in the Genus database with same CATH topology
1U5YA 5EJ3A 5C9AB 4LA2A 1QGLA 1YRZA 3I7DA 3ZFGA 3J8F1 2KM2A 5E88A 3WW2A 1CAUB 2LM3A 5C4WC 1W0OA 5CIRA 1O3RA 1C8M1 2XJUA 4K7JA 1H2LA 2GNDA 2G9FA 1FPN1 2JG8B 1W6MB 4K1ZA 5F6KA 4NHKA 4ZU7A 3VBUA 1YIFA 3H50A 5DG1A 5JPMB 1MZ6A 1CQ9A 4TSVA 2H0VA 2WKKA 5FMOS 4UW4A 1JUHA 2JE7A 1G9DA 1VBC1 3H1WA 1C4RA 4B7EA 4OI4A 1JN2P 4U2AA 2XVKA 2WSUA 2A6VA 2PHLA 3NV2A 1DGWX 4IEPA 1HKDA 4I30A 1UD1A 4LO5B 5JOXA 4EN7B 2R1BA 2A6YA 1LGCA 3NV3A 4MXWB 5GKAC 1WLWA 1JBCA 2KA3A 5A32B 4L99A 2SLIA 1ZBA1 2VMIA 1HQLA 2RS13 3WG2A 3IPVB 4C0HA 1C3HA 1AYN1 1ONAA 3ZN6B 1RUD1 1ULDA 3ASIA 4JDOA 2GSYA 4F7ZA 4LO8A 4CEYA 4NHLA 1VBD1 3OD0A 3GHNA 2OPKA 2Z69A 4EWEA 1VAMA 2WA4A 3LWCA 1R091 3AP7A 3TB0A 1IPJA 1Q56A 4QQLA 3OYWA 2ZGRA 3CJIB 1KQRA 3ZXDA 3IN9A 4IEOA 1AXKA 2O1QA 4GALA 2PA7A 2BW8A 4IETA 3KQRA 1EY2A 2JG9A 3OBRA 2XWBB 2PHXA 3H3UA 4D69A 1QU0A 2PHRA 4YFZA 3V0BA 5DZEA 1KXGA 2AH2A 5J36A 2IWGB 4P9IA 5LRRA 1RHI1 3WX5A 3AB0A 1G7YA 3JZVA 4N43C 3RYKA 2VH9A 1PMIA 1SLAA 1W2UA 4QPYA 2ZX4A 4IV1B 1VBE1 1ULFA 1ASJ1 2W0XA 3POWA 3VZOA 1DBNA 1S0CA 4BPZA 2QDNA 1UPIA 2YMZA 3PMEA 2R16A 1QOTA 3LGRA 2QZ2A 1MS1A 4KG8A 2GAUA 3W59A 3IDEA 2D3RA 1D0HA 1VP6A 1AL23 5DDJ3 3INAA 1DGLA 2AZ5A 1FNZA 1N1VA 4JVAA 5GLWA 1H30A 3POYA 4JGYA 2A71A 3ZXAC 4JCKA 1G9FA 4N7UA 2HEVF 1TMF2 2MPFA 4AI2A 2EF6A 5CVRA 2R32A 1ZBE2 1X50A 3I4IA 1B35C 1EAH3 5L7OA 1AF9A 2DVFA 1DQ4A 1SFYA 4A7KA 3O0VA 1BBT3 1PVC3 3VBHC 2HWE1 4JTNA 1XNBA 4CDXB 4PIXA 2Y0IA 4FPKA 4BM8A 4Z8BA 1RUJ3 5IUQA 3ZMOA 1GQHA 3AK0A 4AEDA 2AYHA 2CTVA 3JB4C 4L8QA 1PZ7A 4LEJA 2WS92 1CJPA 4OLLA 4DFSA 4O9GA 5FLHA 1RL3A 1QDCA 5A33A 2H6CA 4P9JA 2HJIA 4M3CA 3DGTA 3H1MA 1XU1A 4IEUA 1ENXA 1BK1A 1DZTA 2V73A 4M3CE 4ES9A 4Y1VA 1JTZX 1SMVA 4YLZA 5E1RA 4JGZA 1UAIA 5IT6A 4AGVA 4EROA 1AR93 3N35A 3NW4A 4AVCA 4CDWB 4BA6A 2RS12 1AX1A 3E6CC 5FLIA 1XYOA 3AJYA 4NHMA 2OZJA 4D7YA 2I45A 1HQWA 3RQ0A 3KT7A 1GSLA 1LJ7A 1ND3A 4YZ3A 2VUJA 1H8TC 2HYKA 4ZU5A 1JHNA 5ACA3 3UJQA 4KWJA 1OA3A 1VAVA 4HPKA 2QQPA 4LBLA 2UWAA 3N7LA 5IK8A 4L92A 4MH0E 2XL9A 1YI9A 3KGLA 2ZKLA 1W6QB 4COVA 2YGLA 2X8KA 3ZPYA 2DVBA 4P9GA 5E16A 2E6VA 3VBUC 1OPMA 2WWSA 4M3CF 1POV3 1NOVA 3AMHA 1TNRA 4HANA 1RINA 2VQ0A 2A3WA 1Z7S2 4R4ZA 1NCRA 3ATGA 4DY3A 3GF6A 1QJU3 4IEQA 1TQ5A 3R4UA 4RD7A 5KXEA 4GMP1 3EBRA 1EPZA 1PZ9A 2H6BA 1KS5A 2WFPA 2ZABA 1V6NA 1HQNA 4QHBA 4Y22A 1IS4A 4R9CA 3SXWA 4Q0QA 5CU1A 5FBZA 2C1FA 2QCSB 1NA1B 2CV6A 4OHYA 3HT1A 1YNAA 2WNVB 3KLSA 1QXJA 2B9UA 1YFUA 2VGDA 3VKOA 4AF9A 4TWTA 1AX2A 4BH9A 4HLTA 4Y20B 2HKXA 1ULGA 4COYA 1X36A 3FJSA 2PN5A 1AL22 3APBA 1YI7A 4RS5B 3J9SA 5GJ6A 1Z78A 1LOFC 1RUC2 2SBAA 4CEYC 3T1MA 2VOKA 3PVBB 2X5IB 5GLZA 4GH4A 4QM8A 5AC93 1QHDA 1G9BA 2C0ZA 3JCIA 1WBLA 4TLFA 3WV6A 1EAH2 4RR3B 1QJX3 4CEWA 4QPGA 4Q0PA 1PVC2 2PHFA 3CJXA 4Y5Z0 1NYWA 3VDDA 4Q4X3 4K21A 2NM1A 2ZPXA 1QXPA 3U11A 4YM3A 1RUJ2 3OF1A 1G9AA 4AVBA 1F31A 1IPKA 2P34A 4Q1RA 4FPHA 3WINE 3WCSA 1I5ZA 1AHSA 4D7TA 5GALA 1WGPA 4XFAA 4EN0A 1GANA 3V65A 1V6IA 3WNXA 2JG9C 1V00A 4O9EA 2BBVA 1DF0A 5BY5A 3M70A 1RTVA 1PNGA 3LA3A 4I02A 5C9AA 4BWOA 3VKFC 1LESA 4YARA 3MIFA 1DQ2A 4Q29A 3WUCA 1APNA 1CAUA 2D7FA 3E6DA 1ENQA 3B93A 1H4GA 2ARBA 3GBGA 3RMXA 2GH8A 2WC2A 1TMF1 4YSFA 2CNAA 2JG8A 3ZSKA 1W6MA 2IFWA 3N4MA 3MIHA 1SBDA 2PFWA 1EV11 1JW6A 1ZBE1 1AZDA 4YVSB 3MIDA 2ZHLA 1WW5A 3RMYA 4HT1T 2HWC3 4XBNA 2PQQA 2R0FA 4S2FA 4Q4Y3 4DMIA 5ACA2 1LOBA 3NV1A 3B7MA 1AVBA 1GQGA 2P37A 3Q9OA 4JGYC 4AYUA 5JOZA 3LOIA 5CAZA 1MZFA 4FPLA 2RJKA 1PZ8A 4N90A 3QD6A 1RHI3 3IWZA 2WS91 2Y0OA 4IV3B 4K40A 4XQWA 4B7KA 4ITCA 4PBOA 1VALA 4NPRA 5C8CC 1OFSA 3R0RA 5EYYA 1UIJA 3H8UA 3O0XA 4FTBA 5K0UC 2PHWA 5L7OC 5CADA 3USSA 1I9RA 2QDRA 5H9RA 4H7LA 4MXWA 3A0NA 3NAPB 3JUUA 2Q1ZB 4ISRA 2ILMA 4QGLA 4MYEA 5A32A 2WNEA 2QFEA 5T52A 4AQSA 4XILA 4XFBA 4AEDC 3IPVA 5EYXA 4AI0A 1D4M3 1O3SA 3GNEA 3ZN6A 1W6PB 3R05A 1VB2A 2B5HA 2RS11 1NLRA 4YGBA 1FMD3 1S0GA 2WQZC 4XJZA 5L73A 3V64A 4XMIA 1J3PA 3N3HA 4BLIA 4YG3A 4FBFA 5T50A 1XRUA 4DRRA 1ZVFA 3ZYPA 3BODA 1OSGA 1G86A 4ZKTB 1A78A 3N7MA 1RGSA 2ATFA 3PJYA 4COZA 2DCZA 3O0WA 1UPSA 4Y1YA 3J26N 3WDUA 4W6WA 5CG8A 3CJIA 3KCYA 3CU7A 5FQ0B 4LE4A 5GZCA 1ND3C 1Q8PA 4OHZA 4XBLA 3R6SA 4FQZA 2D6LX 5T5PA 5FPZA 1QJZA 4V1PA 4AXOA 3ZIXA 5AC92 3AFGA 1Z7S1 1D2SA 2CL2A 3H0OA 3ZMNA 1QJX2 2YY1A 4OUSA 2ET7A 4Q4X2 1LGBA 5BNOB 5AFEA 4LR4A 3ALQA 4IV1A 2NMOA 1WD3A 2ET1A 3JD72 1OLRA 4HKOA 1S2BA 1E57A 4WVMB 4LHNA 1ZZCA 4K3UA 2WZR3 3ILNA 1M4WA 2DVGA 3TNQA 5C33A 3UV9A 2Q5TA 3RI9A 2VG9A 1ZRRA 1AL21 4N7IA 3WR0A 1RUC1 4Q0VA 1N3OA 2TBVA 3C3VA 4QQPA 1CIWA 1AR72 2VXRA 3O7OA 2Q0AA 4CDXA 3WW3A 3FMGA 2OZ6A 5EV7A 1X33A 4AVTA 1EAH1 1WMEA 4XJAA 5GLUA 1IGOA 1PVC1 1NXMA 4DRVA 4EN9B 3D4KA 2HWC2 4LNVA 3M3OA 4Q4Y2 4LUMA 4XTPA 2ZGKA 1RUJ1 2ZGMA 4YVWB 4CYDA 1PK6B 3WW4A 3LB9A 1O3QA 1FX5A 4FPGA 2HWF2 4AFCA 4RQPB 4MZUA 4GH4C 4FAHA 3WQ1A 1IS3A 2WSVA 4M01A 5F6LB 2BNMA 3P3NA 4CEWC 1A8DA 4QPGC 1D0GA 4YYOA 3IDBB 3NKTA 2ZX3A 3VDDC 1R1A2 3ZYJB 5K7PA 1J58A 4AEKA 5J09A 1XE8A 4CDWA 2PAEA 4I0BA 2NN8A 1D4M2 1ND2B 1CAWB 3ZYIB 1GYKA 1RUG3 3ZSMA 1RUF3 2XKOA 2DUPA 4JQRA 3SNMA 2WZPP 4QQ2A 1FMD2 3ECQA 3IM0A 1BXHA 4C0BA 2K9ZA 5C9AC 1Q8OA 3AP9A 1H9WA 4YGEA 4RHV1 1D2QA 2EAAA 1A8MA 5ACA1 1PO23 2VU9A 4KU7A 3RS6A 4OHVA 1DG6A 2R073 4B4QA 1W6QA 4NVPA 2UURA 2AREA 2JG8C 2VOWA 2VULA 1QQP3 2R0HA 1X7NA 1O7FA 1V6LA 4FP2A 4C1WA 2VMHA 3MIGA 2ZGOA 3AKTA 1MS8A 2VY0A 2OW4A 4FPJA 2YGMA 1FOD3 4LBJA 5IK4A 4AK3A 2Z5WA 1U0AA 1RUE3 1H8TA 3FFZA 4IQPA 1V6MA 1WW4A 1ULCA 2F4PA 3VN4A 1MVQA 4XXAA 3VHPA 2E53A 1SLTA 3E97A 4Y26A 3GYDA 3VHOA 2YROA 4UBHA 1TMF3 1MEC2 1NA1A 4HSLA 4DPNA 3MFAA 1DYKA 2WNVA 1N47A 1EV13 1OI6A 1ZBE3 4FXGB 4Y20A 4E27A 5CG9A 3AMQA 1V6KA 2OIIA 4RS5A 3WQ7A 2WZR2 2DU1A 4OULA 4HSJA 2VVFA 3TBDA 4XF9A 2YC0A 4IXLA 1H9PA 4XF0A 4OZXA 2WS93 3AP5A 3FLTA 2X5IA 3R4DB 2JX9A 1COV3 4XFIA 5T54A 3M7AA 1NY71 1VR3A 1ALYA 4YW4A 4WM7B 4RR3A 5AFBA 1KFXL 2GC1A 4META 4E2SA 1SLIA 5AC91 5FO7B 4YRDA 1MS3A 2Z2SB 5FLJA 4X6RB 3QBQA 1QJX1 1ENSA 4SBVA 4XFHA 4E9KA 2I2SA 2XVLA 3THPA 3CJIC 4Q4X1 2XL7A 2CY6A 2WT1A 3DKWA 4J1XA 3M1HA 3QH7A 2Y26A 1NCQB 2XB6C 1I3HA 2QKDA 3AZZA 3JD71 3ZSLA 4K6BA 2XBO2 2ZA9A 3DF0A 1MQTB 1QH6A 4PLOA 4B4PA 1LOFA 2R063 3AKSA 4IL7A 3L2YA 1LEMA 1B09A 1O3TA 1T6GC 2JD4A 4XW3A 1YXWA 3AMMA 2D44A 4IV1C 5JCTA 3U0ZA 1OQEA 3BOPA 4P9LA 1HRV3 2AENA 2A70A 4HFSA 4N53B 4ATFA 4FPEA 1FXZA 3WP5A 2GNTA 2WLQA 1N3PA 2EXIA 3IMNA 2D40A 1AR71 1FYUA 4BMEA 1RUG2 1RUF2 4XZPA 4MGKE 3I8TA 4AEJA 4H55A 2XJSA 4JAAA 5BNPB 3ZN4A 3OPZA 4FVVA 3KZ4C 3USUB 4KGGA 4CDQB 2RJLA 2HWC1 1Z7S3 4Q4Y1 4WVWA 2DUQA 4IV3A 1PO22 1U5IA 3MI8A 5DUVA 2R072 4QPIA 4NN0A 4JRLA 2E7QA 3S6PA 2D6MA 2VVDA 2HWF1 5KHGA 1QQP2 2ZHNA 1YFXA 4JRAA 4CDXC 2D3SA 2GZWA 2Z42A 1TME2 4Q27A 4AGRA 1SCRA 5F1RA 4Q8KA 5LRSA 3D0SA 3VZMA 1N1TA 1R1A1 4Z1VA 1FOD2 2TNFA 3WLUA 2A3YA 1VIWB 3FHIB 4IESA 4FPOB 5I0RA 1K5MA 4OI0A 1RUE2 3WQ0A 1D4M1 3HMYA 1HRI2 2R30A 1H1AA 1DDLA 2UWBA 5KXBA 2IXIA 3KD4A 2LTNA 1RUC3 4H7MA 1FMD1 1HW5A 1WMFA 3AZXA 4EJRA 1CAVA 5C8CA 1EV12 1REDA 3SCFA 1ZZ8A 5K0UA 4CDWC 4GA9A 5B2GB 1H4HA 1C1LA 2WT0A 3JQWA 4UW6A 4QU2A 2IFRA 3ME2A 2ZKNA 5FQ0A 2DVDA 1PGSA 3SH3A 3NJZA 4NWVA 4B3NA 3GBWA 2QVSB 3IT8A 1S0FA 2A7AA 3JB8A 1AXYA 2GN7A 5DXDA 4FXKB 2BTVC 2W08A 1SLBA 2WT2A 1MVEA 1H1MA 4DOUA 3ZSEA 1COV2 4GQ7A 1Z0HA 4E4SA 4LE3A 5LEJA 1GZCA 1V9U2 1C1FA 3CLPA 4F8AA 4IERA 2RS53 4Q2FA 5H9PA 4BE3A 5BNOA 1KDKA 3VKMA 5JSRA 5KHIA 2DCJA 1I6XA 5CFCB 4B4RA 3JU9A 5JOWA 2G9GA 3MIBA 2P3IA 4HVQA 4GWMA 4WVMA 1NXD1 2UY8A 1MEC1 1NQDA 3SH5A 3BU7A 4LBNA 2VW1A 1AL0G 4GB33 4PLNA 3D8CA 4PBPA 3JBG2 2YHJA 1OOPB 1PO11 4KG0A 2GMPA 3ZX7A 4EV0A 1WCSA 2R062 4MXVA 4RHV3 2WZR1 2DCKA 2ZX2A 3WCRA 4AQTA 1MZ5A 1PGW2 1LHNA 3MLKA 3O14A 2UU8A 1HRV2 4MSVA 1NA1C 1PNFA 3OJBA 3U4XA 3PVEA 4B8EA 2WNVC 5KWRA 4JDMA 3RRDA 1Q8SA 4MGZE 3VZLA