3J7NA

Virus model of brome mosaic virus (second half data set)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
149
structure length
149
Chain Sequence
KAIKAIAGYSISKWEASSDAITAKATNAMSITLPHELSSEKNKELKVGRVLLWLGLLPSVAGRIKACVAEKQAQAEAAFQVALAVADSSKEVVAAMYTDAFRGATLGDLLNLQIYLYASEAVPAKAVVVHLEVEHVRPTFDDFFTPVYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title An atomic model of brome mosaic virus using direct electron detection and real-space optimization.
pubmed doi rcsb
molecule tags Virus
total genus 15
structure length 149
sequence length 149
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01318 Bromo_coat Bromovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.220 Mainly Beta Sandwich Jelly Rolls Satellite virus coat domain 3j7nA00
4OQ8A 1ZA7A 1STMA 3J7LA 1JS9A 1YC61 3J7NA 4NIAA 1A34A 4OQ9A 3J7MA 1CWPA
chains in the Genus database with same CATH superfamily
3C7GA 2K0GA 4OHYA 2OA2A 3MPBA 3T1MA 3FFQA 2XHNA 4XCBA 5J96B 1YQ2A 2MHFA 2ZX3A 2DCTA 2WO7A 4NO4A 5F5AA 3J7LA 5EFUA 1F9KA 1KGYA 3KCXA 2XLFA 1VB4A 4XJZA 5DG2A 3VBOA 1VRH2 3TEXA 4TLGA 1R081 4QWNA 4JC1A 1RHI2 2V72A 5FY7A 3Q9OA 1LHNA 1PVC1 4LHNA 3M3CA 1VBD1 4BU2A 5JPMB 1AYN2 4WM7B 1QNWA 1DZTA 5I8YA 4AHWA 1GOFA 5JZGC 1HV1A 1Q8OA 1SLCA 3LA3A 2YPJA 2EICA 4HONA 4XHXA 5LK7B 1JYWA 1T6GC 1RUJ3 1FV3A 2WJSA 4MGQA 3NJXA 1OA4A 1VBA3 1O91A 4Y33A 3I49A 3IDEA 5CKMA 3VD7A 3KZ4C 1QHDA 3K51A 4IV3A 1HXS3 4DS0A 4HVRA 5JI9A 4FXGB 4H14A 5FP4A 2BNOA 5CZKA 1QJU1 4Y1UA 3FFZA 1ENXA 4V2WA 5EZWA 3WW1A 1IGOA 1CR7A 1POQA 2KXLA 1G9FA 1YCIA 3RS6A 5I0SA 3FLPA 1H1AA 1ENQA 2W1WA 2ZA9A 3WG2A 1YYNA 1VALA 2VZQA 2W39A 5A7WA 1O3TA 1JHNA 3OB8A 4BMBA 4AEJA 4UF0A 1JYVA 5DABA 4DUXA 1PZ9A 2J42A 3NMBA 4XIOA 5IJRA 2FDHA 1GZTA 3MIGA 4GB33 2F6BA 3USUB 4AFDA 3GJBA 1W9FA 3LDRA 3TNQA 2P3IA 1LTEA 1PO12 4KU7A 1KXGA 4ES9A 4GXLA 2OXBA 5JMCA 2HWC3 4NWVA 1DGRN 1DZRA 1B35A 1FNZA 4I0BA 1H8VA 2PAEA 2YXSA 5JSOA 3AZWA 1XE8A 2VVEA 2FDGA 2QBXA 1N3QA 2ZEXA 3LPFA 5C33A 1LOAA 3UV9A 2CGNA 2WT1A 4UYBA 1WMEA 2BYVE 5EPAA 1DCSA 2D43A 2YZ4A 3D82A 1QOOA 1E57A 1RUG1 1PGW2 3T4HB 2D6OX 2X29A 1AR63 1PGSA 1NKGA 1NE4A 3MLJA 3LZZA 4D94A 1JZ4A 4EZHA 4PI0A 3GDBA 2Q8OA 3C7EA 3H8RA 2RM21 1HKDA 3LD8A 4DPNA 3IAPA 1ULPA 4IEUA 4A3XA 1NOVA 3M3QA 4MZUA 4CU9A 2JDPA 3AMMA 2HEYF 2HH9A 3LOIA 2A73B 3WP6A 3R4SA 1JYCA 5BUVA 3DXUA 1ULDA 1I5PA 3TOJA 2WZR2 1AR83 2VUAA 1RXGA 2JB4A 3LE0A 2WYFA 1OVPA 4AI8A 4QXKA 3RZKA 4XF9A 3VBRB 4ZONA 4IEPA 3ZLIA 1RUC2 2UYBA 1VRH3 1T6BX 2VCBA 1REEA 4PDWC 1QIQA 1NXMA 1SLLA 2AENA 4PLMA 1UOBA 1RHI3 2J1AA 4RR3A 1YJLA 4IEXA 4L0PA 1OQEA 4FPOB 3VN4A 1XOYA 4XOGA 3H3LA 1VAVA 2DCYA 3O5SA 1RUI2 5EJZB 1TMF3 4LPLA 4BK5A 2P1BA 4XETA 3LA7A 1VBE1 4QU1A 1O3RA 1LGBA 2R6QA 4RN5A 2XBO3 4XFCA 4AFCA 2BGOA 1W2OA 5K7PA 2ATFA 4O65A 5JPNB 3N9PA 3BYWA 5DUVA 1LHOA 4AI3A 5I0UA 4Q4Y1 3O7OA 4QGLA 2R0FA 3H50A 4Z8BA 1OF3A 3OGRA 3MUY1 5HCHA 1EV11 1HQNA 1X9PA 4B7KA 3LGRA 2MEV1 1JBCA 5C71A 5JXGA 5F9TA 1EPWA 2XJQA 1B09A 3PIJA 1G9BA 3UT0A 4IV1A 3N7LA 3WP4A 3ZPOA 2ZMNA 3HQUA 1YIPA 2D44A 4LTAA 4UBGA 5CFDB 1AYM2 1DBNA 1MVEA 1QEXA 1QKQA 3M3OA 1STMA 5CU1A 4DXTA 1UY4A 5K0UB 2WFF2 2WO3A 3HNMA 1VBB1 3MICA 4CDWA 4FTBA 3I2FA 2BWAA 3IAQA 2E33A 2RR12 3K77A 4CDXA 5JCTA 1Q3EA 2DF7A 1W39A 4SBVA 2C5DA 4ZKTB 4CPBA 4FPLA 1RUD1 1S0IA 2BZDA 3JD72 5DZEA 1K5MA 4UFJA 4AFMA 5FRAA 3FHIB 3BU0A 2A7AA 1ULCA 4QX8A 4E2QA 2P3KA 1TME2 2YGMA 1H9WA 1YQ5A 1D2QA 3HMYA 1J3QA 1C4RA 5A70A 1NE6A 4XFFA 1W06A 1YEWA 4I09A 1I6XA 5FY1A 3W59A 2PAKA 5LY1A 4NJ4A 4FPHA 2X10A 3DXTA 4N43B 3UGFA 1EUTA 1FXZA 3THPA 1PM7A 3BCWA 4ZS2A 1REDA 4BE3A 5IAXA 2WKKA 1W2AX 4RQPA 1S0GA 1COV2 3BVCA 4OQ8A 3WF0A 1U5XA 1T2XA 3H8UA 3LF7A 3SKVA 4GMP0 4DXZA 2WABA 5IW0A 1A34A 3T2OA 5L9VA 4BM8A 1KFXL 3PMSA 4YW4A 1RVF2 4H7LA 3ZFFA 4YM1A 4OI2A 1EYBA 3K4DA 3B7MA 1AF9A 1ZX5A 2AREA 4V1PA 5LATA 3UYJA 2WZR3 1QJY3 1UXXX 2P2KA 1WLDA 1YQ8A 3IDCB 1ULFA 3OD0A 4UT5A 1RUJ1 2ADDA 1BBT1 3DYMA 4GWMA 3S0MA 1DYPA 1GZWA 5LBBA 5CA6A 3VDDB 1W04A 2ZACA 1H8TB 5EIYB 2WAOA 3I2HA 3AMQA 4HPKA 4QPIB 2Z69A 3AXEA 5A3MA 4B1MA 4YM2A 3AYAA 1H9PA 3MF9A 4XF3A 3ZFGC 2DCKA 4YNIA 3AP4A 1JOBA 1OLQA 1TVGA 3DPRC 4Q4X2 4QXHA 5A7SA 4B3NA 3OBAA 4CCKA 2GAUA 4Q4V1 4IW3A 4L8QA 4RFT0 2CDPA 2UU8A 3IM0A 4XJWA 4XUQA 3WW4A 5GZCA 3SH5A 4EZ4A 1QOSA 1BEV3 5FO9B 3LQCA 1NA1C 4CPBD 1MZ6A 4P9WA 5C3QA 3WF4A 4LKDA 1YFYA 3OG2A 4DRVA 4FTSA 4JZRA 5F3GA 1AL0G 3E6CC 5J09A 2IUWA 2ZGMA 3E6BA 2EA7A 3ZPYA 4C1XA 4P9GA 4ZPIA 2HWC1 4CXWA 3W5MA 1RUF1 1RIRA 3NJVA 1ND2A 1JTZX 1RXFA 5FQ0B 3NNMA 5FZOB 1GP4A 1NUKA 2VU9A 4JGZA 4X6RB 2I07B 5LZ6A 3MDPA 3ST7A 2W1SA 2IWGB 4ASMB 3EYPA 3P3PA 1DLLA 4YG3A 5T50A 1MQTA 1HX6A 5L73A 4A45A 5BNPB 4R9BA 3UESA 4YFWA 2VZVA 3L2YA 4EWAA 1GP5A 1LB2A 4NIGA 3VBFA 2Y38A 1AR61 1X50A 3L9JT 3MZHA 2FDJA 5FKBA 4WM7C 2WFF3 4CCEA 4FP2A 4PBPA 5FOJB 2VMIA 3LEMA 1PK6B 3M3EA 4QB6A 2P4EA 3CL1A 3HNYM 3VHRA 4AEDC 3TEYA 1HQWA 1XBFA 2XL7A 3BTAA 5F6LB 1CONA 1S2KA 1SCSA 3VD5A 4FPEA 3WG4A 4N9HA 5IK5A 4CDQA 1AR71 5FZ1A 2O0OA 2VZRA 1UY0A 2DURA 1FMD1 1FOD3 3AX4A 3MW3A 1CVNA 4AVBA 4AXOA 2W52A 2R073 1R093 4FAHA 2NLRA 1XPWA 2ZZQA 1AR81 4QAWA 3OYWA 3OPWA 2OUJA 4GULA 1JYXA 1FPN2 1UOFA 1W90A 3SXWA 3CU7A 4NIHA 4QPGB 3V64A 3VHPA 3AJYA 4Q0VA 1OA2A 5FXZA 2BNMA 3THCA 5BXXA 2D40A 2HWF1 4EE2A 1IPKA 1HRV3 1RINA 1SHWB 5ANNA 5E1RA 5K0UC 1COV3 3JU9A 1W6OA 4Z2WA 4P00B 3U14A 3PJYA 2BP6A 2WZEA 1HW5A 5BNNA 2CSGA 1RMU3 1EAH2 1O4ZA 3AP7A 4RD7A 3WF1A 1KDKA 5CKNA 1QWRA 1UKRA 3CHXA 1CAWB 5I0RA 1RYYA 1TMF1 5A7QA 5C5TA 4Q0SA 2YY1A 3I97A 5SV8A 1TEIA 3NV2A 1W6QB 2XBO1 1QXJA 1DGLA 3ILFA 1FV2A 2ZGSA 2QCSB 4DEVA 2A70A 1UYZA 3LFMA 4K1YA 1W9TA 5ISLA 1BJQA 3OPZA 3CMGA 3U07A 1D7PM 4HL0A 3I2GA 4INDA 3I2OA 2ARXA 1LRHA 1VB2A 3LFIA 3I59B 4YGEA 3GGLA 4XTMA 5TSWA 1TNRA 4WBBA 4IEZA 4AAPA 3GHMA 5FMOL 3SEPA 4CU8A 5C9AA 4BQ4A 1H1IA 3D8CA 5L9BA 3AKPA 4GMP3 3PU8A 1PVXA 1U5YA 2R042 1WD3A 3K4ZA 1OOPA 3F95A 5FMOS 1OPMA 4FT8A 4KGQA 1HLCA 4HK9A 4FOYA 2WNEA 5D8AA 2GC2A 4QQ2A 2RG4A 2JKXA 2ZKLA 3O0WA 3H8XA 3GJAA 3E6DA 1XSRA 3GCXA 3AP9A 4LO7A 4FSJA 2R062 5BNOC 2PHWA 4LBQA 5F37A 1DF0A 4XFIA 5C7GA 2PHRA 3B94A 4Y20B 3WUDA 3B3QE 5GKAC 1ZBE2 3NL1A 1Y7BA 3OGJA 3PVEA 3AYEA 4W6WA 5C8CC 4O61A 1IG3A 3V56A 1VRBA 2R1DA 1SDWA 2JKBA 5FAXA 5GLTA 2Q4SA 4ZZ5A 1WCKA 3AP5A 4COYA 1TG7A 3MLLA 1HN1A 1GWKA 1WBLA 3WNKA 5JZGB 5FY0A 4RS5A 3HD8B 4IE5A 1MVQA 3E5XA 1ZZ8A 2UYAA 2VTXJ 2PXJA 4XFBA 4DINB 5FYVA 1YIFA 1VLNA 4Z07A 1JUHA 5FZCA 1U5ZA 1WGPA 5EXOA 4XURA 5ACA3 2D5HA 1GZ9A 2YPDA 3ILNA 1WLTA 3OUHA 1QJY1 3TAYA 3POFA 4XVHA 3VLBB 3WG3A 3J7HA 3NQHA 3ZOIA 2WN3A 2ERFA 1QXPA 2WS93 5FY8A 5FPLA 1JN2P 5FPZA 5LY2A 2J1SA 4LBOA 3O1OA 3GHNA 4KI5M 5EYXA 2LS6A 4NIDA 1DQ4A 1KQRA 3EXUA 1R1ZA 3Q8BA 4FI9A 5KC5A 2H0BA 3CF6E 2X5IC 5A3OA 1QJX2 3LKJA 1UPSA 1V6KA 2VUCA 1NT0A 5CFDC 2VZTA 4LLFA 2ILMA 4Y22B 1SG3A 1MEC2 5CKQA 4ATEA 4LUKA 1JUIA 4PJYA 4EN0A 2Z42A 5JOZA 2Y6LA 1MR5A 4GJZA 3FL7A 1X36A 3VHOA 4B29A 4P9IA 1UMHA 4YZ3A 4ZXEA 1NZIA 2JIGA 3DECA 1QDOA 2VQ0A 1BEV1 3VKLA 4ARXA 5CAZA 4R8HA 3QD6A 2RDNA 1UQXA 2OW4A 1CN1A 1RGSA 2EAKA 2WNUC 1V6LA 4AE2A 4LBQD 3WQ0A 3ACFA 4P08A 4UBHA 4UI9L 3VKNA 4UFLA 2JDMA 4MGIE 2BBVA 4CP9A 1ND3B 2RS51 2VZPA 2OT7A 5DZFA 1OQDA 1XNDA 4D6QA 5LA0A 1W2UA 4N43C 1PHMA 3ETQA 2XQXA 4GH4B 2FZ1A 2BUKA 5FYZA 4A6OA 3E5UA 1GR3A 3FUOA 4XW3A 1W6MB 1LGNA 1Z7S2 3CBNA 5KXEA 3T3YA 3ZMNA 3BKZA 4B8EA 3SH4A 4AQ6A 1JYTA 3THDA 1OD5A 4I01A 1RUH2 4XABA 2R043 5AFBA 3TEZA 1D4VB 1GLHA 3T08A 1QJEA 1OKQA 1YHFA 1UWWA 1J1TA 5EJ3A 5C3SA 2YU1A 3RYKA 3A0KA 4AI9A 3POBA 3AZXA 1DZQA 1ZM1A 4R9DA 5F2WA 1CAXB 3MV11 3GNEA 4L11A 2RS33 3B02A 1GWLA 4JGYB 3SNMA 4AOCA 1FOD1 1BHGA 1LU2A 3U1XA 1WMXA 4NMIA 1O8PA 2E26A 4KNCA 3ES1A 4OFGA 2JDKA 2R071 3BTZA 1R091 4LBJA 1N47A 4QPIC 5F3CA 2RS12 2VBBA 3WQ7A 4BB3A 5T5JA 4ZY9A 2H6CA 5E89A 4AG4A 2B45X 4Y4YA 2Q8DA 4CCNA 4FCAA 1DP0A 4JKMA 2DCZA 4DZGA 2WQ4A 1W3XA 3WDUA 5FXVA 3U4XA 5FYMA 3RZHA 4IV3C 4OVEA 4D0QA 1HRV1 3AYCA 1SMVA 2VXRA 4NE9A 4QM9A 5T55A 5A1AA 1NCRA 2ZGPA 4WZFA 2HWE3 3IWZA 2EF6A 2ZHNA 5FUNA 3WF3A 1J84A 1PMIA 2W3JA 1RMU1 2J7MA 2Y33A 5D2AA 4FQZA 4YVSB 3MUZ1 3N9MA 4W6YA 5T5OA 3VV1A 2GC0A 3JQXA 3ITQA 3T1LA 4CUCA 4O9EA 2H0VA 1OC1A 1H2LA 3GZTB 3OGSA 3LIGA 4FPYA 4IERA 2VPVA 4S2FA 5AC92 1OHFA 1ULGA 2K2SA 4UFKA 3UJQA 1ZZCA 1DIWA 5DMYA 4XCAA 4XE9A 4BQ5A 1DLCA 2ZX4A 4FBFA 3BIWE 4N53A 1BXHA 1WMFA 1LGCA 1QJX3 2P3YA 2XH6A 4RGAA 5FV3A 4BIOA 5AFEA 4XJ9A 5BNPC 1SPPB 1C1FA 1JODA 4AVTA 1C8NA 5F5IA 4RHV3 1UZ0A 2WC2A 2VMEA 4P9XA 5IT6A 4N7IA 1BK0A 2DWRA 5A32B 3J8F3 1AR93 1FATA 2E6VA 2CHHA 3OEAA 1MPXA 2YU2A 1PK6C 4RA0A 4HLTA 5FZEA 3W9AA 3WZ1A 1IPJA 4XFAA 2DCJA 1LESA 2BOIA 4L99A 4UAPA 4GMP1 1UMIA 2GNBA 1JZ8A 2HYKA 4YW6A 2VQTA 1PNFA 1Q8VA 5IVVA 4URAA 1OH3A 2BWCA 5C3RA 3EJKA 4W50A 3T2TA 4N9IA 1CAVA 3WEZA 5HXMA 2D93A 1CAUB 3AKQA 4NOTA 3VBRA 1US2A 1NY72 2CL2A 5T54A 4NPRA 3U10A 3PUHA 4MGSA 3OY8A 2D6KA 2JDYA 3OUJA 4RL7A 3SCFA 5A33B 2QQPA 1WLCA 1XNCA 1L7QA 3QACA 3E97A 4JHZA 4Z82A 5A7OA 1DU3D 1MZEA 2G19A 1W3VA 1YLLA 2JG8B 2RVAA 4K7JA 2GSYA 2IXLA 3N9LA 4PHZA 1IKQA 1O5UA 1AX0A 1PO21 4MLOA 1V9U2 2Q0AA 3ZIXA 3CNAA 1JS9A 1MS5A 5A6XA 2VAUA 4AHZA 3NV3A 3DYPA 4JKKA 1SEFA 2GU9A 1F5JA 1D0GA 4PQQA 1RUOA 3IT8A 3NAPC 2W94A 4XUOA 4I02A 1OUXA 2RDQA 3AKSA 3AJZA 2PLV2 3FX3A 4JQTA 4XFHA 3DYOA 3O1UA 4XQDA 3KV5A 1C8M3 3C2UA 1N1YA 1RJ7A 1VAKA 1HV0A 2HWB2 3VZJA 4D6SA 5ACA1 1H1MA 5LB6A 1W8HA 5IUQA 1NLQA 4PLNA 2VE1A 2YROA 3M7AA 3CJXA 4YW1A 3SCGA 3T2PA 2ZEYA 2RDSA 4NN0A 3X29B 2WS91 1SACA 3ZFGB 4BYYA 4GIQA 3NJYA 3ZFEB 1M4WA 2G9ZA 3MV01 3HT1A 3KV9A 4B4RA 2MNGA 4E4HA 2PHDA 2WLPA 2PN5A 1XJAA 1DQ1A 3B93A 3CJIB 5KC6A 1RUF2 1MS8A 2WFPA 5K8SA 3K3NA 2J1TA 3MI8A 4C0HA 2X8KA 3IDBB 5FPXA 1VBC3 1W6PB 2GC3A 1RC6A 4UW3A 5T3NA 2JE7A 3KM5A 2XUEA 2ZXQA 5IVYA 5FLHA 1A8MA 4D69A 1H6YA 1LCLA 2QE3A 4K3UA 5LA2A 3RMXA 1ODMA 3RZGA 1AL23 3VBSA 1N1VA 5AC93 1W28A 1G9CA 4MGYE 2FZ2A 3WXPA 1W6NA 4XMIA 3PVNA 2WWUA 4DIQA 4F3JA 1ZRDA 3ZMOA 2A6XA 1E5SA 4CDWC 4CDUA 1SZBA 2XJRA 2B5HA 1K12A 2JIJA 2V4VA 3MW4A 4HVQA 2OS2A 3I2KA 3K75B 1R1A1 3RJRA 2CDOA 4QGNA 1LOEA 4TZDA 2GMPA 1SFNA 1XNAA 1ST8A 2V4AA 3KSCA 4IQPA 3RZJA 3VKFC 2SLIA 3I8TA 5F3IA 4M3CA 3HQRA 4MH0E 4LK6A 5IK4A 4AEDB 2B9UA 2UY9A 1S4CA 3A0NA 3AZVA 4HKWA 5JOYA 2ZAAA 2CTVA 4CCOA 2A3YA 3VBUA 2IXHA 2WWSA 3O0XA 2XUMA 4NHLA 1W0OA 3THTA 1GYKA 2E9QA 2VL4A 3MGUA 4MADA 1BZWA 2WQ8A 2GH8A 4S2GA 1NXD1 4JKLA 4CEWA 3LPGA 3T0DA 1UOJA 4TTGA 1JZ5A 2DV9A 2PQQA 1Q5OA 2NM1A 4HETA 3TRSB 2KM2A 2RS31 4YGCA 3ZSLA 1SBEA 2VBDA 4Z2AA 3ZFFC 1WCDJ 3WCRA 1W0NA 2XXZA 4IE4A 3FWEA 4FPCA 4AGVA 5IWFA 3UKTA 4LO5B 2NYYA 1XC6A 1CJDA 1PZ7A 1TNFA 1UL9A 3ON7A 4Y1ZA 3RVHA 2R0HA 3U37A 4QDQA 5AVAA 3HT2A 5HCBA 2GN3A 5CFCB 1XNKA 2AYHA 5J7MA 2P6HA 1V9U3 3PVOA 2WNVB 4R4ZA 2JENA 2XB6C 4ISRA 4FOQA 4RYDA 4XHBA 4CEYA 2QZ2A 1NCQA 2AGSA 3U11A 4XMAA 1FT9A 2WYSA 4QHOA 1W0PA 4WVZA 3N7MA 2XJSA 4D3WA 2HWE1 2IXCA 2DVBA 5FPUA 1V00A 5FYUA 3TEWA 2SBAA 4E8DA 2GP3A 2ADEA 2ZHMA 4LE4A 2OPWA 4CCDA 2CWMA 2LM3A 5GLUA 2XDVA 2DU1A 1GOHA 1ND3C 4LA2A 4BQ1A 2AZ5A 3U78A 4NIAA 2QTWB 2QQMA 3ILRA 2WINB 4GH4C 1ZYBA 3AMHA 5FDBA 3O1SA 2ZGTA 5FP9A 1D4M2 2UY8A 5L7OA 2LTNA 2EXKA 4HN1A 4E2GA 5JAXA 1OSGA 4Q4W3 3JBG3 5FPAA 1UN1A 3OBTA 2AH2A 3LIHA 2LALA 3D6EA 1HIXA 1RB8G 2Y6GA 2R32A 4RHV1 2VD7A 1ND2C 3ZXKA 1IS5A 5FWJA 3J8F1 4JGZC 5APAA 5FUPA 2FBEA 3J9SA 1QGLA 4QMAA 2W47A 2VNGA 1MQTC 3GYDA 3GZAA 2I45A 5BNOB 4J25A 4JGYC 5IYYA 2VG9A 3VBFC 2WT2A 2FDIA 1HDKA 4MXWB 4QXBA 4GZ9A 3WV6A 1NG0A 4K8RB 1LHWA 1JMUB 1I5ZA 5C8CB 1JZ2A 3C3VA 1ZBA2 2XLGA 4OUEA 1QJZA 5FZ8A 5GLWA 3ZIWA 4WM8C 3IZOA 5K4LA 4Z1VA 1A8DA 1AYN3 2HWD2 2X53S 2ZPXA 3KV4A 2GH2A 1VJ2A 2JJ6A 4Q8LA 3UGHA 2DTYA 2QJVA 2W92A 5F32A 3A22A 1WW6A 4CRQA 3V0AB 5EWSA 1UD1A 3S6PA 1E5RA 1UF2C 2CAUA 1F35A 3IBMA 4PBOA 4AGGA 3ZKYA 2BPA2 4M0NA 1HB1A 1CAWA 3Q8EA 4YVSC 3WY6A 1YQCA 4M01A 1XYOA 2B9VA 5FZAA 4Y3OA 5JI7A 1RUE2 2DFCA 2N7GA 3KQ4B 3LB9A 2Z4FA 1LU1A 3WP3A 4AI1A 1V6JA 5EQUA 4FFFA 4JHTA 1F31A 5FY4A 1C8M1 5KHHA 4AVVA 3M3IA 3ROUA 4W4ZA 5DPNA 3WQ1A 3PNAA 4NHKA 4YSFA 4IGOA 4AVCA 2WUHA 2JG9A 2VOWA 3MIDA 2Y60A 1W8NA 2VOXA 2X5IB 1QOTA 5SV5A 3H7JA 1FAYA 3BODA 2AC1A 4R4XA 1PIV2 4P5YA 4GD4A 5GLVA 3TYJA 2W46A 4YZ1A 1S0DA 2J1VA 4ZU5A 4JX0A 5C6CA 1DYOA 5JOWA 1QQP2 3FZ3A 1Y9MA 4E4DX 2DBNA 1S0JA 4MHUA 3RZZA 5A6YA 2RS52 2E31A 5CB7A 4YG0A 2F17A 4V2VA 4TN7A 1PO13 4QT6A 3VBHB 2G9FA 2BFUL 5IAVA 4GJYA 5A7NA 3POGA 5CNAA 1LOGA 1VBC1 2JWPA 2WNUB 3T30A 1D2SA 1GSLA 2E7AA 1H4GA 2ES3A 2BNNA 3Q8AA 1OFNA 2UWCA 4QB1A 3RI9A 3AVRA 4QDSA 2BFUS 4Q1RA 1XU2A 4QQLA 5EHDA 2PHLA 3WSOA 3ZN6A 1V6OA 2VZOA 5T5PA 4AQTA 4EWDA 1PGL2 4NAOA 3V0BA 2RDRA 1AL21 3GALA 4IESA 2GNTA 3WG1A 3KCYA 3KHBA 3RRDA 1BMV1 3WDVA 1OOPC 4COWA 4GALA 2YBSA 1NYWA 4DEQA 5D8AC 3NNGA 1S2EA 1VMFA 1O4TA 2VH9A 1LR5A 2YBKA 3BTYA 1W8UA 4NRQA 2JG8C 4DUWA 4O9GA 1O3SA 3B5LB 2AUYA 5M0TA 3BN6A 5BY5A 1ODNA 5FYBA 5FZHA 3AL6A 3WHTA 3POYA 5LA9A 3VBOB 4YW5A 2RHPA 3PVBB 5KHGA 2ZEZA 4BXSV 1FX5A 5FMBA 3WDWA 3WNXA 2D7FA 4BK4A 4I2OA 3D4KA 1WBFA 2VJXA 2O8QA 2Y6KA 4MVTA 4FPKA 1VBA1 3WDXA 4AF9A 4JDOA 3CQOA 5JDBA 1WCSA 5DAPA 4DOUA 1HXS1 1RUC3 2BERA 2NPIA 5JXHA 5DAWA 1EY2A 2CNAA 4RS5C 4MG2A 1O59A 1W05A 5FPVA 1NLRA 2GMEA 4UW6A 3AKTA 3ZFEC 2PMWB 5HXVA 4FAGA 3J7MA 1U12A 1GUIA 2XKPA 1XE7A 2PTMA 4GAZA 4IV3B 2CAVA 4XF4A 2RV9A 5FK8A 3CJIC 1QDCA 1RUI3 3H0OA 4UWDA 1ZA4A 2R7EB 1LEMA 3T0AA 2A6ZA 1CWPA 5IK8A 5CEHA 2WBKA 3OUIA 4HMZA 2CY6A 1IQAA 4XDOA 4DB5A 1DGRA 1S1AA 4GB31 1SFPA 4YRDA 2O8OA 2JDHA 2VMFA 1LODA 1RUE3 3POSA 3U0ZA 3IB3A 3KT7A 3QH7A 3I3BA 3VD3A 2WO1A 4Y26A 5A7WB 3ZYIB 4M00A 3QH6A 1UZVA 1QMJA 4H7MA 2VM9A 1YQ6A 2ETEA 3VZLA 4YZ2A 2F4LA 3N9QA 2YMZA 4UF0B 4J1WA 1N3PA 4JTNA 5HCAA 5LEJA 2DYCA 4KH9A 4LBNA 3DL3A 3RFRA 3ASIA 1ZRCA 1YRZA 1JHJA 3J26N 1OLRA 3GBGA 5GALA 3GZEA 1AYM3 3RQ0A 4D8MA 3J4UH 3WVJA 3K48A 4B7EA 5LWBA 5AVPA 4GA9A 4K40A 3S57A 5KHJA 3D3AA 5C4WA 2RR13 4X8NA 3VKOA 2ENRA 4BCUA 4Q4W1 4YGDA 3M70A 4FP3A 3JBG1 1HRI2 4NHYA 4MGTA 3ZO0B 1QY4A 2Z5WA 4FOWA 3JD73 2DUOA 1CESA 1AX2A 1ASJ2 1Y9QA 2XKOA 4FXKB 4IEWA 4QPWA 5F5QA 5K9YA 3I3QA 1EP0A 4JRAA 1S0EA 1TME3 3IMNA 4XJ8A 4KWJA 5LEKA 4DUVA 1W8ZA 1NQDA 3FLTA 1OPOA 4HSLA 4XDQA 3ZN5A 4IE7A 1JU3A 3D0SA 3VDBA 3WW2A 5DDJ2 4IETA 2W08A 4C0BA 1K5JA 5I8TA 1BCXA 4JCKA 4I0WB 4AFBA 2C24A 2XR4A 1PNGA 4HXCA 3IPVA 5CVRA 4PDWA 3TN92 2HBTA 2D5FA 2QQJA 1VRH1 1I3HA 1J3RA 4A6SA 2RMU2 1M06G 5G04L 1RHI1 4J6GA 4XUTA 1LOFC 5CFCC 1DQ2A 3IIAA 1RVF3 1WZXA 2WNVC 1AYN1 4A44A 3WCSA 1RTVA 4COUA 4K8FA 2WIIB 3NAPB 2C6SA 4XYXA 4XAEA 1GICA 3NNFA 5FZ3A 1SQ4A 4XJAA 4MXVA 5FY9A 5A1FA 3EO6A 3MLKA 1P8JA 2PQSA 5I8SA 5F2SA 5IATA 4ORFA 2VVDA 1FYUA 4DY3A 3N35A 3KS7A 3MW2A 3RYPA 1DGWA 4OMDA 4B4QA 3VKMA 4HKLA 5A80A 1W2NA 4ZXKA 5C5UA 3KQRA 3I54A 1W9WA 4Q4X3 1Q43A 5FYTA 4CA9A 4EN7B 1DQ5A 2GMMA 4XJUA 5FFOC 2BQPA 5CG9A 3M2MA 2YBPA 4QKDA 3S5QA 2Y6HA 4WZCA 1MS9A 4META 5GLZA 4ASLA 3J7NA 1SPPA 1UYPA 4KL1A 3FC0A 4UFMA 2VOKA 2IXKA 4LO4B 5FR3A 4E9KA 3ZX7A 3FHAA 5GZEA 1QF3A 1A78A 1R082 5JR7B 1ZRFA 4BOWA 1RL3A 4WVMA 3S5AA 4N53C 1PVC2 1AJKA 1EPZA 1ONAA 1J83A 1POV0 1W9SA 1VBD2 2XJPA 1WCQA 3AVSA 4IV1B 1PO11 4Q0UA 1JZ7A 3KCCA 4QHBA 2V5DA 1QNYA 2GC1A 4NR1A 3TB0A 3CEWA 1CX4A 2QQUA 5A3LA 2IVJA 3LA2A 3VUOA 1DGWX 1VMJA 1OUSA 1RJ8A 4CDWB 4GWJA 2JDUA 1LAJA 3RMYA 4DY5A 3ZYRA 2VNVA 2UURA 1IS3A 2VC9A 4PIYA 3K3OA 4QQHA 3TBDA 1C28A 1SFYA 1K5MB 3P5BA 1PGW1 5JMOA 1OF4A 3H3ZA 2QQNA 2VNOA 3AKRA 1AXZA 4URTA 4MSVA 4NAMA 1OLME 1VAMA 1AUYA 3AXDA 3R4UA 2RJ2A 4UOJA 2TUNA 1CZVA 3RG0A 1QJU2 1MS0A 4ZS3A 1VR3A 5EYYA 4OUSA 1ZRIA 2Q1FA 4BLJA 3WD5A 2NQYA 3N7KA 4LULA 4BQ2A 5IVCA 2W0XA 4AWDA 2J22A 1C3HA 1G86A 2RJKA 1S0FA 2EXHA 4OLLA 4RQPB 1MS4A 2WZR1 3RJ2X 4EN6B 3VDAA 4XC9A 1OT5A 3O1RA 2HBUA 1ZVFA 3C7FA 1UKGA 2VNRA 2QQIA 1W8WA 1FPN3 3I2DA 3NKTA 3QCWA 4DFSA 3LDBA 3WDTA 3DV8A 3W58A 3ZFFB 3H1YA 4P9JA 1RUC1 1DYKA 1F4AA 3B00A 3BOPA 4GKXA 3DPRA 3TN93 3VHNA 4DXSA 4LHSA 2DTWA 2VZ1A 2EALA 3MYXA 3ZSMA 4NPLA 2AR6A 4D7TA 4DO0A 3KHCA 3BUCA 1C1LA 1GZWB 5GZDA 5ABJC 4YVWA 4BHPA 1EAH3 2W87A 3OF1A 1X8MA 2ET7A 4XBQA 2C1FA 4HPKB 2E7QA 5A3UA 1RUI1 1NA1A 1RUG2 4L97A 3MFCA 2BEOA 4BWOA 4CU6A 5JIUA 3R4DB 1YI7A 3WNOA 4OULA 2WZ8A 3O0VA 5G05L 3VBHC 4AQSA 2EVXA 2L9LA 3JQWA 2Y0OA 5FWEA 1K45A 4UXAA 2RM22 4I3PA 2C0ZA 4YWAA 4DXRA 3ZYFA 1MS1A 3ETPA 1YI9A 2JB8A 4P9LA 2PHTA 4OI4A 2HKXA 4QGMA 4TWTA 2JECA 3MEPA 4FO9A 4Z92B 2B42B 1AX1A 4CZSA 1OBNA 4MGZE 4BJ0A 5FZMA 3JUUA 1DQ6A 3OOXA 1GOGA 4YFZA 5FLJA 3BB6A 4BA6A 1V0AA 4LUMA 4Y5TA 2OPKA 2DDUA 4XTPA 2QVSB 2FMYA 5ERLA 5I0DA 2K46A 4CUAA 3VL9A 4XUNA 4WM7A 4AR2A 1OD3A 3VBSC 1AYM1 1AVBA 2FMDA 3OTFA 4CP0A 3AMNA 1ND2B 5FZ4A 2WFF1 2ARCA 3WQBA 2C9KA 4JGZB 3VBOC 2VO5A 1WMDA 2RR11 4HZFA 4PI2A 3H9AA 2W2IA 2XONA 4K21A 3WP5A 1MQTB 1Y3TA 1VBD3 3LWCA 2R063 2FCUA 1PMHX 3JD71 3TNPB 4ATFA 3VBFB 4LHLA 2YC2A 1IS6A 1KEXA 4LKSA 1DFQA 5JOXA 2QZ3A 1YXWA 1YJKA 1W8TA 1TME1 3AFGA 3SMHA 1VBE2 5FYIA 1ZBE3 3CZUA 4Y4RA 3ZXEA 5FXXA 4BQWA 3CZJA 1NAEA 5LA1A 2WAAA 4W65A 3OD4A 3QOPA 4WM8B 3PUSA 4Q4Y2 1AXKA 1MZ5A 1Y43B 1KDMA 1Q8SA 1DHKB 2JX9A 3LCPA 1PM4A 5A3TA 4FTEA 1UAIA 3UGGA 2OZ6A 2NN8A 1COV1 3OYWB 1QJU3 1UXZA 3H42B 5CIRA 5IFTA 1EV12 4FOVA 2MEV2 1CJPA 4BQYA 4K9SA 5FOBB 3OJBA 5KHKA 1RVF1 2WQZC 2RJLA 3MIEA 3USUA 3ACIA 3M4FA 5A3PA 5KBFA 2JDNA 4I0AA 1POV3 4XQ4A 5FPBA 1PMJX 1S0CA 5FJKA 4OHZA 1W6OB 4P9YA 4SLIA 1ENSA 5LRRA 1VBB2 5BNNB 4MX3A 4WV8A 4BXFA 3W20A 1WD4A 2XVLA 4UFIA 4CEYC 1RUD2 4UW5A 1H2MA 2QFEA 3SITA 3HR9A 4X6QB 3I2JA 1UX7A 4BDVB 4Q4X1 1LULA 1MEC3 2FCTA 1L7RA 1B35C 4Y5Z0 3NSTA 2NMOA 3JB4C 1Y4WA 2R16A 2YUEA 2G4IA 3TWIA 3EHKA 1RUG3 1FI2A 4E4SA 2BGPA 1XQNA 5IHRA 2QUOA 2WDBA 2XJVA 3ALQA 3HNBM 4AQ2A 3VD4A 3I3MA 3PHMA 3NV1A 4A3ZA 5F7UA 3HOBA 4NIIA 3A4UA 1YFXA 1KITA 1WLWA 4FFHA 2ARBA 3QBQA 3EQEA 5T5LA 5C9AB 4I3GA 2IZWA 5FP7A 3MHZA 1OOPB 4WVVA 4A42A 3D0JA 3WT3A 5IFPA 5D8AB 4C91A 4DRRA 2EXJA 4B1LA 1RUJ2 2JD9A 1BBT2 1Z7S3 2D3SA 2JICA 3U4SA 2ZCWA 5F5CA 2ZZJA 1RUH3 2VZUA 3ECQA 1V70A 3P3NA 1WW5A 1HXS2 4LBQB 4PIXA 5C3OA 1UY1A 1OMIA 4NUBA 4JQRA 1CZTA 3O1VA 4QKNA 4EN8B 2YFUA 4BIFA 4FQ4A 5DUXA 4IDZA 4R9AA 3FN9A 2ZGRA 4RFRB 4YPJA 2BW8A 2D6MA 3VL8A 4Q4V2 1GFF2 2J1UA 5F39A 4RR3C 4Y1XA 2GZWA 2OIIA 5J1XA 2VMCA 2VUDA 4OYUA 4KGGA 4ONUA 1DG6A 5E6HA 5F6KA 3ZN4A 3T0BA 5F1RA 1RUNA 2UWBA 4XF0A 2A1XA 4LJHA 4KMQA 3ENRA 2Y6FA 2RS13 2TNFA 3B01A 4RS5B 1VE0A 2HJIA 1JH5A 5FY5A 3C7OA 1ACCA 2B4KA 3HBZA 3PJQA 2OX0A 1FPN1 4IEVA 2VCCA 3WX5A 3ZSJA 1J59A 1CIYA 1OA3A 2VMDA 2A6VA 2X5IA 4IE6A 5A3NA 4QD2A 3MPPG 5CFDA 2HWC2 4ET7A 4LITA 1EV13 3AP6A 2OQ6A 2MEV3 3RWKX 3VGIA 2JDZA 1JZ3A 3VDCA 1EAH1 1R64A 2WSUA 1LHUA 2Q8EA 1GQHA 3RNSA 3DGTA 2BRTA 1V6NA 3RSJA 3RWNA 1KS5A 4E4ZA 4IV1C 2QNKA 5I93A 2NMNA 1AR62 4R9CA 4D6RA 4BISA 1H30A 4Y24A 1UYYA 4LBKA 3K2OA 2EAAA 3PUIA 5HCFA 4IGPA 4CDXC 4BMEA 2BDRA 4XEZA 4N43A 1AR72 2XJUA 5CYYA 3NKGA 2OVUA 1FMD2 2IFRA 4LIVA 4XIKA 1K5MC 1O5LA 2CGPA 5FYHA 4EWEA 2IC1A 1OFSA 1SBDA 2XGXA 4IXLA 3ZXLA 1AR82 2LRPA 3GXUA 1QJFA 2JD4A 2Z2SB 3P1IA 4OUMA 1CZSA 4CP1A 1XNTA 4CP9B 2HEVF 2Z79A 4L2NA 1JOPA 1C57A 3ZDSA 2R041 3W5NA 2ZX2A 2HWF2 5LBFA 2ZJCA 2HYXA 4CU7A 4QHZA 3LAGA 4XPVA 3NVCA 2XMLA 2DVAA 4RQPC 2VMHA 3KMHA 5LBEA 3OSDA 4GQ7A 4LOTA 3VZMA 3PMEA 1V6MA 4DQAA 3JZVA 1H4HA 3FHQA 2AACA 3U75A 3VDDA 2R061 3BPZA 5GM0A 1H8TA 4M3CF 5H9PA 4WVWA 2CGOA 2K9ZA 2ZGKA 5FBZA 4QPIA 1SLAA 1TMF2 5FMDA 3OCPA 2XPJA 3H7YA 4XILA 1ZBE1 4NHXA 2XBO2 1UU5A 3KT1A 1BBT3 1IG0A 4GKYA 2ZAHA 1BLZA 1GANA 4MHRA 5LASA 3H8OA 2AEYA 2ZX1A 1KJLA 1TZOA 4Y5SA 1ZRRA 4COVA 4IE0A 1LJ7A 2YC4A 2EIDA 5FZ9A 2DVFA 1APNA 5J98B 3SQOA 2EIGA 3H1MA 4QPYA 1G8WA 4KWUA 2GNMA 2PLV3 4HSJA 5J37A 5A6QA 4Q4V3 1UNBA 3UKNA 5JLVA 2ID4A 2HWB3 2GNDA 3PTYA 2VMGA 4H55A 5D21A 4J1XA 5JXJA 3KT4A 1POV1 4JRLA 4MV2A 3WDYA 3AB0A 1KRIA 4LBMA 4QQPA 5HI0A 5FQ0A 3OPTA 4HOOA 4N8MA 1NCRB 4MYEA 5FZOA 4CP2A 5L9RA 2W68A 3LEIA 1XYPA 3WNMA 1J58A 5H9SA 2OQ7A 3S30A 5KXBA 2VCAA 3ME2A 5FZKA 2IVIB 2PYTA 5BNPA 4B4PA 2R1BA 2W1UA 4P14A 4QX1A 3O12A 3MIHA 3ZYJB 2WO2A 1QJX1 3DKWA 4ASKA 5B2GB 2WZPP 1RUF3 1HJGA 1TE1B 2KR2A 5FO7B 2WNOA 4W8JA 4AL9A 1LHVA 1MEC1 3G7DA 1PK6A 5GJ6A 1AR91 2E32A 4LR4A 1I1EA 4Q5OA 1OURA 4HN0A 4YM3A 4N53B 4RSUA 1K3IA 5L19A 1W8FA 4LK7A 4YZ4A 4AYUA 5ANQA 1Z78A 3UKVA 1XE0A 5C8WA 1GMMA 3BPSA 1UOGA 3N9OA 4CCCA 3MIBA 4U2AA 5CG8A 2GDFA 3NWKA 4Q0PA 4XZPA 3WOGA 5I91A 3DEMA 2VZSA 1E5IA 3AMPA 3APBA 3INAA 5C4WC 1OXCA 1AR73 2YV8A 4QPGA 3PDQA 3FE5A 1FMD3 2R30A 4NVPA 4CDQC 2QQWA 3HAGA 4CSWA 5FCCA 1PX4A 5I0TA 5FZ6A 5L36A 1QJY2 2VQAA 3C7HA 2ZGUA 5B4NA 4E8CA 1F4HA 1YFUA 5EJ1B 5A3WA 1QH6A 2Y8KA 1Z7S1 5FYCA 2PA7A 2VECA 2ZX0A 2DUQA 4PCRA 5KXDA 1C5IA 1CIWA 2JDAA 1CAVB 1HJFA 2D3PA 2JEMA 3HQXA 1RUH1 2QQVA 5KWRA 1ZREA 1MZFA 2ZOEB 3CIHA 1O3QA 2HWF3 3O14A 4AI0A 3RZLA 1CPNA 2A75A 3OY8B 1G7YA 3NAPA 4XF1A 3AL5A 2BVVA 1IZ3A 4A4AA 4BH9A 3I3EA 2W9XA 3FMGA 3ES4A 5FREA 3KVAA 3SCHA 5DUWA 1W6QA 1VMHA 1AZDA 3LDKA 4HG6B 1YC61 4QX3A 1OKOA 5B4XA 1H0BA 2EIBA 3LEKA 3UNPA 2E63A 5BNNC 3RGBA 1JYIA 5CISA 3KGLA 4E2SA 2ZMLA 4KWLA 1BQPA 4YGBA 3WHUA 2HLEA 4OCTA 1BEV2 1DQ0A 1EUUA 1UPIA 2RS11 5DUUA 3I59A 1AHSA 1ZNPA 2DVDA 4NPMA 4NROA 5FZIA 3WINE 1SLTA 3HN3A 3KLSA 5ABJB 4YYOA 3IKWA 1UIJA 3SH3A 5FTTC 4YZ5A 2DVGA 4HFSA 1UZYA 3UK9A 4A7KA 5FZLA 2QDNA 4E27A 2WLQA 1XU1A 4XBNA 3A21A 4OHVA 2VY0A 1GU3A 4U36A 2ZMKA 1OH4A 1WWYA 1UCXA 1WA4A 1BYHA 3NV4A 4W6XA 3RI8A 5A6ZA 2R49A 5GZFA 1QXRA 2QKDA 2BJSA 3Q8FA 4M0HA 5C9AC 1AXYA 1JOJA 4KG0A 2XVKA 5AC91 2ZBJA 4Y20A 4ZU4A 1UX6A 5J48A 1KD7A 3OEBA 3RDIA 3PURA 5IVEA 2KD7A 1YWKA 2VCMA 2YYOA 1D4M3 4BZ4A 1WUVA 5E8AA 4YW3A 2GN7A 4BQ3A 1Q8PA 2BGCA 2P5BA 3R05A 4ZU7A 4MUVA 3AK0A 4FVVA 1V6IA 1FOD2 1HQLA 3VBSB 3WNPA 4MO3M 1WA6X 1U0AA 2PHUA 2R072 1R092 2BBAA 1W6NB 4OZXA 4XUPA 4AFAA 5JZGA 5LW9A 1ZZ7A 1ULOA 4CDUB 1U5IA 2EXIA 2P34A 2FCVA 2OKXA 2XLAA 3ZR5A 1W99A 2CU5A 2W1QA 2ZHLA 1GP6A 2YFZA 3K46A 1GNYA 3AC0A 1HRV2 5JIAA 3S7IA 4CE8A 3GZUC 4N90A 2QQOA 4AEMA 4DNYA 2UWAA 4M3CB 1DDLA 2ET1A 1IKPA 3BI3A 3KB5A 3POIA 4A7YA 1O7FA 3ACLA 1A6CA 1RMU2 4Q29A 3VBUB 3Q8CA 4LIUA 1ALYA 3SC7X 1ZBA3 3KVBA 1NY71 1W9YA 1LECA 4YW2A 1F8VA 5BYNA 4AAXA 2HWD3 4NRMA 2GP5A 2A3XA 2PHFA 4CEWB 1X7NA 4Q0QA 1X9TA 2HEWF 4Y22A 2YHJA 4L92A 2YC0A 4K6BA 4PIZA 3ZYBA 3L2HA 1GQGA 1V9U1 4G3YC 4JV4A 3RYRA 2J1EA 2ARAA 3KV6A 4EV0A 1Y9GA 2V73A 3W21A 3AZYA 4TXWA 3ZSEA 4C8DA 3O1PA 3AYDA 3RZMA 2B7YA 4YW7A 5LCWL 3CKHA 3HIFA 4O7XA 2PLV1 1URXA 1J3PA 2CWSA 2XWJB 2ZS6B 4HANA 4XACA 1JYNA 4FFIA 3PIGA 4LOSA 3KF5A 2I74A 1OI6A 4XFGA 4YVWC 5FZBA 2HWB1 3V65A 3SISA 1ENRA 1HB2A 1ND3A 4CEYB 4Q27A 1NCQB 1XB9A 2CV6A 2D97A 4PF5A 3ZYGA 3E5QA 3I7DA 4GH4A 1YNAA 2A5ZA 2WA4A 3DUIA 1PIV3 3NJZA 3MO4A 2ZEWA 1B35B 1W6MA 1QQP3 3HN1A 4ISQA 3KWVA 2RS53 2G9GA 3A23A 1L3JA 1G9DA 1IOAA 1QU0A 5LK5A 4C1WA 2IFWA 1WW4A 3HBKA 2FDFA 2VW2A 3HVDA 4KWKA 4Q26A 5L7OB 2G1MA 3WNNA 1CAXA 4LHKA 2V09A 1JI6A 1PO22 2Q8CA 4JGYA 3N9NA 5A7PA 5IVBA 3T4VA 1F2NA 3I2IA 2XWBB 2TBVA 1UZWA 1HN0A 3EB7A 3E1F1 4YM0A 4CUBA 5H9QA 1ZZBA 2FDKA 3PTRB 2P3JA 2WR9A 1PX3A 2DFBA 2H6BA 4AK3A 5HV0A 1LENA 4WM8A 5FP8A 4FPJA 4ZZ8A 2PELA 5FZDA 4QKBA 1G9AA 5ACA2 1O8SA 3I4IA 2P17A 4S2DA 4RGKA 1SLIA 2AEZA 4LLOA 5FO8B 2JE8A 3NNLA 2WS92 3PUAA 2QQKA 4OHWA 1Q56A 3IDAA 3ZVXA 1KJRA 3VZOA 3GF6A 4YVSA 4RR3B 4LNVA 4OMCA 1VIWB 2C26A 2DUPA 4JDNA 2B39A 2JE9A 1XNBA 5FJHA 2Q5TA 4MGKE 3LSEA 1I9RA 4XXPA 3VZKA 2F4PA 4OHXA 1UW8A 3IN9A 5FYYA 3ZKUA 2GALA 4LORA 1CD3G 1QH7A 1K42A 2ZGLA 4KBBA 2FD8A 4XDPA 1NCRC 3FUQA 2VULA 4HK8A 5BPXA 4CCMA 1XXNA 4F8AA 5DXDA 1MS3A 2IXJA 2Y26A 4PLOA 3NNJA 2XHKA 3HJRA 4NRPA 3WLUA 4CCLA 1JZ6A 5IVFA 1X33A 5DZGA 1BKZA 3BU7A 2O14A 2B8MA 5A32A 3EBRA 2ZGOA 4BLIA 4CXYA 4OQ9A 2JG9B 1R1A2 5HPOA 4GWIA 4MOAA 1US3A 1ZZ6A 1GNHA 3OGGA 4QQOA 4QX7A 3SHRA 3MIFA 1J1LA 1UO9A 2ZHKA 4CUGA 3JB8A 4H2AA 4CTEA 3BOWA 1JU4A 1BVVA 2D6PA 1IPSA 5DG1A 4CDXB 1CAUA 1WKYA 2Q1MA 2Y6JA 3UL2A 1O4YA 5A1LA 4HVOA 4JVAA 1GWMA 5IK7A 4PT6A 4EN9B 1IS4A 1WW7A 2XL9A 5A33A 1IQDC 3ZM8A 4XAAA 4Y1YA 1BVP1 2MPFA 1D4M1 2JG8A 3POEA 5JSRA 3ZXDA 3ZN6B 1FNYA 4XZUG 2RS32 1BK1A 2TEPA 3HEIA 3T2QA 3ZXJA 1E5HA 1HRI3 2OZJA 4BPZA 3V0BB 1Q8QA 1YFWA 1L7LA 5FZ0A 2X09A 3VBRC 4A7ZA 3NW4A 5FIXA 1LOBA 1ASJ3 2A6YA 3DF0A 1ULEA 2D6NA 5CBLA 3M8LA 2I2SA 1N3OA 4LA3A 1C5HA 3WF2A 1PO23 1GZCA 2YDEA 3DCQA 3NRUA 4R52A 4P02B 1GBGA 4LE3A 4BQXA 3MF6A 1GQPA 5DDJ3 4EROA 4QDRA 1ZA7A 1YO8A 4TSVA 3ZFGA 3DKQA 2HWE2 3ABZA 2J1RA 2VOTA 4H3WA 3ZR6A 3ZFEA 5DN2A 2RMU3 4QKFA 3ZYHA 1ZBA1 4KQ7A 4PQ9A 1JXNA 1OQ1A 2P6CA 3VZNA 1GV9A 2A71A 3CJIA 2HWD1 2YG0A 1G6NA 4G4FA 4FFGA 4F7ZA 3KF3A 2NZ9A 2WSVA 3EMRA 3S7EA 3O1TA 3WR0A 4C90A 1W6PA 2VTFA 2W91A 4M3CE 5JSPA 2WN2A 4IL7A 4JTOA 3AZZA 1NZCA 3IMMA 4LKEA 4A2UA 2P37A 2KA3A 1UIKA 4AI2A 1RUE1 4LEJA 2ZGNA 5LRSA 4EQVA 3URFA 4RHV2 1VP6A 2XJTA 1PZ8A 2XOMA 2D6LX 4TLFA 2VVFA 5FLIA 5HV4A 1MACA 1H2KA 1W8OA 1AR92 3J8F2 2LROA 1UMZA 3POWA 4IEQA 2VW1A 4QX0A 5LBCA 1S55A 4QX5A 3USSA 2VTXA 3O1MA 2CYFA 2Y64A 4S2HA 4I30A 3PU3A 2C9AA 2JXAA 5CADA 3ACHA 4QM8A 2WL1A 2W5FA 3MFAA 4LXLA 5FUIA 1UY2A 3ZXGA 2RE9A 1PIV1 2ZTNA 4N7UA 2WWJA 4CYDA 4AEDA 4EYUA 1RITA 1QQP1 5F8PA 1R083 1NX9A 1S0BA 4CDUC 1R1A3 3JCIA 3WW3A 4Y1VA 4EJRA 1JW6A 1PVC3 5KHIA 3H3UA 4TYSA 3G6JB 4HBNA 4UFHA 4YG6A 4KU8A 3P6BA 5FZGA 1GKBA 3UETA 1KS4A 1HB4A 1SCRA 1UY3A 5FKCA 4NWWA 5FMCA 2VUJA 5DAVA 5FYSA 5J36A 1YUDA 3IIIA 5FBJA 5C4WB 3PLQA 1PGL1 3BGAA 3AM2A 4AHXA 2W95A 3ATGA 5T52A 3VBUC 2EIEA 4XXAA 2E51A 1W03A 3PL0A 4CDQB 3PUQA 1LKNA 2XG3A 4D7SA 1H6XA 1UU6A 2PFWA 4UW4A 5K0UA 4P5HA 1WCUA 2PHXA 1GNZA 4CEWC 2E7TA 2E53A 1LOFA 5CFCA 1C8M2 2LUWA 4AW7A 2VXJA 3CDZB 3ORJA 4YARA 2VGDA 2WNVA 1SBFA 1ZZ9A 3VDDC 1H8TC 2BV4A 2ZABA 4HT1T 1A3KA 2Q30A 4AEKA 5H9RA 5DAQA 2BOJA 5C70A 4RGGA 1TQ5A 3IPVB 4PDWB 2O1QA 3N4MA 3A7QA 2YGLA 2Q1ZB 2QDRA 4F83A 3LSDA 2YB7A 5D1IA 3C8XA 5E16A 4AGRA 3KGZA 1LNSA 4YLZA 3GCWA 3POJA 1CX1A 2OUHA 2XVGA 4XQWA 3WUCA 2BU9A 4M4PA 4ES8A 1NCQC 2D3RA 1AJOA 4Q1PA 1VBC2 2BVBA 1O6UA 4NHMA 1LEDA 3I3DA 5JXIA 1REFA 4IEOA 3OGVA 4Q8KA 5EP9A 3ZYPA 1UYXA 3K4AA 5E88A 4IGQA 1AL22 3N7JA 1XRUA 3WNLA 3FJSA 1BMV2 3ACGA 2Y0IA 3F2ZA 3CO2A 3ZXAC 1KFUL 2A6WA 1N1SA 4ITCA 4X8PA 2VOVA 3OBZA 1XYNA 2RM23 2OYZA 1SDDB 2C4XA 5L7OC 3B9CA 5FP3A 1VPHA 3GM8A 4LO6B 5BNOA 1NQJA 3B9IA 4LBLA 4FPGA 2BTVC 4GWNA 5JVVA 3FBMA 4AVSA 4ARYA 4AHYA 1CGPA 4MXWA 3BALA 3LEGA 4QB2A 2VW0A 2ORZA 3H1WA 4OZOA 4QU2A 4CVUA 5C8CA 1CQ9A 3SLIA 4WVMB 3ZSKA 4AVAA 1VBA2 4HKOA 1NLSA 4LMFA 3QLQA 4OI1A 3BIEA 2DBIA 2B46X 2FHRA 4A41A 3HPNA 2VZ3A 4QX2A 2X05A 5F3EA 3VD9A 4D7YA 1Z0HA 2QQLA 5GZGA 4JDMA 2Y34A 4L9BA 4PF1A 3D5OA 3V0AA 3ZDVA 1X82A 2VQUA 4QXCA 1HRI1 1X8EA 2D98A 3FBYA 4LKFA 4LQRA 4KBZA 4QPGC 5IVJA 4G9SB 2IXIA 3BTXA 1ASJ1 1CPMA 4LO8A 4OI0A 3ELNA 3R0RA 5BV6A 2DU0A 3DN7A 5DQ0A 1IHMA 1VBE3 3CLPA 3M1HA 4XBLA 3AFKA 5FK7A 3UJOA 2NP0A 2ORXA 5FXWA 3LOBA 5FZFA 4CXXA 4K1ZA 4GB32 5DDJ1 3FLRA 3N36A 4Q4Y3 1OVSA 2WA3A 4ZHNA 3VB9A 2V5YA 4IEYA 3TN91 3T09A 5HBAA 2XQRA 5JR2A 5FZ7A 2RMU1 3GBWA 2WT0A 5ABJA 3RPQA 1XSQA 3R6SA 1HB3A 3KD4A 5JWPA 1N1TA 2A3WA 4COZA 2JG9C 2VBPA 4AZZA 4DMIA 1OLMA 3MBWA 5BNQA 4KG8A 1W2TA 1F5FA 1D0HA 3DPRB 3VBHA 1H2NA 2WNUA 4K20A 5DAXA 3JXSA 3GBFA 1VBB3 1LOCA 2LW8A 2ZKNA 3B69A 2ZGQA 3HWJA 4JAAA 4Q2FA 5EV7A 4YVWB 3SEEA 3ZXFA 4Q4W2 5KXCA 5KR7A 2VR4A 3JBG2 3N3HA 4CCJA 4FPFA 4M4RA 1RUD3 4LT5A 2WRAA 1NA1B 3NO8A 1UZZA 5JUVA 1SLBA 2FQPA 3SKJE 1S2BA 2PAMA 1F15A 5C3PA 5J3UA 1UU4A 3OBRA 4IUGA
chains in the Genus database with same CATH topology
4OQ8A 1ZA7A 1STMA 3J7LA 1JS9A 1YC61 3J7NA 4NIAA 1A34A 4OQ9A 3J7MA 1CWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OQ8 A;  1ZA7 A;  1STM A;  3J7L A;  1JS9 A;  1YC6 1;  3J7N A;  4NIA A;  1A34 A;  4OQ9 A;  3J7M A;  1CWP A; 
#chains in the Genus database with same CATH topology
 3C7G A;  2K0G A;  4OHY A;  2OA2 A;  3MPB A;  3T1M A;  3FFQ A;  2XHN A;  4XCB A;  5J96 B;  1YQ2 A;  2MHF A;  2ZX3 A;  2DCT A;  2WO7 A;  4NO4 A;  5F5A A;  3J7L A;  5EFU A;  1F9K A;  1KGY A;  3KCX A;  2XLF A;  1VB4 A;  4XJZ A;  5DG2 A;  3VBO A;  1VRH 2;  3TEX A;  4TLG A;  1R08 1;  4QWN A;  4JC1 A;  1RHI 2;  2V72 A;  5FY7 A;  3Q9O A;  1LHN A;  1PVC 1;  4LHN A;  3M3C A;  1VBD 1;  4BU2 A;  5JPM B;  1AYN 2;  4WM7 B;  1QNW A;  1DZT A;  5I8Y A;  4AHW A;  1GOF A;  5JZG C;  1HV1 A;  1Q8O A;  1SLC A;  3LA3 A;  2YPJ A;  2EIC A;  4HON A;  4XHX A;  5LK7 B;  1JYW A;  1T6G C;  1RUJ 3;  1FV3 A;  2WJS A;  4MGQ A;  3NJX A;  1OA4 A;  1VBA 3;  1O91 A;  4Y33 A;  3I49 A;  3IDE A;  5CKM A;  3VD7 A;  3KZ4 C;  1QHD A;  3K51 A;  4IV3 A;  1HXS 3;  4DS0 A;  4HVR A;  5JI9 A;  4FXG B;  4H14 A;  5FP4 A;  2BNO A;  5CZK A;  1QJU 1;  4Y1U A;  3FFZ A;  1ENX A;  4V2W A;  5EZW A;  3WW1 A;  1IGO A;  1CR7 A;  1POQ A;  2KXL A;  1G9F A;  1YCI A;  3RS6 A;  5I0S A;  3FLP A;  1H1A A;  1ENQ A;  2W1W A;  2ZA9 A;  3WG2 A;  1YYN A;  1VAL A;  2VZQ A;  2W39 A;  5A7W A;  1O3T A;  1JHN A;  3OB8 A;  4BMB A;  4AEJ A;  4UF0 A;  1JYV A;  5DAB A;  4DUX A;  1PZ9 A;  2J42 A;  3NMB A;  4XIO A;  5IJR A;  2FDH A;  1GZT A;  3MIG A;  4GB3 3;  2F6B A;  3USU B;  4AFD A;  3GJB A;  1W9F A;  3LDR A;  3TNQ A;  2P3I A;  1LTE A;  1PO1 2;  4KU7 A;  1KXG A;  4ES9 A;  4GXL A;  2OXB A;  5JMC A;  2HWC 3;  4NWV A;  1DGR N;  1DZR A;  1B35 A;  1FNZ A;  4I0B A;  1H8V A;  2PAE A;  2YXS A;  5JSO A;  3AZW A;  1XE8 A;  2VVE A;  2FDG A;  2QBX A;  1N3Q A;  2ZEX A;  3LPF A;  5C33 A;  1LOA A;  3UV9 A;  2CGN A;  2WT1 A;  4UYB A;  1WME A;  2BYV E;  5EPA A;  1DCS A;  2D43 A;  2YZ4 A;  3D82 A;  1QOO A;  1E57 A;  1RUG 1;  1PGW 2;  3T4H B;  2D6O X;  2X29 A;  1AR6 3;  1PGS A;  1NKG A;  1NE4 A;  3MLJ A;  3LZZ A;  4D94 A;  1JZ4 A;  4EZH A;  4PI0 A;  3GDB A;  2Q8O A;  3C7E A;  3H8R A;  2RM2 1;  1HKD A;  3LD8 A;  4DPN A;  3IAP A;  1ULP A;  4IEU A;  4A3X A;  1NOV A;  3M3Q A;  4MZU A;  4CU9 A;  2JDP A;  3AMM A;  2HEY F;  2HH9 A;  3LOI A;  2A73 B;  3WP6 A;  3R4S A;  1JYC A;  5BUV A;  3DXU A;  1ULD A;  1I5P A;  3TOJ A;  2WZR 2;  1AR8 3;  2VUA A;  1RXG A;  2JB4 A;  3LE0 A;  2WYF A;  1OVP A;  4AI8 A;  4QXK A;  3RZK A;  4XF9 A;  3VBR B;  4ZON A;  4IEP A;  3ZLI A;  1RUC 2;  2UYB A;  1VRH 3;  1T6B X;  2VCB A;  1REE A;  4PDW C;  1QIQ A;  1NXM A;  1SLL A;  2AEN A;  4PLM A;  1UOB A;  1RHI 3;  2J1A A;  4RR3 A;  1YJL A;  4IEX A;  4L0P A;  1OQE A;  4FPO B;  3VN4 A;  1XOY A;  4XOG A;  3H3L A;  1VAV A;  2DCY A;  3O5S A;  1RUI 2;  5EJZ B;  1TMF 3;  4LPL A;  4BK5 A;  2P1B A;  4XET A;  3LA7 A;  1VBE 1;  4QU1 A;  1O3R A;  1LGB A;  2R6Q A;  4RN5 A;  2XBO 3;  4XFC A;  4AFC A;  2BGO A;  1W2O A;  5K7P A;  2ATF A;  4O65 A;  5JPN B;  3N9P A;  3BYW A;  5DUV A;  1LHO A;  4AI3 A;  5I0U A;  4Q4Y 1;  3O7O A;  4QGL A;  2R0F A;  3H50 A;  4Z8B A;  1OF3 A;  3OGR A;  3MUY 1;  5HCH A;  1EV1 1;  1HQN A;  1X9P A;  4B7K A;  3LGR A;  2MEV 1;  1JBC A;  5C71 A;  5JXG A;  5F9T A;  1EPW A;  2XJQ A;  1B09 A;  3PIJ A;  1G9B A;  3UT0 A;  4IV1 A;  3N7L A;  3WP4 A;  3ZPO A;  2ZMN A;  3HQU A;  1YIP A;  2D44 A;  4LTA A;  4UBG A;  5CFD B;  1AYM 2;  1DBN A;  1MVE A;  1QEX A;  1QKQ A;  3M3O A;  1STM A;  5CU1 A;  4DXT A;  1UY4 A;  5K0U B;  2WFF 2;  2WO3 A;  3HNM A;  1VBB 1;  3MIC A;  4CDW A;  4FTB A;  3I2F A;  2BWA A;  3IAQ A;  2E33 A;  2RR1 2;  3K77 A;  4CDX A;  5JCT A;  1Q3E A;  2DF7 A;  1W39 A;  4SBV A;  2C5D A;  4ZKT B;  4CPB A;  4FPL A;  1RUD 1;  1S0I A;  2BZD A;  3JD7 2;  5DZE A;  1K5M A;  4UFJ A;  4AFM A;  5FRA A;  3FHI B;  3BU0 A;  2A7A A;  1ULC A;  4QX8 A;  4E2Q A;  2P3K A;  1TME 2;  2YGM A;  1H9W A;  1YQ5 A;  1D2Q A;  3HMY A;  1J3Q A;  1C4R A;  5A70 A;  1NE6 A;  4XFF A;  1W06 A;  1YEW A;  4I09 A;  1I6X A;  5FY1 A;  3W59 A;  2PAK A;  5LY1 A;  4NJ4 A;  4FPH A;  2X10 A;  3DXT A;  4N43 B;  3UGF A;  1EUT A;  1FXZ A;  3THP A;  1PM7 A;  3BCW A;  4ZS2 A;  1RED A;  4BE3 A;  5IAX A;  2WKK A;  1W2A X;  4RQP A;  1S0G A;  1COV 2;  3BVC A;  4OQ8 A;  3WF0 A;  1U5X A;  1T2X A;  3H8U A;  3LF7 A;  3SKV A;  4GMP 0;  4DXZ A;  2WAB A;  5IW0 A;  1A34 A;  3T2O A;  5L9V A;  4BM8 A;  1KFX L;  3PMS A;  4YW4 A;  1RVF 2;  4H7L A;  3ZFF A;  4YM1 A;  4OI2 A;  1EYB A;  3K4D A;  3B7M A;  1AF9 A;  1ZX5 A;  2ARE A;  4V1P A;  5LAT A;  3UYJ A;  2WZR 3;  1QJY 3;  1UXX X;  2P2K A;  1WLD A;  1YQ8 A;  3IDC B;  1ULF A;  3OD0 A;  4UT5 A;  1RUJ 1;  2ADD A;  1BBT 1;  3DYM A;  4GWM A;  3S0M A;  1DYP A;  1GZW A;  5LBB A;  5CA6 A;  3VDD B;  1W04 A;  2ZAC A;  1H8T B;  5EIY B;  2WAO A;  3I2H A;  3AMQ A;  4HPK A;  4QPI B;  2Z69 A;  3AXE A;  5A3M A;  4B1M A;  4YM2 A;  3AYA A;  1H9P A;  3MF9 A;  4XF3 A;  3ZFG C;  2DCK A;  4YNI A;  3AP4 A;  1JOB A;  1OLQ A;  1TVG A;  3DPR C;  4Q4X 2;  4QXH A;  5A7S A;  4B3N A;  3OBA A;  4CCK A;  2GAU A;  4Q4V 1;  4IW3 A;  4L8Q A;  4RFT 0;  2CDP A;  2UU8 A;  3IM0 A;  4XJW A;  4XUQ A;  3WW4 A;  5GZC A;  3SH5 A;  4EZ4 A;  1QOS A;  1BEV 3;  5FO9 B;  3LQC A;  1NA1 C;  4CPB D;  1MZ6 A;  4P9W A;  5C3Q A;  3WF4 A;  4LKD A;  1YFY A;  3OG2 A;  4DRV A;  4FTS A;  4JZR A;  5F3G A;  1AL0 G;  3E6C C;  5J09 A;  2IUW A;  2ZGM A;  3E6B A;  2EA7 A;  3ZPY A;  4C1X A;  4P9G A;  4ZPI A;  2HWC 1;  4CXW A;  3W5M A;  1RUF 1;  1RIR A;  3NJV A;  1ND2 A;  1JTZ X;  1RXF A;  5FQ0 B;  3NNM A;  5FZO B;  1GP4 A;  1NUK A;  2VU9 A;  4JGZ A;  4X6R B;  2I07 B;  5LZ6 A;  3MDP A;  3ST7 A;  2W1S A;  2IWG B;  4ASM B;  3EYP A;  3P3P A;  1DLL A;  4YG3 A;  5T50 A;  1MQT A;  1HX6 A;  5L73 A;  4A45 A;  5BNP B;  4R9B A;  3UES A;  4YFW A;  2VZV A;  3L2Y A;  4EWA A;  1GP5 A;  1LB2 A;  4NIG A;  3VBF A;  2Y38 A;  1AR6 1;  1X50 A;  3L9J T;  3MZH A;  2FDJ A;  5FKB A;  4WM7 C;  2WFF 3;  4CCE A;  4FP2 A;  4PBP A;  5FOJ B;  2VMI A;  3LEM A;  1PK6 B;  3M3E A;  4QB6 A;  2P4E A;  3CL1 A;  3HNY M;  3VHR A;  4AED C;  3TEY A;  1HQW A;  1XBF A;  2XL7 A;  3BTA A;  5F6L B;  1CON A;  1S2K A;  1SCS A;  3VD5 A;  4FPE A;  3WG4 A;  4N9H A;  5IK5 A;  4CDQ A;  1AR7 1;  5FZ1 A;  2O0O A;  2VZR A;  1UY0 A;  2DUR A;  1FMD 1;  1FOD 3;  3AX4 A;  3MW3 A;  1CVN A;  4AVB A;  4AXO A;  2W52 A;  2R07 3;  1R09 3;  4FAH A;  2NLR A;  1XPW A;  2ZZQ A;  1AR8 1;  4QAW A;  3OYW A;  3OPW A;  2OUJ A;  4GUL A;  1JYX A;  1FPN 2;  1UOF A;  1W90 A;  3SXW A;  3CU7 A;  4NIH A;  4QPG B;  3V64 A;  3VHP A;  3AJY A;  4Q0V A;  1OA2 A;  5FXZ A;  2BNM A;  3THC A;  5BXX A;  2D40 A;  2HWF 1;  4EE2 A;  1IPK A;  1HRV 3;  1RIN A;  1SHW B;  5ANN A;  5E1R A;  5K0U C;  1COV 3;  3JU9 A;  1W6O A;  4Z2W A;  4P00 B;  3U14 A;  3PJY A;  2BP6 A;  2WZE A;  1HW5 A;  5BNN A;  2CSG A;  1RMU 3;  1EAH 2;  1O4Z A;  3AP7 A;  4RD7 A;  3WF1 A;  1KDK A;  5CKN A;  1QWR A;  1UKR A;  3CHX A;  1CAW B;  5I0R A;  1RYY A;  1TMF 1;  5A7Q A;  5C5T A;  4Q0S A;  2YY1 A;  3I97 A;  5SV8 A;  1TEI A;  3NV2 A;  1W6Q B;  2XBO 1;  1QXJ A;  1DGL A;  3ILF A;  1FV2 A;  2ZGS A;  2QCS B;  4DEV A;  2A70 A;  1UYZ A;  3LFM A;  4K1Y A;  1W9T A;  5ISL A;  1BJQ A;  3OPZ A;  3CMG A;  3U07 A;  1D7P M;  4HL0 A;  3I2G A;  4IND A;  3I2O A;  2ARX A;  1LRH A;  1VB2 A;  3LFI A;  3I59 B;  4YGE A;  3GGL A;  4XTM A;  5TSW A;  1TNR A;  4WBB A;  4IEZ A;  4AAP A;  3GHM A;  5FMO L;  3SEP A;  4CU8 A;  5C9A A;  4BQ4 A;  1H1I A;  3D8C A;  5L9B A;  3AKP A;  4GMP 3;  3PU8 A;  1PVX A;  1U5Y A;  2R04 2;  1WD3 A;  3K4Z A;  1OOP A;  3F95 A;  5FMO S;  1OPM A;  4FT8 A;  4KGQ A;  1HLC A;  4HK9 A;  4FOY A;  2WNE A;  5D8A A;  2GC2 A;  4QQ2 A;  2RG4 A;  2JKX A;  2ZKL A;  3O0W A;  3H8X A;  3GJA A;  3E6D A;  1XSR A;  3GCX A;  3AP9 A;  4LO7 A;  4FSJ A;  2R06 2;  5BNO C;  2PHW A;  4LBQ A;  5F37 A;  1DF0 A;  4XFI A;  5C7G A;  2PHR A;  3B94 A;  4Y20 B;  3WUD A;  3B3Q E;  5GKA C;  1ZBE 2;  3NL1 A;  1Y7B A;  3OGJ A;  3PVE A;  3AYE A;  4W6W A;  5C8C C;  4O61 A;  1IG3 A;  3V56 A;  1VRB A;  2R1D A;  1SDW A;  2JKB A;  5FAX A;  5GLT A;  2Q4S A;  4ZZ5 A;  1WCK A;  3AP5 A;  4COY A;  1TG7 A;  3MLL A;  1HN1 A;  1GWK A;  1WBL A;  3WNK A;  5JZG B;  5FY0 A;  4RS5 A;  3HD8 B;  4IE5 A;  1MVQ A;  3E5X A;  1ZZ8 A;  2UYA A;  2VTX J;  2PXJ A;  4XFB A;  4DIN B;  5FYV A;  1YIF A;  1VLN A;  4Z07 A;  1JUH A;  5FZC A;  1U5Z A;  1WGP A;  5EXO A;  4XUR A;  5ACA 3;  2D5H A;  1GZ9 A;  2YPD A;  3ILN A;  1WLT A;  3OUH A;  1QJY 1;  3TAY A;  3POF A;  4XVH A;  3VLB B;  3WG3 A;  3J7H A;  3NQH A;  3ZOI A;  2WN3 A;  2ERF A;  1QXP A;  2WS9 3;  5FY8 A;  5FPL A;  1JN2 P;  5FPZ A;  5LY2 A;  2J1S A;  4LBO A;  3O1O A;  3GHN A;  4KI5 M;  5EYX A;  2LS6 A;  4NID A;  1DQ4 A;  1KQR A;  3EXU A;  1R1Z A;  3Q8B A;  4FI9 A;  5KC5 A;  2H0B A;  3CF6 E;  2X5I C;  5A3O A;  1QJX 2;  3LKJ A;  1UPS A;  1V6K A;  2VUC A;  1NT0 A;  5CFD C;  2VZT A;  4LLF A;  2ILM A;  4Y22 B;  1SG3 A;  1MEC 2;  5CKQ A;  4ATE A;  4LUK A;  1JUI A;  4PJY A;  4EN0 A;  2Z42 A;  5JOZ A;  2Y6L A;  1MR5 A;  4GJZ A;  3FL7 A;  1X36 A;  3VHO A;  4B29 A;  4P9I A;  1UMH A;  4YZ3 A;  4ZXE A;  1NZI A;  2JIG A;  3DEC A;  1QDO A;  2VQ0 A;  1BEV 1;  3VKL A;  4ARX A;  5CAZ A;  4R8H A;  3QD6 A;  2RDN A;  1UQX A;  2OW4 A;  1CN1 A;  1RGS A;  2EAK A;  2WNU C;  1V6L A;  4AE2 A;  4LBQ D;  3WQ0 A;  3ACF A;  4P08 A;  4UBH A;  4UI9 L;  3VKN A;  4UFL A;  2JDM A;  4MGI E;  2BBV A;  4CP9 A;  1ND3 B;  2RS5 1;  2VZP A;  2OT7 A;  5DZF A;  1OQD A;  1XND A;  4D6Q A;  5LA0 A;  1W2U A;  4N43 C;  1PHM A;  3ETQ A;  2XQX A;  4GH4 B;  2FZ1 A;  2BUK A;  5FYZ A;  4A6O A;  3E5U A;  1GR3 A;  3FUO A;  4XW3 A;  1W6M B;  1LGN A;  1Z7S 2;  3CBN A;  5KXE A;  3T3Y A;  3ZMN A;  3BKZ A;  4B8E A;  3SH4 A;  4AQ6 A;  1JYT A;  3THD A;  1OD5 A;  4I01 A;  1RUH 2;  4XAB A;  2R04 3;  5AFB A;  3TEZ A;  1D4V B;  1GLH A;  3T08 A;  1QJE A;  1OKQ A;  1YHF A;  1UWW A;  1J1T A;  5EJ3 A;  5C3S A;  2YU1 A;  3RYK A;  3A0K A;  4AI9 A;  3POB A;  3AZX A;  1DZQ A;  1ZM1 A;  4R9D A;  5F2W A;  1CAX B;  3MV1 1;  3GNE A;  4L11 A;  2RS3 3;  3B02 A;  1GWL A;  4JGY B;  3SNM A;  4AOC A;  1FOD 1;  1BHG A;  1LU2 A;  3U1X A;  1WMX A;  4NMI A;  1O8P A;  2E26 A;  4KNC A;  3ES1 A;  4OFG A;  2JDK A;  2R07 1;  3BTZ A;  1R09 1;  4LBJ A;  1N47 A;  4QPI C;  5F3C A;  2RS1 2;  2VBB A;  3WQ7 A;  4BB3 A;  5T5J A;  4ZY9 A;  2H6C A;  5E89 A;  4AG4 A;  2B45 X;  4Y4Y A;  2Q8D A;  4CCN A;  4FCA A;  1DP0 A;  4JKM A;  2DCZ A;  4DZG A;  2WQ4 A;  1W3X A;  3WDU A;  5FXV A;  3U4X A;  5FYM A;  3RZH A;  4IV3 C;  4OVE A;  4D0Q A;  1HRV 1;  3AYC A;  1SMV A;  2VXR A;  4NE9 A;  4QM9 A;  5T55 A;  5A1A A;  1NCR A;  2ZGP A;  4WZF A;  2HWE 3;  3IWZ A;  2EF6 A;  2ZHN A;  5FUN A;  3WF3 A;  1J84 A;  1PMI A;  2W3J A;  1RMU 1;  2J7M A;  2Y33 A;  5D2A A;  4FQZ A;  4YVS B;  3MUZ 1;  3N9M A;  4W6Y A;  5T5O A;  3VV1 A;  2GC0 A;  3JQX A;  3ITQ A;  3T1L A;  4CUC A;  4O9E A;  2H0V A;  1OC1 A;  1H2L A;  3GZT B;  3OGS A;  3LIG A;  4FPY A;  4IER A;  2VPV A;  4S2F A;  5AC9 2;  1OHF A;  1ULG A;  2K2S A;  4UFK A;  3UJQ A;  1ZZC A;  1DIW A;  5DMY A;  4XCA A;  4XE9 A;  4BQ5 A;  1DLC A;  2ZX4 A;  4FBF A;  3BIW E;  4N53 A;  1BXH A;  1WMF A;  1LGC A;  1QJX 3;  2P3Y A;  2XH6 A;  4RGA A;  5FV3 A;  4BIO A;  5AFE A;  4XJ9 A;  5BNP C;  1SPP B;  1C1F A;  1JOD A;  4AVT A;  1C8N A;  5F5I A;  4RHV 3;  1UZ0 A;  2WC2 A;  2VME A;  4P9X A;  5IT6 A;  4N7I A;  1BK0 A;  2DWR A;  5A32 B;  3J8F 3;  1AR9 3;  1FAT A;  2E6V A;  2CHH A;  3OEA A;  1MPX A;  2YU2 A;  1PK6 C;  4RA0 A;  4HLT A;  5FZE A;  3W9A A;  3WZ1 A;  1IPJ A;  4XFA A;  2DCJ A;  1LES A;  2BOI A;  4L99 A;  4UAP A;  4GMP 1;  1UMI A;  2GNB A;  1JZ8 A;  2HYK A;  4YW6 A;  2VQT A;  1PNF A;  1Q8V A;  5IVV A;  4URA A;  1OH3 A;  2BWC A;  5C3R A;  3EJK A;  4W50 A;  3T2T A;  4N9I A;  1CAV A;  3WEZ A;  5HXM A;  2D93 A;  1CAU B;  3AKQ A;  4NOT A;  3VBR A;  1US2 A;  1NY7 2;  2CL2 A;  5T54 A;  4NPR A;  3U10 A;  3PUH A;  4MGS A;  3OY8 A;  2D6K A;  2JDY A;  3OUJ A;  4RL7 A;  3SCF A;  5A33 B;  2QQP A;  1WLC A;  1XNC A;  1L7Q A;  3QAC A;  3E97 A;  4JHZ A;  4Z82 A;  5A7O A;  1DU3 D;  1MZE A;  2G19 A;  1W3V A;  1YLL A;  2JG8 B;  2RVA A;  4K7J A;  2GSY A;  2IXL A;  3N9L A;  4PHZ A;  1IKQ A;  1O5U A;  1AX0 A;  1PO2 1;  4MLO A;  1V9U 2;  2Q0A A;  3ZIX A;  3CNA A;  1JS9 A;  1MS5 A;  5A6X A;  2VAU A;  4AHZ A;  3NV3 A;  3DYP A;  4JKK A;  1SEF A;  2GU9 A;  1F5J A;  1D0G A;  4PQQ A;  1RUO A;  3IT8 A;  3NAP C;  2W94 A;  4XUO A;  4I02 A;  1OUX A;  2RDQ A;  3AKS A;  3AJZ A;  2PLV 2;  3FX3 A;  4JQT A;  4XFH A;  3DYO A;  3O1U A;  4XQD A;  3KV5 A;  1C8M 3;  3C2U A;  1N1Y A;  1RJ7 A;  1VAK A;  1HV0 A;  2HWB 2;  3VZJ A;  4D6S A;  5ACA 1;  1H1M A;  5LB6 A;  1W8H A;  5IUQ A;  1NLQ A;  4PLN A;  2VE1 A;  2YRO A;  3M7A A;  3CJX A;  4YW1 A;  3SCG A;  3T2P A;  2ZEY A;  2RDS A;  4NN0 A;  3X29 B;  2WS9 1;  1SAC A;  3ZFG B;  4BYY A;  4GIQ A;  3NJY A;  3ZFE B;  1M4W A;  2G9Z A;  3MV0 1;  3HT1 A;  3KV9 A;  4B4R A;  2MNG A;  4E4H A;  2PHD A;  2WLP A;  2PN5 A;  1XJA A;  1DQ1 A;  3B93 A;  3CJI B;  5KC6 A;  1RUF 2;  1MS8 A;  2WFP A;  5K8S A;  3K3N A;  2J1T A;  3MI8 A;  4C0H A;  2X8K A;  3IDB B;  5FPX A;  1VBC 3;  1W6P B;  2GC3 A;  1RC6 A;  4UW3 A;  5T3N A;  2JE7 A;  3KM5 A;  2XUE A;  2ZXQ A;  5IVY A;  5FLH A;  1A8M A;  4D69 A;  1H6Y A;  1LCL A;  2QE3 A;  4K3U A;  5LA2 A;  3RMX A;  1ODM A;  3RZG A;  1AL2 3;  3VBS A;  1N1V A;  5AC9 3;  1W28 A;  1G9C A;  4MGY E;  2FZ2 A;  3WXP A;  1W6N A;  4XMI A;  3PVN A;  2WWU A;  4DIQ A;  4F3J A;  1ZRD A;  3ZMO A;  2A6X A;  1E5S A;  4CDW C;  4CDU A;  1SZB A;  2XJR A;  2B5H A;  1K12 A;  2JIJ A;  2V4V A;  3MW4 A;  4HVQ A;  2OS2 A;  3I2K A;  3K75 B;  1R1A 1;  3RJR A;  2CDO A;  4QGN A;  1LOE A;  4TZD A;  2GMP A;  1SFN A;  1XNA A;  1ST8 A;  2V4A A;  3KSC A;  4IQP A;  3RZJ A;  3VKF C;  2SLI A;  3I8T A;  5F3I A;  4M3C A;  3HQR A;  4MH0 E;  4LK6 A;  5IK4 A;  4AED B;  2B9U A;  2UY9 A;  1S4C A;  3A0N A;  3AZV A;  4HKW A;  5JOY A;  2ZAA A;  2CTV A;  4CCO A;  2A3Y A;  3VBU A;  2IXH A;  2WWS A;  3O0X A;  2XUM A;  4NHL A;  1W0O A;  3THT A;  1GYK A;  2E9Q A;  2VL4 A;  3MGU A;  4MAD A;  1BZW A;  2WQ8 A;  2GH8 A;  4S2G A;  1NXD 1;  4JKL A;  4CEW A;  3LPG A;  3T0D A;  1UOJ A;  4TTG A;  1JZ5 A;  2DV9 A;  2PQQ A;  1Q5O A;  2NM1 A;  4HET A;  3TRS B;  2KM2 A;  2RS3 1;  4YGC A;  3ZSL A;  1SBE A;  2VBD A;  4Z2A A;  3ZFF C;  1WCD J;  3WCR A;  1W0N A;  2XXZ A;  4IE4 A;  3FWE A;  4FPC A;  4AGV A;  5IWF A;  3UKT A;  4LO5 B;  2NYY A;  1XC6 A;  1CJD A;  1PZ7 A;  1TNF A;  1UL9 A;  3ON7 A;  4Y1Z A;  3RVH A;  2R0H A;  3U37 A;  4QDQ A;  5AVA A;  3HT2 A;  5HCB A;  2GN3 A;  5CFC B;  1XNK A;  2AYH A;  5J7M A;  2P6H A;  1V9U 3;  3PVO A;  2WNV B;  4R4Z A;  2JEN A;  2XB6 C;  4ISR A;  4FOQ A;  4RYD A;  4XHB A;  4CEY A;  2QZ2 A;  1NCQ A;  2AGS A;  3U11 A;  4XMA A;  1FT9 A;  2WYS A;  4QHO A;  1W0P A;  4WVZ A;  3N7M A;  2XJS A;  4D3W A;  2HWE 1;  2IXC A;  2DVB A;  5FPU A;  1V00 A;  5FYU A;  3TEW A;  2SBA A;  4E8D A;  2GP3 A;  2ADE A;  2ZHM A;  4LE4 A;  2OPW A;  4CCD A;  2CWM A;  2LM3 A;  5GLU A;  2XDV A;  2DU1 A;  1GOH A;  1ND3 C;  4LA2 A;  4BQ1 A;  2AZ5 A;  3U78 A;  4NIA A;  2QTW B;  2QQM A;  3ILR A;  2WIN B;  4GH4 C;  1ZYB A;  3AMH A;  5FDB A;  3O1S A;  2ZGT A;  5FP9 A;  1D4M 2;  2UY8 A;  5L7O A;  2LTN A;  2EXK A;  4HN1 A;  4E2G A;  5JAX A;  1OSG A;  4Q4W 3;  3JBG 3;  5FPA A;  1UN1 A;  3OBT A;  2AH2 A;  3LIH A;  2LAL A;  3D6E A;  1HIX A;  1RB8 G;  2Y6G A;  2R32 A;  4RHV 1;  2VD7 A;  1ND2 C;  3ZXK A;  1IS5 A;  5FWJ A;  3J8F 1;  4JGZ C;  5APA A;  5FUP A;  2FBE A;  3J9S A;  1QGL A;  4QMA A;  2W47 A;  2VNG A;  1MQT C;  3GYD A;  3GZA A;  2I45 A;  5BNO B;  4J25 A;  4JGY C;  5IYY A;  2VG9 A;  3VBF C;  2WT2 A;  2FDI A;  1HDK A;  4MXW B;  4QXB A;  4GZ9 A;  3WV6 A;  1NG0 A;  4K8R B;  1LHW A;  1JMU B;  1I5Z A;  5C8C B;  1JZ2 A;  3C3V A;  1ZBA 2;  2XLG A;  4OUE A;  1QJZ A;  5FZ8 A;  5GLW A;  3ZIW A;  4WM8 C;  3IZO A;  5K4L A;  4Z1V A;  1A8D A;  1AYN 3;  2HWD 2;  2X53 S;  2ZPX A;  3KV4 A;  2GH2 A;  1VJ2 A;  2JJ6 A;  4Q8L A;  3UGH A;  2DTY A;  2QJV A;  2W92 A;  5F32 A;  3A22 A;  1WW6 A;  4CRQ A;  3V0A B;  5EWS A;  1UD1 A;  3S6P A;  1E5R A;  1UF2 C;  2CAU A;  1F35 A;  3IBM A;  4PBO A;  4AGG A;  3ZKY A;  2BPA 2;  4M0N A;  1HB1 A;  1CAW A;  3Q8E A;  4YVS C;  3WY6 A;  1YQC A;  4M01 A;  1XYO A;  2B9V A;  5FZA A;  4Y3O A;  5JI7 A;  1RUE 2;  2DFC A;  2N7G A;  3KQ4 B;  3LB9 A;  2Z4F A;  1LU1 A;  3WP3 A;  4AI1 A;  1V6J A;  5EQU A;  4FFF A;  4JHT A;  1F31 A;  5FY4 A;  1C8M 1;  5KHH A;  4AVV A;  3M3I A;  3ROU A;  4W4Z A;  5DPN A;  3WQ1 A;  3PNA A;  4NHK A;  4YSF A;  4IGO A;  4AVC A;  2WUH A;  2JG9 A;  2VOW A;  3MID A;  2Y60 A;  1W8N A;  2VOX A;  2X5I B;  1QOT A;  5SV5 A;  3H7J A;  1FAY A;  3BOD A;  2AC1 A;  4R4X A;  1PIV 2;  4P5Y A;  4GD4 A;  5GLV A;  3TYJ A;  2W46 A;  4YZ1 A;  1S0D A;  2J1V A;  4ZU5 A;  4JX0 A;  5C6C A;  1DYO A;  5JOW A;  1QQP 2;  3FZ3 A;  1Y9M A;  4E4D X;  2DBN A;  1S0J A;  4MHU A;  3RZZ A;  5A6Y A;  2RS5 2;  2E31 A;  5CB7 A;  4YG0 A;  2F17 A;  4V2V A;  4TN7 A;  1PO1 3;  4QT6 A;  3VBH B;  2G9F A;  2BFU L;  5IAV A;  4GJY A;  5A7N A;  3POG A;  5CNA A;  1LOG A;  1VBC 1;  2JWP A;  2WNU B;  3T30 A;  1D2S A;  1GSL A;  2E7A A;  1H4G A;  2ES3 A;  2BNN A;  3Q8A A;  1OFN A;  2UWC A;  4QB1 A;  3RI9 A;  3AVR A;  4QDS A;  2BFU S;  4Q1R A;  1XU2 A;  4QQL A;  5EHD A;  2PHL A;  3WSO A;  3ZN6 A;  1V6O A;  2VZO A;  5T5P A;  4AQT A;  4EWD A;  1PGL 2;  4NAO A;  3V0B A;  2RDR A;  1AL2 1;  3GAL A;  4IES A;  2GNT A;  3WG1 A;  3KCY A;  3KHB A;  3RRD A;  1BMV 1;  3WDV A;  1OOP C;  4COW A;  4GAL A;  2YBS A;  1NYW A;  4DEQ A;  5D8A C;  3NNG A;  1S2E A;  1VMF A;  1O4T A;  2VH9 A;  1LR5 A;  2YBK A;  3BTY A;  1W8U A;  4NRQ A;  2JG8 C;  4DUW A;  4O9G A;  1O3S A;  3B5L B;  2AUY A;  5M0T A;  3BN6 A;  5BY5 A;  1ODN A;  5FYB A;  5FZH A;  3AL6 A;  3WHT A;  3POY A;  5LA9 A;  3VBO B;  4YW5 A;  2RHP A;  3PVB B;  5KHG A;  2ZEZ A;  4BXS V;  1FX5 A;  5FMB A;  3WDW A;  3WNX A;  2D7F A;  4BK4 A;  4I2O A;  3D4K A;  1WBF A;  2VJX A;  2O8Q A;  2Y6K A;  4MVT A;  4FPK A;  1VBA 1;  3WDX A;  4AF9 A;  4JDO A;  3CQO A;  5JDB A;  1WCS A;  5DAP A;  4DOU A;  1HXS 1;  1RUC 3;  2BER A;  2NPI A;  5JXH A;  5DAW A;  1EY2 A;  2CNA A;  4RS5 C;  4MG2 A;  1O59 A;  1W05 A;  5FPV A;  1NLR A;  2GME A;  4UW6 A;  3AKT A;  3ZFE C;  2PMW B;  5HXV A;  4FAG A;  3J7M A;  1U12 A;  1GUI A;  2XKP A;  1XE7 A;  2PTM A;  4GAZ A;  4IV3 B;  2CAV A;  4XF4 A;  2RV9 A;  5FK8 A;  3CJI C;  1QDC A;  1RUI 3;  3H0O A;  4UWD A;  1ZA4 A;  2R7E B;  1LEM A;  3T0A A;  2A6Z A;  1CWP A;  5IK8 A;  5CEH A;  2WBK A;  3OUI A;  4HMZ A;  2CY6 A;  1IQA A;  4XDO A;  4DB5 A;  1DGR A;  1S1A A;  4GB3 1;  1SFP A;  4YRD A;  2O8O A;  2JDH A;  2VMF A;  1LOD A;  1RUE 3;  3POS A;  3U0Z A;  3IB3 A;  3KT7 A;  3QH7 A;  3I3B A;  3VD3 A;  2WO1 A;  4Y26 A;  5A7W B;  3ZYI B;  4M00 A;  3QH6 A;  1UZV A;  1QMJ A;  4H7M A;  2VM9 A;  1YQ6 A;  2ETE A;  3VZL A;  4YZ2 A;  2F4L A;  3N9Q A;  2YMZ A;  4UF0 B;  4J1W A;  1N3P A;  4JTN A;  5HCA A;  5LEJ A;  2DYC A;  4KH9 A;  4LBN A;  3DL3 A;  3RFR A;  3ASI A;  1ZRC A;  1YRZ A;  1JHJ A;  3J26 N;  1OLR A;  3GBG A;  5GAL A;  3GZE A;  1AYM 3;  3RQ0 A;  4D8M A;  3J4U H;  3WVJ A;  3K48 A;  4B7E A;  5LWB A;  5AVP A;  4GA9 A;  4K40 A;  3S57 A;  5KHJ A;  3D3A A;  5C4W A;  2RR1 3;  4X8N A;  3VKO A;  2ENR A;  4BCU A;  4Q4W 1;  4YGD A;  3M70 A;  4FP3 A;  3JBG 1;  1HRI 2;  4NHY A;  4MGT A;  3ZO0 B;  1QY4 A;  2Z5W A;  4FOW A;  3JD7 3;  2DUO A;  1CES A;  1AX2 A;  1ASJ 2;  1Y9Q A;  2XKO A;  4FXK B;  4IEW A;  4QPW A;  5F5Q A;  5K9Y A;  3I3Q A;  1EP0 A;  4JRA A;  1S0E A;  1TME 3;  3IMN A;  4XJ8 A;  4KWJ A;  5LEK A;  4DUV A;  1W8Z A;  1NQD A;  3FLT A;  1OPO A;  4HSL A;  4XDQ A;  3ZN5 A;  4IE7 A;  1JU3 A;  3D0S A;  3VDB A;  3WW2 A;  5DDJ 2;  4IET A;  2W08 A;  4C0B A;  1K5J A;  5I8T A;  1BCX A;  4JCK A;  4I0W B;  4AFB A;  2C24 A;  2XR4 A;  1PNG A;  4HXC A;  3IPV A;  5CVR A;  4PDW A;  3TN9 2;  2HBT A;  2D5F A;  2QQJ A;  1VRH 1;  1I3H A;  1J3R A;  4A6S A;  2RMU 2;  1M06 G;  5G04 L;  1RHI 1;  4J6G A;  4XUT A;  1LOF C;  5CFC C;  1DQ2 A;  3IIA A;  1RVF 3;  1WZX A;  2WNV C;  1AYN 1;  4A44 A;  3WCS A;  1RTV A;  4COU A;  4K8F A;  2WII B;  3NAP B;  2C6S A;  4XYX A;  4XAE A;  1GIC A;  3NNF A;  5FZ3 A;  1SQ4 A;  4XJA A;  4MXV A;  5FY9 A;  5A1F A;  3EO6 A;  3MLK A;  1P8J A;  2PQS A;  5I8S A;  5F2S A;  5IAT A;  4ORF A;  2VVD A;  1FYU A;  4DY3 A;  3N35 A;  3KS7 A;  3MW2 A;  3RYP A;  1DGW A;  4OMD A;  4B4Q A;  3VKM A;  4HKL A;  5A80 A;  1W2N A;  4ZXK A;  5C5U A;  3KQR A;  3I54 A;  1W9W A;  4Q4X 3;  1Q43 A;  5FYT A;  4CA9 A;  4EN7 B;  1DQ5 A;  2GMM A;  4XJU A;  5FFO C;  2BQP A;  5CG9 A;  3M2M A;  2YBP A;  4QKD A;  3S5Q A;  2Y6H A;  4WZC A;  1MS9 A;  4MET A;  5GLZ A;  4ASL A;  3J7N A;  1SPP A;  1UYP A;  4KL1 A;  3FC0 A;  4UFM A;  2VOK A;  2IXK A;  4LO4 B;  5FR3 A;  4E9K A;  3ZX7 A;  3FHA A;  5GZE A;  1QF3 A;  1A78 A;  1R08 2;  5JR7 B;  1ZRF A;  4BOW A;  1RL3 A;  4WVM A;  3S5A A;  4N53 C;  1PVC 2;  1AJK A;  1EPZ A;  1ONA A;  1J83 A;  1POV 0;  1W9S A;  1VBD 2;  2XJP A;  1WCQ A;  3AVS A;  4IV1 B;  1PO1 1;  4Q0U A;  1JZ7 A;  3KCC A;  4QHB A;  2V5D A;  1QNY A;  2GC1 A;  4NR1 A;  3TB0 A;  3CEW A;  1CX4 A;  2QQU A;  5A3L A;  2IVJ A;  3LA2 A;  3VUO A;  1DGW X;  1VMJ A;  1OUS A;  1RJ8 A;  4CDW B;  4GWJ A;  2JDU A;  1LAJ A;  3RMY A;  4DY5 A;  3ZYR A;  2VNV A;  2UUR A;  1IS3 A;  2VC9 A;  4PIY A;  3K3O A;  4QQH A;  3TBD A;  1C28 A;  1SFY A;  1K5M B;  3P5B A;  1PGW 1;  5JMO A;  1OF4 A;  3H3Z A;  2QQN A;  2VNO A;  3AKR A;  1AXZ A;  4URT A;  4MSV A;  4NAM A;  1OLM E;  1VAM A;  1AUY A;  3AXD A;  3R4U A;  2RJ2 A;  4UOJ A;  2TUN A;  1CZV A;  3RG0 A;  1QJU 2;  1MS0 A;  4ZS3 A;  1VR3 A;  5EYY A;  4OUS A;  1ZRI A;  2Q1F A;  4BLJ A;  3WD5 A;  2NQY A;  3N7K A;  4LUL A;  4BQ2 A;  5IVC A;  2W0X A;  4AWD A;  2J22 A;  1C3H A;  1G86 A;  2RJK A;  1S0F A;  2EXH A;  4OLL A;  4RQP B;  1MS4 A;  2WZR 1;  3RJ2 X;  4EN6 B;  3VDA A;  4XC9 A;  1OT5 A;  3O1R A;  2HBU A;  1ZVF A;  3C7F A;  1UKG A;  2VNR A;  2QQI A;  1W8W A;  1FPN 3;  3I2D A;  3NKT A;  3QCW A;  4DFS A;  3LDB A;  3WDT A;  3DV8 A;  3W58 A;  3ZFF B;  3H1Y A;  4P9J A;  1RUC 1;  1DYK A;  1F4A A;  3B00 A;  3BOP A;  4GKX A;  3DPR A;  3TN9 3;  3VHN A;  4DXS A;  4LHS A;  2DTW A;  2VZ1 A;  2EAL A;  3MYX A;  3ZSM A;  4NPL A;  2AR6 A;  4D7T A;  4DO0 A;  3KHC A;  3BUC A;  1C1L A;  1GZW B;  5GZD A;  5ABJ C;  4YVW A;  4BHP A;  1EAH 3;  2W87 A;  3OF1 A;  1X8M A;  2ET7 A;  4XBQ A;  2C1F A;  4HPK B;  2E7Q A;  5A3U A;  1RUI 1;  1NA1 A;  1RUG 2;  4L97 A;  3MFC A;  2BEO A;  4BWO A;  4CU6 A;  5JIU A;  3R4D B;  1YI7 A;  3WNO A;  4OUL A;  2WZ8 A;  3O0V A;  5G05 L;  3VBH C;  4AQS A;  2EVX A;  2L9L A;  3JQW A;  2Y0O A;  5FWE A;  1K45 A;  4UXA A;  2RM2 2;  4I3P A;  2C0Z A;  4YWA A;  4DXR A;  3ZYF A;  1MS1 A;  3ETP A;  1YI9 A;  2JB8 A;  4P9L A;  2PHT A;  4OI4 A;  2HKX A;  4QGM A;  4TWT A;  2JEC A;  3MEP A;  4FO9 A;  4Z92 B;  2B42 B;  1AX1 A;  4CZS A;  1OBN A;  4MGZ E;  4BJ0 A;  5FZM A;  3JUU A;  1DQ6 A;  3OOX A;  1GOG A;  4YFZ A;  5FLJ A;  3BB6 A;  4BA6 A;  1V0A A;  4LUM A;  4Y5T A;  2OPK A;  2DDU A;  4XTP A;  2QVS B;  2FMY A;  5ERL A;  5I0D A;  2K46 A;  4CUA A;  3VL9 A;  4XUN A;  4WM7 A;  4AR2 A;  1OD3 A;  3VBS C;  1AYM 1;  1AVB A;  2FMD A;  3OTF A;  4CP0 A;  3AMN A;  1ND2 B;  5FZ4 A;  2WFF 1;  2ARC A;  3WQB A;  2C9K A;  4JGZ B;  3VBO C;  2VO5 A;  1WMD A;  2RR1 1;  4HZF A;  4PI2 A;  3H9A A;  2W2I A;  2XON A;  4K21 A;  3WP5 A;  1MQT B;  1Y3T A;  1VBD 3;  3LWC A;  2R06 3;  2FCU A;  1PMH X;  3JD7 1;  3TNP B;  4ATF A;  3VBF B;  4LHL A;  2YC2 A;  1IS6 A;  1KEX A;  4LKS A;  1DFQ A;  5JOX A;  2QZ3 A;  1YXW A;  1YJK A;  1W8T A;  1TME 1;  3AFG A;  3SMH A;  1VBE 2;  5FYI A;  1ZBE 3;  3CZU A;  4Y4R A;  3ZXE A;  5FXX A;  4BQW A;  3CZJ A;  1NAE A;  5LA1 A;  2WAA A;  4W65 A;  3OD4 A;  3QOP A;  4WM8 B;  3PUS A;  4Q4Y 2;  1AXK A;  1MZ5 A;  1Y43 B;  1KDM A;  1Q8S A;  1DHK B;  2JX9 A;  3LCP A;  1PM4 A;  5A3T A;  4FTE A;  1UAI A;  3UGG A;  2OZ6 A;  2NN8 A;  1COV 1;  3OYW B;  1QJU 3;  1UXZ A;  3H42 B;  5CIR A;  5IFT A;  1EV1 2;  4FOV A;  2MEV 2;  1CJP A;  4BQY A;  4K9S A;  5FOB B;  3OJB A;  5KHK A;  1RVF 1;  2WQZ C;  2RJL A;  3MIE A;  3USU A;  3ACI A;  3M4F A;  5A3P A;  5KBF A;  2JDN A;  4I0A A;  1POV 3;  4XQ4 A;  5FPB A;  1PMJ X;  1S0C A;  5FJK A;  4OHZ A;  1W6O B;  4P9Y A;  4SLI A;  1ENS A;  5LRR A;  1VBB 2;  5BNN B;  4MX3 A;  4WV8 A;  4BXF A;  3W20 A;  1WD4 A;  2XVL A;  4UFI A;  4CEY C;  1RUD 2;  4UW5 A;  1H2M A;  2QFE A;  3SIT A;  3HR9 A;  4X6Q B;  3I2J A;  1UX7 A;  4BDV B;  4Q4X 1;  1LUL A;  1MEC 3;  2FCT A;  1L7R A;  1B35 C;  4Y5Z 0;  3NST A;  2NMO A;  3JB4 C;  1Y4W A;  2R16 A;  2YUE A;  2G4I A;  3TWI A;  3EHK A;  1RUG 3;  1FI2 A;  4E4S A;  2BGP A;  1XQN A;  5IHR A;  2QUO A;  2WDB A;  2XJV A;  3ALQ A;  3HNB M;  4AQ2 A;  3VD4 A;  3I3M A;  3PHM A;  3NV1 A;  4A3Z A;  5F7U A;  3HOB A;  4NII A;  3A4U A;  1YFX A;  1KIT A;  1WLW A;  4FFH A;  2ARB A;  3QBQ A;  3EQE A;  5T5L A;  5C9A B;  4I3G A;  2IZW A;  5FP7 A;  3MHZ A;  1OOP B;  4WVV A;  4A42 A;  3D0J A;  3WT3 A;  5IFP A;  5D8A B;  4C91 A;  4DRR A;  2EXJ A;  4B1L A;  1RUJ 2;  2JD9 A;  1BBT 2;  1Z7S 3;  2D3S A;  2JIC A;  3U4S A;  2ZCW A;  5F5C A;  2ZZJ A;  1RUH 3;  2VZU A;  3ECQ A;  1V70 A;  3P3N A;  1WW5 A;  1HXS 2;  4LBQ B;  4PIX A;  5C3O A;  1UY1 A;  1OMI A;  4NUB A;  4JQR A;  1CZT A;  3O1V A;  4QKN A;  4EN8 B;  2YFU A;  4BIF A;  4FQ4 A;  5DUX A;  4IDZ A;  4R9A A;  3FN9 A;  2ZGR A;  4RFR B;  4YPJ A;  2BW8 A;  2D6M A;  3VL8 A;  4Q4V 2;  1GFF 2;  2J1U A;  5F39 A;  4RR3 C;  4Y1X A;  2GZW A;  2OII A;  5J1X A;  2VMC A;  2VUD A;  4OYU A;  4KGG A;  4ONU A;  1DG6 A;  5E6H A;  5F6K A;  3ZN4 A;  3T0B A;  5F1R A;  1RUN A;  2UWB A;  4XF0 A;  2A1X A;  4LJH A;  4KMQ A;  3ENR A;  2Y6F A;  2RS1 3;  2TNF A;  3B01 A;  4RS5 B;  1VE0 A;  2HJI A;  1JH5 A;  5FY5 A;  3C7O A;  1ACC A;  2B4K A;  3HBZ A;  3PJQ A;  2OX0 A;  1FPN 1;  4IEV A;  2VCC A;  3WX5 A;  3ZSJ A;  1J59 A;  1CIY A;  1OA3 A;  2VMD A;  2A6V A;  2X5I A;  4IE6 A;  5A3N A;  4QD2 A;  3MPP G;  5CFD A;  2HWC 2;  4ET7 A;  4LIT A;  1EV1 3;  3AP6 A;  2OQ6 A;  2MEV 3;  3RWK X;  3VGI A;  2JDZ A;  1JZ3 A;  3VDC A;  1EAH 1;  1R64 A;  2WSU A;  1LHU A;  2Q8E A;  1GQH A;  3RNS A;  3DGT A;  2BRT A;  1V6N A;  3RSJ A;  3RWN A;  1KS5 A;  4E4Z A;  4IV1 C;  2QNK A;  5I93 A;  2NMN A;  1AR6 2;  4R9C A;  4D6R A;  4BIS A;  1H30 A;  4Y24 A;  1UYY A;  4LBK A;  3K2O A;  2EAA A;  3PUI A;  5HCF A;  4IGP A;  4CDX C;  4BME A;  2BDR A;  4XEZ A;  4N43 A;  1AR7 2;  2XJU A;  5CYY A;  3NKG A;  2OVU A;  1FMD 2;  2IFR A;  4LIV A;  4XIK A;  1K5M C;  1O5L A;  2CGP A;  5FYH A;  4EWE A;  2IC1 A;  1OFS A;  1SBD A;  2XGX A;  4IXL A;  3ZXL A;  1AR8 2;  2LRP A;  3GXU A;  1QJF A;  2JD4 A;  2Z2S B;  3P1I A;  4OUM A;  1CZS A;  4CP1 A;  1XNT A;  4CP9 B;  2HEV F;  2Z79 A;  4L2N A;  1JOP A;  1C57 A;  3ZDS A;  2R04 1;  3W5N A;  2ZX2 A;  2HWF 2;  5LBF A;  2ZJC A;  2HYX A;  4CU7 A;  4QHZ A;  3LAG A;  4XPV A;  3NVC A;  2XML A;  2DVA A;  4RQP C;  2VMH A;  3KMH A;  5LBE A;  3OSD A;  4GQ7 A;  4LOT A;  3VZM A;  3PME A;  1V6M A;  4DQA A;  3JZV A;  1H4H A;  3FHQ A;  2AAC A;  3U75 A;  3VDD A;  2R06 1;  3BPZ A;  5GM0 A;  1H8T A;  4M3C F;  5H9P A;  4WVW A;  2CGO A;  2K9Z A;  2ZGK A;  5FBZ A;  4QPI A;  1SLA A;  1TMF 2;  5FMD A;  3OCP A;  2XPJ A;  3H7Y A;  4XIL A;  1ZBE 1;  4NHX A;  2XBO 2;  1UU5 A;  3KT1 A;  1BBT 3;  1IG0 A;  4GKY A;  2ZAH A;  1BLZ A;  1GAN A;  4MHR A;  5LAS A;  3H8O A;  2AEY A;  2ZX1 A;  1KJL A;  1TZO A;  4Y5S A;  1ZRR A;  4COV A;  4IE0 A;  1LJ7 A;  2YC4 A;  2EID A;  5FZ9 A;  2DVF A;  1APN A;  5J98 B;  3SQO A;  2EIG A;  3H1M A;  4QPY A;  1G8W A;  4KWU A;  2GNM A;  2PLV 3;  4HSJ A;  5J37 A;  5A6Q A;  4Q4V 3;  1UNB A;  3UKN A;  5JLV A;  2ID4 A;  2HWB 3;  2GND A;  3PTY A;  2VMG A;  4H55 A;  5D21 A;  4J1X A;  5JXJ A;  3KT4 A;  1POV 1;  4JRL A;  4MV2 A;  3WDY A;  3AB0 A;  1KRI A;  4LBM A;  4QQP A;  5HI0 A;  5FQ0 A;  3OPT A;  4HOO A;  4N8M A;  1NCR B;  4MYE A;  5FZO A;  4CP2 A;  5L9R A;  2W68 A;  3LEI A;  1XYP A;  3WNM A;  1J58 A;  5H9S A;  2OQ7 A;  3S30 A;  5KXB A;  2VCA A;  3ME2 A;  5FZK A;  2IVI B;  2PYT A;  5BNP A;  4B4P A;  2R1B A;  2W1U A;  4P14 A;  4QX1 A;  3O12 A;  3MIH A;  3ZYJ B;  2WO2 A;  1QJX 1;  3DKW A;  4ASK A;  5B2G B;  2WZP P;  1RUF 3;  1HJG A;  1TE1 B;  2KR2 A;  5FO7 B;  2WNO A;  4W8J A;  4AL9 A;  1LHV A;  1MEC 1;  3G7D A;  1PK6 A;  5GJ6 A;  1AR9 1;  2E32 A;  4LR4 A;  1I1E A;  4Q5O A;  1OUR A;  4HN0 A;  4YM3 A;  4N53 B;  4RSU A;  1K3I A;  5L19 A;  1W8F A;  4LK7 A;  4YZ4 A;  4AYU A;  5ANQ A;  1Z78 A;  3UKV A;  1XE0 A;  5C8W A;  1GMM A;  3BPS A;  1UOG A;  3N9O A;  4CCC A;  3MIB A;  4U2A A;  5CG8 A;  2GDF A;  3NWK A;  4Q0P A;  4XZP A;  3WOG A;  5I91 A;  3DEM A;  2VZS A;  1E5I A;  3AMP A;  3APB A;  3INA A;  5C4W C;  1OXC A;  1AR7 3;  2YV8 A;  4QPG A;  3PDQ A;  3FE5 A;  1FMD 3;  2R30 A;  4NVP A;  4CDQ C;  2QQW A;  3HAG A;  4CSW A;  5FCC A;  1PX4 A;  5I0T A;  5FZ6 A;  5L36 A;  1QJY 2;  2VQA A;  3C7H A;  2ZGU A;  5B4N A;  4E8C A;  1F4H A;  1YFU A;  5EJ1 B;  5A3W A;  1QH6 A;  2Y8K A;  1Z7S 1;  5FYC A;  2PA7 A;  2VEC A;  2ZX0 A;  2DUQ A;  4PCR A;  5KXD A;  1C5I A;  1CIW A;  2JDA A;  1CAV B;  1HJF A;  2D3P A;  2JEM A;  3HQX A;  1RUH 1;  2QQV A;  5KWR A;  1ZRE A;  1MZF A;  2ZOE B;  3CIH A;  1O3Q A;  2HWF 3;  3O14 A;  4AI0 A;  3RZL A;  1CPN A;  2A75 A;  3OY8 B;  1G7Y A;  3NAP A;  4XF1 A;  3AL5 A;  2BVV A;  1IZ3 A;  4A4A A;  4BH9 A;  3I3E A;  2W9X A;  3FMG A;  3ES4 A;  5FRE A;  3KVA A;  3SCH A;  5DUW A;  1W6Q A;  1VMH A;  1AZD A;  3LDK A;  4HG6 B;  1YC6 1;  4QX3 A;  1OKO A;  5B4X A;  1H0B A;  2EIB A;  3LEK A;  3UNP A;  2E63 A;  5BNN C;  3RGB A;  1JYI A;  5CIS A;  3KGL A;  4E2S A;  2ZML A;  4KWL A;  1BQP A;  4YGB A;  3WHU A;  2HLE A;  4OCT A;  1BEV 2;  1DQ0 A;  1EUU A;  1UPI A;  2RS1 1;  5DUU A;  3I59 A;  1AHS A;  1ZNP A;  2DVD A;  4NPM A;  4NRO A;  5FZI A;  3WIN E;  1SLT A;  3HN3 A;  3KLS A;  5ABJ B;  4YYO A;  3IKW A;  1UIJ A;  3SH3 A;  5FTT C;  4YZ5 A;  2DVG A;  4HFS A;  1UZY A;  3UK9 A;  4A7K A;  5FZL A;  2QDN A;  4E27 A;  2WLQ A;  1XU1 A;  4XBN A;  3A21 A;  4OHV A;  2VY0 A;  1GU3 A;  4U36 A;  2ZMK A;  1OH4 A;  1WWY A;  1UCX A;  1WA4 A;  1BYH A;  3NV4 A;  4W6X A;  3RI8 A;  5A6Z A;  2R49 A;  5GZF A;  1QXR A;  2QKD A;  2BJS A;  3Q8F A;  4M0H A;  5C9A C;  1AXY A;  1JOJ A;  4KG0 A;  2XVK A;  5AC9 1;  2ZBJ A;  4Y20 A;  4ZU4 A;  1UX6 A;  5J48 A;  1KD7 A;  3OEB A;  3RDI A;  3PUR A;  5IVE A;  2KD7 A;  1YWK A;  2VCM A;  2YYO A;  1D4M 3;  4BZ4 A;  1WUV A;  5E8A A;  4YW3 A;  2GN7 A;  4BQ3 A;  1Q8P A;  2BGC A;  2P5B A;  3R05 A;  4ZU7 A;  4MUV A;  3AK0 A;  4FVV A;  1V6I A;  1FOD 2;  1HQL A;  3VBS B;  3WNP A;  4MO3 M;  1WA6 X;  1U0A A;  2PHU A;  2R07 2;  1R09 2;  2BBA A;  1W6N B;  4OZX A;  4XUP A;  4AFA A;  5JZG A;  5LW9 A;  1ZZ7 A;  1ULO A;  4CDU B;  1U5I A;  2EXI A;  2P34 A;  2FCV A;  2OKX A;  2XLA A;  3ZR5 A;  1W99 A;  2CU5 A;  2W1Q A;  2ZHL A;  1GP6 A;  2YFZ A;  3K46 A;  1GNY A;  3AC0 A;  1HRV 2;  5JIA A;  3S7I A;  4CE8 A;  3GZU C;  4N90 A;  2QQO A;  4AEM A;  4DNY A;  2UWA A;  4M3C B;  1DDL A;  2ET1 A;  1IKP A;  3BI3 A;  3KB5 A;  3POI A;  4A7Y A;  1O7F A;  3ACL A;  1A6C A;  1RMU 2;  4Q29 A;  3VBU B;  3Q8C A;  4LIU A;  1ALY A;  3SC7 X;  1ZBA 3;  3KVB A;  1NY7 1;  1W9Y A;  1LEC A;  4YW2 A;  1F8V A;  5BYN A;  4AAX A;  2HWD 3;  4NRM A;  2GP5 A;  2A3X A;  2PHF A;  4CEW B;  1X7N A;  4Q0Q A;  1X9T A;  2HEW F;  4Y22 A;  2YHJ A;  4L92 A;  2YC0 A;  4K6B A;  4PIZ A;  3ZYB A;  3L2H A;  1GQG A;  1V9U 1;  4G3Y C;  4JV4 A;  3RYR A;  2J1E A;  2ARA A;  3KV6 A;  4EV0 A;  1Y9G A;  2V73 A;  3W21 A;  3AZY A;  4TXW A;  3ZSE A;  4C8D A;  3O1P A;  3AYD A;  3RZM A;  2B7Y A;  4YW7 A;  5LCW L;  3CKH A;  3HIF A;  4O7X A;  2PLV 1;  1URX A;  1J3P A;  2CWS A;  2XWJ B;  2ZS6 B;  4HAN A;  4XAC A;  1JYN A;  4FFI A;  3PIG A;  4LOS A;  3KF5 A;  2I74 A;  1OI6 A;  4XFG A;  4YVW C;  5FZB A;  2HWB 1;  3V65 A;  3SIS A;  1ENR A;  1HB2 A;  1ND3 A;  4CEY B;  4Q27 A;  1NCQ B;  1XB9 A;  2CV6 A;  2D97 A;  4PF5 A;  3ZYG A;  3E5Q A;  3I7D A;  4GH4 A;  1YNA A;  2A5Z A;  2WA4 A;  3DUI A;  1PIV 3;  3NJZ A;  3MO4 A;  2ZEW A;  1B35 B;  1W6M A;  1QQP 3;  3HN1 A;  4ISQ A;  3KWV A;  2RS5 3;  2G9G A;  3A23 A;  1L3J A;  1G9D A;  1IOA A;  1QU0 A;  5LK5 A;  4C1W A;  2IFW A;  1WW4 A;  3HBK A;  2FDF A;  2VW2 A;  3HVD A;  4KWK A;  4Q26 A;  5L7O B;  2G1M A;  3WNN A;  1CAX A;  4LHK A;  2V09 A;  1JI6 A;  1PO2 2;  2Q8C A;  4JGY A;  3N9N A;  5A7P A;  5IVB A;  3T4V A;  1F2N A;  3I2I A;  2XWB B;  2TBV A;  1UZW A;  1HN0 A;  3EB7 A;  3E1F 1;  4YM0 A;  4CUB A;  5H9Q A;  1ZZB A;  2FDK A;  3PTR B;  2P3J A;  2WR9 A;  1PX3 A;  2DFB A;  2H6B A;  4AK3 A;  5HV0 A;  1LEN A;  4WM8 A;  5FP8 A;  4FPJ A;  4ZZ8 A;  2PEL A;  5FZD A;  4QKB A;  1G9A A;  5ACA 2;  1O8S A;  3I4I A;  2P17 A;  4S2D A;  4RGK A;  1SLI A;  2AEZ A;  4LLO A;  5FO8 B;  2JE8 A;  3NNL A;  2WS9 2;  3PUA A;  2QQK A;  4OHW A;  1Q56 A;  3IDA A;  3ZVX A;  1KJR A;  3VZO A;  3GF6 A;  4YVS A;  4RR3 B;  4LNV A;  4OMC A;  1VIW B;  2C26 A;  2DUP A;  4JDN A;  2B39 A;  2JE9 A;  1XNB A;  5FJH A;  2Q5T A;  4MGK E;  3LSE A;  1I9R A;  4XXP A;  3VZK A;  2F4P A;  4OHX A;  1UW8 A;  3IN9 A;  5FYY A;  3ZKU A;  2GAL A;  4LOR A;  1CD3 G;  1QH7 A;  1K42 A;  2ZGL A;  4KBB A;  2FD8 A;  4XDP A;  1NCR C;  3FUQ A;  2VUL A;  4HK8 A;  5BPX A;  4CCM A;  1XXN A;  4F8A A;  5DXD A;  1MS3 A;  2IXJ A;  2Y26 A;  4PLO A;  3NNJ A;  2XHK A;  3HJR A;  4NRP A;  3WLU A;  4CCL A;  1JZ6 A;  5IVF A;  1X33 A;  5DZG A;  1BKZ A;  3BU7 A;  2O14 A;  2B8M A;  5A32 A;  3EBR A;  2ZGO A;  4BLI A;  4CXY A;  4OQ9 A;  2JG9 B;  1R1A 2;  5HPO A;  4GWI A;  4MOA A;  1US3 A;  1ZZ6 A;  1GNH A;  3OGG A;  4QQO A;  4QX7 A;  3SHR A;  3MIF A;  1J1L A;  1UO9 A;  2ZHK A;  4CUG A;  3JB8 A;  4H2A A;  4CTE A;  3BOW A;  1JU4 A;  1BVV A;  2D6P A;  1IPS A;  5DG1 A;  4CDX B;  1CAU A;  1WKY A;  2Q1M A;  2Y6J A;  3UL2 A;  1O4Y A;  5A1L A;  4HVO A;  4JVA A;  1GWM A;  5IK7 A;  4PT6 A;  4EN9 B;  1IS4 A;  1WW7 A;  2XL9 A;  5A33 A;  1IQD C;  3ZM8 A;  4XAA A;  4Y1Y A;  1BVP 1;  2MPF A;  1D4M 1;  2JG8 A;  3POE A;  5JSR A;  3ZXD A;  3ZN6 B;  1FNY A;  4XZU G;  2RS3 2;  1BK1 A;  2TEP A;  3HEI A;  3T2Q A;  3ZXJ A;  1E5H A;  1HRI 3;  2OZJ A;  4BPZ A;  3V0B B;  1Q8Q A;  1YFW A;  1L7L A;  5FZ0 A;  2X09 A;  3VBR C;  4A7Z A;  3NW4 A;  5FIX A;  1LOB A;  1ASJ 3;  2A6Y A;  3DF0 A;  1ULE A;  2D6N A;  5CBL A;  3M8L A;  2I2S A;  1N3O A;  4LA3 A;  1C5H A;  3WF2 A;  1PO2 3;  1GZC A;  2YDE A;  3DCQ A;  3NRU A;  4R52 A;  4P02 B;  1GBG A;  4LE3 A;  4BQX A;  3MF6 A;  1GQP A;  5DDJ 3;  4ERO A;  4QDR A;  1ZA7 A;  1YO8 A;  4TSV A;  3ZFG A;  3DKQ A;  2HWE 2;  3ABZ A;  2J1R A;  2VOT A;  4H3W A;  3ZR6 A;  3ZFE A;  5DN2 A;  2RMU 3;  4QKF A;  3ZYH A;  1ZBA 1;  4KQ7 A;  4PQ9 A;  1JXN A;  1OQ1 A;  2P6C A;  3VZN A;  1GV9 A;  2A71 A;  3CJI A;  2HWD 1;  2YG0 A;  1G6N A;  4G4F A;  4FFG A;  4F7Z A;  3KF3 A;  2NZ9 A;  2WSV A;  3EMR A;  3S7E A;  3O1T A;  3WR0 A;  4C90 A;  1W6P A;  2VTF A;  2W91 A;  4M3C E;  5JSP A;  2WN2 A;  4IL7 A;  4JTO A;  3AZZ A;  1NZC A;  3IMM A;  4LKE A;  4A2U A;  2P37 A;  2KA3 A;  1UIK A;  4AI2 A;  1RUE 1;  4LEJ A;  2ZGN A;  5LRS A;  4EQV A;  3URF A;  4RHV 2;  1VP6 A;  2XJT A;  1PZ8 A;  2XOM A;  2D6L X;  4TLF A;  2VVF A;  5FLI A;  5HV4 A;  1MAC A;  1H2K A;  1W8O A;  1AR9 2;  3J8F 2;  2LRO A;  1UMZ A;  3POW A;  4IEQ A;  2VW1 A;  4QX0 A;  5LBC A;  1S55 A;  4QX5 A;  3USS A;  2VTX A;  3O1M A;  2CYF A;  2Y64 A;  4S2H A;  4I30 A;  3PU3 A;  2C9A A;  2JXA A;  5CAD A;  3ACH A;  4QM8 A;  2WL1 A;  2W5F A;  3MFA A;  4LXL A;  5FUI A;  1UY2 A;  3ZXG A;  2RE9 A;  1PIV 1;  2ZTN A;  4N7U A;  2WWJ A;  4CYD A;  4AED A;  4EYU A;  1RIT A;  1QQP 1;  5F8P A;  1R08 3;  1NX9 A;  1S0B A;  4CDU C;  1R1A 3;  3JCI A;  3WW3 A;  4Y1V A;  4EJR A;  1JW6 A;  1PVC 3;  5KHI A;  3H3U A;  4TYS A;  3G6J B;  4HBN A;  4UFH A;  4YG6 A;  4KU8 A;  3P6B A;  5FZG A;  1GKB A;  3UET A;  1KS4 A;  1HB4 A;  1SCR A;  1UY3 A;  5FKC A;  4NWW A;  5FMC A;  2VUJ A;  5DAV A;  5FYS A;  5J36 A;  1YUD A;  3III A;  5FBJ A;  5C4W B;  3PLQ A;  1PGL 1;  3BGA A;  3AM2 A;  4AHX A;  2W95 A;  3ATG A;  5T52 A;  3VBU C;  2EIE A;  4XXA A;  2E51 A;  1W03 A;  3PL0 A;  4CDQ B;  3PUQ A;  1LKN A;  2XG3 A;  4D7S A;  1H6X A;  1UU6 A;  2PFW A;  4UW4 A;  5K0U A;  4P5H A;  1WCU A;  2PHX A;  1GNZ A;  4CEW C;  2E7T A;  2E53 A;  1LOF A;  5CFC A;  1C8M 2;  2LUW A;  4AW7 A;  2VXJ A;  3CDZ B;  3ORJ A;  4YAR A;  2VGD A;  2WNV A;  1SBF A;  1ZZ9 A;  3VDD C;  1H8T C;  2BV4 A;  2ZAB A;  4HT1 T;  1A3K A;  2Q30 A;  4AEK A;  5H9R A;  5DAQ A;  2BOJ A;  5C70 A;  4RGG A;  1TQ5 A;  3IPV B;  4PDW B;  2O1Q A;  3N4M A;  3A7Q A;  2YGL A;  2Q1Z B;  2QDR A;  4F83 A;  3LSD A;  2YB7 A;  5D1I A;  3C8X A;  5E16 A;  4AGR A;  3KGZ A;  1LNS A;  4YLZ A;  3GCW A;  3POJ A;  1CX1 A;  2OUH A;  2XVG A;  4XQW A;  3WUC A;  2BU9 A;  4M4P A;  4ES8 A;  1NCQ C;  2D3R A;  1AJO A;  4Q1P A;  1VBC 2;  2BVB A;  1O6U A;  4NHM A;  1LED A;  3I3D A;  5JXI A;  1REF A;  4IEO A;  3OGV A;  4Q8K A;  5EP9 A;  3ZYP A;  1UYX A;  3K4A A;  5E88 A;  4IGQ A;  1AL2 2;  3N7J A;  1XRU A;  3WNL A;  3FJS A;  1BMV 2;  3ACG A;  2Y0I A;  3F2Z A;  3CO2 A;  3ZXA C;  1KFU L;  2A6W A;  1N1S A;  4ITC A;  4X8P A;  2VOV A;  3OBZ A;  1XYN A;  2RM2 3;  2OYZ A;  1SDD B;  2C4X A;  5L7O C;  3B9C A;  5FP3 A;  1VPH A;  3GM8 A;  4LO6 B;  5BNO A;  1NQJ A;  3B9I A;  4LBL A;  4FPG A;  2BTV C;  4GWN A;  5JVV A;  3FBM A;  4AVS A;  4ARY A;  4AHY A;  1CGP A;  4MXW A;  3BAL A;  3LEG A;  4QB2 A;  2VW0 A;  2ORZ A;  3H1W A;  4OZO A;  4QU2 A;  4CVU A;  5C8C A;  1CQ9 A;  3SLI A;  4WVM B;  3ZSK A;  4AVA A;  1VBA 2;  4HKO A;  1NLS A;  4LMF A;  3QLQ A;  4OI1 A;  3BIE A;  2DBI A;  2B46 X;  2FHR A;  4A41 A;  3HPN A;  2VZ3 A;  4QX2 A;  2X05 A;  5F3E A;  3VD9 A;  4D7Y A;  1Z0H A;  2QQL A;  5GZG A;  4JDM A;  2Y34 A;  4L9B A;  4PF1 A;  3D5O A;  3V0A A;  3ZDV A;  1X82 A;  2VQU A;  4QXC A;  1HRI 1;  1X8E A;  2D98 A;  3FBY A;  4LKF A;  4LQR A;  4KBZ A;  4QPG C;  5IVJ A;  4G9S B;  2IXI A;  3BTX A;  1ASJ 1;  1CPM A;  4LO8 A;  4OI0 A;  3ELN A;  3R0R A;  5BV6 A;  2DU0 A;  3DN7 A;  5DQ0 A;  1IHM A;  1VBE 3;  3CLP A;  3M1H A;  4XBL A;  3AFK A;  5FK7 A;  3UJO A;  2NP0 A;  2ORX A;  5FXW A;  3LOB A;  5FZF A;  4CXX A;  4K1Z A;  4GB3 2;  5DDJ 1;  3FLR A;  3N36 A;  4Q4Y 3;  1OVS A;  2WA3 A;  4ZHN A;  3VB9 A;  2V5Y A;  4IEY A;  3TN9 1;  3T09 A;  5HBA A;  2XQR A;  5JR2 A;  5FZ7 A;  2RMU 1;  3GBW A;  2WT0 A;  5ABJ A;  3RPQ A;  1XSQ A;  3R6S A;  1HB3 A;  3KD4 A;  5JWP A;  1N1T A;  2A3W A;  4COZ A;  2JG9 C;  2VBP A;  4AZZ A;  4DMI A;  1OLM A;  3MBW A;  5BNQ A;  4KG8 A;  1W2T A;  1F5F A;  1D0H A;  3DPR B;  3VBH A;  1H2N A;  2WNU A;  4K20 A;  5DAX A;  3JXS A;  3GBF A;  1VBB 3;  1LOC A;  2LW8 A;  2ZKN A;  3B69 A;  2ZGQ A;  3HWJ A;  4JAA A;  4Q2F A;  5EV7 A;  4YVW B;  3SEE A;  3ZXF A;  4Q4W 2;  5KXC A;  5KR7 A;  2VR4 A;  3JBG 2;  3N3H A;  4CCJ A;  4FPF A;  4M4R A;  1RUD 3;  4LT5 A;  2WRA A;  1NA1 B;  3NO8 A;  1UZZ A;  5JUV A;  1SLB A;  2FQP A;  3SKJ E;  1S2B A;  2PAM A;  1F15 A;  5C3P A;  5J3U A;  1UU4 A;  3OBR A;  4IUG A; 
#chains in the Genus database with same CATH homology
 4OQ8 A;  1ZA7 A;  1STM A;  3J7L A;  1JS9 A;  1YC6 1;  3J7N A;  4NIA A;  1A34 A;  4OQ9 A;  3J7M A;  1CWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...