3J7NA

Virus model of brome mosaic virus (second half data set)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
149
structure length
149
Chain Sequence
KAIKAIAGYSISKWEASSDAITAKATNAMSITLPHELSSEKNKELKVGRVLLWLGLLPSVAGRIKACVAEKQAQAEAAFQVALAVADSSKEVVAAMYTDAFRGATLGDLLNLQIYLYASEAVPAKAVVVHLEVEHVRPTFDDFFTPVYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Capsid protein
publication title An atomic model of brome mosaic virus using direct electron detection and real-space optimization.
pubmed doi rcsb
total genus 15
structure length 149
sequence length 149
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01318 Bromo_coat Bromovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.220 Mainly Beta Sandwich Jelly Rolls Satellite virus coat domain 3j7nA00
3J7NA 3J7LA 1STMA 1JS9A 3J7MA 4NIAA 1CWPA 1ZA7A 1YC61 4OQ9A 1A34A 4OQ8A
chains in the Genus database with same CATH superfamily
1AR61 1ND3A 1PVC1 4PQQA 2B46X 1L7QA 2RJLA 3M3CA 1NOVA 2VC9A 2RR11 1XQNA 4BPZA 1AX2A 2AACA 2BOIA 5DZEA 3WD5A 1MS3A 3WG4A 4LE4A 2ZGOA 4IGQA 4Q4X3 1ST8A 2XJSA 1W99A 2ORXA 4ITCA 3ZYIB 4RSUA 3BPSA 3FBMA 5JZGC 1JYVA 1NA1C 2XB6C 3BOWA 3SXWA 4D6QA 4ISRA 2KXLA 2W94A 5AC91 1WGPA 4GMP3 2IXHA 4W65A 1BMV2 2WWSA 2GNBA 2VZ1A 5E88A 4FBFA 2Q5TA 2X8KA 4Q4V2 4PIZA 5BY5A 2ZKNA 3VBUC 4CYDA 1T2XA 5CG9A 3GXUA 1UYXA 3Q8AA 2WYFA 4NPMA 4YVSC 1ASJ2 2YBPA 3LF7A 3VBHC 2VTXA 4XFHA 4FPYA 4KWLA 3UT0A 1WCDJ 2VZRA 2Q1MA 3RVHA 5C9AC 2GC0A 1W6NA 2V73A 1NZIA 1RUD3 5C3PA 1VRBA 4JGYA 1DGRN 1UZ0A 4QPGB 1G9AA 1CONA 4RGAA 5CKMA 4CU9A 2X10A 1AR81 3WF2A 4YZ2A 1DZTA 2PHTA 2JG9A 2RM22 2FMYA 2CTVA 3J26N 1ND3C 3MO4A 3CLPA 3KLSA 2IUWA 2WZR1 3ZSEA 4H55A 4UFJA 5FO8B 5JMCA 2D40A 4BQ4A 1E5IA 1S0EA 2RDRA 2W47A 2VQ0A 1H2LA 1PMJX 1RINA 2OUJA 3VBFA 1NXMA 5A33A 3KGLA 3WQBA 4E2SA 2JDZA 3VKOA 1FMD3 1X8EA 4CCDA 1F31A 4GWNA 4C0BA 4NIHA 2RMU3 1J1LA 2YPJA 1R1ZA 5A3PA 4FOYA 1DDLA 4Z82A 2VH9A 1REEA 1B35A 4GZ9A 5DZFA 5DG1A 5FFOC 5DXDA 2GH8A 3ENRA 4DUWA 5JUVA 4AVSA 1X8MA 1BVVA 1WW6A 4WV8A 3CEWA 1CN1A 4QX2A 3AP9A 3RWKX 2QUOA 4AE2A 2WNVA 3B94A 1RUI2 2VZSA 1OH4A 3UNPA 1PVXA 5F6KA 1OFSA 2P4EA 3WNMA 1PIV2 3LWCA 4Y1UA 2I2SA 4D0QA 4C91A 4NR1A 3ZYRA 5K7PA 3OB8A 1SMVA 1MR5A 2WN3A 2B8MA 5FZDA 3IDCB 4J6GA 4LR4A 5F5CA 1A3KA 4MX3A 4UBHA 3RZKA 1CJDA 4AI3A 2WC2A 5EIYB 4IV1B 4IUGA 1AXKA 5FYVA 4XBNA 2BERA 3KM5A 1EAH3 4JRLA 2EIGA 1W3XA 4HVQA 5APAA 2XKPA 3OD4A 3NW4A 5FLIA 5GLTA 3VKNA 4AVAA 1H9WA 4IEUA 3RMXA 1QNWA 1UY0A 4CP1A 5EP9A 4JZRA 2J22A 2GMEA 1MS4A 2VNVA 4QQHA 5FP9A 3VBFC 5FYCA 5KHJA 4LE3A 1DLLA 5JSRA 4FTEA 2ZAAA 3ACGA 5D21A 2D5FA 5GZFA 2VZ3A 1REDA 5CFCA 4FPKA 1LOEA 1KITA 2W92A 5A1AA 1ZA7A 3KQ4B 2GALA 1B35C 1YQ5A 4HKLA 1YQ6A 2AENA 1QXPA 5FYSA 2ZMLA 1RUNA 2ZEYA 4JC1A 2WNUC 3M1HA 1CAUB 2WFF2 4W4ZA 4YPJA 4EWAA 2GP3A 4LULA 5FZFA 3WF3A 1QNYA 1PX3A 4W6YA 5FPZA 4HMZA 2WDBA 4EZHA 5FZBA 5K8SA 4AI9A 4Y22B 1GZ9A 3QD6A 1PZ8A 3I8TA 3T0DA 3FWEA 1S1AA 1RGSA 4D7SA 1JZ2A 1AR72 4NUBA 2RV9A 3CU7A 4COZA 4PDWB 3SEEA 2XQRA 3FMGA 4XQDA 2FZ2A 1ZZ6A 1LR5A 3AZWA 5FXWA 3M3EA 2LROA 5LW9A 2Q1ZB 1MZ5A 3N9NA 3RZHA 1P8JA 1RUF3 5HI0A 4I01A 2RE9A 4XTMA 3ON7A 1RYYA 3ZMOA 3ZYBA 5F32A 4XUQA 4ASLA 3SKVA 3VDAA 3IPVA 5GLZA 1H1MA 3NNGA 3WQ1A 4GB32 1WBFA 2XVGA 1SLIA 1F5FA 3NJVA 5HCAA 4XBLA 5FIXA 1YQ8A 1UOGA 4FPCA 2JG8B 5F3EA 2QQKA 3VBOB 4ZZ5A 4KBBA 4NIAA 3ZDSA 4MGQA 4E4DX 5F1RA 1V9U3 1VBB2 1WCQA 4H7LA 4SBVA 3POFA 3WNXA 1N3PA 4DINB 1LESA 2JD9A 3GHNA 5FWJA 1UN1A 3DYOA 3MIBA 5HXVA 3WW1A 4TYSA 4D6SA 2VNRA 2MHFA 2VW0A 3FLRA 5CZKA 4BXSV 3DN7A 1BMV1 4QPIC 1PNGA 3WW4A 3DPRC 4LBOA 4Q4V1 2J42A 2V4VA 3VZMA 5JIAA 1LODA 4FPGA 3E5QA 5KC5A 4DY3A 5DN2A 5IYYA 5FP4A 5L7OA 5J7MA 1ASJ1 1HRV2 1MQTB 2DV9A 2VAUA 3MLJA 4QQPA 2XONA 3UV9A 5FQ0B 1W03A 2JB4A 2V09A 4XZPA 1XRUA 1ULCA 2I45A 2G9FA 4YLZA 3TRSB 3BKZA 1AL0G 2Z2SB 4OI2A 2V5DA 5D2AA 3GALA 3BUCA 4CDWB 3ZYFA 1G7YA 3OY8A 4COUA 2RDNA 2ZGMA 4QX3A 4HANA 4WM7B 3MUY1 2E33A 3WCSA 2RM21 4H2AA 3ZOIA 2EIEA 5JCTA 2YC2A 2KD7A 4QHBA 5LA2A 4JKMA 3MV11 5FYTA 1OT5A 1G9DA 2AGSA 3U4SA 2QQOA 5FV3A 2WO2A 2Y33A 1NLSA 1O8PA 4BCUA 4NOTA 3O1RA 4W8JA 2V72A 2Z5WA 2BGCA 5ISLA 4N9HA 1N3OA 4WM8A 1CAXB 4Y3OA 4GH4C 5FPVA 1WMEA 4Y1ZA 5IK4A 4NIIA 1GSLA 1DGRA 3RJ2X 1HX6A 3PTYA 1GLHA 5T3NA 3VDDC 5CADA 3VBRA 3TN92 2CGOA 2QQLA 5FREA 5LK7B 1FOD3 4LUMA 1XE0A 2WNOA 4AOCA 1HQLA 3HQUA 3T09A 1Y9MA 2W3JA 1W0NA 1I6XA 1PIV1 2HWF2 1H2KA 2XMLA 3I3DA 4XVHA 5K0UB 2CWMA 5K4LA 4I3GA 1MVEA 4RFT0 3PMEA 3MLLA 5HBAA 4V2VA 1K42A 3RZJA 2D44A 4QB1A 5BNPB 4AFBA 4M4RA 1W2NA 3EO6A 4WZFA 2IFRA 4IV3C 2GSYA 1K45A 1NCQA 1O6UA 3KV4A 3R05A 2D3RA 2YFUA 4IEVA 5CAZA 1O3SA 3ZR5A 4W6WA 5LY1A 4PLMA 1FXZA 1W6OB 2ZA9A 4Q27A 5JI7A 3OG2A 5T54A 1QJU2 1AZDA 4UW4A 3AKRA 3OEBA 1PO12 3ECQA 4NE9A 3KF3A 5BNNB 4JVAA 4P9YA 4CZSA 5FMCA 5D8AB 5AFEA 1QKQA 5JXIA 5CFDA 2AR6A 3IKWA 1FPN2 4Q4X2 1YJLA 4O61A 2P3KA 1R64A 4AQ6A 4KU7A 3OBRA 4YG6A 5F5QA 1AX1A 1QMJA 3FUOA 4BMEA 4AVTA 1RUG3 3BVCA 2XJUA 3PUIA 5KXBA 1WA4A 1UY3A 4YM1A 3AZYA 4ZXEA 4LHKA 1WW7A 1X82A 5I0RA 5HCBA 1G9FA 2WFF1 2OQ6A 3SEPA 1COV2 3DECA 1CX1A 3OPTA 3ST7A 5LA9A 2BQPA 4MUVA 1D4VB 2X05A 2XVLA 5CISA 2QTWB 3P6BA 4GQ7A 1HRI1 5A3NA 3O1SA 2D98A 3GBFA 2PHUA 5FY4A 2I74A 2OX0A 4BLJA 5GKAC 2WRAA 1LEDA 3O1VA 4GD4A 1AR71 3PURA 4HT1T 4OUEA 2JB8A 2QQNA 1Q5OA 5GM0A 2Q1FA 2P3YA 1T6GC 3NO8A 1UXXX 1S55A 3Q8FA 4IE7A 1W6MB 1YRZA 3ZFEB 1RUJ2 2BBAA 1G9BA 2XJPA 3KB5A 4ISQA 4M3CE 5L36A 1YFYA 2NP0A 3I2GA 5F39A 5J98B 2PAEA 1V6OA 4IDZA 3PLQA 2JE7A 4GB31 5LK5A 1KRIA 1C8M3 3WP4A 2BZDA 1H8TB 4JAAA 2XHKA 4RQPA 2D6OX 4CDXA 2WS92 4RGGA 4CXXA 1UW8A 2JEMA 2W9XA 1H4GA 2FDJA 5J09A 3ZX7A 1VBB1 3UK9A 3LPFA 3A0KA 2WJSA 4QWNA 5J37A 3I59A 3MDPA 4DFSA 4LK7A 1HV1A 1NZCA 2NYYA 2A6VA 3LFIA 2DDUA 1NX9A 4Q29A 2QNKA 3THCA 2Y26A 3WX5A 3V65A 2P34A 3VD9A 3ZXDA 4AQSA 3WG1A 2W46A 3E97A 3J7NA 3SH3A 5C70A 4BK5A 2HWC2 5FPUA 1URXA 1E5SA 2QQPA 1HIXA 4AYUA 2Y60A 5DABA 2BGPA 1SLAA 2CY6A 1S0JA 1REFA 1SEFA 2VTFA 2PQQA 1HRV1 4XETA 1X50A 1V0AA 4IV1A 2E51A 5A7NA 5F5AA 1EY2A 5IVBA 4QPGC 3M3IA 3BTZA 4FPLA 3KV9A 3VGIA 3KQRA 2QCSB 2Z42A 4QM9A 2X53S 4O65A 4CUBA 3G7DA 2J1AA 1JYNA 2BW8A 1EAH2 2WT1A 4I02A 2ZKLA 5A6XA 3EQEA 4DUXA 4KH9A 4QX5A 2F4LA 2VXJA 5GJ6A 3BIEA 2LUWA 1JMUB 1PO22 3NMBA 3O5SA 1OA2A 5JOWA 3EXUA 1Z7S2 5HXMA 4GKXA 1SBEA 2ZGPA 1G8WA 3GM8A 1UIKA 4K7JA 4CEWC 1BBT3 2IVIB 2VMCA 5SV8A 5A1LA 3X29B 4IEOA 5L9BA 4FCAA 1FYUA 2ATFA 5FYMA 1DQ4A 2OT7A 2ZHNA 4OHXA 4JGYB 1NCRA 5C5UA 4P00B 5DZGA 3H8RA 4IL7A 2Q8EA 4EWEA 5F2WA 1CAUA 4AZZA 5A1FA 5KXCA 1QQP3 3J4UH 3S7IA 2JG9B 2F6BA 2AYHA 1OLME 2O8QA 5C5TA 3ETQA 1ODNA 4LKEA 4MGKE 1DP0A 4P02B 3O1MA 3NNLA 3WW3A 1CAVB 2RS52 4LBKA 5ACA3 4BQXA 4EQVA 1AJOA 2IXJA 1O5UA 1ENQA 2O1QA 2PQSA 4LBMA 1UZYA 5JOXA 1JZ6A 1LHWA 1FX5A 4V1PA 4QT6A 1I5PA 2XJQA 3MIHA 4Y1VA 2R30A 3AP5A 4LHSA 2YDEA 2V4AA 3ZXLA 5JI9A 2R49A 1US2A 1JHJA 4UFKA 3VV1A 2DURA 4LXLA 5FMBA 4ZZ8A 5CB7A 1EUUA 2PA7A 3UL2A 2LW8A 2NN8A 4K8RB 2Y6GA 3MUZ1 1XNTA 5CA6A 3N9PA 1VALA 2F17A 2WNVB 4PQ9A 1OKQA 3ABZA 5FWEA 3ZN4A 1XBFA 3KS7A 4EN6B 1YFXA 2HWB1 2FHRA 5FXZA 3RPQA 3D82A 3AZVA 1QJU1 4Z2WA 2VJXA 3S57A 1PO11 3OGRA 3POJA 4HK9A 5T55A 5C3SA 5SV5A 3U1XA 2YC4A 1QOSA 2HWE3 3H8OA 1AXYA 3I2JA 5LEJA 5KHKA 2WN2A 4MGZE 3ZXEA 1FPN1 4UW5A 3NVCA 4AFAA 4Q4Y3 1CPNA 1ZVFA 2GC3A 2ZHKA 3HWJA 4AR2A 1QEXA 5J36A 2OS2A 1H6XA 1LOAA 1PK6A 2VUDA 4UFMA 3WNLA 4QKFA 4CCJA 4A2UA 3RWNA 1LULA 4DRVA 2J1VA 2RS13 4DXRA 2CGNA 3ILFA 1COV1 1MQTA 1VBA2 4BQ3A 5LRSA 1SHWB 3IDBB 1AL22 4Q1RA 4Y26A 5FBZA 2H0BA 2VOXA 5A3MA 2ZX2A 5FP8A 1FAYA 2D7FA 1W2UA 2GC1A 3LEMA 4BYYA 3UJOA 5HV0A 1VPHA 2DFBA 4PDWC 4Y4YA 4YG3A 2QQJA 4XJWA 1XSRA 3IM0A 4OZXA 3OUIA 1UWWA 1EV13 1LU1A 2VQAA 3GCWA 2R7EB 1QJX3 4WM7A 3QH7A 3ZXAC 4AFDA 4Q2FA 4NIGA 1LKNA 4NROA 2QE3A 3NKTA 1U5XA 4ATFA 3P3PA 1N1SA 3CIHA 3T4VA 1U12A 3FC0A 1L7RA 1SCSA 2XQXA 3ZLIA 4QXKA 5FOJB 3HR9A 1RUJ1 4ES8A 3U0ZA 1PZ7A 1SQ4A 2W1WA 1J84A 2JG8C 4EJRA 5C71A 3MZHA 3VBOC 5FZ4A 2FZ1A 1RMU2 1V6MA 1CAXA 5DUVA 4Q8LA 4BH9A 1LAJA 1PMIA 3AMNA 2WS91 4MVTA 5BYNA 1TME1 5DDJ2 4B4PA 1QJY1 4EN7B 1NXD1 2VZVA 4MHRA 2WWJA 5BUVA 2JXAA 3AP6A 1EYBA 1DGWX 4ONUA 4XAAA 2A3XA 5LB6A 5C3QA 1W9FA 3FN9A 2BGOA 3R0RA 4K3UA 1G6NA 3PTRB 1J3PA 5FXXA 1GNHA 3I2HA 2VZTA 2YY1A 3AYDA 3HBKA 1NQDA 3NV3A 1CESA 2Y38A 2PLV3 5I8TA 4YZ5A 1TZOA 2WO1A 3ZVXA 1MQTC 4K9SA 4XUTA 2HWC1 5FTTC 1VBE3 4HK8A 3CZUA 5JDBA 3DCQA 2I07B 1HN1A 4NRPA 5FLHA 2CNAA 4GWIA 3NJZA 1AVBA 2QZ3A 3KCYA 3FJSA 3MF9A 1RHI2 3E6CC 4I3PA 4CDWC 4QQOA 1DYOA 1IPKA 5C3OA 5C8CA 4CSWA 4CCOA 5F3CA 4NRMA 4WM7C 3ZSLA 4TLFA 1JI6A 1W6OA 2BPA2 1DYKA 1RUH3 2E9QA 4FFGA 4LO7A 1JTZX 1SLLA 4OHZA 3IT8A 2QQMA 2VVDA 1UU4A 4QX1A 4RD7A 1W6PA 4EV0A 1LU2A 1PO21 5IVFA 5BNNA 1O3QA 1BEV3 3I3QA 5L7OB 5D8AA 5HCHA 2GP5A 1Z7S1 2BDRA 4XDPA 5FY8A 1JZ7A 1C4RA 4J1WA 3VZKA 1W9YA 1GKBA 1A8MA 3IZOA 3NNJA 4FPEA 3WLUA 4CDQC 3ZO0B 3OPWA 3ORJA 1F35A 1H8VA 3PVEA 4LK6A 1R091 5LZ6A 1GWKA 4NHKA 4XUPA 4YW3A 3LB9A 3WDWA 5AVPA 1KGYA 1OUXA 3RDIA 1YXWA 3USUB 3SCGA 4AVBA 4UOJA 4E4SA 1CIWA 1PGSA 3OCPA 1UY2A 1KD7A 2RS51 5FUIA 1NG0A 3URFA 1DCSA 5K0UC 4EN9B 2UU8A 1R1A1 4KMQA 1U5YA 4UW3A 1AYM3 1HB1A 2ZAHA 4PCRA 1GFF2 2YFZA 5J96B 1IS5A 1ENRA 2QQIA 2H6BA 1LOGA 1QWRA 3PMSA 4QPWA 1RUOA 3OGVA 5BNPC 1CZSA 2R1BA 4WM8B 3N7MA 4AQ2A 4X6QB 1BCXA 3M3OA 5T50A 4CCCA 2VGDA 4XACA 4H7MA 3OTFA 3ZFEA 1Q43A 3VBRB 1JZ4A 1VAMA 2C4XA 4RHV3 4HONA 4XAEA 3FHIB 2P5BA 3I2DA 2D43A 2LRPA 4YGCA 4X6RB 3H3ZA 4HPKA 1VAVA 1BHGA 3C7FA 1POV0 3RG0A 3LEIA 1QU0A 1W2OA 3FL7A 5BNNC 1OC1A 1JOBA 5D8AC 4QD2A 4XF0A 2WUHA 1HB3A 3BTAA 3N9MA 4LBJA 2IXLA 1KDKA 4PHZA 3O1OA 1IKQA 3WCRA 3IAPA 4RR3B 3GJAA 5A32B 3WSOA 1TMF2 2W95A 2CL2A 1IQDC 1LJ7A 2LS6A 2OXBA 1NCQB 1LTEA 4G3YC 5DAQA 4JKLA 5H9QA 2GH2A 1HXS3 5BXXA 2VOTA 3K48A 1TVGA 4QMAA 3DEMA 2B45X 5LBEA 5E89A 3TEZA 4QKNA 5T5OA 3D0SA 1HJGA 3KGZA 3P5BA 2WQZC 4J25A 4MGSA 1BQPA 1W3VA 1ZZ7A 3QBQA 2GN3A 5EV7A 1VBA1 2VUJA 3GZTB 4NAOA 1AL21 5FZ0A 4P9GA 3UETA 4XJZA 2RS33 2JE8A 5CFDB 4BOWA 1UOJA 5L19A 1O91A 3O0XA 1H2MA 4BMBA 2NPIA 2A6YA 4LQRA 5BV6A 1O3RA 3LA3A 2FCTA 2HWD3 1W8OA 4XF3A 4C1XA 4Q4W3 5IK8A 2E63A 2JDAA 3IDEA 3KCXA 3VZOA 1UIJA 3AYEA 3PVBB 1O4TA 3DL3A 1ULPA 1RVF1 2BNMA 4N53A 4HN1A 3MW3A 1W8ZA 3OJBA 4XF9A 2D93A 2JDNA 3TEXA 1D4M3 3UKNA 1WW4A 4D6RA 5FBJA 4LBLA 1ULEA 1VRH3 4G4FA 3ES4A 3BU0A 1GZTA 1H8TC 1HQWA 3VLBB 1GP4A 3R6SA 2ZPXA 4NMIA 3W5MA 5F3IA 1POV3 5IVYA 2GU9A 2JDMA 2X5IB 3EBRA 1VMHA 3MI8A 4R9CA 3H1MA 2BBVA 4UFLA 5FDBA 1RMU1 2K46A 4CP0A 5A7WA 3AFGA 4GKYA 5FUPA 4DZGA 1RUC1 1AYN2 3SMHA 1Q3EA 4AGGA 5FQ0A 5DDJ1 1CAVA 3R4UA 2ORZA 4CU6A 5CEHA 3IDAA 2FMDA 5A7QA 2WT0A 1ACCA 1YC61 4BQ5A 4CRQA 2A6XA 5FZOB 2NM1A 4HVOA 4XUOA 5EFUA 3EMRA 5C3RA 5FMOL 4JTOA 5FY7A 4RGKA 4RQPB 1APNA 1U5IA 2ZZJA 4CDXB 5FMDA 4GIQA 2VM9A 3I3BA 4M3CB 2PXJA 5JAXA 3OYWB 1RC6A 1VB4A 3JBG2 1CIYA 3A0NA 3H0OA 3K4AA 2TBVA 3WUDA 3IMMA 5FYIA 4QU2A 3KZ4C 4UFHA 1GICA 1RHI1 1M06G 2RJ2A 3I59B 2GMMA 1VBD1 1KS4A 3HVDA 3MFAA 4R9DA 1GMMA 3ZN6A 5K9YA 2VVFA 3DUIA 3LIHA 4L9BA 4ZU4A 3R4DB 4PBPA 1YCIA 1TME3 2MEV2 3J8F3 2XWBB 3N7LA 4XJAA 3POSA 5T5JA 3WNPA 1AR93 2A6WA 4AL9A 1PMHX 1VLNA 3IIAA 4JDMA 1ZBE2 4RL7A 1MS9A 1XC6A 4JGYC 3T0BA 3THPA 4CEYA 4YM3A 4RA0A 3LDKA 5FXVA 5F9TA 3RI9A 4B7EA 2JG9C 4R9BA 1HDKA 5GLUA 3LSEA 3VN4A 2RJKA 4CCKA 2GNTA 1V00A 3WP5A 4YZ3A 3WUCA 3AJYA 3MEPA 3B9CA 3RQ0A 1NT0A 4JGZA 3VD5A 3PUHA 4NHYA 4OHVA 4W50A 1V6NA 3RMYA 2EA7A 1MEC2 4JHZA 1PGW2 3D4KA 2PHLA 3S0MA 1DU3D 2XHNA 5KXDA 2K2SA 1N1VA 1Q8QA 2XLGA 5KBFA 1F8VA 4TSVA 4LLFA 1YWKA 1DLCA 3VKLA 3J7HA 2JX9A 1NCRB 3DYPA 4I0AA 3FLTA 2R6QA 2JKBA 4FPFA 3K4ZA 1R082 3N4MA 3THDA 3CJIB 3ZFGA 2WNVC 3NNMA 2OQ7A 1NY72 1V6IA 1E57A 2FCUA 3PVOA 4FOWA 3ZXGA 3W20A 3C8XA 3PU3A 4MG2A 2B7YA 2BEOA 5F7UA 4DPNA 2DVFA 3FZ3A 2OYZA 4AI2A 3MW4A 3VBSB 1XNCA 1S4CA 1JYWA 1OVSA 1GQHA 5FCCA 5CIRA 4YARA 4ASKA 2XBO2 3V64A 4LO6B 4P9JA 1GQGA 1W8WA 1DG6A 5JOYA 4EN0A 4OLLA 3K46A 2UY9A 1TMF1 2ZMKA 3GBWA 1LGBA 4K1YA 4DY5A 3HPNA 4LUKA 4HFSA 2AZ5A 2KA3A 1VBC3 4E4ZA 4K20A 1X9PA 2PN5A 4B29A 3LOIA 3C7HA 2CV6A 4MXWA 3VZNA 4J1XA 4PLOA 2FDIA 4V2WA 4YVWA 1V6JA 1NLRA 3OSDA 4M00A 2R062 1TNFA 5CFCC 4AEDA 2OZJA 1N1YA 3K2OA 4ZY9A 2AUYA 4K8FA 4C90A 2BFUL 4BK4A 1WLCA 3VB9A 2ZZQA 4A7KA 1Y7BA 2R043 1RUE3 2QQVA 1OFNA 4JDNA 4MLOA 4EWDA 4P9WA 2YMZA 1PK6B 5FZLA 3S5AA 1IQAA 2EAAA 4KGGA 3HD8B 2E7QA 1W8TA 4XILA 3WQ0A 3U37A 1S0BA 4HETA 1LECA 1NAEA 4XIKA 2R072 1AR63 3V0AB 2VZPA 4D69A 1H1IA 4NWVA 5FYBA 1PVC3 3KD4A 4MSVA 3AZZA 3NL1A 2YZ4A 3H1YA 2RR13 2RDSA 1BK1A 2A75A 1W6QA 3HT2A 2B5HA 1AF9A 3PIGA 2P17A 1DGLA 5A3WA 4CVUA 2BNNA 3E5XA 5F37A 5ANNA 3USUA 1W06A 4LO4B 1QH6A 3BCWA 3JD72 4ZPIA 1AYN1 2J1UA 2W91A 1GZCA 1S2EA 2E32A 4YZ1A 3BTYA 3RZLA 4MXVA 3J7MA 3U4XA 1T6BX 2JIGA 4IEQA 5JMOA 5AC93 2GNMA 2ARXA 1HB4A 1QJZA 4QHZA 4LBNA 1YO8A 1ZBA2 2R0HA 3ASIA 1I9RA 5A6ZA 2A6ZA 2E6VA 1CR7A 4DEVA 4YM0A 1XPWA 3PL0A 5FZ3A 1UZZA 1VMJA 3MV01 4Q0SA 3GDBA 3JBG1 3A22A 4INDA 4FXKB 4IGPA 1RUI1 3I2IA 2JDKA 5A3TA 5ABJA 4IETA 3W58A 3AKSA 1H2NA 1FT9A 2GDFA 4ARXA 1IS4A 3AKQA 1Q8OA 4PIYA 4YFZA 5L7OC 3K3OA 1AR83 3RZMA 2CSGA 1TNRA 2MEV1 2WSUA 4YW2A 4D94A 2J7MA 1LGNA 2BP6A 5IW0A 2WZR3 4I30A 4RR3A 4GWMA 5A32A 1W8FA 4XFCA 1ZBE1 4HN0A 1ND2A 3ACIA 5FK8A 1RIRA 4RYDA 1MZEA 5JVVA 2DVDA 2EIDA 4XCAA 5C8CB 4BQ1A 1F5JA 3K51A 1LEMA 1W8UA 3ZDVA 5FPLA 1IPJA 5H9RA 2ET1A 4UYBA 4F3JA 3N9QA 4CUCA 3TEYA 3T0AA 4XZUG 1WLDA 4QPYA 2P1BA 4PIXA 1PNFA 1W6PB 4OUMA 1XU2A 1H0BA 2HLEA 3CZJA 3LCPA 1IG3A 1MEC1 5GALA 1UPSA 1PGW1 1SZBA 1ZRRA 2DUQA 2VCMA 4GAZA 4OYUA 2ZMNA 3NJYA 4S2FA 5FO7B 3WDTA 1RB8G 4WM8C 1OXCA 3T1MA 3HBZA 1IZ3A 4Q0PA 4AVVA 2X09A 1Z78A 5JSOA 1N3QA 1IS6A 4JTNA 3FHAA 3N36A 4BQ2A 5IFPA 3VBRC 1VP6A 2JDPA 2CGPA 1R081 1E5HA 2YU2A 3PIJA 3ZPYA 4C0HA 3BI3A 1NY71 2C1FA 1UYZA 5FYYA 2W08A 5CG8A 2G19A 2HEYF 1J3RA 4AK3A 2TNFA 3RYPA 2ZGNA 2WSVA 2X5IA 1XNBA 1JUIA 3WP6A 3UKTA 3T4HB 1RUD2 3BB6A 1WW5A 5EZWA 2IC1A 1POQA 4RR3C 1CPMA 2ERFA 3GYDA 4XJ9A 5E1RA 3AL5A 4CCNA 1NUKA 2XBO1 4HSLA 4C1WA 1ENSA 1NCQC 3ZYPA 1OKOA 1DQ1A 5FYHA 2A7AA 2K0GA 2W5FA 4OMDA 1JYXA 3SLIA 1UKGA 5FZOA 1LCLA 3ZXJA 1DQ0A 4HPKB 3P1IA 5C8WA 1O7FA 2TUNA 4Y5TA 3WOGA 5A3OA 4TXWA 1GANA 3LAGA 1FMD2 2R1DA 2HEWF 2CDOA 5LATA 4LIVA 2RMU2 2J1RA 3M70A 2G1MA 5DUUA 3LIGA 4M3CA 5H9PA 3TBDA 4A6OA 3OYWA 4BB3A 2R061 2QQWA 5CFDC 4AEKA 4D8MA 3APBA 4JHTA 4E4HA 4BHPA 1VIWB 5B2GB 1VJ2A 1TE1B 2PFWA 2DTWA 4P9LA 2WYSA 4UW6A 4XBQA 3VD4A 3H7JA 4LJHA 3T2OA 2A70A 4MOAA 1KFXL 3JU9A 5FKCA 1W2AX 4UT5A 2UYBA 3LDBA 4CA9A 4QXHA 5EYXA 5GZDA 4WBBA 2ZX1A 2DF7A 2EALA 3S7EA 5LASA 3ZFFB 3M7AA 4D7TA 3I3EA 2OUHA 5BNOB 2X5IC 2DWRA 2Y6FA 1VMFA 3TOJA 2R071 4X8PA 1UO9A 1ZRCA 1C28A 3EYPA 3RNSA 3N7KA 5BNQA 1W05A 2P2KA 2ZHMA 1YUDA 3MF6A 1Y3TA 5L73A 3F95A 1FV3A 1WKYA 4LBQA 4UF0B 4A7ZA 5JXGA 4ZHNA 4CE8A 2QQUA 5GLVA 1ONAA 4N53B 1EUTA 1CGPA 3JB4C 4LO5B 5D1IA 3JD71 3ZYGA 4L97A 3C2UA 3JCIA 4HG6B 3C3VA 4E9KA 3WF1A 5DQ0A 3SH5A 3FFZA 2Y6LA 4XFFA 1DQ2A 1HB2A 4K1ZA 4P08A 1KJRA 4XQ4A 2JWPA 4YFWA 5GZCA 2ENRA 4XFGA 2UWCA 4GJZA 4RQPC 4UI9L 5FZ8A 4CDXC 2ID4A 4GJYA 2EICA 1ZBA1 1XE7A 1ULGA 1W9TA 4Q4V3 2CWSA 2OVUA 3LA2A 3DKWA 1BJQA 1BXHA 3KF5A 3CJIA 1B09A 1S0IA 4UBGA 5A7WB 2WA4A 2WWUA 2VCAA 3KVBA 2DUOA 1K12A 1W90A 3TNQA 2DU0A 1ASJ3 2J1TA 1NE4A 1C3HA 4UFIA 1O5LA 2HBTA 3D8CA 1VR3A 3VHPA 5I0SA 2C9AA 3TN91 1I5ZA 1SPPA 3K3NA 3VL9A 3POWA 3O0WA 3VBSA 2WQ8A 1OLMA 2QBXA 4QB2A 2HWF1 2Y64A 3CDZB 1S0GA 5FZ6A 1OA3A 1GWMA 3A21A 4R4ZA 1SDWA 4AI8A 2RM23 4IV1C 3QACA 3INAA 2ZACA 2YG0A 3ACHA 2YPDA 4Y20B 1GNZA 2OPWA 2WABA 3RYKA 3TAYA 5A3LA 2C26A 2ZOEB 3N3HA 2VU9A 3B5LB 1UZVA 4B1MA 2JIJA 1RUF2 5FPAA 3B01A 1WA6X 1IS3A 2NZ9A 4KG0A 1BZWA 1ZZ9A 4D7YA 4QU1A 3G6JB 4QGMA 1D0GA 4BE3A 3ZN6B 5I93A 3CF6E 3HNBM 3LOBA 3PUSA 3IAQA 2DUPA 4XF4A 1S2KA 4Y24A 5F5IA 4ASMB 1NLQA 1NYWA 2JECA 2XUMA 3LGRA 3AKTA 4KU8A 1HKDA 3MLKA 4ARYA 1ULDA 5IATA 1V9U2 1ENXA 2AREA 4K40A 4KG8A 1NCRC 4MH0E 4AVCA 5I91A 4CEYB 4Q4X1 3HQXA 1PIV3 5A70A 3FFQA 3AFKA 3CJIC 5JPNB 5KWRA 2HYXA 4OQ8A 1W0PA 1YJKA 1SDDB 3QOPA 4WVMA 4GMP1 2ZX4A 1XOYA 5KHGA 5LEKA 1ZRIA 2EF6A 3WG2A 1YQCA 4JGZB 4OI0A 2J1SA 3AL6A 3HJRA 5FZIA 1UU6A 3ATGA 3AVSA 5FZHA 3VBSC 3WZ1A 3MFCA 1F9KA 1OOPB 3V0AA 2SBAA 4I0WB 3WEZA 3WT3A 3J7LA 1Q56A 2FBEA 5M0TA 3FE5A 4LHNA 1RUD1 2ZGRA 4Y1YA 1XSQA 2BVBA 5FUNA 3WP3A 4N90A 3MIEA 2BTVC 3ZFGB 1QY4A 4R52A 3UGHA 3U10A 2WINB 4SLIA 1OUSA 3NAPA 2VPVA 3WHUA 3SC7X 2D6KA 3TWIA 1DQ5A 1LHUA 4IE6A 3NSTA 5FKBA 1JW6A 2A5ZA 3TYJA 1GOFA 4AEJA 1U0AA 4PJYA 4OHWA 5H9SA 5AVAA 2Q4SA 4EE2A 3C7OA 1FMD1 2VR4A 5JXHA 2WFF3 2RMU1 3FHQA 2XJRA 5IAVA 3BODA 1GZWA 2HKXA 3N9OA 1CVNA 2Q8CA 1LOCA 4XQWA 2DVBA 3CL1A 2WAOA 3I7DA 1PK6C 5I8SA 1HRI3 3QH6A 2NMNA 4QXCA 1FOD2 4R9AA 4DO0A 2IWGB 4K6BA 1VE0A 5LA1A 4CDUB 4IXLA 1XYOA 3N35A 3ZSMA 2ZXQA 2VMGA 1AR73 2CHHA 4MXWB 3AX4A 4BISA 1SBFA 3MHZA 4PLNA 4YVWB 3HOBA 3ZXFA 5F6LB 4BU2A 3WY6A 4AEDB 2W0XA 3NKGA 4QDRA 1CWPA 1PM4A 4Y33A 2WQ4A 3RFRA 2J1EA 4WVZA 4JQRA 2R16A 3LQCA 4OMCA 2UWAA 5AFBA 4LOTA 2KR2A 2VY0A 4GB33 4E8DA 1MZFA 1ULOA 4M01A 1EAH1 1O8SA 1CAWB 2GNDA 2VECA 5L9VA 2DVGA 2HEVF 4M0NA 1MPXA 2IXCA 3VHRA 3PJQA 5FZ1A 5IAXA 3OUJA 1JHNA 1K5JA 2XDVA 3AC0A 1VBB3 3KT7A 4YRDA 5FZAA 3I3MA 4ET7A 1PHMA 3L2YA 1LRHA 2VW1A 1OLQA 3BN6A 4BDVB 1GV9A 1CZVA 1LOBA 2JDYA 4A42A 1QHDA 1W6QB 3KCCA 3ZIWA 1RUG2 5JPMB 1CZTA 4B4RA 2Y6JA 1ZZCA 1KFUL 3ZYHA 1UOFA 1A8DA 4PF1A 3U14A 4DRRA 5FRAA 1HRV3 3O0VA 3UYJA 3ZR6A 5B4NA 2ILMA 4CU8A 5CBLA 2FD8A 2SLIA 4QAWA 1LHNA 4NJ4A 5CNAA 2WO7A 4S2GA 3OEAA 1UOBA 1AUYA 5CYYA 1IGOA 2AEYA 5IUQA 3V56A 4N43A 2PELA 3WR0A 3ITQA 5LRRA 4XTPA 4C8DA 2VO5A 3O12A 3V0BA 1MVQA 2VMIA 3LFMA 2ZEWA 2PMWB 1JZ8A 5C8CC 3MIDA 1GP6A 4FFFA 5I8YA 3VHOA 1OPOA 2XG3A 3M4FA 4IEPA 4A6SA 1X33A 5FPXA 2EXKA 3C7GA 5ABJB 1RUF1 1GU3A 4LNVA 4FFIA 3O1TA 4JRAA 3AP4A 1WCSA 2XGXA 4URAA 2C24A 2DCJA 4NVPA 1C8M2 1NA1A 1YYNA 4DEQA 2TEPA 4BA6A 2W2IA 3GZEA 4IEXA 4QQ2A 4IE5A 3RGBA 2RHPA 1MS8A 5DUWA 5FY1A 4AI1A 1STMA 4XC9A 2W52A 1DF0A 3PHMA 4FPOB 1V9U1 1ND2B 5F3GA 3B00A 4PBOA 3VBUA 4GA9A 2PHXA 3I54A 4JDOA 2Z69A 1D2QA 4ZU7A 2OW4A 3THTA 4Q26A 3ZMNA 4XFIA 2ZABA 1DQ6A 3KV5A 3VBHA 5J3UA 4IQPA 4Q0UA 4P9IA 3IB3A 4HLTA 2Q8OA 1I3HA 5C9AA 4FOQA 4AI0A 4NPRA 4FAHA 2DBIA 2D97A 3B93A 3ZFFA 1Q8SA 4E8CA 2CAUA 4Z8BA 1FATA 3HQRA 5BNOA 3T30A 4NAMA 4QGNA 5FP3A 2CDPA 2VZQA 2ZHLA 5DAPA 3AMPA 1W28A 1FV2A 2ARCA 3H8UA 5A3UA 3MIFA 3NWKA 2JENA 3KWVA 3MGUA 2NMOA 1SLCA 2HWB3 3F2ZA 4UF0A 4BQYA 1IOAA 3OBTA 1C1LA 3MICA 5JIUA 1QJU3 3ZFEC 5GZGA 4FT8A 2QFEA 4LLOA 1PO13 1QIQA 4YWAA 4QM8A 1XU1A 2VW2A 5DG2A 3NNFA 4AFMA 3LPGA 2EAKA 4FFHA 3IBMA 5LBBA 1CD3G 1OF3A 3N7JA 2WZ8A 1K5MB 2WFPA 1FPN3 2VL4A 4XF1A 3BGAA 4YG0A 1ZNPA 1XNAA 1BBT2 1OBNA 1UY4A 3VKFC 4Z1VA 1D7PM 2VMFA 3I2OA 3RZZA 2C6SA 4BM8A 3U11A 1C5HA 4L0PA 1UU5A 3WQ7A 4XYXA 3AYAA 1COV3 3AP7A 4IEYA 5F8PA 1QQP2 5LWBA 4Q5OA 4Y4RA 3GZUC 2VQTA 4NWWA 3T1LA 4BLIA 4Q0VA 5ACA2 4HVRA 4LKDA 4YNIA 3LSDA 2OPKA 2YV8A 1UYPA 1FOD1 1MS1A 1RXGA 4A41A 2JDUA 3ZFFC 3CMGA 3T08A 2FDGA 4TZDA 2IXIA 4B1LA 3W5NA 1A6CA 4MGIE 4UXAA 4KWJA 5BNOC 3TEWA 3VUOA 1GR3A 2Y8KA 4Y20A 5T5LA 3VZJA 4LEJA 3E6DA 2W68A 2Y0OA 3VDBA 1EPWA 3ELNA 1LHOA 3GGLA 5KHIA 4NRQA 1RUJ3 4CTEA 1JZ3A 1Z0HA 2XJTA 1X7NA 3TNPB 1BVP1 5JOZA 1LGCA 4N53C 4A3XA 2PHRA 5E16A 2VZUA 2C0ZA 2CAVA 2XWJB 4CEWB 5IFTA 2WS93 3RSJA 2QKDA 1J59A 2VMHA 4LA3A 1OLRA 4U2AA 3WXPA 2BV4A 1QJY3 3KT1A 3UGGA 4BWOA 3DV8A 1H6YA 5EJZB 3AYCA 4XFBA 5KR7A 2WNUA 5IK5A 1ZZBA 2HWE2 2VZOA 3VL8A 4FXGB 2VE1A 3E6BA 1UAIA 4XURA 4Q4Y2 2OKXA 3S30A 1QGLA 1OF4A 2VQUA 3LDRA 4KL1A 5IJRA 4LBQB 2HWC3 4CXWA 3ILNA 3ZKUA 2PHWA 2NLRA 1RUG1 1UMHA 2E26A 5FZGA 4ES9A 3O7OA 2Y6KA 5IVVA 4OCTA 2RS12 2Z4FA 1IPSA 5A6YA 1HJFA 1A34A 2A3YA 1OOPA 2HH9A 4AAXA 1PZ9A 2VOWA 4BQWA 4TLGA 2D3PA 1D2SA 2E7TA 3K4DA 4XMAA 4DB5A 1O59A 2ZGSA 5FP7A 1FNZA 5J1XA 1Y4WA 3WNNA 3JB8A 5FAXA 1UY1A 2IFWA 3MPPG 5C4WB 1UPIA 1V70A 1SFPA 4MADA 3NV2A 4XE9A 1PO23 3UGFA 1EV12 4LA2A 3FLPA 5JR2A 3H8XA 3WF4A 1QJX2 2LM3A 2GZWA 4YW7A 1DFQA 1Z7S3 3POGA 3CBNA 4P14A 2B4KA 2DCKA 2JICA 3T2QA 2WBKA 3QCWA 1YFWA 2H0VA 3KMHA 3WINE 3ZPOA 4CP2A 4FSJA 1SPPB 1HLCA 1YLLA 3H3LA 1DYPA 1ZX5A 4IGOA 4LPLA 1U5ZA 3NV4A 3BALA 4OI1A 2WLQA 3POIA 3SH4A 2YBSA 3PUAA 5GZEA 3U07A 5CKNA 1R093 3HN1A 3U78A 2GAUA 4LORA 4YW4A 2EVXA 4LITA 1C8M1 2BUKA 1PGL2 4Y1XA 4GALA 4CEYC 3ES1A 1BLZA 2XUEA 4KNCA 2G9GA 2P3JA 2RS53 3CNAA 3SISA 4QPIA 1US3A 2YBKA 2YB7A 4FP3A 3DPRA 5CU1A 3W59A 2MNGA 4F8AA 3JQWA 2RG4A 1R1A3 2VTXJ 1SFNA 3LKJA 4A7YA 2N7GA 3PJYA 5IVCA 5LCWL 2ZBJA 1JU3A 1HRI2 4CDUA 1WLTA 1AX0A 4JGZC 3I2KA 3D5OA 5KXEA 1MS0A 1Y9GA 2XOMA 4K21A 2PLV2 1N47A 1OOPC 3NRUA 4LKSA 4A44A 3OGGA 3Q8EA 1F4AA 5FZ9A 1X36A 2E7AA 3BOPA 2L9LA 1VBE2 4PI2A 1SFYA 4CCMA 4RS5B 1PM7A 3H1WA 5EQUA 5FK7A 4QGLA 5I0DA 5DPNA 4YYOA 2JE9A 3IWZA 4JV4A 2ZEXA 4CCLA 2YHJA 2KM2A 3POBA 4L8QA 1BK0A 3ZFGC 3H3UA 3I97A 4XIOA 3WDYA 5FLJA 1YI7A 2W1QA 1OPMA 1CAWA 3OD0A 4WVMB 1JYCA 1OI6A 5FPBA 1C1FA 1RUH2 1QOOA 3CKHA 2K9ZA 2VMEA 4AQTA 4XJUA 4COYA 1F15A 4KBZA 4XHBA 1J1TA 3E1F1 2XVKA 4JKKA 4XCBA 2YXSA 1WD4A 1BEV2 5KHHA 4GH4A 2WIIB 2XLFA 1DZQA 1ZZ8A 3ETPA 3PVNA 3M8LA 4R4XA 4EYUA 1O3TA 1BBT1 1LHVA 1OD5A 3T2TA 3E5UA 3VDDA 2Y34A 4ZXKA 4H3WA 1QJEA 4COVA 1JZ5A 4YW6A 3T2PA 2AH2A 2O0OA 4ZS2A 4DQAA 4QHOA 3Q9OA 3EJKA 1VBA3 4F83A 1QQP1 1AL23 1FI2A 1TEIA 3NAPB 4CDUC 3OGSA 4O9EA 3IIIA 2D6MA 1N1TA 1HV0A 5ACA1 3HIFA 5ANQA 4CU7A 1GYKA 1OQDA 4L11A 1AYM2 4YVWC 1CJPA 4S2DA 4BXFA 4S2HA 4XHXA 1OA4A 5BPXA 4AEDC 4B7KA 5I0UA 1RVF3 2XJVA 4IV3A 2BOJA 3SCFA 3IN9A 2PHDA 2JKXA 3EB7A 3OPZA 3NV1A 1GZWB 4ORFA 3DXTA 2VBPA 3B7MA 1NKGA 3AK0A 2W1SA 2OZ6A 3GF6A 3LZZA 4IW3A 3HNYM 4RHV2 3SKJE 4JQTA 4B4QA 2BU9A 2QVSB 5G04L 3JXSA 1JXNA 2G9ZA 3H42B 1RMU3 1W8NA 5DAVA 4DOUA 3H50A 4QB6A 5J48A 5T5PA 3VHNA 1RUC3 2BWCA 4CP9B 4O7XA 2O14A 5DDJ3 4CDQB 2C9KA 1KDMA 2EXHA 1QDCA 4NHLA 1UQXA 5DMYA 3O1UA 3EHKA 1YNAA 3AMHA 4KWUA 4QDSA 5GLWA 2XXZA 4ZKTB 3RI8A 2HWE1 2P37A 5FZEA 2D6NA 1G9CA 3MIGA 1DZRA 2Z79A 3HEIA 2CYFA 4Q4Y1 2VMDA 4CXYA 1HXS2 1WMFA 4WVVA 1ULFA 4QDQA 3UJQA 3AMMA 1Y43B 1W39A 2XR4A 5CKQA 2RS11 1KS5A 4XFAA 1YIFA 4FAGA 3USSA 1YI9A 3FUQA 1CX4A 4COWA 1WCUA 1RHI3 2VVEA 3I2FA 1VBD3 1GOGA 4MGTA 1VB2A 4XDOA 1QOTA 1AJKA 4XXPA 4NIDA 2RS32 1V6KA 2P3IA 2DU1A 3SQOA 1OHFA 2HBUA 3BPZA 4YW5A 2JJ6A 4LHLA 4YGDA 2HWD2 2ET7A 3W9AA 2HWB2 2IXKA 4Q4W2 4GXLA 1QXRA 4M0HA 4TN7A 4XMIA 5FJHA 1EV11 1S2BA 3GBGA 1QJX1 2VUAA 5ABJC 4OZOA 1YEWA 3I4IA 3SCHA 2B42B 1D4M2 1K5MA 3DXUA 2R32A 4L99A 4AHWA 1VRH2 2ZGQA 1UX7A 2VCBA 3S5QA 1AXZA 3LD8A 2BNOA 1OMIA 2YUEA 4MZUA 1E5RA 5IVEA 2WLPA 3VD3A 4D3WA 1UMIA 5I0TA 1WZXA 4N43B 3JQXA 4R8HA 3UESA 3V0BB 1ND2C 4DXSA 4KQ7A 1PGL1 1TQ5A 5IWFA 3ZN5A 5FOBB 3ZXKA 1RTVA 2JDHA 5IT6A 3POYA 3WNKA 4E27A 1ZA4A 1WBLA 4LIUA 2XL9A 4ZU5A 3RJRA 4DIQA 4PT6A 2GN7A 3KSCA 3JUUA 4OULA 4I0BA 4QXBA 2R0FA 2D3SA 4AHYA 2FCVA 3ZYJB 5JZGB 4QPGA 3AJZA 1DGWA 2PLV1 4MHUA 4P5YA 1NA1B 3BTXA 1F2NA 5JWPA 3WG3A 1O4YA 1S0FA 4ATEA 1VBE1 1W9WA 1J3QA 1EPZA 1YQ2A 2EXIA 2UY8A 3B9IA 4LKFA 4M3CF 4HBNA 4QX0A 1JS9A 1OH3A 1KJLA 2YC0A 4DXZA 3MYXA 3VBUB 5JXJA 1ZRDA 3OOXA 3U75A 2E53A 3H9AA 1QF3A 3MW2A 4ZONA 4YVSB 1NQJA 1DHKB 1W0OA 3HT1A 3SHRA 3VBHB 1W9SA 2YROA 2BYVE 4FTBA 2X29A 4CEWA 4I2OA 5C9AB 2DTYA 2GMPA 3DYMA 3ILRA 1OVPA 1ZM1A 1K5MC 3POEA 4RFRB 1RUH1 4RN5A 2ZS6B 4YZ4A 4DUVA 1SLBA 2WZPP 1TME2 3J8F2 2DBNA 1QJY2 1AR92 4W6XA 4OQ9A 4MO3M 4AXOA 1BEV1 1TMF3 2VBDA 5KC6A 1WUVA 1YIPA 2ZCWA 3KHBA 4QX7A 1RL3A 1WMDA 4N8MA 1OD3A 4FQ4A 5FY9A 2BVVA 5DAWA 1ND3B 2XH6A 1Q8PA 2Y6HA 3ACLA 5TSWA 4Q8KA 3WDXA 1JYIA 3SITA 1HQNA 2ETEA 4OFGA 1IHMA 5HCFA 5A7OA 1JOJA 2GC2A 2A73B 1JH5A 3J9SA 5FR3A 2MPFA 3RYRA 3HNMA 4QQLA 4AAPA 1XYPA 1IG0A 2LALA 3B69A 3IMNA 3CO2A 5EJ1B 3RRDA 5A7PA 3S6PA 3VD7A 1YHFA 3WF0A 2QDRA 4CCEA 2D5HA 4XPVA 4AGVA 1FNYA 3RZGA 4AHXA 5FMOS 2WL1A 2BWAA 3NJXA 3AZXA 2EXJA 3WDUA 1AYM1 4OHYA 4OVEA 4YGEA 1JN2P 3OGJA 5EHDA 5C7GA 1XYNA 5C4WA 2HYKA 4JCKA 4AWDA 1GNYA 4XW3A 2W87A 1AHSA 3TB0A 2VG9A 3CHXA 3JZVA 4LOSA 4L92A 4NHMA 2C5DA 3L9JT 2O8OA 5C33A 2ZJCA 1H30A 4PI0A 1UMZA 3A23A 3GNEA 2WR9A 5FO9B 1C8NA 3Q8BA 2B39A 4N7IA 4NPLA 3WV6A 5G05L 2RDQA 4META 1LB2A 4OUSA 3O1PA 1UF2C 4RHV1 5FZMA 4AHZA 1EP0A 1W6NB 3A4UA 4HZFA 4Y5SA 2WT2A 3ME2A 5F2SA 2OA2A 4KGQA 2ARBA 2YU1A 4I09A 2DCZA 4AW7A 2QDNA 1D0HA 4FQZA 1R092 1W8HA 5FY5A 1AYN3 4BIOA 4EN8B 3HAGA 3DGTA 1Y9QA 2A71A 2IVJA 4MV2A 1J83A 1OQ1A 3P3NA 1JU4A 3KV6A 4YSFA 5A6QA 4E2GA 1XNDA 3OBZA 2P6CA 4UAPA 1R1A2 3VBFB 1ZRFA 3FX3A 1OURA 3O14A 4Y22A 5A33B 1MS5A 1VBC2 2ZTNA 1HXS1 1UX6A 2ZGUA 3B02A 5DAXA 5HV4A 3Q8CA 4M4PA 5IVJA 4ZS3A 3ZM8A 3PDQA 2WO3A 4HXCA 4PDWA 2FQPA 3JBG3 2JD4A 2PHFA 1B35B 1KQRA 4RS5A 4N7UA 2A1XA 2ZX0A 3H7YA 3MBWA 1M4WA 3WW2A 2VULA 2ZGTA 2G4IA 1UL9A 1RUI3 1GQPA 2WNUB 2D6LX 5C4WC 1UNBA 2RS31 5EXOA 1JOPA 4FI9A 1W04A 3CJXA 5EPAA 2R042 1RUE2 3K75B 3BIWE 4DS0A 4QKBA 2HWD1 2MEV3 4Q4W1 4LMFA 4FO9A 2ARAA 1DBNA 2JG8A 4CPBA 1H9PA 3VBOA 3KVAA 1ZBE3 1UZWA 1L3JA 1D4M1 4LBQD 2WKKA 2QZ2A 3RS6A 2BJSA 2D6PA 1VRH1 3BYWA 1AR62 5EWSA 1DIWA 1QH7A 4DNYA 2V5YA 1PVC2 2W1UA 1RJ7A 2VOKA 1QXJA 4YM2A 4Z07A 4QX8A 2RR12 4UWDA 1POV1 2H6CA 2ZEZA 2WZEA 1F4HA 2B9VA 1RXFA 1LENA 4DMIA 4F7ZA 4O9GA 4LT5A 2BRTA 3UKVA 1MEC3 4MGYE 2AEZA 1CQ9A 4B8EA 3WHTA 1C5IA 3B3QE 1A78A 1WCKA 1WWYA 4P9XA 1SG3A 1JODA 1UD1A 5A80A 5CFCB 3LEGA 1S0DA 3M3QA 5AC92 4OI4A 2CU5A 4E2QA 2WA3A 1BKZA 1TG7A 4CUGA 2ES3A 4RS5C 1X9TA 1WMXA 4XOGA 4CDWA 1R083 1SCRA 1S0CA 4A4AA 3A7QA 5LBFA 2BFUS 1RVF2 1Q8VA 4Z2AA 2HJIA 4XABA 4Y5Z0 1GP5A 4XEZA 3LA7A 4KI5M 2E31A 4QPIB 3DPRB 2NQYA 2XL7A 4LO8A 4BIFA 3QLQA 2YGMA 5IK7A 4XUNA 4YW1A 4Z92B 1G86A 1JYTA 1JBCA 4FPHA 1SACA 1GOHA 3ROUA 3AMQA 1GUIA 4URTA 3MPBA 4WZCA 4XXAA 4Q1PA 2FDKA 1MACA 2PYTA 4CP9A 3L2HA 4N9IA 5FYZA 1AR82 2XBO3 4Q0QA 5EYYA 3W21A 1SBDA 4JX0A 4CDQA 1RUC2 4EZ4A 3AVRA 3J8F1 5LY2A 2WZR2 1AR91 3ZSKA 2ZX3A 1JUHA 5ERLA 5EJ3A 2A3WA 1QDOA 4FOVA 1BYHA 2DYCA 3FBYA 4NN0A 1NE6A 2XLAA 4EROA 3DKQA 3IPVB 1HW5A 3R4SA 1ZREA 4HOOA 2LTNA 4P5HA 5K0UA 1C57A 3NAPC 3VZLA 3WNOA 3ZIXA 3ZKYA 1UXZA 2R063 2DCYA 4A3ZA 1YFUA 3D0JA 1O4ZA 3NQHA 4BJ0A 3GZAA 1OQEA 4HL0A 2OIIA 4IERA 5FYUA 5BNPA 2F4PA 1ZYBA 2UWBA 2VUCA 4GH4B 1OSGA 2B9UA 5FZCA 3K77A 1VBD2 5LA0A 1GBGA 4QKDA 2VD7A 1XE8A 3ALQA 5FJKA 3VDDB 4GWJA 4CPBD 5E8AA 3N9LA 3SNMA 3D3AA 5A7SA 2WNEA 4NO4A 1LNSA 4A45A 3PU8A 2Q0AA 3KHCA 2Q30A 3AXEA 2FDHA 3VKMA 4HKOA 4AGRA 4AF9A 2R073 1LOFA 4IE0A 1RITA 3BU7A 4IEZA 5IHRA 2WAAA 2VXRA 2YYOA 4FTSA 2AC1A 1UKRA 5B4XA 1V6LA 2P6HA 4XDQA 1PX4A 2ZGKA 3GCXA 4H14A 4IE4A 2Q8DA 4IV3B 2ADDA 3JD73 3OY8B 5CVRA 1RJ8A 2YGLA 3AXDA 3ZSJA 3WVJA 4AG4A 4B3NA 2PAMA 5FY0A 1K3IA 1I1EA 5E6HA 3OBAA 3OF1A 2FDFA 1GWLA 1QJFA 4XJ8A 4DXTA 2ADEA 3VDCA 4HKWA 5C6CA 1W2TA 4FPJA 5LBCA 4IEWA 5FZ7A 1ZBA3 2VBBA 2XKOA 4HSJA 2Y0IA 3CQOA 2VNOA 5HPOA 3KT4A 4KWKA 2EIBA 4GMP0 5JZGA 1KEXA 1VBC1 1WLWA 2DVAA 3GJBA 4G9SB 2PAKA 1HN0A 2W39A 3OUHA 3WDVA 3LEKA 2VCCA 5L9RA 2UURA 3PUQA 1SLTA 4PF5A 3GHMA 3T3YA 5JSPA 5JLVA 2DCTA 2RVAA 4FVVA 3TN93 2QJVA 3HN3A 1W6MA 1KXGA 1XNKA 3D6EA 1XB9A 1UYYA 2UYAA 1H4HA 2VOVA 4GULA 3I49A 1L7LA 4TWTA 1XXNA 1MZ6A 4X8NA 4YVSA 2HWF3 4U36A 2XPJA 4NHXA 2IZWA 1ALYA 1WD3A 2R041 1RUE1 3AM2A 4FP2A 4AFCA 3C7EA 4CUAA 1ODMA 5DUXA 3DF0A 1IKPA 1H8TA 1J58A 5JR7B 4MYEA 4YGBA 1UCXA 1XJAA 2VNGA 2PTMA 3M2MA 1LOFC 4BZ4A 3LE0A 5T52A 4AEMA 3AKPA 4WVWA 4IESA 1VAKA 2DFCA 3HMYA 3AB0A 3ACFA 4LTAA 4L2NA 4TTGA 5FZKA 1H1AA 3PNAA 4N43C 2ZGLA
chains in the Genus database with same CATH topology
3J7NA 3J7LA 1STMA 1JS9A 3J7MA 4NIAA 1CWPA 1ZA7A 1YC61 4OQ9A 1A34A 4OQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7N A;  3J7L A;  1STM A;  1JS9 A;  3J7M A;  4NIA A;  1CWP A;  1ZA7 A;  1YC6 1;  4OQ9 A;  1A34 A;  4OQ8 A; 
#chains in the Genus database with same CATH topology
 1AR6 1;  1ND3 A;  1PVC 1;  4PQQ A;  2B46 X;  1L7Q A;  2RJL A;  3M3C A;  1NOV A;  2VC9 A;  2RR1 1;  1XQN A;  4BPZ A;  1AX2 A;  2AAC A;  2BOI A;  5DZE A;  3WD5 A;  1MS3 A;  3WG4 A;  4LE4 A;  2ZGO A;  4IGQ A;  4Q4X 3;  1ST8 A;  2XJS A;  1W99 A;  2ORX A;  4ITC A;  3ZYI B;  4RSU A;  3BPS A;  3FBM A;  5JZG C;  1JYV A;  1NA1 C;  2XB6 C;  3BOW A;  3SXW A;  4D6Q A;  4ISR A;  2KXL A;  2W94 A;  5AC9 1;  1WGP A;  4GMP 3;  2IXH A;  4W65 A;  1BMV 2;  2WWS A;  2GNB A;  2VZ1 A;  5E88 A;  4FBF A;  2Q5T A;  2X8K A;  4Q4V 2;  4PIZ A;  5BY5 A;  2ZKN A;  3VBU C;  4CYD A;  1T2X A;  5CG9 A;  3GXU A;  1UYX A;  3Q8A A;  2WYF A;  4NPM A;  4YVS C;  1ASJ 2;  2YBP A;  3LF7 A;  3VBH C;  2VTX A;  4XFH A;  4FPY A;  4KWL A;  3UT0 A;  1WCD J;  2VZR A;  2Q1M A;  3RVH A;  5C9A C;  2GC0 A;  1W6N A;  2V73 A;  1NZI A;  1RUD 3;  5C3P A;  1VRB A;  4JGY A;  1DGR N;  1UZ0 A;  4QPG B;  1G9A A;  1CON A;  4RGA A;  5CKM A;  4CU9 A;  2X10 A;  1AR8 1;  3WF2 A;  4YZ2 A;  1DZT A;  2PHT A;  2JG9 A;  2RM2 2;  2FMY A;  2CTV A;  3J26 N;  1ND3 C;  3MO4 A;  3CLP A;  3KLS A;  2IUW A;  2WZR 1;  3ZSE A;  4H55 A;  4UFJ A;  5FO8 B;  5JMC A;  2D40 A;  4BQ4 A;  1E5I A;  1S0E A;  2RDR A;  2W47 A;  2VQ0 A;  1H2L A;  1PMJ X;  1RIN A;  2OUJ A;  3VBF A;  1NXM A;  5A33 A;  3KGL A;  3WQB A;  4E2S A;  2JDZ A;  3VKO A;  1FMD 3;  1X8E A;  4CCD A;  1F31 A;  4GWN A;  4C0B A;  4NIH A;  2RMU 3;  1J1L A;  2YPJ A;  1R1Z A;  5A3P A;  4FOY A;  1DDL A;  4Z82 A;  2VH9 A;  1REE A;  1B35 A;  4GZ9 A;  5DZF A;  5DG1 A;  5FFO C;  5DXD A;  2GH8 A;  3ENR A;  4DUW A;  5JUV A;  4AVS A;  1X8M A;  1BVV A;  1WW6 A;  4WV8 A;  3CEW A;  1CN1 A;  4QX2 A;  3AP9 A;  3RWK X;  2QUO A;  4AE2 A;  2WNV A;  3B94 A;  1RUI 2;  2VZS A;  1OH4 A;  3UNP A;  1PVX A;  5F6K A;  1OFS A;  2P4E A;  3WNM A;  1PIV 2;  3LWC A;  4Y1U A;  2I2S A;  4D0Q A;  4C91 A;  4NR1 A;  3ZYR A;  5K7P A;  3OB8 A;  1SMV A;  1MR5 A;  2WN3 A;  2B8M A;  5FZD A;  3IDC B;  4J6G A;  4LR4 A;  5F5C A;  1A3K A;  4MX3 A;  4UBH A;  3RZK A;  1CJD A;  4AI3 A;  2WC2 A;  5EIY B;  4IV1 B;  4IUG A;  1AXK A;  5FYV A;  4XBN A;  2BER A;  3KM5 A;  1EAH 3;  4JRL A;  2EIG A;  1W3X A;  4HVQ A;  5APA A;  2XKP A;  3OD4 A;  3NW4 A;  5FLI A;  5GLT A;  3VKN A;  4AVA A;  1H9W A;  4IEU A;  3RMX A;  1QNW A;  1UY0 A;  4CP1 A;  5EP9 A;  4JZR A;  2J22 A;  2GME A;  1MS4 A;  2VNV A;  4QQH A;  5FP9 A;  3VBF C;  5FYC A;  5KHJ A;  4LE3 A;  1DLL A;  5JSR A;  4FTE A;  2ZAA A;  3ACG A;  5D21 A;  2D5F A;  5GZF A;  2VZ3 A;  1RED A;  5CFC A;  4FPK A;  1LOE A;  1KIT A;  2W92 A;  5A1A A;  1ZA7 A;  3KQ4 B;  2GAL A;  1B35 C;  1YQ5 A;  4HKL A;  1YQ6 A;  2AEN A;  1QXP A;  5FYS A;  2ZML A;  1RUN A;  2ZEY A;  4JC1 A;  2WNU C;  3M1H A;  1CAU B;  2WFF 2;  4W4Z A;  4YPJ A;  4EWA A;  2GP3 A;  4LUL A;  5FZF A;  3WF3 A;  1QNY A;  1PX3 A;  4W6Y A;  5FPZ A;  4HMZ A;  2WDB A;  4EZH A;  5FZB A;  5K8S A;  4AI9 A;  4Y22 B;  1GZ9 A;  3QD6 A;  1PZ8 A;  3I8T A;  3T0D A;  3FWE A;  1S1A A;  1RGS A;  4D7S A;  1JZ2 A;  1AR7 2;  4NUB A;  2RV9 A;  3CU7 A;  4COZ A;  4PDW B;  3SEE A;  2XQR A;  3FMG A;  4XQD A;  2FZ2 A;  1ZZ6 A;  1LR5 A;  3AZW A;  5FXW A;  3M3E A;  2LRO A;  5LW9 A;  2Q1Z B;  1MZ5 A;  3N9N A;  3RZH A;  1P8J A;  1RUF 3;  5HI0 A;  4I01 A;  2RE9 A;  4XTM A;  3ON7 A;  1RYY A;  3ZMO A;  3ZYB A;  5F32 A;  4XUQ A;  4ASL A;  3SKV A;  3VDA A;  3IPV A;  5GLZ A;  1H1M A;  3NNG A;  3WQ1 A;  4GB3 2;  1WBF A;  2XVG A;  1SLI A;  1F5F A;  3NJV A;  5HCA A;  4XBL A;  5FIX A;  1YQ8 A;  1UOG A;  4FPC A;  2JG8 B;  5F3E A;  2QQK A;  3VBO B;  4ZZ5 A;  4KBB A;  4NIA A;  3ZDS A;  4MGQ A;  4E4D X;  5F1R A;  1V9U 3;  1VBB 2;  1WCQ A;  4H7L A;  4SBV A;  3POF A;  3WNX A;  1N3P A;  4DIN B;  1LES A;  2JD9 A;  3GHN A;  5FWJ A;  1UN1 A;  3DYO A;  3MIB A;  5HXV A;  3WW1 A;  4TYS A;  4D6S A;  2VNR A;  2MHF A;  2VW0 A;  3FLR A;  5CZK A;  4BXS V;  3DN7 A;  1BMV 1;  4QPI C;  1PNG A;  3WW4 A;  3DPR C;  4LBO A;  4Q4V 1;  2J42 A;  2V4V A;  3VZM A;  5JIA A;  1LOD A;  4FPG A;  3E5Q A;  5KC5 A;  4DY3 A;  5DN2 A;  5IYY A;  5FP4 A;  5L7O A;  5J7M A;  1ASJ 1;  1HRV 2;  1MQT B;  2DV9 A;  2VAU A;  3MLJ A;  4QQP A;  2XON A;  3UV9 A;  5FQ0 B;  1W03 A;  2JB4 A;  2V09 A;  4XZP A;  1XRU A;  1ULC A;  2I45 A;  2G9F A;  4YLZ A;  3TRS B;  3BKZ A;  1AL0 G;  2Z2S B;  4OI2 A;  2V5D A;  5D2A A;  3GAL A;  3BUC A;  4CDW B;  3ZYF A;  1G7Y A;  3OY8 A;  4COU A;  2RDN A;  2ZGM A;  4QX3 A;  4HAN A;  4WM7 B;  3MUY 1;  2E33 A;  3WCS A;  2RM2 1;  4H2A A;  3ZOI A;  2EIE A;  5JCT A;  2YC2 A;  2KD7 A;  4QHB A;  5LA2 A;  4JKM A;  3MV1 1;  5FYT A;  1OT5 A;  1G9D A;  2AGS A;  3U4S A;  2QQO A;  5FV3 A;  2WO2 A;  2Y33 A;  1NLS A;  1O8P A;  4BCU A;  4NOT A;  3O1R A;  4W8J A;  2V72 A;  2Z5W A;  2BGC A;  5ISL A;  4N9H A;  1N3O A;  4WM8 A;  1CAX B;  4Y3O A;  4GH4 C;  5FPV A;  1WME A;  4Y1Z A;  5IK4 A;  4NII A;  1GSL A;  1DGR A;  3RJ2 X;  1HX6 A;  3PTY A;  1GLH A;  5T3N A;  3VDD C;  5CAD A;  3VBR A;  3TN9 2;  2CGO A;  2QQL A;  5FRE A;  5LK7 B;  1FOD 3;  4LUM A;  1XE0 A;  2WNO A;  4AOC A;  1HQL A;  3HQU A;  3T09 A;  1Y9M A;  2W3J A;  1W0N A;  1I6X A;  1PIV 1;  2HWF 2;  1H2K A;  2XML A;  3I3D A;  4XVH A;  5K0U B;  2CWM A;  5K4L A;  4I3G A;  1MVE A;  4RFT 0;  3PME A;  3MLL A;  5HBA A;  4V2V A;  1K42 A;  3RZJ A;  2D44 A;  4QB1 A;  5BNP B;  4AFB A;  4M4R A;  1W2N A;  3EO6 A;  4WZF A;  2IFR A;  4IV3 C;  2GSY A;  1K45 A;  1NCQ A;  1O6U A;  3KV4 A;  3R05 A;  2D3R A;  2YFU A;  4IEV A;  5CAZ A;  1O3S A;  3ZR5 A;  4W6W A;  5LY1 A;  4PLM A;  1FXZ A;  1W6O B;  2ZA9 A;  4Q27 A;  5JI7 A;  3OG2 A;  5T54 A;  1QJU 2;  1AZD A;  4UW4 A;  3AKR A;  3OEB A;  1PO1 2;  3ECQ A;  4NE9 A;  3KF3 A;  5BNN B;  4JVA A;  4P9Y A;  4CZS A;  5FMC A;  5D8A B;  5AFE A;  1QKQ A;  5JXI A;  5CFD A;  2AR6 A;  3IKW A;  1FPN 2;  4Q4X 2;  1YJL A;  4O61 A;  2P3K A;  1R64 A;  4AQ6 A;  4KU7 A;  3OBR A;  4YG6 A;  5F5Q A;  1AX1 A;  1QMJ A;  3FUO A;  4BME A;  4AVT A;  1RUG 3;  3BVC A;  2XJU A;  3PUI A;  5KXB A;  1WA4 A;  1UY3 A;  4YM1 A;  3AZY A;  4ZXE A;  4LHK A;  1WW7 A;  1X82 A;  5I0R A;  5HCB A;  1G9F A;  2WFF 1;  2OQ6 A;  3SEP A;  1COV 2;  3DEC A;  1CX1 A;  3OPT A;  3ST7 A;  5LA9 A;  2BQP A;  4MUV A;  1D4V B;  2X05 A;  2XVL A;  5CIS A;  2QTW B;  3P6B A;  4GQ7 A;  1HRI 1;  5A3N A;  3O1S A;  2D98 A;  3GBF A;  2PHU A;  5FY4 A;  2I74 A;  2OX0 A;  4BLJ A;  5GKA C;  2WRA A;  1LED A;  3O1V A;  4GD4 A;  1AR7 1;  3PUR A;  4HT1 T;  4OUE A;  2JB8 A;  2QQN A;  1Q5O A;  5GM0 A;  2Q1F A;  2P3Y A;  1T6G C;  3NO8 A;  1UXX X;  1S55 A;  3Q8F A;  4IE7 A;  1W6M B;  1YRZ A;  3ZFE B;  1RUJ 2;  2BBA A;  1G9B A;  2XJP A;  3KB5 A;  4ISQ A;  4M3C E;  5L36 A;  1YFY A;  2NP0 A;  3I2G A;  5F39 A;  5J98 B;  2PAE A;  1V6O A;  4IDZ A;  3PLQ A;  2JE7 A;  4GB3 1;  5LK5 A;  1KRI A;  1C8M 3;  3WP4 A;  2BZD A;  1H8T B;  4JAA A;  2XHK A;  4RQP A;  2D6O X;  4CDX A;  2WS9 2;  4RGG A;  4CXX A;  1UW8 A;  2JEM A;  2W9X A;  1H4G A;  2FDJ A;  5J09 A;  3ZX7 A;  1VBB 1;  3UK9 A;  3LPF A;  3A0K A;  2WJS A;  4QWN A;  5J37 A;  3I59 A;  3MDP A;  4DFS A;  4LK7 A;  1HV1 A;  1NZC A;  2NYY A;  2A6V A;  3LFI A;  2DDU A;  1NX9 A;  4Q29 A;  2QNK A;  3THC A;  2Y26 A;  3WX5 A;  3V65 A;  2P34 A;  3VD9 A;  3ZXD A;  4AQS A;  3WG1 A;  2W46 A;  3E97 A;  3J7N A;  3SH3 A;  5C70 A;  4BK5 A;  2HWC 2;  5FPU A;  1URX A;  1E5S A;  2QQP A;  1HIX A;  4AYU A;  2Y60 A;  5DAB A;  2BGP A;  1SLA A;  2CY6 A;  1S0J A;  1REF A;  1SEF A;  2VTF A;  2PQQ A;  1HRV 1;  4XET A;  1X50 A;  1V0A A;  4IV1 A;  2E51 A;  5A7N A;  5F5A A;  1EY2 A;  5IVB A;  4QPG C;  3M3I A;  3BTZ A;  4FPL A;  3KV9 A;  3VGI A;  3KQR A;  2QCS B;  2Z42 A;  4QM9 A;  2X53 S;  4O65 A;  4CUB A;  3G7D A;  2J1A A;  1JYN A;  2BW8 A;  1EAH 2;  2WT1 A;  4I02 A;  2ZKL A;  5A6X A;  3EQE A;  4DUX A;  4KH9 A;  4QX5 A;  2F4L A;  2VXJ A;  5GJ6 A;  3BIE A;  2LUW A;  1JMU B;  1PO2 2;  3NMB A;  3O5S A;  1OA2 A;  5JOW A;  3EXU A;  1Z7S 2;  5HXM A;  4GKX A;  1SBE A;  2ZGP A;  1G8W A;  3GM8 A;  1UIK A;  4K7J A;  4CEW C;  1BBT 3;  2IVI B;  2VMC A;  5SV8 A;  5A1L A;  3X29 B;  4IEO A;  5L9B A;  4FCA A;  1FYU A;  2ATF A;  5FYM A;  1DQ4 A;  2OT7 A;  2ZHN A;  4OHX A;  4JGY B;  1NCR A;  5C5U A;  4P00 B;  5DZG A;  3H8R A;  4IL7 A;  2Q8E A;  4EWE A;  5F2W A;  1CAU A;  4AZZ A;  5A1F A;  5KXC A;  1QQP 3;  3J4U H;  3S7I A;  2JG9 B;  2F6B A;  2AYH A;  1OLM E;  2O8Q A;  5C5T A;  3ETQ A;  1ODN A;  4LKE A;  4MGK E;  1DP0 A;  4P02 B;  3O1M A;  3NNL A;  3WW3 A;  1CAV B;  2RS5 2;  4LBK A;  5ACA 3;  4BQX A;  4EQV A;  1AJO A;  2IXJ A;  1O5U A;  1ENQ A;  2O1Q A;  2PQS A;  4LBM A;  1UZY A;  5JOX A;  1JZ6 A;  1LHW A;  1FX5 A;  4V1P A;  4QT6 A;  1I5P A;  2XJQ A;  3MIH A;  4Y1V A;  2R30 A;  3AP5 A;  4LHS A;  2YDE A;  2V4A A;  3ZXL A;  5JI9 A;  2R49 A;  1US2 A;  1JHJ A;  4UFK A;  3VV1 A;  2DUR A;  4LXL A;  5FMB A;  4ZZ8 A;  5CB7 A;  1EUU A;  2PA7 A;  3UL2 A;  2LW8 A;  2NN8 A;  4K8R B;  2Y6G A;  3MUZ 1;  1XNT A;  5CA6 A;  3N9P A;  1VAL A;  2F17 A;  2WNV B;  4PQ9 A;  1OKQ A;  3ABZ A;  5FWE A;  3ZN4 A;  1XBF A;  3KS7 A;  4EN6 B;  1YFX A;  2HWB 1;  2FHR A;  5FXZ A;  3RPQ A;  3D82 A;  3AZV A;  1QJU 1;  4Z2W A;  2VJX A;  3S57 A;  1PO1 1;  3OGR A;  3POJ A;  4HK9 A;  5T55 A;  5C3S A;  5SV5 A;  3U1X A;  2YC4 A;  1QOS A;  2HWE 3;  3H8O A;  1AXY A;  3I2J A;  5LEJ A;  5KHK A;  2WN2 A;  4MGZ E;  3ZXE A;  1FPN 1;  4UW5 A;  3NVC A;  4AFA A;  4Q4Y 3;  1CPN A;  1ZVF A;  2GC3 A;  2ZHK A;  3HWJ A;  4AR2 A;  1QEX A;  5J36 A;  2OS2 A;  1H6X A;  1LOA A;  1PK6 A;  2VUD A;  4UFM A;  3WNL A;  4QKF A;  4CCJ A;  4A2U A;  3RWN A;  1LUL A;  4DRV A;  2J1V A;  2RS1 3;  4DXR A;  2CGN A;  3ILF A;  1COV 1;  1MQT A;  1VBA 2;  4BQ3 A;  5LRS A;  1SHW B;  3IDB B;  1AL2 2;  4Q1R A;  4Y26 A;  5FBZ A;  2H0B A;  2VOX A;  5A3M A;  2ZX2 A;  5FP8 A;  1FAY A;  2D7F A;  1W2U A;  2GC1 A;  3LEM A;  4BYY A;  3UJO A;  5HV0 A;  1VPH A;  2DFB A;  4PDW C;  4Y4Y A;  4YG3 A;  2QQJ A;  4XJW A;  1XSR A;  3IM0 A;  4OZX A;  3OUI A;  1UWW A;  1EV1 3;  1LU1 A;  2VQA A;  3GCW A;  2R7E B;  1QJX 3;  4WM7 A;  3QH7 A;  3ZXA C;  4AFD A;  4Q2F A;  4NIG A;  1LKN A;  4NRO A;  2QE3 A;  3NKT A;  1U5X A;  4ATF A;  3P3P A;  1N1S A;  3CIH A;  3T4V A;  1U12 A;  3FC0 A;  1L7R A;  1SCS A;  2XQX A;  3ZLI A;  4QXK A;  5FOJ B;  3HR9 A;  1RUJ 1;  4ES8 A;  3U0Z A;  1PZ7 A;  1SQ4 A;  2W1W A;  1J84 A;  2JG8 C;  4EJR A;  5C71 A;  3MZH A;  3VBO C;  5FZ4 A;  2FZ1 A;  1RMU 2;  1V6M A;  1CAX A;  5DUV A;  4Q8L A;  4BH9 A;  1LAJ A;  1PMI A;  3AMN A;  2WS9 1;  4MVT A;  5BYN A;  1TME 1;  5DDJ 2;  4B4P A;  1QJY 1;  4EN7 B;  1NXD 1;  2VZV A;  4MHR A;  2WWJ A;  5BUV A;  2JXA A;  3AP6 A;  1EYB A;  1DGW X;  4ONU A;  4XAA A;  2A3X A;  5LB6 A;  5C3Q A;  1W9F A;  3FN9 A;  2BGO A;  3R0R A;  4K3U A;  1G6N A;  3PTR B;  1J3P A;  5FXX A;  1GNH A;  3I2H A;  2VZT A;  2YY1 A;  3AYD A;  3HBK A;  1NQD A;  3NV3 A;  1CES A;  2Y38 A;  2PLV 3;  5I8T A;  4YZ5 A;  1TZO A;  2WO1 A;  3ZVX A;  1MQT C;  4K9S A;  4XUT A;  2HWC 1;  5FTT C;  1VBE 3;  4HK8 A;  3CZU A;  5JDB A;  3DCQ A;  2I07 B;  1HN1 A;  4NRP A;  5FLH A;  2CNA A;  4GWI A;  3NJZ A;  1AVB A;  2QZ3 A;  3KCY A;  3FJS A;  3MF9 A;  1RHI 2;  3E6C C;  4I3P A;  4CDW C;  4QQO A;  1DYO A;  1IPK A;  5C3O A;  5C8C A;  4CSW A;  4CCO A;  5F3C A;  4NRM A;  4WM7 C;  3ZSL A;  4TLF A;  1JI6 A;  1W6O A;  2BPA 2;  1DYK A;  1RUH 3;  2E9Q A;  4FFG A;  4LO7 A;  1JTZ X;  1SLL A;  4OHZ A;  3IT8 A;  2QQM A;  2VVD A;  1UU4 A;  4QX1 A;  4RD7 A;  1W6P A;  4EV0 A;  1LU2 A;  1PO2 1;  5IVF A;  5BNN A;  1O3Q A;  1BEV 3;  3I3Q A;  5L7O B;  5D8A A;  5HCH A;  2GP5 A;  1Z7S 1;  2BDR A;  4XDP A;  5FY8 A;  1JZ7 A;  1C4R A;  4J1W A;  3VZK A;  1W9Y A;  1GKB A;  1A8M A;  3IZO A;  3NNJ A;  4FPE A;  3WLU A;  4CDQ C;  3ZO0 B;  3OPW A;  3ORJ A;  1F35 A;  1H8V A;  3PVE A;  4LK6 A;  1R09 1;  5LZ6 A;  1GWK A;  4NHK A;  4XUP A;  4YW3 A;  3LB9 A;  3WDW A;  5AVP A;  1KGY A;  1OUX A;  3RDI A;  1YXW A;  3USU B;  3SCG A;  4AVB A;  4UOJ A;  4E4S A;  1CIW A;  1PGS A;  3OCP A;  1UY2 A;  1KD7 A;  2RS5 1;  5FUI A;  1NG0 A;  3URF A;  1DCS A;  5K0U C;  4EN9 B;  2UU8 A;  1R1A 1;  4KMQ A;  1U5Y A;  4UW3 A;  1AYM 3;  1HB1 A;  2ZAH A;  4PCR A;  1GFF 2;  2YFZ A;  5J96 B;  1IS5 A;  1ENR A;  2QQI A;  2H6B A;  1LOG A;  1QWR A;  3PMS A;  4QPW A;  1RUO A;  3OGV A;  5BNP C;  1CZS A;  2R1B A;  4WM8 B;  3N7M A;  4AQ2 A;  4X6Q B;  1BCX A;  3M3O A;  5T50 A;  4CCC A;  2VGD A;  4XAC A;  4H7M A;  3OTF A;  3ZFE A;  1Q43 A;  3VBR B;  1JZ4 A;  1VAM A;  2C4X A;  4RHV 3;  4HON A;  4XAE A;  3FHI B;  2P5B A;  3I2D A;  2D43 A;  2LRP A;  4YGC A;  4X6R B;  3H3Z A;  4HPK A;  1VAV A;  1BHG A;  3C7F A;  1POV 0;  3RG0 A;  3LEI A;  1QU0 A;  1W2O A;  3FL7 A;  5BNN C;  1OC1 A;  1JOB A;  5D8A C;  4QD2 A;  4XF0 A;  2WUH A;  1HB3 A;  3BTA A;  3N9M A;  4LBJ A;  2IXL A;  1KDK A;  4PHZ A;  3O1O A;  1IKQ A;  3WCR A;  3IAP A;  4RR3 B;  3GJA A;  5A32 B;  3WSO A;  1TMF 2;  2W95 A;  2CL2 A;  1IQD C;  1LJ7 A;  2LS6 A;  2OXB A;  1NCQ B;  1LTE A;  4G3Y C;  5DAQ A;  4JKL A;  5H9Q A;  2GH2 A;  1HXS 3;  5BXX A;  2VOT A;  3K48 A;  1TVG A;  4QMA A;  3DEM A;  2B45 X;  5LBE A;  5E89 A;  3TEZ A;  4QKN A;  5T5O A;  3D0S A;  1HJG A;  3KGZ A;  3P5B A;  2WQZ C;  4J25 A;  4MGS A;  1BQP A;  1W3V A;  1ZZ7 A;  3QBQ A;  2GN3 A;  5EV7 A;  1VBA 1;  2VUJ A;  3GZT B;  4NAO A;  1AL2 1;  5FZ0 A;  4P9G A;  3UET A;  4XJZ A;  2RS3 3;  2JE8 A;  5CFD B;  4BOW A;  1UOJ A;  5L19 A;  1O91 A;  3O0X A;  1H2M A;  4BMB A;  2NPI A;  2A6Y A;  4LQR A;  5BV6 A;  1O3R A;  3LA3 A;  2FCT A;  2HWD 3;  1W8O A;  4XF3 A;  4C1X A;  4Q4W 3;  5IK8 A;  2E63 A;  2JDA A;  3IDE A;  3KCX A;  3VZO A;  1UIJ A;  3AYE A;  3PVB B;  1O4T A;  3DL3 A;  1ULP A;  1RVF 1;  2BNM A;  4N53 A;  4HN1 A;  3MW3 A;  1W8Z A;  3OJB A;  4XF9 A;  2D93 A;  2JDN A;  3TEX A;  1D4M 3;  3UKN A;  1WW4 A;  4D6R A;  5FBJ A;  4LBL A;  1ULE A;  1VRH 3;  4G4F A;  3ES4 A;  3BU0 A;  1GZT A;  1H8T C;  1HQW A;  3VLB B;  1GP4 A;  3R6S A;  2ZPX A;  4NMI A;  3W5M A;  5F3I A;  1POV 3;  5IVY A;  2GU9 A;  2JDM A;  2X5I B;  3EBR A;  1VMH A;  3MI8 A;  4R9C A;  3H1M A;  2BBV A;  4UFL A;  5FDB A;  1RMU 1;  2K46 A;  4CP0 A;  5A7W A;  3AFG A;  4GKY A;  5FUP A;  4DZG A;  1RUC 1;  1AYN 2;  3SMH A;  1Q3E A;  4AGG A;  5FQ0 A;  5DDJ 1;  1CAV A;  3R4U A;  2ORZ A;  4CU6 A;  5CEH A;  3IDA A;  2FMD A;  5A7Q A;  2WT0 A;  1ACC A;  1YC6 1;  4BQ5 A;  4CRQ A;  2A6X A;  5FZO B;  2NM1 A;  4HVO A;  4XUO A;  5EFU A;  3EMR A;  5C3R A;  5FMO L;  4JTO A;  5FY7 A;  4RGK A;  4RQP B;  1APN A;  1U5I A;  2ZZJ A;  4CDX B;  5FMD A;  4GIQ A;  2VM9 A;  3I3B A;  4M3C B;  2PXJ A;  5JAX A;  3OYW B;  1RC6 A;  1VB4 A;  3JBG 2;  1CIY A;  3A0N A;  3H0O A;  3K4A A;  2TBV A;  3WUD A;  3IMM A;  5FYI A;  4QU2 A;  3KZ4 C;  4UFH A;  1GIC A;  1RHI 1;  1M06 G;  2RJ2 A;  3I59 B;  2GMM A;  1VBD 1;  1KS4 A;  3HVD A;  3MFA A;  4R9D A;  1GMM A;  3ZN6 A;  5K9Y A;  2VVF A;  3DUI A;  3LIH A;  4L9B A;  4ZU4 A;  3R4D B;  4PBP A;  1YCI A;  1TME 3;  2MEV 2;  3J8F 3;  2XWB B;  3N7L A;  4XJA A;  3POS A;  5T5J A;  3WNP A;  1AR9 3;  2A6W A;  4AL9 A;  1PMH X;  1VLN A;  3IIA A;  4JDM A;  1ZBE 2;  4RL7 A;  1MS9 A;  1XC6 A;  4JGY C;  3T0B A;  3THP A;  4CEY A;  4YM3 A;  4RA0 A;  3LDK A;  5FXV A;  5F9T A;  3RI9 A;  4B7E A;  2JG9 C;  4R9B A;  1HDK A;  5GLU A;  3LSE A;  3VN4 A;  2RJK A;  4CCK A;  2GNT A;  1V00 A;  3WP5 A;  4YZ3 A;  3WUC A;  3AJY A;  3MEP A;  3B9C A;  3RQ0 A;  1NT0 A;  4JGZ A;  3VD5 A;  3PUH A;  4NHY A;  4OHV A;  4W50 A;  1V6N A;  3RMY A;  2EA7 A;  1MEC 2;  4JHZ A;  1PGW 2;  3D4K A;  2PHL A;  3S0M A;  1DU3 D;  2XHN A;  5KXD A;  2K2S A;  1N1V A;  1Q8Q A;  2XLG A;  5KBF A;  1F8V A;  4TSV A;  4LLF A;  1YWK A;  1DLC A;  3VKL A;  3J7H A;  2JX9 A;  1NCR B;  3DYP A;  4I0A A;  3FLT A;  2R6Q A;  2JKB A;  4FPF A;  3K4Z A;  1R08 2;  3N4M A;  3THD A;  3CJI B;  3ZFG A;  2WNV C;  3NNM A;  2OQ7 A;  1NY7 2;  1V6I A;  1E57 A;  2FCU A;  3PVO A;  4FOW A;  3ZXG A;  3W20 A;  3C8X A;  3PU3 A;  4MG2 A;  2B7Y A;  2BEO A;  5F7U A;  4DPN A;  2DVF A;  3FZ3 A;  2OYZ A;  4AI2 A;  3MW4 A;  3VBS B;  1XNC A;  1S4C A;  1JYW A;  1OVS A;  1GQH A;  5FCC A;  5CIR A;  4YAR A;  4ASK A;  2XBO 2;  3V64 A;  4LO6 B;  4P9J A;  1GQG A;  1W8W A;  1DG6 A;  5JOY A;  4EN0 A;  4OLL A;  3K46 A;  2UY9 A;  1TMF 1;  2ZMK A;  3GBW A;  1LGB A;  4K1Y A;  4DY5 A;  3HPN A;  4LUK A;  4HFS A;  2AZ5 A;  2KA3 A;  1VBC 3;  4E4Z A;  4K20 A;  1X9P A;  2PN5 A;  4B29 A;  3LOI A;  3C7H A;  2CV6 A;  4MXW A;  3VZN A;  4J1X A;  4PLO A;  2FDI A;  4V2W A;  4YVW A;  1V6J A;  1NLR A;  3OSD A;  4M00 A;  2R06 2;  1TNF A;  5CFC C;  4AED A;  2OZJ A;  1N1Y A;  3K2O A;  4ZY9 A;  2AUY A;  4K8F A;  4C90 A;  2BFU L;  4BK4 A;  1WLC A;  3VB9 A;  2ZZQ A;  4A7K A;  1Y7B A;  2R04 3;  1RUE 3;  2QQV A;  1OFN A;  4JDN A;  4MLO A;  4EWD A;  4P9W A;  2YMZ A;  1PK6 B;  5FZL A;  3S5A A;  1IQA A;  2EAA A;  4KGG A;  3HD8 B;  2E7Q A;  1W8T A;  4XIL A;  3WQ0 A;  3U37 A;  1S0B A;  4HET A;  1LEC A;  1NAE A;  4XIK A;  2R07 2;  1AR6 3;  3V0A B;  2VZP A;  4D69 A;  1H1I A;  4NWV A;  5FYB A;  1PVC 3;  3KD4 A;  4MSV A;  3AZZ A;  3NL1 A;  2YZ4 A;  3H1Y A;  2RR1 3;  2RDS A;  1BK1 A;  2A75 A;  1W6Q A;  3HT2 A;  2B5H A;  1AF9 A;  3PIG A;  2P17 A;  1DGL A;  5A3W A;  4CVU A;  2BNN A;  3E5X A;  5F37 A;  5ANN A;  3USU A;  1W06 A;  4LO4 B;  1QH6 A;  3BCW A;  3JD7 2;  4ZPI A;  1AYN 1;  2J1U A;  2W91 A;  1GZC A;  1S2E A;  2E32 A;  4YZ1 A;  3BTY A;  3RZL A;  4MXV A;  3J7M A;  3U4X A;  1T6B X;  2JIG A;  4IEQ A;  5JMO A;  5AC9 3;  2GNM A;  2ARX A;  1HB4 A;  1QJZ A;  4QHZ A;  4LBN A;  1YO8 A;  1ZBA 2;  2R0H A;  3ASI A;  1I9R A;  5A6Z A;  2A6Z A;  2E6V A;  1CR7 A;  4DEV A;  4YM0 A;  1XPW A;  3PL0 A;  5FZ3 A;  1UZZ A;  1VMJ A;  3MV0 1;  4Q0S A;  3GDB A;  3JBG 1;  3A22 A;  4IND A;  4FXK B;  4IGP A;  1RUI 1;  3I2I A;  2JDK A;  5A3T A;  5ABJ A;  4IET A;  3W58 A;  3AKS A;  1H2N A;  1FT9 A;  2GDF A;  4ARX A;  1IS4 A;  3AKQ A;  1Q8O A;  4PIY A;  4YFZ A;  5L7O C;  3K3O A;  1AR8 3;  3RZM A;  2CSG A;  1TNR A;  2MEV 1;  2WSU A;  4YW2 A;  4D94 A;  2J7M A;  1LGN A;  2BP6 A;  5IW0 A;  2WZR 3;  4I30 A;  4RR3 A;  4GWM A;  5A32 A;  1W8F A;  4XFC A;  1ZBE 1;  4HN0 A;  1ND2 A;  3ACI A;  5FK8 A;  1RIR A;  4RYD A;  1MZE A;  5JVV A;  2DVD A;  2EID A;  4XCA A;  5C8C B;  4BQ1 A;  1F5J A;  3K51 A;  1LEM A;  1W8U A;  3ZDV A;  5FPL A;  1IPJ A;  5H9R A;  2ET1 A;  4UYB A;  4F3J A;  3N9Q A;  4CUC A;  3TEY A;  3T0A A;  4XZU G;  1WLD A;  4QPY A;  2P1B A;  4PIX A;  1PNF A;  1W6P B;  4OUM A;  1XU2 A;  1H0B A;  2HLE A;  3CZJ A;  3LCP A;  1IG3 A;  1MEC 1;  5GAL A;  1UPS A;  1PGW 1;  1SZB A;  1ZRR A;  2DUQ A;  2VCM A;  4GAZ A;  4OYU A;  2ZMN A;  3NJY A;  4S2F A;  5FO7 B;  3WDT A;  1RB8 G;  4WM8 C;  1OXC A;  3T1M A;  3HBZ A;  1IZ3 A;  4Q0P A;  4AVV A;  2X09 A;  1Z78 A;  5JSO A;  1N3Q A;  1IS6 A;  4JTN A;  3FHA A;  3N36 A;  4BQ2 A;  5IFP A;  3VBR C;  1VP6 A;  2JDP A;  2CGP A;  1R08 1;  1E5H A;  2YU2 A;  3PIJ A;  3ZPY A;  4C0H A;  3BI3 A;  1NY7 1;  2C1F A;  1UYZ A;  5FYY A;  2W08 A;  5CG8 A;  2G19 A;  2HEY F;  1J3R A;  4AK3 A;  2TNF A;  3RYP A;  2ZGN A;  2WSV A;  2X5I A;  1XNB A;  1JUI A;  3WP6 A;  3UKT A;  3T4H B;  1RUD 2;  3BB6 A;  1WW5 A;  5EZW A;  2IC1 A;  1POQ A;  4RR3 C;  1CPM A;  2ERF A;  3GYD A;  4XJ9 A;  5E1R A;  3AL5 A;  4CCN A;  1NUK A;  2XBO 1;  4HSL A;  4C1W A;  1ENS A;  1NCQ C;  3ZYP A;  1OKO A;  1DQ1 A;  5FYH A;  2A7A A;  2K0G A;  2W5F A;  4OMD A;  1JYX A;  3SLI A;  1UKG A;  5FZO A;  1LCL A;  3ZXJ A;  1DQ0 A;  4HPK B;  3P1I A;  5C8W A;  1O7F A;  2TUN A;  4Y5T A;  3WOG A;  5A3O A;  4TXW A;  1GAN A;  3LAG A;  1FMD 2;  2R1D A;  2HEW F;  2CDO A;  5LAT A;  4LIV A;  2RMU 2;  2J1R A;  3M70 A;  2G1M A;  5DUU A;  3LIG A;  4M3C A;  5H9P A;  3TBD A;  4A6O A;  3OYW A;  4BB3 A;  2R06 1;  2QQW A;  5CFD C;  4AEK A;  4D8M A;  3APB A;  4JHT A;  4E4H A;  4BHP A;  1VIW B;  5B2G B;  1VJ2 A;  1TE1 B;  2PFW A;  2DTW A;  4P9L A;  2WYS A;  4UW6 A;  4XBQ A;  3VD4 A;  3H7J A;  4LJH A;  3T2O A;  2A70 A;  4MOA A;  1KFX L;  3JU9 A;  5FKC A;  1W2A X;  4UT5 A;  2UYB A;  3LDB A;  4CA9 A;  4QXH A;  5EYX A;  5GZD A;  4WBB A;  2ZX1 A;  2DF7 A;  2EAL A;  3S7E A;  5LAS A;  3ZFF B;  3M7A A;  4D7T A;  3I3E A;  2OUH A;  5BNO B;  2X5I C;  2DWR A;  2Y6F A;  1VMF A;  3TOJ A;  2R07 1;  4X8P A;  1UO9 A;  1ZRC A;  1C28 A;  3EYP A;  3RNS A;  3N7K A;  5BNQ A;  1W05 A;  2P2K A;  2ZHM A;  1YUD A;  3MF6 A;  1Y3T A;  5L73 A;  3F95 A;  1FV3 A;  1WKY A;  4LBQ A;  4UF0 B;  4A7Z A;  5JXG A;  4ZHN A;  4CE8 A;  2QQU A;  5GLV A;  1ONA A;  4N53 B;  1EUT A;  1CGP A;  3JB4 C;  4LO5 B;  5D1I A;  3JD7 1;  3ZYG A;  4L97 A;  3C2U A;  3JCI A;  4HG6 B;  3C3V A;  4E9K A;  3WF1 A;  5DQ0 A;  3SH5 A;  3FFZ A;  2Y6L A;  4XFF A;  1DQ2 A;  1HB2 A;  4K1Z A;  4P08 A;  1KJR A;  4XQ4 A;  2JWP A;  4YFW A;  5GZC A;  2ENR A;  4XFG A;  2UWC A;  4GJZ A;  4RQP C;  4UI9 L;  5FZ8 A;  4CDX C;  2ID4 A;  4GJY A;  2EIC A;  1ZBA 1;  1XE7 A;  1ULG A;  1W9T A;  4Q4V 3;  2CWS A;  2OVU A;  3LA2 A;  3DKW A;  1BJQ A;  1BXH A;  3KF5 A;  3CJI A;  1B09 A;  1S0I A;  4UBG A;  5A7W B;  2WA4 A;  2WWU A;  2VCA A;  3KVB A;  2DUO A;  1K12 A;  1W90 A;  3TNQ A;  2DU0 A;  1ASJ 3;  2J1T A;  1NE4 A;  1C3H A;  4UFI A;  1O5L A;  2HBT A;  3D8C A;  1VR3 A;  3VHP A;  5I0S A;  2C9A A;  3TN9 1;  1I5Z A;  1SPP A;  3K3N A;  3VL9 A;  3POW A;  3O0W A;  3VBS A;  2WQ8 A;  1OLM A;  2QBX A;  4QB2 A;  2HWF 1;  2Y64 A;  3CDZ B;  1S0G A;  5FZ6 A;  1OA3 A;  1GWM A;  3A21 A;  4R4Z A;  1SDW A;  4AI8 A;  2RM2 3;  4IV1 C;  3QAC A;  3INA A;  2ZAC A;  2YG0 A;  3ACH A;  2YPD A;  4Y20 B;  1GNZ A;  2OPW A;  2WAB A;  3RYK A;  3TAY A;  5A3L A;  2C26 A;  2ZOE B;  3N3H A;  2VU9 A;  3B5L B;  1UZV A;  4B1M A;  2JIJ A;  1RUF 2;  5FPA A;  3B01 A;  1WA6 X;  1IS3 A;  2NZ9 A;  4KG0 A;  1BZW A;  1ZZ9 A;  4D7Y A;  4QU1 A;  3G6J B;  4QGM A;  1D0G A;  4BE3 A;  3ZN6 B;  5I93 A;  3CF6 E;  3HNB M;  3LOB A;  3PUS A;  3IAQ A;  2DUP A;  4XF4 A;  1S2K A;  4Y24 A;  5F5I A;  4ASM B;  1NLQ A;  1NYW A;  2JEC A;  2XUM A;  3LGR A;  3AKT A;  4KU8 A;  1HKD A;  3MLK A;  4ARY A;  1ULD A;  5IAT A;  1V9U 2;  1ENX A;  2ARE A;  4K40 A;  4KG8 A;  1NCR C;  4MH0 E;  4AVC A;  5I91 A;  4CEY B;  4Q4X 1;  3HQX A;  1PIV 3;  5A70 A;  3FFQ A;  3AFK A;  3CJI C;  5JPN B;  5KWR A;  2HYX A;  4OQ8 A;  1W0P A;  1YJK A;  1SDD B;  3QOP A;  4WVM A;  4GMP 1;  2ZX4 A;  1XOY A;  5KHG A;  5LEK A;  1ZRI A;  2EF6 A;  3WG2 A;  1YQC A;  4JGZ B;  4OI0 A;  2J1S A;  3AL6 A;  3HJR A;  5FZI A;  1UU6 A;  3ATG A;  3AVS A;  5FZH A;  3VBS C;  3WZ1 A;  3MFC A;  1F9K A;  1OOP B;  3V0A A;  2SBA A;  4I0W B;  3WEZ A;  3WT3 A;  3J7L A;  1Q56 A;  2FBE A;  5M0T A;  3FE5 A;  4LHN A;  1RUD 1;  2ZGR A;  4Y1Y A;  1XSQ A;  2BVB A;  5FUN A;  3WP3 A;  4N90 A;  3MIE A;  2BTV C;  3ZFG B;  1QY4 A;  4R52 A;  3UGH A;  3U10 A;  2WIN B;  4SLI A;  1OUS A;  3NAP A;  2VPV A;  3WHU A;  3SC7 X;  2D6K A;  3TWI A;  1DQ5 A;  1LHU A;  4IE6 A;  3NST A;  5FKB A;  1JW6 A;  2A5Z A;  3TYJ A;  1GOF A;  4AEJ A;  1U0A A;  4PJY A;  4OHW A;  5H9S A;  5AVA A;  2Q4S A;  4EE2 A;  3C7O A;  1FMD 1;  2VR4 A;  5JXH A;  2WFF 3;  2RMU 1;  3FHQ A;  2XJR A;  5IAV A;  3BOD A;  1GZW A;  2HKX A;  3N9O A;  1CVN A;  2Q8C A;  1LOC A;  4XQW A;  2DVB A;  3CL1 A;  2WAO A;  3I7D A;  1PK6 C;  5I8S A;  1HRI 3;  3QH6 A;  2NMN A;  4QXC A;  1FOD 2;  4R9A A;  4DO0 A;  2IWG B;  4K6B A;  1VE0 A;  5LA1 A;  4CDU B;  4IXL A;  1XYO A;  3N35 A;  3ZSM A;  2ZXQ A;  2VMG A;  1AR7 3;  2CHH A;  4MXW B;  3AX4 A;  4BIS A;  1SBF A;  3MHZ A;  4PLN A;  4YVW B;  3HOB A;  3ZXF A;  5F6L B;  4BU2 A;  3WY6 A;  4AED B;  2W0X A;  3NKG A;  4QDR A;  1CWP A;  1PM4 A;  4Y33 A;  2WQ4 A;  3RFR A;  2J1E A;  4WVZ A;  4JQR A;  2R16 A;  3LQC A;  4OMC A;  2UWA A;  5AFB A;  4LOT A;  2KR2 A;  2VY0 A;  4GB3 3;  4E8D A;  1MZF A;  1ULO A;  4M01 A;  1EAH 1;  1O8S A;  1CAW B;  2GND A;  2VEC A;  5L9V A;  2DVG A;  2HEV F;  4M0N A;  1MPX A;  2IXC A;  3VHR A;  3PJQ A;  5FZ1 A;  5IAX A;  3OUJ A;  1JHN A;  1K5J A;  2XDV A;  3AC0 A;  1VBB 3;  3KT7 A;  4YRD A;  5FZA A;  3I3M A;  4ET7 A;  1PHM A;  3L2Y A;  1LRH A;  2VW1 A;  1OLQ A;  3BN6 A;  4BDV B;  1GV9 A;  1CZV A;  1LOB A;  2JDY A;  4A42 A;  1QHD A;  1W6Q B;  3KCC A;  3ZIW A;  1RUG 2;  5JPM B;  1CZT A;  4B4R A;  2Y6J A;  1ZZC A;  1KFU L;  3ZYH A;  1UOF A;  1A8D A;  4PF1 A;  3U14 A;  4DRR A;  5FRA A;  1HRV 3;  3O0V A;  3UYJ A;  3ZR6 A;  5B4N A;  2ILM A;  4CU8 A;  5CBL A;  2FD8 A;  2SLI A;  4QAW A;  1LHN A;  4NJ4 A;  5CNA A;  2WO7 A;  4S2G A;  3OEA A;  1UOB A;  1AUY A;  5CYY A;  1IGO A;  2AEY A;  5IUQ A;  3V56 A;  4N43 A;  2PEL A;  3WR0 A;  3ITQ A;  5LRR A;  4XTP A;  4C8D A;  2VO5 A;  3O12 A;  3V0B A;  1MVQ A;  2VMI A;  3LFM A;  2ZEW A;  2PMW B;  1JZ8 A;  5C8C C;  3MID A;  1GP6 A;  4FFF A;  5I8Y A;  3VHO A;  1OPO A;  2XG3 A;  3M4F A;  4IEP A;  4A6S A;  1X33 A;  5FPX A;  2EXK A;  3C7G A;  5ABJ B;  1RUF 1;  1GU3 A;  4LNV A;  4FFI A;  3O1T A;  4JRA A;  3AP4 A;  1WCS A;  2XGX A;  4URA A;  2C24 A;  2DCJ A;  4NVP A;  1C8M 2;  1NA1 A;  1YYN A;  4DEQ A;  2TEP A;  4BA6 A;  2W2I A;  3GZE A;  4IEX A;  4QQ2 A;  4IE5 A;  3RGB A;  2RHP A;  1MS8 A;  5DUW A;  5FY1 A;  4AI1 A;  1STM A;  4XC9 A;  2W52 A;  1DF0 A;  3PHM A;  4FPO B;  1V9U 1;  1ND2 B;  5F3G A;  3B00 A;  4PBO A;  3VBU A;  4GA9 A;  2PHX A;  3I54 A;  4JDO A;  2Z69 A;  1D2Q A;  4ZU7 A;  2OW4 A;  3THT A;  4Q26 A;  3ZMN A;  4XFI A;  2ZAB A;  1DQ6 A;  3KV5 A;  3VBH A;  5J3U A;  4IQP A;  4Q0U A;  4P9I A;  3IB3 A;  4HLT A;  2Q8O A;  1I3H A;  5C9A A;  4FOQ A;  4AI0 A;  4NPR A;  4FAH A;  2DBI A;  2D97 A;  3B93 A;  3ZFF A;  1Q8S A;  4E8C A;  2CAU A;  4Z8B A;  1FAT A;  3HQR A;  5BNO A;  3T30 A;  4NAM A;  4QGN A;  5FP3 A;  2CDP A;  2VZQ A;  2ZHL A;  5DAP A;  3AMP A;  1W28 A;  1FV2 A;  2ARC A;  3H8U A;  5A3U A;  3MIF A;  3NWK A;  2JEN A;  3KWV A;  3MGU A;  2NMO A;  1SLC A;  2HWB 3;  3F2Z A;  4UF0 A;  4BQY A;  1IOA A;  3OBT A;  1C1L A;  3MIC A;  5JIU A;  1QJU 3;  3ZFE C;  5GZG A;  4FT8 A;  2QFE A;  4LLO A;  1PO1 3;  1QIQ A;  4YWA A;  4QM8 A;  1XU1 A;  2VW2 A;  5DG2 A;  3NNF A;  4AFM A;  3LPG A;  2EAK A;  4FFH A;  3IBM A;  5LBB A;  1CD3 G;  1OF3 A;  3N7J A;  2WZ8 A;  1K5M B;  2WFP A;  1FPN 3;  2VL4 A;  4XF1 A;  3BGA A;  4YG0 A;  1ZNP A;  1XNA A;  1BBT 2;  1OBN A;  1UY4 A;  3VKF C;  4Z1V A;  1D7P M;  2VMF A;  3I2O A;  3RZZ A;  2C6S A;  4BM8 A;  3U11 A;  1C5H A;  4L0P A;  1UU5 A;  3WQ7 A;  4XYX A;  3AYA A;  1COV 3;  3AP7 A;  4IEY A;  5F8P A;  1QQP 2;  5LWB A;  4Q5O A;  4Y4R A;  3GZU C;  2VQT A;  4NWW A;  3T1L A;  4BLI A;  4Q0V A;  5ACA 2;  4HVR A;  4LKD A;  4YNI A;  3LSD A;  2OPK A;  2YV8 A;  1UYP A;  1FOD 1;  1MS1 A;  1RXG A;  4A41 A;  2JDU A;  3ZFF C;  3CMG A;  3T08 A;  2FDG A;  4TZD A;  2IXI A;  4B1L A;  3W5N A;  1A6C A;  4MGI E;  4UXA A;  4KWJ A;  5BNO C;  3TEW A;  3VUO A;  1GR3 A;  2Y8K A;  4Y20 A;  5T5L A;  3VZJ A;  4LEJ A;  3E6D A;  2W68 A;  2Y0O A;  3VDB A;  1EPW A;  3ELN A;  1LHO A;  3GGL A;  5KHI A;  4NRQ A;  1RUJ 3;  4CTE A;  1JZ3 A;  1Z0H A;  2XJT A;  1X7N A;  3TNP B;  1BVP 1;  5JOZ A;  1LGC A;  4N53 C;  4A3X A;  2PHR A;  5E16 A;  2VZU A;  2C0Z A;  2CAV A;  2XWJ B;  4CEW B;  5IFT A;  2WS9 3;  3RSJ A;  2QKD A;  1J59 A;  2VMH A;  4LA3 A;  1OLR A;  4U2A A;  3WXP A;  2BV4 A;  1QJY 3;  3KT1 A;  3UGG A;  4BWO A;  3DV8 A;  1H6Y A;  5EJZ B;  3AYC A;  4XFB A;  5KR7 A;  2WNU A;  5IK5 A;  1ZZB A;  2HWE 2;  2VZO A;  3VL8 A;  4FXG B;  2VE1 A;  3E6B A;  1UAI A;  4XUR A;  4Q4Y 2;  2OKX A;  3S30 A;  1QGL A;  1OF4 A;  2VQU A;  3LDR A;  4KL1 A;  5IJR A;  4LBQ B;  2HWC 3;  4CXW A;  3ILN A;  3ZKU A;  2PHW A;  2NLR A;  1RUG 1;  1UMH A;  2E26 A;  5FZG A;  4ES9 A;  3O7O A;  2Y6K A;  5IVV A;  4OCT A;  2RS1 2;  2Z4F A;  1IPS A;  5A6Y A;  1HJF A;  1A34 A;  2A3Y A;  1OOP A;  2HH9 A;  4AAX A;  1PZ9 A;  2VOW A;  4BQW A;  4TLG A;  2D3P A;  1D2S A;  2E7T A;  3K4D A;  4XMA A;  4DB5 A;  1O59 A;  2ZGS A;  5FP7 A;  1FNZ A;  5J1X A;  1Y4W A;  3WNN A;  3JB8 A;  5FAX A;  1UY1 A;  2IFW A;  3MPP G;  5C4W B;  1UPI A;  1V70 A;  1SFP A;  4MAD A;  3NV2 A;  4XE9 A;  1PO2 3;  3UGF A;  1EV1 2;  4LA2 A;  3FLP A;  5JR2 A;  3H8X A;  3WF4 A;  1QJX 2;  2LM3 A;  2GZW A;  4YW7 A;  1DFQ A;  1Z7S 3;  3POG A;  3CBN A;  4P14 A;  2B4K A;  2DCK A;  2JIC A;  3T2Q A;  2WBK A;  3QCW A;  1YFW A;  2H0V A;  3KMH A;  3WIN E;  3ZPO A;  4CP2 A;  4FSJ A;  1SPP B;  1HLC A;  1YLL A;  3H3L A;  1DYP A;  1ZX5 A;  4IGO A;  4LPL A;  1U5Z A;  3NV4 A;  3BAL A;  4OI1 A;  2WLQ A;  3POI A;  3SH4 A;  2YBS A;  3PUA A;  5GZE A;  3U07 A;  5CKN A;  1R09 3;  3HN1 A;  3U78 A;  2GAU A;  4LOR A;  4YW4 A;  2EVX A;  4LIT A;  1C8M 1;  2BUK A;  1PGL 2;  4Y1X A;  4GAL A;  4CEY C;  3ES1 A;  1BLZ A;  2XUE A;  4KNC A;  2G9G A;  2P3J A;  2RS5 3;  3CNA A;  3SIS A;  4QPI A;  1US3 A;  2YBK A;  2YB7 A;  4FP3 A;  3DPR A;  5CU1 A;  3W59 A;  2MNG A;  4F8A A;  3JQW A;  2RG4 A;  1R1A 3;  2VTX J;  1SFN A;  3LKJ A;  4A7Y A;  2N7G A;  3PJY A;  5IVC A;  5LCW L;  2ZBJ A;  1JU3 A;  1HRI 2;  4CDU A;  1WLT A;  1AX0 A;  4JGZ C;  3I2K A;  3D5O A;  5KXE A;  1MS0 A;  1Y9G A;  2XOM A;  4K21 A;  2PLV 2;  1N47 A;  1OOP C;  3NRU A;  4LKS A;  4A44 A;  3OGG A;  3Q8E A;  1F4A A;  5FZ9 A;  1X36 A;  2E7A A;  3BOP A;  2L9L A;  1VBE 2;  4PI2 A;  1SFY A;  4CCM A;  4RS5 B;  1PM7 A;  3H1W A;  5EQU A;  5FK7 A;  4QGL A;  5I0D A;  5DPN A;  4YYO A;  2JE9 A;  3IWZ A;  4JV4 A;  2ZEX A;  4CCL A;  2YHJ A;  2KM2 A;  3POB A;  4L8Q A;  1BK0 A;  3ZFG C;  3H3U A;  3I97 A;  4XIO A;  3WDY A;  5FLJ A;  1YI7 A;  2W1Q A;  1OPM A;  1CAW A;  3OD0 A;  4WVM B;  1JYC A;  1OI6 A;  5FPB A;  1C1F A;  1RUH 2;  1QOO A;  3CKH A;  2K9Z A;  2VME A;  4AQT A;  4XJU A;  4COY A;  1F15 A;  4KBZ A;  4XHB A;  1J1T A;  3E1F 1;  2XVK A;  4JKK A;  4XCB A;  2YXS A;  1WD4 A;  1BEV 2;  5KHH A;  4GH4 A;  2WII B;  2XLF A;  1DZQ A;  1ZZ8 A;  3ETP A;  3PVN A;  3M8L A;  4R4X A;  4EYU A;  1O3T A;  1BBT 1;  1LHV A;  1OD5 A;  3T2T A;  3E5U A;  3VDD A;  2Y34 A;  4ZXK A;  4H3W A;  1QJE A;  4COV A;  1JZ5 A;  4YW6 A;  3T2P A;  2AH2 A;  2O0O A;  4ZS2 A;  4DQA A;  4QHO A;  3Q9O A;  3EJK A;  1VBA 3;  4F83 A;  1QQP 1;  1AL2 3;  1FI2 A;  1TEI A;  3NAP B;  4CDU C;  3OGS A;  4O9E A;  3III A;  2D6M A;  1N1T A;  1HV0 A;  5ACA 1;  3HIF A;  5ANQ A;  4CU7 A;  1GYK A;  1OQD A;  4L11 A;  1AYM 2;  4YVW C;  1CJP A;  4S2D A;  4BXF A;  4S2H A;  4XHX A;  1OA4 A;  5BPX A;  4AED C;  4B7K A;  5I0U A;  1RVF 3;  2XJV A;  4IV3 A;  2BOJ A;  3SCF A;  3IN9 A;  2PHD A;  2JKX A;  3EB7 A;  3OPZ A;  3NV1 A;  1GZW B;  4ORF A;  3DXT A;  2VBP A;  3B7M A;  1NKG A;  3AK0 A;  2W1S A;  2OZ6 A;  3GF6 A;  3LZZ A;  4IW3 A;  3HNY M;  4RHV 2;  3SKJ E;  4JQT A;  4B4Q A;  2BU9 A;  2QVS B;  5G04 L;  3JXS A;  1JXN A;  2G9Z A;  3H42 B;  1RMU 3;  1W8N A;  5DAV A;  4DOU A;  3H50 A;  4QB6 A;  5J48 A;  5T5P A;  3VHN A;  1RUC 3;  2BWC A;  4CP9 B;  4O7X A;  2O14 A;  5DDJ 3;  4CDQ B;  2C9K A;  1KDM A;  2EXH A;  1QDC A;  4NHL A;  1UQX A;  5DMY A;  3O1U A;  3EHK A;  1YNA A;  3AMH A;  4KWU A;  4QDS A;  5GLW A;  2XXZ A;  4ZKT B;  3RI8 A;  2HWE 1;  2P37 A;  5FZE A;  2D6N A;  1G9C A;  3MIG A;  1DZR A;  2Z79 A;  3HEI A;  2CYF A;  4Q4Y 1;  2VMD A;  4CXY A;  1HXS 2;  1WMF A;  4WVV A;  1ULF A;  4QDQ A;  3UJQ A;  3AMM A;  1Y43 B;  1W39 A;  2XR4 A;  5CKQ A;  2RS1 1;  1KS5 A;  4XFA A;  1YIF A;  4FAG A;  3USS A;  1YI9 A;  3FUQ A;  1CX4 A;  4COW A;  1WCU A;  1RHI 3;  2VVE A;  3I2F A;  1VBD 3;  1GOG A;  4MGT A;  1VB2 A;  4XDO A;  1QOT A;  1AJK A;  4XXP A;  4NID A;  2RS3 2;  1V6K A;  2P3I A;  2DU1 A;  3SQO A;  1OHF A;  2HBU A;  3BPZ A;  4YW5 A;  2JJ6 A;  4LHL A;  4YGD A;  2HWD 2;  2ET7 A;  3W9A A;  2HWB 2;  2IXK A;  4Q4W 2;  4GXL A;  1QXR A;  4M0H A;  4TN7 A;  4XMI A;  5FJH A;  1EV1 1;  1S2B A;  3GBG A;  1QJX 1;  2VUA A;  5ABJ C;  4OZO A;  1YEW A;  3I4I A;  3SCH A;  2B42 B;  1D4M 2;  1K5M A;  3DXU A;  2R32 A;  4L99 A;  4AHW A;  1VRH 2;  2ZGQ A;  1UX7 A;  2VCB A;  3S5Q A;  1AXZ A;  3LD8 A;  2BNO A;  1OMI A;  2YUE A;  4MZU A;  1E5R A;  5IVE A;  2WLP A;  3VD3 A;  4D3W A;  1UMI A;  5I0T A;  1WZX A;  4N43 B;  3JQX A;  4R8H A;  3UES A;  3V0B B;  1ND2 C;  4DXS A;  4KQ7 A;  1PGL 1;  1TQ5 A;  5IWF A;  3ZN5 A;  5FOB B;  3ZXK A;  1RTV A;  2JDH A;  5IT6 A;  3POY A;  3WNK A;  4E27 A;  1ZA4 A;  1WBL A;  4LIU A;  2XL9 A;  4ZU5 A;  3RJR A;  4DIQ A;  4PT6 A;  2GN7 A;  3KSC A;  3JUU A;  4OUL A;  4I0B A;  4QXB A;  2R0F A;  2D3S A;  4AHY A;  2FCV A;  3ZYJ B;  5JZG B;  4QPG A;  3AJZ A;  1DGW A;  2PLV 1;  4MHU A;  4P5Y A;  1NA1 B;  3BTX A;  1F2N A;  5JWP A;  3WG3 A;  1O4Y A;  1S0F A;  4ATE A;  1VBE 1;  1W9W A;  1J3Q A;  1EPZ A;  1YQ2 A;  2EXI A;  2UY8 A;  3B9I A;  4LKF A;  4M3C F;  4HBN A;  4QX0 A;  1JS9 A;  1OH3 A;  1KJL A;  2YC0 A;  4DXZ A;  3MYX A;  3VBU B;  5JXJ A;  1ZRD A;  3OOX A;  3U75 A;  2E53 A;  3H9A A;  1QF3 A;  3MW2 A;  4ZON A;  4YVS B;  1NQJ A;  1DHK B;  1W0O A;  3HT1 A;  3SHR A;  3VBH B;  1W9S A;  2YRO A;  2BYV E;  4FTB A;  2X29 A;  4CEW A;  4I2O A;  5C9A B;  2DTY A;  2GMP A;  3DYM A;  3ILR A;  1OVP A;  1ZM1 A;  1K5M C;  3POE A;  4RFR B;  1RUH 1;  4RN5 A;  2ZS6 B;  4YZ4 A;  4DUV A;  1SLB A;  2WZP P;  1TME 2;  3J8F 2;  2DBN A;  1QJY 2;  1AR9 2;  4W6X A;  4OQ9 A;  4MO3 M;  4AXO A;  1BEV 1;  1TMF 3;  2VBD A;  5KC6 A;  1WUV A;  1YIP A;  2ZCW A;  3KHB A;  4QX7 A;  1RL3 A;  1WMD A;  4N8M A;  1OD3 A;  4FQ4 A;  5FY9 A;  2BVV A;  5DAW A;  1ND3 B;  2XH6 A;  1Q8P A;  2Y6H A;  3ACL A;  5TSW A;  4Q8K A;  3WDX A;  1JYI A;  3SIT A;  1HQN A;  2ETE A;  4OFG A;  1IHM A;  5HCF A;  5A7O A;  1JOJ A;  2GC2 A;  2A73 B;  1JH5 A;  3J9S A;  5FR3 A;  2MPF A;  3RYR A;  3HNM A;  4QQL A;  4AAP A;  1XYP A;  1IG0 A;  2LAL A;  3B69 A;  3IMN A;  3CO2 A;  5EJ1 B;  3RRD A;  5A7P A;  3S6P A;  3VD7 A;  1YHF A;  3WF0 A;  2QDR A;  4CCE A;  2D5H A;  4XPV A;  4AGV A;  1FNY A;  3RZG A;  4AHX A;  5FMO S;  2WL1 A;  2BWA A;  3NJX A;  3AZX A;  2EXJ A;  3WDU A;  1AYM 1;  4OHY A;  4OVE A;  4YGE A;  1JN2 P;  3OGJ A;  5EHD A;  5C7G A;  1XYN A;  5C4W A;  2HYK A;  4JCK A;  4AWD A;  1GNY A;  4XW3 A;  2W87 A;  1AHS A;  3TB0 A;  2VG9 A;  3CHX A;  3JZV A;  4LOS A;  4L92 A;  4NHM A;  2C5D A;  3L9J T;  2O8O A;  5C33 A;  2ZJC A;  1H30 A;  4PI0 A;  1UMZ A;  3A23 A;  3GNE A;  2WR9 A;  5FO9 B;  1C8N A;  3Q8B A;  2B39 A;  4N7I A;  4NPL A;  3WV6 A;  5G05 L;  2RDQ A;  4MET A;  1LB2 A;  4OUS A;  3O1P A;  1UF2 C;  4RHV 1;  5FZM A;  4AHZ A;  1EP0 A;  1W6N B;  3A4U A;  4HZF A;  4Y5S A;  2WT2 A;  3ME2 A;  5F2S A;  2OA2 A;  4KGQ A;  2ARB A;  2YU1 A;  4I09 A;  2DCZ A;  4AW7 A;  2QDN A;  1D0H A;  4FQZ A;  1R09 2;  1W8H A;  5FY5 A;  1AYN 3;  4BIO A;  4EN8 B;  3HAG A;  3DGT A;  1Y9Q A;  2A71 A;  2IVJ A;  4MV2 A;  1J83 A;  1OQ1 A;  3P3N A;  1JU4 A;  3KV6 A;  4YSF A;  5A6Q A;  4E2G A;  1XND A;  3OBZ A;  2P6C A;  4UAP A;  1R1A 2;  3VBF B;  1ZRF A;  3FX3 A;  1OUR A;  3O14 A;  4Y22 A;  5A33 B;  1MS5 A;  1VBC 2;  2ZTN A;  1HXS 1;  1UX6 A;  2ZGU A;  3B02 A;  5DAX A;  5HV4 A;  3Q8C A;  4M4P A;  5IVJ A;  4ZS3 A;  3ZM8 A;  3PDQ A;  2WO3 A;  4HXC A;  4PDW A;  2FQP A;  3JBG 3;  2JD4 A;  2PHF A;  1B35 B;  1KQR A;  4RS5 A;  4N7U A;  2A1X A;  2ZX0 A;  3H7Y A;  3MBW A;  1M4W A;  3WW2 A;  2VUL A;  2ZGT A;  2G4I A;  1UL9 A;  1RUI 3;  1GQP A;  2WNU B;  2D6L X;  5C4W C;  1UNB A;  2RS3 1;  5EXO A;  1JOP A;  4FI9 A;  1W04 A;  3CJX A;  5EPA A;  2R04 2;  1RUE 2;  3K75 B;  3BIW E;  4DS0 A;  4QKB A;  2HWD 1;  2MEV 3;  4Q4W 1;  4LMF A;  4FO9 A;  2ARA A;  1DBN A;  2JG8 A;  4CPB A;  1H9P A;  3VBO A;  3KVA A;  1ZBE 3;  1UZW A;  1L3J A;  1D4M 1;  4LBQ D;  2WKK A;  2QZ2 A;  3RS6 A;  2BJS A;  2D6P A;  1VRH 1;  3BYW A;  1AR6 2;  5EWS A;  1DIW A;  1QH7 A;  4DNY A;  2V5Y A;  1PVC 2;  2W1U A;  1RJ7 A;  2VOK A;  1QXJ A;  4YM2 A;  4Z07 A;  4QX8 A;  2RR1 2;  4UWD A;  1POV 1;  2H6C A;  2ZEZ A;  2WZE A;  1F4H A;  2B9V A;  1RXF A;  1LEN A;  4DMI A;  4F7Z A;  4O9G A;  4LT5 A;  2BRT A;  3UKV A;  1MEC 3;  4MGY E;  2AEZ A;  1CQ9 A;  4B8E A;  3WHT A;  1C5I A;  3B3Q E;  1A78 A;  1WCK A;  1WWY A;  4P9X A;  1SG3 A;  1JOD A;  1UD1 A;  5A80 A;  5CFC B;  3LEG A;  1S0D A;  3M3Q A;  5AC9 2;  4OI4 A;  2CU5 A;  4E2Q A;  2WA3 A;  1BKZ A;  1TG7 A;  4CUG A;  2ES3 A;  4RS5 C;  1X9T A;  1WMX A;  4XOG A;  4CDW A;  1R08 3;  1SCR A;  1S0C A;  4A4A A;  3A7Q A;  5LBF A;  2BFU S;  1RVF 2;  1Q8V A;  4Z2A A;  2HJI A;  4XAB A;  4Y5Z 0;  1GP5 A;  4XEZ A;  3LA7 A;  4KI5 M;  2E31 A;  4QPI B;  3DPR B;  2NQY A;  2XL7 A;  4LO8 A;  4BIF A;  3QLQ A;  2YGM A;  5IK7 A;  4XUN A;  4YW1 A;  4Z92 B;  1G86 A;  1JYT A;  1JBC A;  4FPH A;  1SAC A;  1GOH A;  3ROU A;  3AMQ A;  1GUI A;  4URT A;  3MPB A;  4WZC A;  4XXA A;  4Q1P A;  2FDK A;  1MAC A;  2PYT A;  4CP9 A;  3L2H A;  4N9I A;  5FYZ A;  1AR8 2;  2XBO 3;  4Q0Q A;  5EYY A;  3W21 A;  1SBD A;  4JX0 A;  4CDQ A;  1RUC 2;  4EZ4 A;  3AVR A;  3J8F 1;  5LY2 A;  2WZR 2;  1AR9 1;  3ZSK A;  2ZX3 A;  1JUH A;  5ERL A;  5EJ3 A;  2A3W A;  1QDO A;  4FOV A;  1BYH A;  2DYC A;  3FBY A;  4NN0 A;  1NE6 A;  2XLA A;  4ERO A;  3DKQ A;  3IPV B;  1HW5 A;  3R4S A;  1ZRE A;  4HOO A;  2LTN A;  4P5H A;  5K0U A;  1C57 A;  3NAP C;  3VZL A;  3WNO A;  3ZIX A;  3ZKY A;  1UXZ A;  2R06 3;  2DCY A;  4A3Z A;  1YFU A;  3D0J A;  1O4Z A;  3NQH A;  4BJ0 A;  3GZA A;  1OQE A;  4HL0 A;  2OII A;  4IER A;  5FYU A;  5BNP A;  2F4P A;  1ZYB A;  2UWB A;  2VUC A;  4GH4 B;  1OSG A;  2B9U A;  5FZC A;  3K77 A;  1VBD 2;  5LA0 A;  1GBG A;  4QKD A;  2VD7 A;  1XE8 A;  3ALQ A;  5FJK A;  3VDD B;  4GWJ A;  4CPB D;  5E8A A;  3N9L A;  3SNM A;  3D3A A;  5A7S A;  2WNE A;  4NO4 A;  1LNS A;  4A45 A;  3PU8 A;  2Q0A A;  3KHC A;  2Q30 A;  3AXE A;  2FDH A;  3VKM A;  4HKO A;  4AGR A;  4AF9 A;  2R07 3;  1LOF A;  4IE0 A;  1RIT A;  3BU7 A;  4IEZ A;  5IHR A;  2WAA A;  2VXR A;  2YYO A;  4FTS A;  2AC1 A;  1UKR A;  5B4X A;  1V6L A;  2P6H A;  4XDQ A;  1PX4 A;  2ZGK A;  3GCX A;  4H14 A;  4IE4 A;  2Q8D A;  4IV3 B;  2ADD A;  3JD7 3;  3OY8 B;  5CVR A;  1RJ8 A;  2YGL A;  3AXD A;  3ZSJ A;  3WVJ A;  4AG4 A;  4B3N A;  2PAM A;  5FY0 A;  1K3I A;  1I1E A;  5E6H A;  3OBA A;  3OF1 A;  2FDF A;  1GWL A;  1QJF A;  4XJ8 A;  4DXT A;  2ADE A;  3VDC A;  4HKW A;  5C6C A;  1W2T A;  4FPJ A;  5LBC A;  4IEW A;  5FZ7 A;  1ZBA 3;  2VBB A;  2XKO A;  4HSJ A;  2Y0I A;  3CQO A;  2VNO A;  5HPO A;  3KT4 A;  4KWK A;  2EIB A;  4GMP 0;  5JZG A;  1KEX A;  1VBC 1;  1WLW A;  2DVA A;  3GJB A;  4G9S B;  2PAK A;  1HN0 A;  2W39 A;  3OUH A;  3WDV A;  3LEK A;  2VCC A;  5L9R A;  2UUR A;  3PUQ A;  1SLT A;  4PF5 A;  3GHM A;  3T3Y A;  5JSP A;  5JLV A;  2DCT A;  2RVA A;  4FVV A;  3TN9 3;  2QJV A;  3HN3 A;  1W6M A;  1KXG A;  1XNK A;  3D6E A;  1XB9 A;  1UYY A;  2UYA A;  1H4H A;  2VOV A;  4GUL A;  3I49 A;  1L7L A;  4TWT A;  1XXN A;  1MZ6 A;  4X8N A;  4YVS A;  2HWF 3;  4U36 A;  2XPJ A;  4NHX A;  2IZW A;  1ALY A;  1WD3 A;  2R04 1;  1RUE 1;  3AM2 A;  4FP2 A;  4AFC A;  3C7E A;  4CUA A;  1ODM A;  5DUX A;  3DF0 A;  1IKP A;  1H8T A;  1J58 A;  5JR7 B;  4MYE A;  4YGB A;  1UCX A;  1XJA A;  2VNG A;  2PTM A;  3M2M A;  1LOF C;  4BZ4 A;  3LE0 A;  5T52 A;  4AEM A;  3AKP A;  4WVW A;  4IES A;  1VAK A;  2DFC A;  3HMY A;  3AB0 A;  3ACF A;  4LTA A;  4L2N A;  4TTG A;  5FZK A;  1H1A A;  3PNA A;  4N43 C;  2ZGL A; 
#chains in the Genus database with same CATH homology
 3J7N A;  3J7L A;  1STM A;  1JS9 A;  3J7M A;  4NIA A;  1CWP A;  1ZA7 A;  1YC6 1;  4OQ9 A;  1A34 A;  4OQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...